4DV2O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv2O00
3SDLA 4LFAO 2UXBO 4B3TO 4DR6O 3J81N 3JAMN 3J7AU 4DR1O 1HR0O 4JI3O 1D2DA 2VQFO 1R6TA 3RT3C 1XMQO 4JI2O 2DOSA 1J5EO 4DUZO 4JI4O 1HNXO 4KHPO 3J80N 5BR8O 4LF6O 1XEQA 4LF8O 5LL6Y 4A5UB 4K0KO 4DV3O 2UXDO 4JI6O 2UXCO 2VQEO 2AGAA 5A2QN 4X64O 4X62O 1R1BA 4GKJO 4B3SO 4DR4O 1N34O 4DV0O 4JYAO 1DK1A 1XMOO 1FKAO 1YZBA 2ZKOA 1XNQO 1IBMO 3F5TA 4DV7O 1I94O 1FYJA 4OPHA 4GKKO 4DV5O 1IBLO 4DR7O 2UUCO 1G1XB 4JI1O 1NS1A 2UU9O 3M8AA 2UUBO 1F7YA 4B3MO 1FJGO 1HNZO 3T1HO 5LMNO 5BY1A 5LMUO 4DR3O 5IT9N 2UUAO 4DV4O 5BXZA 4OPAA 3T1YO 4NXMO 1A32A 4JI5O 1XNRO 4B3RO 2F4VO 4DUYO 4DV1O 4X66O 4DR5O 4LF4O 1N33O 4DV2O 1IBKO 1AB3A 2DJVA 4OX9O 1N36O 1N32O 1AILA 4X65O 2Z0AA 1HNWO 4DR2O 4DV6O 4LF9O 1KUQA 4JI0O 4JV5O 4LFCO 2ZM6O 5H5NA 5IWAO 2LW7A 5FLXN 1X59A 4JI8O 4LFBO 3O65A 2FKXA 2JRIA 2E5LO 4JI7O 4YHHO 4AQYO 2HHHO 2N74A 4NXNO 4LF5O 4YY3O 3OTOO 4LF7O 3R66A
chains in the Genus database with same CATH superfamily
1J5EB 4DR6O 4GLXA 2EILB 2EINC 4O4IA 3RT3C 2NR5A 4CC6A 3A0RA 3K3WA 4FLUA 3BEHA 1JJ2U 2CTRA 2V7QG 1WA8B 5EBMC 4JI6B 4UCVA 4IGGA 2Q7GA 2LGWA 4LFAB 2DW4A 3CRRA 4L87A 4UV8A 4B3TB 1GAXA 1EN5A 4C7UA 1XMOB 2BTQA 2EIJB 1IBMB 1AJQA 3ZHQA 4MVRA 2P6JA 4XDJA 3UKMA 4CS3A 5KHJA 2QGNA 3OUFA 1V54B 1AR5A 1GO3F 1XREA 2A3QA 3E8BA 2GTAA 4KFMA 1FYJA 4PA6A 5JJEB 1IBLO 3CMAV 5JVDA 2XAHA 3K0DA 1BGYH 1VEWA 1N34B 1WP7A 5EBWC 3SR2C 3G6EV 2LP7A 3OR7C 5J2UB 4DV4O 5BXZA 2QWNB 4RUFA 4GCZA 4LR3A 4HZ3A 4K8ZA 2EJ7A 4ZHQB 3OUSA 4QIWF 5L3BA 4GX2A 3K5MA 2DJVA 2UXNA 1WB8A 4JV5B 1KP3A 2X6CA 2RNBA 5A9GA 5DM6V 3EFFK 1FFXB 1WB7A 4E4EA 2KQXA 4FM1A 2GBOA 2FL4A 1IX9A 1OZ0A 4YXWG 5GTHZ 2N74A 5B1BC 4LF5O 3CS5A 4UXNA 3K57A 2Z3YA 3K79A 1OHHG 3PJSK 3AG2C 1K73W 3OTFA 4LFCB 2WPDG 4CH4A 3B8NA 1VP7A 2VQFO 1EM1A 3T1CA 5AG2A 4LH6A 3N27A 4K0KO 4CC5A 5KX5A 3JAKA 4CBCA 2JS3A 2IM9A 2NLJC 1MSWD 1O9HA 3RYHA 5B66Z 3OMNB 4B7EA 3W7XA 3CRMA 3APQA 1TUEB 1DGSA 5LYJA 3RYIA 1IXBA 1I94O 2ADPA 3SYOA 4DV5O 4X89A 5FPOA 1Q6UA 1K8AW 5KHGA 5IYDO 3ZN1A 4RO2A 2FYUH 3CCUV 4F6EA 3BFRA 4GT1A 1Y76A 4J41A 4IIJB 5LP6A 3JD2A 4FLYA 1DF4A 3IC7A 2UU9B 4DV2O 4DR2B 4UVAA 2JGUA 3ASNC 3MAQA 3Q4HA 5LA6A 3CEIA 5EYPA 5GONB 3ABMC 2QKAA 2XNDG 1ZSPA 4PV1B 4X88A 2ZM6O 3A8TA 1G6UA 3ZRXA 1FXVA 2OIGA 1GM7A 1KU9A 3ZJZA 4NXNO 1Y66A 4ZKIA 3TJTA 2AHZA 4I0XA 2WA3A 1ZLZA 1S3JA 1AVMA 1NBMG 5JCOC 3D36A 1YTFB 1F23A 3ZRSA 4QJFB 1IURA 4I50A 1WAZA 2HKOA 1Q43A 4RQEA 1HNXO 3SPJA 1E79G 4EEQA 5L3GA 2PI4A 1JMKC 3FYIB 1M56C 2D2CB 3CHXA 5IJ0B 2JVDA 4FFBA 2P4VA 2RQ6A 2D3OW 2EIMC 4NVPA 5JQGA 1XNQO 1M93A 5JCOA 4IYIA 1L0LH 5KA6A 4LNUB 2QR4A 4O4LA 4JTCB 3LSUA 2WA4A 2L6LA 2PYLA 2NN4A 2KSDA 3QF7A 4HNAA 2DMXA 1HNZO 3TGUH 4RUEA 5IY5B 4MW3A 2UUAO 2CE4A 2WLJA 3ABLB 1XNRB 4BW5A 2BSKB 2M7WA 4OPAA 4FIPC 1K5QA 3DC5A 3T1YO 3AG3B 3BY6A 3ABUA 4MSWC 4BIZA 4WBNA 2B1IA 4OX9B 2Y4UA 1VMGA 1NVPB 2ITDC 1YTFD 3F5WC 5CA0A 5B1NA 2RCVA 4HBNA 1SC5B 5EC1C 4DV6O 3BABA 2A7WA 1EBOA 3L71H 4D7TA 3K58A 5IJ9B 1W2BU 2VS0A 3HKDB 1RFYA 1VQ7V 3TCUA 4UFZA 1VQ9V 4X65B 4PDVA 1HNWB 3K08A 3HKBA 4LFAO 2P06A 2X0LA 2XT9A 2WLNA 4FLWA 1O9GA 1R6KA 2WLIA 4B3TO 3OGCC 4QPKA 2DE0X 2Q9LA 3U11A 3CCMV 1PM9A 3C3SA 4YHHB 2KG7B 3CB2A 1ZAUA 3SPGA 5HFMA 3E35A 4GKJB 5B3SB 3RYFB 4BR6A 1SZTA 3WB2A 2AGAA 4DRXA 3G6BA 4L8JA 1N34O 4LBEC 1NVPD 1Y6XA 5C8YA 5BR8B 3P3NA 3I5DA 4PDMA 5KAFZ 5LBQA 2HJFC 3CC7V 5ITZB 3JSNA 1QHTA 1E1RG 3ZIAG 5BMVB 4TV8B 1K9MW 4TUYB 3W7WA 4Z1VA 3UQ8A 1VQ8V 3QNEA 4OXSA 2BE3A 2KB1A 5CB4B 3I56V 3JAWA 2QSAA 4EB6A 2QWPB 4U3FH 5DECA 5LHGA 4KUMA 1K97A 1BCCH 4K3AA 4TT3G 1S5JA 2LFRA 1TUBA 5CA1B 4ZIBA 4B3MB 1SKVA 1SQFA 3K9SA 2WLLB 2P5OA 3FX7A 4BIOA 4BAYA 5LGTA 1YIJV 4W4KA 1KUQA 4TV9B 4JI0O 4JI8B 2QWOB 3ABKB 4W4LA 3IFXA 2EILC 4LFCO 5KMGB 4JI7B 3ZX6A 3JARB 3ETEA 1YJ9V 1SQBH 3CYOA 1MA1A 2CH7A 3GWKC 4WFEA 1HR0B 4FZ1A 3F7VC 2ZDIC 2QWRB 1H38A 2EIJC 5JH7B 3WG7B 3CJHA 5HFLA 1PNLA 3ASOB 2GUZB 4X1IB 1EN4A 4AQYB 1V54C 3KCYA 2Y0IA 2QEXV 2Q67A 1SA0B 3OAAG 3QO7A 1CEZA 1ZL8A 3OR6C 1X4TA 3DSQA 3JATB 1F4NA 4X8AA 4DUZB 3WFVA 1BSMA 1OCRB 2ZDIA 4JYBA 1WJZA 2DN9A 2ZKOA 4LF6B 1RSOB 3OMIB 3E8GA 2FMLA 3B8MA 1US6A 2AXTZ 1Z2GA 3H1HH 1SQQH 4GKKO 1AI7A 1AI5A 1S5HC 1FJGB 2RN9A 4X62B 4B3SB 4N23A 2UU9O 5J2TB 2XAGA 3FB6C 4J9ZB 4MTFA 1GH6A 3FB7C 2YICA 1GM8A 4MVMA 3K04A 3MD0A 3E8HA 4DR7B 1A32A 5J2UA 1N36B 2DYSB 1MZFA 3QG5A 1BHAA 1FD9A 4ZHQA 2ODMA 3FAVB 1SRYA 3EXAA 3N2GA 1AJNA 3IJ4A 3EHBB 1UJWB 3CXHF 4LFBB 1S76D 2LW7A 4JF3A 1XHZA 3HKCB 1PNKA 2FKXA 1YF2A 4IHJA 1L8DA 4DXWA 3CCEV 3ABTA 2OTJV 1VQ4V 4LF7O 4EFBA 2EIKB 5K1PA 2Q0OC 4X20B 1I5XA 2HEPA 2Q8VA 1N8RW 1MMMA 1VQOV 1NTMH 5EZYB 1NTZH 2H3OA 3CC2V 4JI4O 1SQXH 3BVOA 4YJ2A 4ICGA 1YHQV 4O2AB 3K9AA 2UXCB 2QM8A 3K5OA 3H1IH 1F51A 1RPRA 5B5EZ 1KQSU 1TVKB 2P22C 1M90W 3BA8A 4ZOLA 4X64O 1UPGA 3ML0A 4J7JA 2WLHA 1FKAO 2ZD9A 3MHSC 2CGNA 1QLEB 2JK5C 1VQNV 2HVJC 1CXZB 2P7TC 4MVZA 4OPHA 1ZUQA 4GX0A 1R3JC 1GM9A 1KBHA 2LW1A 2YIBA 1WLEA 2HG5C 3WU2Z 4DR3B 3IGAC 4PJ0Z 2IH1C 2ATKC 2HVKC 3FB8C 1I0HA 1PL4A 2YXYA 1WP8A 2PGGA 4DV7B 3C3TA 4DUYB 1M9NA 4MS2A 1KYOF 3L74H 2QA4V 1VQPV 1VF5B 3ETGA 1OCOB 4I7ZB 4IIJA 1ZX3A 4MTGA 2CDYA 1LR1A 4RQFA 4PHZA 1VARA 5KHKA 5LMUB 4X65O 1HNWO 1KMIZ 3S3WA 2X6AA 3HR0A 5FNVB 4H44B 3HKEA 1AP5A 4O4JA 4J7ZA 3L9DA 2QWQB 5GONA 4G28B 1IXMA 5B1AB 3OT7A 4YHHO 3K5NA 1DTOA 2ZIOA 1GTOA 3JAMN 2Q4PA 3UT5A 5DN6G 1VQMV 1MG1A 4H37A 5K1XA 4FZ0A 4KHPO 1K3EA 4DV3B 5BR8O 1XEQA 3ZMUA 1P4RA 5IYZA 5E1AC 2UXDB 4F6RB 3N2KB 3H9VA 3SYQA 2G38A 2ZXWB 4JYAB 1Q6IA 3ZBHA 1K7DA 2YUAA 4O4HB 5IY5C 4IYHA 4JZ2A 3ABLC 3D8CA 3VQXA 2YI9A 3AG3C 5EK0A 2AHYA 1COWG 1Q7YW 5E79Z 2Q5ZA 1PV0A 1PKXA 1JX9A 2QM7A 1N0NA 2UUBO 4B3MO 1VQ6V 5LMNO 5BY1A 2E74B 4Z2WA 2JGDB 1XHXA 3JALB 5CBFA 4J42A 1AI4A 1B3QA 3ETQA 4DR5B 1H8EG 5LOVA 4LF4B 3WB1A 1H2GA 5IYCO 3DXRB 1K4CC 1UFIA 3OEEG 1PP9H 4IL6Z 1S77D 1GN2A 2Q6AA 3STLC 2RMKB 4H0LB 3M99B 5H9CA 1XL4A 4JI5B 2XTAA 1T5EA 4ASUG 4ZI7A 3K06A 4DV1B 4X66B 3E22B 1IBKB 4UVBA 2BTQB 4X1YB 1Q8IA 5CN0A 4AQYO 2QJ1A 1R3LC 5IJ9A 2IJIA 1BZKA 1YVWA 5B3SC 1TAEA 4JPRA 4I55B 1GN3A 4DR1O 4JI3O 2R9IA 2WLKA 4DUZO 3BRCA 2Y4TA 2E5LB 3J80N 4LF6O 1NTKH 1AROP 2CUGA 4JAUA 3O9OA 4NR1A 4LF8O 1AI6A 4Z1MG 2FTKA 4HYOA 3JASB 2KKWA 2KG7A 2Q7HA 3KCXA 4X62O 4B3SO 1XMQB 3K59A 1OCCB 1E1QG 3RW0A 3RYFA 3SYPA 4FLTA 3VOUA 4P2ZA 3LDDA 5LHIA 3CCVV 2P4KA 2IJKA 3P30A 2YIAA 2MW2B 4MVSA 1ORQC 4DR7O 3THOA 1IDSA 2JS5A 1IZ3A 2JDIG 3D3QA 2Q7EA 1Q86W 1JJOA 4X9QA 2PUSA 2F66C 1DF5A 3JCUZ 4H13B 4PD4F 5BMVA 1SS3A 4E2LA 4TUYA 2F4VB 2LQTA 5D5PA 1YCIA 1VF6C 2CK3G 5CMUA 4YIPA 3ABKC 2ZE6A 4Q6GA 3LDEA 3VQVA 2LGQA 4JI1B 5KAIZ 5LHHA 2GDSA 3QTCA 3K0GA 2ZR3A 1FXKB 1FXHA 3B77A 2VWJA 4ABMA 1GKFA 4LF9O 5CA1A 2WLLA 1JOYA 1KP2A 1M57B 2F95B 2AZ0A 5F2VO 3WG7C 1V9PA 3AK2A 1WPXA 3ASOC 4YY3B 4FLVA 1WN7A 2XHBA 4DR6B 3L75H 2W6IG 4UCOA 4DW1A 3OTOO 3JARA 4U7NA 3SDLA 2HR3A 1P7BA 4F4LA 5IWAB 2WAMA 1XL6A 1J5EO 1RPOA 4FMTA 3JCZA 1OCRC 1B04A 2ZINA 4Q20A 2XAFA 3RYCA 3JYCA 2IBZH 5JH7A 3UO2A 2GSMB 3C90A 5LP6B 2GUZA 4JI6O 4X1IA 1DLBA 1SQVH 5H6RA 4U3JB 4EKWA 4WFBV 5J9PC 3SJCC 4P9OA 1XMOO 4YJ3A 1XUQA 1IBMO 3JATA 3W7TA 1S5LZ 4DV7O 1K4DC 4TWKA 3B40A 5JWPA 3G67A 5LA6B 5LXTB 4RAIA 3ZHTA 5IDJA 4I4TB 1D5NA 3K5LA 1RSOA 2DYSC 2R9RB 3CC4V 3JD3A 3MDSA 3QO5A 1B06A 2FB5A 2XOKG 4DV4B 2N05A 4QPJA 2YDEA 5LMUO 1OCZB 2OCCB 1NU1H 3OGIB 3R65A 4RWUA 2XUMA 1Q3EA 4I0XB 2HFEC 4PA4A 4WFGA 2ZNIA 2WWWA 5JJNB 3L70H 2IU0A 4I50B 3BCCH 1IVSA 1R73A 4X1KB 3OM3B 1KECA 4O2BA 3JSLA 2EIKC 2O57A 4NXMB 4JV5O 1QR8A 1ROPA 2ZQMA 3OE7G 2VRZA 3FAVA 1XI1A 3B4SA 1GRJA 1QVGU 1VIBA 5L3FA 2QTOA 4LF5B 3ZHVA 4FFBB 1ENVA 3KZIZ 1AR1B 3CCLV 5JQGB 2QKCA 2M6YA 1RM1B 3HKCA 2UXDO 2VQFB 1YJNV 1PL0A 2W6JG 2JJ1G 3A2FA 4CZZA 3UM7A 2EX3A 2W0XA 1JCHA 4WFFA 4X20A 1QLEC 2HLDG 2E3CA 2R72A 2AW9A 3NXSA 4GYCB 4GX5A 2BCCH 1HW7A 3RN4A 1Y74B 2EBOA 1Q90D 1AJPA 4R7CA 3IC9A 1QU7A 1I94B 4D7SA 5CA0B 1W0JG 3APOA 3AG1B 3ICXA 1OCOC 3M7MX 4J80A 1SF9A 5DEDA 1FFTB 1NR1A 3UO3A 2L35A 4DV0B 4LWSB 1WA8A 1L0NH 2GHYA 2E75B 2OWOA 3SYCA 4G2KA 2A79B 2B1GA 3GWOA 3HKBB 4DV2B 1BE3H 4JI5O 2DWEC 3CXCU 2N04A 2HP8A 4DV1O 4X66O 3LNNA 4G27B 1IBKO 3AG7A 5B1AC 2X6BA 1MNGA 2Q73A 3BAAA 1W59A 3LSQA 1AP6A 2IJJA 2IW5A 1EN6A 4DR2O 3ZRWB 4BWAA 3CSXA 3E89A 3T2MA 5H5NA 4FM0A 4NXNB 4DRXB 3AEIA 5L3EA 2E5LO 2DYRB 2A0LA 5C8YB 1PD3A 2ZXWC 2GTSA 1R6TA 1XMQO 4JYYA 4J11A 1W0KG 1TGOA 4PI0A 3RFRA 2CTPA 3P32A 1FFXA 2ZT9B 1VQKV 2BOCC 2VWKA 3CRQA 3W7SA 4EB6B 2UXBB 3ZHUA 4UB8Z 2CGOA 1NZ6A 3ZHRA 3F7YC 4F6RA 1GMGA 3WB0A 1YI2V 1MZEA 3N2KA 2Y0PA 4FJCC 1QQCA 3JD4A 2V4DA 3F5TA 1SZXA 2H94A 3AG4B 2H8PC 4O4HA 1NI8A 3TXQA 1BQZA 2ZE5A 4J7KA 1HNZB 4JI1O 2RJZA 5KA5A 3ZMTA 4DR4B 3MHHC 2UUAB 2PYJA 1WPBA 3T1YB 3CWBH 4CS4A 1CPYA 2Q69A 2BTOA 4AHCA 1XNRO 2DQ0A 2JGDA 1BMFG 3JALA 4QGPA 3G71V 4FLZA 3K03A 4OX9O 1Z5WA 4FFKA 3ETDA 4NTXA 4NKGB 1EZVH 4CH3A 3DXRA 3CX5F 2JEXA 4JTAB 1M1KW 2OYQA 5IWAO 1AR4A 1ZL8B 1YXBA 1ZWIC 1F4MA 2LFSA 1N32B 1XBLA 4TQFA 4MT8A 3E22A 4X1YA 2EZPA 3LNMB 1JFFB 2YIDA 3DTUB 1Q5OA 1OCCC 2P90A 1L1FA 3CMEV 4WCEV 3ZMSA 2HHHB 4I55A 3H1JH 1U97A 2EZOA 5EIBD 4MVOA 3OD4A 2YSUB 1Z5VA 1TA8A 5KLVH 3TK1A 2CTWA 4DW0A 5A2QN 1R1BA 4GKJO 1Y4MA 1B6QA 3DGEA 4DK0A 2Z5UA 3JASA 2Y69B 1LUWA 5GW7A 2PI5A 4OGQB 1PPJH 4JTDB 1V55B 1SQPH 3N2GB 2VQEB 1YJWV 5KUMA 2OCHA 1K34A 2YI8A 4UCSA 3M8AA 3I55V 1FXKC 4IHJB 1XQ8A 3ZCCA 4PDRA 2OTLV 4IT5A 4JASA 4YIOA 4DK1A 5IJ0A 4GUNA 4NXMO 2CAZC 1M57C 4UB6Z 2E76B 3T1HB 2C2AA 4JI0B 4YJ2B 4LNUA 2WLMA 4PA7A 5TISZ 5CBGA 1YITV 2R9AA 3GB7C 1I08A 2YEVB 1H2MA 4B3RB 1FXKA 5LGUA 3CCRV 2DWDC 4XDLA 1QNMA 4JI8O 1KKDA 4ZOLB 3SJAC 3ZMVA 5JJJB 4JI7O 2F1MA 4LH7A 2BSKA 1FPOA 1H2LA 4DYLA 3BPZA 4O4IB 5FPRA 3X2QB 3AK3A 1SESA 4AI8A 5LP6C 2W0FC 1Y67A 4WF9V 2MK3A 3SPCA 4P30A 3EVKA 1QVFU 1HR0O 1D2DA 3B2EE 3ZEDA 1VQLV 4UCUA 1CP9A 1HP8A 4R8CA 3RGBA 4A5UB 3VQWA 3HKDA 2PY5A 3FKSG 3KKYA 1YEWA 4B7KA 2IJHA 2YXHA 4JI2B 2EINB 4KXRA 4DV0O 3ZRVA 4QNHB 2V1DA 4FLXA 3BHPA 2F43G 1OCZC 2GV9A 1YZBA 2OCCC 4MW8A 5JVDB 4XDKA 4GKKB 2QKSA 3SYAA 1XILA 4U3JA 5KUKA 1VF7A 4AILC 2IU3A 3A0BZ 1QCEA 2A9HA 4MVUA 3HKEB 4O4JB 5EC2C 4JZGA 3D36C 3E8FA 3GVMA 4K35A 4QE9A 4PA3A 1F7YA 1FJGO 2Y48A 5LXTA 3NR7A 4I4TA 5IT9N 4R50A 4JGSA 3JD0A 2K9PA 2UUCB 1G8MA 2B5UA 3UT5B 1YDXA 1SERA 3OFNG 2YIBD 1N36O 4MTXA 3CCQV 1P7GA 4UUJC 1RM1C 2OT5A 5ITZA 3P3PA 4UCTA 2F23A 1M5IA 4TV8A 5IYZB 3FYEB 4J10A 3G80A 4X1KA 4NTYA 1EFRG 1X59A 4LFBO 3O65A 4GZRB 1N33B 1S72V 2JRIA 5CB4A 4PELA 4LF7B 2JJ2G 2AZ2A 1RP3B 1LNQA 2NNUA 5CA3A 2UXBO 1U96A 1JQ0A 3SPHA 4JI4B 3CPWU 1QLNA 1KKCA 1OV9A 3HPLC 2UXXA 2XAJA 2YXLA 5IE9A 5KX5B 3JAKB 4J9YB 1BL8A 4FK5C 4TQDA 1THZA 4TV9A 5B1BB 1FS0G 1I5YA 1VF6A 3RYHB 1KB9F 1NR7A 3AG1C 3G4SV 4X64B 1H8HG 5KMGA 3AG2B 2UXCO 3SJQC 4NYKA 5LOVB 3LSSA 1JA8A 4KP4A 1EZJA 2EULA 5LYJB 3RYIB 1XDCA 4DR4O 1DK1A 2OIEA 4NTWA 3ZN0A 4I9QA 1Y74A 1JVMA 1J95A 3W7UA 4MVQA 1Y76B 3L73H 4FM2A 1K92A 1HWYA 3RWRD 4ZI7B 2ILMA 4D6TH 2IH3C 1R6NA 1SA0A 4DR3O 1H2KA 3CCSV 1JPXA 3SJBC 3RVZA 4LWSA 2PZSA 1PNMA 2XASA 1IBLB 1URFA 3B09A 4DUYO 2ZR2A 3Q4HB 4NB5A 5EYPB 5D5QA 2DYRC 1N32O 2Z0AA 1VQ5V 2JEUA 4I5SA 4R6ZA 3FB5C 2ZE7A 1K33A 5J2TA 5FLXN 1GK9A 3FFQA 3ZRWA 2ARHA 3HB3B 2HHHO 2XAQA 4K8XA 3ASNB 3BA9A 2DQ3A 3OEHG 1R3KC 4WFHA 3ABMB 2QDOA 4H33A 3L72H 4KHPB 3CRCA 2YS8A 1YSCA 3CD6V 3CP1A 4MTOA 2ADQB 3AG4C 4FVMA 3QO8A 3U0ZA 4DV3O 5BZBA 3RBZA 4I9WA 3QVNA 2VQEO 4JAAA 4FPPA 5B1OA 1KD1W 1QR9A 1BT8A 4LP8A 4JYAO 5EIBC 4O4LB 1NT2B 3CRAA 1FAFA 5GTIZ 4U7OA 1N4CA 3RVYA 5CBHA 4K0KB 4HNAB 2PF4E 1BS3A 1BQ0A 5EBLC 5EZYA 2UUBB 1M56B 4BIUA 5LMNB 3IAYA 1NS1A 4ZBMA 2EIMB 1QBZA 4O2AA 3T1HO 4LC1A 4WBNB 2PTMA 1H2NA 2Q68A 1TVKA 3ZS8C 4DV5B 4B3RO 1M4UA 4HAMA 4DR5O 4LF4O 2QE7G 1AB3A 3OMAB 2JIZG 4UCRA 3FD9A 4JAVA 1KC8W 1GN6A 1AILA 4KL1A 2EJRA 2P67A 1ZTEA 2B9ZA 4TSFG 3RYCB 3T4DA 3ZHSA 4BW9A 4CH6A 1XOUA 4UVCA 3LUTB 1S0VA 1NQTA 4GX1A 2X7RB 1OJHA 2ZCEA 1SETA 2R70A 2HJDA 1WNSA 4P9PA 3S3XA 1I7FA 1NJIW 4UV9A 2WLIB 1D5AA 4CS2A 4B08A 3CCJV 3D3IA 1R3IC 4YJ3B 3U10A 4DR1B 4JI3B 1H2SB 3E83A 4WFAV 3J81N 2CTQA 2ZM6B 1Q82W 3J7AU 2BOBC 3E2EA 4JI2O 2DOSA 3SGIA 3SPIA 5L3CA 3AK1A 4LF8B 2Y69C 5IYBO 1JFFA 2ZE8A 5FNVA 2A06H 5LL6Y 1V55C 1N0JA 3STZC 1NH2B 4PA9A 2WSSG 3H01A 1Q6HA 1GN4A 2Q0AA 1P49A 3ZMZA 1LUVA 5FL7G 1HNXB 2LJ2A 4CH5A 1BHBA 2ITCC 3T4ZA 3KG2A 1G4YB 1HDJA 3LDCA 3H1LH 1K5SA 4O2BB 1MSDA 4N21A 4XBFA 5KHHA 2UUCO 1G1XB 3JAWB 1JR9A 1MOFA 1SQGA 4QE7A 2ZIMA 1P84F 1XNQB 3A0HZ 3PN1A 1TUBB 3JD1A 2ZNJA 5H2FZ 3VBBA 4PDLA 2F4VO 3UCSC 1Q81W 1N33O 2ETNA 4LF9B 2LO1A 2QTSA 5H6QA 3DC6A 2K1EA 3X2QC 1NKDA 5C93A 1MABG 4EFEA 3TXSA 2F93B 5LGNA 5KHIA 2CH7B 2YC0A 4DO2A 1NH2D 3E86A 4TOIA 2QM4A 4LCUC 3CE2A 3H1KH 5L3DA 2YEVA 3OTOB 4JYCA 4YY3O 3VQYA 4PI2A 3OW2U 3CJHB 4DV6B 2RDCA 3TETA 3R66A
chains in the Genus database with same CATH topology
3SDLA 4LFAO 2UXBO 4B3TO 4DR6O 3J81N 3JAMN 3J7AU 4DR1O 1HR0O 4JI3O 1D2DA 2VQFO 1R6TA 3RT3C 1XMQO 4JI2O 2DOSA 1J5EO 4DUZO 4JI4O 1HNXO 4KHPO 3J80N 5BR8O 4LF6O 1XEQA 4LF8O 5LL6Y 4A5UB 4K0KO 4DV3O 2UXDO 4JI6O 2UXCO 2VQEO 2AGAA 5A2QN 4X64O 4X62O 1R1BA 4GKJO 4B3SO 4DR4O 1N34O 4DV0O 4JYAO 1DK1A 1XMOO 1FKAO 1YZBA 2ZKOA 1XNQO 1IBMO 3F5TA 4DV7O 1I94O 1FYJA 4OPHA 4GKKO 4DV5O 1IBLO 4DR7O 2UUCO 1G1XB 4JI1O 1NS1A 2UU9O 3M8AA 2UUBO 1F7YA 4B3MO 1FJGO 1HNZO 3T1HO 5LMNO 5BY1A 5LMUO 4DR3O 5IT9N 2UUAO 4DV4O 5BXZA 4OPAA 3T1YO 4NXMO 1A32A 4JI5O 1XNRO 4B3RO 2F4VO 4DUYO 4DV1O 4X66O 4DR5O 4LF4O 1N33O 4DV2O 1IBKO 1AB3A 2DJVA 4OX9O 1N36O 1N32O 1AILA 4X65O 2Z0AA 1HNWO 4DR2O 4DV6O 4LF9O 1KUQA 4JI0O 4JV5O 4LFCO 2ZM6O 5H5NA 5IWAO 2LW7A 5FLXN 1X59A 4JI8O 4LFBO 3O65A 2FKXA 2JRIA 2E5LO 4JI7O 4YHHO 4AQYO 2HHHO 2N74A 4NXNO 4LF5O 4YY3O 3OTOO 4LF7O 3R66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDL A;  4LFA O;  2UXB O;  4B3T O;  4DR6 O;  3J81 N;  3JAM N;  3J7A U;  4DR1 O;  1HR0 O;  4JI3 O;  1D2D A;  2VQF O;  1R6T A;  3RT3 C;  1XMQ O;  4JI2 O;  2DOS A;  1J5E O;  4DUZ O;  4JI4 O;  1HNX O;  4KHP O;  3J80 N;  5BR8 O;  4LF6 O;  1XEQ A;  4LF8 O;  5LL6 Y;  4A5U B;  4K0K O;  4DV3 O;  2UXD O;  4JI6 O;  2UXC O;  2VQE O;  2AGA A;  5A2Q N;  4X64 O;  4X62 O;  1R1B A;  4GKJ O;  4B3S O;  4DR4 O;  1N34 O;  4DV0 O;  4JYA O;  1DK1 A;  1XMO O;  1FKA O;  1YZB A;  2ZKO A;  1XNQ O;  1IBM O;  3F5T A;  4DV7 O;  1I94 O;  1FYJ A;  4OPH A;  4GKK O;  4DV5 O;  1IBL O;  4DR7 O;  2UUC O;  1G1X B;  4JI1 O;  1NS1 A;  2UU9 O;  3M8A A;  2UUB O;  1F7Y A;  4B3M O;  1FJG O;  1HNZ O;  3T1H O;  5LMN O;  5BY1 A;  5LMU O;  4DR3 O;  5IT9 N;  2UUA O;  4DV4 O;  5BXZ A;  4OPA A;  3T1Y O;  4NXM O;  1A32 A;  4JI5 O;  1XNR O;  4B3R O;  2F4V O;  4DUY O;  4DV1 O;  4X66 O;  4DR5 O;  4LF4 O;  1N33 O;  4DV2 O;  1IBK O;  1AB3 A;  2DJV A;  4OX9 O;  1N36 O;  1N32 O;  1AIL A;  4X65 O;  2Z0A A;  1HNW O;  4DR2 O;  4DV6 O;  4LF9 O;  1KUQ A;  4JI0 O;  4JV5 O;  4LFC O;  2ZM6 O;  5H5N A;  5IWA O;  2LW7 A;  5FLX N;  1X59 A;  4JI8 O;  4LFB O;  3O65 A;  2FKX A;  2JRI A;  2E5L O;  4JI7 O;  4YHH O;  4AQY O;  2HHH O;  2N74 A;  4NXN O;  4LF5 O;  4YY3 O;  3OTO O;  4LF7 O;  3R66 A; 
#chains in the Genus database with same CATH topology
 1J5E B;  4DR6 O;  4GLX A;  2EIL B;  2EIN C;  4O4I A;  3RT3 C;  2NR5 A;  4CC6 A;  3A0R A;  3K3W A;  4FLU A;  3BEH A;  1JJ2 U;  2CTR A;  2V7Q G;  1WA8 B;  5EBM C;  4JI6 B;  4UCV A;  4IGG A;  2Q7G A;  2LGW A;  4LFA B;  2DW4 A;  3CRR A;  4L87 A;  4UV8 A;  4B3T B;  1GAX A;  1EN5 A;  4C7U A;  1XMO B;  2BTQ A;  2EIJ B;  1IBM B;  1AJQ A;  3ZHQ A;  4MVR A;  2P6J A;  4XDJ A;  3UKM A;  4CS3 A;  5KHJ A;  2QGN A;  3OUF A;  1V54 B;  1AR5 A;  1GO3 F;  1XRE A;  2A3Q A;  3E8B A;  2GTA A;  4KFM A;  1FYJ A;  4PA6 A;  5JJE B;  1IBL O;  3CMA V;  5JVD A;  2XAH A;  3K0D A;  1BGY H;  1VEW A;  1N34 B;  1WP7 A;  5EBW C;  3SR2 C;  3G6E V;  2LP7 A;  3OR7 C;  5J2U B;  4DV4 O;  5BXZ A;  2QWN B;  4RUF A;  4GCZ A;  4LR3 A;  4HZ3 A;  4K8Z A;  2EJ7 A;  4ZHQ B;  3OUS A;  4QIW F;  5L3B A;  4GX2 A;  3K5M A;  2DJV A;  2UXN A;  1WB8 A;  4JV5 B;  1KP3 A;  2X6C A;  2RNB A;  5A9G A;  5DM6 V;  3EFF K;  1FFX B;  1WB7 A;  4E4E A;  2KQX A;  4FM1 A;  2GBO A;  2FL4 A;  1IX9 A;  1OZ0 A;  4YXW G;  5GTH Z;  2N74 A;  5B1B C;  4LF5 O;  3CS5 A;  4UXN A;  3K57 A;  2Z3Y A;  3K79 A;  1OHH G;  3PJS K;  3AG2 C;  1K73 W;  3OTF A;  4LFC B;  2WPD G;  4CH4 A;  3B8N A;  1VP7 A;  2VQF O;  1EM1 A;  3T1C A;  5AG2 A;  4LH6 A;  3N27 A;  4K0K O;  4CC5 A;  5KX5 A;  3JAK A;  4CBC A;  2JS3 A;  2IM9 A;  2NLJ C;  1MSW D;  1O9H A;  3RYH A;  5B66 Z;  3OMN B;  4B7E A;  3W7X A;  3CRM A;  3APQ A;  1TUE B;  1DGS A;  5LYJ A;  3RYI A;  1IXB A;  1I94 O;  2ADP A;  3SYO A;  4DV5 O;  4X89 A;  5FPO A;  1Q6U A;  1K8A W;  5KHG A;  5IYD O;  3ZN1 A;  4RO2 A;  2FYU H;  3CCU V;  4F6E A;  3BFR A;  4GT1 A;  1Y76 A;  4J41 A;  4IIJ B;  5LP6 A;  3JD2 A;  4FLY A;  1DF4 A;  3IC7 A;  2UU9 B;  4DV2 O;  4DR2 B;  4UVA A;  2JGU A;  3ASN C;  3MAQ A;  3Q4H A;  5LA6 A;  3CEI A;  5EYP A;  5GON B;  3ABM C;  2QKA A;  2XND G;  1ZSP A;  4PV1 B;  4X88 A;  2ZM6 O;  3A8T A;  1G6U A;  3ZRX A;  1FXV A;  2OIG A;  1GM7 A;  1KU9 A;  3ZJZ A;  4NXN O;  1Y66 A;  4ZKI A;  3TJT A;  2AHZ A;  4I0X A;  2WA3 A;  1ZLZ A;  1S3J A;  1AVM A;  1NBM G;  5JCO C;  3D36 A;  1YTF B;  1F23 A;  3ZRS A;  4QJF B;  1IUR A;  4I50 A;  1WAZ A;  2HKO A;  1Q43 A;  4RQE A;  1HNX O;  3SPJ A;  1E79 G;  4EEQ A;  5L3G A;  2PI4 A;  1JMK C;  3FYI B;  1M56 C;  2D2C B;  3CHX A;  5IJ0 B;  2JVD A;  4FFB A;  2P4V A;  2RQ6 A;  2D3O W;  2EIM C;  4NVP A;  5JQG A;  1XNQ O;  1M93 A;  5JCO A;  4IYI A;  1L0L H;  5KA6 A;  4LNU B;  2QR4 A;  4O4L A;  4JTC B;  3LSU A;  2WA4 A;  2L6L A;  2PYL A;  2NN4 A;  2KSD A;  3QF7 A;  4HNA A;  2DMX A;  1HNZ O;  3TGU H;  4RUE A;  5IY5 B;  4MW3 A;  2UUA O;  2CE4 A;  2WLJ A;  3ABL B;  1XNR B;  4BW5 A;  2BSK B;  2M7W A;  4OPA A;  4FIP C;  1K5Q A;  3DC5 A;  3T1Y O;  3AG3 B;  3BY6 A;  3ABU A;  4MSW C;  4BIZ A;  4WBN A;  2B1I A;  4OX9 B;  2Y4U A;  1VMG A;  1NVP B;  2ITD C;  1YTF D;  3F5W C;  5CA0 A;  5B1N A;  2RCV A;  4HBN A;  1SC5 B;  5EC1 C;  4DV6 O;  3BAB A;  2A7W A;  1EBO A;  3L71 H;  4D7T A;  3K58 A;  5IJ9 B;  1W2B U;  2VS0 A;  3HKD B;  1RFY A;  1VQ7 V;  3TCU A;  4UFZ A;  1VQ9 V;  4X65 B;  4PDV A;  1HNW B;  3K08 A;  3HKB A;  4LFA O;  2P06 A;  2X0L A;  2XT9 A;  2WLN A;  4FLW A;  1O9G A;  1R6K A;  2WLI A;  4B3T O;  3OGC C;  4QPK A;  2DE0 X;  2Q9L A;  3U11 A;  3CCM V;  1PM9 A;  3C3S A;  4YHH B;  2KG7 B;  3CB2 A;  1ZAU A;  3SPG A;  5HFM A;  3E35 A;  4GKJ B;  5B3S B;  3RYF B;  4BR6 A;  1SZT A;  3WB2 A;  2AGA A;  4DRX A;  3G6B A;  4L8J A;  1N34 O;  4LBE C;  1NVP D;  1Y6X A;  5C8Y A;  5BR8 B;  3P3N A;  3I5D A;  4PDM A;  5KAF Z;  5LBQ A;  2HJF C;  3CC7 V;  5ITZ B;  3JSN A;  1QHT A;  1E1R G;  3ZIA G;  5BMV B;  4TV8 B;  1K9M W;  4TUY B;  3W7W A;  4Z1V A;  3UQ8 A;  1VQ8 V;  3QNE A;  4OXS A;  2BE3 A;  2KB1 A;  5CB4 B;  3I56 V;  3JAW A;  2QSA A;  4EB6 A;  2QWP B;  4U3F H;  5DEC A;  5LHG A;  4KUM A;  1K97 A;  1BCC H;  4K3A A;  4TT3 G;  1S5J A;  2LFR A;  1TUB A;  5CA1 B;  4ZIB A;  4B3M B;  1SKV A;  1SQF A;  3K9S A;  2WLL B;  2P5O A;  3FX7 A;  4BIO A;  4BAY A;  5LGT A;  1YIJ V;  4W4K A;  1KUQ A;  4TV9 B;  4JI0 O;  4JI8 B;  2QWO B;  3ABK B;  4W4L A;  3IFX A;  2EIL C;  4LFC O;  5KMG B;  4JI7 B;  3ZX6 A;  3JAR B;  3ETE A;  1YJ9 V;  1SQB H;  3CYO A;  1MA1 A;  2CH7 A;  3GWK C;  4WFE A;  1HR0 B;  4FZ1 A;  3F7V C;  2ZDI C;  2QWR B;  1H38 A;  2EIJ C;  5JH7 B;  3WG7 B;  3CJH A;  5HFL A;  1PNL A;  3ASO B;  2GUZ B;  4X1I B;  1EN4 A;  4AQY B;  1V54 C;  3KCY A;  2Y0I A;  2QEX V;  2Q67 A;  1SA0 B;  3OAA G;  3QO7 A;  1CEZ A;  1ZL8 A;  3OR6 C;  1X4T A;  3DSQ A;  3JAT B;  1F4N A;  4X8A A;  4DUZ B;  3WFV A;  1BSM A;  1OCR B;  2ZDI A;  4JYB A;  1WJZ A;  2DN9 A;  2ZKO A;  4LF6 B;  1RSO B;  3OMI B;  3E8G A;  2FML A;  3B8M A;  1US6 A;  2AXT Z;  1Z2G A;  3H1H H;  1SQQ H;  4GKK O;  1AI7 A;  1AI5 A;  1S5H C;  1FJG B;  2RN9 A;  4X62 B;  4B3S B;  4N23 A;  2UU9 O;  5J2T B;  2XAG A;  3FB6 C;  4J9Z B;  4MTF A;  1GH6 A;  3FB7 C;  2YIC A;  1GM8 A;  4MVM A;  3K04 A;  3MD0 A;  3E8H A;  4DR7 B;  1A32 A;  5J2U A;  1N36 B;  2DYS B;  1MZF A;  3QG5 A;  1BHA A;  1FD9 A;  4ZHQ A;  2ODM A;  3FAV B;  1SRY A;  3EXA A;  3N2G A;  1AJN A;  3IJ4 A;  3EHB B;  1UJW B;  3CXH F;  4LFB B;  1S76 D;  2LW7 A;  4JF3 A;  1XHZ A;  3HKC B;  1PNK A;  2FKX A;  1YF2 A;  4IHJ A;  1L8D A;  4DXW A;  3CCE V;  3ABT A;  2OTJ V;  1VQ4 V;  4LF7 O;  4EFB A;  2EIK B;  5K1P A;  2Q0O C;  4X20 B;  1I5X A;  2HEP A;  2Q8V A;  1N8R W;  1MMM A;  1VQO V;  1NTM H;  5EZY B;  1NTZ H;  2H3O A;  3CC2 V;  4JI4 O;  1SQX H;  3BVO A;  4YJ2 A;  4ICG A;  1YHQ V;  4O2A B;  3K9A A;  2UXC B;  2QM8 A;  3K5O A;  3H1I H;  1F51 A;  1RPR A;  5B5E Z;  1KQS U;  1TVK B;  2P22 C;  1M90 W;  3BA8 A;  4ZOL A;  4X64 O;  1UPG A;  3ML0 A;  4J7J A;  2WLH A;  1FKA O;  2ZD9 A;  3MHS C;  2CGN A;  1QLE B;  2JK5 C;  1VQN V;  2HVJ C;  1CXZ B;  2P7T C;  4MVZ A;  4OPH A;  1ZUQ A;  4GX0 A;  1R3J C;  1GM9 A;  1KBH A;  2LW1 A;  2YIB A;  1WLE A;  2HG5 C;  3WU2 Z;  4DR3 B;  3IGA C;  4PJ0 Z;  2IH1 C;  2ATK C;  2HVK C;  3FB8 C;  1I0H A;  1PL4 A;  2YXY A;  1WP8 A;  2PGG A;  4DV7 B;  3C3T A;  4DUY B;  1M9N A;  4MS2 A;  1KYO F;  3L74 H;  2QA4 V;  1VQP V;  1VF5 B;  3ETG A;  1OCO B;  4I7Z B;  4IIJ A;  1ZX3 A;  4MTG A;  2CDY A;  1LR1 A;  4RQF A;  4PHZ A;  1VAR A;  5KHK A;  5LMU B;  4X65 O;  1HNW O;  1KMI Z;  3S3W A;  2X6A A;  3HR0 A;  5FNV B;  4H44 B;  3HKE A;  1AP5 A;  4O4J A;  4J7Z A;  3L9D A;  2QWQ B;  5GON A;  4G28 B;  1IXM A;  5B1A B;  3OT7 A;  4YHH O;  3K5N A;  1DTO A;  2ZIO A;  1GTO A;  3JAM N;  2Q4P A;  3UT5 A;  5DN6 G;  1VQM V;  1MG1 A;  4H37 A;  5K1X A;  4FZ0 A;  4KHP O;  1K3E A;  4DV3 B;  5BR8 O;  1XEQ A;  3ZMU A;  1P4R A;  5IYZ A;  5E1A C;  2UXD B;  4F6R B;  3N2K B;  3H9V A;  3SYQ A;  2G38 A;  2ZXW B;  4JYA B;  1Q6I A;  3ZBH A;  1K7D A;  2YUA A;  4O4H B;  5IY5 C;  4IYH A;  4JZ2 A;  3ABL C;  3D8C A;  3VQX A;  2YI9 A;  3AG3 C;  5EK0 A;  2AHY A;  1COW G;  1Q7Y W;  5E79 Z;  2Q5Z A;  1PV0 A;  1PKX A;  1JX9 A;  2QM7 A;  1N0N A;  2UUB O;  4B3M O;  1VQ6 V;  5LMN O;  5BY1 A;  2E74 B;  4Z2W A;  2JGD B;  1XHX A;  3JAL B;  5CBF A;  4J42 A;  1AI4 A;  1B3Q A;  3ETQ A;  4DR5 B;  1H8E G;  5LOV A;  4LF4 B;  3WB1 A;  1H2G A;  5IYC O;  3DXR B;  1K4C C;  1UFI A;  3OEE G;  1PP9 H;  4IL6 Z;  1S77 D;  1GN2 A;  2Q6A A;  3STL C;  2RMK B;  4H0L B;  3M99 B;  5H9C A;  1XL4 A;  4JI5 B;  2XTA A;  1T5E A;  4ASU G;  4ZI7 A;  3K06 A;  4DV1 B;  4X66 B;  3E22 B;  1IBK B;  4UVB A;  2BTQ B;  4X1Y B;  1Q8I A;  5CN0 A;  4AQY O;  2QJ1 A;  1R3L C;  5IJ9 A;  2IJI A;  1BZK A;  1YVW A;  5B3S C;  1TAE A;  4JPR A;  4I55 B;  1GN3 A;  4DR1 O;  4JI3 O;  2R9I A;  2WLK A;  4DUZ O;  3BRC A;  2Y4T A;  2E5L B;  3J80 N;  4LF6 O;  1NTK H;  1ARO P;  2CUG A;  4JAU A;  3O9O A;  4NR1 A;  4LF8 O;  1AI6 A;  4Z1M G;  2FTK A;  4HYO A;  3JAS B;  2KKW A;  2KG7 A;  2Q7H A;  3KCX A;  4X62 O;  4B3S O;  1XMQ B;  3K59 A;  1OCC B;  1E1Q G;  3RW0 A;  3RYF A;  3SYP A;  4FLT A;  3VOU A;  4P2Z A;  3LDD A;  5LHI A;  3CCV V;  2P4K A;  2IJK A;  3P30 A;  2YIA A;  2MW2 B;  4MVS A;  1ORQ C;  4DR7 O;  3THO A;  1IDS A;  2JS5 A;  1IZ3 A;  2JDI G;  3D3Q A;  2Q7E A;  1Q86 W;  1JJO A;  4X9Q A;  2PUS A;  2F66 C;  1DF5 A;  3JCU Z;  4H13 B;  4PD4 F;  5BMV A;  1SS3 A;  4E2L A;  4TUY A;  2F4V B;  2LQT A;  5D5P A;  1YCI A;  1VF6 C;  2CK3 G;  5CMU A;  4YIP A;  3ABK C;  2ZE6 A;  4Q6G A;  3LDE A;  3VQV A;  2LGQ A;  4JI1 B;  5KAI Z;  5LHH A;  2GDS A;  3QTC A;  3K0G A;  2ZR3 A;  1FXK B;  1FXH A;  3B77 A;  2VWJ A;  4ABM A;  1GKF A;  4LF9 O;  5CA1 A;  2WLL A;  1JOY A;  1KP2 A;  1M57 B;  2F95 B;  2AZ0 A;  5F2V O;  3WG7 C;  1V9P A;  3AK2 A;  1WPX A;  3ASO C;  4YY3 B;  4FLV A;  1WN7 A;  2XHB A;  4DR6 B;  3L75 H;  2W6I G;  4UCO A;  4DW1 A;  3OTO O;  3JAR A;  4U7N A;  3SDL A;  2HR3 A;  1P7B A;  4F4L A;  5IWA B;  2WAM A;  1XL6 A;  1J5E O;  1RPO A;  4FMT A;  3JCZ A;  1OCR C;  1B04 A;  2ZIN A;  4Q20 A;  2XAF A;  3RYC A;  3JYC A;  2IBZ H;  5JH7 A;  3UO2 A;  2GSM B;  3C90 A;  5LP6 B;  2GUZ A;  4JI6 O;  4X1I A;  1DLB A;  1SQV H;  5H6R A;  4U3J B;  4EKW A;  4WFB V;  5J9P C;  3SJC C;  4P9O A;  1XMO O;  4YJ3 A;  1XUQ A;  1IBM O;  3JAT A;  3W7T A;  1S5L Z;  4DV7 O;  1K4D C;  4TWK A;  3B40 A;  5JWP A;  3G67 A;  5LA6 B;  5LXT B;  4RAI A;  3ZHT A;  5IDJ A;  4I4T B;  1D5N A;  3K5L A;  1RSO A;  2DYS C;  2R9R B;  3CC4 V;  3JD3 A;  3MDS A;  3QO5 A;  1B06 A;  2FB5 A;  2XOK G;  4DV4 B;  2N05 A;  4QPJ A;  2YDE A;  5LMU O;  1OCZ B;  2OCC B;  1NU1 H;  3OGI B;  3R65 A;  4RWU A;  2XUM A;  1Q3E A;  4I0X B;  2HFE C;  4PA4 A;  4WFG A;  2ZNI A;  2WWW A;  5JJN B;  3L70 H;  2IU0 A;  4I50 B;  3BCC H;  1IVS A;  1R73 A;  4X1K B;  3OM3 B;  1KEC A;  4O2B A;  3JSL A;  2EIK C;  2O57 A;  4NXM B;  4JV5 O;  1QR8 A;  1ROP A;  2ZQM A;  3OE7 G;  2VRZ A;  3FAV A;  1XI1 A;  3B4S A;  1GRJ A;  1QVG U;  1VIB A;  5L3F A;  2QTO A;  4LF5 B;  3ZHV A;  4FFB B;  1ENV A;  3KZI Z;  1AR1 B;  3CCL V;  5JQG B;  2QKC A;  2M6Y A;  1RM1 B;  3HKC A;  2UXD O;  2VQF B;  1YJN V;  1PL0 A;  2W6J G;  2JJ1 G;  3A2F A;  4CZZ A;  3UM7 A;  2EX3 A;  2W0X A;  1JCH A;  4WFF A;  4X20 A;  1QLE C;  2HLD G;  2E3C A;  2R72 A;  2AW9 A;  3NXS A;  4GYC B;  4GX5 A;  2BCC H;  1HW7 A;  3RN4 A;  1Y74 B;  2EBO A;  1Q90 D;  1AJP A;  4R7C A;  3IC9 A;  1QU7 A;  1I94 B;  4D7S A;  5CA0 B;  1W0J G;  3APO A;  3AG1 B;  3ICX A;  1OCO C;  3M7M X;  4J80 A;  1SF9 A;  5DED A;  1FFT B;  1NR1 A;  3UO3 A;  2L35 A;  4DV0 B;  4LWS B;  1WA8 A;  1L0N H;  2GHY A;  2E75 B;  2OWO A;  3SYC A;  4G2K A;  2A79 B;  2B1G A;  3GWO A;  3HKB B;  4DV2 B;  1BE3 H;  4JI5 O;  2DWE C;  3CXC U;  2N04 A;  2HP8 A;  4DV1 O;  4X66 O;  3LNN A;  4G27 B;  1IBK O;  3AG7 A;  5B1A C;  2X6B A;  1MNG A;  2Q73 A;  3BAA A;  1W59 A;  3LSQ A;  1AP6 A;  2IJJ A;  2IW5 A;  1EN6 A;  4DR2 O;  3ZRW B;  4BWA A;  3CSX A;  3E89 A;  3T2M A;  5H5N A;  4FM0 A;  4NXN B;  4DRX B;  3AEI A;  5L3E A;  2E5L O;  2DYR B;  2A0L A;  5C8Y B;  1PD3 A;  2ZXW C;  2GTS A;  1R6T A;  1XMQ O;  4JYY A;  4J11 A;  1W0K G;  1TGO A;  4PI0 A;  3RFR A;  2CTP A;  3P32 A;  1FFX A;  2ZT9 B;  1VQK V;  2BOC C;  2VWK A;  3CRQ A;  3W7S A;  4EB6 B;  2UXB B;  3ZHU A;  4UB8 Z;  2CGO A;  1NZ6 A;  3ZHR A;  3F7Y C;  4F6R A;  1GMG A;  3WB0 A;  1YI2 V;  1MZE A;  3N2K A;  2Y0P A;  4FJC C;  1QQC A;  3JD4 A;  2V4D A;  3F5T A;  1SZX A;  2H94 A;  3AG4 B;  2H8P C;  4O4H A;  1NI8 A;  3TXQ A;  1BQZ A;  2ZE5 A;  4J7K A;  1HNZ B;  4JI1 O;  2RJZ A;  5KA5 A;  3ZMT A;  4DR4 B;  3MHH C;  2UUA B;  2PYJ A;  1WPB A;  3T1Y B;  3CWB H;  4CS4 A;  1CPY A;  2Q69 A;  2BTO A;  4AHC A;  1XNR O;  2DQ0 A;  2JGD A;  1BMF G;  3JAL A;  4QGP A;  3G71 V;  4FLZ A;  3K03 A;  4OX9 O;  1Z5W A;  4FFK A;  3ETD A;  4NTX A;  4NKG B;  1EZV H;  4CH3 A;  3DXR A;  3CX5 F;  2JEX A;  4JTA B;  1M1K W;  2OYQ A;  5IWA O;  1AR4 A;  1ZL8 B;  1YXB A;  1ZWI C;  1F4M A;  2LFS A;  1N32 B;  1XBL A;  4TQF A;  4MT8 A;  3E22 A;  4X1Y A;  2EZP A;  3LNM B;  1JFF B;  2YID A;  3DTU B;  1Q5O A;  1OCC C;  2P90 A;  1L1F A;  3CME V;  4WCE V;  3ZMS A;  2HHH B;  4I55 A;  3H1J H;  1U97 A;  2EZO A;  5EIB D;  4MVO A;  3OD4 A;  2YSU B;  1Z5V A;  1TA8 A;  5KLV H;  3TK1 A;  2CTW A;  4DW0 A;  5A2Q N;  1R1B A;  4GKJ O;  1Y4M A;  1B6Q A;  3DGE A;  4DK0 A;  2Z5U A;  3JAS A;  2Y69 B;  1LUW A;  5GW7 A;  2PI5 A;  4OGQ B;  1PPJ H;  4JTD B;  1V55 B;  1SQP H;  3N2G B;  2VQE B;  1YJW V;  5KUM A;  2OCH A;  1K34 A;  2YI8 A;  4UCS A;  3M8A A;  3I55 V;  1FXK C;  4IHJ B;  1XQ8 A;  3ZCC A;  4PDR A;  2OTL V;  4IT5 A;  4JAS A;  4YIO A;  4DK1 A;  5IJ0 A;  4GUN A;  4NXM O;  2CAZ C;  1M57 C;  4UB6 Z;  2E76 B;  3T1H B;  2C2A A;  4JI0 B;  4YJ2 B;  4LNU A;  2WLM A;  4PA7 A;  5TIS Z;  5CBG A;  1YIT V;  2R9A A;  3GB7 C;  1I08 A;  2YEV B;  1H2M A;  4B3R B;  1FXK A;  5LGU A;  3CCR V;  2DWD C;  4XDL A;  1QNM A;  4JI8 O;  1KKD A;  4ZOL B;  3SJA C;  3ZMV A;  5JJJ B;  4JI7 O;  2F1M A;  4LH7 A;  2BSK A;  1FPO A;  1H2L A;  4DYL A;  3BPZ A;  4O4I B;  5FPR A;  3X2Q B;  3AK3 A;  1SES A;  4AI8 A;  5LP6 C;  2W0F C;  1Y67 A;  4WF9 V;  2MK3 A;  3SPC A;  4P30 A;  3EVK A;  1QVF U;  1HR0 O;  1D2D A;  3B2E E;  3ZED A;  1VQL V;  4UCU A;  1CP9 A;  1HP8 A;  4R8C A;  3RGB A;  4A5U B;  3VQW A;  3HKD A;  2PY5 A;  3FKS G;  3KKY A;  1YEW A;  4B7K A;  2IJH A;  2YXH A;  4JI2 B;  2EIN B;  4KXR A;  4DV0 O;  3ZRV A;  4QNH B;  2V1D A;  4FLX A;  3BHP A;  2F43 G;  1OCZ C;  2GV9 A;  1YZB A;  2OCC C;  4MW8 A;  5JVD B;  4XDK A;  4GKK B;  2QKS A;  3SYA A;  1XIL A;  4U3J A;  5KUK A;  1VF7 A;  4AIL C;  2IU3 A;  3A0B Z;  1QCE A;  2A9H A;  4MVU A;  3HKE B;  4O4J B;  5EC2 C;  4JZG A;  3D36 C;  3E8F A;  3GVM A;  4K35 A;  4QE9 A;  4PA3 A;  1F7Y A;  1FJG O;  2Y48 A;  5LXT A;  3NR7 A;  4I4T A;  5IT9 N;  4R50 A;  4JGS A;  3JD0 A;  2K9P A;  2UUC B;  1G8M A;  2B5U A;  3UT5 B;  1YDX A;  1SER A;  3OFN G;  2YIB D;  1N36 O;  4MTX A;  3CCQ V;  1P7G A;  4UUJ C;  1RM1 C;  2OT5 A;  5ITZ A;  3P3P A;  4UCT A;  2F23 A;  1M5I A;  4TV8 A;  5IYZ B;  3FYE B;  4J10 A;  3G80 A;  4X1K A;  4NTY A;  1EFR G;  1X59 A;  4LFB O;  3O65 A;  4GZR B;  1N33 B;  1S72 V;  2JRI A;  5CB4 A;  4PEL A;  4LF7 B;  2JJ2 G;  2AZ2 A;  1RP3 B;  1LNQ A;  2NNU A;  5CA3 A;  2UXB O;  1U96 A;  1JQ0 A;  3SPH A;  4JI4 B;  3CPW U;  1QLN A;  1KKC A;  1OV9 A;  3HPL C;  2UXX A;  2XAJ A;  2YXL A;  5IE9 A;  5KX5 B;  3JAK B;  4J9Y B;  1BL8 A;  4FK5 C;  4TQD A;  1THZ A;  4TV9 A;  5B1B B;  1FS0 G;  1I5Y A;  1VF6 A;  3RYH B;  1KB9 F;  1NR7 A;  3AG1 C;  3G4S V;  4X64 B;  1H8H G;  5KMG A;  3AG2 B;  2UXC O;  3SJQ C;  4NYK A;  5LOV B;  3LSS A;  1JA8 A;  4KP4 A;  1EZJ A;  2EUL A;  5LYJ B;  3RYI B;  1XDC A;  4DR4 O;  1DK1 A;  2OIE A;  4NTW A;  3ZN0 A;  4I9Q A;  1Y74 A;  1JVM A;  1J95 A;  3W7U A;  4MVQ A;  1Y76 B;  3L73 H;  4FM2 A;  1K92 A;  1HWY A;  3RWR D;  4ZI7 B;  2ILM A;  4D6T H;  2IH3 C;  1R6N A;  1SA0 A;  4DR3 O;  1H2K A;  3CCS V;  1JPX A;  3SJB C;  3RVZ A;  4LWS A;  2PZS A;  1PNM A;  2XAS A;  1IBL B;  1URF A;  3B09 A;  4DUY O;  2ZR2 A;  3Q4H B;  4NB5 A;  5EYP B;  5D5Q A;  2DYR C;  1N32 O;  2Z0A A;  1VQ5 V;  2JEU A;  4I5S A;  4R6Z A;  3FB5 C;  2ZE7 A;  1K33 A;  5J2T A;  5FLX N;  1GK9 A;  3FFQ A;  3ZRW A;  2ARH A;  3HB3 B;  2HHH O;  2XAQ A;  4K8X A;  3ASN B;  3BA9 A;  2DQ3 A;  3OEH G;  1R3K C;  4WFH A;  3ABM B;  2QDO A;  4H33 A;  3L72 H;  4KHP B;  3CRC A;  2YS8 A;  1YSC A;  3CD6 V;  3CP1 A;  4MTO A;  2ADQ B;  3AG4 C;  4FVM A;  3QO8 A;  3U0Z A;  4DV3 O;  5BZB A;  3RBZ A;  4I9W A;  3QVN A;  2VQE O;  4JAA A;  4FPP A;  5B1O A;  1KD1 W;  1QR9 A;  1BT8 A;  4LP8 A;  4JYA O;  5EIB C;  4O4L B;  1NT2 B;  3CRA A;  1FAF A;  5GTI Z;  4U7O A;  1N4C A;  3RVY A;  5CBH A;  4K0K B;  4HNA B;  2PF4 E;  1BS3 A;  1BQ0 A;  5EBL C;  5EZY A;  2UUB B;  1M56 B;  4BIU A;  5LMN B;  3IAY A;  1NS1 A;  4ZBM A;  2EIM B;  1QBZ A;  4O2A A;  3T1H O;  4LC1 A;  4WBN B;  2PTM A;  1H2N A;  2Q68 A;  1TVK A;  3ZS8 C;  4DV5 B;  4B3R O;  1M4U A;  4HAM A;  4DR5 O;  4LF4 O;  2QE7 G;  1AB3 A;  3OMA B;  2JIZ G;  4UCR A;  3FD9 A;  4JAV A;  1KC8 W;  1GN6 A;  1AIL A;  4KL1 A;  2EJR A;  2P67 A;  1ZTE A;  2B9Z A;  4TSF G;  3RYC B;  3T4D A;  3ZHS A;  4BW9 A;  4CH6 A;  1XOU A;  4UVC A;  3LUT B;  1S0V A;  1NQT A;  4GX1 A;  2X7R B;  1OJH A;  2ZCE A;  1SET A;  2R70 A;  2HJD A;  1WNS A;  4P9P A;  3S3X A;  1I7F A;  1NJI W;  4UV9 A;  2WLI B;  1D5A A;  4CS2 A;  4B08 A;  3CCJ V;  3D3I A;  1R3I C;  4YJ3 B;  3U10 A;  4DR1 B;  4JI3 B;  1H2S B;  3E83 A;  4WFA V;  3J81 N;  2CTQ A;  2ZM6 B;  1Q82 W;  3J7A U;  2BOB C;  3E2E A;  4JI2 O;  2DOS A;  3SGI A;  3SPI A;  5L3C A;  3AK1 A;  4LF8 B;  2Y69 C;  5IYB O;  1JFF A;  2ZE8 A;  5FNV A;  2A06 H;  5LL6 Y;  1V55 C;  1N0J A;  3STZ C;  1NH2 B;  4PA9 A;  2WSS G;  3H01 A;  1Q6H A;  1GN4 A;  2Q0A A;  1P49 A;  3ZMZ A;  1LUV A;  5FL7 G;  1HNX B;  2LJ2 A;  4CH5 A;  1BHB A;  2ITC C;  3T4Z A;  3KG2 A;  1G4Y B;  1HDJ A;  3LDC A;  3H1L H;  1K5S A;  4O2B B;  1MSD A;  4N21 A;  4XBF A;  5KHH A;  2UUC O;  1G1X B;  3JAW B;  1JR9 A;  1MOF A;  1SQG A;  4QE7 A;  2ZIM A;  1P84 F;  1XNQ B;  3A0H Z;  3PN1 A;  1TUB B;  3JD1 A;  2ZNJ A;  5H2F Z;  3VBB A;  4PDL A;  2F4V O;  3UCS C;  1Q81 W;  1N33 O;  2ETN A;  4LF9 B;  2LO1 A;  2QTS A;  5H6Q A;  3DC6 A;  2K1E A;  3X2Q C;  1NKD A;  5C93 A;  1MAB G;  4EFE A;  3TXS A;  2F93 B;  5LGN A;  5KHI A;  2CH7 B;  2YC0 A;  4DO2 A;  1NH2 D;  3E86 A;  4TOI A;  2QM4 A;  4LCU C;  3CE2 A;  3H1K H;  5L3D A;  2YEV A;  3OTO B;  4JYC A;  4YY3 O;  3VQY A;  4PI2 A;  3OW2 U;  3CJH B;  4DV6 B;  2RDC A;  3TET A;  3R66 A; 
#chains in the Genus database with same CATH homology
 3SDL A;  4LFA O;  2UXB O;  4B3T O;  4DR6 O;  3J81 N;  3JAM N;  3J7A U;  4DR1 O;  1HR0 O;  4JI3 O;  1D2D A;  2VQF O;  1R6T A;  3RT3 C;  1XMQ O;  4JI2 O;  2DOS A;  1J5E O;  4DUZ O;  4JI4 O;  1HNX O;  4KHP O;  3J80 N;  5BR8 O;  4LF6 O;  1XEQ A;  4LF8 O;  5LL6 Y;  4A5U B;  4K0K O;  4DV3 O;  2UXD O;  4JI6 O;  2UXC O;  2VQE O;  2AGA A;  5A2Q N;  4X64 O;  4X62 O;  1R1B A;  4GKJ O;  4B3S O;  4DR4 O;  1N34 O;  4DV0 O;  4JYA O;  1DK1 A;  1XMO O;  1FKA O;  1YZB A;  2ZKO A;  1XNQ O;  1IBM O;  3F5T A;  4DV7 O;  1I94 O;  1FYJ A;  4OPH A;  4GKK O;  4DV5 O;  1IBL O;  4DR7 O;  2UUC O;  1G1X B;  4JI1 O;  1NS1 A;  2UU9 O;  3M8A A;  2UUB O;  1F7Y A;  4B3M O;  1FJG O;  1HNZ O;  3T1H O;  5LMN O;  5BY1 A;  5LMU O;  4DR3 O;  5IT9 N;  2UUA O;  4DV4 O;  5BXZ A;  4OPA A;  3T1Y O;  4NXM O;  1A32 A;  4JI5 O;  1XNR O;  4B3R O;  2F4V O;  4DUY O;  4DV1 O;  4X66 O;  4DR5 O;  4LF4 O;  1N33 O;  4DV2 O;  1IBK O;  1AB3 A;  2DJV A;  4OX9 O;  1N36 O;  1N32 O;  1AIL A;  4X65 O;  2Z0A A;  1HNW O;  4DR2 O;  4DV6 O;  4LF9 O;  1KUQ A;  4JI0 O;  4JV5 O;  4LFC O;  2ZM6 O;  5H5N A;  5IWA O;  2LW7 A;  5FLX N;  1X59 A;  4JI8 O;  4LFB O;  3O65 A;  2FKX A;  2JRI A;  2E5L O;  4JI7 O;  4YHH O;  4AQY O;  2HHH O;  2N74 A;  4NXN O;  4LF5 O;  4YY3 O;  3OTO O;  4LF7 O;  3R66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...