4DV2O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv2O00
1XMOO 4LF8O 4DR1O 2FKXA 1FKAO 4JI3O 4JYAO 2UXCO 1XNRO 4X64O 2LW7A 4JI5O 4LF4O 4DV1O 1N36O 1AB3A 3OTOO 4LF5O 4LFAO 4GKJO 2UU9O 4KHPO 4JI8O 3M8AA 1XNQO 1F7YA 2HHHO 5LMNO 1I94O 2UUAO 4X66O 5H5NA 4B3TO 4LFBO 3F5TA 1KUQA 1N32O 2DJVA 4JI1O 4DR3O 4JI2O 1G1XB 4DR7O 4NXNO 3T1HO 4LF6O 5IWAO 3JAMN 5FLXN 4LFCO 5IT9N 2UXDO 4K0KO 4JI7O 4AQYO 4OX9O 1FYJA 4DR4O 4LF7O 5BR8O 1IBKO 1XMQO 4DV5O 2DOSA 4A5UB 4B3MO 1R1BA 2Z0AA 1A32A 4LF9O 1HR0O 4JV5O 4GKKO 1AILA 2ZM6O 2N74A 3J80N 2E5LO 1HNWO 5A2QN 3T1YO 4JI6O 3J7AU 1XEQA 1X59A 1YZBA 2UUCO 2UXBO 4DUZO 4X65O 5BY1A 4NXMO 1N34O 2JRIA 2AGAA 4JI4O 1HNXO 4DR5O 1DK1A 4B3RO 3RT3C 4DV2O 1FJGO 4YY3O 4OPAA 1IBLO 1N33O 4DV6O 3R66A 5LL6Y 4DR2O 5LMUO 4B3SO 4DV3O 2ZKOA 3SDLA 4DV0O 4DR6O 3J81N 4DUYO 2UUBO 1R6TA 4OPHA 1J5EO 2F4VO 1HNZO 4JI0O 4DV4O 4X62O 1IBMO 2VQEO 1D2DA 5BXZA 1NS1A 2VQFO 3O65A 4DV7O 4YHHO
chains in the Genus database with same CATH superfamily
5EK0A 1VF7A 4CC5A 4EFBA 3B4SA 3RYHA 4I0XA 1RM1B 1G4YB 1PL0A 4IYIA 3L74H 4LF5O 1FXVA 5JJJB 3VQWA 2DQ3A 2CAZC 4LFBO 1N4CA 4JYAB 2ARHA 4MVSA 2IH1C 3SPGA 1K33A 3JAMN 3ZMTA 2W0FC 4JI0B 4FJCC 3ETQA 5L3BA 5A9GA 4DV7B 3W7XA 4FZ0A 4EKWA 5C93A 3JATA 3KZIZ 2YI8A 3OMAB 4X1YA 1WNSA 1NI8A 4LFCB 1PL4A 2R9IA 2Q4PA 1OZ0A 2M7WA 2NN4A 1N0JA 4X20B 1PKXA 1XNQB 4X88A 3T2MA 2D2CB 1HR0B 1JFFA 1GO3F 1N34O 1NTZH 4JI4O 4FLUA 4FFBB 1GTOA 4JI1B 5LYJA 4NVPA 1K34A 1AJQA 4OPAA 4RUEA 5FPOA 1Q81W 1KYOF 4DV6O 3VQVA 3R66A 1JPXA 5BZBA 5LMUO 1YTFB 5K1XA 2HJDA 5LXTB 5J2UB 1KBHA 4UCVA 1VQ9V 1SRYA 2LQTA 1SA0A 2IU0A 4X62O 4HAMA 3DSQA 4ZHQB 2QTSA 3F5WC 4JGSA 1K92A 3P32A 4XDLA 2DYSC 1Q7YW 1K5SA 4QE7A 1AR1B 4DR1O 1NH2D 3GB7C 4WCEV 1F4NA 5IYCO 1R73A 1AB3A 4TQDA 1GM7A 2UU9O 3W7WA 3OMIB 1Q86W 3ZCCA 1CPYA 5IJ9A 3JALB 4G28B 5HFMA 3CJHA 5IYDO 3H01A 3UT5A 4K3AA 2Q8VA 2HLDG 3F5TA 4IIJB 5KHJA 3JYCA 1RM1C 1K4DC 1AJPA 3P30A 1CXZB 3ABMB 4KHPB 2WLHA 4EFEA 3AG7A 4CS4A 3ZJZA 2Q73A 1O9HA 4Z1VA 4JI7O 4B7KA 1XMQO 1NVPD 4OXSA 2R9RB 4YHHB 5H9CA 3IC7A 1CEZA 4JI3B 2AHYA 4UV9A 2N74A 1WB8A 3HPLC 2B1GA 3J80N 1K4CC 1Q8IA 4F6EA 3EHBB 2ZE8A 3CXCU 3T1YO 1B06A 2BOBC 1ZL8A 1OCCB 2YC0A 1KD1W 2UUAB 4NXMO 1RFYA 3SYCA 1KP2A 2Y0IA 4FMTA 5CB4B 4MVMA 3CCVV 3H1JH 1H2SB 4DR5O 1WB7A 2YIBD 1I0HA 3BRCA 1P7BA 4YY3O 2ZQMA 1IBLO 3QF7A 1L1FA 3JARB 2K9PA 4B3SO 5IE9A 4K35A 2ATKC 3SDLA 3QTCA 4E2LA 1XREA 3VQXA 1VF6A 1K8AW 2CDYA 5B3SB 2WLLA 4OPHA 4CH6A 4JV5B 1ZLZA 2AW9A 3IC9A 2JK5C 3BPZA 4QPJA 3K5NA 2DW4A 2HJFC 4J10A 1H8HG 3BA9A 4DUZB 2H94A 2OTLV 2F43G 3SJQC 2DYRB 4EB6A 4K8ZA 1Z2GA 1BL8A 3E22B 4O2BA 4EEQA 1MMMA 4LWSB 3RFRA 2EIMB 4DV0B 1JCHA 2IBZH 2YEVB 3OMNB 4LNUB 3N2GB 3OW2U 2F93B 4PV1B 3CCLV 3JAWA 3WB0A 3CWBH 2VWKA 2L35A 3ABMC 3TGUH 4QIWF 5C8YA 2DN9A 1JOYA 1I5XA 4YJ2B 5LHGA 1TAEA 4LCUC 1AI4A 3CXHF 3L9DA 4UVAA 1M56B 3OEHG 3T4ZA 3E2EA 1S5JA 1B6QA 2F1MA 3RT3C 3SYQA 4JI2B 4F6RA 4PI2A 3BVOA 4DR7B 4FM1A 2A9HA 1OCCC 1VQMV 3G4SV 4R50A 2QEXV 2CTRA 2ZIOA 2YICA 2YUAA 3ETGA 1RPRA 4ICGA 2PF4E 2ZKOA 4TV8B 1U96A 3ZX6A 1QHTA 1JA8A 1MNGA 3KKYA 3E8HA 3X2QB 1SQQH 5D5QA 3LUTB 3LSUA 5IYBO 4O4IA 4WFEA 4O4HA 5B1OA 2R72A 4DO2A 2WLKA 3ABKB 5LGNA 5B3SC 1Y6XA 3G67A 2LW7A 3GWKC 4MVZA 1DTOA 2CGOA 4D6TH 3OTOO 2ZINA 4MVRA 3AG4B 4UCUA 3ZRWB 1J95A 1Q6UA 4F4LA 4D7TA 1H2KA 1WLEA 5JJEB 3IAYA 2L6LA 4PA6A 2ZDIC 1YDXA 3SR2C 1VIBA 1XUQA 2DYRC 5IWAO 5DN6G 1URFA 4K0KO 1ENVA 2LJ2A 1YF2A 1IBMB 1RPOA 2KB1A 2DMXA 1YTFD 4RAIA 2ZDIA 1N32B 2EIMC 1VARA 1XQ8A 3MDSA 2Q5ZA 4RO2A 1L0LH 5IY5B 1BHBA 3T1HB 2KG7A 3B40A 5H6QA 1JX9A 5EZYB 3ZMUA 1PV0A 3OTFA 2AXTZ 1ORQC 4FFKA 2JEUA 3JASB 2YEVA 1HNXO 2NLJC 5E79Z 2E74B 1HNWB 2LGWA 1Y67A 4CBCA 2FL4A 3DGEA 1WJZA 5L3CA 4DR2O 1M56C 2ZXWB 5D5PA 4MTXA 4DV5B 4JYYA 4P9PA 4I9WA 2QWQB 1K9MW 2AHZA 4YIPA 1VQKV 2PUSA 2B5UA 1HNZO 3EXAA 1S76D 1NS1A 2VQFO 1U97A 1JR9A 1OV9A 1MZFA 1Y66A 3UO2A 2PYJA 4PI0A 5KA6A 3ETDA 2H3OA 3CCQV 2ETNA 2QWRB 3QO5A 4UB8Z 4X64O 5LGTA 4LF4O 3E89A 1US6A 4B3RB 3BA8A 3SJAC 1SQVH 4X1IB 4HNAB 3I55V 3TK1A 2ITCC 4B3TO 3JAKB 5CMUA 4GZRB 1THZA 2ZE5A 3CYOA 3QNEA 1S5LZ 2UXNA 2PI5A 4QE9A 5K1PA 2GTSA 4LFAB 3AG4C 1EBOA 2Z3YA 3ASOB 3BABA 2GDSA 1P7GA 4GX1A 3R65A 4BIOA 4GUNA 3JD3A 3RN4A 1VMGA 4L8JA 4QNHB 5GONA 3ZIAG 4J80A 4PDLA 1NQTA 1DLBA 2QWPB 2JDIG 2E5LO 4GKJB 2FYUH 4JI6O 4I50B 5LOVB 3BAAA 1Q82W 2B1IA 5IY5C 1XHXA 1S0VA 2NNUA 4NTXA 1B3QA 2JEXA 1VEWA 4UVCA 2Y4TA 4IT5A 4J9YB 3CSXA 1Y76B 4O4JA 1F4MA 3IGAC 4LF9B 2ZIMA 2Q7HA 2HR3A 3BEHA 2ZXWC 2W0XA 1H38A 1YEWA 2ZNJA 3GWOA 3A0BZ 3Q4HB 1DGSA 2UUBB 1EFRG 5B66Z 3UO3A 2X6AA 4NTWA 4KUMA 1TUBA 3APQA 3TXSA 1MZEA 4ZBMA 2EIJB 3FFQA 4O4LB 1UFIA 1V55B 4R6ZA 4Q6GA 4J9ZB 3CHXA 4DR3O 4ABMA 1YIJV 4FLVA 3RWRD 5B5EZ 5IYZA 2CTWA 1EZVH 3CP1A 3MD0A 4OX9O 2E3CA 3E83A 2PGGA 4DR4O 4I4TB 1FXHA 3SYAA 4B3MO 3CRQA 5B1AC 3ASOC 1A32A 3OEEG 4PA9A 4WFFA 3STLC 3CX5F 4HNAA 3OD4A 5KHGA 2ZM6O 1VQLV 1IZ3A 1ZTEA 5L3DA 4QJFB 2DQ0A 4UCOA 4H0LB 1FXKB 3J7AU 5KHKA 4TSFG 1XEQA 4BIUA 3ZMVA 4BR6A 1X59A 3VBBA 2HHHB 1SQBH 4AI8A 5E1AC 2XAQA 3E8GA 4RWUA 2JRIA 5LP6B 1GN2A 1S5HC 1EN4A 1AI5A 3JD2A 1LNQA 1GK9A 2YIBA 3L75H 3VOUA 2IJHA 3K06A 2WSSG 5IDJA 1AI7A 2GUZB 4I55A 3RYCB 5LL6Y 3C90A 3A8TA 3B09A 4G27B 1R3IC 3E8FA 1SZTA 3K3WA 1WPBA 1QLNA 3B8NA 4LF7B 5BR8B 1IBKB 2XNDG 2BTOA 4TWKA 1HW7A 2R9AA 1R6TA 2KKWA 2IH3C 3ABTA 5JH7B 2F4VO 5KMGB 1EN6A 4JI0O 4TOIA 5LOVA 2V4DA 4P2ZA 5CBFA 1S77D 4DV7O 2WLIA 3SJBC 5FNVB 4FK5C 5CBGA 3MAQA 1SQPH 4DV1O 2Q69A 1JQ0A 5JCOC 3W7TA 4FVMA 3CS5A 3M8AA 1SKVA 1XNQO 3G6EV 1D5NA 3LDEA 3FX7A 4DR1B 5LBQA 2GBOA 1DF5A 3G80A 1WP8A 4JI1O 3LNMB 5KX5A 5JCOA 5JQGB 2EIJC 5DEDA 3WG7B 1V55C 1K7DA 2RNBA 3EFFK 2UXDO 4RQEA 3QVNA 1NTMH 1FAFA 1MSDA 4DYLA 4RUFA 5ITZB 4U3JB 4DW0A 3K5LA 4A5UB 4LF8B 2Z0AA 3IJ4A 1K97A 2EINB 3P3NA 1AILA 4W4KA 1VQOV 4JI7B 2YXHA 2ADQB 3OFNG 1XMQB 2F23A 3OAAG 4CS3A 3K5OA 1KU9A 1JJOA 3CD6V 2JS5A 1XL4A 2MK3A 1FXKC 4ZOLB 2OCHA 3WU2Z 5JWPA 4AQYB 5LP6C 2HVKC 3OT7A 2OIEA 4DR5B 4JTAB 2IJJA 4PDVA 1FXKA 2N05A 2ZE6A 2ZNIA 4YHHO 5LP6A 1K3EA 4B3SB 2BSKB 2JJ2G 3H9VA 4JPRA 3JSNA 3L72H 3K79A 4JI3O 4NKGB 4JI5O 4Z2WA 3SPJA 5IJ0B 4GT1A 3G6BA 2R70A 1YCIA 3UKMA 2JVDA 4U7OA 4X20A 1KC8W 2UUAO 2QM8A 5H5NA 5LA6B 2LFSA 1ZUQA 1N33B 2CTPA 1T5EA 3RW0A 4FFBA 3CCEV 4DR6B 3CC2V 4WF9V 2A0LA 2P67A 3CEIA 5FLXN 2ITDC 2VQEB 4NYKA 5J9PC 3E8BA 1P49A 2NR5A 5LXTA 5J2UA 4CC6A 1ZAUA 4B7EA 1E79G 2ZD9A 3WG7C 4JV5O 5L3GA 3PN1A 1NJIW 2ZR2A 4PA3A 4ZHQA 2WA4A 1QCEA 4PDMA 4TV9B 5CN0A 5J2TB 2EIKB 3ZBHA 1H2MA 2BTQB 1M4UA 4X66B 2UUCO 4DUZO 2CH7B 1SESA 4NR1A 1M5IA 1W2BU 2ILMA 2IM9A 3JALA 3HB3B 3K9SA 1LUWA 4IGGA 2EILB 1M9NA 4IIJA 3CCMV 1NKDA 4DV3O 4Z1MG 4DV0O 1COWG 2O57A 2MW2B 1SC5B 3LSSA 4GKKB 1QQCA 2AZ0A 3HKCB 2M6YA 2LGQA 2Y69B 5EYPB 4J7JA 1SETA 3WB2A 1FFXB 2UXCO 3RYFB 4FPPA 1PNKA 5B1NA 1KKDA 3ZMSA 1L0NH 1BS3A 2QR4A 3CB2A 2GHYA 4ZKIA 2Z5UA 2N04A 5CA1B 4ZI7B 3LSQA 2Q6AA 4JI2O 5CB4A 4JAVA 3FYEB 1G1XB 4DR7O 4BAYA 1PP9H 2KQXA 3UQ8A 3OGIB 1PNMA 4DV4B 3JARA 3DXRB 2AZ2A 1WN7A 2WPDG 2F95B 4JYBA 5CBHA 1VQ5V 4X1KB 2W6IG 4JASA 4JZ2A 3CCUV 1V9PA 1SS3A 3AG1B 5IWAB 2V7QG 2A06H 4K0KB 3APOA 4YXWG 3KCXA 4JI8B 5B1BB 3ZN1A 3W7SA 2WA3A 3S3WA 2UXBO 2A3QA 4PDRA 1BT8A 2WLJA 2EZOA 1KQSU 2D3OW 5L3FA 1OCRB 2YI9A 4TUYB 1OCOB 2QGNA 3DC6A 3K9AA 2EIKC 1ZSPA 3FAVB 2Q7GA 3E22A 3K08A 4LBEC 2Q9LA 3D3QA 3N2KB 1HNXB 4LWSA 2EX3A 1J5EO 2IU3A 4FM2A 5J2TA 1IBMO 2EILC 1D2DA 4LNUA 3N2GA 2CK3G 4DR2B 2P4VA 2ODMA 2ADPA 5KAFZ 5AG2A 4PJ0Z 2Q0OC 2QKCA 1P84F 4JYCA 4YJ2A 3TXQA 1XL6A 2PY5A 2CTQA 2VQFB 4ZIBA 4MTFA 2Y69C 2HKOA 4I7ZB 5LMNO 2RCVA 4H33A 2H8PC 4GX0A 3A2FA 2XAHA 1NBMG 1KUQA 4X64B 1QBZA 3OR7C 4LF4B 3L73H 3N27A 2QDOA 1YHQV 5CA0B 3CCRV 3X2QC 3FYIB 1KMIZ 3RYIB 5EYPA 4JTDB 5GW7A 4UVBA 3OUSA 3B2EE 2QWOB 1N8RW 4DV5O 1JMKC 3AEIA 2X6CA 1XMOB 3RYHB 4TV8A 3ABKC 2CUGA 5LHIA 1R6NA 3ASNB 1XI1A 1DF4A 1XNRB 3GVMA 2Q7EA 4MVQA 2GTAA 3CCJV 1N36B 1AJNA 2YIDA 1P4RA 3CMEV 1GM8A 5CA1A 1Q6IA 4ZI7A 1GN3A 3ZS8C 1Y74B 2JGDB 1I94B 1YZBA 2YDEA 4CH5A 2IJIA 3AG1C 1QVGU 3AK2A 2IW5A 4B3RO 2E5LB 3ZRWA 4QGPA 1BMFG 1PD3A 4NXNB 5B1BC 2EJ7A 5TISZ 1H2LA 1K73W 2XUMA 3JATB 1OCRC 4DUYO 5KUMA 4PA7A 1SQFA 3ETEA 2LFRA 1JJ2U 4WBNB 3O65A 3CPWU 1IDSA 1XOUA 4NTYA 4CH3A 3U0ZA 4TUYA 1JFFB 1K5QA 4MTOA 5GTIZ 2DWEC 4RQFA 3ZHRA 1QR8A 5LYJB 5F2VO 1QLEB 4GKJO 5EZYA 3K58A 1YXBA 4DV2B 1FJGB 1VQ7V 1F7YA 4FM0A 2HEPA 3JSLA 1W0JG 2DE0X 4X89A 3D8CA 3JASA 2QM4A 1YSCA 3D3IA 1IXMA 2Y0PA 4G2KA 5HFLA 4P30A 3U11A 4LF6O 3OUFA 2OWOA 3K0GA 2X6BA 1M57B 4FLXA 1SQGA 3SYPA 1S3JA 5EBWC 2FMLA 3OE7G 4LF9O 3JD1A 3I5DA 1GMGA 2RDCA 2OYQA 3BHPA 4H37A 4LF5B 5L3EA 5IJ9B 1SERA 4DR4B 3DTUB 1SZXA 4JF3A 3CRCA 3UT5B 2F66C 4B3MB 2DWDC 4LFBB 4H44B 4X65O 4UCTA 3RYIA 2LP7A 1NT2B 2X7RB 5LHHA 1Q43A 3HKDB 5KHIA 4KL1A 1VQPV 1Z5VA 4X1IA 3ZRVA 4NB5A 2VWJA 4BIZA 3JAKA 2OT5A 1ROPA 3ZHTA 3J81N 1AP5A 1BGYH 1D5AA 2QE7G 4XDJA 1Y74A 2JGDA 2JJ1G 1VQ4V 5EC2C 1F23A 5KLVH 1IX9A 1ZL8B 1TVKB 1MA1A 1X4TA 3E86A 1I08A 4JYAO 4DK0A 2HG5C 2XAFA 2F4VB 1N34B 3DC5A 2JIZG 2V1DA 3L70H 4JI4B 3ABLB 3AG3B 1OJHA 1GN4A 4QPKA 2HHHO 3AG2B 4B08A 4I50A 4UUJC 2XASA 3ZHUA 4UV8A 4DV6B 4FZ1A 1BQ0A 4KFMA 4IL6Z 5LMUB 4DV1B 4KP4A 4MT8A 1QLEC 1AR4A 5FL7G 4WBNA 3K03A 1N0NA 4DK1A 2WLLB 2QSAA 3ZHQA 4LFCO 1PPJH 1MG1A 1I5YA 2P06A 1KP3A 1WA8B 5EBLC 2OIGA 4X62B 2VRZA 4LF7O 4O2AB 5BR8O 1IBKO 3H1LH 2QTOA 1WP7A 1Y76A 3K04A 4KXRA 5EIBD 1GKFA 3S3XA 3VQYA 1HR0O 2QWNB 2C2AA 4IHJB 2UXDB 1M57C 2VS0A 3UCSC 2QKSA 5A2QN 2UU9B 4EB6B 2YSUB 4J7ZA 4D7SA 4O2BB 3Q4HA 4GCZA 2B9ZA 4UB6Z 2AGAA 1OHHG 4U3FH 2ZT9B 3QO8A 4UCRA 3FD9A 3FB5C 4UFZA 4O4LA 1MOFA 2PTMA 3JAWB 4X8AA 4L87A 4Q20A 2BE3A 4HZ3A 4R8CA 1H2NA 2HVJC 3CC4V 1H8EG 4BW5A 5C8YB 1WPXA 2P5OA 4MVOA 1UPGA 3ML0A 4MS2A 1IXBA 4I4TA 4LF8O 3T1YB 4MVUA 3HKDA 1ZX3A 1FKAO 3JD4A 2WWWA 1KKCA 1QR9A 2RMKB 4NXMB 4YIOA 2LW1A 2E75B 4F6RB 4KHPO 2EJRA 5KHHA 2XOKG 3CRMA 3UM7A 4LC1A 1YVWA 4YY3B 1MABG 1IBLB 3WB1A 1W0KG 2X0LA 1BCCH 4DRXB 4JI5B 4CS2A 3M7MX 4XBFA 3ABLC 2WLMA 1KB9F 3AG3C 3AG2C 4LH7A 1TVKA 2GUZA 5IT9N 4O4IB 1B04A 3FKSG 4J41A 4C7UA 3RYCA 4XDKA 4AQYO 4O4HB 1AI6A 2QJ1A 2BCCH 3D36C 2QKAA 1VF6C 3K5MA 3PJSK 4P9OA 4FLWA 5LGUA 1V54B 2RJZA 2E76B 5JH7A 4X9QA 4TT3G 5KMGA 5H6RA 1I7FA 3TJTA 2EBOA 3B8MA 4PA4A 3OR6C 3QG5A 3D36A 1NR7A 1Q6HA 4GX2A 5FNVA 1AVMA 3SJCC 5BY1A 3E35A 4WFAV 1GAXA 1Q90D 1GH6A 2CE4A 2YIAA 4OGQB 1WA8A 3NR7A 4O2AA 4BWAA 1YJWV 1N33O 1G6UA 2XAJA 2UUCB 2CGNA 4IHJA 3HKEB 4DR6O 3L71H 2EINC 5JQGA 2LO1A 3A0HZ 2KG7B 2VQEO 3JD0A 3U10A 5ITZA 1EN5A 4U3JA 3I56V 3EVKA 4WFBV 4DV3B 3TETA 3ZN0A 2P6JA 2YXYA 1R3LC 3K57A 4X66O 3QO7A 1XHZA 2UXCB 2BOCC 1CP9A 4HYOA 1YJ9V 4BW9A 1AP6A 3CMAV 1QVFU 1BE3H 1AROP 4ZOLA 4YJ3B 1H2GA 5DM6V 2P4KA 1E1RG 2OTJV 2Q0AA 2DOSA 1Q5OA 4CH4A 3BCCH 1R1BA 3CRAA 3AK3A 4MW3A 1SF9A 4GKKO 3SGIA 2Y48A 1QNMA 1O9GA 3OTOB 5EC1C 2PYLA 4DRXA 5DECA 1KECA 5BMVB 4AHCA 2BSKA 2YS8A 4N21A 3ZEDA 3RBZA 1V54C 1S72V 5IJ0A 1ZWIC 3W7UA 4ASUG 4FLZA 3F7VC 3IFXA 1TUEB 5LA6A 1TA8A 1Z5WA 2XAGA 2UXBB 5KA5A 1AR5A 3KG2A 4PHZA 5GONB 1PNLA 4JAAA 4E4EA 1R3JC 4U7NA 3B77A 2GV9A 3C3SA 2XTAA 5KUKA 1G8MA 4DV4O 1NU1H 3P3PA 5BXZA 3LDDA 4UCSA 3A0RA 3K0DA 5EBMC 1PM9A 3FB8C 2FKXA 4DXWA 1J5EB 3CRRA 2UXXA 1YITV 3JCUZ 2A79B 3T1CA 4JI8O 1VP7A 3RVZA 2IJKA 1NZ6A 3ABUA 3HKEA 3SPHA 4MW8A 4TV9A 3H1HH 4K8XA 2GSMB 2BTQA 1BSMA 1TGOA 4IYHA 4FIPC 2CH7A 2DJVA 4MTGA 1UJWB 1N32O 4O4JB 4JAUA 2ZR3A 5KAIZ 1BZKA 3T1HO 5JJNB 5LMNB 1HNZB 1FPOA 1RSOB 4J7KA 3G71V 5JVDB 1NH2B 1VQ8V 2A7WA 3STZC 2PZSA 4GX5A 3HKBB 3ICXA 1XBLA 1E1QG 1TUBB 3CCSV 1HNWO 3HKCA 2P22C 2EULA 3MHHC 3FB6C 1FFXA 1M1KW 4I5SA 4B3TB 4PELA 4FLYA 4AILC 2Q68A 3RYFA 1OCZB 4HBNA 1Y4MA 4N23A 3RGBA 3RVYA 4YJ3A 4TQFA 1IVSA 3SPIA 5H2FZ 2OCCB 4I0XB 5IYZB 4J42A 1FS0G 2EZPA 4LR3A 3SYOA 4JTCB 3AK1A 1NVPB 1W59A 3H1KH 2WLNA 2FTKA 2XHBA 2YXLA 1RP3B 2Q67A 3OGCC 5BMVA 1EM1A 2JGUA 1R6KA 2ZE7A 4GYCB 3SPCA 1HWYA 1VQNV 4CZZA 2RN9A 3C3TA 1XMOO 3DXRA 3O9OA 4JI6B 5B1AB 1NR1A 1FD9A 2HP8A 3M99B 4DUYB 1XNRO 4X1KA 1YJNV 2QA4V 1F51A 1N36O 2K1EA 4J11A 4LFAO 4R7CA 3H1IH 4GLXA 1GM9A 2RQ6A 2P7TC 2P90A 1OCOC 1XDCA 3MHSC 5GTHZ 4X1YB 4I55B 1I94O 1HP8A 4UXNA 1M90W 1BHAA 3ZHSA 4DW1A 3CC7V 5EIBC 3THOA 3JCZA 3TCUA 1YI2V 1QU7A 3FB7C 3BY6A 3KCYA 3ZRXA 2Y4UA 4NXNO 1M93A 2JS3A 1SQXH 3HR0A 4W4LA 2XT9A 3FAVA 1IURA 1FYJA 4WFGA 1MSWD 2ZCEA 2WLIB 2PI4A 1NTKH 3LDCA 2QM7A 1GN6A 3N2KA 1LUVA 4JZGA 4MSWC 1VF5B 4LF6B 1L8DA 2WAMA 5CA3A 3CE2A 1LR1A 1SA0B 3ZHVA 2W6JG 3F7YC 1R3KC 3ZRSA 3BFRA 5KX5B 4FLTA 1DK1A 4DR3B 1RSOA 4DV2O 1FJGO 4H13B 2G38A 4PD4F 3K59A 2KSDA 5JVDA 1BQZA 4LP8A 1FFTB 3OM3B 4I9QA 1GRJA 2HFEC 3HKBA 1OCZC 4OX9B 1JVMA 3ZMZA 5FPRA 3NXSA 4X65B 4LH6A 1VQ6V 2DYSB 3CJHB 2UUBO 1XILA 5CA0A 2OCCC 3ASNC 1EZJA 1Q3EA 3WFVA 3T4DA 3LNNA 4WFHA 2ZM6B 1WAZA 1HDJA 2FB5A
chains in the Genus database with same CATH topology
1XMOO 4LF8O 4DR1O 2FKXA 1FKAO 4JI3O 4JYAO 2UXCO 1XNRO 4X64O 2LW7A 4JI5O 4LF4O 4DV1O 1N36O 1AB3A 3OTOO 4LF5O 4LFAO 4GKJO 2UU9O 4KHPO 4JI8O 3M8AA 1XNQO 1F7YA 2HHHO 5LMNO 1I94O 2UUAO 4X66O 5H5NA 4B3TO 4LFBO 3F5TA 1KUQA 1N32O 2DJVA 4JI1O 4DR3O 4JI2O 1G1XB 4DR7O 4NXNO 3T1HO 4LF6O 5IWAO 3JAMN 5FLXN 4LFCO 5IT9N 2UXDO 4K0KO 4JI7O 4AQYO 4OX9O 1FYJA 4DR4O 4LF7O 5BR8O 1IBKO 1XMQO 4DV5O 2DOSA 4A5UB 4B3MO 1R1BA 2Z0AA 1A32A 4LF9O 1HR0O 4JV5O 4GKKO 1AILA 2ZM6O 2N74A 3J80N 2E5LO 1HNWO 5A2QN 3T1YO 4JI6O 3J7AU 1XEQA 1X59A 1YZBA 2UUCO 2UXBO 4DUZO 4X65O 5BY1A 4NXMO 1N34O 2JRIA 2AGAA 4JI4O 1HNXO 4DR5O 1DK1A 4B3RO 3RT3C 4DV2O 1FJGO 4YY3O 4OPAA 1IBLO 1N33O 4DV6O 3R66A 5LL6Y 4DR2O 5LMUO 4B3SO 4DV3O 2ZKOA 3SDLA 4DV0O 4DR6O 3J81N 4DUYO 2UUBO 1R6TA 4OPHA 1J5EO 2F4VO 1HNZO 4JI0O 4DV4O 4X62O 1IBMO 2VQEO 1D2DA 5BXZA 1NS1A 2VQFO 3O65A 4DV7O 4YHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO O;  4LF8 O;  4DR1 O;  2FKX A;  1FKA O;  4JI3 O;  4JYA O;  2UXC O;  1XNR O;  4X64 O;  2LW7 A;  4JI5 O;  4LF4 O;  4DV1 O;  1N36 O;  1AB3 A;  3OTO O;  4LF5 O;  4LFA O;  4GKJ O;  2UU9 O;  4KHP O;  4JI8 O;  3M8A A;  1XNQ O;  1F7Y A;  2HHH O;  5LMN O;  1I94 O;  2UUA O;  4X66 O;  5H5N A;  4B3T O;  4LFB O;  3F5T A;  1KUQ A;  1N32 O;  2DJV A;  4JI1 O;  4DR3 O;  4JI2 O;  1G1X B;  4DR7 O;  4NXN O;  3T1H O;  4LF6 O;  5IWA O;  3JAM N;  5FLX N;  4LFC O;  5IT9 N;  2UXD O;  4K0K O;  4JI7 O;  4AQY O;  4OX9 O;  1FYJ A;  4DR4 O;  4LF7 O;  5BR8 O;  1IBK O;  1XMQ O;  4DV5 O;  2DOS A;  4A5U B;  4B3M O;  1R1B A;  2Z0A A;  1A32 A;  4LF9 O;  1HR0 O;  4JV5 O;  4GKK O;  1AIL A;  2ZM6 O;  2N74 A;  3J80 N;  2E5L O;  1HNW O;  5A2Q N;  3T1Y O;  4JI6 O;  3J7A U;  1XEQ A;  1X59 A;  1YZB A;  2UUC O;  2UXB O;  4DUZ O;  4X65 O;  5BY1 A;  4NXM O;  1N34 O;  2JRI A;  2AGA A;  4JI4 O;  1HNX O;  4DR5 O;  1DK1 A;  4B3R O;  3RT3 C;  4DV2 O;  1FJG O;  4YY3 O;  4OPA A;  1IBL O;  1N33 O;  4DV6 O;  3R66 A;  5LL6 Y;  4DR2 O;  5LMU O;  4B3S O;  4DV3 O;  2ZKO A;  3SDL A;  4DV0 O;  4DR6 O;  3J81 N;  4DUY O;  2UUB O;  1R6T A;  4OPH A;  1J5E O;  2F4V O;  1HNZ O;  4JI0 O;  4DV4 O;  4X62 O;  1IBM O;  2VQE O;  1D2D A;  5BXZ A;  1NS1 A;  2VQF O;  3O65 A;  4DV7 O;  4YHH O; 
#chains in the Genus database with same CATH topology
 5EK0 A;  1VF7 A;  4CC5 A;  4EFB A;  3B4S A;  3RYH A;  4I0X A;  1RM1 B;  1G4Y B;  1PL0 A;  4IYI A;  3L74 H;  4LF5 O;  1FXV A;  5JJJ B;  3VQW A;  2DQ3 A;  2CAZ C;  4LFB O;  1N4C A;  4JYA B;  2ARH A;  4MVS A;  2IH1 C;  3SPG A;  1K33 A;  3JAM N;  3ZMT A;  2W0F C;  4JI0 B;  4FJC C;  3ETQ A;  5L3B A;  5A9G A;  4DV7 B;  3W7X A;  4FZ0 A;  4EKW A;  5C93 A;  3JAT A;  3KZI Z;  2YI8 A;  3OMA B;  4X1Y A;  1WNS A;  1NI8 A;  4LFC B;  1PL4 A;  2R9I A;  2Q4P A;  1OZ0 A;  2M7W A;  2NN4 A;  1N0J A;  4X20 B;  1PKX A;  1XNQ B;  4X88 A;  3T2M A;  2D2C B;  1HR0 B;  1JFF A;  1GO3 F;  1N34 O;  1NTZ H;  4JI4 O;  4FLU A;  4FFB B;  1GTO A;  4JI1 B;  5LYJ A;  4NVP A;  1K34 A;  1AJQ A;  4OPA A;  4RUE A;  5FPO A;  1Q81 W;  1KYO F;  4DV6 O;  3VQV A;  3R66 A;  1JPX A;  5BZB A;  5LMU O;  1YTF B;  5K1X A;  2HJD A;  5LXT B;  5J2U B;  1KBH A;  4UCV A;  1VQ9 V;  1SRY A;  2LQT A;  1SA0 A;  2IU0 A;  4X62 O;  4HAM A;  3DSQ A;  4ZHQ B;  2QTS A;  3F5W C;  4JGS A;  1K92 A;  3P32 A;  4XDL A;  2DYS C;  1Q7Y W;  1K5S A;  4QE7 A;  1AR1 B;  4DR1 O;  1NH2 D;  3GB7 C;  4WCE V;  1F4N A;  5IYC O;  1R73 A;  1AB3 A;  4TQD A;  1GM7 A;  2UU9 O;  3W7W A;  3OMI B;  1Q86 W;  3ZCC A;  1CPY A;  5IJ9 A;  3JAL B;  4G28 B;  5HFM A;  3CJH A;  5IYD O;  3H01 A;  3UT5 A;  4K3A A;  2Q8V A;  2HLD G;  3F5T A;  4IIJ B;  5KHJ A;  3JYC A;  1RM1 C;  1K4D C;  1AJP A;  3P30 A;  1CXZ B;  3ABM B;  4KHP B;  2WLH A;  4EFE A;  3AG7 A;  4CS4 A;  3ZJZ A;  2Q73 A;  1O9H A;  4Z1V A;  4JI7 O;  4B7K A;  1XMQ O;  1NVP D;  4OXS A;  2R9R B;  4YHH B;  5H9C A;  3IC7 A;  1CEZ A;  4JI3 B;  2AHY A;  4UV9 A;  2N74 A;  1WB8 A;  3HPL C;  2B1G A;  3J80 N;  1K4C C;  1Q8I A;  4F6E A;  3EHB B;  2ZE8 A;  3CXC U;  3T1Y O;  1B06 A;  2BOB C;  1ZL8 A;  1OCC B;  2YC0 A;  1KD1 W;  2UUA B;  4NXM O;  1RFY A;  3SYC A;  1KP2 A;  2Y0I A;  4FMT A;  5CB4 B;  4MVM A;  3CCV V;  3H1J H;  1H2S B;  4DR5 O;  1WB7 A;  2YIB D;  1I0H A;  3BRC A;  1P7B A;  4YY3 O;  2ZQM A;  1IBL O;  3QF7 A;  1L1F A;  3JAR B;  2K9P A;  4B3S O;  5IE9 A;  4K35 A;  2ATK C;  3SDL A;  3QTC A;  4E2L A;  1XRE A;  3VQX A;  1VF6 A;  1K8A W;  2CDY A;  5B3S B;  2WLL A;  4OPH A;  4CH6 A;  4JV5 B;  1ZLZ A;  2AW9 A;  3IC9 A;  2JK5 C;  3BPZ A;  4QPJ A;  3K5N A;  2DW4 A;  2HJF C;  4J10 A;  1H8H G;  3BA9 A;  4DUZ B;  2H94 A;  2OTL V;  2F43 G;  3SJQ C;  2DYR B;  4EB6 A;  4K8Z A;  1Z2G A;  1BL8 A;  3E22 B;  4O2B A;  4EEQ A;  1MMM A;  4LWS B;  3RFR A;  2EIM B;  4DV0 B;  1JCH A;  2IBZ H;  2YEV B;  3OMN B;  4LNU B;  3N2G B;  3OW2 U;  2F93 B;  4PV1 B;  3CCL V;  3JAW A;  3WB0 A;  3CWB H;  2VWK A;  2L35 A;  3ABM C;  3TGU H;  4QIW F;  5C8Y A;  2DN9 A;  1JOY A;  1I5X A;  4YJ2 B;  5LHG A;  1TAE A;  4LCU C;  1AI4 A;  3CXH F;  3L9D A;  4UVA A;  1M56 B;  3OEH G;  3T4Z A;  3E2E A;  1S5J A;  1B6Q A;  2F1M A;  3RT3 C;  3SYQ A;  4JI2 B;  4F6R A;  4PI2 A;  3BVO A;  4DR7 B;  4FM1 A;  2A9H A;  1OCC C;  1VQM V;  3G4S V;  4R50 A;  2QEX V;  2CTR A;  2ZIO A;  2YIC A;  2YUA A;  3ETG A;  1RPR A;  4ICG A;  2PF4 E;  2ZKO A;  4TV8 B;  1U96 A;  3ZX6 A;  1QHT A;  1JA8 A;  1MNG A;  3KKY A;  3E8H A;  3X2Q B;  1SQQ H;  5D5Q A;  3LUT B;  3LSU A;  5IYB O;  4O4I A;  4WFE A;  4O4H A;  5B1O A;  2R72 A;  4DO2 A;  2WLK A;  3ABK B;  5LGN A;  5B3S C;  1Y6X A;  3G67 A;  2LW7 A;  3GWK C;  4MVZ A;  1DTO A;  2CGO A;  4D6T H;  3OTO O;  2ZIN A;  4MVR A;  3AG4 B;  4UCU A;  3ZRW B;  1J95 A;  1Q6U A;  4F4L A;  4D7T A;  1H2K A;  1WLE A;  5JJE B;  3IAY A;  2L6L A;  4PA6 A;  2ZDI C;  1YDX A;  3SR2 C;  1VIB A;  1XUQ A;  2DYR C;  5IWA O;  5DN6 G;  1URF A;  4K0K O;  1ENV A;  2LJ2 A;  1YF2 A;  1IBM B;  1RPO A;  2KB1 A;  2DMX A;  1YTF D;  4RAI A;  2ZDI A;  1N32 B;  2EIM C;  1VAR A;  1XQ8 A;  3MDS A;  2Q5Z A;  4RO2 A;  1L0L H;  5IY5 B;  1BHB A;  3T1H B;  2KG7 A;  3B40 A;  5H6Q A;  1JX9 A;  5EZY B;  3ZMU A;  1PV0 A;  3OTF A;  2AXT Z;  1ORQ C;  4FFK A;  2JEU A;  3JAS B;  2YEV A;  1HNX O;  2NLJ C;  5E79 Z;  2E74 B;  1HNW B;  2LGW A;  1Y67 A;  4CBC A;  2FL4 A;  3DGE A;  1WJZ A;  5L3C A;  4DR2 O;  1M56 C;  2ZXW B;  5D5P A;  4MTX A;  4DV5 B;  4JYY A;  4P9P A;  4I9W A;  2QWQ B;  1K9M W;  2AHZ A;  4YIP A;  1VQK V;  2PUS A;  2B5U A;  1HNZ O;  3EXA A;  1S76 D;  1NS1 A;  2VQF O;  1U97 A;  1JR9 A;  1OV9 A;  1MZF A;  1Y66 A;  3UO2 A;  2PYJ A;  4PI0 A;  5KA6 A;  3ETD A;  2H3O A;  3CCQ V;  2ETN A;  2QWR B;  3QO5 A;  4UB8 Z;  4X64 O;  5LGT A;  4LF4 O;  3E89 A;  1US6 A;  4B3R B;  3BA8 A;  3SJA C;  1SQV H;  4X1I B;  4HNA B;  3I55 V;  3TK1 A;  2ITC C;  4B3T O;  3JAK B;  5CMU A;  4GZR B;  1THZ A;  2ZE5 A;  3CYO A;  3QNE A;  1S5L Z;  2UXN A;  2PI5 A;  4QE9 A;  5K1P A;  2GTS A;  4LFA B;  3AG4 C;  1EBO A;  2Z3Y A;  3ASO B;  3BAB A;  2GDS A;  1P7G A;  4GX1 A;  3R65 A;  4BIO A;  4GUN A;  3JD3 A;  3RN4 A;  1VMG A;  4L8J A;  4QNH B;  5GON A;  3ZIA G;  4J80 A;  4PDL A;  1NQT A;  1DLB A;  2QWP B;  2JDI G;  2E5L O;  4GKJ B;  2FYU H;  4JI6 O;  4I50 B;  5LOV B;  3BAA A;  1Q82 W;  2B1I A;  5IY5 C;  1XHX A;  1S0V A;  2NNU A;  4NTX A;  1B3Q A;  2JEX A;  1VEW A;  4UVC A;  2Y4T A;  4IT5 A;  4J9Y B;  3CSX A;  1Y76 B;  4O4J A;  1F4M A;  3IGA C;  4LF9 B;  2ZIM A;  2Q7H A;  2HR3 A;  3BEH A;  2ZXW C;  2W0X A;  1H38 A;  1YEW A;  2ZNJ A;  3GWO A;  3A0B Z;  3Q4H B;  1DGS A;  2UUB B;  1EFR G;  5B66 Z;  3UO3 A;  2X6A A;  4NTW A;  4KUM A;  1TUB A;  3APQ A;  3TXS A;  1MZE A;  4ZBM A;  2EIJ B;  3FFQ A;  4O4L B;  1UFI A;  1V55 B;  4R6Z A;  4Q6G A;  4J9Z B;  3CHX A;  4DR3 O;  4ABM A;  1YIJ V;  4FLV A;  3RWR D;  5B5E Z;  5IYZ A;  2CTW A;  1EZV H;  3CP1 A;  3MD0 A;  4OX9 O;  2E3C A;  3E83 A;  2PGG A;  4DR4 O;  4I4T B;  1FXH A;  3SYA A;  4B3M O;  3CRQ A;  5B1A C;  3ASO C;  1A32 A;  3OEE G;  4PA9 A;  4WFF A;  3STL C;  3CX5 F;  4HNA A;  3OD4 A;  5KHG A;  2ZM6 O;  1VQL V;  1IZ3 A;  1ZTE A;  5L3D A;  4QJF B;  2DQ0 A;  4UCO A;  4H0L B;  1FXK B;  3J7A U;  5KHK A;  4TSF G;  1XEQ A;  4BIU A;  3ZMV A;  4BR6 A;  1X59 A;  3VBB A;  2HHH B;  1SQB H;  4AI8 A;  5E1A C;  2XAQ A;  3E8G A;  4RWU A;  2JRI A;  5LP6 B;  1GN2 A;  1S5H C;  1EN4 A;  1AI5 A;  3JD2 A;  1LNQ A;  1GK9 A;  2YIB A;  3L75 H;  3VOU A;  2IJH A;  3K06 A;  2WSS G;  5IDJ A;  1AI7 A;  2GUZ B;  4I55 A;  3RYC B;  5LL6 Y;  3C90 A;  3A8T A;  3B09 A;  4G27 B;  1R3I C;  3E8F A;  1SZT A;  3K3W A;  1WPB A;  1QLN A;  3B8N A;  4LF7 B;  5BR8 B;  1IBK B;  2XND G;  2BTO A;  4TWK A;  1HW7 A;  2R9A A;  1R6T A;  2KKW A;  2IH3 C;  3ABT A;  5JH7 B;  2F4V O;  5KMG B;  1EN6 A;  4JI0 O;  4TOI A;  5LOV A;  2V4D A;  4P2Z A;  5CBF A;  1S77 D;  4DV7 O;  2WLI A;  3SJB C;  5FNV B;  4FK5 C;  5CBG A;  3MAQ A;  1SQP H;  4DV1 O;  2Q69 A;  1JQ0 A;  5JCO C;  3W7T A;  4FVM A;  3CS5 A;  3M8A A;  1SKV A;  1XNQ O;  3G6E V;  1D5N A;  3LDE A;  3FX7 A;  4DR1 B;  5LBQ A;  2GBO A;  1DF5 A;  3G80 A;  1WP8 A;  4JI1 O;  3LNM B;  5KX5 A;  5JCO A;  5JQG B;  2EIJ C;  5DED A;  3WG7 B;  1V55 C;  1K7D A;  2RNB A;  3EFF K;  2UXD O;  4RQE A;  3QVN A;  1NTM H;  1FAF A;  1MSD A;  4DYL A;  4RUF A;  5ITZ B;  4U3J B;  4DW0 A;  3K5L A;  4A5U B;  4LF8 B;  2Z0A A;  3IJ4 A;  1K97 A;  2EIN B;  3P3N A;  1AIL A;  4W4K A;  1VQO V;  4JI7 B;  2YXH A;  2ADQ B;  3OFN G;  1XMQ B;  2F23 A;  3OAA G;  4CS3 A;  3K5O A;  1KU9 A;  1JJO A;  3CD6 V;  2JS5 A;  1XL4 A;  2MK3 A;  1FXK C;  4ZOL B;  2OCH A;  3WU2 Z;  5JWP A;  4AQY B;  5LP6 C;  2HVK C;  3OT7 A;  2OIE A;  4DR5 B;  4JTA B;  2IJJ A;  4PDV A;  1FXK A;  2N05 A;  2ZE6 A;  2ZNI A;  4YHH O;  5LP6 A;  1K3E A;  4B3S B;  2BSK B;  2JJ2 G;  3H9V A;  4JPR A;  3JSN A;  3L72 H;  3K79 A;  4JI3 O;  4NKG B;  4JI5 O;  4Z2W A;  3SPJ A;  5IJ0 B;  4GT1 A;  3G6B A;  2R70 A;  1YCI A;  3UKM A;  2JVD A;  4U7O A;  4X20 A;  1KC8 W;  2UUA O;  2QM8 A;  5H5N A;  5LA6 B;  2LFS A;  1ZUQ A;  1N33 B;  2CTP A;  1T5E A;  3RW0 A;  4FFB A;  3CCE V;  4DR6 B;  3CC2 V;  4WF9 V;  2A0L A;  2P67 A;  3CEI A;  5FLX N;  2ITD C;  2VQE B;  4NYK A;  5J9P C;  3E8B A;  1P49 A;  2NR5 A;  5LXT A;  5J2U A;  4CC6 A;  1ZAU A;  4B7E A;  1E79 G;  2ZD9 A;  3WG7 C;  4JV5 O;  5L3G A;  3PN1 A;  1NJI W;  2ZR2 A;  4PA3 A;  4ZHQ A;  2WA4 A;  1QCE A;  4PDM A;  4TV9 B;  5CN0 A;  5J2T B;  2EIK B;  3ZBH A;  1H2M A;  2BTQ B;  1M4U A;  4X66 B;  2UUC O;  4DUZ O;  2CH7 B;  1SES A;  4NR1 A;  1M5I A;  1W2B U;  2ILM A;  2IM9 A;  3JAL A;  3HB3 B;  3K9S A;  1LUW A;  4IGG A;  2EIL B;  1M9N A;  4IIJ A;  3CCM V;  1NKD A;  4DV3 O;  4Z1M G;  4DV0 O;  1COW G;  2O57 A;  2MW2 B;  1SC5 B;  3LSS A;  4GKK B;  1QQC A;  2AZ0 A;  3HKC B;  2M6Y A;  2LGQ A;  2Y69 B;  5EYP B;  4J7J A;  1SET A;  3WB2 A;  1FFX B;  2UXC O;  3RYF B;  4FPP A;  1PNK A;  5B1N A;  1KKD A;  3ZMS A;  1L0N H;  1BS3 A;  2QR4 A;  3CB2 A;  2GHY A;  4ZKI A;  2Z5U A;  2N04 A;  5CA1 B;  4ZI7 B;  3LSQ A;  2Q6A A;  4JI2 O;  5CB4 A;  4JAV A;  3FYE B;  1G1X B;  4DR7 O;  4BAY A;  1PP9 H;  2KQX A;  3UQ8 A;  3OGI B;  1PNM A;  4DV4 B;  3JAR A;  3DXR B;  2AZ2 A;  1WN7 A;  2WPD G;  2F95 B;  4JYB A;  5CBH A;  1VQ5 V;  4X1K B;  2W6I G;  4JAS A;  4JZ2 A;  3CCU V;  1V9P A;  1SS3 A;  3AG1 B;  5IWA B;  2V7Q G;  2A06 H;  4K0K B;  3APO A;  4YXW G;  3KCX A;  4JI8 B;  5B1B B;  3ZN1 A;  3W7S A;  2WA3 A;  3S3W A;  2UXB O;  2A3Q A;  4PDR A;  1BT8 A;  2WLJ A;  2EZO A;  1KQS U;  2D3O W;  5L3F A;  1OCR B;  2YI9 A;  4TUY B;  1OCO B;  2QGN A;  3DC6 A;  3K9A A;  2EIK C;  1ZSP A;  3FAV B;  2Q7G A;  3E22 A;  3K08 A;  4LBE C;  2Q9L A;  3D3Q A;  3N2K B;  1HNX B;  4LWS A;  2EX3 A;  1J5E O;  2IU3 A;  4FM2 A;  5J2T A;  1IBM O;  2EIL C;  1D2D A;  4LNU A;  3N2G A;  2CK3 G;  4DR2 B;  2P4V A;  2ODM A;  2ADP A;  5KAF Z;  5AG2 A;  4PJ0 Z;  2Q0O C;  2QKC A;  1P84 F;  4JYC A;  4YJ2 A;  3TXQ A;  1XL6 A;  2PY5 A;  2CTQ A;  2VQF B;  4ZIB A;  4MTF A;  2Y69 C;  2HKO A;  4I7Z B;  5LMN O;  2RCV A;  4H33 A;  2H8P C;  4GX0 A;  3A2F A;  2XAH A;  1NBM G;  1KUQ A;  4X64 B;  1QBZ A;  3OR7 C;  4LF4 B;  3L73 H;  3N27 A;  2QDO A;  1YHQ V;  5CA0 B;  3CCR V;  3X2Q C;  3FYI B;  1KMI Z;  3RYI B;  5EYP A;  4JTD B;  5GW7 A;  4UVB A;  3OUS A;  3B2E E;  2QWO B;  1N8R W;  4DV5 O;  1JMK C;  3AEI A;  2X6C A;  1XMO B;  3RYH B;  4TV8 A;  3ABK C;  2CUG A;  5LHI A;  1R6N A;  3ASN B;  1XI1 A;  1DF4 A;  1XNR B;  3GVM A;  2Q7E A;  4MVQ A;  2GTA A;  3CCJ V;  1N36 B;  1AJN A;  2YID A;  1P4R A;  3CME V;  1GM8 A;  5CA1 A;  1Q6I A;  4ZI7 A;  1GN3 A;  3ZS8 C;  1Y74 B;  2JGD B;  1I94 B;  1YZB A;  2YDE A;  4CH5 A;  2IJI A;  3AG1 C;  1QVG U;  3AK2 A;  2IW5 A;  4B3R O;  2E5L B;  3ZRW A;  4QGP A;  1BMF G;  1PD3 A;  4NXN B;  5B1B C;  2EJ7 A;  5TIS Z;  1H2L A;  1K73 W;  2XUM A;  3JAT B;  1OCR C;  4DUY O;  5KUM A;  4PA7 A;  1SQF A;  3ETE A;  2LFR A;  1JJ2 U;  4WBN B;  3O65 A;  3CPW U;  1IDS A;  1XOU A;  4NTY A;  4CH3 A;  3U0Z A;  4TUY A;  1JFF B;  1K5Q A;  4MTO A;  5GTI Z;  2DWE C;  4RQF A;  3ZHR A;  1QR8 A;  5LYJ B;  5F2V O;  1QLE B;  4GKJ O;  5EZY A;  3K58 A;  1YXB A;  4DV2 B;  1FJG B;  1VQ7 V;  1F7Y A;  4FM0 A;  2HEP A;  3JSL A;  1W0J G;  2DE0 X;  4X89 A;  3D8C A;  3JAS A;  2QM4 A;  1YSC A;  3D3I A;  1IXM A;  2Y0P A;  4G2K A;  5HFL A;  4P30 A;  3U11 A;  4LF6 O;  3OUF A;  2OWO A;  3K0G A;  2X6B A;  1M57 B;  4FLX A;  1SQG A;  3SYP A;  1S3J A;  5EBW C;  2FML A;  3OE7 G;  4LF9 O;  3JD1 A;  3I5D A;  1GMG A;  2RDC A;  2OYQ A;  3BHP A;  4H37 A;  4LF5 B;  5L3E A;  5IJ9 B;  1SER A;  4DR4 B;  3DTU B;  1SZX A;  4JF3 A;  3CRC A;  3UT5 B;  2F66 C;  4B3M B;  2DWD C;  4LFB B;  4H44 B;  4X65 O;  4UCT A;  3RYI A;  2LP7 A;  1NT2 B;  2X7R B;  5LHH A;  1Q43 A;  3HKD B;  5KHI A;  4KL1 A;  1VQP V;  1Z5V A;  4X1I A;  3ZRV A;  4NB5 A;  2VWJ A;  4BIZ A;  3JAK A;  2OT5 A;  1ROP A;  3ZHT A;  3J81 N;  1AP5 A;  1BGY H;  1D5A A;  2QE7 G;  4XDJ A;  1Y74 A;  2JGD A;  2JJ1 G;  1VQ4 V;  5EC2 C;  1F23 A;  5KLV H;  1IX9 A;  1ZL8 B;  1TVK B;  1MA1 A;  1X4T A;  3E86 A;  1I08 A;  4JYA O;  4DK0 A;  2HG5 C;  2XAF A;  2F4V B;  1N34 B;  3DC5 A;  2JIZ G;  2V1D A;  3L70 H;  4JI4 B;  3ABL B;  3AG3 B;  1OJH A;  1GN4 A;  4QPK A;  2HHH O;  3AG2 B;  4B08 A;  4I50 A;  4UUJ C;  2XAS A;  3ZHU A;  4UV8 A;  4DV6 B;  4FZ1 A;  1BQ0 A;  4KFM A;  4IL6 Z;  5LMU B;  4DV1 B;  4KP4 A;  4MT8 A;  1QLE C;  1AR4 A;  5FL7 G;  4WBN A;  3K03 A;  1N0N A;  4DK1 A;  2WLL B;  2QSA A;  3ZHQ A;  4LFC O;  1PPJ H;  1MG1 A;  1I5Y A;  2P06 A;  1KP3 A;  1WA8 B;  5EBL C;  2OIG A;  4X62 B;  2VRZ A;  4LF7 O;  4O2A B;  5BR8 O;  1IBK O;  3H1L H;  2QTO A;  1WP7 A;  1Y76 A;  3K04 A;  4KXR A;  5EIB D;  1GKF A;  3S3X A;  3VQY A;  1HR0 O;  2QWN B;  2C2A A;  4IHJ B;  2UXD B;  1M57 C;  2VS0 A;  3UCS C;  2QKS A;  5A2Q N;  2UU9 B;  4EB6 B;  2YSU B;  4J7Z A;  4D7S A;  4O2B B;  3Q4H A;  4GCZ A;  2B9Z A;  4UB6 Z;  2AGA A;  1OHH G;  4U3F H;  2ZT9 B;  3QO8 A;  4UCR A;  3FD9 A;  3FB5 C;  4UFZ A;  4O4L A;  1MOF A;  2PTM A;  3JAW B;  4X8A A;  4L87 A;  4Q20 A;  2BE3 A;  4HZ3 A;  4R8C A;  1H2N A;  2HVJ C;  3CC4 V;  1H8E G;  4BW5 A;  5C8Y B;  1WPX A;  2P5O A;  4MVO A;  1UPG A;  3ML0 A;  4MS2 A;  1IXB A;  4I4T A;  4LF8 O;  3T1Y B;  4MVU A;  3HKD A;  1ZX3 A;  1FKA O;  3JD4 A;  2WWW A;  1KKC A;  1QR9 A;  2RMK B;  4NXM B;  4YIO A;  2LW1 A;  2E75 B;  4F6R B;  4KHP O;  2EJR A;  5KHH A;  2XOK G;  3CRM A;  3UM7 A;  4LC1 A;  1YVW A;  4YY3 B;  1MAB G;  1IBL B;  3WB1 A;  1W0K G;  2X0L A;  1BCC H;  4DRX B;  4JI5 B;  4CS2 A;  3M7M X;  4XBF A;  3ABL C;  2WLM A;  1KB9 F;  3AG3 C;  3AG2 C;  4LH7 A;  1TVK A;  2GUZ A;  5IT9 N;  4O4I B;  1B04 A;  3FKS G;  4J41 A;  4C7U A;  3RYC A;  4XDK A;  4AQY O;  4O4H B;  1AI6 A;  2QJ1 A;  2BCC H;  3D36 C;  2QKA A;  1VF6 C;  3K5M A;  3PJS K;  4P9O A;  4FLW A;  5LGU A;  1V54 B;  2RJZ A;  2E76 B;  5JH7 A;  4X9Q A;  4TT3 G;  5KMG A;  5H6R A;  1I7F A;  3TJT A;  2EBO A;  3B8M A;  4PA4 A;  3OR6 C;  3QG5 A;  3D36 A;  1NR7 A;  1Q6H A;  4GX2 A;  5FNV A;  1AVM A;  3SJC C;  5BY1 A;  3E35 A;  4WFA V;  1GAX A;  1Q90 D;  1GH6 A;  2CE4 A;  2YIA A;  4OGQ B;  1WA8 A;  3NR7 A;  4O2A A;  4BWA A;  1YJW V;  1N33 O;  1G6U A;  2XAJ A;  2UUC B;  2CGN A;  4IHJ A;  3HKE B;  4DR6 O;  3L71 H;  2EIN C;  5JQG A;  2LO1 A;  3A0H Z;  2KG7 B;  2VQE O;  3JD0 A;  3U10 A;  5ITZ A;  1EN5 A;  4U3J A;  3I56 V;  3EVK A;  4WFB V;  4DV3 B;  3TET A;  3ZN0 A;  2P6J A;  2YXY A;  1R3L C;  3K57 A;  4X66 O;  3QO7 A;  1XHZ A;  2UXC B;  2BOC C;  1CP9 A;  4HYO A;  1YJ9 V;  4BW9 A;  1AP6 A;  3CMA V;  1QVF U;  1BE3 H;  1ARO P;  4ZOL A;  4YJ3 B;  1H2G A;  5DM6 V;  2P4K A;  1E1R G;  2OTJ V;  2Q0A A;  2DOS A;  1Q5O A;  4CH4 A;  3BCC H;  1R1B A;  3CRA A;  3AK3 A;  4MW3 A;  1SF9 A;  4GKK O;  3SGI A;  2Y48 A;  1QNM A;  1O9G A;  3OTO B;  5EC1 C;  2PYL A;  4DRX A;  5DEC A;  1KEC A;  5BMV B;  4AHC A;  2BSK A;  2YS8 A;  4N21 A;  3ZED A;  3RBZ A;  1V54 C;  1S72 V;  5IJ0 A;  1ZWI C;  3W7U A;  4ASU G;  4FLZ A;  3F7V C;  3IFX A;  1TUE B;  5LA6 A;  1TA8 A;  1Z5W A;  2XAG A;  2UXB B;  5KA5 A;  1AR5 A;  3KG2 A;  4PHZ A;  5GON B;  1PNL A;  4JAA A;  4E4E A;  1R3J C;  4U7N A;  3B77 A;  2GV9 A;  3C3S A;  2XTA A;  5KUK A;  1G8M A;  4DV4 O;  1NU1 H;  3P3P A;  5BXZ A;  3LDD A;  4UCS A;  3A0R A;  3K0D A;  5EBM C;  1PM9 A;  3FB8 C;  2FKX A;  4DXW A;  1J5E B;  3CRR A;  2UXX A;  1YIT V;  3JCU Z;  2A79 B;  3T1C A;  4JI8 O;  1VP7 A;  3RVZ A;  2IJK A;  1NZ6 A;  3ABU A;  3HKE A;  3SPH A;  4MW8 A;  4TV9 A;  3H1H H;  4K8X A;  2GSM B;  2BTQ A;  1BSM A;  1TGO A;  4IYH A;  4FIP C;  2CH7 A;  2DJV A;  4MTG A;  1UJW B;  1N32 O;  4O4J B;  4JAU A;  2ZR3 A;  5KAI Z;  1BZK A;  3T1H O;  5JJN B;  5LMN B;  1HNZ B;  1FPO A;  1RSO B;  4J7K A;  3G71 V;  5JVD B;  1NH2 B;  1VQ8 V;  2A7W A;  3STZ C;  2PZS A;  4GX5 A;  3HKB B;  3ICX A;  1XBL A;  1E1Q G;  1TUB B;  3CCS V;  1HNW O;  3HKC A;  2P22 C;  2EUL A;  3MHH C;  3FB6 C;  1FFX A;  1M1K W;  4I5S A;  4B3T B;  4PEL A;  4FLY A;  4AIL C;  2Q68 A;  3RYF A;  1OCZ B;  4HBN A;  1Y4M A;  4N23 A;  3RGB A;  3RVY A;  4YJ3 A;  4TQF A;  1IVS A;  3SPI A;  5H2F Z;  2OCC B;  4I0X B;  5IYZ B;  4J42 A;  1FS0 G;  2EZP A;  4LR3 A;  3SYO A;  4JTC B;  3AK1 A;  1NVP B;  1W59 A;  3H1K H;  2WLN A;  2FTK A;  2XHB A;  2YXL A;  1RP3 B;  2Q67 A;  3OGC C;  5BMV A;  1EM1 A;  2JGU A;  1R6K A;  2ZE7 A;  4GYC B;  3SPC A;  1HWY A;  1VQN V;  4CZZ A;  2RN9 A;  3C3T A;  1XMO O;  3DXR A;  3O9O A;  4JI6 B;  5B1A B;  1NR1 A;  1FD9 A;  2HP8 A;  3M99 B;  4DUY B;  1XNR O;  4X1K A;  1YJN V;  2QA4 V;  1F51 A;  1N36 O;  2K1E A;  4J11 A;  4LFA O;  4R7C A;  3H1I H;  4GLX A;  1GM9 A;  2RQ6 A;  2P7T C;  2P90 A;  1OCO C;  1XDC A;  3MHS C;  5GTH Z;  4X1Y B;  4I55 B;  1I94 O;  1HP8 A;  4UXN A;  1M90 W;  1BHA A;  3ZHS A;  4DW1 A;  3CC7 V;  5EIB C;  3THO A;  3JCZ A;  3TCU A;  1YI2 V;  1QU7 A;  3FB7 C;  3BY6 A;  3KCY A;  3ZRX A;  2Y4U A;  4NXN O;  1M93 A;  2JS3 A;  1SQX H;  3HR0 A;  4W4L A;  2XT9 A;  3FAV A;  1IUR A;  1FYJ A;  4WFG A;  1MSW D;  2ZCE A;  2WLI B;  2PI4 A;  1NTK H;  3LDC A;  2QM7 A;  1GN6 A;  3N2K A;  1LUV A;  4JZG A;  4MSW C;  1VF5 B;  4LF6 B;  1L8D A;  2WAM A;  5CA3 A;  3CE2 A;  1LR1 A;  1SA0 B;  3ZHV A;  2W6J G;  3F7Y C;  1R3K C;  3ZRS A;  3BFR A;  5KX5 B;  4FLT A;  1DK1 A;  4DR3 B;  1RSO A;  4DV2 O;  1FJG O;  4H13 B;  2G38 A;  4PD4 F;  3K59 A;  2KSD A;  5JVD A;  1BQZ A;  4LP8 A;  1FFT B;  3OM3 B;  4I9Q A;  1GRJ A;  2HFE C;  3HKB A;  1OCZ C;  4OX9 B;  1JVM A;  3ZMZ A;  5FPR A;  3NXS A;  4X65 B;  4LH6 A;  1VQ6 V;  2DYS B;  3CJH B;  2UUB O;  1XIL A;  5CA0 A;  2OCC C;  3ASN C;  1EZJ A;  1Q3E A;  3WFV A;  3T4D A;  3LNN A;  4WFH A;  2ZM6 B;  1WAZ A;  1HDJ A;  2FB5 A; 
#chains in the Genus database with same CATH homology
 1XMO O;  4LF8 O;  4DR1 O;  2FKX A;  1FKA O;  4JI3 O;  4JYA O;  2UXC O;  1XNR O;  4X64 O;  2LW7 A;  4JI5 O;  4LF4 O;  4DV1 O;  1N36 O;  1AB3 A;  3OTO O;  4LF5 O;  4LFA O;  4GKJ O;  2UU9 O;  4KHP O;  4JI8 O;  3M8A A;  1XNQ O;  1F7Y A;  2HHH O;  5LMN O;  1I94 O;  2UUA O;  4X66 O;  5H5N A;  4B3T O;  4LFB O;  3F5T A;  1KUQ A;  1N32 O;  2DJV A;  4JI1 O;  4DR3 O;  4JI2 O;  1G1X B;  4DR7 O;  4NXN O;  3T1H O;  4LF6 O;  5IWA O;  3JAM N;  5FLX N;  4LFC O;  5IT9 N;  2UXD O;  4K0K O;  4JI7 O;  4AQY O;  4OX9 O;  1FYJ A;  4DR4 O;  4LF7 O;  5BR8 O;  1IBK O;  1XMQ O;  4DV5 O;  2DOS A;  4A5U B;  4B3M O;  1R1B A;  2Z0A A;  1A32 A;  4LF9 O;  1HR0 O;  4JV5 O;  4GKK O;  1AIL A;  2ZM6 O;  2N74 A;  3J80 N;  2E5L O;  1HNW O;  5A2Q N;  3T1Y O;  4JI6 O;  3J7A U;  1XEQ A;  1X59 A;  1YZB A;  2UUC O;  2UXB O;  4DUZ O;  4X65 O;  5BY1 A;  4NXM O;  1N34 O;  2JRI A;  2AGA A;  4JI4 O;  1HNX O;  4DR5 O;  1DK1 A;  4B3R O;  3RT3 C;  4DV2 O;  1FJG O;  4YY3 O;  4OPA A;  1IBL O;  1N33 O;  4DV6 O;  3R66 A;  5LL6 Y;  4DR2 O;  5LMU O;  4B3S O;  4DV3 O;  2ZKO A;  3SDL A;  4DV0 O;  4DR6 O;  3J81 N;  4DUY O;  2UUB O;  1R6T A;  4OPH A;  1J5E O;  2F4V O;  1HNZ O;  4JI0 O;  4DV4 O;  4X62 O;  1IBM O;  2VQE O;  1D2D A;  5BXZ A;  1NS1 A;  2VQF O;  3O65 A;  4DV7 O;  4YHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...