2LJ2A

Integral membrane core domain of the mercury transporter merf in lipid bilayer membranes
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
IGTTLVALSSFTPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of a membrane protein in proteoliposomes.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
molecule keywords MerF
total genus 18
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2lj2A00
2H3OA 1WAZA 2LJ2A
chains in the Genus database with same CATH superfamily
1F51A 3B40A 5BXZA 1BL8A 1IZ3A 2A06H 3UCSC 4JYBA 2XT9A 3AEIA 3VQWA 4DV4B 2YIBD 1KC8W 3RYFA 3JAWA 4G27B 5GTHZ 1I94B 4X65O 5B1BB 1JA8A 2ZIMA 2UUCO 4XBFA 3ABTA 4I7ZB 4JI3B 2ZNIA 2IU3A 1DTOA 3ETQA 2JGDB 3IAYA 3C3SA 2Y4TA 2P4VA 3JALA 1XBLA 2OIGA 4EFBA 1H2NA 2CE4A 4LF4O 2EILC 5KX5A 2WAMA 3EHBB 4LWSA 3SJBC 1DGSA 1XUQA 4B3MB 1FD9A 4JI1O 4DK1A 3RGBA 4LF7B 1AP5A 2L35A 2DQ0A 2N05A 4X62B 4QIWF 2X7RB 5JJNB 1SQQH 3ZMUA 1YJNV 4HAMA 3ASOB 4FLVA 4ASUG 4TV9A 5CBHA 1FXKC 4U7NA 3H1IH 4ZIBA 5LHGA 3CSXA 1BE3H 1H2GA 3ETGA 3JATA 2AHYA 3JYCA 4MVMA 5KHJA 4I50B 2E3CA 3ASNB 4RUFA 2IJIA 4BR6A 1JVMA 2NNUA 2QM4A 4NVPA 1R6NA 4Z1MG 1AVMA 5D5PA 1XNQO 3UM7A 3G6BA 3BVOA 3OMAB 2AZ0A 3JARB 1HNWB 3G4SV 4WCEV 1FFTB 4O2AB 3JSLA 3OR7C 5CMUA 1EN4A 3EXAA 1V54B 3K08A 3ZHSA 1NVPD 3BFRA 1S5LZ 1TUBB 5CA1A 3CCEV 2DYSB 4PJ0Z 1RM1B 1AILA 2GTAA 2A3QA 3UO3A 3E8HA 1GK9A 1V55B 2CK3G 4CS2A 3TCUA 2JIZG 4TUYB 3S3XA 3SYOA 4I4TA 3JASB 4K8XA 1JX9A 3OUFA 1SQGA 4PELA 3K06A 3CCJV 3DXRB 4YJ2A 2LW7A 1HR0O 5J2TB 4FJCC 5L3CA 5CN0A 3LSSA 1BSMA 2HEPA 4LF5O 4RQFA 3H01A 5D5QA 3APQA 5K1PA 3SGIA 3E83A 1KB9F 4KFMA 2KQXA 4PDRA 2BTQB 1U97A 4TV8A 1OCRC 1UFIA 5LHIA 4CH6A 1PNKA 4JTCB 5B1BC 2ILMA 1W2BU 1XOUA 2FTKA 2XOKG 4JI6B 4LFAB 1XHXA 2OTJV 4YHHO 4X66O 4DUZB 1VQ8V 3HKBA 1PD3A 2CUGA 4A5UB 4G2KA 3SJCC 3ZMVA 2K9PA 4X65B 4UV8A 4KUMA 2UU9B 3LNNA 1VQNV 1Y6XA 5B3SC 2E74B 3LDDA 3T1YB 4I0XB 4MSWC 1PPJH 4F6RB 2QGNA 4LF5B 4LFBO 4NTWA 5J2UA 1ZX3A 4H37A 1B04A 3CHXA 3L70H 1PNMA 3HKCB 1IURA 2F4VB 5LXTB 5TISZ 1GO3F 3BCCH 2VQEB 1TVKA 4MVRA 4Z2WA 4CH4A 1K5SA 4X1IA 2CDYA 4K0KO 1OCCC 1IBMB 4DR5O 4JPRA 2DYRB 3W7SA 3ZCCA 1WB7A 2AGAA 4E4EA 4CC6A 3GWOA 2Q73A 1YITV 2OCHA 2Q6AA 2V1DA 2X6BA 2CGNA 3AG2B 4XDJA 4DV3B 4TSFG 2P22C 5B1OA 4KHPO 1FS0G 3ZMZA 3A0HZ 3ASNC 4DR7O 5GONA 1V9PA 1YXBA 1FXVA 1HNXO 4GKKO 4KXRA 1N34B 2H8PC 4DW0A 1Z5WA 4QPKA 3SR2C 2LGWA 1FJGO 2EZOA 5CBGA 2ZE6A 3BA9A 4DUYO 4LF8B 4WFHA 2JK5C 1K92A 4JI6O 1FXKB 2WLJA 1EN6A 1MNGA 5KHGA 4DV3O 1AI4A 4Q6GA 1IBLB 1JPXA 2WLKA 1L1FA 2YUAA 3CRMA 4NTXA 1CEZA 4NXMB 4FFKA 4GX2A 1J95A 1VQ7V 1NQTA 1QNMA 2ZT9B 3FAVA 4OGQB 5K1XA 1FXHA 1XNQB 3R65A 4JI5O 5EYPA 3FB5C 2DWEC 1IXMA 1Z2GA 3CEIA 3I55V 1X4TA 2ODMA 1CP9A 3TJTA 1QLEB 1BCCH 2B9ZA 3OTOO 2EIKB 2Q68A 2YEVA 4H13B 1KKCA 4HZ3A 4LNUB 3VQXA 3OEHG 1SQXH 1M57B 4YY3B 1G8MA 4KHPB 2QKSA 5LGTA 5IJ0A 1D5AA 2YSUB 4JYAO 3O9OA 1M90W 5DEDA 3WG7C 2BSKA 4I55B 1K5QA 4LP8A 3LNMB 1AI6A 4X1YB 4GLXA 4IIJA 1S76D 3PJSK 1BZKA 2CTPA 3S3WA 4QE9A 3FKSG 4UVBA 5FNVB 2IM9A 3D3QA 1V55C 4JZ2A 5H6QA 4MT8A 4DO2A 4J42A 4DV6O 1PP9H 1SZTA 1YZBA 5KHKA 2JJ2G 3ZN0A 1EZJA 3ABUA 5BR8O 3E35A 1QU7A 1XMOB 1FPOA 4PV1B 3I56V 2PYLA 2JEXA 1N36O 4O4HB 5LOVB 2JGUA 2EX3A 4GUNA 3OD4A 5AG2A 4FZ1A 4DYLA 2UXXA 1DK1A 1NI8A 1NZ6A 3E8FA 2EULA 3LSQA 3QO5A 4HNAB 4FLUA 1IXBA 2UU9O 3D36A 2VWJA 1GN2A 5H5NA 5LBQA 2F95B 5JVDB 5B3SB 1KU9A 1AJQA 5IY5C 2RCVA 5HFMA 2H3OA 4ZKIA 3U0ZA 3ETDA 4IHJA 5LMNB 3SPIA 4CC5A 3RVYA 3HR0A 4HBNA 3K59A 3OMIB 4FM1A 2EBOA 2HHHB 4UCVA 4DR3O 5FPOA 2H94A 5GTIZ 3JAWB 3VOUA 1R3KC 1M56C 1XEQA 4HYOA 2DQ3A 2DN9A 1K9MW 1HP8A 4NXNB 1LNQA 1WA8A 5IY5B 2A0LA 2Q0OC 4OX9O 3K5NA 2CTQA 1H8HG 3N2GB 3ZX6A 1XDCA 1W0KG 1WAZA 3ZRXA 4FLXA 2QWRB 1ROPA 4J9YB 2JJ1G 3J80N 5CA3A 3X2QC 1F7YA 2NLJC 2UXCO 4LWSB 5EIBD 2BCCH 5CB4A 4LH7A 1K3EA 1S3JA 5KA6A 4DK0A 5C8YA 2HVJC 2EIJC 4JI0B 2PZSA 2OT5A 5DN6G 4AI8A 1HR0B 2KB1A 1GRJA 1COWG 4JV5O 4RUEA 3ML0A 3OUSA 1F4MA 2FL4A 4DR1O 3JD1A 3T4DA 1TAEA 2Z5UA 1XNRB 5KA5A 4U3FH 1Q43A 3BRCA 4TQDA 4DXWA 4YJ3A 4ZHQA 3LDEA 3ETEA 2LO1A 1M56B 3F5TA 4PHZA 3TXSA 1Q6IA 1SA0A 3K9SA 3RYIA 2CTRA 4ZI7B 2WA4A 4DR5B 4GX1A 1B6QA 1PL0A 1Y76A 4JAUA 1AJPA 1HDJA 3E22A 4CH5A 2GHYA 2IJKA 1KECA 2K1EA 5BZBA 1S5HC 1J5EO 1OV9A 1K4CC 1UPGA 1P7GA 1RPRA 4WFAV 4FZ0A 3A0BZ 4MTFA 2QWPB 5CA1B 1AROP 3CRRA 4H0LB 3CPWU 4JI4B 3R66A 1YF2A 5B5EZ 4PDMA 4EFEA 1IBKO 3CE2A 1H2KA 1NT2B 3ZEDA 3CJHA 4DW1A 2XAJA 3JASA 2LJ2A 1FYJA 1H2MA 4JAAA 4MVQA 2UXNA 2PF4E 3T1YO 3VQVA 2QJ1A 1FKAO 1HNZO 5JWPA 5C93A 2DYSC 1KD1W 2CH7A 2UUAO 3G71V 1KP2A 3JAKB 4F4LA 2W6IG 4DV7B 3STZC 4J10A 4U3JB 2QTOA 4B7EA 4DV5O 1H38A 1URFA 2DWDC 1N36B 3NR7A 5LP6B 1N33B 1XHZA 2D3OW 3HKEB 3RN4A 2NR5A 3SYPA 1ORQC 1NBMG 4L8JA 1Q82W 4IYIA 3CCQV 2Q5ZA 3Q4HB 2ZE5A 3RWRD 4XDKA 3B4SA 2P6JA 4DV2B 4TT3G 2P7TC 2OCCB 1VF7A 2ZDIA 2L6LA 2P67A 1FFXA 3BA8A 2YXYA 4B3RB 1TGOA 1YTFD 2E5LO 1E1QG 2X6AA 1JFFB 5IE9A 5J2UB 2BOBC 1R1BA 3NXSA 4UCOA 4MVOA 4O4JB 1WN7A 4CH3A 3F5WC 1EBOA 5IJ9A 3FB7C 2Y69C 2P5OA 2HG5C 2Q7EA 2KG7A 4QPJA 3K04A 2WLIB 3SPCA 1QVFU 4EB6A 2JDIG 2ZM6O 2VQFB 4X1IB 4LC1A 3GB7C 4DV5B 4BIUA 2LGQA 5JJJB 4GZRB 1VP7A 4FFBB 1GTOA 3CXCU 2GUZA 1RP3B 2HJDA 3ABMC 1NU1H 4DV4O 3IGAC 4C7UA 1ENVA 1JQ0A 1U96A 3AG4B 2FKXA 4K35A 1YHQV 3ICXA 2XHBA 5L3BA 4BWAA 4MW3A 4UCUA 3EFFK 5LA6B 1KMIZ 1PM9A 1KUQA 5KUKA 1VQKV 2WLLA 3K5MA 4UVCA 4NTYA 5GW7A 1BMFG 4WFFA 4R8CA 3CCSV 3SPJA 1N32B 1YIJV 3ABKB 5IT9N 3ZBHA 4N23A 2VRZA 1PNLA 3U11A 2QWQB 1YEWA 4X1KA 2BOCC 3LDCA 5JQGA 1XILA 2Q69A 4ZOLB 2C2AA 4I9QA 3CMAV 1B06A 1GN4A 4MVZA 1VQLV 4GCZA 4FM2A 4JI4O 5ITZB 2F66C 4FLZA 1I7FA 3W7TA 1Q8IA 1QQCA 1K7DA 2EIMC 4I9WA 3JCUZ 3STLC 3D3IA 4TQFA 1W59A 1OCZB 5H6RA 4UXNA 3TK1A 5E79Z 1R6KA 1EZVH 1ZSPA 1F4NA 1WP8A 3D36C 1V54C 1VIBA 1VARA 3H1LH 1VQMV 1W0JG 3W7XA 4WBNA 1QHTA 4LNUA 3APOA 4JAVA 4MVUA 1LUWA 1MSWD 5JJEB 2PTMA 4PI0A 1DF5A 3UQ8A 3ABLB 2P90A 4UCRA 2M6YA 3RYCB 2QDOA 4JI2O 5JH7A 2ZR3A 4DR4O 2R9RB 1QLEC 2QM8A 4IIJB 2B1IA 2GV9A 1VMGA 1CPYA 4DRXB 4G28B 1YCIA 3KCYA 1DLBA 2R9AA 1Q90D 4JI8B 1QVGU 2GDSA 2YC0A 2ZE8A 3C90A 4BAYA 3ZHRA 2GBOA 4LF4B 3AG3B 1YSCA 2G38A 1XMQO 2AHZA 4X64B 2UUAB 1RSOB 2EZPA 4ICGA 4RWUA 4O4HA 4DV7O 3E89A 5BR8B 2EJRA 5EZYB 1BS3A 1NR1A 1SESA 2F1MA 3TGUH 2LW1A 4JF3A 4P2ZA 2HKOA 1HW7A 3AK1A 1RPOA 1P4RA 2A79B 2Q4PA 3CCUV 2CAZC 2UXDB 4HNAA 4JTDB 4X20B 4P9OA 3P3NA 1KKDA 3CX5F 5L3DA 4XDLA 3G6EV 3ABLC 4EKWA 2GTSA 2RMKB 2XAQA 5KHIA 5KAIZ 4B3TO 2XAGA 4AQYB 4F6EA 4O2AA 2P06A 2ETNA 1LUVA 5EBWC 3CCMV 3TETA 3B77A 3JD4A 3M8AA 1L0NH 1GMGA 3IJ4A 3CXHF 3E86A 1I5XA 3E8BA 4RAIA 1ZUQA 3D8CA 5IYCO 2Y69B 2Q0AA 2Q7GA 3RT3C 4TUYA 4BIOA 3FB6C 2UXBB 4H44B 5B1NA 4IT5A 3N2GA 1MZEA 1QBZA 4X9QA 2WLHA 4JASA 3DXRA 4CS4A 4P9PA 1VF6C 1BGYH 2Z0AA 3DSQA 1AR1B 3M7MX 5A2QN 4PA7A 2XASA 1XMOO 4X89A 1XI1A 5CB4B 1Z5VA 2EINC 3UT5A 2ZXWB 3AK2A 1SQVH 2F93B 2MK3A 4GKJO 1JR9A 2LQTA 4J11A 4TV8B 1FJGB 3OGIB 3CP1A 5L3EA 2F43G 4JZGA 3J7AU 4O4LA 5KHHA 2ARHA 3OEEG 3QVNA 4X62O 1M57C 1M1KW 1QLNA 3FD9A 1WJZA 2UUBO 3O65A 1MG1A 1OCOB 4UFZA 1IBLO 3CC7V 4LBEC 1SETA 1WP7A 5LHHA 1YI2V 4RO2A 3H1HH 4YJ3B 1GM9A 1MMMA 1SA0B 1AP6A 4JYYA 1H8EG 1SKVA 2JS3A 4LF7O 3RYFB 4DR6B 3UO2A 2ZR2A 2N04A 1AR5A 2EIKC 3SPHA 1Q3EA 1N4CA 2GSMB 1SS3A 2RNBA 4JI0O 3PN1A 3OM3B 2HHHO 3K9AA 1K4DC 3AK3A 2VQEO 1Y74A 1D2DA 2JGDA 5A9GA 3B8MA 2LFRA 1GM7A 3OT7A 1HWYA 2HFEC 3MD0A 1TVKB 3ZRWB 2Y0IA 3JALB 2E76B 5LL6Y 4R6ZA 1ZTEA 1AB3A 2V4DA 4JV5B 1NKDA 3CJHB 1GH6A 5LMNO 5H9CA 3WB2A 4CS3A 1IVSA 1SQFA 4E2LA 1JJ2U 4YIOA 2EJ7A 1I08A 1PV0A 3HKDB 4TWKA 2XTAA 3ZHQA 2R9IA 4Z1VA 3G67A 3DC6A 1TA8A 4JI8O 2XNDG 3JSNA 1N0JA 2DE0X 4U3JA 2PY5A 3SYCA 4UCSA 2UXDO 1OCZC 2EINB 3IC7A 1R3LC 3P3PA 4MW8A 1EFRG 1PKXA 3RFRA 1G4YB 3N2KB 4DUYB 4LF8O 1VQ9V 3AG2C 1YJWV 3G80A 3B8NA 4BIZA 3LSUA 1NVPB 3QF7A 4W4KA 1QR8A 5EIBC 2Z3YA 4AILC 4GKKB 4UCTA 2IH1C 3JD3A 2Y0PA 1UJWB 5JCOC 1FFXB 4GKJB 4MTOA 3FAVB 1WPBA 1T5EA 1SQPH 3K5OA 4I5SA 3K57A 2IU0A 2QEXV 3KKYA 4PA6A 2M7WA 1F23A 1L0LH 2ITCC 2W0XA 3P30A 3P32A 4NXNO 3GWKC 2BE3A 2QA4V 1MSDA 4LR3A 4KL1A 4QE7A 5IWAO 4YJ2B 3ZHTA 1GN6A 3J81N 3BAAA 5J2TA 2X0LA 3KCXA 3SJAC 4I55A 2XUMA 4OPHA 5LMUO 3C3TA 4JI3O 5CA0B 1PL4A 3E2EA 1EM1A 4BW9A 2E75B 3IFXA 3SPGA 3VQYA 3ZHUA 4FM0A 3CCLV 2LFSA 4Q20A 2BTQA 4FIPC 3FB8C 4DR2B 1SQBH 4JTAB 3H1JH 2DMXA 4JI7O 1VQ6V 2DYRC 2AZ2A 3AG1B 4DR7B 5BMVA 3L75H 2R72A 2UXCB 3AG7A 4K8ZA 3BEHA 3T4ZA 4YY3O 3OW2U 2WA3A 2QM7A 1M93A 3GVMA 2QWOB 4NR1A 1VEWA 2A9HA 3CRAA 1BQZA 4JI1B 4X1KB 1RM1C 1B3QA 4DV1B 4GYCB 1OHHG 4UUJC 1H2SB 4WFBV 1Y67A 1Q6HA 3KZIZ 2HJFC 3CYOA 1XMQB 4PDLA 4O4IA 4BW5A 1D5NA 4B08A 5IYZA 5JVDA 2Q67A 5FL7G 5B66Z 2Q8VA 3BY6A 1Q86W 2ADQB 3HKCA 1XNRO 1JJOA 5LYJB 1BHBA 4DR2O 2RQ6A 4WFGA 1M4UA 5KAFZ 2ZDIC 3DGEA 2Y48A 3MHSC 1N32O 4LH6A 1QR9A 4WBNB 1G1XB 3WFVA 2DW4A 4NKGB 1VQ4V 2YICA 4R50A 2W6JG 3THOA 4B3RO 1Y4MA 2IJHA 5KLVH 4JI7B 3WB0A 3ZS8C 5JH7B 5CBFA 2FB5A 1H2LA 4FPPA 3RYHA 2YDEA 4X66B 5GONB 1R73A 1NJIW 1OCOC 3K79A 5IYDO 1Y66A 2N74A 3RW0A 1KP3A 4DRXA 3QG5A 4DV1O 5C8YB 3K0DA 1S0VA 4DR6O 1P84F 1OCCB 5EK0A 1CXZB 1X59A 2MW2B 4X88A 5IWAB 4LFAO 3F7VC 2B5UA 3ZMSA 2ADPA 5HFLA 1RSOA 5EC2C 2B1GA 4O2BA 2QE7G 1S5JA 5L3FA 2YIBA 4PA4A 3BABA 1ZL8A 3CCVV 5KMGA 3H1KH 2WSSG 4ZHQB 4K3AA 2KKWA 3RYIB 3JAMN 2FMLA 4ZI7A 3ABMB 4X20A 3WB1A 5EYPB 2ZCEA 3SJQC 3WG7B 1Y76B 4D7SA 1R6TA 4IL6Z 1NS1A 2QWNB 3JD2A 4KP4A 4WFEA 2JVDA 1OJHA 3AG1C 1ZLZA 2YEVB 3K5LA 3L73H 3OTOB 3CD6V 3ZJZA 2AXTZ 2A7WA 3T1HB 1YDXA 2JS5A 2WLNA 4PA3A 5EBMC 5LGUA 4CBCA 1N33O 2ZXWC 2ATKC 2NN4A 2V7QG 2O57A 4NXMO 4YHHB 1VQPV 2YI8A 1YTFB 1XL4A 5KX5B 1I5YA 5FNVA 4X64O 3ZRSA 4FK5C 3A2FA 2QKCA 1MABG 1R3JC 4DR4B 2CH7B 2OCCC 1HNXB 1US6A 2W0FC 3A8TA 2VWKA 2HP8A 1WB8A 1DF4A 1GN3A 3T1HO 4P30A 1S72V 1THZA 3OMNB 3W7UA 1K8AW 4LCUC 3ZN1A 1N34O 3ABKC 1L8DA 4L87A 2OIEA 4TV9B 4D6TH 3MAQA 5LP6A 4QGPA 4QJFB 1E79G 1WPXA 3JATB 4OPAA 1G6UA 3AG3C 4I50A 5IDJA 4J9ZB 1P7BA 3AG4C 4J41A 4LFCO 5IYBO 4JGSA 3JARA 1N0NA 4IHJB 2PI4A 5DM6V 2DJVA 5BY1A 2OYQA 2ZE7A 2WLMA 1LR1A 2RJZA 4D7TA 1GM8A 3SYQA 1MA1A 3FFQA 1TUBA 4JI2B 4MVSA 1SRYA 3OGCC 2PI5A 4J7ZA 1MOFA 1I94O 2HR3A 2YIDA 2UUCB 2CTWA 3FYIB 4O4JA 2IH3C 5IJ9B 3K0GA 1Y74B 4I4TB 1KYOF 1WA8B 5JCOA 4K0KB 3HPLC 4QNHB 1O9HA 1NTZH 3CB2A 5B1AC 3FYEB 1TUEB 3ZRWA 4EB6B 4UVAA 2ZIOA 1JMKC 2OWOA 1VQOV 4LF9B 3OFNG 3RBZA 1SZXA 4B3SO 5LMUB 1XQ8A 2GUZB 4DR3B 1HNWO 1ZWIC 2PYJA 3VBBA 4U7OA 2DOSA 3HKDA 2ZNJA 1AJNA 1E1RG 2EIMB 4EEQA 4DV6B 2HVKC 2ZM6B 2VQFO 1JCHA 5LGNA 2Q9LA 1IBMO 1O9GA 2YXLA 1A32A 2UUBB 2WLLB 1M5IA 4FVMA 4RQEA 4CZZA 4PD4F 3HKBB 3K58A 2UXBO 3E8GA 4ABMA 1XL6A 5E1AC 3N2KA 3M99B 1FAFA 5H2FZ 2Y4UA 4DV0B 3QO7A 2QSAA 3CMEV 2EILB 4I0XA 5JQGB 3U10A 4F6RA 4ZOLA 3DC5A 2LP7A 3ZHVA 4GX5A 2YS8A 3X2QB 2IW5A 1VF6A 4H33A 2F4VO 3E22B 2QTSA 3L74H 3CS5A 5J9PC 1WLEA 3B2EE 3SDLA 4J7JA 5EBLC 3ZRVA 5LXTA 4YIPA 4AQYO 2OTLV 4N21A 4PDVA 1P49A 4FLWA 4W4LA 1NH2B 3ZMTA 4IGGA 2XAHA 1XREA 3L9DA 4UB6Z 3OAAG 1K33A 3QO8A 4UB8Z 3W7WA 2ZD9A 1HNZB 4UV9A 2AW9A 1OCRB 4YXWG 3IC9A 2ZQMA 4FMTA 1NH2D 3WU2Z 4OXSA 4GT1A 3H9VA 3K03A 3RYCA 4FLYA 3EVKA 3OTFA 4LF6B 3JAKA 2E5LB 3CWBH 3L72H 3UKMA 4B3SB 5CA0A 1BHAA 2WWWA 3CRCA 1SF9A 4JYAB 1WNSA 2P4KA 1BT8A 4MTXA 2RDCA 3HKEA 3T1CA 1NTKH 4FLTA 3BHPA 2PUSA 2KSDA 1QCEA 4ZBMA 1Q5OA 2QR4A 2BTOA 1FXKA 2Q7HA 3Q4HA 4NB5A 5BMVB 1GKFA 2F23A 1NR7A 2JEUA 5FLXN 4X8AA 1KQSU 5EZYA 4LF6O 2WPDG 1YJ9V 1SERA 4JI5B 1IBKB 3N27A 2EIJB 4WF9V 4PI2A 3SYAA 3RVZA 3CC2V 1JFFA 4J80A 3BPZA 3DTUB 3OR6C 4O4IB 1RFYA 5IYZB 4B7KA 2YXHA 3FX7A 5DECA 2CGOA 3LUTB 1AI7A 1J5EB 3ASOC 4IYHA 5LYJA 4PA9A 2KG7B 5KUMA 5L3GA 3L71H 3ZIAG 2WLIA 5LP6C 3CCRV 5IJ0B 3HB3B 1IDSA 2ZINA 1BQ0A 1R3IC 3CC4V 2BSKB 2XAFA 4TOIA 3KG2A 1K73W 1JOYA 1MZFA 2QKAA 3MDSA 5F2VO 1Q6UA 4FFBA 3MHHC 1Q81W 1NTMH 2JRIA 1AI5A 4X1YA 1K34A 2PGGA 2YIAA 4LFBB 3B09A 2D2CB 4MS2A 1KBHA 1Q7YW 4B3MO 4DV2O 1S77D 2X6CA 2R70A 3TXQA 4DV0O 3RYHB 4GX0A 4J7KA 4MTGA 5LA6A 4R7CA 3JCZA 1N8RW 2HLDG 2ITDC 3T2MA 1VQ5V 1ZAUA 2IJJA 4OX9B 3UT5B 3K3WA 1EN5A 2VS0A 1SC5B 1GAXA 5LOVA 5FPRA 1IX9A 4DR1B 2RN9A 3F7YC 1YVWA 1VF5B 2YI9A 2ZKOA 3QNEA 3OE7G 5B1AB 1I0HA 1K97A 5EC1C 4O4LB 2IBZH 1AR4A 4DUZO 4LFCB 4O2BB 2FYUH 3A0RA 3CRQA 1M9NA 4NYKA 5ITZA 1ZL8B 4B3TB 5KMGB 4JYCA 3QTCA 3JD0A 4AHCA 4LF9O 1OZ0A 3I5DA
chains in the Genus database with same CATH topology
2H3OA 1WAZA 2LJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3O A;  1WAZ A;  2LJ2 A; 
#chains in the Genus database with same CATH topology
 1F51 A;  3B40 A;  5BXZ A;  1BL8 A;  1IZ3 A;  2A06 H;  3UCS C;  4JYB A;  2XT9 A;  3AEI A;  3VQW A;  4DV4 B;  2YIB D;  1KC8 W;  3RYF A;  3JAW A;  4G27 B;  5GTH Z;  1I94 B;  4X65 O;  5B1B B;  1JA8 A;  2ZIM A;  2UUC O;  4XBF A;  3ABT A;  4I7Z B;  4JI3 B;  2ZNI A;  2IU3 A;  1DTO A;  3ETQ A;  2JGD B;  3IAY A;  3C3S A;  2Y4T A;  2P4V A;  3JAL A;  1XBL A;  2OIG A;  4EFB A;  1H2N A;  2CE4 A;  4LF4 O;  2EIL C;  5KX5 A;  2WAM A;  3EHB B;  4LWS A;  3SJB C;  1DGS A;  1XUQ A;  4B3M B;  1FD9 A;  4JI1 O;  4DK1 A;  3RGB A;  4LF7 B;  1AP5 A;  2L35 A;  2DQ0 A;  2N05 A;  4X62 B;  4QIW F;  2X7R B;  5JJN B;  1SQQ H;  3ZMU A;  1YJN V;  4HAM A;  3ASO B;  4FLV A;  4ASU G;  4TV9 A;  5CBH A;  1FXK C;  4U7N A;  3H1I H;  4ZIB A;  5LHG A;  3CSX A;  1BE3 H;  1H2G A;  3ETG A;  3JAT A;  2AHY A;  3JYC A;  4MVM A;  5KHJ A;  4I50 B;  2E3C A;  3ASN B;  4RUF A;  2IJI A;  4BR6 A;  1JVM A;  2NNU A;  2QM4 A;  4NVP A;  1R6N A;  4Z1M G;  1AVM A;  5D5P A;  1XNQ O;  3UM7 A;  3G6B A;  3BVO A;  3OMA B;  2AZ0 A;  3JAR B;  1HNW B;  3G4S V;  4WCE V;  1FFT B;  4O2A B;  3JSL A;  3OR7 C;  5CMU A;  1EN4 A;  3EXA A;  1V54 B;  3K08 A;  3ZHS A;  1NVP D;  3BFR A;  1S5L Z;  1TUB B;  5CA1 A;  3CCE V;  2DYS B;  4PJ0 Z;  1RM1 B;  1AIL A;  2GTA A;  2A3Q A;  3UO3 A;  3E8H A;  1GK9 A;  1V55 B;  2CK3 G;  4CS2 A;  3TCU A;  2JIZ G;  4TUY B;  3S3X A;  3SYO A;  4I4T A;  3JAS B;  4K8X A;  1JX9 A;  3OUF A;  1SQG A;  4PEL A;  3K06 A;  3CCJ V;  3DXR B;  4YJ2 A;  2LW7 A;  1HR0 O;  5J2T B;  4FJC C;  5L3C A;  5CN0 A;  3LSS A;  1BSM A;  2HEP A;  4LF5 O;  4RQF A;  3H01 A;  5D5Q A;  3APQ A;  5K1P A;  3SGI A;  3E83 A;  1KB9 F;  4KFM A;  2KQX A;  4PDR A;  2BTQ B;  1U97 A;  4TV8 A;  1OCR C;  1UFI A;  5LHI A;  4CH6 A;  1PNK A;  4JTC B;  5B1B C;  2ILM A;  1W2B U;  1XOU A;  2FTK A;  2XOK G;  4JI6 B;  4LFA B;  1XHX A;  2OTJ V;  4YHH O;  4X66 O;  4DUZ B;  1VQ8 V;  3HKB A;  1PD3 A;  2CUG A;  4A5U B;  4G2K A;  3SJC C;  3ZMV A;  2K9P A;  4X65 B;  4UV8 A;  4KUM A;  2UU9 B;  3LNN A;  1VQN V;  1Y6X A;  5B3S C;  2E74 B;  3LDD A;  3T1Y B;  4I0X B;  4MSW C;  1PPJ H;  4F6R B;  2QGN A;  4LF5 B;  4LFB O;  4NTW A;  5J2U A;  1ZX3 A;  4H37 A;  1B04 A;  3CHX A;  3L70 H;  1PNM A;  3HKC B;  1IUR A;  2F4V B;  5LXT B;  5TIS Z;  1GO3 F;  3BCC H;  2VQE B;  1TVK A;  4MVR A;  4Z2W A;  4CH4 A;  1K5S A;  4X1I A;  2CDY A;  4K0K O;  1OCC C;  1IBM B;  4DR5 O;  4JPR A;  2DYR B;  3W7S A;  3ZCC A;  1WB7 A;  2AGA A;  4E4E A;  4CC6 A;  3GWO A;  2Q73 A;  1YIT V;  2OCH A;  2Q6A A;  2V1D A;  2X6B A;  2CGN A;  3AG2 B;  4XDJ A;  4DV3 B;  4TSF G;  2P22 C;  5B1O A;  4KHP O;  1FS0 G;  3ZMZ A;  3A0H Z;  3ASN C;  4DR7 O;  5GON A;  1V9P A;  1YXB A;  1FXV A;  1HNX O;  4GKK O;  4KXR A;  1N34 B;  2H8P C;  4DW0 A;  1Z5W A;  4QPK A;  3SR2 C;  2LGW A;  1FJG O;  2EZO A;  5CBG A;  2ZE6 A;  3BA9 A;  4DUY O;  4LF8 B;  4WFH A;  2JK5 C;  1K92 A;  4JI6 O;  1FXK B;  2WLJ A;  1EN6 A;  1MNG A;  5KHG A;  4DV3 O;  1AI4 A;  4Q6G A;  1IBL B;  1JPX A;  2WLK A;  1L1F A;  2YUA A;  3CRM A;  4NTX A;  1CEZ A;  4NXM B;  4FFK A;  4GX2 A;  1J95 A;  1VQ7 V;  1NQT A;  1QNM A;  2ZT9 B;  3FAV A;  4OGQ B;  5K1X A;  1FXH A;  1XNQ B;  3R65 A;  4JI5 O;  5EYP A;  3FB5 C;  2DWE C;  1IXM A;  1Z2G A;  3CEI A;  3I55 V;  1X4T A;  2ODM A;  1CP9 A;  3TJT A;  1QLE B;  1BCC H;  2B9Z A;  3OTO O;  2EIK B;  2Q68 A;  2YEV A;  4H13 B;  1KKC A;  4HZ3 A;  4LNU B;  3VQX A;  3OEH G;  1SQX H;  1M57 B;  4YY3 B;  1G8M A;  4KHP B;  2QKS A;  5LGT A;  5IJ0 A;  1D5A A;  2YSU B;  4JYA O;  3O9O A;  1M90 W;  5DED A;  3WG7 C;  2BSK A;  4I55 B;  1K5Q A;  4LP8 A;  3LNM B;  1AI6 A;  4X1Y B;  4GLX A;  4IIJ A;  1S76 D;  3PJS K;  1BZK A;  2CTP A;  3S3W A;  4QE9 A;  3FKS G;  4UVB A;  5FNV B;  2IM9 A;  3D3Q A;  1V55 C;  4JZ2 A;  5H6Q A;  4MT8 A;  4DO2 A;  4J42 A;  4DV6 O;  1PP9 H;  1SZT A;  1YZB A;  5KHK A;  2JJ2 G;  3ZN0 A;  1EZJ A;  3ABU A;  5BR8 O;  3E35 A;  1QU7 A;  1XMO B;  1FPO A;  4PV1 B;  3I56 V;  2PYL A;  2JEX A;  1N36 O;  4O4H B;  5LOV B;  2JGU A;  2EX3 A;  4GUN A;  3OD4 A;  5AG2 A;  4FZ1 A;  4DYL A;  2UXX A;  1DK1 A;  1NI8 A;  1NZ6 A;  3E8F A;  2EUL A;  3LSQ A;  3QO5 A;  4HNA B;  4FLU A;  1IXB A;  2UU9 O;  3D36 A;  2VWJ A;  1GN2 A;  5H5N A;  5LBQ A;  2F95 B;  5JVD B;  5B3S B;  1KU9 A;  1AJQ A;  5IY5 C;  2RCV A;  5HFM A;  2H3O A;  4ZKI A;  3U0Z A;  3ETD A;  4IHJ A;  5LMN B;  3SPI A;  4CC5 A;  3RVY A;  3HR0 A;  4HBN A;  3K59 A;  3OMI B;  4FM1 A;  2EBO A;  2HHH B;  4UCV A;  4DR3 O;  5FPO A;  2H94 A;  5GTI Z;  3JAW B;  3VOU A;  1R3K C;  1M56 C;  1XEQ A;  4HYO A;  2DQ3 A;  2DN9 A;  1K9M W;  1HP8 A;  4NXN B;  1LNQ A;  1WA8 A;  5IY5 B;  2A0L A;  2Q0O C;  4OX9 O;  3K5N A;  2CTQ A;  1H8H G;  3N2G B;  3ZX6 A;  1XDC A;  1W0K G;  1WAZ A;  3ZRX A;  4FLX A;  2QWR B;  1ROP A;  4J9Y B;  2JJ1 G;  3J80 N;  5CA3 A;  3X2Q C;  1F7Y A;  2NLJ C;  2UXC O;  4LWS B;  5EIB D;  2BCC H;  5CB4 A;  4LH7 A;  1K3E A;  1S3J A;  5KA6 A;  4DK0 A;  5C8Y A;  2HVJ C;  2EIJ C;  4JI0 B;  2PZS A;  2OT5 A;  5DN6 G;  4AI8 A;  1HR0 B;  2KB1 A;  1GRJ A;  1COW G;  4JV5 O;  4RUE A;  3ML0 A;  3OUS A;  1F4M A;  2FL4 A;  4DR1 O;  3JD1 A;  3T4D A;  1TAE A;  2Z5U A;  1XNR B;  5KA5 A;  4U3F H;  1Q43 A;  3BRC A;  4TQD A;  4DXW A;  4YJ3 A;  4ZHQ A;  3LDE A;  3ETE A;  2LO1 A;  1M56 B;  3F5T A;  4PHZ A;  3TXS A;  1Q6I A;  1SA0 A;  3K9S A;  3RYI A;  2CTR A;  4ZI7 B;  2WA4 A;  4DR5 B;  4GX1 A;  1B6Q A;  1PL0 A;  1Y76 A;  4JAU A;  1AJP A;  1HDJ A;  3E22 A;  4CH5 A;  2GHY A;  2IJK A;  1KEC A;  2K1E A;  5BZB A;  1S5H C;  1J5E O;  1OV9 A;  1K4C C;  1UPG A;  1P7G A;  1RPR A;  4WFA V;  4FZ0 A;  3A0B Z;  4MTF A;  2QWP B;  5CA1 B;  1ARO P;  3CRR A;  4H0L B;  3CPW U;  4JI4 B;  3R66 A;  1YF2 A;  5B5E Z;  4PDM A;  4EFE A;  1IBK O;  3CE2 A;  1H2K A;  1NT2 B;  3ZED A;  3CJH A;  4DW1 A;  2XAJ A;  3JAS A;  2LJ2 A;  1FYJ A;  1H2M A;  4JAA A;  4MVQ A;  2UXN A;  2PF4 E;  3T1Y O;  3VQV A;  2QJ1 A;  1FKA O;  1HNZ O;  5JWP A;  5C93 A;  2DYS C;  1KD1 W;  2CH7 A;  2UUA O;  3G71 V;  1KP2 A;  3JAK B;  4F4L A;  2W6I G;  4DV7 B;  3STZ C;  4J10 A;  4U3J B;  2QTO A;  4B7E A;  4DV5 O;  1H38 A;  1URF A;  2DWD C;  1N36 B;  3NR7 A;  5LP6 B;  1N33 B;  1XHZ A;  2D3O W;  3HKE B;  3RN4 A;  2NR5 A;  3SYP A;  1ORQ C;  1NBM G;  4L8J A;  1Q82 W;  4IYI A;  3CCQ V;  2Q5Z A;  3Q4H B;  2ZE5 A;  3RWR D;  4XDK A;  3B4S A;  2P6J A;  4DV2 B;  4TT3 G;  2P7T C;  2OCC B;  1VF7 A;  2ZDI A;  2L6L A;  2P67 A;  1FFX A;  3BA8 A;  2YXY A;  4B3R B;  1TGO A;  1YTF D;  2E5L O;  1E1Q G;  2X6A A;  1JFF B;  5IE9 A;  5J2U B;  2BOB C;  1R1B A;  3NXS A;  4UCO A;  4MVO A;  4O4J B;  1WN7 A;  4CH3 A;  3F5W C;  1EBO A;  5IJ9 A;  3FB7 C;  2Y69 C;  2P5O A;  2HG5 C;  2Q7E A;  2KG7 A;  4QPJ A;  3K04 A;  2WLI B;  3SPC A;  1QVF U;  4EB6 A;  2JDI G;  2ZM6 O;  2VQF B;  4X1I B;  4LC1 A;  3GB7 C;  4DV5 B;  4BIU A;  2LGQ A;  5JJJ B;  4GZR B;  1VP7 A;  4FFB B;  1GTO A;  3CXC U;  2GUZ A;  1RP3 B;  2HJD A;  3ABM C;  1NU1 H;  4DV4 O;  3IGA C;  4C7U A;  1ENV A;  1JQ0 A;  1U96 A;  3AG4 B;  2FKX A;  4K35 A;  1YHQ V;  3ICX A;  2XHB A;  5L3B A;  4BWA A;  4MW3 A;  4UCU A;  3EFF K;  5LA6 B;  1KMI Z;  1PM9 A;  1KUQ A;  5KUK A;  1VQK V;  2WLL A;  3K5M A;  4UVC A;  4NTY A;  5GW7 A;  1BMF G;  4WFF A;  4R8C A;  3CCS V;  3SPJ A;  1N32 B;  1YIJ V;  3ABK B;  5IT9 N;  3ZBH A;  4N23 A;  2VRZ A;  1PNL A;  3U11 A;  2QWQ B;  1YEW A;  4X1K A;  2BOC C;  3LDC A;  5JQG A;  1XIL A;  2Q69 A;  4ZOL B;  2C2A A;  4I9Q A;  3CMA V;  1B06 A;  1GN4 A;  4MVZ A;  1VQL V;  4GCZ A;  4FM2 A;  4JI4 O;  5ITZ B;  2F66 C;  4FLZ A;  1I7F A;  3W7T A;  1Q8I A;  1QQC A;  1K7D A;  2EIM C;  4I9W A;  3JCU Z;  3STL C;  3D3I A;  4TQF A;  1W59 A;  1OCZ B;  5H6R A;  4UXN A;  3TK1 A;  5E79 Z;  1R6K A;  1EZV H;  1ZSP A;  1F4N A;  1WP8 A;  3D36 C;  1V54 C;  1VIB A;  1VAR A;  3H1L H;  1VQM V;  1W0J G;  3W7X A;  4WBN A;  1QHT A;  4LNU A;  3APO A;  4JAV A;  4MVU A;  1LUW A;  1MSW D;  5JJE B;  2PTM A;  4PI0 A;  1DF5 A;  3UQ8 A;  3ABL B;  2P90 A;  4UCR A;  2M6Y A;  3RYC B;  2QDO A;  4JI2 O;  5JH7 A;  2ZR3 A;  4DR4 O;  2R9R B;  1QLE C;  2QM8 A;  4IIJ B;  2B1I A;  2GV9 A;  1VMG A;  1CPY A;  4DRX B;  4G28 B;  1YCI A;  3KCY A;  1DLB A;  2R9A A;  1Q90 D;  4JI8 B;  1QVG U;  2GDS A;  2YC0 A;  2ZE8 A;  3C90 A;  4BAY A;  3ZHR A;  2GBO A;  4LF4 B;  3AG3 B;  1YSC A;  2G38 A;  1XMQ O;  2AHZ A;  4X64 B;  2UUA B;  1RSO B;  2EZP A;  4ICG A;  4RWU A;  4O4H A;  4DV7 O;  3E89 A;  5BR8 B;  2EJR A;  5EZY B;  1BS3 A;  1NR1 A;  1SES A;  2F1M A;  3TGU H;  2LW1 A;  4JF3 A;  4P2Z A;  2HKO A;  1HW7 A;  3AK1 A;  1RPO A;  1P4R A;  2A79 B;  2Q4P A;  3CCU V;  2CAZ C;  2UXD B;  4HNA A;  4JTD B;  4X20 B;  4P9O A;  3P3N A;  1KKD A;  3CX5 F;  5L3D A;  4XDL A;  3G6E V;  3ABL C;  4EKW A;  2GTS A;  2RMK B;  2XAQ A;  5KHI A;  5KAI Z;  4B3T O;  2XAG A;  4AQY B;  4F6E A;  4O2A A;  2P06 A;  2ETN A;  1LUV A;  5EBW C;  3CCM V;  3TET A;  3B77 A;  3JD4 A;  3M8A A;  1L0N H;  1GMG A;  3IJ4 A;  3CXH F;  3E86 A;  1I5X A;  3E8B A;  4RAI A;  1ZUQ A;  3D8C A;  5IYC O;  2Y69 B;  2Q0A A;  2Q7G A;  3RT3 C;  4TUY A;  4BIO A;  3FB6 C;  2UXB B;  4H44 B;  5B1N A;  4IT5 A;  3N2G A;  1MZE A;  1QBZ A;  4X9Q A;  2WLH A;  4JAS A;  3DXR A;  4CS4 A;  4P9P A;  1VF6 C;  1BGY H;  2Z0A A;  3DSQ A;  1AR1 B;  3M7M X;  5A2Q N;  4PA7 A;  2XAS A;  1XMO O;  4X89 A;  1XI1 A;  5CB4 B;  1Z5V A;  2EIN C;  3UT5 A;  2ZXW B;  3AK2 A;  1SQV H;  2F93 B;  2MK3 A;  4GKJ O;  1JR9 A;  2LQT A;  4J11 A;  4TV8 B;  1FJG B;  3OGI B;  3CP1 A;  5L3E A;  2F43 G;  4JZG A;  3J7A U;  4O4L A;  5KHH A;  2ARH A;  3OEE G;  3QVN A;  4X62 O;  1M57 C;  1M1K W;  1QLN A;  3FD9 A;  1WJZ A;  2UUB O;  3O65 A;  1MG1 A;  1OCO B;  4UFZ A;  1IBL O;  3CC7 V;  4LBE C;  1SET A;  1WP7 A;  5LHH A;  1YI2 V;  4RO2 A;  3H1H H;  4YJ3 B;  1GM9 A;  1MMM A;  1SA0 B;  1AP6 A;  4JYY A;  1H8E G;  1SKV A;  2JS3 A;  4LF7 O;  3RYF B;  4DR6 B;  3UO2 A;  2ZR2 A;  2N04 A;  1AR5 A;  2EIK C;  3SPH A;  1Q3E A;  1N4C A;  2GSM B;  1SS3 A;  2RNB A;  4JI0 O;  3PN1 A;  3OM3 B;  2HHH O;  3K9A A;  1K4D C;  3AK3 A;  2VQE O;  1Y74 A;  1D2D A;  2JGD A;  5A9G A;  3B8M A;  2LFR A;  1GM7 A;  3OT7 A;  1HWY A;  2HFE C;  3MD0 A;  1TVK B;  3ZRW B;  2Y0I A;  3JAL B;  2E76 B;  5LL6 Y;  4R6Z A;  1ZTE A;  1AB3 A;  2V4D A;  4JV5 B;  1NKD A;  3CJH B;  1GH6 A;  5LMN O;  5H9C A;  3WB2 A;  4CS3 A;  1IVS A;  1SQF A;  4E2L A;  1JJ2 U;  4YIO A;  2EJ7 A;  1I08 A;  1PV0 A;  3HKD B;  4TWK A;  2XTA A;  3ZHQ A;  2R9I A;  4Z1V A;  3G67 A;  3DC6 A;  1TA8 A;  4JI8 O;  2XND G;  3JSN A;  1N0J A;  2DE0 X;  4U3J A;  2PY5 A;  3SYC A;  4UCS A;  2UXD O;  1OCZ C;  2EIN B;  3IC7 A;  1R3L C;  3P3P A;  4MW8 A;  1EFR G;  1PKX A;  3RFR A;  1G4Y B;  3N2K B;  4DUY B;  4LF8 O;  1VQ9 V;  3AG2 C;  1YJW V;  3G80 A;  3B8N A;  4BIZ A;  3LSU A;  1NVP B;  3QF7 A;  4W4K A;  1QR8 A;  5EIB C;  2Z3Y A;  4AIL C;  4GKK B;  4UCT A;  2IH1 C;  3JD3 A;  2Y0P A;  1UJW B;  5JCO C;  1FFX B;  4GKJ B;  4MTO A;  3FAV B;  1WPB A;  1T5E A;  1SQP H;  3K5O A;  4I5S A;  3K57 A;  2IU0 A;  2QEX V;  3KKY A;  4PA6 A;  2M7W A;  1F23 A;  1L0L H;  2ITC C;  2W0X A;  3P30 A;  3P32 A;  4NXN O;  3GWK C;  2BE3 A;  2QA4 V;  1MSD A;  4LR3 A;  4KL1 A;  4QE7 A;  5IWA O;  4YJ2 B;  3ZHT A;  1GN6 A;  3J81 N;  3BAA A;  5J2T A;  2X0L A;  3KCX A;  3SJA C;  4I55 A;  2XUM A;  4OPH A;  5LMU O;  3C3T A;  4JI3 O;  5CA0 B;  1PL4 A;  3E2E A;  1EM1 A;  4BW9 A;  2E75 B;  3IFX A;  3SPG A;  3VQY A;  3ZHU A;  4FM0 A;  3CCL V;  2LFS A;  4Q20 A;  2BTQ A;  4FIP C;  3FB8 C;  4DR2 B;  1SQB H;  4JTA B;  3H1J H;  2DMX A;  4JI7 O;  1VQ6 V;  2DYR C;  2AZ2 A;  3AG1 B;  4DR7 B;  5BMV A;  3L75 H;  2R72 A;  2UXC B;  3AG7 A;  4K8Z A;  3BEH A;  3T4Z A;  4YY3 O;  3OW2 U;  2WA3 A;  2QM7 A;  1M93 A;  3GVM A;  2QWO B;  4NR1 A;  1VEW A;  2A9H A;  3CRA A;  1BQZ A;  4JI1 B;  4X1K B;  1RM1 C;  1B3Q A;  4DV1 B;  4GYC B;  1OHH G;  4UUJ C;  1H2S B;  4WFB V;  1Y67 A;  1Q6H A;  3KZI Z;  2HJF C;  3CYO A;  1XMQ B;  4PDL A;  4O4I A;  4BW5 A;  1D5N A;  4B08 A;  5IYZ A;  5JVD A;  2Q67 A;  5FL7 G;  5B66 Z;  2Q8V A;  3BY6 A;  1Q86 W;  2ADQ B;  3HKC A;  1XNR O;  1JJO A;  5LYJ B;  1BHB A;  4DR2 O;  2RQ6 A;  4WFG A;  1M4U A;  5KAF Z;  2ZDI C;  3DGE A;  2Y48 A;  3MHS C;  1N32 O;  4LH6 A;  1QR9 A;  4WBN B;  1G1X B;  3WFV A;  2DW4 A;  4NKG B;  1VQ4 V;  2YIC A;  4R50 A;  2W6J G;  3THO A;  4B3R O;  1Y4M A;  2IJH A;  5KLV H;  4JI7 B;  3WB0 A;  3ZS8 C;  5JH7 B;  5CBF A;  2FB5 A;  1H2L A;  4FPP A;  3RYH A;  2YDE A;  4X66 B;  5GON B;  1R73 A;  1NJI W;  1OCO C;  3K79 A;  5IYD O;  1Y66 A;  2N74 A;  3RW0 A;  1KP3 A;  4DRX A;  3QG5 A;  4DV1 O;  5C8Y B;  3K0D A;  1S0V A;  4DR6 O;  1P84 F;  1OCC B;  5EK0 A;  1CXZ B;  1X59 A;  2MW2 B;  4X88 A;  5IWA B;  4LFA O;  3F7V C;  2B5U A;  3ZMS A;  2ADP A;  5HFL A;  1RSO A;  5EC2 C;  2B1G A;  4O2B A;  2QE7 G;  1S5J A;  5L3F A;  2YIB A;  4PA4 A;  3BAB A;  1ZL8 A;  3CCV V;  5KMG A;  3H1K H;  2WSS G;  4ZHQ B;  4K3A A;  2KKW A;  3RYI B;  3JAM N;  2FML A;  4ZI7 A;  3ABM B;  4X20 A;  3WB1 A;  5EYP B;  2ZCE A;  3SJQ C;  3WG7 B;  1Y76 B;  4D7S A;  1R6T A;  4IL6 Z;  1NS1 A;  2QWN B;  3JD2 A;  4KP4 A;  4WFE A;  2JVD A;  1OJH A;  3AG1 C;  1ZLZ A;  2YEV B;  3K5L A;  3L73 H;  3OTO B;  3CD6 V;  3ZJZ A;  2AXT Z;  2A7W A;  3T1H B;  1YDX A;  2JS5 A;  2WLN A;  4PA3 A;  5EBM C;  5LGU A;  4CBC A;  1N33 O;  2ZXW C;  2ATK C;  2NN4 A;  2V7Q G;  2O57 A;  4NXM O;  4YHH B;  1VQP V;  2YI8 A;  1YTF B;  1XL4 A;  5KX5 B;  1I5Y A;  5FNV A;  4X64 O;  3ZRS A;  4FK5 C;  3A2F A;  2QKC A;  1MAB G;  1R3J C;  4DR4 B;  2CH7 B;  2OCC C;  1HNX B;  1US6 A;  2W0F C;  3A8T A;  2VWK A;  2HP8 A;  1WB8 A;  1DF4 A;  1GN3 A;  3T1H O;  4P30 A;  1S72 V;  1THZ A;  3OMN B;  3W7U A;  1K8A W;  4LCU C;  3ZN1 A;  1N34 O;  3ABK C;  1L8D A;  4L87 A;  2OIE A;  4TV9 B;  4D6T H;  3MAQ A;  5LP6 A;  4QGP A;  4QJF B;  1E79 G;  1WPX A;  3JAT B;  4OPA A;  1G6U A;  3AG3 C;  4I50 A;  5IDJ A;  4J9Z B;  1P7B A;  3AG4 C;  4J41 A;  4LFC O;  5IYB O;  4JGS A;  3JAR A;  1N0N A;  4IHJ B;  2PI4 A;  5DM6 V;  2DJV A;  5BY1 A;  2OYQ A;  2ZE7 A;  2WLM A;  1LR1 A;  2RJZ A;  4D7T A;  1GM8 A;  3SYQ A;  1MA1 A;  3FFQ A;  1TUB A;  4JI2 B;  4MVS A;  1SRY A;  3OGC C;  2PI5 A;  4J7Z A;  1MOF A;  1I94 O;  2HR3 A;  2YID A;  2UUC B;  2CTW A;  3FYI B;  4O4J A;  2IH3 C;  5IJ9 B;  3K0G A;  1Y74 B;  4I4T B;  1KYO F;  1WA8 B;  5JCO A;  4K0K B;  3HPL C;  4QNH B;  1O9H A;  1NTZ H;  3CB2 A;  5B1A C;  3FYE B;  1TUE B;  3ZRW A;  4EB6 B;  4UVA A;  2ZIO A;  1JMK C;  2OWO A;  1VQO V;  4LF9 B;  3OFN G;  3RBZ A;  1SZX A;  4B3S O;  5LMU B;  1XQ8 A;  2GUZ B;  4DR3 B;  1HNW O;  1ZWI C;  2PYJ A;  3VBB A;  4U7O A;  2DOS A;  3HKD A;  2ZNJ A;  1AJN A;  1E1R G;  2EIM B;  4EEQ A;  4DV6 B;  2HVK C;  2ZM6 B;  2VQF O;  1JCH A;  5LGN A;  2Q9L A;  1IBM O;  1O9G A;  2YXL A;  1A32 A;  2UUB B;  2WLL B;  1M5I A;  4FVM A;  4RQE A;  4CZZ A;  4PD4 F;  3HKB B;  3K58 A;  2UXB O;  3E8G A;  4ABM A;  1XL6 A;  5E1A C;  3N2K A;  3M99 B;  1FAF A;  5H2F Z;  2Y4U A;  4DV0 B;  3QO7 A;  2QSA A;  3CME V;  2EIL B;  4I0X A;  5JQG B;  3U10 A;  4F6R A;  4ZOL A;  3DC5 A;  2LP7 A;  3ZHV A;  4GX5 A;  2YS8 A;  3X2Q B;  2IW5 A;  1VF6 A;  4H33 A;  2F4V O;  3E22 B;  2QTS A;  3L74 H;  3CS5 A;  5J9P C;  1WLE A;  3B2E E;  3SDL A;  4J7J A;  5EBL C;  3ZRV A;  5LXT A;  4YIP A;  4AQY O;  2OTL V;  4N21 A;  4PDV A;  1P49 A;  4FLW A;  4W4L A;  1NH2 B;  3ZMT A;  4IGG A;  2XAH A;  1XRE A;  3L9D A;  4UB6 Z;  3OAA G;  1K33 A;  3QO8 A;  4UB8 Z;  3W7W A;  2ZD9 A;  1HNZ B;  4UV9 A;  2AW9 A;  1OCR B;  4YXW G;  3IC9 A;  2ZQM A;  4FMT A;  1NH2 D;  3WU2 Z;  4OXS A;  4GT1 A;  3H9V A;  3K03 A;  3RYC A;  4FLY A;  3EVK A;  3OTF A;  4LF6 B;  3JAK A;  2E5L B;  3CWB H;  3L72 H;  3UKM A;  4B3S B;  5CA0 A;  1BHA A;  2WWW A;  3CRC A;  1SF9 A;  4JYA B;  1WNS A;  2P4K A;  1BT8 A;  4MTX A;  2RDC A;  3HKE A;  3T1C A;  1NTK H;  4FLT A;  3BHP A;  2PUS A;  2KSD A;  1QCE A;  4ZBM A;  1Q5O A;  2QR4 A;  2BTO A;  1FXK A;  2Q7H A;  3Q4H A;  4NB5 A;  5BMV B;  1GKF A;  2F23 A;  1NR7 A;  2JEU A;  5FLX N;  4X8A A;  1KQS U;  5EZY A;  4LF6 O;  2WPD G;  1YJ9 V;  1SER A;  4JI5 B;  1IBK B;  3N27 A;  2EIJ B;  4WF9 V;  4PI2 A;  3SYA A;  3RVZ A;  3CC2 V;  1JFF A;  4J80 A;  3BPZ A;  3DTU B;  3OR6 C;  4O4I B;  1RFY A;  5IYZ B;  4B7K A;  2YXH A;  3FX7 A;  5DEC A;  2CGO A;  3LUT B;  1AI7 A;  1J5E B;  3ASO C;  4IYH A;  5LYJ A;  4PA9 A;  2KG7 B;  5KUM A;  5L3G A;  3L71 H;  3ZIA G;  2WLI A;  5LP6 C;  3CCR V;  5IJ0 B;  3HB3 B;  1IDS A;  2ZIN A;  1BQ0 A;  1R3I C;  3CC4 V;  2BSK B;  2XAF A;  4TOI A;  3KG2 A;  1K73 W;  1JOY A;  1MZF A;  2QKA A;  3MDS A;  5F2V O;  1Q6U A;  4FFB A;  3MHH C;  1Q81 W;  1NTM H;  2JRI A;  1AI5 A;  4X1Y A;  1K34 A;  2PGG A;  2YIA A;  4LFB B;  3B09 A;  2D2C B;  4MS2 A;  1KBH A;  1Q7Y W;  4B3M O;  4DV2 O;  1S77 D;  2X6C A;  2R70 A;  3TXQ A;  4DV0 O;  3RYH B;  4GX0 A;  4J7K A;  4MTG A;  5LA6 A;  4R7C A;  3JCZ A;  1N8R W;  2HLD G;  2ITD C;  3T2M A;  1VQ5 V;  1ZAU A;  2IJJ A;  4OX9 B;  3UT5 B;  3K3W A;  1EN5 A;  2VS0 A;  1SC5 B;  1GAX A;  5LOV A;  5FPR A;  1IX9 A;  4DR1 B;  2RN9 A;  3F7Y C;  1YVW A;  1VF5 B;  2YI9 A;  2ZKO A;  3QNE A;  3OE7 G;  5B1A B;  1I0H A;  1K97 A;  5EC1 C;  4O4L B;  2IBZ H;  1AR4 A;  4DUZ O;  4LFC B;  4O2B B;  2FYU H;  3A0R A;  3CRQ A;  1M9N A;  4NYK A;  5ITZ A;  1ZL8 B;  4B3T B;  5KMG B;  4JYC A;  3QTC A;  3JD0 A;  4AHC A;  4LF9 O;  1OZ0 A;  3I5D A; 
#chains in the Genus database with same CATH homology
 2H3O A;  1WAZ A;  2LJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...