2PTMA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
DSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hyperpolarization-activated (Ih) channel
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Transport protein
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ptmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ptmA02
4PIYA 5FLIA 1JUHA 4EROA 5JCTA 2Q30A 3CJXA 1YFWA 3FX3A 2GZWA 3TNQA 3E6DA 4ZU4A 1RC6A 2GC1A 4YSFA 4QXKA 4HZFA 3EO6A 2ET1A 4EV0A 2ATFA 4Q29A 3IDBB 1HW5A 2XLGA 4AQ6A 1GQHA 4O9EA 4IEYA 1UCXA 4N9HA 3NL1A 4UXAA 2PQQA 4UBGA 4Q0QA 3LOIA 1NYWA 3RDIA 2Q0AA 4JV4A 1XE7A 1CAUA 4AXOA 2ET7A 5KHHA 3BPZA 2OZJA 5I0RA 2VQAA 1ZZ9A 3FZ3A 3KGZA 4A2UA 4QX5A 3C3VA 1U12A 5E1RA 2ZKLA 3H3ZA 5JR7B 5FPZA 5C8WA 1CAUB 1VP6A 4L2NA 1YWKA 3O14A 1YLLA 3S0MA 4LA2A 1PM7A 2HJIA 4PIZA 2D5FA 3LZZA 1CGPA 5KHKA 4IESA 2B9UA 1ZX5A 2DCTA 2EAAA 2BNMA 3LA3A 3H50A 4UBHA 5JSPA 1EPZA 1J3RA 3FFQA 4QM8A 1ZZ7A 1DZTA 1EY2A 5LEJA 4XF0A 1YFYA 4EWEA 4XFGA 4ONUA 3BU7A 1LR5A 1XE8A 2XLFA 3ZDSA 3RNSA 1ZZ8A 5FQ0A 4HMZA 4WBBA 2O8QA 5AVPA 1ZRFA 4LA3A 1ZRDA 1YFUA 1L3JA 1NXMA 4OLLA 5FQ0B 1Y9QA 2IXKA 3E6BA 3N4MA 3GBFA 4MGKE 3S7IA 2XL9A 2XHKA 2XGXA 4JVAA 3LAGA 3EHKA 2Y0OA 5FDBA 2N7GA 1Y3TA 4XF9A 1J3PA 4L11A 4HVQA 2ETEA 3NKTA 2FMYA 4IEZA 4Q0PA 4JTNA 1Q43A 1QXJA 3NVCA 4WVZA 3R6SA 2EA7A 3BB6A 3BCWA 3ES4A 2OYZA 5K8SA 1UPIA 4WZCA 3RZZA 5BV6A 1RL3A 1YHFA 2QDRA 2XLAA 3IIAA 3PLQA 4I02A 2FQPA 2PHLA 3MYXA 4OFGA 3HT2A 1ZZ6A 2EVXA 5LRSA 2VECA 5I8SA 2WC2A 4KU7A 4HVRA 3CLPA 3SCGA 5I0TA 3MDPA 4LUMA 2IXCA 4FBFA 2Z69A 4IEXA 4XETA 2PYTA 1GQGA 1EP0A 3KSCA 4FAGA 3EQEA 5CU1A 4AVAA 5J7MA 1VJ2A 4XFBA 3H7YA 3L2HA 1X7NA 3DL3A 4E2GA 4KL1A 3CL1A 3WW1A 1Q5OA 1H1IA 5KHJA 2IXHA 2QCSB 3SXWA 4BHPA 5FCCA 3H3UA 2PHDA 1LRHA 2IXIA 3H1YA 1O7FA 3ST7A 1DZRA 4AVCA 4XF4A 5BUVA 3SHRA 3WW3A 5JSRA 5C6CA 2MPFA 3H8UA 4B29A 3FE5A 5JSOA 1QY4A 4BYYA 2UY9A 2XKOA 2O1QA 4R8HA 3PVBB 4IEVA 1FI2A 4YNIA 4HSLA 5I91A 4MGYE 3OCPA 5BY5A 2BNOA 1CX4A 4QGNA 4CYDA 1RGSA 3NJZA 1NE6A 3M3IA 1J58A 3CO2A 4MGZE 4N9IA 1Q3EA 2QJVA 5LRRA 3WW4A 2UY8A 4I01A 4F8AA 3IDCB 3B02A 4IEQA 1YFXA 4R52A 4XEZA 1J3QA 1WGPA 1NZCA 1FXZA 4HLTA 2GC2A 2UYAA 5F1RA 4GULA 4D7SA 2OPKA 2PAKA 4F7ZA 2Z2SB 5EFUA 1DGRA 4X6RB 4EWDA 3DKWA 3H1MA 1QXRA 2QVSB 4PIXA 4QM9A 3U10A 3HIFA 3NSTA 3U0ZA 2PTMA 2BNNA 4IEOA 2CGPA 4TLFA 1ZREA 2H6CA 5BXXA 1O3QA 4HSJA 5KHIA 4Q0VA 4LLOA 3UKVA 3H1WA 4LTAA 1X82A 4AQ2A 2CAUA 2C0ZA 3RYPA 3LWCA 3D0JA 2ZCWA 3GYDA 1ZZCA 3S7EA 4XFIA 3H9AA 1FT9A 5CVRA 4MH0E 2B5HA 1LKNA 1DGWA 1WLTA 4YYOA 3OGJA 2D5HA 4XF1A 1ZNPA 2GU9A 4K8FA 1YUDA 3E5QA 4KWLA 3RYRA 5JAXA 3I59A 4I2OA 4E2SA 1O3SA 1H1MA 3TNPB 2KXLA 3SCFA 4IERA 1TQ5A 2HKXA 3I59B 4META 5I0UA 2CAVA 4HN0A 1UD1A 3SMHA 5BPXA 1WA4A 2BEOA 1OMIA 4J1WA 1ZRRA 1X8MA 1O4TA 5I0SA 4MX3A 2GAUA 3SCHA 3ES1A 4QMAA 3KGLA 1O3TA 3EBRA 4I0AA 3IBMA 3E6CC 2IC1A 1IPJA 1SFNA 1ZVFA 2Q4SA 5LEKA 2MHFA 3FJSA 2GC3A 2XL7A 5EZWA 3FHIB 1V70A 3HT1A 3U11A 4J1XA 2CV6A 1X8EA 2I45A 4KWKA 4MV2A 3RPQA 3UKTA 1OFNA 1O5LA 4MZUA 4HVOA 3E5XA 4YRDA 3OD0A 4X6QB 1I5ZA 1QWRA 2Q1ZB 3JZVA 2H0VA 5FLHA 3LA7A 4BIFA 5CADA 4PJYA 4HBNA 4IEWA 3E97A 1SEFA 4LULA 1I6XA 4P9GA 3QACA 1XRUA 3I7DA 2B8MA 2P17A 3E5UA 2BGCA 1NE4A 4Q0SA 4ZU5A 3DN7A 4Z82A 2WFPA 3ETQA 3KMHA 4HN1A 4Z07A 2V09A 3I54A 4NVPA 1SQ4A 4XFHA 5FPXA 1O5UA 4QGMA 2K9ZA 3USSA 2PA7A 3G7DA 1CAXA 5I8TA 3RYKA 4LUKA 1G6NA 2H6BA 4ORFA 4H7LA 1ZRCA 4XFAA 4EWAA 2PAEA 2PFWA 3ROUA 2OZ6A 3H7JA 3VHRA 4Q0UA 4O9GA 4IETA 1CAXB 4XFCA 1UW8A 5T3NA 1RTVA 5KHGA 4I09A 3IWZA 4KU8A 1O3RA 4QGLA 3EJKA 1OI6A 3CF6E 2E9QA 3MZHA 4E2QA 3LA2A 2XKPA 4MUVA 3DV8A 4JTOA 5J48A 4DINB 4XFFA 3OTFA 3KCCA 4KWJA 3M70A 3CEWA 4I3PA 2VPVA 3FWEA 1UIJA 1J1LA 4FAHA 4IEPA 5I8YA 2MNGA 3NW4A 4ZU7A 5D1IA 3HQXA 2OA2A 4RD7A 2BYVE 3D0SA 5I93A 1RUNA 1UIKA 4FT8A 3ACLA 2GC0A 3UKNA 1IPKA 5FLJA 3OF1A 2K0GA 1ZZBA 4BH9A 5HI0A 3QOPA 5J3UA 4LEJA 1J59A 2IXJA 2D40A 3ELNA 2GH2A 1RUOA 4D7TA 1LB2A 3BALA 1CAVA 1VR3A 2QNKA 4AVBA 2IXLA 2PAMA 2D93A 3WW2A 3MPBA 3D82A 5E16A 4YARA 1CAWA 1CAVB 4IEUA 5KBFA 1OD5A 3PNAA 4MGIE 2F4PA 1EYBA 1PMIA 4XF3A 2UYBA 1CAWB 4I0BA
chains in the Genus database with same CATH superfamily
3N36A 2K9PA 3M7AA 1XQ8A 3T1HB 5GTHZ 1AR91 1A32A 4EV0A 2Q67A 4ZHNA 3IDBB 2V7QG 2JDUA 1HW5A 3M2MA 4O9EA 3OUJA 1ULEA 3K5OA 1S2EA 3QF7A 1BEV3 1QJEA 4UBGA 5FP7A 1P49A 4Q0QA 2VQUA 2VZQA 2KQXA 4YM1A 5A1FA 1N3OA 2WQ4A 2VR4A 4NHLA 3H3ZA 4A6SA 1N0JA 2Z42A 3M99B 4GKKO 1TMF3 1GZTA 4BQ5A 2OIGA 1CGPA 3A22A 4L99A 4Q8KA 5FYYA 1JHNA 4X1KA 3SPJA 2VBPA 3ZXEA 3CE2A 5FY8A 4I9QA 1PO22 1CR7A 2VNRA 3RNSA 1LOFC 4CP1A 1ZRDA 1N4CA 5LZ6A 1V0AA 3ZEDA 3ZJZA 3CDZB 2ZXQA 1EV11 3WDYA 4W65A 3NNMA 3S3WA 2IJHA 2RS12 4O61A 2QA4V 5J09A 2W0FC 4K6BA 2PZSA 3I56V 4FPKA 4AI9A 1T6GC 4CCOA 3ZXDA 3CB2A 1BK1A 4YHHB 3B01A 3PVEA 1ZZ6A 1SERA 4UFKA 5BNQA 1YQ8A 2QM4A 4KU7A 1OOPB 1PPJH 3FBYA 3N7LA 3NJXA 2Z3YA 2VW1A 2P06A 1O4YA 1SDWA 1BMV2 1RUE1 2EZPA 1K4CC 3WW1A 5JWPA 2BSKA 3JU9A 4BHPA 3M7MX 1NY72 3KT1A 4AQYB 5FBJA 2Q8VA 4MYEA 2CGNA 1DF4A 5FZLA 4RHV1 4DV5B 2HEYF 1A34A 1GN2A 1QLEC 4XUOA 2VMDA 4KUMA 4XC9A 2C1FA 4MGZE 3Q4HB 3C7HA 4X20A 3ZRXA 4N53A 1NA1C 5LW9A 3WHTA 2EULA 4U2AA 2QQWA 1PVXA 3A0RA 1WKYA 4CBCA 1RUD2 3P30A 1G6UA 4MSVA 3ABMB 1Y66A 1QOTA 3J9SA 3K4ZA 1DQ2A 1B6QA 2XJSA 3QO5A 5CG8A 3B5LB 4GB32 1OZ0A 3OAAG 4Q0VA 1OCCB 3RW0A 4DUYO 1W8NA 2C0ZA 1LOCA 4UVBA 2GDFA 3N9OA 5JCOA 2WNUC 4SBVA 2WLLB 4MH0E 3ZYGA 2JJ1G 2A7AA 1RVF3 5JOYA 4AK3A 2ZGPA 1ZNPA 2ZGOA 2YEVA 4DR6B 4FIPC 3CQOA 4DXRA 4GX0A 1QJX2 1CD3G 2DCKA 3NXSA 4META 1WA4A 2Y6JA 5FXVA 4DV1B 3G71V 3ES1A 4I0AA 3LNMB 1SFNA 3VKMA 5EZWA 2ZE8A 4Q4X2 1VQ5V 5F6LB 4YFWA 2G19A 4F6RA 1KUQA 4X65B 3K4AA 3E5XA 4Y4RA 5GLUA 5EIYB 4DUWA 1D5AA 5B1OA 1S1AA 1AYN2 4L97A 4ARXA 2NR5A 1JBCA 5DAPA 5DAWA 5FZ0A 5L7OA 1SQGA 4PJYA 3JSLA 4EKWA 5LA6A 5FOJB 3T0DA 3QBQA 3RYFB 5HV4A 2XWBB 4BU2A 2RNBA 1G9CA 5IFPA 4AFBA 1NQJA 1SQXH 3CRCA 4JTCB 1XHZA 3RYCA 3TN93 4WFHA 5J98B 4DW0A 3Q8AA 2HHHB 1GUIA 5C3SA 3BA9A 4FQZA 3G7DA 2VXRA 5CBHA 1UF2C 3WF3A 1O8PA 2H6BA 3FAVB 4BZ4A 4M0HA 4IETA 1RJ7A 3CRRA 5FY7A 1YIJV 4OMDA 2ADEA 4XAAA 4WM7C 4RQPC 3FWEA 1FX5A 1SMVA 1OCZC 3ZSMA 3MO4A 3VDAA 4Y5TA 2AENA 5FY0A 1VB2A 2IFRA 2GC0A 2HEWF 4K35A 2HWC1 4OHYA 2K0GA 2ES3A 3ELNA 4W6XA 4Y1ZA 2CSGA 2WWJA 4FFBA 2BJSA 3AXDA 1DLLA 3AZYA 3IDAA 3OM3B 3UV9A 3WNNA 4FTSA 4CCEA 5H9PA 4MTFA 1MVQA 3LPFA 4Q4V3 1VP7A 5DN6G 1G8MA 4MGTA 5E89A 4CCDA 1PO12 2VZOA 3T1LA 1D4M2 1GV9A 4JPRA 2FTKA 2JEXA 1XYOA 1QIQA 4H2AA 3OGCC 3A7QA 2Q0AA 4AXOA 3HKEB 2A3QA 4P2ZA 2FDKA 3VL9A 4DV3O 4QX5A 4X1IA 4BIZA 3VBOA 1VP6A 3A0KA 4NN0A 5DQ0A 4K21A 2EIJC 4GWMA 3OBZA 2WQ8A 3SH5A 1POQA 5B4XA 1DF5A 4LC1A 5H9CA 4Q5OA 4E4SA 1TGOA 2R7EB 2GSMB 3FFQA 3GCWA 4UF0A 3L9JT 5A3MA 4LF9O 1ZBA1 4BQ1A 5KA6A 1SPPB 1OCOC 3CJIB 3T4HB 5L9VA 1G7YA 3PUQA 4OHXA 2ZEZA 1YFUA 3SPGA 1ND3B 2E7QA 2BQPA 2WZR1 5JH7B 1HRV3 1Q8OA 3O1UA 2BOJA 2VJXA 1MEC3 1VB4A 2EF6A 3UT5A 1UPIA 2JDHA 1HNWB 4DXZA 3AP6A 3FHQA 1RMU2 5B3SB 4LWSB 2A06H 2VECA 5I8SA 2R072 3MW3A 2BZDA 2UWBA 1WLEA 4NIGA 3CC4V 4NXNB 2G1MA 1IBKO 5EP9A 2VZPA 5IVCA 2W46A 2VZSA 2PLV3 4LOSA 1SQVH 3IMNA 1G86A 2DWRA 1H8TA 2IXIA 4GMP3 4P30A 2Q73A 1LU1A 3WW3A 3H8UA 4IW3A 1P84F 3CMAV 5FWJA 4DR7O 4BE3A 3KHCA 4MGYE 4MTOA 1WMFA 3ZYFA 4FI9A 5JMCA 1VBD3 4NO4A 3LDEA 4A42A 5LK7B 4F8AA 5LGTA 2OWOA 2DN9A 3C7GA 2OPKA 1K45A 4DR1B 5EFUA 3APOA 4INDA 4X6RB 2UXDB 3GDBA 4FLXA 3H1MA 3K03A 5KC5A 2ZAAA 2E51A 1GLHA 2RMU3 5FYCA 1GN4A 5BXXA 2JS3A 4J80A 2BDRA 4LLOA 4K1YA 2VVEA 5IWAO 5L19A 2ID4A 3GYDA 2QKSA 5FPRA 2D43A 1ZZCA 5T50A 1HW7A 3S7EA 2ZS6B 4XCAA 1TZOA 1NQDA 1COWG 1BT8A 3V0AA 1XNQB 1S0VA 3E5QA 5JAXA 3I59A 4DV7O 1IHMA 1TQ5A 4Q4W3 2YICA 4B3SB 2CAVA 5IW0A 5F5IA 2R041 1UZWA 3OGVA 3RYHB 1ZRRA 1VBE1 4MX3A 2M6YA 5JXJA 2XPJA 3KGLA 3FLTA 4TTGA 1YITV 3T2QA 4EN7B 5DN2A 4XJ9A 3FHIB 1PGW1 4BDVB 1ZM1A 4XABA 2ZGNA 3GZTB 3TWIA 2CH7A 4GKYA 4JHZA 5A9GA 1M57C 4WVMA 3UGFA 1JCHA 4OI2A 4XBLA 5LA0A 5LMNB 3NNFA 3OD0A 2YUAA 5LASA 1PIV3 1JFFA 1CESA 2P4VA 3KV5A 3LSSA 4FZ0A 5EJZB 5FYIA 3ZR6A 1P4RA 4JF3A 3HKCA 1XNRO 5FPBA 3CBNA 4ES9A 1KRIA 1QMJA 1SRYA 3QACA 1XRUA 4YXWG 2WNUB 1S5LZ 4ZU5A 1VQ4V 4AI8A 3KMHA 2WZ8A 2V09A 4NHKA 2NLRA 4URTA 5LGUA 1Q8VA 2Y0PA 5FY9A 4K3UA 1JZ3A 4AZZA 4B4RA 3C7FA 4OI0A 4EWAA 4H55A 3WDUA 2E3CA 1OUXA 4I09A 2HWF2 2D3SA 2DF7A 4LCUC 3ZIWA 4MUVA 1COV2 1UZ0A 3VQXA 5FYZA 5CMUA 5GKAC 4DR2B 3P5BA 5H2FZ 5F3CA 3K06A 1QOSA 2J22A 4HFSA 3IC9A 4PHZA 1PO23 2V1DA 2CAZC 2WLNA 3DPRC 3RBZA 4P5YA 1VBA1 1AILA 4GAZA 1XQNA 1VR3A 5JXHA 2YXYA 4CCLA 5B1BC 3K08A 2UXNA 4ASMB 3ASOC 4IEUA 1REFA 1YTFB 1W8FA 3HR0A 3ZOIA 3N7JA 4CDXA 4YWAA 4I0BA 2RS13 2AREA 3ILNA 3WNPA 4AE2A 1FYJA 5CB7A 2CH7B 1V00A 3I5DA 1D7PM 1H9PA 2W6JG 4LR4A 5FY1A 3BCCH 5EBMC 3RZJA 1BBT2 5J2UB 5B1AC 4IL7A 5AVAA 5EQUA 1NTZH 1NYWA 1XE7A 1FMD1 4M01A 3ZN1A 5DAQA 5F3IA 2ZKLA 3ZSEA 5B1NA 4UFIA 3QO8A 2E7AA 4L2NA 4WM7B 4RQPB 1YLLA 2P4EA 2SLIA 1TMF1 1C4RA 5EC2C 1J95A 2DBNA 3F2ZA 1OCZB 2CWSA 2DCTA 5F2WA 4CCNA 1PVC2 2ZZQA 5IWFA 2H8PC 2ETNA 4NTWA 3LSDA 4ZOLA 4AVTA 3JASA 2N04A 3MGUA 2HVJC 4XFGA 4QT6A 5FZOA 1OHHG 2JE9A 4FXKB 3AK0A 4AQTA 1CONA 1NU1H 4B8EA 1JYTA 3OBRA 1W0PA 1VBC2 3ZFGC 4F4LA 4XDPA 3INAA 5KXDA 4XCBA 1RUD3 3IDEA 2B4KA 2ITCC 1Z78A 4WVZA 2QGNA 3RZGA 1V9U1 3RZZA 2Y38A 2VOVA 4IGOA 4FTEA 3TETA 2DWDC 4TV9B 4GB33 4HVRA 5GZFA 5CFCA 2P90A 1STMA 4I0WB 4BM8A 1ZBE2 5EJ1B 3WF4A 2W91A 4YJ3B 1JQ0A 4P00B 4AVAA 4QKFA 3ZXJA 1IZ3A 4DO0A 2JXAA 4QX7A 3KVAA 2EIJB 4Z1VA 4JDOA 2A6YA 1QJX3 3ST7A 1Z5VA 5JSRA 3APBA 1OCOB 1ULCA 1DCSA 1UYXA 2BVVA 4HKOA 2VZRA 5FZDA 1IBMB 4HSLA 4QHBA 5JIAA 1R1A2 5FMDA 4OQ9A 3HN3A 1C5IA 2B39A 1NZCA 4Q4X3 5TSWA 2JDKA 3AVSA 4L0PA 3SH3A 4JHTA 3DKWA 2ZMKA 1NCQA 3I3EA 5IYYA 4PBPA 2ZM6B 3J26N 4ZZ5A 4UW3A 1LENA 2VZ3A 4LF4O 3K75B 1AYN3 1VF7A 1ACCA 3NSTA 3RWNA 3BTZA 2YXSA 3P3NA 5GALA 1WBFA 1W2TA 5F32A 4FMTA 1UU5A 4R9AA 1M56C 4GX1A 2KD7A 3VZOA 1UU4A 1AXZA 2VMHA 3A23A 3POWA 1PX4A 2PY5A 1CZSA 1H2KA 2RCVA 5EZYB 1HXS2 4TUYA 5FKCA 2PN5A 4XIKA 4COVA 3QLQA 4K8FA 4JC1A 4RSUA 2QDNA 3MEPA 3WX5A 5G05L 1CPYA 5I0UA 3OTOO 4M4PA 4NTXA 1XB9A 2HYXA 3VKFC 4B7KA 2B42B 3FKSG 4DK0A 2LS6A 4DQAA 2E5LB 5I0SA 1FYUA 2W47A 4JI2O 5IAXA 1OA2A 2ZHKA 4Q2FA 4H33A 1RXFA 5LEKA 2MHFA 4NTYA 4EQVA 2HVKC 2WQZC 1BS3A 4GCZA 3U11A 4J1XA 1JYVA 2I2SA 2ZX4A 1NZIA 3ZR5A 1S0GA 4J7KA 5HPOA 2XBO2 4LF6O 5IAVA 3N2KB 2PHTA 4Q1PA 4JGYC 5LWBA 4B3MB 2A3WA 4QKNA 1QWRA 5FLHA 4DPNA 2YY1A 3UKMA 3BKZA 4HOOA 3OPTA 2QQIA 1S55A 5E79Z 3OT7A 3E97A 1YNAA 1CEZA 2TEPA 1Q8SA 5FZ1A 1WLDA 4PDWA 1W99A 2DURA 1EN6A 1NE4A 3LEKA 3ZSLA 4LNVA 4V2WA 3E35A 3GJBA 3VBUA 3MW2A 2YUEA 1TE1B 3APQA 3VDCA 1O5UA 1VF6A 3USSA 1PO13 1JYWA 1WJZA 3D8CA 1GMGA 1D4M3 2Y34A 1RFYA 1NH2B 2R1DA 4ORFA 1KYOF 1ZRCA 5IFTA 3H7JA 4TWKA 2XH6A 4N23A 1I5PA 3PL0A 5CB4B 5FTTC 3CCQV 3OE7G 4FM0A 1SACA 4E2QA 2VOTA 4D6SA 3S57A 2UXBB 4CS4A 4IQPA 4G28B 1B35A 4FAHA 1AL22 3N9NA 1LNQA 1XSQA 2JK5C 5I93A 1M57B 3UKNA 2CU5A 5K1PA 4XBFA 2D97A 1Q90D 2JIJA 2WA4A 1LOBA 2YGLA 4P9YA 2JG8C 3BALA 2O8OA 2HLEA 5FMBA 3MPBA 4PD4F 4TLGA 1L7LA 1R081 4YARA 4YY3B 2HWD2 1MS1A 4MGIE 1E5SA 4GALA 5FMOS 1FNZA 1KB9F 5CA1B 1WLWA 1O59A 3UK9A 4FZ1A 1VQOV 1QQP1 2YV8A 3AKQA 2BBAA 5FZ4A 2JGDA 4G4FA 2ZDIC 5C71A 1GSLA 1WBLA 5BNPA 4B4PA 1EPWA 5K9YA 1RMU3 3J7HA 3M8AA 4N9HA 3UO2A 2VMIA 2R073 5IT9N 4XBQA 1US2A 3ACIA 3JCZA 3NAPA 5F5QA 4DR4B 4B3TB 3J4UH 2Q7HA 4IGQA 2EIMC 3ZKYA 4BQ2A 2OXBA 5C8WA 2RS31 1XDCA 2CTVA 2R32A 4EZHA 1FPN1 5FK8A 2EAAA 2GV9A 3ZFFC 3JQWA 5DUUA 1W8OA 1N34O 5HBAA 1YFYA 3W9AA 5J2TA 2VQEO 4FLUA 3B7MA 1JJOA 1GMMA 5AVPA 1R092 5JQGB 1O9GA 3BU0A 2A71A 3ASOB 4GA9A 1WW5A 3AYEA 4P9WA 1PM4A 3IMMA 1ZTEA 4AVVA 1D4VB 5BMVA 2HBUA 2BTOA 1OVSA 2OUJA 4LHKA 2VOWA 1UX6A 2N7GA 3OG2A 2ETEA 1W9TA 3S5AA 2N05A 4O2AA 1XNDA 4AEJA 2P2KA 1NCRA 2ZOEB 3ES4A 3PMEA 1YJ9V 4PA3A 2GDSA 4QPGC 3H8RA 3S3XA 3ABLC 4H0LB 1O4ZA 4OFGA 5B2GB 5FREA 1UMIA 3CLPA 3SCGA 1UYZA 4YVWA 4NRPA 1UMHA 2YDEA 4FAGA 2ILMA 1VQLV 5J1XA 4J7ZA 5A7SA 1NBMG 5CBLA 3WNMA 1HQWA 5DECA 5IK5A 4WVWA 3MIFA 3FN9A 3KZ4C 3H9VA 1N3QA 1G9BA 4TSFG 1G9AA 1W05A 2XJRA 4EFEA 4CXXA 3THOA 2LGQA 2J42A 3ON7A 3OCPA 1VBD1 1RP3B 4N9IA 3AYAA 2WLIA 3WW4A 3BUCA 2UY8A 4I01A 5IYDO 1UOFA 2JD9A 1MS9A 3K2OA 2GC2A 2UXCB 4QD2A 4XJWA 2DBIA 4A6OA 3UL2A 2ZPXA 5BNNA 3BAAA 1LTEA 4IEOA 3MFAA 4AHZA 4FVVA 1X82A 4JKKA 4FO9A 1H2LA 1K3IA 4U7NA 4IV3A 3VDBA 2UUBO 3WCRA 3JAKB 5T5LA 2B5HA 1EUTA 2XJUA 4YGDA 1MVEA 2DFCA 1SBEA 2RJ2A 1T5EA 4KWLA 4XUQA 3AP7A 3OUSA 1O91A 5SV8A 2X53S 2HH9A 1Q6HA 5CEHA 4DY3A 2P5BA 2PHFA 3I97A 4Q4W1 1Y67A 1JUIA 2HWF3 1K34A 2BEOA 4OX9B 1QH6A 4CDUA 1DQ0A 1TAEA 1BZKA 1COV3 3IPVA 5FZEA 1ZVFA 4S2FA 3VZLA 1X4TA 2BU9A 4HPKA 4I9WA 3KVBA 1JR9A 2N74A 1GNZA 4XILA 1AUYA 4PA4A 4ZI7B 4CDQA 3ZX6A 2Z5UA 4R9BA 1PIV1 5J9PC 2WO7A 2GMPA 2F17A 3PVNA 4BIFA 4EEQA 1H6YA 3GZEA 4X89A 4LNUA 1Y9GA 3VBFC 1A3KA 3SH4A 3F95A 2YHJA 4K0KO 3ZRVA 3K0DA 3E5UA 4KH9A 1K5MA 2MEV2 3VD5A 3WD5A 3PUIA 2KSDA 3AP4A 3I54A 4FP3A 5E6HA 1DG6A 3W5NA 5HCBA 3ZMNA 2EICA 2PA7A 1W9WA 1B06A 4NAMA 4ATEA 4OUSA 1B3QA 3A4UA 4XFAA 3WFVA 1BBT3 1U5IA 2PAEA 2BTQB 2R49A 3N7KA 4O9GA 5KHGA 5FZ9A 1M90W 4QGLA 2NN4A 2OCHA 5LA9A 4N8MA 2MK3A 5FOBB 1V55C 1VF5B 3I2FA 4UVAA 3J80N 1IS4A 3GGLA 4DZGA 2XOKG 2RR11 5IT6A 1PVC3 1W0OA 1BCXA 4EB6A 4JGYB 3AG3C 3ILRA 1WN7A 3ZSKA 1K8AW 3UGHA 1QU7A 1JYCA 1L0NH 3O1VA 2Y0IA 1IS6A 1NA1A 3KD4A 3L75H 5LBEA 2YIDA 5FZBA 3D3QA 5DDJ1 1XHXA 3FUQA 3QH7A 1Y76B 4G2KA 5LOVA 1CAVB 1VBC3 4PT6A 4FFKA 4R50A 4YZ3A 2WLJA 2RS11 4PIYA 2W1QA 3B77A 2R9AA 1KQRA 3WB0A 3CCUV 5LK5A 1W90A 1UY0A 2EXKA 1X59A 3I8TA 1W6OA 5F39A 3VBRB 4FFIA 4BISA 2WZPP 2YIBA 5A3LA 3T30A 1XBFA 2BUKA 1ZBE3 2FCVA 4GKJO 1BXHA 1OUSA 4LBQA 1CAUA 4CEYC 4JYBA 4LBQD 1Y74A 5E1RA 1U12A 2PI5A 1XL6A 2WKKA 1YWKA 2VY0A 3GHNA 2WLMA 4LA2A 2VXJA 1MQTA 4FOVA 1ZX5A 4MVOA 1MZFA 4CA9A 4L92A 2PHWA 3K58A 3JALB 3MLJA 3JYCA 1BHGA 1LOAA 3KQRA 4EWEA 4PI0A 3WDXA 4DV2B 2JG8B 5FNVA 2O8QA 1R1A3 4LA3A 4CUAA 4QHOA 2FDIA 3TEZA 1U5YA 3DECA 1Y9QA 3VBHA 2RVAA 2XT9A 4CS2A 1FXKA 1Q8QA 1HP8A 2P3IA 4XF9A 1YIFA 3WP5A 3N9LA 4JTNA 1AJPA 2JENA 2DW4A 3I3BA 4DIQA 3BCWA 4GIQA 4Y33A 4LBJA 1YHFA 4FLYA 5C33A 1DDLA 5FZIA 1SDDB 1IKQA 1GWKA 4PBOA 4XUNA 3O1SA 3HT2A 1H2NA 4GB31 1NKDA 2UU9O 1SBDA 5T55A 1VPHA 4KP4A 5FAXA 2XWJB 5DUXA 4IEXA 2PYTA 5LA2A 4YJ2B 2WLHA 3H0OA 2EIMB 5FKBA 3POIA 2TNFA 1OJHA 3EQEA 1HXS3 4FK5C 4FM2A 4E2GA 4HKLA 5FYUA 4MTGA 3GF6A 3SXWA 1QGLA 4L9BA 1QJX1 3H1YA 1MZ5A 3ZFFB 1M93A 3MBWA 1YQCA 1NI8A 3NWKA 2EIGA 3AMQA 5A6XA 2X6CA 5KX5B 3G6EV 3KV4A 1IS3A 1FI2A 5K0UA 2JJ2G 4X66B 3BTAA 3V65A 1UZYA 2VBDA 4H37A 1VMHA 2P67A 4N43C 5H9SA 4DR3O 3OEEG 3ZS8C 2VC9A 2EXJA 4R52A 4XEZA 3VDDC 5ABJC 1J3QA 3FBMA 1SESA 1P8JA 2WWWA 5LP6C 1RB8G 4TN7A 4XW3A 2XBO3 3MHHC 3GZAA 1AYM2 5C9AB 2P6CA 3ACHA 2F6BA 2GH8A 4QPGB 3ABLB 2BNNA 5JZGA 4UT5A 3PJQA 2DYSB 2Z0AA 4MXWA 2A70A 3B9CA 3JBG2 4PDLA 1JOYA 4Y5SA 1C1FA 4RA0A 3T2OA 1HR0B 2XHNA 4IE4A 4MO3M 3CYOA 2WZEA 1OF4A 4DUVA 3AL6A 3H9AA 4Q4Y2 5LHHA 4NPMA 3EB7A 1Z5WA 2D44A 4X64B 1KC8W 3VD4A 1GO3F 2ZBJA 4OI4A 2Z79A 5DMYA 2D6MA 4JAUA 1SLLA 3JQXA 4W4ZA 5H9QA 1SS3A 2RM21 4Y4YA 3WT3A 4FLVA 1ULDA 4QU1A 3HKDB 4Y22A 1OC1A 1JHJA 3R4UA 2JX9A 1AL23 1HN0A 3E8BA 1IVSA 4LFCO 1Y4MA 3KT4A 4MZUA 1VQNV 1XREA 3T4DA 4AI1A 1ULPA 4B3NA 4BCUA 4JAAA 1CP9A 4PF1A 3DXUA 4TV8A 3ZYBA 3LA7A 4G27B 4UOJA 3WF0A 3ZMSA 3R05A 5FWEA 4LH7A 2J1TA 2XJTA 2HWD3 2EIEA 3O5SA 2P17A 3ACFA 2CDOA 3P3PA 2Q6AA 1E5IA 1V6IA 4FPLA 4OZXA 1CJPA 4P5HA 3W7WA 4AI3A 3U4XA 3LIHA 3O0XA 4FOYA 1D4M1 4ASUG 1QEXA 2NLJC 2GUZB 5I8TA 4LFBO 1THZA 2XHBA 3AX4A 1L8DA 2R9IA 2XJPA 5JZGB 2ZNJA 5CNAA 1AF9A 3FC0A 2JDNA 1CPNA 4UCVA 1SBFA 4I0XA 2XKPA 5D5QA 4JRAA 3OTFA 1IDSA 4I3PA 1N1YA 2VPVA 4ASLA 2WLQA 3NW4A 4ZU7A 4TQDA 4J9YB 2OA2A 2BYVE 4JZGA 2PHUA 1WPBA 2WA3A 3AEIA 3POJA 5IYZA 5LB6A 4P08A 2D40A 1W6MB 2ZHNA 5ACA2 5FZCA 2E7TA 4N90A 3ZMOA 4O4LA 1R093 3VBFB 1S2BA 2VMGA 3TK1A 1ZX3A 4JI6O 2F1MA 4XXPA 4COUA 1XMOO 1OURA 3OUHA 4BQXA 5BNOA 2CDPA 1Z7S1 3E2EA 3VKLA 2NPIA 2DVBA 2PMWB 2W1WA 5JVDA 4O4HB 1TVKA 3X2QC 2Q30A 4DRVA 5FP9A 2GZWA 2GC1A 5FZ7A 4YSFA 4QXKA 1QNMA 4Q29A 2JDYA 1WLCA 2X05A 1RMU1 1HLCA 2YROA 2ZEXA 2BVBA 2UUAO 1V6NA 4UXAA 3THCA 3JAWB 5HV0A 4LXLA 1V55B 1P7GA 4UCUA 3CD6V 5EYPB 1HIXA 2Y69C 4I5SA 1O6UA 1JVMA 1PGL2 2V4AA 4ZKTB 4PIZA 4DW1A 3BTYA 3ZHUA 2BNMA 4RN5A 3VD9A 3LA3A 4TXWA 1VQPV 3DKQA 5EWSA 3IIIA 2IW5A 3J8F2 1NAEA 3AG3B 2V4VA 4LHSA 5LCWL 1AL0G 2D3PA 1RUH2 4LF7B 5LEJA 1LR5A 5DABA 5EYYA 5FY4A 2AGAA 4DYLA 5FQ0A 5JPMB 1ZRFA 3HQRA 1KU9A 3GNEA 1UKGA 5FZ3A 4LF5B 2NYYA 2XL9A 1MR5A 2XGXA 3KF3A 5EJ3A 2Q9LA 2UU8A 2V72A 1KFUL 2OW4A 3SYCA 2WYFA 4IEZA 4KHPO 1AXYA 3ENRA 1QXJA 3NVCA 2FCUA 2LQTA 1ZL8B 3G6JB 4CEWA 2HP8A 4FP2A 1BHAA 3NV2A 3AK3A 2ZD9A 1POV1 1XILA 2GMMA 2EVXA 3RZMA 2J1RA 1JA8A 2A3XA 3K3NA 4YZ4A 4CEYB 4FQ4A 2EXIA 1Y43B 5DZEA 4G3YC 1QKQA 5BNOB 2BERA 1E57A 4LKFA 5J7MA 1Y4WA 1FJGO 2AHYA 4XFBA 1NS1A 1KGYA 1FV3A 1PHMA 5CG9A 1H1IA 4L8QA 5A7QA 2FYUH 4QB1A 3J7AU 1AR82 4GX5A 2LP7A 1HB1A 3RG0A 1JZ7A 4Y3OA 3HR9A 1I9RA 3C3TA 2UY9A 4OXSA 1G9FA 2Q1MA 2B7YA 4LF8B 1N36O 5DG2A 2P1BA 3E89A 3PTRB 2YZ4A 5D8AA 5F37A 4F7ZA 2R16A 2E31A 1S72V 4LT5A 4IE7A 2QM8A 3ZVXA 4B4QA 3TXQA 3LDKA 4YPJA 1C1LA 4DRXA 4QPYA 5C4WC 3I4IA 4Y5Z0 4GWNA 5DM6V 1TME2 3UKVA 2J1UA 3ITQA 4FPHA 1LUVA 4XHXA 2MEV3 4WBNA 5ANNA 5L36A 3OGIB 5CBGA 1AR92 4B3RB 2OUHA 1H1MA 4LBLA 2ZGSA 4CP9B 3SCFA 4IERA 1HJGA 4XDJA 4X88A 3L70H 5EC1C 5BPXA 2ZX0A 2P7TC 1VBB1 4AYUA 1X8MA 1HJFA 4XTPA 3SCHA 1JTZX 5LMUO 1COV1 3VBSA 3WUCA 5LXTB 5CA0A 4DV0O 4C90A 5L3CA 4N43B 1AVMA 2Q4SA 4MVMA 1BQPA 2YC4A 1LECA 5JLVA 5C3QA 2GC3A 3VDDB 5ABJB 2TBVA 5FMOL 1OLRA 5KMGA 1K5JA 4BQ4A 1OA4A 5LP6B 1I94B 1HDJA 3TRSB 1HX6A 1WMDA 3JCIA 4CCMA 4WM8C 4UWDA 3IC7A 1WPXA 5IVVA 3OYWB 4GH4A 1XMQB 4MHRA 3F7YC 2AC1A 5T52A 2BE3A 2RDNA 3WV6A 4DXTA 4U3FH 1SLCA 4ZZ8A 1SLBA 2R70A 3MV01 2VMEA 1W8ZA 4A7ZA 3VD3A 1EV12 1X36A 4YVSC 4P9GA 1RUJ1 3DXRA 2B8MA 4W50A 4LFAO 2GNBA 3ZO0B 5LBFA 1ODMA 3CCEV 3U07A 4Y20B 5FR3A 4E4EA 3T1HO 4DEVA 2ORZA 1SC5B 4DXWA 2E75B 1BBT1 3SYQA 5CA6A 2W52A 1OXCA 4MADA 1HB2A 4IIJB 4XTMA 3ZXLA 2IH3C 1ZLZA 4TYSA 2KB1A 3MZHA 1MG1A 3MIEA 5FPAA 4CU8A 1JXNA 5FP3A 1RUE2 4J6GA 4XJ8A 5EXOA 4DR5O 1PVC1 5D1IA 1H9WA 3D0SA 2ZNIA 1FOD2 4ISQA 3A8TA 5IJ0A 1OD3A 1KJLA 5I0DA 4WFAV 5IY5B 3OPWA 1ULGA 2W87A 3AYDA 4UFHA 2E6VA 4NWWA 4PLNA 1OCCC 1NT2B 4BIUA 2F4PA 4BQYA 1EYBA 3O1TA 2YXLA 5LA1A 1CAWB 5A6QA 3T4VA 1JOBA 3NQHA 3V64A 5JCTA 1EAH2 1JZ2A 3VZKA 3ORJA 4IUGA 3ZHRA 4XHBA 4COYA 2WINB 1J5EO 4X8AA 1YZBA 1IBLB 4HZFA 2CWMA 2ET1A 3R4DB 1QU0A 5C8CA 3CZUA 4QPWA 4K7JA 5C8YB 4CXWA 3H1KH 4YHHO 2VTXJ 2EILC 5FPOA 3BVOA 1SKVA 3N9MA 4HZ3A 2DUQA 3BFRA 2JKBA 5CKQA 1ZUQA 4QX8A 3CZJA 1YSCA 4W4KA 4YW5A 4JQTA 1N8RW 3B09A 3T0BA 1PM7A 4MXVA 4AG4A 1OHFA 3LZZA 4LMFA 1H1AA 4AQYO 2ZKNA 1DZTA 3IFXA 1S0JA 1ENVA 3B8NA 4DV5O 3CX5F 1W6PB 4D6RA 3D4KA 1EN4A 1GN3A 1RPRA 3DEMA 2X6BA 2XLFA 3ZDSA 4HMZA 4WBBA 1R1A1 1W6QB 3L9DA 2ZZJA 2B45X 2ZGLA 2IXKA 2EJ7A 3WCSA 1H4HA 2HFEC 4B7EA 1XYPA 2LJ2A 3L72H 4AL9A 5FO8B 1E5HA 4N53C 2IU3A 3X2QB 3AJYA 1AZDA 2ZT9B 1AYM3 1WCSA 2ZINA 3BB6A 3HNBM 1W2OA 1Z0HA 1I5XA 1C8M1 3ZHQA 4I3GA 5BV6A 2ZR2A 2RS51 2DTYA 2AYHA 3PLQA 4I02A 4NJ4A 4NRMA 4M4RA 4E4DX 4I50B 3JBG3 4X1YB 2J7MA 3B94A 2D6NA 2VG9A 3MLKA 4XETA 2YXHA 4Q4Y3 4Q26A 2VMFA 2Y69B 1VJ2A 2P6HA 3CL1A 2YU1A 4JI8B 1JX9A 2P5OA 2OTJV 4DV6O 4DR6O 3O0VA 1DZRA 5F7UA 4PDMA 4XF4A 5C8CB 1R6KA 2MPFA 4XBNA 4XDOA 3KCXA 1WAZA 1QY4A 1PK6A 3K04A 2W92A 1H2GA 4R8HA 3G80A 5I91A 4ZHQB 4UV8A 1EZVH 4DV1O 1F9KA 4A7YA 2VAUA 1QF3A 3ASIA 4K8ZA 3JXSA 2G4IA 5A2QN 4YGEA 2ZE7A 5F1RA 1LCLA 2P3KA 4IYIA 2XBO1 2HWC2 4JYAB 3CP1A 4P9IA 1QXRA 2PUSA 4X65O 1I08A 3HIFA 3ZXKA 1W9FA 1GTOA 2M7WA 1ZREA 3H1WA 2LUWA 5L7OC 1M5IA 3JARA 1QLNA 4E4ZA 1QNYA 3LKJA 4WV8A 4LBEC 3NJVA 4LBOA 3JATB 3THTA 4D6TH 2WS91 1E5RA 4QXBA 5LL6Y 3RYRA 3UT0A 2HHHO 1WZXA 4I2OA 2E33A 4HT1T 2JG9B 1QJU2 1QR8A 2SBAA 2WO2A 3AM2A 3PUHA 2R6QA 5A3NA 1QXPA 4QDRA 3ZMVA 1ENRA 1DYOA 2ZIOA 1DLBA 2X8KA 4H3WA 3FD9A 3HKBB 3SKJE 4AQSA 1AI7A 2ZE5A 1FFTB 2F4VB 4FM1A 3RI8A 4O7XA 3HJRA 2XL7A 1V70A 1WP7A 3WQ0A 2CV6A 3GALA 4RYDA 2BGPA 5T5JA 5K7PA 1ZBA2 5C4WB 4I4TB 3ZLIA 5ACA3 1HRI1 1RSOA 2ZCEA 1GZWB 2K1EA 4WFBV 1PK6B 2Y33A 2ZX2A 5B3SC 1SLIA 3NJYA 2HWD1 2XVLA 4LULA 1I6XA 3I7DA 2L9LA 2BCCH 1ZRIA 2VULA 4AGVA 5GJ6A 1BJQA 2WFPA 3ETQA 4QQOA 4HNAA 3WG7C 1GNHA 1F4MA 3E8GA 4C91A 2WL1A 1FXVA 1K7DA 3RMYA 3ZMZA 3ZN6A 1GOFA 4C1XA 2XUEA 5T3NA 4KU8A 4KMQA 1FFXB 1SQFA 1R3LC 2CYFA 3VUOA 1WA8A 5E1AC 4QPIA 3M70A 3ZPYA 4ZKIA 3VBOC 3B2EE 2AHZA 3J8F3 1TEIA 4WM8B 3RJRA 1RUH3 2Y6LA 5F2VO 1LEDA 3RSJA 4BH9A 5HI0A 1YJKA 1XYNA 4LEJA 2DCZA 1WW6A 3JUUA 2QM7A 1R091 3E1F1 2Q8CA 3U75A 4UFZA 4YVSB 1OD5A 4LIVA 3EVKA 3A21A 1C3HA 3POBA 4KBBA 2C9AA 1AI6A 2CTPA 3CCRV 2CUGA 1YRZA 3CJXA 3FX3A 2Y6HA 1GOGA 4D0QA 5A3TA 2ATFA 1IPSA 2B46X 2XLGA 3E8HA 1HNWO 1VQ8V 1YYNA 1WB8A 1JOJA 2ZMNA 3NL1A 5GLWA 3H1LH 4I55A 3WDWA 1ZA7A 3F7VC 2UUBB 2ZE6A 5KHHA 1BCCH 5I0RA 3BN6A 3C3VA 4NXNO 3VKOA 2BOCC 3VV1A 4NXMB 4LE3A 3OY8A 3RJ2X 2HJIA 4YG6A 4HG6B 2FMLA 4IHJA 4CCKA 1AR83 3J7MA 1GM9A 1PM9A 1XUQA 2BTVC 3RVZA 1DIWA 2GBOA 1YF2A 5LYJA 1H8TC 3W58A 4X1KB 4RR3A 3HN1A 1VBE2 3TXSA 1BL8A 3O1MA 1RUC1 1N1VA 2VOXA 2VCMA 1NLQA 4ES8A 1UFIA 1PGW2 4IV1A 2OX0A 5GTIZ 2RJKA 1RUI1 3N9PA 4CUGA 2OT7A 2Y0OA 3MIDA 4YW4A 4L11A 4YZ2A 3BRCA 4DR1O 2GNMA 4OQ8A 1UN1A 1DGSA 3PJYA 1XC6A 1X9PA 3AMNA 1BQ0A 2PF4E 3T1YB 1SCRA 3GCXA 1TME3 2A73B 3QVNA 3MYXA 3TGUH 3AJZA 3ML0A 2IWGB 2FB5A 1SA0A 2EILB 1KS5A 4FVMA 1XNBA 2DFBA 4DV4B 2WYSA 4MT8A 1T6BX 1EP0A 1DK1A 1VQ6V 4AEDA 2W95A 4UFMA 5JUVA 1AR93 1HB3A 2VWJA 2RE9A 1XNQO 3FLRA 5E8AA 4GLXA 1W8WA 3VHOA 5H9RA 5JXIA 4AVCA 2BSKB 2LRPA 2G9ZA 4MVUA 2VMCA 3MIGA 4B3SO 4PI2A 3MF9A 4B29A 4CU6A 4F3JA 3CJHA 1PGSA 1VAMA 1DFQA 1YQ2A 3ZFEA 4I55B 4F83A 2WO3A 1X9TA 2LW7A 4X8NA 2B9ZA 2F95B 1ULFA 1AHSA 4X20B 4QQ2A 2W6IG 4Q20A 1FXZA 2QQLA 3PMSA 3QTCA 1MPXA 1NX9A 4D7SA 4N53B 4CSWA 3T4ZA 1F31A 2J1VA 2IJKA 1UYPA 4C0BA 1G9DA 3OUIA 4J11A 1M9NA 3C7OA 4PIXA 2Y6GA 1BE3H 5LMNO 1VBA2 4LKDA 2CGPA 1PZ9A 2XJVA 3POGA 1EV13 4FLZA 2ZCWA 3OW2U 3HOBA 3WINE 1KD1W 2Z5WA 4M3CF 1BLZA 5CKNA 3K46A 1WLTA 4XF1A 1PNFA 3HNMA 1M4WA 4DUXA 2HWE1 1JN2P 2JE8A 2JDPA 3WQBA 1HNZB 2WIIB 1QJY1 2YEVB 2AR6A 1O8SA 4KGGA 3DYMA 4J1WA 2OQ7A 1FMD2 1O3TA 4C8DA 4UV9A 4PF5A 2UUCB 2KG7A 1RUE3 2VO5A 3DC5A 3LDDA 4GYCB 5CFDA 4A41A 3OEBA 3B9IA 4DR2O 1KXGA 1VMFA 3ASNC 4XZUG 1QBZA 4MVTA 1FOD3 3SR2C 3BEHA 1MS4A 1D0HA 4KNCA 3TEXA 4BJ0A 1N3PA 4LBNA 3OMNB 4F6RB 2VCAA 4QQLA 2QWOB 2ODMA 4XMAA 3E22A 1RUF1 2QEXV 5GONA 3CMGA 4HBNA 1F23A 1HQNA 1XNCA 4MS2A 5L7OB 4FPPA 4F6EA 3CCLV 1S5JA 5LA6B 1K97A 4FXGB 1CX1A 1EAH3 4JYYA 4CDXC 3OMIB 1SQ4A 1YI9A 1XL4A 4QGMA 2QKAA 1V9U2 3RYCB 1AX0A 1BGYH 1CAXA 1G6NA 5K1XA 3WF2A 4IDZA 2HR3A 2D3OW 1DYPA 4Q6GA 3WDVA 2CDYA 2LFRA 2E9QA 2QQPA 2ENRA 1GKFA 1AP6A 3VHPA 1NJIW 3BY6A 3DV8A 4QDQA 3CHXA 4XE9A 1H8EG 2QQOA 1AXKA 1XNKA 4H14A 2CK3G 1WA6X 1UOJA 2W1SA 1HKDA 2H3OA 2NQYA 2R30A 3GB7C 4U3JA 3QOPA 3CSXA 2IXJA 1NTMH 4GMP0 5IVJA 1VRH1 1IG0A 2IXLA 5D5PA 4NIHA 4FFBB 4LQRA 5EIBC 1PMIA 4CPBD 2UYBA 2W68A 2QTOA 3JD1A 1S0IA 4RFT0 4UCTA 3WG7B 3WXPA 3RVYA 3RRDA 4E9KA 3A0BZ 5FV3A 2ZEWA 4PLOA 2X09A 3ZN5A 2CHHA 1W04A 1BVVA 2W39A 4ZPIA 2PQQA 4ZY9A 3T2TA 4GX2A 1GK9A 3DTUB 3BPZA 2BOBC 5CFCC 2XTAA 5KC6A 2ZKOA 2Q0OC 5FL7G 4URAA 5FJKA 3T3YA 1S0CA 2EX3A 4X1IB 3ZRWA 2WT0A 3VBOB 3R66A 1KDKA 4OMCA 1UU6A 5EK0A 5KR7A 3ALQA 1R1BA 4R9DA 5H6QA 2QFEA 1MSDA 2P34A 5FPLA 4LORA 3LDCA 5GW7A 4UF0B 1T2XA 1PNMA 3WUDA 4UCOA 1K3EA 1XE8A 3AMMA 3D6EA 1AX1A 1IBMO 5HCHA 1SZTA 2VOKA 2VQFB 3ATGA 3BHPA 5A33A 4A44A 1Q7YW 2QQJA 3E6BA 3N4MA 3GBFA 2ATKC 3RZKA 4GT1A 3EHBB 4MHUA 3KT7A 2WR9A 4OPHA 2Q7EA 4YGCA 1VEWA 2RN9A 2HWC3 4RS5A 3JD0A 4P9PA 3D3IA 1AYM1 1BSMA 2EA7A 1QQCA 2OYZA 1EBOA 2ZM6O 2WSUA 4GZRB 4BW9A 1NCQC 4M3CA 3UT5B 2Y60A 2Q68A 4ISRA 5KA5A 1F4AA 3AVRA 3NMBA 1GRJA 2YB7A 5FUNA 1BKZA 1PNLA 1R64A 4Q4Y1 1CVNA 2GP5A 2E26A 4GJYA 1PL0A 1CN1A 2XNDG 3MIBA 5A7NA 1HWYA 1XOYA 1QJU3 1GH6A 1K12A 1LJ7A 3AK1A 2VZ1A 4Q1RA 1EM1A 1H8TB 3O9OA 1VLNA 3ZDVA 4EN8B 3AL5A 2E5LO 3V0BA 3U78A 1RGSA 1AR4A 3Q8FA 4YG0A 3WHUA 2AZ5A 4NHXA 1I7FA 4BOWA 1QHDA 4AAXA 1BZWA 4HLTA 3CRQA 4LBMA 2CTQA 1HNXB 3AKRA 3LEIA 4EWDA 2VZVA 4X62B 1ZBA3 5BYNA 3IGAC 4A7KA 2A7WA 4B3MO 1W9SA 4JI0B 4JI6B 2WAOA 3CC7V 2Q8DA 2QQKA 2XAHA 3SJCC 5KHIA 1R082 4AQ2A 2WNVA 1K42A 3D0JA 5FBZA 3SITA 2C24A 1QQP2 3CRMA 2GNTA 1DGWA 2ZX3A 4JV5B 4O4JA 4PDWC 2D5HA 4YIPA 2CTWA 4QHZA 4LITA 3VBUC 4XQDA 5H6RA 3OFNG 4K20A 3V0AB 2VH9A 1W0NA 1VF6C 2HYKA 3I59B 2QJ1A 4R6ZA 4FFFA 3P1IA 3SMHA 4HETA 3LPGA 3AZVA 5LY2A 5IJ9A 2DCYA 4W8JA 3VZJA 4RGKA 3IBMA 2RS32 3FJSA 2UXBO 1DLCA 3HBKA 1MMMA 2WJSA 4UCRA 1SLAA 1FPN2 1W8UA 5EPAA 3WNLA 2Y48A 1B35C 5C7GA 4WFGA 4O2BA 1UL9A 5JI7A 2O57A 5ACA1 4KWUA 4WVMB 3VZNA 3ZXFA 4LKEA 4JGZA 3RMXA 4PA9A 1BEV1 5FZAA 1JFFB 4RUFA 4OZOA 3AKPA 2DQ3A 4YY3O 3I2JA 3HKCB 4YLZA 3DN7A 4O4IA 1NQTA 1UY2A 2ZGRA 5FFOC 2P22C 2E74B 1RITA 2DJVA 4XFHA 2VVDA 1WW4A 2CGOA 4JDMA 5JDBA 2WBKA 2XG3A 1YI7A 1RXGA 4LKSA 2OZ6A 4R9CA 1X50A 1TA8A 1S3JA 2XUMA 5BNPC 3WZ1A 5FYMA 3IWZA 2YG0A 3LF7A 3SISA 4DR4O 4B3TO 2QKDA 1VRBA 3NAPC 2RJZA 3KCCA 1PX3A 4BW5A 1PGL1 3WG1A 5IATA 4H44B 1QNWA 3LEMA 1U5XA 2UWAA 3BOPA 3ASNB 4JI4B 1US3A 2PYJA 1RUNA 3J8F1 5FLJA 1RUH1 3OF1A 5HCAA 2QZ3A 1W03A 1JODA 5A7WA 1VBE3 1ODNA 2G9GA 2Q1FA 2HJDA 1N33B 2LTNA 2X5IA 2DDUA 3IAQA 4XUTA 2Q69A 1QJFA 2XQXA 5BY1A 1D2QA 3IAPA 4RFRB 1QVFU 3OJBA 3UNPA 2BOIA 4DB5A 1SG3A 4H13B 4CDXB 3WQ7A 3NO8A 1CIYA 4RAIA 5DAVA 3LNNA 3EO6A 3E86A 1V6LA 5A32A 1NCRC 4UFLA 4AQ6A 3FYEB 1YJWV 2BGOA 1LUWA 5KUKA 4BQWA 3WF1A 2XAJA 3M3OA 3FZ3A 3LSEA 3I2DA 1A8DA 1UOGA 4YVWC 3O1RA 3OEHG 2KM2A 1HQLA 3I2OA 1E79G 1DGRN 2DVDA 4QNHB 2ZAHA 4PCRA 1ZZ7A 2GTSA 2JJ6A 4ZOLB 4IT5A 2C9KA 3TAYA 1UPSA 3JASB 3VHNA 4DK1A 4DV0B 1OKQA 3FHAA 4OULA 5FZOB 3GHMA 1YHQV 1L3JA 4OLLA 2DVGA 5A7OA 4IGGA 1LGBA 3ETDA 4PDRA 2UXCO 4P9XA 1RVF1 1WD4A 1Q43A 3JCUZ 5FZHA 1VBA3 3M1HA 2VRZA 3SPIA 4M00A 2DYCA 1OOPA 5T54A 5SV5A 4QX3A 5BNNC 1JZ6A 3MDPA 1UOBA 4LUMA 3BGAA 4W6WA 4E8CA 3HAGA 3POEA 4IE5A 5BR8B 4AFDA 1DQ1A 5CFCB 2Q4PA 3D36A 2XQRA 1F8VA 2Y4UA 5C5TA 1OVPA 1US6A 4AFCA 5B5EZ 1XU2A 4IV3C 1H4GA 3W59A 4A5UB 4DMIA 3SKVA 3H3UA 2AH2A 1W59A 2YU2A 2XDVA 4XPVA 1OLQA 2EZOA 1W3VA 5BUVA 5A32B 2GTAA 4TSVA 3WG4A 1JS9A 2D6PA 4MVZA 4OPAA 3Q4HA 1FMD3 2XKOA 4OX9O 3PVBB 4BXFA 1W2AX 4IEVA 1W2NA 2BNOA 1H6XA 4XDKA 1J58A 4CDUC 5A6ZA 5KXEA 4DR5B 4IEQA 2RR12 4K8XA 1WGPA 4IE0A 1ASJ2 2WSVA 1QDOA 4IE6A 3EYPA 2Z2SB 2PELA 2WNEA 1YCIA 2PHXA 3TN91 3AK2A 1NG0A 2FHRA 3JSNA 3DGEA 3LEGA 4CXYA 3U0ZA 4QAWA 1NCQB 1G4YB 5DDJ2 4TLFA 3VBRC 2IVIB 4CDQC 1NOVA 1EUUA 2R062 2IH1C 2YBKA 4NIDA 3MD0A 1J84A 2A6XA 3RZHA 3RYPA 3ZHVA 2WLLA 3PUAA 2JICA 4JI1B 3THDA 5JMOA 2PQSA 2WPDG 3CWBH 1J5EB 5FMCA 5BXZA 2KR2A 1KKDA 4D3WA 1K5MC 1V9U3 3PJSK 4TUYB 4JI5O 4GWJA 1O3SA 2OIIA 2ZABA 4KXRA 4DUZB 4MW8A 2W5FA 5HXVA 1QH7A 5JXGA 3WSOA 2WN3A 3FB8C 2ARBA 2LO1A 4TZDA 3C2UA 4FLTA 4NWVA 4UYBA 3FMGA 4UXNA 2QUOA 4OHVA 1XEQA 4XUPA 5GLTA 2QQNA 4JI7B 3BI3A 3WLUA 3AG1C 1X8EA 5F9TA 5L9BA 1YI2V 4Q4V1 1DYKA 3P32A 1FOD1 4U7OA 2IJIA 2J1EA 3ETEA 3K9AA 4TQFA 3QO7A 2Q1ZB 3TEYA 4NROA 4NB5A 3RYFA 5CADA 3NV4A 2DUOA 5HFLA 1GANA 2Q8OA 4NHMA 1LODA 1RYYA 4UW4A 3KQ4B 3FB6C 2BGCA 5FUIA 3ME2A 4UW6A 4XDLA 5KLVH 1EAH1 4PDWB 4NVPA 3FAVA 3VBUB 5IHRA 1EZJA 4COZA 4XVHA 4CP0A 1IURA 3O12A 1RINA 3HEIA 5F2SA 4DY5A 2JECA 4CZZA 3EJKA 4LIUA 2WAAA 3OD4A 4LBKA 1POV0 1VQ7V 1RUG2 1WCUA 3J81N 3CXCU 2ZGQA 4JTOA 5J48A 2GHYA 3SEPA 4R4ZA 1UIJA 5JIUA 3MFCA 3RYIA 4DV6B 1HRV1 3HQXA 5L3EA 1B35B 1XXNA 4FT8A 4GZ9A 4WZFA 3ACLA 1B09A 1MQTC 1MEC1 4L87A 1PMHX 5IVEA 4BWOA 5C9AC 2JGUA 4D7TA 1FD9A 4DV2O 3GWKC 1CZTA 3MW4A 3ABUA 4J10A 2J1AA 1N32B 3D5OA 2DYSC 3U1XA 3WNKA 2NM1A 3AG4C 2ZTNA 4ZIBA 1KS4A 2DYRC 3VBHC 3ZHTA 4KGQA 1FXKC 5FZFA 2Q8EA 2PLV1 4A4AA 2JGDB 2EIBA 2R0HA 3MUZ1 4GMP1 3ZSJA 3HKEA 4E8DA 1Q86W 5BNPB 2FDFA 3KCYA 1WUVA 3RDIA 4AILC 5H5NA 2WWUA 4CDWA 1PZ7A 4A2UA 3VL8A 5JR7B 1GAXA 3NAPB 4Z2AA 2B1GA 1ULOA 4XQWA 3LE0A 3SDLA 1BHBA 2H0BA 3CXHF 4TOIA 1EPZA 1SPPA 3CJIA 3PURA 3FLPA 1IG3A 2ARXA 3E8FA 4DRRA 2EJRA 2YFZA 4ONUA 3UGGA 2RM22 3VQWA 1CPMA 3WQ1A 1ND3A 2RMU1 1ND2A 4X66O 5J2TB 3NV1A 2DE0X 3WDTA 5JH7A 3KB5A 4BMEA 3LFIA 2E53A 5K0UC 1YDXA 1NLRA 3CKHA 1Q8IA 5BMVB 1GP4A 2FZ1A 1J3PA 1QCEA 3RYIB 4HKWA 5FYSA 1AR62 4FPCA 4WZCA 1KEXA 4LWSA 4O2AB 1AR1B 1RL3A 3S6PA 4AEKA 1NCRB 1GFF2 2PHLA 4YW6A 1JZ8A 4ITCA 5BZBA 1R083 3WP3A 2D3RA 3ZYJB 2GALA 2VCCA 5JZGC 2XAGA 3VBBA 2VVFA 3STLC 1HR0O 1GQGA 3NNGA 1D2SA 1QQP3 4LO7A 4XMIA 4I7ZB 4YVWB 1F2NA 4GKKB 4P9LA 3ZYHA 2BV4A 3B3QE 2GSYA 4X64O 1QJU1 3SPHA 1O7FA 2OQ6A 4GXLA 5C6CA 3THPA 1LOFA 3EXAA 4BYYA 5HCFA 4XIOA 2FMDA 3JAMN 5A3OA 5JR2A 2G38A 2EIKB 2A6VA 3NJZA 3LOBA 3W7TA 2RS33 3CO2A 1Q3EA 2QJVA 2QZ2A 4CDWB 4CS3A 4BA6A 1HB4A 4EN6B 2WLIB 1FPN3 3TEWA 2ZIMA 5C3RA 3G67A 1DGRA 1UMZA 1GZ9A 1JZ4A 4FJCC 1PZ8A 4LLFA 1N47A 5CBFA 3Q8EA 1BQZA 1OH4A 5BNNB 1GWLA 2VUJA 5EV7A 3HB3B 2AACA 4ZBMA 1ND2B 2QTSA 3WG2A 3LWCA 5DUWA 1TG7A 1Z7S2 4O65A 4LO8A 3S30A 5A3PA 1H30A 4DO2A 4XFIA 5A3WA 4FPOB 1VAKA 1VAVA 2Y26A 1UPGA 4IV3B 3WG3A 1CZVA 4YYOA 5FYBA 1YC61 2VGDA 2VUDA 5FZ8A 2R1BA 2YC2A 2QWNB 3TNPB 1OCRC 2KXLA 4JKLA 5FK7A 4AFMA 2P4KA 3RYHA 1PO21 2QDOA 1AR72 2GN7A 3MIHA 2W9XA 5APAA 1DHKB 4XAEA 2FDJA 3E6CC 4CDUB 1GWMA 1IPJA 4S2DA 5A70A 1RHI2 3IPVB 1WCKA 1B04A 2A6WA 3HT1A 3IKWA 5M0TA 4HPKB 2YYOA 2I45A 3M3QA 1UJWB 1LGCA 1O5LA 2R72A 3SGIA 1OLME 5IDJA 1C5HA 2XVGA 4YRDA 1V9PA 5AC92 1OSGA 3O1OA 4CDQB 2CNAA 4AF9A 4DUYB 3UO3A 2WNUA 1S77D 3AZWA 4XURA 1SQPH 4LNUB 3VLBB 2D98A 3STZC 3KKYA 2EXHA 4Q0SA 5BNOC 3WB1A 4Z82A 3U37A 4B08A 3RWRD 1BMV1 4X9QA 1K5MB 5FPXA 2DTWA 4FFHA 2UURA 1NY71 2MW2B 2VD7A 4LUKA 1NR1A 4H7LA 3ZM8A 1S2KA 2IU0A 4DOUA 1IS5A 1OI6A 3CF6E 1LGNA 1UKRA 3SJQC 3LA2A 2ADPA 3FYIB 5CAZA 4YM2A 5GZGA 2NN8A 3BIEA 3AG1B 1ALYA 4C1WA 4OUEA 1AJNA 4RD7A 1MA1A 1OV9A 1AJOA 1RUD1 5K4LA 3CCVV 1PMJX 5JVVA 5KWRA 1ZZBA 4EB6B 1M4UA 4LF7O 1J59A 1C28A 3IZOA 1QLEB 2VW0A 1RUOA 3EXUA 1PL4A 2JIZG 3D82A 1NA1B 4R4XA 4XDQA 1YTFD 4LF5O 2P6JA 4QPKA 4LK7A 4Y24A 5LOVB 2A5ZA 4CP2A 4QDSA 2XOMA 1YFWA 3TNQA 2Z4FA 2JWPA 2AGSA 2NMOA 4D6QA 5J2UA 4D8MA 3VKNA 4IEYA 4CEWC 2A6ZA 1V54C 4XJAA 1W6OB 1XNAA 3KG2A 1PKXA 3AKTA 2F4LA 1OF3A 5C5UA 2ET7A 4GD4A 4WM7A 3VD7A 2OZJA 4RQPA 1ZZ9A 3HVDA 4LBQB 3OB8A 3LQCA 1CAUB 3S0MA 4PQ9A 3AMHA 1VQ9V 1Y74B 3RFRA 1GP5A 5FXZA 5KHKA 3I3DA 2B9UA 4IESA 4Q4X1 2AZ2A 1MQTB 2RG4A 5FO7B 4TWTA 1K9MW 1W39A 1VBB2 3SNMA 4CCCA 1AYN1 3CCSV 2HKOA 2LGWA 4P9JA 1ONAA 3ABKC 1A6CA 5J36A 3DUIA 5FNVB 4LF8O 3N7MA 2RR13 2XHKA 1ASJ3 3AG4B 4JVAA 1MZEA 3Q8BA 3JD2A 2GNDA 2A3YA 2DYRB 3VBHB 1S5HC 3BODA 4NAOA 2FMYA 2RMKB 5D8AC 1FXKB 2WFF2 4IXLA 2W1UA 2W3JA 4XZPA 4TV9A 2JB4A 4J9ZB 4CH6A 1K5QA 4BK4A 5DDJ3 1OPMA 1HDKA 4MGSA 3DYOA 2R063 5CZKA 4FOWA 2D2CB 1UY3A 1GICA 3SYAA 1I1EA 1MABG 4YJ3A 1RUJ2 1M06G 3A2FA 1MNGA 4DV3B 3RT3C 1S0BA 3WEZA 5AG2A 3ZBHA 4CCJA 3EFFK 3L71H 1XI1A 1XOUA 1X7NA 1I0HA 3DL3A 1I5YA 1IQDC 3K59A 5KHJA 5IK4A 3JD3A 1UYYA 2ZGUA 4B3RO 3OGRA 2ZJCA 3T1CA 1LRHA 2YBPA 3PU3A 4LF9B 2WDBA 4LHLA 4UVCA 3L2YA 3AKSA 3MI8A 1NVPB 3I2HA 3WNXA 1LR1A 5FRAA 2BW8A 5IY5C 3CMEV 1KP3A 2VUCA 5FXXA 2YS8A 1PD3A 4AAPA 2C4XA 3M3IA 4FOQA 2K2SA 4JYCA 4UAPA 5K0UB 3ICXA 2ZA9A 2VW2A 1YFXA 3O65A 3VBSC 1R6TA 1MSWD 3ZRSA 4JI3O 2DCJA 2ARHA 1I94O 2Y4TA 3E83A 1C8NA 2DQ0A 1FKAO 1PO11 3K5LA 1XMQO 2QKCA 4HONA 1R3IC 4GH4C 3H01A 5FYVA 4EE2A 2ZHLA 3P6BA 5EIBD 3BVCA 5EZYA 3NR7A 5IVBA 1NTKH 4MXWB 3HD8B 1K33A 1IBKB 3K5NA 1S0EA 4IGPA 3U4SA 5IK7A 1GN6A 3KLSA 1VARA 1P7BA 4P14A 2QBXA 3ZIAG 4LO6B 3JD4A 3ECQA 4LPLA 4DR7B 3ZYPA 2E76B 1D0GA 3PIJA 2GAUA 4QMAA 1RUG3 3H8XA 2FKXA 3Q8CA 2ZGTA 2UWCA 1L0LH 4Y22B 3RN4A 2FZ2A 3N2KA 5IVFA 1AX2A 4KWKA 4Z8BA 3J7LA 3RVHA 3UKTA 2WAMA 1K92A 2JS5A 5A1AA 1ORQC 1C57A 2F43G 3CC2V 3MHSC 5IWAB 1H2MA 4TV8B 2WLKA 2R071 3I2IA 2IM9A 2RDQA 4RUEA 1VIWB 5L3BA 2F93B 4Z07A 4V2VA 3VQVA 3K5MA 1LHNA 3PHMA 4DV7B 2A0LA 1IBLO 1VE0A 1C8M2 2V5DA 1NH2D 1OCRB 2P3JA 2RS52 5F3EA 1WCQA 3RYKA 3CPWU 1YXWA 4MW3A 4ABMA 1WMEA 2JDMA 3ROUA 3VHRA 1ENQA 5CB4A 3FB7C 5C8CC 1LULA 2NNUA 1YXBA 2E32A 2ZXWC 1LHVA 4QPJA 4AHYA 4WF9V 1LOEA 4XFFA 4KWJA 4AGRA 2D7FA 1BVP1 1I3HA 3KWVA 4I0XB 1J1LA 2OYQA 4BLJA 5IK8A 1UIKA 3K79A 4COWA 2XB6C 3LCPA 3K9SA 1BYHA 3A0NA 3RS6A 4PA6A 2RM23 4EYUA 1LB2A 1MS8A 5IYZB 1CJDA 3J7NA 4TT3G 2QNKA 4AVBA 2VCBA 5CA1A 1XNRB 2HWB2 2WT2A 4QE7A 2BFUS 4O4LB 4OHWA 3NNLA 3CEIA 5AFEA 1U96A 3B40A 4XF3A 1QOOA 1SF9A 1V6KA 1JUHA 3GJAA 3HPLC 3UM7A 4LHNA 1AR63 1UY4A 5JVDB 3HWJA 1TVKB 2X6AA 2Q5ZA 2ADQB 4DNYA 1SFPA 2JG9C 1JJ2U 1UCXA 2AEYA 1JU3A 4S2HA 1W8TA 3BA8A 4ARYA 1F4HA 5FUPA 4QIWF 4EJRA 1DGLA 3ABTA 1D2DA 2WS92 1KDMA 1UAIA 3MDSA 3K57A 4Y1UA 2D5FA 4JI8O 4BK5A 3JD72 3AC0A 4UBHA 4N7IA 4CVUA 1J3RA 3DPRA 5TISZ 1EY2A 4XF0A 1N0NA 1OQ1A 3UYJA 5JQGA 3I55V 4LO5B 3ILFA 3CCMV 4KG8A 1IXMA 1AP5A 1PK6C 1D5NA 3T2PA 1V6JA 4R7CA 5FQ0B 2FDHA 2VZUA 3RQ0A 3W5MA 4WVVA 4P02B 3LAGA 2X10A 2O14A 3F5TA 4LOTA 3NKTA 1KQSU 3OPZA 4ZXEA 4DEQA 4Q0PA 1Q8PA 4JYAO 3LDBA 3R6SA 5K8SA 5IYBO 3O7OA 2DVAA 1HRI2 1GZCA 3OMAB 2NMNA 2FQPA 5FP8A 4JCKA 4CEWB 1MACA 1V54B 3SC7X 5LRSA 3LB9A 1UZVA 1ZSPA 2XAQA 2HWF1 4RWUA 1Z7S3 4RQFA 1AR5A 4OUMA 2BRTA 1JW6A 2LALA 3USUA 1GKBA 5CU1A 2A1XA 4BLIA 2QWQB 3KF5A 1A8MA 5FY5A 2XAFA 1W6NA 1Q5OA 1CWPA 2EINC 1FATA 5LHIA 3WB2A 5LBQA 2XJQA 4A3XA 4Z2WA 2XR4A 4D69A 1EN5A 1R6NA 2JVDA 3K77A 1AB3A 1MOFA 4E4HA 4EN9B 3SHRA 1AR73 3OEAA 2YPDA 1K4DC 1UWWA 4YNIA 3POYA 3ABKB 2BP6A 1AJQA 4Q8LA 1NE6A 3ZFGA 2HBTA 2F4VO 4LR3A 3W7SA 3AP9A 2YIAA 5LRRA 3ZKUA 3RGBA 1RHI3 4M0NA 1JOPA 4OCTA 4QQPA 4C0HA 1KP2A 3W7UA 1YQ6A 5D8AB 4NHYA 1W2UA 4NRQA 2OIEA 3DPRB 2CTRA 2QVSB 5IUQA 4K3AA 5AC93 5DUVA 5F5CA 2PTMA 4DRXB 4FLWA 5D2AA 1N1SA 5B1BB 4X8PA 5FZ6A 1J83A 1TUEB 3JAKA 3O1PA 3K4DA 5IE9A 4GKXA 1LHOA 1ENSA 3VOUA 2RJLA 4EZ4A 1JH5A 2YI9A 3GBGA 5F5AA 1URFA 4WBNB 3BIWE 3DYPA 4MSWC 2JEMA 2RV9A 4E2SA 3R4SA 4ICGA 1NUKA 1POV3 4FPFA 5B1AB 4YW7A 2ZACA 4CE8A 1PV0A 1UD1A 3FUOA 4RHV2 5T5OA 3ZIXA 3HNYM 2OS2A 2V5YA 5ERLA 1YEWA 3LGRA 5JOWA 1GM8A 4Y26A 3USUB 3U14A 1PP9H 3GXUA 3VBSB 1VBC1 5CA0B 2IUWA 3WOGA 3L74H 4B1LA 2EALA 2NP0A 1W6NB 4QPIC 4ZI7A 4RQEA 4WFEA 4ZONA 4MV2A 5KXBA 1UO9A 5C3OA 4CU7A 5KMGB 4LF4B 1KBHA 3QH6A 3MICA 4AGGA 4X6QB 5A1LA 4GH4B 1YQ5A 4FPJA 1RUC2 1N1TA 3IAYA 4IEWA 1ZBE1 3ZFGB 4Z1MG 1WCDJ 3G4SV 4YM0A 2JD4A 1RUI2 3MV11 3O0WA 2WABA 3OUFA 5GLZA 3DXRB 5GZDA 1YVWA 4CH4A 3R0RA 4J7JA 2BTQA 5DZFA 1R1ZA 3IJ4A 4HK8A 3OTOB 4UW5A 3JB8A 5FPVA 4XFCA 5FLXN 1O3RA 1H2SB 1H8HG 4JI2B 3GM8A 3SLIA 3RZLA 1LAJA 1W8HA 2D6OX 1Q81W 2JEUA 2QSAA 3CEWA 3BYWA 4NXMO 3ZHSA 1JI6A 4JGYA 2IBZH 2D6LX 1W2BU 1M1KW 4RGAA 4LF6B 1L7QA 2KA3A 3RWKX 3S5QA 2VZTA 1VBB3 3MAQA 3GZUC 2GMEA 1Y76A 1XPWA 4Y1YA 4GJZA 1KJRA 5IJ0B 3M4FA 1CAVA 1ST8A 4RR3C 3T09A 5DG1A 4OGQB 5A6YA 5E16A 2DU0A 2QR4A 3X29B 1ROPA 2JDZA 4QX2A 4AR2A 5T5PA 1HXS1 3ZN4A 2DV9A 4BXSV 4JTAB 1UNBA 4IV1C 2WFF3 3E6DA 5JCOC 2Y8KA 2JB8A 4QU2A 2E63A 3VBRA 2CY6A 4NR1A 2D6KA 2VBBA 3ZMTA 4HL0A 5L3DA 4MGQA 2JKXA 5F8PA 4AOCA 1Y6XA 3T1YO 4YW1A 3ETPA 1M56B 3LOIA 3BOWA 2ZXWB 2AXTZ 3UJQA 3WY6A 1RUJ3 2A75A 4H7MA 1VQKV 4DV4O 2F23A 3LD8A 5FPZA 3O14A 3DXTA 4JI5B 2HWE2 4A45A 4D94A 3JALA 4AEDC 4ZS3A 3AXEA 3N9QA 3OBTA 5FYHA 1L1FA 5JSPA 3VQYA 1QJY2 4QM8A 3D3AA 3HPNA 2JG8A 1MZ6A 1YJNV 1DQ5A 3GWOA 2VE1A 3DSQA 4AW7A 2W08A 1GR3A 1GBGA 1FV2A 4AFAA 2VL4A 2C6SA 1TVGA 1MS5A 2BWCA 3ZFEC 2QWRB 1ASJ1 3W20A 4BMBA 3SJBC 2FCTA 3ZMUA 3BTXA 2ZDIA 2X7RB 4NIAA 3HBZA 1K73W 2QDRA 5DAXA 1AJKA 1RUF2 1SFYA 2R061 5FJHA 2WC2A 4YJ2A 2WSSG 2PGGA 4OHZA 4YZ1A 1EFRG 1R3JC 1XNTA 2FBEA 2IXCA 4QB6A 2Z69A 3SPCA 3ZYIB 3H42B 3H7YA 4FSJA 4KL1A 5C3PA 3ZFFA 2IXHA 2QCSB 1AL21 1IQAA 2ITDC 2WWSA 3WP4A 3I3MA 1HNZO 4CC6A 1IX9A 5KX5A 2QE7G 1JYIA 1N34B 4XJZA 2JIGA 2YIBD 2VQEB 5JSOA 5FYTA 4CH5A 4Q27A 1H8VA 2O1QA 4GUNA 1W3XA 2QE3A 4GWIA 5BY5A 2HEPA 1OFSA 4QGNA 1RM1C 3H1JH 4QGPA 2UUCO 3VB9A 1UQXA 1E1QG 3B4SA 2WZR2 1F5JA 3M3EA 5C9AA 5CFDC 4E27A 2JDIG 5FO9B 4QPGA 2FD8A 2ZEYA 4QM9A 1FNYA 3U10A 3WR0A 1XSRA 2GN3A 3LSUA 1NKGA 1VRH2 4BWAA 1ENXA 1F5FA 4LO4B 5F6KA 5ANQA 1FAFA 3T2MA 4NYKA 2YMZA 4IL6Z 3JARB 4YG3A 5C93A 3KV6A 3N27A 2EINB 1S0DA 3LSQA 1C8M3 2Y6FA 2RS53 1WWYA 1KITA 4Y1VA 3OOXA 5FZMA 1BK0A 3FX7A 3SYOA 2IFWA 3AZZA 3I49A 1O4TA 3HKDA 1RUG1 3TYJA 2Y6KA 4JTDB 1VMJA 4N21A 3K3OA 1DZQA 5E88A 2BWAA 3KV9A 4AHWA 4XQ4A 3AB0A 3MHZA 4G9SB 3L73H 2OPWA 3OGGA 2ZR3A 2WN2A 1NVPD 4HVOA 2XXZA 4XACA 2W0XA 4JASA 4AVSA 3JZVA 2H0VA 5JI9A 4UFJA 4M3CE 3C7EA 2HWB3 1RSOB 2HJFC 5DZGA 1BMFG 2IVJA 5JJJB 1KD7A 4JZRA 4YW3A 2VWKA 3AZXA 3GBWA 5A7PA 4UCSA 3SQOA 2LW8A 1UXZA 2XMLA 2GUZA 1LU2A 4K40A 3MPPG 4HANA 4HNAB 3DGTA 2VNOA 1NZ6A 3BPSA 4KI5M 4NPRA 5D21A 2ZGKA 3B69A 4OYUA 4BAYA 2R042 3ZN6B 3WU2Z 3VZMA 2W2IA 4DS0A 4GQ7A 2ARCA 2P3YA 4C7UA 2O0OA 4OVEA 4QE9A 4DINB 2VTFA 2C5DA 2WS93 1WA8B 3ZCCA 4QPIB 3JD73 2JDAA 1SZXA 1F4NA 5FP4A 2PHRA 1W6MA 1KECA 3ETGA 5LHGA 2UXDO 5J3UA 3VBFA 3KM5A 3K3WA 3WVJA 5FZGA 2GH2A 4RGGA 3N3HA 3TCUA 4MG2A 3QG5A 4NMIA 1W28A 4K0KB 2PAMA 3WW2A 3TBDA 3ZN0A 1OBNA 2VQFO 5EYXA 2OKXA 1REEA 4O4HA 1VMGA 1GM7A 3PDQA 1DP0A 3W7XA 3A0HZ 4PQQA 4BB3A 5JOXA 1O9HA 1AR61 4RL7A 1Y7BA 1RC6A 3HQUA 2KKWA 3UCSC 3PIGA 2EIDA 4RS5C 1HRI3 3NNJA 2ZMLA 2X0LA 2A9HA 3JAWA 4FPYA 5EYPA 3H1IH 4AI0A 2VQAA 3KGZA 1PNKA 4J42A 3C3SA 5LY1A 1AVBA 3POFA 2ZX1A 4MVSA 4Z92B 3N2GA 3H50A 1G8WA 3OY8B 1YIPA 4IHJB 3M3CA 2DWEC 1XE0A 2BBVA 1DQ6A 3QD6A 4ATFA 4JX0A 4JZ2A 5LYJB 1ZZ8A 3NV3A 4RR3B 1ZWIC 1WNSA 2X29A 4XOGA 2AEZA 1JMKC 5CA3A 2P37A 1NXMA 1VQMV 5FXWA 2RQ6A 2VNVA 1LEMA 5J37A 3CU7A 3QCWA 2CE4A 3S7IA 1AI4A 1ZAUA 5FIXA 3LFMA 3EHKA 2DVFA 2DMXA 2MEV1 1Y3TA 4LH6A 3LUTB 1ZL8A 1RJ8A 3SEEA 4IV1B 4UB8Z 1HNXO 2LW1A 3FB5C 4X62O 3URFA 4PDVA 1W9YA 1W0KG 1H38A 1RIRA 1S0FA 4FPEA 1LOGA 1OA3A 2OCCC 4JI0O 4CEYA 3I3QA 3IM0A 1BEV2 4GKJB 5I0TA 2R0FA 1SA0B 4AWDA 1TNRA 4YM3A 5JJNB 2WNVC 3I2GA 3KZIZ 3L2HA 2JRIA 4JV5O 2DOSA 1TMF2 4AEDB 5DPNA 3C8XA 3K48A 3B93A 2WLPA 5FCCA 2I07B 4RO2A 2PHDA 2RDSA 2K46A 3AG2C 4RHV3 1WMXA 1AR71 1ZYBA 3R65A 3NRUA 2VS0A 1DQ4A 2DUPA 3TJTA 1OH3A 3CJHB 1CX4A 3TB0A 4CYDA 3PN1A 3PTYA 1SCSA 3H3LA 3ZFEB 3UQ8A 2FDGA 1RHI1 1NT0A 3B02A 5CN0A 1HV0A 4L8JA 4GULA 5LGNA 2JE7A 4KBZA 4J41A 2ADDA 3N2GB 3MF6A 2XVKA 3UJOA 5FPUA 4QX1A 1W06A 5AC91 1JMUB 5EHDA 4CU9A 2UU9B 2H6CA 4CRQA 1RUC3 4LTAA 1G1XB 3ZPOA 4ASKA 2CAUA 2VTXA 3KHBA 4JGZC 4CZSA 5DEDA 1W0JG 1OKOA 3TOJA 1RUI3 1WW7A 4I30A 4QXCA 5CVRA 1LKNA 3OGJA 4MVQA 1JZ5A 1OLMA 5JJEB 4CP9A 4NUBA 5IJRA 3BABA 1U97A 2EAKA 3FL7A 2HKXA 2AW9A 4ZS2A 4V1PA 4FFGA 2ARAA 1IKPA 1UY1A 2V4DA 1CQ9A 5LXTA 4N43A 3EBRA 1OQEA 3VDDA 5ABJA 4DR3B 2IC1A 1RM1B 3JB4C 2C2AA 2YI8A 2L35A 5LP6A 2BFUL 3CNAA 2CL2A 4CPBA 4ET7A 5HFMA 1QVGU 4QKDA 2KG7B 4JQRA 4N7UA 1Z2GA 2Y64A 5CFDB 1F51A 4JI4O 3OYWA 5GZCA 2PYLA 1GYKA 5GM0A 5KXCA 4KFMA 1V6MA 3HMYA 3FFZA 2VM9A 1N33O 1JYXA 5JPNB 1SEFA 3E22B 2X5IC 5GONB 1PNGA 1QJZA 4YIOA 4K1ZA 4Y20A 5B4NA 2NZ9A 4XYXA 1RVF2 1XJAA 1NXD1 1JPXA 1R3KC 4JDNA 1LHWA 5CISA 4JRLA 3IB3A 3IN9A 4IIJA 1WD3A 4K9SA 4HK9A 2PFWA 3B00A 1WB7A 1FXHA 1CAXB 1UW8A 1RTVA 3G6BA 5CIRA 3W21A 2BPA2 4KG0A 1VALA 2L6LA 2TUNA 1S76D 4PELA 2HWE3 1F15A 1R73A 4IEPA 4PJ0Z 5I8YA 1V6OA 2IZWA 4AHCA 1QDCA 4LFCB 5FZKA 5J96B 5ISLA 4MOAA 1QJY3 4JAVA 3ACGA 3N35A 2YC0A 1F35A 2RDRA 2GP3A 4CH3A 2DU1A 3DC6A 3K0GA 2YBSA 3EMRA 4XXAA 3QNEA 2H94A 4CUBA 5F3GA 1UXXX 4U3JB 3AG7A 1NR7A 1QHTA 3JBG1 1CAWA 3POSA 3ZX7A 3PNAA 2YSUB 4EFBA 5LBCA 4JI3B 2ZGMA 1Q56A 1VIBA 5FLIA 5L3GA 4EROA 2HEVF 5KAFZ 2WFF1 4QWNA 3F5WC 5CKMA 3TN92 3K51A 2YFUA 4QQHA 4ZU4A 3WNOA 5C8YA 3WP6A 4W6YA 4LFBB 3OBAA 1GQHA 5EBWC 4LK6A 4QXHA 1RUF3 1SHWB 2VNGA 2WT1A 1TUBA 1OOPC 2B9VA 1Y9MA 4JV4A 4MVRA 1GOHA 3Q9OA 5EBLC 5BR8O 2QWPB 2I74A 2R9RB 1K5SA 1LESA 2LM3A 5KAIZ 4QKBA 3D36C 4QB2A 4CUCA 2Q7GA 4AI2A 4W4LA 3OR6C 2RHPA 3ZRWB 1W6PA 3CIHA 1LHUA 2HLDG 4D7YA 1SZBA 1W6QA 3BU7A 3T0AA 4E2LA 3ZYRA 2ORXA 1MS0A 5IVYA 2PI4A 2C26A 4QX0A 1DGWX 4JKMA 3IT8A 2LROA 5CYYA 1XMOB 4S2GA 4MGKE 3OSDA 2WNOA 4WFFA 2WZR3 5A33B 1DU3D 3H1HH 4LP8A 5FDBA 4Q4V2 4CC5A 4HVQA 1OPOA 3AYCA 3ABMC 1DF0A 4RS5B 4UB6Z 4J25A 2XLAA 4I50A 3IIAA 1NLSA 1JU4A 5HXMA 4X1YA 3PU8A 3M8LA 1VRH3 4NOTA 2UUAB 3MLLA 4UUJC 2G9FA 3VGIA 2W94A 4M3CB 1IOAA 1URXA 4FBFA 1UZZA 3T1MA 2WRAA 1SQQH 1HN1A 3KSCA 4FCAA 4JI1O 1FAYA 4OI1A 2B5UA 3V56A 3KS7A 4IYHA 1MS3A 4HXCA 4YFZA 2FL4A 1Q82W 4YZ5A 3AMPA 4ZXKA 4AHXA 4DUZO 4ZHQA 3PUSA 3FE5A 2LFSA 1DTOA 1TUBB 1GQPA 3AFGA 2YGMA 3UETA 2OVUA 4PLMA 3V0BB 3IDCB 2VQ0A 4Y1XA 5IYCO 4NKGB 2UYAA 4AEMA 1HRV2 4JI7O 2PAKA 1CXZB 4NPLA 4WCEV 5DXDA 4P9OA 4KHPB 4PV1B 1MEC2 1TNFA 1QR9A 3ZXAC 4U36A 5G04L 1A78A 4LE4A 5GZEA 3DCQA 2OCCB 4BQ3A 1O3QA 4HSJA 4B1MA 1UX7A 3MUY1 4UI9L 1Q6IA 3T08A 4HYOA 3JATA 4HAMA 2WUHA 2WNVB 1FJGB 1FT9A 5KUMA 1LNSA 2JG9A 3NKGA 5L3FA 4A3ZA 1OT5A 2GU9A 3RI9A 1YUDA 2PLV2 4O4JB 5C70A 4BPZA 3OGSA 2QQUA 2VU9A 2RDCA 1IXBA