2PTMA

Structure and rearrangements in the carboxy-terminal region of spih channels
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
192
structure length
192
Chain Sequence
b'DSSSRQYREKLKQVEEYMQYRKLPSHLRNKILDYYEYRYRGKMFDERHIFREVSESIRQDVANYNCRDLVASVPFFVGADSNFVTRVVTLLEFEVFQPADYVIQEGTFGDRMFFIQQGIVDIIMSDGVIATSLSDGSYFGEICLLTRERRVASVKCETYCTLFSLSVQHFNQVLDEFPAMRKTMEEIAVRRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hyperpolarization-activated (Ih) channel
publication title Structure and rearrangements in the carboxy-terminal region of SpIH channels.
pubmed doi rcsb
source organism Strongylocentrotus purpuratus
molecule tags Transport protein
total genus 64
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2ptmA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ptmA02
2ETEA 4MUVA 1RC6A 3H3UA 1TQ5A 4LULA 5AVPA 1EYBA 2OZ6A 3CF6E 1EY2A 4I02A 4E2GA 4QMAA 1QXRA 3SXWA 4HN1A 1CAUB 1Q5OA 2Q30A 2GC3A 5FLJA 1J59A 4FBFA 2XL9A 1YLLA 4OFGA 3E5QA 4I01A 1X8MA 4TLFA 1OMIA 4LA2A 4MGKE 2XL7A 4J1WA 5JAXA 1OD5A 1IPJA 1DGWA 4X6RB 2I45A 3NJZA 4HVQA 4JTNA 3B02A 3CL1A 4ONUA 1RUOA 1NE4A 4MGYE 3RYRA 1O3RA 5CADA 3CJXA 1QXJA 3IBMA 2K9ZA 4Q0QA 3GYDA 3CLPA 5FLHA 2ET7A 2HKXA 5KHHA 1SQ4A 2N7GA 5CVRA 2PQQA 4K8FA 3E5XA 1HW5A 2UY9A 1RUNA 4XF3A 3VHRA 5KHIA 1FXZA 3MDPA 1O3SA 1CAXB 2QCSB 3DKWA 2MNGA 1QY4A 5JSOA 3S0MA 4IEXA 4KWLA 4XFIA 3ELNA 1O7FA 2O1QA 2OA2A 3DL3A 1NXMA 1ZZ6A 4IEQA 3GBFA 1I5ZA 1VJ2A 3DV8A 3KSCA 4XF9A 4J1XA 4B29A 3FZ3A 4Z82A 4A2UA 1LB2A 2PAKA 4LEJA 3KCCA 5I0RA 1ZRRA 3I59A 1XE7A 1Y9QA 3RPQA 4HN0A 2HJIA 2PAMA 1CAXA 1FT9A 4YYOA 1VR3A 2GC1A 4YARA 1Q3EA 5I0TA 1OFNA 5FLIA 4IEOA 5I93A 1ZZ8A 3E6BA 2GH2A 1J1LA 3KMHA 3H1YA 3ROUA 5I8TA 4I0BA 4META 1PMIA 1UCXA 1YFYA 5BPXA 3D82A 3E5UA 1GQGA 4IETA 4XF1A 4AVBA 2ATFA 3ETQA 5J7MA 3HQXA 2XKOA 3SCGA 3BCWA 3BU7A 1ZZ7A 2GU9A 2GC2A 4R8HA 5JSRA 1JUHA 4HZFA 3LA7A 3LZZA 2IXJA 5K8SA 4QM9A 1YFXA 3H7JA 4UXAA 1ZZ9A 4WBBA 3H1WA 5BV6A 4KU8A 1O3TA 4L2NA 1UPIA 3QACA 2UY8A 3G7DA 3FWEA 5FQ0B 1J3RA 1CAWB 2BGCA 5C6CA 1ZRFA 4Z07A 4HLTA 4O9EA 5C8WA 3NW4A 1OI6A 2XKPA 3IWZA 3KGZA 2XHKA 3S7IA 4AQ6A 3MZHA 5JCTA 1X7NA 4AQ2A 5F1RA 5EFUA 3RYPA 3U11A 2DCTA 2VQAA 2PTMA 4XFAA 3H9AA 4E2QA 4LUMA 3WW1A 1ZRCA 2GAUA 5EZWA 4WVZA 2GC0A 1RTVA 5FQ0A 5LRSA 3FFQA 1CAWA 3H7YA 3SMHA 1UIJA 3E6CC 1UIKA 2Z2SB 4WZCA 3WW4A 3OD0A 1WGPA 4Q29A 4XFFA 2D5FA 5J3UA 3RNSA 2IXHA 2B9UA 2B8MA 2PA7A 5E16A 4PIXA 3LA3A 3H1MA 4QGLA 2BNMA 3C3VA 3JZVA 3UKTA 4HVRA 4MX3A 1O5LA 2BEOA 4LA3A 5J48A 1YUDA 1NZCA 3D0SA 4QXKA 4EV0A 1PM7A 1YWKA 3I59B 1ZNPA 2UYBA 4YSFA 4PJYA 4XFCA 4XF4A 5FDBA 4FAHA 1SEFA 3E6DA 4LLOA 2BNOA 3TNPB 5LEKA 1L3JA 1G6NA 1DGRA 4MGIE 2Q0AA 5I91A 2OZJA 3BB6A 3HT2A 5BXXA 5I8SA 2IXLA 4L11A 4YRDA 2PHLA 4IEYA 4BH9A 4I2OA 1UD1A 1NYWA 1WLTA 4HMZA 2P17A 3M3IA 4XFGA 3OCPA 5JSPA 2H0VA 3SCFA 4KU7A 3EJKA 4AXOA 4XETA 4HSLA 3ACLA 1RL3A 3LOIA 3WW2A 3L2HA 4IEZA 4CYDA 3CO2A 1LR5A 1SFNA 4D7SA 3PVBB 1QWRA 1J58A 3PNAA 4HBNA 4F8AA 2PYTA 2D93A 2PFWA 5KHGA 3IDCB 4I0AA 1ZZCA 3PLQA 4EROA 3EBRA 2Q4SA 4F7ZA 1YHFA 3OF1A 2CAUA 4HVOA 2C0ZA 5T3NA 1EP0A 1ZRDA 4Q0SA 4Q0UA 4MH0E 3UKVA 3RDIA 4IEPA 3H50A 3R6SA 4YNIA 1DZRA 1FI2A 1LKNA 2QJVA 1H1IA 1Y3TA 4KL1A 1CAVA 3O14A 5FCCA 2MPFA 2PAEA 4QGNA 4Q0VA 3RZZA 3H8UA 4P9GA 4IEWA 4FAGA 4AVCA 5I0SA 1ZX5A 3N4MA 1Q43A 4XFBA 3D0JA 4KWKA 2KXLA 3IIAA 5FPZA 2Q1ZB 4XF0A 4MZUA 3LAGA 4N9IA 3RYKA 1VP6A 2XLFA 2QDRA 3FJSA 4E2SA 1X82A 2PHDA 3LA2A 3HIFA 2F4PA 4ZU7A 4UBGA 3UKNA 4IERA 2B5HA 2VECA 3E97A 4PIYA 1YFUA 3LWCA 3ES4A 2OYZA 1CX4A 1O5UA 4BYYA 1I6XA 4IEVA 3NKTA 3OTFA 3EHKA 3ES1A 4JVAA 4QGMA 3QOPA 2FQPA 4MGZE 3SCHA 2XLGA 2CGPA 2V09A 1O4TA 5JR7B 2K0GA 3EQEA 4FT8A 4GULA 4MV2A 4BHPA 4X6QB 1UW8A 1EPZA 1CAUA 4N9HA 5LEJA 4I09A 1ZREA 3M70A 4AVAA 1U12A 2OPKA 1X8EA 5E1RA 3ZDSA 4EWDA 1ZZBA 3NL1A 3U0ZA 2EVXA 2QVSB 2MHFA 4ZU5A 3H3ZA 4LUKA 2IXCA 4OLLA 1ZVFA 3I7DA 4PIZA 3WW3A 2IXKA 2ZKLA 5I8YA 2H6CA 2BYVE 3IDBB 3FE5A 3S7EA 3BALA 5CU1A 2O8QA 4R52A 1V70A 5KHKA 4IEUA 2FMYA 4ORFA 4EWEA 5BY5A 2H6BA 5I0UA 1O3QA 4IESA 2ZCWA 3SHRA 1WA4A 2Z69A 1YFWA 3TNQA 2D5HA 1IPKA 4JV4A 4DINB 3KGLA 1NE6A 3ST7A 4EWAA 1CAVB 4XFHA 4HSJA 3EO6A 5HI0A 3CEWA 4D7TA 3OGJA 1J3PA 2XGXA 2BNNA 4Q0PA 3USSA 2XLAA 3MPBA 2WFPA 2WC2A 2GZWA 5KBFA 2VPVA 4QM8A 1RGSA 4H7LA 4LTAA 3U10A 1XRUA 1J3QA 4O9GA 1CGPA 4XEZA 5KHJA 4UBHA 3HT1A 4ZU4A 5BUVA 1LRHA 3FX3A 2CV6A 3FHIB 2ET1A 2E9QA 3MYXA 2EA7A 5D1IA 4NVPA 4KWJA 3I54A 3DN7A 2EAAA 3NSTA 2Y0OA 1XE8A 5FPXA 5LRRA 3BPZA 2IXIA 4I3PA 2CAVA 2UYAA 4RD7A 1DZTA 3NVCA 1GQHA 1H1MA 4BIFA 2IC1A 4JTOA 2QNKA 2D40A 4QX5A
chains in the Genus database with same CATH superfamily
3N9PA 3IDAA 2HWD1 5A7WA 1JU4A 2HWE3 2D3SA 2V4DA 4LF5O 1OA3A 3AG1C 1M56B 1ZSPA 2HBTA 2WN2A 2WAMA 2A3XA 2Q30A 2Y4UA 4XOGA 3M2MA 3UGHA 1O9HA 1M57C 4Q8LA 4I4TA 1PMJX 2NN8A 2A3QA 4LNVA 2WLIA 4JI5B 2P1BA 1DGWA 2IWGB 4HVQA 1NI8A 3UNPA 3WDVA 3P32A 3MI8A 1TAEA 1SQFA 1XMQB 3QH6A 1FOD2 1WA8A 5FK7A 5FWJA 1ZA7A 5K0UC 2YC0A 4K8FA 4IHJA 1XSRA 3NV1A 5FY7A 1P7BA 5C4WB 1K7DA 1AX0A 3RMXA 4QX1A 3GB7C 2WLKA 5C9AC 3C3TA 2W95A 4NAOA 2E76B 3ELNA 1FFTB 4YM1A 4K1ZA 1EV11 4AYUA 3OFNG 3UO3A 4A2UA 1WB7A 1GWLA 1E5SA 4BQ5A 4XJZA 4Y5TA 4LBNA 5EQUA 2IVJA 1NVPD 4KNCA 4YY3O 2ZX3A 5FY0A 3AG2B 2ZDIA 1HXS3 4X1KA 4KGQA 1UY4A 4Y20B 2ID4A 2VUAA 4META 4UCOA 1PMIA 2WO3A 2RV9A 2HH9A 4XAEA 2Y38A 2ZGUA 1CJPA 5K1PA 3JSNA 2XJQA 2VXRA 4B3TB 1B09A 5EIBD 2AR6A 2OUHA 3BA9A 1NTKH 3B2EE 2KKWA 3QACA 3I4IA 3ABTA 3FWEA 4RQEA 1V6JA 4XQWA 1J3RA 1CAWB 1SLTA 4JGZC 4FM0A 3IPVA 3IWZA 2LFRA 3OBTA 5ITZA 1DYOA 5LGUA 2Q6AA 1M5IA 4PQ9A 5EBMC 2J1RA 2WRAA 2QJ1A 3RG0A 4E4EA 3THDA 2D6OX 4DR2O 3LNNA 1JZ8A 5CG8A 3SMHA 3UYJA 5FOBB 3O1UA 5KMGA 4DUYO 2L35A 1WWYA 3F5TA 2YGMA 4KBBA 3LD8A 1AXZA 3H1MA 2EIDA 4QHBA 4PF1A 1HRI1 1GN6A 5B4XA 4QQHA 2KB1A 2OCHA 1PM7A 5B4NA 4JZRA 4HYOA 2N74A 3L9DA 5LOVA 2VMHA 4AVSA 1R091 4G4FA 3UETA 5CA0B 2D6NA 3BB6A 1UZ0A 4FFHA 1AI6A 4ITCA 2W91A 3ZRSA 4GB33 4LOTA 3Q8FA 4M3CB 1RVF2 3ZMTA 1VLNA 4AXOA 3K0GA 3KM5A 3WHUA 5D2AA 4AHXA 1MEC1 4PLNA 2B5UA 4CPBA 4DV6O 5CB4A 3DTUB 3BOWA 1CN1A 1ZX3A 3WOGA 1PIV2 4WFGA 3MO4A 1CZVA 5ITZB 3QH7A 4TUYB 4YNIA 4Q4W3 1W6OB 5DM6V 3POJA 4KL1A 1N36O 1NTZH 3FHAA 3G80A 3UO2A 2CTRA 1X33A 1SS3A 3G4SV 1AXKA 4XFBA 3CCJV 5CFCA 2X7RB 1I3HA 2AHYA 2YC4A 1AR93 3RYKA 4AQSA 4Q4V1 1U5YA 2JXAA 4L8QA 5FBZA 3N2KA 3IT8A 5F2VO 4COVA 1VBE1 4XUPA 3H3LA 3TGUH 3TN92 2F6BA 1W8WA 4F6RA 1IG3A 2F17A 3CRQA 2B5HA 1GSLA 2QGNA 3WP3A 3RW0A 1KKDA 4AGRA 3VKMA 3K57A 4UFIA 1LECA 4FPKA 5FP9A 1YEWA 1XYNA 2GTSA 1JJOA 3JATA 3JB8A 4N9HA 4KQ7A 1W03A 4F83A 3WF0A 2J1EA 1S5HC 1ZZBA 1RSOB 3JD0A 1QLEB 3U0ZA 2EVXA 1GR3A 1OPMA 3J80N 4NIGA 5IT9N 1BE3H 2FZ2A 2BYVE 2P6CA 3AKPA 4JF3A 3O1OA 2PY5A 3BALA 3AMQA 4IEUA 3B01A 3ZRXA 2FMYA 2O8OA 5FMOS 4IESA 5A1FA 5FV3A 4ZI7B 2D5HA 3CRCA 2IJIA 1AR61 2XNDG 2D6LX 4J9ZB 3DSQA 3ACGA 4OX9B 3N7LA 3PDQA 5CFCB 3T0AA 2WFPA 4RR3C 5IFPA 3N2KB 1WP7A 3JD4A 3I2GA 3GZAA 1D4VB 1BEV3 1O59A 5D1IA 1GMMA 4ASLA 1F4AA 4KG0A 4F6RB 5FZ7A 2EAAA 1OZ0A 1QQCA 2CAVA 4RD7A 4MG2A 4XUTA 1SESA 2WO7A 4YJ2B 5DEDA 4K8XA 5E88A 2QQVA 1QJY1 1PO12 4C1XA 1PL4A 1VQ9V 1XYPA 4PBOA 2VZRA 4LFCB 2RR12 4CH4A 4IDZA 3PUSA 4LF6O 1ENQA 1YC61 4CEYA 2I45A 3NJZA 3GNEA 1GM9A 3MFAA 1RUOA 2ZHKA 1C28A 2L6LA 5LW9A 3CJXA 3K04A 5KHHA 1A32A 3HKDA 1ND2A 1OPOA 4DUWA 2PHRA 2XVGA 4IL7A 4ASMB 1QQP1 2RDQA 1JMKC 3ZYIB 3HEIA 3NAPA 2GN3A 3K0DA 1SZBA 1S2EA 3RS6A 2E7QA 4JASA 4JGSA 4JI8B 3VBOA 2ARCA 4TV8B 2WZR3 1XXNA 2JIJA 2A0LA 4XBLA 4YYOA 1OLRA 2C24A 2VG9A 2PYJA 2IFWA 2GSYA 3MIBA 4HT1T 2ZD9A 4D6RA 4UVCA 1SFYA 1L7QA 4JTCB 4IETA 4JI1B 3AG4B 3NKGA 4Y4YA 1XNKA 5J7MA 3G71V 4DV0O 4WM8C 1ZZ7A 1AR81 3HN3A 4DV4O 2A6YA 1Z5VA 4Z8BA 2HWB2 4JYAO 1AB3A 3HKCB 1DFQA 5JQGB 4M3CF 5CEHA 4FPCA 5C6CA 4CEYB 2W1SA 2B1GA 1REFA 1KU9A 4JTDB 2HYKA 5B3SC 1HNZO 2XHKA 4YJ3A 4O4IA 2WJSA 3AMNA 4M4RA 3E89A 1GNHA 3U14A 4WFAV 3ZYFA 1NQTA 3K9SA 1HKDA 1W39A 1ZRCA 4PA9A 4WVZA 5BNOA 2YS8A 1OT5A 4X1YB 5DABA 3FFQA 2JDMA 2ZGOA 1QF3A 1UIKA 1WGPA 2J22A 4MADA 5EYYA 3RNSA 1BCXA 3BA8A 3FN9A 4HNAA 4IV1A 2BNMA 5FWEA 4A45A 1N3QA 1PK6A 2AGSA 1AI7A 1Z7S2 1KD1W 4Y3OA 2AENA 4RQPA 4DV1O 4I50A 4XJ8A 5FY5A 4YW7A 4KMQA 5DAPA 3THOA 2IXLA 1D0HA 5F3EA 2CUGA 3INAA 3CYOA 3R4UA 4QX8A 2RMU3 4YXWG 1TME2 3ZXDA 5JIUA 2VC9A 5GJ6A 2SLIA 2PN5A 3FX7A 3APOA 3LOIA 3DGEA 2WWWA 3L2HA 1QOTA 2JEMA 4IYHA 3F5WC 4CXWA 5LGTA 1RUE1 4LQRA 5FFOC 3U78A 3OR7C 1PX4A 1WW6A 3M8AA 5EIBC 3IDCB 2QE3A 4YG0A 4I0AA 1AJPA 3OG2A 4BQ4A 1ZBA1 4H3WA 3RDIA 3ZR6A 1UZZA 4L0PA 4O4IB 1F2NA 5L9RA 4RA0A 4JI3B 3POFA 1SF9A 4Z1MG 3LPGA 2YROA 4PDRA 5LBFA 3AZVA 4OI0A 1KDMA 5IY5B 4QU1A 2R071 4BR6A 2YYOA 4HNAB 4UCVA 3C3SA 4LP8A 2XLFA 1COWG 2JK5C 1QJX2 4XBQA 4LO6B 1XU1A 2H94A 2ADDA 3LPFA 4IUGA 4AI1A 4RQPB 5FPVA 3CB2A 2WLLB 1BHBA 1MABG 4D6SA 5L7OA 1RUI3 1LUWA 5JR7B 4FT8A 3T2QA 3WDXA 5DUVA 3ZEDA 3ZO0B 1G9AA 1EPZA 4BISA 4PBPA 3U4XA 1KYOF 4XXAA 5C33A 4AVAA 1KUQA 2QEXV 1L7LA 5FZFA 4NWWA 4JDOA 2XG3A 3MHHC 2ZEZA 1RUG2 2RJ2A 4DR6O 3NL1A 1PZ8A 4D0QA 1ZYBA 4NHLA 5C70A 3RJRA 3W7XA 4QJFB 2VOTA 3Q8AA 1JXNA 2ZPXA 2R6QA 3KLSA 4P9WA 4GUNA 4JRAA 2JDPA 2FHRA 5D5QA 1RUH3 4AFDA 2VCMA 2A9HA 1CZTA 1JZ4A 3WZ1A 1SBDA 1VB2A 1SMVA 3ZSMA 3T4HB 2Y34A 2IH3C 5F5IA 4DINB 2CGNA 2WZPP 5FZMA 2FDFA 5KX5A 2KQXA 2WYFA 1C8M2 4JI7B 1W6QB 4A3ZA 2D7FA 4YW3A 3MPBA 2X5IC 4UFKA 4U7OA 4GH4C 4GWJA 4QM8A 2QFEA 2WNVA 3SITA 5LK7B 3ASOC 5FZDA 3KV9A 1E1RG 3PIJA 4C0HA 2UXXA 1Q86W 1ASJ3 5FYIA 5LRRA 3BPZA 3DCQA 3AEIA 4BMBA 1VQKV 1DZTA 3NVCA 3FUQA 4JGYC 1N34O 5HCHA 4CEWA 3H3UA 3HNYM 4RYDA 1VQNV 4I02A 3L73H 4FBFA 4XILA 4E4DX 4LK7A 3P1IA 1HR0O 1DP0A 3CJIB 1OMIA 1PVC2 2R9IA 4LHKA 4X6RB 5FMBA 4DR1B 3CBNA 1BXHA 4W50A 5FYZA 4O4LA 3R0RA 2CTQA 1RM1C 2Y69B 2VRZA 1VBD3 3WQ1A 5A3WA 1JZ5A 3WXPA 5KC6A 1RUF3 3CS5A 1FXZA 1CAXB 1XBFA 4QQ2A 2UU8A 1LENA 1BBT3 3JALA 1X50A 2WZEA 3UT5A 1W0OA 1K4CC 2WNVB 4CCCA 3AZWA 4RUEA 3DV8A 4PELA 2GP3A 3PJSK 3DXTA 1FFXA 3VBHA 4YGCA 3SPIA 4TV9A 2VUCA 3BVOA 3CZJA 3O1RA 3STLC 1V6MA 2R7EB 4NPMA 2QTOA 1X9PA 4QE9A 2DF7A 5FYBA 1IHMA 5C3OA 2FDIA 4QKFA 2BTOA 1UQXA 4NXNB 2RDCA 1YHQV 3VHNA 3B40A 4JKKA 1JZ7A 3OUSA 4HZFA 5KWRA 1H4HA 4BW9A 1SA0A 1PKXA 2JDUA 4BIUA 4QPGA 1UMHA 4PDWB 2ZMLA 4L2NA 1UXXX 1KDKA 3DXRA 5T5OA 2UXCO 2BGCA 3MV01 1XYOA 1BLZA 3KT1A 1AL21 4ES8A 4J80A 1BQ0A 1ST8A 2JGDB 1X7NA 4AGVA 1VBC1 2D97A 1JZ2A 3M7MX 3HPLC 5T54A 1R082 2JG9A 2VW2A 3MIGA 3EFFK 2Q1MA 1M9NA 1VMHA 2JKXA 4LK6A 2YFZA 3IMMA 3BIEA 3ETGA 2JG8C 4J10A 1P7GA 3JAWA 3RYFB 5J37A 2X0LA 2ILMA 5IVCA 3B9CA 5FUNA 1IXMA 4QQPA 4RFT0 4UT5A 3K3NA 1IURA 4QB6A 3VBHB 3S57A 2GHYA 4UCTA 2VMEA 4YZ1A 2XMLA 4XDOA 2OCCC 3I2HA 4X66B 3O1SA 1JYIA 3ZCCA 3ABKC 2DU0A 4MVUA 3OUJA 4EZHA 3VL8A 1W2BU 5DG1A 4XFGA 1NZ6A 1FKAO 2A6VA 5AVAA 4LXLA 5LWBA 3CP1A 3RQ0A 3SH4A 2LW8A 2BW8A 1EUUA 1AL0G 4I3GA 3CCEV 1TMF3 1N33B 3QBQA 1ZBE2 2Q4SA 1R1ZA 2CY6A 3OF1A 3W59A 1KBHA 1S2BA 3B3QE 5BNNA 2PXJA 5FZ3A 4LBOA 3CJHB 4QT6A 4LFBB 4MW8A 4K1YA 4QIWF 4DV2O 4X62O 3UKMA 4RQFA 2PLV3 1T5EA 1MACA 2R9AA 4DW1A 3OM3B 2FZ1A 1H2GA 4OMCA 4WVMB 1OCCB 3BY6A 3SEEA 1PGW1 1H6YA 2Q7GA 3K9AA 3JAWB 2W1WA 2XONA 3J7MA 1G9CA 4MOAA 1OVPA 2VCAA 1UL9A 1BYHA 1KMIZ 1NA1A 3DUIA 5A7SA 1ZLZA 1W6MB 4TN7A 1J95A 3FB6C 1CX4A 1QLNA 4BYYA 4AEDC 3SLIA 1NH2B 1YYNA 2P5BA 4JKMA 1OSGA 3AYDA 3ZYHA 4UVAA 1DG6A 2IZWA 5LZ6A 1B35B 5CBFA 1CAUA 3LGRA 1O4YA 5LEJA 2V4VA 2C6SA 3WB0A 1RUJ2 3RBZA 5GONA 3X2QB 2PHWA 5HCFA 3AFKA 3A0NA 2HWC3 3NR7A 5FYTA 4TSVA 4A44A 4B3MO 3DPRC 1AJKA 1G7YA 2C5DA 2DVFA 5BNNB 2ZMNA 2JENA 2Y0IA 2L9LA 5I0UA 1AYN2 2GN7A 4I30A 1NCRC 2VQEB 3J8F1 4DK0A 4D7TA 4CDUB 2DJVA 3JYCA 2GSMB 4O9GA 1N1VA 3OTOO 3PL0A 1LRHA 2OQ7A 4NPRA 1ULFA 1VBA2 5E79Z 2EF6A 3NNMA 5CIRA 1WJZA 1O91A 1NA1B 5KA5A 2QTWB 5A6QA 4LBQA 1R73A 1IQAA 4HONA 1F5FA 2ZE8A 1OBNA 3FL7A 3WG3A 2WS92 3HAGA 5ACA2 3J7AU 1C57A 1YI9A 3RN4A 2ZGQA 5H9QA 4PHZA 1BQZA 1CAUB 2W1QA 3WF3A 3GBWA 1ACCA 2Q8OA 5GONB 2G19A 1E57A 4MHRA 1X8MA 4M3CE 2ZQMA 4EJRA 2XL7A 1Q6HA 4Y26A 2R041 3VKLA 4EN6B 2HWF1 5JI7A 3OGIB 4ZS2A 5EYPA 1WBFA 1HNWO 2Q0OC 1ND3C 5C71A 3HR0A 1C1FA 2JJ6A 4CTEA 5FZHA 3GGLA 5FZOB 2JJ2G 1MEC3 1S0DA 1XILA 4CSWA 4H7MA 1UU6A 1FD9A 1LNQA 4BJ0A 3ABZA 3GBGA 1W6NA 3BUCA 1VQ7V 2VTXJ 4OQ9A 3BYWA 4B29A 3FZ3A 3A0HZ 1DF4A 1K34A 2GUZA 1JOPA 5C9AA 4FOVA 4XYXA 3FB5C 5IW0A 1DHKB 1LCLA 1CXZB 2FBEA 2HFEC 1OFNA 4B8EA 1IBKB 1QKQA 4JYBA 1O8PA 4UW5A 4AFMA 2JD4A 2W08A 3I56V 4YVSC 1WKYA 3BCWA 2ADPA 2JKBA 4W65A 2ZXWB 1VBE3 5K8SA 4AEKA 1AI5A 1H2KA 3SGIA 1MA1A 1XNAA 2VZOA 4IW3A 3AXEA 2OXBA 2WT1A 1Y74B 4OHXA 5CBHA 4WFEA 3AG1B 4N53C 3OD4A 5CA3A 3WG7C 1VAVA 5JI9A 5EYPB 1M57B 3ASIA 5GKAC 2WNUB 3ZXAC 3K06A 4NMIA 4CS2A 5B1OA 4LUMA 2GAUA 4WM7C 4XMIA 5FQ0A 4JGZA 5A70A 3K3OA 1UIJA 1UN1A 2P3IA 3ZMNA 4XHXA 1DQ5A 5CZKA 5K0UB 3UKTA 2N05A 3VZOA 3OW2U 2QQPA 4YG3A 3W7SA 4UOJA 1UAIA 3IJ4A 4DFSA 2BSKA 1QVFU 4X64O 2ZHMA 4K0KB 1V9U1 2RS12 3LSEA 4QPIC 2EIJC 4CUGA 3TETA 4CBCA 2XT9A 4QPWA 5F37A 1SRYA 1S0FA 1POV1 2WA3A 4RGKA 1RUD3 5LP6C 2VZSA 3V0AA 1MZ6A 1B3QA 1FATA 4FIPC 4MTXA 1RMU1 3ZRWB 5EC1C 4W4ZA 1IPSA 1SFNA 4XW3A 1NX9A 3PIGA 2YICA 1G4YB 4O61A 2OKXA 2YPDA 3VD9A 1A78A 1GP5A 2EULA 1QJY3 2A3WA 1EN5A 5LXTA 2OPWA 4O2AA 1Q6IA 2Y8KA 2NQYA 1NY71 1K5SA 3H1JH 4FVMA 2BFUS 2EAKA 5IT6A 2JDKA 3O14A 1KEXA 4JGZB 1LGBA 1NAEA 3AKTA 2JDYA 3RWRD 1DK1A 1KQSU 2WABA 3GM8A 4RAIA 2YIAA 4GALA 2W68A 2V1DA 2FCUA 1GLHA 1Q8QA 2R72A 4CCLA 2XTAA 1XMOB 3ZN5A 3RVZA 1RJ8A 1OCZC 5G04L 1X82A 5FZGA 3NWKA 4C91A 5D21A 3J7NA 2ZZJA 2F4PA 2P6HA 4UW4A 2H8PC 1VIBA 3B8NA 3OBRA 1FXHA 3O1MA 1YFUA 3LWCA 1YO8A 3UL2A 3K4DA 4IEVA 4QDRA 3KHBA 2PZSA 4XDLA 5DUUA 2EBOA 3RYIA 4LHSA 3AK0A 4NTXA 3T3YA 2MEV3 4OUSA 4CDQB 4RHV2 1W8OA 2K0GA 1S5LZ 4HANA 3MIFA 3KZ4C 4BHPA 1HIXA 2YV8A 3WF2A 1RHI1 3LDRA 3HJRA 1S1AA 5E1RA 2YUEA 1VF7A 4EB6A 3WW3A 2IXKA 2WL1A 3FE5A 2RJZA 2V7QG 1AROP 2K9PA 4CXXA 3TAYA 3AM2A 3CDZB 3ZFEA 2JE7A 4LF7B 2DURA 5C8YB 3RI8A 3H1IH 4JV4A 4PQQA 4EWAA 1WMDA 1H8HG 4KGGA 4N7IA 1N0NA 4IYIA 4FFIA 2ZR3A 1N1TA 3CC7V 4HOOA 4L87A 2XLAA 4UYBA 3K51A 4HAMA 4DY3A 1PV0A 4H7LA 3GVMA 2ADEA 1LOEA 5FR3A 1CGPA 5FPUA 2XBO2 3A7QA 2CV6A 4MYEA 3MYXA 2QM7A 3IGAC 3E1F1 4KWJA 3VBUC 2AUYA 2ZHLA 5GLVA 3L72H 4B3TO 5AC91 1N32B 3CWBH 3HNMA 5BMVB 4RR3A 4JTOA 5HV4A 4DRXB 2VS0A 4D6TH 5AVPA 2WO2A 5JVDA 3CF6E 3ZHSA 5GM0A 1EAH3 1FNYA 3PURA 1CVNA 5J9PC 3K79A 1SPPB 4BWAA 3N7KA 4YIPA 3ZSJA 3WD5A 5HCAA 4AQYO 4FM1A 5CBLA 2Y4TA 3H8RA 1OD5A 1UFIA 2HEVF 1Y76A 5BR8O 4ZIBA 1TUBB 4H0LB 4LOSA 2J7MA 1L7RA 5CADA 2DV9A 3N2GB 2HWE1 4NOTA 3T2PA 1SQ4A 3E5XA 3T1LA 1Y9GA 1Q8OA 2UY9A 1RUNA 2WWJA 1Q8PA 1VBB3 5L3EA 4G28B 2BTQA 3ZYBA 1GOHA 2W3JA 3FD9A 5T5PA 5HXVA 3AZZA 3WF1A 5C7GA 3BOPA 1Q8IA 4QHOA 3ALQA 3N7MA 2G9ZA 4O4HA 5JXHA 3PTYA 5ISLA 1XE7A 3VKOA 4X65O 1E5RA 5I0TA 2EILC 1OLME 1XI1A 1WLDA 4RR3B 3LUTB 5T5LA 1HB3A 1F15A 3H1YA 5I8TA 1HX6A 4I0BA 2XVKA 1OURA 4X9QA 2JD9A 3LCPA 2JRIA 1Q8VA 4EE2A 1F4MA 3FKSG 4PJ0Z 3VL9A 4AE2A 2UXDO 3I3BA 3N9LA 3CQOA 5IYZA 1W0PA 3T08A 1HV0A 1POV0 4FP3A 2R9RB 2EIBA 1PZ7A 2EIMC 2WZ8A 2K46A 3G7DA 1LOFC 5LA0A 5FPLA 3W7WA 1HXS1 2GDSA 4KBZA 2QKAA 4WM8A 1W8HA 3KD4A 3PU3A 4Y5SA 5C8WA 1OI6A 5GZGA 5CFDC 3LKJA 1UYYA 2YUAA 4NIHA 3RYPA 2XWJB 5B1BC 4B4QA 4XFAA 5ERLA 3ZVXA 1DQ2A 4MGSA 1RTVA 3M8LA 3ZYPA 3JBG3 1PZ9A 5FYYA 3WW4A 1O6UA 1OA4A 4UB6Z 4QB1A 5C8CB 2UU9B 5E16A 4PIXA 2HP8A 3B69A 1N0JA 5KAFZ 4M0NA 1RINA 2Y6JA 1WBLA 5CA1A 1TMF2 4LLOA 1RITA 4COWA 3POWA 3ENRA 3LOBA 3SJAC 1IZ3A 1R1A3 3MLJA 3CCSV 1FJGB 2HWD2 4R4XA 2XAFA 3ASNC 4QE7A 4XUQA 3VBBA 4IEYA 1UD1A 1NYWA 4YW1A 5EV7A 2AC1A 1K92A 3OCPA 5JSPA 4TWKA 1NLRA 3HVDA 2EINB 5EC2C 5IYZB 4IEZA 1K3EA 4LCUC 2VWJA 4GWIA 2FDHA 1YXBA 1QU0A 2FKXA 4F8AA 2PYTA 4GX0A 3ZX7A 3PLQA 4OX9O 3C7HA 3DYOA 3VV1A 4URTA 4X1IB 5IVFA 4CUBA 2QTSA 5EZYB 1ZRDA 4LKDA 3H8OA 4GB31 1W8TA 4Y1XA 5FPOA 4Q5OA 5HCBA 3ETPA 3WSOA 4PT6A 2JS3A 3I5DA 3RVHA 2GNTA 2XWBB 1QGLA 1XPWA 2Z4FA 5B3SB 3WDWA 1EV12 3PVNA 3ZFGC 3HWJA 5KXEA 3N9NA 3FJSA 5BNPB 2PHDA 1MZEA 3JD72 2KSDA 4UUJC 2PQSA 3RSJA 1KS4A 4Q4W1 1X4TA 4XUNA 5DUWA 4LFCO 2VUJA 5ABJB 4GKXA 2WQ4A 3ES1A 4ZXKA 2VBBA 4BW5A 3B5LB 2GDFA 2W0FC 4D69A 5K4LA 2YXLA 3VZJA 1AR91 2HJFC 1FS0G 2ZHNA 1K33A 2VMGA 3N27A 1OJHA 1LAJA 4CU6A 2ZM6O 5A3TA 3SYAA 2X29A 3CEIA 5DAXA 3I7DA 3E86A 4LF9O 1M93A 5FRAA 5FZ9A 1UY3A 1OLQA 2ZGNA 2CK3G 1M90W 3POYA 4D3WA 3O12A 3C7FA 4ARYA 1IPKA 2EX3A 4H37A 1S0IA 3SPHA 1HQNA 4A5UB 2WLPA 2LROA 3TEYA 1J3PA 4D7YA 2JICA 1HRI2 1PNGA 3LDKA 3G67A 1THZA 4JI1O 3JARB 1UOFA 1FOD1 4RS5B 2DQ0A 2RMKB 1R092 1STMA 3FLTA 2XJTA 2A3YA 2X5IA 3TBDA 4AW7A 2EIKB 4GH4A 1LTEA 1RC6A 2AZ0A 4ICGA 2WKKA 3L74H 1G9DA 2VGDA 5AFBA 3H1KH 3SXWA 1FAFA 1LR1A 1R3JC 1BEV1 3D5OA 3IAQA 5LMUB 2KR2A 2XL9A 4JGYA 3MF9A 5IVVA 1QDCA 4LF8O 3ZFFB 1NZIA 1NU1H 4Q4Y3 4J42A 3WLUA 5FUIA 2RS31 3K5OA 2K9ZA 1URFA 3VDDC 1SQXH 4AFBA 2IJHA 4DOUA 3M7AA 2DUOA 3MDPA 5IDJA 2B1IA 2QCSB 2UXBO 2CDPA 2VBPA 3VHPA 4Q4V2 1PO23 2MW2B 4BB3A 1VBE2 4H13B 1NTMH 5M0TA 4LEJA 1XU2A 1B06A 1Y43B 5A3OA 3I55V 4NHXA 3JUUA 4DXWA 4ZXEA 5C3QA 4CU9A 4DV7B 4AOCA 2F66C 4CCKA 2JIGA 2VNGA 2DCJA 1LEMA 4YHHB 2WZR1 3RMYA 3LZZA 2G9GA 1E1QG 1K12A 4YZ3A 1ZZ9A 3MF6A 4QQLA 4EN7B 1UPIA 3OUIA 4LBQD 5FZ4A 3X29B 4GKKB 2C9AA 1SG3A 2J1SA 5FK8A 3ETEA 3ZRVA 1ZRFA 2PHXA 3PVOA 4NPLA 5FYVA 1G9FA 2DUPA 4LF4B 2CH7A 2OW4A 1AR62 1YITV 3BHPA 2AW9A 3J81N 4JI2O 1U5XA 4TTGA 4YVWA 1G8MA 2YC2A 4GXLA 1XEQA 4E8CA 3OSDA 4LHNA 1RM1B 3MLKA 2UUAB 4GKJO 1I94O 1GFF2 3OEAA 1H2SB 5GZDA 3VZKA 3ZHRA 2O14A 1TUEB 3E6DA 4YPJA 3T09A 1WLWA 2JG8A 1QJY2 5I8SA 4FOQA 4AFCA 4MVZA 3VD7A 4DR4B 4CDXA 2JDIG 1W05A 3DGTA 3MDSA 4XUOA 1JQ0A 4FPPA 4TWTA 4AAXA 1JR9A 3DKQA 5IJ9B 3CMGA 1GZ9A 3E8FA 1IBLB 1UXZA 4JI7O 4IT5A 4EROA 4F7ZA 1YHFA 2BU9A 2OUJA 4XC9A 2RMU1 3T4ZA 2A7AA 4DMIA 1VAMA 1AHSA 1QQP2 1JYXA 3LDBA 2JE8A 1J1TA 1T6BX 2R063 4Q4X1 1JUIA 4LF5B 4XDJA 4Z92B 5C5UA 3D36A 1WP8A 5IK7A 2HWF3 5F6LB 4OGQB 4NN0A 3CE2A 2X53S 4LT5A 4PDLA 3HIFA 4J11A 4IERA 2OYZA 2QKDA 3UQ8A 4QD2A 5EPAA 3Q8BA 3UGGA 5EBLC 3B09A 5IWFA 3WNOA 2HVKC 1AR82 2W92A 4BCUA 4MV2A 4GKYA 4X6QB 1XNRO 3ZN6B 1W99A 1IOAA 2OCCB 4PA6A 4I9QA 4KG8A 4AEDA 4XE9A 1X8EA 4OMDA 1MG1A 1D4M3 4LUKA 3EXAA 3TWIA 2VVEA 1MZFA 4Y33A 1OXCA 2CL2A 5IATA 4QQOA 3QNEA 4A4AA 4CP0A 2BE3A 2ZGSA 2QKCA 4ASUG 3UESA 1O3QA 2BWCA 4SBVA 1NCQB 2WINB 3LIHA 3THCA 5F6KA 1U5ZA 3DPRA 1GU3A 1OHFA 3BI3A 1RPRA 1OC1A 2XGXA 2HG5C 5DG2A 3KT4A 3STZC 1OH3A 1VB4A 5KHJA 1RUH1 4NXNO 4QPGC 1NCRA 4FFFA 2EXJA 5E8AA 3FAVA 3OB8A 1BMV2 4ZZ8A 2FMLA 4L9BA 3O65A 1K5QA 1COV3 1VARA 2ITDC 4BK5A 4JDMA 1R64A 3WNMA 1SLCA 3ZXLA 4XBNA 3HBKA 4DR2B 1M56C 3LIGA 1YQ6A 4DUYB 2GC3A 1H2LA 5IFTA 1RUE2 4AEDB 3HQUA 1NT2B 1D2SA 1ASJ1 2DW4A 3IDEA 2BPA2 5LHGA 4MVMA 1VQ4V 4UB8Z 3ILNA 3GCWA 3OR6C 1ZBA2 2W46A 3ZPYA 5HV0A 3S5AA 1AR4A 4AI0A 3NJYA 3CIHA 1TVKA 3IBMA 5J98B 1RP3B 4Q0QA 2R30A 1LHUA 4IGPA 4OHYA 4PLOA 3T1MA 3VHRA 3SYQA 1OV9A 5C4WC 3CMEV 1BJQA 5CG9A 5FMCA 2R072 3K77A 4UFJA 4W6WA 2OA2A 1ND3A 4HZ3A 1WA6X 5JPNB 5FZBA 1D7PM 2TNFA 3ZXFA 4K35A 4P9OA 5JOZA 4CZZA 1S0JA 2J1UA 1NCRB 2QBXA 1D5AA 1OKOA 2A71A 4DV6B 1VBD1 5HXMA 2HBUA 1RUF1 3SDLA 1NS1A 1Q90D 3R66A 1QJU1 4P30A 1P84F 5EJZB 1OUSA 5F5AA 3ECQA 1XQ8A 3K4AA 4OI2A 5T50A 4AAPA 1N36B 3D3QA 4R8HA 2GMEA 4CDWB 5IE9A 4S2GA 4V2VA 4LFBO 1Z78A 3N3HA 4QM9A 1FNZA 1SZXA 1F7YA 4HPKA 2YPJA 2QQIA 2QUOA 4YVSA 4XJAA 5FZ8A 3U75A 2BOBC 2GNBA 4PDMA 1QR8A 2P5OA 1TME1 1LU2A 3WV6A 3ABUA 4FZ0A 3IN9A 1C5HA 1IKPA 2D43A 3KG2A 1I9RA 1C5IA 1OOPB 2W47A 2YBKA 1RHI3 2ZA9A 3OYWA 1W8NA 2GMPA 1CJDA 2B42B 1CPNA 4N53A 4BQYA 4XFFA 3N36A 3ZOIA 3V0BA 2XASA 1XDCA 2IXHA 4H55A 1S3JA 2D98A 4WFBV 3AZXA 1SQQH 3B94A 5B1AB 3MD0A 4WM7A 1FPOA 2ZXQA 2ZCEA 1NZCA 3D0SA 1YWKA 4PJYA 2A6XA 2QQKA 2W87A 4JZ2A 5JUVA 2BNOA 1XOUA 4FI9A 4FM2A 2IJKA 1ULCA 1HJFA 2PHLA 2WSVA 4I2OA 5CYYA 1XL4A 2P17A 1AP6A 2P3YA 4BLIA 1K5MB 2C9KA 4XETA 4Y4RA 4OULA 1ENVA 4QPIA 4JHZA 4CYDA 2VCCA 4NYKA 1CONA 2VQEO 4M00A 5AC93 4ZZ5A 1HW7A 4FLXA 1NKGA 3ON7A 2B9VA 1ZZCA 3ZXJA 5A32B 2UUCO 5BYNA 4HVOA 4Q0UA 2WWUA 3N9QA 2RS51 2X6CA 1DQ4A 2UWAA 1W3VA 3A4UA 1FI2A 2QQUA 2W39A 2QJVA 1FPN3 2DBNA 3DXUA 1RUG1 2MPFA 5JMCA 1V6KA 4P9GA 4N53B 3HBZA 3ABLC 2JECA 4AHCA 4QXBA 3V0BB 2HHHB 4X89A 3AMHA 1UY1A 3A0KA 4QKNA 1AYM3 1RUC3 2UURA 5BZBA 2BZDA 4UAPA 4E2SA 5GZCA 1SCRA 4FP2A 3A0RA 5FPBA 2VNOA 1JX9A 3CCQV 2PLV1 3AYCA 3WNXA 5GALA 1FMD3 1AZDA 3EHKA 4LR4A 1E79G 4NB5A 5FZIA 4O4JB 1GNYA 5LASA 3IZOA 3IB3A 2CDYA 1Q8SA 2ZKNA 2D44A 4QPIB 4P00B 2EIJB 2WFF3 3OMNB 2MHFA 2A1XA 3H3ZA 4A3XA 3VD5A 3OPTA 1ZVFA 3SJBC 5LP6B 1H0BA 1XSQA 5DAVA 4A6OA 1AL22 2E7TA 2O8QA 3GF6A 1VBC2 3KV6A 2VWKA 5FO7B 3ZYRA 3RZMA 1L8DA 3EHBB 2Z69A 1KJRA 2P3KA 1VQLV 1LJ7A 1Y4MA 1JOYA 3ZR5A 4XFHA 1PVC1 3EO6A 3ILFA 5DPNA 1KFUL 1QNWA 2HWC1 4DV0B 3OPZA 3JD3A 4GMP0 1IBKO 2GZWA 3TK1A 1RGSA 4CRQA 4K6BA 4XEZA 5BUVA 1QBZA 5A7WB 4JYAB 1AR73 1X9TA 2ET1A 1K97A 4QKDA 2WT2A 3NSTA 5FPXA 4GZRB 1MPXA 3ABMC 1GV9A 1PL0A 1UWWA 3I3DA 1HNZB 1M1KW 1MNGA 4QX5A 3OMIB 2NPIA 1RIRA 3WNNA 4I4TB 2ZINA 1B04A 1VRH3 2DQ3A 2WLIB 4JI6O 3VBUA 1EY2A 3JSLA 1NG0A 1OFSA 1H8TA 1NXD1 5FKCA 4DXZA 2I07B 2DCZA 5K9YA 1WA8B 4LA2A 3AP4A 4IHJB 4J1WA 1XNTA 2BVVA 1PP9H 3K03A 4EN8B 4TZDA 1JFFA 5F5QA 4DV1B 4IE0A 3WVJA 1G9BA 2WT0A 3GYDA 4FPGA 5CVRA 3OGVA 3ILRA 3GHNA 1HNXO 3CMAV 3HQRA 4UV8A 4ES9A 3K75B 3GJBA 1W6PA 2XQRA 2ERFA 4XFIA 2VH9A 5LA9A 4A6SA 4X1KB 3H9VA 4LORA 1ZZ6A 3S30A 1CP9A 1GBGA 4BQXA 3GDBA 2DOSA 3M99B 2JJ1G 1HB4A 5C93A 3I59A 1IS6A 2VZTA 2NNUA 5EJ3A 4NIIA 1IBMO 1ZZ8A 1YQ2A 5FZLA 2P3JA 1UCXA 3GJAA 1GYKA 2JDAA 1URXA 5I0DA 3FYEB 3VBUB 3AG4C 2CAZC 2XH6A 3IPVB 1JN2P 1JCHA 4R7CA 1F23A 5FNVA 3USUA 5F2SA 2NYYA 2J1TA 3K48A 2AGAA 5KMGB 1JFFB 2RE9A 4O9EA 2DUQA 2XKPA 3NW4A 1ROPA 3AK2A 1WMEA 2HLEA 4DXRA 1N3PA 2GALA 1GH6A 1RPOA 5F1RA 1XMOO 5FZAA 4TXWA 2BUKA 1LOFA 4E2QA 3J8F2 2LW7A 2A6ZA 5LOVB 5CA6A 4LBKA 3AP7A 3E8GA 2AH2A 1MR5A 1PNLA 3ZIAG 5CFDA 4FCAA 5T55A 5A7OA 1NR7A 3W7UA 1NUKA 2QWQB 3BVCA 2W9XA 4LO5B 5JCOA 1CZSA 3BIWE 1QOSA 2V4AA 4YWAA 2TUNA 2Y6KA 3I59B 4GT1A 2UYBA 1QJZA 3OAAG 1NH2D 3BRCA 4DS0A 2DYSC 1HRV2 3SPCA 1G6NA 2Q0AA 5I91A 3KS7A 4YFWA 3ZFEC 4C1WA 3AG3B 4Y1ZA 4K8ZA 4CUCA 2DVAA 3R4DB 1TZOA 1WLTA 1BHAA 4JQRA 1WCKA 5CB4B 3M3IA 4OZOA 2AZ5A 2ZX0A 3BABA 1FOD3 1GNZA 2C26A 2O0OA 3MW2A 3KCXA 2DYRC 4CH3A 1VMJA 1VQ5V 2V73A 2R042 5IYYA 2EIEA 1J58A 4AWDA 2HWF2 1LU1A 4K9SA 1FAYA 1XNQO 4I9WA 5HFLA 5IJ0A 5AG2A 5FXXA 4MH0E 2ZAAA 3R6SA 1RUD1 1L1FA 4IQPA 3FBYA 1RJ7A 2EIMB 1ZAUA 1N34B 1BVVA 3PU8A 3TXQA 4QGNA 4Q6GA 4IEWA 1N32O 3BTXA 1R3KC 4YGDA 5FPZA 2Q1ZB 2W94A 2LJ2A 4N9IA 4Y1UA 4A7ZA 5IY5C 2RS33 4NROA 2G9FA 2PELA 3MHZA 4RUFA 4NXMO 1F51A 2D2CB 1MS8A 1PD3A 1ODMA 2J42A 1WN7A 3JATB 1KECA 4PIYA 5G05L 3ZFGA 4FOWA 1XJAA 4JI4B 5H5NA 3U1XA 1YVWA 2GMMA 3H42B 2HEYF 4GIQA 3R05A 2QDNA 2E32A 1U12A 3I2OA 4TLGA 4WBNA 3ML0A 2Y6HA 2B9ZA 3ASNB 1GOFA 3ATGA 3FC0A 1P49A 4XDQA 1Y4WA 5I8YA 2DVBA 4Y1VA 1AF9A 2WS91 1S4CA 1H2MA 1UYXA 4K7JA 2MEV1 4MSWC 1MVQA 5FTTC 4B3SB 3AJYA 2YB7A 1G86A 3OEEG 3GWKC 1AJNA 1WPBA 5KC5A 1NE6A 4OPHA 4LO7A 4HSJA 3RVYA 1XE0A 1Y6XA 1UF2C 4W4KA 3OGJA 4DIQA 1QIQA 1SQBH 3ZIWA 1RVF3 3CXCU 2Y26A 1US2A 3FX3A 3MUY1 4Y24A 3LQCA 5LGNA 3DF0A 2DN9A 3SJQC 5FJKA 1V9U2 3WDUA 1TGOA 3R4SA 1XE8A 4GZ9A 2BOJA 1NLQA 3TJTA 1NBMG 1H1MA 3R65A 1BGYH 4ATEA 4YLZA 2R1DA 4EN9B 2OZ6A 5L9BA 1PIV3 1MS9A 4OYUA 1C4RA 4HN1A 1RMU2 4MXVA 3G6BA 1YCIA 1GP4A 1G1XB 3CCRV 3ITQA 1QHTA 4WBNB 1K45A 3D3AA 3HKDB 1ND2B 3CJIC 2YMZA 1MZ5A 1SFPA 4IXLA 1IPJA 3WFVA 3NAPB 2Z3YA 2YG0A 1NY72 2UU9O 1WMFA 2FCTA 1MS5A 4GWNA 3TN93 2Y69C 4N90A 1GZTA 3VBOB 4DR5O 1HW5A 1EAH1 4K21A 5T52A 3ZPOA 1QH6A 4U36A 1UKRA 2QQLA 4Q1PA 4X88A 1RFYA 4IEXA 3TCUA 3PTRB 1UX7A 2WN3A 1FJGO 5LMNO 2HEPA 3VDDA 5GZEA 1GN4A 1IXBA 1GZWA 4XF9A 4J1XA 3SH3A 1YRZA 1R1BA 2E3CA 1PVXA 1Y9QA 5L3CA 5LA6A 2WSSG 2PAMA 3DECA 4EYUA 2AREA 2RN9A 5IYDO 5FLIA 1VBB1 4AVVA 4COZA 3E6BA 2Z42A 4Q4X3 5JWPA 3QG5A 4CVUA 1AJQA 5A7PA 3C8XA 3D82A 3E5UA 4DV2B 4X62B 4SLIA 1IX9A 3E22A 3HQXA 5L36A 4KWUA 1U5IA 2Y60A 2Q9LA 4YJ3B 2OQ6A 3SPJA 2Q69A 2GBOA 2WIIB 1SACA 5IVBA 3OGRA 1UY2A 5BNOB 2RQ6A 3BTAA 3POIA 4U3FH 1NOVA 1JBCA 2VZ1A 3CCUV 3MIDA 2W1UA 3QLQA 4I0XA 4A42A 4JYYA 3RYCA 4DUZB 2YBSA 4IV1B 3W5NA 2DCTA 2VQAA 3H9AA 3GHMA 1PK6B 3WUDA 1IKQA 3I49A 4E4ZA 5AFEA 2YEVA 3CC2V 4I50B 5FXWA 5E89A 5JH7A 5J3UA 3AKSA 1PO13 2VD7A 4UF0A 3I2KA 5A6YA 4QGLA 3VDDB 2RM22 3K5LA 3MV11 2UWCA 1O5LA 4OZXA 2BEOA 4L92A 5J48A 1YUDA 2RR13 5GW7A 3CRMA 4YSFA 3NRUA 1WD4A 4B3MB 5DZGA 3KT7A 1SLBA 1R6NA 3JBG1 4FLUA 3F2ZA 1FYUA 1V55B 4B3RB 2RJKA 4AR2A 4CCDA 5IUQA 1W90A 3H8XA 1KITA 5A3MA 2BOCC 1OCRB 4KU7A 1N3OA 4GLXA 3KZIZ 2QKSA 5FXVA 1JU3A 3POBA 1D0GA 4HBNA 2PFWA 1R1A1 3EBRA 1AP5A 1OUXA 3CD6V 2HWE2 1J5EO 4P9JA 3M4FA 2WO1A 3Q4HA 4XDKA 2VXJA 3H50A 2ZNJA 1TNRA 3HMYA 5CBGA 5HFMA 1MQTC 2NMNA 2XHBA 2QWPB 1UZVA 4H44B 4RN5A 2A5ZA 2GTAA 2PAEA 5EXOA 2YEVB 3V56A 4S2HA 1PX3A 3NNLA 5JH7B 1UYPA 4X8PA 3E35A 2Q4PA 1VP6A 3ZHQA 4UF0B 2ZMKA 3B8MA 3O0WA 5L7OB 5E6HA 3L2YA 2J1VA 2JIZG 3P6BA 3Q9OA 4XIOA 2HWB3 3E97A 3ACIA 5LMUO 3CSXA 2ZGTA 1GKFA 3JASA 3URFA 1BCCH 1ENSA 4H2AA 4W6XA 3K59A 4CE8A 3SCHA 2CGPA 3T1CA 2FTKA 2DVDA 4NJ4A 3WB2A 4JYCA 4X20A 4CA9A 2M6YA 4G3YC 3MFCA 1UW8A 3WNLA 1B35C 2A06H 3OEHG 1DBNA 1UOGA 1KJLA 3X2QC 2D3PA 1YIFA 1HXS2 1LUVA 4GAZA 2YGLA 2Y0PA 2H6CA 1QJU3 1S0GA 5KX5B 5BNQA 4BOWA 3AL6A 3A2FA 4Y22A 1YJLA 2ZCWA 1WA4A 4AEMA 1Z7S3 2XAHA 3MPPG 4DXTA 3TNQA 2V72A 3ZSKA 4BWOA 3VBSC 3VUOA 4JAVA 5FYSA 1Z0HA 4MVSA 4CDUC 1U97A 4DV7O 3ETDA 2BGOA 3A0BZ 3JCUZ 4OPAA 2LGWA 4CEWB 1TME3 3RZKA 2EA7A 3VB9A 4YHHO 2HEWF 2AXTZ 4CP9A 3VBRC 3EYPA 1W9FA 2A70A 3PN1A 3ZHUA 4MLOA 3JASB 2OIGA 2ETEA 4MUVA 1UNBA 2Q73A 4E2GA 5CMUA 4YVWC 2ITCC 2EXHA 5L9VA 2Q5TA 4P9LA 4LF4O 1OQEA 4O4LB 3T2TA 2EZOA 1I5PA 4OFGA 3HNBM 2R0FA 4YM0A 3LSSA 4C8DA 1I5XA 3JD1A 4UFHA 4GB32 2ZR2A 1NE4A 2KM2A 3VBFC 3JALB 5KUKA 2P06A 4FLYA 3UT5B 2UUAO 1QJX3 4Y22B 1KP2A 5LCWL 4ET7A 2HKXA 1GM8A 4O65A 1V00A 3MAQA 2CE4A 4W6YA 2I74A 1EN6A 1A3KA 4CDXC 2VQTA 1FFXB 2ZT9B 3LEGA 3DKWA 4TV9B 2MNGA 1W9WA 4E4SA 3Q8CA 2K2SA 3DL3A 3ZMSA 3GBFA 3ACFA 2WBKA 4Q4Y1 4AVTA 4DR4O 5C4WA 4Q4W2 3KCCA 1YNAA 2RS53 4GQ7A 3THTA 2VW1A 3RPQA 2HJIA 3LSDA 2ZE6A 3J9SA 1MVEA 1NR1A 1RUG3 4LFAB 3DYMA 1N8RW 1K4DC 3EMRA 1SA0B 1TG7A 3TB0A 2X8KA 3JQXA 4L97A 4L8JA 1W9SA 1YJKA 3VOUA 5HPOA 2JB4A 4QPGB 3FLPA 1FXVA 3MW4A 5BPXA 1IBLO 1OA2A 1AR92 3QF7A 4XF1A 1PO21 3DXRB 5FPRA 1ONAA 5DAWA 3JD2A 4HK8A 1UO9A 1JUHA 1LODA 5H6QA 3F95A 3D36C 4UW3A 5KR7A 2VU9A 4MVTA 4AI8A 4UXAA 4BMEA 2JG9B 1C8M3 4UI9L 2UY8A 4WVVA 3TYJA 2XJRA 3KKYA 1Q81W 4YM3A 4NIAA 2JX9A 3AK1A 2AEZA 2RJLA 3KV5A 1S77D 2ZEWA 1JOBA 5IWAO 1O9GA 3T4DA 4XTMA 1QCEA 3WG2A 4R8CA 4AQ2A 5EFUA 5FY1A 2WNUC 3QO5A 4P02B 1VMFA 2ENRA 2VTFA 3WW1A 2GC0A 1H9PA 1CAWA 4WZCA 3ZXEA 4DV3B 3A21A 5JPMB 2IFRA 3EXUA 2B9UA 2QE7G 2VOXA 2WDBA 3LSUA 4FK5C 3J26N 3S3WA 1ZNPA 4XFCA 3QD6A 4FAHA 4E8DA 2GP5A 2KG7A 3BTYA 1PVC3 4N7UA 2FD8A 5BXXA 1ULDA 1JJ2U 2E5LO 2CU5A 2LW1A 2XDVA 3RZGA 4DQAA 1BEV2 3JD71 1DGSA 2ZACA 4BLJA 1VRBA 5CA0A 4LHLA 3PUQA 3IC9A 4XTPA 3NJVA 5A3UA 3VD4A 2RS32 4M3CA 4ZONA 3WHTA 1GOGA 3ZSEA 1BQPA 5FZ1A 4AI9A 1ALYA 1SERA 2ZS6B 2F4VO 4IE5A 3RZZA 4XURA 3WX5A 4BU2A 1R3LC 1GKBA 4S2DA 1NKDA 5J2TA 4XF0A 1CD3G 3CCMV 4TUYA 5DQ0A 1YTFD 2CWSA 3T1HO 1W6OA 1JA8A 4FXGB 3O1PA 2LO1A 4DR7B 2HVJC 1OKQA 2IUWA 4AQYB 4COUA 1WCQA 1XUQA 2KG7B 5BR8B 3RZHA 4NWVA 1KQRA 3C90A 2YDEA 3NKTA 5B1NA 5FY9A 2R061 5A9GA 3RI9A 3AL5A 2PHTA 3I2IA 2V09A 4URAA 1O4TA 1SBEA 4CDQC 3SKVA 3NV4A 2WZR2 3VDBA 1DYKA 2F43G 2BBVA 4S2FA 1HLCA 5EK0A 4FLZA 1GWMA 5FAXA 5F5CA 3K5NA 1R083 3V65A 2N04A 2IW5A 2VZ3A 4UV9A 1QMJA 2OPKA 2QWNB 2D3OW 4L99A 5FZEA 3ZDSA 1TVGA 4OLLA 4PIZA 4YW4A 1MOFA 3IDBB 3O5SA 1W2OA 1J84A 3LSQA 4X65B 1VPHA 5KHKA 2DFCA 1Z2GA 5LHIA 1W04A 3CZUA 1YFWA 3M3CA 1RSOA 4AL9A 2DFBA 3KGLA 1DU3D 4BK4A 1F35A 4B3NA 1S76D 4CUAA 4PI0A 1XB9A 5A6ZA 2NLRA 1GICA 3CEWA 4YGEA 4F3JA 4JZGA 4LBQB 1D4M1 2P7TC 4MVRA 1G8WA 1XL6A 5J2TB 1YDXA 2UXDB 2JS5A 2M7WA 3I8TA 4ZI7A 4Q8KA 4EQVA 2NR5A 2AEYA 3DN7A 4CC5A 3ZKYA 2VAUA 1YSCA 3ABLB 2DVGA 2IXIA 3BODA 3ZN4A 3ZYGA 3T0BA 2IC1A 1VQ6V 2QR4A 5DECA 1ZBE3 2D40A 2XVLA 3MHSC 1DQ0A 2V5YA 4OHZA 4QAWA 2Z5UA 1DYPA 3L75H 1GAXA 1QXRA 4COYA 3GALA 1WCUA 2JE9A 1Q5OA 5FP4A 1QHDA 5FLJA 2PYLA 5CKQA 4YJ2A 4DV5B 3HR9A 4MGKE 5J09A 4DK1A 2QSAA 2ZIOA 1COV1 4WF9V 3RWNA 4ZKTB 2FL4A 2WA4A 2XR4A 2GV9A 4ZOLA 3HPNA 4MGYE 1W6NB 1LGCA 3RYRA 1ZUQA 1QXJA 2RMU2 3HB3B 2PQQA 3AMMA 4FPYA 1SETA 4J6GA 1A8DA 1IS3A 4Q4X2 2GUZB 5KHIA 5C9AB 4XAAA 4JX0A 4LC1A 3SNMA 1QH7A 3BEHA 5FO8B 4BAYA 2BFUL 1RYYA 4Z82A 2ZABA 1LB2A 3SYCA 3C7OA 5I0RA 4HETA 1RUJ3 4QX0A 3L70H 5IAXA 3WP6A 4E9KA 3WEZA 1LOGA 1YI2V 4XXPA 2ATKC 2GH8A 1CR7A 1O8SA 1OD3A 2BGPA 1J1LA 5FZKA 4TV8A 2D6PA 4R9BA 2D6MA 3SCGA 2ZAHA 1FV2A 2VZPA 3ABMB 3EB7A 4XZUG 1AYN3 2ZGPA 3LB9A 2EICA 1D2DA 3MBWA 1LGNA 1Y7BA 5A7NA 1AUYA 1W06A 4Q1RA 3ZXGA 3DC5A 2RVAA 3T1YO 2F93B 2FDGA 3ZMUA 5FQ0B 1MS1A 1DGWX 4ZBMA 3VKNA 3ZDVA 1WW4A 4Z07A 1RUI2 2HHHO 2R70A 3NJXA 1QNMA 4ZOLB 1V6IA 3MZHA 1VBA3 1FXKC 3A8TA 3HKCA 3U11A 5APAA 4FQ4A 5JQGA 4EN0A 3TEZA 1DQ1A 1SBFA 1K42A 2IBZH 5LRSA 2H0BA 1GRJA 2BSKB 2E53A 3E6CC 2VQFB 2BBAA 5ANNA 4R6ZA 1HV1A 3HN1A 1TA8A 1LOBA 5FZ6A 1S0BA 1UU5A 4GA9A 2WS93 5C8CC 3U4SA 3VZNA 1RUH2 5ACA3 4PDVA 3JZVA 3ZN0A 4HVRA 4JI5O 4UVBA 1W0NA 3SQOA 4AK3A 1HWYA 5FPAA 2ZM6B 1B6QA 4X1YA 3FFZA 4XF4A 3V0AB 1LOCA 1VIWB 3W7TA 1XMQO 4LF9B 2W6IG 3D4KA 1SCSA 5JXJA 1GN3A 1IDSA 5SV5A 1H4GA 4LO8A 4D6QA 4FLWA 3M3QA 5LB6A 4DB5A 2WNEA 4BH9A 4QKBA 2ODMA 4NE9A 4NR1A 5LXTB 4KHPB 4HSLA 3P3NA 4O2AB 2JDZA 4GYCB 2Q1FA 2EINC 1ASJ2 2NN4A 2OTJV 3CU7A 5D8AC 3FUOA 4DR3B 4Y5Z0 4DW0A 4BQ2A 4CCMA 2D93A 5KHGA 2ZGRA 5GLUA 3F7YC 2O57A 4FLTA 4QWNA 2ZGLA 3UKVA 1VF5B 4YG6A 1DZRA 2ZGMA 5A3LA 5CNAA 2GNDA 1S2KA 1Y3TA 2Z5WA 1CAVA 4QPKA 4LIUA 2DYCA 4CS3A 4AVCA 1MS4A 1H8TC 2QQOA 1Q43A 1H30A 1ULGA 3D0JA 3BFRA 3NNJA 4NTWA 3JAMN 3JCIA 3MICA 3O1VA 3POEA 5FKBA 4AG4A 2IU0A 3RYIB 5L3FA 2Q68A 2PMWB 4YGBA 1OQDA 2A73B 5BNPC 1BVP1 1CWPA 4LF8B 1VBD2 3B77A 5EYXA 3WUCA 1WB8A 1SLAA 1BHGA 1NQJA 4Z2AA 3LFMA 1RUF2 4LH7A 2VECA 1FPN1 1OCOC 3N9MA 1QJU2 5ABJC 2WQ8A 1BBT2 3H01A 1OLMA 4EB6B 3CC4V 3WT3A 1JZ3A 1AVMA 3PJYA 2ZX2A 3H1HH 1AYM1 1PGL1 1V6NA 1RUC1 4OCTA 4GD4A 1W8ZA 2DYSB 1POQA 2WLLA 4I09A 1BMV1 2UXBB 4JHTA 3FLRA 3ZFEB 2EALA 3N9OA 1IQDC 1FMD1 2XB6C 4IGOA 5LBCA 1A8MA 2G1MA 2H6BA 2DYRB 1DF0A 3SHRA 4FLVA 5FIXA 3RZJA 5JLVA 1QU7A 1CAVB 2RS13 3FMGA 2WFF1 3AMPA 2W0XA 1JYCA 1APNA 5H9PA 2MK3A 1C3HA 2WC2A 4LTAA 2P4EA 3GXUA 2TEPA 3PUAA 2CTVA 4RS5C 3QO8A 3B00A 5JVDB 3CCVV 3E83A 1W6QA 2YZ4A 4U3JA 2A75A 4MHUA 2Z79A 2D6KA 2RG4A 2EIKC 4XQDA 5EHDA 5FOJB 3SYOA 2ZKOA 3C2UA 3I97A 4XABA 2VMCA 2WPDG 5GTHZ 1EYBA 4G27B 4DEQA 1BT8A 1Y76B 5B5EZ 3AB0A 5FY4A 3M3OA 3WNPA 4JI2B 2P4KA 2BWAA 4GCZA 2P2KA 1FYJA 1AR71 1PM4A 1F9KA 1JYTA 2ES3A 4XPVA 1XNBA 3E5QA 5JCOC 4ISRA 4KXRA 4GKJB 4W8JA 1I94B 5FO9B 4R4ZA 3KHCA 3ZFFC 2BTQB 4DO2A 3JXSA 1YQCA 3JQWA 1VRH1 2RS52 2RDNA 3AX4A 1DGRN 2FYUH 5KUMA 1SQVH 2N7GA 3AYEA 5IAVA 3CJIA 4O4HB 4M01A 2C4XA 4XF3A 5FMDA 3K58A 4FQZA 2PHFA 4JDNA 2XUEA 2W2IA 1QY4A 4JKLA 4EKWA 3UJOA 2ZX4A 5JDBA 1JI6A 4U2AA 1NXMA 5L73A 5C3PA 3AP9A 4RHV3 1WW7A 3ORJA 4J7ZA 3OT7A 4MTFA 3B4SA 1CAXA 1FT9A 1P4RA 2GC1A 2ZEYA 1Q3EA 2PLV2 4U3JB 5FYUA 5GLZA 1VQPV 4LR3A 1G6UA 2GH2A 1PPJH 4WCEV 2UUBB 3GZUC 4P14A 3OGSA 1GQGA 1F31A 3GWOA 2ATFA 4WM8B 2YIBD 1SZTA 2F95B 2GU9A 1WLCA 2BQPA 3SJCC 1X36A 5JVVA 2YXHA 1UOJA 4WBBA 1C1LA 2VW0A 1S0VA 3FBMA 4D94A 1SLIA 3T0DA 3N35A 1OF4A 4DUXA 4HLTA 2YXSA 3KVBA 5H9SA 4YW2A 1GANA 4GMP3 4YZ2A 4FTBA 2XBO3 4JAAA 5DDJ1 4IL6Z 3IIIA 4CS4A 2DCYA 4PDWA 5CA1B 1ZA4A 4YIOA 5EZWA 3WB1A 2X05A 1RB8G 1BK0A 2HWC2 4QX2A 2EJRA 2PF4E 5LA1A 3OEBA 3NNFA 2E51A 5TISZ 4KH9A 1XNRB 2JGDA 4K3AA 4JI4O 4K8RB 4JI0B 4JV5B 4F4LA 4QU2A 3WP5A 1UPSA 4PLMA 4XJUA 2CHHA 5A6XA 3O0XA 1VF6C 3K5MA 4FTEA 3GZEA 1DGRA 1NVPB 4NRMA 3GCXA 2NP0A 3RYFA 4UFZA 5LBBA 1HQWA 4LBMA 4N43C 4IE4A 2P4VA 5J2UA 2ZGKA 4PCRA 4IV3C 4PA4A 1SC5B 3W9AA 3I3MA 2WNOA 2H0VA 3I2JA 3WDYA 4B3SO 5K1XA 4JI8O 1MMMA 4DEVA 3CO2A 1AR5A 3L71H 2VL4A 2F1MA 3OGCC 1DF5A 1UJWB 4NKGB 5JXIA 2VNVA 3SR2C 2H3OA 1T2XA 2BTVC 1V54C 1QNYA 2VUDA 4OVEA 4JTAB 3J7HA 5F3IA 3ZHTA 1DLBA 4DY5A 4LBJA 4RFRB 1H6XA 3APBA 4KI5M 5IVJA 1ZX5A 4KWKA 2XOMA 3CJHA 2VMFA 1MQTA 1KXGA 2QDRA 1EPWA 4OI1A 2R0HA 3LF7A 2EIGA 1CIWA 4LJHA 1N4CA 3W58A 4D8MA 3SEPA 4AFAA 4N8MA 1MEC2 2Q7EA 5L19A 4WVMA 1O5UA 1WLEA 3OTFA 4JVAA 3QOPA 2ZNIA 2HYXA 2E74B 1BZWA 4MXWA 2X6AA 5J2UB 3S6PA 3ZIXA 5JZGC 4RWUA 4MT8A 4IGQA 1W6MA 3L9JT 3NO8A 4P9XA 4ZU5A 4ZHQA 1UU4A 1Q56A 4H33A 4WFHA 1AXYA 1H1AA 1B35A 3QTCA 3ZLIA 4FPOB 3ZMOA 2YSUB 1JYVA 5FZCA 1M4WA 1YJWV 2UWBA 1NCQC 4J9YB 1H2NA 3PJQA 1GZCA 1AJOA 4WV8A 5LA2A 5B2GB 3OOXA 2BNNA 2X5IB 2HWD3 4GH4B 3AVRA 3O7OA 4I0WB 5B66Z 2E6VA 3C7GA 4XCAA 2FDJA 1F4NA 4C90A 1J3QA 3ASOB 4TQFA 1MQTB 5ANQA 4ZU4A 3POSA 1TEIA 3AK3A 1JVMA 3VBSA 4EZ4A 1UMZA 3ZM8A 4IE7A 1ZRIA 4CDUA 5E1AC 1V9PA 4BIFA 2QWOB 1FX5A 5J96B 4JGYB 1U0AA 4DPNA 4JI3O 1TQ5A 3BU0A 4MXWB 1HB1A 2QZ3A 2RDSA 3VBRA 1QR9A 1RVF1 1WD3A 4BPZA 4DUZO 3ZMVA 4A7YA 4LBEC 5LY2A 3BTZA 4GJYA 4FOYA 1QJEA 4CU8A 1AI4A 2Q8VA 5FUPA 4ZHQB 5JAXA 5CN0A 1EV13 5DN2A 4ONUA 1ZL8A 1DQ6A 2ZX1A 1F5JA 1RUD2 5TSWA 1P8JA 5FZ0A 1PIV1 2ET7A 3JD73 3SPGA 1S0CA 3HD8B 2FB5A 3TEXA 3SKJE 1A6CA 1O3SA 1XREA 5FLXN 3VBFA 4B7KA 2WQZC 4NTYA 2LUWA 2XJVA 4IEQA 4FMTA 4B3RO 5CB7A 2DTWA 3S3XA 5FZOA 4KFMA 3BN6A 3VBSB 2VMDA 1YIJV 1YZBA 1EFRG 3TN91 4IEOA 2UUCB 2WAAA 1W8UA 4CPBD 4FSJA 2ZZQA 3ROUA 1YFYA 1SDWA 2W52A 2DU1A 2HKOA 1ENRA 1LOAA 1RXFA 1T6GC 4AVBA 3VKFC 2XKOA 4LO4B 3VBRB 2P34A 4PF5A 4CDWC 5HBAA 2NMOA 3QCWA 1YFXA 1HRV1 2CH7B 1Y9MA 1YXWA 4Z2WA 3VDCA 3LDEA 1V6LA 4GX1A 1O3TA 1LHOA 2Y48A 2G38A 3CXHF 4NRPA 1LEDA 4YVWB 4MVOA 3OJBA 2YXYA 4M4PA 1HRI3 2MEV2 1ZL8B 5GZFA 1SQGA 3S7IA 4AQ6A 2IJJA 5A1AA 2IVIB 4FFGA 2PTMA 1OOPC 1CPMA 1R093 2OX0A 4OUMA 1Y74A 2P6JA 4FPFA 3NNGA 4DO0A 2Z2SB 4ATFA 1HQLA 1PHMA 5A80A 3VBFB 4HK9A 2W5FA 2D5FA 2JG8B 3IAPA 2DWEC 1S0EA 1JODA 1EZJA 2VMIA 2WNUA 5C5TA 2EZPA 4FJCC 3C3VA 5B1AC 3ACHA 2LGQA 1S5JA 2NZ9A 4CDXB 2RNBA 4DR1O 5GTIZ 2VULA 4I5SA 4FPHA 4MW3A 2VE1A 3UCSC 1QDOA 2OT5A 1L3JA 3ABKB 4MGIE 4QDSA 4JCKA 1QOOA 2BOIA 4O7XA 5K0UA 1CEZA 3CNAA 1BK1A 1PO11 1AR1B 3EJKA 1SLLA 5IHRA 1K5MC 4QX7A 1RL3A 1UZYA 2I2SA 4YY3B 3WW2A 1N1SA 4P5YA 2RR11 3RT3C 1JS9A 5KAIZ 5JJEB 1A34A 1VE0A 3PUHA 3CRAA 4KP4A 1DLCA 2B7YA 4Q4V3 2NLJC 4XJWA 1JMUB 1PMHX 4UCUA 4XBFA 5IK5A 3IMNA 1HJGA 4Q0SA 4AHZA 1SQPH 4IEPA 2DTYA 1H38A 4WVWA 3ZRWA 3KF3A 1EAH2 5EP9A 1M4UA 4UWDA 4QXHA 4XDPA 4R9DA 3AVSA 4IGGA 4JI6B 1ULPA 1R3IC 4BQ1A 1YF2A 2ZIMA 3WCRA 2KXLA 3IIAA 2WLMA 3UJQA 2JGUA 4AF9A 2OYQA 2FMDA 2OIIA 4Q20A 2X6BA 5D5PA 3JCZA 2Q5ZA 2QA4V 4JPRA 3MIHA 1EN4A 1H8VA 1VBB2 2CNAA 2VOVA 3ES4A 3IM0A 2QM8A 1V6OA 2XLGA 3VZLA 4P9PA 3AC0A 4BIOA 5CKNA 4GULA 4R9CA 4K40A 1CQ9A 1HNXB 1X59A 2NM1A 3MLLA 4RO2A 4MSVA 1SHWB 5A7QA 4FXKB 1ZREA 1AR63 4AQTA 2VOKA 1LHVA 3POGA 2W6JG 3V64A 5A3NA 3W21A 2HWB1 2Q7HA 1XHZA 3BGAA 3J7LA 1W9YA 1WNSA 3GZTB 1CESA 2IXCA 4CDQA 3IFXA 4TT3G 2WLQA 3DPRB 3B93A 3ZN1A 4LE3A 3T2OA 4X66O 2E31A 1V70A 1CPYA 2YBPA 2HR3A 3WQ0A 1IBMB 5KXCA 1IS5A 2E33A 2QZ2A 2ETNA 2KA3A 2VZVA 4PV1B 2CTWA 4ZY9A 4B08A 4BA6A 3FAVB 1IVSA 2IM9A 4LFAO 2DWDC 3AG2C 4FO9A 5KBFA 2VPVA 1AX1A 3HT1A 1N33O 4AZZA 3NV3A 5C8YA 1QVGU 1Z5WA 2CWMA 3LE0A 1I08A 1Z7S1 1BMFG 1YI7A 5H6RA 4I3PA 3UM7A 3JBG2 3KQ4B 3WCSA 4BM8A 3PMSA 4OXSA 3E2EA 4LULA 3NMBA 5KXDA 1YQ8A 5JXGA 4R50A 1IGOA 5EWSA 4HXCA 1UYZA 3BAAA 1TVKB 4GJZA 5BMVA 2E26A 1TE1B 1QQP3 4DRXA 2ARAA 1PGSA 1R1A2 2B45X 4HKOA 4DV3O 4CCNA 3ZYJB 3B02A 2QQJA 2Y6LA 5IK8A 4MTGA 1ND3B 2RCVA 1K3IA 1SPPA 2XJUA 3VQWA 5JJJB 1WCDJ 4FFKA 1W2UA 5F3GA 5CISA 4O2BA 1TUBA 5JSOA 3S0MA 3PUIA 1GTOA 4KWLA 1DGLA 2BCCH 3N2GA 2O1QA 2VM9A 2ZDIC 2AZ2A 3VGIA 4TYSA 1AR83 3LEIA 2DDUA 4CC6A 2PAKA 1QJX1 2LRPA 4XCBA 3VN4A 4HN0A 4RSUA 4JC1A 4LIVA 1NT0A 1XNQB 2ARHA 3VHOA 4HKWA 3FB7C 4K3UA 4HPKB 2RM21 4YVSB 3W5MA 4MGTA 2F23A 4TSFG 3ZHVA 1XNDA 2IXJA 3PVEA 4EEQA 1SKVA 5EIYB 4QHZA 4PI2A 4DRRA 3H7JA 3Q8EA 3UGFA 1W28A 1JHNA 4KU8A 4KUMA 5J36A 5FYCA 3J4UH 3OYWB 2A79B 4LNUA 2XQXA 4NXMB 1AX2A 1GN2A 3WG7B 3VQYA 3KGZA 2JVDA 4HL0A 3LFIA 4BXSV 1KB9F 1UPGA 3P30A 1UX6A 4LF6B 4DR7O 4WM7B 1V0AA 4GX2A 3RYHA 5J1XA 4P9YA 1BKZA 1GUIA 4CCOA 4O2BB 3OD0A 1C8M1 3K08A 5LBEA 2PA7A 3LA3A 3K4ZA 1O4ZA 1FXKA 4AHWA 3KB5A 3MEPA 4MX3A 4Q27A 3I2FA 2IH1C 3D3IA 1JYNA 3HKBA 4B1LA 4QXKA 4FFBA 1I5YA 5FY8A 3VLBB 1RUE3 1F8VA 3TNPB 5LEKA 3O9OA 3O0VA 4UXNA 5C8CA 3HT2A 1ZBA3 3AG3C 1QLEC 5F8PA 4Q26A 4ABMA 4HMZA 4LKSA 1DZQA 1E5IA 5JOYA 4OUEA 4ZS3A 2JEUA 2BDRA 1S72V 1W0KG 4AHYA 4LKFA 4CU7A 4NUBA 4DNYA 2BRTA 4J7JA 2ORXA 5F39A 1LR5A 1VALA 2JDNA 3RWKX 1XBLA 1M06G 5H2FZ 3PNAA 2DWRA 1W2NA 2R073 2A7WA 3NV2A 4LNUB 3KV4A 1GM7A 3MIEA 5CFCC 3AP5A 2XJPA 1OH4A 4DV4B 4EFBA 5D8AA 2CYFA 1LKNA 1K9MW 4OHVA 1PNKA 2FDKA 2Y6FA 1WMXA 3RYHB 3A23A 4YZ4A 2BVBA 3H8UA 3AJZA 3N4MA 4X1IA 5EZYA 1VQ8V 2DE0X 2XUMA 4Q4Y2 4MZUA 1FXKB 4RGGA 5BXZA 1UY0A 3AFGA 1DDLA 1US6A 4N23A 1KKCA 1OCZB 3WNKA 1JHJA 5IYBO 4BZ4A 3HKBB 2VJXA 5DZFA 4FFBB 3WU2Z 3RRDA 4ZU7A 4UBGA 2XPJA 3SH5A 2RDRA 2Y6GA 2QM4A 3UKNA 2CDOA 4J25A 2AYHA 2VY0A 4DV5O 1I6XA 1EUTA 4QGMA 2FQPA 4MGZE 1MSDA 3WG4A 1PO22 1VQMV 5BNPA 2R1BA 4DR5B 3RZLA 1MS0A 3EQEA 1N1YA 5F3CA 1NQDA 4CH5A 5ABJA 3APQA 2P90A 4UCSA 3WY6A 4EWDA 5LMNB 3BCCH 2QVSB 4B7EA 4ZKIA 2BV4A 2ZKLA 4YFZA 4C7UA 4K0KO 5DAQA 3S7EA 3UV9A 4R52A 2Y64A 1PGW2 3FHQA 2OT7A 1BS3A 3QVNA 4UFLA 3WQ7A 1W2AX 3ZBHA 5BY5A 4EWEA 1QJFA 5D8AB 2PI4A 1ENXA 2VR4A 3KWVA 4DUVA 2LQTA 3ST7A 1R081 4PD4F 1WW5A 5HI0A 3F7VC 3FYIB 2WYSA 2AHZA 2B46X 4TQDA 1GQPA 3ZXKA 4UBHA 2VVDA 2WSUA 2ZBJA 3K3WA 3OUFA 1H8EG 5DDJ3 4NVPA 4Q2FA 3TOJA 4INDA 4ARXA 2Y0OA 2ZOEB 1H8TB 1PNMA 4GWMA 5FXZA 2BP6A 2X10A 3UT0A 2UYAA 4MVQA 4ZHNA 4PA7A 1GQHA 2WAOA 2QNKA 4NHKA 1MSWD 5H9CA 3JARA 4RS5A 4BIZA 1XOYA 1FV3A 2DBIA 4MTOA 1HN1A 1L0LH 2V5DA 3KVAA 4CEYC 3VQVA 3M1HA 5IYCO 1R6TA 1OCOB 5K7PA 4YZ5A 5KLVH 1J59A 1KD7A 1LHWA 2P37A 2DMXA 1YLLA 4RL7A 2EXKA 5JOXA 3LDDA 4I01A 4TLFA 1ND2C 1EBOA 2VQFO 4P9IA 2CTPA 1JOJA 4UFMA 1ZBE1 4JTNA 1W6PB 3NAPC 3VZMA 4CCJA 4XQ4A 2PUSA 5FMOL 2QQWA 3CLPA 4DXSA 4Z1VA 1D2QA 3CHXA 3AKQA 2YY1A 3VBOC 1N47A 4DR6B 4CXYA 2QQMA 3HKEA 3ZFFA 5FP3A 3SYPA 4X8AA 3WINE 1JW6A 4NRQA 2VZUA 1ULEA 2R49A 1O7FA 3DYPA 2WLNA 2LM3A 2XAJA 2ZJCA 1VJ2A 4XMAA 1Y67A 3TRSB 4KHPO 1VR3A 4YARA 2EILB 5I93A 2R062 3CRRA 1J5EB 4LF7O 4FTSA 1NJIW 4DR3O 1GWKA 2ZEXA 5FNVB 4J41A 1AVBA 1NLSA 1AL23 1WUVA 3USUB 3UK9A 1KFXL 5DMYA 1VBC3 1YTFB 2ZE5A 3BU7A 2GC2A 1JH5A 4XVHA 5LK5A 1KC8W 2WLJA 2XJSA 1US3A 3LNMB 4C0BA 1RUJ1 1PM9A 2KD7A 1REEA 2JB8A 2YI9A 4A7KA 5BNOC 4Y1YA 2XHNA 4LWSA 4CP2A 5CFDB 3P3PA 5JCTA 2ADQB 2Q8EA 2XAGA 5B1BB 4IV1C 1W8FA 2Y33A 1HR0B 2LS6A 1AYN1 3HKEB 1KGYA 1PK6C 1D4M2 5FREA 4RQPC 1Q82W 5L3BA 1JTZX 4Q29A 5EJ1B 3JU9A 3H0OA 3A22A 4CP1A 5A3PA 2XAQA 2IU3A 5A1LA 1HB2A 2YHJA 2ZE7A 1OVSA 2ARBA 1HP8A 4LA3A 3OE7G 4NO4A 1ZM1A 1VBA1 4J7KA 5FDBA 2P67A 1SEFA 3G6EV 1KP3A 3MUZ1 4HFSA 3O1TA 4E27A 4H14A 2E63A 5T5JA 3IC7A 1V55C 3D6EA 3B7MA 4YW5A 5ACA1 1OCRC 3I2DA 5IJ0B 1VF6A 3JAKA 1GO3F 4QGPA 3ACLA 5FBJA 3I3QA 4XHBA 1EM1A 1ORQC 2VNRA 1YQ5A 1VQOV 2BERA 4WFFA 1COV2 2DCKA 4N43A 2P22C 4IV3A 5DUXA 3ICXA 4JQTA 1EP0A 4LKEA 4LWSB 4F6EA 3SC7X 1DTOA 4IE6A 4B4RA 5CAZA 5IJ9A 3THPA 1H1IA 2CGOA 1ULOA 4G9SB 4G2KA 5FCCA 1KS5A 3G6JB 2PI5A 4FAGA 2UXCB 4QDQA 5I0SA 1BSMA 5A33A 1DLLA 2B4KA 2WR9A 4I55A 3LAGA 3E8BA 3ZFGB 3CKHA 2E75B 1REDA 2WWSA 5L7OC 3LA2A 5FYMA 1QXPA 1WZXA 4K20A 3ME2A 2B39A 2VQ0A 1K5JA 4FVVA 5DZEA 1I7FA 1DCSA 5FYHA 3VQXA 3M3EA 2BJSA 4CH6A 3ZS8C 1HN0A 4OI4A 3KF5A 1U96A 1Q6UA 1E5HA 1H9WA 3JAKB 2C1FA 4LE4A 4W4LA 3MGUA 3BPSA 1I0HA 1SDDB 5FP8A 3J8F3 2F4LA 2XXZA 2G4IA 2LFSA 4N43B 2X09A 3T30A 4IV3B 5LBQA 5JZGA 1WAZA 3T2MA 2HLDG 2VBDA 5C3SA 3ZN6A 1W59A 3CX5F 4X8NA 5GLWA 4B1MA 3BKZA 2WNVC 3WQBA 3VDAA 1W3XA 2ORZA 3WDTA 3OMAB 2YU2A 1HRV3 2ZTNA 1CX1A 3WP4A 1BL8A 3NXSA 3USSA 3ZKUA 5A33B 1V54B 1LHNA 4I55B 4AI2A 1W0JG 2OVUA 3AP6A 2UUBO 3ZMZA 1NCQA 4MGQA 1LNSA 4MS2A 4CEWC 3ZSLA 5SV8A 3B9IA 3U07A 1RHI2 2VOWA 3K2OA 2D3RA 2R043 1YJNV 4U7NA 3ZX6A 2RS11 1YJ9V 1K8AW 4QPYA 5IWAB 5L3GA 5LYJA 1WCSA 2EXIA 3DEMA 4PDWC 1JYWA 3OBZA 1VAKA 4P5HA 4PA3A 3IAYA 4QMAA 1VP7A 3AXDA 4E2LA 3IKWA 3PMEA 4OHWA 3WF4A 1XC6A 1YIPA 5IVYA 4TOIA 4AILC 1UMIA 4P2ZA 2Q8CA 5JZGB 4NHYA 3N7JA 3CL1A 2VZQA 2WLHA 5F2WA 1O3RA 1KRIA 5F9TA 5DN6G 5FLHA 4JI0O 1GZWB 5FJHA 4AEJA 4QXCA 4JV5O 2C2AA 4A41A 1HDKA 5LA6B 2E5LB 5AC92 1Q7YW 4LLFA 2HJDA 3VBHC 3HOBA 2ARXA 5IK4A 3FB8C 4AGGA 1RUI1 1I5ZA 4ZPIA 3KSCA 4LPLA 4BE3A 4AI3A 2YU1A 3E22B 1ZRRA 1TNFA 3W20A 2VCBA 1FPN2 2VVFA 5LHHA 4XIKA 4BQWA 4GX5A 3H1LH 4I7ZB 4BDVB 2OTLV 5LATA 4IIJA 2FCVA 3OBAA 1JZ6A 3KMHA 5LYJB 3OTOB 3MW3A 4ASKA 1AYM2 1PGL2 3ETQA 2F4VB 1RUC2 1CIYA 4UCRA 4YM2A 5F7UA 2Z0AA 4RHV1 5JSRA 4NIDA 4I0XB 3LA7A 2LTNA 3RYCB 4ISQA 5LL6Y 3OGGA 4FPEA 3AZYA 3H1WA 5BV6A 1Y66A 5DXDA 3WG1A 1MS3A 2JG9C 3T1HB 3KCYA 1FMD2 2JEXA 2OWOA 1ZWIC 2LP7A 4NAMA 4LH6A 1XQNA 3E8HA 4CDWA 3TEWA 2YIDA 3OPWA 1PNFA 1XHXA 4QB2A 4N21A 4QX3A 4XACA 1OCCC 4E4HA 4DZGA 1OQ1A 1GMGA 3OUHA 5H9RA 1V9U3 5IJRA 1JPXA 2VO5A 2WFF2 3H7YA 1VMGA 5JIAA 2QQNA 1F4HA 1LESA 3NQHA 1POV3 2WUHA 2B8MA 3D8CA 5F32A 1HNWB 1S55A 4RGAA 1OOPA 1QEXA 4GMP1 1ZTEA 2XBO1 1RMU3 4EV0A 4M0HA 5KA6A 2R32A 3SISA 3LEKA 2OIEA 4IIJB 2OZJA 1RXGA 4L11A 4YRDA 3OY8A 5L3DA 3S5QA 1UKGA 2QDOA 1IS4A <