1I5YA

Hiv-1 gp41 core
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
61
structure length
61
Chain Sequence
IVQQQNNLLRAIEAQQHLLQLTVWAIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of interhelical interactions in the human immunodeficiency virus type 1 gp41 envelope glycoprotein by alanine-scanning mutagenesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords TRANSMEMBRANE GLYCOPROTEIN (GP41)
total genus 26
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1i5yA00
1I5YA 4FK5C 1QCEA 1QR8A 1QR9A 3P30A 1EBOA 3K9AA 4JPRA 1Y4MA 2MK3A 4FJCC 5CMUA 1K34A 3M99B 1MOFA 4N21A 3MHHC 1Y66A 5HFLA 3GWOA 1K33A 1SZTA 2X7RB 4JF3A 5HFMA 2EZPA 5KA5A 2EZOA 4G2KA 4JGSA 1JPXA 1QBZA 2P6JA 3MHSC 1ENVA 1MG1A 3B8MA 3H01A 2LP7A 5KA6A 5CN0A 1DLBA 1I5XA 2EBOA 1F23A 3B77A 1DF5A 3CYOA 5H9CA 3B8NA 1DF4A 4E2LA 3CP1A 1JQ0A 4N23A 2OT5A 3WFVA 2M7WA 4FIPC
chains in the Genus database with same CATH superfamily
1E79G 4DR7B 2WWWA 2WSSG 2AW9A 1N4CA 4KXRA 4U3JB 2EZPA 2H8PC 3SPJA 4LFBB 1HP8A 4JTDB 5DECA 4YJ2B 4IGGA 3L72H 4CH5A 5CA0A 4J42A 4N23A 1GN6A 1NS1A 2C2AA 2Q7GA 3ML0A 2D2CB 2B9ZA 1K34A 1XDCA 4UCVA 1N8RW 5IDJA 2QE7G 4DV1B 2CTPA 4Z1VA 3F7VC 3U10A 2IU0A 2ETNA 4O4HA 2CH7B 1K7DA 3QO8A 3SPCA 5EYPB 1ZUQA 4X66O 2Z3YA 4JI5B 4W4KA 1AJNA 4C7UA 3K0DA 3GWOA 3DGEA 1EZJA 3LUTB 1Y74A 1RP3B 3RYCA 1BMFG 1Y76B 3EXAA 3N2GB 3FB5C 3L73H 5LP6A 3GB7C 1ZLZA 1QNMA 4PA4A 4YHHB 1N0NA 4DW1A 1RSOB 1N0JA 2Y4UA 1KECA 5JQGB 4DRXB 4O4IB 2YEVA 1HNWB 3E8GA 1GRJA 3T1YB 3AG2B 4CZZA 2ZT9B 4JI3O 5ITZA 2OT5A 2F43G 1MSWD 2MW2B 1I5YA 3TJTA 4H33A 4TUYA 2UXNA 4I4TA 3CWBH 4JAUA 1D5AA 3AG2C 1Q6IA 3AG4B 3SYCA 1U96A 3CRMA 3ZMUA 2E74B 1IZ3A 1SKVA 5BY1A 2QGNA 2ILMA 1VARA 3N2KB 2DYSB 1JFFA 5IT9N 4E2LA 4IHJA 1VQOV 1JA8A 3S3WA 3ABMC 3SYAA 3A0HZ 4QGPA 3JSNA 4CH3A 4FJCC 5KLVH 1R6KA 2QM8A 3J80N 2RJZA 2HLDG 3VQXA 3ETQA 4YHHO 3IGAC 5GONB 4DK0A 5JQGA 4JI1B 4B3TB 4UV8A 3ICXA 4NTWA 3WG7B 4O4LA 3K58A 1IBLO 5IYZA 1H2GA 2QEXV 3RYHB 2UXXA 1NU1H 2AGAA 3UM7A 4O2AB 1DTOA 1AI4A 1JCHA 5LXTA 1BL8A 2ZINA 3ZRWA 1KKDA 2XOKG 2EZOA 4JGSA 2CAZC 5EC2C 2AXTZ 2JJ1G 4HNAB 5LOVB 1EN6A 4FLXA 1XL4A 1O9HA 2ZD9A 5FNVB 1BZKA 1Q90D 4BIZA 2XAQA 2EILC 1DGSA 2Q5ZA 1H2LA 2Q7EA 4I5SA 1BSMA 3F7YC 1ZX3A 1FFTB 2YEVB 1H8HG 4LFCB 2DYRC 2VQEB 3ZHQA 2BSKB 3ZN1A 2N04A 3FB8C 1QBZA 2PZSA 1NR7A 1VQMV 1PL4A 2GSMB 1OCZB 1JR9A 5LHGA 2XTAA 1YCIA 1JQ0A 2GBOA 2YI9A 1XMOO 4LF5O 4LBEC 1N36B 2ZKOA 1YIJV 2EJRA 3OE7G 2L35A 3BAAA 4PELA 4K0KO 4R8CA 4QPKA 4NXNB 3A8TA 1EN5A 4O4JA 4MTXA 4TV8B 5L3BA 1GM7A 1H2SB 3CRAA 1EM1A 4RUFA 1M93A 1DK1A 2QWPB 1I94B 3CCMV 1XHXA 2GTSA 3C3TA 1BT8A 1THZA 2YXHA 2PI4A 4WBNB 5JVDA 5BR8O 1EFRG 3QNEA 1HW7A 1TUBA 3G80A 4FM2A 3OAAG 1YF2A 1YVWA 2KSDA 3F5TA 4KHPO 2FL4A 1B06A 2A06H 3JD4A 2WLLA 2AZ0A 3ZMSA 4I50A 4YIOA 2R9RB 3DTUB 5F2VO 5JWPA 1FFXB 2VWKA 3RYHA 3MHHC 5GTHZ 1XL6A 2EIKB 1KP3A 4LH6A 1VQ6V 1AROP 1VF7A 4MVSA 3ASOC 1H2KA 3J81N 4RWUA 1F7YA 2WLMA 1VQ5V 2A79B 1BCCH 1AI7A 3BVOA 1SRYA 4MVOA 1ZAUA 4A5UB 2ZNJA 4LFAB 2Y0PA 5BR8B 5LGTA 1FXVA 3K79A 3SPIA 2WPDG 4B3SO 3STZC 5JJEB 1D2DA 1VQKV 4AQYB 2E3CA 3BEHA 5LHIA 1EBOA 4DV4B 2AZ2A 2ARHA 3W7UA 3CHXA 4J7JA 2P06A 3TCUA 3ASOB 2YS8A 3AG3B 3LSSA 3ETDA 1AJPA 1AI6A 3K5OA 5CA3A 1NJIW 3CXCU 1Q3EA 2PF4E 5CB4A 3UO2A 2EIJC 4O4JB 4YJ3A 4MVUA 3LSQA 1LNQA 4MW8A 4MTOA 2Q8VA 3I56V 3N2KA 4IIJA 3CMAV 4IYHA 4GT1A 4HBNA 3K0GA 3AG1C 2VS0A 2WLNA 3P32A 5JH7B 3H01A 4DR2O 3DXRA 2XAJA 4X20A 5LMUB 4Z1MG 4LNUB 4DR4B 3FAVA 2PYJA 3CD6V 2OIEA 4FFBA 4UFZA 1TVKB 4OGQB 4ZBMA 4DW0A 1K33A 3DSQA 2JDIG 4JI7O 5EZYA 1PNMA 4DV5O 2EULA 1IDSA 5KAFZ 3CXHF 2QWQB 2HJDA 1PM9A 1ZSPA 3ASNB 4CS4A 4F6EA 3RGBA 3OTOO 2FMLA 4BIOA 1VQLV 5DN6G 1OCCB 4PDMA 1Q5OA 3J7AU 5CA0B 5LGNA 1ZWIC 4IIJB 4PI0A 1IBLB 2BTQB 3BA9A 1VP7A 1XBLA 5JJJB 1FKAO 2RNBA 1K4DC 1V9PA 2VRZA 5LMUO 4DRXA 3FAVB 2A7WA 2QTOA 1OZ0A 2OIGA 5EIBC 1K5SA 4JI0O 4GKKO 3BFRA 4DR1B 4KL1A 1GKFA 2CH7A 3KG2A 4JASA 4WFFA 1N34O 1GAXA 3OR7C 1E1QG 3K5NA 1VQ8V 3E8BA 3VBBA 5IYBO 3D3QA 5D5PA 1YITV 2UUAB 1TUEB 1WLEA 2KQXA 4NTYA 4GX1A 4UCTA 1T5EA 2ZCEA 3K08A 1WP8A 4G2KA 4X20B 1EN4A 1UJWB 2JGDA 5JJNB 3O9OA 4X88A 4AHCA 1RM1B 3IAYA 4E4EA 3E22B 3R65A 2VQFO 1QLEC 2DOSA 1COWG 3OD4A 4UVAA 2M7WA 4BR6A 1MMMA 4B3RO 2XNDG 3HKCA 4JI2B 2F66C 1Q7YW 1SQVH 1Y66A 3ABMB 5KHJA 3D8CA 4K8XA 1I94O 1XMQB 4FLUA 4UCRA 1Q8IA 4TWKA 3DC5A 1MZEA 2HVKC 1TA8A 2WLIB 2GHYA 1BE3H 2P90A 5KUMA 4QNHB 3JATA 4JI7B 5KHKA 3AK1A 4HYOA 3JD2A 2X7RB 3UO3A 4YJ2A 4UB8Z 5IJ9A 2DQ0A 1HR0B 2JGDB 2QSAA 4FIPC 3P3PA 4LF7O 4FK5C 4DR7O 3FFQA 3SJBC 2CDYA 3H1JH 4UXNA 1N36O 4JYAO 5HFLA 2Q9LA 4EB6A 4DUYB 3H9VA 5JCOC 1N32B 3SYOA 1NVPD 3KCYA 2Q73A 3OUFA 3OEHG 3B77A 3OFNG 4X64O 3T1CA 5FNVA 4J7ZA 1ROPA 4RQEA 1GM9A 3O65A 4OPAA 4DV2O 2QA4V 1X4TA 4GUNA 4X62O 5EBMC 1PP9H 1YHQV 5KA6A 3GVMA 4DV7O 4X65O 2Y48A 1SESA 3C90A 5LP6B 3RFRA 4DR4O 1RFYA 3LSUA 1P7GA 1IBKB 2BSKA 1NZ6A 3RT3C 3OGIB 1FJGB 1A32A 3ABUA 1VQPV 4O2AA 3TXQA 4H13B 1Q81W 1S5HC 2HEPA 5EK0A 2YIBA 4FZ0A 4B3TO 4B7EA 3D36C 4JYAB 4I50B 3AG3C 1RPRA 2DMXA 4Q6GA 2XAFA 2GUZA 1K3EA 1QR8A 5H6QA 5BZBA 5KHGA 4FLWA 5CMUA 4JI3B 2P7TC 2HJFC 5KMGB 1K8AW 3STLC 3T1YO 2DE0X 4CS3A 1I0HA 4B3MO 3K57A 1TUBB 3CYOA 3DC6A 4GYCB 1DF4A 3CX5F 5IJ9B 4ZI7A 3HR0A 3CC2V 3OTFA 2Q67A 1R3KC 3P30A 3TGUH 5FLXN 1J5EO 4LFAO 4DV0B 3UKMA 2QDOA 3D3IA 3KKYA 4FFBB 4I55B 4D6TH 2WLJA 4LH7A 3EVKA 1VQNV 3APOA 2UXDB 3E8HA 1EZVH 4AILC 3RYFA 4DV4O 1ZTEA 1IBMB 3CRCA 4UUJC 5L3DA 3N2GA 2A9HA 1SA0A 3RYIB 1M56B 4PV1B 3RVYA 1W2BU 3LNNA 3BA8A 1E1RG 1J95A 4HNAA 2F93B 4JF3A 1K92A 3B2EE 3T4DA 3ZCCA 3UT5A 4WF9V 4TSFG 2LGWA 1M9NA 4DR2B 2ZR3A 1HNXB 1WA8B 2ATKC 4PA9A 2DW4A 1QU7A 1L0LH 1AI5A 2Q7HA 3WU2Z 2BOCC 2GV9A 2YSUB 2Q69A 5GONA 2OCHA 4PDVA 1M90W 1XREA 5B3SB 2VQEO 2F1MA 2ZE8A 3SDLA 1V54B 4PA6A 1B3QA 1M1KW 1R3JC 1GM8A 4EEQA 3K9AA 4G27B 5L3EA 4DV5B 3NXSA 2EINC 5LL6Y 4NYKA 4F6RB 3LNMB 3H1IH 4ZHQA 1P7BA 2JIZG 1KQSU 4JI4O 3RWRD 4JZ2A 2ZIOA 1M5IA 1BHAA 4QPJA 2IU3A 1S5JA 5A2QN 1H8EG 2NNUA 3RYFB 4PI2A 1M57B 3BABA 2R70A 1HWYA 2QTSA 4JYCA 4EB6B 4DV1O 5K1PA 3W7WA 5LA6B 2HR3A 1NTMH 2ZXWB 3CCUV 5IYCO 3C3SA 4J9YB 2V1DA 3HKEB 2HHHO 4DR3O 4LF9B 2UU9B 4TQFA 3ZIAG 1YSCA 4NR1A 3RYCB 1AR1B 1NQTA 4J41A 1KB9F 4P2ZA 3KZIZ 5J9PC 4DV7B 1Z2GA 2H94A 3B4SA 1MSDA 3HB3B 1SQFA 3X2QC 3QO7A 4JAAA 2WAMA 2WLHA 2ZR2A 1YZBA 5AG2A 2V7QG 4CS2A 5H2FZ 4FZ1A 3JALB 2YIAA 3VQWA 2A3QA 2X6BA 2YIDA 2DYRB 3ZRVA 1FFXA 4Z2WA 3JCZA 4LCUC 4DV2B 3OW2U 3LDEA 1SQQH 4JPRA 2ZXWC 1Q6UA 2HVJC 4QIWF 4FM0A 5LHHA 1KYOF 2F23A 2Y4TA 5JVDB 2LGQA 3E89A 4MVMA 4TQDA 5KHIA 1DLBA 2HG5C 3TXSA 5B1OA 1NTZH 1F4MA 1F51A 4FM1A 1FJGO 2P5OA 4OXSA 3K03A 4LC1A 3F5WC 4GKJO 1XMOB 1NTKH 2XT9A 3M99B 4JTAB 3B40A 5A9GA 1LR1A 4H0LB 4J7KA 2B1GA 2P4VA 4I9QA 1AJQA 3OMNB 2ZDIA 3AG7A 4X89A 3VOUA 2JEUA 4MS2A 2WA3A 1Q82W 1MNGA 4PDRA 1OCCC 1TVKA 2E75B 4MW3A 4CH4A 1V54C 5LBQA 1CPYA 3HKBB 1PPJH 1K73W 1P49A 3JAKB 4TV9A 4DV3O 1N33B 3B8MA 1VF5B 2QWNB 1SS3A 5CN0A 2PY5A 2GDSA 2ADPA 5E79Z 4MVQA 5EBWC 4RO2A 3B8NA 3CP1A 1P84F 1PKXA 2JGUA 3FX7A 5FPRA 2Z5UA 3JATB 3CEIA 1N33O 1I7FA 3QVNA 4WFAV 1IXBA 3SJAC 3SJQC 2CTWA 4LF6O 2W6IG 2LQTA 1JPXA 3H1LH 1WNSA 2PI5A 3AK3A 3OMAB 4RQFA 5J2TA 2BOBC 3ZN0A 3WB1A 5B5EZ 3UCSC 4O2BB 2OWOA 2F4VB 4BW9A 1MZFA 3OR6C 3RBZA 1D5NA 1KKCA 2EILB 4ABMA 3G6BA 2HFEC 4D7TA 3MHSC 3WG7C 1M4UA 2LP7A 4K35A 4OX9B 2UUCO 5EBLC 4PJ0Z 4WCEV 1WPXA 2JRIA 5H9CA 1K9MW 3FYEB 2JS3A 4X1KB 1N34B 1L8DA 1WAZA 3NR7A 3M7MX 4JI0B 4GKKB 4ZOLB 2IH3C 4QE7A 3G67A 2YXLA 2DYSC 4OPHA 4O4IA 2E5LO 1W0JG 4JAVA 2G38A 4ZI7B 5BMVB 1FXHA 2BTOA 3AG4C 2CK3G 1X59A 5ITZB 3U11A 1KMIZ 3ZRWB 5CA1B 3LDCA 1WB7A 3OTOB 5L3FA 3CC4V 2YXYA 4RAIA 2JJ2G 3Q4HB 2CTRA 1YDXA 4F6RA 5B1NA 4U3JA 4UB6Z 3K5LA 1QQCA 2BTQA 4PA7A 1R6TA 2BCCH 4YY3O 4NKGB 2RDCA 2OYQA 4U7OA 4ASUG 5KMGA 1K5QA 3ABLB 1B04A 4X9QA 3OUSA 2P6JA 3JARB 1ENVA 3W7SA 5EIBD 4LF4B 1I5XA 5B3SC 4BAYA 1YI2V 1QLNA 1AVMA 3MD0A 2Y69B 1BGYH 4U3FH 4AQYO 5B66Z 1KBHA 2A0LA 3W7TA 1J5EB 1IXMA 1OV9A 2NLJC 3CRQA 4LF6B 1XQ8A 3K59A 1P4RA 3FKSG 2QM4A 2JEXA 1OJHA 3ZEDA 4DYLA 3ABLC 3U0ZA 2WLIA 4DUYO 1N32O 2ZE6A 4FLZA 3SGIA 3K3WA 2ZNIA 3CS5A 1MA1A 2WLKA 4FLTA 1FAFA 1OCZC 1NH2B 3HKDA 1S76D 1O9GA 4CBCA 4JV5B 4WBNA 1I08A 4LF5B 3T1HO 2UXCO 1ORQC 1Z5WA 3N27A 3JASB 2OTLV 5CA1A 2FYUH 2B1IA 1XMQO 4O4HB 4DV0O 1QHTA 1JX9A 2B5UA 2PGGA 1M56C 4GCZA 4YIPA 3WB2A 1V55C 1NR1A 3K9SA 3M8AA 4X62B 2EIJB 2FB5A 1VEWA 5IYDO 4JI6B 4MT8A 2E5LB 1AP5A 5KHHA 3OT7A 4LWSB 3ZHTA 2NR5A 4TV8A 4GX5A 4PA3A 3ZRXA 1NH2D 4X66B 4K8ZA 2ITDC 4JI5O 4D7SA 4X1YA 1JFFB 5K1XA 3CJHA 3AK2A 2W0XA 3T2MA 3ZBHA 3JARA 1NVPB 2D3OW 1CEZA 2UXBB 2E76B 4J9ZB 1FD9A 2Y69C 2Q4PA 3CB2A 4DR5B 1SQXH 3QG5A 2ZE7A 1GN4A 3GWKC 3I55V 3KCXA 2EBOA 3OM3B 1AB3A 4H44B 1FPOA 2BE3A 1WPBA 4K3AA 2LW7A 5GW7A 2QKCA 5J2UA 5IWAO 3A2FA 5JCOA 2Q68A 3K04A 1Y4MA 1YJWV 3ETGA 3CCLV 1H38A 1HNWO 1S3JA 2UUBB 2PTMA 2K1EA 3L75H 2YC0A 1Y67A 5CB4B 3IC7A 4DR1O 1F23A 4IL6Z 1SA0B 3RYIA 3PN1A 5IE9A 3S3XA 2QWRB 4R7CA 3G6EV 5GTIZ 2EIMB 1QCEA 3HKDB 5H5NA 5LYJB 2EJ7A 1XNQO 1ZL8B 4XBFA 4MVZA 4R50A 2Q6AA 5CBGA 4WFGA 3CMEV 4L8JA 4CC6A 3CRRA 5EC1C 1G6UA 3BPZA 3G71V 1YJNV 4GKJB 1IBMO 1GTOA 1LUWA 3EHBB 1XNQB 4XDLA 2DWEC 5IY5C 4DR6O 1NKDA 1QR9A 2ZIMA 2MK3A 3JYCA 4J80A 5FPOA 3SPGA 5EYPA 5J2UB 4MTFA 5IWAB 4Q20A 1S77D 1JVMA 2JK5C 2Z0AA 2HKOA 4X1IA 1Y74B 2IJIA 4NVPA 3L74H 1GO3F 4WFBV 5C93A 1NBMG 1OHHG 3AG1B 2HHHB 1FXKC 4P9PA 2IW5A 5BXZA 3ZHUA 1AP6A 3CCJV 1G8MA 2R72A 1BHBA 1WN7A 1HNZO 3CE2A 1RSOA 2AHYA 4B7KA 3K5MA 2UUAO 5CBFA 4X8AA 3QO5A 2LFSA 1NT2B 1R3IC 2K9PA 1JMKC 1OCOB 4LF8B 3CCVV 4DR5O 1G1XB 4JI4B 3QF7A 5LA6A 4B3RB 1KP2A 5EZYB 1SETA 5DM6V 3VQYA 1F4NA 4F4LA 1W59A 2IJKA 4WFEA 3CCQV 1Y76A 5LMNO 4I0XB 3WB0A 3ZMTA 2ZM6O 2IJJA 2LJ2A 4EFBA 1SQBH 3FD9A 2JS5A 4OX9O 4FFKA 2UUBO 2N05A 5LYJA 5IY5B 3T4ZA 4XDKA 3VQVA 3SR2C 4NXMO 1Q86W 3T1HB 1GK9A 1R1BA 4PDLA 4UVBA 2QR4A 4R6ZA 2LO1A 3E22A 2FTKA 1GN3A 5CBHA 2YDEA 5IYZB 2LW1A 2CE4A 4O2BA 3R66A 4MSWC 4P30A 1QVGU 3AEIA 3JAKA 3JSLA 4JTCB 4LF8O 1KU9A 3CCRV 2GUZB 4UVCA 5KX5B 1VQ4V 1SQGA 1U97A 2QM7A 4DUZO 2OCCC 3THOA 2DN9A 2Q0AA 4CH6A 5B1AB 4YJ3B 4LP8A 1TGOA 4IT5A 1SERA 5LP6C 3CSXA 3ABKC 5D5QA 1RPOA 1SZTA 3Q4HA 4KFMA 2H3OA 1QVFU 2X0LA 3H1KH 3IJ4A 3SYPA 4ZOLA 1WB8A 2IM9A 5JH7A 1HDJA 2CTQA 3ZX6A 4QJFB 4EKWA 5B1BB 3ABKB 1Q6HA 2ZE5A 3E35A 3MDSA 4KHPB 1KD1W 1YTFD 1XILA 3JD0A 3L70H 3CCEV 5LGUA 3A0BZ 1AR4A 4JZGA 2M6YA 4FLVA 4GX0A 4DV6O 2UXDO 4BW5A 3E83A 5KAIZ 4PD4F 4HAMA 5C8YA 1R3LC 2PYLA 2NN4A 3LDDA 2OCCB 2ODMA 2IJHA 1OCOC 2RMKB 4W4LA 3IFXA 2KG7B 2HP8A 4XDJA 1YXBA 4BWAA 1XOUA 5LMNB 5TISZ 2YIBD 2ZM6B 1S72V 1VF6C 5BMVA 3FB6C 3E86A 3SPHA 3ZMZA 4FMTA 4AI8A 2RQ6A 2ZDIC 3ASNC 4X64B 3OMIB 5J2TB 3K06A 4RUEA 3L9DA 4LF4O 2ZQMA 4G28B 4UV9A 1R73A 1NI8A 3JD1A 2DQ3A 5L3GA 2EINB 4JI8O 3JD3A 4ZHQB 3SYQA 2KB1A 2UXBO 1FS0G 4GX2A 2F4VO 1Z5VA 4UCUA 3RN4A 3APQA 2P22C 4YY3B 5FL7G 4X1KA 1GN2A 3IC9A 3CJHB 3WFVA 1S0VA 3FB7C 3L71H 3CPWU 1XNRB 2PUSA 4B08A 2WLLB 1R6NA 3CCSV 1UFIA 2YUAA 1MOFA 4N21A 4P9OA 2CGOA 4I4TB 2W0FC 3HKBA 1JJOA 3DXRB 5KA5A 3BHPA 4J11A 4O4LB 1VMGA 4NXNO 2QKAA 4J10A 2P4KA 5KUKA 4TT3G 2ITCC 3TK1A 5LOVA 3QTCA 2VWJA 3ZHSA 1PNKA 2OTJV 1IVSA 3JAWA 4IHJB 2QWOB 4KP4A 2CUGA 1PV0A 4FVMA 1WP7A 4FPPA 3B09A 1UPGA 2FKXA 2KG7A 5IJ0A 4LF7B 4QE9A 3HPLC 1CXZB 1JJ2U 1SC5B 1B6QA 3A0RA 5B1AC 2XUMA 4JV5O 4LR3A 3HKCB 1XNRO 4DO2A 2EIKC 4DV3B 5H6RA 1YEWA 1VQ9V 3W7XA 2P67A 4LWSA 1BQ0A 2EX3A 4PHZA 3JCUZ 2UUCB 2EIMC 4H37A 1PL0A 1PD3A 4MTGA 4TV9B 4X1YB 3MAQA 3ZJZA 1Q43A 3JAWB 1IURA 3TETA 4LFCO 1VF6A 2DWDC 3OGCC 1MG1A 1WA8A 4X1IB 4CC5A 2XHBA 1KUQA 1ZL8A 4UCSA 3ZMVA 3OEEG 2YICA 1AILA 3EFFK 4IYIA 3UT5B 4DK1A 1S5LZ 2UU9O 1YJ9V 2JVDA 2V4DA 3ZHVA 2O57A 4JI8B 1AR5A 4LNUA 4I7ZB 1G4YB 2RN9A 4I9WA 4JYBA 3FYIB 2XASA 4GLXA 2IBZH 4L87A 2XAGA 4DUZB 4KUMA 1OCRB 4DV6B 1SQPH 2KKWA 2RCVA 4U7NA 4TUYB 1XHZA 1WJZA 1KC8W 1FXKB 3H1HH 3G4SV 4BIUA 4JI1O 3BRCA 1TAEA 1V55B 3RVZA 1W0KG 3D36A 4DR6B 1QLEB 5LXTB 3X2QB 4ZKIA 5C8YB 1H2NA 1BS3A 5B1BC 3ZHRA 1XUQA 5HFMA 4B3MB 3I5DA 4DR3B 4LF9O 5DEDA 2AHZA 5IJ0B 2L6LA 2QJ1A 1M57C 1JOYA 4GZRB 4NTXA 3E2EA 3P3NA 1FYJA 1K4CC 2CGNA 1SZXA 4JI6O 1HR0O 1BQZA 3ZRSA 2Q0OC 4DXWA 4ICGA 4EFEA 3JASA 1HNZB 1VQ7V 2W6JG 3HKEA 2X6CA 3UQ8A 4JYYA 3RW0A 1CP9A 3ETEA 1IX9A 2VQFB 2XAHA 1L1FA 4TOIA 2LFRA 4LFBO 1L0NH 4FLYA 3BY6A 4I0XA 3BCCH 1GMGA 2WA4A 4UCOA 1XI1A 1K97A 1VIBA 3E8FA 2ADQB 2X6AA 1SF9A 5KX5A 1Y6XA 3ZS8C 2F95B 1HNXO 1PNLA 3JAMN 4K0KB 4JI2O 1H2MA 2IH1C 4NB5A 4WFHA 2UXCB 1URFA 4MVRA 2QKSA 4YXWG 3CC7V 4B3SB 1MABG 4X65B 1YTFB 2GTAA 2R9AA 3ABTA 1LUVA 2N74A 1XEQA 1IBKO 2Y0IA 3SJCC 4NXMB 4I55A 3PJSK 2DJVA 1FXKA 1RM1C 5E1AC 1DF5A 4ZIBA 1OCRC 1GH6A 2YI8A 3JALA 4HZ3A 2R9IA 5L3CA 1US6A
chains in the Genus database with same CATH topology
3ZMTA 3K03A 4LC1A 3F5WC 2IJJA 1E79G 1K4DC 3M99B 2QTOA 4JTAB 5IY5B 2WWWA 1OZ0A 3T4ZA 2WSSG 4XDKA 1K5SA 2EZPA 2H8PC 3SPJA 1Q86W 2B1GA 4JTDB 1AJQA 1GKFA 3KG2A 3OMNB 4JASA 4WFFA 1GK9A 4UVBA 4PDLA 2ZDIA 3OR7C 1E1QG 4X89A 3VOUA 1VQ8V 2JEUA 3E8BA 4MS2A 4R6ZA 1Q82W 3VBBA 4N23A 2C2AA 4PDRA 5IYBO 1OCCC 3ML0A 1YITV 2FTKA 5CBHA 4MW3A 1TUEB 1WLEA 1V54C 1K34A 5LBQA 1CPYA 4GX1A 1K73W 1N8RW 5IDJA 3K08A 4MSWC 4P30A 1QVGU 3AEIA 4G2KA 2QE7G 3B8MA 4JTCB 1UJWB 5CN0A 4X88A 1RM1B 3CCRV 3F7VC 2IU0A 4UVCA 1VQ4V 4MVQA 5EBWC 4RO2A 3R65A 3B8NA 2QM7A 2OCCC 1QLEC 3CP1A 1COWG 1PKXA 1K7DA 3QO8A 2M7WA 4UVAA 3SPCA 2Z5UA 5B1AB 4LP8A 2XNDG 2Z3YA 4WFAV 3SJQC 1Q7YW 1SERA 1AJNA 3ABMB 1Y66A 3ABKC 3K0DA 3GWOA 1RPOA 1SZTA 4KFMA 3DGEA 1QVFU 1EZJA 2W6IG 1JPXA 2X0LA 3LUTB 2PI5A 3SYPA 3OMAB 1BMFG 4RQFA 2BOBC 4TWKA 3ZN0A 3FB5C 4QJFB 4EKWA 2HVKC 3GB7C 5B1BB 3ABKB 2WLIB 2GHYA 4PA4A 2P90A 5KUMA 3E35A 3OR6C 3RBZA 2EILB 4QNHB 1KD1W 1KECA 2HFEC 1YTFD 2YEVA 3JD0A 3JD2A 2X7RB 4HYOA 3CCEV 3E8GA 5LGUA 3MHSC 3WG7C 2LP7A 5EBLC 3AG2B 4WCEV 4GX0A 1WPXA 2DQ0A 4BW5A 5H9CA 3E83A 4CZZA 1K9MW 2OT5A 3FYEB 2F43G 4FIPC 1MSWD 4HAMA 1I5YA 1R3LC 4FK5C 3LDDA 4H33A 2UXNA 2OCCB 4UXNA 2IJHA 1OCOC 4JAUA 5HFLA 2IH3C 4QE7A 3AG2C 3AG4B 3SYCA 3SYOA 3ZMUA 1NVPD 2DYSC 3IFXA 3OUFA 4XDJA 1W0JG 3OEHG 4JAVA 3B77A 3OFNG 2DYSB 1FXHA 4E2LA 3AG4C 2CK3G 3T1CA 1VQOV 1S72V 3FB6C 1ROPA 3ABMC 3E86A 3SPHA 3SYAA 3ZMZA 4RQEA 4FMTA 1GM9A 4FJCC 2ZDIC 1R6KA 2QM8A 3ASNC 3ZRWB 3LDCA 2HLDG 2QA4V 5L3FA 5EBMC 3OMIB 3CC4V 4RAIA 1YHQV 2JJ2G 5KA6A 3IGAC 3K06A 2Y48A 5B1NA 4RUEA 1SESA 4UV8A 4PA7A 2ZQMA 3WG7B 4G28B 4UV9A 1R73A 3JD1A 2DQ3A 5L3GA 1H2GA 2QEXV 4U7OA 4ASUG 2EINB 2UXXA 1K5QA 3JD3A 3UM7A 3SYQA 1DTOA 2KB1A 3ABLB 1AI4A 1JCHA 3ABUA 1BL8A 1KKDA 3ZRWA 1VQPV 2XOKG 1FS0G 3OUSA 2EZOA 4GX2A 4JGSA 2P6JA 1Q81W 1S5HC 1ENVA 5EC2C 3W7SA 2JJ1G 5EK0A 1I5XA 1XL4A 2ZD9A 5B3SC 4BIZA 2XAQA 2EILC 3AG3C 1RPRA 5FL7G 4BAYA 1YI2V 1QLNA 3MD0A 2Y69B 3WFVA 2XAFA 1S0VA 4I5SA 3FB7C 1K3EA 1QR8A 3CPWU 3F7YC 5H6QA 5BZBA 2WLLB 1FFTB 2YEVB 1H8HG 1R6NA 2A0LA 5CMUA 3W7TA 3CCSV 1IXMA 2DYRC 1MOFA 2NLJC 2P7TC 4N21A 4P9OA 1P4RA 2HJFC 1K8AW 3STLC 3ZN1A 2W0FC 3FKSG 5KA5A 3FB8C 1QBZA 2JEXA 1NR7A 1VQMV 3CYOA 2GSMB 5KUKA 3ABLC 4TT3G 2ITCC 1OCZB 2WLIA 5LHGA 1DF4A 3TK1A 1JQ0A 3CC2V 1PNKA 2Q67A 1R3KC 2OTJV 3P30A 3K3WA 4LBEC 1YIJV 3UKMA 2WLKA 1OCZC 3D3IA 4KP4A 2EJRA 1NH2B 3OE7G 1S76D 4PELA 4CBCA 4R8CA 2WLJA 4QPKA 1VQNV 4FPPA 3E8HA 4MTXA 5L3BA 1GM7A 1ORQC 4UUJC 4RUFA 5L3DA 2A9HA 2OTLV 1M56B 4QE9A 3RVYA 3CCMV 1W2BU 2B1IA 3HPLC 1JX9A 2B5UA 4GCZA 1M56C 1JJ2U 1E1RG 1THZA 1V55C 1NR1A 1B6QA 3A0RA 2PI4A 5B1AC 1J95A 2EIJB 1EFRG 3QNEA 5IYDO 4MT8A 4JF3A 4DO2A 1K92A 3OAAG 2EIKC 3T4DA 3ZCCA 5H6RA 4WF9V 4TSFG 1VQ9V 1M9NA 3W7XA 2ZR3A 2P67A 3JD4A 2ATKC 4GX5A 4PA3A 4PA9A 2WLLA 3ZMSA 3ZRXA 1NH2D 2DW4A 2ITDC 2EIMC 2R9RB 3DTUB 1AI5A 4H37A 1PL0A 1PD3A 3T2MA 4MTGA 2BOCC 2D3OW 1NVPB 1CEZA 3MHHC 3ZJZA 2YSUB 2Q69A 4J9ZB 2Y69C 3TETA 4PDVA 1M90W 2DWDC 1XL6A 1MG1A 2EIKB 3OGCC 1KP3A 3I55V 5B3SB 1VQ6V 1AROP 2EBOA 3OEEG 3OM3B 3ZMVA 3EFFK 4MVSA 3ASOC 1YJ9V 1V54B 4PA6A 1M1KW 1R3JC 1GM8A 5GW7A 2Q68A 3K04A 3K9AA 4G27B 1Y4MA 2WLMA 1YJWV 1VQ5V 1G4YB 5L3EA 2A79B 3NXSA 4I9WA 3ETGA 2EINC 3CCLV 4JYBA 1H38A 1AI7A 3FYIB 1S3JA 1SRYA 2XASA 4MVOA 4L87A 2K1EA 2XAGA 3LNMB 4KUMA 1P7BA 2JIZG 1OCRB 1KQSU 3IC7A 1F23A 5LGTA 1FXVA 3K79A 4U7NA 3SPIA 2WPDG 4R7CA 3STZC 1KC8W 1FXKB 3G6EV 1VQKV 3G4SV 1BHAA 2EIMB 4QPJA 1QCEA 4BIUA 2IU3A 3BEHA 5LHIA 1EBOA 1V55B 3RVZA 1W0KG 3D36A 1QLEB 3X2QB 4ZKIA 3W7UA 1H8EG 5B1BC 4XBFA 4MVZA 4R50A 2NNUA 2Q6AA 3TCUA 5HFMA 5CBGA 3ASOB 4WFGA 3AG3B 3LSSA 1M57B 3ETDA 3CMEV 2AHZA 1AJPA 1AI6A 1HWYA 5EC1C 3G71V 1YJNV 4JYCA 5CA3A 1NJIW 3CXCU 3W7WA 1GTOA 2EIJC 1M57C 2HR3A 3EHBB 1JOYA 4MVUA 3LSQA 1LNQA 2ZXWB 4MW8A 3CCUV 4MTOA 5IYCO 3E2EA 4XDLA 3I56V 2DWEC 4J9YB 5IY5C 3CMAV 1K4CC 1NKDA 1QR9A 2V1DA 4GT1A 2MK3A 3JYCA 3K0GA 3SPGA 3ZIAG 3AG1C 1YSCA 4MTFA 1AR1B 1NQTA 4P2ZA 3ZRSA 5J9PC 2WLNA 3P32A 4Q20A 4DXWA 3H01A 2H94A 1S77D 1JVMA 2JK5C 2XAJA 1VQ7V 2HKOA 2W6JG 2X6CA 3HB3B 2IJIA 3X2QC 3RW0A 1CP9A 3ETEA 4Z1MG 3QO7A 1GO3F 4WFBV 5C93A 1NBMG 1OHHG 3AG1B 2XAHA 3CD6V 1L1FA 1FXKC 2LFRA 4P9PA 2WAMA 2IW5A 3BY6A 2WLHA 4ZBMA 3CCJV 2ZR2A 1G8MA 1GMGA 1K33A 1K97A 1BHBA 2JDIG 3E8FA 1PNMA 2X6AA 2V7QG 2AHYA 1PNLA 2X6BA 5CBFA 4X8AA 3QO5A 2DYRB 2LFSA 3ASNB 3ZRVA 3JCZA 4LCUC 1R3IC 3OW2U 2IH1C 1VQLV 5DN6G 1OCCB 4PDMA 1OCOB 4WFHA 3LDEA 4JPRA 4MVRA 2ZXWC 2QKSA 2HVJC 4YXWG 5LGNA 3CC7V 4QIWF 1MABG 3CCVV 1YTFB 1ZWIC 3ABTA 5LHHA 3E89A 4MVMA 3PJSK 1DLBA 1KP2A 1FXKA 1RM1C 1SETA 5E1AC 2HG5C 1DF5A 5DM6V 4F4LA 1F4NA 1OCRC 2IJKA 5B1OA 4WFEA 1F4MA 1F51A 4HZ3A 3CCQV 2R9IA 5L3CA 4OXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5Y A;  4FK5 C;  1QCE A;  1QR8 A;  1QR9 A;  3P30 A;  1EBO A;  3K9A A;  4JPR A;  1Y4M A;  2MK3 A;  4FJC C;  5CMU A;  1K34 A;  3M99 B;  1MOF A;  4N21 A;  3MHH C;  1Y66 A;  5HFL A;  3GWO A;  1K33 A;  1SZT A;  2X7R B;  4JF3 A;  5HFM A;  2EZP A;  5KA5 A;  2EZO A;  4G2K A;  4JGS A;  1JPX A;  1QBZ A;  2P6J A;  3MHS C;  1ENV A;  1MG1 A;  3B8M A;  3H01 A;  2LP7 A;  5KA6 A;  5CN0 A;  1DLB A;  1I5X A;  2EBO A;  1F23 A;  3B77 A;  1DF5 A;  3CYO A;  5H9C A;  3B8N A;  1DF4 A;  4E2L A;  3CP1 A;  1JQ0 A;  4N23 A;  2OT5 A;  3WFV A;  2M7W A;  4FIP C; 
#chains in the Genus database with same CATH topology
 1E79 G;  4DR7 B;  2WWW A;  2WSS G;  2AW9 A;  1N4C A;  4KXR A;  4U3J B;  2EZP A;  2H8P C;  3SPJ A;  4LFB B;  1HP8 A;  4JTD B;  5DEC A;  4YJ2 B;  4IGG A;  3L72 H;  4CH5 A;  5CA0 A;  4J42 A;  4N23 A;  1GN6 A;  1NS1 A;  2C2A A;  2Q7G A;  3ML0 A;  2D2C B;  2B9Z A;  1K34 A;  1XDC A;  4UCV A;  1N8R W;  5IDJ A;  2QE7 G;  4DV1 B;  2CTP A;  4Z1V A;  3F7V C;  3U10 A;  2IU0 A;  2ETN A;  4O4H A;  2CH7 B;  1K7D A;  3QO8 A;  3SPC A;  5EYP B;  1ZUQ A;  4X66 O;  2Z3Y A;  4JI5 B;  4W4K A;  1AJN A;  4C7U A;  3K0D A;  3GWO A;  3DGE A;  1EZJ A;  3LUT B;  1Y74 A;  1RP3 B;  3RYC A;  1BMF G;  1Y76 B;  3EXA A;  3N2G B;  3FB5 C;  3L73 H;  5LP6 A;  3GB7 C;  1ZLZ A;  1QNM A;  4PA4 A;  4YHH B;  1N0N A;  4DW1 A;  1RSO B;  1N0J A;  2Y4U A;  1KEC A;  5JQG B;  4DRX B;  4O4I B;  2YEV A;  1HNW B;  3E8G A;  1GRJ A;  3T1Y B;  3AG2 B;  4CZZ A;  2ZT9 B;  4JI3 O;  5ITZ A;  2OT5 A;  2F43 G;  1MSW D;  2MW2 B;  1I5Y A;  3TJT A;  4H33 A;  4TUY A;  2UXN A;  4I4T A;  3CWB H;  4JAU A;  1D5A A;  3AG2 C;  1Q6I A;  3AG4 B;  3SYC A;  1U96 A;  3CRM A;  3ZMU A;  2E74 B;  1IZ3 A;  1SKV A;  5BY1 A;  2QGN A;  2ILM A;  1VAR A;  3N2K B;  2DYS B;  1JFF A;  5IT9 N;  4E2L A;  4IHJ A;  1VQO V;  1JA8 A;  3S3W A;  3ABM C;  3SYA A;  3A0H Z;  4QGP A;  3JSN A;  4CH3 A;  4FJC C;  5KLV H;  1R6K A;  2QM8 A;  3J80 N;  2RJZ A;  2HLD G;  3VQX A;  3ETQ A;  4YHH O;  3IGA C;  5GON B;  4DK0 A;  5JQG A;  4JI1 B;  4B3T B;  4UV8 A;  3ICX A;  4NTW A;  3WG7 B;  4O4L A;  3K58 A;  1IBL O;  5IYZ A;  1H2G A;  2QEX V;  3RYH B;  2UXX A;  1NU1 H;  2AGA A;  3UM7 A;  4O2A B;  1DTO A;  1AI4 A;  1JCH A;  5LXT A;  1BL8 A;  2ZIN A;  3ZRW A;  1KKD A;  2XOK G;  2EZO A;  4JGS A;  2CAZ C;  5EC2 C;  2AXT Z;  2JJ1 G;  4HNA B;  5LOV B;  1EN6 A;  4FLX A;  1XL4 A;  1O9H A;  2ZD9 A;  5FNV B;  1BZK A;  1Q90 D;  4BIZ A;  2XAQ A;  2EIL C;  1DGS A;  2Q5Z A;  1H2L A;  2Q7E A;  4I5S A;  1BSM A;  3F7Y C;  1ZX3 A;  1FFT B;  2YEV B;  1H8H G;  4LFC B;  2DYR C;  2VQE B;  3ZHQ A;  2BSK B;  3ZN1 A;  2N04 A;  3FB8 C;  1QBZ A;  2PZS A;  1NR7 A;  1VQM V;  1PL4 A;  2GSM B;  1OCZ B;  1JR9 A;  5LHG A;  2XTA A;  1YCI A;  1JQ0 A;  2GBO A;  2YI9 A;  1XMO O;  4LF5 O;  4LBE C;  1N36 B;  2ZKO A;  1YIJ V;  2EJR A;  3OE7 G;  2L35 A;  3BAA A;  4PEL A;  4K0K O;  4R8C A;  4QPK A;  4NXN B;  3A8T A;  1EN5 A;  4O4J A;  4MTX A;  4TV8 B;  5L3B A;  1GM7 A;  1H2S B;  3CRA A;  1EM1 A;  4RUF A;  1M93 A;  1DK1 A;  2QWP B;  1I94 B;  3CCM V;  1XHX A;  2GTS A;  3C3T A;  1BT8 A;  1THZ A;  2YXH A;  2PI4 A;  4WBN B;  5JVD A;  5BR8 O;  1EFR G;  3QNE A;  1HW7 A;  1TUB A;  3G80 A;  4FM2 A;  3OAA G;  1YF2 A;  1YVW A;  2KSD A;  3F5T A;  4KHP O;  2FL4 A;  1B06 A;  2A06 H;  3JD4 A;  2WLL A;  2AZ0 A;  3ZMS A;  4I50 A;  4YIO A;  2R9R B;  3DTU B;  5F2V O;  5JWP A;  1FFX B;  2VWK A;  3RYH A;  3MHH C;  5GTH Z;  1XL6 A;  2EIK B;  1KP3 A;  4LH6 A;  1VQ6 V;  1ARO P;  1VF7 A;  4MVS A;  3ASO C;  1H2K A;  3J81 N;  4RWU A;  1F7Y A;  2WLM A;  1VQ5 V;  2A79 B;  1BCC H;  1AI7 A;  3BVO A;  1SRY A;  4MVO A;  1ZAU A;  4A5U B;  2ZNJ A;  4LFA B;  2Y0P A;  5BR8 B;  5LGT A;  1FXV A;  3K79 A;  3SPI A;  2WPD G;  4B3S O;  3STZ C;  5JJE B;  1D2D A;  1VQK V;  4AQY B;  2E3C A;  3BEH A;  5LHI A;  1EBO A;  4DV4 B;  2AZ2 A;  2ARH A;  3W7U A;  3CHX A;  4J7J A;  2P06 A;  3TCU A;  3ASO B;  2YS8 A;  3AG3 B;  3LSS A;  3ETD A;  1AJP A;  1AI6 A;  3K5O A;  5CA3 A;  1NJI W;  3CXC U;  1Q3E A;  2PF4 E;  5CB4 A;  3UO2 A;  2EIJ C;  4O4J B;  4YJ3 A;  4MVU A;  3LSQ A;  1LNQ A;  4MW8 A;  4MTO A;  2Q8V A;  3I56 V;  3N2K A;  4IIJ A;  3CMA V;  4IYH A;  4GT1 A;  4HBN A;  3K0G A;  3AG1 C;  2VS0 A;  2WLN A;  3P32 A;  5JH7 B;  3H01 A;  4DR2 O;  3DXR A;  2XAJ A;  4X20 A;  5LMU B;  4Z1M G;  4LNU B;  4DR4 B;  3FAV A;  2PYJ A;  3CD6 V;  2OIE A;  4FFB A;  4UFZ A;  1TVK B;  4OGQ B;  4ZBM A;  4DW0 A;  1K33 A;  3DSQ A;  2JDI G;  4JI7 O;  5EZY A;  1PNM A;  4DV5 O;  2EUL A;  1IDS A;  5KAF Z;  3CXH F;  2QWQ B;  2HJD A;  1PM9 A;  1ZSP A;  3ASN B;  4CS4 A;  4F6E A;  3RGB A;  3OTO O;  2FML A;  4BIO A;  1VQL V;  5DN6 G;  1OCC B;  4PDM A;  1Q5O A;  3J7A U;  5CA0 B;  5LGN A;  1ZWI C;  4IIJ B;  4PI0 A;  1IBL B;  2BTQ B;  3BA9 A;  1VP7 A;  1XBL A;  5JJJ B;  1FKA O;  2RNB A;  1K4D C;  1V9P A;  2VRZ A;  5LMU O;  4DRX A;  3FAV B;  2A7W A;  2QTO A;  1OZ0 A;  2OIG A;  5EIB C;  1K5S A;  4JI0 O;  4GKK O;  3BFR A;  4DR1 B;  4KL1 A;  1GKF A;  2CH7 A;  3KG2 A;  4JAS A;  4WFF A;  1N34 O;  1GAX A;  3OR7 C;  1E1Q G;  3K5N A;  1VQ8 V;  3E8B A;  3VBB A;  5IYB O;  3D3Q A;  5D5P A;  1YIT V;  2UUA B;  1TUE B;  1WLE A;  2KQX A;  4NTY A;  4GX1 A;  4UCT A;  1T5E A;  2ZCE A;  3K08 A;  1WP8 A;  4G2K A;  4X20 B;  1EN4 A;  1UJW B;  2JGD A;  5JJN B;  3O9O A;  4X88 A;  4AHC A;  1RM1 B;  3IAY A;  4E4E A;  3E22 B;  3R65 A;  2VQF O;  1QLE C;  2DOS A;  1COW G;  3OD4 A;  4UVA A;  2M7W A;  4BR6 A;  1MMM A;  4B3R O;  2XND G;  3HKC A;  4JI2 B;  2F66 C;  1Q7Y W;  1SQV H;  1Y66 A;  3ABM B;  5KHJ A;  3D8C A;  4K8X A;  1I94 O;  1XMQ B;  4FLU A;  4UCR A;  1Q8I A;  4TWK A;  3DC5 A;  1MZE A;  2HVK C;  1TA8 A;  2WLI B;  2GHY A;  1BE3 H;  2P90 A;  5KUM A;  4QNH B;  3JAT A;  4JI7 B;  5KHK A;  3AK1 A;  4HYO A;  3JD2 A;  2X7R B;  3UO3 A;  4YJ2 A;  4UB8 Z;  5IJ9 A;  2DQ0 A;  1HR0 B;  2JGD B;  2QSA A;  4FIP C;  3P3P A;  4LF7 O;  4FK5 C;  4DR7 O;  3FFQ A;  3SJB C;  2CDY A;  3H1J H;  4UXN A;  1N36 O;  4JYA O;  5HFL A;  2Q9L A;  4EB6 A;  4DUY B;  3H9V A;  5JCO C;  1N32 B;  3SYO A;  1NVP D;  3KCY A;  2Q73 A;  3OUF A;  3OEH G;  3B77 A;  3OFN G;  4X64 O;  3T1C A;  5FNV A;  4J7Z A;  1ROP A;  4RQE A;  1GM9 A;  3O65 A;  4OPA A;  4DV2 O;  2QA4 V;  1X4T A;  4GUN A;  4X62 O;  5EBM C;  1PP9 H;  1YHQ V;  5KA6 A;  3GVM A;  4DV7 O;  4X65 O;  2Y48 A;  1SES A;  3C90 A;  5LP6 B;  3RFR A;  4DR4 O;  1RFY A;  3LSU A;  1P7G A;  1IBK B;  2BSK A;  1NZ6 A;  3RT3 C;  3OGI B;  1FJG B;  1A32 A;  3ABU A;  1VQP V;  4O2A A;  3TXQ A;  4H13 B;  1Q81 W;  1S5H C;  2HEP A;  5EK0 A;  2YIB A;  4FZ0 A;  4B3T O;  4B7E A;  3D36 C;  4JYA B;  4I50 B;  3AG3 C;  1RPR A;  2DMX A;  4Q6G A;  2XAF A;  2GUZ A;  1K3E A;  1QR8 A;  5H6Q A;  5BZB A;  5KHG A;  4FLW A;  5CMU A;  4JI3 B;  2P7T C;  2HJF C;  5KMG B;  1K8A W;  3STL C;  3T1Y O;  2DE0 X;  4CS3 A;  1I0H A;  4B3M O;  3K57 A;  1TUB B;  3CYO A;  3DC6 A;  4GYC B;  1DF4 A;  3CX5 F;  5IJ9 B;  4ZI7 A;  3HR0 A;  3CC2 V;  3OTF A;  2Q67 A;  1R3K C;  3P30 A;  3TGU H;  5FLX N;  1J5E O;  4LFA O;  4DV0 B;  3UKM A;  2QDO A;  3D3I A;  3KKY A;  4FFB B;  4I55 B;  4D6T H;  2WLJ A;  4LH7 A;  3EVK A;  1VQN V;  3APO A;  2UXD B;  3E8H A;  1EZV H;  4AIL C;  3RYF A;  4DV4 O;  1ZTE A;  1IBM B;  3CRC A;  4UUJ C;  5L3D A;  3N2G A;  2A9H A;  1SA0 A;  3RYI B;  1M56 B;  4PV1 B;  3RVY A;  1W2B U;  3LNN A;  3BA8 A;  1E1R G;  1J95 A;  4HNA A;  2F93 B;  4JF3 A;  1K92 A;  3B2E E;  3T4D A;  3ZCC A;  3UT5 A;  4WF9 V;  4TSF G;  2LGW A;  1M9N A;  4DR2 B;  2ZR3 A;  1HNX B;  1WA8 B;  2ATK C;  4PA9 A;  2DW4 A;  1QU7 A;  1L0L H;  1AI5 A;  2Q7H A;  3WU2 Z;  2BOC C;  2GV9 A;  2YSU B;  2Q69 A;  5GON A;  2OCH A;  4PDV A;  1M90 W;  1XRE A;  5B3S B;  2VQE O;  2F1M A;  2ZE8 A;  3SDL A;  1V54 B;  4PA6 A;  1B3Q A;  1M1K W;  1R3J C;  1GM8 A;  4EEQ A;  3K9A A;  4G27 B;  5L3E A;  4DV5 B;  3NXS A;  2EIN C;  5LL6 Y;  4NYK A;  4F6R B;  3LNM B;  3H1I H;  4ZHQ A;  1P7B A;  2JIZ G;  1KQS U;  4JI4 O;  3RWR D;  4JZ2 A;  2ZIO A;  1M5I A;  1BHA A;  4QPJ A;  2IU3 A;  1S5J A;  5A2Q N;  1H8E G;  2NNU A;  3RYF B;  4PI2 A;  1M57 B;  3BAB A;  2R70 A;  1HWY A;  2QTS A;  4JYC A;  4EB6 B;  4DV1 O;  5K1P A;  3W7W A;  5LA6 B;  2HR3 A;  1NTM H;  2ZXW B;  3CCU V;  5IYC O;  3C3S A;  4J9Y B;  2V1D A;  3HKE B;  2HHH O;  4DR3 O;  4LF9 B;  2UU9 B;  4TQF A;  3ZIA G;  1YSC A;  4NR1 A;  3RYC B;  1AR1 B;  1NQT A;  4J41 A;  1KB9 F;  4P2Z A;  3KZI Z;  5J9P C;  4DV7 B;  1Z2G A;  2H94 A;  3B4S A;  1MSD A;  3HB3 B;  1SQF A;  3X2Q C;  3QO7 A;  4JAA A;  2WAM A;  2WLH A;  2ZR2 A;  1YZB A;  5AG2 A;  2V7Q G;  4CS2 A;  5H2F Z;  4FZ1 A;  3JAL B;  2YIA A;  3VQW A;  2A3Q A;  2X6B A;  2YID A;  2DYR B;  3ZRV A;  1FFX A;  4Z2W A;  3JCZ A;  4LCU C;  4DV2 B;  3OW2 U;  3LDE A;  1SQQ H;  4JPR A;  2ZXW C;  1Q6U A;  2HVJ C;  4QIW F;  4FM0 A;  5LHH A;  1KYO F;  2F23 A;  2Y4T A;  5JVD B;  2LGQ A;  3E89 A;  4MVM A;  4TQD A;  5KHI A;  1DLB A;  2HG5 C;  3TXS A;  5B1O A;  1NTZ H;  1F4M A;  1F51 A;  4FM1 A;  1FJG O;  2P5O A;  4OXS A;  3K03 A;  4LC1 A;  3F5W C;  4GKJ O;  1XMO B;  1NTK H;  2XT9 A;  3M99 B;  4JTA B;  3B40 A;  5A9G A;  1LR1 A;  4H0L B;  4J7K A;  2B1G A;  2P4V A;  4I9Q A;  1AJQ A;  3OMN B;  2ZDI A;  3AG7 A;  4X89 A;  3VOU A;  2JEU A;  4MS2 A;  2WA3 A;  1Q82 W;  1MNG A;  4PDR A;  1OCC C;  1TVK A;  2E75 B;  4MW3 A;  4CH4 A;  1V54 C;  5LBQ A;  1CPY A;  3HKB B;  1PPJ H;  1K73 W;  1P49 A;  3JAK B;  4TV9 A;  4DV3 O;  1N33 B;  3B8M A;  1VF5 B;  2QWN B;  1SS3 A;  5CN0 A;  2PY5 A;  2GDS A;  2ADP A;  5E79 Z;  4MVQ A;  5EBW C;  4RO2 A;  3B8N A;  3CP1 A;  1P84 F;  1PKX A;  2JGU A;  3FX7 A;  5FPR A;  2Z5U A;  3JAT B;  3CEI A;  1N33 O;  1I7F A;  3QVN A;  4WFA V;  1IXB A;  3SJA C;  3SJQ C;  2CTW A;  4LF6 O;  2W6I G;  2LQT A;  1JPX A;  3H1L H;  1WNS A;  2PI5 A;  3AK3 A;  3OMA B;  4RQF A;  5J2T A;  2BOB C;  3ZN0 A;  3WB1 A;  5B5E Z;  3UCS C;  4O2B B;  2OWO A;  2F4V B;  4BW9 A;  1MZF A;  3OR6 C;  3RBZ A;  1D5N A;  1KKC A;  2EIL B;  4ABM A;  3G6B A;  2HFE C;  4D7T A;  3MHS C;  3WG7 C;  1M4U A;  2LP7 A;  4K35 A;  4OX9 B;  2UUC O;  5EBL C;  4PJ0 Z;  4WCE V;  1WPX A;  2JRI A;  5H9C A;  1K9M W;  3FYE B;  2JS3 A;  4X1K B;  1N34 B;  1L8D A;  1WAZ A;  3NR7 A;  3M7M X;  4JI0 B;  4GKK B;  4ZOL B;  2IH3 C;  4QE7 A;  3G67 A;  2YXL A;  2DYS C;  4OPH A;  4O4I A;  2E5L O;  1W0J G;  4JAV A;  2G38 A;  4ZI7 B;  5BMV B;  1FXH A;  2BTO A;  3AG4 C;  2CK3 G;  1X59 A;  5ITZ B;  3U11 A;  1KMI Z;  3ZRW B;  5CA1 B;  3LDC A;  1WB7 A;  3OTO B;  5L3F A;  3CC4 V;  2YXY A;  4RAI A;  2JJ2 G;  3Q4H B;  2CTR A;  1YDX A;  4F6R A;  5B1N A;  4U3J A;  4UB6 Z;  3K5L A;  1QQC A;  2BTQ A;  4PA7 A;  1R6T A;  2BCC H;  4YY3 O;  4NKG B;  2RDC A;  2OYQ A;  4U7O A;  4ASU G;  5KMG A;  1K5Q A;  3ABL B;  1B04 A;  4X9Q A;  3OUS A;  2P6J A;  3JAR B;  1ENV A;  3W7S A;  5EIB D;  4LF4 B;  1I5X A;  5B3S C;  4BAY A;  1YI2 V;  1QLN A;  1AVM A;  3MD0 A;  2Y69 B;  1BGY H;  4U3F H;  4AQY O;  5B66 Z;  1KBH A;  2A0L A;  3W7T A;  1J5E B;  1IXM A;  1OV9 A;  2NLJ C;  3CRQ A;  4LF6 B;  1XQ8 A;  3K59 A;  1P4R A;  3FKS G;  2QM4 A;  2JEX A;  1OJH A;  3ZED A;  4DYL A;  3ABL C;  3U0Z A;  2WLI A;  4DUY O;  1N32 O;  2ZE6 A;  4FLZ A;  3SGI A;  3K3W A;  2ZNI A;  3CS5 A;  1MA1 A;  2WLK A;  4FLT A;  1FAF A;  1OCZ C;  1NH2 B;  3HKD A;  1S76 D;  1O9G A;  4CBC A;  4JV5 B;  4WBN A;  1I08 A;  4LF5 B;  3T1H O;  2UXC O;  1ORQ C;  1Z5W A;  3N27 A;  3JAS B;  2OTL V;  5CA1 A;  2FYU H;  2B1I A;  1XMQ O;  4O4H B;  4DV0 O;  1QHT A;  1JX9 A;  2B5U A;  2PGG A;  1M56 C;  4GCZ A;  4YIP A;  3WB2 A;  1V55 C;  1NR1 A;  3K9S A;  3M8A A;  4X62 B;  2EIJ B;  2FB5 A;  1VEW A;  5IYD O;  4JI6 B;  4MT8 A;  2E5L B;  1AP5 A;  5KHH A;  3OT7 A;  4LWS B;  3ZHT A;  2NR5 A;  4TV8 A;  4GX5 A;  4PA3 A;  3ZRX A;  1NH2 D;  4X66 B;  4K8Z A;  2ITD C;  4JI5 O;  4D7S A;  4X1Y A;  1JFF B;  5K1X A;  3CJH A;  3AK2 A;  2W0X A;  3T2M A;  3ZBH A;  3JAR A;  1NVP B;  2D3O W;  1CEZ A;  2UXB B;  2E76 B;  4J9Z B;  1FD9 A;  2Y69 C;  2Q4P A;  3CB2 A;  4DR5 B;  1SQX H;  3QG5 A;  2ZE7 A;  1GN4 A;  3GWK C;  3I55 V;  3KCX A;  2EBO A;  3OM3 B;  1AB3 A;  4H44 B;  1FPO A;  2BE3 A;  1WPB A;  4K3A A;  2LW7 A;  5GW7 A;  2QKC A;  5J2U A;  5IWA O;  3A2F A;  5JCO A;  2Q68 A;  3K04 A;  1Y4M A;  1YJW V;  3ETG A;  3CCL V;  1H38 A;  1HNW O;  1S3J A;  2UUB B;  2PTM A;  2K1E A;  3L75 H;  2YC0 A;  1Y67 A;  5CB4 B;  3IC7 A;  4DR1 O;  1F23 A;  4IL6 Z;  1SA0 B;  3RYI A;  3PN1 A;  5IE9 A;  3S3X A;  2QWR B;  4R7C A;  3G6E V;  5GTI Z;  2EIM B;  1QCE A;  3HKD B;  5H5N A;  5LYJ B;  2EJ7 A;  1XNQ O;  1ZL8 B;  4XBF A;  4MVZ A;  4R50 A;  2Q6A A;  5CBG A;  4WFG A;  3CME V;  4L8J A;  4CC6 A;  3CRR A;  5EC1 C;  1G6U A;  3BPZ A;  3G71 V;  1YJN V;  4GKJ B;  1IBM O;  1GTO A;  1LUW A;  3EHB B;  1XNQ B;  4XDL A;  2DWE C;  5IY5 C;  4DR6 O;  1NKD A;  1QR9 A;  2ZIM A;  2MK3 A;  3JYC A;  4J80 A;  5FPO A;  3SPG A;  5EYP A;  5J2U B;  4MTF A;  5IWA B;  4Q20 A;  1S77 D;  1JVM A;  2JK5 C;  2Z0A A;  2HKO A;  4X1I A;  1Y74 B;  2IJI A;  4NVP A;  3L74 H;  1GO3 F;  4WFB V;  5C93 A;  1NBM G;  1OHH G;  3AG1 B;  2HHH B;  1FXK C;  4P9P A;  2IW5 A;  5BXZ A;  3ZHU A;  1AP6 A;  3CCJ V;  1G8M A;  2R72 A;  1BHB A;  1WN7 A;  1HNZ O;  3CE2 A;  1RSO A;  2AHY A;  4B7K A;  3K5M A;  2UUA O;  5CBF A;  4X8A A;  3QO5 A;  2LFS A;  1NT2 B;  1R3I C;  2K9P A;  1JMK C;  1OCO B;  4LF8 B;  3CCV V;  4DR5 O;  1G1X B;  4JI4 B;  3QF7 A;  5LA6 A;  4B3R B;  1KP2 A;  5EZY B;  1SET A;  5DM6 V;  3VQY A;  1F4N A;  4F4L A;  1W59 A;  2IJK A;  4WFE A;  3CCQ V;  1Y76 A;  5LMN O;  4I0X B;  3WB0 A;  3ZMT A;  2ZM6 O;  2IJJ A;  2LJ2 A;  4EFB A;  1SQB H;  3FD9 A;  2JS5 A;  4OX9 O;  4FFK A;  2UUB O;  2N05 A;  5LYJ A;  5IY5 B;  3T4Z A;  4XDK A;  3VQV A;  3SR2 C;  4NXM O;  1Q86 W;  3T1H B;  1GK9 A;  1R1B A;  4PDL A;  4UVB A;  2QR4 A;  4R6Z A;  2LO1 A;  3E22 A;  2FTK A;  1GN3 A;  5CBH A;  2YDE A;  5IYZ B;  2LW1 A;  2CE4 A;  4O2B A;  3R66 A;  4MSW C;  4P30 A;  1QVG U;  3AEI A;  3JAK A;  3JSL A;  4JTC B;  4LF8 O;  1KU9 A;  3CCR V;  2GUZ B;  4UVC A;  5KX5 B;  1VQ4 V;  1SQG A;  1U97 A;  2QM7 A;  4DUZ O;  2OCC C;  3THO A;  2DN9 A;  2Q0A A;  4CH6 A;  5B1A B;  4YJ3 B;  4LP8 A;  1TGO A;  4IT5 A;  1SER A;  5LP6 C;  3CSX A;  3ABK C;  5D5Q A;  1RPO A;  1SZT A;  3Q4H A;  4KFM A;  2H3O A;  1QVF U;  2X0L A;  3H1K H;  3IJ4 A;  3SYP A;  4ZOL A;  1WB8 A;  2IM9 A;  5JH7 A;  1HDJ A;  2CTQ A;  3ZX6 A;  4QJF B;  4EKW A;  5B1B B;  3ABK B;  1Q6H A;  2ZE5 A;  3E35 A;  3MDS A;  4KHP B;  1KD1 W;  1YTF D;  1XIL A;  3JD0 A;  3L70 H;  3CCE V;  5LGU A;  3A0B Z;  1AR4 A;  4JZG A;  2M6Y A;  4FLV A;  4GX0 A;  4DV6 O;  2UXD O;  4BW5 A;  3E83 A;  5KAI Z;  4PD4 F;  4HAM A;  5C8Y A;  1R3L C;  2PYL A;  2NN4 A;  3LDD A;  2OCC B;  2ODM A;  2IJH A;  1OCO C;  2RMK B;  4W4L A;  3IFX A;  2KG7 B;  2HP8 A;  4XDJ A;  1YXB A;  4BWA A;  1XOU A;  5LMN B;  5TIS Z;  2YIB D;  2ZM6 B;  1S72 V;  1VF6 C;  5BMV A;  3FB6 C;  3E86 A;  3SPH A;  3ZMZ A;  4FMT A;  4AI8 A;  2RQ6 A;  2ZDI C;  3ASN C;  4X64 B;  3OMI B;  5J2T B;  3K06 A;  4RUE A;  3L9D A;  4LF4 O;  2ZQM A;  4G28 B;  4UV9 A;  1R73 A;  1NI8 A;  3JD1 A;  2DQ3 A;  5L3G A;  2EIN B;  4JI8 O;  3JD3 A;  4ZHQ B;  3SYQ A;  2KB1 A;  2UXB O;  1FS0 G;  4GX2 A;  2F4V O;  1Z5V A;  4UCU A;  3RN4 A;  3APQ A;  2P22 C;  4YY3 B;  5FL7 G;  4X1K A;  1GN2 A;  3IC9 A;  3CJH B;  3WFV A;  1S0V A;  3FB7 C;  3L71 H;  3CPW U;  1XNR B;  2PUS A;  4B08 A;  2WLL B;  1R6N A;  3CCS V;  1UFI A;  2YUA A;  1MOF A;  4N21 A;  4P9O A;  2CGO A;  4I4T B;  2W0F C;  3HKB A;  1JJO A;  3DXR B;  5KA5 A;  3BHP A;  4J11 A;  4O4L B;  1VMG A;  4NXN O;  2QKA A;  4J10 A;  2P4K A;  5KUK A;  4TT3 G;  2ITC C;  3TK1 A;  5LOV A;  3QTC A;  2VWJ A;  3ZHS A;  1PNK A;  2OTJ V;  1IVS A;  3JAW A;  4IHJ B;  2QWO B;  4KP4 A;  2CUG A;  1PV0 A;  4FVM A;  1WP7 A;  4FPP A;  3B09 A;  1UPG A;  2FKX A;  2KG7 A;  5IJ0 A;  4LF7 B;  4QE9 A;  3HPL C;  1CXZ B;  1JJ2 U;  1SC5 B;  1B6Q A;  3A0R A;  5B1A C;  2XUM A;  4JV5 O;  4LR3 A;  3HKC B;  1XNR O;  4DO2 A;  2EIK C;  4DV3 B;  5H6R A;  1YEW A;  1VQ9 V;  3W7X A;  2P67 A;  4LWS A;  1BQ0 A;  2EX3 A;  4PHZ A;  3JCU Z;  2UUC B;  2EIM C;  4H37 A;  1PL0 A;  1PD3 A;  4MTG A;  4TV9 B;  4X1Y B;  3MAQ A;  3ZJZ A;  1Q43 A;  3JAW B;  1IUR A;  3TET A;  4LFC O;  1VF6 A;  2DWD C;  3OGC C;  1MG1 A;  1WA8 A;  4X1I B;  4CC5 A;  2XHB A;  1KUQ A;  1ZL8 A;  4UCS A;  3ZMV A;  3OEE G;  2YIC A;  1AIL A;  3EFF K;  4IYI A;  3UT5 B;  4DK1 A;  1S5L Z;  2UU9 O;  1YJ9 V;  2JVD A;  2V4D A;  3ZHV A;  2O57 A;  4JI8 B;  1AR5 A;  4LNU A;  4I7Z B;  1G4Y B;  2RN9 A;  4I9W A;  4JYB A;  3FYI B;  2XAS A;  4GLX A;  2IBZ H;  4L87 A;  2XAG A;  4DUZ B;  4KUM A;  1OCR B;  4DV6 B;  1SQP H;  2KKW A;  2RCV A;  4U7N A;  4TUY B;  1XHZ A;  1WJZ A;  1KC8 W;  1FXK B;  3H1H H;  3G4S V;  4BIU A;  4JI1 O;  3BRC A;  1TAE A;  1V55 B;  3RVZ A;  1W0K G;  3D36 A;  4DR6 B;  1QLE B;  5LXT B;  3X2Q B;  4ZKI A;  5C8Y B;  1H2N A;  1BS3 A;  5B1B C;  3ZHR A;  1XUQ A;  5HFM A;  4B3M B;  3I5D A;  4DR3 B;  4LF9 O;  5DED A;  2AHZ A;  5IJ0 B;  2L6L A;  2QJ1 A;  1M57 C;  1JOY A;  4GZR B;  4NTX A;  3E2E A;  3P3N A;  1FYJ A;  1K4C C;  2CGN A;  1SZX A;  4JI6 O;  1HR0 O;  1BQZ A;  3ZRS A;  2Q0O C;  4DXW A;  4ICG A;  4EFE A;  3JAS A;  1HNZ B;  1VQ7 V;  2W6J G;  3HKE A;  2X6C A;  3UQ8 A;  4JYY A;  3RW0 A;  1CP9 A;  3ETE A;  1IX9 A;  2VQF B;  2XAH A;  1L1F A;  4TOI A;  2LFR A;  4LFB O;  1L0N H;  4FLY A;  3BY6 A;  4I0X A;  3BCC H;  1GMG A;  2WA4 A;  4UCO A;  1XI1 A;  1K97 A;  1VIB A;  3E8F A;  2ADQ B;  2X6A A;  1SF9 A;  5KX5 A;  1Y6X A;  3ZS8 C;  2F95 B;  1HNX O;  1PNL A;  3JAM N;  4K0K B;  4JI2 O;  1H2M A;  2IH1 C;  4NB5 A;  4WFH A;  2UXC B;  1URF A;  4MVR A;  2QKS A;  4YXW G;  3CC7 V;  4B3S B;  1MAB G;  4X65 B;  1YTF B;  2GTA A;  2R9A A;  3ABT A;  1LUV A;  2N74 A;  1XEQ A;  1IBK O;  2Y0I A;  3SJC C;  4NXM B;  4I55 A;  3PJS K;  2DJV A;  1FXK A;  1RM1 C;  5E1A C;  1DF5 A;  4ZIB A;  1OCR C;  1GH6 A;  2YI8 A;  3JAL A;  4HZ3 A;  2R9I A;  5L3C A;  1US6 A; 
#chains in the Genus database with same CATH homology
 3ZMT A;  3K03 A;  4LC1 A;  3F5W C;  2IJJ A;  1E79 G;  1K4D C;  3M99 B;  2QTO A;  4JTA B;  5IY5 B;  2WWW A;  1OZ0 A;  3T4Z A;  2WSS G;  4XDK A;  1K5S A;  2EZP A;  2H8P C;  3SPJ A;  1Q86 W;  2B1G A;  4JTD B;  1AJQ A;  1GKF A;  3KG2 A;  3OMN B;  4JAS A;  4WFF A;  1GK9 A;  4UVB A;  4PDL A;  2ZDI A;  3OR7 C;  1E1Q G;  4X89 A;  3VOU A;  1VQ8 V;  2JEU A;  3E8B A;  4MS2 A;  4R6Z A;  1Q82 W;  3VBB A;  4N23 A;  2C2A A;  4PDR A;  5IYB O;  1OCC C;  3ML0 A;  1YIT V;  2FTK A;  5CBH A;  4MW3 A;  1TUE B;  1WLE A;  1V54 C;  1K34 A;  5LBQ A;  1CPY A;  4GX1 A;  1K73 W;  1N8R W;  5IDJ A;  3K08 A;  4MSW C;  4P30 A;  1QVG U;  3AEI A;  4G2K A;  2QE7 G;  3B8M A;  4JTC B;  1UJW B;  5CN0 A;  4X88 A;  1RM1 B;  3CCR V;  3F7V C;  2IU0 A;  4UVC A;  1VQ4 V;  4MVQ A;  5EBW C;  4RO2 A;  3R65 A;  3B8N A;  2QM7 A;  2OCC C;  1QLE C;  3CP1 A;  1COW G;  1PKX A;  1K7D A;  3QO8 A;  2M7W A;  4UVA A;  3SPC A;  2Z5U A;  5B1A B;  4LP8 A;  2XND G;  2Z3Y A;  4WFA V;  3SJQ C;  1Q7Y W;  1SER A;  1AJN A;  3ABM B;  1Y66 A;  3ABK C;  3K0D A;  3GWO A;  1RPO A;  1SZT A;  4KFM A;  3DGE A;  1QVF U;  1EZJ A;  2W6I G;  1JPX A;  2X0L A;  3LUT B;  2PI5 A;  3SYP A;  3OMA B;  1BMF G;  4RQF A;  2BOB C;  4TWK A;  3ZN0 A;  3FB5 C;  4QJF B;  4EKW A;  2HVK C;  3GB7 C;  5B1B B;  3ABK B;  2WLI B;  2GHY A;  4PA4 A;  2P90 A;  5KUM A;  3E35 A;  3OR6 C;  3RBZ A;  2EIL B;  4QNH B;  1KD1 W;  1KEC A;  2HFE C;  1YTF D;  2YEV A;  3JD0 A;  3JD2 A;  2X7R B;  4HYO A;  3CCE V;  3E8G A;  5LGU A;  3MHS C;  3WG7 C;  2LP7 A;  5EBL C;  3AG2 B;  4WCE V;  4GX0 A;  1WPX A;  2DQ0 A;  4BW5 A;  5H9C A;  3E83 A;  4CZZ A;  1K9M W;  2OT5 A;  3FYE B;  2F43 G;  4FIP C;  1MSW D;  4HAM A;  1I5Y A;  1R3L C;  4FK5 C;  3LDD A;  4H33 A;  2UXN A;  2OCC B;  4UXN A;  2IJH A;  1OCO C;  4JAU A;  5HFL A;  2IH3 C;  4QE7 A;  3AG2 C;  3AG4 B;  3SYC A;  3SYO A;  3ZMU A;  1NVP D;  2DYS C;  3IFX A;  3OUF A;  4XDJ A;  1W0J G;  3OEH G;  4JAV A;  3B77 A;  3OFN G;  2DYS B;  1FXH A;  4E2L A;  3AG4 C;  2CK3 G;  3T1C A;  1VQO V;  1S72 V;  3FB6 C;  1ROP A;  3ABM C;  3E86 A;  3SPH A;  3SYA A;  3ZMZ A;  4RQE A;  4FMT A;  1GM9 A;  4FJC C;  2ZDI C;  1R6K A;  2QM8 A;  3ASN C;  3ZRW B;  3LDC A;  2HLD G;  2QA4 V;  5L3F A;  5EBM C;  3OMI B;  3CC4 V;  4RAI A;  1YHQ V;  2JJ2 G;  5KA6 A;  3IGA C;  3K06 A;  2Y48 A;  5B1N A;  4RUE A;  1SES A;  4UV8 A;  4PA7 A;  2ZQM A;  3WG7 B;  4G28 B;  4UV9 A;  1R73 A;  3JD1 A;  2DQ3 A;  5L3G A;  1H2G A;  2QEX V;  4U7O A;  4ASU G;  2EIN B;  2UXX A;  1K5Q A;  3JD3 A;  3UM7 A;  3SYQ A;  1DTO A;  2KB1 A;  3ABL B;  1AI4 A;  1JCH A;  3ABU A;  1BL8 A;  1KKD A;  3ZRW A;  1VQP V;  2XOK G;  1FS0 G;  3OUS A;  2EZO A;  4GX2 A;  4JGS A;  2P6J A;  1Q81 W;  1S5H C;  1ENV A;  5EC2 C;  3W7S A;  2JJ1 G;  5EK0 A;  1I5X A;  1XL4 A;  2ZD9 A;  5B3S C;  4BIZ A;  2XAQ A;  2EIL C;  3AG3 C;  1RPR A;  5FL7 G;  4BAY A;  1YI2 V;  1QLN A;  3MD0 A;  2Y69 B;  3WFV A;  2XAF A;  1S0V A;  4I5S A;  3FB7 C;  1K3E A;  1QR8 A;  3CPW U;  3F7Y C;  5H6Q A;  5BZB A;  2WLL B;  1FFT B;  2YEV B;  1H8H G;  1R6N A;  2A0L A;  5CMU A;  3W7T A;  3CCS V;  1IXM A;  2DYR C;  1MOF A;  2NLJ C;  2P7T C;  4N21 A;  4P9O A;  1P4R A;  2HJF C;  1K8A W;  3STL C;  3ZN1 A;  2W0F C;  3FKS G;  5KA5 A;  3FB8 C;  1QBZ A;  2JEX A;  1NR7 A;  1VQM V;  3CYO A;  2GSM B;  5KUK A;  3ABL C;  4TT3 G;  2ITC C;  1OCZ B;  2WLI A;  5LHG A;  1DF4 A;  3TK1 A;  1JQ0 A;  3CC2 V;  1PNK A;  2Q67 A;  1R3K C;  2OTJ V;  3P30 A;  3K3W A;  4LBE C;  1YIJ V;  3UKM A;  2WLK A;  1OCZ C;  3D3I A;  4KP4 A;  2EJR A;  1NH2 B;  3OE7 G;  1S76 D;  4PEL A;  4CBC A;  4R8C A;  2WLJ A;  4QPK A;  1VQN V;  4FPP A;  3E8H A;  4MTX A;  5L3B A;  1GM7 A;  1ORQ C;  4UUJ C;  4RUF A;  5L3D A;  2A9H A;  2OTL V;  1M56 B;  4QE9 A;  3RVY A;  3CCM V;  1W2B U;  2B1I A;  3HPL C;  1JX9 A;  2B5U A;  4GCZ A;  1M56 C;  1JJ2 U;  1E1R G;  1THZ A;  1V55 C;  1NR1 A;  1B6Q A;  3A0R A;  2PI4 A;  5B1A C;  1J95 A;  2EIJ B;  1EFR G;  3QNE A;  5IYD O;  4MT8 A;  4JF3 A;  4DO2 A;  1K92 A;  3OAA G;  2EIK C;  3T4D A;  3ZCC A;  5H6R A;  4WF9 V;  4TSF G;  1VQ9 V;  1M9N A;  3W7X A;  2ZR3 A;  2P67 A;  3JD4 A;  2ATK C;  4GX5 A;  4PA3 A;  4PA9 A;  2WLL A;  3ZMS A;  3ZRX A;  1NH2 D;  2DW4 A;  2ITD C;  2EIM C;  2R9R B;  3DTU B;  1AI5 A;  4H37 A;  1PL0 A;  1PD3 A;  3T2M A;  4MTG A;  2BOC C;  2D3O W;  1NVP B;  1CEZ A;  3MHH C;  3ZJZ A;  2YSU B;  2Q69 A;  4J9Z B;  2Y69 C;  3TET A;  4PDV A;  1M90 W;  2DWD C;  1XL6 A;  1MG1 A;  2EIK B;  3OGC C;  1KP3 A;  3I55 V;  5B3S B;  1VQ6 V;  1ARO P;  2EBO A;  3OEE G;  3OM3 B;  3ZMV A;  3EFF K;  4MVS A;  3ASO C;  1YJ9 V;  1V54 B;  4PA6 A;  1M1K W;  1R3J C;  1GM8 A;  5GW7 A;  2Q68 A;  3K04 A;  3K9A A;  4G27 B;  1Y4M A;  2WLM A;  1YJW V;  1VQ5 V;  1G4Y B;  5L3E A;  2A79 B;  3NXS A;  4I9W A;  3ETG A;  2EIN C;  3CCL V;  4JYB A;  1H38 A;  1AI7 A;  3FYI B;  1S3J A;  1SRY A;  2XAS A;  4MVO A;  4L87 A;  2K1E A;  2XAG A;  3LNM B;  4KUM A;  1P7B A;  2JIZ G;  1OCR B;  1KQS U;  3IC7 A;  1F23 A;  5LGT A;  1FXV A;  3K79 A;  4U7N A;  3SPI A;  2WPD G;  4R7C A;  3STZ C;  1KC8 W;  1FXK B;  3G6E V;  1VQK V;  3G4S V;  1BHA A;  2EIM B;  4QPJ A;  1QCE A;  4BIU A;  2IU3 A;  3BEH A;  5LHI A;  1EBO A;  1V55 B;  3RVZ A;  1W0K G;  3D36 A;  1QLE B;  3X2Q B;  4ZKI A;  3W7U A;  1H8E G;  5B1B C;  4XBF A;  4MVZ A;  4R50 A;  2NNU A;  2Q6A A;  3TCU A;  5HFM A;  5CBG A;  3ASO B;  4WFG A;  3AG3 B;  3LSS A;  1M57 B;  3ETD A;  3CME V;  2AHZ A;  1AJP A;  1AI6 A;  1HWY A;  5EC1 C;  3G71 V;  1YJN V;  4JYC A;  5CA3 A;  1NJI W;  3CXC U;  3W7W A;  1GTO A;  2EIJ C;  1M57 C;  2HR3 A;  3EHB B;  1JOY A;  4MVU A;  3LSQ A;  1LNQ A;  2ZXW B;  4MW8 A;  3CCU V;  4MTO A;  5IYC O;  3E2E A;  4XDL A;  3I56 V;  2DWE C;  4J9Y B;  5IY5 C;  3CMA V;  1K4C C;  1NKD A;  1QR9 A;  2V1D A;  4GT1 A;  2MK3 A;  3JYC A;  3K0G A;  3SPG A;  3ZIA G;  3AG1 C;  1YSC A;  4MTF A;  1AR1 B;  1NQT A;  4P2Z A;  3ZRS A;  5J9P C;  2WLN A;  3P32 A;  4Q20 A;  4DXW A;  3H01 A;  2H94 A;  1S77 D;  1JVM A;  2JK5 C;  2XAJ A;  1VQ7 V;  2HKO A;  2W6J G;  2X6C A;  3HB3 B;  2IJI A;  3X2Q C;  3RW0 A;  1CP9 A;  3ETE A;  4Z1M G;  3QO7 A;  1GO3 F;  4WFB V;  5C93 A;  1NBM G;  1OHH G;  3AG1 B;  2XAH A;  3CD6 V;  1L1F A;  1FXK C;  2LFR A;  4P9P A;  2WAM A;  2IW5 A;  3BY6 A;  2WLH A;  4ZBM A;  3CCJ V;  2ZR2 A;  1G8M A;  1GMG A;  1K33 A;  1K97 A;  1BHB A;  2JDI G;  3E8F A;  1PNM A;  2X6A A;  2V7Q G;  2AHY A;  1PNL A;  2X6B A;  5CBF A;  4X8A A;  3QO5 A;  2DYR B;  2LFS A;  3ASN B;  3ZRV A;  3JCZ A;  4LCU C;  1R3I C;  3OW2 U;  2IH1 C;  1VQL V;  5DN6 G;  1OCC B;  4PDM A;  1OCO B;  4WFH A;  3LDE A;  4JPR A;  4MVR A;  2ZXW C;  2QKS A;  2HVJ C;  4YXW G;  5LGN A;  3CC7 V;  4QIW F;  1MAB G;  3CCV V;  1YTF B;  1ZWI C;  3ABT A;  5LHH A;  3E89 A;  4MVM A;  3PJS K;  1DLB A;  1KP2 A;  1FXK A;  1RM1 C;  1SET A;  5E1A C;  2HG5 C;  1DF5 A;  5DM6 V;  4F4L A;  1F4N A;  1OCR C;  2IJK A;  5B1O A;  4WFE A;  1F4M A;  1F51 A;  4HZ3 A;  3CCQ V;  2R9I A;  5L3C A;  4OXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...