4DV2O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv2O00
2DJVA 3J81N 4B3SO 3T1HO 4JI5O 5BR8O 3SDLA 1AILA 4DV7O 2N74A 2VQEO 4JV5O 2HHHO 1YZBA 4DV4O 1HR0O 4JI3O 1IBKO 4KHPO 1R6TA 4YY3O 1IBMO 1XEQA 1KUQA 3R66A 1G1XB 4DR7O 4DV2O 5BXZA 4JI0O 4LFCO 4DR4O 2UUCO 1A32A 4OX9O 1FKAO 4X66O 1HNWO 4DV6O 4DR2O 1R1BA 4DUZO 4LF7O 1FYJA 2UXCO 3O65A 4DV3O 1FJGO 3J7AU 3JAMN 5IWAO 4LF6O 4B3RO 1X59A 1IBLO 1N36O 4X65O 3RT3C 4GKKO 1D2DA 4AQYO 1XMOO 4DV0O 4JI7O 2LW7A 4OPHA 3M8AA 4A5UB 5A2QN 3OTOO 4NXMO 1AB3A 2ZM6O 4OPAA 1N33O 5LMNO 4B3MO 4DR6O 1HNZO 4DR3O 4LF8O 4B3TO 4X64O 2VQFO 4DV5O 4JYAO 3T1YO 4NXNO 4LF4O 5H5NA 4JI6O 4GKJO 2UXDO 4LF9O 2UU9O 3F5TA 2UUBO 4JI8O 1N32O 1XNQO 1XNRO 1J5EO 1F7YA 2FKXA 4JI1O 1I94O 4LFAO 4LFBO 2UUAO 1NS1A 2F4VO 5FLXN 4DV1O 1HNXO 4DR1O 1XMQO 4DUYO 4DR5O 2E5LO 2JRIA 5BY1A 1N34O 2AGAA 5LMUO 4JI2O 2DOSA 2ZKOA 5LL6Y 4K0KO 4LF5O 4X62O 2Z0AA 5IT9N 2UXBO 4YHHO 3J80N 1DK1A 4JI4O
chains in the Genus database with same CATH superfamily
4B3SO 1BS3A 1AILA 1H2GA 2XASA 3K08A 3QNEA 1YZBA 3AG2C 4IHJB 3ZN1A 3DGEA 4D6TH 3K59A 1PNMA 2IJHA 4B3RB 1OCCB 4GCZA 5LA6A 1L0NH 4JAAA 3ABMC 4K8ZA 1M93A 4LFBB 3GWKC 2DYSB 3OMIB 2Q69A 1XILA 4JI8B 3NXSA 2LFRA 4MVRA 5A9GA 3RGBA 2ZE6A 1SA0B 1UJWB 1BHAA 3ASNB 3ML0A 4H37A 5LMUB 2P4KA 3M8AA 4CH3A 4B3TB 3B8NA 3QO5A 4F6RB 2ZM6O 3B2EE 3GVMA 3K03A 1UPGA 2LO1A 3BA9A 4I55B 5EK0A 4ZI7B 1QLEB 3OE7G 4UVCA 4UB6Z 3CD6V 2YIBD 3M7MX 1Q7YW 2B5UA 1P49A 4PELA 2ZR2A 3SR2C 1XNQO 5JWPA 5LP6A 5CBGA 3E8HA 1GN2A 2UUAO 5F2VO 4H13B 1OJHA 3BCCH 4X20A 5CB4B 4FLUA 5KX5B 3OMNB 1HNXO 4JI0B 4ZKIA 2EIJC 4FLTA 4X1IB 1QNMA 4TUYB 1N34O 5LMUO 4JI7B 4UCSA 1FFTB 4GYCB 5KMGB 1VEWA 5KAIZ 1W0JG 2UXBO 4X64B 3K5MA 1E1RG 1DK1A 2EJ7A 4X1IA 3SPGA 3JSLA 2DJVA 3T1HB 1Q81W 3E22B 1H2MA 2N04A 1RSOA 5B66Z 2HG5C 1YSCA 2GV9A 2OTLV 1Q43A 4J41A 3AEIA 1XEQA 4X66B 1FAFA 2R70A 3FYEB 5FNVA 1N8RW 3CYOA 1GN3A 4PD4F 4MTXA 1X4TA 1ZL8A 4JF3A 3B8MA 1D5NA 3RYCA 4FM0A 2Y0IA 3DXRB 5KAFZ 3QF7A 1ORQC 3G80A 1LNQA 4J10A 5DM6V 5B5EZ 4DV3O 2ADPA 1ZTEA 1N36O 3HKBB 2XTAA 2ZNJA 3R65A 1NR1A 1OCOB 2WLIA 3PJSK 1YF2A 2ZXWC 3BFRA 3T4ZA 1JVMA 4OPHA 1SRYA 4WFHA 2DWDC 2RNBA 4NKGB 2HVJC 1TAEA 1B3QA 1NJIW 1TUBB 5EZYB 2QSAA 1N0JA 5FL7G 2AZ2A 1PNKA 1JX9A 4BAYA 3FAVA 5JJNB 3ZMTA 1IX9A 4HBNA 2EBOA 5D5PA 2LJ2A 5H2FZ 4HYOA 1F7YA 2P6JA 1BSMA 5IYDO 4LFAO 2YS8A 4TV9A 2QM7A 3OM3B 1TVKB 5KHKA 2D3OW 5LOVA 4P9OA 2YICA 4H33A 2PF4E 1HWYA 2AHYA 2XAGA 3QG5A 4G28B 1V55B 4X9QA 3B40A 3N2KA 4HNAB 1Y76B 4UUJC 4Z1MG 5JJJB 3ZHRA 3H01A 3K5NA 1OCOC 2IH1C 4JV5B 4HZ3A 5EIBD 2HFEC 2HR3A 5EYPB 1SA0A 2WA4A 3VQXA 1L1FA 2B1IA 3ZMSA 2KG7A 1US6A 5HFLA 3VQWA 2XAFA 1R3JC 4JAUA 3THOA 4DV2O 2FL4A 3JAKB 4R7CA 4DR1B 3N27A 4ZI7A 1VIBA 4B08A 2GSMB 1E1QG 4J11A 1EN6A 1VQ4V 4LFAB 5EBWC 4JI5B 1RPOA 1SC5B 4LF9B 3JARA 2QEXV 3E86A 3I5DA 4YXWG 1I7FA 1NH2D 1UFIA 5IY5B 4B7EA 5LXTB 1H2NA 1KMIZ 4FM2A 1AR5A 2RJZA 4UB8Z 2AXTZ 2WPDG 1S5HC 5KA6A 3SPHA 1VQPV 4YJ3A 4RQFA 5B3SB 1W2BU 1N4CA 1ZLZA 1FXKB 2OYQA 4FFKA 4PA3A 4U7NA 1ZX3A 2DYRC 4C7UA 1WB7A 4GX0A 1IBMB 1I94O 2C2AA 2ZNIA 2M7WA 2BE3A 2F4VO 3AK2A 3CB2A 1R3LC 4YJ2B 2Y69C 1F4MA 1BGYH 1SESA 4NVPA 3KCYA 1AI6A 1K8AW 4ZBMA 1MABG 4LF5O 4IYIA 5IT9N 3FB7C 3AG1C 3H1IH 4ZHQA 1QR9A 4O2AB 2VS0A 1GK9A 3K79A 1F23A 4DV7O 1YEWA 2X7RB 3CCUV 1WAZA 3T2MA 1IBKO 2W0FC 2JGDA 1YXBA 4W4KA 5EBMC 5LHIA 3SJQC 4K8XA 2ZR3A 2FMLA 1H2KA 1F51A 5BXZA 2WWWA 1L0LH 3BAAA 1HNXB 1AR1B 3HKBA 3SYPA 1Q8IA 2HJDA 1IVSA 1SQBH 2YXYA 3D3QA 3HR0A 1QQCA 4DW0A 1PV0A 1R3IC 3K0GA 1HDJA 3KKYA 3LDCA 4JYBA 1IBLO 4DYLA 1WLEA 1RM1B 5KUMA 4U3JA 2ETNA 3EHBB 4DRXA 2Q6AA 1WB8A 1XMOO 2Y4TA 3JD2A 1XREA 4GX1A 2ODMA 3ABLB 1AJNA 1WP7A 3ABKC 2W0XA 1NTZH 3L71H 5BMVA 4B3TO 4FLZA 2YC0A 3TCUA 2GDSA 4O4HB 2YIAA 2UUBB 4JI6O 3K04A 4DO2A 1QHTA 1Y67A 1ZAUA 1Y76A 1XL4A 2IJJA 2JIZG 2KSDA 2UUBO 4JI8O 3APOA 1VQNV 1YJWV 4LFBO 3NR7A 3CJHA 4LNUB 4LH6A 5LMNB 2AW9A 4FLXA 4TV8A 3OMAB 4DR1O 2ZD9A 3Q4HB 2CH7B 1OV9A 4JI6B 2ITDC 3ZJZA 4XDJA 3K0DA 5BMVB 5L3FA 2EZOA 3Q4HA 1GN6A 1FJGB 1BHBA 5LP6C 3STZC 3ABKB 4PHZA 3CCMV 2F23A 5L3GA 1EN4A 4O4IB 1KUQA 4OX9B 3CS5A 3G6EV 2E5LB 3DTUB 3F5WC 1G4YB 1KP2A 3AG3C 4DR7B 3SPJA 1FKAO 3B09A 4NTXA 4UCOA 3CWBH 1V9PA 2GTAA 3EFFK 2ZE8A 2FTKA 1K73W 3ABUA 4CS3A 4X8AA 4LF7O 5B1AB 4UV9A 2JK5C 1JCHA 3B77A 4PI0A 2QKCA 3IJ4A 1KU9A 4LH7A 3H1JH 4GKKO 1SZTA 1K34A 3L72H 2A9HA 4DV5B 3ABTA 4XDKA 5A2QN 5KLVH 2P06A 2YXHA 1JJOA 5IWAB 2HKOA 3HKDB 4N23A 1SQQH 3OR7C 4LF5B 4NYKA 4FMTA 1WPXA 3F7VC 3IC7A 5H5NA 2QWQB 1PKXA 4BIZA 3ZMZA 2QGNA 3ETGA 4UCVA 2XT9A 4O2BA 1J5EO 3RYCB 4FFBB 5J9PC 2Y48A 5IJ0B 1Y66A 2DMXA 1XNQB 4DV7B 4RO2A 2KQXA 3N2KB 3HKDA 3FAVB 4G27B 4KXRA 4KUMA 4JI2O 1VQ7V 2EIJB 1N34B 2DE0X 2IH3C 1OCZB 1NVPB 3RVYA 3T1HO 2ZM6B 3ZRSA 4LWSA 1SQPH 4KHPO 4CC5A 3K06A 1IBMO 4DR7O 4MVMA 1R6NA 1HW7A 4DV2B 4OX9O 4UCRA 1VARA 5LP6B 3WB0A 4JYAB 1Q86W 3BA8A 2Y0PA 1ZUQA 1NZ6A 5CA3A 3ZEDA 3ZN0A 3OFNG 1KYOF 2OCCB 3RYHA 1IDSA 1R73A 2E76B 4AILC 1JPXA 3HKCB 1GMGA 4B3RO 2Q8VA 2AHZA 2OIGA 1H2LA 2NR5A 3JCUZ 4MVUA 3OT7A 3UM7A 1D2DA 2WLNA 3L9DA 1AI4A 2QWPB 3A0HZ 1V54B 5IDJA 4KFMA 1YTFB 1K3EA 4FIPC 1W59A 1K4DC 1TVKA 1F4NA 4QJFB 1VMGA 2JEUA 4KP4A 2QKAA 2Q7GA 2Q7EA 3ZHUA 3CRMA 2FYUH 1S3JA 4MT8A 2P4VA 5FNVB 3OUFA 4RAIA 2WLIB 2P22C 3HKCA 1RP3B 2XAHA 5LGTA 4YY3B 3ZHTA 2Q9LA 2WLJA 4DV1O 1BT8A 3BPZA 3OUSA 3SPIA 4I5SA 2ZCEA 3FFQA 2GUZB 2JGDB 1G6UA 1SETA 2UXDB 1V54C 2LGWA 3ETQA 1V55C 2GTSA 2DN9A 2ZKOA 1H8EG 1Q6HA 2DW4A 1IURA 3P3NA 2M6YA 1FPOA 3K58A 4ZHQB 1XOUA 3MDSA 3K57A 1TGOA 5EC1C 3ZHVA 1N0NA 2N74A 2LP7A 4GUNA 2R72A 2PYJA 4MVOA 2EIMB 3UO3A 2LW1A 2CTWA 3CCVV 3MHHC 2HLDG 2ILMA 3G71V 2WA3A 2W6JG 1AP6A 2ZE5A 3E8GA 3O9OA 2Y4UA 4QPJA 2VQEB 1H2SB 1YDXA 4CBCA 3O65A 1K97A 1WA8A 2NN4A 2CAZC 2KB1A 4WFBV 1PNLA 4AQYO 1S5JA 3JAWB 3RN4A 3FB5C 2OIEA 2EILB 4NXMO 2NNUA 3MD0A 1JR9A 4OPAA 4PDLA 4MTOA 4J7JA 1M90W 2JDIG 4J7KA 4B3MO 3ABLC 2IJKA 1E79G 2CTRA 2EJRA 4WBNA 5KHJA 3ABMB 4MSWC 1H8HG 3WU2Z 2CH7A 1N32B 4DR4B 1B6QA 1ROPA 5GW7A 3C90A 3ETDA 4Q20A 3CEIA 1NTMH 1OZ0A 2HEPA 3CJHB 5LGUA 4DV4B 2UUAB 2XNDG 1DLBA 4Q6GA 2UUCB 3I56V 4TWKA 3CCLV 4JTDB 2EILC 1Q6IA 5JQGB 4YJ3B 4WF9V 1S77D 3P30A 2A06H 2V7QG 5LL6Y 4IYHA 4HAMA 5LHGA 3QTCA 5BR8B 1XI1A 2UXCB 4JI5O 2JS3A 4X1KA 3OTFA 4CH6A 2IW5A 2ZINA 4JI3O 2RN9A 3QO8A 1DGSA 4MVSA 2LFSA 1OCZC 3R66A 3RBZA 4Z2WA 4UCTA 3EVKA 2K9PA 1RPRA 4MTFA 2F93B 4PDVA 1QLNA 4DR4O 3C3SA 2UUCO 4KL1A 1YTFD 2R9RB 4FLVA 4MVZA 2YIDA 4O4LB 4DUZB 4WFAV 3ZCCA 4DV6B 2D2CB 3JSNA 5GONA 4I0XB 4FM1A 3PN1A 4ZOLA 3JAMN 2DYRB 5IE9A 4LC1A 3IC9A 2BSKB 3JASA 1YI2V 2WLLA 5J2TA 5IYZB 2CDYA 5CA1B 2AZ0A 3OTOO 4IGGA 1YIJV 5EYPA 4E2LA 5JVDB 2IBZH 1N33O 4EB6A 3WFVA 4X1YA 1WJZA 4E4EA 4TV8B 3SYCA 5J2UB 3OW2U 4DV0B 3T1YO 1K4CC 4LF4O 4O4LA 4LBEC 3ZX6A 4CS2A 4O4JB 1O9GA 1CPYA 2QWRB 1NI8A 4CZZA 4LF4B 4F6EA 3WG7B 4IHJA 4NR1A 1U96A 5B1AC 2B1GA 2DQ3A 2Q4PA 2Q0OC 1MOFA 1KECA 5EC2C 4D7SA 2E5LO 1YCIA 3AG4B 4MW8A 2A79B 1M57C 2Q7HA 3T1YB 1AVMA 3E22A 3FX7A 5LGNA 2Z0AA 2EINC 4FLYA 3P3PA 1IXMA 3ZS8C 3OR6C 4DV3B 3JASB 1MA1A 4CS4A 5KHGA 1TA8A 5JCOA 3AK3A 1THZA 4PJ0Z 1XHXA 3LUTB 4JTCB 3E89A 4DR5B 5CB4A 1P7BA 4TQDA 3CCRV 4LCUC 2X0LA 4IL6Z 2F66C 2UXNA 4X66O 1HP8A 1TUEB 4DV6O 1WP8A 2WLKA 3SJBC 5JH7A 2E75B 2DQ0A 2WLHA 4DUZO 4MW3A 2GHYA 2UXCO 3RFRA 2HP8A 3A0RA 1GRJA 3CC4V 1NKDA 2UXBB 3OEHG 4EFBA 1B04A 4JI7O 4ZOLB 5B1BC 2O57A 1H38A 2OCCC 5KA5A 2CGOA 1MMMA 4GZRB 3CRQA 4U3FH 1Q90D 1VF7A 2K1EA 3IFXA 3STLC 1VQ5V 1FXVA 3UT5B 2VQFO 1KQSU 5K1XA 2IU3A 3L73H 2V1DA 3MHSC 3E83A 5GTIZ 3QO7A 2P90A 4G2KA 2R9AA 1QVFU 2Q73A 5B3SC 1N32O 3H1KH 5JQGA 4EKWA 4JI1O 1MSDA 4FLWA 3F7YC 1M9NA 1MG1A 5TISZ 4DUYO 3ICXA 3JYCA 3JD3A 3VQVA 1IBKB 3K3WA 2PI5A 4WFFA 3SGIA 1PD3A 2PGGA 2KG7B 3D3IA 3SDLA 5CN0A 4PV1B 1AI7A 1I08A 2VQEO 4CC6A 1I0HA 3CSXA 2Z3YA 4PA7A 2QDOA 1M4UA 3CXCU 1G1XB 1FFXB 3OGIB 5HFMA 5KX5A 4J9ZB 5C8YB 2YSUB 4YJ2A 1XMQB 2ZIOA 1KBHA 4BW9A 4GX2A 3JARB 1NR7A 2Q0AA 2F43G 3TGUH 1VF6A 5H6RA 2ZIMA 2QTOA 5JVDA 2GBOA 1Q6UA 1SQXH 3FKSG 1HNWB 5IYZA 1FYJA 2P5OA 4B3SB 4LWSB 1Q5OA 1W0KG 2QJ1A 3JATA 2EIKB 1JOYA 1I5XA 1PPJH 4UXNA 1M57B 1VQ6V 5LYJA 4JASA 4RQEA 2JS5A 4X62B 1FS0G 1Y4MA 4R50A 3JALA 1XQ8A 2BOCC 3ASOB 4DXWA 1GM8A 1NQTA 2V4DA 4DV1B 2HVKC 4DRXB 2PYLA 4DK1A 1QU7A 3C3TA 1Z5VA 2Q5ZA 4DV5O 1VQLV 1WA8B 2BTQB 1EFRG 5FPRA 1Z5WA 4LFCB 4U7OA 3CMAV 4LF9O 4LF7B 4WFGA 3T4DA 2OCHA 1K33A 2Q67A 5AG2A 1Q3EA 5C8YA 3LSQA 3U11A 1AROP 5IJ0A 5B1NA 3E8FA 1NU1H 3SYAA 2HJFC 1Y74A 2RQ6A 3CHXA 4GKJB 1M5IA 1URFA 3CCEV 4K0KO 2IU0A 3ZHQA 4YHHO 3HKEA 3JATB 3T1CA 1GN4A 1DF5A 3K9SA 4ASUG 3FD9A 1WPBA 4R6ZA 1HR0O 2EINB 3HKEB 3H1HH 5L3BA 4YY3O 2RDCA 4RWUA 3TK1A 3AK1A 2CGNA 4NTWA 4JZGA 2MK3A 2YI9A 3UT5A 1CEZA 2CTPA 3E2EA 4DR2O 4ICGA 1IZ3A 1L8DA 1FXKA 3A8TA 4PA6A 1X59A 2PI4A 1AI5A 2F95B 2LGQA 4O4JA 1QR8A 2B9ZA 3CXHF 4X65B 2L35A 3UKMA 4TUYA 2QM8A 4H44B 3QVNA 3X2QC 5IYBO 1VF6C 1MSWD 4DR3O 1K7DA 3SYOA 3H9VA 4L8JA 4JYAO 3AG1B 1AR4A 1M1KW 4XDLA 4YIOA 1K5SA 3D8CA 3KCXA 3CC2V 1B06A 3ZRVA 3HPLC 4LF6B 2ZDIA 1DTOA 4I50A 2OTJV 3ZRWB 3S3XA 2A7WA 1Y74B 1GH6A 3OGCC 4FZ1A 4DR6B 1R6KA 2UXXA 2IJIA 2LQTA 2N05A 1EBOA 4LR3A 2WSSG 4BIOA 1AP5A 5B1BB 1GTOA 3P32A 3FB8C 4GKKB 1AJQA 1WN7A 2VRZA 2ZQMA 4JI4O 1JFFB 4I7ZB 2QR4A 2YDEA 4DK0A 4NTYA 1GM7A 2NLJC 1ENVA 2QWOB 1JJ2U 2HHHO 3JALB 3ZRWA 2BTOA 4PDMA 4L87A 5EIBC 1I94B 1J5EB 3BHPA 2P67A 2EIMC 1OCCC 4JI0O 1ZSPA 1KKCA 2XHBA 2YI8A 5IJ9B 3CX5F 3GWOA 4GT1A 1QBZA 4AI8A 1M56B 4LP8A 2PZSA 5CA0B 3ASOC 5IWAO 1LUVA 4LF6O 3G6BA 4JAVA 4X65O 3CPWU 3RT3C 4JGSA 3RYIB 3JAWA 2EX3A 4OXSA 5CA0A 4JTAB 1HR0B 5FPOA 2A0LA 4F6RA 1AJPA 1JA8A 5LMNO 2E74B 3W7TA 1BCCH 2VWJA 3ZBHA 1NVPD 1MZEA 4X88A 3IGAC 4N21A 4TOIA 3GB7C 5EBLC 3VOUA 3S3WA 3CRCA 3DSQA 5BZBA 1DF4A 2QA4V 4QE7A 1NT2B 3CRRA 4I50B 4UVAA 4B7KA 5IJ9A 5GTHZ 4I4TA 4DR5O 3E35A 4QGPA 1FXKC 4YHHB 5L3CA 5H9CA 3ZMUA 1EN5A 4Z1VA 1SS3A 5JCOC 3UO2A 1IBLB 3HB3B 1I5YA 1BZKA 3J81N 1JMKC 4JV5O 2YUAA 3APQA 1KP3A 2MW2B 2BSKA 3D36A 3OAAG 2X6BA 3OEEG 4LFCO 3W7WA 1EM1A 1WNSA 2YEVA 2RCVA 5CBHA 2PTMA 4EB6B 1Z2GA 2HHHB 1VQMV 4TV9B 1YJNV 4CH5A 3FYIB 1TUBA 5EZYA 2JJ2G 4GX5A 1Q82W 4JI4B 4BR6A 1LR1A 4J80A 1XMOB 1KKDA 4JI2B 2BCCH 1OHHG 5E1AC 2RMKB 3I55V 4DW1A 4PI2A 2XAQA 4GLXA 4LF8O 3SJAC 2F4VB 5DN6G 4X64O 5LOVB 3CC7V 4O2AA 2ZT9B 2UU9B 2F1MA 3E8BA 3LNMB 4DUYB 3CMEV 3F5TA 2UU9O 4BW5A 4ABMA 1XBLA 3M99B 4TT3G 2GUZA 2L6LA 5L3DA 1XUQA 3BRCA 4IIJA 5FLXN 4LF8B 4TQFA 3JD1A 2XUMA 2WAMA 1O9HA 1VP7A 5H6QA 3W7SA 1XMQO 1GAXA 1YVWA 3W7UA 3KG2A 1XDCA 3A2FA 4FJCC 2BTQA 3RWRD 2AGAA 2VWKA 3UQ8A 5KMGA 1MNGA 4CH4A 1S0VA 4D7TA 4FK5C 3J80N 3LSUA 1SQGA 5L3EA 1QLEC 2ITCC 3ZIAG 1BQ0A 4PDRA 5BR8O 4QE9A 2OT5A 5CBFA 4X1YB 3U0ZA 1BMFG 3BEHA 1R6TA 1QCEA 4XBFA 1SKVA 1RM1C 4UV8A 4IIJB 3OD4A 1J95A 1EZVH 1Y6XA 4J7ZA 4FVMA 1KC8W 4MVQA 3X2QB 2QWNB 4X1KB 1SZXA 1BQZA 4IT5A 4JI1B 1SQFA 4DR2B 5JJEB 3AG7A 4MTGA 3DC6A 1FJGO 1KB9F 4O2BB 5KHIA 3JCZA 3ASNC 1NH2B 3LDEA 5KUKA 2PY5A 2CK3G 1PL0A 1JQ0A 2A3QA 1S72V 3N2GA 3WB2A 4X20B 1HNZO 4NXMB 5D5QA 4R8CA 3ETEA 2YXLA 1GO3F 5ITZA 1FFXA 4I4TB 4GKJO 5LA6B 1ZL8B 3IAYA 3TETA 2ADQB 2FKXA 5K1PA 1K9MW 3KZIZ 1CXZB 2Q68A 1SQVH 3AG3B 1D5AA 2QKSA 4FFBA 3L75H 4FPPA 2CUGA 4JZ2A 1RFYA 3N2GB 2DOSA 2ARHA 1YJ9V 4K0KB 4PA4A 2ZE7A 1IXBA 2BOBC 1NTKH 5ITZB 4OGQB 2XOKG 1M56C 3B4SA 2WLMA 4JYCA 1FXHA 3G67A 4F4LA 4K35A 3W7XA 4QNHB 4WCEV 4PA9A 2YIBA 5LYJB 4I9QA 1VQKV 4QIWF 1N36B 3CCSV 3JD0A 3RYHB 4EEQA 3U10A 3RW0A 2IM9A 3UCSC 1S5LZ 3FB6C 1HNWO 3TXSA 2JVDA 1NBMG 2QM4A 5LBQA 3A0BZ 3K5OA 1XHZA 2JGUA 3BVOA 1R1BA 4P2ZA 2P7TC 1YITV 3K5LA 1N33B 3J7AU 3ZHSA 1YHQV 2ZXWB 2JJ1G 2CTQA 1GM9A 1K5QA 4DV0O 1SF9A 2X6AA 4I0XA 3TJTA 1BE3H 1HNZB 1CP9A 5JH7B 2G38A 1U97A 2WLLB 4DR6O 3OTOB 1G8MA 3CE2A 1PP9H 3DC5A 4P30A 4BIUA 4NXNO 4UVBA 3BY6A 2DWEC 4RUFA 3AG4C 4O4IA 4U3JB 2JEXA 2KKWA 2EIKC 3SYQA 2EZPA 2ZDIC 1XNRO 3ZMVA 1OCRC 4JI3B 1KD1W 1K92A 1QVGU 1NS1A 5C93A 3CCJV 1PL4A 4DR3B 3WG7C 1XNRB 5IY5C 2H8PC 4JPRA 2JRIA 3RYFB 5BY1A 2Z5UA 5E79Z 4KHPB 2CE4A 4H0LB 1JFFA 5LHHA 3SJCC 4B3MB 1ZWIC 3LDDA 5B1OA 4BWAA 4K3AA 4UFZA 2QTSA 3CP1A 4QPKA 5J2TB 3EXAA 4I9WA 1VQ8V 4DV4O 1FD9A 3ZRXA 1P4RA 5KHHA 4AQYB 4HNAA 3TXQA 5GONB 4WBNB 1GKFA 1A32A 3CRAA 2Y69B 4NXNB 1P7GA 4X89A 1P84F 2VQFB 4NB5A 5DECA 1SERA 2DYSC 2OWOA 3WB1A 2X6CA 4AHCA 4J9YB 2EULA 3JAKA 2FB5A 5IYCO 1VF5B 2LW7A 3RYIA 4FZ0A 1RSOB 3D36C 5DEDA 1VQ9V 4A5UB 5J2UA 4WFEA 1AB3A 3BABA 4TSFG 3AG2B 4ZIBA 3MAQA 3K9AA 5CMUA 2PUSA 1COWG 2ATKC 3SPCA 1MZFA 1T5EA 1VQOV 1R3KC 1BL8A 3DXRA 3CCQV 4RUEA 3L70H 2UXDO 2QE7G 1PM9A 3JD4A 2H3OA 1EZJA 2YEVB 4LNUA 1LUWA 3VBBA 1OCRB 3VQYA 4JYYA 2XAJA 2R9IA 4MS2A 3RVZA 2H94A 5CA1A 4UCUA 4O4HA 1S76D 3LSSA 4W4LA 4P9PA 3G4SV 1XL6A 3H1LH 4EFEA 4J42A 4YIPA 4I55A 3LNNA 2E3CA 4X62O 5LXTA 3L74H 3RYFA 2W6IG
chains in the Genus database with same CATH topology
2DJVA 3J81N 4B3SO 3T1HO 4JI5O 5BR8O 3SDLA 1AILA 4DV7O 2N74A 2VQEO 4JV5O 2HHHO 1YZBA 4DV4O 1HR0O 4JI3O 1IBKO 4KHPO 1R6TA 4YY3O 1IBMO 1XEQA 1KUQA 3R66A 1G1XB 4DR7O 4DV2O 5BXZA 4JI0O 4LFCO 4DR4O 2UUCO 1A32A 4OX9O 1FKAO 4X66O 1HNWO 4DV6O 4DR2O 1R1BA 4DUZO 4LF7O 1FYJA 2UXCO 3O65A 4DV3O 1FJGO 3J7AU 3JAMN 5IWAO 4LF6O 4B3RO 1X59A 1IBLO 1N36O 4X65O 3RT3C 4GKKO 1D2DA 4AQYO 1XMOO 4DV0O 4JI7O 2LW7A 4OPHA 3M8AA 4A5UB 5A2QN 3OTOO 4NXMO 1AB3A 2ZM6O 4OPAA 1N33O 5LMNO 4B3MO 4DR6O 1HNZO 4DR3O 4LF8O 4B3TO 4X64O 2VQFO 4DV5O 4JYAO 3T1YO 4NXNO 4LF4O 5H5NA 4JI6O 4GKJO 2UXDO 4LF9O 2UU9O 3F5TA 2UUBO 4JI8O 1N32O 1XNQO 1XNRO 1J5EO 1F7YA 2FKXA 4JI1O 1I94O 4LFAO 4LFBO 2UUAO 1NS1A 2F4VO 5FLXN 4DV1O 1HNXO 4DR1O 1XMQO 4DUYO 4DR5O 2E5LO 2JRIA 5BY1A 1N34O 2AGAA 5LMUO 4JI2O 2DOSA 2ZKOA 5LL6Y 4K0KO 4LF5O 4X62O 2Z0AA 5IT9N 2UXBO 4YHHO 3J80N 1DK1A 4JI4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJV A;  3J81 N;  4B3S O;  3T1H O;  4JI5 O;  5BR8 O;  3SDL A;  1AIL A;  4DV7 O;  2N74 A;  2VQE O;  4JV5 O;  2HHH O;  1YZB A;  4DV4 O;  1HR0 O;  4JI3 O;  1IBK O;  4KHP O;  1R6T A;  4YY3 O;  1IBM O;  1XEQ A;  1KUQ A;  3R66 A;  1G1X B;  4DR7 O;  4DV2 O;  5BXZ A;  4JI0 O;  4LFC O;  4DR4 O;  2UUC O;  1A32 A;  4OX9 O;  1FKA O;  4X66 O;  1HNW O;  4DV6 O;  4DR2 O;  1R1B A;  4DUZ O;  4LF7 O;  1FYJ A;  2UXC O;  3O65 A;  4DV3 O;  1FJG O;  3J7A U;  3JAM N;  5IWA O;  4LF6 O;  4B3R O;  1X59 A;  1IBL O;  1N36 O;  4X65 O;  3RT3 C;  4GKK O;  1D2D A;  4AQY O;  1XMO O;  4DV0 O;  4JI7 O;  2LW7 A;  4OPH A;  3M8A A;  4A5U B;  5A2Q N;  3OTO O;  4NXM O;  1AB3 A;  2ZM6 O;  4OPA A;  1N33 O;  5LMN O;  4B3M O;  4DR6 O;  1HNZ O;  4DR3 O;  4LF8 O;  4B3T O;  4X64 O;  2VQF O;  4DV5 O;  4JYA O;  3T1Y O;  4NXN O;  4LF4 O;  5H5N A;  4JI6 O;  4GKJ O;  2UXD O;  4LF9 O;  2UU9 O;  3F5T A;  2UUB O;  4JI8 O;  1N32 O;  1XNQ O;  1XNR O;  1J5E O;  1F7Y A;  2FKX A;  4JI1 O;  1I94 O;  4LFA O;  4LFB O;  2UUA O;  1NS1 A;  2F4V O;  5FLX N;  4DV1 O;  1HNX O;  4DR1 O;  1XMQ O;  4DUY O;  4DR5 O;  2E5L O;  2JRI A;  5BY1 A;  1N34 O;  2AGA A;  5LMU O;  4JI2 O;  2DOS A;  2ZKO A;  5LL6 Y;  4K0K O;  4LF5 O;  4X62 O;  2Z0A A;  5IT9 N;  2UXB O;  4YHH O;  3J80 N;  1DK1 A;  4JI4 O; 
#chains in the Genus database with same CATH topology
 4B3S O;  1BS3 A;  1AIL A;  1H2G A;  2XAS A;  3K08 A;  3QNE A;  1YZB A;  3AG2 C;  4IHJ B;  3ZN1 A;  3DGE A;  4D6T H;  3K59 A;  1PNM A;  2IJH A;  4B3R B;  1OCC B;  4GCZ A;  5LA6 A;  1L0N H;  4JAA A;  3ABM C;  4K8Z A;  1M93 A;  4LFB B;  3GWK C;  2DYS B;  3OMI B;  2Q69 A;  1XIL A;  4JI8 B;  3NXS A;  2LFR A;  4MVR A;  5A9G A;  3RGB A;  2ZE6 A;  1SA0 B;  1UJW B;  1BHA A;  3ASN B;  3ML0 A;  4H37 A;  5LMU B;  2P4K A;  3M8A A;  4CH3 A;  4B3T B;  3B8N A;  3QO5 A;  4F6R B;  2ZM6 O;  3B2E E;  3GVM A;  3K03 A;  1UPG A;  2LO1 A;  3BA9 A;  4I55 B;  5EK0 A;  4ZI7 B;  1QLE B;  3OE7 G;  4UVC A;  4UB6 Z;  3CD6 V;  2YIB D;  3M7M X;  1Q7Y W;  2B5U A;  1P49 A;  4PEL A;  2ZR2 A;  3SR2 C;  1XNQ O;  5JWP A;  5LP6 A;  5CBG A;  3E8H A;  1GN2 A;  2UUA O;  5F2V O;  4H13 B;  1OJH A;  3BCC H;  4X20 A;  5CB4 B;  4FLU A;  5KX5 B;  3OMN B;  1HNX O;  4JI0 B;  4ZKI A;  2EIJ C;  4FLT A;  4X1I B;  1QNM A;  4TUY B;  1N34 O;  5LMU O;  4JI7 B;  4UCS A;  1FFT B;  4GYC B;  5KMG B;  1VEW A;  5KAI Z;  1W0J G;  2UXB O;  4X64 B;  3K5M A;  1E1R G;  1DK1 A;  2EJ7 A;  4X1I A;  3SPG A;  3JSL A;  2DJV A;  3T1H B;  1Q81 W;  3E22 B;  1H2M A;  2N04 A;  1RSO A;  5B66 Z;  2HG5 C;  1YSC A;  2GV9 A;  2OTL V;  1Q43 A;  4J41 A;  3AEI A;  1XEQ A;  4X66 B;  1FAF A;  2R70 A;  3FYE B;  5FNV A;  1N8R W;  3CYO A;  1GN3 A;  4PD4 F;  4MTX A;  1X4T A;  1ZL8 A;  4JF3 A;  3B8M A;  1D5N A;  3RYC A;  4FM0 A;  2Y0I A;  3DXR B;  5KAF Z;  3QF7 A;  1ORQ C;  3G80 A;  1LNQ A;  4J10 A;  5DM6 V;  5B5E Z;  4DV3 O;  2ADP A;  1ZTE A;  1N36 O;  3HKB B;  2XTA A;  2ZNJ A;  3R65 A;  1NR1 A;  1OCO B;  2WLI A;  3PJS K;  1YF2 A;  2ZXW C;  3BFR A;  3T4Z A;  1JVM A;  4OPH A;  1SRY A;  4WFH A;  2DWD C;  2RNB A;  4NKG B;  2HVJ C;  1TAE A;  1B3Q A;  1NJI W;  1TUB B;  5EZY B;  2QSA A;  1N0J A;  5FL7 G;  2AZ2 A;  1PNK A;  1JX9 A;  4BAY A;  3FAV A;  5JJN B;  3ZMT A;  1IX9 A;  4HBN A;  2EBO A;  5D5P A;  2LJ2 A;  5H2F Z;  4HYO A;  1F7Y A;  2P6J A;  1BSM A;  5IYD O;  4LFA O;  2YS8 A;  4TV9 A;  2QM7 A;  3OM3 B;  1TVK B;  5KHK A;  2D3O W;  5LOV A;  4P9O A;  2YIC A;  4H33 A;  2PF4 E;  1HWY A;  2AHY A;  2XAG A;  3QG5 A;  4G28 B;  1V55 B;  4X9Q A;  3B40 A;  3N2K A;  4HNA B;  1Y76 B;  4UUJ C;  4Z1M G;  5JJJ B;  3ZHR A;  3H01 A;  3K5N A;  1OCO C;  2IH1 C;  4JV5 B;  4HZ3 A;  5EIB D;  2HFE C;  2HR3 A;  5EYP B;  1SA0 A;  2WA4 A;  3VQX A;  1L1F A;  2B1I A;  3ZMS A;  2KG7 A;  1US6 A;  5HFL A;  3VQW A;  2XAF A;  1R3J C;  4JAU A;  3THO A;  4DV2 O;  2FL4 A;  3JAK B;  4R7C A;  4DR1 B;  3N27 A;  4ZI7 A;  1VIB A;  4B08 A;  2GSM B;  1E1Q G;  4J11 A;  1EN6 A;  1VQ4 V;  4LFA B;  5EBW C;  4JI5 B;  1RPO A;  1SC5 B;  4LF9 B;  3JAR A;  2QEX V;  3E86 A;  3I5D A;  4YXW G;  1I7F A;  1NH2 D;  1UFI A;  5IY5 B;  4B7E A;  5LXT B;  1H2N A;  1KMI Z;  4FM2 A;  1AR5 A;  2RJZ A;  4UB8 Z;  2AXT Z;  2WPD G;  1S5H C;  5KA6 A;  3SPH A;  1VQP V;  4YJ3 A;  4RQF A;  5B3S B;  1W2B U;  1N4C A;  1ZLZ A;  1FXK B;  2OYQ A;  4FFK A;  4PA3 A;  4U7N A;  1ZX3 A;  2DYR C;  4C7U A;  1WB7 A;  4GX0 A;  1IBM B;  1I94 O;  2C2A A;  2ZNI A;  2M7W A;  2BE3 A;  2F4V O;  3AK2 A;  3CB2 A;  1R3L C;  4YJ2 B;  2Y69 C;  1F4M A;  1BGY H;  1SES A;  4NVP A;  3KCY A;  1AI6 A;  1K8A W;  4ZBM A;  1MAB G;  4LF5 O;  4IYI A;  5IT9 N;  3FB7 C;  3AG1 C;  3H1I H;  4ZHQ A;  1QR9 A;  4O2A B;  2VS0 A;  1GK9 A;  3K79 A;  1F23 A;  4DV7 O;  1YEW A;  2X7R B;  3CCU V;  1WAZ A;  3T2M A;  1IBK O;  2W0F C;  2JGD A;  1YXB A;  4W4K A;  5EBM C;  5LHI A;  3SJQ C;  4K8X A;  2ZR3 A;  2FML A;  1H2K A;  1F51 A;  5BXZ A;  2WWW A;  1L0L H;  3BAA A;  1HNX B;  1AR1 B;  3HKB A;  3SYP A;  1Q8I A;  2HJD A;  1IVS A;  1SQB H;  2YXY A;  3D3Q A;  3HR0 A;  1QQC A;  4DW0 A;  1PV0 A;  1R3I C;  3K0G A;  1HDJ A;  3KKY A;  3LDC A;  4JYB A;  1IBL O;  4DYL A;  1WLE A;  1RM1 B;  5KUM A;  4U3J A;  2ETN A;  3EHB B;  4DRX A;  2Q6A A;  1WB8 A;  1XMO O;  2Y4T A;  3JD2 A;  1XRE A;  4GX1 A;  2ODM A;  3ABL B;  1AJN A;  1WP7 A;  3ABK C;  2W0X A;  1NTZ H;  3L71 H;  5BMV A;  4B3T O;  4FLZ A;  2YC0 A;  3TCU A;  2GDS A;  4O4H B;  2YIA A;  2UUB B;  4JI6 O;  3K04 A;  4DO2 A;  1QHT A;  1Y67 A;  1ZAU A;  1Y76 A;  1XL4 A;  2IJJ A;  2JIZ G;  2KSD A;  2UUB O;  4JI8 O;  3APO A;  1VQN V;  1YJW V;  4LFB O;  3NR7 A;  3CJH A;  4LNU B;  4LH6 A;  5LMN B;  2AW9 A;  4FLX A;  4TV8 A;  3OMA B;  4DR1 O;  2ZD9 A;  3Q4H B;  2CH7 B;  1OV9 A;  4JI6 B;  2ITD C;  3ZJZ A;  4XDJ A;  3K0D A;  5BMV B;  5L3F A;  2EZO A;  3Q4H A;  1GN6 A;  1FJG B;  1BHB A;  5LP6 C;  3STZ C;  3ABK B;  4PHZ A;  3CCM V;  2F23 A;  5L3G A;  1EN4 A;  4O4I B;  1KUQ A;  4OX9 B;  3CS5 A;  3G6E V;  2E5L B;  3DTU B;  3F5W C;  1G4Y B;  1KP2 A;  3AG3 C;  4DR7 B;  3SPJ A;  1FKA O;  3B09 A;  4NTX A;  4UCO A;  3CWB H;  1V9P A;  2GTA A;  3EFF K;  2ZE8 A;  2FTK A;  1K73 W;  3ABU A;  4CS3 A;  4X8A A;  4LF7 O;  5B1A B;  4UV9 A;  2JK5 C;  1JCH A;  3B77 A;  4PI0 A;  2QKC A;  3IJ4 A;  1KU9 A;  4LH7 A;  3H1J H;  4GKK O;  1SZT A;  1K34 A;  3L72 H;  2A9H A;  4DV5 B;  3ABT A;  4XDK A;  5A2Q N;  5KLV H;  2P06 A;  2YXH A;  1JJO A;  5IWA B;  2HKO A;  3HKD B;  4N23 A;  1SQQ H;  3OR7 C;  4LF5 B;  4NYK A;  4FMT A;  1WPX A;  3F7V C;  3IC7 A;  5H5N A;  2QWQ B;  1PKX A;  4BIZ A;  3ZMZ A;  2QGN A;  3ETG A;  4UCV A;  2XT9 A;  4O2B A;  1J5E O;  3RYC B;  4FFB B;  5J9P C;  2Y48 A;  5IJ0 B;  1Y66 A;  2DMX A;  1XNQ B;  4DV7 B;  4RO2 A;  2KQX A;  3N2K B;  3HKD A;  3FAV B;  4G27 B;  4KXR A;  4KUM A;  4JI2 O;  1VQ7 V;  2EIJ B;  1N34 B;  2DE0 X;  2IH3 C;  1OCZ B;  1NVP B;  3RVY A;  3T1H O;  2ZM6 B;  3ZRS A;  4LWS A;  1SQP H;  4KHP O;  4CC5 A;  3K06 A;  1IBM O;  4DR7 O;  4MVM A;  1R6N A;  1HW7 A;  4DV2 B;  4OX9 O;  4UCR A;  1VAR A;  5LP6 B;  3WB0 A;  4JYA B;  1Q86 W;  3BA8 A;  2Y0P A;  1ZUQ A;  1NZ6 A;  5CA3 A;  3ZED A;  3ZN0 A;  3OFN G;  1KYO F;  2OCC B;  3RYH A;  1IDS A;  1R73 A;  2E76 B;  4AIL C;  1JPX A;  3HKC B;  1GMG A;  4B3R O;  2Q8V A;  2AHZ A;  2OIG A;  1H2L A;  2NR5 A;  3JCU Z;  4MVU A;  3OT7 A;  3UM7 A;  1D2D A;  2WLN A;  3L9D A;  1AI4 A;  2QWP B;  3A0H Z;  1V54 B;  5IDJ A;  4KFM A;  1YTF B;  1K3E A;  4FIP C;  1W59 A;  1K4D C;  1TVK A;  1F4N A;  4QJF B;  1VMG A;  2JEU A;  4KP4 A;  2QKA A;  2Q7G A;  2Q7E A;  3ZHU A;  3CRM A;  2FYU H;  1S3J A;  4MT8 A;  2P4V A;  5FNV B;  3OUF A;  4RAI A;  2WLI B;  2P22 C;  3HKC A;  1RP3 B;  2XAH A;  5LGT A;  4YY3 B;  3ZHT A;  2Q9L A;  2WLJ A;  4DV1 O;  1BT8 A;  3BPZ A;  3OUS A;  3SPI A;  4I5S A;  2ZCE A;  3FFQ A;  2GUZ B;  2JGD B;  1G6U A;  1SET A;  2UXD B;  1V54 C;  2LGW A;  3ETQ A;  1V55 C;  2GTS A;  2DN9 A;  2ZKO A;  1H8E G;  1Q6H A;  2DW4 A;  1IUR A;  3P3N A;  2M6Y A;  1FPO A;  3K58 A;  4ZHQ B;  1XOU A;  3MDS A;  3K57 A;  1TGO A;  5EC1 C;  3ZHV A;  1N0N A;  2N74 A;  2LP7 A;  4GUN A;  2R72 A;  2PYJ A;  4MVO A;  2EIM B;  3UO3 A;  2LW1 A;  2CTW A;  3CCV V;  3MHH C;  2HLD G;  2ILM A;  3G71 V;  2WA3 A;  2W6J G;  1AP6 A;  2ZE5 A;  3E8G A;  3O9O A;  2Y4U A;  4QPJ A;  2VQE B;  1H2S B;  1YDX A;  4CBC A;  3O65 A;  1K97 A;  1WA8 A;  2NN4 A;  2CAZ C;  2KB1 A;  4WFB V;  1PNL A;  4AQY O;  1S5J A;  3JAW B;  3RN4 A;  3FB5 C;  2OIE A;  2EIL B;  4NXM O;  2NNU A;  3MD0 A;  1JR9 A;  4OPA A;  4PDL A;  4MTO A;  4J7J A;  1M90 W;  2JDI G;  4J7K A;  4B3M O;  3ABL C;  2IJK A;  1E79 G;  2CTR A;  2EJR A;  4WBN A;  5KHJ A;  3ABM B;  4MSW C;  1H8H G;  3WU2 Z;  2CH7 A;  1N32 B;  4DR4 B;  1B6Q A;  1ROP A;  5GW7 A;  3C90 A;  3ETD A;  4Q20 A;  3CEI A;  1NTM H;  1OZ0 A;  2HEP A;  3CJH B;  5LGU A;  4DV4 B;  2UUA B;  2XND G;  1DLB A;  4Q6G A;  2UUC B;  3I56 V;  4TWK A;  3CCL V;  4JTD B;  2EIL C;  1Q6I A;  5JQG B;  4YJ3 B;  4WF9 V;  1S77 D;  3P30 A;  2A06 H;  2V7Q G;  5LL6 Y;  4IYH A;  4HAM A;  5LHG A;  3QTC A;  5BR8 B;  1XI1 A;  2UXC B;  4JI5 O;  2JS3 A;  4X1K A;  3OTF A;  4CH6 A;  2IW5 A;  2ZIN A;  4JI3 O;  2RN9 A;  3QO8 A;  1DGS A;  4MVS A;  2LFS A;  1OCZ C;  3R66 A;  3RBZ A;  4Z2W A;  4UCT A;  3EVK A;  2K9P A;  1RPR A;  4MTF A;  2F93 B;  4PDV A;  1QLN A;  4DR4 O;  3C3S A;  2UUC O;  4KL1 A;  1YTF D;  2R9R B;  4FLV A;  4MVZ A;  2YID A;  4O4L B;  4DUZ B;  4WFA V;  3ZCC A;  4DV6 B;  2D2C B;  3JSN A;  5GON A;  4I0X B;  4FM1 A;  3PN1 A;  4ZOL A;  3JAM N;  2DYR B;  5IE9 A;  4LC1 A;  3IC9 A;  2BSK B;  3JAS A;  1YI2 V;  2WLL A;  5J2T A;  5IYZ B;  2CDY A;  5CA1 B;  2AZ0 A;  3OTO O;  4IGG A;  1YIJ V;  5EYP A;  4E2L A;  5JVD B;  2IBZ H;  1N33 O;  4EB6 A;  3WFV A;  4X1Y A;  1WJZ A;  4E4E A;  4TV8 B;  3SYC A;  5J2U B;  3OW2 U;  4DV0 B;  3T1Y O;  1K4C C;  4LF4 O;  4O4L A;  4LBE C;  3ZX6 A;  4CS2 A;  4O4J B;  1O9G A;  1CPY A;  2QWR B;  1NI8 A;  4CZZ A;  4LF4 B;  4F6E A;  3WG7 B;  4IHJ A;  4NR1 A;  1U96 A;  5B1A C;  2B1G A;  2DQ3 A;  2Q4P A;  2Q0O C;  1MOF A;  1KEC A;  5EC2 C;  4D7S A;  2E5L O;  1YCI A;  3AG4 B;  4MW8 A;  2A79 B;  1M57 C;  2Q7H A;  3T1Y B;  1AVM A;  3E22 A;  3FX7 A;  5LGN A;  2Z0A A;  2EIN C;  4FLY A;  3P3P A;  1IXM A;  3ZS8 C;  3OR6 C;  4DV3 B;  3JAS B;  1MA1 A;  4CS4 A;  5KHG A;  1TA8 A;  5JCO A;  3AK3 A;  1THZ A;  4PJ0 Z;  1XHX A;  3LUT B;  4JTC B;  3E89 A;  4DR5 B;  5CB4 A;  1P7B A;  4TQD A;  3CCR V;  4LCU C;  2X0L A;  4IL6 Z;  2F66 C;  2UXN A;  4X66 O;  1HP8 A;  1TUE B;  4DV6 O;  1WP8 A;  2WLK A;  3SJB C;  5JH7 A;  2E75 B;  2DQ0 A;  2WLH A;  4DUZ O;  4MW3 A;  2GHY A;  2UXC O;  3RFR A;  2HP8 A;  3A0R A;  1GRJ A;  3CC4 V;  1NKD A;  2UXB B;  3OEH G;  4EFB A;  1B04 A;  4JI7 O;  4ZOL B;  5B1B C;  2O57 A;  1H38 A;  2OCC C;  5KA5 A;  2CGO A;  1MMM A;  4GZR B;  3CRQ A;  4U3F H;  1Q90 D;  1VF7 A;  2K1E A;  3IFX A;  3STL C;  1VQ5 V;  1FXV A;  3UT5 B;  2VQF O;  1KQS U;  5K1X A;  2IU3 A;  3L73 H;  2V1D A;  3MHS C;  3E83 A;  5GTI Z;  3QO7 A;  2P90 A;  4G2K A;  2R9A A;  1QVF U;  2Q73 A;  5B3S C;  1N32 O;  3H1K H;  5JQG A;  4EKW A;  4JI1 O;  1MSD A;  4FLW A;  3F7Y C;  1M9N A;  1MG1 A;  5TIS Z;  4DUY O;  3ICX A;  3JYC A;  3JD3 A;  3VQV A;  1IBK B;  3K3W A;  2PI5 A;  4WFF A;  3SGI A;  1PD3 A;  2PGG A;  2KG7 B;  3D3I A;  3SDL A;  5CN0 A;  4PV1 B;  1AI7 A;  1I08 A;  2VQE O;  4CC6 A;  1I0H A;  3CSX A;  2Z3Y A;  4PA7 A;  2QDO A;  1M4U A;  3CXC U;  1G1X B;  1FFX B;  3OGI B;  5HFM A;  5KX5 A;  4J9Z B;  5C8Y B;  2YSU B;  4YJ2 A;  1XMQ B;  2ZIO A;  1KBH A;  4BW9 A;  4GX2 A;  3JAR B;  1NR7 A;  2Q0A A;  2F43 G;  3TGU H;  1VF6 A;  5H6R A;  2ZIM A;  2QTO A;  5JVD A;  2GBO A;  1Q6U A;  1SQX H;  3FKS G;  1HNW B;  5IYZ A;  1FYJ A;  2P5O A;  4B3S B;  4LWS B;  1Q5O A;  1W0K G;  2QJ1 A;  3JAT A;  2EIK B;  1JOY A;  1I5X A;  1PPJ H;  4UXN A;  1M57 B;  1VQ6 V;  5LYJ A;  4JAS A;  4RQE A;  2JS5 A;  4X62 B;  1FS0 G;  1Y4M A;  4R50 A;  3JAL A;  1XQ8 A;  2BOC C;  3ASO B;  4DXW A;  1GM8 A;  1NQT A;  2V4D A;  4DV1 B;  2HVK C;  4DRX B;  2PYL A;  4DK1 A;  1QU7 A;  3C3T A;  1Z5V A;  2Q5Z A;  4DV5 O;  1VQL V;  1WA8 B;  2BTQ B;  1EFR G;  5FPR A;  1Z5W A;  4LFC B;  4U7O A;  3CMA V;  4LF9 O;  4LF7 B;  4WFG A;  3T4D A;  2OCH A;  1K33 A;  2Q67 A;  5AG2 A;  1Q3E A;  5C8Y A;  3LSQ A;  3U11 A;  1ARO P;  5IJ0 A;  5B1N A;  3E8F A;  1NU1 H;  3SYA A;  2HJF C;  1Y74 A;  2RQ6 A;  3CHX A;  4GKJ B;  1M5I A;  1URF A;  3CCE V;  4K0K O;  2IU0 A;  3ZHQ A;  4YHH O;  3HKE A;  3JAT B;  3T1C A;  1GN4 A;  1DF5 A;  3K9S A;  4ASU G;  3FD9 A;  1WPB A;  4R6Z A;  1HR0 O;  2EIN B;  3HKE B;  3H1H H;  5L3B A;  4YY3 O;  2RDC A;  4RWU A;  3TK1 A;  3AK1 A;  2CGN A;  4NTW A;  4JZG A;  2MK3 A;  2YI9 A;  3UT5 A;  1CEZ A;  2CTP A;  3E2E A;  4DR2 O;  4ICG A;  1IZ3 A;  1L8D A;  1FXK A;  3A8T A;  4PA6 A;  1X59 A;  2PI4 A;  1AI5 A;  2F95 B;  2LGQ A;  4O4J A;  1QR8 A;  2B9Z A;  3CXH F;  4X65 B;  2L35 A;  3UKM A;  4TUY A;  2QM8 A;  4H44 B;  3QVN A;  3X2Q C;  5IYB O;  1VF6 C;  1MSW D;  4DR3 O;  1K7D A;  3SYO A;  3H9V A;  4L8J A;  4JYA O;  3AG1 B;  1AR4 A;  1M1K W;  4XDL A;  4YIO A;  1K5S A;  3D8C A;  3KCX A;  3CC2 V;  1B06 A;  3ZRV A;  3HPL C;  4LF6 B;  2ZDI A;  1DTO A;  4I50 A;  2OTJ V;  3ZRW B;  3S3X A;  2A7W A;  1Y74 B;  1GH6 A;  3OGC C;  4FZ1 A;  4DR6 B;  1R6K A;  2UXX A;  2IJI A;  2LQT A;  2N05 A;  1EBO A;  4LR3 A;  2WSS G;  4BIO A;  1AP5 A;  5B1B B;  1GTO A;  3P32 A;  3FB8 C;  4GKK B;  1AJQ A;  1WN7 A;  2VRZ A;  2ZQM A;  4JI4 O;  1JFF B;  4I7Z B;  2QR4 A;  2YDE A;  4DK0 A;  4NTY A;  1GM7 A;  2NLJ C;  1ENV A;  2QWO B;  1JJ2 U;  2HHH O;  3JAL B;  3ZRW A;  2BTO A;  4PDM A;  4L87 A;  5EIB C;  1I94 B;  1J5E B;  3BHP A;  2P67 A;  2EIM C;  1OCC C;  4JI0 O;  1ZSP A;  1KKC A;  2XHB A;  2YI8 A;  5IJ9 B;  3CX5 F;  3GWO A;  4GT1 A;  1QBZ A;  4AI8 A;  1M56 B;  4LP8 A;  2PZS A;  5CA0 B;  3ASO C;  5IWA O;  1LUV A;  4LF6 O;  3G6B A;  4JAV A;  4X65 O;  3CPW U;  3RT3 C;  4JGS A;  3RYI B;  3JAW A;  2EX3 A;  4OXS A;  5CA0 A;  4JTA B;  1HR0 B;  5FPO A;  2A0L A;  4F6R A;  1AJP A;  1JA8 A;  5LMN O;  2E74 B;  3W7T A;  1BCC H;  2VWJ A;  3ZBH A;  1NVP D;  1MZE A;  4X88 A;  3IGA C;  4N21 A;  4TOI A;  3GB7 C;  5EBL C;  3VOU A;  3S3W A;  3CRC A;  3DSQ A;  5BZB A;  1DF4 A;  2QA4 V;  4QE7 A;  1NT2 B;  3CRR A;  4I50 B;  4UVA A;  4B7K A;  5IJ9 A;  5GTH Z;  4I4T A;  4DR5 O;  3E35 A;  4QGP A;  1FXK C;  4YHH B;  5L3C A;  5H9C A;  3ZMU A;  1EN5 A;  4Z1V A;  1SS3 A;  5JCO C;  3UO2 A;  1IBL B;  3HB3 B;  1I5Y A;  1BZK A;  3J81 N;  1JMK C;  4JV5 O;  2YUA A;  3APQ A;  1KP3 A;  2MW2 B;  2BSK A;  3D36 A;  3OAA G;  2X6B A;  3OEE G;  4LFC O;  3W7W A;  1EM1 A;  1WNS A;  2YEV A;  2RCV A;  5CBH A;  2PTM A;  4EB6 B;  1Z2G A;  2HHH B;  1VQM V;  4TV9 B;  1YJN V;  4CH5 A;  3FYI B;  1TUB A;  5EZY A;  2JJ2 G;  4GX5 A;  1Q82 W;  4JI4 B;  4BR6 A;  1LR1 A;  4J80 A;  1XMO B;  1KKD A;  4JI2 B;  2BCC H;  1OHH G;  5E1A C;  2RMK B;  3I55 V;  4DW1 A;  4PI2 A;  2XAQ A;  4GLX A;  4LF8 O;  3SJA C;  2F4V B;  5DN6 G;  4X64 O;  5LOV B;  3CC7 V;  4O2A A;  2ZT9 B;  2UU9 B;  2F1M A;  3E8B A;  3LNM B;  4DUY B;  3CME V;  3F5T A;  2UU9 O;  4BW5 A;  4ABM A;  1XBL A;  3M99 B;  4TT3 G;  2GUZ A;  2L6L A;  5L3D A;  1XUQ A;  3BRC A;  4IIJ A;  5FLX N;  4LF8 B;  4TQF A;  3JD1 A;  2XUM A;  2WAM A;  1O9H A;  1VP7 A;  5H6Q A;  3W7S A;  1XMQ O;  1GAX A;  1YVW A;  3W7U A;  3KG2 A;  1XDC A;  3A2F A;  4FJC C;  2BTQ A;  3RWR D;  2AGA A;  2VWK A;  3UQ8 A;  5KMG A;  1MNG A;  4CH4 A;  1S0V A;  4D7T A;  4FK5 C;  3J80 N;  3LSU A;  1SQG A;  5L3E A;  1QLE C;  2ITC C;  3ZIA G;  1BQ0 A;  4PDR A;  5BR8 O;  4QE9 A;  2OT5 A;  5CBF A;  4X1Y B;  3U0Z A;  1BMF G;  3BEH A;  1R6T A;  1QCE A;  4XBF A;  1SKV A;  1RM1 C;  4UV8 A;  4IIJ B;  3OD4 A;  1J95 A;  1EZV H;  1Y6X A;  4J7Z A;  4FVM A;  1KC8 W;  4MVQ A;  3X2Q B;  2QWN B;  4X1K B;  1SZX A;  1BQZ A;  4IT5 A;  4JI1 B;  1SQF A;  4DR2 B;  5JJE B;  3AG7 A;  4MTG A;  3DC6 A;  1FJG O;  1KB9 F;  4O2B B;  5KHI A;  3JCZ A;  3ASN C;  1NH2 B;  3LDE A;  5KUK A;  2PY5 A;  2CK3 G;  1PL0 A;  1JQ0 A;  2A3Q A;  1S72 V;  3N2G A;  3WB2 A;  4X20 B;  1HNZ O;  4NXM B;  5D5Q A;  4R8C A;  3ETE A;  2YXL A;  1GO3 F;  5ITZ A;  1FFX A;  4I4T B;  4GKJ O;  5LA6 B;  1ZL8 B;  3IAY A;  3TET A;  2ADQ B;  2FKX A;  5K1P A;  1K9M W;  3KZI Z;  1CXZ B;  2Q68 A;  1SQV H;  3AG3 B;  1D5A A;  2QKS A;  4FFB A;  3L75 H;  4FPP A;  2CUG A;  4JZ2 A;  1RFY A;  3N2G B;  2DOS A;  2ARH A;  1YJ9 V;  4K0K B;  4PA4 A;  2ZE7 A;  1IXB A;  2BOB C;  1NTK H;  5ITZ B;  4OGQ B;  2XOK G;  1M56 C;  3B4S A;  2WLM A;  4JYC A;  1FXH A;  3G67 A;  4F4L A;  4K35 A;  3W7X A;  4QNH B;  4WCE V;  4PA9 A;  2YIB A;  5LYJ B;  4I9Q A;  1VQK V;  4QIW F;  1N36 B;  3CCS V;  3JD0 A;  3RYH B;  4EEQ A;  3U10 A;  3RW0 A;  2IM9 A;  3UCS C;  1S5L Z;  3FB6 C;  1HNW O;  3TXS A;  2JVD A;  1NBM G;  2QM4 A;  5LBQ A;  3A0B Z;  3K5O A;  1XHZ A;  2JGU A;  3BVO A;  1R1B A;  4P2Z A;  2P7T C;  1YIT V;  3K5L A;  1N33 B;  3J7A U;  3ZHS A;  1YHQ V;  2ZXW B;  2JJ1 G;  2CTQ A;  1GM9 A;  1K5Q A;  4DV0 O;  1SF9 A;  2X6A A;  4I0X A;  3TJT A;  1BE3 H;  1HNZ B;  1CP9 A;  5JH7 B;  2G38 A;  1U97 A;  2WLL B;  4DR6 O;  3OTO B;  1G8M A;  3CE2 A;  1PP9 H;  3DC5 A;  4P30 A;  4BIU A;  4NXN O;  4UVB A;  3BY6 A;  2DWE C;  4RUF A;  3AG4 C;  4O4I A;  4U3J B;  2JEX A;  2KKW A;  2EIK C;  3SYQ A;  2EZP A;  2ZDI C;  1XNR O;  3ZMV A;  1OCR C;  4JI3 B;  1KD1 W;  1K92 A;  1QVG U;  1NS1 A;  5C93 A;  3CCJ V;  1PL4 A;  4DR3 B;  3WG7 C;  1XNR B;  5IY5 C;  2H8P C;  4JPR A;  2JRI A;  3RYF B;  5BY1 A;  2Z5U A;  5E79 Z;  4KHP B;  2CE4 A;  4H0L B;  1JFF A;  5LHH A;  3SJC C;  4B3M B;  1ZWI C;  3LDD A;  5B1O A;  4BWA A;  4K3A A;  4UFZ A;  2QTS A;  3CP1 A;  4QPK A;  5J2T B;  3EXA A;  4I9W A;  1VQ8 V;  4DV4 O;  1FD9 A;  3ZRX A;  1P4R A;  5KHH A;  4AQY B;  4HNA A;  3TXQ A;  5GON B;  4WBN B;  1GKF A;  1A32 A;  3CRA A;  2Y69 B;  4NXN B;  1P7G A;  4X89 A;  1P84 F;  2VQF B;  4NB5 A;  5DEC A;  1SER A;  2DYS C;  2OWO A;  3WB1 A;  2X6C A;  4AHC A;  4J9Y B;  2EUL A;  3JAK A;  2FB5 A;  5IYC O;  1VF5 B;  2LW7 A;  3RYI A;  4FZ0 A;  1RSO B;  3D36 C;  5DED A;  1VQ9 V;  4A5U B;  5J2U A;  4WFE A;  1AB3 A;  3BAB A;  4TSF G;  3AG2 B;  4ZIB A;  3MAQ A;  3K9A A;  5CMU A;  2PUS A;  1COW G;  2ATK C;  3SPC A;  1MZF A;  1T5E A;  1VQO V;  1R3K C;  1BL8 A;  3DXR A;  3CCQ V;  4RUE A;  3L70 H;  2UXD O;  2QE7 G;  1PM9 A;  3JD4 A;  2H3O A;  1EZJ A;  2YEV B;  4LNU A;  1LUW A;  3VBB A;  1OCR B;  3VQY A;  4JYY A;  2XAJ A;  2R9I A;  4MS2 A;  3RVZ A;  2H94 A;  5CA1 A;  4UCU A;  4O4H A;  1S76 D;  3LSS A;  4W4L A;  4P9P A;  3G4S V;  1XL6 A;  3H1L H;  4EFE A;  4J42 A;  4YIP A;  4I55 A;  3LNN A;  2E3C A;  4X62 O;  5LXT A;  3L74 H;  3RYF A;  2W6I G; 
#chains in the Genus database with same CATH homology
 2DJV A;  3J81 N;  4B3S O;  3T1H O;  4JI5 O;  5BR8 O;  3SDL A;  1AIL A;  4DV7 O;  2N74 A;  2VQE O;  4JV5 O;  2HHH O;  1YZB A;  4DV4 O;  1HR0 O;  4JI3 O;  1IBK O;  4KHP O;  1R6T A;  4YY3 O;  1IBM O;  1XEQ A;  1KUQ A;  3R66 A;  1G1X B;  4DR7 O;  4DV2 O;  5BXZ A;  4JI0 O;  4LFC O;  4DR4 O;  2UUC O;  1A32 A;  4OX9 O;  1FKA O;  4X66 O;  1HNW O;  4DV6 O;  4DR2 O;  1R1B A;  4DUZ O;  4LF7 O;  1FYJ A;  2UXC O;  3O65 A;  4DV3 O;  1FJG O;  3J7A U;  3JAM N;  5IWA O;  4LF6 O;  4B3R O;  1X59 A;  1IBL O;  1N36 O;  4X65 O;  3RT3 C;  4GKK O;  1D2D A;  4AQY O;  1XMO O;  4DV0 O;  4JI7 O;  2LW7 A;  4OPH A;  3M8A A;  4A5U B;  5A2Q N;  3OTO O;  4NXM O;  1AB3 A;  2ZM6 O;  4OPA A;  1N33 O;  5LMN O;  4B3M O;  4DR6 O;  1HNZ O;  4DR3 O;  4LF8 O;  4B3T O;  4X64 O;  2VQF O;  4DV5 O;  4JYA O;  3T1Y O;  4NXN O;  4LF4 O;  5H5N A;  4JI6 O;  4GKJ O;  2UXD O;  4LF9 O;  2UU9 O;  3F5T A;  2UUB O;  4JI8 O;  1N32 O;  1XNQ O;  1XNR O;  1J5E O;  1F7Y A;  2FKX A;  4JI1 O;  1I94 O;  4LFA O;  4LFB O;  2UUA O;  1NS1 A;  2F4V O;  5FLX N;  4DV1 O;  1HNX O;  4DR1 O;  1XMQ O;  4DUY O;  4DR5 O;  2E5L O;  2JRI A;  5BY1 A;  1N34 O;  2AGA A;  5LMU O;  4JI2 O;  2DOS A;  2ZKO A;  5LL6 Y;  4K0K O;  4LF5 O;  4X62 O;  2Z0A A;  5IT9 N;  2UXB O;  4YHH O;  3J80 N;  1DK1 A;  4JI4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...