1I5YA

Hiv-1 gp41 core
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWAIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSMEMBRANE GLYCOPROTEIN (GP41)
publication title Structural and functional analysis of interhelical interactions in the human immunodeficiency virus type 1 gp41 envelope glycoprotein by alanine-scanning mutagenesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 26
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1i5yA00
2OT5A 1QBZA 3P30A 4JPRA 5CMUA 1EBOA 3M99B 4N23A 1MG1A 5CN0A 1Y66A 4JF3A 1JPXA 1K34A 5H9CA 3MHSC 1DF4A 4E2LA 1I5YA 3MHHC 4JGSA 3B8MA 5HFMA 2LP7A 3CYOA 1JQ0A 1MOFA 1K33A 1QCEA 1DLBA 1DF5A 4FK5C 2MK3A 1I5XA 5HFLA 1Y4MA 4FJCC 1QR8A 1SZTA 2X7RB 4G2KA 3H01A 4FIPC 1F23A 3K9AA 3WFVA 2EZPA 3GWOA 3B8NA 2EBOA 2P6JA 3CP1A 4N21A 2M7WA 1QR9A 2EZOA 5KA6A 5KA5A 1ENVA 3B77A
chains in the Genus database with same CATH superfamily
1HNZO 1WA8A 3AG2C 4D7TA 5B1OA 3F5TA 2E5LB 3OE7G 3K59A 1H2KA 1HNWO 1GK9A 3PN1A 4MW3A 1WN7A 2RJZA 1L1FA 3HKDB 1F4NA 4ZOLB 3CXHF 5J2UA 4DV0B 3HB3B 1RP3B 2GV9A 5J9PC 4MTXA 3K5LA 4RAIA 4O4HA 1FYJA 5KA6A 3K5OA 3ETQA 5IJ9B 2H3OA 2LW1A 2ZNJA 2D2CB 3QO7A 2Y0IA 2ZXWC 2O57A 1SC5B 4BWAA 1S77D 1WP8A 1Q6HA 2DJVA 5JH7B 1KB9F 2WLKA 3DGEA 3CCSV 2ZKOA 1M57C 5BMVA 4DR1O 2P90A 3P32A 3CB2A 3IC7A 3RYHA 1Q82W 4LF9B 1KU9A 3JASA 3OMAB 1XMOO 4OGQB 4IT5A 4I4TB 1M56B 3HKBB 3UQ8A 3ASOB 4JV5B 3OTFA 2PZSA 4TV8A 5KHGA 3N2GA 3SPGA 1KP2A 4WFGA 1SF9A 3CP1A 3Q4HA 5DM6V 1R6TA 4FLUA 2PF4E 3X2QC 5CBFA 2A7WA 3ABMC 1NR1A 1PPJH 2JVDA 3QO8A 5CB4A 1XMQO 1MA1A 4MVZA 2YXHA 3UT5A 4JYBA 1F4MA 5B5EZ 2WWWA 1WPXA 4DR3B 3CCRV 1R1BA 4ABMA 2F93B 3T1HO 2YDEA 4MSWC 2A0LA 2H94A 4BIOA 5AG2A 1FJGB 4QIWF 1GRJA 5JJNB 4ZI7B 1AP5A 2JS5A 4X1IA 1AB3A 4CZZA 3HPLC 4ZIBA 2VWJA 4O4JB 3CCUV 4NTXA 1YTFB 1RM1C 1FD9A 1L8DA 1V55B 4UCSA 1FXKB 3JATA 4KFMA 3O9OA 5L3CA 5D5PA 1BS3A 1QR8A 3U0ZA 3J80N 2JJ1G 4JZGA 4DK1A 5IYCO 1SRYA 3BRCA 4DR5B 3JD1A 4PDMA 3R65A 3H1KH 3B4SA 4LH6A 2UXCB 1TAEA 5LOVA 4WBNA 2QM8A 1GTOA 1QLNA 2WLIA 3VBBA 2P5OA 4H33A 3K04A 2UXDO 5KMGA 4PDVA 1PL0A 1THZA 4JYAO 3J7AU 2LGWA 2FKXA 2PTMA 2W0FC 1FPOA 2EZPA 2JK5C 5EC2C 2LO1A 3B77A 5J2TA 1K4CC 5LYJA 3ZN1A 4DV4O 1VARA 1L0LH 1K7DA 5E79Z 5TISZ 2F1MA 3SYAA 5C93A 1PD3A 2DYSB 2NNUA 1JJ2U 3NXSA 3A0HZ 5IWAB 2HLDG 5H2FZ 2WA4A 1ROPA 5BR8O 4ZOLA 3U11A 1GN6A 2XAJA 4DV2O 1US6A 3B8NA 4NB5A 2Q68A 5KHJA 5IYDO 1CEZA 3R66A 1I7FA 5IJ9A 1NS1A 2V7QG 1PNMA 3I5DA 2VWKA 1Y4MA 4LFAB 2F4VO 1NU1H 3CHXA 4PDLA 1BSMA 4FM1A 1F23A 3K58A 3JD2A 1XL4A 2YXLA 3RN4A 3E35A 5JH7A 4F6RB 1E1RG 2LQTA 1YEWA 1BMFG 2CDYA 1ZUQA 2RNBA 1B6QA 3CRQA 1IXMA 4TV9B 1JR9A 2E5LO 2VRZA 3EHBB 1JQ0A 3DC5A 4I55A 1DLBA 4HBNA 3SYOA 4FLVA 4CBCA 4UUJC 3IGAC 2QKCA 2XNDG 5JQGB 3BABA 5L3FA 1Y74B 3K08A 4B7EA 4JI8B 4LR3A 5CMUA 4LFBB 1GKFA 2Q6AA 1NTZH 3AG4B 2BCCH 2UUCB 5KX5B 4DV1B 2ZE6A 1IBMB 2HFEC 3G67A 2P22C 3CE2A 1M1KW 3UKMA 2ODMA 5CBHA 1KQSU 3K0GA 2QA4V 2BE3A 4LBEC 3JAWB 4ZHQA 4DV6B 1R6NA 4QPJA 2ZIMA 3C3TA 1SQGA 4LF9O 4QJFB 1JPXA 4O4JA 4X64B 5EBMC 4JV5O 4LF8B 2GHYA 2BTQA 2DMXA 3K03A 3K3WA 1PKXA 3AG2B 2OIEA 3L73H 5B1BC 1Z5WA 2KG7B 4J10A 4Q20A 2VQEB 3OM3B 3SGIA 3WB1A 4FLYA 4I50B 3H1HH 2Q69A 4DR3O 2QKSA 1VQPV 2QTSA 1NQTA 4RWUA 4ZKIA 3SJBC 4X1KB 1RSOB 1RPOA 2ZXWB 4U7OA 5DECA 2ARHA 1M57B 3OUFA 3JD4A 4B3SB 1EN5A 1R3IC 3P3NA 4JTDB 4EKWA 2EIJB 3KCYA 1TUBB 4QPKA 2IU3A 1IDSA 4DR5O 2WPDG 2VQFB 3IAYA 1H38A 2IH3C 4X9QA 2ZE7A 2UXCO 4JZ2A 3F7VC 2FL4A 4GX5A 1H2GA 1LNQA 1M93A 5LA6B 3GB7C 2DW4A 1MSWD 1QQCA 2IJJA 4LNUA 3X2QB 3ZHVA 3RYCB 1FAFA 3ABMB 1OHHG 3CSXA 1R3JC 4BIUA 3TJTA 4KP4A 4O2AB 4F6RA 2Q0OC 2OYQA 3OAAG 3K0DA 4NXNB 3OR6C 1MMMA 2OWOA 2YXYA 5IWAO 3IFXA 2WLLB 1RM1B 1FFTB 4NVPA 4JPRA 1Y74A 1WA8B 5CN0A 3RWRD 3T4ZA 5JVDA 1YSCA 2LP7A 3G6EV 1MOFA 5J2UB 1JOYA 2GDSA 4LFAO 4X66B 3BVOA 3ETDA 1X4TA 3CCVV 3JAWA 2N05A 1MG1A 3DSQA 4NKGB 4EB6B 3OMNB 1VQOV 1P7BA 3LSUA 3CCJV 4FM2A 2QR4A 4I0XB 1QR9A 3RYHB 3FB5C 1N0JA 1XNRB 3BA8A 2PUSA 4JI8O 2JDIG 3FAVB 2KG7A 4CH6A 4LFBO 3LSQA 1S5HC 3ML0A 2UUCO 4DV1O 1IBMO 1VQ4V 5LGTA 4TV8B 4J9ZB 3SJQC 4AHCA 2WA3A 4I50A 2CH7B 4FZ0A 3CCMV 3Q4HB 1SKVA 2ZD9A 2H8PC 4J80A 3DTUB 4UFZA 4YJ2B 2EX3A 3TCUA 4DV6O 3RVZA 2K9PA 4KXRA 3SYPA 1XNQO 2Y4UA 1SERA 1GN4A 4X1KA 1RSOA 4F4LA 3BA9A 4X64O 3QNEA 4LF8O 5K1XA 3AG3C 5IY5C 3GWKC 4JYAB 1AILA 1T5EA 4PA7A 3CMEV 1EM1A 5KHHA 3OUSA 1TUBA 5LXTB 4X89A 2QWNB 4X1IB 1HW7A 3P30A 5IYBO 1N8RW 1V54C 2YC0A 1BHAA 1Q8IA 1VQ5V 5HFMA 2VQEO 3QF7A 1RFYA 2CGNA 1NVPB 2RMKB 1N34B 3ZEDA 3RYCA 4BAYA 3A2FA 4B08A 4X62B 3RVYA 2K1EA 2YIAA 4MVUA 5KUMA 4WBNB 5LOVB 3AG7A 4XDKA 2L35A 1K3EA 5KMGB 2QEXV 1LUWA 2X6BA 4B3SO 4KUMA 5IT9N 3OGCC 1B06A 2IW5A 4RQEA 2WLLA 2OCCC 4CH5A 2ZQMA 5LYJB 2Q4PA 1DK1A 2CK3G 2VQFO 4I9WA 5IYZA 2Y4TA 5KLVH 1XQ8A 5L3BA 2N04A 3ICXA 4CS3A 4LFCB 3FKSG 5B1BB 1K92A 2F66C 5L3EA 4UV8A 1SETA 2Q73A 1Y76A 5A9GA 3BFRA 2Q7HA 1YDXA 2Q0AA 4NXNO 1Z2GA 4JAUA 4O4LA 4EB6A 1VF5B 5CBGA 4CH4A 3E86A 4JI1B 1BL8A 1GM7A 4ZBMA 4DW0A 4TT3G 3W7SA 3CC7V 3OEHG 1V9PA 2F43G 4JYYA 3E8HA 5LHGA 3FYIB 4I0XA 1U97A 1IBLB 1HR0B 3E8GA 1B3QA 2DWDC 3FAVA 1LR1A 4JASA 1GM9A 3DXRA 4I55B 4JAAA 4BIZA 2ADPA 3N2KA 1OV9A 2AZ0A 3CCEV 1SZTA 4K0KB 1XREA 3OEEG 1YITV 2BOCC 2CTWA 1ZWIC 2HVKC 2AHZA 1K4DC 4X66O 3MD0A 2CH7A 1PNKA 2M7WA 3KZIZ 1PL4A 5CA3A 3ZRXA 1KD1W 1UFIA 4FMTA 4YJ2A 1SS3A 2JGUA 1NZ6A 4TSFG 3RYIA 3AEIA 3BPZA 2IH1C 1GMGA 5IDJA 1I5XA 3QG5A 2ATKC 3I55V 3G6BA 1CP9A 1EFRG 2HKOA 4OX9B 4PDRA 4X8AA 3I56V 1IBKB 5L3DA 4ZHQB 4DR2B 4N21A 3CC4V 5LXTA 4FFKA 3QO5A 3B09A 1XNRO 3H1LH 4FZ1A 3TETA 1JX9A 3SPHA 4UCVA 4X20A 3B8MA 1PNLA 3KG2A 2BTQB 4CC5A 4LF6B 1NTKH 1IVSA 4O2BA 2UXXA 3BCCH 4BW9A 4HNAA 3WFVA 3GWOA 3M7MX 4MVSA 2Y48A 4MTOA 2Z5UA 3CPWU 4L87A 1QBZA 4LH7A 4X1YB 1S72V 1BCCH 2JEXA 4GUNA 5JCOC 3AK3A 2G38A 3T1CA 3MHHC 5A2QN 4QE7A 1Q6IA 1AR1B 3S3WA 5H6RA 3K5MA 2KB1A 3H01A 1I94B 3CS5A 3SJCC 2BTOA 1GH6A 4R8CA 3RBZA 5FNVB 5KA5A 4NTWA 2A9HA 5H6QA 1WAZA 2N74A 2YI9A 4UCTA 1H2NA 1D2DA 1AI4A 1EN4A 3ZIAG 2LW7A 1AJPA 1W0JG 4W4LA 4FLWA 2BSKA 3CYOA 2PYJA 1NH2B 1VQ9V 3SPCA 1N34O 3VQXA 3CC2V 1U96A 4B7KA 1URFA 4Z1VA 3F5WC 4X62O 2YEVA 4WFAV 2A3QA 3UCSC 1JCHA 4TOIA 3E8BA 1DF4A 4P9PA 4X88A 2Z0AA 3OMIB 4IYIA 4PA6A 2PYLA 3UO3A 4LNUB 1D5NA 3ABUA 1ZLZA 3DC6A 2QWOB 4DK0A 1N36B 3ZMUA 3HR0A 4DV7B 5C8YA 2ZDIC 3G4SV 2OT5A 4JYCA 2QKAA 3A8TA 3OTOB 1Y66A 3AG3B 5IY5B 1Q3EA 3H1IH 1P84F 4LFCO 1AR5A 2A79B 2BOBC 1V54B 2QSAA 5B3SC 3LDDA 3KCXA 4XDLA 2AZ2A 3TXSA 3WU2Z 3RW0A 3OW2U 5JVDB 4MT8A 1MABG 3JD0A 1X59A 4KL1A 4UCRA 2OCHA 1F51A 4MTGA 4OPAA 4G2KA 4JI1O 1WB7A 3CRRA 2R70A 3WG7C 4FM0A 2Q7GA 2XUMA 1AI6A 1EBOA 1P4RA 1IBLO 1HR0O 1XNQB 2ADQB 4ASUG 2RQ6A 3ZMZA 1K34A 1A32A 1N4CA 4JGSA 1R73A 2DQ0A 5LP6A 2OCCB 3BY6A 4MTFA 2QE7G 4K0KO 3K79A 3E2EA 1DGSA 3C90A 4JI3B 3L74H 3SDLA 4U3JA 4X1YA 4UCOA 5KHKA 1GN3A 4U3FH 2QWPB 2ZIOA 1S5JA 1K9MW 1DTOA 1Q90D 1OCCC 1NKDA 1SQQH 4DO2A 4DUZB 1YHQV 3ZJZA 4OX9O 2KKWA 1IBKO 1FXVA 4DR2O 2GBOA 2P06A 5FNVA 1BZKA 4IIJA 3E22B 2XT9A 1I5YA 4YY3B 2Y69C 4YIPA 4RQFA 1FKAO 1WNSA 4LF6O 4LF4B 5FPRA 1YVWA 4IHJB 3JYCA 3HKCA 1R6KA 4J7JA 4JI0B 2YSUB 1SA0B 2WSSG 4PA3A 4LF5B 4DXWA 2B9ZA 1ZL8B 2IBZH 2RN9A 4G27B 4K3AA 2LJ2A 4DRXA 4FJCC 2XTAA 5D5QA 4GKKB 1JVMA 1I94O 5KUKA 2KQXA 4AI8A 5KAFZ 3RYFA 3FFQA 2FTKA 4LP8A 2HJFC 4J9YB 1EZJA 4WFBV 3SJAC 3BAAA 4DR7B 3L72H 3FYEB 4LWSB 2YIBD 3HKEA 3ABLC 4FLTA 3JALB 5IJ0B 1S5LZ 1M90W 2ITDC 1K5QA 3M8AA 5LP6C 1COWG 4FLZA 2X6CA 3ZMVA 1JJOA 1N0NA 2R9IA 4IYHA 4N23A 5IYZB 2X0LA 4WCEV 2CTRA 5EIBD 1NI8A 5LMNB 4DV5B 1QLEC 4IGGA 4LF7O 1KC8W 5FL7G 2PY5A 4PJ0Z 4B3RB 2F95B 3IC9A 3JARA 3D36C 1Y76B 2HHHB 5CA0A 2Q9LA 1N36O 1L0NH 4DV7O 2YIDA 3ZX6A 4C7UA 4CS2A 1VQNV 4JI6B 5LHHA 3OTOO 1OCRC 3ABTA 4O4LB 3WB2A 2YS8A 3TGUH 1ZSPA 1BT8A 1QVGU 5LBQA 2E75B 5LMUB 1M5IA 3A0BZ 2W0XA 2ZINA 1YJNV 2OTLV 4TUYA 3DXRB 2GUZB 2ZR2A 2DYRC 1VIBA 2ZCEA 3EFFK 4JI4B 3N2KB 5B1NA 4WFFA 3K57A 2JIZG 2XHBA 1Q5OA 2UU9B 1TGOA 5L3GA 1H2MA 3CD6V 2JEUA 1W2BU 2XAGA 5GTIZ 2B1GA 4DYLA 5LGNA 4JI2B 2YUAA 3CWBH 5EBLC 4GKJB 3RYIB 4I9QA 5B1AC 3L9DA 2UXNA 3E22A 1KECA 2JS3A 1XL6A 3JSLA 2AXTZ 5BXZA 3STLC 2HJDA 4R7CA 1VQLV 1WLEA 4D6TH 4U7NA 4IHJA 2X6AA 4WF9V 3L71H 3ABKC 1R3KC 2DOSA 2Q7EA 1SA0A 4CC6A 4JI3O 1NT2B 1ZL8A 4QGPA 3AK2A 4X20B 1BQ0A 1EN6A 4ICGA 2UXBB 4O2BB 5B3SB 3CJHA 4UVCA 2X7RB 4HNAB 4HYOA 4DUZO 1VQMV 1ZTEA 2R9AA 5LL6Y 2JRIA 1VEWA 4BR6A 5K1PA 4JTCB 4JI7B 1E1QG 4P2ZA 4DR6B 1TVKA 3SR2C 3S3XA 3H1JH 3ZRSA 3ZRVA 4K8ZA 5GW7A 4B3MB 4YHHB 2XOKG 4QE9A 4YY3O 4MW8A 4LWSA 1VQKV 2YICA 1MSDA 3WG7B 1MZFA 1Z5VA 4LF4O 1S76D 3JALA 5IJ0A 4FIPC 2NN4A 4JI0O 1W59A 2IU0A 1XI1A 3THOA 3FB7C 4LF5O 4J42A 2EULA 4LC1A 2GSMB 1BGYH 1S3JA 5EIBC 5H9CA 1GO3F 2BSKB 2FYUH 1EZVH 2QM4A 5EK0A 3JCUZ 5FLXN 1O9HA 1FXHA 4R50A 5JJJB 1VF6A 4GKKO 4GCZA 1XBLA 4NR1A 2YEVB 5JCOA 3LNMB 2P7TC 3ASNC 1YF2A 3O65A 1OCCB 4KHPB 3EVKA 4DR7O 5FPOA 3K9SA 1QCEA 1D5AA 3D3IA 5E1AC 3K5NA 4GZRB 3T1YB 4UV9A 2HEPA 2WLJA 2YI8A 4J7KA 5C8YB 4P9OA 1K97A 2ZE5A 1IURA 1XILA 2Y69B 1YJ9V 1J5EB 4XDJA 1VQ6V 2WLNA 4J11A 4FLXA 2CUGA 5LMNO 4O4IB 1ZX3A 1AROP 3L70H 4P30A 2GUZA 1K33A 4DV5O 4MS2A 3CRMA 5EZYB 1ZAUA 2QGNA 2QWRB 4CH3A 4FFBB 1SQFA 1WP7A 1WB8A 4PELA 4B3RO 4AQYB 2M6YA 4UB6Z 2UUAB 3JAKB 3ZHSA 1XEQA 2LFSA 2EIJC 4NXMB 4H0LB 2JJ2G 2WLHA 2HHHO 3K06A 1Q81W 4JI5B 2EIKC 3SPJA 2LGQA 1W0KG 1AI7A 4JI6O 1UJWB 1K8AW 1QHTA 2UUBB 2FB5A 1YXBA 1XOUA 3ZHQA 4YJ3A 2A06H 2ZDIA 3OGIB 1SESA 2P6JA 1CPYA 1PM9A 1NVPD 5LMUO 1O9GA 2AGAA 4G28B 2E76B 2LFRA 3ABLB 3CEIA 4PV1B 1FFXB 4RUFA 5LP6B 4JI4O 1S0VA 3VQVA 3VQYA 5BZBA 2UU9O 1XUQA 3CMAV 4XBFA 3CCQV 4K8XA 1ENVA 1HP8A 1VF6C 1AR4A 1QLEB 2DWEC 4U3JB 4JI2O 4GKJO 3UO2A 4GT1A 2EILC 5EYPB 1Q86W 1OCOC 1G1XB 2CTQA 4J7ZA 4DUYB 1SQBH 2ILMA 4UVBA 1NJIW 5B66Z 3FB6C 1VMGA 1I08A 4TWKA 1OCRB 4PI0A 2P4VA 3ZHRA 1N32B 2B1IA 4IIJB 3OD4A 1FS0G 2DE0X 3LNNA 2Q67A 2UXBO 1OZ0A 1SQPH 4MVQA 5EBWC 3HKCB 4GX2A 4TQDA 3T2MA 3K9AA 4X65B 2AW9A 4UCUA 4JI7O 2DYRB 4DR6O 3L75H 2QM7A 1BHBA 3P3PA 1XDCA 2Q5ZA 2DN9A 4B3MO 4DRXB 4YHHO 1SQVH 1GM8A 4LF7B 3HKDA 2OIGA 3RYFB 2P67A 4OPHA 5B1AB 4PA9A 3QTCA 4Z2WA 3G80A 4PHZA 2L6LA 1YIJV 2XAQA 3HKEB 4J41A 5JWPA 3AK1A 1OJHA 2EIMC 4O4IA 2IJHA 2JGDB 1M4UA 2ETNA 5EZYA 3ABKB 3AG1C 4NYKA 4FFBA 3CRCA 2EINC 4I5SA 3JAKA 5ITZB 2Q8VA 4RUEA 2NLJC 1OCZC 1JMKC 1ORQC 2XAHA 2CE4A 1NR7A 4I4TA 3HKBA 3JCZA 4B3TB 3SPIA 4KHPO 2MK3A 2W6IG 1YTFD 3F7YC 2V4DA 4DV0O 1VQ7V 2ZNIA 3JARB 2FMLA 3T1YO 2PI4A 5CA0B 4PD4F 4HAMA 3N27A 5GONB 4MVRA 1AJQA 3ZRWB 1YJWV 1J95A 1J5EO 1DF5A 1FFXA 4Q6GA 2AHYA 5BY1A 2PI5A 2ZR3A 4EFEA 1K5SA 1YI2V 4D7SA 2GTAA 4AQYO 1F7YA 2UUAO 3W7UA 2ITCC 4ZI7A 4NXMO 4TUYB 4JI5O 1GAXA 4AILC 2ZM6B 4DW1A 4L8JA 1BE3H 4MVMA 4QNHB 3E8FA 3APQA 3TXQA 5EYPA 2UUBO 4FK5C 4E4EA 1FXKA 3D36A 1N33B 5KHIA 4RO2A 4DV3B 3PJSK 1H2SB 1SZXA 2EBOA 3ASNB 1JFFB 2OTJV 3SYCA 1NH2D 2HP8A 5F2VO 4GLXA 4DR4B 3FD9A 5JJEB 1IXBA 5IE9A 1TA8A 1KUQA 3C3SA 4EEQA 4YIOA 4NTYA 1QNMA 3CRAA 1HDJA 1FJGO 2RCVA 3OFNG 1HNXB 3LUTB 4FPPA 1G6UA 3MAQA 1H8HG 4YXWG 1AP6A 2P4KA 3APOA 4R6ZA 2E74B 2IM9A 1R3LC 3CJHB 2GTSA 3VOUA 1M56C 4DUYO 3U10A 2EJRA 2XAFA 3ASOC 3JD3A 3ZHTA 1SQXH 1G8MA 2EIKB 2E3CA 3ZMSA 4DR1B 1TVKB 4F6EA 1HNZB 1Y67A 1N32O 2QWQB 4TQFA 1HNWB 3H9VA 1IX9A 1XHZA 3OR7C 4H37A 2F23A 1VP7A 5CA1B 3ETGA 4MVOA 2JGDA 2MW2B 3FX7A 4X65O 1H2LA 1NBMG 3SYQA 1IZ3A 5ITZA 2C2AA 3STZC 2D3OW 3ZMTA 1WJZA 1JA8A 2VS0A 1MZEA 3KKYA 4TV9A 3UM7A 4EFBA 1QVFU 3D8CA 1XHXA 3RFRA 3WB0A 2R9RB 3T4DA 4FVMA 2DQ3A 1V55C 1FXKC 5EC1C 1UPGA 5JQGA 2EILB 1CXZB 1G4YB 3IJ4A 2Z3YA 4HZ3A 1XMOB 3M99B 1NTMH 1OCOB 5GONA 3RT3C 2YIBA 4JF3A 3LDCA 2QJ1A 4OXSA 3ZRWA 3JAMN 5KX5A 2KSDA 3OT7A 4WFHA 3D3QA 1P7GA 2RDCA 3W7TA 4K35A 4O4HB 2IJKA 3ZHUA 2HG5C 2ZE8A 1QU7A 1M9NA 5LHIA 1RPRA 3ZCCA 4WFEA 1XMQB 2XASA 1BQZA 3A0RA 4B3TO 3T1HB 4PI2A 1WPBA 2B5UA 2ZT9B 2DYSC 5DEDA 3ETEA 3E89A 3ZBHA 4UVAA 5BMVB 3ZS8C 1KKCA 3GVMA 1JFFA 3JASB 2Y0PA 3J81N 3MHSC 4UXNA 1Q43A 4IL6Z 3N2GB 1KP3A 3CX5F 3W7WA 3CXCU 1VQ8V 4LCUC 4YJ3B 2PGGA 4H44B 3CCLV 1E79G 4CS4A 2EZOA 2CTPA 3EXAA 1YCIA 5DN6G 5CB4B 1KYOF 3TK1A 2EIMB 3UT5B 3BEHA 1KKDA 2ZM6O 4I7ZB 5KAIZ 1Q6UA 2EJ7A 3AG1B 2UXDB 1AJNA 1LUVA 5HFLA 2EINB 3FB8C 4Z1MG 3LSSA 1N33O 1GN2A 1OCZB 4PA4A 1I0HA 3B2EE 4GX0A 4DV3O 1K73W 1KBHA 2QDOA 2NR5A 4GX1A 3G71V 4DV4B 5LGUA 2CAZC 1HWYA 2QTOA 2WLMA 4JAVA 2R72A 4DR4O 4A5UB 4BW5A 1KMIZ 3MDSA 3ZN0A 4E2LA 2CGOA 2W6JG 3JATB 3W7XA 1H8EG 3AG4C 3E83A 1Q7YW 4JTAB 5LA6A 2IJIA 5BR8B 4DV2B 3BHPA 5CA1A 2HVJC 3VQWA 5H5NA 1TUEB 1MNGA 2WAMA 1HNXO 4O2AA 3JSNA 1AI5A 1Y6XA 2WLIB 3LDEA 2HR3A 4GYCB 4H13B 2F4VB 1PP9H 1AVMA 1B04A 3QVNA 2V1DA 3NR7A 1VF7A 1P49A 1YZBA 1PV0A 3B40A 5J2TB 4UB8Z 4W4KA 3RGBA 5GTHZ
chains in the Genus database with same CATH topology
2B1IA 1MG1A 3AG2C 1FS0G 5B1OA 3OE7G 2Q67A 3OMNB 1GK9A 4MW3A 1VQOV 1K9MW 1DTOA 1L1FA 1F4NA 1OCCC 1OZ0A 4MVQA 1NKDA 1P7BA 4DO2A 3CCJV 5EBWC 3HB3B 4GX2A 1YHQV 3ZJZA 3T2MA 3K9AA 5J9PC 4MTXA 4RAIA 1QR9A 5KA6A 1FXVA 3FB5C 2DYRB 2JDIG 3LSQA 1S5HC 3ML0A 2QM7A 1BHBA 1VQ4V 1I5YA 3QO7A 5LGTA 2Y69C 2ZXWC 4RQFA 1GM8A 4J9ZB 3SJQC 1S77D 3JYCA 1R6KA 3CCMV 3CCSV 2WLKA 3DGEA 2ZD9A 2H8PC 1M57C 2P67A 3DTUB 2P90A 2YSUB 3P32A 2WSSG 4PA9A 4PA3A 3IC7A 5B1AB 4DXWA 1Q82W 3TCUA 3RVZA 3OMAB 3SYPA 1SERA 4F4LA 1M56B 3ASOB 4G27B 1YIJV 2XAQA 3QNEA 2EIMC 3AG3C 2IJHA 5IY5C 4FJCC 4PA7A 1KP2A 3ABKB 3SPGA 3AG1C 3CMEV 4WFGA 1JVMA 3OUSA 5KUKA 3CP1A 5DM6V 2EINC 4I5SA 4X89A 2FTKA 4LP8A 2HJFC 4J9YB 3X2QC 5CBFA 3P30A 5IYBO 1N8RW 3ABMC 4RUEA 1EZJA 1V54C 2NLJC 4WFBV 1OCZC 1NR1A 1ORQC 2XAHA 3QO8A 1NR7A 4MVZA 1BHAA 3JCZA 3FYEB 1VQ5V 5HFMA 3SPIA 4JYBA 1F4MA 3ABLC 2WWWA 2MK3A 1WPXA 2W6IG 3CCRV 1YTFD 3F7YC 1NVPB 1VQ7V 1M90W 4MSWC 2ITDC 1K5QA 4BAYA 2A0LA 2H94A 2PI4A 1COWG 4QIWF 4HAMA 2X6CA 3ZMVA 4MVRA 2R9IA 3RVYA 4CZZA 1AJQA 4N23A 2K1EA 3HPLC 3ZRWB 1YJWV 1J95A 3CCUV 2X0LA 4WCEV 1YTFB 1RM1C 4MVUA 5KUMA 4XDKA 1QLEC 1K3EA 1V55B 1DF5A 1FXKB 4KFMA 5L3CA 2QEXV 2AHYA 1QR8A 1KC8W 5FL7G 2X6BA 2JJ1G 5IYCO 4KUMA 2PI5A 1SRYA 3OGCC 2ZR3A 1K5SA 2IW5A 1YI2V 4RQEA 2WLLA 2OCCC 3JD1A 3W7UA 4PDMA 2ITCC 3R65A 2ZQMA 2CK3G 4I9WA 1VQNV 5LHHA 1OCRC 4MVMA 4QNHB 3E8FA 3ABTA 5L3BA 2QM8A 1GTOA 1QLNA 2WLIA 3VBBA 4FK5C 4H33A 3K04A 4PDVA 3FKSG 1PL0A 1FXKA 1THZA 5B1BB 1K92A 3D36A 4RO2A 2W0FC 3PJSK 1QVGU 5LBQA 2EZPA 5L3EA 2EBOA 2JK5C 3ASNB 4UV8A 5EC2C 3SYCA 1NH2D 2OTJV 1SETA 3B77A 1K4CC 3ZN1A 1YJNV 2OTLV 1K7DA 3SYAA 5C93A 1PD3A 2DYSB 2NNUA 1JJ2U 3NXSA 2ZR2A 2DYRC 3EFFK 4JAUA 2HLDG 5B1NA 4WFFA 1ROPA 5CBGA 2JIZG 3E86A 1BL8A 1GM7A 2XAJA 4ZBMA 5L3GA 4TT3G 3W7SA 3CC7V 3OEHG 3CD6V 2JEUA 2F43G 3B8NA 1W2BU 2XAGA 3E8HA 3OFNG 5LHGA 2B1GA 2Q68A 3FYIB 5IYDO 3LUTB 4FPPA 1CEZA 1H8HG 5LGNA 4YXWG 3E8GA 5EBLC 2DWDC 4R6ZA 5B1AC 2V7QG 2UXNA 4JASA 1GM9A 1PNMA 1KECA 4BIZA 1R3LC 1XL6A 3STLC 3VOUA 1M56C 1Y4MA 3CCEV 1SZTA 2EJRA 2XAFA 3ASOC 3JD3A 3OEEG 4R7CA 1WLEA 1VQLV 4PDLA 1YITV 2BOCC 1ZWIC 2HVKC 4U7NA 2AHZA 1G8MA 1F23A 1K4DC 2EIKB 2X6AA 3MD0A 3JD2A 4WF9V 1XL4A 1PNKA 2M7WA 3E35A 3ZMSA 5CA3A 3ZRXA 1E1RG 3ABKC 1KD1W 4FMTA 1R3KC 1BMFG 4TSFG 1B6QA 1IXMA 3AEIA 3OR7C 2IH1C 3EHBB 1JQ0A 4H37A 1DLBA 1GMGA 5B3SB 5IDJA 1I5XA 3SYOA 2ATKC 3I55V 1CP9A 1EFRG 2X7RB 2HKOA 3IGAC 4UUJC 4UVCA 4CBCA 4HYOA 3ETGA 4MVOA 4PDRA 4X8AA 1VQMV 2XNDG 3I56V 5L3DA 4N21A 3CC4V 4JTCB 5L3FA 3K08A 1E1QG 4P2ZA 1NBMG 5CMUA 3QO5A 1GKFA 2Q6AA 3SYQA 2C2AA 3AG4B 3STZC 3ZRSA 3TETA 2D3OW 3ZMTA 3ZRVA 5GW7A 1JX9A 2HFEC 3SPHA 3UM7A 3B8MA 1QVFU 2XOKG 1PNLA 3KG2A 4QE9A 4MW8A 1VQKV 3WG7B 2R9RB 3T4DA 1M1KW 3UKMA 2UXXA 5CBHA 1S76D 1KQSU 3K0GA 4FIPC 2DQ3A 2QA4V 1V55C 4LBEC 3WFVA 3GWOA 1FXKC 4MVSA 5EC1C 2Y48A 2IU0A 4MTOA 2Z5UA 1R6NA 2EILB 4L87A 4QPJA 3CPWU 3FB7C 1G4YB 1QBZA 2Z3YA 4LC1A 4HZ3A 2GSMB 4QJFB 3M99B 1S72V 1OCOB 2JEXA 4JF3A 1JPXA 3LDCA 4OXSA 1S3JA 3ZRWA 5H9CA 3T1CA 1GO3F 3MHHC 5EBMC 4QE7A 2GHYA 1AR1B 4WFHA 3K03A 5EK0A 3K3WA 5H6RA 2KB1A 1PKXA 1FXHA 3H01A 4R50A 3W7TA 2IJKA 3AG2B 2HG5C 4GCZA 4R8CA 3RBZA 5KA5A 5B1BC 2YEVB 2A9HA 1M9NA 5LHIA 1RPRA 5H6QA 3LNMB 2P7TC 3ASNC 4WFEA 2XASA 3ZCCA 4Q20A 1OCCB 1AI4A 3ZIAG 3A0RA 1AJPA 1W0JG 3CYOA 3OM3B 1QCEA 2Q69A 3D3IA 1NH2B 2B5UA 5E1AC 2DYSC 3ETEA 3E89A 4UVAA 1VQ9V 3SPCA 2QKSA 1VQPV 4UV9A 1NQTA 2WLJA 3CC2V 3F5WC 4P9OA 1K97A 4ZKIA 2YEVA 4WFAV 2Y69B 1JCHA 1RPOA 2ZXWB 1YJ9V 4U7OA 4XDJA 1VQ6V 2WLNA 3E8BA 3MHSC 1DF4A 4UXNA 4P9PA 4X88A 1AROP 4P30A 1K33A 3OMIB 4MS2A 4PA6A 1M57B 1KP3A 3W7WA 3OUFA 3CXCU 1VQ8V 3JD4A 4LCUC 1R3IC 4JTDB 4EKWA 2EIJB 3ABUA 4PELA 4QPKA 2IU3A 3CCLV 1E79G 3ZMUA 2EZOA 2LFSA 2EIJC 2JJ2G 2WLHA 2ZDIC 2WPDG 3G4SV 2OT5A 3K06A 1Q81W 4JYCA 2EIKC 5DN6G 3SPJA 3TK1A 1H38A 2EIMB 1Y66A 1W0KG 1AI7A 2IH3C 3AG3B 5IY5B 3BEHA 1KKDA 1UJWB 3F7VC 4GX5A 3AG1B 1K8AW 1H2GA 1AJNA 1LNQA 5HFLA 2EINB 3GB7C 2DW4A 3FB8C 2IJJA 3X2QB 1MSWD 4Z1MG 2A79B 2BOBC 3LSSA 3ABMB 1V54B 2ZDIA 1OHHG 1OCZB 1R3JC 3LDDA 1SESA 4GX0A 2P6JA 4PA4A 5B3SC 1K73W 4XDLA 1CPYA 4BIUA 1NVPD 4GX1A 4KP4A 3G71V 5LGUA 2QTOA 1HWYA 4G28B 3RW0A 2WLMA 4JAVA 2LFRA 3ABLB 3OAAG 4BW5A 3K0DA 3OW2U 4MT8A 3ZN0A 4E2LA 1MABG 3OR6C 3JD0A 2W6JG 3W7XA 1H8EG 3AG4C 3E83A 4RUFA 1Q7YW 1S0VA 4JTAB 1F51A 2IJIA 3IFXA 4MTGA 4G2KA 5BZBA 2WLLB 2HVJC 1TUEB 3WG7C 3CMAV 1RM1B 4XBFA 3CCQV 1ENVA 1FFTB 2WAMA 1AI6A 4JPRA 1EBOA 1P4RA 1QLEB 2DWEC 5CN0A 4ASUG 3ZMZA 3T4ZA 1K34A 1AI5A 2EILC 4GT1A 2WLIB 3LDEA 1Q86W 4JGSA 2HR3A 1YSCA 2LP7A 3G6EV 1MOFA 1OCOC 1R73A 2DQ0A 2OCCB 1JOYA 3BY6A 2V1DA 4MTFA 2QE7G 4UVBA 1NJIW 3K79A 3E2EA 3FB6C 3ETDA 4TWKA 1OCRB 3CCVV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT5 A;  1QBZ A;  3P30 A;  4JPR A;  5CMU A;  1EBO A;  3M99 B;  4N23 A;  1MG1 A;  5CN0 A;  1Y66 A;  4JF3 A;  1JPX A;  1K34 A;  5H9C A;  3MHS C;  1DF4 A;  4E2L A;  1I5Y A;  3MHH C;  4JGS A;  3B8M A;  5HFM A;  2LP7 A;  3CYO A;  1JQ0 A;  1MOF A;  1K33 A;  1QCE A;  1DLB A;  1DF5 A;  4FK5 C;  2MK3 A;  1I5X A;  5HFL A;  1Y4M A;  4FJC C;  1QR8 A;  1SZT A;  2X7R B;  4G2K A;  3H01 A;  4FIP C;  1F23 A;  3K9A A;  3WFV A;  2EZP A;  3GWO A;  3B8N A;  2EBO A;  2P6J A;  3CP1 A;  4N21 A;  2M7W A;  1QR9 A;  2EZO A;  5KA6 A;  5KA5 A;  1ENV A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1HNZ O;  1WA8 A;  3AG2 C;  4D7T A;  5B1O A;  3F5T A;  2E5L B;  3OE7 G;  3K59 A;  1H2K A;  1HNW O;  1GK9 A;  3PN1 A;  4MW3 A;  1WN7 A;  2RJZ A;  1L1F A;  3HKD B;  1F4N A;  4ZOL B;  3CXH F;  5J2U A;  4DV0 B;  3HB3 B;  1RP3 B;  2GV9 A;  5J9P C;  4MTX A;  3K5L A;  4RAI A;  4O4H A;  1FYJ A;  5KA6 A;  3K5O A;  3ETQ A;  5IJ9 B;  2H3O A;  2LW1 A;  2ZNJ A;  2D2C B;  3QO7 A;  2Y0I A;  2ZXW C;  2O57 A;  1SC5 B;  4BWA A;  1S77 D;  1WP8 A;  1Q6H A;  2DJV A;  5JH7 B;  1KB9 F;  2WLK A;  3DGE A;  3CCS V;  2ZKO A;  1M57 C;  5BMV A;  4DR1 O;  2P90 A;  3P32 A;  3CB2 A;  3IC7 A;  3RYH A;  1Q82 W;  4LF9 B;  1KU9 A;  3JAS A;  3OMA B;  1XMO O;  4OGQ B;  4IT5 A;  4I4T B;  1M56 B;  3HKB B;  3UQ8 A;  3ASO B;  4JV5 B;  3OTF A;  2PZS A;  4TV8 A;  5KHG A;  3N2G A;  3SPG A;  1KP2 A;  4WFG A;  1SF9 A;  3CP1 A;  3Q4H A;  5DM6 V;  1R6T A;  4FLU A;  2PF4 E;  3X2Q C;  5CBF A;  2A7W A;  3ABM C;  1NR1 A;  1PPJ H;  2JVD A;  3QO8 A;  5CB4 A;  1XMQ O;  1MA1 A;  4MVZ A;  2YXH A;  3UT5 A;  4JYB A;  1F4M A;  5B5E Z;  2WWW A;  1WPX A;  4DR3 B;  3CCR V;  1R1B A;  4ABM A;  2F93 B;  3T1H O;  2YDE A;  4MSW C;  2A0L A;  2H94 A;  4BIO A;  5AG2 A;  1FJG B;  4QIW F;  1GRJ A;  5JJN B;  4ZI7 B;  1AP5 A;  2JS5 A;  4X1I A;  1AB3 A;  4CZZ A;  3HPL C;  4ZIB A;  2VWJ A;  4O4J B;  3CCU V;  4NTX A;  1YTF B;  1RM1 C;  1FD9 A;  1L8D A;  1V55 B;  4UCS A;  1FXK B;  3JAT A;  4KFM A;  3O9O A;  5L3C A;  5D5P A;  1BS3 A;  1QR8 A;  3U0Z A;  3J80 N;  2JJ1 G;  4JZG A;  4DK1 A;  5IYC O;  1SRY A;  3BRC A;  4DR5 B;  3JD1 A;  4PDM A;  3R65 A;  3H1K H;  3B4S A;  4LH6 A;  2UXC B;  1TAE A;  5LOV A;  4WBN A;  2QM8 A;  1GTO A;  1QLN A;  2WLI A;  3VBB A;  2P5O A;  4H33 A;  3K04 A;  2UXD O;  5KMG A;  4PDV A;  1PL0 A;  1THZ A;  4JYA O;  3J7A U;  2LGW A;  2FKX A;  2PTM A;  2W0F C;  1FPO A;  2EZP A;  2JK5 C;  5EC2 C;  2LO1 A;  3B77 A;  5J2T A;  1K4C C;  5LYJ A;  3ZN1 A;  4DV4 O;  1VAR A;  1L0L H;  1K7D A;  5E79 Z;  5TIS Z;  2F1M A;  3SYA A;  5C93 A;  1PD3 A;  2DYS B;  2NNU A;  1JJ2 U;  3NXS A;  3A0H Z;  5IWA B;  2HLD G;  5H2F Z;  2WA4 A;  1ROP A;  5BR8 O;  4ZOL A;  3U11 A;  1GN6 A;  2XAJ A;  4DV2 O;  1US6 A;  3B8N A;  4NB5 A;  2Q68 A;  5KHJ A;  5IYD O;  1CEZ A;  3R66 A;  1I7F A;  5IJ9 A;  1NS1 A;  2V7Q G;  1PNM A;  3I5D A;  2VWK A;  1Y4M A;  4LFA B;  2F4V O;  1NU1 H;  3CHX A;  4PDL A;  1BSM A;  4FM1 A;  1F23 A;  3K58 A;  3JD2 A;  1XL4 A;  2YXL A;  3RN4 A;  3E35 A;  5JH7 A;  4F6R B;  1E1R G;  2LQT A;  1YEW A;  1BMF G;  2CDY A;  1ZUQ A;  2RNB A;  1B6Q A;  3CRQ A;  1IXM A;  4TV9 B;  1JR9 A;  2E5L O;  2VRZ A;  3EHB B;  1JQ0 A;  3DC5 A;  4I55 A;  1DLB A;  4HBN A;  3SYO A;  4FLV A;  4CBC A;  4UUJ C;  3IGA C;  2QKC A;  2XND G;  5JQG B;  3BAB A;  5L3F A;  1Y74 B;  3K08 A;  4B7E A;  4JI8 B;  4LR3 A;  5CMU A;  4LFB B;  1GKF A;  2Q6A A;  1NTZ H;  3AG4 B;  2BCC H;  2UUC B;  5KX5 B;  4DV1 B;  2ZE6 A;  1IBM B;  2HFE C;  3G67 A;  2P22 C;  3CE2 A;  1M1K W;  3UKM A;  2ODM A;  5CBH A;  1KQS U;  3K0G A;  2QA4 V;  2BE3 A;  4LBE C;  3JAW B;  4ZHQ A;  4DV6 B;  1R6N A;  4QPJ A;  2ZIM A;  3C3T A;  1SQG A;  4LF9 O;  4QJF B;  1JPX A;  4O4J A;  4X64 B;  5EBM C;  4JV5 O;  4LF8 B;  2GHY A;  2BTQ A;  2DMX A;  3K03 A;  3K3W A;  1PKX A;  3AG2 B;  2OIE A;  3L73 H;  5B1B C;  1Z5W A;  2KG7 B;  4J10 A;  4Q20 A;  2VQE B;  3OM3 B;  3SGI A;  3WB1 A;  4FLY A;  4I50 B;  3H1H H;  2Q69 A;  4DR3 O;  2QKS A;  1VQP V;  2QTS A;  1NQT A;  4RWU A;  4ZKI A;  3SJB C;  4X1K B;  1RSO B;  1RPO A;  2ZXW B;  4U7O A;  5DEC A;  2ARH A;  1M57 B;  3OUF A;  3JD4 A;  4B3S B;  1EN5 A;  1R3I C;  3P3N A;  4JTD B;  4EKW A;  2EIJ B;  3KCY A;  1TUB B;  4QPK A;  2IU3 A;  1IDS A;  4DR5 O;  2WPD G;  2VQF B;  3IAY A;  1H38 A;  2IH3 C;  4X9Q A;  2ZE7 A;  2UXC O;  4JZ2 A;  3F7V C;  2FL4 A;  4GX5 A;  1H2G A;  1LNQ A;  1M93 A;  5LA6 B;  3GB7 C;  2DW4 A;  1MSW D;  1QQC A;  2IJJ A;  4LNU A;  3X2Q B;  3ZHV A;  3RYC B;  1FAF A;  3ABM B;  1OHH G;  3CSX A;  1R3J C;  4BIU A;  3TJT A;  4KP4 A;  4O2A B;  4F6R A;  2Q0O C;  2OYQ A;  3OAA G;  3K0D A;  4NXN B;  3OR6 C;  1MMM A;  2OWO A;  2YXY A;  5IWA O;  3IFX A;  2WLL B;  1RM1 B;  1FFT B;  4NVP A;  4JPR A;  1Y74 A;  1WA8 B;  5CN0 A;  3RWR D;  3T4Z A;  5JVD A;  1YSC A;  2LP7 A;  3G6E V;  1MOF A;  5J2U B;  1JOY A;  2GDS A;  4LFA O;  4X66 B;  3BVO A;  3ETD A;  1X4T A;  3CCV V;  3JAW A;  2N05 A;  1MG1 A;  3DSQ A;  4NKG B;  4EB6 B;  3OMN B;  1VQO V;  1P7B A;  3LSU A;  3CCJ V;  4FM2 A;  2QR4 A;  4I0X B;  1QR9 A;  3RYH B;  3FB5 C;  1N0J A;  1XNR B;  3BA8 A;  2PUS A;  4JI8 O;  2JDI G;  3FAV B;  2KG7 A;  4CH6 A;  4LFB O;  3LSQ A;  1S5H C;  3ML0 A;  2UUC O;  4DV1 O;  1IBM O;  1VQ4 V;  5LGT A;  4TV8 B;  4J9Z B;  3SJQ C;  4AHC A;  2WA3 A;  4I50 A;  2CH7 B;  4FZ0 A;  3CCM V;  3Q4H B;  1SKV A;  2ZD9 A;  2H8P C;  4J80 A;  3DTU B;  4UFZ A;  4YJ2 B;  2EX3 A;  3TCU A;  4DV6 O;  3RVZ A;  2K9P A;  4KXR A;  3SYP A;  1XNQ O;  2Y4U A;  1SER A;  1GN4 A;  4X1K A;  1RSO A;  4F4L A;  3BA9 A;  4X64 O;  3QNE A;  4LF8 O;  5K1X A;  3AG3 C;  5IY5 C;  3GWK C;  4JYA B;  1AIL A;  1T5E A;  4PA7 A;  3CME V;  1EM1 A;  5KHH A;  3OUS A;  1TUB A;  5LXT B;  4X89 A;  2QWN B;  4X1I B;  1HW7 A;  3P30 A;  5IYB O;  1N8R W;  1V54 C;  2YC0 A;  1BHA A;  1Q8I A;  1VQ5 V;  5HFM A;  2VQE O;  3QF7 A;  1RFY A;  2CGN A;  1NVP B;  2RMK B;  1N34 B;  3ZED A;  3RYC A;  4BAY A;  3A2F A;  4B08 A;  4X62 B;  3RVY A;  2K1E A;  2YIA A;  4MVU A;  5KUM A;  4WBN B;  5LOV B;  3AG7 A;  4XDK A;  2L35 A;  1K3E A;  5KMG B;  2QEX V;  1LUW A;  2X6B A;  4B3S O;  4KUM A;  5IT9 N;  3OGC C;  1B06 A;  2IW5 A;  4RQE A;  2WLL A;  2OCC C;  4CH5 A;  2ZQM A;  5LYJ B;  2Q4P A;  1DK1 A;  2CK3 G;  2VQF O;  4I9W A;  5IYZ A;  2Y4T A;  5KLV H;  1XQ8 A;  5L3B A;  2N04 A;  3ICX A;  4CS3 A;  4LFC B;  3FKS G;  5B1B B;  1K92 A;  2F66 C;  5L3E A;  4UV8 A;  1SET A;  2Q73 A;  1Y76 A;  5A9G A;  3BFR A;  2Q7H A;  1YDX A;  2Q0A A;  4NXN O;  1Z2G A;  4JAU A;  4O4L A;  4EB6 A;  1VF5 B;  5CBG A;  4CH4 A;  3E86 A;  4JI1 B;  1BL8 A;  1GM7 A;  4ZBM A;  4DW0 A;  4TT3 G;  3W7S A;  3CC7 V;  3OEH G;  1V9P A;  2F43 G;  4JYY A;  3E8H A;  5LHG A;  3FYI B;  4I0X A;  1U97 A;  1IBL B;  1HR0 B;  3E8G A;  1B3Q A;  2DWD C;  3FAV A;  1LR1 A;  4JAS A;  1GM9 A;  3DXR A;  4I55 B;  4JAA A;  4BIZ A;  2ADP A;  3N2K A;  1OV9 A;  2AZ0 A;  3CCE V;  1SZT A;  4K0K B;  1XRE A;  3OEE G;  1YIT V;  2BOC C;  2CTW A;  1ZWI C;  2HVK C;  2AHZ A;  1K4D C;  4X66 O;  3MD0 A;  2CH7 A;  1PNK A;  2M7W A;  3KZI Z;  1PL4 A;  5CA3 A;  3ZRX A;  1KD1 W;  1UFI A;  4FMT A;  4YJ2 A;  1SS3 A;  2JGU A;  1NZ6 A;  4TSF G;  3RYI A;  3AEI A;  3BPZ A;  2IH1 C;  1GMG A;  5IDJ A;  1I5X A;  3QG5 A;  2ATK C;  3I55 V;  3G6B A;  1CP9 A;  1EFR G;  2HKO A;  4OX9 B;  4PDR A;  4X8A A;  3I56 V;  1IBK B;  5L3D A;  4ZHQ B;  4DR2 B;  4N21 A;  3CC4 V;  5LXT A;  4FFK A;  3QO5 A;  3B09 A;  1XNR O;  3H1L H;  4FZ1 A;  3TET A;  1JX9 A;  3SPH A;  4UCV A;  4X20 A;  3B8M A;  1PNL A;  3KG2 A;  2BTQ B;  4CC5 A;  4LF6 B;  1NTK H;  1IVS A;  4O2B A;  2UXX A;  3BCC H;  4BW9 A;  4HNA A;  3WFV A;  3GWO A;  3M7M X;  4MVS A;  2Y48 A;  4MTO A;  2Z5U A;  3CPW U;  4L87 A;  1QBZ A;  4LH7 A;  4X1Y B;  1S72 V;  1BCC H;  2JEX A;  4GUN A;  5JCO C;  3AK3 A;  2G38 A;  3T1C A;  3MHH C;  5A2Q N;  4QE7 A;  1Q6I A;  1AR1 B;  3S3W A;  5H6R A;  3K5M A;  2KB1 A;  3H01 A;  1I94 B;  3CS5 A;  3SJC C;  2BTO A;  1GH6 A;  4R8C A;  3RBZ A;  5FNV B;  5KA5 A;  4NTW A;  2A9H A;  5H6Q A;  1WAZ A;  2N74 A;  2YI9 A;  4UCT A;  1H2N A;  1D2D A;  1AI4 A;  1EN4 A;  3ZIA G;  2LW7 A;  1AJP A;  1W0J G;  4W4L A;  4FLW A;  2BSK A;  3CYO A;  2PYJ A;  1NH2 B;  1VQ9 V;  3SPC A;  1N34 O;  3VQX A;  3CC2 V;  1U96 A;  4B7K A;  1URF A;  4Z1V A;  3F5W C;  4X62 O;  2YEV A;  4WFA V;  2A3Q A;  3UCS C;  1JCH A;  4TOI A;  3E8B A;  1DF4 A;  4P9P A;  4X88 A;  2Z0A A;  3OMI B;  4IYI A;  4PA6 A;  2PYL A;  3UO3 A;  4LNU B;  1D5N A;  3ABU A;  1ZLZ A;  3DC6 A;  2QWO B;  4DK0 A;  1N36 B;  3ZMU A;  3HR0 A;  4DV7 B;  5C8Y A;  2ZDI C;  3G4S V;  2OT5 A;  4JYC A;  2QKA A;  3A8T A;  3OTO B;  1Y66 A;  3AG3 B;  5IY5 B;  1Q3E A;  3H1I H;  1P84 F;  4LFC O;  1AR5 A;  2A79 B;  2BOB C;  1V54 B;  2QSA A;  5B3S C;  3LDD A;  3KCX A;  4XDL A;  2AZ2 A;  3TXS A;  3WU2 Z;  3RW0 A;  3OW2 U;  5JVD B;  4MT8 A;  1MAB G;  3JD0 A;  1X59 A;  4KL1 A;  4UCR A;  2OCH A;  1F51 A;  4MTG A;  4OPA A;  4G2K A;  4JI1 O;  1WB7 A;  3CRR A;  2R70 A;  3WG7 C;  4FM0 A;  2Q7G A;  2XUM A;  1AI6 A;  1EBO A;  1P4R A;  1IBL O;  1HR0 O;  1XNQ B;  2ADQ B;  4ASU G;  2RQ6 A;  3ZMZ A;  1K34 A;  1A32 A;  1N4C A;  4JGS A;  1R73 A;  2DQ0 A;  5LP6 A;  2OCC B;  3BY6 A;  4MTF A;  2QE7 G;  4K0K O;  3K79 A;  3E2E A;  1DGS A;  3C90 A;  4JI3 B;  3L74 H;  3SDL A;  4U3J A;  4X1Y A;  4UCO A;  5KHK A;  1GN3 A;  4U3F H;  2QWP B;  2ZIO A;  1S5J A;  1K9M W;  1DTO A;  1Q90 D;  1OCC C;  1NKD A;  1SQQ H;  4DO2 A;  4DUZ B;  1YHQ V;  3ZJZ A;  4OX9 O;  2KKW A;  1IBK O;  1FXV A;  4DR2 O;  2GBO A;  2P06 A;  5FNV A;  1BZK A;  4IIJ A;  3E22 B;  2XT9 A;  1I5Y A;  4YY3 B;  2Y69 C;  4YIP A;  4RQF A;  1FKA O;  1WNS A;  4LF6 O;  4LF4 B;  5FPR A;  1YVW A;  4IHJ B;  3JYC A;  3HKC A;  1R6K A;  4J7J A;  4JI0 B;  2YSU B;  1SA0 B;  2WSS G;  4PA3 A;  4LF5 B;  4DXW A;  2B9Z A;  1ZL8 B;  2IBZ H;  2RN9 A;  4G27 B;  4K3A A;  2LJ2 A;  4DRX A;  4FJC C;  2XTA A;  5D5Q A;  4GKK B;  1JVM A;  1I94 O;  5KUK A;  2KQX A;  4AI8 A;  5KAF Z;  3RYF A;  3FFQ A;  2FTK A;  4LP8 A;  2HJF C;  4J9Y B;  1EZJ A;  4WFB V;  3SJA C;  3BAA A;  4DR7 B;  3L72 H;  3FYE B;  4LWS B;  2YIB D;  3HKE A;  3ABL C;  4FLT A;  3JAL B;  5IJ0 B;  1S5L Z;  1M90 W;  2ITD C;  1K5Q A;  3M8A A;  5LP6 C;  1COW G;  4FLZ A;  2X6C A;  3ZMV A;  1JJO A;  1N0N A;  2R9I A;  4IYH A;  4N23 A;  5IYZ B;  2X0L A;  4WCE V;  2CTR A;  5EIB D;  1NI8 A;  5LMN B;  4DV5 B;  1QLE C;  4IGG A;  4LF7 O;  1KC8 W;  5FL7 G;  2PY5 A;  4PJ0 Z;  4B3R B;  2F95 B;  3IC9 A;  3JAR A;  3D36 C;  1Y76 B;  2HHH B;  5CA0 A;  2Q9L A;  1N36 O;  1L0N H;  4DV7 O;  2YID A;  3ZX6 A;  4C7U A;  4CS2 A;  1VQN V;  4JI6 B;  5LHH A;  3OTO O;  1OCR C;  3ABT A;  4O4L B;  3WB2 A;  2YS8 A;  3TGU H;  1ZSP A;  1BT8 A;  1QVG U;  5LBQ A;  2E75 B;  5LMU B;  1M5I A;  3A0B Z;  2W0X A;  2ZIN A;  1YJN V;  2OTL V;  4TUY A;  3DXR B;  2GUZ B;  2ZR2 A;  2DYR C;  1VIB A;  2ZCE A;  3EFF K;  4JI4 B;  3N2K B;  5B1N A;  4WFF A;  3K57 A;  2JIZ G;  2XHB A;  1Q5O A;  2UU9 B;  1TGO A;  5L3G A;  1H2M A;  3CD6 V;  2JEU A;  1W2B U;  2XAG A;  5GTI Z;  2B1G A;  4DYL A;  5LGN A;  4JI2 B;  2YUA A;  3CWB H;  5EBL C;  4GKJ B;  3RYI B;  4I9Q A;  5B1A C;  3L9D A;  2UXN A;  3E22 A;  1KEC A;  2JS3 A;  1XL6 A;  3JSL A;  2AXT Z;  5BXZ A;  3STL C;  2HJD A;  4R7C A;  1VQL V;  1WLE A;  4D6T H;  4U7N A;  4IHJ A;  2X6A A;  4WF9 V;  3L71 H;  3ABK C;  1R3K C;  2DOS A;  2Q7E A;  1SA0 A;  4CC6 A;  4JI3 O;  1NT2 B;  1ZL8 A;  4QGP A;  3AK2 A;  4X20 B;  1BQ0 A;  1EN6 A;  4ICG A;  2UXB B;  4O2B B;  5B3S B;  3CJH A;  4UVC A;  2X7R B;  4HNA B;  4HYO A;  4DUZ O;  1VQM V;  1ZTE A;  2R9A A;  5LL6 Y;  2JRI A;  1VEW A;  4BR6 A;  5K1P A;  4JTC B;  4JI7 B;  1E1Q G;  4P2Z A;  4DR6 B;  1TVK A;  3SR2 C;  3S3X A;  3H1J H;  3ZRS A;  3ZRV A;  4K8Z A;  5GW7 A;  4B3M B;  4YHH B;  2XOK G;  4QE9 A;  4YY3 O;  4MW8 A;  4LWS A;  1VQK V;  2YIC A;  1MSD A;  3WG7 B;  1MZF A;  1Z5V A;  4LF4 O;  1S76 D;  3JAL A;  5IJ0 A;  4FIP C;  2NN4 A;  4JI0 O;  1W59 A;  2IU0 A;  1XI1 A;  3THO A;  3FB7 C;  4LF5 O;  4J42 A;  2EUL A;  4LC1 A;  2GSM B;  1BGY H;  1S3J A;  5EIB C;  5H9C A;  1GO3 F;  2BSK B;  2FYU H;  1EZV H;  2QM4 A;  5EK0 A;  3JCU Z;  5FLX N;  1O9H A;  1FXH A;  4R50 A;  5JJJ B;  1VF6 A;  4GKK O;  4GCZ A;  1XBL A;  4NR1 A;  2YEV B;  5JCO A;  3LNM B;  2P7T C;  3ASN C;  1YF2 A;  3O65 A;  1OCC B;  4KHP B;  3EVK A;  4DR7 O;  5FPO A;  3K9S A;  1QCE A;  1D5A A;  3D3I A;  5E1A C;  3K5N A;  4GZR B;  3T1Y B;  4UV9 A;  2HEP A;  2WLJ A;  2YI8 A;  4J7K A;  5C8Y B;  4P9O A;  1K97 A;  2ZE5 A;  1IUR A;  1XIL A;  2Y69 B;  1YJ9 V;  1J5E B;  4XDJ A;  1VQ6 V;  2WLN A;  4J11 A;  4FLX A;  2CUG A;  5LMN O;  4O4I B;  1ZX3 A;  1ARO P;  3L70 H;  4P30 A;  2GUZ A;  1K33 A;  4DV5 O;  4MS2 A;  3CRM A;  5EZY B;  1ZAU A;  2QGN A;  2QWR B;  4CH3 A;  4FFB B;  1SQF A;  1WP7 A;  1WB8 A;  4PEL A;  4B3R O;  4AQY B;  2M6Y A;  4UB6 Z;  2UUA B;  3JAK B;  3ZHS A;  1XEQ A;  2LFS A;  2EIJ C;  4NXM B;  4H0L B;  2JJ2 G;  2WLH A;  2HHH O;  3K06 A;  1Q81 W;  4JI5 B;  2EIK C;  3SPJ A;  2LGQ A;  1W0K G;  1AI7 A;  4JI6 O;  1UJW B;  1K8A W;  1QHT A;  2UUB B;  2FB5 A;  1YXB A;  1XOU A;  3ZHQ A;  4YJ3 A;  2A06 H;  2ZDI A;  3OGI B;  1SES A;  2P6J A;  1CPY A;  1PM9 A;  1NVP D;  5LMU O;  1O9G A;  2AGA A;  4G28 B;  2E76 B;  2LFR A;  3ABL B;  3CEI A;  4PV1 B;  1FFX B;  4RUF A;  5LP6 B;  4JI4 O;  1S0V A;  3VQV A;  3VQY A;  5BZB A;  2UU9 O;  1XUQ A;  3CMA V;  4XBF A;  3CCQ V;  4K8X A;  1ENV A;  1HP8 A;  1VF6 C;  1AR4 A;  1QLE B;  2DWE C;  4U3J B;  4JI2 O;  4GKJ O;  3UO2 A;  4GT1 A;  2EIL C;  5EYP B;  1Q86 W;  1OCO C;  1G1X B;  2CTQ A;  4J7Z A;  4DUY B;  1SQB H;  2ILM A;  4UVB A;  1NJI W;  5B66 Z;  3FB6 C;  1VMG A;  1I08 A;  4TWK A;  1OCR B;  4PI0 A;  2P4V A;  3ZHR A;  1N32 B;  2B1I A;  4IIJ B;  3OD4 A;  1FS0 G;  2DE0 X;  3LNN A;  2Q67 A;  2UXB O;  1OZ0 A;  1SQP H;  4MVQ A;  5EBW C;  3HKC B;  4GX2 A;  4TQD A;  3T2M A;  3K9A A;  4X65 B;  2AW9 A;  4UCU A;  4JI7 O;  2DYR B;  4DR6 O;  3L75 H;  2QM7 A;  1BHB A;  3P3P A;  1XDC A;  2Q5Z A;  2DN9 A;  4B3M O;  4DRX B;  4YHH O;  1SQV H;  1GM8 A;  4LF7 B;  3HKD A;  2OIG A;  3RYF B;  2P67 A;  4OPH A;  5B1A B;  4PA9 A;  3QTC A;  4Z2W A;  3G80 A;  4PHZ A;  2L6L A;  1YIJ V;  2XAQ A;  3HKE B;  4J41 A;  5JWP A;  3AK1 A;  1OJH A;  2EIM C;  4O4I A;  2IJH A;  2JGD B;  1M4U A;  2ETN A;  5EZY A;  3ABK B;  3AG1 C;  4NYK A;  4FFB A;  3CRC A;  2EIN C;  4I5S A;  3JAK A;  5ITZ B;  2Q8V A;  4RUE A;  2NLJ C;  1OCZ C;  1JMK C;  1ORQ C;  2XAH A;  2CE4 A;  1NR7 A;  4I4T A;  3HKB A;  3JCZ A;  4B3T B;  3SPI A;  4KHP O;  2MK3 A;  2W6I G;  1YTF D;  3F7Y C;  2V4D A;  4DV0 O;  1VQ7 V;  2ZNI A;  3JAR B;  2FML A;  3T1Y O;  2PI4 A;  5CA0 B;  4PD4 F;  4HAM A;  3N27 A;  5GON B;  4MVR A;  1AJQ A;  3ZRW B;  1YJW V;  1J95 A;  1J5E O;  1DF5 A;  1FFX A;  4Q6G A;  2AHY A;  5BY1 A;  2PI5 A;  2ZR3 A;  4EFE A;  1K5S A;  1YI2 V;  4D7S A;  2GTA A;  4AQY O;  1F7Y A;  2UUA O;  3W7U A;  2ITC C;  4ZI7 A;  4NXM O;  4TUY B;  4JI5 O;  1GAX A;  4AIL C;  2ZM6 B;  4DW1 A;  4L8J A;  1BE3 H;  4MVM A;  4QNH B;  3E8F A;  3APQ A;  3TXQ A;  5EYP A;  2UUB O;  4FK5 C;  4E4E A;  1FXK A;  3D36 A;  1N33 B;  5KHI A;  4RO2 A;  4DV3 B;  3PJS K;  1H2S B;  1SZX A;  2EBO A;  3ASN B;  1JFF B;  2OTJ V;  3SYC A;  1NH2 D;  2HP8 A;  5F2V O;  4GLX A;  4DR4 B;  3FD9 A;  5JJE B;  1IXB A;  5IE9 A;  1TA8 A;  1KUQ A;  3C3S A;  4EEQ A;  4YIO A;  4NTY A;  1QNM A;  3CRA A;  1HDJ A;  1FJG O;  2RCV A;  3OFN G;  1HNX B;  3LUT B;  4FPP A;  1G6U A;  3MAQ A;  1H8H G;  4YXW G;  1AP6 A;  2P4K A;  3APO A;  4R6Z A;  2E74 B;  2IM9 A;  1R3L C;  3CJH B;  2GTS A;  3VOU A;  1M56 C;  4DUY O;  3U10 A;  2EJR A;  2XAF A;  3ASO C;  3JD3 A;  3ZHT A;  1SQX H;  1G8M A;  2EIK B;  2E3C A;  3ZMS A;  4DR1 B;  1TVK B;  4F6E A;  1HNZ B;  1Y67 A;  1N32 O;  2QWQ B;  4TQF A;  1HNW B;  3H9V A;  1IX9 A;  1XHZ A;  3OR7 C;  4H37 A;  2F23 A;  1VP7 A;  5CA1 B;  3ETG A;  4MVO A;  2JGD A;  2MW2 B;  3FX7 A;  4X65 O;  1H2L A;  1NBM G;  3SYQ A;  1IZ3 A;  5ITZ A;  2C2A A;  3STZ C;  2D3O W;  3ZMT A;  1WJZ A;  1JA8 A;  2VS0 A;  1MZE A;  3KKY A;  4TV9 A;  3UM7 A;  4EFB A;  1QVF U;  3D8C A;  1XHX A;  3RFR A;  3WB0 A;  2R9R B;  3T4D A;  4FVM A;  2DQ3 A;  1V55 C;  1FXK C;  5EC1 C;  1UPG A;  5JQG A;  2EIL B;  1CXZ B;  1G4Y B;  3IJ4 A;  2Z3Y A;  4HZ3 A;  1XMO B;  3M99 B;  1NTM H;  1OCO B;  5GON A;  3RT3 C;  2YIB A;  4JF3 A;  3LDC A;  2QJ1 A;  4OXS A;  3ZRW A;  3JAM N;  5KX5 A;  2KSD A;  3OT7 A;  4WFH A;  3D3Q A;  1P7G A;  2RDC A;  3W7T A;  4K35 A;  4O4H B;  2IJK A;  3ZHU A;  2HG5 C;  2ZE8 A;  1QU7 A;  1M9N A;  5LHI A;  1RPR A;  3ZCC A;  4WFE A;  1XMQ B;  2XAS A;  1BQZ A;  3A0R A;  4B3T O;  3T1H B;  4PI2 A;  1WPB A;  2B5U A;  2ZT9 B;  2DYS C;  5DED A;  3ETE A;  3E89 A;  3ZBH A;  4UVA A;  5BMV B;  3ZS8 C;  1KKC A;  3GVM A;  1JFF A;  3JAS B;  2Y0P A;  3J81 N;  3MHS C;  4UXN A;  1Q43 A;  4IL6 Z;  3N2G B;  1KP3 A;  3CX5 F;  3W7W A;  3CXC U;  1VQ8 V;  4LCU C;  4YJ3 B;  2PGG A;  4H44 B;  3CCL V;  1E79 G;  4CS4 A;  2EZO A;  2CTP A;  3EXA A;  1YCI A;  5DN6 G;  5CB4 B;  1KYO F;  3TK1 A;  2EIM B;  3UT5 B;  3BEH A;  1KKD A;  2ZM6 O;  4I7Z B;  5KAI Z;  1Q6U A;  2EJ7 A;  3AG1 B;  2UXD B;  1AJN A;  1LUV A;  5HFL A;  2EIN B;  3FB8 C;  4Z1M G;  3LSS A;  1N33 O;  1GN2 A;  1OCZ B;  4PA4 A;  1I0H A;  3B2E E;  4GX0 A;  4DV3 O;  1K73 W;  1KBH A;  2QDO A;  2NR5 A;  4GX1 A;  3G71 V;  4DV4 B;  5LGU A;  2CAZ C;  1HWY A;  2QTO A;  2WLM A;  4JAV A;  2R72 A;  4DR4 O;  4A5U B;  4BW5 A;  1KMI Z;  3MDS A;  3ZN0 A;  4E2L A;  2CGO A;  2W6J G;  3JAT B;  3W7X A;  1H8E G;  3AG4 C;  3E83 A;  1Q7Y W;  4JTA B;  5LA6 A;  2IJI A;  5BR8 B;  4DV2 B;  3BHP A;  5CA1 A;  2HVJ C;  3VQW A;  5H5N A;  1TUE B;  1MNG A;  2WAM A;  1HNX O;  4O2A A;  3JSN A;  1AI5 A;  1Y6X A;  2WLI B;  3LDE A;  2HR3 A;  4GYC B;  4H13 B;  2F4V B;  1PP9 H;  1AVM A;  1B04 A;  3QVN A;  2V1D A;  3NR7 A;  1VF7 A;  1P49 A;  1YZB A;  1PV0 A;  3B40 A;  5J2T B;  4UB8 Z;  4W4K A;  3RGB A;  5GTH Z; 
#chains in the Genus database with same CATH homology
 2B1I A;  1MG1 A;  3AG2 C;  1FS0 G;  5B1O A;  3OE7 G;  2Q67 A;  3OMN B;  1GK9 A;  4MW3 A;  1VQO V;  1K9M W;  1DTO A;  1L1F A;  1F4N A;  1OCC C;  1OZ0 A;  4MVQ A;  1NKD A;  1P7B A;  4DO2 A;  3CCJ V;  5EBW C;  3HB3 B;  4GX2 A;  1YHQ V;  3ZJZ A;  3T2M A;  3K9A A;  5J9P C;  4MTX A;  4RAI A;  1QR9 A;  5KA6 A;  1FXV A;  3FB5 C;  2DYR B;  2JDI G;  3LSQ A;  1S5H C;  3ML0 A;  2QM7 A;  1BHB A;  1VQ4 V;  1I5Y A;  3QO7 A;  5LGT A;  2Y69 C;  2ZXW C;  4RQF A;  1GM8 A;  4J9Z B;  3SJQ C;  1S77 D;  3JYC A;  1R6K A;  3CCM V;  3CCS V;  2WLK A;  3DGE A;  2ZD9 A;  2H8P C;  1M57 C;  2P67 A;  3DTU B;  2P90 A;  2YSU B;  3P32 A;  2WSS G;  4PA9 A;  4PA3 A;  3IC7 A;  5B1A B;  4DXW A;  1Q82 W;  3TCU A;  3RVZ A;  3OMA B;  3SYP A;  1SER A;  4F4L A;  1M56 B;  3ASO B;  4G27 B;  1YIJ V;  2XAQ A;  3QNE A;  2EIM C;  3AG3 C;  2IJH A;  5IY5 C;  4FJC C;  4PA7 A;  1KP2 A;  3ABK B;  3SPG A;  3AG1 C;  3CME V;  4WFG A;  1JVM A;  3OUS A;  5KUK A;  3CP1 A;  5DM6 V;  2EIN C;  4I5S A;  4X89 A;  2FTK A;  4LP8 A;  2HJF C;  4J9Y B;  3X2Q C;  5CBF A;  3P30 A;  5IYB O;  1N8R W;  3ABM C;  4RUE A;  1EZJ A;  1V54 C;  2NLJ C;  4WFB V;  1OCZ C;  1NR1 A;  1ORQ C;  2XAH A;  3QO8 A;  1NR7 A;  4MVZ A;  1BHA A;  3JCZ A;  3FYE B;  1VQ5 V;  5HFM A;  3SPI A;  4JYB A;  1F4M A;  3ABL C;  2WWW A;  2MK3 A;  1WPX A;  2W6I G;  3CCR V;  1YTF D;  3F7Y C;  1NVP B;  1VQ7 V;  1M90 W;  4MSW C;  2ITD C;  1K5Q A;  4BAY A;  2A0L A;  2H94 A;  2PI4 A;  1COW G;  4QIW F;  4HAM A;  2X6C A;  3ZMV A;  4MVR A;  2R9I A;  3RVY A;  4CZZ A;  1AJQ A;  4N23 A;  2K1E A;  3HPL C;  3ZRW B;  1YJW V;  1J95 A;  3CCU V;  2X0L A;  4WCE V;  1YTF B;  1RM1 C;  4MVU A;  5KUM A;  4XDK A;  1QLE C;  1K3E A;  1V55 B;  1DF5 A;  1FXK B;  4KFM A;  5L3C A;  2QEX V;  2AHY A;  1QR8 A;  1KC8 W;  5FL7 G;  2X6B A;  2JJ1 G;  5IYC O;  4KUM A;  2PI5 A;  1SRY A;  3OGC C;  2ZR3 A;  1K5S A;  2IW5 A;  1YI2 V;  4RQE A;  2WLL A;  2OCC C;  3JD1 A;  3W7U A;  4PDM A;  2ITC C;  3R65 A;  2ZQM A;  2CK3 G;  4I9W A;  1VQN V;  5LHH A;  1OCR C;  4MVM A;  4QNH B;  3E8F A;  3ABT A;  5L3B A;  2QM8 A;  1GTO A;  1QLN A;  2WLI A;  3VBB A;  4FK5 C;  4H33 A;  3K04 A;  4PDV A;  3FKS G;  1PL0 A;  1FXK A;  1THZ A;  5B1B B;  1K92 A;  3D36 A;  4RO2 A;  2W0F C;  3PJS K;  1QVG U;  5LBQ A;  2EZP A;  5L3E A;  2EBO A;  2JK5 C;  3ASN B;  4UV8 A;  5EC2 C;  3SYC A;  1NH2 D;  2OTJ V;  1SET A;  3B77 A;  1K4C C;  3ZN1 A;  1YJN V;  2OTL V;  1K7D A;  3SYA A;  5C93 A;  1PD3 A;  2DYS B;  2NNU A;  1JJ2 U;  3NXS A;  2ZR2 A;  2DYR C;  3EFF K;  4JAU A;  2HLD G;  5B1N A;  4WFF A;  1ROP A;  5CBG A;  2JIZ G;  3E86 A;  1BL8 A;  1GM7 A;  2XAJ A;  4ZBM A;  5L3G A;  4TT3 G;  3W7S A;  3CC7 V;  3OEH G;  3CD6 V;  2JEU A;  2F43 G;  3B8N A;  1W2B U;  2XAG A;  3E8H A;  3OFN G;  5LHG A;  2B1G A;  2Q68 A;  3FYI B;  5IYD O;  3LUT B;  4FPP A;  1CEZ A;  1H8H G;  5LGN A;  4YXW G;  3E8G A;  5EBL C;  2DWD C;  4R6Z A;  5B1A C;  2V7Q G;  2UXN A;  4JAS A;  1GM9 A;  1PNM A;  1KEC A;  4BIZ A;  1R3L C;  1XL6 A;  3STL C;  3VOU A;  1M56 C;  1Y4M A;  3CCE V;  1SZT A;  2EJR A;  2XAF A;  3ASO C;  3JD3 A;  3OEE G;  4R7C A;  1WLE A;  1VQL V;  4PDL A;  1YIT V;  2BOC C;  1ZWI C;  2HVK C;  4U7N A;  2AHZ A;  1G8M A;  1F23 A;  1K4D C;  2EIK B;  2X6A A;  3MD0 A;  3JD2 A;  4WF9 V;  1XL4 A;  1PNK A;  2M7W A;  3E35 A;  3ZMS A;  5CA3 A;  3ZRX A;  1E1R G;  3ABK C;  1KD1 W;  4FMT A;  1R3K C;  1BMF G;  4TSF G;  1B6Q A;  1IXM A;  3AEI A;  3OR7 C;  2IH1 C;  3EHB B;  1JQ0 A;  4H37 A;  1DLB A;  1GMG A;  5B3S B;  5IDJ A;  1I5X A;  3SYO A;  2ATK C;  3I55 V;  1CP9 A;  1EFR G;  2X7R B;  2HKO A;  3IGA C;  4UUJ C;  4UVC A;  4CBC A;  4HYO A;  3ETG A;  4MVO A;  4PDR A;  4X8A A;  1VQM V;  2XND G;  3I56 V;  5L3D A;  4N21 A;  3CC4 V;  4JTC B;  5L3F A;  3K08 A;  1E1Q G;  4P2Z A;  1NBM G;  5CMU A;  3QO5 A;  1GKF A;  2Q6A A;  3SYQ A;  2C2A A;  3AG4 B;  3STZ C;  3ZRS A;  3TET A;  2D3O W;  3ZMT A;  3ZRV A;  5GW7 A;  1JX9 A;  2HFE C;  3SPH A;  3UM7 A;  3B8M A;  1QVF U;  2XOK G;  1PNL A;  3KG2 A;  4QE9 A;  4MW8 A;  1VQK V;  3WG7 B;  2R9R B;  3T4D A;  1M1K W;  3UKM A;  2UXX A;  5CBH A;  1S76 D;  1KQS U;  3K0G A;  4FIP C;  2DQ3 A;  2QA4 V;  1V55 C;  4LBE C;  3WFV A;  3GWO A;  1FXK C;  4MVS A;  5EC1 C;  2Y48 A;  2IU0 A;  4MTO A;  2Z5U A;  1R6N A;  2EIL B;  4L87 A;  4QPJ A;  3CPW U;  3FB7 C;  1G4Y B;  1QBZ A;  2Z3Y A;  4LC1 A;  4HZ3 A;  2GSM B;  4QJF B;  3M99 B;  1S72 V;  1OCO B;  2JEX A;  4JF3 A;  1JPX A;  3LDC A;  4OXS A;  1S3J A;  3ZRW A;  5H9C A;  3T1C A;  1GO3 F;  3MHH C;  5EBM C;  4QE7 A;  2GHY A;  1AR1 B;  4WFH A;  3K03 A;  5EK0 A;  3K3W A;  5H6R A;  2KB1 A;  1PKX A;  1FXH A;  3H01 A;  4R50 A;  3W7T A;  2IJK A;  3AG2 B;  2HG5 C;  4GCZ A;  4R8C A;  3RBZ A;  5KA5 A;  5B1B C;  2YEV B;  2A9H A;  1M9N A;  5LHI A;  1RPR A;  5H6Q A;  3LNM B;  2P7T C;  3ASN C;  4WFE A;  2XAS A;  3ZCC A;  4Q20 A;  1OCC B;  1AI4 A;  3ZIA G;  3A0R A;  1AJP A;  1W0J G;  3CYO A;  3OM3 B;  1QCE A;  2Q69 A;  3D3I A;  1NH2 B;  2B5U A;  5E1A C;  2DYS C;  3ETE A;  3E89 A;  4UVA A;  1VQ9 V;  3SPC A;  2QKS A;  1VQP V;  4UV9 A;  1NQT A;  2WLJ A;  3CC2 V;  3F5W C;  4P9O A;  1K97 A;  4ZKI A;  2YEV A;  4WFA V;  2Y69 B;  1JCH A;  1RPO A;  2ZXW B;  1YJ9 V;  4U7O A;  4XDJ A;  1VQ6 V;  2WLN A;  3E8B A;  3MHS C;  1DF4 A;  4UXN A;  4P9P A;  4X88 A;  1ARO P;  4P30 A;  1K33 A;  3OMI B;  4MS2 A;  4PA6 A;  1M57 B;  1KP3 A;  3W7W A;  3OUF A;  3CXC U;  1VQ8 V;  3JD4 A;  4LCU C;  1R3I C;  4JTD B;  4EKW A;  2EIJ B;  3ABU A;  4PEL A;  4QPK A;  2IU3 A;  3CCL V;  1E79 G;  3ZMU A;  2EZO A;  2LFS A;  2EIJ C;  2JJ2 G;  2WLH A;  2ZDI C;  2WPD G;  3G4S V;  2OT5 A;  3K06 A;  1Q81 W;  4JYC A;  2EIK C;  5DN6 G;  3SPJ A;  3TK1 A;  1H38 A;  2EIM B;  1Y66 A;  1W0K G;  1AI7 A;  2IH3 C;  3AG3 B;  5IY5 B;  3BEH A;  1KKD A;  1UJW B;  3F7V C;  4GX5 A;  3AG1 B;  1K8A W;  1H2G A;  1AJN A;  1LNQ A;  5HFL A;  2EIN B;  3GB7 C;  2DW4 A;  3FB8 C;  2IJJ A;  3X2Q B;  1MSW D;  4Z1M G;  2A79 B;  2BOB C;  3LSS A;  3ABM B;  1V54 B;  2ZDI A;  1OHH G;  1OCZ B;  1R3J C;  3LDD A;  1SES A;  4GX0 A;  2P6J A;  4PA4 A;  5B3S C;  1K73 W;  4XDL A;  1CPY A;  4BIU A;  1NVP D;  4GX1 A;  4KP4 A;  3G71 V;  5LGU A;  2QTO A;  1HWY A;  4G28 B;  3RW0 A;  2WLM A;  4JAV A;  2LFR A;  3ABL B;  3OAA G;  4BW5 A;  3K0D A;  3OW2 U;  4MT8 A;  3ZN0 A;  4E2L A;  1MAB G;  3OR6 C;  3JD0 A;  2W6J G;  3W7X A;  1H8E G;  3AG4 C;  3E83 A;  4RUF A;  1Q7Y W;  1S0V A;  4JTA B;  1F51 A;  2IJI A;  3IFX A;  4MTG A;  4G2K A;  5BZB A;  2WLL B;  2HVJ C;  1TUE B;  3WG7 C;  3CMA V;  1RM1 B;  4XBF A;  3CCQ V;  1ENV A;  1FFT B;  2WAM A;  1AI6 A;  4JPR A;  1EBO A;  1P4R A;  1QLE B;  2DWE C;  5CN0 A;  4ASU G;  3ZMZ A;  3T4Z A;  1K34 A;  1AI5 A;  2EIL C;  4GT1 A;  2WLI B;  3LDE A;  1Q86 W;  4JGS A;  2HR3 A;  1YSC A;  2LP7 A;  3G6E V;  1MOF A;  1OCO C;  1R73 A;  2DQ0 A;  2OCC B;  1JOY A;  3BY6 A;  2V1D A;  4MTF A;  2QE7 G;  4UVB A;  1NJI W;  3K79 A;  3E2E A;  3FB6 C;  3ETD A;  4TWK A;  1OCR B;  3CCV V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...