2PTMA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
DSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Hyperpolarization-activated (Ih) channel
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ptmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ptmA02
2IC1A 1CX4A 3IWZA 4X6QB 3WW3A 1RUOA 2CGPA 4AVAA 3H3ZA 3WW2A 5FCCA 2ZCWA 1YUDA 2MPFA 4PIZA 4IEUA 3MYXA 2GAUA 2D5HA 2EA7A 3BALA 1ZVFA 4B29A 2XL9A 3LA7A 1J3PA 1UPIA 4F8AA 1LKNA 5JAXA 4WZCA 5FQ0B 3MPBA 2PAKA 3S0MA 1QXRA 1ZRRA 5FPZA 4A2UA 4CYDA 3PLQA 4MX3A 4QM8A 4PIYA 4TLFA 2BNOA 2XGXA 4XFFA 2ET1A 1CAVA 3GBFA 4RD7A 4KWKA 4FAHA 2Q1ZB 3KCCA 5J7MA 4J1XA 4L2NA 1Y9QA 4Z07A 1YHFA 3NVCA 4LA3A 4XF4A 1G6NA 4Q29A 4YARA 1I5ZA 1YWKA 3D0SA 1QWRA 2BGCA 1O5LA 2I45A 5FPXA 2QCSB 2XLAA 1LR5A 4FT8A 4N9IA 3LAGA 4Q0UA 3E5QA 5I8TA 4UBGA 5LRSA 3OTFA 3H1MA 2Z69A 4BYYA 4FBFA 5LEKA 4IEPA 1O7FA 1ZX5A 4Q0SA 1SFNA 3C3VA 5BXXA 4IEYA 5LEJA 2ZKLA 3FWEA 2XLGA 4JVAA 5FDBA 4XFBA 4MGYE 2D5FA 2IXCA 4PIXA 2K9ZA 4LA2A 3D82A 1CAUA 5JR7B 2CAVA 2IXKA 3E97A 4HLTA 1IPJA 1ZZ8A 2FQPA 3EBRA 2WFPA 3RNSA 1NE4A 1ZRDA 3G7DA 1ZZ6A 5KHKA 3MDPA 4MGKE 2IXLA 4XFHA 4XF0A 1H1IA 3FJSA 3R6SA 3IBMA 3CEWA 3ROUA 3QOPA 2ETEA 2PTMA 4EROA 1J3QA 1NE6A 2GC3A 1Y3TA 1FXZA 2MHFA 1SEFA 3M70A 5T3NA 4HZFA 3S7EA 2BYVE 1LB2A 4BH9A 4NVPA 1OD5A 2DCTA 2GC0A 3E6CC 1O4TA 4ORFA 4EWDA 2D40A 3LZZA 3EHKA 2O8QA 4XFIA 4Z82A 5EFUA 4JTNA 2HJIA 2B9UA 3NJZA 5I93A 1SQ4A 3U11A 2FMYA 5KBFA 4IEOA 4QXKA 1XRUA 4LTAA 4MH0E 4I09A 5FQ0A 4HSLA 4LEJA 1DZRA 1O3QA 3NW4A 3SCGA 4LLOA 1EY2A 3DL3A 4AQ2A 5BV6A 3JZVA 1UIKA 4XF3A 4FAGA 4KWJA 5CVRA 2OYZA 2K0GA 1Q5OA 2Y0OA 3LWCA 4GULA 3LOIA 2PA7A 4UBHA 1CAWB 1XE7A 2Z2SB 3ES4A 3RYPA 1WLTA 3HT1A 5BUVA 5J48A 2ATFA 4I01A 2WC2A 4HVRA 2CAUA 2BNNA 3OGJA 1H1MA 3DN7A 4HMZA 4MV2A 2UYAA 1YFWA 1ZZ7A 3PVBB 4X6RB 1ZRFA 5FLIA 4IEZA 5KHGA 3CLPA 5F1RA 1X82A 3E5XA 4AXOA 4OLLA 1X8MA 2VECA 1I6XA 1VR3A 4YSFA 1DGWA 2GH2A 3SXWA 1VJ2A 1PM7A 2E9QA 1CGPA 2XLFA 2VPVA 4OFGA 3UKTA 3NSTA 3RZZA 2PYTA 1U12A 4YRDA 5FLJA 1NXMA 3U0ZA 3SCFA 5JSRA 2H6CA 4XETA 2XHKA 3N4MA 1RL3A 1JUHA 3CF6E 2PFWA 1DZTA 4E2SA 4K8FA 4QGMA 3FFQA 1X7NA 3KSCA 5KHIA 1EYBA 1UIJA 2V09A 3CJXA 3NL1A 4IETA 1RC6A 4YNIA 2VQAA 2KXLA 4MZUA 4Q0VA 4YYOA 5AVPA 1FT9A 3D0JA 5HI0A 4HSJA 1V70A 1L3JA 3UKVA 3ETQA 2B8MA 5I0UA 4WBBA 1OI6A 2PHDA 4DINB 1OFNA 4H7LA 1ZZBA 3I7DA 5D1IA 2PAMA 3EQEA 5C6CA 1PMIA 1J59A 3WW4A 5JSOA 3ES1A 5FLHA 1CAXA 2H6BA 3OCPA 4XFCA 4ZU4A 1UW8A 4KL1A 1OMIA 1X8EA 4HVOA 5I0SA 4MGZE 2EVXA 3ST7A 2HKXA 3HQXA 3LA3A 4XF9A 5I8YA 1O3TA 1QXJA 4QGNA 3B02A 1ZNPA 2IXHA 4BHPA 3H1WA 4I02A 4MUVA 4HN1A 3ACLA 3DKWA 1CAWA 3DV8A 4IEQA 4IEWA 1O5UA 4EV0A 1WGPA 4BIFA 3U10A 4EWEA 3QACA 5I0TA 3KMHA 4QMAA 3WW1A 4AQ6A 1CAXB 4ONUA 3BPZA 1HW5A 2PQQA 4IEXA 2ET7A 3LA2A 1ZRCA 4ZU5A 3EO6A 3SHRA 2Q30A 3M3IA 1YLLA 3E6BA 4E2GA 2P17A 1VP6A 2BNMA 5E1RA 3SCHA 4Q0QA 2C0ZA 1Q43A 4EWAA 3ZDSA 5KHJA 3CO2A 3I59B 1NYWA 2Q0AA 1QY4A 3TNQA 2BEOA 3UKNA 1EP0A 3O14A 3H9AA 1WA4A 4R8HA 4L11A 3RYKA 4HBNA 2IXJA 4LUMA 1LRHA 5I91A 2QNKA 2Q4SA 3PNAA 4I0AA 1O3RA 1ZREA 1GQHA 2XKPA 3KGLA 2XKOA 4UXAA 1RUNA 5I0RA 3BB6A 3FE5A 4E2QA 4Q0PA 5C8WA 4JV4A 3GYDA 1RTVA 2QJVA 2PAEA 3H1YA 3IDCB 2OA2A 4META 3RPQA 4XF1A 5CADA 5K8SA 1UD1A 1XE8A 1YFXA 1RGSA 5BY5A 3HT2A 4KU8A 3MZHA 2UY9A 4JTOA 4LULA 4HVQA 1FI2A 4HN0A 3HIFA 2H0VA 5LRRA 1UCXA 3CL1A 1Q3EA 2GZWA 2O1QA 2GC1A 4ZU7A 1IPKA 2GC2A 3I54A 4KU7A 4KWLA 3OF1A 5J3UA 5E16A 3BU7A 3L2HA 5JSPA 1CAVB 2IXIA 1DGRA 4I0BA 3FHIB 2QVSB 4XFGA 3H8UA 3TNPB 4D7TA 3VHRA 2MNGA 4AVBA 2D93A 4O9EA 3USSA 3NKTA 3FX3A 4XEZA 4WVZA 1ZZCA 4D7SA 3H50A 5KHHA 2OZ6A 3H7JA 5CU1A 4F7ZA 4QM9A 3ELNA 3RYRA 5JCTA 1YFYA 1O3SA 2CV6A 2PHLA 1GQGA 2UYBA 3BCWA 2OZJA 4XFAA 3S7IA 2EAAA 4R52A 2B5HA 4I2OA 4LUKA 4O9GA 3I59A 3RDIA 2UY8A 4IERA 1YFUA 1CAUB 3IDBB 2OPKA 1J1LA 3SMHA 3OD0A 4QGLA 4AVCA 4QX5A 1NZCA 1J3RA 1TQ5A 4MGIE 4PJYA 3KGZA 4J1WA 5EZWA 1EPZA 3E5UA 3FZ3A 3H3UA 4N9HA 2XL7A 2GU9A 3EJKA 2F4PA 2N7GA 5I8SA 5BPXA 3IIAA 1J58A 3H7YA 4I3PA 2QDRA 4P9GA 4IEVA 4IESA 1ZZ9A 3E6DA
chains in the Genus database with same CATH superfamily
5H2FZ 2WLNA 1V55C 4MVZA 1NOVA 3CP1A 5GLWA 3KT4A 1CZVA 4XJZA 1RUH3 4G9SB 3T1YB 3TRSB 2XL9A 4QKFA 1SHWB 2JB4A 1UPIA 4LF6O 2ATKC 1F35A 3HJRA 2BBAA 2PQSA 3PLQA 1H1AA 2QEXV 2XAGA 5JXHA 4CH3A 2UU9O 4LA3A 3VDDB 4YARA 4LF5B 3JB8A 3JD71 4DV5O 3MW2A 5IDJA 2JB8A 3ZFEB 1OOPC 3D36A 4O4HB 1TME3 1CXZB 4OI1A 4CUCA 2DVBA 4UI9L 1X59A 3ALQA 4JVAA 1LNQA 3FBMA 1HDJA 2VNGA 3KV9A 3H1IH 2JEMA 2VZQA 2XBO1 5A80A 4P14A 2CAVA 2EILB 4DOUA 4IE6A 3LIHA 3EBRA 2DVAA 4CS2A 1W8NA 2XWJB 1F4NA 1OQDA 2BOCC 2GTSA 4D8MA 4QU2A 1W3XA 4YZ1A 1COWG 4OHYA 1WLWA 4S2DA 4JI7B 1BT8A 5A1AA 3CRRA 5CA0B 4AWDA 4RS5A 3I2DA 3ZBHA 4XFIA 1S1AA 5EFUA 1OF3A 3OFNG 3U11A 5HCBA 5L3CA 3WF1A 1O3QA 2WR9A 3VD7A 4AI3A 1I5YA 4BWOA 1Q8VA 2QGNA 2EINB 3AMPA 1VBE2 5KMGB 4PV1B 5HFLA 3MLJA 5ISLA 1CP9A 1H8TB 3AP4A 4WFEA 2WLPA 1EUTA 2WSUA 3FLRA 4NOTA 2RDQA 4NIAA 4AVTA 2Q8EA 3T4VA 3VD4A 1S5JA 1KRIA 2Z4FA 4CP2A 4LP8A 1R6NA 4ZOLB 4LNVA 2ZGUA 4NTYA 3MIDA 2VZOA 3MV01 3SPIA 1HNZO 2EIGA 4AXOA 2VECA 1Q7YW 2V7QG 2X6BA 1C8NA 3SXWA 1HW7A 2F66C 1L0NH 4BAYA 5JOYA 1ND2B 3THDA 4LF4B 3NSTA 4CXYA 1WMDA 2ARBA 2XHKA 1FOD3 1RL3A 1SLBA 1GNHA 2VVEA 1UIJA 1HQNA 3TAYA 5F9TA 4D6SA 4OUMA 4QB6A 2VOXA 3NL1A 3BPSA 5DG1A 1N1VA 3OW2U 4PA7A 5EJ3A 1FT9A 3ZS8C 2ZD9A 2ZXWB 3J9SA 1YXBA 2VCAA 4LE4A 4QQ2A 4GIQA 3N2GB 2PAMA 2FDGA 2DUPA 3ZMOA 2H6BA 3OCPA 2BZDA 4P9IA 4W50A 4X64O 1X8EA 2TUNA 1UNBA 3C7EA 3CCUV 3W5MA 3D4KA 4K9SA 1SFYA 3VKNA 1FPOA 2YC4A 1CAWA 1D4M1 2DWDC 3WDYA 3GZUC 5IW0A 4LBJA 2SLIA 3U10A 5L7OC 3AG2B 4IHJA 4EWEA 1GANA 2WZR1 1OPOA 3JB4C 2O14A 4LBOA 2R72A 3CCJV 5LW9A 1JU4A 5F2WA 2J1AA 4J80A 1W2UA 2AREA 1XL6A 2UXBB 2CUGA 1SPPB 3ZHVA 3EB7A 2W87A 1GZ9A 4B3SO 4YVSC 1IS3A 3LDKA 2KD7A 4B7EA 1L7QA 3K9AA 4X89A 4UB8Z 1GV9A 1DGRN 2TNFA 5IFPA 4YHHB 2Q0AA 2ZGMA 5T52A 2QQNA 3WQBA 3QH7A 4KBZA 3HBZA 2LGWA 1K8AW 4JGZA 4CPBA 3JD73 4DEQA 2WO2A 2QTOA 1GM9A 3DYMA 4XJ9A 4MGTA 5FP9A 3GYDA 5CG9A 5BR8O 4JYAB 1K5JA 5FOBB 1VF7A 2E63A 2EIDA 2WDBA 4CEWB 1PM4A 5FY5A 1R6TA 5DABA 2W0XA 1JYIA 3CSXA 3CRQA 3POJA 4B08A 2W1QA 5FMOS 3RGBA 3UGHA 3CL1A 3WCSA 2HWE1 3BU7A 3ON7A 4KG0A 1JZ4A 1NCRC 5E8AA 3H8UA 1QNWA 1NT2B 4D7TA 4LFCO 2FDKA 2QSAA 1BQZA 3A23A 4TV8B 3LKJA 1PMHX 4IYIA 2JE9A 1P8JA 3FX3A 2A3WA 2DTYA 4JI8O 1TVKB 5KHHA 3OD4A 4J25A 5H9RA 1AI4A 2EIMC 4Q4V2 2XR4A 3THOA 2VMFA 3KQ4B 4BB3A 4JI4O 2LJ2A 1CVNA 2ZMKA 2PMWB 2UUAB 1C1LA 4QX3A 3IMNA 1GKFA 1G9AA 5A3LA 5FZ8A 3J7LA 1FJGO 5L3EA 4Q4Y2 1M9NA 4FK5C 1J95A 5FPRA 5A9GA 1VAKA 3JASA 4CUGA 4RR3C 3ETGA 3DGEA 4EN0A 4QB2A 2P6HA 4ZXEA 3JATB 5KXDA 5FP7A 3R4SA 2ZCWA 3K0DA 4IXLA 3ZXGA 4GH4B 1ZVFA 3K46A 2Y69B 4CEYB 2GNMA 3ZSJA 1LKNA 1CIYA 4LH6A 1PK6C 4PQQA 2VZ1A 5A7WA 1GO3F 3CX5F 5FYYA 2EJ7A 4CDWB 1N4CA 3B93A 1SA0A 5H5NA 2XJVA 1TUBB 5FYZA 2PUSA 4XYXA 4YVWA 1W59A 2WABA 2XASA 1CN1A 3U37A 3AMHA 5L3FA 1RPRA 2ZNIA 3OGRA 4Y4RA 3FUOA 1W04A 1AR81 5LB6A 1M1KW 5KC6A 1K4DC 1OCOC 1WA6X 3P30A 4YGCA 4IEPA 4JCKA 1ZX5A 4BQ3A 3ZX7A 2HYXA 3CB2A 1EV12 1N1YA 1IHMA 2YU1A 1WP7A 1GAXA 2D5FA 3KG2A 1QIQA 5KXBA 3KVBA 2HLDG 1JXNA 4XURA 3H1LH 4ASMB 3ZHTA 5LGNA 4QD2A 5LBCA 3I8TA 1TGOA 3RSJA 3USUA 3DYOA 2WNUA 1WW6A 4X66B 2GUZA 2IXLA 2WZR3 4SBVA 2YS8A 2B9ZA 3BI3A 4LLFA 3T0BA 2XVGA 2D2CB 1GWKA 4JASA 1Q86W 1DTOA 3QCWA 1K7DA 4BH9A 5LHHA 1P84F 1JQ0A 3LZZA 4H14A 5FP3A 1V9U1 4CZZA 1SQQH 1BMV2 1G9BA 4B3NA 3QF7A 4ATFA 1W8HA 1RVF1 1RUH2 2Y4TA 1HRI1 3W21A 1ULPA 1PZ9A 2Z2SB 3D36C 2QDNA 3OGGA 2WFF1 3P3NA 3VD3A 4YG6A 4HMZA 2JDMA 1N1SA 2VR4A 1NU1H 2AR6A 2DYSB 4MVSA 1RXFA 4BXSV 2D6KA 1BK0A 1VBB1 4R6ZA 4O4JB 1GFF2 4UCRA 1H2LA 2GNBA 4XUNA 4FPLA 3ZPOA 1WPBA 4IUGA 5FL7G 1LOGA 3ZHUA 1TME2 2HWE3 2PYTA 1UO9A 4X8AA 1I5XA 1N36O 3K3WA 5G04L 4TZDA 5DPNA 2P4VA 2YXSA 4TSVA 1L7LA 2A71A 1UY3A 1XMOO 3CJHA 4FM0A 3VD9A 2A3YA 1UZVA 3OTOB 4GWIA 1US3A 4RS5C 3UJOA 2W94A 3D0JA 4CDXB 1JA8A 4WVVA 2VZ3A 1XNCA 4XMIA 1RXGA 3DXUA 2RS11 1OFNA 2OCCC 3OEEG 4EFEA 4LPLA 1OV9A 2ETNA 1UW8A 1O91A 1FXKB 5I0SA 2WA3A 5I8YA 1XUQA 2IXHA 4I02A 4JHTA 2QKSA 3RVZA 3DKWA 3B40A 4DW1A 3VBRB 4FP3A 5HCHA 3LPFA 2BRTA 2WL1A 4LIUA 5IWAO 4YZ3A 5FY0A 3W7SA 5APAA 5LCWL 2OT7A 4NXNO 1MS5A 2ET7A 4ZHQA 3NRUA 3M3IA 2C26A 1QLNA 3L2YA 4CC6A 1V6NA 5FZ9A 3JAKB 4LBQB 4EQVA 1AP5A 2Y4UA 4DS0A 2HWC3 2WS91 3A2FA 1ZBE3 4ZZ8A 5GZCA 3T0AA 3TETA 3VBUA 1H8HG 4MG2A 4F4LA 3BTYA 4QE9A 3K5OA 3JARB 1PL4A 3CEIA 1PNFA 4TYSA 5ABJC 5IYZA 1AR83 2XKPA 5E89A 1FFTB 1MACA 1EUUA 1FOD2 2W39A 5JH7A 4BMEA 2C6SA 3IDCB 3SPJA 4XQWA 4XDJA 4DXSA 2CSGA 5KX5A 2QDOA 1PNLA 5CADA 5K8SA 2GP3A 4JC1A 1WNSA 2UY9A 4HN0A 3CMEV 3AZYA 5LRRA 1WN7A 1UCXA 3R4DB 4Z2WA 4YM0A 3L9DA 4RSUA 4H37A 3UO2A 5F6LB 5J3UA 5LL6Y 2CWSA 1OA4A 1WCSA 2QVSB 3SKVA 1S0JA 2DUQA 4XIOA 1V55B 4JRLA 3POGA 2ENRA 5F2SA 1YI9A 1WA8B 2AHZA 4NHYA 1IKQA 4Q1PA 2IFRA 1ULFA 5A1LA 4MVOA 4K8RB 3AG4C 4B3TB 2K9PA 2MEV1 2YBPA 4QM9A 2JG8A 2GNTA 4UOJA 1O3SA 1KITA 3B94A 3LIGA 1V9U3 3ZIWA 4R52A 3WF2A 3CJIB 3WX5A 3AZXA 2XB6C 3RDIA 3CXCU 5ACA1 1VQ7V 1NX9A 1RVF3 4Y22A 4JGZC 1VBA2 4XHBA 2VCBA 1H30A 1OQEA 1MS8A 1T5EA 1SF9A 4I30A 3BRCA 4IV1C 2WFF3 2DVGA 1PGL1 4AQYB 2PI5A 3THPA 1J3PA 3TN91 1FYJA 2JD9A 1O6UA 2H3OA 1VF6A 5FY8A 2BTQB 4AVAA 2BPA2 2PLV1 3AKTA 2AH2A 1WP8A 2G19A 3JD72 2GAUA 4S2GA 4LO6B 1IKPA 1IGOA 3SNMA 2PAKA 2D7FA 1CPYA 5CKNA 3I2GA 5CEHA 2VQFB 4QWNA 1RJ7A 3JALB 4ZBMA 3T30A 4AI8A 4QB1A 4Q29A 4FPEA 2HEWF 1CR7A 4AI0A 2WLIA 5FPXA 1LR5A 4DV0O 1IBMB 5DZGA 3H8RA 4L87A 2Z69A 4PA3A 2ZXQA 1MA1A 4OHWA 3M1HA 1C5IA 1UPGA 1M4UA 3N2KB 2ZKLA 3I49A 2E33A 3LUTB 1LHWA 4ZHNA 1Q56A 1BJQA 4DV3B 1NQTA 4YJ3B 1HWYA 1H8VA 1LECA 1LOAA 1ZZ8A 4JGYA 5BZBA 3QO7A 3AEIA 3IZOA 3O1TA 3HBKA 1FXHA 1D2QA 1KQRA 1D7PM 4MTXA 2Y34A 3DTUB 1VEWA 1SEFA 3M70A 5LXTA 4UCVA 2BYVE 3AMQA 2GBOA 1O4TA 1SRYA 1KKDA 2WS93 1RUC3 5H9PA 4YZ2A 5KLVH 1WAZA 3P32A 4HXCA 1PIV1 4XTPA 1VQOV 4UT5A 4MSWC 4WFHA 5BMVB 1EZJA 4HVRA 1YJKA 4FTEA 2BNNA 2P6CA 1GH6A 1GOHA 1YFWA 1NCQC 4DUYO 2HKOA 5EIYB 4BQ4A 4C0HA 2AHYA 5FYTA 3A4UA 4YSFA 1JYWA 3UETA 4Y24A 4NRPA 2ZX0A 4OFGA 2VQUA 4N8MA 5D8AC 4MVUA 2CWMA 2WNUC 4C0BA 2VGDA 4L8QA 3HKBA 4E2SA 2BTVC 2VCCA 4QGMA 5KHIA 3H42B 4CU9A 1MVEA 3NV3A 3ZYFA 4YNIA 1VQLV 3ZEDA 4KH9A 2HEYF 2MEV3 3PMEA 5JZGA 4YVSB 1V70A 3AG1B 1GR3A 1NVPD 2WZR2 2OTJV 3WFVA 5C6CA 1F4HA 4LK6A 2FBEA 1J59A 3OSDA 3WW4A 5ACA3 2UXDB 2JICA 1F5FA 1CAXA 3GALA 3X2QC 1YIJV 4KL1A 4GALA 2W1WA 4YGBA 3ZPYA 1ULDA 3VGIA 4P30A 2GN3A 4MUVA 2WLLA 2F6BA 4N7UA 1R3IC 1NS1A 3C7HA 2WLQA 1OZ0A 4WM7C 3TN93 2D44A 4W6WA 5JXIA 3N9LA 3IPVB 5CBLA 4IEXA 3BVOA 4Y20B 4XXPA 4ZU5A 2AACA 1YLLA 4LJHA 5AFBA 5A32A 1F4AA 1JJOA 4TT3G 2YEVA 3LCPA 5E1RA 2FMLA 4JTCB 4I3GA 1UN1A 3ZIAG 1QJY3 4BQYA 2ZEZA 5CB4A 2WT2A 1NCRB 3TNQA 2BEOA 4DZGA 1SETA 2YICA 1NR1A 2DYRC 3RYKA 4X8PA 1O8SA 3AKPA 4AI9A 4HBNA 1WBLA 4AFDA 4MGSA 5T50A 3S3XA 2QNKA 3GGLA 1S3JA 1QEXA 2Q4SA 4QNHB 2RV9A 5IWFA 3UT5A 4J10A 4UW5A 3BOPA 2EIMB 4UFJA 2HWF1 1JMUB 1W9SA 4P5YA 3OMIB 4AG4A 1LGNA 4XUOA 1XE8A 3RVYA 4QQOA 5BY5A 5IVFA 3MW4A 1W8FA 1RUI3 3P5BA 3OM3B 2ERFA 1O8PA 2O1QA 3I54A 4KU7A 2D43A 3E83A 1GNZA 1HQWA 5JSPA 1FS0G 1CAVB 1OLMA 5C3QA 3ABLB 4RR3B 3K9SA 4PDWA 1W03A 3IMMA 4OI0A 1GTOA 2VAUA 1OCZC 3LEKA 4LFBB 5BNNA 4EJRA 4ZS3A 2CH7B 4KFMA 3ELNA 1PK6B 1JW6A 2RNBA 2CV6A 5FZFA 1KQSU 2DJVA 1AXYA 3RJ2X 4JAAA 4FXGB 4LKFA 5CBFA 2CDYA 3OR7C 2IU0A 2ZOEB 3INAA 1PIV3 2ORZA 3TXSA 5FYCA 3IDBB 5LOVA 1N32O 3BIWE 2KG7B 4UV9A 1TQ5A 3T1HB 4BLJA 4PJYA 1RUG1 1PM9A 1JYCA 3EJKA 1OCOB 2HWC2 3AC0A 4I3PA 2QDRA 2R072 2XJQA 4I4TB 1ZBE2 1OVPA 2E51A 1JOJA 2P06A 3SJAC 4CS4A 3H1HH 4ISQA 1XNRB 3AVRA 5C70A 4NTXA 1W0NA 1YJNV 3ETPA 4IL7A 1XDCA 5LBQA 2ZGPA 1OXCA 1JZ5A 5H9QA 2ADQB 3RWNA 3THCA 5J36A 1AP6A 3HKDA 3O1MA 4CYDA 1I9RA 3WD5A 3T4DA 3ZN0A 1FPN1 1WW7A 1FV3A 5LA1A 1JYNA 2BWAA 4FOWA 2JWPA 2JG8C 3WT3A 2A1XA 3H1MA 3VZOA 5LEKA 5FRAA 1EAH1 3B7MA 4XCBA 1BE3H 4KWUA 5JR7B 3L75H 2VVFA 2ZBJA 3IDEA 1JTZX 1R3KC 2ZEWA 4P5HA 1CX1A 3CXHF 1R64A 3RNSA 1V9U2 3WNNA 1HN0A 4JYBA 3HAGA 1VF6C 1RVF2 3IAPA 3GWKC 4EROA 4GX0A 1S0DA 3AP9A 1R1A1 1RHI1 2Y64A 2XUMA 2WFF2 5LATA 2JKBA 3EHKA 3VBFA 4N53A 4YXWG 5CA3A 4O65A 1AR5A 4CP9A 4B3MO 2MK3A 5IJ9A 3FLTA 2OUHA 2UUCB 1Q5OA 1IG3A 2VOTA 3VQVA 2ZX4A 3LOIA 4RS5B 4UBHA 2QQUA 2FHRA 1XE7A 3AYDA 5GTHZ 2W91A 4YW1A 4XMAA 1F2NA 2OCCB 2WLKA 4MYEA 1XU2A 4I0WB 3WQ0A 5EJ1B 2ITCC 4XXAA 3VKOA 4OLLA 4M01A 1J5EB 2BQPA 4DR1O 1HRV1 1WW4A 2B1GA 2XLFA 4JGYC 5LY1A 3CDZB 1PD3A 3ZDVA 3UESA 3SJQC 5A2QN 4AEMA 2E26A 1JUHA 4J42A 3J8F2 1NVPB 3O9OA 1AL21 1VAMA 4FXKB 4JYCA 3CCLV 4J9YB 5JI9A 3KZIZ 1SBFA 1UWWA 3WG7C 1UYXA 1BYHA 1QJU3 2P3YA 1Q6UA 5AG2A 4L9BA 3QH6A 3N7MA 2W6JG 4TOIA 4UF0A 3SYOA 2HWD2 1OI6A 1LODA 2YUEA 4DINB 4H7LA 1JCHA 1MZ5A 4FO9A 3KV4A 2BBVA 4B4PA 4OULA 1UY0A 1RUG3 5ABJB 4W4ZA 3B02A 4JPRA 3RZLA 1NH2D 2FCTA 2WS92 1RUC2 2R061 5FMBA 2IJHA 4SLIA 2AGAA 3I97A 5I0TA 1SZBA 3CE2A 4FTBA 3U1XA 3DECA 3VHNA 4MLOA 3C2UA 3E6BA 1QHTA 5A6YA 1CD3G 3V65A 3ZRSA 3HKCA 4UW3A 4R9CA 1AX1A 5KHJA 3CO2A 4IHJB 4X1KA 1VP7A 1PNKA 2OW4A 1FPN3 5G05L 1A3KA 3JSLA 2QQWA 4N43A 4A7ZA 3AG4B 1BGYH 3GDBA 3KHBA 3L70H 5JZGC 2CE4A 1IURA 1Y76A 2A6XA 4AFBA 5SV5A 1OBNA 2Z5WA 2R7EB 2QQOA 2QJVA 1JZ2A 3JQXA 2EALA 1EAH3 1APNA 4QT6A 1HXS1 2IH1C 4JGZB 3ZYIB 2YXHA 4FSJA 2R0FA 4IV1B 4O4LB 4ZU7A 4TTGA 4HPKB 2YB7A 2ZM6B 3LSSA 3AP6A 5ACA2 4NAOA 4AEDA 1S0FA 1S2BA 1G9DA 1RHI3 4NHLA 4O2BA 2EXHA 1VQ9V 1PGW1 1UYZA 3B09A 1JPXA 3K08A 1R091 3ETDA 3TN92 4H0LB 4GKKO 3U07A 4JI0B 4J9ZB 3QBQA 3WF0A 2Y60A 3ZO0B 4W65A 1R081 2ZTNA 3NV2A 4MGIE 3SITA 3AVSA 2OIEA 2WIIB 4N9HA 3O0WA 4UFIA 1QJY2 5A33A 3ZN1A 2OS2A 1Q6HA 1W39A 2ARAA 2Q1FA 4DO2A 3UKMA 4IEVA 1W8TA 2DURA 2VUAA 2JRIA 2DU1A 4KMQA 3T2PA 5JJNB 4OYUA 2CGPA 1S76D 2R9AA 1ULEA 1GLHA 3ABKC 2QZ2A 5FCCA 1NUKA 3J4UH 1F8VA 4J7ZA 1HRV3 1DQ4A 3W20A 2JGDA 2JK5C 2WQ4A 5DECA 3LDRA 1GP4A 1C8M1 3ZSMA 4D0QA 5EK0A 1AROP 1OHFA 3WCRA 4PDWC 4PIYA 4TLFA 3OY8A 4V1PA 5FZGA 4CCEA 2ZX1A 1V54C 1NT0A 3A0HZ 2FD8A 1BHAA 1J83A 1HNXB 1RUI2 4FPFA 3I3EA 4NO4A 4XAEA 1SZTA 2P67A 3ZFFA 1NY71 3O1PA 4DUXA 5I8TA 4O2AA 3AFGA 5J1XA 3F5WC 5A7WB 2OQ6A 2YXYA 4JI5O 4JHZA 1NXD1 2PHTA 2QTSA 3JCUZ 1VBC1 1K5QA 3KV5A 5F8PA 1I94O 1SA0B 1QQCA 4K8ZA 3CCMV 4XFBA 1G86A 1DIWA 5EYPA 1GZWB 1JI6A 4CDUA 4UV8A 3K48A 4FI9A 2HJFC 4X1YB 4FCAA 4A41A 2R063 1LOBA 2UWCA 1ZRDA 4XDKA 3E8BA 2XJPA 2J1VA 1SFPA 4XFHA 1GYKA 4XF0A 1PIV2 1NCQB 3R05A 1SACA 2ZGOA 4EN7B 4DO0A 2PTMA 1OLQA 5FFOC 5KC5A 5CKMA 4XOGA 2WNEA 3S7EA 5D8AB 3TEZA 2WNUB 5IK5A 1LHOA 1Q8PA 2GUZB 5LZ6A 3OBRA 3N7KA 1IX9A 1IVSA 2P4KA 1URFA 4ZKTB 3WOGA 2CTWA 4E4SA 5EIBD 4AL9A 5F5CA 3ECQA 3B77A 1QU7A 5A3OA 2R042 3W7UA 4MXWA 4TLGA 3AZWA 5FWJA 1EN5A 4CCLA 5J09A 4JV5O 1K5MC 1G9FA 2FYUH 4M3CA 2EIJC 5DDJ1 3WG3A 2ADDA 1HXS3 4TV9A 3X2QB 4EN9B 3ITQA 5LBBA 4J7JA 5FPOA 1MS1A 5FPAA 3NNLA 1CESA 2ZA9A 5TSWA 3ZYPA 3RYCA 1NXMA 2Q69A 2NM1A 3SCFA 2AC1A 3K4ZA 4WM7B 4C1XA 1VAVA 1PZ8A 1JZ3A 4LITA 2RJZA 4DR6O 4E2LA 2KXLA 4PF5A 3WF4A 3CQOA 3BGAA 5AVPA 4Q4W1 2H0BA 1DGLA 3VBFC 4KHPO 4N53C 5LMUO 1R093 1YHQV 1DLBA 1AJPA 1GN4A 3I3BA 4XBNA 1JMKC 4NHKA 2DYRB 2J7MA 4LHNA 1JZ8A 4XFCA 3E86A 4B3RB 4PT6A 1R083 3WINE 4UYBA 2Y0IA 2RE9A 1QXJA 4QGNA 2OWOA 4LF8O 1YTFD 3ACLA 1TMF1 3DV8A 4IEQA 4QAWA 4X62O 1SG3A 1QHDA 2PY5A 3QACA 4QJFB 4NXMO 1JJ2U 1VLNA 1GWLA 2LQTA 1DQ2A 1IXBA 1VP6A 1C8M3 2QQLA 4FM1A 4RFRB 3ZDSA 2CK3G 4Q8KA 4LR4A 3AG7A 1GOFA 3W7TA 1ENQA 4F6RA 4KUMA 3WZ1A 4NIIA 3HMYA 3D3AA 3VUOA 1U97A 3ML0A 2ES3A 4DXWA 2RDSA 2OTLV 4KBBA 5EC1C 3LFIA 4E4HA 3BODA 1HJGA 3AK2A 1OT5A 4QX8A 2QUOA 4LOTA 2J1EA 1ALYA 3JD0A 2WQ8A 5LK5A 3WG1A 5JOZA 2JJ6A 2B45X 1YFXA 3V64A 2UXXA 1BKZA 2VXRA 3EFFK 4MVQA 4KU8A 3DC5A 3CC2V 5GONA 1QJU2 1FI2A 4A6OA 1ACCA 1DU3D 2PF4E 3V0BB 2OIGA 2GC2A 2PHXA 4KWLA 4FPGA 1JFFA 5FZHA 3LQCA 2GN7A 3VBOA 2FTKA 3ZFGA 2MNGA 4XUTA 4LO7A 4XABA 1RUG2 3E22A 3FB8C 3L9JT 3H50A 2FZ2A 1M90W 1OUXA 4MXVA 1AVBA 1POV1 3CNAA 2IU3A 2E7QA 2RS31 4JX0A 4O9GA 5EC2C 1GU3A 1DGSA 2WYSA 2X7RB 1CAUB 4XE9A 4N43C 1AI5A 4QX5A 1OQ1A 2JG8B 4JAUA 2XL7A 5EV7A 3U4SA 4CCKA 4GQ7A 4U3FH 1S0EA 1VQPV 2XJSA 1LTEA 5JR2A 3H1JH 1FPN2 1F5JA 1Y67A 5BNPA 1DP0A 3C8XA 1ZZ9A 5AC91 4GLXA 3NNMA 2A6ZA 2HWB2 1K12A 4Y22B 1V6JA 3KF5A 3DPRA 1NA1A 5EPAA 3VDBA 3LA7A 1V6OA 4A3XA 1THZA 5C8CA 1EZVH 4H33A 2LTNA 4KQ7A 3DKQA 4OI2A 1EAH2 2QWQB 2YIBD 2LW7A 1AHSA 4AEDC 4DV6O 5T5OA 1U5YA 5J96B 1M56C 1YHFA 3NVCA 4DV7O 1YWKA 2PHWA 3KWVA 2ZPXA 5IATA 3M3CA 1LHNA 4DXRA 2D3SA 3RS6A 4JI2O 1POV0 4DXTA 1O7FA 1J84A 2A7AA 4NE9A 3JD2A 3WB2A 2D3OW 3ZX6A 2DF7A 3ACGA 2XPJA 1RHI2 2V1DA 4XDLA 4MTGA 3F7YC 4UVBA 2OCHA 1TMF3 5FLXN 1H2GA 4M00A 3CZUA 2VZSA 5FZ3A 5FBJA 4IE4A 1O9HA 4QQHA 4PDRA 3OG2A 3SJCC 3T4HB 3ZXJA 4JQRA 2YC0A 5GLZA 1IG0A 3WHUA 2GC0A 3ETEA 3SPHA 4E4ZA 4JGYB 1WB8A 3OGIB 4FQ4A 2LP7A 3M3OA 1YRZA 3CPWU 3CS5A 4Z82A 4PDMA 1PO22 5I93A 5KBFA 4IEOA 4QXKA 5IK4A 2OPWA 1H6XA 1US2A 1RUE1 3ZOIA 4DR2B 1XREA 3K59A 4WM8A 5CVRA 5LXTB 1HRV2 3WG7B 3PUSA 1XNQB 1ZAUA 3ZFFC 2W2IA 1AR91 2A6VA 1XQNA 5M0TA 4ARYA 2RQ6A 3WV6A 3OPTA 2E53A 3IFXA 2F93B 1TAEA 5FUPA 3TB0A 3OGJA 4MV2A 4WBNA 2V5YA 3WB1A 2QM4A 5J2UB 1QJZA 2F43G 3E5XA 1Z78A 3ZR5A 2N74A 4QDQA 3S57A 1SLLA 4QKNA 3VDAA 4KGQA 2HR3A 3L71H 2TEPA 3U0ZA 4ASLA 3N3HA 2WPDG 4AZZA 5T5JA 5C3OA 3I2JA 2IVJA 3T2QA 2AZ0A 1YNAA 2J1SA 1HR0O 4D3WA 3JBG1 1A32A 1HNWO 2YY1A 3ZN4A 1SBEA 2R062 4JZGA 1POV3 1LGBA 2RS51 1IBKO 3HKBB 1YTFB 3Q8EA 4CU8A 2WQZC 3N7JA 4PLOA 1MR5A 4YW6A 3DC6A 1I1EA 1EM1A 4HVOA 1QDCA 3LA3A 4XF9A 4LOSA 1TA8A 5FYMA 2VWKA 3H1WA 4UFMA 2BWCA 1K92A 4EV0A 3MLKA 1YYNA 1W05A 5AC93 4BISA 1IS5A 3IN9A 1MQTA 3HKEA 4PLMA 1CAXB 1P7BA 2HVKC 2VMCA 2EZOA 1YJLA 2W52A 4W6YA 3KCXA 3AXDA 4YIPA 2QA4V 2F4VO 2P17A 3CMGA 1U5ZA 2GTAA 3PJQA 4P9LA 1HXS2 1WA4A 1RUF1 2NR5A 1HP8A 3ABTA 1GM7A 1AR63 1B06A 1OKOA 4LNUA 1DDLA 2J1UA 4I0AA 2HHHB 4QDSA 4M0HA 5BYNA 2X09A 4I5SA 2ZE8A 3I3MA 2JD4A 2ARHA 3NAPC 1N34B 2FCUA 2YI8A 3LOBA 1OLME 1ZWIC 4DUZO 1DYKA 1DBNA 1N8RW 1V9PA 1RM1C 4NAMA 1QQP1 5CIRA 1PGW2 3AMNA 3PVEA 1AJKA 1R092 4LXLA 2A06H 1YQ5A 2CDPA 2CYFA 5B1AB 3VD5A 3ASIA 2Y6JA 5L19A 3SQOA 2A6YA 3NNJA 2HEPA 2P7TC 1DLCA 3ABKB 2QR4A 2IFWA 1ZZCA 1B35A 2ARXA 2R30A 5A70A 2D3PA 1VE0A 2ADPA 1RUE3 4EZHA 2OUJA 3RYFA 5L36A 4TXWA 1VRH1 4CSWA 2VOVA 3KGZA 2YC2A 3GHMA 1EN4A 2IH3C 3SH4A 1J58A 4AVSA 1WMFA 4AHXA 4P9GA 3IM0A 3CHXA 1GN6A 1YVWA 2RDCA 1URXA 4UAPA 4W4KA 2CNAA 1RUOA 5A3WA 1P4RA 1K45A 5EXOA 1UOGA 2HJDA 3VBHA 4JI6O 3FYEB 1QNMA 3A7QA 5JAXA 4EZ4A 3T1YO 4CDQA 4QPIA 1STMA 2BNOA 3PIGA 4QU1A 5FZOA 1HX6A 5DZFA 1CPMA 3E8FA 2JIGA 2VNVA 5FOJB 1Y9QA 3JBG3 1G6NA 1QGLA 1KU9A 3F5TA 2QCSB 1MABG 4XTMA 3E5QA 5E79Z 5LRSA 3MO4A 3HKDB 4YJ2B 3SR2C 2WWJA 2RS53 4NIGA 2RMKB 1UZZA 3RI9A 4LF5O 5BNOA 2YMZA 1MS9A 3S30A 5C9AC 3AM2A 5FDBA 1S0GA 3ZXKA 1AYM3 2ADEA 2K9ZA 4CU6A 1SQPH 2R9RB 2W3JA 4L97A 1BEV1 2IXKA 2P3JA 4JI1B 2W1SA 1H9PA 3CBNA 1K5MB 1NE4A 4MO3M 4DV1B 3LEGA 5BNPC 2EIJB 5CG8A 2P5BA 4CXWA 1HKDA 2XVLA 3DPRC 3KQRA 2NP0A 5JLVA 2FCVA 1DFQA 5FP4A 2RVAA 1POQA 5C8CC 1XBFA 4JTNA 2QM8A 4LFAB 5IAVA 1VMHA 2FMYA 4JI7O 3CWBH 1YZBA 4P08A 1ULGA 1UPSA 3FB6C 1RUF3 2XOKG 4FAGA 3T4ZA 2YUAA 3HQRA 3TBDA 2W46A 1Q81W 1GMMA 2UWBA 2PA7A 1TEIA 4L92A 4FFHA 1V6KA 2F17A 3VBFB 3UCSC 4N53B 2ATFA 4NYKA 4XIKA 3K5LA 1DQ5A 2LO1A 1K3IA 5FKBA 3RJRA 4O4HA 4CP9B 4RL7A 1REEA 5J37A 5IJ9B 2C1FA 5EWSA 1V0AA 1GKBA 4X6RB 3LB9A 4YM1A 4LMFA 1W8WA 1QQP3 1VMFA 4RO2A 4FVVA 3MGUA 3V56A 4PQ9A 4TUYB 4EN8B 2VPVA 4XUQA 2ZT9B 3R66A 4JZRA 1WB7A 3R65A 2FDJA 2VD7A 1PVC1 1BBT1 4WCEV 2EIBA 2Q68A 1IZ3A 3J7NA 4LF4O 3FFQA 3JYCA 1X7NA 3O7OA 1RYYA 5EJZB 2Q5ZA 3CCEV 1VMJA 4YPJA 3T3YA 3OAAG 4YM2A 1G8WA 3N9NA 4NROA 3FHAA 4S2FA 2G9ZA 1TMF2 4YYOA 3POIA 1IOAA 3WG2A 1Q82W 3UKVA 1X33A 1EBOA 4CRQA 3K0GA 3I7DA 2OT5A 3EQEA 4C90A 3MIGA 4WM8C 5JSOA 3SPCA 2OKXA 3ES1A 1S72V 5SV8A 5KMGA 1F9KA 3ZYRA 1H8TA 1FKAO 4BU2A 5GKAC 4UF0B 1XMQB 5A3MA 1NTZH 3WDXA 1O5UA 1IQAA 3AK1A 1KFXL 3VHPA 2NLJC 5LMNB 1W2NA 3KMHA 1QH6A 4ZOLA 5K1XA 4XJAA 3ZR6A 1KD7A 1ZRCA 4LHKA 1W8OA 5CAZA 2ZEYA 3EYPA 5FTTC 1M5IA 2W0FC 4P9JA 1ND2A 3AXEA 1ZLZA 1GZTA 1QY4A 2PZSA 3N9MA 1EP0A 3O14A 4OMDA 1GWMA 4YHHO 2YFUA 5L73A 5CN0A 4AAPA 4XZUG 1VQKV 1ZREA 3JD1A 4YFWA 4UFHA 3NKGA 3MUY1 5JQGA 4X1KB 2ZDIC 5FYUA 4CUAA 3ZN6B 3H1YA 2EIKC 4UCTA 1H0BA 3WEZA 4XZPA 2EX3A 3N2GA 1ZL8B 4OVEA 4N43B 4JYAO 4RYDA 1YQ8A 2Z3YA 1BEV3 1Y76B 4COYA 5LK7B 3FAVA 4QIWF 1C5HA 1I3HA 5IVYA 5LYJA 2Q9LA 1MQTC 4AQSA 3TEXA 1NTMH 4AHCA 2WWUA 3WNKA 2VG9A 4COUA 2BDRA 1AX2A 2X10A 3VKMA 1SPPA 1AR71 1YFYA 4H2AA 1GQGA 2Y6KA 4P9YA 5AC92 1BZWA 4D6RA 1LU1A 3OR6C 2KA3A 5GALA 4GT1A 1RMU1 1M56B 1J1LA 3K3NA 4O2BB 1ZSPA 1LAJA 2PHUA 4XW3A 2UUAO 3H3UA 4U7OA 3RG0A 4PI2A 2F4PA 5I8SA 4LO5B 5T5PA 4GMP3 1AR62 3WW3A 1UMZA 4BZ4A 3GZTB 1HIXA 3GJAA 2D97A 4CEWA 3VV1A 1GBGA 2ZGLA 5ANNA 5EZYB 4YLZA 2O57A 4JQTA 4F83A 4H13B 2QWOB 3ZJZA 1A34A 1RUD3 1PVC3 1BBT3 2JJ1G 4MTFA 2Y26A 2G9FA 1XJAA 1JS9A 1ODMA 4RD7A 4E9KA 5LHGA 2GSMB 4J1XA 4L2NA 3A22A 1MSDA 2ZMLA 1B35C 4TV8A 5LP6A 2BGCA 1O5LA 5CA6A 3O1SA 4QXHA 1IS6A 4Q0UA 1TVKA 2YSUB 4FBFA 2ZMNA 3OY8B 2UXCB 5EHDA 1SFNA 5LWBA 5IE9A 3VQXA 3K57A 1OFSA 1XYOA 3FHQA 2V73A 1PGSA 2HEVF 3ZFFB 3MLLA 4O2AB 4GAZA 4BQ2A 2WT0A 5C5TA 1DF4A 1IPJA 2R9IA 2VM9A 2VNOA 1RUE2 4FTSA 1TNRA 1V00A 2XDVA 2QWNB 1CIWA 4IGPA 1Z7S1 1XHXA 5EYPB 2Y8KA 4Q20A 3VBHC 4I0XA 4RQFA 2PXJA 3WNMA 3KKYA 2QQPA 4K7JA 1CWPA 4HT1T 1E79G 2CY6A 1SDDB 2XONA 3NJZA 3D6EA 4QPIC 3HWJA 4DY3A 1EY2A 5FXXA 2BSKA 4CDWA 4M3CE 4GXLA 4BIOA 2I07B 2JS3A 1R73A 4GWJA 5FO8B 5CMUA 1TUBA 1BK1A 1XC6A 4LHLA 4BIUA 2GH8A 3H0OA 2UUBO 4G28B 5HCAA 4NB5A 1SLIA 3HT1A 3MIBA 4BE3A 2JEXA 5BNOC 4LBNA 4PA4A 4P02B 1JYTA 2V4VA 3RQ0A 3JBG2 1X9TA 2DCKA 3CLPA 3SJBC 1X82A 4LBQD 1I6XA 5CBHA 1WD4A 1EPWA 1QCEA 1G1XB 5C7GA 1ONAA 1VJ2A 4X1IB 3VBSB 4MXWB 2A75A 2QQMA 2RS52 2DMXA 2WNVC 3WSOA 5C4WC 1N0JA 3CF6E 2DCJA 2PFWA 3MDSA 3OGVA 1B04A 5EYXA 4K8FA 1CEZA 4TV9B 4QX0A 1AYM2 3KSCA 1Z5VA 1GICA 2XBO3 3MUZ1 3CJXA 5J9PC 2DQ3A 3HVDA 1AR73 3RMXA 4X65B 3HOBA 4COZA 3AK3A 1T6BX 3OTOO 4PLNA 1XU1A 1LULA 1ZZBA 2VMEA 1RMU3 4URTA 2A3QA 3POWA 3L73H 5D2AA 1NBMG 1AUYA 3BY6A 4K8XA 5JIAA 4K40A 3POEA 3P6BA 1FFXB 4BCUA 3NAPB 3BOWA 1RUF2 2QBXA 4FP2A 5FO9B 1LOFC 3BPZA 1HW5A 4LCUC 1HLCA 1SMVA 3KT1A 1RM1B 3EO6A 4WFGA 3SHRA 3ZKUA 3DCQA 5A1FA 3RFRA 1QVGU 3S3WA 1XNAA 5L3BA 5HXMA 1UZYA 1HV0A 4DXZA 4NMIA 3W58A 1HQLA 4UWDA 3NJXA 2K1EA 2WUHA 3H9AA 2DTWA 4K20A 1UKRA 1QQP2 5FJKA 5AFEA 2Y6FA 3O1OA 4F3JA 1Y6XA 5LA0A 3L74H 4C7UA 3LD8A 4V2VA 2SBAA 3HN1A 3I55V 1O3RA 2GMMA 1RFYA 1F23A 3VHOA 1W9YA 3ME2A 4FFBA 4Q0PA 4DRRA 4CVUA 4YW2A 2UWAA 2PAEA 5F3IA 4F6RB 4AK3A 4IV3C 4NJ4A 1L1FA 1JHNA 2DYCA 3RPQA 3RRDA 2DU0A 5EBWC 1H2SB 2XHNA 3DUIA 1W0KG 2KKWA 4N90A 3PTYA 4GKJB 3T08A 1Q3EA 1FXKA 4OX9O 2ODMA 4BA6A 5E16A 3VZKA 1QLEC 1QOTA 2L6LA 2E76B 2P6JA 2XJUA 4QPKA 5CKQA 2ITDC 1C4RA 5GONB 1W90A 5CFDB 4R4XA 4F7ZA 1KKCA 3SGIA 3NNGA 1D4M3 3RYRA 4CZSA 3NXSA 1JFFB 1ND2C 1D0HA 1EN6A 3FN9A 4B3TO 3F7VC 4DUWA 4O4IA 1PMJX 1TG7A 1OPMA 2L9LA 5JUVA 1AJQA 4YY3B 1XE0A 1UOFA 1QJFA 5JVDA 1JZ6A 3HR9A 4FFGA 5B1OA 2FB5A 4ZKIA 2VQ0A 4IQPA 4RQPA 2PGGA 2GHYA 3M99B 4IESA 5C9AB 5B4XA 1AXZA 4X6QB 1HB3A 3ZYGA 3W7XA 3SH5A 4H44B 2WRAA 2VBPA 4PIZA 3MYXA 4X20B 2XAJA 2XQXA 1YC61 3BALA 3LDBA 1SLAA 2YI9A 4AGRA 3LNNA 1DK1A 2Z5UA 5FPBA 5FPZA 3D3QA 3IT8A 3SEPA 2DVDA 2ZZJA 1KC8W 2D6OX 3E2EA 2Q7EA 4LO4B 3WNLA 2RM21 3AFKA 3DPRB 3DF0A 1QOOA 1US6A 2VQFO 1YJWV 2WJSA 1BEV2 4B1LA 2C5DA 3H8XA 3ILFA 3D3IA 1SQBH 4Y5SA 5JJJB 4Y4YA 1YQ2A 2R32A 1VQ6V 1IBMO 3OOXA 1H2MA 2AEZA 1LOCA 3I2OA 3AX4A 3CJIA 1W6PA 2NMOA 4BPZA 5IHRA 1BMFG 4NR1A 1OA3A 5LY2A 1Q8SA 3JAWA 4HLTA 3P1IA 3CRAA 2Y48A 2W5FA 4DV3O 2VZPA 5H9CA 2LW1A 1UL9A 4TWKA 1FXZA 1Y3TA 1GRJA 5J2TB 4MHUA 2DCTA 2P37A 4Q4X1 1M57C 4AE2A 4XCAA 2Q7HA 3KB5A 4BW5A 3NW4A 2VBDA 3F95A 3N9PA 5FYBA 5IYDO 5IJ0A 4XF3A 3DXRB 2R16A 2GMEA 4DR4O 5LP6C 1AI7A 4AEJA 1RUD2 4IT5A 1XBLA 1MZ6A 4LF7B 4I01A 1BBT2 4DRXA 3OEBA 3SLIA 3DN7A 4Q4Y1 4OMCA 1K9MW 2UYAA 1K34A 1ZRFA 4WM8B 5FNVB 1WZXA 4OPAA 1AJNA 1W9WA 4IE0A 4YW5A 4FJCC 1VR3A 4LWSB 3P3PA 2WAAA 3K4DA 1ORQC 1CGPA 4K0KB 2EULA 2EICA 2V5DA 1O59A 1X36A 4UFZA 5JSRA 3S5QA 2JDZA 1ZUQA 3POFA 3PUAA 4COWA 1EYBA 1NQDA 5LGUA 2VOKA 5LA6A 2B5UA 3PVOA 3OUIA 4DB5A 2LFRA 3PTRB 4FMTA 4Q0VA 5FO7B 4G27B 3OPZA 5FP8A 5I0UA 1TVGA 5KR7A 5CISA 2VCMA 2ZX3A 2BERA 4FOVA 4RGAA 2X5IA 5FLHA 4GX2A 3OUFA 1EV11 1KUQA 4DR3B 1KEXA 1UFIA 1OMIA 2OXBA 3HQXA 3BKZA 2UXDO 3GZEA 3PVNA 4X9QA 4HL0A 1SCRA 3ZHRA 1UYYA 3ASOC 4Y33A 4AR2A 2EIKB 5H6RA 2I2SA 3GNEA 3T1MA 4KP4A 4LQRA 3MHZA 5L9VA 1HRI3 1W8ZA 4HNAA 4RGGA 3WNPA 2JKXA 4E2GA 2WWWA 4DR7B 1OOPB 2EAKA 3SCHA 4Q0QA 2Q5TA 1NLSA 4NN0A 1UMHA 3W59A 3U14A 3O5SA 3I59B 4L0PA 2BUKA 4U2AA 1MQTB 1S2EA 2RM23 4DV4B 1VBB3 1BMV1 3RBZA 4DR5B 3LF7A 4LUMA 5DQ0A 2YGLA 4QKDA 1XYNA 4N23A 1S0CA 3NV1A 2C9KA 3G6JB 3ZKYA 3BB6A 3PL0A 1VQ5V 1GK9A 3NO8A 4YG3A 2XBO2 1HNWB 1OH3A 2QFEA 3HT2A 3CC4V 4LNUB 4XJWA 1AR72 3WY6A 2QJ1A 5IK8A 4GX1A 2VMIA 2B39A 2ZHMA 1IBKB 2GC1A 2ZACA 2RS13 2X0LA 1ENXA 4R9DA 4XHXA 5FZ1A 5IVEA 2MW2B 1KXGA 5DN2A 3J26N 4LR3A 3G4SV 4I0BA 5LBEA 1RMU2 2W68A 3A21A 3TNPB 3OUJA 3VHRA 4GZRB 3NKTA 2WSSG 3NJYA 2VXJA 4J11A 5FZKA 1D0GA 2DW4A 4Y20A 4ZI7B 4Q4X3 2KM2A 5JCTA 1JYVA 3VL8A 3POBA 3NMBA 4KNCA 3ZIXA 1RB8G 4BIZA 2BTOA 3UYJA 1TUEB 1MS0A 4CCCA 3VN4A 3OD0A 4QGLA 2UU8A 3BYWA 1B35B 3OMAB 5TISZ 3FL7A 1BQ0A 2A9HA 5A7QA 3BA9A 4BOWA 3T1HO 2ZHKA 2EF6A 3QNEA 2JG9A 2A70A 3RYFB 4GD4A 4JDOA 1N3PA 5B1NA 4YVWC 4FPKA 4AQTA 1QBZA 1FXKC 1W2AX 2XAHA 1XNRO 3URFA 1NKDA 4W6XA 2IBZH 5FQ0B 4AI1A 2LS6A 2VQEB 1SDWA 4A2UA 4DUZB 1G8MA 3O0VA 2XT9A 3AP5A 1XSRA 4BDVB 1CAVA 1UF2C 1JOBA 1Y4MA 4QQLA 3KCCA 5J7MA 3BHPA 2RJ2A 4EFBA 1W6NA 3VBHB 3RVHA 2JDKA 3LSQA 3PMSA 4NWWA 3VQYA 4N9IA 4LBMA 4MVTA 2CH7A 3A0KA 5L7OB 4QPIB 1CZTA 4ZS2A 2Q7GA 1PK6A 4UW6A 5FYIA 5CB7A 1DZQA 4Z8BA 1FOD1 2VW1A 2RDNA 5DG2A 1W28A 3AYAA 3POSA 2YZ4A 1Y74A 3IB3A 1Y7BA 1D4M2 1WCUA 3SYQA 2FZ1A 3E97A 1SESA 1WCKA 3GCWA 3K04A 2ILMA 1A78A 1KS5A 3DYPA 5BNOB 2OX0A 3B5LB 4HK9A 4RQPC 3MDPA 3VZJA 3GZAA 3HNBM 2QWPB 1NZ6A 2F95B 2VUDA 1QR9A 4YIOA 2W95A 4AGVA 2GC3A 3AL6A 1WPXA 3O0XA 4AHWA 1LB2A 1OD5A 3W7WA 2VW2A 3O1RA 2IJIA 2D40A 2O8QA 2ZR2A 2WNVB 2BVVA 2F23A 1C28A 2R49A 5C4WB 1SQ4A 2Q67A 4XPVA 4I09A 4HSLA 1NAEA 2PLV3 5E88A 4JI6B 3TK1A 1LJ7A 1Q8OA 3S6PA 1PV0A 1CJPA 4HOOA 1PL0A 1VBA1 4R9BA 2UUCO 4CH6A 5K4LA 2BCCH 2QKCA 3MEPA 3SYAA 1MSWD 1ZZ7A 2EXJA 4WZFA 4BXFA 3CJIC 1G7YA 1OSGA 5A3TA 3G6BA 1X8MA 4GJYA 1NTKH 2HWE2 4C8DA 5JDBA 1Y43B 2E9QA 3Q8CA 4BQ5A 1SKVA 2VTFA 2J22A 3SDLA 3ZXEA 1J5EO 4XAAA 3WDUA 1L8DA 3LNMB 2GDFA 4MS2A 1KS4A 3CRMA 2BGPA 3VZMA 2VJXA 3PIJA 4MSVA 3KVAA 4FFFA 5ANQA 5FZ0A 2QQVA 3FD9A 4IW3A 2QKAA 4Q6GA 1ZM1A 2PHDA 4CPBD 4DNYA 1FX5A 4RWUA 1PMIA 3JXSA 2WINB 4R4ZA 4CCNA 2XMLA 4R9AA 3PHMA 1E1QG 3TYJA 2QE7G 2M6YA 4WVWA 4A5UB 5JXGA 5C71A 4IV3B 3VBUC 3HEIA 3G67A 4UW4A 3M7MX 1LEDA 1JVMA 1WW5A 3ZMUA 2HBUA 1L0LH 2R1DA 1W6MA 2JVDA 1XB9A 1W2OA 4QHOA 2C0ZA 2W6IG 1FD9A 1NKGA 3OYWB 4CTEA 3BU0A 1QLEB 5FZBA 2ZEXA 5FZIA 4QE7A 5BNQA 2LALA 3RYHA 3I2FA 3ZRXA 2VWJA 4PF1A 4ICGA 2JDNA 3MFCA 2WO3A 1LRHA 1AR82 3ABZA 3VB9A 2XKOA 1GNYA 2JDIG 5CFCA 3N36A 3LEMA 1FV2A 3KCYA 3MV11 1S0VA 4FOYA 3JUUA 4K1ZA 2Q8OA 1UAIA 2X5IC 3FC0A 3I5DA 4BWAA 4EE2A 2H0VA 1W0PA 3J81N 4QX2A 1GN2A 2GZWA 3MPPG 5ABJA 2XUEA 5JQGB 2VUJA 1CJDA 4XILA 1AYN1 2B42B 1Q8QA 3RMYA 1PVXA 2NN4A 1DCSA 1AXKA 5I0DA 3M3QA 2ZM6O 4PA6A 3USSA 3B9CA 4JI3B 4I55A 3KD4A 4IDZA 2W47A 2P22C 5CU1A 4YW4A 4FM2A 3FAVB 4NRMA 3RYIA 4DV2B 5LYJB 1E57A 2HFEC 1K97A 2OZJA 2DBNA 2QQKA 4UCSA 2WO7A 1HRI2 4NKGB 2OPKA 4FPJA 4BW9A 5FZCA 3IIIA 4JI0O 1VBA3 3CU7A 4NHMA 1Q8IA 1H38A 2ZGTA 2HYKA 3AG1C 1A8DA 2VULA 2RM22 1I5PA 4L8JA 4HVQA 3OMNB 1S0IA 1VBB2 2HP8A 4FLXA 1CX4A 4M4RA 4S2HA 5F3GA 3SYCA 2F1MA 1YUDA 4WFAV 5H6QA 2MPFA 4LF6B 4QKBA 4DW0A 1FAFA 2Q8DA 2D5HA 5GLVA 4I50A 3ZVXA 3ACIA 2YV8A 4CH4A 3AB0A 1IXMA 5ITZA 4F8AA 4P9PA 2HWF3 4QX1A 1DYOA 4WZCA 4EYUA 5GW7A 3K75B 4IV1A 4O4LA 1ZRRA 2UU9B 4HPKA 5IFTA 1JYXA 4Y1VA 1DYPA 3GVMA 5C93A 4CC5A 5A6QA 4DUVA 2Q0OC 5HV4A 2VTXA 1MOFA 4DV5B 4AW7A 1UOJA 2A7WA 1V6LA 1A8MA 2FDHA 1M57B 1HNXO 2RS12 3OPWA 1G4YB 4NPRA 4P9OA 5L9RA 2CTQA 1ZA4A 5EP9A 2LM3A 2IM9A 3A0RA 4YWAA 2XLGA 4ABMA 3LDDA 5DUXA 2B7YA 5LP6B 3D82A 4Q4X2 4G2KA 2D6PA 3X29B 2WN2A 5D5QA 3ZSLA 3ZYJB 4K35A 1ZZ6A 5DAVA 1C3HA 2OQ7A 4AVVA 4ZZ5A 2C9AA 1E5IA 2JG9C 3FJSA 1LR1A 4LK7A 3CEWA 5HV0A 5K7PA 2P5OA 4O61A 4DPNA 3WUDA 4ES9A 3OGCC 5FZEA 2JIZG 3HNMA 4EWDA 4UB6Z 2HJIA 5F5QA 1LGCA 2ZAAA 3ABLC 3DL3A 4HKOA 3JZVA 2VMHA 1UIKA 2WO1A 4A7KA 4LORA 1XNTA 1E5HA 1VIWB 4I0XB 2K0GA 3AJYA 3AKQA 4D6QA 1CAWB 2YBKA 2PHRA 3ES4A 3RYPA 2BV4A 4A3ZA 1X9PA 5F39A 1QF3A 3N9QA 1HNZB 2QWRB 2HWC1 2BSKB 1AVMA 2ARCA 3PVBB 2R071 1ZBE1 3I2IA 2O0OA 4YG0A 3QTCA 2NMNA 1GZWA 5C8YA 2BOBC 2VH9A 2GNDA 2ZQMA 1AYN3 5FLJA 3ASOB 1K4CC 3WUCA 4X1YA 4FLUA 1UQXA 5JCOA 3ZYHA 3MF6A 2YDEA 2MEV2 1NCQA 1LENA 3N35A 1CZSA 1FNZA 3LSDA 4EN6B 1PPJH 1TZOA 4FFIA 1MZEA 4DFSA 5B3SC 4CP1A 5HI0A 4B4RA 5D8AA 4TWTA 1KFUL 2PELA 4WBBA 3QO8A 4X64B 1I0HA 3ZMSA 1ZA7A 1N33O 2D6NA 3K51A 4ZY9A 2JEUA 4QQPA 1R1A3 5A3PA 3K03A 5IT6A 4LE3A 1PGL2 3WG4A 3N7LA 4B3RO 2YIDA 1SERA 1SQVH 2PLV2 2PYLA 2XHBA 1S0BA 3GCXA 2YBSA 1OLRA 1DLLA 4B3SB 3GB7C 2L35A 2UUBB 4FPHA 3DXTA 3ZXFA 1OHHG 2VL4A 1W9FA 5IYYA 4YGEA 4QHBA 2E6VA 1OH4A 4HAMA 1NYWA 5FYSA 3JQWA 4Z2AA 1JODA 4WM7A 2GDSA 3PUIA 5JPMB 2FMDA 1GZCA 5I91A 4XQDA 5BR8B 1UKGA 1RSOA 3JCZA 3JASB 4H3WA 3A0NA 5GLUA 3VDCA 5C8WA 4E8CA 1ND3A 1AL23 5IYCO 2YROA 1UY1A 3IGAC 3LEIA 4YZ5A 2CHHA 1W6OA 1W6QA 5BNNC 5GJ6A 5C5UA 5CYYA 2XQRA 1MPXA 3ZMVA 1YCIA 2QKDA 4MTOA 4RA0A 5FREA 1BZKA 1W06A 1SBDA 4WFBV 3M8LA 3T2TA 4Q5OA 2YPJA 4FFBB 3OF1A 4LFCB 3DEMA 4LC1A 4RQEA 2Q73A 4JI8B 1J1TA 2ZHLA 1W2BU 4YVWB 3M7AA 4PA9A 4PJ0Z 1OF4A 3J8F1 2D93A 1K3EA 4QPYA 1QDOA 1GUIA 4OHVA 4P9XA 3H7JA 1QOSA 1P7GA 3CKHA 4HKLA 3ABMC 4JI4B 2LFSA 3BCWA 5FY9A 1COV1 4I2OA 2P3IA 1AILA 5DAWA 2HWD1 1D5AA 4UCOA 1FJGB 3RT3C 2ZGKA 4A45A 3HQUA 2VO5A 3LSUA 4J1WA 4MT8A 5EZWA 3USUB 1S5LZ 3ENRA 5CFCC 2CAZC 3H7YA 4K21A 4AGGA 1MS4A 4MW8A 3N9OA 4O4IB 4B7KA 3SYPA 2R073 3E6DA 3T2OA 1RUC1 2IC1A 2YXLA 2Y0PA 1VMGA 2VRZA 2NN8A 1B6QA 3TJTA 2LROA 3HB3B 5JVDB 3ATGA 5FYVA 3S0MA 4RQPB 3V0BA 2JDHA 1JH5A 1UY4A 1K42A 2XAFA 2YU2A 3W5NA 4IL6Z 5L3DA 5JWPA 5KA5A 2E7AA 4OX9B 3B4SA 4UBGA 3OTFA 1K73W 5JMOA 4PDLA 2RMU1 3C3VA 3QO5A 4GB31 4XJUA 3FWEA 2YGMA 2NQYA 4AI2A 1LCLA 1WLEA 1YIFA 4QXBA 1KP3A 4HONA 2UURA 3U78A 1CAUA 4UFLA 2J42A 2FKXA 5F3EA 1E5SA 4IIJA 1GSLA 1Y9MA 1SS3A 4WVMA 4FQZA 3WQ1A 3O12A 1ENVA 5A7NA 3M3EA 4TQDA 5DUWA 1HB2A 3Q4HA 2E3CA 4LF9O 2JECA 4OI4A 3CJHB 3ROUA 2JIJA 4D69A 1W6PB 4GKYA 5F37A 1NZIA 1U0AA 3BIEA 1WKYA 4ITCA 2P34A 3JAWB 3MHHC 1X4TA 3VQWA 5FYHA 2FDFA 1NLQA 4DYLA 5T5LA 1NR7A 2VNRA 2PHFA 4UFKA 2NPIA 2D3RA 2I74A 3ZM8A 3WHTA 3KHCA 4KWJA 1V6IA 1PZ7A 2IUWA 1L7RA 3OJBA 4DR2O 1NJIW 5FK8A 2N05A 1SZXA 2HWF2 2A73B 4A7YA 1UU4A 3FBYA 1D2DA 1XNQO 2B46X 3MW3A 3KS7A 1FMD1 3ILRA 1D5NA 2DQ0A 1XNBA 1XOYA 3V0AA 1QJY1 1RUJ1 5KXCA 2XJTA 4BK4A 5IJ0B 1OCZB 2E32A 3I56V 3BCCH 4ZHQB 3GXUA 3UV9A 4UXNA 5GZEA 4CXXA 1N36B 1PM7A 2Y6GA 4DRXB 3UKTA 2V4AA 1VBC3 3CIHA 1WD3A 2H6CA 3CYOA 1XMOB 3VBUB 1JX9A 1DG6A 2V72A 3K79A 3NV4A 2ZX2A 3ZRWA 3J8F3 3M4FA 4XQ4A 4ASKA 4IETA 5IYZB 1T6GC 4OCTA 1RUI1 5JH7B 3BTXA 5KX5B 1MG1A 1COV3 4U3JA 3ACFA 2HWD3 3ZHQA 2DDUA 5F5IA 2CGNA 5LA6B 4CUBA 1P49A 4ZU4A 1JUIA 1IBLO 3THTA 4QDRA 4TQFA 4H7MA 4FLTA 5IWAB 4BHPA 3ZCCA 5FR3A 1QJEA 4ET7A 4JYYA 4EB6A 1YXWA 4NXNB 1OD3A 1PKXA 2M7WA 3WVJA 4DR4B 2X5IB 2PQQA 3CZJA 5F2VO 5DZEA 5J2UA 3N27A 2H8PC 1BXHA 1XQ8A 3ZMTA 3E35A 1Z0HA 3Q8FA 1VALA 3TGUH 5DDJ3 1OKQA 3UKNA 5JCOC 1VPHA 3UM7A 4RUEA 4GYCB 3JD3A 1D4VB 4CE8A 4HNAB 3LFMA 2YPDA 3BUCA 4GZ9A 3K77A 3PNAA 5F7UA 2ZGSA 3AYCA 4CCMA 1AL0G 1AYN2 3KGLA 1GP5A 4NHXA 5I0RA 4MW3A 2WAMA 2RMU3 2R041 2HHHO 4FPCA 4GB33 2OA2A 3LDEA 1ENRA 4DK0A 4AFMA 3OEHG 2G1MA 1LU2A 5T54A 5CA1A 3RZHA 1N34O 1DQ0A 5EQUA 4LULA 2DE0X 3HIFA 4LO8A 5DAQA 1BS3A 4Q4W3 2D98A 5HBAA 4E4EA 5IK7A 1BHGA 3FFZA 1PO11 1XXNA 2ZCEA 1A6CA 2WLJA 4HFSA 1R1A2 3TOJA 3I2HA 2WLIB 4XBFA 2CTRA 4D7SA 1ZX3A 1F15A 4U36A 2QQJA 3VOUA 2WYFA 1HV1A 3D8CA 2EZPA 4BR6A 4E4DX 3G6EV 4XFAA 1ST8A 1REDA 2E7TA 2XAQA 2EAAA 3UJQA 3WP4A 2B5HA 2WLHA 1GQPA 2ZINA 2JXAA 3APOA 5K0UA 3GJBA 1H8EG 1W9TA 1M93A 1NZCA 1J3RA 4H55A 2JE8A 3MHSC 5FWEA 1ODNA 2V4DA 5D5PA 4Y26A 1M06G 4FLWA 1FMD3 5C3SA 2NZ9A 1ND3C 3UT0A 3QD6A 3VBBA 3C90A 4JTAB 1RUJ3 5C3PA 1WCQA 4U7NA 3FB7C 1UXZA 3ABUA 4LH7A 2NNUA 3BVCA 5FUIA 3WW2A 4I9QA 5LBFA 1Q90D 4B29A 5K9YA 3I4IA 1AL22 1B09A 3PUHA 4QPGA 3K2OA 1JZ7A 2JG9B 3UL2A 1GN3A 4ES8A 5C33A 2E5LO 3B2EE 1OCCC 4DV0B 3J7AU 4CDUC 4Z07A 2CL2A 4XDQA 5IJRA 1H4HA 3GF6A 2XLAA 4ZIBA 3LAGA 1RP3B 5FZ7A 2AZ5A 2Z79A 1S55A 3K58A 3OGSA 4WFFA 1HDKA 1GOGA 4IEYA 5F5AA 2HVJC 1W6NB 2FDIA 4E8DA 2BU9A 2OYQA 4QXCA 1W2TA 5FXWA 1FNYA 1JU3A 1TE1B 1QJU1 2RS33 3G7DA 4Y1UA 4MGKE 4D7YA 1H1IA 4JI1O 1EFRG 3BAAA 4DV1O 1J3QA 1IDSA 5FV3A 5T3NA 2P2KA 1Y74B 5JZGB 2YIBA 2IW5A 3EHBB 3OUSA 1K33A 1WWYA 3STZC 2ZIOA 3DSQA 3ZRVA 2DWEC 2XXZA 3KM5A 2E75B 2NLRA 4AQ2A 5BV6A 4LFAO 2DFBA 2ZS6B 2Y0OA 3O65A 1VB2A 1V6MA 1KB9F 2WLLB 1N0NA 5B3SB 1KJRA 3ZXDA 4IGOA 1VQ4V 3IAYA 2W08A 4HETA 2WC2A 3WDTA 4DUYB 1OC1A 2R043 1H1MA 1ZBA1 4YJ2A 4YGDA 2VY0A 4GWMA 3B8MA 3JU9A 5KHGA 1C1FA 5F1RA 5A32B 2EXKA 1ASJ1 2HWB1 2YEVB 2GH2A 4PBOA 1VBD1 5F32A 1PO13 5CB4B 3BN6A 5EYYA 2ZE5A 3Q8BA 4RHV1 1I08A 5T55A 2DOSA 1K5MA 2VMDA 5HPOA 4UCUA 1KBHA 4Z92B 1XL4A 4I7ZB 1RC6A 3UT5B 5DAPA 1NQJA 4PCRA 4BMBA 4XDPA 3DGTA 2JDUA 4HSJA 2X6CA 2BGOA 1KGYA 1HB1A 3NWKA 4FZ0A 2C4XA 1E5RA 3AK0A 1R082 1GMGA 1WMXA 2RJKA 1YDXA 1UMIA 3IKWA 1XYPA 2EVXA 3ST7A 1UYPA 2JS5A 1R1ZA 1OJHA 4PDWB 2AGSA 1WGPA 1V54B 4BIFA 5A7OA 3TXQA 2N04A 1XMQO 5JVVA 3MIFA 4ONUA 5BNNB 1AR93 1JR9A 5LMNO 3ASNC 3LA2A 2Q30A 5FBZA 3OT7A 3PJYA 1C8M2 4K6BA 4OZXA 3HD8B 1CPNA 2BE3A 3NNFA 3M2MA 1HB4A 4Z1MG 2IWGB 2LRPA 4EWAA 1Q43A 2EIEA 2UXNA 4TUYA 4CA9A 3C7GA 3JSNA 4P2ZA 5LOVB 3OEAA 1PO21 1NY72 1W6MB 3NJVA 2RJLA 4Y5Z0 1VBC2 2CTPA 4EEQA 4UXAA 3ABMB 4E2QA 3VBOC 3ZFGC 5EIBC 5DM6V 5KWRA 3RYHB 2RHPA 2DCYA 3KLSA 2VU9A 5FMDA 3SH3A 1PX3A 3B69A 5LA2A 4UVAA 3ZMNA 4A42A 5CFCB 5H9SA 3R4UA 1COV2 4WF9V 1FXVA 4NPMA 3F2ZA 1YQCA 4BLIA 5IY5C 4NWVA 3B01A 3E89A 2PN5A 4ARXA 4ZONA 2OIIA 1U96A 3FYIB 2A79B 2P1BA 1F51A 1U5XA 5A3UA 4R7CA 3S5AA 5FUNA 5FZAA 1BCCH 2PHLA 2VBBA 3WDWA 4UUJC 1N32B 2ZZQA 5KAIZ 2UY8A 2XNDG 1UJWB 1S77D 1NA1C 4I55B 3MIHA 2Z0AA 2WAOA 3ZXAC 2WWSA 4N21A 2XH6A 3J80N 3NQHA 3RYIB 2QE3A 4LHSA 5IYBO 1BVVA 3ZSKA 1N3QA 1XILA 5DDJ2 1ZBA3 1AJOA 3AZVA 3WDVA 4QHZA 4LT5A 3ZN6A 3PU8A 3IWZA 2XTAA 1VARA 4Q8LA 3AMMA 1ASJ3 2HWB3 3BTZA 1VRBA 4YM3A 1ZL8A 4OHXA 3VDDA 3T1LA 1VBD3 4NTWA 1OUSA 1YIPA 3TWIA 1R3LC 1WCDJ 3PU3A 3AZZA 1CQ9A 4HG6B 3ZFEA 2VS0A 2RMU2 4RHV3 1DF0A 4GB32 1W0OA 4OGQB 3GBFA 3U4XA 3G80A 3FKSG 4DQAA 4ATEA 1AR1B 3HPLC 1NI8A 3RZKA 4XF4A 2QTWB 4Q4W2 3D0SA 1GM8A 2QQIA 2AYHA 4I50B 1UXXX 4FT8A 5DN6G 5ITZB 1MEC1 2WZPP 3STLC 1KDMA 3Q8AA 4I9WA 4AAXA 5D21A 2R70A 5BXXA 4UVCA 5K0UC 2LW8A 1AF9A 5CNAA 2UXCO 1H2NA 1WLCA 4LA2A 1XSQA 3H3LA 5CA0A 5A7PA 1PHMA 5KHKA 1IPSA 1QJX1 3BFRA 2ZJCA 4YZ4A 2R6QA 3R6SA 3IBMA 5A3NA 2ETEA 1VRH3 2MHFA 3MF9A 4X88A 1PNMA 3E6CC 5EZYA 2P4EA 1JOYA 1FMD2 3MFAA 1Q6IA 4ORFA 5FZMA 4Z1VA 4B3MB 1W3VA 5KXEA 1RUJ2 3FLPA 4QPGC 4LEJA 5B1AC 1BLZA 1PO23 4LLOA 2A3XA 4JZ2A 1BSMA 3FUQA 4MVRA 1WJZA 3LWCA 3SKJE 1WLTA 1DQ6A 4FPPA 2UXBO 5J48A 5KA6A 3D5OA 4AILC 5A6ZA 4JGSA 2CAUA 2WKKA 4MOAA 5FLIA 4DR1B 2D6LX 2ZNJA 4IEZA 1W99A 2E31A 5JPNB 5IVJA 3RI8A 4G3YC 4YW7A 4XDOA 3AYEA 1DGWA 5DUUA 1S4CA 3HKCB 2RCVA 5F6KA 3Q9OA 4YRDA 2F4LA 1SC5B 5JI7A 3K3OA 1DZTA 2YYOA 1O4YA 2LGQA 2ZAHA 1XEQA 4GKXA 1BHBA 3H1KH 4URAA 4JKKA 2RR11 5C8YB 1ENSA 4NPLA 1RIRA 5FMCA 4MZUA 1N47A 5FZLA 4FPYA 5JJEB 3MIEA 2RS32 1L3JA 1KJLA 5EBMC 4OHZA 3LDCA 3ZHSA 2DBIA 2P90A 3VKLA 5FY7A 4X65O 1YI2V 4D94A 5K1PA 4FLZA 4RAIA 5FAXA 3E8HA 5B1BC 5B66Z 5E1AC 1S5HC 4MGZE 3A0BZ 3B3QE 4HK8A 3FX7A 3T2MA 4DIQA 3IC9A 3RW0A 4KG8A 1QU0A 2YFZA 2GV9A 4AEDB 3GBWA 2HG5C 4IE5A 1R1BA 4INDA 4AQ6A 3WB0A 1VQNV 2BFUL 3QLQA 1WBFA 4E27A 4XJ8A 4X1IA 3VBSA 3GWOA 2B1IA 4LBKA 2GSYA 1HJFA 4AFCA 5HCFA 4G4FA 2BOIA 4R8HA 4OPHA 5IUQA 4FIPC 3CC7V 5CZKA 5AVAA 3RWKX 2J1RA 2IXJA 2VOWA 4AHZA 5A33B 1MEC3 1PO12 1GQHA 2ZGQA 4P00B 3TEWA 3FE5A 3VKFC 2JE7A 4QPWA 1H9WA 4HKWA 1UD1A 5JMCA 3G71V 1RGSA 3FB5C 3PDQA 2JGDB 4JTOA 2WBKA 3EXAA 1RSOB 4HYOA 2K46A 2WLMA 1OCRC 1XI1A 5GZGA 1ND3B 3LPGA 2VC9A 1N33B 3L2HA 1QJX3 4BM8A 4GKJO 4JTDB 3AL5A 4GWNA 1FFXA 1DGRA 3NAPA 1W6OB 1NH2B 1W6QB 4RGKA 5BXZA 4O9EA 5A6XA 1N3OA 4XEZA 4OQ9A 4L99A 1QXPA 1AZDA 2FL4A 4Q26A 4GKKB 2DCZA 2Q4PA 4J7KA 5IT9N 1FYUA 4FPOB 4JRAA 3AG3C 4CU7A 1OCCB 1AR92 4X66O 4IERA 4CDUB 2WA4A 3SMHA 2WZEA 2YG0A 3JATA 4AVCA 4Q2FA 1HN1A 2WN3A 3K06A 1EPZA 3E5UA 1QH7A 3C7FA 1ROPA 4GH4A 3WNXA 4JF3A 4CEYA 4CDQC 3IIAA 4YY3O 1MMMA 2E74B 3PJSK 1ULOA 2CTVA 1F31A 2D6MA 3FMGA 3TCUA 4HZ3A 1F4MA 5FXZA 4OZOA 2VUCA 2IVIB 4XBQA 1SQFA 1B3QA 1AX0A 2Y6LA 4C91A 1OA2A 3MI8A 1XOUA 3WU2Z 1AB3A 5F3CA 3J7MA 2WZ8A 4BJ0A 4MX3A 4QM8A 1D2SA 3SEEA 2XGXA 2ET1A 3ZYBA 4KWKA 4P9WA 4FAHA 2Q1ZB 3SISA 3W9AA 1JBCA 3SPGA 4Y1XA 2RR13 1I5ZA 2EJRA 4JI5B 3RWRD 5JOXA 2I45A 1YITV 5CFDA 1I94B 4AOCA 4LIVA 3VZLA 3RZJA 1KECA 4M3CB 3AP7A 4DMIA 4JKLA 1MNGA 4M3CF 4MGYE 2AXTZ 2AZ2A 5KAFZ 2IXCA 1IS4A 4PIXA 3EMRA 5FZDA 1DGWX 3RYCB 3OE7G 3WP3A 4B4QA 4LKDA 4NIDA 3HN3A 2C2AA 4CBCA 2BOJA 4JDNA 2JDAA 3WXPA 2EBOA 1JHJA 3WNOA 3QOPA 4X8NA 2AUYA 4AHYA 4BK5A 1LUVA 5C9AA 4QPJA 4K3UA 4MHRA 3VDDC 4IIJB 4NVPA 4WVMB 4X20A 2QZ3A 3UGFA 3ZFEC 1ZBA2 2B9UA 1UX7A 3OB8A 1VB4A 3Q4HB 4LTAA 4R50A 1DZRA 1Z2GA 1MZFA 4NUBA 5E6HA 1ASJ2 1U5IA 4KGGA 1LUWA 1MVQA 1Z5WA 4JV5B 1VBD2 4O4JA 5LGTA 2EILC 3QVNA 3O1UA 5BUVA 3ILNA 4RHV2 2VW0A 3BABA 3HPNA 2ZE6A 1PP9H 4LF7O 3PUQA 2B9VA 3CCRV 4GCZA 2AW9A 1AI6A 4QGPA 4XUPA 1AR61 1F7YA 4LBLA 4FVMA 1VBE1 1VQMV 2CDOA 1ZYBA 1XHZA 5FJHA 1YSCA 4LBEC 1JOPA 3RZZA 3I3DA 1KD1W 1U12A 4CDXA 3CD6V 2BFUS 1BL8A 2KSDA 2RN9A 4PDVA 3UNPA 3V0AB 4MADA 4DR6B 3KF3A 4K0KO 2VQTA 1AR4A 2VMGA 5JOWA 4LKSA 5LASA 2EINC 3GBGA 3ASNB 5GTIZ 4KHPB 2ZGNA 5LMUB 1H8TC 5IVCA 1LNSA 4OUSA 5J2TA 4LKEA 5FXVA 4LF9B 2B8MA 2VTXJ 4AFAA 3VBRA 3SC7X 1KMIZ 3CCVV 1Z7S3 1LESA 3UO3A 3OBTA 3ZRWB 3JAMN 4FLVA 1VRH2 4TSFG 4ZXKA 4LF8B 1YEWA 5ERLA 2DN9A 1RINA 3WF3A 3DXRA 3WQ7A 4X62B 2HKXA 1O3TA 1C57A 4C1WA 2X8KA 4DR3O 3JAKA 4LBQA 3VBOB 1E1RG 4IEWA 4J41A 4U3JB 3ZN5A 3ZFGB 4NXMB 4CCOA 3ACHA 3WW1A 4GA9A 3E22B 3RZGA 3E8GA 4NIHA 3AJZA 4D6TH 5FNVA 2WNOA 3JARA 4PBPA 3B9IA 5B4NA 2B4KA 3MD0A 4LWSA 2HLEA 2Q8CA 2ZXWC 2EXIA 4EB6B 4O7XA 2RDRA 4DR7O 4N7IA 3E1F1 1IQDC 4GX5A 4FZ1A 3IC7A 5IY5B 1H6YA 2AEYA 1O4ZA 4CCJA 1YJ9V 4AQYO 1LOEA 4L11A 3I2KA 2X05A 2IJJA 1R6KA 4ZPIA 1WMEA 2R0HA 3CMAV 4DV4O 3WLUA 4AEKA 4TN7A 4DR5O 3IDAA 5BNPB 1RTVA 1UU6A 3K4AA 4MGQA 4CCDA 3AG2C 3UK9A 4META 2KB1A 2WSVA 4XF1A 4M0NA 1JN2P 4PD4F 4B8EA 1NA1B 2Y6HA 3B00A 3VZNA 3MAQA 3UGGA 2G4IA 5JXJA 1WA8A 2GMPA 3ICXA 4Y1ZA 2KQXA 1UU5A 1Y4WA 5C8CB 5FPLA 1KDKA 5HFMA 1VIBA 2BP6A 4XBLA 5CBGA 4JAVA 5IVVA 2ZDIA 2IXIA 3MICA 2ZGRA 3FHIB 4XFGA 1CONA 1IBLB 1YQ6A 4V2WA 5CA1B 4WV8A 2XOMA 4AVBA 4YFZA 1SLTA 2Z42A 4WVZA 4IGGA 1AYM1 1H2KA 4PELA 2JENA 4Y3OA 4IGQA 3IAQA 3M8AA 1DHKB 2JGUA 1QKQA 4EKWA 3VBSC 1M4WA 1OOPA 2UYBA 3HNYM 2DVFA 3S7IA 1FATA 3L72H 2CU5A 4LUKA 3I59A 4PI0A 2CGOA 2XJRA 4CEWC 1YFUA 4K1YA 1UY2A 4JDMA 2BTQA 3FZ3A 2ZHNA 4NRQA 5EBLC 4W4LA 1YO8A 2GU9A 4HANA 5BPXA 2ZKOA 2Q1MA 4FOQA 5FY4A 2ZKNA 4Q4V1 4OQ8A 5K0UB 5FPVA 2A5ZA 2XG3A 3APQA 3WP6A 3JALA 3H3ZA 3CCQV 3CCSV 1VBE3 2Q6AA 4IEUA 1MEC2 3NR7A 2EA7A 3T09A 4J6GA 1PVC2 3PN1A 4AF9A 3MPBA 4DV6B 1QXRA 1DQ1A 5GZDA 1UZWA 3GM8A 4DV7B 4IE7A 4XFFA 2XVKA 2VQEO 3N2KA 4CH5A 4CS3A 1RITA 4A6SA 2X6AA 2OVUA 2LUWA 4RFT0 1QWRA 3J7HA 4JI2B 2ID4A 2C24A 3KT7A 4YJ3A 4ZI7A 3CRCA 1QJX2 1XNKA 3K5MA 4WBNB 2JDPA 4BYYA 4QPGB 4Q0SA 5KUKA 2X53S 3GHNA 5FK7A 5LEJA 2QM7A 1YI7A 4XACA 4BQ1A 1NLRA 3T0DA 1W8UA 4AYUA 5IVBA 4GH4C 1BVP1 2Y69C 4CEYC 2FQPA 5A7SA 2WFPA 3MBWA 4RUFA 2W1UA 3BA8A 3EXUA 4F6EA 1VF5B 5L3GA 2DWRA 4CP0A 4CDWC 1I7FA 3BTAA 3QG5A 1NE6A 2ORXA 4HZFA 3RZMA 5B5EZ 4Y1YA 2IJKA 1QMJA 1PX4A 3APBA 4B1MA 4MVMA 4OXSA 4A4AA 5BMVA 1XRUA 4MH0E 5FQ0A 2HH9A 1G6UA 5DUVA 4GUNA 3KV6A 3SCGA 5GZFA 3H01A 4K3AA 1SQXH 3KZ4C 4ASUG 3LGRA 3C3SA 3H9VA 2OYZA 2BW8A 2W9XA 1LHVA 2VVDA 4GULA 2PI4A 5CFDC 3WR0A 5LA9A 3JCIA 3AKSA 1BQPA 1XNDA 3AKRA 2RG4A 2Y38A 3HKEB 2E5LB 5L7OA 1QVFU 3LE0A 3TEYA 4KXRA 5B1BB 3EVKA 2RR12 3I3QA 4ISRA 1KP2A 1GP6A 4XVHA 4BQXA 2AENA 1H4GA 4COVA 1RUH1 2X29A 4R8CA 1O9GA 4YVSA 4A44A 1HR0B 5HXVA 1S2KA 1RPOA 3HR0A 3N4MA 4XETA 4XC9A 1ZRIA 2GP5A 3ZSEA 2A6WA 2ZIMA 5B2GB 4FLYA 2V09A 1G9CA 2VQAA 1SLCA 3R0RA 1XPWA 1UOBA 3B8NA 5FIXA 3ETQA 2BVBA 1WUVA 2GALA 1TME1 2R1BA 2WNVA 2DFCA 1UZ0A 1N1TA 5D1IA 5C4WA 4YW3A 3C7OA 1WLDA