2LJ2A

Integral membrane core domain of the mercury transporter merf in lipid bilayer membranes
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords MerF
publication title Structure determination of a membrane protein in proteoliposomes.
pubmed doi rcsb
source organism Morganella morganii
total genus 18
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2lj2A00
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH superfamily
4DR2B 2P7TC 1LNQA 2RCVA 2JIZG 4YHHO 4DRXB 1BHBA 1KYOF 2IH3C 2VQEB 5D5QA 1QHTA 1H2NA 3THOA 3ZEDA 2B9ZA 2AXTZ 1R1BA 4FLXA 2UXNA 4K0KO 3DC5A 2GHYA 3K06A 2F93B 1DGSA 2F4VO 3BABA 3SR2C 3SYOA 2Q4PA 4FM1A 4DUYB 4JI3O 5L3GA 4CS2A 3CRMA 4HYOA 1U97A 1P7BA 3I5DA 4RUEA 4J42A 2BE3A 3H1KH 4I4TA 1XL6A 1PNKA 2Q7EA 2P6JA 1O9GA 3IFXA 2HJFC 1XI1A 5KLVH 5CMUA 3AG3C 1PNMA 1Q43A 4GX1A 5LL6Y 4O2BB 3ML0A 1KP2A 2LW7A 1SC5B 2EJRA 5IYCO 1BQ0A 1I0HA 5EBLC 4NTYA 2YUAA 3K3WA 1AB3A 4MW3A 3CX5F 4FLZA 1Q86W 3OEHG 3LSQA 2BTQB 1EM1A 3H9VA 2FYUH 4ZI7B 3OGIB 4LF7O 4DR2O 2PUSA 4LCUC 1I08A 5B3SC 4LFAB 4O2BA 2CH7B 2EX3A 1VQOV 2ZXWB 1QVFU 3OE7G 3SPHA 3UM7A 2VQEO 3FB7C 2XOKG 1FYJA 3AG4C 2EILC 4G28B 1WJZA 3FB6C 2Y4TA 3A2FA 1DTOA 4ZI7A 1M57B 4H44B 5FL7G 3WB2A 4NXNB 3T4ZA 2QGNA 4GKJB 3CRAA 3LNNA 2CH7A 2Q8VA 2FB5A 2VQFO 3E35A 2LGWA 3CMAV 3QO5A 4JYBA 5IJ9A 4J80A 4KL1A 2AW9A 3ZMUA 2GSMB 2DOSA 5KHKA 1TGOA 3ETEA 2Y69B 4R8CA 4HNAA 2LQTA 4N23A 2QEXV 4B7KA 1URFA 3SDLA 3ZX6A 3N27A 1GK9A 2LGQA 5IT9N 4JI0B 2D3OW 3B09A 2JRIA 5B1OA 1H2MA 3OM3B 5C8YA 2DQ3A 1TAEA 2QM8A 1X4TA 1JOYA 1GAXA 2N74A 2B1GA 1LUVA 5CN0A 2IJHA 4WFHA 3G6EV 4UV9A 1IBMB 2Q0AA 2F1MA 1I5XA 4TQDA 1VQ7V 2XNDG 3KG2A 1ZWIC 1I5YA 3A0HZ 4LH7A 3VQXA 4PA3A 1JJ2U 1U96A 1FFTB 3JALB 1V54B 2OTJV 3E8BA 1E79G 4JYAB 1ZSPA 4OPAA 4UFZA 1VQ5V 2AHZA 2OIGA 2WAMA 2YIDA 4DR3B 3HKBB 3W7XA 3W7SA 3AK2A 1XUQA 1ZTEA 4JI1O 4GKJO 3CPWU 3JASB 4X65B 3LNMB 3W7TA 1B06A 3P3PA 3SGIA 1THZA 3BVOA 2ARHA 3HKBA 2OCCC 4X1YB 1NI8A 1S5LZ 3UT5B 4CS4A 1L1FA 4MVUA 3K79A 1H8EG 5HFLA 1E1QG 4X64B 2ODMA 3JASA 3JSLA 4W4KA 1AJNA 3E2EA 4UXNA 1RPOA 4JI0O 5EIBD 2RQ6A 3ETGA 4UVBA 3F7VC 4HBNA 1OCOB 5B5EZ 1L0NH 4X1YA 1M5IA 3UT5A 1R6KA 3CB2A 4R50A 3WG7B 1B04A 2DWDC 3JD0A 1JQ0A 2BSKB 2YEVA 1ZAUA 2JGDA 1L0LH 5BXZA 3CD6V 1RSOB 1IBMO 4X66B 4X62B 4J11A 1AR1B 4X8AA 4C7UA 2CTQA 3CCUV 5FLXN 1AVMA 3CCVV 3CC2V 2ZINA 3OTOB 2ZE8A 4DR1B 3X2QC 5AG2A 4K3AA 2IU3A 2OWOA 4LF4O 3SJBC 4QIWF 2PF4E 4JI6B 4JYAO 2OTLV 2BSKA 2UUCB 3IGAC 3LSUA 1J5EB 1RSOA 2HLDG 4DV4B 2PZSA 1Q6UA 3NR7A 4JAAA 5L3DA 4H37A 4X65O 3CRRA 4IYHA 5HFMA 2H3OA 3ZRWA 4B3TO 2DYRB 4PA4A 3RN4A 4F6EA 3ASOC 1XILA 3E86A 4B08A 4PDLA 1NVPD 4FMTA 1RFYA 2PYJA 2ADQB 1I94B 5LGUA 2JEUA 1B3QA 4LWSB 5JJNB 4GYCB 4DO2A 1HWYA 3AG1B 2Z5UA 2ZDIC 4XDJA 2Y48A 4WFBV 1AILA 4X64O 1YF2A 1SQPH 4XBFA 2WA4A 3T1HB 4DR7B 3ASNB 3UO3A 1YTFB 2ADPA 5KHGA 1JR9A 2G38A 5IYBO 1UFIA 4LWSA 3ZRXA 4AILC 4PD4F 3PN1A 5EIBC 2F66C 5GW7A 1S5JA 4QE7A 3ABKC 3WFVA 1FFXB 1TUEB 1KC8W 3TETA 4JTAB 4X66O 3CRCA 4X62O 3K03A 3C3TA 1P4RA 2VWKA 1OCCB 2A79B 4NYKA 1JJOA 2QDOA 3ZN1A 4JASA 3OTOO 3L70H 3K9SA 2A0LA 1N0JA 1PKXA 5IDJA 1SQVH 1FFXA 2LP7A 4HZ3A 1XHXA 3K58A 4JI6O 2Q6AA 3M8AA 4UCOA 1VQMV 3CC4V 2VS0A 2UUCO 4YXWG 3G80A 1J5EO 2WLMA 2Q7HA 4DV4O 1WP7A 1PL4A 5E79Z 5F2VO 3UO2A 2ZE6A 5IJ0B 2A3QA 2UUAB 1J95A 1VQ8V 5GTIZ 5B1BB 2HVJC 1FD9A 5EBWC 5E1AC 2Q0OC 3ZHRA 4BW9A 2Q73A 2AHYA 3DGEA 3E8GA 5KMGB 5LP6B 1FXKA 1AR5A 1TUBB 3VQYA 1Y4MA 5LBQA 3BHPA 1WNSA 2WPDG 5IJ0A 5LHGA 1FS0G 3EFFK 2HFEC 2JK5C 1H2KA 4DYLA 3K5LA 4DR7O 2EIKC 3LSSA 4BIOA 3OR7C 5KMGA 5LP6A 3T1YB 1F4NA 4U7NA 1VF6C 2UXXA 1H38A 3RVZA 1JA8A 4JI2B 1FAFA 3HKEB 1AROP 4IYIA 3E8HA 1SF9A 2UUBB 3OUSA 2IW5A 3KCYA 3RYIA 1XDCA 2E5LB 1PD3A 1GN4A 2ETNA 2XAHA 1VQPV 4UCTA 2ZR3A 4OX9B 4DR4B 4O4LB 1FXVA 3ABLB 1GN2A 2YC0A 2YIBA 2ZM6B 2HEPA 2KKWA 2Y0IA 4MSWC 3HKEA 3BEHA 3W7WA 3ZRSA 1V55B 5CA1B 5B1NA 2ZR2A 4EEQA 3RBZA 3FAVB 2EZOA 3DC6A 3SYAA 5GONB 1Q6HA 4O4LA 4O2AB 2RN9A 3BY6A 1NH2B 1AI7A 2ILMA 5LHHA 2QTSA 2UUAO 5FNVB 3T4DA 1NT2B 1N8RW 2QTOA 4BIZA 3LDEA 4X9QA 3SJQC 5CA1A 4PV1B 2QM4A 3F7YC 3ABMB 3FKSG 2Y4UA 3I55V 3D3IA 3FAVA 1FJGB 2EZPA 3M7MX 3KCXA 5FPRA 5GONA 4J10A 4LF8O 4CZZA 4O2AA 2ZT9B 3CCMV 3IAYA 2CGNA 2HVKC 1QNMA 2GBOA 1Z5WA 4DW0A 5FNVA 4QJFB 1JFFB 4TV8B 5EZYB 2GV9A 2XTAA 1AP5A 2UXBB 2OCHA 5KUKA 4JYYA 1QR8A 2DQ0A 4LF5B 1YJ9V 4CS3A 3T1YO 2P22C 1SERA 1D2DA 1RM1B 4JI2O 1Z2GA 2CDYA 1GKFA 1N32B 1BHAA 2E5LO 3A8TA 1JFFA 4TV8A 4I4TB 5EZYA 4NVPA 4OX9O 1N33O 2GUZB 4DR4O 4LNUB 4GLXA 5B66Z 5LA6B 3K9AA 2XHBA 2DWEC 2ZM6O 2JJ2G 2FTKA 1VF7A 1T5EA 3ETQA 4LP8A 1OJHA 4I9WA 4B3SB 1XEQA 4GKKB 2EIMB 3L75H 1IDSA 3CCJV 4DW1A 2Q67A 2V7QG 3FYIB 4GX5A 3H1HH 2A7WA 2GUZA 5KX5B 4LNUA 4H13B 2RJZA 3WB1A 1YJNV 5LA6A 4MS2A 5DM6V 1QBZA 1K4CC 1BCCH 1QQCA 3BCCH 2WLLB 2R70A 3AK3A 4YIPA 4J9ZB 3ZIAG 1HNZB 2A9HA 1FJGO 4U3FH 3JAMN 2NN4A 3H1LH 1SZXA 4UB6Z 5KX5A 2ZXWC 2MK3A 1W59A 3AG2B 1CEZA 3C90A 2QKCA 3J80N 1AI6A 4FPPA 2X6AA 2WLLA 3JATB 1PP9H 3MHHC 5GTHZ 3IJ4A 4JI8B 2UXBO 1KD1W 2HKOA 3E22A 4LF5O 2L6LA 1M57C 4I50B 1NS1A 1Y76B 5IJ9B 4FFKA 2A06H 2YICA 5IY5C 3AK1A 1N0NA 1N32O 4AQYB 1GRJA 1GN6A 2EIJB 1FPOA 4F4LA 4B3RB 3K04A 4Z1MG 2E75B 4QNHB 3BFRA 4HNAB 1ROPA 3JATA 1WA8B 5L3EA 1YI2V 1CPYA 1UPGA 4BW5A 2Y69C 4GX0A 3HB3B 2F23A 4RAIA 5JH7B 4LF9B 4I50A 4DUYO 4FJCC 4DR6B 1IURA 4PJ0Z 2P5OA 1XOUA 1Q6IA 4JAUA 1Y76A 1M9NA 3CCLV 1G8MA 2LFRA 2WLKA 2AZ2A 4GKKO 5C8YB 3ZHSA 4PA9A 4WF9V 1R3IC 2W6IG 3CCEV 2NR5A 4HAMA 4IIJB 1WA8A 2DYSC 3TCUA 4EFEA 3AG4B 3PJSK 1AP6A 5KAFZ 1OZ0A 5JH7A 3JD4A 1KKDA 3B8MA 3O65A 1VQLV 5LMNB 3BA9A 5H6RA 1BE3H 1HNZO 4L87A 3TJTA 4CH3A 3CSXA 2L35A 1XQ8A 1SKVA 1XNRB 4IIJA 4MVZA 2WLJA 4MW8A 4MTGA 3BRCA 5JVDB 1V54C 1SRYA 4JI5B 3S3XA 1Q8IA 4X20A 4JI8O 2YXYA 1HR0B 1M4UA 4LFBB 5JCOA 4LFAO 1JMKC 5KHIA 4ASUG 2ZD9A 1WB7A 4XDKA 5EK0A 1XREA 1HNXB 4PDMA 3SYCA 5JVDA 2PYLA 1EN6A 4B3RO 1FXHA 4BIUA 1EZJA 3RW0A 4NXNO 2ZNJA 1P49A 2WSSG 5JWPA 1IBLB 1NBMG 2FKXA 1SQQH 1TA8A 4LF9O 4L8JA 4UCVA 3L71H 2XAFA 1YTFD 3G71V 2XASA 2EINB 1Q82W 1DF4A 3GWOA 1YZBA 2DN9A 5C93A 3B40A 1YHQV 1OCOC 2YEVB 4NTXA 5CA0B 2JGDB 2YXLA 2ZIOA 3WG7C 4LFCB 1JCHA 1BZKA 1XMOB 1S77D 4LH6A 5IE9A 1ORQC 5LMNO 4N21A 2HJDA 2LJ2A 4D7TA 1SA0B 1NZ6A 4MVSA 1AI4A 3QO8A 5DECA 4NXMB 3D3QA 1XNRO 1AI5A 2NNUA 4YY3B 3AEIA 5CA0A 3LDCA 1BMFG 2DE0X 2OCCB 2XAQA 3JCZA 3I56V 1SQBH 4Z2WA 2Y0PA 4ZHQA 3A0BZ 4OPHA 3AG7A 3HR0A 2QKSA 1NKDA 1OCZB 3A0RA 2BOBC 4P30A 1UJWB 1HR0O 4LFBO 2QR4A 3ZRWB 1SA0A 1QLEB 4DV5B 1GTOA 2VRZA 3TXSA 3H1IH 1VQKV 3DTUB 2DYRC 4PA6A 1HNXO 1WLEA 3W7UA 4LF6B 4DR3O 3N2KA 1HDJA 5B1AB 1K5SA 4CH6A 3ZBHA 4OGQB 4PDVA 5LGNA 2BTOA 3GWKC 1IBLO 3AG1C 2Q68A 1QCEA 1X59A 4G27B 4PI2A 5L3FA 3K5MA 3QVNA 5TISZ 1TVKB 1HNWB 5A9GA 3ASNC 2CUGA 4MVRA 3CHXA 2YIBD 4E4EA 3X2QB 3KZIZ 3ZMSA 1XL4A 1SETA 1XMQB 3K5OA 2R9AA 1IVSA 1H2LA 3MDSA 4B7EA 1VQ9V 3VQWA 5D5PA 2NLJC 4BWAA 4JTDB 4JI4B 1CP9A 2R9RB 3ZRVA 1SS3A 4LFCO 4GCZA 4H33A 4J9YB 1R6TA 4WBNB 4ZIBA 1XMOO 4NTWA 3RYHA 4F6RB 1TVKA 2Q69A 3IC9A 1WN7A 2ITCC 1S3JA 1SQGA 3FYEB 2X6BA 1MABG 3ASOB 1OCCC 4JAVA 4JV5B 1MNGA 4NXMO 2FMLA 1YJWV 3B4SA 4K8XA 1NR7A 3ZCCA 5DN6G 4YY3O 1RPRA 3RFRA 1VMGA 1QVGU 4YJ2B 4DV2B 2P90A 4WBNA 2WWWA 4F6RA 3OMNB 2RNBA 3FFQA 1NH2D 4JTCB 2CK3G 4NB5A 2ZQMA 3D36C 4DR1O 1YIJV 1VEWA 4DV5O 4KFMA 5B1BC 4DK1A 3EXAA 4MVMA 1KBHA 1FXKB 3E89A 1HW7A 1F4MA 4LF6O 4YJ2A 4WFAV 3ABKB 3BAAA 3S3WA 4TSFG 3K59A 5EC2C 4K35A 3FB8C 2OYQA 1YITV 2IJKA 4IT5A 4DV7B 2K1EA 1H8HG 4DV6B 1N34B 1W0KG 1HNWO 1KP3A 5BMVB 1I94O 3JAWA 2ZIMA 3DSQA 3SPCA 1K8AW 3N2GA 3OEEG 4DUZB 1XMQO 3ZS8C 5A2QN 3RYIB 1OV9A 3EHBB 4JI4O 3T1HO 2Z3YA 1IBKB 4KUMA 4D7SA 3G6BA 5BMVA 4P2ZA 2PTMA 5LHIA 1OCRB 3ABLC 1GH6A 2DJVA 4JV5O 4QE9A 4JI7B 4J7ZA 1KQSU 4E2LA 1BL8A 2C2AA 1AJQA 4WFGA 1S5HC 1V55C 3Q4HA 3JD1A 5EYPB 4WFEA 4FFBB 5KA6A 2MW2B 2PY5A 2LFSA 2RMKB 1MSDA 2QJ1A 3OAAG 2EIKB 1YVWA 1M56B 1RP3B 4AHCA 2IM9A 1MMMA 2QE7G 1R3LC 5IWAB 1ZUQA 1NTMH 1IZ3A 5EYPA 5KHJA 3J7AU 3C3SA 1F23A 4FFBA 1EN5A 3T1CA 2CTWA 4PDRA 4FZ0A 1Q3EA 2WLNA 3STLC 1CXZB 4O4HB 3SPGA 2Q5ZA 4PELA 5H2FZ 3RWRD 2YI9A 4DV7O 2H8PC 2R9IA 1ZL8B 4I55B 1N34O 1AJPA 1K7DA 4MVQA 3ZHTA 4CH5A 1QU7A 4J41A 3J81N 4IL6Z 1HP8A 4DUZO 1K33A 1RM1C 3WU2Z 4O4HA 2UU9B 4Q20A 4KHPB 2QWQB 1GM9A 3L9DA 4H0LB 4FIPC 5CA3A 4RO2A 1JX9A 1IBKO 1VQNV 3STZC 1ZL8A 3RGBA 4I55A 5CB4B 4BAYA 4X1IB 2QWPB 3JCUZ 4YIOA 3OGCC 3O9OA 3VOUA 1VIBA 3K08A 1Q5OA 4RUFA 2UUBO 4JI7O 3JD2A 4U7OA 2P06A 4LF7B 1YCIA 4EKWA 1MZEA 2EIMC 1ENVA 5LXTB 2P67A 2Z0AA 5CB4A 1E1RG 3DXRB 4KXRA 1Q7YW 4R7CA 1JVMA 4DXWA 2OT5A 4P9OA 3CCQV 4X1IA 1V9PA 4GT1A 4K8ZA 3CEIA 4FLUA 1K34A 1Y66A 1SZTA 4AI8A 3APQA 5IWAO 3ZJZA 3G67A 2M7WA 3CS5A 2F95B 4DRXA 1NR1A 5LXTA 1NJIW 2VQFB 4UV8A 3L74H 3DXRA 1SESA 4I5SA 1M93A 2XT9A 3LDDA 4ABMA 4FLVA 2CAZC 5KAIZ 1H2SB 3AG2C 3OD4A 2QWNB 3E22B 4LR3A 3CXCU 1L8DA 3APOA 2JS3A 5K1XA 1GO3F 5LMUB 2W0FC 2ATKC 1YEWA 2JEXA 3JSNA 4WCEV 1VQ4V 5LOVB 2UU9O 1GMGA 4KHPO 1QR9A 3MAQA 5H5NA 1SQXH 2EIJC 1YXBA 4LC1A 4FLWA 1GM7A 5CBHA 3TXQA 2H94A 1KKCA 4X1KB 2CGOA 5J2TB 1KECA 4J7KA 1AR4A 3AG3B 1Q81W 3NXSA 2PGGA 4JZ2A 4A5UB 5LOVA 3BPZA 3K0DA 1F51A 1WPXA 1VP7A 5IYDO 3U10A 1IXMA 3D8CA 1QLNA 3ZMTA 3FD9A 3CCRV 4X1KA 3SJAC 5J2TA 3UQ8A 4R6ZA 5JJJB 2JJ1G 1N4CA 4PI0A 1D5AA 4ICGA 2BTQA 5B3SB 4X89A 4O4JB 4B3SO 2JDIG 3CYOA 2YDEA 3B8NA 1F7YA 3SPJA 2JVDA 4JI1B 1OHHG 5JCOC 5IY5B 4U3JB 1MSWD 2EILB 4WFFA 2N05A 3GVMA 1K9MW 3GB7C 4EFBA 2DW4A 3QO7A 3P32A 1WAZA 2CE4A 4UCUA 1R3KC 2YXHA 3OUFA 2IBZH 4O4JA 1G4YB 4TT3G 3CXHF 2QSAA 4X20B 2KB1A 1R6NA 2EULA 4QPJA 5LMUO 1M1KW 4UCRA 4U3JA 1EZVH 1PPJH 1K4DC 1Y67A 3ABUA 1VF5B 2X6CA 3HPLC 4Z1VA 1SQFA 3IC7A 4TOIA 1XHZA 1EFRG 4UUJC 3EVKA 4B3MB 4PA7A 2DYSB 3OMIB 2YS8A 3KKYA 2QWRB 4CC5A 1MZFA 4W4LA 1YSCA 1JPXA 3OW2U 1I7FA 3ZMVA 4DV3B 1MOFA 2WA3A 4YJ3B 3JD3A 1PNLA 4FZ1A 3SYQA 2JGUA 4AQYO 2JS5A 2IU0A 2EINC 1LR1A 1D5NA 4LF4B 4RWUA 4Q6GA 1BQZA 2KSDA 4DR6O 2W6JG 1NTZH 3U0ZA 4YJ3A 1R3JC 1M90W 3RYCB 2N04A 1K97A 3K0GA 1PL0A 2D2CB 4B3TB 2YSUB 3JALA 4RQEA 1YDXA 4FLYA 4MTXA 3P3NA 1IXBA 2ZKOA 2WLHA 4ZHQB 2UXDB 3E83A 3QF7A 2AZ0A 3LUTB 4UVCA 2OIEA 3VQVA 3RYCA 5CBFA 2K9PA 4XDLA 4LBEC 1OCZC 3RT3C 2ZCEA 2R72A 3HKDB 4DV1B 1QLEC 2QKAA 1XBLA 3BA8A 3N2KB 2VWJA 2HHHB 2WLIB 4GZRB 4JI5O 4B3MO 4I7ZB 1WB8A 4IGGA 2QWOB 1G1XB 2LW1A 5B1AC 3RYFB 3H01A 2IJIA 1DK1A 4GX2A 3OMAB 4OXSA 3VBBA 1N36B 1KU9A 5IYZB 2UXCB 3HKDA 3ZN0A 4FVMA 4DV3O 5JJEB 4MTFA 3P30A 2B5UA 2WLIA 3TK1A 5JQGB 4I9QA 4TQFA 2W0XA 3SPIA 3JAKB 3RYFA 3F5TA 2ITDC 3E8FA 4MT8A 2E74B 3CC7V 1ZLZA 5J2UB 5IYZA 5EBMC 1Y6XA 3RYHB 4FLTA 2O57A 5KHHA 4DR5B 3ABTA 1KUQA 2BOCC 3SYPA 2QA4V 2V1DA 4QGPA 5JQGA 5CBGA 2XUMA 1W0JG 1DF5A 2X0LA 2XAJA 1GM8A 2F43G 3JAKA 1G6UA 3CE2A 3H1JH 3UCSC 1GN3A 2IH1C 5J2UA 4FM2A 3L73H 3SJCC 3ZHUA 1EN4A 2UXDO 4JF3A 3QG5A 2GDSA 2Q9LA 2PI4A 3TGUH 4CH4A 1P84F 1K3EA 3UKMA 1BGYH 4DV1O 4JGSA 2V4DA 1R73A 3CJHB 5FPOA 5H9CA 5H6QA 4GUNA 4JPRA 1A32A 1COWG 1S72V 2HHHO 2HR3A 1FXKC 4IHJB 4NR1A 2X7RB 1NQTA 4MTOA 2DMXA 1N36O 1S76D 5J9PC 2B1IA 3L72H 2UXCO 2HP8A 3JAWB 3ETDA 1NU1H 3CJHA 5BR8B 2YIAA 5EC1C 5L3CA 5LP6C 3CP1A 1MG1A 2ZDIA 3N2GB 1H2GA 4MVOA 4JYCA 4IHJA 1VQ6V 4TWKA 3RVYA 1XNQB 4ZKIA 1BS3A 3HKCB 3G4SV 4FM0A 5KA5A 3CMEV 1O9HA 3B2EE 4ZOLB 3QNEA 3M99B 2PI5A 4DV0B 3OFNG 1US6A 4I0XB 4DR5O 2BCCH 2P4KA 3T2MA 1DLBA 1OCRC 4ZBMA 1Y74B 2M6YA 3ZHQA 1K73W 2KQXA 2EBOA 3Q4HB 4FK5C 1S0VA 3HKCA 4ZOLA 3WB0A 2CTRA 3ZMZA 5DEDA 3ZHVA 4LF8B 2YI8A 4I0XA 1K5QA 3D36A 4DK0A 5LYJB 3OR6C 2Q7GA 4TV9B 2KG7B 1W2BU 4PHZA 1Y74A 2HG5C 2ZE5A 4UB8Z 2LO1A 1NVPB 4G2KA 1BT8A 3MD0A 1M56C 3OT7A 4KP4A 1KMIZ 2E76B 3ICXA 4YHHB 4DV2O 2ZE7A 1ZX3A 3FB5C 2E3CA 1TUBA 1IX9A 2ZNIA 2RDCA 1K92A 1WP8A 5BY1A 1FKAO 3CRQA 4BR6A 3JARB 5LYJA 1PM9A 4TV9A 1Q90D 4UCSA 2KG7A 3R65A 4K0KB 5ITZB 1N33B 5K1PA 3CWBH 4CBCA 1KB9F 4NKGB 2QM7A 5BR8O 2F4VB 4RQFA 3ABMC 5L3BA 3OTFA 2IJJA 4EB6B 1VARA 2P4VA 3CCSV 4TUYB 5LGTA 4JI3B 1B6QA 4O4IB 4JZGA 3FX7A 3JARA 1XNQO 1EBOA 2AGAA 3B77A 1NTKH 2GTAA 4DV6O 4J7JA 1Z5VA 3QTCA 1BSMA 5ITZA 1VF6A 4DV0O 2GTSA 5BZBA 2CTPA 5KUMA 4EB6A 1LUWA 4TUYA 4O4IA 4UVAA 3JYCA 4QPKA 2FL4A 4D6TH 1P7GA 3MHSC 1WPBA 3K57A 3K5NA 1MA1A 1PV0A 2XAGA 3F5WC 3R66A 3U11A 2EJ7A 4X88A 4CC6A 4P9PA
chains in the Genus database with same CATH topology
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ2 A;  2H3O A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 4DR2 B;  2P7T C;  1LNQ A;  2RCV A;  2JIZ G;  4YHH O;  4DRX B;  1BHB A;  1KYO F;  2IH3 C;  2VQE B;  5D5Q A;  1QHT A;  1H2N A;  3THO A;  3ZED A;  2B9Z A;  2AXT Z;  1R1B A;  4FLX A;  2UXN A;  4K0K O;  3DC5 A;  2GHY A;  3K06 A;  2F93 B;  1DGS A;  2F4V O;  3BAB A;  3SR2 C;  3SYO A;  2Q4P A;  4FM1 A;  4DUY B;  4JI3 O;  5L3G A;  4CS2 A;  3CRM A;  4HYO A;  1U97 A;  1P7B A;  3I5D A;  4RUE A;  4J42 A;  2BE3 A;  3H1K H;  4I4T A;  1XL6 A;  1PNK A;  2Q7E A;  2P6J A;  1O9G A;  3IFX A;  2HJF C;  1XI1 A;  5KLV H;  5CMU A;  3AG3 C;  1PNM A;  1Q43 A;  4GX1 A;  5LL6 Y;  4O2B B;  3ML0 A;  1KP2 A;  2LW7 A;  1SC5 B;  2EJR A;  5IYC O;  1BQ0 A;  1I0H A;  5EBL C;  4NTY A;  2YUA A;  3K3W A;  1AB3 A;  4MW3 A;  3CX5 F;  4FLZ A;  1Q86 W;  3OEH G;  3LSQ A;  2BTQ B;  1EM1 A;  3H9V A;  2FYU H;  4ZI7 B;  3OGI B;  4LF7 O;  4DR2 O;  2PUS A;  4LCU C;  1I08 A;  5B3S C;  4LFA B;  4O2B A;  2CH7 B;  2EX3 A;  1VQO V;  2ZXW B;  1QVF U;  3OE7 G;  3SPH A;  3UM7 A;  2VQE O;  3FB7 C;  2XOK G;  1FYJ A;  3AG4 C;  2EIL C;  4G28 B;  1WJZ A;  3FB6 C;  2Y4T A;  3A2F A;  1DTO A;  4ZI7 A;  1M57 B;  4H44 B;  5FL7 G;  3WB2 A;  4NXN B;  3T4Z A;  2QGN A;  4GKJ B;  3CRA A;  3LNN A;  2CH7 A;  2Q8V A;  2FB5 A;  2VQF O;  3E35 A;  2LGW A;  3CMA V;  3QO5 A;  4JYB A;  5IJ9 A;  4J80 A;  4KL1 A;  2AW9 A;  3ZMU A;  2GSM B;  2DOS A;  5KHK A;  1TGO A;  3ETE A;  2Y69 B;  4R8C A;  4HNA A;  2LQT A;  4N23 A;  2QEX V;  4B7K A;  1URF A;  3SDL A;  3ZX6 A;  3N27 A;  1GK9 A;  2LGQ A;  5IT9 N;  4JI0 B;  2D3O W;  3B09 A;  2JRI A;  5B1O A;  1H2M A;  3OM3 B;  5C8Y A;  2DQ3 A;  1TAE A;  2QM8 A;  1X4T A;  1JOY A;  1GAX A;  2N74 A;  2B1G A;  1LUV A;  5CN0 A;  2IJH A;  4WFH A;  3G6E V;  4UV9 A;  1IBM B;  2Q0A A;  2F1M A;  1I5X A;  4TQD A;  1VQ7 V;  2XND G;  3KG2 A;  1ZWI C;  1I5Y A;  3A0H Z;  4LH7 A;  3VQX A;  4PA3 A;  1JJ2 U;  1U96 A;  1FFT B;  3JAL B;  1V54 B;  2OTJ V;  3E8B A;  1E79 G;  4JYA B;  1ZSP A;  4OPA A;  4UFZ A;  1VQ5 V;  2AHZ A;  2OIG A;  2WAM A;  2YID A;  4DR3 B;  3HKB B;  3W7X A;  3W7S A;  3AK2 A;  1XUQ A;  1ZTE A;  4JI1 O;  4GKJ O;  3CPW U;  3JAS B;  4X65 B;  3LNM B;  3W7T A;  1B06 A;  3P3P A;  3SGI A;  1THZ A;  3BVO A;  2ARH A;  3HKB A;  2OCC C;  4X1Y B;  1NI8 A;  1S5L Z;  3UT5 B;  4CS4 A;  1L1F A;  4MVU A;  3K79 A;  1H8E G;  5HFL A;  1E1Q G;  4X64 B;  2ODM A;  3JAS A;  3JSL A;  4W4K A;  1AJN A;  3E2E A;  4UXN A;  1RPO A;  4JI0 O;  5EIB D;  2RQ6 A;  3ETG A;  4UVB A;  3F7V C;  4HBN A;  1OCO B;  5B5E Z;  1L0N H;  4X1Y A;  1M5I A;  3UT5 A;  1R6K A;  3CB2 A;  4R50 A;  3WG7 B;  1B04 A;  2DWD C;  3JD0 A;  1JQ0 A;  2BSK B;  2YEV A;  1ZAU A;  2JGD A;  1L0L H;  5BXZ A;  3CD6 V;  1RSO B;  1IBM O;  4X66 B;  4X62 B;  4J11 A;  1AR1 B;  4X8A A;  4C7U A;  2CTQ A;  3CCU V;  5FLX N;  1AVM A;  3CCV V;  3CC2 V;  2ZIN A;  3OTO B;  2ZE8 A;  4DR1 B;  3X2Q C;  5AG2 A;  4K3A A;  2IU3 A;  2OWO A;  4LF4 O;  3SJB C;  4QIW F;  2PF4 E;  4JI6 B;  4JYA O;  2OTL V;  2BSK A;  2UUC B;  3IGA C;  3LSU A;  1J5E B;  1RSO A;  2HLD G;  4DV4 B;  2PZS A;  1Q6U A;  3NR7 A;  4JAA A;  5L3D A;  4H37 A;  4X65 O;  3CRR A;  4IYH A;  5HFM A;  2H3O A;  3ZRW A;  4B3T O;  2DYR B;  4PA4 A;  3RN4 A;  4F6E A;  3ASO C;  1XIL A;  3E86 A;  4B08 A;  4PDL A;  1NVP D;  4FMT A;  1RFY A;  2PYJ A;  2ADQ B;  1I94 B;  5LGU A;  2JEU A;  1B3Q A;  4LWS B;  5JJN B;  4GYC B;  4DO2 A;  1HWY A;  3AG1 B;  2Z5U A;  2ZDI C;  4XDJ A;  2Y48 A;  4WFB V;  1AIL A;  4X64 O;  1YF2 A;  1SQP H;  4XBF A;  2WA4 A;  3T1H B;  4DR7 B;  3ASN B;  3UO3 A;  1YTF B;  2ADP A;  5KHG A;  1JR9 A;  2G38 A;  5IYB O;  1UFI A;  4LWS A;  3ZRX A;  4AIL C;  4PD4 F;  3PN1 A;  5EIB C;  2F66 C;  5GW7 A;  1S5J A;  4QE7 A;  3ABK C;  3WFV A;  1FFX B;  1TUE B;  1KC8 W;  3TET A;  4JTA B;  4X66 O;  3CRC A;  4X62 O;  3K03 A;  3C3T A;  1P4R A;  2VWK A;  1OCC B;  2A79 B;  4NYK A;  1JJO A;  2QDO A;  3ZN1 A;  4JAS A;  3OTO O;  3L70 H;  3K9S A;  2A0L A;  1N0J A;  1PKX A;  5IDJ A;  1SQV H;  1FFX A;  2LP7 A;  4HZ3 A;  1XHX A;  3K58 A;  4JI6 O;  2Q6A A;  3M8A A;  4UCO A;  1VQM V;  3CC4 V;  2VS0 A;  2UUC O;  4YXW G;  3G80 A;  1J5E O;  2WLM A;  2Q7H A;  4DV4 O;  1WP7 A;  1PL4 A;  5E79 Z;  5F2V O;  3UO2 A;  2ZE6 A;  5IJ0 B;  2A3Q A;  2UUA B;  1J95 A;  1VQ8 V;  5GTI Z;  5B1B B;  2HVJ C;  1FD9 A;  5EBW C;  5E1A C;  2Q0O C;  3ZHR A;  4BW9 A;  2Q73 A;  2AHY A;  3DGE A;  3E8G A;  5KMG B;  5LP6 B;  1FXK A;  1AR5 A;  1TUB B;  3VQY A;  1Y4M A;  5LBQ A;  3BHP A;  1WNS A;  2WPD G;  5IJ0 A;  5LHG A;  1FS0 G;  3EFF K;  2HFE C;  2JK5 C;  1H2K A;  4DYL A;  3K5L A;  4DR7 O;  2EIK C;  3LSS A;  4BIO A;  3OR7 C;  5KMG A;  5LP6 A;  3T1Y B;  1F4N A;  4U7N A;  1VF6 C;  2UXX A;  1H38 A;  3RVZ A;  1JA8 A;  4JI2 B;  1FAF A;  3HKE B;  1ARO P;  4IYI A;  3E8H A;  1SF9 A;  2UUB B;  3OUS A;  2IW5 A;  3KCY A;  3RYI A;  1XDC A;  2E5L B;  1PD3 A;  1GN4 A;  2ETN A;  2XAH A;  1VQP V;  4UCT A;  2ZR3 A;  4OX9 B;  4DR4 B;  4O4L B;  1FXV A;  3ABL B;  1GN2 A;  2YC0 A;  2YIB A;  2ZM6 B;  2HEP A;  2KKW A;  2Y0I A;  4MSW C;  3HKE A;  3BEH A;  3W7W A;  3ZRS A;  1V55 B;  5CA1 B;  5B1N A;  2ZR2 A;  4EEQ A;  3RBZ A;  3FAV B;  2EZO A;  3DC6 A;  3SYA A;  5GON B;  1Q6H A;  4O4L A;  4O2A B;  2RN9 A;  3BY6 A;  1NH2 B;  1AI7 A;  2ILM A;  5LHH A;  2QTS A;  2UUA O;  5FNV B;  3T4D A;  1NT2 B;  1N8R W;  2QTO A;  4BIZ A;  3LDE A;  4X9Q A;  3SJQ C;  5CA1 A;  4PV1 B;  2QM4 A;  3F7Y C;  3ABM B;  3FKS G;  2Y4U A;  3I55 V;  3D3I A;  3FAV A;  1FJG B;  2EZP A;  3M7M X;  3KCX A;  5FPR A;  5GON A;  4J10 A;  4LF8 O;  4CZZ A;  4O2A A;  2ZT9 B;  3CCM V;  3IAY A;  2CGN A;  2HVK C;  1QNM A;  2GBO A;  1Z5W A;  4DW0 A;  5FNV A;  4QJF B;  1JFF B;  4TV8 B;  5EZY B;  2GV9 A;  2XTA A;  1AP5 A;  2UXB B;  2OCH A;  5KUK A;  4JYY A;  1QR8 A;  2DQ0 A;  4LF5 B;  1YJ9 V;  4CS3 A;  3T1Y O;  2P22 C;  1SER A;  1D2D A;  1RM1 B;  4JI2 O;  1Z2G A;  2CDY A;  1GKF A;  1N32 B;  1BHA A;  2E5L O;  3A8T A;  1JFF A;  4TV8 A;  4I4T B;  5EZY A;  4NVP A;  4OX9 O;  1N33 O;  2GUZ B;  4DR4 O;  4LNU B;  4GLX A;  5B66 Z;  5LA6 B;  3K9A A;  2XHB A;  2DWE C;  2ZM6 O;  2JJ2 G;  2FTK A;  1VF7 A;  1T5E A;  3ETQ A;  4LP8 A;  1OJH A;  4I9W A;  4B3S B;  1XEQ A;  4GKK B;  2EIM B;  3L75 H;  1IDS A;  3CCJ V;  4DW1 A;  2Q67 A;  2V7Q G;  3FYI B;  4GX5 A;  3H1H H;  2A7W A;  2GUZ A;  5KX5 B;  4LNU A;  4H13 B;  2RJZ A;  3WB1 A;  1YJN V;  5LA6 A;  4MS2 A;  5DM6 V;  1QBZ A;  1K4C C;  1BCC H;  1QQC A;  3BCC H;  2WLL B;  2R70 A;  3AK3 A;  4YIP A;  4J9Z B;  3ZIA G;  1HNZ B;  2A9H A;  1FJG O;  4U3F H;  3JAM N;  2NN4 A;  3H1L H;  1SZX A;  4UB6 Z;  5KX5 A;  2ZXW C;  2MK3 A;  1W59 A;  3AG2 B;  1CEZ A;  3C90 A;  2QKC A;  3J80 N;  1AI6 A;  4FPP A;  2X6A A;  2WLL A;  3JAT B;  1PP9 H;  3MHH C;  5GTH Z;  3IJ4 A;  4JI8 B;  2UXB O;  1KD1 W;  2HKO A;  3E22 A;  4LF5 O;  2L6L A;  1M57 C;  4I50 B;  1NS1 A;  1Y76 B;  5IJ9 B;  4FFK A;  2A06 H;  2YIC A;  5IY5 C;  3AK1 A;  1N0N A;  1N32 O;  4AQY B;  1GRJ A;  1GN6 A;  2EIJ B;  1FPO A;  4F4L A;  4B3R B;  3K04 A;  4Z1M G;  2E75 B;  4QNH B;  3BFR A;  4HNA B;  1ROP A;  3JAT A;  1WA8 B;  5L3E A;  1YI2 V;  1CPY A;  1UPG A;  4BW5 A;  2Y69 C;  4GX0 A;  3HB3 B;  2F23 A;  4RAI A;  5JH7 B;  4LF9 B;  4I50 A;  4DUY O;  4FJC C;  4DR6 B;  1IUR A;  4PJ0 Z;  2P5O A;  1XOU A;  1Q6I A;  4JAU A;  1Y76 A;  1M9N A;  3CCL V;  1G8M A;  2LFR A;  2WLK A;  2AZ2 A;  4GKK O;  5C8Y B;  3ZHS A;  4PA9 A;  4WF9 V;  1R3I C;  2W6I G;  3CCE V;  2NR5 A;  4HAM A;  4IIJ B;  1WA8 A;  2DYS C;  3TCU A;  4EFE A;  3AG4 B;  3PJS K;  1AP6 A;  5KAF Z;  1OZ0 A;  5JH7 A;  3JD4 A;  1KKD A;  3B8M A;  3O65 A;  1VQL V;  5LMN B;  3BA9 A;  5H6R A;  1BE3 H;  1HNZ O;  4L87 A;  3TJT A;  4CH3 A;  3CSX A;  2L35 A;  1XQ8 A;  1SKV A;  1XNR B;  4IIJ A;  4MVZ A;  2WLJ A;  4MW8 A;  4MTG A;  3BRC A;  5JVD B;  1V54 C;  1SRY A;  4JI5 B;  3S3X A;  1Q8I A;  4X20 A;  4JI8 O;  2YXY A;  1HR0 B;  1M4U A;  4LFB B;  5JCO A;  4LFA O;  1JMK C;  5KHI A;  4ASU G;  2ZD9 A;  1WB7 A;  4XDK A;  5EK0 A;  1XRE A;  1HNX B;  4PDM A;  3SYC A;  5JVD A;  2PYL A;  1EN6 A;  4B3R O;  1FXH A;  4BIU A;  1EZJ A;  3RW0 A;  4NXN O;  2ZNJ A;  1P49 A;  2WSS G;  5JWP A;  1IBL B;  1NBM G;  2FKX A;  1SQQ H;  1TA8 A;  4LF9 O;  4L8J A;  4UCV A;  3L71 H;  2XAF A;  1YTF D;  3G71 V;  2XAS A;  2EIN B;  1Q82 W;  1DF4 A;  3GWO A;  1YZB A;  2DN9 A;  5C93 A;  3B40 A;  1YHQ V;  1OCO C;  2YEV B;  4NTX A;  5CA0 B;  2JGD B;  2YXL A;  2ZIO A;  3WG7 C;  4LFC B;  1JCH A;  1BZK A;  1XMO B;  1S77 D;  4LH6 A;  5IE9 A;  1ORQ C;  5LMN O;  4N21 A;  2HJD A;  2LJ2 A;  4D7T A;  1SA0 B;  1NZ6 A;  4MVS A;  1AI4 A;  3QO8 A;  5DEC A;  4NXM B;  3D3Q A;  1XNR O;  1AI5 A;  2NNU A;  4YY3 B;  3AEI A;  5CA0 A;  3LDC A;  1BMF G;  2DE0 X;  2OCC B;  2XAQ A;  3JCZ A;  3I56 V;  1SQB H;  4Z2W A;  2Y0P A;  4ZHQ A;  3A0B Z;  4OPH A;  3AG7 A;  3HR0 A;  2QKS A;  1NKD A;  1OCZ B;  3A0R A;  2BOB C;  4P30 A;  1UJW B;  1HR0 O;  4LFB O;  2QR4 A;  3ZRW B;  1SA0 A;  1QLE B;  4DV5 B;  1GTO A;  2VRZ A;  3TXS A;  3H1I H;  1VQK V;  3DTU B;  2DYR C;  4PA6 A;  1HNX O;  1WLE A;  3W7U A;  4LF6 B;  4DR3 O;  3N2K A;  1HDJ A;  5B1A B;  1K5S A;  4CH6 A;  3ZBH A;  4OGQ B;  4PDV A;  5LGN A;  2BTO A;  3GWK C;  1IBL O;  3AG1 C;  2Q68 A;  1QCE A;  1X59 A;  4G27 B;  4PI2 A;  5L3F A;  3K5M A;  3QVN A;  5TIS Z;  1TVK B;  1HNW B;  5A9G A;  3ASN C;  2CUG A;  4MVR A;  3CHX A;  2YIB D;  4E4E A;  3X2Q B;  3KZI Z;  3ZMS A;  1XL4 A;  1SET A;  1XMQ B;  3K5O A;  2R9A A;  1IVS A;  1H2L A;  3MDS A;  4B7E A;  1VQ9 V;  3VQW A;  5D5P A;  2NLJ C;  4BWA A;  4JTD B;  4JI4 B;  1CP9 A;  2R9R B;  3ZRV A;  1SS3 A;  4LFC O;  4GCZ A;  4H33 A;  4J9Y B;  1R6T A;  4WBN B;  4ZIB A;  1XMO O;  4NTW A;  3RYH A;  4F6R B;  1TVK A;  2Q69 A;  3IC9 A;  1WN7 A;  2ITC C;  1S3J A;  1SQG A;  3FYE B;  2X6B A;  1MAB G;  3ASO B;  1OCC C;  4JAV A;  4JV5 B;  1MNG A;  4NXM O;  2FML A;  1YJW V;  3B4S A;  4K8X A;  1NR7 A;  3ZCC A;  5DN6 G;  4YY3 O;  1RPR A;  3RFR A;  1VMG A;  1QVG U;  4YJ2 B;  4DV2 B;  2P90 A;  4WBN A;  2WWW A;  4F6R A;  3OMN B;  2RNB A;  3FFQ A;  1NH2 D;  4JTC B;  2CK3 G;  4NB5 A;  2ZQM A;  3D36 C;  4DR1 O;  1YIJ V;  1VEW A;  4DV5 O;  4KFM A;  5B1B C;  4DK1 A;  3EXA A;  4MVM A;  1KBH A;  1FXK B;  3E89 A;  1HW7 A;  1F4M A;  4LF6 O;  4YJ2 A;  4WFA V;  3ABK B;  3BAA A;  3S3W A;  4TSF G;  3K59 A;  5EC2 C;  4K35 A;  3FB8 C;  2OYQ A;  1YIT V;  2IJK A;  4IT5 A;  4DV7 B;  2K1E A;  1H8H G;  4DV6 B;  1N34 B;  1W0K G;  1HNW O;  1KP3 A;  5BMV B;  1I94 O;  3JAW A;  2ZIM A;  3DSQ A;  3SPC A;  1K8A W;  3N2G A;  3OEE G;  4DUZ B;  1XMQ O;  3ZS8 C;  5A2Q N;  3RYI B;  1OV9 A;  3EHB B;  4JI4 O;  3T1H O;  2Z3Y A;  1IBK B;  4KUM A;  4D7S A;  3G6B A;  5BMV A;  4P2Z A;  2PTM A;  5LHI A;  1OCR B;  3ABL C;  1GH6 A;  2DJV A;  4JV5 O;  4QE9 A;  4JI7 B;  4J7Z A;  1KQS U;  4E2L A;  1BL8 A;  2C2A A;  1AJQ A;  4WFG A;  1S5H C;  1V55 C;  3Q4H A;  3JD1 A;  5EYP B;  4WFE A;  4FFB B;  5KA6 A;  2MW2 B;  2PY5 A;  2LFS A;  2RMK B;  1MSD A;  2QJ1 A;  3OAA G;  2EIK B;  1YVW A;  1M56 B;  1RP3 B;  4AHC A;  2IM9 A;  1MMM A;  2QE7 G;  1R3L C;  5IWA B;  1ZUQ A;  1NTM H;  1IZ3 A;  5EYP A;  5KHJ A;  3J7A U;  3C3S A;  1F23 A;  4FFB A;  1EN5 A;  3T1C A;  2CTW A;  4PDR A;  4FZ0 A;  1Q3E A;  2WLN A;  3STL C;  1CXZ B;  4O4H B;  3SPG A;  2Q5Z A;  4PEL A;  5H2F Z;  3RWR D;  2YI9 A;  4DV7 O;  2H8P C;  2R9I A;  1ZL8 B;  4I55 B;  1N34 O;  1AJP A;  1K7D A;  4MVQ A;  3ZHT A;  4CH5 A;  1QU7 A;  4J41 A;  3J81 N;  4IL6 Z;  1HP8 A;  4DUZ O;  1K33 A;  1RM1 C;  3WU2 Z;  4O4H A;  2UU9 B;  4Q20 A;  4KHP B;  2QWQ B;  1GM9 A;  3L9D A;  4H0L B;  4FIP C;  5CA3 A;  4RO2 A;  1JX9 A;  1IBK O;  1VQN V;  3STZ C;  1ZL8 A;  3RGB A;  4I55 A;  5CB4 B;  4BAY A;  4X1I B;  2QWP B;  3JCU Z;  4YIO A;  3OGC C;  3O9O A;  3VOU A;  1VIB A;  3K08 A;  1Q5O A;  4RUF A;  2UUB O;  4JI7 O;  3JD2 A;  4U7O A;  2P06 A;  4LF7 B;  1YCI A;  4EKW A;  1MZE A;  2EIM C;  1ENV A;  5LXT B;  2P67 A;  2Z0A A;  5CB4 A;  1E1R G;  3DXR B;  4KXR A;  1Q7Y W;  4R7C A;  1JVM A;  4DXW A;  2OT5 A;  4P9O A;  3CCQ V;  4X1I A;  1V9P A;  4GT1 A;  4K8Z A;  3CEI A;  4FLU A;  1K34 A;  1Y66 A;  1SZT A;  4AI8 A;  3APQ A;  5IWA O;  3ZJZ A;  3G67 A;  2M7W A;  3CS5 A;  2F95 B;  4DRX A;  1NR1 A;  5LXT A;  1NJI W;  2VQF B;  4UV8 A;  3L74 H;  3DXR A;  1SES A;  4I5S A;  1M93 A;  2XT9 A;  3LDD A;  4ABM A;  4FLV A;  2CAZ C;  5KAI Z;  1H2S B;  3AG2 C;  3OD4 A;  2QWN B;  3E22 B;  4LR3 A;  3CXC U;  1L8D A;  3APO A;  2JS3 A;  5K1X A;  1GO3 F;  5LMU B;  2W0F C;  2ATK C;  1YEW A;  2JEX A;  3JSN A;  4WCE V;  1VQ4 V;  5LOV B;  2UU9 O;  1GMG A;  4KHP O;  1QR9 A;  3MAQ A;  5H5N A;  1SQX H;  2EIJ C;  1YXB A;  4LC1 A;  4FLW A;  1GM7 A;  5CBH A;  3TXQ A;  2H94 A;  1KKC A;  4X1K B;  2CGO A;  5J2T B;  1KEC A;  4J7K A;  1AR4 A;  3AG3 B;  1Q81 W;  3NXS A;  2PGG A;  4JZ2 A;  4A5U B;  5LOV A;  3BPZ A;  3K0D A;  1F51 A;  1WPX A;  1VP7 A;  5IYD O;  3U10 A;  1IXM A;  3D8C A;  1QLN A;  3ZMT A;  3FD9 A;  3CCR V;  4X1K A;  3SJA C;  5J2T A;  3UQ8 A;  4R6Z A;  5JJJ B;  2JJ1 G;  1N4C A;  4PI0 A;  1D5A A;  4ICG A;  2BTQ A;  5B3S B;  4X89 A;  4O4J B;  4B3S O;  2JDI G;  3CYO A;  2YDE A;  3B8N A;  1F7Y A;  3SPJ A;  2JVD A;  4JI1 B;  1OHH G;  5JCO C;  5IY5 B;  4U3J B;  1MSW D;  2EIL B;  4WFF A;  2N05 A;  3GVM A;  1K9M W;  3GB7 C;  4EFB A;  2DW4 A;  3QO7 A;  3P32 A;  1WAZ A;  2CE4 A;  4UCU A;  1R3K C;  2YXH A;  3OUF A;  2IBZ H;  4O4J A;  1G4Y B;  4TT3 G;  3CXH F;  2QSA A;  4X20 B;  2KB1 A;  1R6N A;  2EUL A;  4QPJ A;  5LMU O;  1M1K W;  4UCR A;  4U3J A;  1EZV H;  1PPJ H;  1K4D C;  1Y67 A;  3ABU A;  1VF5 B;  2X6C A;  3HPL C;  4Z1V A;  1SQF A;  3IC7 A;  4TOI A;  1XHZ A;  1EFR G;  4UUJ C;  3EVK A;  4B3M B;  4PA7 A;  2DYS B;  3OMI B;  2YS8 A;  3KKY A;  2QWR B;  4CC5 A;  1MZF A;  4W4L A;  1YSC A;  1JPX A;  3OW2 U;  1I7F A;  3ZMV A;  4DV3 B;  1MOF A;  2WA3 A;  4YJ3 B;  3JD3 A;  1PNL A;  4FZ1 A;  3SYQ A;  2JGU A;  4AQY O;  2JS5 A;  2IU0 A;  2EIN C;  1LR1 A;  1D5N A;  4LF4 B;  4RWU A;  4Q6G A;  1BQZ A;  2KSD A;  4DR6 O;  2W6J G;  1NTZ H;  3U0Z A;  4YJ3 A;  1R3J C;  1M90 W;  3RYC B;  2N04 A;  1K97 A;  3K0G A;  1PL0 A;  2D2C B;  4B3T B;  2YSU B;  3JAL A;  4RQE A;  1YDX A;  4FLY A;  4MTX A;  3P3N A;  1IXB A;  2ZKO A;  2WLH A;  4ZHQ B;  2UXD B;  3E83 A;  3QF7 A;  2AZ0 A;  3LUT B;  4UVC A;  2OIE A;  3VQV A;  3RYC A;  5CBF A;  2K9P A;  4XDL A;  4LBE C;  1OCZ C;  3RT3 C;  2ZCE A;  2R72 A;  3HKD B;  4DV1 B;  1QLE C;  2QKA A;  1XBL A;  3BA8 A;  3N2K B;  2VWJ A;  2HHH B;  2WLI B;  4GZR B;  4JI5 O;  4B3M O;  4I7Z B;  1WB8 A;  4IGG A;  2QWO B;  1G1X B;  2LW1 A;  5B1A C;  3RYF B;  3H01 A;  2IJI A;  1DK1 A;  4GX2 A;  3OMA B;  4OXS A;  3VBB A;  1N36 B;  1KU9 A;  5IYZ B;  2UXC B;  3HKD A;  3ZN0 A;  4FVM A;  4DV3 O;  5JJE B;  4MTF A;  3P30 A;  2B5U A;  2WLI A;  3TK1 A;  5JQG B;  4I9Q A;  4TQF A;  2W0X A;  3SPI A;  3JAK B;  3RYF A;  3F5T A;  2ITD C;  3E8F A;  4MT8 A;  2E74 B;  3CC7 V;  1ZLZ A;  5J2U B;  5IYZ A;  5EBM C;  1Y6X A;  3RYH B;  4FLT A;  2O57 A;  5KHH A;  4DR5 B;  3ABT A;  1KUQ A;  2BOC C;  3SYP A;  2QA4 V;  2V1D A;  4QGP A;  5JQG A;  5CBG A;  2XUM A;  1W0J G;  1DF5 A;  2X0L A;  2XAJ A;  1GM8 A;  2F43 G;  3JAK A;  1G6U A;  3CE2 A;  3H1J H;  3UCS C;  1GN3 A;  2IH1 C;  5J2U A;  4FM2 A;  3L73 H;  3SJC C;  3ZHU A;  1EN4 A;  2UXD O;  4JF3 A;  3QG5 A;  2GDS A;  2Q9L A;  2PI4 A;  3TGU H;  4CH4 A;  1P84 F;  1K3E A;  3UKM A;  1BGY H;  4DV1 O;  4JGS A;  2V4D A;  1R73 A;  3CJH B;  5FPO A;  5H9C A;  5H6Q A;  4GUN A;  4JPR A;  1A32 A;  1COW G;  1S72 V;  2HHH O;  2HR3 A;  1FXK C;  4IHJ B;  4NR1 A;  2X7R B;  1NQT A;  4MTO A;  2DMX A;  1N36 O;  1S76 D;  5J9P C;  2B1I A;  3L72 H;  2UXC O;  2HP8 A;  3JAW B;  3ETD A;  1NU1 H;  3CJH A;  5BR8 B;  2YIA A;  5EC1 C;  5L3C A;  5LP6 C;  3CP1 A;  1MG1 A;  2ZDI A;  3N2G B;  1H2G A;  4MVO A;  4JYC A;  4IHJ A;  1VQ6 V;  4TWK A;  3RVY A;  1XNQ B;  4ZKI A;  1BS3 A;  3HKC B;  3G4S V;  4FM0 A;  5KA5 A;  3CME V;  1O9H A;  3B2E E;  4ZOL B;  3QNE A;  3M99 B;  2PI5 A;  4DV0 B;  3OFN G;  1US6 A;  4I0X B;  4DR5 O;  2BCC H;  2P4K A;  3T2M A;  1DLB A;  1OCR C;  4ZBM A;  1Y74 B;  2M6Y A;  3ZHQ A;  1K73 W;  2KQX A;  2EBO A;  3Q4H B;  4FK5 C;  1S0V A;  3HKC A;  4ZOL A;  3WB0 A;  2CTR A;  3ZMZ A;  5DED A;  3ZHV A;  4LF8 B;  2YI8 A;  4I0X A;  1K5Q A;  3D36 A;  4DK0 A;  5LYJ B;  3OR6 C;  2Q7G A;  4TV9 B;  2KG7 B;  1W2B U;  4PHZ A;  1Y74 A;  2HG5 C;  2ZE5 A;  4UB8 Z;  2LO1 A;  1NVP B;  4G2K A;  1BT8 A;  3MD0 A;  1M56 C;  3OT7 A;  4KP4 A;  1KMI Z;  2E76 B;  3ICX A;  4YHH B;  4DV2 O;  2ZE7 A;  1ZX3 A;  3FB5 C;  2E3C A;  1TUB A;  1IX9 A;  2ZNI A;  2RDC A;  1K92 A;  1WP8 A;  5BY1 A;  1FKA O;  3CRQ A;  4BR6 A;  3JAR B;  5LYJ A;  1PM9 A;  4TV9 A;  1Q90 D;  4UCS A;  2KG7 A;  3R65 A;  4K0K B;  5ITZ B;  1N33 B;  5K1P A;  3CWB H;  4CBC A;  1KB9 F;  4NKG B;  2QM7 A;  5BR8 O;  2F4V B;  4RQF A;  3ABM C;  5L3B A;  3OTF A;  2IJJ A;  4EB6 B;  1VAR A;  2P4V A;  3CCS V;  4TUY B;  5LGT A;  4JI3 B;  1B6Q A;  4O4I B;  4JZG A;  3FX7 A;  3JAR A;  1XNQ O;  1EBO A;  2AGA A;  3B77 A;  1NTK H;  2GTA A;  4DV6 O;  4J7J A;  1Z5V A;  3QTC A;  1BSM A;  5ITZ A;  1VF6 A;  4DV0 O;  2GTS A;  5BZB A;  2CTP A;  5KUM A;  4EB6 A;  1LUW A;  4TUY A;  4O4I A;  4UVA A;  3JYC A;  4QPK A;  2FL4 A;  4D6T H;  1P7G A;  3MHS C;  1WPB A;  3K57 A;  3K5N A;  1MA1 A;  1PV0 A;  2XAG A;  3F5W C;  3R66 A;  3U11 A;  2EJ7 A;  4X88 A;  4CC6 A;  4P9P A; 
#chains in the Genus database with same CATH homology
 2LJ2 A;  2H3O A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...