2LJ2A

Integral membrane core domain of the mercury transporter merf in lipid bilayer membranes
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
b'IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure determination of a membrane protein in proteoliposomes.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 18
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2lj2A00
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH superfamily
1F4NA 4PA7A 1W0JG 1VF6C 1THZA 1BZKA 1RSOB 1VQPV 4LF7O 2GDSA 4JTCB 5EBWC 4DR4B 4JF3A 5B1AB 4GT1A 2YIDA 3HKBA 3ABLC 1XDCA 1B6QA 5JWPA 5KLVH 5B1BB 1V9PA 3A0RA 3CCQV 1YTFD 3B2EE 1GM8A 1OCOC 1GAXA 5FNVB 4JZGA 4N23A 3RFRA 4KP4A 1PNLA 4U3JA 4DR2B 1JOYA 4J10A 1NVPB 1FFTB 3T1YB 4TT3G 2QA4V 2IU0A 3T4ZA 4LFCB 2BCCH 1KU9A 3P3NA 3TJTA 1AJQA 2HVKC 5H5NA 2X0LA 1BHBA 3CSXA 3OD4A 3P32A 4GKKO 4ZKIA 3C90A 4H44B 5HFLA 2M7WA 2Q67A 1YJWV 4BIOA 5JJEB 4UUJC 3SJBC 2PGGA 3D3QA 1IBKB 4DR5O 3CRAA 2W6JG 2OIGA 2A0LA 2PYJA 2E74B 1D5NA 1PPJH 3EHBB 3WB2A 5KHJA 5B3SB 4DV2B 1S76D 1QNMA 4HNAA 4X88A 1G8MA 4DR3B 1GKFA 3PJSK 3SYPA 5ITZA 2QSAA 1KBHA 4B08A 2E76B 4YIOA 4HAMA 3OR7C 4LNUB 5LA6B 3D3IA 5J9PC 4ZHQA 2XAJA 4UFZA 2HFEC 4TV9A 3UKMA 1SETA 2BSKA 2AZ0A 3BABA 1AILA 4CBCA 5CMUA 3G80A 2EZPA 1W0KG 1SQXH 1PKXA 1AP6A 1Y67A 2QWNB 3Q4HB 4JYAB 1HNWB 2HJDA 3HB3B 4RWUA 4NXNB 4DO2A 2QWPB 3BCCH 3GB7C 4JYBA 4PI0A 1VQ4V 2W6IG 4X62O 2E75B 3JYCA 4FVMA 1I94B 3E89A 4YY3O 3JASA 1LNQA 3VQVA 1XHZA 4R50A 2R9IA 1RPOA 3ETGA 3N27A 4P2ZA 1RPRA 3QO7A 3K3WA 4CZZA 5B1AC 1WPXA 2H8PC 2CE4A 4DV0O 3E8FA 3CMAV 5EZYB 5LMNB 1TVKA 3RN4A 1K33A 5CB4B 5LOVB 2OCCB 1M57B 1HNXB 4I9WA 3TGUH 4X65B 2CTWA 3B40A 2F43G 4BW5A 5BMVB 5IWAB 5KHIA 3ETDA 3ZCCA 4LF9B 3A8TA 1N0NA 4IYHA 3B8MA 2FB5A 2QTOA 2YIAA 4JI3B 5C93A 4ZOLA 4B3MB 1BS3A 2F4VB 3SR2C 1N32B 3HKCB 4DR2O 1SQQH 5L3BA 4MTOA 5LP6A 4I7ZB 1PP9H 2B1IA 2OWOA 3JAMN 5IJ0B 1H8HG 4H0LB 3E2EA 4DR6B 4LF4B 1XHXA 1Y66A 3SJCC 5KA5A 3TETA 3FX7A 1P7GA 3LNMB 2F93B 4LBEC 4O2AB 5B3SC 5GONB 3TK1A 4LF8B 2UXNA 1FFXB 1HDJA 4B3RB 1WA8B 4EEQA 3CC7V 3WU2Z 1AB3A 2R72A 3K5NA 1KUQA 2M6YA 3T4DA 1TUBB 3SJQC 1Y74B 2ZCEA 4X1YB 1M90W 2W0FC 1R6TA 1NTMH 2WLMA 3ASNC 4WFBV 2ZM6B 4FLYA 4O4IB 4IIJB 1KP2A 3T1CA 2R70A 3JALB 3BY6A 4AI8A 2DE0X 4PA4A 4NXNO 1F4MA 4LFBB 3A0HZ 1GO3F 1NZ6A 3G6BA 1IX9A 3H1LH 3QG5A 1YJNV 3JARB 5IYDO 1N36B 3CRMA 4AQYO 3D36C 2ZNIA 2GTAA 4L8JA 2EINB 2YEVB 4JZ2A 2OCCC 1VQLV 1M57C 4NKGB 4UCVA 2LW7A 1ZTEA 2GUZA 3LUTB 1K92A 2Z0AA 4J9YB 3RYIB 2JS5A 4CC6A 4K8ZA 1JMKC 1JVMA 3L74H 1FJGB 2EJ7A 1HNXO 1Q5OA 4DR1B 3JAWB 2E5LB 1VQ7V 5JQGB 1FS0G 1N0JA 4LF9O 2IJIA 5B1OA 1AJPA 3VQXA 4I50B 5JVDB 4JI3O 2DQ0A 4B3MO 3QO8A 3SPIA 4XBFA 4KL1A 1HNZB 5A9GA 1E1QG 1K5SA 4JI0B 2VWJA 3M8AA 1VARA 4DRXB 1GM9A 4J80A 1GTOA 3LDEA 5CA0B 4DV3O 2WLNA 4F4LA 3K0GA 4NXMO 4LFAB 3CRCA 3STLC 3ZN1A 3G4SV 1W2BU 1Q6UA 1YSCA 1IBMB 4LF8O 1LUVA 2QGNA 2W0XA 1YEWA 4BAYA 1SQPH 1Q3EA 4K0KB 4DUZB 4PV1B 2O57A 3MAQA 4B3SO 2YXLA 5CA1A 4X66B 4FLXA 4D7SA 2ETNA 1H2SB 4TOIA 5DM6V 4CS4A 3CD6V 1DGSA 4LF5O 1XBLA 5LMUO 4O4JA 1AI6A 2AXTZ 3K03A 4JI5O 5C8YA 1FXKA 4JV5O 3UT5A 3U10A 1Y76B 5CN0A 1KMIZ 2P67A 4XDKA 2JGDA 3K9AA 1OCCB 3W7WA 1KP3A 3IGAC 1FKAO 4XDLA 1GH6A 3AG3B 5B5EZ 3JD3A 3AK1A 5F2VO 5LGUA 2HLDG 1SQFA 4I9QA 3EXAA 3NR7A 4G27B 4FFBB 1XNQB 1KC8W 1CXZB 2DJVA 2EINC 3ML0A 4ZIBA 2YIBA 5LGNA 1DLBA 4YJ2A 2ARHA 3RYCA 4H33A 3OT7A 3K06A 3R66A 4LH7A 4CS2A 4JI6O 1ZWIC 4X1IA 4JI1B 3UM7A 4BIZA 3WB1A 2N74A 2QTSA 2VQEB 4IGGA 2BTOA 1F23A 2EJRA 5JH7B 4FM1A 3K79A 3CCMV 4Z2WA 4DV1B 1FJGO 4AILC 1DF5A 4I0XA 2E5LO 4UCRA 3JATA 3K5OA 1CEZA 4JPRA 2UXDO 1WNSA 2RCVA 2QM8A 3B4SA 5EC1C 5KX5A 4OPHA 1HW7A 2RDCA 4WFGA 1R3LC 5J2TA 3JAKA 4DV5O 1H2GA 2K9PA 1EFRG 1N8RW 2HKOA 1AI7A 4GKJB 3CCEV 2YXHA 4LH6A 2KKWA 2HG5C 1QLNA 4O4LB 3UO2A 1K4CC 1EN6A 1K7DA 2KB1A 2GV9A 4UXNA 4F6EA 1FXHA 3HPLC 4TUYA 4LFAO 2XT9A 2Y0IA 1WB8A 4FLZA 1FXVA 3RYFA 2IJJA 1O9GA 2CH7B 4K0KO 2XASA 1AROP 3W7SA 4DUZO 2ZXWB 3K04A 3FB7C 1OJHA 2NN4A 1TGOA 2Z3YA 4X89A 1QR9A 2VS0A 3CC2V 3LSSA 1AR5A 2DOSA 1URFA 2ZNJA 2RQ6A 1IBLB 2P4KA 3R65A 3A0BZ 2EIKB 3OEEG 2LGWA 3OGIB 1OCCC 5GTHZ 1E79G 3FB5C 1L0NH 1VQKV 2YC0A 3CJHA 4UV9A 3RVYA 3AG3C 1SZTA 1WN7A 4RAIA 2Q0OC 4WFEA 1ORQC 4Q20A 4HZ3A 4DV7B 2Y4UA 5ITZB 3H1JH 3RYHB 4PI2A 4C7UA 2N05A 5EBLC 1L8DA 3L70H 2IM9A 3AG2B 1JFFB 3OGCC 4ZHQB 4FIPC 1TUEB 5J2UB 2XAGA 4X1KA 2KQXA 3ZMSA 4TV9B 3L71H 3OEHG 3JD4A 2Q8VA 5IYCO 5H6QA 4BR6A 2XOKG 4DV4B 3KZIZ 2BSKB 4LR3A 1I0HA 1Y6XA 4BWAA 4QGPA 3KCYA 4RO2A 4N21A 4D7TA 3ZHRA 2N04A 4B3TB 4JI4B 1NQTA 1S0VA 3WB0A 4MVQA 1EN4A 2P90A 3HKDB 2BTQA 1TAEA 1JCHA 1VEWA 1EN5A 1FYJA 3N2KB 2AGAA 3OMNB 1U97A 1P7BA 5JCOC 1R3JC 5LXTA 2CTPA 3I5DA 2Q6AA 3ZHUA 2XTAA 5A2QN 1Y4MA 3DXRB 4WBNA 5AG2A 5LHHA 2VQEO 1NTZH 1KKCA 3FKSG 4DV1O 1P49A 1BHAA 3BVOA 2WWWA 2IJKA 4WFAV 1US6A 2QM7A 4F6RB 4LWSB 3VQWA 4RUEA 3TXSA 2P6JA 3BPZA 3OFNG 2UUAB 1OHHG 3ZN0A 1TVKB 1K9MW 1BT8A 4O2BB 1FPOA 1RSOA 1Q81W 4JASA 4EKWA 4HBNA 2CUGA 3M99B 4GKJO 1NH2B 3D8CA 4EB6A 1N33B 2CGNA 3ABKB 3C3TA 1XNRB 4TQDA 2BOBC 3ASNB 4IT5A 5KA6A 1YZBA 2DMXA 2Y69C 2Q9LA 2JGUA 4L87A 2ZXWC 3C3SA 5LGTA 4HYOA 5L3CA 5D5QA 4NB5A 2UUBB 2AHZA 2ATKC 3T1HO 1SS3A 4MTFA 1MA1A 1ENVA 4JI8B 1KB9F 2ZE8A 2WSSG 3JSNA 3AEIA 1G4YB 2EIKC 2ZR2A 1S5LZ 3HKEA 1N34B 2EILC 1XL4A 3VQYA 2ZD9A 1R6KA 1IBLO 1N4CA 1FAFA 3CC4V 2Q7HA 1B06A 4H37A 3K58A 5KMGA 2LP7A 1B3QA 4JAUA 3DC6A 4FZ0A 4GCZA 3AG2C 4B7KA 3GWKC 4UB8Z 4DR7B 4J41A 4DR4O 4UCSA 4DV7O 2FL4A 4KFMA 2Q73A 1VF5B 2DYSB 4ZBMA 3SGIA 5IY5B 3BEHA 2VRZA 2YI8A 3CXCU 1WJZA 1LUWA 2Q7EA 1ZUQA 1VQMV 4MW3A 1NVPD 4TWKA 1KECA 5LA6A 1H2LA 1R3KC 4DXWA 2WPDG 3M7MX 3CE2A 1KKDA 3T1YO 2F1MA 2RMKB 4O4HB 4B3TO 4GX1A 4AHCA 4LFCO 3ASOB 4GX5A 2ZE6A 1D5AA 2WLIB 3AK3A 2GSMB 4FLVA 3Q4HA 1Q82W 5DN6G 1QVGU 2RNBA 1NI8A 4K35A 1Z5VA 4GZRB 3MD0A 1H2NA 4TV8A 5BXZA 1YI2V 1XMOB 1IBKO 5D5PA 4J7KA 1XOUA 1YIJV 4I55A 2R9RB 2YS8A 4E4EA 5L3GA 4X20B 1K34A 4DV2O 4CC5A 3L72H 5IT9N 4DR3O 4NTXA 2B1GA 1KQSU 1UFIA 2GUZB 5IYZA 2OTJV 4UVBA 2JK5C 4KUMA 3ABKC 1T5EA 3APQA 3D36A 2ITDC 1ZLZA 3B77A 4UB6Z 1NH2D 3LSQA 5LYJA 2PUSA 5CB4A 4NVPA 5LOVA 3SPJA 2UU9B 4FM0A 1N33O 1MZEA 2PY5A 1XNRO 1K3EA 5BMVA 3EFFK 2XNDG 4U3FH 1NJIW 4PDVA 4JYAO 3I55V 1SA0B 1HNWO 1IDSA 3AG7A 4OX9B 2Q7GA 2ADQB 2UUBO 3CCSV 3HKCA 2L35A 1OZ0A 4J7JA 3MHSC 4Z1VA 5EK0A 4I4TB 1R1BA 3J7AU 2UXBB 1XMQB 1I94O 4MTGA 2QDOA 4MVSA 2B5UA 2XUMA 1N34O 1G6UA 1H2MA 1XUQA 3ZRVA 2JEUA 1IURA 4JTDB 3X2QB 3SPCA 1NBMG 2JJ1G 1L0LH 1QU7A 2A9HA 3WG7C 4IHJB 2DYSC 5CA1B 5IY5C 1Z2GA 1WA8A 5H2FZ 5LMNO 1MZFA 1OCRB 2R9AA 1WB7A 3FYEB 2EBOA 4DR7O 2CTQA 4X65O 4DV6B 1GRJA 5IWAO 1Y74A 3F7VC 4X1YA 3U11A 5C8YB 4YHHB 3BA9A 4DK1A 3IC7A 2ZDIA 1FXKB 4J9ZB 3BA8A 1VIBA 5KUMA 4K8XA 2IW5A 2OCHA 1YITV 3CCRV 2WLKA 3FAVB 2F4VO 3ASOC 1N32O 3LDCA 2JGDB 5EIBC 2WA3A 4JI7B 4O4IA 2AHYA 1E1RG 1ZX3A 2QWOB 2HP8A 5EIBD 2A79B 5E1AC 1VF7A 2UUCB 2XHBA 4LP8A 4DR6O 4LF4O 2LFRA 1Q43A 4IIJA 2ILMA 3JALA 1X59A 3DGEA 1NTKH 5H6RA 3CCJV 1YXBA 4JAVA 2IH1C 4YJ2B 1J5EB 4MVMA 3G71V 3ABTA 4B3RO 3RVZA 2X7RB 1MOFA 1CPYA 2A06H 1ZSPA 4R8CA 1NR7A 3CB2A 1M4UA 2ZR3A 4X64B 1SQGA 1ZAUA 5EYPB 2A3QA 3LNNA 4ZI7B 3BAAA 2VQFB 4OXSA 2CDYA 3DSQA 2ZM6O 4I0XB 3JATB 2F23A 2LGQA 1COWG 5KAIZ 2IJHA 3VBBA 2UXCB 3ZRWA 3STZC 2ZQMA 3K5MA 3JAWA 1TA8A 5B66Z 5JQGA 5L3DA 4FLUA 1V54B 2Q4PA 4B7EA 1MNGA 3SYOA 4I50A 3W7UA 1M5IA 4LF7B 1M9NA 1AR1B 3H1KH 4LFBO 4OX9O 3E22A 3JCZA 1P84F 3F5TA 3RWRD 4PA6A 3CHXA 3CPWU 3UQ8A 2DW4A 3X2QC 2ZIMA 4UVAA 4KHPB 1F7YA 3RW0A 3CP1A 1N36O 1SESA 3N2GB 4PHZA 2QKSA 2ZE7A 4UCTA 1XMQO 4FPPA 4QPKA 3ICXA 4DRXA 4TUYB 3T2MA 2KG7B 1XL6A 1OCRC 1SC5B 1WPBA 1RFYA 5BR8B 3OR6C 4UCOA 4R6ZA 1FXKC 3SYCA 3QNEA 4DR1O 4GKKB 1ZL8B 2D3OW 4YJ3B 4DV6O 2EIMC 2P06A 4FFKA 2PTMA 2CK3G 1QLEB 2AW9A 1R3IC 4I5SA 4PELA 2Q5ZA 4NTYA 1SERA 3RT3C 1DF4A 3OTOB 2JJ2G 1HNZO 3HKBB 4PD4F 1Y76A 4JI7O 2QM4A 5E79Z 3W7XA 4JI0O 2HHHB 4Z1MG 4X1KB 1VF6A 5IE9A 4EFEA 4WFFA 2AZ2A 4U3JB 2DQ3A 2H94A 2VWKA 4CH3A 5BZBA 4MVRA 2DWEC 1IBMO 1ROPA 3ZHSA 2Y69B 3CRRA 4H13B 3L73H 1S72V 2GTSA 2K1EA 2DYRB 4LCUC 2E3CA 3K08A 4WCEV 3H01A 2ZINA 4X66O 4PDMA 2Q68A 1AJNA 4CS3A 1XQ8A 5LXTB 4MVZA 4X64O 2IH3C 4PDLA 1U96A 1VQNV 4X62B 2LO1A 3UO3A 2H3OA 2EILB 4UCUA 1V54C 4QE9A 1YDXA 4HNAB 1XREA 3ETEA 5IJ9A 5JH7A 5CBGA 2YSUB 2UXCO 1DTOA 4NR1A 1JR9A 3CRQA 2V4DA 3S3XA 3ZMVA 4FK5C 1OCZB 2F95B 4DV0B 3G6EV 2FMLA 1X4TA 2YI9A 4EB6B 1QR8A 3B8NA 3LDDA 4E2LA 4X9QA 4P30A 4DUYB 1RP3B 1XNQO 4R7CA 1S5HC 3FYIB 4NYKA 4KHPO 2IBZH 4QJFB 2ZE5A 4O4LA 3SPHA 1XEQA 4D6TH 4FLWA 1OV9A 3FB6C 4DW1A 3ZJZA 1IVSA 2JS3A 2QWQB 2HR3A 1AVMA 3H1IH 5JJJB 1G1XB 4RQFA 5L3FA 1K97A 4DK0A 1MSWD 3JSLA 4JI1O 4JAAA 2C2AA 5BR8O 5LL6Y 3JASB 3HKEB 1J95A 1QLEC 2CH7A 2CGOA 4CH5A 2Q0AA 4J7ZA 4PA3A 1WAZA 4TSFG 1AR4A 3BHPA 4JYCA 5EC2C 3RBZA 4MT8A 3GWOA 1I5YA 5KMGB 5KAFZ 4ICGA 2FYUH 2WLLA 1Q6HA 3O65A 3OTOO 3ZMZA 4FZ1A 3UCSC 4G2KA 2P4VA 4J42A 2D2CB 3EVKA 1LR1A 1QVFU 5KHGA 1RM1C 3WFVA 3RYHA 2HHHO 1SKVA 1M93A 1CP9A 4PA9A 4ZOLB 5TISZ 3CEIA 1Q8IA 1GN3A 1BCCH 1JFFA 5J2UA 2DYRC 3NXSA 4UV8A 3ZHVA 5LP6B 5FNVA 3E86A 1H2KA 3E35A 4A5UB 2QWRB 4DW0A 3ZEDA 1NKDA 2RJZA 4FM2A 1NU1H 2QE7G 1S3JA 3QVNA 1PM9A 2EULA 4W4KA 5GW7A 3HKDA 4YIPA 2X6BA 2YUAA 4LC1A 1NR1A 1KD1W 3SJAC 3CS5A 2X6CA 3SYAA 3N2KA 4TV8B 3THOA 1UPGA 4MVUA 1JJ2U 4I55B 5HFMA 3KCXA 3OE7G 2V1DA 1M56B 4AQYB 3DXRA 3J81N 1OCZC 5IYBO 3CYOA 2JEXA 3JD2A 4JI2B 2ITCC 5IYZB 3H1HH 5L3EA 3F5WC 3WG7B 3ZBHA 3JD1A 2ZIOA 3OAAG 4F6RA 3AK2A 4LWSA 5LYJB 4QIWF 2YDEA 3IFXA 3HR0A 1NT2B 1JPXA 5B1BC 4LNUA 3P3PA 4GLXA 1VQ9V 4O2BA 4DV4O 3IAYA 1SQVH 3ZS8C 4DUYO 3ZMTA 5FLXN 2OTLV 2Z5UA 1QCEA 4JI4O 2PF4E 2OYQA 3QF7A 5DECA 5BY1A 2G38A 3CCUV 1JJOA 1PL4A 4NTWA 4U7NA 2P22C 5EBMC 1BSMA 1IZ3A 1DK1A 3SDLA 3K0DA 3S3WA 2QKCA 2A7WA 3OUFA 2NR5A 2JDIG 3ZHQA 3K9SA 2QKAA 4JTAB 3OM3B 4DV3B 4NXMB 2FKXA 3E8BA 1GN2A 3JCUZ 1Z5WA 4GX2A 1BQ0A 2GBOA 3J80N 1R73A 1GM7A 2WAMA 2UUAO 2JVDA 2MW2B 2HJFC 1MABG 1WLEA 4B3SB 1F51A 3KKYA 1JA8A 1GK9A 5EZYA 2OIEA 1HR0B 1YCIA 4LF5B 5LMUB 1W59A 2CTRA 2PYLA 5LP6C 3AG4B 1EZJA 4JI5B 1K5QA 4JV5B 2HVJC 1BMFG 1VMGA 5K1PA 2OT5A 1MMMA 4LF6B 1NS1A 1S5JA 3L9DA 3L75H 2EIJB 3TCUA 2HEPA 2WLHA 3ABUA 4JI8O 4XDJA 4O4HA 5IJ0A 4TQFA 3ZRXA 2WLIA 3QTCA 4W4LA 2EX3A 1M56C 5CBFA 3H9VA 1PNMA 1IXBA 1BE3H 2ZKOA 4FLTA 1K73W 3K5LA 3OW2U 4O2AA 1K4DC 3FB8C 4PJ0Z 5GONA 3OMAB 4IL6Z 1FFXA 1XILA 5LHIA 5KHKA 3QO5A 5KHHA 2WA4A 1PD3A 4U7OA 1MSDA 1GMGA 1XI1A 4X20A 4ASUG 4JI2O 3SPGA 2IU3A 1I08A 1Q90D 4O4JB 1SF9A 3LSUA 2LW1A 3BRCA 4JI6B 4X8AA 1TUBA 4DYLA 3CWBH 1S77D 2XAFA 3UT5B 2BOCC 3ZIAG 1WP8A 4P9OA 3AG1B 3ZRWB 4GX0A 1R6NA 2LJ2A 1I5XA 2EIMB 3E8GA 1AI5A 4JGSA 2UXDB 1FD9A 5DEDA 4K3AA 1V55B 3ABMB 2Y0PA 4EFBA 2QEXV 2PI4A 2CAZC 1IXMA 2ADPA 4DV5B 1EZVH 2YXYA 4G28B 3CXHF 4YXWG 3E22B 3ZHTA 3E83A 1SQBH 1SA0A 3K59A 1UJWB 4GYCB 1EBOA 4OPAA 1XMOO 3CCVV 2P5OA 1M1KW 1VQ5V 2DWDC 3RYCB 1MG1A 3OUSA 3JARA 4CH6A 2ODMA 4I4TA 1WP7A 2JRIA 3ZRSA 1QHTA 2NLJC 4BIUA 1Q86W 5IDJA 1O9HA 4FJCC 4X1IB 5LBQA 2Y48A 2L6LA 2YEVA 4KXRA 5CA3A 4GUNA 5KUKA 1SRYA 2ZDIC 2YICA 3AG4C 3RYIA 4IHJA 1GN4A 2PZSA 1BGYH 5GTIZ 1AI4A 1HR0O 2UU9O 2XAHA 4J11A 4MTXA 3K57A 3GVMA 5KX5B 1VQOV 2NNUA 2Y4TA 5J2TB 3CMEV 2EIJC 4RQEA 2GHYA 1JX9A 3JAKB 1QQCA 2QJ1A 5JVDA 4CH4A 2F66C 4Q6GA 2WLJA 2FTKA 3FAVA 1YJ9V 3OTFA 3OMIB 1P4RA 2EZOA 3KG2A 4LF6O 3P30A 3DC5A 5FPRA 2LFSA 1SZXA 2UXBO 1JQ0A 2ZT9B 2QR4A 1EM1A 1K8AW 3ABLB 3ETQA 3MHHC 5CA0A 1YF2A 1YTFB 4ABMA 4IYIA 3ZX6A 1PL0A 2XAQA 3FD9A 3RYFB 1OCOB 3BFRA 4UVCA 1I7FA 3IJ4A 1PV0A 5FL7G 2LQTA 3CX5F 3AG1C 2JIZG 1H38A 3VOUA 1Q6IA 4YHHO 2DN9A 4MW8A 4DR5B 5CBHA 5EYPA 3CJHB 2Q69A 4QNHB 1KYOF 1V55C 4PDRA 3ABMC 4ZI7A 4FMTA 1YVWA 5IJ9B 1Q7YW 5FPOA 1D2DA 1BQZA 3MDSA 3B09A 3SYQA 3A2FA 2PI5A 4OGQB 3JD0A 2UXXA 5JJNB 2UUCO 3CCLV 3G67A 2BE3A 4WFHA 3E8HA 2V7QG 3U0ZA 1PNKA 1RM1B 4MVOA 2YIBD 5K1XA 1VQ8V 3ZMUA 3FFQA 4FFBA 4WF9V 1J5EO 1VP7A 3DTUB 2BTQB 5B1NA 3N2GA 4MS2A 1YHQV 3IC9A 2KSDA 4RUFA 3W7TA 1GN6A 2KG7A 3TXQA 3T1HB 1L1FA 1H8EG 4WBNB 3RGBA 1HP8A 2MK3A 2P7TC 5LHGA 3F7YC 2VQFO 4P9PA 1HWYA 4YY3B 4MSWC 3APOA 4JYYA 2RN9A 1AP5A 5JCOA 1A32A 1B04A 1ZL8A 3I56V 4QPJA 4YJ3A 2B9ZA 5H9CA 1QBZA 4QE7A 3PN1A 3O9OA 2WLLB 1VQ6V 1BL8A 4BW9A 2X6AA
chains in the Genus database with same CATH topology
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAZ A;  2LJ2 A;  2H3O A; 
#chains in the Genus database with same CATH topology
 1F4N A;  4PA7 A;  1W0J G;  1VF6 C;  1THZ A;  1BZK A;  1RSO B;  1VQP V;  4LF7 O;  2GDS A;  4JTC B;  5EBW C;  4DR4 B;  4JF3 A;  5B1A B;  4GT1 A;  2YID A;  3HKB A;  3ABL C;  1XDC A;  1B6Q A;  5JWP A;  5KLV H;  5B1B B;  1V9P A;  3A0R A;  3CCQ V;  1YTF D;  3B2E E;  1GM8 A;  1OCO C;  1GAX A;  5FNV B;  4JZG A;  4N23 A;  3RFR A;  4KP4 A;  1PNL A;  4U3J A;  4DR2 B;  1JOY A;  4J10 A;  1NVP B;  1FFT B;  3T1Y B;  4TT3 G;  2QA4 V;  2IU0 A;  3T4Z A;  4LFC B;  2BCC H;  1KU9 A;  3P3N A;  3TJT A;  1AJQ A;  2HVK C;  5H5N A;  2X0L A;  1BHB A;  3CSX A;  3OD4 A;  3P32 A;  4GKK O;  4ZKI A;  3C90 A;  4H44 B;  5HFL A;  2M7W A;  2Q67 A;  1YJW V;  4BIO A;  5JJE B;  4UUJ C;  3SJB C;  2PGG A;  3D3Q A;  1IBK B;  4DR5 O;  3CRA A;  2W6J G;  2OIG A;  2A0L A;  2PYJ A;  2E74 B;  1D5N A;  1PPJ H;  3EHB B;  3WB2 A;  5KHJ A;  5B3S B;  4DV2 B;  1S76 D;  1QNM A;  4HNA A;  4X88 A;  1G8M A;  4DR3 B;  1GKF A;  3PJS K;  3SYP A;  5ITZ A;  2QSA A;  1KBH A;  4B08 A;  2E76 B;  4YIO A;  4HAM A;  3OR7 C;  4LNU B;  5LA6 B;  3D3I A;  5J9P C;  4ZHQ A;  2XAJ A;  4UFZ A;  2HFE C;  4TV9 A;  3UKM A;  1SET A;  2BSK A;  2AZ0 A;  3BAB A;  1AIL A;  4CBC A;  5CMU A;  3G80 A;  2EZP A;  1W0K G;  1SQX H;  1PKX A;  1AP6 A;  1Y67 A;  2QWN B;  3Q4H B;  4JYA B;  1HNW B;  2HJD A;  3HB3 B;  4RWU A;  4NXN B;  4DO2 A;  2QWP B;  3BCC H;  3GB7 C;  4JYB A;  4PI0 A;  1VQ4 V;  2W6I G;  4X62 O;  2E75 B;  3JYC A;  4FVM A;  1I94 B;  3E89 A;  4YY3 O;  3JAS A;  1LNQ A;  3VQV A;  1XHZ A;  4R50 A;  2R9I A;  1RPO A;  3ETG A;  3N27 A;  4P2Z A;  1RPR A;  3QO7 A;  3K3W A;  4CZZ A;  5B1A C;  1WPX A;  2H8P C;  2CE4 A;  4DV0 O;  3E8F A;  3CMA V;  5EZY B;  5LMN B;  1TVK A;  3RN4 A;  1K33 A;  5CB4 B;  5LOV B;  2OCC B;  1M57 B;  1HNX B;  4I9W A;  3TGU H;  4X65 B;  2CTW A;  3B40 A;  2F43 G;  4BW5 A;  5BMV B;  5IWA B;  5KHI A;  3ETD A;  3ZCC A;  4LF9 B;  3A8T A;  1N0N A;  4IYH A;  3B8M A;  2FB5 A;  2QTO A;  2YIA A;  4JI3 B;  5C93 A;  4ZOL A;  4B3M B;  1BS3 A;  2F4V B;  3SR2 C;  1N32 B;  3HKC B;  4DR2 O;  1SQQ H;  5L3B A;  4MTO A;  5LP6 A;  4I7Z B;  1PP9 H;  2B1I A;  2OWO A;  3JAM N;  5IJ0 B;  1H8H G;  4H0L B;  3E2E A;  4DR6 B;  4LF4 B;  1XHX A;  1Y66 A;  3SJC C;  5KA5 A;  3TET A;  3FX7 A;  1P7G A;  3LNM B;  2F93 B;  4LBE C;  4O2A B;  5B3S C;  5GON B;  3TK1 A;  4LF8 B;  2UXN A;  1FFX B;  1HDJ A;  4B3R B;  1WA8 B;  4EEQ A;  3CC7 V;  3WU2 Z;  1AB3 A;  2R72 A;  3K5N A;  1KUQ A;  2M6Y A;  3T4D A;  1TUB B;  3SJQ C;  1Y74 B;  2ZCE A;  4X1Y B;  1M90 W;  2W0F C;  1R6T A;  1NTM H;  2WLM A;  3ASN C;  4WFB V;  2ZM6 B;  4FLY A;  4O4I B;  4IIJ B;  1KP2 A;  3T1C A;  2R70 A;  3JAL B;  3BY6 A;  4AI8 A;  2DE0 X;  4PA4 A;  4NXN O;  1F4M A;  4LFB B;  3A0H Z;  1GO3 F;  1NZ6 A;  3G6B A;  1IX9 A;  3H1L H;  3QG5 A;  1YJN V;  3JAR B;  5IYD O;  1N36 B;  3CRM A;  4AQY O;  3D36 C;  2ZNI A;  2GTA A;  4L8J A;  2EIN B;  2YEV B;  4JZ2 A;  2OCC C;  1VQL V;  1M57 C;  4NKG B;  4UCV A;  2LW7 A;  1ZTE A;  2GUZ A;  3LUT B;  1K92 A;  2Z0A A;  4J9Y B;  3RYI B;  2JS5 A;  4CC6 A;  4K8Z A;  1JMK C;  1JVM A;  3L74 H;  1FJG B;  2EJ7 A;  1HNX O;  1Q5O A;  4DR1 B;  3JAW B;  2E5L B;  1VQ7 V;  5JQG B;  1FS0 G;  1N0J A;  4LF9 O;  2IJI A;  5B1O A;  1AJP A;  3VQX A;  4I50 B;  5JVD B;  4JI3 O;  2DQ0 A;  4B3M O;  3QO8 A;  3SPI A;  4XBF A;  4KL1 A;  1HNZ B;  5A9G A;  1E1Q G;  1K5S A;  4JI0 B;  2VWJ A;  3M8A A;  1VAR A;  4DRX B;  1GM9 A;  4J80 A;  1GTO A;  3LDE A;  5CA0 B;  4DV3 O;  2WLN A;  4F4L A;  3K0G A;  4NXM O;  4LFA B;  3CRC A;  3STL C;  3ZN1 A;  3G4S V;  1W2B U;  1Q6U A;  1YSC A;  1IBM B;  4LF8 O;  1LUV A;  2QGN A;  2W0X A;  1YEW A;  4BAY A;  1SQP H;  1Q3E A;  4K0K B;  4DUZ B;  4PV1 B;  2O57 A;  3MAQ A;  4B3S O;  2YXL A;  5CA1 A;  4X66 B;  4FLX A;  4D7S A;  2ETN A;  1H2S B;  4TOI A;  5DM6 V;  4CS4 A;  3CD6 V;  1DGS A;  4LF5 O;  1XBL A;  5LMU O;  4O4J A;  1AI6 A;  2AXT Z;  3K03 A;  4JI5 O;  5C8Y A;  1FXK A;  4JV5 O;  3UT5 A;  3U10 A;  1Y76 B;  5CN0 A;  1KMI Z;  2P67 A;  4XDK A;  2JGD A;  3K9A A;  1OCC B;  3W7W A;  1KP3 A;  3IGA C;  1FKA O;  4XDL A;  1GH6 A;  3AG3 B;  5B5E Z;  3JD3 A;  3AK1 A;  5F2V O;  5LGU A;  2HLD G;  1SQF A;  4I9Q A;  3EXA A;  3NR7 A;  4G27 B;  4FFB B;  1XNQ B;  1KC8 W;  1CXZ B;  2DJV A;  2EIN C;  3ML0 A;  4ZIB A;  2YIB A;  5LGN A;  1DLB A;  4YJ2 A;  2ARH A;  3RYC A;  4H33 A;  3OT7 A;  3K06 A;  3R66 A;  4LH7 A;  4CS2 A;  4JI6 O;  1ZWI C;  4X1I A;  4JI1 B;  3UM7 A;  4BIZ A;  3WB1 A;  2N74 A;  2QTS A;  2VQE B;  4IGG A;  2BTO A;  1F23 A;  2EJR A;  5JH7 B;  4FM1 A;  3K79 A;  3CCM V;  4Z2W A;  4DV1 B;  1FJG O;  4AIL C;  1DF5 A;  4I0X A;  2E5L O;  4UCR A;  3JAT A;  3K5O A;  1CEZ A;  4JPR A;  2UXD O;  1WNS A;  2RCV A;  2QM8 A;  3B4S A;  5EC1 C;  5KX5 A;  4OPH A;  1HW7 A;  2RDC A;  4WFG A;  1R3L C;  5J2T A;  3JAK A;  4DV5 O;  1H2G A;  2K9P A;  1EFR G;  1N8R W;  2HKO A;  1AI7 A;  4GKJ B;  3CCE V;  2YXH A;  4LH6 A;  2KKW A;  2HG5 C;  1QLN A;  4O4L B;  3UO2 A;  1K4C C;  1EN6 A;  1K7D A;  2KB1 A;  2GV9 A;  4UXN A;  4F6E A;  1FXH A;  3HPL C;  4TUY A;  4LFA O;  2XT9 A;  2Y0I A;  1WB8 A;  4FLZ A;  1FXV A;  3RYF A;  2IJJ A;  1O9G A;  2CH7 B;  4K0K O;  2XAS A;  1ARO P;  3W7S A;  4DUZ O;  2ZXW B;  3K04 A;  3FB7 C;  1OJH A;  2NN4 A;  1TGO A;  2Z3Y A;  4X89 A;  1QR9 A;  2VS0 A;  3CC2 V;  3LSS A;  1AR5 A;  2DOS A;  1URF A;  2ZNJ A;  2RQ6 A;  1IBL B;  2P4K A;  3R65 A;  3A0B Z;  2EIK B;  3OEE G;  2LGW A;  3OGI B;  1OCC C;  5GTH Z;  1E79 G;  3FB5 C;  1L0N H;  1VQK V;  2YC0 A;  3CJH A;  4UV9 A;  3RVY A;  3AG3 C;  1SZT A;  1WN7 A;  4RAI A;  2Q0O C;  4WFE A;  1ORQ C;  4Q20 A;  4HZ3 A;  4DV7 B;  2Y4U A;  5ITZ B;  3H1J H;  3RYH B;  4PI2 A;  4C7U A;  2N05 A;  5EBL C;  1L8D A;  3L70 H;  2IM9 A;  3AG2 B;  1JFF B;  3OGC C;  4ZHQ B;  4FIP C;  1TUE B;  5J2U B;  2XAG A;  4X1K A;  2KQX A;  3ZMS A;  4TV9 B;  3L71 H;  3OEH G;  3JD4 A;  2Q8V A;  5IYC O;  5H6Q A;  4BR6 A;  2XOK G;  4DV4 B;  3KZI Z;  2BSK B;  4LR3 A;  1I0H A;  1Y6X A;  4BWA A;  4QGP A;  3KCY A;  4RO2 A;  4N21 A;  4D7T A;  3ZHR A;  2N04 A;  4B3T B;  4JI4 B;  1NQT A;  1S0V A;  3WB0 A;  4MVQ A;  1EN4 A;  2P90 A;  3HKD B;  2BTQ A;  1TAE A;  1JCH A;  1VEW A;  1EN5 A;  1FYJ A;  3N2K B;  2AGA A;  3OMN B;  1U97 A;  1P7B A;  5JCO C;  1R3J C;  5LXT A;  2CTP A;  3I5D A;  2Q6A A;  3ZHU A;  2XTA A;  5A2Q N;  1Y4M A;  3DXR B;  4WBN A;  5AG2 A;  5LHH A;  2VQE O;  1NTZ H;  1KKC A;  3FKS G;  4DV1 O;  1P49 A;  1BHA A;  3BVO A;  2WWW A;  2IJK A;  4WFA V;  1US6 A;  2QM7 A;  4F6R B;  4LWS B;  3VQW A;  4RUE A;  3TXS A;  2P6J A;  3BPZ A;  3OFN G;  2UUA B;  1OHH G;  3ZN0 A;  1TVK B;  1K9M W;  1BT8 A;  4O2B B;  1FPO A;  1RSO A;  1Q81 W;  4JAS A;  4EKW A;  4HBN A;  2CUG A;  3M99 B;  4GKJ O;  1NH2 B;  3D8C A;  4EB6 A;  1N33 B;  2CGN A;  3ABK B;  3C3T A;  1XNR B;  4TQD A;  2BOB C;  3ASN B;  4IT5 A;  5KA6 A;  1YZB A;  2DMX A;  2Y69 C;  2Q9L A;  2JGU A;  4L87 A;  2ZXW C;  3C3S A;  5LGT A;  4HYO A;  5L3C A;  5D5Q A;  4NB5 A;  2UUB B;  2AHZ A;  2ATK C;  3T1H O;  1SS3 A;  4MTF A;  1MA1 A;  1ENV A;  4JI8 B;  1KB9 F;  2ZE8 A;  2WSS G;  3JSN A;  3AEI A;  1G4Y B;  2EIK C;  2ZR2 A;  1S5L Z;  3HKE A;  1N34 B;  2EIL C;  1XL4 A;  3VQY A;  2ZD9 A;  1R6K A;  1IBL O;  1N4C A;  1FAF A;  3CC4 V;  2Q7H A;  1B06 A;  4H37 A;  3K58 A;  5KMG A;  2LP7 A;  1B3Q A;  4JAU A;  3DC6 A;  4FZ0 A;  4GCZ A;  3AG2 C;  4B7K A;  3GWK C;  4UB8 Z;  4DR7 B;  4J41 A;  4DR4 O;  4UCS A;  4DV7 O;  2FL4 A;  4KFM A;  2Q73 A;  1VF5 B;  2DYS B;  4ZBM A;  3SGI A;  5IY5 B;  3BEH A;  2VRZ A;  2YI8 A;  3CXC U;  1WJZ A;  1LUW A;  2Q7E A;  1ZUQ A;  1VQM V;  4MW3 A;  1NVP D;  4TWK A;  1KEC A;  5LA6 A;  1H2L A;  1R3K C;  4DXW A;  2WPD G;  3M7M X;  3CE2 A;  1KKD A;  3T1Y O;  2F1M A;  2RMK B;  4O4H B;  4B3T O;  4GX1 A;  4AHC A;  4LFC O;  3ASO B;  4GX5 A;  2ZE6 A;  1D5A A;  2WLI B;  3AK3 A;  2GSM B;  4FLV A;  3Q4H A;  1Q82 W;  5DN6 G;  1QVG U;  2RNB A;  1NI8 A;  4K35 A;  1Z5V A;  4GZR B;  3MD0 A;  1H2N A;  4TV8 A;  5BXZ A;  1YI2 V;  1XMO B;  1IBK O;  5D5P A;  4J7K A;  1XOU A;  1YIJ V;  4I55 A;  2R9R B;  2YS8 A;  4E4E A;  5L3G A;  4X20 B;  1K34 A;  4DV2 O;  4CC5 A;  3L72 H;  5IT9 N;  4DR3 O;  4NTX A;  2B1G A;  1KQS U;  1UFI A;  2GUZ B;  5IYZ A;  2OTJ V;  4UVB A;  2JK5 C;  4KUM A;  3ABK C;  1T5E A;  3APQ A;  3D36 A;  2ITD C;  1ZLZ A;  3B77 A;  4UB6 Z;  1NH2 D;  3LSQ A;  5LYJ A;  2PUS A;  5CB4 A;  4NVP A;  5LOV A;  3SPJ A;  2UU9 B;  4FM0 A;  1N33 O;  1MZE A;  2PY5 A;  1XNR O;  1K3E A;  5BMV A;  3EFF K;  2XND G;  4U3F H;  1NJI W;  4PDV A;  4JYA O;  3I55 V;  1SA0 B;  1HNW O;  1IDS A;  3AG7 A;  4OX9 B;  2Q7G A;  2ADQ B;  2UUB O;  3CCS V;  3HKC A;  2L35 A;  1OZ0 A;  4J7J A;  3MHS C;  4Z1V A;  5EK0 A;  4I4T B;  1R1B A;  3J7A U;  2UXB B;  1XMQ B;  1I94 O;  4MTG A;  2QDO A;  4MVS A;  2B5U A;  2XUM A;  1N34 O;  1G6U A;  1H2M A;  1XUQ A;  3ZRV A;  2JEU A;  1IUR A;  4JTD B;  3X2Q B;  3SPC A;  1NBM G;  2JJ1 G;  1L0L H;  1QU7 A;  2A9H A;  3WG7 C;  4IHJ B;  2DYS C;  5CA1 B;  5IY5 C;  1Z2G A;  1WA8 A;  5H2F Z;  5LMN O;  1MZF A;  1OCR B;  2R9A A;  1WB7 A;  3FYE B;  2EBO A;  4DR7 O;  2CTQ A;  4X65 O;  4DV6 B;  1GRJ A;  5IWA O;  1Y74 A;  3F7V C;  4X1Y A;  3U11 A;  5C8Y B;  4YHH B;  3BA9 A;  4DK1 A;  3IC7 A;  2ZDI A;  1FXK B;  4J9Z B;  3BA8 A;  1VIB A;  5KUM A;  4K8X A;  2IW5 A;  2OCH A;  1YIT V;  3CCR V;  2WLK A;  3FAV B;  2F4V O;  3ASO C;  1N32 O;  3LDC A;  2JGD B;  5EIB C;  2WA3 A;  4JI7 B;  4O4I A;  2AHY A;  1E1R G;  1ZX3 A;  2QWO B;  2HP8 A;  5EIB D;  2A79 B;  5E1A C;  1VF7 A;  2UUC B;  2XHB A;  4LP8 A;  4DR6 O;  4LF4 O;  2LFR A;  1Q43 A;  4IIJ A;  2ILM A;  3JAL A;  1X59 A;  3DGE A;  1NTK H;  5H6R A;  3CCJ V;  1YXB A;  4JAV A;  2IH1 C;  4YJ2 B;  1J5E B;  4MVM A;  3G71 V;  3ABT A;  4B3R O;  3RVZ A;  2X7R B;  1MOF A;  1CPY A;  2A06 H;  1ZSP A;  4R8C A;  1NR7 A;  3CB2 A;  1M4U A;  2ZR3 A;  4X64 B;  1SQG A;  1ZAU A;  5EYP B;  2A3Q A;  3LNN A;  4ZI7 B;  3BAA A;  2VQF B;  4OXS A;  2CDY A;  3DSQ A;  2ZM6 O;  4I0X B;  3JAT B;  2F23 A;  2LGQ A;  1COW G;  5KAI Z;  2IJH A;  3VBB A;  2UXC B;  3ZRW A;  3STZ C;  2ZQM A;  3K5M A;  3JAW A;  1TA8 A;  5B66 Z;  5JQG A;  5L3D A;  4FLU A;  1V54 B;  2Q4P A;  4B7E A;  1MNG A;  3SYO A;  4I50 A;  3W7U A;  1M5I A;  4LF7 B;  1M9N A;  1AR1 B;  3H1K H;  4LFB O;  4OX9 O;  3E22 A;  3JCZ A;  1P84 F;  3F5T A;  3RWR D;  4PA6 A;  3CHX A;  3CPW U;  3UQ8 A;  2DW4 A;  3X2Q C;  2ZIM A;  4UVA A;  4KHP B;  1F7Y A;  3RW0 A;  3CP1 A;  1N36 O;  1SES A;  3N2G B;  4PHZ A;  2QKS A;  2ZE7 A;  4UCT A;  1XMQ O;  4FPP A;  4QPK A;  3ICX A;  4DRX A;  4TUY B;  3T2M A;  2KG7 B;  1XL6 A;  1OCR C;  1SC5 B;  1WPB A;  1RFY A;  5BR8 B;  3OR6 C;  4UCO A;  4R6Z A;  1FXK C;  3SYC A;  3QNE A;  4DR1 O;  4GKK B;  1ZL8 B;  2D3O W;  4YJ3 B;  4DV6 O;  2EIM C;  2P06 A;  4FFK A;  2PTM A;  2CK3 G;  1QLE B;  2AW9 A;  1R3I C;  4I5S A;  4PEL A;  2Q5Z A;  4NTY A;  1SER A;  3RT3 C;  1DF4 A;  3OTO B;  2JJ2 G;  1HNZ O;  3HKB B;  4PD4 F;  1Y76 A;  4JI7 O;  2QM4 A;  5E79 Z;  3W7X A;  4JI0 O;  2HHH B;  4Z1M G;  4X1K B;  1VF6 A;  5IE9 A;  4EFE A;  4WFF A;  2AZ2 A;  4U3J B;  2DQ3 A;  2H94 A;  2VWK A;  4CH3 A;  5BZB A;  4MVR A;  2DWE C;  1IBM O;  1ROP A;  3ZHS A;  2Y69 B;  3CRR A;  4H13 B;  3L73 H;  1S72 V;  2GTS A;  2K1E A;  2DYR B;  4LCU C;  2E3C A;  3K08 A;  4WCE V;  3H01 A;  2ZIN A;  4X66 O;  4PDM A;  2Q68 A;  1AJN A;  4CS3 A;  1XQ8 A;  5LXT B;  4MVZ A;  4X64 O;  2IH3 C;  4PDL A;  1U96 A;  1VQN V;  4X62 B;  2LO1 A;  3UO3 A;  2H3O A;  2EIL B;  4UCU A;  1V54 C;  4QE9 A;  1YDX A;  4HNA B;  1XRE A;  3ETE A;  5IJ9 A;  5JH7 A;  5CBG A;  2YSU B;  2UXC O;  1DTO A;  4NR1 A;  1JR9 A;  3CRQ A;  2V4D A;  3S3X A;  3ZMV A;  4FK5 C;  1OCZ B;  2F95 B;  4DV0 B;  3G6E V;  2FML A;  1X4T A;  2YI9 A;  4EB6 B;  1QR8 A;  3B8N A;  3LDD A;  4E2L A;  4X9Q A;  4P30 A;  4DUY B;  1RP3 B;  1XNQ O;  4R7C A;  1S5H C;  3FYI B;  4NYK A;  4KHP O;  2IBZ H;  4QJF B;  2ZE5 A;  4O4L A;  3SPH A;  1XEQ A;  4D6T H;  4FLW A;  1OV9 A;  3FB6 C;  4DW1 A;  3ZJZ A;  1IVS A;  2JS3 A;  2QWQ B;  2HR3 A;  1AVM A;  3H1I H;  5JJJ B;  1G1X B;  4RQF A;  5L3F A;  1K97 A;  4DK0 A;  1MSW D;  3JSL A;  4JI1 O;  4JAA A;  2C2A A;  5BR8 O;  5LL6 Y;  3JAS B;  3HKE B;  1J95 A;  1QLE C;  2CH7 A;  2CGO A;  4CH5 A;  2Q0A A;  4J7Z A;  4PA3 A;  1WAZ A;  4TSF G;  1AR4 A;  3BHP A;  4JYC A;  5EC2 C;  3RBZ A;  4MT8 A;  3GWO A;  1I5Y A;  5KMG B;  5KAF Z;  4ICG A;  2FYU H;  2WLL A;  1Q6H A;  3O65 A;  3OTO O;  3ZMZ A;  4FZ1 A;  3UCS C;  4G2K A;  2P4V A;  4J42 A;  2D2C B;  3EVK A;  1LR1 A;  1QVF U;  5KHG A;  1RM1 C;  3WFV A;  3RYH A;  2HHH O;  1SKV A;  1M93 A;  1CP9 A;  4PA9 A;  4ZOL B;  5TIS Z;  3CEI A;  1Q8I A;  1GN3 A;  1BCC H;  1JFF A;  5J2U A;  2DYR C;  3NXS A;  4UV8 A;  3ZHV A;  5LP6 B;  5FNV A;  3E86 A;  1H2K A;  3E35 A;  4A5U B;  2QWR B;  4DW0 A;  3ZED A;  1NKD A;  2RJZ A;  4FM2 A;  1NU1 H;  2QE7 G;  1S3J A;  3QVN A;  1PM9 A;  2EUL A;  4W4K A;  5GW7 A;  3HKD A;  4YIP A;  2X6B A;  2YUA A;  4LC1 A;  1NR1 A;  1KD1 W;  3SJA C;  3CS5 A;  2X6C A;  3SYA A;  3N2K A;  4TV8 B;  3THO A;  1UPG A;  4MVU A;  1JJ2 U;  4I55 B;  5HFM A;  3KCX A;  3OE7 G;  2V1D A;  1M56 B;  4AQY B;  3DXR A;  3J81 N;  1OCZ C;  5IYB O;  3CYO A;  2JEX A;  3JD2 A;  4JI2 B;  2ITC C;  5IYZ B;  3H1H H;  5L3E A;  3F5W C;  3WG7 B;  3ZBH A;  3JD1 A;  2ZIO A;  3OAA G;  4F6R A;  3AK2 A;  4LWS A;  5LYJ B;  4QIW F;  2YDE A;  3IFX A;  3HR0 A;  1NT2 B;  1JPX A;  5B1B C;  4LNU A;  3P3P A;  4GLX A;  1VQ9 V;  4O2B A;  4DV4 O;  3IAY A;  1SQV H;  3ZS8 C;  4DUY O;  3ZMT A;  5FLX N;  2OTL V;  2Z5U A;  1QCE A;  4JI4 O;  2PF4 E;  2OYQ A;  3QF7 A;  5DEC A;  5BY1 A;  2G38 A;  3CCU V;  1JJO A;  1PL4 A;  4NTW A;  4U7N A;  2P22 C;  5EBM C;  1BSM A;  1IZ3 A;  1DK1 A;  3SDL A;  3K0D A;  3S3W A;  2QKC A;  2A7W A;  3OUF A;  2NR5 A;  2JDI G;  3ZHQ A;  3K9S A;  2QKA A;  4JTA B;  3OM3 B;  4DV3 B;  4NXM B;  2FKX A;  3E8B A;  1GN2 A;  3JCU Z;  1Z5W A;  4GX2 A;  1BQ0 A;  2GBO A;  3J80 N;  1R73 A;  1GM7 A;  2WAM A;  2UUA O;  2JVD A;  2MW2 B;  2HJF C;  1MAB G;  1WLE A;  4B3S B;  1F51 A;  3KKY A;  1JA8 A;  1GK9 A;  5EZY A;  2OIE A;  1HR0 B;  1YCI A;  4LF5 B;  5LMU B;  1W59 A;  2CTR A;  2PYL A;  5LP6 C;  3AG4 B;  1EZJ A;  4JI5 B;  1K5Q A;  4JV5 B;  2HVJ C;  1BMF G;  1VMG A;  5K1P A;  2OT5 A;  1MMM A;  4LF6 B;  1NS1 A;  1S5J A;  3L9D A;  3L75 H;  2EIJ B;  3TCU A;  2HEP A;  2WLH A;  3ABU A;  4JI8 O;  4XDJ A;  4O4H A;  5IJ0 A;  4TQF A;  3ZRX A;  2WLI A;  3QTC A;  4W4L A;  2EX3 A;  1M56 C;  5CBF A;  3H9V A;  1PNM A;  1IXB A;  1BE3 H;  2ZKO A;  4FLT A;  1K73 W;  3K5L A;  3OW2 U;  4O2A A;  1K4D C;  3FB8 C;  4PJ0 Z;  5GON A;  3OMA B;  4IL6 Z;  1FFX A;  1XIL A;  5LHI A;  5KHK A;  3QO5 A;  5KHH A;  2WA4 A;  1PD3 A;  4U7O A;  1MSD A;  1GMG A;  1XI1 A;  4X20 A;  4ASU G;  4JI2 O;  3SPG A;  2IU3 A;  1I08 A;  1Q90 D;  4O4J B;  1SF9 A;  3LSU A;  2LW1 A;  3BRC A;  4JI6 B;  4X8A A;  1TUB A;  4DYL A;  3CWB H;  1S77 D;  2XAF A;  3UT5 B;  2BOC C;  3ZIA G;  1WP8 A;  4P9O A;  3AG1 B;  3ZRW B;  4GX0 A;  1R6N A;  2LJ2 A;  1I5X A;  2EIM B;  3E8G A;  1AI5 A;  4JGS A;  2UXD B;  1FD9 A;  5DED A;  4K3A A;  1V55 B;  3ABM B;  2Y0P A;  4EFB A;  2QEX V;  2PI4 A;  2CAZ C;  1IXM A;  2ADP A;  4DV5 B;  1EZV H;  2YXY A;  4G28 B;  3CXH F;  4YXW G;  3E22 B;  3ZHT A;  3E83 A;  1SQB H;  1SA0 A;  3K59 A;  1UJW B;  4GYC B;  1EBO A;  4OPA A;  1XMO O;  3CCV V;  2P5O A;  1M1K W;  1VQ5 V;  2DWD C;  3RYC B;  1MG1 A;  3OUS A;  3JAR A;  4CH6 A;  2ODM A;  4I4T A;  1WP7 A;  2JRI A;  3ZRS A;  1QHT A;  2NLJ C;  4BIU A;  1Q86 W;  5IDJ A;  1O9H A;  4FJC C;  4X1I B;  5LBQ A;  2Y48 A;  2L6L A;  2YEV A;  4KXR A;  5CA3 A;  4GUN A;  5KUK A;  1SRY A;  2ZDI C;  2YIC A;  3AG4 C;  3RYI A;  4IHJ A;  1GN4 A;  2PZS A;  1BGY H;  5GTI Z;  1AI4 A;  1HR0 O;  2UU9 O;  2XAH A;  4J11 A;  4MTX A;  3K57 A;  3GVM A;  5KX5 B;  1VQO V;  2NNU A;  2Y4T A;  5J2T B;  3CME V;  2EIJ C;  4RQE A;  2GHY A;  1JX9 A;  3JAK B;  1QQC A;  2QJ1 A;  5JVD A;  4CH4 A;  2F66 C;  4Q6G A;  2WLJ A;  2FTK A;  3FAV A;  1YJ9 V;  3OTF A;  3OMI B;  1P4R A;  2EZO A;  3KG2 A;  4LF6 O;  3P30 A;  3DC5 A;  5FPR A;  2LFS A;  1SZX A;  2UXB O;  1JQ0 A;  2ZT9 B;  2QR4 A;  1EM1 A;  1K8A W;  3ABL B;  3ETQ A;  3MHH C;  5CA0 A;  1YF2 A;  1YTF B;  4ABM A;  4IYI A;  3ZX6 A;  1PL0 A;  2XAQ A;  3FD9 A;  3RYF B;  1OCO B;  3BFR A;  4UVC A;  1I7F A;  3IJ4 A;  1PV0 A;  5FL7 G;  2LQT A;  3CX5 F;  3AG1 C;  2JIZ G;  1H38 A;  3VOU A;  1Q6I A;  4YHH O;  2DN9 A;  4MW8 A;  4DR5 B;  5CBH A;  5EYP A;  3CJH B;  2Q69 A;  4QNH B;  1KYO F;  1V55 C;  4PDR A;  3ABM C;  4ZI7 A;  4FMT A;  1YVW A;  5IJ9 B;  1Q7Y W;  5FPO A;  1D2D A;  1BQZ A;  3MDS A;  3B09 A;  3SYQ A;  3A2F A;  2PI5 A;  4OGQ B;  3JD0 A;  2UXX A;  5JJN B;  2UUC O;  3CCL V;  3G67 A;  2BE3 A;  4WFH A;  3E8H A;  2V7Q G;  3U0Z A;  1PNK A;  1RM1 B;  4MVO A;  2YIB D;  5K1X A;  1VQ8 V;  3ZMU A;  3FFQ A;  4FFB A;  4WF9 V;  1J5E O;  1VP7 A;  3DTU B;  2BTQ B;  5B1N A;  3N2G A;  4MS2 A;  1YHQ V;  3IC9 A;  2KSD A;  4RUF A;  3W7T A;  1GN6 A;  2KG7 A;  3TXQ A;  3T1H B;  1L1F A;  1H8E G;  4WBN B;  3RGB A;  1HP8 A;  2MK3 A;  2P7T C;  5LHG A;  3F7Y C;  2VQF O;  4P9P A;  1HWY A;  4YY3 B;  4MSW C;  3APO A;  4JYY A;  2RN9 A;  1AP5 A;  5JCO A;  1A32 A;  1B04 A;  1ZL8 A;  3I56 V;  4QPJ A;  4YJ3 A;  2B9Z A;  5H9C A;  1QBZ A;  4QE7 A;  3PN1 A;  3O9O A;  2WLL B;  1VQ6 V;  1BL8 A;  4BW9 A;  2X6A A; 
#chains in the Genus database with same CATH homology
 1WAZ A;  2LJ2 A;  2H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...