2LJ2A

Integral membrane core domain of the mercury transporter merf in lipid bilayer membranes
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure determination of a membrane protein in proteoliposomes.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 18
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2lj2A00
2LJ2A 1WAZA 2H3OA
chains in the Genus database with same CATH superfamily
2BCCH 3SPGA 5TISZ 4OXSA 1IZ3A 3CRAA 4O2BB 3A2FA 5KA6A 2VWJA 3OMAB 4I55B 2XHBA 4G27B 4CH3A 4X1YB 4DV5O 3M99B 1VQ4V 1VF6A 2UXDO 5IYDO 4O2AB 1K9MW 5IWAB 5JJJB 2EIJC 5EIBC 4FLYA 3OM3B 3F5WC 1VF7A 1JX9A 2XAGA 4NR1A 1QLNA 4GUNA 3BCCH 4GKKB 1VQ6V 3VBBA 3STLC 1SS3A 1KQSU 1Q5OA 1AR4A 4QPKA 2QWPB 3P30A 5IJ9A 1Q3EA 4DYLA 4UB6Z 3JATB 4X20A 4XDJA 2Z3YA 4GX1A 2WAMA 5IT9N 4LFCB 4HZ3A 2Q0OC 4GT1A 4PA7A 1UFIA 5L3FA 2CDYA 4DV2B 1TVKA 3OAAG 2D3OW 2BTOA 3T4DA 4DW0A 4G2KA 3CPWU 2A3QA 4DR3O 2LQTA 5JQGB 2DYSB 3CYOA 3ZBHA 1GM9A 4FZ1A 3VQYA 1N0JA 5FPRA 1QU7A 1VF6C 2HVKC 3ZMSA 3ZHSA 2CTWA 2ZE7A 5IYBO 2EINC 1Y76B 4NKGB 1ZX3A 2Q68A 1PL4A 3SR2C 4MW8A 4B3RB 3ABUA 5JCOC 2ZIMA 4GX0A 1IBMO 1N8RW 4OX9B 1ORQC 2PTMA 2H94A 3AG1B 2PGGA 2YIBA 1Q6HA 3TETA 3AG3B 1Y67A 3B77A 4O4JB 1N33B 3MHSC 2UXCB 5GW7A 2F4VB 3E35A 2DW4A 3E86A 2JDIG 5LHGA 2Z0AA 3BFRA 4O4LB 3CCMV 4KFMA 1SF9A 3JARA 2PY5A 1AI4A 2HJDA 1CXZB 2DJVA 3DSQA 4O2BA 1JA8A 5B1BC 1IURA 1QVFU 4YY3B 3IC9A 5KX5B 4PD4F 1VQLV 1OCZB 1OCCC 4DR5O 2QDOA 4DV3B 4NXNB 1R6TA 4O2AA 3RFRA 2UUCO 1JQ0A 2HVJC 1JJ2U 2RJZA 5JJNB 2QA4V 1XQ8A 5H9CA 1SZXA 2P4KA 5A2QN 3ABTA 1QNMA 1F4MA 1V54C 2IH3C 2QKAA 2AZ2A 5EBWC 1NKDA 4J9ZB 1F51A 3HKBB 4LC1A 2XAHA 2BTQB 3CXHF 3SPCA 3UO3A 4EB6A 2NNUA 3C90A 3ABLB 2AXTZ 2Y4UA 3CMAV 1S72V 2A9HA 2YIBD 4J7JA 2ITDC 1NVPD 3E8BA 5C8YB 4Q20A 3X2QB 4K8ZA 2YI8A 4A5UB 4TV8B 1N32B 1J5EO 4IIJB 3T1HO 1BMFG 5JQGA 4MVOA 4GZRB 4DR6B 2E3CA 3HKEB 1JMKC 4B3SO 1M1KW 1GAXA 3JALB 2R70A 4RUEA 1HNWB 4BAYA 3K9AA 1NTZH 2X6AA 4JI2B 3JAWB 2P5OA 3T1YB 4X1KB 2GTAA 3FAVA 5CN0A 2DN9A 2F66C 1EN5A 1VF5B 1M93A 3AG7A 4X65O 4O4JA 2E5LB 1IX9A 2VS0A 3AG4C 3CRMA 1IXMA 4HNAB 2RN9A 1BS3A 2XAJA 3RYCA 5EZYB 2JEXA 2F23A 4JYBA 4OGQB 1QLEC 1A32A 1DF5A 3QF7A 3CCSV 3L9DA 5IJ0B 2QTOA 1I94B 1NR1A 5EC1C 2Q0AA 2BSKA 4DR7B 4WFGA 3CCQV 2V1DA 5DN6G 4JTAB 1JCHA 2IU3A 1SQXH 3E83A 3FB6C 1V55C 4QPJA 1R6NA 3C3SA 2ZE6A 3U10A 3A8TA 5FNVB 1N36B 3OW2U 2JS3A 4B3TO 4CS4A 2EILC 3H1HH 4RO2A 2ZR2A 4QNHB 4JPRA 4OX9O 1S5JA 2UXBB 1AI5A 3N2GA 5BXZA 4TUYB 3HKBA 4PELA 2BTQA 5GTIZ 5K1PA 4LNUA 4FK5C 2HJFC 1AVMA 2RDCA 2F4VO 5A9GA 2WA3A 2ATKC 2LW1A 4BIUA 5C8YA 2EIKC 2EBOA 3IC7A 4TV8A 4Z1MG 3K08A 4PDRA 4IIJA 3DTUB 2Y0IA 3W7UA 2DQ0A 1OCRC 1VQMV 3ZJZA 4DV6B 3CD6V 3HKEA 4DO2A 3I56V 4MVQA 3JALA 2LFSA 4R6ZA 2Y4TA 1EZJA 5AG2A 1XEQA 1YTFB 2QTSA 2YS8A 4WFEA 2OCCC 4WF9V 1CEZA 4B3MO 3SYOA 3W7WA 5GONB 4DUYO 4GCZA 3JAWA 3WB1A 5J9PC 4X1KA 2F1MA 4J10A 3L74H 4JASA 4YXWG 4LF7B 1P7BA 4D6TH 3LDCA 3GB7C 2EIMC 3F7YC 4QIWF 2P6JA 3WB0A 2GBOA 5LMNO 3B8MA 1M5IA 1ENVA 5F2VO 4HNAA 1OCOC 5EZYA 3J81N 2YXYA 2JK5C 2EIJB 4RWUA 1NS1A 3CRRA 3JAKB 2JGDB 2Q7HA 5L3CA 1EM1A 4I9WA 1SQPH 1M9NA 1YSCA 3LSQA 5JJEB 2XUMA 3ASOC 1NZ6A 4K8XA 3Q4HB 4X8AA 4K35A 4JYAO 4JAUA 2QM8A 2NN4A 4D7SA 4ZIBA 1M90W 1RSOB 4ICGA 1OZ0A 2GDSA 1TA8A 4WCEV 5FNVA 4O4HA 5KHHA 2IJIA 2X7RB 4P2ZA 3LDDA 3OR6C 2OIEA 2Y0PA 1FXVA 1KUQA 3WG7C 4MVRA 4YIPA 2A79B 4TUYA 5IY5C 1YVWA 4IYHA 3P3NA 2UU9B 1XHXA 4J11A 1S3JA 3CS5A 1XMQO 1KYOF 1PP9H 3H1IH 1WB8A 2Q8VA 1AJPA 2ZE5A 4JI1O 2EINB 3ZMZA 3GWOA 4LF4O 2YI9A 4LH7A 1VQ7V 1YI2V 3LSSA 1WB7A 3ZMTA 1UJWB 1G6UA 4DW1A 2CK3G 1N4CA 4TQFA 2GUZA 4FLTA 2K1EA 3D36C 1I94O 3ABMC 4UXNA 4LBEC 2Q7GA 3A0BZ 3JD4A 5LP6A 1UPGA 1GN6A 3E2EA 2QM4A 3G67A 4X20B 2PUSA 4FZ0A 3IFXA 3KCXA 3BA8A 5GONA 3ETGA 4HBNA 3THOA 1AB3A 3CCJV 4BIZA 5KHKA 3M7MX 1BHBA 4UVAA 1JPXA 3CEIA 5FPOA 2GSMB 3SPHA 4DUZO 5B1BB 1YXBA 4JI0B 1IVSA 1GK9A 1D5NA 1OCCB 4PDLA 1E1RG 5CBFA 4BR6A 2VWKA 1F23A 1H2KA 3JAKA 2JGDA 1YJ9V 2LP7A 1MZFA 5IYZB 1NTKH 4PA3A 1GKFA 1V54B 1IBKO 1BGYH 3Q4HA 2ZM6B 4FLUA 3BEHA 5LP6C 4R50A 4DV6O 5BZBA 4LR3A 2CH7A 2HKOA 4FFBB 4YIOA 4ASUG 3CCLV 1FFXB 4CC6A 3ZHTA 3DC6A 4LF9O 2ZIOA 1BCCH 4X62B 2JEUA 2VQEB 3CRCA 1JVMA 4KHPB 3OGCC 4IHJB 4AQYO 3OTFA 4F6RB 1VQKV 5B1NA 1GN4A 4LF8O 2OTJV 4P9OA 2HEPA 4WFAV 4DV0O 1XNRO 3K0DA 2YDEA 4H44B 3RYFB 1M56C 3CCVV 2PYLA 2RQ6A 3JD0A 3K9SA 2Q69A 4DR1B 5LOVB 3EFFK 2Q4PA 5JCOA 1SERA 4DR4O 4MSWC 4OPAA 2JGUA 5H5NA 3CE2A 1R3IC 4QE7A 2OYQA 1FD9A 2HG5C 3PN1A 5J2UB 5EBMC 5LGUA 3CCEV 3ETDA 3CX5F 5EIBD 4DR2B 3W7TA 5B1OA 3H1LH 1XMOB 4EB6B 3AG4B 4DK0A 2ZNIA 3AEIA 4IGGA 3U0ZA 4PI0A 2DE0X 1MZEA 3K5OA 5HFMA 2PI5A 4KUMA 3TXSA 3OTOB 1KP3A 4TT3G 1QLEB 4JI4O 4LF6B 2UUBB 1Y6XA 3SJAC 4JV5O 1YITV 3ZRVA 4LFAB 1ZTEA 4X88A 2B1GA 1K73W 1CP9A 2ZXWC 1NQTA 1AP5A 5HFLA 2ITCC 1V55B 3UQ8A 4ZOLB 2ZQMA 1B06A 4AI8A 1TAEA 3SYAA 4PDMA 4LF5O 4CZZA 5IYZA 3APQA 1COWG 3FD9A 1WJZA 5KA5A 2OWOA 2EILB 2DWDC 5B1AC 3FAVB 4U3FH 1ZL8B 1G4YB 4X66O 3ZHVA 3IGAC 4AHCA 4FFBA 1S5HC 1FFXA 4N23A 2LJ2A 1SC5B 3RYCB 3K03A 3B40A 3T2MA 2OCHA 2ZKOA 2G38A 5CBGA 1WLEA 4E2LA 2EIKB 2ADQB 4NB5A 3MD0A 1IXBA 4IHJA 4F6RA 2GTSA 3CP1A 1OCRB 2UXXA 4JI6B 1WP7A 2BSKB 4KL1A 3BAAA 3SDLA 3OMIB 1THZA 2QKSA 3RYFA 3WB2A 4FFKA 3E22B 1PV0A 3EHBB 2OCCB 5LOVA 2XOKG 1K8AW 1U97A 2PYJA 1XDCA 4G28B 5H6RA 1SZTA 1SRYA 1R1BA 1H2LA 4P9PA 1XBLA 4DV1O 1EZVH 1K5SA 2AHYA 5J2UA 4LFBO 2DYRC 4KXRA 4YHHB 2WLIA 1S5LZ 2LFRA 4TWKA 4U7OA 2YICA 3N2GB 2EIMB 1S0VA 3S3WA 4LNUB 4JTDB 4QGPA 1VQPV 3E89A 3B2EE 4DXWA 3JAMN 1OCOB 1M4UA 5J2TB 4UV9A 1KECA 4LP8A 5EBLC 1OJHA 4MT8A 4CH4A 3BHPA 3K57A 4UCVA 2W6JG 2B5UA 3E8FA 4J7ZA 4DV7O 2VQEO 2D2CB 4ZHQB 1K3EA 2F43G 1TUEB 1HNZO 3ASOB 2QGNA 3ZRWB 1NH2B 2IJKA 4CC5A 4W4KA 3WFVA 4KP4A 4FM2A 1HP8A 1GRJA 2EZPA 4FLWA 1M57C 4F6EA 1HNXB 2CTRA 4ZOLA 2WSSG 1V9PA 4QE9A 3HKCB 5IWAO 3QO5A 1XL6A 4XDKA 3TCUA 2IJHA 5L3BA 5CA3A 3GWKC 3WG7B 1FXKC 1ZL8A 4GKKO 3ZS8C 2M6YA 5IY5B 1VQ9V 3G80A 3ML0A 4X64B 2ILMA 2ZCEA 1EBOA 4RAIA 1N0NA 4GYCB 3FX7A 3BVOA 2Q73A 4LFCO 3OTOO 2LGQA 1W0JG 4K0KB 3G6EV 2CTPA 2N05A 2R9AA 2CE4A 4DV2O 2QSAA 1Y74B 3ZHRA 3ABMB 5KHJA 5KLVH 5EYPB 1Q8IA 3EXAA 4H33A 3FYEB 3RYHB 3E22A 2P67A 2JIZG 2NR5A 4JI3B 3IAYA 4O4HB 2P4VA 1SQQH 3QTCA 3TK1A 1SA0B 1L0LH 3J80N 1VQNV 1BL8A 1XILA 4B3RO 3VQXA 3ASNC 1RPRA 3UT5B 1VP7A 4B08A 3BPZA 3K58A 1YJWV 4NXMB 4JI8B 4CS3A 2MW2B 1PNKA 4MVZA 1I0HA 2UUAB 3R65A 2FB5A 2GHYA 5D5QA 1N33O 4X1IA 3AK1A 5J2TA 2UXCO 1I5XA 1GMGA 3ZRXA 5KUKA 4FLXA 4L87A 3MHHC 1IDSA 1QVGU 4J42A 1S76D 1B6QA 3HKDA 4R8CA 4R7CA 4MTFA 1IBLB 1PD3A 4ZHQA 3A0HZ 2GUZB 3RN4A 1TGOA 3GVMA 1FXHA 1B3QA 3K04A 3ZRWA 2QR4A 2X0LA 3CWBH 3W7XA 4YY3O 4JI6O 3UKMA 3ZX6A 5LP6B 5B66Z 2KQXA 2Q9LA 2Q7EA 2WLNA 3JSLA 3HKCA 3OEEG 4DV3O 4NXNO 5LMUB 1HDJA 4I9QA 1K97A 4LH6A 1KU9A 1PL0A 3LDEA 5IDJA 3RW0A 1SQGA 1H8HG 2JS5A 2DWEC 1Q6IA 3H1KH 1ZLZA 5CMUA 2Y48A 1NU1H 1P7GA 2WLJA 2ZD9A 2WLHA 4TOIA 3ZEDA 4AILC 5JH7B 5L3DA 1E1QG 1EN6A 1KD1W 4X89A 1M56B 3CC2V 3FB8C 5CB4A 5E1AC 1Y66A 1BSMA 3NXSA 1WPXA 2DOSA 5DECA 1K4CC 3I5DA 3K59A 4DV5B 2K9PA 4TQDA 3TJTA 2UXDB 2A0LA 2QWRB 2HHHB 3D36A 3G6BA 1LUWA 1P4RA 3LNNA 1Y74A 4JZ2A 1N32O 2RMKB 3C3TA 1RPOA 4BWAA 3CSXA 5KHGA 1SQFA 5EYPA 2MK3A 5KMGA 4DR6O 3RGBA 1K33A 3RYHA 1OHHG 2CH7B 1AP6A 2HFEC 5LGNA 1XI1A 1K92A 5ITZA 1H8EG 3OD4A 1SA0A 1BT8A 4K3AA 1HNWO 1NH2D 4FLZA 4Z2WA 1G1XB 1PNMA 1N34B 2ZDIC 4JI2O 3UT5A 3T1YO 2YEVB 1BQZA 4PA6A 4U3JB 1URFA 2ZXWB 1I5YA 3LNMB 3O9OA 1PKXA 3JD1A 4ZI7A 2W6IG 4HYOA 5JWPA 2E5LO 1MA1A 1QCEA 2WWWA 4PDVA 2PI4A 2LO1A 4GLXA 4DR3B 2QWQB 4WBNA 1AI7A 3SPIA 1GN2A 1ZSPA 2H8PC 1SESA 3QNEA 1RM1C 5B1AB 3JCUZ 2OIGA 3OUSA 3ZHQA 3F5TA 2R9IA 1H2NA 1VARA 1QR8A 5B3SC 1Q86W 4E4EA 4DR7O 5L3EA 1IBMB 3SJCC 4JI5B 2WA4A 3CXCU 1R3JC 3SJBC 2ZNJA 3K0GA 4J80A 3W7SA 3WU2Z 2QE7G 4MVUA 4JI3O 3OGIB 1N36O 4JYCA 1W0KG 2UXNA 3N27A 3LSUA 2IU0A 2FL4A 2IBZH 3ZN0A 1G8MA 5H2FZ 5LYJB 2UXBO 3OMNB 1XUQA 1VQ5V 1OV9A 5JH7A 2ZR3A 5LBQA 1JR9A 4JI8O 3L72H 5CA1A 2YIDA 1BZKA 3HPLC 4UUJC 5CBHA 2DQ3A 1KB9F 1D5AA 4MTXA 4FM1A 4IT5A 5LA6A 1WPBA 2L6LA 4DR5B 1ZAUA 3APOA 2X6CA 2UUCB 2DYRB 3R66A 4I0XB 3DGEA 1MOFA 1X59A 5L3GA 2QWNB 5LL6Y 2ZINA 1YDXA 2N04A 5K1XA 1QQCA 2L35A 1ZUQA 1J95A 3NR7A 1GTOA 3CRQA 3AG2C 1R6KA 4FIPC 4WFHA 2NLJC 2X6BA 1YTFD 2YEVA 1FYJA 1NR7A 4OPHA 4U3JA 4LF7O 1F7YA 3AK2A 1L1FA 2V4DA 1KP2A 3CCRV 4LWSA 1M57B 1J5EB 3T1HB 1K4DC 2CGOA 1H2MA 2ODMA 3ETQA 1LNQA 3JD2A 2O57A 4MVSA 3BABA 4Q6GA 4B3SB 3HB3B 1Z2GA 4UCSA 4LCUC 4PJ0Z 4NYKA 4UVBA 2WLIB 1FXKB 4ZKIA 2HHHO 1SQVH 2HR3A 1W59A 1KKDA 2EZOA 4I50A 2QEXV 3ABKC 1AJQA 1XREA 2JJ1G 2JJ2G 4CH6A 1H38A 1AROP 4FPPA 4X65B 1DGSA 4L8JA 2Q67A 1BHAA 3D8CA 4FMTA 1BE3H 1N34O 3TGUH 1YF2A 1YEWA 1LR1A 5LYJA 3VQVA 4X9QA 3KZIZ 2CGNA 2P06A 4GKJB 4CBCA 1VQOV 1KBHA 2UU9O 2OT5A 4XBFA 2Z5UA 1Q7YW 2XTAA 3PJSK 2PZSA 4MS2A 5KUMA 2E76B 1NBMG 4I4TB 3ASNB 2CAZC 3DXRA 3RYIB 4I0XA 1Q82W 3B4SA 5H6QA 2LW7A 2HP8A 1PNLA 2FTKA 1AR5A 4B3TB 1JFFB 4TSFG 4BW5A 5DM6V 1Q43A 3K79A 3N2KB 1SETA 4NTWA 4JI5O 3OFNG 1YHQV 2IW5A 4XDLA 2XT9A 2EX3A 5LXTB 1U96A 4C7UA 5CA0B 3FYIB 1SQBH 3UO2A 1L8DA 4PA4A 4UV8A 2ARHA 2ZT9B 1KC8W 2IH1C 4JI0O 2F93B 2XASA 2XAFA 1W2BU 4Z1VA 2FMLA 3H01A 5LHHA 5JVDA 3STZC 4JZGA 3I55V 2EJRA 2R72A 2N74A 4I55A 5BMVB 4JF3A 3ZMUA 1DLBA 1FJGB 1R3KC 4X1YA 3JCZA 3SYPA 1DF4A 3M8AA 1FXKA 1AI6A 2PF4E 4DRXB 4B3MB 2VQFB 3RT3C 4EEQA 4DUYB 1GM8A 2AZ0A 2ZM6O 5BR8B 4H37A 1FS0G 4DV4B 1I08A 3CC4V 1H2GA 1K7DA 3OT7A 1X4TA 2YXHA 3B09A 3QO8A 4X1IB 4F4LA 4RQEA 2KG7B 3IJ4A 4J41A 4WFBV 1PPJH 5LMNB 3QVNA 1MABG 1MSDA 3HKDB 1Q90D 1NI8A 4X62O 2RCVA 1NJIW 1Q81W 3JATA 1P84F 2R9RB 4UB8Z 4KHPO 2H3OA 1FPOA 3BRCA 4RQFA 2Y69C 3RBZA 3AK3A 3CMEV 2CUGA 1KKCA 3JSNA 2A06H 3VQWA 3OE7G 3S3XA 1HR0B 4JYAB 2YSUB 4DR1O 4D7TA 4IL6Z 4I4TA 1CPYA 3BY6A 3SYQA 3RYIA 3D3QA 3K5MA 4O4IB 4PA9A 3UCSC 4NTXA 1Y76A 1L0NH 3K5LA 3K5NA 2F95B 3ETEA 1SKVA 1JFFA 1BQ0A 3ZIAG 4DR2O 1FFTB 1I7FA 3P32A 1Z5WA 3N2KA 1XMOO 3D3IA 3K3WA 3H9VA 5C93A 5CB4B 1QHTA 3B8NA 1WP8A 5B5EZ 1US6A 2IJJA 2ETNA 3CJHB 4GX5A 3ZCCA 5LXTA 5CA0A 2P22C 1XMQB 1TUBB 2AW9A 2OTLV 1RM1B 4JI1B 4LF6O 4EFEA 2UUBO 3DC5A 4LF4B 2W0FC 4W4LA 2QWOB 4JI7B 5KAFZ 1XOUA 3QO7A 1RP3B 4LFAO 5B3SB 3E8HA 3SJQC 4U7NA 5KMGB 4O4LA 2QJ1A 1JJOA 4JAVA 1HW7A 3L73H 4I5SA 4GKJO 1KMIZ 1AILA 3OUFA 2VRZA 5ITZB 1MSWD 3KG2A 2BOCC 5KX5A 5BMVA 2DYSC 1EN4A 2WLKA 4YJ2B 3ZMVA 2DMXA 2YXLA 4DRXA 3LUTB 1QR9A 3SPJA 3KKYA 5LGTA 2KKWA 1DTOA 1YCIA 3ICXA 4ZI7B 3BA9A 4DUZB 2KG7A 1MG1A 3AG1C 2AGAA 4NTYA 5LHIA 3AG3C 4WBNB 1QBZA 5EC2C 1VQ8V 2YUAA 3H1JH 5EK0A 3FKSG 1JOYA 1F4NA 2E75B 4EFBA 4MTOA 2EJ7A 4MVMA 4QJFB 2YC0A 3L75H 4UCTA 2P7TC 4BIOA 4ABMA 4J7KA 2AHZA 1WN7A 1IBKB 3G4SV 3FFQA 2E74B 2WLLB 4TV9B 4YJ3B 2XAQA 2BOBC 1YIJV 1OCZC 2ZDIA 1XNQB 3MDSA 4PI2A 3AG2B 5FL7G 1FJGO 4O4IA 3ZHUA 4LF9B 4YHHO 1H2SB 3JASB 2VQFO 2FKXA 5CA1B 1VMGA 3UM7A 5BR8O 4JTCB 4AQYB 1FAFA 4DV4O 4H0LB 4EKWA 5D5PA 4LF8B 3KCYA 3U11A 5LA6B 3CJHA 4DV0B 1XNRB 1TUBA 2XNDG 4MW3A 1R3LC 4N21A 1YJNV 2WLMA 3ABLC 3JD3A 4DR4B 1WA8B 4HAMA 3OEHG 4WFFA 2HLDG 4H13B 4NVPA 5E79Z 3X2QC 2W0XA 4IYIA 3ABKB 5IJ0A 1HNXO 2ADPA 2KSDA 3EVKA 2YIAA 4FLVA 1HR0O 3RVYA 3CCUV 2JVDA 3T1CA 4YJ2A 4PHZA 2EULA 2QKCA 3HR0A 2ZE8A 2RNBA 4PV1B 2FYUH 2Q6AA 4JI4B 4LWSB 1K5QA 3CC7V 2BE3A 4JV5B 4X64O 1Y4MA 4P30A 3ZN1A 3A0RA 3TXQA 3RWRD 1XL4A 1XHZA 2P90A 4K0KO 2KB1A 3SGIA 4LF5B 4JI7O 1T5EA 4I50B 3J7AU 5FLXN 1HWYA 1GM7A 3FB5C 4B7KA 5BY1A 5IYCO 3CHXA 1NT2B 2WLLA 4TV9A 1FKAO 5KHIA 4X66B 3JYCA 4YJ3A 3L71H 1AJNA 3L70H 4UFZA 1E79G 1ZWIC 4CS2A 1NTMH 3CB2A 1P49A 5IJ9B 4B7EA 3JASA 1MMMA 1EFRG 2B9ZA 2GV9A 1PM9A 1GO3F 3K06A 4NXMO 4ZBMA 4I7ZB 2C2AA 4UCUA 2UUAO 1TVKB 2V7QG 4JAAA 3O65A 3RVZA 3OR7C 1RFYA 4FVMA 1GN3A 4BW9A 4UCRA 2M7WA 2WPDG 1WNSA 1MNGA 2B1IA 3G71V 4JYYA 3DXRB 1IBLO 1Z5VA 4J9YB 3F7VC 4RUFA 1WAZA 3MAQA 1YZBA 1WA8A 4UVCA 1ROPA 1DK1A 4DV1B 3VOUA 4LFBB 1VEWA 1VIBA 4UCOA 1LUVA 4CH5A 1R73A 3QG5A 1K34A 2LGWA 4GX2A 1O9GA 3ZRSA 3FB7C 5LMUO 4FM0A 1NVPB 2CTQA 5KAIZ 4JGSA 1RSOA 1O9HA 4FJCC 4MTGA 4DK1A 3T4ZA 1B04A 2QM7A 3SYCA 1AR1B 1XNQO 5GTHZ 2A7WA 2Y69B 1D2DA 3P3PA 2IM9A 4DV7B 1Q6UA 1GH6A 1S77D 2Q5ZA 5IE9A 5DEDA 3E8GA 3JARB 5JVDB 1HNZB 2JRIA
chains in the Genus database with same CATH topology
2LJ2A 1WAZA 2H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ2 A;  1WAZ A;  2H3O A; 
#chains in the Genus database with same CATH topology
 2BCC H;  3SPG A;  5TIS Z;  4OXS A;  1IZ3 A;  3CRA A;  4O2B B;  3A2F A;  5KA6 A;  2VWJ A;  3OMA B;  4I55 B;  2XHB A;  4G27 B;  4CH3 A;  4X1Y B;  4DV5 O;  3M99 B;  1VQ4 V;  1VF6 A;  2UXD O;  5IYD O;  4O2A B;  1K9M W;  5IWA B;  5JJJ B;  2EIJ C;  5EIB C;  4FLY A;  3OM3 B;  3F5W C;  1VF7 A;  1JX9 A;  2XAG A;  4NR1 A;  1QLN A;  4GUN A;  3BCC H;  4GKK B;  1VQ6 V;  3VBB A;  3STL C;  1SS3 A;  1KQS U;  1Q5O A;  1AR4 A;  4QPK A;  2QWP B;  3P30 A;  5IJ9 A;  1Q3E A;  4DYL A;  4UB6 Z;  3JAT B;  4X20 A;  4XDJ A;  2Z3Y A;  4GX1 A;  2WAM A;  5IT9 N;  4LFC B;  4HZ3 A;  2Q0O C;  4GT1 A;  4PA7 A;  1UFI A;  5L3F A;  2CDY A;  4DV2 B;  1TVK A;  3OAA G;  2D3O W;  2BTO A;  3T4D A;  4DW0 A;  4G2K A;  3CPW U;  2A3Q A;  4DR3 O;  2LQT A;  5JQG B;  2DYS B;  3CYO A;  3ZBH A;  1GM9 A;  4FZ1 A;  3VQY A;  1N0J A;  5FPR A;  1QU7 A;  1VF6 C;  2HVK C;  3ZMS A;  3ZHS A;  2CTW A;  2ZE7 A;  5IYB O;  2EIN C;  1Y76 B;  4NKG B;  1ZX3 A;  2Q68 A;  1PL4 A;  3SR2 C;  4MW8 A;  4B3R B;  3ABU A;  5JCO C;  2ZIM A;  4GX0 A;  1IBM O;  1N8R W;  4OX9 B;  1ORQ C;  2PTM A;  2H94 A;  3AG1 B;  2PGG A;  2YIB A;  1Q6H A;  3TET A;  3AG3 B;  1Y67 A;  3B77 A;  4O4J B;  1N33 B;  3MHS C;  2UXC B;  5GW7 A;  2F4V B;  3E35 A;  2DW4 A;  3E86 A;  2JDI G;  5LHG A;  2Z0A A;  3BFR A;  4O4L B;  3CCM V;  4KFM A;  1SF9 A;  3JAR A;  2PY5 A;  1AI4 A;  2HJD A;  1CXZ B;  2DJV A;  3DSQ A;  4O2B A;  1JA8 A;  5B1B C;  1IUR A;  1QVF U;  4YY3 B;  3IC9 A;  5KX5 B;  4PD4 F;  1VQL V;  1OCZ B;  1OCC C;  4DR5 O;  2QDO A;  4DV3 B;  4NXN B;  1R6T A;  4O2A A;  3RFR A;  2UUC O;  1JQ0 A;  2HVJ C;  1JJ2 U;  2RJZ A;  5JJN B;  2QA4 V;  1XQ8 A;  5H9C A;  1SZX A;  2P4K A;  5A2Q N;  3ABT A;  1QNM A;  1F4M A;  1V54 C;  2IH3 C;  2QKA A;  2AZ2 A;  5EBW C;  1NKD A;  4J9Z B;  1F51 A;  3HKB B;  4LC1 A;  2XAH A;  2BTQ B;  3CXH F;  3SPC A;  3UO3 A;  4EB6 A;  2NNU A;  3C90 A;  3ABL B;  2AXT Z;  2Y4U A;  3CMA V;  1S72 V;  2A9H A;  2YIB D;  4J7J A;  2ITD C;  1NVP D;  3E8B A;  5C8Y B;  4Q20 A;  3X2Q B;  4K8Z A;  2YI8 A;  4A5U B;  4TV8 B;  1N32 B;  1J5E O;  4IIJ B;  3T1H O;  1BMF G;  5JQG A;  4MVO A;  4GZR B;  4DR6 B;  2E3C A;  3HKE B;  1JMK C;  4B3S O;  1M1K W;  1GAX A;  3JAL B;  2R70 A;  4RUE A;  1HNW B;  4BAY A;  3K9A A;  1NTZ H;  2X6A A;  4JI2 B;  3JAW B;  2P5O A;  3T1Y B;  4X1K B;  2GTA A;  3FAV A;  5CN0 A;  2DN9 A;  2F66 C;  1EN5 A;  1VF5 B;  1M93 A;  3AG7 A;  4X65 O;  4O4J A;  2E5L B;  1IX9 A;  2VS0 A;  3AG4 C;  3CRM A;  1IXM A;  4HNA B;  2RN9 A;  1BS3 A;  2XAJ A;  3RYC A;  5EZY B;  2JEX A;  2F23 A;  4JYB A;  4OGQ B;  1QLE C;  1A32 A;  1DF5 A;  3QF7 A;  3CCS V;  3L9D A;  5IJ0 B;  2QTO A;  1I94 B;  1NR1 A;  5EC1 C;  2Q0A A;  2BSK A;  4DR7 B;  4WFG A;  3CCQ V;  2V1D A;  5DN6 G;  4JTA B;  1JCH A;  2IU3 A;  1SQX H;  3E83 A;  3FB6 C;  1V55 C;  4QPJ A;  1R6N A;  3C3S A;  2ZE6 A;  3U10 A;  3A8T A;  5FNV B;  1N36 B;  3OW2 U;  2JS3 A;  4B3T O;  4CS4 A;  2EIL C;  3H1H H;  4RO2 A;  2ZR2 A;  4QNH B;  4JPR A;  4OX9 O;  1S5J A;  2UXB B;  1AI5 A;  3N2G A;  5BXZ A;  4TUY B;  3HKB A;  4PEL A;  2BTQ A;  5GTI Z;  5K1P A;  4LNU A;  4FK5 C;  2HJF C;  1AVM A;  2RDC A;  2F4V O;  5A9G A;  2WA3 A;  2ATK C;  2LW1 A;  4BIU A;  5C8Y A;  2EIK C;  2EBO A;  3IC7 A;  4TV8 A;  4Z1M G;  3K08 A;  4PDR A;  4IIJ A;  3DTU B;  2Y0I A;  3W7U A;  2DQ0 A;  1OCR C;  1VQM V;  3ZJZ A;  4DV6 B;  3CD6 V;  3HKE A;  4DO2 A;  3I56 V;  4MVQ A;  3JAL A;  2LFS A;  4R6Z A;  2Y4T A;  1EZJ A;  5AG2 A;  1XEQ A;  1YTF B;  2QTS A;  2YS8 A;  4WFE A;  2OCC C;  4WF9 V;  1CEZ A;  4B3M O;  3SYO A;  3W7W A;  5GON B;  4DUY O;  4GCZ A;  3JAW A;  3WB1 A;  5J9P C;  4X1K A;  2F1M A;  4J10 A;  3L74 H;  4JAS A;  4YXW G;  4LF7 B;  1P7B A;  4D6T H;  3LDC A;  3GB7 C;  2EIM C;  3F7Y C;  4QIW F;  2P6J A;  3WB0 A;  2GBO A;  5LMN O;  3B8M A;  1M5I A;  1ENV A;  5F2V O;  4HNA A;  1OCO C;  5EZY A;  3J81 N;  2YXY A;  2JK5 C;  2EIJ B;  4RWU A;  1NS1 A;  3CRR A;  3JAK B;  2JGD B;  2Q7H A;  5L3C A;  1EM1 A;  4I9W A;  1SQP H;  1M9N A;  1YSC A;  3LSQ A;  5JJE B;  2XUM A;  3ASO C;  1NZ6 A;  4K8X A;  3Q4H B;  4X8A A;  4K35 A;  4JYA O;  4JAU A;  2QM8 A;  2NN4 A;  4D7S A;  4ZIB A;  1M90 W;  1RSO B;  4ICG A;  1OZ0 A;  2GDS A;  1TA8 A;  4WCE V;  5FNV A;  4O4H A;  5KHH A;  2IJI A;  2X7R B;  4P2Z A;  3LDD A;  3OR6 C;  2OIE A;  2Y0P A;  1FXV A;  1KUQ A;  3WG7 C;  4MVR A;  4YIP A;  2A79 B;  4TUY A;  5IY5 C;  1YVW A;  4IYH A;  3P3N A;  2UU9 B;  1XHX A;  4J11 A;  1S3J A;  3CS5 A;  1XMQ O;  1KYO F;  1PP9 H;  3H1I H;  1WB8 A;  2Q8V A;  1AJP A;  2ZE5 A;  4JI1 O;  2EIN B;  3ZMZ A;  3GWO A;  4LF4 O;  2YI9 A;  4LH7 A;  1VQ7 V;  1YI2 V;  3LSS A;  1WB7 A;  3ZMT A;  1UJW B;  1G6U A;  4DW1 A;  2CK3 G;  1N4C A;  4TQF A;  2GUZ A;  4FLT A;  2K1E A;  3D36 C;  1I94 O;  3ABM C;  4UXN A;  4LBE C;  2Q7G A;  3A0B Z;  3JD4 A;  5LP6 A;  1UPG A;  1GN6 A;  3E2E A;  2QM4 A;  3G67 A;  4X20 B;  2PUS A;  4FZ0 A;  3IFX A;  3KCX A;  3BA8 A;  5GON A;  3ETG A;  4HBN A;  3THO A;  1AB3 A;  3CCJ V;  4BIZ A;  5KHK A;  3M7M X;  1BHB A;  4UVA A;  1JPX A;  3CEI A;  5FPO A;  2GSM B;  3SPH A;  4DUZ O;  5B1B B;  1YXB A;  4JI0 B;  1IVS A;  1GK9 A;  1D5N A;  1OCC B;  4PDL A;  1E1R G;  5CBF A;  4BR6 A;  2VWK A;  1F23 A;  1H2K A;  3JAK A;  2JGD A;  1YJ9 V;  2LP7 A;  1MZF A;  5IYZ B;  1NTK H;  4PA3 A;  1GKF A;  1V54 B;  1IBK O;  1BGY H;  3Q4H A;  2ZM6 B;  4FLU A;  3BEH A;  5LP6 C;  4R50 A;  4DV6 O;  5BZB A;  4LR3 A;  2CH7 A;  2HKO A;  4FFB B;  4YIO A;  4ASU G;  3CCL V;  1FFX B;  4CC6 A;  3ZHT A;  3DC6 A;  4LF9 O;  2ZIO A;  1BCC H;  4X62 B;  2JEU A;  2VQE B;  3CRC A;  1JVM A;  4KHP B;  3OGC C;  4IHJ B;  4AQY O;  3OTF A;  4F6R B;  1VQK V;  5B1N A;  1GN4 A;  4LF8 O;  2OTJ V;  4P9O A;  2HEP A;  4WFA V;  4DV0 O;  1XNR O;  3K0D A;  2YDE A;  4H44 B;  3RYF B;  1M56 C;  3CCV V;  2PYL A;  2RQ6 A;  3JD0 A;  3K9S A;  2Q69 A;  4DR1 B;  5LOV B;  3EFF K;  2Q4P A;  5JCO A;  1SER A;  4DR4 O;  4MSW C;  4OPA A;  2JGU A;  5H5N A;  3CE2 A;  1R3I C;  4QE7 A;  2OYQ A;  1FD9 A;  2HG5 C;  3PN1 A;  5J2U B;  5EBM C;  5LGU A;  3CCE V;  3ETD A;  3CX5 F;  5EIB D;  4DR2 B;  3W7T A;  5B1O A;  3H1L H;  1XMO B;  4EB6 B;  3AG4 B;  4DK0 A;  2ZNI A;  3AEI A;  4IGG A;  3U0Z A;  4PI0 A;  2DE0 X;  1MZE A;  3K5O A;  5HFM A;  2PI5 A;  4KUM A;  3TXS A;  3OTO B;  1KP3 A;  4TT3 G;  1QLE B;  4JI4 O;  4LF6 B;  2UUB B;  1Y6X A;  3SJA C;  4JV5 O;  1YIT V;  3ZRV A;  4LFA B;  1ZTE A;  4X88 A;  2B1G A;  1K73 W;  1CP9 A;  2ZXW C;  1NQT A;  1AP5 A;  5HFL A;  2ITC C;  1V55 B;  3UQ8 A;  4ZOL B;  2ZQM A;  1B06 A;  4AI8 A;  1TAE A;  3SYA A;  4PDM A;  4LF5 O;  4CZZ A;  5IYZ A;  3APQ A;  1COW G;  3FD9 A;  1WJZ A;  5KA5 A;  2OWO A;  2EIL B;  2DWD C;  5B1A C;  3FAV B;  4U3F H;  1ZL8 B;  1G4Y B;  4X66 O;  3ZHV A;  3IGA C;  4AHC A;  4FFB A;  1S5H C;  1FFX A;  4N23 A;  2LJ2 A;  1SC5 B;  3RYC B;  3K03 A;  3B40 A;  3T2M A;  2OCH A;  2ZKO A;  2G38 A;  5CBG A;  1WLE A;  4E2L A;  2EIK B;  2ADQ B;  4NB5 A;  3MD0 A;  1IXB A;  4IHJ A;  4F6R A;  2GTS A;  3CP1 A;  1OCR B;  2UXX A;  4JI6 B;  1WP7 A;  2BSK B;  4KL1 A;  3BAA A;  3SDL A;  3OMI B;  1THZ A;  2QKS A;  3RYF A;  3WB2 A;  4FFK A;  3E22 B;  1PV0 A;  3EHB B;  2OCC B;  5LOV A;  2XOK G;  1K8A W;  1U97 A;  2PYJ A;  1XDC A;  4G28 B;  5H6R A;  1SZT A;  1SRY A;  1R1B A;  1H2L A;  4P9P A;  1XBL A;  4DV1 O;  1EZV H;  1K5S A;  2AHY A;  5J2U A;  4LFB O;  2DYR C;  4KXR A;  4YHH B;  2WLI A;  1S5L Z;  2LFR A;  4TWK A;  4U7O A;  2YIC A;  3N2G B;  2EIM B;  1S0V A;  3S3W A;  4LNU B;  4JTD B;  4QGP A;  1VQP V;  3E89 A;  3B2E E;  4DXW A;  3JAM N;  1OCO B;  1M4U A;  5J2T B;  4UV9 A;  1KEC A;  4LP8 A;  5EBL C;  1OJH A;  4MT8 A;  4CH4 A;  3BHP A;  3K57 A;  4UCV A;  2W6J G;  2B5U A;  3E8F A;  4J7Z A;  4DV7 O;  2VQE O;  2D2C B;  4ZHQ B;  1K3E A;  2F43 G;  1TUE B;  1HNZ O;  3ASO B;  2QGN A;  3ZRW B;  1NH2 B;  2IJK A;  4CC5 A;  4W4K A;  3WFV A;  4KP4 A;  4FM2 A;  1HP8 A;  1GRJ A;  2EZP A;  4FLW A;  1M57 C;  4F6E A;  1HNX B;  2CTR A;  4ZOL A;  2WSS G;  1V9P A;  4QE9 A;  3HKC B;  5IWA O;  3QO5 A;  1XL6 A;  4XDK A;  3TCU A;  2IJH A;  5L3B A;  5CA3 A;  3GWK C;  3WG7 B;  1FXK C;  1ZL8 A;  4GKK O;  3ZS8 C;  2M6Y A;  5IY5 B;  1VQ9 V;  3G80 A;  3ML0 A;  4X64 B;  2ILM A;  2ZCE A;  1EBO A;  4RAI A;  1N0N A;  4GYC B;  3FX7 A;  3BVO A;  2Q73 A;  4LFC O;  3OTO O;  2LGQ A;  1W0J G;  4K0K B;  3G6E V;  2CTP A;  2N05 A;  2R9A A;  2CE4 A;  4DV2 O;  2QSA A;  1Y74 B;  3ZHR A;  3ABM B;  5KHJ A;  5KLV H;  5EYP B;  1Q8I A;  3EXA A;  4H33 A;  3FYE B;  3RYH B;  3E22 A;  2P67 A;  2JIZ G;  2NR5 A;  4JI3 B;  3IAY A;  4O4H B;  2P4V A;  1SQQ H;  3QTC A;  3TK1 A;  1SA0 B;  1L0L H;  3J80 N;  1VQN V;  1BL8 A;  1XIL A;  4B3R O;  3VQX A;  3ASN C;  1RPR A;  3UT5 B;  1VP7 A;  4B08 A;  3BPZ A;  3K58 A;  1YJW V;  4NXM B;  4JI8 B;  4CS3 A;  2MW2 B;  1PNK A;  4MVZ A;  1I0H A;  2UUA B;  3R65 A;  2FB5 A;  2GHY A;  5D5Q A;  1N33 O;  4X1I A;  3AK1 A;  5J2T A;  2UXC O;  1I5X A;  1GMG A;  3ZRX A;  5KUK A;  4FLX A;  4L87 A;  3MHH C;  1IDS A;  1QVG U;  4J42 A;  1S76 D;  1B6Q A;  3HKD A;  4R8C A;  4R7C A;  4MTF A;  1IBL B;  1PD3 A;  4ZHQ A;  3A0H Z;  2GUZ B;  3RN4 A;  1TGO A;  3GVM A;  1FXH A;  1B3Q A;  3K04 A;  3ZRW A;  2QR4 A;  2X0L A;  3CWB H;  3W7X A;  4YY3 O;  4JI6 O;  3UKM A;  3ZX6 A;  5LP6 B;  5B66 Z;  2KQX A;  2Q9L A;  2Q7E A;  2WLN A;  3JSL A;  3HKC A;  3OEE G;  4DV3 O;  4NXN O;  5LMU B;  1HDJ A;  4I9Q A;  1K97 A;  4LH6 A;  1KU9 A;  1PL0 A;  3LDE A;  5IDJ A;  3RW0 A;  1SQG A;  1H8H G;  2JS5 A;  2DWE C;  1Q6I A;  3H1K H;  1ZLZ A;  5CMU A;  2Y48 A;  1NU1 H;  1P7G A;  2WLJ A;  2ZD9 A;  2WLH A;  4TOI A;  3ZED A;  4AIL C;  5JH7 B;  5L3D A;  1E1Q G;  1EN6 A;  1KD1 W;  4X89 A;  1M56 B;  3CC2 V;  3FB8 C;  5CB4 A;  5E1A C;  1Y66 A;  1BSM A;  3NXS A;  1WPX A;  2DOS A;  5DEC A;  1K4C C;  3I5D A;  3K59 A;  4DV5 B;  2K9P A;  4TQD A;  3TJT A;  2UXD B;  2A0L A;  2QWR B;  2HHH B;  3D36 A;  3G6B A;  1LUW A;  1P4R A;  3LNN A;  1Y74 A;  4JZ2 A;  1N32 O;  2RMK B;  3C3T A;  1RPO A;  4BWA A;  3CSX A;  5KHG A;  1SQF A;  5EYP A;  2MK3 A;  5KMG A;  4DR6 O;  3RGB A;  1K33 A;  3RYH A;  1OHH G;  2CH7 B;  1AP6 A;  2HFE C;  5LGN A;  1XI1 A;  1K92 A;  5ITZ A;  1H8E G;  3OD4 A;  1SA0 A;  1BT8 A;  4K3A A;  1HNW O;  1NH2 D;  4FLZ A;  4Z2W A;  1G1X B;  1PNM A;  1N34 B;  2ZDI C;  4JI2 O;  3UT5 A;  3T1Y O;  2YEV B;  1BQZ A;  4PA6 A;  4U3J B;  1URF A;  2ZXW B;  1I5Y A;  3LNM B;  3O9O A;  1PKX A;  3JD1 A;  4ZI7 A;  2W6I G;  4HYO A;  5JWP A;  2E5L O;  1MA1 A;  1QCE A;  2WWW A;  4PDV A;  2PI4 A;  2LO1 A;  4GLX A;  4DR3 B;  2QWQ B;  4WBN A;  1AI7 A;  3SPI A;  1GN2 A;  1ZSP A;  2H8P C;  1SES A;  3QNE A;  1RM1 C;  5B1A B;  3JCU Z;  2OIG A;  3OUS A;  3ZHQ A;  3F5T A;  2R9I A;  1H2N A;  1VAR A;  1QR8 A;  5B3S C;  1Q86 W;  4E4E A;  4DR7 O;  5L3E A;  1IBM B;  3SJC C;  4JI5 B;  2WA4 A;  3CXC U;  1R3J C;  3SJB C;  2ZNJ A;  3K0G A;  4J80 A;  3W7S A;  3WU2 Z;  2QE7 G;  4MVU A;  4JI3 O;  3OGI B;  1N36 O;  4JYC A;  1W0K G;  2UXN A;  3N27 A;  3LSU A;  2IU0 A;  2FL4 A;  2IBZ H;  3ZN0 A;  1G8M A;  5H2F Z;  5LYJ B;  2UXB O;  3OMN B;  1XUQ A;  1VQ5 V;  1OV9 A;  5JH7 A;  2ZR3 A;  5LBQ A;  1JR9 A;  4JI8 O;  3L72 H;  5CA1 A;  2YID A;  1BZK A;  3HPL C;  4UUJ C;  5CBH A;  2DQ3 A;  1KB9 F;  1D5A A;  4MTX A;  4FM1 A;  4IT5 A;  5LA6 A;  1WPB A;  2L6L A;  4DR5 B;  1ZAU A;  3APO A;  2X6C A;  2UUC B;  2DYR B;  3R66 A;  4I0X B;  3DGE A;  1MOF A;  1X59 A;  5L3G A;  2QWN B;  5LL6 Y;  2ZIN A;  1YDX A;  2N04 A;  5K1X A;  1QQC A;  2L35 A;  1ZUQ A;  1J95 A;  3NR7 A;  1GTO A;  3CRQ A;  3AG2 C;  1R6K A;  4FIP C;  4WFH A;  2NLJ C;  2X6B A;  1YTF D;  2YEV A;  1FYJ A;  1NR7 A;  4OPH A;  4U3J A;  4LF7 O;  1F7Y A;  3AK2 A;  1L1F A;  2V4D A;  1KP2 A;  3CCR V;  4LWS A;  1M57 B;  1J5E B;  3T1H B;  1K4D C;  2CGO A;  1H2M A;  2ODM A;  3ETQ A;  1LNQ A;  3JD2 A;  2O57 A;  4MVS A;  3BAB A;  4Q6G A;  4B3S B;  3HB3 B;  1Z2G A;  4UCS A;  4LCU C;  4PJ0 Z;  4NYK A;  4UVB A;  2WLI B;  1FXK B;  4ZKI A;  2HHH O;  1SQV H;  2HR3 A;  1W59 A;  1KKD A;  2EZO A;  4I50 A;  2QEX V;  3ABK C;  1AJQ A;  1XRE A;  2JJ1 G;  2JJ2 G;  4CH6 A;  1H38 A;  1ARO P;  4FPP A;  4X65 B;  1DGS A;  4L8J A;  2Q67 A;  1BHA A;  3D8C A;  4FMT A;  1BE3 H;  1N34 O;  3TGU H;  1YF2 A;  1YEW A;  1LR1 A;  5LYJ A;  3VQV A;  4X9Q A;  3KZI Z;  2CGN A;  2P06 A;  4GKJ B;  4CBC A;  1VQO V;  1KBH A;  2UU9 O;  2OT5 A;  4XBF A;  2Z5U A;  1Q7Y W;  2XTA A;  3PJS K;  2PZS A;  4MS2 A;  5KUM A;  2E76 B;  1NBM G;  4I4T B;  3ASN B;  2CAZ C;  3DXR A;  3RYI B;  4I0X A;  1Q82 W;  3B4S A;  5H6Q A;  2LW7 A;  2HP8 A;  1PNL A;  2FTK A;  1AR5 A;  4B3T B;  1JFF B;  4TSF G;  4BW5 A;  5DM6 V;  1Q43 A;  3K79 A;  3N2K B;  1SET A;  4NTW A;  4JI5 O;  3OFN G;  1YHQ V;  2IW5 A;  4XDL A;  2XT9 A;  2EX3 A;  5LXT B;  1U96 A;  4C7U A;  5CA0 B;  3FYI B;  1SQB H;  3UO2 A;  1L8D A;  4PA4 A;  4UV8 A;  2ARH A;  2ZT9 B;  1KC8 W;  2IH1 C;  4JI0 O;  2F93 B;  2XAS A;  2XAF A;  1W2B U;  4Z1V A;  2FML A;  3H01 A;  5LHH A;  5JVD A;  3STZ C;  4JZG A;  3I55 V;  2EJR A;  2R72 A;  2N74 A;  4I55 A;  5BMV B;  4JF3 A;  3ZMU A;  1DLB A;  1FJG B;  1R3K C;  4X1Y A;  3JCZ A;  3SYP A;  1DF4 A;  3M8A A;  1FXK A;  1AI6 A;  2PF4 E;  4DRX B;  4B3M B;  2VQF B;  3RT3 C;  4EEQ A;  4DUY B;  1GM8 A;  2AZ0 A;  2ZM6 O;  5BR8 B;  4H37 A;  1FS0 G;  4DV4 B;  1I08 A;  3CC4 V;  1H2G A;  1K7D A;  3OT7 A;  1X4T A;  2YXH A;  3B09 A;  3QO8 A;  4X1I B;  4F4L A;  4RQE A;  2KG7 B;  3IJ4 A;  4J41 A;  4WFB V;  1PPJ H;  5LMN B;  3QVN A;  1MAB G;  1MSD A;  3HKD B;  1Q90 D;  1NI8 A;  4X62 O;  2RCV A;  1NJI W;  1Q81 W;  3JAT A;  1P84 F;  2R9R B;  4UB8 Z;  4KHP O;  2H3O A;  1FPO A;  3BRC A;  4RQF A;  2Y69 C;  3RBZ A;  3AK3 A;  3CME V;  2CUG A;  1KKC A;  3JSN A;  2A06 H;  3VQW A;  3OE7 G;  3S3X A;  1HR0 B;  4JYA B;  2YSU B;  4DR1 O;  4D7T A;  4IL6 Z;  4I4T A;  1CPY A;  3BY6 A;  3SYQ A;  3RYI A;  3D3Q A;  3K5M A;  4O4I B;  4PA9 A;  3UCS C;  4NTX A;  1Y76 A;  1L0N H;  3K5L A;  3K5N A;  2F95 B;  3ETE A;  1SKV A;  1JFF A;  1BQ0 A;  3ZIA G;  4DR2 O;  1FFT B;  1I7F A;  3P32 A;  1Z5W A;  3N2K A;  1XMO O;  3D3I A;  3K3W A;  3H9V A;  5C93 A;  5CB4 B;  1QHT A;  3B8N A;  1WP8 A;  5B5E Z;  1US6 A;  2IJJ A;  2ETN A;  3CJH B;  4GX5 A;  3ZCC A;  5LXT A;  5CA0 A;  2P22 C;  1XMQ B;  1TUB B;  2AW9 A;  2OTL V;  1RM1 B;  4JI1 B;  4LF6 O;  4EFE A;  2UUB O;  3DC5 A;  4LF4 B;  2W0F C;  4W4L A;  2QWO B;  4JI7 B;  5KAF Z;  1XOU A;  3QO7 A;  1RP3 B;  4LFA O;  5B3S B;  3E8H A;  3SJQ C;  4U7N A;  5KMG B;  4O4L A;  2QJ1 A;  1JJO A;  4JAV A;  1HW7 A;  3L73 H;  4I5S A;  4GKJ O;  1KMI Z;  1AIL A;  3OUF A;  2VRZ A;  5ITZ B;  1MSW D;  3KG2 A;  2BOC C;  5KX5 A;  5BMV A;  2DYS C;  1EN4 A;  2WLK A;  4YJ2 B;  3ZMV A;  2DMX A;  2YXL A;  4DRX A;  3LUT B;  1QR9 A;  3SPJ A;  3KKY A;  5LGT A;  2KKW A;  1DTO A;  1YCI A;  3ICX A;  4ZI7 B;  3BA9 A;  4DUZ B;  2KG7 A;  1MG1 A;  3AG1 C;  2AGA A;  4NTY A;  5LHI A;  3AG3 C;  4WBN B;  1QBZ A;  5EC2 C;  1VQ8 V;  2YUA A;  3H1J H;  5EK0 A;  3FKS G;  1JOY A;  1F4N A;  2E75 B;  4EFB A;  4MTO A;  2EJ7 A;  4MVM A;  4QJF B;  2YC0 A;  3L75 H;  4UCT A;  2P7T C;  4BIO A;  4ABM A;  4J7K A;  2AHZ A;  1WN7 A;  1IBK B;  3G4S V;  3FFQ A;  2E74 B;  2WLL B;  4TV9 B;  4YJ3 B;  2XAQ A;  2BOB C;  1YIJ V;  1OCZ C;  2ZDI A;  1XNQ B;  3MDS A;  4PI2 A;  3AG2 B;  5FL7 G;  1FJG O;  4O4I A;  3ZHU A;  4LF9 B;  4YHH O;  1H2S B;  3JAS B;  2VQF O;  2FKX A;  5CA1 B;  1VMG A;  3UM7 A;  5BR8 O;  4JTC B;  4AQY B;  1FAF A;  4DV4 O;  4H0L B;  4EKW A;  5D5P A;  4LF8 B;  3KCY A;  3U11 A;  5LA6 B;  3CJH A;  4DV0 B;  1XNR B;  1TUB A;  2XND G;  4MW3 A;  1R3L C;  4N21 A;  1YJN V;  2WLM A;  3ABL C;  3JD3 A;  4DR4 B;  1WA8 B;  4HAM A;  3OEH G;  4WFF A;  2HLD G;  4H13 B;  4NVP A;  5E79 Z;  3X2Q C;  2W0X A;  4IYI A;  3ABK B;  5IJ0 A;  1HNX O;  2ADP A;  2KSD A;  3EVK A;  2YIA A;  4FLV A;  1HR0 O;  3RVY A;  3CCU V;  2JVD A;  3T1C A;  4YJ2 A;  4PHZ A;  2EUL A;  2QKC A;  3HR0 A;  2ZE8 A;  2RNB A;  4PV1 B;  2FYU H;  2Q6A A;  4JI4 B;  4LWS B;  1K5Q A;  3CC7 V;  2BE3 A;  4JV5 B;  4X64 O;  1Y4M A;  4P30 A;  3ZN1 A;  3A0R A;  3TXQ A;  3RWR D;  1XL4 A;  1XHZ A;  2P90 A;  4K0K O;  2KB1 A;  3SGI A;  4LF5 B;  4JI7 O;  1T5E A;  4I50 B;  3J7A U;  5FLX N;  1HWY A;  1GM7 A;  3FB5 C;  4B7K A;  5BY1 A;  5IYC O;  3CHX A;  1NT2 B;  2WLL A;  4TV9 A;  1FKA O;  5KHI A;  4X66 B;  3JYC A;  4YJ3 A;  3L71 H;  1AJN A;  3L70 H;  4UFZ A;  1E79 G;  1ZWI C;  4CS2 A;  1NTM H;  3CB2 A;  1P49 A;  5IJ9 B;  4B7E A;  3JAS A;  1MMM A;  1EFR G;  2B9Z A;  2GV9 A;  1PM9 A;  1GO3 F;  3K06 A;  4NXM O;  4ZBM A;  4I7Z B;  2C2A A;  4UCU A;  2UUA O;  1TVK B;  2V7Q G;  4JAA A;  3O65 A;  3RVZ A;  3OR7 C;  1RFY A;  4FVM A;  1GN3 A;  4BW9 A;  4UCR A;  2M7W A;  2WPD G;  1WNS A;  1MNG A;  2B1I A;  3G71 V;  4JYY A;  3DXR B;  1IBL O;  1Z5V A;  4J9Y B;  3F7V C;  4RUF A;  1WAZ A;  3MAQ A;  1YZB A;  1WA8 A;  4UVC A;  1ROP A;  1DK1 A;  4DV1 B;  3VOU A;  4LFB B;  1VEW A;  1VIB A;  4UCO A;  1LUV A;  4CH5 A;  1R73 A;  3QG5 A;  1K34 A;  2LGW A;  4GX2 A;  1O9G A;  3ZRS A;  3FB7 C;  5LMU O;  4FM0 A;  1NVP B;  2CTQ A;  5KAI Z;  4JGS A;  1RSO A;  1O9H A;  4FJC C;  4MTG A;  4DK1 A;  3T4Z A;  1B04 A;  2QM7 A;  3SYC A;  1AR1 B;  1XNQ O;  5GTH Z;  2A7W A;  2Y69 B;  1D2D A;  3P3P A;  2IM9 A;  4DV7 B;  1Q6U A;  1GH6 A;  1S77 D;  2Q5Z A;  5IE9 A;  5DED A;  3E8G A;  3JAR B;  5JVD B;  1HNZ B;  2JRI A; 
#chains in the Genus database with same CATH homology
 2LJ2 A;  1WAZ A;  2H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...