2PTMA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
DSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Transport protein
molecule keywords Hyperpolarization-activated (Ih) channel
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ptmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ptmA02
3S7EA 3GYDA 4LLOA 4QM8A 2PHLA 1Y3TA 1V70A 3QACA 3E6CC 3SCGA 3FJSA 4XFFA 4QMAA 4HN0A 4P9GA 2PFWA 1X8MA 4FAGA 1SEFA 4XFCA 1NXMA 2IXJA 3S7IA 5KHHA 5FPXA 4L2NA 1LR5A 2Q30A 1H1MA 2IC1A 2BNMA 4YSFA 3BALA 2GC1A 4QXKA 3H3ZA 4IEXA 2QNKA 3H9AA 3LOIA 5KBFA 2V09A 2MHFA 3OCPA 3SCHA 4J1XA 3H50A 1CAXA 1O3RA 4FT8A 1EPZA 3KSCA 2ZKLA 4AQ6A 1YFUA 5FLJA 4O9GA 3FE5A 4MH0E 2GC2A 4BH9A 1OMIA 3NW4A 2Y0OA 4MX3A 5KHJA 3RNSA 4MUVA 3SXWA 2CGPA 5BV6A 2ET7A 2CAUA 2Q0AA 4Z82A 3I59B 5C6CA 4HVOA 3DN7A 3LA7A 2VPVA 3HT2A 1YFYA 2B5HA 3ES1A 5BUVA 1XE8A 2IXLA 2QVSB 3WW1A 1H1IA 2K9ZA 5BXXA 3ETQA 3BB6A 3CO2A 4EWEA 2Z2SB 1J1LA 4F7ZA 4GULA 1O3TA 1RGSA 4AXOA 5FLIA 1LB2A 2ZCWA 1ZZ7A 3OD0A 3SCFA 4B29A 1QXJA 4MZUA 1FT9A 4I09A 4XF4A 4AVAA 1NE4A 4HVQA 5J3UA 2EA7A 4WBBA 2GH2A 3H3UA 1XE7A 3I59A 4NVPA 4D7SA 3WW3A 1RUOA 3OF1A 3NL1A 1XRUA 3FHIB 4WVZA 2UYBA 4O9EA 1EYBA 3ZDSA 1OD5A 4R8HA 2XLGA 4IEZA 2BNOA 2OPKA 2CAVA 2P17A 4HSJA 1ZRCA 2H6BA 2PA7A 1Q5OA 3B02A 2ET1A 4PJYA 4D7TA 1YFXA 3PNAA 4MGIE 4R52A 4IEYA 1CAVA 2XGXA 3CL1A 4Q0PA 3FX3A 4LA3A 3OTFA 5AVPA 5C8WA 2XKOA 4Q0UA 5F1RA 3C3VA 2C0ZA 1ZVFA 4QGLA 3HIFA 5CU1A 4CYDA 5K8SA 3PVBB 5I8YA 3NKTA 2GC3A 1ZRFA 3ACLA 3CJXA 3LWCA 5I93A 4IEVA 1J3QA 4MV2A 2BEOA 2FMYA 3KCCA 4E2QA 1UCXA 5FQ0B 5I0SA 3CF6E 1ZZ6A 2FQPA 4META 3ELNA 4KWJA 3KMHA 2QJVA 4XF9A 2WC2A 4HLTA 1Q43A 2VECA 1O5UA 1ZNPA 4IEUA 2BNNA 3O14A 1WA4A 3E5XA 4J1WA 3E5QA 3RPQA 1VR3A 2UY9A 2IXHA 2Z69A 5FLHA 4AVBA 1Y9QA 3EHKA 4H7LA 3EO6A 3IDBB 4ZU4A 1X82A 2GU9A 4PIXA 1O7FA 3H8UA 1J59A 4EWDA 4ZU5A 3USSA 4TLFA 2D40A 5FQ0A 3CLPA 3U0ZA 1JUHA 2ATFA 3BU7A 1NZCA 3BPZA 4I2OA 3UKNA 3RDIA 1WLTA 3S0MA 1DGRA 2PQQA 1YFWA 3LA3A 2MPFA 3RYPA 3RYKA 5JSPA 1ZZ8A 1DGWA 4HMZA 4MGKE 1UIJA 3FFQA 2D5FA 3HQXA 5JSRA 3QOPA 4IERA 3ROUA 5I0TA 4EV0A 4F8AA 4HN1A 2H0VA 4LUKA 4UBHA 2ETEA 1SQ4A 1CAWA 4ORFA 5JR7B 4QGNA 4L11A 2UY8A 4KL1A 3VHRA 5LRSA 1YWKA 1FI2A 1ZRDA 4BHPA 4ZU7A 1CGPA 4MGYE 4HSLA 2CV6A 1O3QA 1RL3A 3H7YA 1U12A 1CAXB 3LZZA 3E6DA 1EP0A 4Q0SA 1J3PA 4LUMA 5JSOA 1ZZCA 1UIKA 3DV8A 1ZZBA 4I0AA 4Q0QA 4YARA 3M70A 3EBRA 4LTAA 3EJKA 2Q4SA 1GQHA 2N7GA 4UBGA 2BGCA 1PMIA 2KXLA 3H1WA 2H6CA 4FBFA 4QX5A 2D93A 4YYOA 1X7NA 2K0GA 5I8SA 4PIZA 4LULA 2OZ6A 1DZRA 3ST7A 1RTVA 4XF1A 2IXIA 2HKXA 4N9IA 1EY2A 4KU7A 4K8FA 3DKWA 5FPZA 2EVXA 1CAUA 4IEQA 2UYAA 3FZ3A 3IBMA 1IPKA 3WW4A 4I3PA 2F4PA 3U11A 1UD1A 3L2HA 1CX4A 4BIFA 4YNIA 1RC6A 1X8EA 2D5HA 2GAUA 5JAXA 2O1QA 4IESA 1ZREA 5J7MA 4Q29A 1CAWB 3DL3A 1J3RA 4XFBA 4AVCA 5KHKA 2I45A 3IIAA 4QGMA 5FDBA 5E16A 4I01A 2EAAA 4MGZE 1CAVB 4WZCA 5I0RA 3N4MA 2QDRA 1O5LA 1HW5A 1OI6A 4PIYA 3MDPA 4XEZA 3H7JA 2HJIA 4XF3A 2VQAA 3MPBA 1YHFA 4XFAA 3IDCB 2IXCA 3JZVA 5CADA 4E2GA 3EQEA 4JTOA 2MNGA 3E97A 2XL9A 3NVCA 3KGLA 4JTNA 5CVRA 2PAEA 1I6XA 3M3IA 5JCTA 4HBNA 5EFUA 1ZRRA 4I02A 4OFGA 1GQGA 1VP6A 4BYYA 4FAHA 2O8QA 1G6NA 3G7DA 4ONUA 5LEKA 4Z07A 4KWLA 3H1YA 4XFIA 2Q1ZB 3CEWA 1I5ZA 3GBFA 3PLQA 5I0UA 4X6QB 4XFGA 5HI0A 3D0SA 1Q3EA 1LRHA 5J48A 2GZWA 4X6RB 3E5UA 4N9HA 1O4TA 2XHKA 2BYVE 4IETA 1DZTA 3KGZA 4EWAA 4KU8A 3I54A 3R6SA 1UPIA 3H1MA 3RYRA 4EROA 1NYWA 2QCSB 4IEOA 5KHIA 5BY5A 1QXRA 5FCCA 2B8MA 1L3JA 3U10A 5BPXA 3MYXA 3UKTA 1OFNA 4XF0A 2IXKA 1YUDA 2GC0A 1ZX5A 2WFPA 5LRRA 1IPJA 4I0BA 3OGJA 2E9QA 4UXAA 1QY4A 2OYZA 4DINB 3LAGA 3SHRA 4JVAA 1WGPA 1J58A 4JV4A 3IWZA 2XKPA 4Q0VA 5I91A 4OLLA 2OA2A 3NJZA 4A2UA 3TNQA 4AQ2A 4XFHA 2XLFA 4IEWA 1ZZ9A 3E6BA 5EZWA 3MZHA 1NE6A 3NSTA 2XL7A 1FXZA 3FWEA 1SFNA 4LEJA 1LKNA 1PM7A 1QWRA 5D1IA 5T3NA 1RUNA 1VJ2A 4HZFA 5I8TA 4QM9A 2PYTA 3BCWA 3D82A 3TNPB 2DCTA 3LA2A 4E2SA 1UW8A 3SMHA 1CAUB 2B9UA 2XLAA 4XETA 4YRDA 3ES4A 1TQ5A 3WW2A 2PAMA 5KHGA 2PTMA 3D0JA 4LA2A 3HT1A 4HVRA 3UKVA 5E1RA 1YLLA 4RD7A 2PAKA 2OZJA 3RZZA 4IEPA 2PHDA 1O3SA 4KWKA 5LEJA 3I7DA
chains in the Genus database with same CATH superfamily
3UQ8A 5FZCA 5B5EZ 1GZCA 4LF6O 2CY6A 4LBNA 4FAGA 2P4EA 1SLTA 5FYHA 2GN3A 3I2GA 5FP7A 1HV0A 3OMIB 2OTJV 5CYYA 4K3UA 4XILA 1RUG2 3LOIA 2GBOA 1KP2A 1H6XA 5HPOA 3UKMA 2FTKA 3PUAA 4QQ2A 2ZKLA 4Y33A 4AQ6A 5FOBB 4MG2A 4O9GA 3OUJA 3GALA 4CA9A 2PI5A 3RNSA 2DQ0A 4CH5A 3VKOA 1TNRA 2ENRA 4B3SB 3WDXA 5H9PA 2VNVA 1QNYA 2A3XA 1OCCC 4LFAB 5FY1A 3ETQA 2V72A 5FMDA 5LK5A 4NO4A 1D7PM 2WZ8A 1ZZ7A 3ZYJB 1XE7A 2JJ6A 3VQXA 3ZEDA 3AP5A 1NR1A 4LWSA 4KI5M 2DYRB 2XJVA 3FUQA 2Q1MA 4GH4B 3VZNA 1YQ6A 1C4RA 1B35B 4LKSA 1QU7A 4TV9B 1PHMA 1P8JA 2ET1A 3K46A 3N9LA 2R073 4GQ7A 3K08A 3FFZA 3SGIA 5CA0A 1JA8A 4CYDA 1PZ9A 4BQ5A 3SYCA 3ACLA 2XJRA 1VBA3 2XDVA 1J3QA 2A6XA 2X5IC 1EN6A 1K9MW 1TEIA 5FQ0B 1RUH2 4LNUB 2R49A 4WM8A 4LF8B 3CMEV 4B3MB 1GICA 5D2AA 2R9AA 3X29B 3KQ4B 1VRH3 1VALA 5B1BC 2QKDA 4RQEA 5FBJA 5JWPA 2ZINA 1V0AA 1AR62 1SLIA 1GWMA 3O7OA 1CESA 2CE4A 4UCOA 2E7TA 3AYAA 2PHFA 4FLYA 5BNNB 4K1YA 3NRUA 1OFSA 4OI4A 1NKDA 3VBRC 1ZX3A 3CLPA 5FYTA 4FXGB 3VBUC 1ODNA 3C3SA 1HWYA 4IE4A 4Q4Y3 4PA6A 1T2XA 2E74B 4WVMB 3RYKA 4GX5A 1LUVA 1VBA2 1PMHX 5LASA 1H2MA 2P1BA 3IMNA 4F8AA 4CP9B 2JK5C 3G67A 1F2NA 2ZAAA 4UBHA 3R05A 1YI7A 4KMQA 4DR3B 1WPXA 1LOGA 1MOFA 1V6MA 1GM7A 3AEIA 1UOGA 2YEVA 2ZGOA 3KVAA 3CB2A 3POFA 2A5ZA 1OUSA 2EZPA 1I94O 4FLWA 5JQGA 2HKXA 4F3JA 2BCCH 3B69A 1VAKA 3ZMNA 4FZ1A 3VD4A 3AMHA 3A8TA 5IK5A 2JG8A 4XCBA 3CYOA 4U3JA 3GZEA 3L2HA 2JG9C 4IV1C 4OMDA 4LT5A 2WWSA 5JR2A 2JE7A 3W7UA 1VAMA 4SLIA 2QKCA 2ZXWB 4MVTA 3M3EA 1C3HA 4YJ2A 4S2GA 3NV2A 5I0RA 3WNKA 2PMWB 5FWJA 4B7KA 4I5SA 1OA2A 3SH4A 3M99B 1TAEA 5F5AA 3HR9A 1BLZA 2YI9A 3TXQA 3NJVA 1C8NA 1POV3 5FYYA 3LSSA 1G9BA 1OCZB 1K7DA 1GBGA 1GYKA 1EUTA 1E79G 4L92A 4GUNA 5BNPB 1GN4A 1D2SA 3ZLIA 3FLTA 3LDBA 4D69A 4Z07A 3CSXA 4K6BA 4NRMA 5KX5B 3N2GB 1HLCA 1O4TA 4I30A 4CXWA 2O8OA 4A42A 3F5TA 1HB4A 1WCKA 4JV5O 1G9CA 3QH6A 1JI6A 2DU0A 1VLNA 4XW3A 3PUIA 3ZHRA 1HRI2 4P9YA 4NROA 2ITCC 1OH4A 5LXTA 4XTPA 4LBQD 4LIVA 3T1HB 4N7IA 2OUJA 4I0BA 5BNOA 1S2BA 2ZMLA 2BSKA 5C9AB 1RUI3 1YIFA 1NU1H 2DCJA 3BEHA 2N05A 2NQYA 4V2VA 3JARA 4Q0VA 3LIGA 1LEDA 5JOZA 4UVAA 3MIGA 4YXWG 1IBKO 1RUJ1 2F17A 2XL7A 2UUBO 5FZAA 3G6JB 1RUNA 1BBT2 5E79Z 1EFRG 1VQMV 1XC6A 2PYTA 3WHTA 3AFGA 5AFBA 1ZM1A 3UV9A 2YMZA 2UXDB 1BK0A 2CTQA 4I0WB 2XBO3 3APBA 2BE3A 3WINE 1SDDB 2PGGA 4O2AA 3JSNA 4UW6A 1FD9A 3K9SA 1YLLA 1S0CA 4L8QA 5LA2A 2QGNA 3ZFGB 3DEMA 2WFF3 3RZZA 4SBVA 5FY5A 4LOTA 1FKAO 1VRH1 2MK3A 2WWUA 1L7LA 4HKLA 1FJGB 2J1SA 3UT0A 3E6CC 5GKAC 4YZ4A 4XFFA 4K0KB 2K2SA 1ZBE3 3OGIB 4KBZA 2VXRA 4DV1O 2ZAHA 4LOSA 2Q30A 2VH9A 3BCCH 2I2SA 1G9FA 3H9AA 5KBFA 4ES9A 2CGOA 2D97A 3FL7A 1BL8A 4FQZA 2Z0AA 1R083 2QM8A 2Y0OA 3FB5C 4PDLA 1GV9A 2W1SA 4ZXKA 1QF3A 1OOPC 3CEIA 2LUWA 1GANA 2ET7A 2XG3A 1X50A 1IXMA 3HT2A 1UKRA 2DV9A 3RW0A 1XE8A 5BXXA 1AILA 4QE9A 2GNMA 2HVJC 3BB6A 3LEMA 3IB3A 5C5TA 1ROPA 3T3YA 1Y76A 4Y5SA 2YS8A 4RFT0 1ZBE2 5HXMA 1YIJV 5L73A 3D4KA 2EA7A 4WBBA 3ZCCA 1PNGA 5ABJA 3LIHA 2IFWA 3O1VA 3H0OA 2ADEA 5LXTB 1ZBE1 2W91A 3A21A 1EAH1 2A79B 1IKPA 1E5SA 4R8HA 3AYEA 1H4HA 2ZDIC 5B4XA 1K3EA 3Q4HA 2H6BA 3CJIA 4B08A 2X6AA 4MGIE 4R52A 1FJGO 2MEV3 4HNAB 3EYPA 3AZYA 1ZVFA 5A6QA 4MVQA 3K06A 4DFSA 1Q82W 2DUPA 5CKQA 3I97A 1VBC2 3FYIB 4I55B 1LODA 1ULDA 3ELNA 3POGA 1OHFA 2Y6HA 3CJIB 2P3JA 1SC5B 1JOPA 4RFRB 4AW7A 1LULA 4KXRA 4D6QA 3ZXJA 4CDQC 5LBFA 4IGGA 4KP4A 4FPFA 2RS51 4N43B 2XH6A 1MZEA 1R1BA 2WLIB 2VZ1A 3IJ4A 3IT8A 1P84F 3VQWA 5IVEA 4JTAB 4DEQA 3IPVA 3USSA 5T5JA 3DSQA 1SMVA 3H1LH 2GH8A 2JWPA 4I50B 4MT8A 1JYVA 3BVCA 4X20B 3HQXA 2K9PA 1DTOA 4H14A 5LW9A 4JHZA 2ARAA 3IPVB 4LP8A 2QQVA 3TEZA 4DQAA 2V1DA 5DAPA 5FPUA 2AH2A 1NOVA 1O3QA 2CUGA 3FBMA 1JJ2U 3DV8A 2ZE8A 4GWMA 5T5OA 1XNAA 2WO1A 4U3FH 2M6YA 2VCAA 1VF6C 4A6OA 3VOUA 3BIWE 2K0GA 4EB6B 3RMXA 1S0DA 2RV9A 1GZ9A 4RR3C 1SERA 5L3FA 1J95A 5LL6Y 4W4LA 3JQXA 3N36A 1WCUA 2JE8A 1LOFC 5F9TA 4CP9A 4LBJA 3JAWB 3PU3A 1UX6A 5AFEA 3WF2A 2HKOA 1Q81W 4OHVA 5C7GA 4JYCA 5F3GA 3C7HA 4XJAA 3VBRB 1TMF1 4XPVA 4FP2A 3S57A 3TEXA 4DR7O 3LQCA 4QGMA 3CE2A 1UMZA 1CAVB 3ZPOA 4BIZA 1QCEA 1HXS3 2H94A 2NPIA 5G05L 1HW5A 1FPN3 1D4VB 1GNHA 4O4JA 2OYQA 2Y6GA 2VBDA 1DQ2A 1XNBA 1F51A 5JQGB 5KA6A 2VULA 4E2GA 4FIPC 5L3BA 3WG7B 4K8ZA 4I02A 2WLNA 5C8CC 2O8QA 4JGZB 4LBLA 3WB1A 5HI0A 4OHXA 1SQQH 2OQ6A 1Z7S2 5L3CA 1FV2A 4X6RB 1VAVA 2XR4A 4YGCA 2E5LO 4D8MA 2YC4A 4GH4C 4EWAA 4GKXA 3E35A 4IE6A 3I54A 3HPLC 3CRMA 2VCBA 2DVAA 4R6ZA 3CC4V 3U10A 1G1XB 2BUKA 2XJQA 2B1IA 1FPN2 4CS3A 3ZMZA 2FDGA 2NMOA 5LRRA 1GU3A 3K58A 5GONA 3IN9A 2XHNA 1YIPA 3AYCA 1YZBA 2L35A 3VHNA 3CCSV 2QZ3A 1TUBA 3GBWA 4FPGA 2XKPA 4IL6Z 3IC9A 5C93A 5J2UA 2ZTNA 1XMQB 1N32B 4NAOA 5E89A 4IEWA 3K4DA 1R64A 3DPRC 2JE9A 4OZOA 1GOHA 5FREA 2W92A 1FXZA 3W58A 2VNRA 1FMD2 2QDNA 2E7QA 1KFXL 4CEWB 1A6CA 3FN9A 2VW0A 4XETA 3SEEA 1W0OA 3BI3A 4ARXA 1GWKA 1PGSA 3D0JA 3O5SA 1WPBA 2RNBA 1SQGA 2CH7B 2P67A 2N04A 2BRTA 2N74A 3HKDA 3K03A 4QXCA 3IAYA 3HWJA 3BTZA 4Y5TA 2RJ2A 2KA3A 3DYPA 4BPZA 4NPLA 4XTMA 2WS93 2DUQA 3MHZA 4G2KA 3IM0A 3IC7A 4O4JB 5J2TB 5LGTA 4UWDA 4UCUA 4YPJA 4CCJA 2PLV2 3VDDB 1F31A 3OYWA 4DUYB 1EPZA 3KSCA 1YFUA 2WAMA 3GBGA 1NTKH 1D4M1 3B5LB 3GHMA 3MF6A 2R30A 2Y6KA 5KUMA 4MX3A 1AXKA 2TBVA 2W1QA 3OUIA 3H1JH 4Z82A 1DHKB 3O65A 2K9ZA 2P6CA 4EWEA 5EPAA 3OBRA 3PJQA 5D8AA 4NYKA 3L9JT 2GV9A 4BWOA 4I09A 4AVAA 5FO8B 4XURA 2R1BA 4UYBA 4W6XA 2C5DA 4AF9A 2BWAA 4KHPO 2XJUA 4LO7A 1MQTB 2EIJB 1AR73 2E31A 1OF3A 1N0NA 5FPRA 4GJZA 3DGTA 2YIBA 1HRI1 2B7YA 1N1VA 1DK1A 4DRXB 5CG8A 5DABA 4PA9A 2BOCC 5F1RA 1MSWD 1F4MA 3PVBB 1ZRFA 3THPA 4CVUA 1BBT3 4FPKA 5I0SA 1KJLA 4JI0B 4AFCA 2ZHKA 5FZDA 4GKJO 3MLLA 1FX5A 4X62B 2LW8A 2GSYA 3ZFEA 4R9BA 3E5QA 3U4SA 2CWSA 1VR3A 1DQ0A 2FCTA 2Z5WA 2XWBB 3LCPA 5A33A 4NHLA 1J59A 2LRPA 1H2GA 4JI7O 4JI8B 1PV0A 4K0KO 1WLTA 4UVBA 1KFUL 2VOKA 3T2OA 4AAXA 3BODA 4JDMA 2ZA9A 5JSRA 1C8M2 5JI9A 2V5DA 2ETEA 2J1RA 3VGIA 4ORFA 5HCFA 1K73W 2LTNA 1XQNA 4QJFB 1FAYA 4W50A 4LUMA 1VQNV 1CIWA 4MTGA 3P5BA 1AB3A 3KF5A 2BW8A 1CN1A 4E4DX 3IAQA 4UBGA 4ASLA 1YF2A 4WM7A 5IYDO 4QXBA 1L8DA 2OS2A 1UY2A 2OZ6A 4LF4B 4MVOA 2AR6A 3PMSA 4XF1A 1YJWV 2VQEB 2IXIA 1S3JA 3ZFFC 4AEKA 4XOGA 1LOAA 2WQ4A 2WWJA 3VHPA 4Y1YA 1W05A 2VMFA 3HPNA 1I94B 3D8CA 4R9DA 2W6IG 3VBFC 1CZTA 5H9QA 2VRZA 1OPOA 1Q7YW 1FNZA 5BYNA 2I45A 4EKWA 3V56A 2QQUA 4AFAA 4JI0O 2WNVA 1RIRA 3NQHA 5JIAA 1W2BU 4J6GA 5IJ9B 1QGLA 3THTA 4XFAA 4QPIC 2OTLV 5SV8A 1W99A 2WABA 1JYCA 5CVRA 1K34A 1IOAA 2YZ4A 4CH4A 3NNMA 3PTYA 5GALA 4OFGA 4X1KB 1G6NA 4PBPA 5J48A 5JZGA 4KHPB 3JAWA 4WCEV 4GKJB 2XHKA 2AXTZ 1S2EA 4ISRA 4KU8A 3CCVV 1UPIA 1XPWA 2HLDG 3ZYIB 3UT5A 4IEOA 4YVWC 2HH9A 5FP8A 4FPPA 4M00A 1LNSA 1BQ0A 2JDNA 4LF8O 2WJSA 3K57A 1XB9A 4RQFA 5IJ0A 4YWAA 1JS9A 3GWOA 3KVBA 1R091 4RS5B 4O2BA 5FY0A 3OMNB 4A2UA 4QX8A 4LO4B 2HFEC 1OXCA 3L72H 5F7UA 1NE6A 2UUAO 2XUEA 3BOPA 5T3NA 3CD6V 3ZMVA 2Y33A 1AR71 2IJKA 2Z3YA 1S5LZ 3AL5A 1JZ5A 4GKYA 4YRDA 1K5MB 3ABZA 2X53S 3RZJA 5KHGA 4LA2A 3R0RA 4JC1A 4B3SO 5ANNA 2PAKA 2GNTA 3CU7A 4KWKA 5CFCA 5LEJA 5A7PA 3SPGA 4Z92B 2EXKA 5A3TA 4DK0A 1Y3TA 5DG2A 3WV6A 4UV9A 3CCLV 4IV1A 4FFKA 3KT7A 4YVSB 1F4NA 3OT7A 2R071 2D43A 1QEXA 3FB6C 1AR61 3UGFA 5D8AC 1WN7A 3T1YO 1FOD1 3AG4B 2WFF1 2YIDA 4UW5A 4AE2A 1K97A 1VQLV 2WNOA 3KWVA 4TUYB 5BNPA 5C5UA 1BJQA 4LR4A 3CNAA 4XJ9A 3HAGA 1XBFA 2A7WA 2CAUA 2GP3A 3K0DA 1BMV1 2LFSA 3SPJA 1YFYA 1OH3A 1JOYA 4MOAA 2JIGA 3WDVA 4AXOA 3CMGA 1JVMA 4O7XA 3MUZ1 5FZMA 4GB32 5G04L 4LO5B 4DUWA 4OXSA 4MS2A 4MW8A 1UNBA 5C9AA 3ZPYA 4MADA 1EYBA 5IHRA 2VWJA 3OYWB 1PO11 2P17A 4HSJA 1ZTEA 1ZRCA 1V9U1 5IYBO 5LMUB 4J10A 2OUHA 2A75A 3PNAA 1VEWA 2WL1A 1NCQA 4J7ZA 5ABJB 1W9WA 1NH2D 1VE0A 2IW5A 5KXDA 1GOGA 1OVSA 4M01A 2VJXA 4JGZC 3UO2A 4DUYO 1D2DA 5FK7A 1QJX2 1M57B 4PLMA 4PA7A 4FPCA 4N53A 4PQ9A 2W2IA 1RUE3 4XF9A 4QU1A 4D6SA 5LA6B 1DFQA 3AG2C 1BT8A 4AEJA 3RPQA 5CZKA 3JQWA 1JZ4A 2Z69A 3EHKA 2GU9A 1O7FA 2X10A 1OPMA 4OVEA 1OA3A 1MQTA 1SFYA 1MQTC 3WOGA 3O1UA 3P30A 3MV11 4LITA 3MFCA 1ONAA 3BKZA 1Q6IA 1FAFA 1RUG1 1QNWA 1WMFA 4YHHB 1S0BA 2CWMA 5JSPA 1QJX3 4CCNA 2D5FA 4UI9L 1VQ6V 2BOIA 1RUD1 4PA3A 3ABTA 3OUHA 4YVSA 4L11A 3KV4A 5LRSA 3JAKA 1NY72 2VUJA 1PO21 1HN0A 3ZHSA 1P49A 3LZZA 1AR91 2WO2A 4Q0SA 1J3PA 4O4HA 5GJ6A 1UIKA 2BTVC 4LTAA 2ZE6A 1RSOA 2N7GA 1GMGA 4FVVA 1W6OA 5C3QA 4QX5A 2EJ7A 2R72A 2RS11 3ZDVA 5I8SA 3ILRA 3LDKA 4XQDA 3O1TA 1WLDA 5JXGA 1V6JA 1W8UA 2JS5A 1K8AW 2WT2A 2QWRB 3AMMA 1Q6HA 1UF2C 4Q5OA 1W6NA 1OOPA 1GN3A 4Q26A 4AEMA 1YTFD 4WFGA 4BIFA 2CTWA 4R9AA 1HXS1 3UO3A 1X8EA 1YCIA 1ZREA 4JI2O 2XOKG 5H5NA 3JATA 1WP7A 2YBSA 3A4UA 2X6BA 1TMF3 1UZYA 2RM23 1GOFA 5FYVA 1XE0A 3MIBA 1VF6A 4AI0A 1I5XA 1SLLA 4HK9A 4CC6A 2Q7HA 4AOCA 5LOVB 2ZD9A 3K0GA 1HDKA 2DFBA 2R041 3I49A 3AC0A 4I55A 1J5EO 1JR9A 1YHFA 3K51A 3H1IH 5J1XA 1YC61 4FCAA 3FC0A 2AACA 3E97A 4HG6B 2AEZA 5CEHA 3OB8A 3TETA 4ZONA 4RGGA 2YICA 1Z78A 1SQFA 3HNYM 3GBFA 3FUOA 2O14A 2VOXA 2GZWA 1NVPD 2JDKA 1KS4A 3RYHB 3OR6C 3MI8A 2WNUC 1I3HA 3KGZA 3WZ1A 2HYXA 3OBZA 3AG7A 1CPMA 1ND2C 5K4LA 1XU1A 5BPXA 1C8M3 2RDCA 2HEVF 5JH7A 1N1YA 2IXKA 3HN1A 4DR2O 4PELA 1C57A 1GR3A 2WYFA 4AI2A 4MXVA 4B4RA 3VBOA 1UMIA 3FLPA 1WGPA 1OCOB 3MAQA 3M2MA 1FPOA 3FMGA 5FO9B 1R1A2 2F23A 4QIWF 1QJFA 2DUOA 2RS53 3BTYA 1HB1A 4W8JA 2VGDA 2ORZA 2UWCA 3WXPA 2GMMA 5E1AC 4DV2B 3O1SA 5I8TA 4CU6A 1HJGA 5DAXA 2XHBA 1UW8A 3K04A 4RUFA 5F5QA 2VWKA 2D6LX 4ASKA 1UOJA 4XJ8A 1T6BX 3VBUB 3T08A 5F6KA 5DDJ3 2WBKA 2CL2A 1COV2 4B3NA 1VBB2 3H1KH 1XSRA 5BNNA 4Q1RA 2XAGA 4LLOA 2W08A 3M3QA 4MVUA 2JS3A 4OQ9A 3RJ2X 5FPAA 3VZLA 5IVFA 4DXZA 2RS52 4FFBA 1ND2B 3B9IA 2P7TC 3AK0A 2Y6FA 3WF0A 1RB8G 1NA1B 4NWWA 3ZXEA 2V09A 5ACA2 3I2HA 2DTYA 3JASB 3BYWA 2W3JA 4BH9A 4IGPA 3WCRA 3FHAA 3IDAA 2ERFA 5DDJ2 3Q8FA 1PVC3 1R081 5GM0A 2WZR2 2LP7A 2QVSB 2UUBB 1HRV2 4PDVA 2W47A 1AI4A 4JAUA 1UMHA 4QE7A 5IFPA 3RVZA 1QXJA 5FXWA 3E86A 4X89A 5A9GA 5GLWA 5KMGB 2NNUA 5IE9A 3SEPA 2AZ0A 4LMFA 3NL1A 3NKGA 5IYZB 2AENA 1ACCA 4TWKA 2JRIA 1AYM2 1Y67A 3CPWU 3MEPA 3ICXA 1VBE1 3ZN0A 1YFXA 2HWE3 2VZQA 1G86A 3RBZA 4CU7A 5IAXA 2Y34A 3LDDA 2BZDA 2D2CB 3GWKC 3F95A 5BR8O 4BCUA 1PVXA 3CJXA 1S4CA 2J1UA 4MV2A 1JFFB 2VVFA 1RMU1 1JYWA 3K9AA 4LFBB 2Y26A 2OW4A 2A1XA 1XYPA 2Q8DA 4JGSA 5JJEB 1G9AA 2EBOA 2P5OA 2DMXA 4BE3A 5LY1A 2C26A 2KG7B 2JXAA 4FMTA 4AVTA 4H7LA 1SLAA 2XQXA 4XZUG 4H13B 2G1MA 4I3GA 4ZPIA 3MUY1 4YW5A 4IDZA 4ZZ5A 3ZSEA 2CH7A 3V0AA 2VZUA 3S0MA 2PQQA 2V4AA 1WW5A 1UIJA 3GJAA 2SBAA 3QOPA 5IUQA 3RYCB 1M5IA 3VZOA 3ON7A 1CZVA 4UVCA 2YU1A 2C1FA 4ZU7A 1X9PA 2CV6A 2X05A 1GKBA 2X29A 2F1MA 4YLZA 1ZZBA 2UU8A 1RUJ2 5L7OC 4A7KA 1C28A 2LM3A 3RYCA 1NCRB 1WA8B 3SKJE 4PI0A 1YQ8A 4TN7A 2H8PC 4GB33 4JKLA 1J83A 4EN9B 5JMOA 3IMMA 4I9QA 1O91A 3BVOA 4JI6O 3CS5A 3FZ3A 1FATA 4KGGA 3C7EA 4YY3O 3ILFA 4FLUA 3RYHA 1VBD2 3B4SA 3C7GA 1VPHA 1N8RW 1WW4A 5K9YA 2Q6AA 1KD1W 3VBBA 2Y8KA 2HVKC 3T4DA 4FTSA 4NXMO 1N34O 2VTXJ 3RZMA 4XJZA 2JG9A 4CP2A 4Q4Y1 5FYBA 3T1MA 3I3MA 2FZ1A 5JUVA 4GLXA 1JYTA 2BTOA 2GTAA 1XREA 4JTOA 1BEV1 2MNGA 2VQ0A 1FS0G 2DFCA 4IE0A 1PGL1 2BDRA 4BYYA 1UO9A 4C91A 3DPRA 1VBD3 1AXZA 2Q1ZB 4DUXA 1Q3EA 3VB9A 4FO9A 1MS9A 3T2MA 5J37A 3JATB 2XVLA 2ZE7A 2ZX2A 4TSVA 1QLNA 5FZEA 3VL9A 2HWC2 1JMUB 5KHIA 2QWOB 2CHHA 3ZX7A 1GTOA 1Y76B 2Y60A 2PZSA 3MYXA 4XF0A 4LK6A 1W8ZA 4ES8A 1EM1A 3PVEA 3DKQA 2UWAA 2A06H 5GLVA 2GMPA 1W8HA 2KM2A 1XMOB 5EJ3A 4XAAA 4FPEA 1S72V 1J58A 2FYUH 1C5IA 2W1WA 1YI9A 1PX4A 2JDPA 1XNDA 4AQ2A 3POJA 3BGAA 1DF5A 3E6BA 1AVBA 1QJEA 2X7RB 4CXXA 3E8BA 2R0FA 5IJ0B 4LBQA 2QUOA 1VJ2A 3LEKA 1ULPA 3OPTA 1JTZX 3D82A 3LSDA 1MEC3 4Y20B 3I4IA 5KWRA 2B9UA 4FM2A 1ENXA 1UYPA 2RR11 1DF0A 2SLIA 3WU2Z 5GZCA 2PTMA 3HT1A 3ABKB 4PD4F 1E5IA 2QFEA 3UKVA 5K0UA 4IIJB 1NUKA 1D5AA 1ZUQA 3HB3B 4BAYA 2K46A 2ZX0A 3GNEA 1L7QA 3TOJA 3ZN4A 1TUBB 1IVSA 4QB6A 2VNGA 4KWUA 1BKZA 1IGOA 1PP9H 3V65A 3P6BA 2C9KA 4UFZA 2IXJA 1LR5A 3K5MA 1KQRA 4IL7A 1VBE3 2CAZC 3ZYHA 4WFEA 2XAJA 1OCOC 5JJNB 4Q4V2 4FT8A 3TK1A 1TNFA 1WUVA 2P2KA 5ERLA 5FLJA 4PDRA 2WLPA 3WNPA 2BP6A 4F6EA 1YDXA 3KF3A 1BMFG 1UYXA 2ZJCA 1FOD2 2CGPA 4HVOA 3N2GA 2ITDC 2ZIMA 5CFCC 2WNEA 3M1HA 4QPIB 2IXLA 1H1IA 1XOYA 1GUIA 1J1LA 3MLKA 1QHDA 1O3TA 2WZEA 1ORQC 4WFHA 4UCTA 3ITQA 4K35A 4FPHA 4HT1T 1TVGA 2W39A 5B4NA 1DLBA 1RMU3 4QU2A 2DYSC 4ATEA 3RYIA 5EXOA 2UYBA 3RJRA 3OR7C 5ANQA 1OD5A 2EINB 3QG5A 1BXHA 4BMEA 3VBRA 5IWAO 1HP8A 4D3WA 5IVYA 3ZHTA 1DYOA 2EIMC 4BWAA 4LA3A 1FOD3 2FDFA 4OPHA 4LF5B 3RGBA 3HBZA 1SQBH 3EHBB 1TG7A 2GTSA 1QHTA 1RUF1 2JIZG 4GZ9A 2YI8A 3E8FA 2H3OA 5A3MA 1JOJA 3DXRA 1O5UA 1RUF2 2ZHMA 4NHXA 4LF6B 2Q8CA 4GAZA 2BNNA 1AX2A 2GHYA 2DN9A 3USUA 4CXYA 3TBDA 4PJ0Z 1COV3 5F5IA 1X82A 1AP6A 2EIGA 2YXSA 4K8XA 2ATFA 3D36A 1NZCA 1TVKB 3UKNA 2LALA 2VAUA 2ZABA 1HNWO 5FYUA 3ZRXA 1AXYA 3TJTA 3FX7A 2Y64A 3ZIWA 1W2OA 1XHXA 3IDEA 2V4DA 5DXDA 2DYRC 3AYDA 5LP6C 3R4DB 1FYUA 1CGPA 3BA9A 1XBLA 2KSDA 2ZX3A 3J8F3 4FPYA 2WLKA 1QQCA 1PVC2 3HNBM 1UOFA 3ACFA 5IK8A 1HR0O 2Q5ZA 3LD8A 1LNQA 5BNPC 2EIMB 1V6LA 1RHI1 3TEYA 2VZVA 2VBBA 4UAPA 3WP6A 4LH7A 3OEEG 4DR7B 1V54C 4K8FA 1A32A 4EN6B 2J42A 1IPKA 4ZI7A 4KH9A 4DPNA 3SITA 3RZKA 5IK4A 1UWWA 2AZ5A 1RC6A 2D5HA 2V73A 3J8F2 3ETDA 2HWE2 4AHXA 3W7XA 4NIHA 1MNGA 2DE0X 1MA1A 3CZUA 4ZI7B 4XDJA 2NMNA 5EIYB 1LUWA 4P9OA 4DV0O 2QQPA 1LGNA 1UJWB 2X6CA 1K4DC 4YM2A 3WDYA 1M57C 3DXUA 1XNRB 2DWRA 3KT1A 3K3OA 1UZVA 2IXCA 3SPCA 3JZVA 4QB2A 4ICGA 4YY3B 3WQBA 3ORJA 1PD3A 5DUXA 4CCCA 1M06G 4R9CA 2ETNA 1U5XA 5A7WA 1W0PA 4HPKB 1SQVH 2C2AA 3PIGA 1GQPA 1SZBA 3WLUA 1N0JA 3DC6A 5EJZB 4AEDB 2EXHA 4CCKA 1GM8A 1TE1B 2WN2A 4R4XA 2E63A 1XNRO 2NN8A 1L0LH 4YFWA 4AQYO 1HDJA 2UXBO 4B8EA 1EZVH 1V6IA 4EROA 3GVMA 1H30A 5C4WA 2IJHA 2EIJC 2Q8OA 1WB8A 1JU4A 4CPBA 4RGAA 1OQDA 1MACA 1YUDA 3CBNA 5A80A 4K20A 1JZ3A 3ZSMA 3QH7A 5F39A 4JRAA 2FKXA 5EV7A 4DXRA 5C70A 3S3XA 4EFEA 4PDWA 4XIOA 4FTEA 3MO4A 3OG2A 3MW2A 4C1WA 4AILC 3JSLA 1OCZC 3J8F1 1O9HA 4GX1A 2ZXQA 4BW9A 3HR0A 3ASNC 2GSMB 2DVDA 5JPNB 2B9ZA 2YGLA 5L36A 2BBAA 1KRIA 2RHPA 4YGBA 3Q9OA 3RVHA 3AG1B 3UJQA 3LOBA 4OHYA 4B7EA 4WM8B 3N9PA 1IBLO 1U5YA 1ZYBA 4LJHA 2XAQA 3TXSA 5FZIA 2ZZQA 3JALB 1GNZA 2IU0A 3JBG3 3WW2A 4DO0A 1NQTA 4K1ZA 2O57A 5KA5A 4H0LB 5A33B 3E2EA 1KKDA 2D3PA 1N36B 2PHRA 4DR5B 3AJYA 1IDSA 2OX0A 4P5YA 4WBNA 1V70A 1W6QB 2QWNB 1LGCA 4KGQA 4EN8B 3RQ0A 2BNMA 1SF9A 1K4CC 4JI7B 2G9FA 3QNEA 3JCIA 3SNMA 3WY6A 3W5MA 2VY0A 2HLEA 2D44A 3FE5A 1POV0 4RQPC 5BV6A 5B1AB 4EN0A 3LFIA 4URAA 5LB6A 3WG1A 4QKNA 3KZIZ 1I0HA 3ZHVA 4LF5O 5KUKA 3DGEA 4WM7B 4H2AA 2VM9A 2Z2SB 4F7ZA 4GULA 1VQPV 1VQOV 5FLIA 3SLIA 1VBD1 4B29A 2J1VA 3SCFA 1H6YA 3JD1A 1NE4A 3QCWA 2XJPA 4P5HA 1AJKA 3UYJA 4BQ4A 1D2QA 1XRUA 2D6OX 4NRPA 2UXCB 1JQ0A 1KXGA 1LESA 4IEZA 2RDQA 3E8HA 4PDWB 1UAIA 3F7VC 2OIGA 2WYSA 4CU8A 1GN2A 5FP9A 1UYZA 4A3ZA 1V9U3 2Q5TA 1R6KA 4QGLA 2JG9B 4UF0A 1K33A 5ACA1 1ZSPA 2LW7A 3W5NA 4ISQA 4P9LA 1WLEA 4P00B 4HOOA 4IEVA 1WMXA 3BHPA 4GKKO 2QZ2A 4ZKTB 1CXZB 1ZZ6A 1MEC2 3W7SA 1NLSA 2WC2A 4TSFG 1HNXO 4QQOA 3CDZB 1Y66A 2HWF1 1LOCA 1QJY2 1PGW1 1WA4A 4X1KA 2V7QG 3RFRA 4TV8B 5FLHA 2CK3G 2DURA 5F2SA 4DOUA 4HXCA 2VQTA 4E8DA 4ZU5A 2HHHB 3FB8C 1OT5A 2W95A 2LFRA 4CU9A 4UOJA 1YQCA 4I4TB 4E27A 2A6ZA 1Y43B 2J1EA 1DGWA 5DAQA 1NR7A 4BB3A 1W06A 2VMCA 1EBOA 5DZEA 3ZO0B 4CRQA 3A0NA 1VBE2 4IERA 2A3WA 2P3KA 1Q8IA 4V2WA 5FZ8A 5BZBA 1WBFA 5BNNC 4QPGB 4RS5C 2JGUA 1I5PA 2C24A 2K1EA 2Q9LA 1VMFA 5FOJB 1W6PA 2WZR1 3USUB 3PDQA 4NTWA 1SZTA 3G6BA 2BGCA 3KLSA 4EN7B 3OTOO 4JCKA 3JD4A 4N23A 1JYIA 4E2LA 2ZKOA 4AQTA 3ATGA 1Z5WA 3J9SA 2TNFA 2D6PA 5EYXA 4IQPA 5FPZA 1PO12 1B35C 2EVXA 1OCRB 2UYAA 2EIKB 4XUOA 4LHLA 2NZ9A 4CDXA 4K40A 4U7OA 3P3NA 1IBMB 1NH2B 3TWIA 1MS5A 3AVSA 3MIEA 1HNXB 4P9WA 4RN5A 3T2PA 4WFBV 4NIAA 1DCSA 4FLXA 1RUD3 1W6OB 4JI2B 3VKFC 3WNOA 4FK5C 2R1DA 2XB6C 2HWD3 4IYIA 3WDWA 1P4RA 4NAMA 2QQNA 3K3NA 3RWKX 1FPN1 3ENRA 1EV13 1XYNA 2YUEA 2PUSA 2EALA 1COV1 3AG3C 4H44B 4JTNA 4QHOA 1ZRRA 1BGYH 3K4ZA 3ABMC 3H1YA 4FOYA 3MW4A 4J7KA 4LORA 1I5ZA 2LROA 5IVJA 1APNA 5FZOA 2ZGSA 5A2QN 3ZXGA 5IT6A 2FDHA 4L99A 1DZTA 3CWBH 5FRAA 1PVC1 2BWCA 4IE5A 3L73H 2A71A 1V54B 5BY5A 2Y4TA 4XDLA 4EYUA 2ZOEB 3UL2A 3NNFA 4NJ4A 3ML0A 4DR4O 3HVDA 2QWQB 1NQJA 1RVF3 1PIV1 2IH3C 4LE4A 4DY5A 3ZHQA 4GWIA 2VL4A 2ZKNA 4CCDA 5DN6G 2VUCA 5A7WB 3DUIA 3QVNA 1ULFA 3N7LA 3BU0A 3A0BZ 3ZMUA 1YHQV 1UKGA 3J26N 3CHXA 4XBNA 3AG2B 4Q4W2 3NJZA 5FY4A 2E75B 2HWE1 1SETA 1GFF2 1SBFA 3A22A 1DGWX 2PF4E 2M7WA 4FLZA 4L8JA 5LYJA 3THOA 1G7YA 1RUH3 2VBPA 5FKBA 4YGDA 4Z2AA 3BIEA 3LA2A 4E2SA 1CP9A 2PI4A 1W8NA 1F4HA 2BOBC 1BQPA 3QO5A 2Q8EA 2IH1C 4TZDA 2OZJA 2ZEYA 2BNOA 4DUZB 1W3VA 5HXVA 3O1OA 2QQMA 2XJTA 3S7IA 1ZBA3 4B4QA 3EVKA 3M3OA 4QPIA 2IC1A 2QTSA 3A0KA 4B3RB 4QXKA 3H3ZA 3ZS8C 2Z4FA 2F93B 1GN6A 3SCHA 1R6NA 3N2KB 1AF9A 5EJ1B 4AI3A 3WF4A 1BVVA 2GC2A 5J09A 5GLZA 1YI2V 3SJBC 5H9RA 1SKVA 3ABUA 5K1XA 1D4M2 3ASNB 1RXGA 3I59B 4CDWB 2GP5A 1MS8A 1UN1A 1PGL2 2ARXA 5JXIA 1XNQO 2VZRA 4XHXA 4YIOA 3P1IA 1RGSA 1AYN3 5CNAA 4GX2A 4XUTA 4TLGA 3OBAA 2YEVB 4KFMA 3I59A 5FZKA 4CDWA 4MXWB 4HNAA 3M7AA 1PNMA 1RUOA 1NY71 4XUNA 4AI1A 5L19A 3ZDSA 2HG5C 2JKBA 4AI8A 2XLGA 3RZGA 4XDQA 4FPLA 4BXSV 4NTYA 2PHTA 4IEYA 1CAVA 3CL1A 4AGRA 4ZHQA 2XKOA 2UXNA 1UXXX 2QTOA 3VD3A 4QKBA 1V55B 3UNPA 1LJ7A 4RQPB 4E4ZA 4JGYB 5GW7A 1SRYA 5T52A 2P5BA 3LSQA 3AG1C 3KCCA 3VKNA 5EIBD 1AR83 1AYN2 3CF6E 4Q8LA 4INDA 2G9GA 4G3YC 4D6TH 2QJVA 1HQNA 1YYNA 4PDMA 4L0PA 3L71H 4RQPA 4X64O 4HPKA 3VZKA 4HAMA 2QE3A 1DGRN 4AVBA 1OHHG 4URTA 1AJOA 4TQFA 2OXBA 4PIXA 1ENQA 4RA0A 2AW9A 4OULA 3I3DA 3J7MA 3CXHF 4KG8A 1LOBA 3VBFB 2OCCB 1DGRA 3LPGA 5JXJA 5CBHA 1XUQA 4HMZA 4MGKE 4BDVB 1VF7A 4UXNA 1F23A 3ZN6B 1W8OA 1QOTA 4HN1A 1DYKA 1E1RG 2RS31 4M0NA 3URFA 1C8M1 5EP9A 1JX9A 4PLOA 1NJIW 1ZRDA 4MGYE 4DV7O 4GJYA 1UFIA 1JCHA 5LHGA 4FM1A 5EC1C 5EQUA 1QJU1 1H8TA 1OBNA 2UUCO 4OYUA 5LWBA 1X4TA 4YARA 2Q4SA 2DYCA 4K7JA 4YIPA 4BMBA 1FXHA 3HKBB 1DG6A 2BSKB 2KD7A 1X7NA 4COVA 4FI9A 4YZ5A 3B94A 5T5PA 1EAH2 4UCSA 4CEWA 4FXKB 4FTBA 4OZXA 4QD2A 2R043 3WW4A 5FZGA 3B2EE 1UD1A 2EIDA 4BOWA 2DYSB 2H0BA 1WNSA 2JGDA 1K92A 1W2TA 3NO8A 2WSSG 3OGRA 4CCMA 1W39A 4GX0A 4FQ4A 3DXTA 5FO7B 4NE9A 4LNVA 1BMV2 5FYZA 1Q8VA 4BU2A 3I3EA 4LO6B 3RWRD 1H38A 1S0JA 2P4VA 4JDNA 5FZFA 5L3GA 1D0GA 4XF3A 5BNOB 4LCUC 2WLLB 3H8RA 1FFTB 5CB4A 1Q6UA 4QPGC 1AUYA 1QJY3 1RUC1 3M7MX 2R042 3LSUA 1XMQO 4YM3A 1GQGA 4WVMA 2TEPA 4W6WA 3PLQA 3DC5A 2Y48A 1RPOA 3PIJA 3OPWA 4JAVA 5K1PA 3K75B 3VL8A 1W2UA 4C7UA 4NHMA 2BJSA 2ZT9B 3J7AU 2ADDA 4YVWB 2CYFA 3H1MA 1BEV3 1MG1A 2VQFB 1YEWA 4YJ2B 4LHSA 1W28A 1NCRC 5FAXA 4PA4A 2P4KA 1ZX5A 4YZ2A 1XNCA 1REEA 4I9WA 4IGOA 1CX1A 1M56B 1Q86W 4JI5B 3OAAG 3E83A 2ODMA 5A3OA 2XNDG 5CA0B 4OLLA 4LBMA 2D98A 1VBB1 1HRV1 4Y5Z0 4R7CA 4ZIBA 1GNYA 4XDKA 1M93A 1IG3A 3WF3A 5T5LA 1WJZA 3JD0A 2WNVC 1PO13 5LZ6A 1QJX1 2IWGB 4HZFA 4K8RB 2JDIG 2WO3A 4DV3B 2P3IA 1LR1A 1RHI2 1RUG3 4H55A 4CUBA 4RR3A 1Z5VA 1DQ4A 1CAUB 1NKGA 2XLAA 4KG0A 3TYJA 4BK5A 4C0BA 1IX9A 5FZBA 1R3LC 5ITZB 1NA1C 2DF7A 3K2OA 1ASJ3 3ZRWA 2UXCO 5F5CA 3O12A 4PLNA 3S7EA 2W68A 3GYDA 3GGLA 3QACA 3AZWA 3B7MA 3CXCU 4P9GA 4Y3OA 1NXMA 3SQOA 3U14A 3T1YB 1WAZA 5EBLC 4AHCA 4Y22B 3BALA 5IW0A 1OURA 2QNKA 3UETA 4QX2A 4Y20A 1JHNA 1AZDA 1JHJA 4MH0E 5FUPA 1KD7A 1OMIA 3GZAA 2R072 4XIKA 2OT5A 3SXWA 5EK0A 1AR92 2GDSA 5C6CA 1BQZA 3PUSA 1W0KG 3NWKA 1KC8W 3OEBA 2VZTA 5CFDC 1NCRA 3ES1A 3D5OA 3CCUV 4BQ2A 4XBLA 4XACA 3AK1A 2B45X 5KLVH 4LF9B 4N43A 3GJBA 3FHQA 3S6PA 4QXHA 4JI5O 1E5HA 4CUCA 1RVF2 4DY3A 1A8DA 1JZ2A 4J11A 1M1KW 1G8MA 1XMOO 1W8WA 4YW3A 1RVF1 1S76D 3B93A 3Q8BA 2VQFO 1Q5OA 3CJHA 3CRQA 2D6NA 4DXTA 3WD5A 3HIFA 1FMD1 1O8PA 3M8LA 4CS4A 1TGOA 1XOUA 4W4KA 2ATKC 3TN91 2RR12 4AHWA 1KGYA 5FFOC 1HIXA 1OLQA 3WFVA 5IVBA 2VECA 1ZNPA 2YYOA 5L9BA 1DU3D 3W20A 2RG4A 2UY9A 3R65A 2LW1A 3T1LA 2FDKA 1VARA 3SDLA 4C1XA 2EAKA 1N32O 2QKAA 2D40A 5E88A 5FQ0A 2W5FA 1US6A 2AUYA 3Q8CA 1QU0A 3J7LA 1SS3A 3JD72 4HFSA 4OI1A 1ZZ8A 2HWB1 2W0FC 3ROUA 2OPWA 3ZRVA 5A32B 2ZGUA 1XL6A 2UY8A 4G4FA 4BHPA 1BK1A 4JZ2A 3T1CA 1JODA 1EP0A 3W21A 5T54A 1S2KA 1SLBA 1VIWB 5A3NA 3EXUA 2FMLA 4AR2A 2ZHLA 1NBMG 5CFDA 5CA1A 1PMIA 4JGYC 4Y1ZA 3H1WA 2H6CA 2VCMA 1AX1A 3MHHC 2ZGMA 1TVKA 5JVVA 4Q4Y2 3ZFGC 2IM9A 1QDCA 3MPPG 2VMDA 5LMUO 2C6SA 2UUCB 4X8AA 4CDUC 1O59A 3IBMA 4DV7B 4PCRA 1OF4A 1N33O 5JIUA 3VBHB 5KAFZ 3U4XA 3E22B 3SC7X 1PNKA 4YJ3A 1HX6A 1IXBA 1MSDA 1Z0HA 1QVFU 5FDBA 5AC91 3BOWA 5IT9N 2XJSA 1XU2A 3AP7A 5FJHA 1O5LA 1AR82 1O4YA 5B66Z 1JFFA 1HRI3 5IJRA 2VMGA 4X1IA 4CDQA 4NIDA 4H7MA 2LO1A 4P9PA 2WS92 1IG0A 3SH3A 1JPXA 5JDBA 1REDA 4HK8A 5AC93 2XL9A 4COWA 1I6XA 1VQ4V 5EFUA 2PLV3 1G6UA 1IURA 1VP6A 3SJAC 1LOEA 2G19A 4DW0A 1LRHA 3ZXAC 2W0XA 3E5UA 1SDWA 1XDCA 4RWUA 3K79A 1BZWA 2OIIA 2PHUA 3PMEA 5BNQA 1F35A 4GZRB 5FCCA 5LCWL 3T1HO 4NKGB 4BISA 3K3WA 3F5WC 5FZOB 4DB5A 4LKDA 4JI4O 1OFNA 2YPJA 1ZA4A 5CB7A 2ADPA 3VD5A 3B01A 2E33A 1KS5A 3NJYA 4JV5B 1LU2A 2XPJA 3B9CA 3NR7A 1YSCA 1Q8QA 1RPRA 2VQEO 1GP6A 4M3CF 2UXXA 3KM5A 1WA8A 1XNQB 4CEYC 1V9PA 4XYXA 1KU9A 2P22C 3ZJZA 1N3OA 2ZEZA 3RN4A 1X36A 3MZHA 4YVWA 3X2QC 1ULCA 5IVVA 3LNNA 2OIEA 4PDWC 3E89A 2WLQA 2E3CA 2VR4A 2P34A 3JB8A 3KG2A 3D6EA 1QKQA 3T30A 3AG4C 3ASIA 4LNUA 1GZTA 3HBKA 1OUXA 2NYYA 2YY1A 4JKMA 2UURA 3RYFA 1GH6A 4IEPA 5EYPA 5DAWA 3AKTA 3TGUH 4IXLA 2VD7A 4QDRA 5EWSA 2YDEA 4QMAA 2IJJA 2ZNIA 2E26A 1LHNA 3K5LA 1B04A 1I5YA 1OD3A 4XBFA 1VMJA 4F6RB 1F9KA 1A34A 3SJCC 2E76B 4UFLA 4B4PA 4J1XA 1O3RA 4RR3B 4O4HB 2XBO2 2WS91 5K7PA 1HNWB 3ABMB 5LGNA 3TB0A 3C90A 2F6BA 1MABG 4E9KA 1HN1A 2VPVA 2WFF2 5E6HA 1SLCA 2B5HA 1QLEB 1VBC3 3CCMV 3WW1A 4CS2A 2ZR2A 4PHZA 3CO2A 1BS3A 4CEYA 1JZ8A 2FL4A 4CP1A 4KUMA 4IV3B 5KXBA 3H8OA 3OD0A 2YC0A 3N7MA 3THDA 4QPJA 1CVNA 4HYOA 1FFXB 4D7SA 2VO5A 2BQPA 5B1BB 4XUQA 5FYMA 3OD4A 1CD3G 5D21A 5A1LA 2YB7A 4BQXA 2JGDB 1RYYA 5CMUA 3L74H 2QJ1A 1SZXA 2OPKA 4JF3A 4DV0B 3UM7A 1PL0A 4XUPA 4P02B 4YW1A 4M3CE 4D7TA 4JASA 2KQXA 5FY9A 2OCHA 5FZ7A 4Q0UA 4GD4A 2C0ZA 3ZXKA 1QH7A 2JG8B 1OCRC 5A1AA 4CTEA 2GC3A 3BTAA 5A32A 2Q67A 3N3HA 5FZ0A 4FPJA 3WUCA 4GMP0 4UB8Z 4E2QA 3A0HZ 2FQPA 3RZHA 2JB8A 1AL23 1GRJA 1VQ5V 3TN92 5HV0A 1W6MA 4YVSC 1Q43A 5FLXN 3O1RA 2PHXA 5D8AB 1IS4A 5CA1B 4JTCB 4K21A 2IXHA 3G80A 3HQRA 3I3QA 5LY2A 4GB31 3H9VA 1S1AA 1PK6A 4Z1MG 1JUHA 1J5EB 2MEV2 3KHCA 3AX4A 1I1EA 2Y6LA 3WVJA 5FPOA 2UXBB 4XVHA 4YM0A 1VP7A 1WD3A 4X8PA 3OE7G 4PF1A 3WCSA 3JD2A 1KB9F 3JU9A 4AHZA 3PJSK 4U3JB 1MS1A 1HNZB 4XDOA 2FCUA 3GCWA 3KV6A 1H8HG 2L9LA 2PLV1 4EV0A 2F66C 4DUZO 3NNGA 3AZZA 3AKPA 2GUZB 2GNBA 3KKYA 1QQP1 1YXBA 1FI2A 2P06A 1V00A 1V6OA 3HMYA 3NV4A 3BUCA 1IS6A 2J22A 3H7YA 1VQ9V 2WQ8A 1WW6A 5LK7B 1JJOA 1ZZCA 1Y4MA 3OGSA 1H2SB 1OLME 2YV8A 2WNVB 4I0AA 1Z2GA 1ND3C 4YW6A 2OVUA 5KC5A 4X20A 1VMGA 4BJ0A 3RSJA 3WG3A 3VBSA 4YYOA 5IJ9A 1DZRA 3AM2A 4JQRA 3ZXLA 5CN0A 2C9AA 4G27B 4KU7A 3O0VA 5JVDB 4OHWA 5HV4A 4AFDA 4I3PA 4BQ3A 3VBSB 3AK2A 1YXWA 1YO8A 3ILNA 5LHIA 4MLOA 5IVCA 1LHVA 3LEIA 1Z7S3 4N7UA 3UESA 3MIDA 5KHKA 4ATFA 2PY5A 3RMYA 4AGVA 3ABLB 2NM1A 3N4MA 1F7YA 2MEV1 1N3PA 5JVDA 4FFBB 1ND2A 2LQTA 2OCCC 4PIYA 2JEUA 2QQWA 2W87A 3VDAA 3VUOA 4JI1B 2VQAA 3INAA 2F4VB 3IDCB 2QM7A 4UW3A 3V64A 4DMIA 2WAAA 4OUMA 1WCQA 3NVCA 5B1AC 5A3PA 5DG1A 5L7OB 4JKKA 1QNMA 1IS5A 2JJ1G 5BNOC 3VBHA 2B1GA 3CEWA 1M90W 2R9IA 1AHSA 3O1MA 3KCYA 1KQSU 3JD73 5JJJB 1QR8A 4FLTA 1NYWA 2QM4A 1HXS2 2VUAA 1FMD3 5EYYA 3C3TA 3OUFA 1QH6A 5IAVA 3LUTB 5EIBC 4M0HA 3ZR5A 5FZLA 4X1IB 3OGVA 3LNMB 1VIBA 1IPJA 2ZMNA 1SHWB 4FFHA 1GO3F 2ES3A 3I2DA 3S5AA 1PL4A 4TV9A 4JVAA 2E7AA 2XAHA 1Y9MA 3R4SA 1MS4A 1F5FA 5EHDA 2GALA 5J9PC 4NB5A 1PPJH 4DS0A 1EN5A 1VF5B 3OSDA 2WRAA 3ZXDA 2EF6A 3OBTA 4Y4YA 2VTXA 1Y74A 2Q8VA 2ZXWC 2C4XA 3RT3C 1H4GA 4XCAA 1GK9A 2F95B 3B3QE 4I7ZB 1KDMA 5BR8B 5KXEA 4JQTA 2R7EB 2Z42A 5LBBA 3G4SV 2IZWA 3P3PA 3J81N 5C8YA 2NN4A 5FJKA 4TV8A 1YJ9V 2JEXA 1X9TA 2HR3A 4ZHNA 4ZS2A 3VDDA 3HEIA 1DQ1A 1E57A 2PXJA 5GLTA 3L9DA 4QX3A 3I7DA 4UFKA 5J98B 1ZRIA 4QPWA 3IZOA 3AJZA 1NAEA 3VDBA 1N36O 1OSGA 5FTTC 2EXIA 3ASOB 4I4TA 3JARB 2JX9A 4NHYA 2JECA 3V0BB 3AB0A 3WSOA 3NNLA 2Q7EA 5AC92 1PGW2 3OJBA 3OCPA 3CJIC 4AEDA 1A3KA 4GA9A 1OCCB 4BIOA 2WSUA 5L7OA 1NCQB 3NW4A 1NQDA 1S5JA 2CDYA 3QLQA 2B5UA 4Y22A 4OPAA 4N53C 3EB7A 3E8GA 5C8CB 2QA4V 3ZR6A 2CNAA 1JW6A 2ZGTA 3ZFFB 2ZCWA 3CRRA 1WB7A 5FWEA 4RS5A 2GH2A 3ZOIA 4JHTA 1RUI2 2ZIOA 2VW1A 1AR5A 4MGQA 3FHIB 3THCA 1QOOA 3R66A 5DN2A 2L6LA 3LKJA 1IZ3A 2BPA2 1BE3H 4DV6O 5GZGA 2WKKA 1NVPB 4AK3A 4QPYA 3JCUZ 4X9QA 5EZYB 1TMF2 2QQIA 2HBTA 4QQPA 3T2QA 3NKTA 3ZKUA 3I5DA 2B9VA 2JDAA 4NMIA 1NI8A 1B09A 1DGSA 2P37A 2XT9A 3L75H 3B09A 3RVYA 1VRBA 2Q7GA 4QWNA 1NT2B 1ZAUA 2VVEA 3POIA 3JALA 1M56C 2A9HA 3UGGA 4DV5O 5JXHA 5C9AC 4YW2A 1X59A 4IHJA 3APOA 3SJQC 2XONA 2FHRA 1QJY1 1L7RA 1HNZO 1VB2A 3STZC 2ADQB 1W03A 2LS6A 2XBO1 2Q0OC 3U0ZA 1G4YB 3BU7A 3U78A 5E8AA 4X88A 1K12A 3N7JA 3VZMA 1PMJX 3RDIA 5L3DA 1ND3A 1W6NB 2ARCA 3GDBA 4ZY9A 5CISA 2BFUS 3POBA 2WLJA 3FFQA 5ABJC 4UFMA 2RJZA 3H42B 5CIRA 4BLIA 1R1ZA 5T50A 3U1XA 4KL1A 3AP6A 3ZMOA 1GSLA 4HSLA 2XTAA 1ENSA 1C1LA 2UXDO 1R082 5DUUA 4Q4W1 3ZSJA 1U12A 1UX7A 3STLC 1ND3B 3AKQA 2PQSA 1O8SA 4A5UB 3M70A 1NLRA 1XJAA 4M4RA 5C3SA 2KXLA 2W9XA 3RS6A 2FD8A 5DEDA 3PVOA 1W2NA 3CZJA 1URXA 1R1A3 2W94A 1LHOA 4O4IB 3Q4HB 3IKWA 3VQVA 1V55C 1DZQA 2BTQB 4Z2WA 2ARBA 3ZKYA 3WNMA 1RXFA 1S55A 1M4UA 4YG6A 5LA0A 4MVRA 1UZ0A 2O1QA 3D3QA 3DL3A 1XXNA 3UGHA 4X62O 5M0TA 1AL0G 3ACHA 3AG3B 3VBHC 5E16A 2EAAA 1CZSA 4LKEA 3KV5A 1POV1 2YXYA 3AK3A 2QDRA 3WDTA 1AL22 1IHMA 1TZOA 2HJIA 2NLJC 3N9QA 4JI8O 3ALQA 3WT3A 4NN0A 3KGLA 3W59A 4H37A 4UUJC 5B3SB 1UZWA 4ONUA 1URFA 2EIBA 4NXNB 4KWLA 4DV5B 5FL7G 1C1FA 3D0SA 5I0DA 2HWB2 4CUGA 1NTMH 4TT3G 4QPKA 1NA1A 3QD6A 1QJU3 3QO7A 1OZ0A 2DQ3A 4YFZA 4DW1A 3KCXA 1F4AA 3RZLA 4HKWA 2X09A 3NAPB 3RYRA 2R16A 1AL21 4AL9A 3U75A 2ZM6O 3WNLA 3MDSA 3FYEB 4BLJA 2PYJA 2Y69B 4B3MO 2DDUA 1HB2A 2WFPA 2YROA 3QBQA 4MXWA 1JN2P 1SQPH 3BPSA 4J25A 1FNYA 3WR0A 3OGJA 1YITV 5FBZA 5LA1A 3SYPA 1Y6XA 1W3XA 1N3QA 3M4FA 1I08A 1AR81 3K5OA 1CWPA 4CDWC 4CH3A 3WDUA 3RRDA 1XEQA 1GM9A 2DTWA 4CUAA 2DCYA 1K5MA 4LPLA 3TNQA 2TUNA 2HWB3 4KNCA 5A6ZA 1YJLA 2ZPXA 5EZWA 3FWEA 1NS1A 1PM7A 1DQ6A 3OM3B 3WX5A 1ENRA 4LQRA 5LA6A 4O4IA 1GLHA 4OHZA 1VBC1 4QX1A 5FZ3A 1YRZA 3T09A 3CC7V 4L97A 3ME2A 2VMHA 1REFA 1RJ8A 2EXJA 4U2AA 3R4UA 1ALYA 5L3EA 3ZMSA 2XQRA 1BHGA 4QM8A 1RUC2 2IFRA 3ABKC 4FFFA 5H2FZ 4GALA 3CCJV 1YJNV 5GTIZ 1B6QA 3ZN6A 2X5IA 1Y74B 4L2NA 1PKXA 1TME3 1WMDA 2WNUB 1UU5A 4DR2B 5DDJ1 4IIJA 2MHFA 5IFTA 2YSUB 3KD4A 2ZGLA 2E32A 3I2KA 4YHHO 2IJIA 1LAJA 5C3PA 3HJRA 2X5IB 4EQVA 3JBG1 4AGGA 2P6HA 4B3TB 3HKEB 4Q4V1 4X65O 3DN7A 3LA7A 2J7MA 2VUDA 1RUJ3 3OW2U 5A70A 2YXLA 4XC9A 4DR4B 1GWLA 2W6JG 3ZFEB 1LB2A 4A7YA 2R061 1NXD1 3AFKA 1IS3A 4Y1UA 5F2VO 1CR7A 1XILA 1BCXA 2WT0A 4NVPA 1WKYA 1TME2 3WEZA 4ZZ8A 5JOXA 4PBOA 3B77A 2JICA 3OF1A 4WVZA 1RUI1 4TXWA 3T2TA 4LH6A 2VOWA 3B02A 3F2ZA 2EICA 5T55A 2F4VO 5AVPA 3N9MA 1WZXA 3I2OA 3I55V 3B00A 5I8YA 1YVWA 4LFAO 3LWCA 3AP9A 2BEOA 2DVFA 1UCXA 4META 2ZBJA 4DV4B 3CMAV 4WFFA 2E5LB 1FXVA 4GKKB 2YUAA 2WLLA 3HKDB 1XHZA 1ZLZA 1AYN1 2GMEA 2Y0PA 3D3IA 4QHZA 1FV3A 4J1WA 5C71A 2KB1A 3AKSA 1Y9QA 1JZ7A 5LBCA 1HB3A 3L2YA 4P9JA 5B2GB 3EMRA 3IDBB 4ZU4A 3ZFGA 1WD4A 3RYFB 4JI3B 1MZFA 4IE7A 2RDRA 3PHMA 3VQYA 2BOJA 1XL4A 4I2OA 3VD9A 3MV01 2QQOA 4Y4RA 1KMIZ 2EILC 2V4VA 5FZ6A 4KBBA 4X1YA 2HWC3 3WG2A 2WN3A 4YW7A 2NR5A 4OGQB 2WIIB 3WNNA 1SQ4A 3K59A 5DAVA 5JR7B 3N2KA 1RUE2 5FNVB 3KZ4C 1R093 5IYYA 3ACGA 5J36A 4ZBMA 3HN3A 4X1YB 4XE9A 1N4CA 4N90A 3SPIA 4AHYA 2VZPA 1Y7BA 5FKCA 3EJKA 4BR6A 2Y38A 3C8XA 5HCHA 2D93A 5LA9A 3VN4A 2R0HA 4QDQA 1N1SA 1RTVA 1WWYA 3ZSKA 4QX7A 4N9IA 4NHKA 2MW2B 2A7AA 2BV4A 2RMU3 2RJLA 5HCBA 1NG0A 4IEQA 3ZYPA 4A44A 3U11A 4Y26A 1AR72 5JMCA 4DR6B 4XQWA 2GDFA 5JZGC 1S0EA 3FB7C 3NAPA 1VMHA 4UCRA 4UFHA 4CCLA 3WF1A 4CE8A 1BYHA 2AYHA 3W7WA 3BY6A 4ET7A 1ODMA 2XUMA 1STMA 1QQP2 3K77A 2D7FA 5CFDB 3VLBB 1PIV3 1IBMO 4NOTA 1RJ7A 3MDPA 3AZVA 3POWA 5C33A 5BY1A 3TAYA 1UZZA 4LF4O 2BU9A 5L9RA 1W0JG 1F5JA 1WMEA 5CKMA 2JKXA 1W2AX 5CADA 2RMU2 3PN1A 2EULA 4COZA 4LF7B 1XQ8A 3PU8A 2PAEA 4XXPA 2XOMA 3ZYGA 2WT1A 1MPXA 4A45A 1W90A 5FMCA 1AYM1 2JG8C 2ZR3A 2ID4A 4AVSA 4IV1B 5I0UA 5KXCA 5JH7B 5GONB 3OTOB 3EXAA 4UCVA 2BYVE 4DR1O 1VBA1 4LBQB 2XWJB 1P7BA 3ZFFA 1QQP3 1F15A 5FMOS 2RDNA 4HANA 2DBIA 2GUZA 5A6XA 1L0NH 3O9OA 4XDPA 4OI0A 4AQYB 5CFCB 4LWSB 2HEPA 1YNAA 1A78A 3SHRA 1AX0A 2FBEA 5GZDA 3CJHB 3IWZA 1E1QG 2VZ3A 4LBKA 4XFHA 3FLRA 4CC5A 1Q56A 3HQUA 1SACA 1WLCA 1WW7A 3MW3A 5CBGA 5FZ1A 3VBOB 2HWF3 4LEJA 3MICA 2WINB 5D1IA 4NIGA 1H9WA 1DGLA 1DQ5A 2J1TA 3ZYBA 2X0LA 4K3AA 5F6LB 2ZDIA 3A7QA 3KV9A 1TQ5A 2RS13 3I2FA 1LOFA 4CCOA 3LE0A 3N9NA 1NLQA 2RDSA 2DJVA 2PHDA 4YZ3A 2WZR3 3NJXA 4K9SA 1HRV3 5DPNA 1XNKA 1SBDA 2E6VA 4MVSA 1IBKB 3O1PA 1X8MA 5A7QA 2RQ6A 1JYXA 1BBT1 5KHHA 5FPXA 1SFPA 1W9YA 3PVNA 1H1MA 4MHUA 4YSFA 3OOXA 5CB4B 1DDLA 3JB4C 3WQ0A 2DW4A 2JDUA 3E1F1 1AI6A 1CAXA 2P3YA 5H6QA 4Y1VA 2DWEC 4Q27A 1PZ8A 1ULOA 4CP0A 5LBQA 4MUVA 3TCUA 4YG3A 3TEWA 5J2TA 1QJU2 4QT6A 4GWNA 3T4ZA 3BN6A 1PK6C 1J84A 2RN9A 1K3IA 1UU4A 1CPNA 4TOIA 4JDOA 5GLUA 4QGPA 4IW3A 4RHV2 1JH5A 2VG9A 3WUDA 1WA6X 4X66O 4N8MA 1W0NA 5J3UA 4XZPA 5F3IA 2FZ2A 1K5QA 3JAMN 1EPWA 3S3WA 3D36C 4O9EA 1UPGA 1HJFA 5ACA3 4FZ0A 1KEXA 2ZGPA 1PM9A 2JIJA 1MS0A 2CAVA 5SV5A 3H8XA 2EJRA 3PURA 4MTOA 4J9ZB 4C0HA 2XGXA 4Q0PA 2RVAA 1FXKB 1OOPB 1SPPA 3C3VA 1W8FA 3AMNA 4XBQA 4AYUA 4FSJA 4WVVA 5A7SA 4OUEA 4P2ZA 4S2FA 1U96A 4RHV3 2ZCEA 1QMJA 4KWJA 3V0AB 2RS32 2XXZA 4LF7O 4EZHA 2BVVA 2NP0A 3CP1A 4EE2A 4XJUA 3BAAA 4AAPA 3E5XA 1K5JA 3SH5A 4EJRA 3VKLA 1OJHA 3H8UA 5HBAA 2R9RB 3ZRWB 1M4WA 4EZ4A 4JYBA 1RUC3 3J7NA 4OMCA 3UK9A 4H33A 5FP4A 1YFWA 1ULGA 1N47A 3A2FA 2YXHA 3RYPA 1W6PB 4O61A 1XI1A 4JYAB 1IQDC 3ZX6A 2PN5A 1ULEA 3H01A 4QHBA 3ZXFA 3GCXA 4LUKA 2VNOA 3I8TA 2RS33 1YWKA 4NUBA 2WLHA 3WG4A 2Q68A 2YBKA 3GXUA 4FLVA 1K5MC 3E6DA 2JJ2G 5JSOA 3OGGA 4BQWA 4P9XA 4TWTA 1H8EG 1NX9A 4Y24A 3RWNA 3C2UA 1R3KC 1LGBA 5FXXA 4QX0A 3MD0A 4BM8A 4GT1A 2D6MA 3CQOA 1R1A1 4DRVA 4I50A 2EIEA 1O9GA 4FP3A 1MMMA 1H2KA 4UV8A 5FZ9A 2JDHA 4O4LA 1CX4A 4YNIA 4GH4A 1W9FA 2XASA 3POSA 3JAKB 3H1HH 5J7MA 4DRXA 5FXZA 5FNVA 1OLRA 4XFBA 1D0HA 3OEHG 4I01A 4WZCA 1OA4A 4BZ4A 4D6RA 1GZWA 2EIKC 2AC1A 5FYIA 1IPSA 3DPRB 4OUSA 1YTFB 4G28B 3M8AA 4NR1A 4DR1B 1R73A 1JMKC 3CRCA 2IU3A 5JI7A 3U37A 1UU6A 4GMP1 4TTGA 2Q69A 1GZWB 3M3IA 5JCTA 3POYA 2ORXA 4TUYA 1W6QA 1GP4A 1QR9A 4DV4O 2DU1A 1O6UA 5IWAB 1AI7A 4IHJB 4DNYA 5LHHA 2FMDA 4CEYB 3O0WA 5B1NA 4CPBD 5FYSA 2B8MA 4XMIA 1UY3A 1L3JA 1US3A 2Y0IA 3H3LA 2VTFA 5JZGB 3UKTA 2WAOA 2VOVA 5H9CA 4JX0A 3NXSA 4E4HA 2WQZC 1FFXA 2ZE5A 1R092 4RYDA 2JEMA 2LJ2A 1K42A 2LGWA 5CG9A 2E9QA 4AWDA 3BABA 1ZBA1 4DINB 3LAGA 4QQLA 2HJFC 2D3SA 5DUVA 1S0VA 2VC9A 4L9BA 1BZKA 3VHOA 2YPDA 1Q8OA 3FBYA 4F4LA 1V9U2 2KKWA 1DP0A 5GZEA 4DR3O 2QQKA 4LR3A 2JD4A 4AG4A 1LKNA 2G4IA 5LMNO 5CA6A 3C7FA 4O2BB 2DCTA 4XQ4A 4JI3O 2V5YA 2YFZA 2YIAA 2BTQA 2HEYF 3ETGA 3PTRB 1RUH1 5DM6V 1H8TC 4P08A 1BHAA 2FDJA 5EBWC 2EILB 2RM22 5C3OA 4YJ3B 2PYLA 2OQ7A 3T0AA 4XHBA 2WLMA 1O3SA 1PIV2 3WP5A 4AZZA 3SCGA 1WCDJ 4D7YA 1DIWA 4HN0A 2IBZH 2HHHO 2FCVA 4Q1PA 4LO8A 2CDPA 2VU9A 2WUHA 2LGQA 1KKCA 1MVEA 2QQLA 1OVPA 4NPRA 2YG0A 4D0QA 2IVJA 1FXKA 3VDDC 3GHNA 4PT6A 4XJWA 5KX5A 5F37A 1SA0B 3AL6A 5APAA 5DQ0A 1A8MA 3RG0A 5BUVA 5FR3A 1ASJ1 4JPRA 2ZX4A 2VE1A 4DV1B 3ZVXA 1LENA 2HYKA 4YW4A 1VQ7V 2R32A 4MSWC 2CTVA 4RHV1 1RUF3 4IYHA 1AP5A 4JI1O 4JTDB 4ZXEA 4B3TO 4R50A 4RAIA 4Q4V3 2UU9B 2HBUA 5CKNA 1GMMA 2JVDA 3F7YC 1QVGU 2HP8A 3LB9A 3VBSC 1VB4A 1L1FA 3OTFA 2B46X 1QXPA 4MTXA 4JAAA 1LCLA 3RYIB 4O4LB 5CBFA 3IAPA 4AVVA 3MIHA 2HWF2 2W1UA 4D94A 1AR4A 1JYNA 2QBXA 4DRRA 5IATA 5DECA 2HWD2 3LGRA 2A6WA 3ETPA 3X2QB 1LTEA 3JD3A 5H6RA 4HLTA 1LHWA 3GZTB 4X65B 4B1LA 2RS12 2PELA 1RMU2 4YG0A 4MO3M 1SQXH 1S5HC 4DYLA 4J80A 1VBB3 3EO6A 5GTHZ 1KBHA 4NWVA 4EWDA 1UXZA 4XABA 4TLFA 1U97A 3B8NA 3L70H 3BPZA 5JCOC 4GMP3 4IT5A 2R70A 5C3RA 2A70A 2VMIA 4W6YA 4YM1A 1E5RA 5TSWA 1RITA 4J42A 2VVDA 4CDXC 2UUAB 4LFCO 4HZ3A 4TQDA 3OMAB 3PL0A 4X66B 3ZFEC 5A3LA 5F32A 4QKFA 5FMBA 4UFJA 4NIIA 3K4AA 1CAWA 3TRSB 3VHRA 3OY8A 4DZGA 2NLRA 2ZEXA 4J9YB 4CDUA 1HQLA 1RL3A 1S0FA 4LBOA 3NNJA 4LK7A 2CU5A 4QNHB 4LHNA 1GQHA 4FBFA 3OEAA 1UY4A 2VMEA 4PIZA 3ABLC 5DUWA 3ST7A 3MHSC 1GAXA 4AFBA 3Q8EA 3LFMA 3VD7A 3DKWA 5EBMC 3O0XA 2B39A 1HW7A 2CTPA 4A41A 4ITCA 5AG2A 2E53A 1UL9A 1AYM3 4OQ8A 1AJNA 3KB5A 4IESA 3EFFK 3FAVB 2EINC 4Q4X1 4COYA 5ITZA 1J3RA 3FKSG 1HR0B 3IIAA 4NXMB 4XMAA 5HFLA 1NCQC 4TYSA 1OI6A 3AXEA 1EZJA 4IGQA 4AFMA 3H7JA 4QDSA 3ZSLA 2RMKB 2EX3A 2A6YA 3LPFA 4P30A 3ECQA 3MFAA 1T6GC 4LKFA 2AZ2A 2WWWA 4FVMA 3G7DA 1MZ6A 5LOVA 4NXNO 2WLIA 4LC1A 5DZFA 2WR9A 4X6QB 4XFGA 2JDYA 1OQ1A 2RMU1 1YJKA 1QOSA 3A23A 3KT4A 4BA6A 1Q8SA 1KITA 2YU2A 5C8CA 3R6SA 1POQA 5LBEA 1XSQA 2KR2A 4CSWA 3LEGA 3AKRA 4DV6B 4XXAA 5D5QA 1SA0A 5CAZA 3JBG2 4S2HA 4UXAA 3B40A 1OLMA 4JYAO 5HCAA 2HJDA 2BGPA 2FB5A 2E51A 5EYPB 4Q20A 4JV4A 1RINA 4B3RO 3LSEA 2EZOA 2YGMA 1DLLA 3MIFA 1ZZ9A 4DK1A 2UWBA 4QAWA 5JOYA 5IWFA 1OC1A 2ARHA 3BA8A 1SFNA 3UT5B 1CONA 2DCKA 4OX9B 4G9SB 2QDOA 5FMOL 5LP6B 2BBVA 2Q73A 4S2DA 4Y1XA 1R6TA 4LFBO 2YC2A 5DZGA 5IYCO 4HVRA 4ZOLA 1OQEA 4WVWA 2G9ZA 3WP3A 1HV1A 1BHBA 1GKFA 4V1PA 1RUE1 2PHLA 1QBZA 2B42B 1NZ6A 3FJSA 3ZYRA 1FYJA 2PFWA 1Q90D 4N43C 4XFCA 3SR2C 4A7ZA 3WG7C 2JENA 1UYYA 4MVZA 2CTRA 2ZGNA 4LXLA 1D5NA 2DCZA 2Y4UA 1AI5A 3KQRA 1W9TA 2I07B 4GXLA 2VS0A 3DYOA 4ARYA 1NTZH 3H50A 3NV1A 2P6JA 4ZHQB 4JGZA 5LATA 2ZGRA 3BFRA 1CJDA 1EN4A 2BVBA 5C4WC 4JGYA 5KHJA 1RM1C 3DCQA 5KMGA 4I0XB 3T0DA 4DXWA 2Q0AA 4WFAV 2ZS6B 2VOTA 1LHUA 3ZHUA 4FPOB 4PQQA 3QTCA 2G38A 1JBCA 1SCSA 4H3WA 4MZUA 1FT9A 3IGAC 4XF4A 3J4UH 3J80N 1OV9A 4DIQA 2O0OA 3WW3A 4CZSA 2W46A 5DMYA 3M3CA 5JPMB 2DWDC 1F8VA 5B3SC 3SISA 3RI9A 1JOBA 5B1OA 1KJRA 1ZA7A 4MW3A 2PA7A 2ILMA 3WB0A 1CJPA 2WA4A 3OGCC 3Q8AA 2VZSA 1QJZA 3CIHA 3ZN5A 3GF6A 1DF4A 2PHWA 5C8WA 5CU1A 1BVP1 2AHYA 1H1AA 5K8SA 3ZIXA 3J7HA 2Q1FA 4R8CA 5IYZA 2RCVA 5F8PA 1EUUA 5FY8A 3QF7A 5KR7A 4Q6GA 5L9VA 1JU3A 3VBOC 4WF9V 4RSUA 2ZACA 4QB1A 2A73B 4UF0B 5FY7A 4IEUA 2AGSA 3O14A 2YIBD 4LF9O 2D6KA 5EC2C 3BRCA 4LFCB 1VQKV 4JI4B 4W4ZA 1W9SA 2BGOA 4UT5A 3AP4A 2WPDG 2OT7A 2ZGQA 3DF0A 3LA3A 1Q8PA 1UOBA 1RFYA 1MS3A 2XAFA 4BIUA 2RM21 5FP3A 4CBCA 2Z79A 2QKSA 5JOWA 5FYCA 4BK4A 1WBLA 4Q4X3 4NRQA 3WB2A 1ENVA 1PO22 3AXDA 3POEA 4QGNA 4ABMA 3WHUA 2ZQMA 1CAXB 2RJKA 4PI2A 3CCQV 3DXRB 2XVKA 5LMNB 1UY0A 3ZM8A 4ASMB 4Q0QA 3EBRA 2XMLA 3HOBA 3MGUA 1WLWA 1GP5A 2GN7A 1H0BA 4QPGA 5A1FA 2QWPB 2VCCA 1EY2A 5FPLA 1EV11 2QTWB 1U0AA 4JI6B 2R6QA 1H2LA 2UU9O 4WM7C 1UY1A 1PX3A 1RHI3 1JZ6A 3SKVA 2HWD1 1PO23 2J1AA 4CH6A 2GAUA 5FPVA 5JAXA 3BTXA 3W9AA 1SBEA 3JUUA 4CDUB 4Q29A 3ZRSA 1CAWB 4NPMA 4AVCA 3HKCA 2AREA 2VZOA 5EZYA 5LP6A 5GZFA 1AJQA 5BXZA 4MGZE 1AVMA 4CDXB 1SPPB 4CEWC 2BERA 1U5IA 2D3OW 5KC6A 5JCOA 4F6RA 1Y9GA 2A3YA 4ZOLB 3MPBA 4CCEA 1K5SA 1WP8A 3N9OA 3EQEA 2VXJA 2WA3A 2DOSA 1S77D 4R4ZA 4HBNA 5LGUA 2DVGA 5LEKA 1V6KA 1H9PA 4XFIA 5A7OA 1PNLA 3MBWA 2IVIB 3FD9A 3FAVA 4N9HA 4Q8KA 3WQ1A 2Z5UA 1AR93 4IETA 1S0GA 2RE9A 3MLJA 5FUIA 3ZIAG 4LBEC 3ACIA 1N34B 2QSAA 1QXRA 1RUD2 1DYPA 2WZPP 5TISZ 3VV1A 1DBNA 2ZHNA 4J41A 1I9RA 4UW4A 2GC0A 1KDKA 1EV12 1JXNA 3WQ7A 1DLCA 2ZZJA 4JYYA 1B06A 4MYEA 4FOVA 1K45A 2OYZA 5BMVA 4WBNB 2AGAA 2P90A 4C90A 2OA2A 1RM1B 3AZXA 3B8MA 2AHZA 2XLFA 1VQ8V 3SYOA 4FOQA 1S0IA 1NZIA 1YQ5A 5CBLA 2R063 5D5PA 1QWRA 2F4LA 4PV1B 1O4ZA 4N53B 3SPHA 2RR13 3BCWA 2ZX1A 3QO8A 3TNPB 2JB4A 4N21A 2VW2A 1SG3A 4DV3O 4UB6Z 3SMHA 4A3XA 1MEC1 4JZGA 5JLVA 1FXKC 1VRH2 3ES4A 3LDRA 5A6YA 1J1TA 2PAMA 3VZJA 1WCSA 4L87A 4LE3A 1D4M3 1AR63 3I2JA 1KYOF 4AI9A 5KAIZ 1JUIA 1PK6B 2VQUA 3UCSC 4M4PA 4FFIA 3A0RA 1R3IC 4Q4W3 3ASOC 3T0BA 3GM8A 4QKDA 2I74A 3HD8B 1SEFA 4B1MA 5K0UB 1U5ZA 2R062 4COUA 4DR5O 4CDQB 2DBNA 4BQ1A 4Q2FA 2GC1A 1AJPA 3N35A 1ZWIC 4IEXA 1N1TA 3N27A 5A3UA 5CA3A 1TA8A 1LU1A 1PNFA 5C4WB 1KECA 1THZA 4NTXA 5IDJA 1ZL8A 3DYMA 3VKMA 3VBUA 3T4HB 1IBLB 3ETEA 4OI2A 1HQWA 1UPSA 5FV3A 4EB6A 2HEWF 5IY5B 1SESA 5AVAA 3K5NA 2WDBA 2QQJA 2ZM6B 4HVQA 2W52A 1ZBA2 1PZ7A 3H3UA 3VDCA 4DV2O 3NMBA 4OCTA 1MZ5A 2YFUA 4LIUA 1G9DA 1T5EA 4J7JA 1M9NA 4PJYA 4U7NA 1V6NA 4ZKIA 3FX3A 5FZHA 3S5QA 2IUWA 1AR1B 2DVBA 2GNDA 1R3JC 5I93A 2FMYA 4GCZA 5F2WA 5FIXA 2CGNA 4ZS3A 3WNXA 2OWOA 1LECA 4LLFA 3KMHA 3PUHA 2A6VA 4X8NA 1US2A 4EEQA 4WZFA 4ASUG 4O2AB 1TUEB 1QIQA 1BCCH 4FOWA 1RP3B 4E4SA 1B3QA 2CDOA 2A3QA 1H8TB 4HL0A 1OKOA 4MTFA 2MPFA 1I7FA 5FPBA 2FDIA 3WP4A 2ZGKA 4OX9O 2YBPA 3K48A 5I0TA 5IY5C 1LEMA 5F3CA 2H0VA 2WNUA 3D3AA 2ZNJA 3CX5F 4WM8C 3E22A 3VBFA 4PF5A 4AQSA 3NV3A 1X33A 4MGSA 4MHRA 3OFNG 2WSVA 2QE7G 5A7NA 1SCRA 3C7OA 4FM0A 1COWG 3ZMTA 4IUGA 1MR5A 4IV3C 1C5HA 3HKEA 3GB7C 1CPYA 4KQ7A 4M3CB 5FUNA 1NT0A 4C8DA 1W59A 3OY8B 4EFBA 3I3BA 4LULA 1W8TA 2ZMKA 5BMVB 4WV8A 1XNTA 4XAEA 4IV3A 5J96B 1BSMA 1CAUA 2F43G 2F4PA 3AMPA 3HKBA 5HFMA 3G6EV 1H8VA 1P7GA 3DTUB 3IFXA 3P32A 3AMQA 5C8YB 3DECA 3ZYFA