4GZRB

Crystal structure of the mycobacterium tuberculosis h37rv esxop (rv2346c-rv2347c) complex in space group c2221
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
77
Chain Sequence
RFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords ESAT-6-like protein 6
total genus 33
structure length 77
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4gzrB00
3ZBHA 1WA8A 2AZ2A 3Q4HB 3FD9A 2VRZA 4I0XB 3GVMA 2VS0A 4LWSB 3G80A 1WA8B 4I0XA 3TXQA 3FAVA 4ABMA 4GZRB 4LWSA 3GWKC 2B9ZA 3HR0A 3OGIB 3FAVB 3O9OA 2KG7B 3TXSA 2AZ0A 2KG7A 3Q4HA 2DE0X
chains in the Genus database with same CATH superfamily
1UFIA 1SRYA 2UUAB 4YJ3A 1Q81W 4MVRA 4JI4O 4FZ1A 5B3SC 1V55B 5FNVA 3RGBA 4AI8A 3VQWA 4HNAA 1SQGA 2Q0AA 3A0RA 4DR6B 2N74A 3SPJA 5BY1A 2ADQB 1YXBA 1E79G 1ENVA 1HR0B 4PA4A 5L3BA 5CMUA 1SQXH 3LSUA 1TUBB 1K5QA 4DK0A 3CB2A 4P30A 4IGGA 1MABG 4I7ZB 1I5XA 4HNAB 5IYZB 4PD4F 1XNQO 4N23A 3S3WA 3E86A 1YJNV 1O9HA 5A2QN 4IYIA 2ATKC 1FFXB 4B08A 2VWJA 3JAKA 3MAQA 3STZC 2YXLA 3L70H 3OGCC 1R6KA 1IBLB 1N4CA 2YDEA 3ZRWA 3W7UA 1VF7A 2HKOA 1I0HA 3RT3C 2NN4A 5JH7B 1AR5A 1R3LC 1JJOA 3MHSC 2DWEC 5LP6C 1FFXA 4IL6Z 3ZEDA 3HKDA 3JAKB 2W6JG 1CEZA 2BSKA 1OCRC 2CGOA 2ODMA 4ZI7A 4B7EA 1K33A 3GWOA 2PZSA 1X4TA 3E8BA 1ZSPA 2Y4TA 5JVDB 2YSUB 2LO1A 3AG3B 4DXWA 1RM1C 4DR2O 4MVSA 1VQMV 1F51A 4ZI7B 1JA8A 1ZUQA 4GUNA 4DR5O 3ETQA 2LW1A 1H8HG 2ZCEA 2ZT9B 1XEQA 1VQOV 4GYCB 1Q6HA 4G28B 3OR6C 1NVPD 2Y69C 1Q7YW 1YJ9V 3K5NA 4X66O 3K9AA 4UUJC 5K1PA 4DUZB 4LF8O 5D5PA 1Y74A 1NR7A 2LQTA 3ASNB 5IJ9B 2R9RB 1R6NA 4TQFA 4UCRA 1B3QA 2Q7HA 4LR3A 4GX2A 1EN4A 1XL4A 2PTMA 4JYAO 2PI5A 3N27A 4PJ0Z 2CTQA 3CCUV 3UO3A 2KG7A 2P22C 4BWAA 5LHGA 2QKAA 3BVOA 2XOKG 4QNHB 5J9PC 3LDCA 1DGSA 1V54B 2EIMB 4I5SA 3GWKC 4QPJA 2A3QA 3FKSG 3KCYA 2V7QG 1YZBA 5EC2C 3IGAC 2IJKA 3B4SA 3QVNA 1BHBA 5H6QA 3CCJV 2GHYA 3WFVA 4IT5A 1NI8A 4I55B 2XAQA 1Y76A 1F4NA 4LFBO 2HHHO 5B5EZ 5JJNB 1AP6A 2RCVA 4DYLA 4EFEA 2EIJC 1P84F 4B3TB 3OGIB 3CS5A 3L75H 4YJ2A 4KUMA 1HW7A 2GBOA 3E35A 3SYQA 3UKMA 4I55A 2F1MA 5IJ0B 5LMUB 4NXMO 3OM3B 4UCOA 1IX9A 3CRCA 1M93A 4JAVA 1MZFA 5BZBA 4LF4B 1S5JA 1WNSA 3M7MX 2AXTZ 1NTZH 1ZL8B 1M56C 3JSLA 2JIZG 2DOSA 4YJ2B 3H1KH 3RYHB 4D7SA 3JATA 4RQFA 3D3IA 1VQ8V 2AZ0A 3L9DA 4L8JA 2ZE6A 4WBNA 4FLVA 1QU7A 1ZL8A 4JI8O 1SETA 3AG1B 1T5EA 5EBLC 1BGYH 2YI8A 3RVYA 3HKBA 1SQPH 2QSAA 2F95B 4RAIA 3QO8A 1R3JC 2BOBC 3AG4C 1SQBH 1W0JG 1I94B 1VQ6V 1IBKB 3RYIB 1AI5A 2ZXWB 1IVSA 4PI2A 3H1JH 3E2EA 3LSSA 4NVPA 4DR3O 3MD0A 3AK3A 3J80N 3QF7A 2B9ZA 3RYIA 2WA3A 3SPHA 5IWAO 4JI2O 1FXKC 3OTOO 3K59A 2YC0A 3K9SA 4X65B 1AJQA 2CTWA 5J2TB 2BCCH 1KB9F 3X2QC 1N0NA 2VWKA 2ZR3A 4DR4O 2ZM6O 4YHHB 3FAVB 1EFRG 3WB2A 2CK3G 2RNBA 3CRMA 2R9AA 2ZE8A 4B3MB 4DV7B 4O4IB 2BTQA 5KMGA 1EZJA 3IFXA 1N33O 4NTYA 2ZNIA 3ABMB 4FM2A 5CA0A 2QTOA 3ML0A 4N21A 4MS2A 4WFEA 5H6RA 5HFMA 3F5WC 3ASOC 1R73A 1VQ9V 2R70A 2XUMA 2JS3A 2OCCC 1BT8A 2LGWA 2YICA 2GSMB 5FPOA 3ZHSA 1K5SA 1VQ5V 1TVKA 2EULA 1XREA 3MHHC 1FXKB 2WLLA 1YTFB 2M7WA 4U7NA 1W59A 4ZIBA 4TV8B 1QLEB 3OMAB 1KC8W 2GDSA 3BAAA 3TCUA 4EB6A 3ZMTA 4JI2B 2L35A 3RYHA 3ASNC 3JATB 3OEEG 5L3DA 3LDDA 1FJGB 1B04A 3CCSV 1GM8A 1COWG 4JI7O 3T1CA 2YEVB 2KSDA 2XTAA 4DV1O 4B3RO 1PM9A 4EEQA 3JAWB 3SGIA 1GKFA 3CCEV 5L3CA 1HDJA 3HKBB 3O9OA 2K1EA 3ABKC 1QR9A 1G4YB 3T4ZA 2ZD9A 5LGUA 4JI0B 3CRQA 2VS0A 5JQGA 3B77A 1AILA 2AHYA 4UCVA 1Y67A 4Z1VA 2MW2B 4LF6B 3CCVV 5L3FA 1SF9A 3RVZA 1L1FA 1WJZA 5AG2A 1K7DA 2AHZA 2ZIMA 3HKEB 2ILMA 2PYLA 4ZOLA 4NB5A 2UUBO 4UVBA 2D3OW 4DV3B 5BXZA 4JI7B 3ZMZA 3ZHUA 4YY3O 2FYUH 1FD9A 1P4RA 1VQLV 1GRJA 4JI0O 1N8RW 3CMEV 5C8YB 4IHJA 5KHGA 2BTQB 1RM1B 1H2GA 1F4MA 5KUMA 2B1GA 1KP2A 5BR8O 2F4VO 4JI3O 5B3SB 5KAIZ 4Z1MG 2PGGA 1NVPB 3ICXA 3FB5C 1AI4A 4X1KA 1JFFA 3JALA 4IHJB 2CDYA 2IM9A 4FLXA 3SYPA 2MK3A 4LC1A 2XNDG 4I9WA 2W0FC 1SQVH 1YJWV 4RWUA 1FXKA 5B1AB 1XMQO 3ETEA 2ZINA 1XQ8A 3HKCB 4X1KB 1M57C 4F6RA 3JALB 2K9PA 4NKGB 3J81N 1KKDA 4W4LA 2DYSB 1P49A 3ZX6A 1XHZA 1YIJV 1K3EA 4EB6B 1PNKA 3JCUZ 4JYBA 1QVFU 4UXNA 3NR7A 3UCSC 1IBMO 2A7WA 3EHBB 4TUYA 1WP8A 1JVMA 1OZ0A 4DV2B 4FFBA 4F6EA 3ZN0A 4BW5A 3A2FA 1WLEA 5GTHZ 3SPIA 4B7KA 4ICGA 3G71V 4OPAA 4X89A 3O65A 1NT2B 4KP4A 5BMVB 3AG2C 2QGNA 2QWQB 5EC1C 3CCQV 5J2UA 2JGDA 3K04A 1VIBA 3AG3C 1QVGU 4FFBB 4UVAA 1WA8B 2Q9LA 3RYCB 5CA3A 1Q6UA 3SJQC 1OCOC 3KG2A 1Q3EA 2Y0PA 1YEWA 2CH7A 5B1OA 4DR1O 2EINB 4JGSA 2JDIG 5ITZB 1RSOB 1N36B 4DV6B 1SC5B 3HKEA 4O4HA 2DQ0A 2P67A 2KB1A 5EZYB 1O9GA 2RJZA 1OCCB 4UV8A 2F43G 3BPZA 2QM7A 3LUTB 4MVQA 3BA8A 4DR3B 4GKJO 3JARB 2YIDA 4U3FH 4JI1B 4WCEV 3AK1A 4ZKIA 1XDCA 1SZTA 2HLDG 4I0XB 4MVZA 4PDRA 4FMTA 3G6EV 3LSQA 3RYFB 2BSKB 1OHHG 5LA6B 1I94O 2OTJV 3JYCA 4RO2A 2PY5A 1S77D 1N32B 3EVKA 4JYCA 2HR3A 1I08A 4KXRA 3BEHA 3L72H 3QTCA 1YI2V 1BHAA 5LGNA 3BCCH 3E22A 1H2MA 4MT8A 2A79B 4X1YB 3RYFA 4NR1A 4JI1O 3E8HA 5JCOC 4OX9O 3DXRB 4GKKB 1W0KG 2LFSA 2B5UA 4YIOA 1AR1B 1ZLZA 4J11A 2HHHB 3GB7C 1KECA 1Y6XA 1S72V 5B66Z 4R8CA 5LL6Y 2Q7GA 1L0LH 4FM1A 4DO2A 5IJ9A 4FLZA 2WLNA 1H2NA 2VQFO 3ZRXA 1YF2A 2YXHA 3RFRA 5FL7G 5F2VO 4DR1B 4I50A 2NR5A 4LNUA 3UM7A 3SYCA 1FKAO 1NU1H 3R66A 1N0JA 2EIMC 1Q90D 1KP3A 4LFBB 3CSXA 2ETNA 2QM4A 1OCZB 3OUFA 3E83A 4LFCO 1V55C 3ZMVA 4DV0B 5LP6A 1VQKV 1M56B 5J2UB 2Q6AA 4LNUB 3UT5B 1SS3A 2UUCO 1CP9A 4LFCB 1NH2D 1L0NH 2EIKC 1KQSU 2JRIA 4RUFA 4WFHA 4LP8A 1JPXA 1MOFA 1VF6C 4XBFA 4E4EA 4BW9A 5EBMC 1R1BA 3Q4HB 3FD9A 1I7FA 2JJ1G 2OCCB 1SERA 1OCZC 1Z5WA 5IE9A 1K4DC 4MVUA 4FZ0A 4UB8Z 1PD3A 2ZKOA 2JGUA 4JZ2A 1GN4A 2Y0IA 5LMNO 4KHPB 4JTCB 1Q5OA 1J95A 5KHHA 5IJ0A 4FPPA 5KA5A 3K03A 3Q4HA 1GN6A 4QE7A 3IAYA 2IJIA 5DEDA 2EJRA 1I5YA 3WB0A 1PPJH 4HBNA 2RN9A 4LF6O 2O57A 3E8GA 2KKWA 2WLHA 5LA6A 5IY5C 4UB6Z 1P7GA 2CTRA 3JASA 4WBNB 1Z5VA 1PNMA 2G38A 3HKDB 1MSDA 3CWBH 3FYEB 3D36C 3K06A 3VQXA 4GX1A 3AG4B 5EYPB 3DXRA 3ZHVA 1W2BU 4P2ZA 3JSNA 3PN1A 5IDJA 2P06A 1YCIA 2ZNJA 4IYHA 4DR7B 4JI3B 4LBEC 4H37A 2X6CA 1IBLO 3B8MA 4X62B 1VARA 1PV0A 2DJVA 5EYPA 3JD2A 4J41A 3QO5A 1OCCC 2WLIA 2JS5A 4NTWA 4JI8B 2XAFA 2R72A 3A8TA 3CMAV 5J2TA 2PYJA 4FK5C 1YHQV 4O2AB 4LF9O 1QLEC 3UQ8A 5LP6B 4YIPA 3FAVA 4WFAV 1HNWO 2FTKA 3SYAA 4DV4B 4JF3A 5IY5B 2WA4A 2HJDA 1IXMA 3I55V 3CP1A 3N2GA 4IIJB 3OMIB 4TOIA 3ABKB 3TK1A 4DV1B 4FJCC 4B3MO 4DV2O 4LH7A 2Y69B 3BA9A 2QKSA 5GTIZ 4D7TA 4FLUA 4P9OA 5LXTB 3APOA 4J7KA 2X0LA 3QG5A 4CC6A 5KX5B 1BCCH 1ROPA 4WFBV 2QWOB 3JAMN 3EFFK 2ZE7A 3OAAG 2HP8A 3ZMSA 3B09A 1AR4A 3S3XA 1NR1A 3JD1A 3HR0A 1FJGO 1FAFA 4NXNO 3SPCA 3SPGA 3MDSA 2HFEC 1B6QA 2GV9A 4FLYA 3OEHG 1GMGA 1M4UA 2QJ1A 2X6BA 3WB1A 1FYJA 3JASB 1IBKO 3OTOB 1UPGA 3BRCA 4GZRB 4BAYA 1DLBA 4JV5B 3CXHF 2NLJC 1KYOF 1VEWA 1SESA 4AQYB 2IJHA 3OT7A 4OX9B 1QBZA 5KHIA 1VQNV 1S76D 4OXSA 2UUBB 1GH6A 3ZRVA 1LUVA 2F23A 1AJNA 4HAMA 1N33B 4GCZA 2PI4A 1J5EB 1XI1A 5JCOA 5KLVH 2XASA 5IYBO 4JYYA 2WLIB 1VF6A 1G1XB 3N2KB 1LUWA 4MTOA 5GONA 2UXCO 3K57A 2E76B 3PJSK 1XMOO 4DW1A 4PELA 4QPKA 5D5QA 5KAFZ 4TT3G 4MW8A 1QR8A 2H94A 1M90W 3N2KA 1D2DA 2YIBD 5C8YA 3ZMUA 4LF4O 3CPWU 2ZXWC 3BABA 1KUQA 4DR7O 2N04A 1N32O 3FB6C 5K1XA 3U10A 4MVOA 1VMGA 4JI5O 4LWSB 1K97A 3FB8C 1URFA 4FVMA 1XILA 3DGEA 1YVWA 1KU9A 5H2FZ 1NBMG 3ABTA 5KMGB 1MA1A 1MG1A 1R3KC 4JI6B 2AW9A 2YXYA 1U96A 5KX5A 5CA0B 3KKYA 2UUCB 3B40A 3HB3B 3OW2U 3ABLB 2Q7EA 2R9IA 1V54C 3HKCA 3C3TA 2AGAA 1OV9A 1P7BA 1S3JA 2QR4A 3WG7B 4LF5B 1XOUA 1JCHA 3W7XA 1JQ0A 1FFTB 2NNUA 2WLJA 1K73W 4LH6A 2HEPA 4DUZO 3ETDA 1NS1A 1QNMA 5DM6V 3TXSA 3OUSA 4CZZA 1E1QG 3ABUA 2Y48A 1F23A 2DQ3A 2F66C 2XAGA 2V1DA 4X9QA 3P30A 2FKXA 3SYOA 4TQDA 3LNNA 2IH3C 5CBFA 5EK0A 3I5DA 4Q20A 5BMVA 2HVJC 4O4LA 3G6BA 4JTDB 2EBOA 2YEVA 4LF5O 1XMQB 1HNXB 1WA8A 5IYDO 1XBLA 3RYCA 1HWYA 2E75B 4PA6A 4PA3A 2VQEB 3T4DA 2JJ2G 2W6IG 1PKXA 2M6YA 3EXAA 1BL8A 1LNQA 2CH7B 2OTLV 3OFNG 2DYRB 3D8CA 4X88A 2F93B 5GW7A 4DV0O 3SR2C 5E79Z 4BR6A 4C7UA 1YSCA 4O2BA 2E74B 1EZVH 3VOUA 1S5HC 1XUQA 5GONB 4K3AA 3RBZA 2WSSG 3D36A 5EIBC 1XNQB 3K5MA 2VQFB 4JI5B 5CA1B 3CCMV 4JYAB 1MMMA 3M99B 2DE0X 2IU3A 5B1BB 4MTXA 3FYIB 3CC4V 4K0KB 1DF5A 2DMXA 2JK5C 2YIBA 3AG1C 3F5TA 1JJ2U 4LF8B 3C90A 5JWPA 1N36O 1AVMA 4QJFB 4LWSA 3SJAC 2GTSA 4MSWC 1PL0A 3ZJZA 2IW5A 3E22B 4X1YA 4TV9A 5DECA 3CRRA 4DR5B 1G8MA 3ZBHA 1TGOA 4CH4A 1JR9A 2QA4V 2E3CA 2BE3A 3FX7A 1HR0O 1D5NA 1EN5A 2ARHA 4NXMB 1JFFB 1Q6IA 3K3WA 4MTGA 3ZS8C 4BIZA 4JASA 1OCOB 1DF4A 1MSWD 1YDXA 2QE7G 3CCLV 4JI4B 5CBGA 4FLWA 4WF9V 5JVDA 4PDVA 2CE4A 2VRZA 1SKVA 4AQYO 3APQA 1QLNA 2CUGA 2A0LA 1N34B 4F6RB 1JMKC 3H1HH 4GX0A 2ZIOA 4JZGA 3B8NA 2OIGA 1FXHA 1NJIW 1IXBA 5LYJA 1VF5B 1RPRA 4CH6A 1CXZB 4OGQB 4QGPA 1A32A 4DV6O 2A9HA 5L3EA 4O4LB 4W4KA 3CXCU 4TUYB 3FB7C 3L71H 1RPOA 1GAXA 1TUEB 1AB3A 4UCSA 2FMLA 4KFMA 1AP5A 3CE2A 4GLXA 2DWDC 3CD6V 4U3JB 4JTAB 3I56V 2B1IA 3K79A 3P32A 2JGDB 1Q86W 2OIEA 2Q69A 3CJHA 1EN6A 2QTSA 3G4SV 4PDLA 1XNRO 2E5LB 3ZHTA 2PF4E 3TXQA 2UUAO 4U3JA 4DV7O 1H2LA 2CTPA 1WAZA 3ABLC 4RQEA 1IURA 4UV9A 1THZA 5ITZA 3CJHB 2X7RB 1HNWB 4NYKA 2FL4A 1GN3A 4O4HB 2V4DA 1GO3F 2IH1C 1H2SB 4FLTA 3A0HZ 4YJ3B 1KBHA 2H3OA 3CRAA 1BSMA 2L6LA 2UXNA 1YITV 2ITDC 3W7SA 4LF9B 1M1KW 2GUZB 2UU9O 4PA7A 3FFQA 1BQ0A 3ETGA 1TUBA 4XDLA 4R6ZA 4DR4B 2EX3A 2EINC 4QIWF 3W7TA 4TV9B 5H5NA 3F7VC 3OD4A 3KCXA 4K0KO 4G2KA 3BFRA 4ZBMA 1XL6A 4X62O 2EZPA 4LF7O 2P90A 4OPHA 2P6JA 4JAAA 3OMNB 3CHXA 4AHCA 1GTOA 4BIOA 2WLMA 3ZRWB 1B06A 1G6UA 4B3RB 5E1AC 3T1YB 2OYQA 1AJPA 1LR1A 2DYRC 1IZ3A 2IBZH 1Z2GA 1WPXA 2N05A 2QWPB 2RDCA 4FFKA 4DK1A 5L3GA 2OT5A 2OWOA 2EIJB 4UCUA 5LYJB 1K34A 1BQZA 1KMIZ 4A5UB 5LBQA 1SZXA 1K4CC 1V9PA 2Y4UA 3GVMA 2ZR2A 4DRXA 5DN6G 2UXXA 3TETA 1ZWIC 3T1HO 4PHZA 1OJHA 5LMUO 3N2GB 4IIJA 1US6A 2Q67A 1KD1W 1MNGA 1OCRB 2JVDA 3CYOA 3TJTA 4MVMA 5B1AC 3ZN1A 5LMNB 2XAHA 4B3TO 2ZE5A 1RP3B 4CS2A 3AK2A 4Z2WA 3RN4A 4ZHQB 3DTUB 2WLKA 5B1NA 1SQFA 4B3SB 2ITCC 2HJFC 3AG2B 4J7ZA 3VQVA 5KUKA 3QO7A 1XNRB 2WWWA 4YHHO 4ZHQA 5LHIA 2ADPA 2XAJA 5KHKA 2UXDB 5LGTA 2PUSA 1R3IC 1KKCA 1JX9A 2DYSC 4HZ3A 2XHBA 1TA8A 4K35A 1M57B 1Q8IA 1SQQH 1TAEA 1HNXO 1NZ6A 5IWAB 1FPOA 1CPYA 3THOA 2GUZA 5TISZ 2EIKB 4WFGA 4O4JA 4DV5O 1QCEA 1TVKB 4P9PA 1Y76B 4CC5A 2UXBB 1WPBA 3BHPA 4EFBA 4X1IB 1FS0G 1AI6A 4H13B 3WG7C 2IU0A 2YI9A 1NH2B 3K5LA 4O4JB 4Q6GA 4DUYB 1XMOB 2Q68A 2LFRA 4R7CA 2WAMA 4X1IA 5FLXN 2YS8A 4CH5A 2QDOA 3R65A 3SJBC 3DC5A 3JAWA 2YUAA 4J42A 4GX5A 2XT9A 4NTXA 3H01A 1U97A 1X59A 4X65O 4JI6O 2BOCC 1NKDA 1EBOA 4DRXB 5JQGB 2Q0OC 3L73H 4GKJB 1XHXA 4X20B 1R6TA 2QKCA 1H2KA 4DV5B 1MZEA 3CEIA 4PDMA 4F4LA 4U7OA 3C3SA 5EIBD 4O2AA 2Z5UA 1HNZB 3LNMB 1VQ7V 4XDKA 4WFFA 4LF7B 4HYOA 1L8DA 4TWKA 3G80A 2EJ7A 4X20A 1BE3H 3SDLA 4UCTA 3K5OA 3ASOB 1K9MW 1HNZO 2Z3YA 1Y4MA 3UO2A 4RUEA 1WB7A 4BIUA 2DW4A 4NXNB 3LDEA 3CX5F 4ASUG 1AI7A 2JEUA 2LP7A 1BZKA 1Q82W 3TGUH 3P3NA 2LJ2A 5LXTA 3OR7C 1DK1A 1VQPV 3VBBA 3K0GA 3STLC 2VQEO 1GN2A 5IT9N 4XDJA 2UXBO 3RW0A 1ZX3A 4O4IA 1GK9A 2AZ2A 4CH3A 5HFLA 2Q73A 2CAZC 3D3QA 4ABMA 4X66B 3G67A 4DUYO 3H1IH 3P3PA 4B3SO 1S5LZ 1PP9H 3IC9A 1IBMB 1Q43A 2BTOA 3ZIAG 2LGQA 1M5IA 4PI0A 3DSQA 5LHHA 3CCRV 2A06H 2WLLB 2C2AA 3ABMC 4FIPC 4AILC 2IJJA 2P4KA 4TV8A 2P5OA 5JJJB 3T1HB 1E1RG 5LOVA 4O2BB 4YXWG 5H9CA 4DW0A 3U0ZA 5BR8B 2F4VB 4FM0A 1NTKH 2EZOA 1SA0A 4X8AA 2OCHA 4UVCA 1H38A 1AROP 2D2CB 3X2QB 4I4TB 3A0BZ 1FXVA 3VQYA 4JPRA 3NXSA 1EM1A 3IJ4A 4E2LA 2P7TC 3CC2V 4G27B 5CA1A 3K0DA 3AG7A 1VP7A 3K08A 2UXCB 2YIAA 5JJEB 2EILB 4R50A 5CB4A 2EILC 3JD4A 4J10A 1SA0B 4MTFA 1H8EG 2HG5C 5FNVB 4H44B 4I4TA 2RMKB 2P4VA 4CS4A 1Y66A 4YY3B 1RSOA 4J7JA 1J5EO 4DV3O 4PA9A 3M8AA 5IYCO 4X64O 2Q5ZA 4QE9A 4D6TH 1RFYA 2LW7A 2RQ6A 5CB4B 1DTOA 5EZYA 3OTFA 1ZAUA 1D5AA 3W7WA 2ZQMA 4DR2B 3B2EE 3JCZA 4EKWA 4H33A 4K8ZA 1GM7A 4L87A 5IYZA 5C93A 4DR6O 1ZTEA 2HVKC 4GT1A 3J7AU 1WN7A 2UU9B 3JARA 1NTMH 5B1BC 3H1LH 1JOYA 4JV5O 3E8FA 3CC7V 1M9NA 4I0XA 4I9QA 5CBHA 4ZOLB 2QM8A 2WPDG 3ZCCA 3KZIZ 4KHPO 5JH7A 1UJWB 1VQ4V 1QHTA 3RWRD 3WU2Z 4X64B 3QNEA 4J9ZB 3SJCC 4CS3A 2GTAA 4MW3A 5KHJA 1IDSA 2Q8VA 3IC7A 3ZHQA 3F7YC 5EBWC 3ZHRA 3T1YO 3U11A 1PNLA 1K92A 3H9VA 2QWRB 4JAUA 2ZDIA 2E5LO 1GM9A 1HP8A 2Q4PA 1BMFG 4K8XA 3JD0A 1QQCA 2W0XA 1K8AW 1F7YA 4TSFG 3BY6A 4J9YB 1S0VA 5FPRA 3DC6A 2CGNA 2DN9A 5CN0A 2KQXA 2UXDO 3ZRSA 4H0LB 2QEXV 1NQTA 3AEIA 1N34O 3HPLC 1BS3A 2X6AA 2QWNB 3T2MA 4I50B 5KA6A 5LOVB 3K58A 3E89A 1Y74B 1WP7A 1WB8A 4KL1A 5A9GA 2ZDIC 2JEXA 2Z0AA 4LFAB 2H8PC 4DV4O 4UFZA 1ORQC 4CBCA 3L74H 1PL4A 3UT5A 4LCUC 3OE7G 4J80A 3JD3A 2FB5A 1YTFD 4LFAO 2KG7B 4PV1B 4GKKO 2ZM6B
chains in the Genus database with same CATH topology
3ZBHA 1WA8A 2AZ2A 3Q4HB 3FD9A 2VRZA 4I0XB 3GVMA 2VS0A 4LWSB 3G80A 1WA8B 4I0XA 3TXQA 3FAVA 4ABMA 4GZRB 4LWSA 3GWKC 2B9ZA 3HR0A 3OGIB 3FAVB 3O9OA 2KG7B 3TXSA 2AZ0A 2KG7A 3Q4HA 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZBH A;  1WA8 A;  2AZ2 A;  3Q4H B;  3FD9 A;  2VRZ A;  4I0X B;  3GVM A;  2VS0 A;  4LWS B;  3G80 A;  1WA8 B;  4I0X A;  3TXQ A;  3FAV A;  4ABM A;  4GZR B;  4LWS A;  3GWK C;  2B9Z A;  3HR0 A;  3OGI B;  3FAV B;  3O9O A;  2KG7 B;  3TXS A;  2AZ0 A;  2KG7 A;  3Q4H A;  2DE0 X; 
#chains in the Genus database with same CATH topology
 1UFI A;  1SRY A;  2UUA B;  4YJ3 A;  1Q81 W;  4MVR A;  4JI4 O;  4FZ1 A;  5B3S C;  1V55 B;  5FNV A;  3RGB A;  4AI8 A;  3VQW A;  4HNA A;  1SQG A;  2Q0A A;  3A0R A;  4DR6 B;  2N74 A;  3SPJ A;  5BY1 A;  2ADQ B;  1YXB A;  1E79 G;  1ENV A;  1HR0 B;  4PA4 A;  5L3B A;  5CMU A;  1SQX H;  3LSU A;  1TUB B;  1K5Q A;  4DK0 A;  3CB2 A;  4P30 A;  4IGG A;  1MAB G;  4I7Z B;  1I5X A;  4HNA B;  5IYZ B;  4PD4 F;  1XNQ O;  4N23 A;  3S3W A;  3E86 A;  1YJN V;  1O9H A;  5A2Q N;  4IYI A;  2ATK C;  1FFX B;  4B08 A;  2VWJ A;  3JAK A;  3MAQ A;  3STZ C;  2YXL A;  3L70 H;  3OGC C;  1R6K A;  1IBL B;  1N4C A;  2YDE A;  3ZRW A;  3W7U A;  1VF7 A;  2HKO A;  1I0H A;  3RT3 C;  2NN4 A;  5JH7 B;  1AR5 A;  1R3L C;  1JJO A;  3MHS C;  2DWE C;  5LP6 C;  1FFX A;  4IL6 Z;  3ZED A;  3HKD A;  3JAK B;  2W6J G;  1CEZ A;  2BSK A;  1OCR C;  2CGO A;  2ODM A;  4ZI7 A;  4B7E A;  1K33 A;  3GWO A;  2PZS A;  1X4T A;  3E8B A;  1ZSP A;  2Y4T A;  5JVD B;  2YSU B;  2LO1 A;  3AG3 B;  4DXW A;  1RM1 C;  4DR2 O;  4MVS A;  1VQM V;  1F51 A;  4ZI7 B;  1JA8 A;  1ZUQ A;  4GUN A;  4DR5 O;  3ETQ A;  2LW1 A;  1H8H G;  2ZCE A;  2ZT9 B;  1XEQ A;  1VQO V;  4GYC B;  1Q6H A;  4G28 B;  3OR6 C;  1NVP D;  2Y69 C;  1Q7Y W;  1YJ9 V;  3K5N A;  4X66 O;  3K9A A;  4UUJ C;  5K1P A;  4DUZ B;  4LF8 O;  5D5P A;  1Y74 A;  1NR7 A;  2LQT A;  3ASN B;  5IJ9 B;  2R9R B;  1R6N A;  4TQF A;  4UCR A;  1B3Q A;  2Q7H A;  4LR3 A;  4GX2 A;  1EN4 A;  1XL4 A;  2PTM A;  4JYA O;  2PI5 A;  3N27 A;  4PJ0 Z;  2CTQ A;  3CCU V;  3UO3 A;  2KG7 A;  2P22 C;  4BWA A;  5LHG A;  2QKA A;  3BVO A;  2XOK G;  4QNH B;  5J9P C;  3LDC A;  1DGS A;  1V54 B;  2EIM B;  4I5S A;  3GWK C;  4QPJ A;  2A3Q A;  3FKS G;  3KCY A;  2V7Q G;  1YZB A;  5EC2 C;  3IGA C;  2IJK A;  3B4S A;  3QVN A;  1BHB A;  5H6Q A;  3CCJ V;  2GHY A;  3WFV A;  4IT5 A;  1NI8 A;  4I55 B;  2XAQ A;  1Y76 A;  1F4N A;  4LFB O;  2HHH O;  5B5E Z;  5JJN B;  1AP6 A;  2RCV A;  4DYL A;  4EFE A;  2EIJ C;  1P84 F;  4B3T B;  3OGI B;  3CS5 A;  3L75 H;  4YJ2 A;  4KUM A;  1HW7 A;  2GBO A;  3E35 A;  3SYQ A;  3UKM A;  4I55 A;  2F1M A;  5IJ0 B;  5LMU B;  4NXM O;  3OM3 B;  4UCO A;  1IX9 A;  3CRC A;  1M93 A;  4JAV A;  1MZF A;  5BZB A;  4LF4 B;  1S5J A;  1WNS A;  3M7M X;  2AXT Z;  1NTZ H;  1ZL8 B;  1M56 C;  3JSL A;  2JIZ G;  2DOS A;  4YJ2 B;  3H1K H;  3RYH B;  4D7S A;  3JAT A;  4RQF A;  3D3I A;  1VQ8 V;  2AZ0 A;  3L9D A;  4L8J A;  2ZE6 A;  4WBN A;  4FLV A;  1QU7 A;  1ZL8 A;  4JI8 O;  1SET A;  3AG1 B;  1T5E A;  5EBL C;  1BGY H;  2YI8 A;  3RVY A;  3HKB A;  1SQP H;  2QSA A;  2F95 B;  4RAI A;  3QO8 A;  1R3J C;  2BOB C;  3AG4 C;  1SQB H;  1W0J G;  1I94 B;  1VQ6 V;  1IBK B;  3RYI B;  1AI5 A;  2ZXW B;  1IVS A;  4PI2 A;  3H1J H;  3E2E A;  3LSS A;  4NVP A;  4DR3 O;  3MD0 A;  3AK3 A;  3J80 N;  3QF7 A;  2B9Z A;  3RYI A;  2WA3 A;  3SPH A;  5IWA O;  4JI2 O;  1FXK C;  3OTO O;  3K59 A;  2YC0 A;  3K9S A;  4X65 B;  1AJQ A;  2CTW A;  5J2T B;  2BCC H;  1KB9 F;  3X2Q C;  1N0N A;  2VWK A;  2ZR3 A;  4DR4 O;  2ZM6 O;  4YHH B;  3FAV B;  1EFR G;  3WB2 A;  2CK3 G;  2RNB A;  3CRM A;  2R9A A;  2ZE8 A;  4B3M B;  4DV7 B;  4O4I B;  2BTQ A;  5KMG A;  1EZJ A;  3IFX A;  1N33 O;  4NTY A;  2ZNI A;  3ABM B;  4FM2 A;  5CA0 A;  2QTO A;  3ML0 A;  4N21 A;  4MS2 A;  4WFE A;  5H6R A;  5HFM A;  3F5W C;  3ASO C;  1R73 A;  1VQ9 V;  2R70 A;  2XUM A;  2JS3 A;  2OCC C;  1BT8 A;  2LGW A;  2YIC A;  2GSM B;  5FPO A;  3ZHS A;  1K5S A;  1VQ5 V;  1TVK A;  2EUL A;  1XRE A;  3MHH C;  1FXK B;  2WLL A;  1YTF B;  2M7W A;  4U7N A;  1W59 A;  4ZIB A;  4TV8 B;  1QLE B;  3OMA B;  1KC8 W;  2GDS A;  3BAA A;  3TCU A;  4EB6 A;  3ZMT A;  4JI2 B;  2L35 A;  3RYH A;  3ASN C;  3JAT B;  3OEE G;  5L3D A;  3LDD A;  1FJG B;  1B04 A;  3CCS V;  1GM8 A;  1COW G;  4JI7 O;  3T1C A;  2YEV B;  2KSD A;  2XTA A;  4DV1 O;  4B3R O;  1PM9 A;  4EEQ A;  3JAW B;  3SGI A;  1GKF A;  3CCE V;  5L3C A;  1HDJ A;  3HKB B;  3O9O A;  2K1E A;  3ABK C;  1QR9 A;  1G4Y B;  3T4Z A;  2ZD9 A;  5LGU A;  4JI0 B;  3CRQ A;  2VS0 A;  5JQG A;  3B77 A;  1AIL A;  2AHY A;  4UCV A;  1Y67 A;  4Z1V A;  2MW2 B;  4LF6 B;  3CCV V;  5L3F A;  1SF9 A;  3RVZ A;  1L1F A;  1WJZ A;  5AG2 A;  1K7D A;  2AHZ A;  2ZIM A;  3HKE B;  2ILM A;  2PYL A;  4ZOL A;  4NB5 A;  2UUB O;  4UVB A;  2D3O W;  4DV3 B;  5BXZ A;  4JI7 B;  3ZMZ A;  3ZHU A;  4YY3 O;  2FYU H;  1FD9 A;  1P4R A;  1VQL V;  1GRJ A;  4JI0 O;  1N8R W;  3CME V;  5C8Y B;  4IHJ A;  5KHG A;  2BTQ B;  1RM1 B;  1H2G A;  1F4M A;  5KUM A;  2B1G A;  1KP2 A;  5BR8 O;  2F4V O;  4JI3 O;  5B3S B;  5KAI Z;  4Z1M G;  2PGG A;  1NVP B;  3ICX A;  3FB5 C;  1AI4 A;  4X1K A;  1JFF A;  3JAL A;  4IHJ B;  2CDY A;  2IM9 A;  4FLX A;  3SYP A;  2MK3 A;  4LC1 A;  2XND G;  4I9W A;  2W0F C;  1SQV H;  1YJW V;  4RWU A;  1FXK A;  5B1A B;  1XMQ O;  3ETE A;  2ZIN A;  1XQ8 A;  3HKC B;  4X1K B;  1M57 C;  4F6R A;  3JAL B;  2K9P A;  4NKG B;  3J81 N;  1KKD A;  4W4L A;  2DYS B;  1P49 A;  3ZX6 A;  1XHZ A;  1YIJ V;  1K3E A;  4EB6 B;  1PNK A;  3JCU Z;  4JYB A;  1QVF U;  4UXN A;  3NR7 A;  3UCS C;  1IBM O;  2A7W A;  3EHB B;  4TUY A;  1WP8 A;  1JVM A;  1OZ0 A;  4DV2 B;  4FFB A;  4F6E A;  3ZN0 A;  4BW5 A;  3A2F A;  1WLE A;  5GTH Z;  3SPI A;  4B7K A;  4ICG A;  3G71 V;  4OPA A;  4X89 A;  3O65 A;  1NT2 B;  4KP4 A;  5BMV B;  3AG2 C;  2QGN A;  2QWQ B;  5EC1 C;  3CCQ V;  5J2U A;  2JGD A;  3K04 A;  1VIB A;  3AG3 C;  1QVG U;  4FFB B;  4UVA A;  1WA8 B;  2Q9L A;  3RYC B;  5CA3 A;  1Q6U A;  3SJQ C;  1OCO C;  3KG2 A;  1Q3E A;  2Y0P A;  1YEW A;  2CH7 A;  5B1O A;  4DR1 O;  2EIN B;  4JGS A;  2JDI G;  5ITZ B;  1RSO B;  1N36 B;  4DV6 B;  1SC5 B;  3HKE A;  4O4H A;  2DQ0 A;  2P67 A;  2KB1 A;  5EZY B;  1O9G A;  2RJZ A;  1OCC B;  4UV8 A;  2F43 G;  3BPZ A;  2QM7 A;  3LUT B;  4MVQ A;  3BA8 A;  4DR3 B;  4GKJ O;  3JAR B;  2YID A;  4U3F H;  4JI1 B;  4WCE V;  3AK1 A;  4ZKI A;  1XDC A;  1SZT A;  2HLD G;  4I0X B;  4MVZ A;  4PDR A;  4FMT A;  3G6E V;  3LSQ A;  3RYF B;  2BSK B;  1OHH G;  5LA6 B;  1I94 O;  2OTJ V;  3JYC A;  4RO2 A;  2PY5 A;  1S77 D;  1N32 B;  3EVK A;  4JYC A;  2HR3 A;  1I08 A;  4KXR A;  3BEH A;  3L72 H;  3QTC A;  1YI2 V;  1BHA A;  5LGN A;  3BCC H;  3E22 A;  1H2M A;  4MT8 A;  2A79 B;  4X1Y B;  3RYF A;  4NR1 A;  4JI1 O;  3E8H A;  5JCO C;  4OX9 O;  3DXR B;  4GKK B;  1W0K G;  2LFS A;  2B5U A;  4YIO A;  1AR1 B;  1ZLZ A;  4J11 A;  2HHH B;  3GB7 C;  1KEC A;  1Y6X A;  1S72 V;  5B66 Z;  4R8C A;  5LL6 Y;  2Q7G A;  1L0L H;  4FM1 A;  4DO2 A;  5IJ9 A;  4FLZ A;  2WLN A;  1H2N A;  2VQF O;  3ZRX A;  1YF2 A;  2YXH A;  3RFR A;  5FL7 G;  5F2V O;  4DR1 B;  4I50 A;  2NR5 A;  4LNU A;  3UM7 A;  3SYC A;  1FKA O;  1NU1 H;  3R66 A;  1N0J A;  2EIM C;  1Q90 D;  1KP3 A;  4LFB B;  3CSX A;  2ETN A;  2QM4 A;  1OCZ B;  3OUF A;  3E83 A;  4LFC O;  1V55 C;  3ZMV A;  4DV0 B;  5LP6 A;  1VQK V;  1M56 B;  5J2U B;  2Q6A A;  4LNU B;  3UT5 B;  1SS3 A;  2UUC O;  1CP9 A;  4LFC B;  1NH2 D;  1L0N H;  2EIK C;  1KQS U;  2JRI A;  4RUF A;  4WFH A;  4LP8 A;  1JPX A;  1MOF A;  1VF6 C;  4XBF A;  4E4E A;  4BW9 A;  5EBM C;  1R1B A;  3Q4H B;  3FD9 A;  1I7F A;  2JJ1 G;  2OCC B;  1SER A;  1OCZ C;  1Z5W A;  5IE9 A;  1K4D C;  4MVU A;  4FZ0 A;  4UB8 Z;  1PD3 A;  2ZKO A;  2JGU A;  4JZ2 A;  1GN4 A;  2Y0I A;  5LMN O;  4KHP B;  4JTC B;  1Q5O A;  1J95 A;  5KHH A;  5IJ0 A;  4FPP A;  5KA5 A;  3K03 A;  3Q4H A;  1GN6 A;  4QE7 A;  3IAY A;  2IJI A;  5DED A;  2EJR A;  1I5Y A;  3WB0 A;  1PPJ H;  4HBN A;  2RN9 A;  4LF6 O;  2O57 A;  3E8G A;  2KKW A;  2WLH A;  5LA6 A;  5IY5 C;  4UB6 Z;  1P7G A;  2CTR A;  3JAS A;  4WBN B;  1Z5V A;  1PNM A;  2G38 A;  3HKD B;  1MSD A;  3CWB H;  3FYE B;  3D36 C;  3K06 A;  3VQX A;  4GX1 A;  3AG4 B;  5EYP B;  3DXR A;  3ZHV A;  1W2B U;  4P2Z A;  3JSN A;  3PN1 A;  5IDJ A;  2P06 A;  1YCI A;  2ZNJ A;  4IYH A;  4DR7 B;  4JI3 B;  4LBE C;  4H37 A;  2X6C A;  1IBL O;  3B8M A;  4X62 B;  1VAR A;  1PV0 A;  2DJV A;  5EYP A;  3JD2 A;  4J41 A;  3QO5 A;  1OCC C;  2WLI A;  2JS5 A;  4NTW A;  4JI8 B;  2XAF A;  2R72 A;  3A8T A;  3CMA V;  5J2T A;  2PYJ A;  4FK5 C;  1YHQ V;  4O2A B;  4LF9 O;  1QLE C;  3UQ8 A;  5LP6 B;  4YIP A;  3FAV A;  4WFA V;  1HNW O;  2FTK A;  3SYA A;  4DV4 B;  4JF3 A;  5IY5 B;  2WA4 A;  2HJD A;  1IXM A;  3I55 V;  3CP1 A;  3N2G A;  4IIJ B;  3OMI B;  4TOI A;  3ABK B;  3TK1 A;  4DV1 B;  4FJC C;  4B3M O;  4DV2 O;  4LH7 A;  2Y69 B;  3BA9 A;  2QKS A;  5GTI Z;  4D7T A;  4FLU A;  4P9O A;  5LXT B;  3APO A;  4J7K A;  2X0L A;  3QG5 A;  4CC6 A;  5KX5 B;  1BCC H;  1ROP A;  4WFB V;  2QWO B;  3JAM N;  3EFF K;  2ZE7 A;  3OAA G;  2HP8 A;  3ZMS A;  3B09 A;  1AR4 A;  3S3X A;  1NR1 A;  3JD1 A;  3HR0 A;  1FJG O;  1FAF A;  4NXN O;  3SPC A;  3SPG A;  3MDS A;  2HFE C;  1B6Q A;  2GV9 A;  4FLY A;  3OEH G;  1GMG A;  1M4U A;  2QJ1 A;  2X6B A;  3WB1 A;  1FYJ A;  3JAS B;  1IBK O;  3OTO B;  1UPG A;  3BRC A;  4GZR B;  4BAY A;  1DLB A;  4JV5 B;  3CXH F;  2NLJ C;  1KYO F;  1VEW A;  1SES A;  4AQY B;  2IJH A;  3OT7 A;  4OX9 B;  1QBZ A;  5KHI A;  1VQN V;  1S76 D;  4OXS A;  2UUB B;  1GH6 A;  3ZRV A;  1LUV A;  2F23 A;  1AJN A;  4HAM A;  1N33 B;  4GCZ A;  2PI4 A;  1J5E B;  1XI1 A;  5JCO A;  5KLV H;  2XAS A;  5IYB O;  4JYY A;  2WLI B;  1VF6 A;  1G1X B;  3N2K B;  1LUW A;  4MTO A;  5GON A;  2UXC O;  3K57 A;  2E76 B;  3PJS K;  1XMO O;  4DW1 A;  4PEL A;  4QPK A;  5D5Q A;  5KAF Z;  4TT3 G;  4MW8 A;  1QR8 A;  2H94 A;  1M90 W;  3N2K A;  1D2D A;  2YIB D;  5C8Y A;  3ZMU A;  4LF4 O;  3CPW U;  2ZXW C;  3BAB A;  1KUQ A;  4DR7 O;  2N04 A;  1N32 O;  3FB6 C;  5K1X A;  3U10 A;  4MVO A;  1VMG A;  4JI5 O;  4LWS B;  1K97 A;  3FB8 C;  1URF A;  4FVM A;  1XIL A;  3DGE A;  1YVW A;  1KU9 A;  5H2F Z;  1NBM G;  3ABT A;  5KMG B;  1MA1 A;  1MG1 A;  1R3K C;  4JI6 B;  2AW9 A;  2YXY A;  1U96 A;  5KX5 A;  5CA0 B;  3KKY A;  2UUC B;  3B40 A;  3HB3 B;  3OW2 U;  3ABL B;  2Q7E A;  2R9I A;  1V54 C;  3HKC A;  3C3T A;  2AGA A;  1OV9 A;  1P7B A;  1S3J A;  2QR4 A;  3WG7 B;  4LF5 B;  1XOU A;  1JCH A;  3W7X A;  1JQ0 A;  1FFT B;  2NNU A;  2WLJ A;  1K73 W;  4LH6 A;  2HEP A;  4DUZ O;  3ETD A;  1NS1 A;  1QNM A;  5DM6 V;  3TXS A;  3OUS A;  4CZZ A;  1E1Q G;  3ABU A;  2Y48 A;  1F23 A;  2DQ3 A;  2F66 C;  2XAG A;  2V1D A;  4X9Q A;  3P30 A;  2FKX A;  3SYO A;  4TQD A;  3LNN A;  2IH3 C;  5CBF A;  5EK0 A;  3I5D A;  4Q20 A;  5BMV A;  2HVJ C;  4O4L A;  3G6B A;  4JTD B;  2EBO A;  2YEV A;  4LF5 O;  1XMQ B;  1HNX B;  1WA8 A;  5IYD O;  1XBL A;  3RYC A;  1HWY A;  2E75 B;  4PA6 A;  4PA3 A;  2VQE B;  3T4D A;  2JJ2 G;  2W6I G;  1PKX A;  2M6Y A;  3EXA A;  1BL8 A;  1LNQ A;  2CH7 B;  2OTL V;  3OFN G;  2DYR B;  3D8C A;  4X88 A;  2F93 B;  5GW7 A;  4DV0 O;  3SR2 C;  5E79 Z;  4BR6 A;  4C7U A;  1YSC A;  4O2B A;  2E74 B;  1EZV H;  3VOU A;  1S5H C;  1XUQ A;  5GON B;  4K3A A;  3RBZ A;  2WSS G;  3D36 A;  5EIB C;  1XNQ B;  3K5M A;  2VQF B;  4JI5 B;  5CA1 B;  3CCM V;  4JYA B;  1MMM A;  3M99 B;  2DE0 X;  2IU3 A;  5B1B B;  4MTX A;  3FYI B;  3CC4 V;  4K0K B;  1DF5 A;  2DMX A;  2JK5 C;  2YIB A;  3AG1 C;  3F5T A;  1JJ2 U;  4LF8 B;  3C90 A;  5JWP A;  1N36 O;  1AVM A;  4QJF B;  4LWS A;  3SJA C;  2GTS A;  4MSW C;  1PL0 A;  3ZJZ A;  2IW5 A;  3E22 B;  4X1Y A;  4TV9 A;  5DEC A;  3CRR A;  4DR5 B;  1G8M A;  3ZBH A;  1TGO A;  4CH4 A;  1JR9 A;  2QA4 V;  2E3C A;  2BE3 A;  3FX7 A;  1HR0 O;  1D5N A;  1EN5 A;  2ARH A;  4NXM B;  1JFF B;  1Q6I A;  3K3W A;  4MTG A;  3ZS8 C;  4BIZ A;  4JAS A;  1OCO B;  1DF4 A;  1MSW D;  1YDX A;  2QE7 G;  3CCL V;  4JI4 B;  5CBG A;  4FLW A;  4WF9 V;  5JVD A;  4PDV A;  2CE4 A;  2VRZ A;  1SKV A;  4AQY O;  3APQ A;  1QLN A;  2CUG A;  2A0L A;  1N34 B;  4F6R B;  1JMK C;  3H1H H;  4GX0 A;  2ZIO A;  4JZG A;  3B8N A;  2OIG A;  1FXH A;  1NJI W;  1IXB A;  5LYJ A;  1VF5 B;  1RPR A;  4CH6 A;  1CXZ B;  4OGQ B;  4QGP A;  1A32 A;  4DV6 O;  2A9H A;  5L3E A;  4O4L B;  4W4K A;  3CXC U;  4TUY B;  3FB7 C;  3L71 H;  1RPO A;  1GAX A;  1TUE B;  1AB3 A;  4UCS A;  2FML A;  4KFM A;  1AP5 A;  3CE2 A;  4GLX A;  2DWD C;  3CD6 V;  4U3J B;  4JTA B;  3I56 V;  2B1I A;  3K79 A;  3P32 A;  2JGD B;  1Q86 W;  2OIE A;  2Q69 A;  3CJH A;  1EN6 A;  2QTS A;  3G4S V;  4PDL A;  1XNR O;  2E5L B;  3ZHT A;  2PF4 E;  3TXQ A;  2UUA O;  4U3J A;  4DV7 O;  1H2L A;  2CTP A;  1WAZ A;  3ABL C;  4RQE A;  1IUR A;  4UV9 A;  1THZ A;  5ITZ A;  3CJH B;  2X7R B;  1HNW B;  4NYK A;  2FL4 A;  1GN3 A;  4O4H B;  2V4D A;  1GO3 F;  2IH1 C;  1H2S B;  4FLT A;  3A0H Z;  4YJ3 B;  1KBH A;  2H3O A;  3CRA A;  1BSM A;  2L6L A;  2UXN A;  1YIT V;  2ITD C;  3W7S A;  4LF9 B;  1M1K W;  2GUZ B;  2UU9 O;  4PA7 A;  3FFQ A;  1BQ0 A;  3ETG A;  1TUB A;  4XDL A;  4R6Z A;  4DR4 B;  2EX3 A;  2EIN C;  4QIW F;  3W7T A;  4TV9 B;  5H5N A;  3F7V C;  3OD4 A;  3KCX A;  4K0K O;  4G2K A;  3BFR A;  4ZBM A;  1XL6 A;  4X62 O;  2EZP A;  4LF7 O;  2P90 A;  4OPH A;  2P6J A;  4JAA A;  3OMN B;  3CHX A;  4AHC A;  1GTO A;  4BIO A;  2WLM A;  3ZRW B;  1B06 A;  1G6U A;  4B3R B;  5E1A C;  3T1Y B;  2OYQ A;  1AJP A;  1LR1 A;  2DYR C;  1IZ3 A;  2IBZ H;  1Z2G A;  1WPX A;  2N05 A;  2QWP B;  2RDC A;  4FFK A;  4DK1 A;  5L3G A;  2OT5 A;  2OWO A;  2EIJ B;  4UCU A;  5LYJ B;  1K34 A;  1BQZ A;  1KMI Z;  4A5U B;  5LBQ A;  1SZX A;  1K4C C;  1V9P A;  2Y4U A;  3GVM A;  2ZR2 A;  4DRX A;  5DN6 G;  2UXX A;  3TET A;  1ZWI C;  3T1H O;  4PHZ A;  1OJH A;  5LMU O;  3N2G B;  4IIJ A;  1US6 A;  2Q67 A;  1KD1 W;  1MNG A;  1OCR B;  2JVD A;  3CYO A;  3TJT A;  4MVM A;  5B1A C;  3ZN1 A;  5LMN B;  2XAH A;  4B3T O;  2ZE5 A;  1RP3 B;  4CS2 A;  3AK2 A;  4Z2W A;  3RN4 A;  4ZHQ B;  3DTU B;  2WLK A;  5B1N A;  1SQF A;  4B3S B;  2ITC C;  2HJF C;  3AG2 B;  4J7Z A;  3VQV A;  5KUK A;  3QO7 A;  1XNR B;  2WWW A;  4YHH O;  4ZHQ A;  5LHI A;  2ADP A;  2XAJ A;  5KHK A;  2UXD B;  5LGT A;  2PUS A;  1R3I C;  1KKC A;  1JX9 A;  2DYS C;  4HZ3 A;  2XHB A;  1TA8 A;  4K35 A;  1M57 B;  1Q8I A;  1SQQ H;  1TAE A;  1HNX O;  1NZ6 A;  5IWA B;  1FPO A;  1CPY A;  3THO A;  2GUZ A;  5TIS Z;  2EIK B;  4WFG A;  4O4J A;  4DV5 O;  1QCE A;  1TVK B;  4P9P A;  1Y76 B;  4CC5 A;  2UXB B;  1WPB A;  3BHP A;  4EFB A;  4X1I B;  1FS0 G;  1AI6 A;  4H13 B;  3WG7 C;  2IU0 A;  2YI9 A;  1NH2 B;  3K5L A;  4O4J B;  4Q6G A;  4DUY B;  1XMO B;  2Q68 A;  2LFR A;  4R7C A;  2WAM A;  4X1I A;  5FLX N;  2YS8 A;  4CH5 A;  2QDO A;  3R65 A;  3SJB C;  3DC5 A;  3JAW A;  2YUA A;  4J42 A;  4GX5 A;  2XT9 A;  4NTX A;  3H01 A;  1U97 A;  1X59 A;  4X65 O;  4JI6 O;  2BOC C;  1NKD A;  1EBO A;  4DRX B;  5JQG B;  2Q0O C;  3L73 H;  4GKJ B;  1XHX A;  4X20 B;  1R6T A;  2QKC A;  1H2K A;  4DV5 B;  1MZE A;  3CEI A;  4PDM A;  4F4L A;  4U7O A;  3C3S A;  5EIB D;  4O2A A;  2Z5U A;  1HNZ B;  3LNM B;  1VQ7 V;  4XDK A;  4WFF A;  4LF7 B;  4HYO A;  1L8D A;  4TWK A;  3G80 A;  2EJ7 A;  4X20 A;  1BE3 H;  3SDL A;  4UCT A;  3K5O A;  3ASO B;  1K9M W;  1HNZ O;  2Z3Y A;  1Y4M A;  3UO2 A;  4RUE A;  1WB7 A;  4BIU A;  2DW4 A;  4NXN B;  3LDE A;  3CX5 F;  4ASU G;  1AI7 A;  2JEU A;  2LP7 A;  1BZK A;  1Q82 W;  3TGU H;  3P3N A;  2LJ2 A;  5LXT A;  3OR7 C;  1DK1 A;  1VQP V;  3VBB A;  3K0G A;  3STL C;  2VQE O;  1GN2 A;  5IT9 N;  4XDJ A;  2UXB O;  3RW0 A;  1ZX3 A;  4O4I A;  1GK9 A;  2AZ2 A;  4CH3 A;  5HFL A;  2Q73 A;  2CAZ C;  3D3Q A;  4ABM A;  4X66 B;  3G67 A;  4DUY O;  3H1I H;  3P3P A;  4B3S O;  1S5L Z;  1PP9 H;  3IC9 A;  1IBM B;  1Q43 A;  2BTO A;  3ZIA G;  2LGQ A;  1M5I A;  4PI0 A;  3DSQ A;  5LHH A;  3CCR V;  2A06 H;  2WLL B;  2C2A A;  3ABM C;  4FIP C;  4AIL C;  2IJJ A;  2P4K A;  4TV8 A;  2P5O A;  5JJJ B;  3T1H B;  1E1R G;  5LOV A;  4O2B B;  4YXW G;  5H9C A;  4DW0 A;  3U0Z A;  5BR8 B;  2F4V B;  4FM0 A;  1NTK H;  2EZO A;  1SA0 A;  4X8A A;  2OCH A;  4UVC A;  1H38 A;  1ARO P;  2D2C B;  3X2Q B;  4I4T B;  3A0B Z;  1FXV A;  3VQY A;  4JPR A;  3NXS A;  1EM1 A;  3IJ4 A;  4E2L A;  2P7T C;  3CC2 V;  4G27 B;  5CA1 A;  3K0D A;  3AG7 A;  1VP7 A;  3K08 A;  2UXC B;  2YIA A;  5JJE B;  2EIL B;  4R50 A;  5CB4 A;  2EIL C;  3JD4 A;  4J10 A;  1SA0 B;  4MTF A;  1H8E G;  2HG5 C;  5FNV B;  4H44 B;  4I4T A;  2RMK B;  2P4V A;  4CS4 A;  1Y66 A;  4YY3 B;  1RSO A;  4J7J A;  1J5E O;  4DV3 O;  4PA9 A;  3M8A A;  5IYC O;  4X64 O;  2Q5Z A;  4QE9 A;  4D6T H;  1RFY A;  2LW7 A;  2RQ6 A;  5CB4 B;  1DTO A;  5EZY A;  3OTF A;  1ZAU A;  1D5A A;  3W7W A;  2ZQM A;  4DR2 B;  3B2E E;  3JCZ A;  4EKW A;  4H33 A;  4K8Z A;  1GM7 A;  4L87 A;  5IYZ A;  5C93 A;  4DR6 O;  1ZTE A;  2HVK C;  4GT1 A;  3J7A U;  1WN7 A;  2UU9 B;  3JAR A;  1NTM H;  5B1B C;  3H1L H;  1JOY A;  4JV5 O;  3E8F A;  3CC7 V;  1M9N A;  4I0X A;  4I9Q A;  5CBH A;  4ZOL B;  2QM8 A;  2WPD G;  3ZCC A;  3KZI Z;  4KHP O;  5JH7 A;  1UJW B;  1VQ4 V;  1QHT A;  3RWR D;  3WU2 Z;  4X64 B;  3QNE A;  4J9Z B;  3SJC C;  4CS3 A;  2GTA A;  4MW3 A;  5KHJ A;  1IDS A;  2Q8V A;  3IC7 A;  3ZHQ A;  3F7Y C;  5EBW C;  3ZHR A;  3T1Y O;  3U11 A;  1PNL A;  1K92 A;  3H9V A;  2QWR B;  4JAU A;  2ZDI A;  2E5L O;  1GM9 A;  1HP8 A;  2Q4P A;  1BMF G;  4K8X A;  3JD0 A;  1QQC A;  2W0X A;  1K8A W;  1F7Y A;  4TSF G;  3BY6 A;  4J9Y B;  1S0V A;  5FPR A;  3DC6 A;  2CGN A;  2DN9 A;  5CN0 A;  2KQX A;  2UXD O;  3ZRS A;  4H0L B;  2QEX V;  1NQT A;  3AEI A;  1N34 O;  3HPL C;  1BS3 A;  2X6A A;  2QWN B;  3T2M A;  4I50 B;  5KA6 A;  5LOV B;  3K58 A;  3E89 A;  1Y74 B;  1WP7 A;  1WB8 A;  4KL1 A;  5A9G A;  2ZDI C;  2JEX A;  2Z0A A;  4LFA B;  2H8P C;  4DV4 O;  4UFZ A;  1ORQ C;  4CBC A;  3L74 H;  1PL4 A;  3UT5 A;  4LCU C;  3OE7 G;  4J80 A;  3JD3 A;  2FB5 A;  1YTF D;  4LFA O;  2KG7 B;  4PV1 B;  4GKK O;  2ZM6 B; 
#chains in the Genus database with same CATH homology
 3ZBH A;  1WA8 A;  2AZ2 A;  3Q4H B;  3FD9 A;  2VRZ A;  4I0X B;  3GVM A;  2VS0 A;  4LWS B;  3G80 A;  1WA8 B;  4I0X A;  3TXQ A;  3FAV A;  4ABM A;  4GZR B;  4LWS A;  3GWK C;  2B9Z A;  3HR0 A;  3OGI B;  3FAV B;  3O9O A;  2KG7 B;  3TXS A;  2AZ0 A;  2KG7 A;  3Q4H A;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...