4GZRB

Crystal structure of the mycobacterium tuberculosis h37rv esxop (rv2346c-rv2347c) complex in space group c2221
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
77
Chain Sequence
RFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESAT-6-like protein 6
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4gzrB00
1WA8B 3GVMA 3ZBHA 3GWKC 2B9ZA 3FAVB 3G80A 3OGIB 3Q4HA 2VS0A 4GZRB 2AZ0A 4LWSA 3TXQA 3TXSA 4I0XA 3Q4HB 2KG7A 4ABMA 1WA8A 3O9OA 2VRZA 3HR0A 4LWSB 4I0XB 2DE0X 3FAVA 3FD9A 2AZ2A 2KG7B
chains in the Genus database with same CATH superfamily
1JPXA 2Y0IA 4P9OA 2DMXA 5CBFA 1FYJA 5H6QA 3SPHA 1QQCA 1FJGO 2QKCA 1OCOC 3RBZA 1F51A 3CRCA 4O4IA 3T2MA 3ABTA 1V55B 1EBOA 4PELA 2YXLA 4GX5A 3AG3B 1H2MA 2K1EA 2PZSA 3OMIB 1G6UA 1KECA 3FAVA 5IYZB 3CXHF 2OT5A 1FXKB 1LR1A 1NZ6A 4RQFA 2QR4A 4LF9B 3ABKB 2ADQB 3B8NA 4I4TB 1WPBA 1K33A 3HB3B 5LOVB 4JI5O 4LWSB 5B5EZ 3OT7A 1Q6HA 1IZ3A 4DR1O 4LF5O 1IURA 4DK0A 2OTJV 1QNMA 1SQFA 3JCZA 2Y4TA 1BQ0A 5H5NA 3G4SV 5BY1A 4LFCB 2QKSA 3KKYA 1J95A 4PDLA 1RM1C 4JI2O 3RYIA 4RWUA 1QU7A 2DN9A 4MVZA 4PI2A 4G28B 1BCCH 2DYRC 1ZWIC 2EIKC 5AG2A 4O2BA 4PA4A 1Q90D 4I50A 3ZN0A 4LF6O 1X59A 1XMOO 4I7ZB 4NTYA 4X1IB 3ASNB 4PJ0Z 5CA3A 4JI8B 1YTFB 3QTCA 4LFBO 5B1BB 1AR1B 2YEVA 4X64O 3U0ZA 3AG1C 1FS0G 2ZKOA 4QGPA 5C8YA 1H8EG 3D3IA 5B1NA 1BT8A 1VF5B 2ODMA 3WB2A 2W6IG 1VP7A 1XREA 5JJNB 4X62O 1EZJA 4FFKA 1E1QG 1PPJH 3RYHA 1IBLB 4X65O 1BQZA 4GUNA 4J9ZB 4CBCA 1M1KW 4K35A 1PM9A 2EIMC 2WWWA 5J2TB 2UU9O 3K5NA 1N34B 4DV5B 4MW8A 4MVUA 3RYIB 1QVGU 2Q6AA 1XHXA 5EZYA 4EEQA 3CB2A 3SYCA 2ZE5A 1VQ5V 3EFFK 4OPHA 2VQEB 5KHJA 2UXNA 4IYHA 1NTZH 1W59A 4CH5A 5IJ9B 4LBEC 4MTOA 3OTOB 1SQGA 2EIJC 2EINB 1P84F 1V9PA 5ITZA 4I0XB 2WPDG 2CGNA 2X6BA 3RYFA 1L8DA 4AQYB 1JJ2U 3SR2C 2XNDG 1U96A 5HFMA 3ZRWA 1SC5B 1GK9A 3SPJA 5B66Z 3VQYA 1YJNV 3AK3A 2JEXA 3OM3B 1OCCB 2HR3A 2DW4A 3ETDA 1O9HA 3ZBHA 4UCVA 5GONB 5KHHA 5EK0A 2CAZC 1XL6A 1QBZA 4LFAB 1S0VA 4PD4F 4OXSA 4C7UA 4FLXA 3CJHA 2GBOA 3ASOC 2W0XA 2VQFB 4DR5B 3MHHC 3ZJZA 2HJDA 3JALA 4U7OA 2QJ1A 3MD0A 4RQEA 5E1AC 3NXSA 4J7KA 3ZHUA 4IYIA 1TA8A 2NLJC 4JYAO 4DV0B 2A3QA 2B1IA 2UXCO 1V55C 2EJRA 1IXMA 4TSFG 5LA6B 3RYFB 1NTKH 3AG3C 3LSSA 1TUBB 1NU1H 3ZMUA 4DV6B 1UJWB 1SQXH 5IDJA 1EN4A 4Z1VA 1RPOA 1FXKC 2AZ2A 4J10A 3F7YC 4K0KO 4PA6A 3CCLV 5D5QA 3ABKC 2JK5C 1OHHG 1OZ0A 4X20B 4KHPO 5B1AB 2ZDIA 4LF8O 1OCZB 2GTAA 3F7VC 1K4DC 2JJ1G 4JI4B 4A5UB 3GB7C 4IIJA 4ASUG 3LDEA 3QO8A 3AEIA 1I08A 4BWAA 3JD4A 4CC5A 3CPWU 2LQTA 4QPKA 1S3JA 1SQPH 1WP7A 4FLYA 4F4LA 2X6CA 1N36O 4DR2O 1EN5A 4UXNA 4GT1A 1FJGB 3DXRB 4U3JA 4TQDA 1MA1A 2PUSA 3JATA 4LR3A 4FK5C 1VQ9V 2CE4A 3ASNC 5H9CA 4B08A 2P7TC 5LXTB 1JOYA 5JVDB 1Q5OA 4OX9B 1KP3A 1FPOA 5DECA 1SZTA 3A0BZ 2E76B 5JQGA 4JAVA 5B1BC 5E79Z 4IHJB 4UB6Z 4NXMB 2PI5A 2LW1A 3K58A 1AI5A 1WA8A 3D36C 3CCEV 4DR1B 3I5DA 3RN4A 4X9QA 4P30A 4TWKA 3UM7A 4FPPA 3UT5A 2H3OA 3E35A 2Y4UA 3E86A 1NH2D 1H2KA 3L72H 4LF9O 1N32O 2XUMA 1KMIZ 4QJFB 4ZBMA 5KUMA 1JJOA 1WP8A 3JAKA 5A2QN 2HHHB 2P4KA 4JI2B 2F1MA 4ABMA 4WFBV 3O9OA 3HKDA 3BABA 4DV4B 1KBHA 2LO1A 1Q6UA 1XILA 4FLZA 2UXDB 1NVPB 4UVCA 2ZM6B 4LF6B 1BZKA 3E8GA 2GSMB 2Y0PA 3IJ4A 3OAAG 4R8CA 4UFZA 4O4HA 4LFCO 1HP8A 4JI1B 3CRQA 1WPXA 2QSAA 4LFBB 2EINC 1P7GA 1GTOA 3ZX6A 3CRRA 4CH6A 2X6AA 1ZTEA 3ZMTA 3X2QB 3AG7A 1H38A 4ZOLB 2LGQA 2LJ2A 2A0LA 4DV1B 1NJIW 3HKEB 1IBKB 4JPRA 3JD3A 4MT8A 5IWAB 5JJJB 2UXXA 3JAWA 4X62B 2VWKA 2GUZB 1AI6A 3J81N 1DF4A 3OE7G 4X65B 4UCUA 4YJ2A 4O4LB 1OCCC 3UQ8A 3QNEA 4HNAB 1QHTA 2F23A 1Q82W 3CC4V 1AJPA 2Q68A 3W7UA 1US6A 1PNLA 1BSMA 3JSNA 3W7WA 1TGOA 5GW7A 1GN4A 4XDJA 4JTDB 1ZUQA 3U10A 4NTWA 4BAYA 3CEIA 1IXBA 1NTMH 1MZEA 4AI8A 1M57C 2QM4A 2QDOA 3ZRSA 1N34O 4DV5O 2RN9A 1BE3H 2AGAA 3WB1A 4J11A 3M7MX 1R6NA 4FLWA 2M7WA 4H33A 5KLVH 2VQEO 4X88A 1Y4MA 2YI8A 4PV1B 1MMMA 3OEEG 2IM9A 1TAEA 2QWQB 4H37A 3G71V 2IJKA 3ABLB 4JI0O 5KX5B 1YITV 3OTOO 2DJVA 2LGWA 2Z5UA 3STLC 2Q7GA 1OCRB 1K92A 1VF7A 3ZHVA 3AG2B 4MSWC 3CCUV 1AI4A 3IFXA 2JGDB 4ZHQB 4FIPC 2XASA 4YIPA 5B1AC 4WFGA 4AQYO 2QGNA 1OCZC 4H44B 4JV5O 1ENVA 1Q86W 4DV7O 1NR7A 2F95B 1I94O 4X66B 3C3SA 4JZ2A 4F6RB 1A32A 4HAMA 2Q67A 1GO3F 3N2GA 1GN3A 5GTIZ 3BA9A 3I55V 2JJ2G 1GM8A 4DUYB 2UXCB 4NKGB 4DXWA 4Q20A 2BTQB 4O2AA 1NBMG 1SQQH 3UKMA 2VQFO 4DR5O 3IGAC 4FLTA 2QWRB 2DE0X 3T1CA 4PDVA 4CZZA 4FLVA 3BRCA 3H1LH 2NN4A 3OGIB 2GHYA 4B3SO 4LF8B 1G1XB 2PYLA 2BTOA 1D5NA 4B3TO 5JH7B 4DV6O 3ZHRA 3ML0A 5CN0A 1GKFA 2Q4PA 2QWNB 4PA3A 2VRZA 3WB0A 1FXKA 1Q81W 4B3RO 5LGTA 4O4JB 3PJSK 2OIEA 1M4UA 1YJWV 3CCRV 2CK3G 1QLEB 3SPGA 4CH3A 1SZXA 3ZHQA 4I4TA 5LOVA 1N36B 1SESA 4LWSA 2C2AA 3N2GB 2ZR2A 3Q4HB 2E5LO 2AHZA 3E83A 1YZBA 2P22C 4JI4O 2ZINA 4MVMA 3OR7C 2ILMA 4TOIA 4O2AB 3DSQA 1WAZA 2B9ZA 3M8AA 1YI2V 1VQOV 1AR5A 1K9MW 1XHZA 3X2QC 4JI6O 1R3JC 1WN7A 1JA8A 1K5SA 4TUYB 2PYJA 4I9WA 1SF9A 5EIBD 1Z5VA 4X1IA 1FFXB 5B3SB 4NTXA 2XHBA 4PDRA 2AHYA 4OX9O 5LHIA 1WB7A 5KMGB 4I9QA 1N32B 5CMUA 3HKCB 3FB6C 4G2KA 2XT9A 4UUJC 3CCMV 3CRMA 2NR5A 4NXMO 1XQ8A 3D36A 1QR8A 1D2DA 1WJZA 4EFBA 3TGUH 4JYCA 3JSLA 2KG7B 4G27B 2WA3A 1GM9A 4LF4B 2XAQA 5J2TA 3K5LA 1YXBA 2EJ7A 3BCCH 1H2GA 2DWEC 2HHHO 4H13B 2CGOA 1AJQA 4FZ1A 3T1HO 4PI0A 3L9DA 4DV4O 2QM7A 2LP7A 4FM0A 2JEUA 2GV9A 3WU2Z 3SPIA 2UXDO 1IVSA 2Z3YA 1XEQA 4BIZA 5JJEB 1Q7YW 3C90A 2ZM6O 5IJ9A 1KKCA 3ABLC 1F7YA 2BE3A 1YEWA 2E74B 2P90A 4JI1O 3K59A 3P30A 4FFBB 2QA4V 1OCRC 5D5PA 4I0XA 1S76D 1MSWD 4UB8Z 3AG2C 2P6JA 2DQ0A 2ZNJA 3FFQA 3KZIZ 3LSQA 4DV1O 1Y66A 1SQBH 4LH6A 3E8BA 1IBKO 2A7WA 5IWAO 2WSSG 1EZVH 1XL4A 4BR6A 3UCSC 2AZ0A 2E3CA 4LF7B 4MTFA 3LNNA 2JRIA 5GONA 3D8CA 3ETGA 1JFFB 3H1HH 4DV2O 4R6ZA 1JX9A 4OPAA 4DR4B 1BHAA 3JD1A 2FKXA 4JI0B 4UCOA 4TV8B 1AI7A 4CS2A 2KB1A 1JMKC 4YXWG 1YDXA 3IAYA 3ZS8C 3SYQA 5LA6A 1V54B 1TUBA 1OV9A 1R6KA 4JV5B 1N4CA 5H6RA 4QNHB 3G6BA 1VIBA 3LSUA 1NVPD 2YC0A 4DV7B 3JASB 1EN6A 1I94B 2BOCC 1K3EA 4UCSA 3CC2V 1NKDA 1QLEC 3JD2A 3LDCA 5EYPB 2YS8A 4X20A 4WFAV 4BIUA 5KAIZ 1S77D 1VMGA 2UUCB 4HBNA 4ZI7B 3THOA 1GN2A 3UO3A 3J80N 2QWPB 4X66O 2AXTZ 2O57A 2WLJA 2HJFC 1AVMA 3DC5A 3ZHSA 1N33O 3DXRA 2KQXA 4JASA 1RSOB 2L35A 4D6TH 2OTLV 2IH3C 3VQVA 3BY6A 3B40A 2P5OA 3VBBA 4DUYO 1EFRG 2CDYA 4NB5A 4B3SB 3VQWA 3S3WA 4B3TB 5IYCO 4YHHB 3KCXA 3ZMSA 1YSCA 4R7CA 4B3RB 2ZXWB 5B3SC 5LXTA 5FLXN 5JVDA 4UCTA 4UV8A 3KG2A 3FB5C 2IJHA 1XMQB 4IHJA 4L87A 4GYCB 3ZN1A 5LYJB 3SJCC 1DK1A 1SERA 1M9NA 2CH7B 4DO2A 2EZPA 1IBMB 4DR6B 4IL6Z 2E5LB 1GH6A 1HDJA 2QE7G 2N74A 4E2LA 1P49A 1PKXA 5LGNA 5KAFZ 2RQ6A 2F93B 1GAXA 4DUZO 3ZCCA 1MNGA 3BFRA 3TXQA 3N2KB 2LFSA 4JI6B 4U3FH 2OIGA 3CX5F 3MDSA 1S72V 1W0KG 3ICXA 5FNVA 4D7TA 4NXNB 5KHIA 2UXBB 3ZRVA 2RMKB 1H8HG 4JI3B 3L74H 4RUEA 2HVJC 4ZOLA 5IYBO 2YXHA 3HKEA 5J2UB 1B6QA 1HWYA 2DWDC 4PA7A 4HYOA 4RAIA 4QE9A 1VQLV 3JARA 2GUZA 4UVAA 1QLNA 2QM8A 4O4LA 3SJBC 2K9PA 3A0HZ 4IGGA 4H0LB 3WFVA 4HNAA 4FLUA 2CTQA 5J9PC 4B3MO 4N21A 2R9IA 3T1HB 1P4RA 1RP3B 2RNBA 3AG4B 2YDEA 3UO2A 4QE7A 5CA1B 1X4TA 1N0NA 5LP6B 1HW7A 1HNZB 4N23A 3TJTA 4X8AA 4LF4O 4ICGA 2UUBO 2IJIA 4P2ZA 3FYIB 1H2NA 5FNVB 2BCCH 2D2CB 4X1KA 2CUGA 1NS1A 1PD3A 5DM6V 1COWG 1Y6XA 3P32A 1KD1W 4B7KA 1V54C 2EULA 4OGQB 3M99B 1BS3A 3B8MA 5LHHA 1BL8A 5KX5A 4JTCB 1DF5A 1QCEA 3JARB 4B7EA 2ETNA 1HNXO 1K8AW 3TETA 4YJ3B 2JGDA 4LNUB 1IX9A 4ZHQA 1R3KC 5LMUO 2W0FC 5EBLC 5A9GA 2QTSA 4R50A 4WCEV 1Y76B 2QTOA 4TV9B 5DN6G 3G80A 5EIBC 4EFEA 2N05A 4DV2B 3EHBB 2VS0A 4KP4A 1CEZA 2Q5ZA 3CHXA 4F6RA 4LF7O 1JQ0A 3FX7A 5BMVB 1VQKV 3BVOA 2YI9A 4KFMA 3H1KH 2WLIB 4X1KB 3AK2A 3G67A 1W2BU 3J7AU 2HG5C 4FMTA 1K4CC 2CTPA 1ROPA 1XBLA 2ARHA 1NQTA 4DW1A 1URFA 2BTQA 2F4VB 1KP2A 3E22B 3I56V 2DQ3A 4J9YB 2ZXWC 1KB9F 3K08A 2ZQMA 4DR4O 1W0JG 3E2EA 1FFTB 2N04A 5IT9N 3BA8A 2RJZA 4AHCA 4DR3B 1BMFG 3HKBB 1VQNV 3W7XA 3K9AA 1TUEB 5JH7A 3K0DA 3APQA 2MW2B 3STZC 2GTSA 5EBMC 1CXZB 3RW0A 4MVSA 4O4JA 3T4DA 2DYSB 4X1YB 3QO5A 3H9VA 5L3EA 4EB6B 1N33B 4ZIBA 4FVMA 3E8HA 3Q4HA 4DYLA 2UUCO 2Q8VA 1Z2GA 1M56B 1F23A 2EBOA 1R6TA 1ZLZA 3RVZA 1KYOF 3BHPA 4I55B 3SJQC 2BSKB 3ZHTA 1JCHA 4JZGA 3FD9A 3OMNB 2ZNIA 1BHBA 2JDIG 1WNSA 4XDLA 3DGEA 3B77A 3SYOA 1S5LZ 1L1FA 2ZIOA 4WFEA 5JCOC 2PY5A 3OTFA 3RT3C 4TUYA 4YHHO 1K73W 4P9PA 1FFXA 3OD4A 5BR8B 2FTKA 4BW5A 5C93A 2HLDG 1B04A 1Q43A 2EIJB 3CRAA 5FL7G 5KMGA 1HNWB 3BEHA 1XMQO 3HKCA 4DUZB 3L75H 3E89A 1PNKA 5L3GA 1I5XA 4GKKB 3G6EV 1TVKA 4Z2WA 1IBMO 4WBNB 3W7SA 2KG7A 1ZAUA 4DR6O 2G38A 1P7BA 3AG4C 1NI8A 5H2FZ 3RGBA 2PGGA 5CB4B 2A79B 2RDCA 2PF4E 4LC1A 1GRJA 3QVNA 2BOBC 3LNMB 2JIZG 1KC8W 2HFEC 3FKSG 1XNQB 2F66C 3QG5A 5HFLA 4EKWA 2ZT9B 5IJ0B 3ETEA 3ASOB 5K1XA 2WLLA 3CC7V 1MABG 4I5SA 2IU3A 3GVMA 3NR7A 2JS3A 2Z0AA 4RO2A 4FFBA 5KA6A 4NXNO 4D7SA 2UXBO 4PDMA 2P06A 1VF6C 4JI3O 4MVRA 2A06H 2KKWA 1PV0A 3LUTB 2Q0AA 3A8TA 1F4NA 1K34A 3C3TA 2EZOA 4B3MB 1E79G 4K8ZA 1HR0O 4GCZA 1YF2A 1PL4A 1TVKB 1JR9A 3CE2A 4J7ZA 2ATKC 1DTOA 1O9GA 5CA0B 5LHGA 3ZIAG 2JVDA 4NYKA 3ETQA 1FKAO 2CTWA 4CC6A 2UUBB 3K03A 2V4DA 3HPLC 3JD0A 3S3XA 1K7DA 4GX1A 1XDCA 3ZRXA 1ZL8A 5L3CA 1I7FA 2E75B 3K06A 1JFFA 1AP6A 4GKJB 2WLLB 2WLMA 1PP9H 2AW9A 1AJNA 2Q0OC 1HNZO 1S5JA 4TV8A 3IC7A 3TK1A 3T4ZA 3R65A 5KHKA 1HNXB 3SGIA 2Q9LA 5B1OA 2FL4A 5LMUB 4O4IB 5BXZA 4ZKIA 3E8FA 4KUMA 3FAVB 2YXYA 3OW2U 4U7NA 4JAAA 4DK1A 3N27A 3JASA 2FB5A 3O65A 1M93A 3EXAA 1XNRO 2DYSC 3APOA 4CS4A 1G8MA 1B06A 3K79A 5EYPA 2XTAA 1KU9A 1N8RW 1G4YB 2WLNA 3B4SA 4JF3A 1J5EB 2IBZH 2R72A 1QVFU 1GM7A 4ZI7A 4JGSA 2EX3A 3H1IH 1ZL8B 3K5MA 2ZE6A 1M56C 1N0JA 4PHZA 5FPRA 5LMNB 1M90W 1IDSA 1MSDA 3QF7A 3CP1A 5IE9A 1T5EA 4DV3B 3ZMZA 1FXVA 1YIJV 1FD9A 1SS3A 4CS3A 1SQVH 1RSOA 3TCUA 4MTXA 3SYPA 2LFRA 1LUVA 3K0GA 2F4VO 4O2BB 2IH1C 1R1BA 4I50B 4W4KA 5LL6Y 3R66A 4K8XA 1H2LA 2H8PC 2R9AA 4QPJA 4WF9V 2XAJA 4JI7B 3OMAB 2ZD9A 3H01A 4HZ3A 5LYJA 2Y69B 2YEVB 3CS5A 4PA9A 4DR3O 2CH7A 2PTMA 3VQXA 1UFIA 5C8YB 1B3QA 2ADPA 4X89A 3W7TA 4YY3B 2ZR3A 5L3BA 2Q7HA 2EILB 3OEHG 4L8JA 2JS5A 2ITCC 1F4MA 1Y74A 5TISZ 3MAQA 3RYHB 1AB3A 2QKAA 4TT3G 2RCVA 1L0LH 3N2KA 3FB7C 1VQ4V 1NR1A 1NT2B 2PI4A 1RPRA 2UUAB 1CP9A 1GN6A 2OCHA 5EBWC 1MOFA 5EZYB 4GX2A 5JWPA 1XUQA 3ABMB 1PL0A 3CMAV 1Q6IA 2V1DA 4LH7A 5LGUA 4TQFA 2WLHA 2H94A 4LCUC 1MZFA 1M57B 1AP5A 5ITZB 3T1YO 5JCOA 3FB8C 5J2UA 1VQ8V 2P67A 3AK1A 2W6JG 5CBGA 2F43G 2IW5A 3L73H 5DEDA 4MTGA 1YVWA 1VQ7V 2NNUA 1E1RG 5BR8O 3ZRWB 3WG7B 2WA4A 1Y74B 1DLBA 1Q3EA 1HNWO 3GWKC 1GMGA 3K5OA 3QO7A 4WFHA 2YIDA 1VQPV 3P3PA 2ITDC 4GKKO 3CCSV 2R70A 4GX0A 3D3QA 5GTHZ 5CA1A 2YICA 3CJHB 4UCRA 5LP6A 1RFYA 3JALB 5CBHA 2HP8A 5FPOA 1OJHA 3EVKA 2Q73A 1H2SB 1XOUA 2OCCB 3ABUA 3P3NA 3DC6A 4DR7O 4GZRB 1FXHA 2X7RB 2YIAA 1XNQO 3F5TA 1FAFA 1AROP 3L71H 4JAUA 1HR0B 1LNQA 3A2FA 2Q7EA 2XAGA 2YIBD 4FZ0A 1VF6A 1CPYA 3A0RA 1ORQC 1Y67A 2Y48A 2OYQA 4YJ3A 4LNUA 3K57A 1I5YA 1ZX3A 4JI5B 3H1JH 1KKDA 4MVOA 1Y76A 2YSUB 4MVQA 4TV9A 4LF5B 4JYYA 2V7QG 3VOUA 3CCQV 2ZE8A 4IIJB 1I0HA 5BMVA 3CWBH 2L6LA 4NVPA 2WLIA 4XDKA 4U3JB 5IY5B 3CXCU 2LW7A 4WFFA 3JCUZ 1SA0A 2QWOB 2R9RB 4UV9A 3JATB 3E22A 1EM1A 3FYEB 4GKJO 1Q8IA 1PNMA 1XMOB 4UVBA 3CCVV 4DW0A 1KUQA 2CTRA 2M6YA 1S5HC 2XAFA 4MS2A 1K97A 1YHQV 1XNRB 4K3AA 4X64B 1UPGA 3CD6V 5JQGB 2Y69C 4JYBA 3MHSC 3HR0A 1OCOB 3HKBA 1ZSPA 2QEXV 3CMEV 2KSDA 1SETA 3ZMVA 1THZA 2B5UA 1WA8B 2D3OW 4BIOA 3PN1A 2EILC 2GDSA 1U97A 3B2EE 4JI8O 3UT5B 4X1YA 2VWJA 2ZE7A 4J42A 2UU9B 4EB6A 3SJAC 3JAKB 5KA5A 2FYUH 2WAMA 1LUWA 3L70H 4F6EA 1R3LC 1VARA 1J5EO 3HKDB 1D5AA 3GWOA 3JYCA 3RYCA 2YIBA 1SA0B 1Z5WA 2MK3A 4J41A 1AR4A 4E4EA 3ABMC 4YIOA 3RFRA 5LMNO 4DRXA 2A9HA 4I55A 3TXSA 1IBLO 2BSKA 2YUAA 4DV3O 3BPZA 4O4HB 1R3IC 1RM1B 4NR1A 2ZIMA 5L3DA 1M5IA 2DYRB 1XI1A 2EIKB 5K1PA 4W4LA 2IU0A 4KXRA 4JTAB 3CYOA 5KUKA 1VQMV 5EC2C 4FJCC 2IJJA 1BGYH 3JAWB 3SYAA 4GLXA 3WG7C 2JGUA 4JI7O 3OFNG 2FMLA 4YJ2B 1VEWA 1SKVA 3AG1B 3DTUB 3OUFA 1JVMA 2XAHA 5F2VO 3OUSA 1R73A 2HEPA 3KCYA 5KHGA 4WBNA 4YY3O 3K3WA 1YCIA 3RYCB 5CB4A 1QR9A 4DRXB 4FM1A 4KL1A 1YTFD 2X0LA 2OCCC 3F5WC 2EIMB 4RUFA 1WB8A 3BAAA 1DGSA 4IT5A 1AILA 3T1YB 4JYAB 3K9SA 5L3FA 5IJ0A 2UUAO 4LFAO 2P4VA 5BZBA 3U11A 1L0NH 1K5QA 2ZCEA 3OGCC 4BW9A 3B09A 3K04A 2Q69A 1NH2B 3LDDA 4K0KB 3JAMN 1KQSU 3RWRD 4XBFA 5LBQA 2B1GA 2OWOA 3SPCA 5EC1C 4DV0O 4AILC 4KHPB 4MW3A 3CCJV 2WLKA 1MG1A 3RVYA 2ZDIC 4J80A 1YJ9V 5IYDO 5IYZA 1WLEA 1SRYA 5CA0A 3SDLA 4Q6GA 4CH4A 5LP6C 4J7JA 2DOSA 2XOKG 1VQ6V 2HKOA 4DR7B 4DR2B 4Z1MG 5IY5C 4LP8A 3IC9A 3CSXA 3OR6C 2HVKC 4FM2A 3ZEDA 4QIWF
chains in the Genus database with same CATH topology
1WA8B 3GVMA 3ZBHA 3GWKC 2B9ZA 3FAVB 3G80A 3OGIB 3Q4HA 2VS0A 4GZRB 2AZ0A 4LWSA 3TXQA 3TXSA 4I0XA 3Q4HB 2KG7A 4ABMA 1WA8A 3O9OA 2VRZA 3HR0A 4LWSB 4I0XB 2DE0X 3FAVA 3FD9A 2AZ2A 2KG7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 B;  3GVM A;  3ZBH A;  3GWK C;  2B9Z A;  3FAV B;  3G80 A;  3OGI B;  3Q4H A;  2VS0 A;  4GZR B;  2AZ0 A;  4LWS A;  3TXQ A;  3TXS A;  4I0X A;  3Q4H B;  2KG7 A;  4ABM A;  1WA8 A;  3O9O A;  2VRZ A;  3HR0 A;  4LWS B;  4I0X B;  2DE0 X;  3FAV A;  3FD9 A;  2AZ2 A;  2KG7 B; 
#chains in the Genus database with same CATH topology
 1JPX A;  2Y0I A;  4P9O A;  2DMX A;  5CBF A;  1FYJ A;  5H6Q A;  3SPH A;  1QQC A;  1FJG O;  2QKC A;  1OCO C;  3RBZ A;  1F51 A;  3CRC A;  4O4I A;  3T2M A;  3ABT A;  1V55 B;  1EBO A;  4PEL A;  2YXL A;  4GX5 A;  3AG3 B;  1H2M A;  2K1E A;  2PZS A;  3OMI B;  1G6U A;  1KEC A;  3FAV A;  5IYZ B;  3CXH F;  2OT5 A;  1FXK B;  1LR1 A;  1NZ6 A;  4RQF A;  2QR4 A;  4LF9 B;  3ABK B;  2ADQ B;  3B8N A;  4I4T B;  1WPB A;  1K33 A;  3HB3 B;  5LOV B;  4JI5 O;  4LWS B;  5B5E Z;  3OT7 A;  1Q6H A;  1IZ3 A;  4DR1 O;  4LF5 O;  1IUR A;  4DK0 A;  2OTJ V;  1QNM A;  1SQF A;  3JCZ A;  2Y4T A;  1BQ0 A;  5H5N A;  3G4S V;  5BY1 A;  4LFC B;  2QKS A;  3KKY A;  1J95 A;  4PDL A;  1RM1 C;  4JI2 O;  3RYI A;  4RWU A;  1QU7 A;  2DN9 A;  4MVZ A;  4PI2 A;  4G28 B;  1BCC H;  2DYR C;  1ZWI C;  2EIK C;  5AG2 A;  4O2B A;  4PA4 A;  1Q90 D;  4I50 A;  3ZN0 A;  4LF6 O;  1X59 A;  1XMO O;  4I7Z B;  4NTY A;  4X1I B;  3ASN B;  4PJ0 Z;  5CA3 A;  4JI8 B;  1YTF B;  3QTC A;  4LFB O;  5B1B B;  1AR1 B;  2YEV A;  4X64 O;  3U0Z A;  3AG1 C;  1FS0 G;  2ZKO A;  4QGP A;  5C8Y A;  1H8E G;  3D3I A;  5B1N A;  1BT8 A;  1VF5 B;  2ODM A;  3WB2 A;  2W6I G;  1VP7 A;  1XRE A;  5JJN B;  4X62 O;  1EZJ A;  4FFK A;  1E1Q G;  1PPJ H;  3RYH A;  1IBL B;  4X65 O;  1BQZ A;  4GUN A;  4J9Z B;  4CBC A;  1M1K W;  4K35 A;  1PM9 A;  2EIM C;  2WWW A;  5J2T B;  2UU9 O;  3K5N A;  1N34 B;  4DV5 B;  4MW8 A;  4MVU A;  3RYI B;  1QVG U;  2Q6A A;  1XHX A;  5EZY A;  4EEQ A;  3CB2 A;  3SYC A;  2ZE5 A;  1VQ5 V;  3EFF K;  4OPH A;  2VQE B;  5KHJ A;  2UXN A;  4IYH A;  1NTZ H;  1W59 A;  4CH5 A;  5IJ9 B;  4LBE C;  4MTO A;  3OTO B;  1SQG A;  2EIJ C;  2EIN B;  1P84 F;  1V9P A;  5ITZ A;  4I0X B;  2WPD G;  2CGN A;  2X6B A;  3RYF A;  1L8D A;  4AQY B;  1JJ2 U;  3SR2 C;  2XND G;  1U96 A;  5HFM A;  3ZRW A;  1SC5 B;  1GK9 A;  3SPJ A;  5B66 Z;  3VQY A;  1YJN V;  3AK3 A;  2JEX A;  3OM3 B;  1OCC B;  2HR3 A;  2DW4 A;  3ETD A;  1O9H A;  3ZBH A;  4UCV A;  5GON B;  5KHH A;  5EK0 A;  2CAZ C;  1XL6 A;  1QBZ A;  4LFA B;  1S0V A;  4PD4 F;  4OXS A;  4C7U A;  4FLX A;  3CJH A;  2GBO A;  3ASO C;  2W0X A;  2VQF B;  4DR5 B;  3MHH C;  3ZJZ A;  2HJD A;  3JAL A;  4U7O A;  2QJ1 A;  3MD0 A;  4RQE A;  5E1A C;  3NXS A;  4J7K A;  3ZHU A;  4IYI A;  1TA8 A;  2NLJ C;  4JYA O;  4DV0 B;  2A3Q A;  2B1I A;  2UXC O;  1V55 C;  2EJR A;  1IXM A;  4TSF G;  5LA6 B;  3RYF B;  1NTK H;  3AG3 C;  3LSS A;  1TUB B;  1NU1 H;  3ZMU A;  4DV6 B;  1UJW B;  1SQX H;  5IDJ A;  1EN4 A;  4Z1V A;  1RPO A;  1FXK C;  2AZ2 A;  4J10 A;  3F7Y C;  4K0K O;  4PA6 A;  3CCL V;  5D5Q A;  3ABK C;  2JK5 C;  1OHH G;  1OZ0 A;  4X20 B;  4KHP O;  5B1A B;  2ZDI A;  4LF8 O;  1OCZ B;  2GTA A;  3F7V C;  1K4D C;  2JJ1 G;  4JI4 B;  4A5U B;  3GB7 C;  4IIJ A;  4ASU G;  3LDE A;  3QO8 A;  3AEI A;  1I08 A;  4BWA A;  3JD4 A;  4CC5 A;  3CPW U;  2LQT A;  4QPK A;  1S3J A;  1SQP H;  1WP7 A;  4FLY A;  4F4L A;  2X6C A;  1N36 O;  4DR2 O;  1EN5 A;  4UXN A;  4GT1 A;  1FJG B;  3DXR B;  4U3J A;  4TQD A;  1MA1 A;  2PUS A;  3JAT A;  4LR3 A;  4FK5 C;  1VQ9 V;  2CE4 A;  3ASN C;  5H9C A;  4B08 A;  2P7T C;  5LXT B;  1JOY A;  5JVD B;  1Q5O A;  4OX9 B;  1KP3 A;  1FPO A;  5DEC A;  1SZT A;  3A0B Z;  2E76 B;  5JQG A;  4JAV A;  5B1B C;  5E79 Z;  4IHJ B;  4UB6 Z;  4NXM B;  2PI5 A;  2LW1 A;  3K58 A;  1AI5 A;  1WA8 A;  3D36 C;  3CCE V;  4DR1 B;  3I5D A;  3RN4 A;  4X9Q A;  4P30 A;  4TWK A;  3UM7 A;  4FPP A;  3UT5 A;  2H3O A;  3E35 A;  2Y4U A;  3E86 A;  1NH2 D;  1H2K A;  3L72 H;  4LF9 O;  1N32 O;  2XUM A;  1KMI Z;  4QJF B;  4ZBM A;  5KUM A;  1JJO A;  1WP8 A;  3JAK A;  5A2Q N;  2HHH B;  2P4K A;  4JI2 B;  2F1M A;  4ABM A;  4WFB V;  3O9O A;  3HKD A;  3BAB A;  4DV4 B;  1KBH A;  2LO1 A;  1Q6U A;  1XIL A;  4FLZ A;  2UXD B;  1NVP B;  4UVC A;  2ZM6 B;  4LF6 B;  1BZK A;  3E8G A;  2GSM B;  2Y0P A;  3IJ4 A;  3OAA G;  4R8C A;  4UFZ A;  4O4H A;  4LFC O;  1HP8 A;  4JI1 B;  3CRQ A;  1WPX A;  2QSA A;  4LFB B;  2EIN C;  1P7G A;  1GTO A;  3ZX6 A;  3CRR A;  4CH6 A;  2X6A A;  1ZTE A;  3ZMT A;  3X2Q B;  3AG7 A;  1H38 A;  4ZOL B;  2LGQ A;  2LJ2 A;  2A0L A;  4DV1 B;  1NJI W;  3HKE B;  1IBK B;  4JPR A;  3JD3 A;  4MT8 A;  5IWA B;  5JJJ B;  2UXX A;  3JAW A;  4X62 B;  2VWK A;  2GUZ B;  1AI6 A;  3J81 N;  1DF4 A;  3OE7 G;  4X65 B;  4UCU A;  4YJ2 A;  4O4L B;  1OCC C;  3UQ8 A;  3QNE A;  4HNA B;  1QHT A;  2F23 A;  1Q82 W;  3CC4 V;  1AJP A;  2Q68 A;  3W7U A;  1US6 A;  1PNL A;  1BSM A;  3JSN A;  3W7W A;  1TGO A;  5GW7 A;  1GN4 A;  4XDJ A;  4JTD B;  1ZUQ A;  3U10 A;  4NTW A;  4BAY A;  3CEI A;  1IXB A;  1NTM H;  1MZE A;  4AI8 A;  1M57 C;  2QM4 A;  2QDO A;  3ZRS A;  1N34 O;  4DV5 O;  2RN9 A;  1BE3 H;  2AGA A;  3WB1 A;  4J11 A;  3M7M X;  1R6N A;  4FLW A;  2M7W A;  4H33 A;  5KLV H;  2VQE O;  4X88 A;  1Y4M A;  2YI8 A;  4PV1 B;  1MMM A;  3OEE G;  2IM9 A;  1TAE A;  2QWQ B;  4H37 A;  3G71 V;  2IJK A;  3ABL B;  4JI0 O;  5KX5 B;  1YIT V;  3OTO O;  2DJV A;  2LGW A;  2Z5U A;  3STL C;  2Q7G A;  1OCR B;  1K92 A;  1VF7 A;  3ZHV A;  3AG2 B;  4MSW C;  3CCU V;  1AI4 A;  3IFX A;  2JGD B;  4ZHQ B;  4FIP C;  2XAS A;  4YIP A;  5B1A C;  4WFG A;  4AQY O;  2QGN A;  1OCZ C;  4H44 B;  4JV5 O;  1ENV A;  1Q86 W;  4DV7 O;  1NR7 A;  2F95 B;  1I94 O;  4X66 B;  3C3S A;  4JZ2 A;  4F6R B;  1A32 A;  4HAM A;  2Q67 A;  1GO3 F;  3N2G A;  1GN3 A;  5GTI Z;  3BA9 A;  3I55 V;  2JJ2 G;  1GM8 A;  4DUY B;  2UXC B;  4NKG B;  4DXW A;  4Q20 A;  2BTQ B;  4O2A A;  1NBM G;  1SQQ H;  3UKM A;  2VQF O;  4DR5 O;  3IGA C;  4FLT A;  2QWR B;  2DE0 X;  3T1C A;  4PDV A;  4CZZ A;  4FLV A;  3BRC A;  3H1L H;  2NN4 A;  3OGI B;  2GHY A;  4B3S O;  4LF8 B;  1G1X B;  2PYL A;  2BTO A;  1D5N A;  4B3T O;  5JH7 B;  4DV6 O;  3ZHR A;  3ML0 A;  5CN0 A;  1GKF A;  2Q4P A;  2QWN B;  4PA3 A;  2VRZ A;  3WB0 A;  1FXK A;  1Q81 W;  4B3R O;  5LGT A;  4O4J B;  3PJS K;  2OIE A;  1M4U A;  1YJW V;  3CCR V;  2CK3 G;  1QLE B;  3SPG A;  4CH3 A;  1SZX A;  3ZHQ A;  4I4T A;  5LOV A;  1N36 B;  1SES A;  4LWS A;  2C2A A;  3N2G B;  2ZR2 A;  3Q4H B;  2E5L O;  2AHZ A;  3E83 A;  1YZB A;  2P22 C;  4JI4 O;  2ZIN A;  4MVM A;  3OR7 C;  2ILM A;  4TOI A;  4O2A B;  3DSQ A;  1WAZ A;  2B9Z A;  3M8A A;  1YI2 V;  1VQO V;  1AR5 A;  1K9M W;  1XHZ A;  3X2Q C;  4JI6 O;  1R3J C;  1WN7 A;  1JA8 A;  1K5S A;  4TUY B;  2PYJ A;  4I9W A;  1SF9 A;  5EIB D;  1Z5V A;  4X1I A;  1FFX B;  5B3S B;  4NTX A;  2XHB A;  4PDR A;  2AHY A;  4OX9 O;  5LHI A;  1WB7 A;  5KMG B;  4I9Q A;  1N32 B;  5CMU A;  3HKC B;  3FB6 C;  4G2K A;  2XT9 A;  4UUJ C;  3CCM V;  3CRM A;  2NR5 A;  4NXM O;  1XQ8 A;  3D36 A;  1QR8 A;  1D2D A;  1WJZ A;  4EFB A;  3TGU H;  4JYC A;  3JSL A;  2KG7 B;  4G27 B;  2WA3 A;  1GM9 A;  4LF4 B;  2XAQ A;  5J2T A;  3K5L A;  1YXB A;  2EJ7 A;  3BCC H;  1H2G A;  2DWE C;  2HHH O;  4H13 B;  2CGO A;  1AJQ A;  4FZ1 A;  3T1H O;  4PI0 A;  3L9D A;  4DV4 O;  2QM7 A;  2LP7 A;  4FM0 A;  2JEU A;  2GV9 A;  3WU2 Z;  3SPI A;  2UXD O;  1IVS A;  2Z3Y A;  1XEQ A;  4BIZ A;  5JJE B;  1Q7Y W;  3C90 A;  2ZM6 O;  5IJ9 A;  1KKC A;  3ABL C;  1F7Y A;  2BE3 A;  1YEW A;  2E74 B;  2P90 A;  4JI1 O;  3K59 A;  3P30 A;  4FFB B;  2QA4 V;  1OCR C;  5D5P A;  4I0X A;  1S76 D;  1MSW D;  4UB8 Z;  3AG2 C;  2P6J A;  2DQ0 A;  2ZNJ A;  3FFQ A;  3KZI Z;  3LSQ A;  4DV1 O;  1Y66 A;  1SQB H;  4LH6 A;  3E8B A;  1IBK O;  2A7W A;  5IWA O;  2WSS G;  1EZV H;  1XL4 A;  4BR6 A;  3UCS C;  2AZ0 A;  2E3C A;  4LF7 B;  4MTF A;  3LNN A;  2JRI A;  5GON A;  3D8C A;  3ETG A;  1JFF B;  3H1H H;  4DV2 O;  4R6Z A;  1JX9 A;  4OPA A;  4DR4 B;  1BHA A;  3JD1 A;  2FKX A;  4JI0 B;  4UCO A;  4TV8 B;  1AI7 A;  4CS2 A;  2KB1 A;  1JMK C;  4YXW G;  1YDX A;  3IAY A;  3ZS8 C;  3SYQ A;  5LA6 A;  1V54 B;  1TUB A;  1OV9 A;  1R6K A;  4JV5 B;  1N4C A;  5H6R A;  4QNH B;  3G6B A;  1VIB A;  3LSU A;  1NVP D;  2YC0 A;  4DV7 B;  3JAS B;  1EN6 A;  1I94 B;  2BOC C;  1K3E A;  4UCS A;  3CC2 V;  1NKD A;  1QLE C;  3JD2 A;  3LDC A;  5EYP B;  2YS8 A;  4X20 A;  4WFA V;  4BIU A;  5KAI Z;  1S77 D;  1VMG A;  2UUC B;  4HBN A;  4ZI7 B;  3THO A;  1GN2 A;  3UO3 A;  3J80 N;  2QWP B;  4X66 O;  2AXT Z;  2O57 A;  2WLJ A;  2HJF C;  1AVM A;  3DC5 A;  3ZHS A;  1N33 O;  3DXR A;  2KQX A;  4JAS A;  1RSO B;  2L35 A;  4D6T H;  2OTL V;  2IH3 C;  3VQV A;  3BY6 A;  3B40 A;  2P5O A;  3VBB A;  4DUY O;  1EFR G;  2CDY A;  4NB5 A;  4B3S B;  3VQW A;  3S3W A;  4B3T B;  5IYC O;  4YHH B;  3KCX A;  3ZMS A;  1YSC A;  4R7C A;  4B3R B;  2ZXW B;  5B3S C;  5LXT A;  5FLX N;  5JVD A;  4UCT A;  4UV8 A;  3KG2 A;  3FB5 C;  2IJH A;  1XMQ B;  4IHJ A;  4L87 A;  4GYC B;  3ZN1 A;  5LYJ B;  3SJC C;  1DK1 A;  1SER A;  1M9N A;  2CH7 B;  4DO2 A;  2EZP A;  1IBM B;  4DR6 B;  4IL6 Z;  2E5L B;  1GH6 A;  1HDJ A;  2QE7 G;  2N74 A;  4E2L A;  1P49 A;  1PKX A;  5LGN A;  5KAF Z;  2RQ6 A;  2F93 B;  1GAX A;  4DUZ O;  3ZCC A;  1MNG A;  3BFR A;  3TXQ A;  3N2K B;  2LFS A;  4JI6 B;  4U3F H;  2OIG A;  3CX5 F;  3MDS A;  1S72 V;  1W0K G;  3ICX A;  5FNV A;  4D7T A;  4NXN B;  5KHI A;  2UXB B;  3ZRV A;  2RMK B;  1H8H G;  4JI3 B;  3L74 H;  4RUE A;  2HVJ C;  4ZOL A;  5IYB O;  2YXH A;  3HKE A;  5J2U B;  1B6Q A;  1HWY A;  2DWD C;  4PA7 A;  4HYO A;  4RAI A;  4QE9 A;  1VQL V;  3JAR A;  2GUZ A;  4UVA A;  1QLN A;  2QM8 A;  4O4L A;  3SJB C;  2K9P A;  3A0H Z;  4IGG A;  4H0L B;  3WFV A;  4HNA A;  4FLU A;  2CTQ A;  5J9P C;  4B3M O;  4N21 A;  2R9I A;  3T1H B;  1P4R A;  1RP3 B;  2RNB A;  3AG4 B;  2YDE A;  3UO2 A;  4QE7 A;  5CA1 B;  1X4T A;  1N0N A;  5LP6 B;  1HW7 A;  1HNZ B;  4N23 A;  3TJT A;  4X8A A;  4LF4 O;  4ICG A;  2UUB O;  2IJI A;  4P2Z A;  3FYI B;  1H2N A;  5FNV B;  2BCC H;  2D2C B;  4X1K A;  2CUG A;  1NS1 A;  1PD3 A;  5DM6 V;  1COW G;  1Y6X A;  3P32 A;  1KD1 W;  4B7K A;  1V54 C;  2EUL A;  4OGQ B;  3M99 B;  1BS3 A;  3B8M A;  5LHH A;  1BL8 A;  5KX5 A;  4JTC B;  1DF5 A;  1QCE A;  3JAR B;  4B7E A;  2ETN A;  1HNX O;  1K8A W;  3TET A;  4YJ3 B;  2JGD A;  4LNU B;  1IX9 A;  4ZHQ A;  1R3K C;  5LMU O;  2W0F C;  5EBL C;  5A9G A;  2QTS A;  4R50 A;  4WCE V;  1Y76 B;  2QTO A;  4TV9 B;  5DN6 G;  3G80 A;  5EIB C;  4EFE A;  2N05 A;  4DV2 B;  3EHB B;  2VS0 A;  4KP4 A;  1CEZ A;  2Q5Z A;  3CHX A;  4F6R A;  4LF7 O;  1JQ0 A;  3FX7 A;  5BMV B;  1VQK V;  3BVO A;  2YI9 A;  4KFM A;  3H1K H;  2WLI B;  4X1K B;  3AK2 A;  3G67 A;  1W2B U;  3J7A U;  2HG5 C;  4FMT A;  1K4C C;  2CTP A;  1ROP A;  1XBL A;  2ARH A;  1NQT A;  4DW1 A;  1URF A;  2BTQ A;  2F4V B;  1KP2 A;  3E22 B;  3I56 V;  2DQ3 A;  4J9Y B;  2ZXW C;  1KB9 F;  3K08 A;  2ZQM A;  4DR4 O;  1W0J G;  3E2E A;  1FFT B;  2N04 A;  5IT9 N;  3BA8 A;  2RJZ A;  4AHC A;  4DR3 B;  1BMF G;  3HKB B;  1VQN V;  3W7X A;  3K9A A;  1TUE B;  5JH7 A;  3K0D A;  3APQ A;  2MW2 B;  3STZ C;  2GTS A;  5EBM C;  1CXZ B;  3RW0 A;  4MVS A;  4O4J A;  3T4D A;  2DYS B;  4X1Y B;  3QO5 A;  3H9V A;  5L3E A;  4EB6 B;  1N33 B;  4ZIB A;  4FVM A;  3E8H A;  3Q4H A;  4DYL A;  2UUC O;  2Q8V A;  1Z2G A;  1M56 B;  1F23 A;  2EBO A;  1R6T A;  1ZLZ A;  3RVZ A;  1KYO F;  3BHP A;  4I55 B;  3SJQ C;  2BSK B;  3ZHT A;  1JCH A;  4JZG A;  3FD9 A;  3OMN B;  2ZNI A;  1BHB A;  2JDI G;  1WNS A;  4XDL A;  3DGE A;  3B77 A;  3SYO A;  1S5L Z;  1L1F A;  2ZIO A;  4WFE A;  5JCO C;  2PY5 A;  3OTF A;  3RT3 C;  4TUY A;  4YHH O;  1K73 W;  4P9P A;  1FFX A;  3OD4 A;  5BR8 B;  2FTK A;  4BW5 A;  5C93 A;  2HLD G;  1B04 A;  1Q43 A;  2EIJ B;  3CRA A;  5FL7 G;  5KMG A;  1HNW B;  3BEH A;  1XMQ O;  3HKC A;  4DUZ B;  3L75 H;  3E89 A;  1PNK A;  5L3G A;  1I5X A;  4GKK B;  3G6E V;  1TVK A;  4Z2W A;  1IBM O;  4WBN B;  3W7S A;  2KG7 A;  1ZAU A;  4DR6 O;  2G38 A;  1P7B A;  3AG4 C;  1NI8 A;  5H2F Z;  3RGB A;  2PGG A;  5CB4 B;  2A79 B;  2RDC A;  2PF4 E;  4LC1 A;  1GRJ A;  3QVN A;  2BOB C;  3LNM B;  2JIZ G;  1KC8 W;  2HFE C;  3FKS G;  1XNQ B;  2F66 C;  3QG5 A;  5HFL A;  4EKW A;  2ZT9 B;  5IJ0 B;  3ETE A;  3ASO B;  5K1X A;  2WLL A;  3CC7 V;  1MAB G;  4I5S A;  2IU3 A;  3GVM A;  3NR7 A;  2JS3 A;  2Z0A A;  4RO2 A;  4FFB A;  5KA6 A;  4NXN O;  4D7S A;  2UXB O;  4PDM A;  2P06 A;  1VF6 C;  4JI3 O;  4MVR A;  2A06 H;  2KKW A;  1PV0 A;  3LUT B;  2Q0A A;  3A8T A;  1F4N A;  1K34 A;  3C3T A;  2EZO A;  4B3M B;  1E79 G;  4K8Z A;  1HR0 O;  4GCZ A;  1YF2 A;  1PL4 A;  1TVK B;  1JR9 A;  3CE2 A;  4J7Z A;  2ATK C;  1DTO A;  1O9G A;  5CA0 B;  5LHG A;  3ZIA G;  2JVD A;  4NYK A;  3ETQ A;  1FKA O;  2CTW A;  4CC6 A;  2UUB B;  3K03 A;  2V4D A;  3HPL C;  3JD0 A;  3S3X A;  1K7D A;  4GX1 A;  1XDC A;  3ZRX A;  1ZL8 A;  5L3C A;  1I7F A;  2E75 B;  3K06 A;  1JFF A;  1AP6 A;  4GKJ B;  2WLL B;  2WLM A;  1PP9 H;  2AW9 A;  1AJN A;  2Q0O C;  1HNZ O;  1S5J A;  4TV8 A;  3IC7 A;  3TK1 A;  3T4Z A;  3R65 A;  5KHK A;  1HNX B;  3SGI A;  2Q9L A;  5B1O A;  2FL4 A;  5LMU B;  4O4I B;  5BXZ A;  4ZKI A;  3E8F A;  4KUM A;  3FAV B;  2YXY A;  3OW2 U;  4U7N A;  4JAA A;  4DK1 A;  3N27 A;  3JAS A;  2FB5 A;  3O65 A;  1M93 A;  3EXA A;  1XNR O;  2DYS C;  3APO A;  4CS4 A;  1G8M A;  1B06 A;  3K79 A;  5EYP A;  2XTA A;  1KU9 A;  1N8R W;  1G4Y B;  2WLN A;  3B4S A;  4JF3 A;  1J5E B;  2IBZ H;  2R72 A;  1QVF U;  1GM7 A;  4ZI7 A;  4JGS A;  2EX3 A;  3H1I H;  1ZL8 B;  3K5M A;  2ZE6 A;  1M56 C;  1N0J A;  4PHZ A;  5FPR A;  5LMN B;  1M90 W;  1IDS A;  1MSD A;  3QF7 A;  3CP1 A;  5IE9 A;  1T5E A;  4DV3 B;  3ZMZ A;  1FXV A;  1YIJ V;  1FD9 A;  1SS3 A;  4CS3 A;  1SQV H;  1RSO A;  3TCU A;  4MTX A;  3SYP A;  2LFR A;  1LUV A;  3K0G A;  2F4V O;  4O2B B;  2IH1 C;  1R1B A;  4I50 B;  4W4K A;  5LL6 Y;  3R66 A;  4K8X A;  1H2L A;  2H8P C;  2R9A A;  4QPJ A;  4WF9 V;  2XAJ A;  4JI7 B;  3OMA B;  2ZD9 A;  3H01 A;  4HZ3 A;  5LYJ A;  2Y69 B;  2YEV B;  3CS5 A;  4PA9 A;  4DR3 O;  2CH7 A;  2PTM A;  3VQX A;  1UFI A;  5C8Y B;  1B3Q A;  2ADP A;  4X89 A;  3W7T A;  4YY3 B;  2ZR3 A;  5L3B A;  2Q7H A;  2EIL B;  3OEH G;  4L8J A;  2JS5 A;  2ITC C;  1F4M A;  1Y74 A;  5TIS Z;  3MAQ A;  3RYH B;  1AB3 A;  2QKA A;  4TT3 G;  2RCV A;  1L0L H;  3N2K A;  3FB7 C;  1VQ4 V;  1NR1 A;  1NT2 B;  2PI4 A;  1RPR A;  2UUA B;  1CP9 A;  1GN6 A;  2OCH A;  5EBW C;  1MOF A;  5EZY B;  4GX2 A;  5JWP A;  1XUQ A;  3ABM B;  1PL0 A;  3CMA V;  1Q6I A;  2V1D A;  4LH7 A;  5LGU A;  4TQF A;  2WLH A;  2H94 A;  4LCU C;  1MZF A;  1M57 B;  1AP5 A;  5ITZ B;  3T1Y O;  5JCO A;  3FB8 C;  5J2U A;  1VQ8 V;  2P67 A;  3AK1 A;  2W6J G;  5CBG A;  2F43 G;  2IW5 A;  3L73 H;  5DED A;  4MTG A;  1YVW A;  1VQ7 V;  2NNU A;  1E1R G;  5BR8 O;  3ZRW B;  3WG7 B;  2WA4 A;  1Y74 B;  1DLB A;  1Q3E A;  1HNW O;  3GWK C;  1GMG A;  3K5O A;  3QO7 A;  4WFH A;  2YID A;  1VQP V;  3P3P A;  2ITD C;  4GKK O;  3CCS V;  2R70 A;  4GX0 A;  3D3Q A;  5GTH Z;  5CA1 A;  2YIC A;  3CJH B;  4UCR A;  5LP6 A;  1RFY A;  3JAL B;  5CBH A;  2HP8 A;  5FPO A;  1OJH A;  3EVK A;  2Q73 A;  1H2S B;  1XOU A;  2OCC B;  3ABU A;  3P3N A;  3DC6 A;  4DR7 O;  4GZR B;  1FXH A;  2X7R B;  2YIA A;  1XNQ O;  3F5T A;  1FAF A;  1ARO P;  3L71 H;  4JAU A;  1HR0 B;  1LNQ A;  3A2F A;  2Q7E A;  2XAG A;  2YIB D;  4FZ0 A;  1VF6 A;  1CPY A;  3A0R A;  1ORQ C;  1Y67 A;  2Y48 A;  2OYQ A;  4YJ3 A;  4LNU A;  3K57 A;  1I5Y A;  1ZX3 A;  4JI5 B;  3H1J H;  1KKD A;  4MVO A;  1Y76 A;  2YSU B;  4MVQ A;  4TV9 A;  4LF5 B;  4JYY A;  2V7Q G;  3VOU A;  3CCQ V;  2ZE8 A;  4IIJ B;  1I0H A;  5BMV A;  3CWB H;  2L6L A;  4NVP A;  2WLI A;  4XDK A;  4U3J B;  5IY5 B;  3CXC U;  2LW7 A;  4WFF A;  3JCU Z;  1SA0 A;  2QWO B;  2R9R B;  4UV9 A;  3JAT B;  3E22 A;  1EM1 A;  3FYE B;  4GKJ O;  1Q8I A;  1PNM A;  1XMO B;  4UVB A;  3CCV V;  4DW0 A;  1KUQ A;  2CTR A;  2M6Y A;  1S5H C;  2XAF A;  4MS2 A;  1K97 A;  1YHQ V;  1XNR B;  4K3A A;  4X64 B;  1UPG A;  3CD6 V;  5JQG B;  2Y69 C;  4JYB A;  3MHS C;  3HR0 A;  1OCO B;  3HKB A;  1ZSP A;  2QEX V;  3CME V;  2KSD A;  1SET A;  3ZMV A;  1THZ A;  2B5U A;  1WA8 B;  2D3O W;  4BIO A;  3PN1 A;  2EIL C;  2GDS A;  1U97 A;  3B2E E;  4JI8 O;  3UT5 B;  4X1Y A;  2VWJ A;  2ZE7 A;  4J42 A;  2UU9 B;  4EB6 A;  3SJA C;  3JAK B;  5KA5 A;  2FYU H;  2WAM A;  1LUW A;  3L70 H;  4F6E A;  1R3L C;  1VAR A;  1J5E O;  3HKD B;  1D5A A;  3GWO A;  3JYC A;  3RYC A;  2YIB A;  1SA0 B;  1Z5W A;  2MK3 A;  4J41 A;  1AR4 A;  4E4E A;  3ABM C;  4YIO A;  3RFR A;  5LMN O;  4DRX A;  2A9H A;  4I55 A;  3TXS A;  1IBL O;  2BSK A;  2YUA A;  4DV3 O;  3BPZ A;  4O4H B;  1R3I C;  1RM1 B;  4NR1 A;  2ZIM A;  5L3D A;  1M5I A;  2DYR B;  1XI1 A;  2EIK B;  5K1P A;  4W4L A;  2IU0 A;  4KXR A;  4JTA B;  3CYO A;  5KUK A;  1VQM V;  5EC2 C;  4FJC C;  2IJJ A;  1BGY H;  3JAW B;  3SYA A;  4GLX A;  3WG7 C;  2JGU A;  4JI7 O;  3OFN G;  2FML A;  4YJ2 B;  1VEW A;  1SKV A;  3AG1 B;  3DTU B;  3OUF A;  1JVM A;  2XAH A;  5F2V O;  3OUS A;  1R73 A;  2HEP A;  3KCY A;  5KHG A;  4WBN A;  4YY3 O;  3K3W A;  1YCI A;  3RYC B;  5CB4 A;  1QR9 A;  4DRX B;  4FM1 A;  4KL1 A;  1YTF D;  2X0L A;  2OCC C;  3F5W C;  2EIM B;  4RUF A;  1WB8 A;  3BAA A;  1DGS A;  4IT5 A;  1AIL A;  3T1Y B;  4JYA B;  3K9S A;  5L3F A;  5IJ0 A;  2UUA O;  4LFA O;  2P4V A;  5BZB A;  3U11 A;  1L0N H;  1K5Q A;  2ZCE A;  3OGC C;  4BW9 A;  3B09 A;  3K04 A;  2Q69 A;  1NH2 B;  3LDD A;  4K0K B;  3JAM N;  1KQS U;  3RWR D;  4XBF A;  5LBQ A;  2B1G A;  2OWO A;  3SPC A;  5EC1 C;  4DV0 O;  4AIL C;  4KHP B;  4MW3 A;  3CCJ V;  2WLK A;  1MG1 A;  3RVY A;  2ZDI C;  4J80 A;  1YJ9 V;  5IYD O;  5IYZ A;  1WLE A;  1SRY A;  5CA0 A;  3SDL A;  4Q6G A;  4CH4 A;  5LP6 C;  4J7J A;  2DOS A;  2XOK G;  1VQ6 V;  2HKO A;  4DR7 B;  4DR2 B;  4Z1M G;  5IY5 C;  4LP8 A;  3IC9 A;  3CSX A;  3OR6 C;  2HVK C;  4FM2 A;  3ZED A;  4QIW F; 
#chains in the Genus database with same CATH homology
 1WA8 B;  3GVM A;  3ZBH A;  3GWK C;  2B9Z A;  3FAV B;  3G80 A;  3OGI B;  3Q4H A;  2VS0 A;  4GZR B;  2AZ0 A;  4LWS A;  3TXQ A;  3TXS A;  4I0X A;  3Q4H B;  2KG7 A;  4ABM A;  1WA8 A;  3O9O A;  2VRZ A;  3HR0 A;  4LWS B;  4I0X B;  2DE0 X;  3FAV A;  3FD9 A;  2AZ2 A;  2KG7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...