4GZRB

Crystal structure of the mycobacterium tuberculosis h37rv esxop (rv2346c-rv2347c) complex in space group c2221
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
77
Chain Sequence
b'RFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESAT-6-like protein 6
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 33
structure length 77
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4gzrB00
4I0XA 2KG7B 2DE0X 3FAVB 4GZRB 3GWKC 3HR0A 3Q4HA 1WA8A 4LWSB 3G80A 3TXSA 2KG7A 4ABMA 2VS0A 4I0XB 3TXQA 3FAVA 3OGIB 3FD9A 4LWSA 3O9OA 2AZ0A 2B9ZA 2AZ2A 3ZBHA 3GVMA 1WA8B 2VRZA 3Q4HB
chains in the Genus database with same CATH superfamily
4J9YB 3RYHB 4BR6A 2AHYA 3STLC 3B2EE 1P4RA 2A0LA 1BQ0A 4YY3B 3K9AA 4G28B 2YXLA 4C7UA 3K04A 4QPKA 4X20B 5C8YA 4DRXA 1FJGB 1QLEC 3KCYA 3CD6V 3UQ8A 4L8JA 4PD4F 1H2GA 3E8BA 3JAMN 2GTAA 3JAWB 3EHBB 1F4MA 4ZBMA 1Y66A 1K4DC 4MVRA 4KFMA 2JGDA 2ARHA 3G6EV 3AG4C 3SYQA 2KSDA 4EB6A 2YIBA 3RGBA 2JEXA 3JSLA 3G6BA 4KHPB 4B3SB 1YHQV 4JI0O 1EZVH 4UCOA 3F5WC 3K57A 4X1KB 1K5QA 3BA9A 2BTQA 1AJQA 4UCSA 5KHIA 5KAFZ 1VQLV 2WLMA 4BIZA 4J7ZA 3TJTA 5B1AC 5IDJA 3AK3A 4JI8B 5E1AC 1K73W 1SQXH 2B5UA 4RUFA 5B1BB 4LR3A 4G27B 2H3OA 4MVZA 1GN3A 2O57A 3K9SA 3KG2A 3NXSA 3APQA 4FM2A 4DR5O 5BXZA 2PUSA 3CJHA 3SPIA 3ZN1A 1SS3A 1R1BA 2EBOA 1YJNV 1SETA 3MDSA 4JI2B 1R3IC 4DR2O 3ZRVA 2JS5A 1M1KW 1J5EB 4DR3B 1I7FA 3OMAB 1K92A 1I5XA 4DUYO 2QDOA 5L3GA 4NXNB 1Y74B 1XNRO 1QVGU 1TVKB 2LW1A 2Q6AA 1N8RW 4OX9O 3OEEG 3E22A 1HNXO 3VQVA 3CS5A 1HNWO 1GM8A 3K58A 1WAZA 3JARA 1Z2GA 3UT5B 3N2KB 4LFCO 4MVSA 5CA1B 2FTKA 3ETEA 4JI5O 1SRYA 2ZINA 4X64B 1GM9A 1ZUQA 2AW9A 3AG2B 4GYCB 1AJNA 2YC0A 3AG3B 4ZI7B 2M7WA 4RAIA 1JJOA 2XOKG 2LJ2A 4LNUB 4GX0A 4U3JB 2BOBC 1XMQB 3ZN0A 4O4IA 3ZMZA 5IJ9B 1NS1A 1PNKA 2W6IG 1I5YA 4OPHA 4LF5B 4BIUA 1SESA 1JQ0A 3ZIAG 4X1IA 3JCUZ 3S3XA 2MK3A 4IIJB 3F7YC 4X66B 2GHYA 3AG2C 4PDVA 1YVWA 3K3WA 2Z0AA 5LP6B 2C2AA 2CGOA 2WLLA 1K9MW 2IM9A 3QG5A 1FXKA 4IYHA 2EIJB 1YIJV 2Y48A 4U7NA 3WG7C 3E83A 1Q8IA 1EN5A 4TV8B 4JV5B 4IL6Z 2OCHA 1M5IA 5CMUA 3ZHRA 5LHIA 3WB1A 4AQYB 5JQGB 2F66C 3LDCA 4EFBA 1S0VA 4O4LB 3MD0A 2XTAA 3SJAC 4DV6B 2DJVA 2LGQA 3AG1B 3B09A 5LP6C 5H6RA 3RYFB 4G2KA 2A9HA 2DYSC 4JI7B 1WJZA 2CUGA 5EYPB 1BZKA 4MTXA 3GB7C 4HNAA 1NI8A 3CCMV 2ETNA 4NTWA 5KA5A 4DK1A 1QU7A 3LDEA 2YIDA 3CRCA 1TUBB 2P4VA 3DC6A 1JFFB 2BOCC 2E5LB 4D6TH 3ABMC 3AG1C 5EBMC 3X2QB 5LOVB 4TOIA 4YJ2A 3N2GB 1AVMA 3K59A 3CE2A 1N34O 3GWOA 3CCJV 5DEDA 5A9GA 1YXBA 3U11A 3OAAG 5K1XA 4FLWA 2HJFC 3JALB 4YJ3A 5J2TA 4RQEA 4QIWF 2DE0X 3R65A 4JYYA 5CA0A 4GKKB 1RPOA 3CRAA 2WLJA 5LXTA 2P4KA 5J2UA 1YTFB 3X2QC 1UPGA 2UXDO 3T2MA 5L3FA 2UXNA 1EFRG 4JI0B 2F95B 3Q4HB 3K0GA 3LSQA 3CCLV 4K35A 1XL4A 2DN9A 4JPRA 4I5SA 2WLKA 2DYRB 3LSSA 1G8MA 4P2ZA 2UXBO 3FB6C 5CBFA 2VS0A 3DGEA 1TAEA 2E76B 2ZDIA 5IJ0A 5IYDO 3W7SA 1GH6A 4DR7B 2PY5A 2HVJC 2IBZH 3SDLA 1Y76B 1EM1A 2KB1A 4I4TB 5FPRA 3FB7C 4J7JA 4EKWA 2ZR3A 1WP8A 1AR5A 1CP9A 2DYRC 5JCOC 2BSKA 2IW5A 2EILB 1M9NA 4UVAA 5EIBD 4NXMO 1LNQA 1S72V 1CPYA 4Q6GA 1YSCA 3L75H 4JI6O 1O9HA 1Z5WA 1P84F 1ENVA 3IAYA 4WCEV 1IBKO 1GN4A 5BR8O 4DUYB 2RJZA 3G71V 4JI3B 1EN6A 2QTOA 2ZNIA 1XNRB 2EILC 4OX9B 3RW0A 3ZRWA 4CC5A 2WSSG 4O4JA 2KG7B 5EZYB 1VQMV 3SYAA 3K5MA 3CRMA 3OE7G 1AI6A 4UFZA 2UUCO 2EINB 4B3MB 4JI1O 1IBLO 1K34A 2YI9A 3ZS8C 5ITZA 4YHHO 1SA0A 1X59A 3B8MA 3M8AA 4JASA 3P3PA 3APOA 4KUMA 2DW4A 1NKDA 2Q69A 3RYIB 2XUMA 3EFFK 3TK1A 2UU9B 2A06H 1AP6A 4IYIA 1G4YB 1H8HG 2VQEO 1XI1A 2EINC 1WNSA 1DTOA 5DN6G 4F6RB 2ZD9A 3CCRV 4DV2O 4DV7B 2CDYA 1QR8A 4D7TA 2DQ0A 2Q68A 1LR1A 1ZTEA 4E4EA 1AILA 3DC5A 1BE3H 3SPGA 2JVDA 4B7KA 3DXRA 1T5EA 1VF6C 3BAAA 3CSXA 5IYCO 1XMOO 4JYAO 2FYUH 4DR6O 1SQFA 3D3QA 1AROP 4WFEA 3FFQA 4UV8A 1ZWIC 2EIKB 2LP7A 2YEVB 3QO8A 2N74A 1HNZO 4UVBA 4DYLA 5BY1A 1S3JA 4L87A 3I55V 3ZRSA 3G4SV 1MABG 3FAVA 3OD4A 2Q7HA 5LYJB 1HDJA 1K33A 1H2SB 2YXYA 1AI5A 5JVDA 1WP7A 3E8GA 2EIKC 2GUZA 2QEXV 4MTOA 2F43G 1MSWD 2GDSA 1GKFA 4GUNA 3T1HB 3BVOA 4DXWA 2P5OA 1PD3A 1ZSPA 5IWAB 1Y67A 4J11A 4PI2A 5GW7A 4HYOA 4ICGA 2CH7B 4N21A 4LWSA 3TCUA 3GVMA 2HG5C 3DTUB 5KHGA 2VQFO 3J7AU 4FLYA 1OCOB 2NN4A 5CBGA 2F4VO 2F1MA 1K4CC 3HKEA 3AEIA 3QVNA 3BEHA 4MW8A 2UXDB 4FZ0A 4FFKA 1IZ3A 1UJWB 2OIEA 1URFA 2B9ZA 3SJCC 4FFBA 2QKAA 4NKGB 4IT5A 1IX9A 2Q73A 2Q4PA 5LMUB 1OCOC 3SJQC 2NLJC 3HKCA 3JAKA 1FPOA 3KCXA 5FNVB 1ZL8B 2ZXWB 2UXBB 1FD9A 4Z1VA 1K97A 1SQQH 2HR3A 1FFXB 3KZIZ 4RQFA 4IHJB 1BSMA 5JWPA 5EBWC 1NH2D 1EBOA 3CWBH 3ICXA 3HKDB 5BMVB 3D8CA 1W2BU 1JA8A 5CBHA 1H2NA 1N4CA 3K03A 4PHZA 3RYHA 1PPJH 2ZXWC 4ABMA 5JJEB 3F5TA 3W7WA 1VQ7V 2V7QG 4GKJO 3JSNA 4H44B 2GV9A 1KBHA 4JAVA 3ZHQA 1H2LA 1DF5A 5L3BA 1JJ2U 5L3DA 3ZX6A 4X20A 4D7SA 1XHZA 1VEWA 2ATKC 1L0LH 2YXHA 1QNMA 4X89A 4BIOA 1J95A 2E75B 4DRXB 3JD1A 1VQ5V 2XAFA 5A2QN 5BR8B 3OGCC 4E2LA 2NNUA 3PJSK 5J9PC 1SF9A 1DGSA 2HHHO 3B40A 1KD1W 5GTIZ 3U0ZA 1RPRA 1H2KA 3LSUA 4F6EA 2JDIG 1S76D 2B1IA 2JGDB 2X6CA 1EZJA 3VQWA 4EB6B 1QHTA 4N23A 2QWOB 4R6ZA 4DW1A 1B6QA 3B8NA 3IJ4A 4FLZA 3DSQA 2ODMA 1GTOA 4LP8A 3ABKB 4I9WA 4JI1B 3K08A 1JPXA 5KHKA 2ZE5A 2BTQB 3ETDA 1AI4A 4YIPA 1SZTA 4YHHB 3S3WA 5C93A 2CK3G 1NJIW 2MW2B 4DV5O 1L1FA 4LF7O 1YI2V 2ADPA 1YF2A 1VQNV 1M93A 1QR9A 5IE9A 1GMGA 1VQ4V 4I55B 4O4HA 4K0KO 1K3EA 2VQEB 1L8DA 3ABKC 1W59A 5LHGA 4DV2B 1Q6HA 2ZNJA 1ZAUA 1VQKV 1JCHA 3CJHB 5B1BC 1XL6A 3MHSC 3CXHF 4WF9V 1IBMO 4JAUA 3BHPA 4NTYA 5E79Z 2AHZA 1AB3A 1B3QA 2XAHA 1YITV 3CYOA 4TV9A 3WB0A 4BW5A 1XMOB 2RQ6A 4JYAB 3T1YO 1JMKC 4CZZA 5B3SB 2Y69B 5KMGA 4X62O 2R9AA 2Y0IA 4LF9B 1Y74A 2LQTA 1TGOA 1AR1B 1SQPH 1HNZB 3RVZA 2ZQMA 3E22B 3FYEB 2ZIOA 3QTCA 2WPDG 2ADQB 4PA4A 5B3SC 5DM6V 2Y69C 2YI8A 3UT5A 3IC9A 3N2KA 2OTLV 1FAFA 1LUVA 2BCCH 3K06A 3MAQA 2LFRA 1G6UA 2FL4A 2KQXA 4EEQA 3ABUA 5JH7A 1KKDA 4XDLA 5AG2A 4LNUA 3B4SA 2OCCB 5IJ9A 1SERA 2G38A 5EC1C 4DR1O 5CB4B 2GTSA 1I94B 1OCCB 2Q8VA 1E1RG 3AG3C 3ZEDA 4DR4O 4IIJA 4X1IB 5H9CA 4PELA 3RYCA 3CC4V 1YJWV 2WA3A 1Q81W 5KUMA 1KU9A 1NVPD 1N33O 2WLLB 2FMLA 1IXBA 4B7EA 3L74H 5H2FZ 4A5UB 1IXMA 3L71H 2PYJA 4AILC 1SQBH 2CTQA 2PYLA 3CHXA 3K5NA 4UB8Z 3GWKC 3W7TA 1PL4A 4MS2A 1GK9A 4LF8O 4GX2A 4DUZB 3ZCCA 3JATB 2EIJC 1Y4MA 4TWKA 1UFIA 4PA3A 3WB2A 1GRJA 3A0RA 1BT8A 4DK0A 1SQVH 5LA6A 1RFYA 4I9QA 4H33A 3BFRA 1YDXA 4HNAB 2WWWA 1NU1H 3D3IA 3MHHC 5GONB 3K5OA 4CH6A 2FKXA 4DV0O 3H9VA 3ETQA 4FLTA 2YICA 5LOVA 4DV3O 5CA3A 2QE7G 3HPLC 5CN0A 5EC2C 3F7VC 2D2CB 4P30A 4LH7A 3C3TA 2BTOA 3ZRXA 4B3RO 3JALA 1WLEA 4PA6A 4CS4A 2AXTZ 4YJ3B 3LNMB 4DV1O 1V54B 5CA0B 1RSOA 4MVOA 4LC1A 1VP7A 4R7CA 4I50A 1FXHA 5J2UB 2A3QA 2RCVA 4U3FH 1SC5B 3THOA 4JTDB 1MZFA 5IYZA 1JOYA 4JI4O 1XNQO 3Q4HA 4O2AB 2QWQB 1PV0A 1Q7YW 1XHXA 1M57B 2PI4A 3CCQV 1Q6UA 3JD0A 1QCEA 1V54C 2P67A 3ZMSA 4GX1A 1KKCA 2P7TC 1XILA 4DV4O 1F23A 1XEQA 2LW7A 3E35A 3WFVA 2UUBO 4DR5B 3EVKA 1FXVA 1WA8A 1M90W 1Y76A 4K0KB 1BHBA 2VWKA 2OIGA 4QPJA 1HW7A 3ZMVA 1VF7A 2P90A 4I0XB 1VQOV 1NT2B 4CH5A 1EN4A 1NQTA 2H8PC 1VQPV 1PM9A 3ZHSA 2FB5A 4DR2B 4LH6A 2BSKB 5KX5A 4BAYA 5BZBA 2WLIA 4YY3O 3IGAC 3FB8C 2ZDIC 3HKBA 4FMTA 1BS3A 4RUEA 1R6TA 4XDKA 5IY5B 3JASB 2XAJA 2Q7GA 2JJ1G 5DECA 1HNXB 3QO5A 5EBLC 1HNWB 1WN7A 2ILMA 1KECA 3STZC 4DO2A 1Q5OA 2KG7A 2ZT9B 1ZX3A 1DLBA 4O4JB 4LFCB 4Z1MG 5LGNA 3TXQA 2KKWA 3W7XA 4JI5B 5IY5C 3OR6C 4NTXA 5B5EZ 3CCUV 1PKXA 4KHPO 4B3SO 3SPCA 2ZCEA 1HR0O 2ZM6O 1H38A 3L72H 2W0XA 2YSUB 3FKSG 5ITZB 1US6A 4JI8O 1SA0B 1VQ8V 4NYKA 4UB6Z 2XAQA 3UO3A 3CCSV 1JVMA 4DR1B 4LFBO 1NBMG 1K8AW 1D5NA 1H2MA 4DR4B 2E74B 2ZE6A 2EZOA 4UCTA 2RMKB 5KHHA 2Z3YA 4X88A 1MOFA 1IVSA 4LBEC 1XDCA 2JS3A 1ORQC 3DXRB 2PTMA 4JI2O 3CMEV 3ABLB 3K5LA 3A8TA 2M6YA 2N05A 4DR3O 4ZOLB 2R9IA 1MSDA 4X65O 1PL0A 4FVMA 3CCEV 1BL8A 2YS8A 1Q6IA 3ASNB 3JYCA 2XASA 4WBNA 3L70H 3QF7A 2XHBA 3RBZA 1S5LZ 1KYOF 3ABLC 3FAVB 1N0NA 1OCZB 1Q3EA 5EK0A 1VQ6V 3OMNB 3SYPA 5JVDB 1N34B 4O2BA 2GUZB 4MTGA 2CGNA 2X6AA 4DV3B 4I7ZB 4JYBA 4FJCC 3AG7A 1YZBA 3SGIA 1NTMH 4WFGA 2F93B 4LF6O 1FS0G 4K8ZA 4B3RB 1QBZA 1XMQO 4P9OA 1NTKH 4LWSB 4JAAA 2QTSA 1OCZC 3I5DA 4LF5O 4PA9A 4NR1A 3OUSA 2L35A 3CMAV 4FZ1A 5KHJA 2Y4TA 5B1NA 2DWDC 1AI7A 3UCSC 4R8CA 3HKEB 4X66O 1YCIA 5LMNO 2JK5C 1K7DA 3JD4A 4RO2A 4ZHQA 1K5SA 4X1YB 1KB9F 1U96A 4CH3A 4X9QA 3CCVV 4TUYA 3KKYA 1VQ9V 2Q9LA 4JV5O 2EJRA 5EIBC 3JAKB 3H1KH 2Y4UA 4AQYO 1SKVA 3RT3C 4DV4B 2ITDC 2IU3A 1WPXA 4IHJA 2UUBB 4X8AA 3M7MX 3HKDA 4JI7O 1AP5A 2OTJV 2LFSA 1HWYA 4NXMB 3HB3B 1VF5B 3ZBHA 3OUFA 5LGTA 4DW0A 4JI6B 4UUJC 5B66Z 1MMMA 3T4DA 3CX5F 5C8YB 2E5LO 1IBKB 3D36C 3BABA 1CEZA 2EJ7A 3AG4B 1O9GA 3JCZA 4TT3G 3JAWA 2CE4A 2DOSA 3UO2A 1H8EG 1KP2A 3SPJA 4PDLA 1IDSA 2OYQA 4MTFA 3CEIA 5HFLA 1P49A 2R70A 2W0FC 2D3OW 1P7BA 2EULA 5KAIZ 1FKAO 1Q43A 4GKKO 2F23A 2RDCA 5B1AB 1MZEA 2A7WA 3H1JH 4X1KA 2UUCB 3T1CA 3ML0A 4LF4O 1HP8A 5JJJB 3EXAA 1IBLB 2ZE8A 3E8FA 3CRRA 3P3NA 1SQGA 3N27A 1VARA 1D2DA 2IJKA 2RNBA 2X0LA 4HAMA 4JTCB 2ZM6B 1HR0B 3LUTB 2Q0AA 3J81N 4H13B 1KP3A 3CP1A 1TUEB 2PGGA 3BA8A 4F4LA 2P6JA 1Z5VA 4KXRA 4Q20A 4B3TO 3OR7C 4PDRA 3BY6A 1V9PA 4I55A 4H0LB 2GSMB 2WLHA 5D5QA 4DR7O 4LFBB 4O4HB 4Z2WA 3L73H 1YTFD 4FLVA 2R9RB 1DF4A 4DR6B 4J7KA 1OCRB 3R66A 2RN9A 4PDMA 2BE3A 1SZXA 5H5NA 4QE7A 4AI8A 4TV9B 4J42A 4EFEA 1TVKA 1VIBA 3H1HH 5KMGB 3P30A 1LUWA 4X65B 4TQDA 3G80A 4JI3O 2QM7A 1A32A 1FYJA 4WFBV 3B77A 3JD2A 3JARB 1OCRC 4QGPA 1E1QG 3ASOB 1QVFU 5CA1A 4FM1A 1BCCH 3NR7A 4ZI7A 2QWNB 3RWRD 4FM0A 2OWOA 1KUQA 3CRQA 1W0JG 4ZIBA 4B3MO 2JIZG 4WFHA 4U3JA 4ZKIA 3RVYA 3BRCA 3ZHTA 3H1IH 1F7YA 4O4IB 5JH7B 1NH2B 2A79B 2Q7EA 3ASOC 4LF6B 2VWJA 2VQFB 4FPPA 3K79A 3WG7B 2F4VB 2X6BA 5CB4A 2WLNA 4J9ZB 4QNHB 1GO3F 2UUAO 1GM7A 3SJBC 2UU9O 1KQSU 4UCRA 2X7RB 3VQYA 5LP6A 2QKSA 3FD9A 2Y0PA 2OCCC 1NTZH 5LMNB 4DV7O 3TGUH 1FXKB 3RYCB 1THZA 2HLDG 3CC2V 1E79G 5K1PA 2Q5ZA 2HKOA 1JX9A 4TV8A 2Z5UA 1OCCC 3HR0A 2DYSB 5JQGA 4AHCA 4UV9A 4TSFG 2XNDG 4O4LA 4UCVA 4UVCA 3OTFA 4NVPA 1RM1B 3RYFA 1KC8W 2WAMA 3JATA 4P9PA 5EYPA 1FXKC 4QJFB 4UXNA 3ABMB 3K0DA 3LDDA 2N04A 2UXCO 5KLVH 1YJ9V 4MW3A 1Q86W 1TUBA 2XT9A 2Q0OC 5B1OA 4GKJB 1JFFA 2ZIMA 5LA6B 4FLUA 2QKCA 1X4TA 2NR5A 1ZLZA 1RM1C 3N2GA 3CB2A 5GONA 4NB5A 4ASUG 4YJ2B 3OM3B 3QO7A 3SYCA 1KMIZ 5FLXN 1N36O 1N32O 3T1HO 2HHHB 5D5PA 2P22C 3FYIB 3L9DA 3ABTA 5J2TB 2PZSA 5IWAO 4KL1A 3OEHG 4OPAA 4CBCA 2ITCC 1Q82W 3LNNA 2R72A 1ROPA 1NR1A 2VRZA 1WB7A 5LXTB 1XREA 3UKMA 4B08A 4KP4A 1XBLA 1M56B 2B1GA 1CXZB 1MG1A 2HJDA 1RSOB 5JJNB 2EIMB 3A0BZ 3OT7A 4I50B 4MVQA 3OTOO 2QM4A 4LF4B 3ZMTA 1S77D 3SR2C 5IYZB 2IJJA 2OT5A 1I08A 4XBFA 4O2AA 3H01A 3WU2Z 3E86A 5JCOA 2E3CA 4TQFA 4JTAB 1PNMA 5LBQA 2GBOA 2QA4V 4HZ3A 4DV5B 4LF7B 4GLXA 4K3AA 5LMUO 1M56C 3JD3A 2PF4E 2L6LA 3CPWU 4QE9A 2P06A 2IH1C 5GTHZ 5IJ0B 2EIMC 1G1XB 4I4TA 2ZR2A 1TA8A 1R6NA 4R50A 1P7GA 3M99B 4PJ0Z 4B3TB 1M57C 3CXCU 4WFAV 4HBNA 4BW9A 4LFAO 1WA8B 1PNLA 1NR7A 5F2VO 4I0XA 3A2FA 1XQ8A 5KA6A 2YIAA 1IBMB 4XDJA 2QWPB 2V1DA 3CC7V 4GT1A 3T1YB 1R3KC 1FJGO 2QR4A 3SYOA 5KX5B 2HVKC 4X62B 3AK2A 2WLIB 3ZHUA 2QGNA 3HKBB 1U97A 4FLXA 2LGWA 3U10A 3JASA 2YDEA 4MVMA 3QNEA 1RP3B 4JF3A 4CS3A 3ZJZA 1F51A 3ZRWB 2ZKOA 2IJHA 3PN1A 5EZYA 4MSWC 4YIOA 1BGYH 1R6KA 5FPOA 3BPZA 1NVPB 1V55B 1GN6A 1WPBA 4GX5A 1D5AA 5L3EA 1COWG 1XOUA 3H1LH 2K1EA 5KUKA 2LO1A 2CTPA 2WA4A 2DMXA 1L0NH 2HEPA 2K9PA 3IFXA 1B04A 3P32A 1VF6A 2QSAA 4OXSA 1JR9A 4CC6A 2V4DA 2AZ0A 2HP8A 2AZ2A 3RYIA 1V55C 1AR4A 3C90A 4W4LA 3VQXA 2YUAA 4H37A 3E89A 2HFEC 2QM8A 3OW2U 1QQCA 4F6RA 3W7UA 1QLNA 2XAGA 2UUAB 2CTWA 3A0HZ 1R73A 1MA1A 2QWRB 1B06A 3O65A 1BHAA 3FX7A 1S5JA 2DQ3A 3OMIB 3VBBA 3T4ZA 4MVUA 1N33B 1S5HC 1OV9A 4JYCA 3OFNG 4K8XA 1YEWA 4FK5C 2YIBD 1J5EO 1MNGA 3ZMUA 5L3CA 4FIPC 4OGQB 1OHHG 1VMGA 1F4NA 3TXSA 2YEVA 5HFMA 4LF8B 1GN2A 3I56V 3TETA 4NXNO 2H94A 1WB8A 4ZOLA 4W4KA 2DWEC 2IH3C 2W6JG 1M4UA 4LF9O 3O9OA 4J41A 2JEUA 1BQZA 2QJ1A 1R3LC 2ZE7A 4LCUC 3SPHA 4RWUA 2UXCB 5IYBO 4GZRB 5LYJA 1R3JC 2PI5A 4MT8A 4WBNB 4WFFA 4DV0B 3OGIB 4JGSA 4BWAA 3RFRA 2JRIA 4X64O 2AGAA 3ZHVA 2JJ2G 3ASNC 5IT9N 1N36B 1N32B 4O2BB 1BMFG 3E8HA 2CH7A 4PV1B 4J10A 4J80A 2JGUA 4DV1B 1IURA 3IC7A 1AJPA 4U7OA 4JZ2A 3C3SA 4PA7A 1NZ6A 4IGGA 1I94O 1XUQA 5LL6Y 4JZGA 5FL7G 3UM7A 5H6QA 4JI4B 4YXWG 2CTRA 3RN4A 1XNQB 1OJHA 3VOUA 3G67A 1N0JA 1Y6XA 1FFTB 3OTOB 3ETGA 4GCZA 1PP9H 4FFBB 5TISZ 4X1YA 3FB5C 2CAZC 4ZHQB 3AK1A 5FNVA 1ZL8A 2EX3A 3HKCB 4CS2A 1W0KG 2IJIA 2IU0A 1GAXA 4TUYB 4CH4A 1FFXA 1Q90D 4PI0A 1DK1A 4DV6O 5LGUA 1I0HA 3E2EA 3J80N 2UXXA 3D36A 4UCUA 4DUZO 5BMVA 3BCCH 2EZPA 2Q67A 1QLEB 4LFAB 5LHHA 1OZ0A
chains in the Genus database with same CATH topology
4I0XA 2KG7B 2DE0X 3FAVB 4GZRB 3GWKC 3HR0A 3Q4HA 1WA8A 4LWSB 3G80A 3TXSA 2KG7A 4ABMA 2VS0A 4I0XB 3TXQA 3FAVA 3OGIB 3FD9A 4LWSA 3O9OA 2AZ0A 2B9ZA 2AZ2A 3ZBHA 3GVMA 1WA8B 2VRZA 3Q4HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0X A;  2KG7 B;  2DE0 X;  3FAV B;  4GZR B;  3GWK C;  3HR0 A;  3Q4H A;  1WA8 A;  4LWS B;  3G80 A;  3TXS A;  2KG7 A;  4ABM A;  2VS0 A;  4I0X B;  3TXQ A;  3FAV A;  3OGI B;  3FD9 A;  4LWS A;  3O9O A;  2AZ0 A;  2B9Z A;  2AZ2 A;  3ZBH A;  3GVM A;  1WA8 B;  2VRZ A;  3Q4H B; 
#chains in the Genus database with same CATH topology
 4J9Y B;  3RYH B;  4BR6 A;  2AHY A;  3STL C;  3B2E E;  1P4R A;  2A0L A;  1BQ0 A;  4YY3 B;  3K9A A;  4G28 B;  2YXL A;  4C7U A;  3K04 A;  4QPK A;  4X20 B;  5C8Y A;  4DRX A;  1FJG B;  1QLE C;  3KCY A;  3CD6 V;  3UQ8 A;  4L8J A;  4PD4 F;  1H2G A;  3E8B A;  3JAM N;  2GTA A;  3JAW B;  3EHB B;  1F4M A;  4ZBM A;  1Y66 A;  1K4D C;  4MVR A;  4KFM A;  2JGD A;  2ARH A;  3G6E V;  3AG4 C;  3SYQ A;  2KSD A;  4EB6 A;  2YIB A;  3RGB A;  2JEX A;  3JSL A;  3G6B A;  4KHP B;  4B3S B;  1YHQ V;  4JI0 O;  1EZV H;  4UCO A;  3F5W C;  3K57 A;  4X1K B;  1K5Q A;  3BA9 A;  2BTQ A;  1AJQ A;  4UCS A;  5KHI A;  5KAF Z;  1VQL V;  2WLM A;  4BIZ A;  4J7Z A;  3TJT A;  5B1A C;  5IDJ A;  3AK3 A;  4JI8 B;  5E1A C;  1K73 W;  1SQX H;  2B5U A;  4RUF A;  5B1B B;  4LR3 A;  4G27 B;  2H3O A;  4MVZ A;  1GN3 A;  2O57 A;  3K9S A;  3KG2 A;  3NXS A;  3APQ A;  4FM2 A;  4DR5 O;  5BXZ A;  2PUS A;  3CJH A;  3SPI A;  3ZN1 A;  1SS3 A;  1R1B A;  2EBO A;  1YJN V;  1SET A;  3MDS A;  4JI2 B;  1R3I C;  4DR2 O;  3ZRV A;  2JS5 A;  1M1K W;  1J5E B;  4DR3 B;  1I7F A;  3OMA B;  1K92 A;  1I5X A;  4DUY O;  2QDO A;  5L3G A;  4NXN B;  1Y74 B;  1XNR O;  1QVG U;  1TVK B;  2LW1 A;  2Q6A A;  1N8R W;  4OX9 O;  3OEE G;  3E22 A;  1HNX O;  3VQV A;  3CS5 A;  1HNW O;  1GM8 A;  3K58 A;  1WAZ A;  3JAR A;  1Z2G A;  3UT5 B;  3N2K B;  4LFC O;  4MVS A;  5CA1 B;  2FTK A;  3ETE A;  4JI5 O;  1SRY A;  2ZIN A;  4X64 B;  1GM9 A;  1ZUQ A;  2AW9 A;  3AG2 B;  4GYC B;  1AJN A;  2YC0 A;  3AG3 B;  4ZI7 B;  2M7W A;  4RAI A;  1JJO A;  2XOK G;  2LJ2 A;  4LNU B;  4GX0 A;  4U3J B;  2BOB C;  1XMQ B;  3ZN0 A;  4O4I A;  3ZMZ A;  5IJ9 B;  1NS1 A;  1PNK A;  2W6I G;  1I5Y A;  4OPH A;  4LF5 B;  4BIU A;  1SES A;  1JQ0 A;  3ZIA G;  4X1I A;  3JCU Z;  3S3X A;  2MK3 A;  4IIJ B;  3F7Y C;  4X66 B;  2GHY A;  3AG2 C;  4PDV A;  1YVW A;  3K3W A;  2Z0A A;  5LP6 B;  2C2A A;  2CGO A;  2WLL A;  1K9M W;  2IM9 A;  3QG5 A;  1FXK A;  4IYH A;  2EIJ B;  1YIJ V;  2Y48 A;  4U7N A;  3WG7 C;  3E83 A;  1Q8I A;  1EN5 A;  4TV8 B;  4JV5 B;  4IL6 Z;  2OCH A;  1M5I A;  5CMU A;  3ZHR A;  5LHI A;  3WB1 A;  4AQY B;  5JQG B;  2F66 C;  3LDC A;  4EFB A;  1S0V A;  4O4L B;  3MD0 A;  2XTA A;  3SJA C;  4DV6 B;  2DJV A;  2LGQ A;  3AG1 B;  3B09 A;  5LP6 C;  5H6R A;  3RYF B;  4G2K A;  2A9H A;  2DYS C;  4JI7 B;  1WJZ A;  2CUG A;  5EYP B;  1BZK A;  4MTX A;  3GB7 C;  4HNA A;  1NI8 A;  3CCM V;  2ETN A;  4NTW A;  5KA5 A;  4DK1 A;  1QU7 A;  3LDE A;  2YID A;  3CRC A;  1TUB B;  2P4V A;  3DC6 A;  1JFF B;  2BOC C;  2E5L B;  4D6T H;  3ABM C;  3AG1 C;  5EBM C;  3X2Q B;  5LOV B;  4TOI A;  4YJ2 A;  3N2G B;  1AVM A;  3K59 A;  3CE2 A;  1N34 O;  3GWO A;  3CCJ V;  5DED A;  5A9G A;  1YXB A;  3U11 A;  3OAA G;  5K1X A;  4FLW A;  2HJF C;  3JAL B;  4YJ3 A;  5J2T A;  4RQE A;  4QIW F;  2DE0 X;  3R65 A;  4JYY A;  5CA0 A;  4GKK B;  1RPO A;  3CRA A;  2WLJ A;  5LXT A;  2P4K A;  5J2U A;  1YTF B;  3X2Q C;  1UPG A;  2UXD O;  3T2M A;  5L3F A;  2UXN A;  1EFR G;  4JI0 B;  2F95 B;  3Q4H B;  3K0G A;  3LSQ A;  3CCL V;  4K35 A;  1XL4 A;  2DN9 A;  4JPR A;  4I5S A;  2WLK A;  2DYR B;  3LSS A;  1G8M A;  4P2Z A;  2UXB O;  3FB6 C;  5CBF A;  2VS0 A;  3DGE A;  1TAE A;  2E76 B;  2ZDI A;  5IJ0 A;  5IYD O;  3W7S A;  1GH6 A;  4DR7 B;  2PY5 A;  2HVJ C;  2IBZ H;  3SDL A;  1Y76 B;  1EM1 A;  2KB1 A;  4I4T B;  5FPR A;  3FB7 C;  4J7J A;  4EKW A;  2ZR3 A;  1WP8 A;  1AR5 A;  1CP9 A;  2DYR C;  5JCO C;  2BSK A;  2IW5 A;  2EIL B;  1M9N A;  4UVA A;  5EIB D;  4NXM O;  1LNQ A;  1S72 V;  1CPY A;  4Q6G A;  1YSC A;  3L75 H;  4JI6 O;  1O9H A;  1Z5W A;  1P84 F;  1ENV A;  3IAY A;  4WCE V;  1IBK O;  1GN4 A;  5BR8 O;  4DUY B;  2RJZ A;  3G71 V;  4JI3 B;  1EN6 A;  2QTO A;  2ZNI A;  1XNR B;  2EIL C;  4OX9 B;  3RW0 A;  3ZRW A;  4CC5 A;  2WSS G;  4O4J A;  2KG7 B;  5EZY B;  1VQM V;  3SYA A;  3K5M A;  3CRM A;  3OE7 G;  1AI6 A;  4UFZ A;  2UUC O;  2EIN B;  4B3M B;  4JI1 O;  1IBL O;  1K34 A;  2YI9 A;  3ZS8 C;  5ITZ A;  4YHH O;  1SA0 A;  1X59 A;  3B8M A;  3M8A A;  4JAS A;  3P3P A;  3APO A;  4KUM A;  2DW4 A;  1NKD A;  2Q69 A;  3RYI B;  2XUM A;  3EFF K;  3TK1 A;  2UU9 B;  2A06 H;  1AP6 A;  4IYI A;  1G4Y B;  1H8H G;  2VQE O;  1XI1 A;  2EIN C;  1WNS A;  1DTO A;  5DN6 G;  4F6R B;  2ZD9 A;  3CCR V;  4DV2 O;  4DV7 B;  2CDY A;  1QR8 A;  4D7T A;  2DQ0 A;  2Q68 A;  1LR1 A;  1ZTE A;  4E4E A;  1AIL A;  3DC5 A;  1BE3 H;  3SPG A;  2JVD A;  4B7K A;  3DXR A;  1T5E A;  1VF6 C;  3BAA A;  3CSX A;  5IYC O;  1XMO O;  4JYA O;  2FYU H;  4DR6 O;  1SQF A;  3D3Q A;  1ARO P;  4WFE A;  3FFQ A;  4UV8 A;  1ZWI C;  2EIK B;  2LP7 A;  2YEV B;  3QO8 A;  2N74 A;  1HNZ O;  4UVB A;  4DYL A;  5BY1 A;  1S3J A;  4L87 A;  3I55 V;  3ZRS A;  3G4S V;  1MAB G;  3FAV A;  3OD4 A;  2Q7H A;  5LYJ B;  1HDJ A;  1K33 A;  1H2S B;  2YXY A;  1AI5 A;  5JVD A;  1WP7 A;  3E8G A;  2EIK C;  2GUZ A;  2QEX V;  4MTO A;  2F43 G;  1MSW D;  2GDS A;  1GKF A;  4GUN A;  3T1H B;  3BVO A;  4DXW A;  2P5O A;  1PD3 A;  1ZSP A;  5IWA B;  1Y67 A;  4J11 A;  4PI2 A;  5GW7 A;  4HYO A;  4ICG A;  2CH7 B;  4N21 A;  4LWS A;  3TCU A;  3GVM A;  2HG5 C;  3DTU B;  5KHG A;  2VQF O;  3J7A U;  4FLY A;  1OCO B;  2NN4 A;  5CBG A;  2F4V O;  2F1M A;  1K4C C;  3HKE A;  3AEI A;  3QVN A;  3BEH A;  4MW8 A;  2UXD B;  4FZ0 A;  4FFK A;  1IZ3 A;  1UJW B;  2OIE A;  1URF A;  2B9Z A;  3SJC C;  4FFB A;  2QKA A;  4NKG B;  4IT5 A;  1IX9 A;  2Q73 A;  2Q4P A;  5LMU B;  1OCO C;  3SJQ C;  2NLJ C;  3HKC A;  3JAK A;  1FPO A;  3KCX A;  5FNV B;  1ZL8 B;  2ZXW B;  2UXB B;  1FD9 A;  4Z1V A;  1K97 A;  1SQQ H;  2HR3 A;  1FFX B;  3KZI Z;  4RQF A;  4IHJ B;  1BSM A;  5JWP A;  5EBW C;  1NH2 D;  1EBO A;  3CWB H;  3ICX A;  3HKD B;  5BMV B;  3D8C A;  1W2B U;  1JA8 A;  5CBH A;  1H2N A;  1N4C A;  3K03 A;  4PHZ A;  3RYH A;  1PPJ H;  2ZXW C;  4ABM A;  5JJE B;  3F5T A;  3W7W A;  1VQ7 V;  2V7Q G;  4GKJ O;  3JSN A;  4H44 B;  2GV9 A;  1KBH A;  4JAV A;  3ZHQ A;  1H2L A;  1DF5 A;  5L3B A;  1JJ2 U;  5L3D A;  3ZX6 A;  4X20 A;  4D7S A;  1XHZ A;  1VEW A;  2ATK C;  1L0L H;  2YXH A;  1QNM A;  4X89 A;  4BIO A;  1J95 A;  2E75 B;  4DRX B;  3JD1 A;  1VQ5 V;  2XAF A;  5A2Q N;  5BR8 B;  3OGC C;  4E2L A;  2NNU A;  3PJS K;  5J9P C;  1SF9 A;  1DGS A;  2HHH O;  3B40 A;  1KD1 W;  5GTI Z;  3U0Z A;  1RPR A;  1H2K A;  3LSU A;  4F6E A;  2JDI G;  1S76 D;  2B1I A;  2JGD B;  2X6C A;  1EZJ A;  3VQW A;  4EB6 B;  1QHT A;  4N23 A;  2QWO B;  4R6Z A;  4DW1 A;  1B6Q A;  3B8N A;  3IJ4 A;  4FLZ A;  3DSQ A;  2ODM A;  1GTO A;  4LP8 A;  3ABK B;  4I9W A;  4JI1 B;  3K08 A;  1JPX A;  5KHK A;  2ZE5 A;  2BTQ B;  3ETD A;  1AI4 A;  4YIP A;  1SZT A;  4YHH B;  3S3W A;  5C93 A;  2CK3 G;  1NJI W;  2MW2 B;  4DV5 O;  1L1F A;  4LF7 O;  1YI2 V;  2ADP A;  1YF2 A;  1VQN V;  1M93 A;  1QR9 A;  5IE9 A;  1GMG A;  1VQ4 V;  4I55 B;  4O4H A;  4K0K O;  1K3E A;  2VQE B;  1L8D A;  3ABK C;  1W59 A;  5LHG A;  4DV2 B;  1Q6H A;  2ZNJ A;  1ZAU A;  1VQK V;  1JCH A;  3CJH B;  5B1B C;  1XL6 A;  3MHS C;  3CXH F;  4WF9 V;  1IBM O;  4JAU A;  3BHP A;  4NTY A;  5E79 Z;  2AHZ A;  1AB3 A;  1B3Q A;  2XAH A;  1YIT V;  3CYO A;  4TV9 A;  3WB0 A;  4BW5 A;  1XMO B;  2RQ6 A;  4JYA B;  3T1Y O;  1JMK C;  4CZZ A;  5B3S B;  2Y69 B;  5KMG A;  4X62 O;  2R9A A;  2Y0I A;  4LF9 B;  1Y74 A;  2LQT A;  1TGO A;  1AR1 B;  1SQP H;  1HNZ B;  3RVZ A;  2ZQM A;  3E22 B;  3FYE B;  2ZIO A;  3QTC A;  2WPD G;  2ADQ B;  4PA4 A;  5B3S C;  5DM6 V;  2Y69 C;  2YI8 A;  3UT5 A;  3IC9 A;  3N2K A;  2OTL V;  1FAF A;  1LUV A;  2BCC H;  3K06 A;  3MAQ A;  2LFR A;  1G6U A;  2FL4 A;  2KQX A;  4EEQ A;  3ABU A;  5JH7 A;  1KKD A;  4XDL A;  5AG2 A;  4LNU A;  3B4S A;  2OCC B;  5IJ9 A;  1SER A;  2G38 A;  5EC1 C;  4DR1 O;  5CB4 B;  2GTS A;  1I94 B;  1OCC B;  2Q8V A;  1E1R G;  3AG3 C;  3ZED A;  4DR4 O;  4IIJ A;  4X1I B;  5H9C A;  4PEL A;  3RYC A;  3CC4 V;  1YJW V;  2WA3 A;  1Q81 W;  5KUM A;  1KU9 A;  1NVP D;  1N33 O;  2WLL B;  2FML A;  1IXB A;  4B7E A;  3L74 H;  5H2F Z;  4A5U B;  1IXM A;  3L71 H;  2PYJ A;  4AIL C;  1SQB H;  2CTQ A;  2PYL A;  3CHX A;  3K5N A;  4UB8 Z;  3GWK C;  3W7T A;  1PL4 A;  4MS2 A;  1GK9 A;  4LF8 O;  4GX2 A;  4DUZ B;  3ZCC A;  3JAT B;  2EIJ C;  1Y4M A;  4TWK A;  1UFI A;  4PA3 A;  3WB2 A;  1GRJ A;  3A0R A;  1BT8 A;  4DK0 A;  1SQV H;  5LA6 A;  1RFY A;  4I9Q A;  4H33 A;  3BFR A;  1YDX A;  4HNA B;  2WWW A;  1NU1 H;  3D3I A;  3MHH C;  5GON B;  3K5O A;  4CH6 A;  2FKX A;  4DV0 O;  3H9V A;  3ETQ A;  4FLT A;  2YIC A;  5LOV A;  4DV3 O;  5CA3 A;  2QE7 G;  3HPL C;  5CN0 A;  5EC2 C;  3F7V C;  2D2C B;  4P30 A;  4LH7 A;  3C3T A;  2BTO A;  3ZRX A;  4B3R O;  3JAL A;  1WLE A;  4PA6 A;  4CS4 A;  2AXT Z;  4YJ3 B;  3LNM B;  4DV1 O;  1V54 B;  5CA0 B;  1RSO A;  4MVO A;  4LC1 A;  1VP7 A;  4R7C A;  4I50 A;  1FXH A;  5J2U B;  2A3Q A;  2RCV A;  4U3F H;  1SC5 B;  3THO A;  4JTD B;  1MZF A;  5IYZ A;  1JOY A;  4JI4 O;  1XNQ O;  3Q4H A;  4O2A B;  2QWQ B;  1PV0 A;  1Q7Y W;  1XHX A;  1M57 B;  2PI4 A;  3CCQ V;  1Q6U A;  3JD0 A;  1QCE A;  1V54 C;  2P67 A;  3ZMS A;  4GX1 A;  1KKC A;  2P7T C;  1XIL A;  4DV4 O;  1F23 A;  1XEQ A;  2LW7 A;  3E35 A;  3WFV A;  2UUB O;  4DR5 B;  3EVK A;  1FXV A;  1WA8 A;  1M90 W;  1Y76 A;  4K0K B;  1BHB A;  2VWK A;  2OIG A;  4QPJ A;  1HW7 A;  3ZMV A;  1VF7 A;  2P90 A;  4I0X B;  1VQO V;  1NT2 B;  4CH5 A;  1EN4 A;  1NQT A;  2H8P C;  1VQP V;  1PM9 A;  3ZHS A;  2FB5 A;  4DR2 B;  4LH6 A;  2BSK B;  5KX5 A;  4BAY A;  5BZB A;  2WLI A;  4YY3 O;  3IGA C;  3FB8 C;  2ZDI C;  3HKB A;  4FMT A;  1BS3 A;  4RUE A;  1R6T A;  4XDK A;  5IY5 B;  3JAS B;  2XAJ A;  2Q7G A;  2JJ1 G;  5DEC A;  1HNX B;  3QO5 A;  5EBL C;  1HNW B;  1WN7 A;  2ILM A;  1KEC A;  3STZ C;  4DO2 A;  1Q5O A;  2KG7 A;  2ZT9 B;  1ZX3 A;  1DLB A;  4O4J B;  4LFC B;  4Z1M G;  5LGN A;  3TXQ A;  2KKW A;  3W7X A;  4JI5 B;  5IY5 C;  3OR6 C;  4NTX A;  5B5E Z;  3CCU V;  1PKX A;  4KHP O;  4B3S O;  3SPC A;  2ZCE A;  1HR0 O;  2ZM6 O;  1H38 A;  3L72 H;  2W0X A;  2YSU B;  3FKS G;  5ITZ B;  1US6 A;  4JI8 O;  1SA0 B;  1VQ8 V;  4NYK A;  4UB6 Z;  2XAQ A;  3UO3 A;  3CCS V;  1JVM A;  4DR1 B;  4LFB O;  1NBM G;  1K8A W;  1D5N A;  1H2M A;  4DR4 B;  2E74 B;  2ZE6 A;  2EZO A;  4UCT A;  2RMK B;  5KHH A;  2Z3Y A;  4X88 A;  1MOF A;  1IVS A;  4LBE C;  1XDC A;  2JS3 A;  1ORQ C;  3DXR B;  2PTM A;  4JI2 O;  3CME V;  3ABL B;  3K5L A;  3A8T A;  2M6Y A;  2N05 A;  4DR3 O;  4ZOL B;  2R9I A;  1MSD A;  4X65 O;  1PL0 A;  4FVM A;  3CCE V;  1BL8 A;  2YS8 A;  1Q6I A;  3ASN B;  3JYC A;  2XAS A;  4WBN A;  3L70 H;  3QF7 A;  2XHB A;  3RBZ A;  1S5L Z;  1KYO F;  3ABL C;  3FAV B;  1N0N A;  1OCZ B;  1Q3E A;  5EK0 A;  1VQ6 V;  3OMN B;  3SYP A;  5JVD B;  1N34 B;  4O2B A;  2GUZ B;  4MTG A;  2CGN A;  2X6A A;  4DV3 B;  4I7Z B;  4JYB A;  4FJC C;  3AG7 A;  1YZB A;  3SGI A;  1NTM H;  4WFG A;  2F93 B;  4LF6 O;  1FS0 G;  4K8Z A;  4B3R B;  1QBZ A;  1XMQ O;  4P9O A;  1NTK H;  4LWS B;  4JAA A;  2QTS A;  1OCZ C;  3I5D A;  4LF5 O;  4PA9 A;  4NR1 A;  3OUS A;  2L35 A;  3CMA V;  4FZ1 A;  5KHJ A;  2Y4T A;  5B1N A;  2DWD C;  1AI7 A;  3UCS C;  4R8C A;  3HKE B;  4X66 O;  1YCI A;  5LMN O;  2JK5 C;  1K7D A;  3JD4 A;  4RO2 A;  4ZHQ A;  1K5S A;  4X1Y B;  1KB9 F;  1U96 A;  4CH3 A;  4X9Q A;  3CCV V;  4TUY A;  3KKY A;  1VQ9 V;  2Q9L A;  4JV5 O;  2EJR A;  5EIB C;  3JAK B;  3H1K H;  2Y4U A;  4AQY O;  1SKV A;  3RT3 C;  4DV4 B;  2ITD C;  2IU3 A;  1WPX A;  4IHJ A;  2UUB B;  4X8A A;  3M7M X;  3HKD A;  4JI7 O;  1AP5 A;  2OTJ V;  2LFS A;  1HWY A;  4NXM B;  3HB3 B;  1VF5 B;  3ZBH A;  3OUF A;  5LGT A;  4DW0 A;  4JI6 B;  4UUJ C;  5B66 Z;  1MMM A;  3T4D A;  3CX5 F;  5C8Y B;  2E5L O;  1IBK B;  3D36 C;  3BAB A;  1CEZ A;  2EJ7 A;  3AG4 B;  1O9G A;  3JCZ A;  4TT3 G;  3JAW A;  2CE4 A;  2DOS A;  3UO2 A;  1H8E G;  1KP2 A;  3SPJ A;  4PDL A;  1IDS A;  2OYQ A;  4MTF A;  3CEI A;  5HFL A;  1P49 A;  2R70 A;  2W0F C;  2D3O W;  1P7B A;  2EUL A;  5KAI Z;  1FKA O;  1Q43 A;  4GKK O;  2F23 A;  2RDC A;  5B1A B;  1MZE A;  2A7W A;  3H1J H;  4X1K A;  2UUC B;  3T1C A;  3ML0 A;  4LF4 O;  1HP8 A;  5JJJ B;  3EXA A;  1IBL B;  2ZE8 A;  3E8F A;  3CRR A;  3P3N A;  1SQG A;  3N27 A;  1VAR A;  1D2D A;  2IJK A;  2RNB A;  2X0L A;  4HAM A;  4JTC B;  2ZM6 B;  1HR0 B;  3LUT B;  2Q0A A;  3J81 N;  4H13 B;  1KP3 A;  3CP1 A;  1TUE B;  2PGG A;  3BA8 A;  4F4L A;  2P6J A;  1Z5V A;  4KXR A;  4Q20 A;  4B3T O;  3OR7 C;  4PDR A;  3BY6 A;  1V9P A;  4I55 A;  4H0L B;  2GSM B;  2WLH A;  5D5Q A;  4DR7 O;  4LFB B;  4O4H B;  4Z2W A;  3L73 H;  1YTF D;  4FLV A;  2R9R B;  1DF4 A;  4DR6 B;  4J7K A;  1OCR B;  3R66 A;  2RN9 A;  4PDM A;  2BE3 A;  1SZX A;  5H5N A;  4QE7 A;  4AI8 A;  4TV9 B;  4J42 A;  4EFE A;  1TVK A;  1VIB A;  3H1H H;  5KMG B;  3P30 A;  1LUW A;  4X65 B;  4TQD A;  3G80 A;  4JI3 O;  2QM7 A;  1A32 A;  1FYJ A;  4WFB V;  3B77 A;  3JD2 A;  3JAR B;  1OCR C;  4QGP A;  1E1Q G;  3ASO B;  1QVF U;  5CA1 A;  4FM1 A;  1BCC H;  3NR7 A;  4ZI7 A;  2QWN B;  3RWR D;  4FM0 A;  2OWO A;  1KUQ A;  3CRQ A;  1W0J G;  4ZIB A;  4B3M O;  2JIZ G;  4WFH A;  4U3J A;  4ZKI A;  3RVY A;  3BRC A;  3ZHT A;  3H1I H;  1F7Y A;  4O4I B;  5JH7 B;  1NH2 B;  2A79 B;  2Q7E A;  3ASO C;  4LF6 B;  2VWJ A;  2VQF B;  4FPP A;  3K79 A;  3WG7 B;  2F4V B;  2X6B A;  5CB4 A;  2WLN A;  4J9Z B;  4QNH B;  1GO3 F;  2UUA O;  1GM7 A;  3SJB C;  2UU9 O;  1KQS U;  4UCR A;  2X7R B;  3VQY A;  5LP6 A;  2QKS A;  3FD9 A;  2Y0P A;  2OCC C;  1NTZ H;  5LMN B;  4DV7 O;  3TGU H;  1FXK B;  3RYC B;  1THZ A;  2HLD G;  3CC2 V;  1E79 G;  5K1P A;  2Q5Z A;  2HKO A;  1JX9 A;  4TV8 A;  2Z5U A;  1OCC C;  3HR0 A;  2DYS B;  5JQG A;  4AHC A;  4UV9 A;  4TSF G;  2XND G;  4O4L A;  4UCV A;  4UVC A;  3OTF A;  4NVP A;  1RM1 B;  3RYF A;  1KC8 W;  2WAM A;  3JAT A;  4P9P A;  5EYP A;  1FXK C;  4QJF B;  4UXN A;  3ABM B;  3K0D A;  3LDD A;  2N04 A;  2UXC O;  5KLV H;  1YJ9 V;  4MW3 A;  1Q86 W;  1TUB A;  2XT9 A;  2Q0O C;  5B1O A;  4GKJ B;  1JFF A;  2ZIM A;  5LA6 B;  4FLU A;  2QKC A;  1X4T A;  2NR5 A;  1ZLZ A;  1RM1 C;  3N2G A;  3CB2 A;  5GON A;  4NB5 A;  4ASU G;  4YJ2 B;  3OM3 B;  3QO7 A;  3SYC A;  1KMI Z;  5FLX N;  1N36 O;  1N32 O;  3T1H O;  2HHH B;  5D5P A;  2P22 C;  3FYI B;  3L9D A;  3ABT A;  5J2T B;  2PZS A;  5IWA O;  4KL1 A;  3OEH G;  4OPA A;  4CBC A;  2ITC C;  1Q82 W;  3LNN A;  2R72 A;  1ROP A;  1NR1 A;  2VRZ A;  1WB7 A;  5LXT B;  1XRE A;  3UKM A;  4B08 A;  4KP4 A;  1XBL A;  1M56 B;  2B1G A;  1CXZ B;  1MG1 A;  2HJD A;  1RSO B;  5JJN B;  2EIM B;  3A0B Z;  3OT7 A;  4I50 B;  4MVQ A;  3OTO O;  2QM4 A;  4LF4 B;  3ZMT A;  1S77 D;  3SR2 C;  5IYZ B;  2IJJ A;  2OT5 A;  1I08 A;  4XBF A;  4O2A A;  3H01 A;  3WU2 Z;  3E86 A;  5JCO A;  2E3C A;  4TQF A;  4JTA B;  1PNM A;  5LBQ A;  2GBO A;  2QA4 V;  4HZ3 A;  4DV5 B;  4LF7 B;  4GLX A;  4K3A A;  5LMU O;  1M56 C;  3JD3 A;  2PF4 E;  2L6L A;  3CPW U;  4QE9 A;  2P06 A;  2IH1 C;  5GTH Z;  5IJ0 B;  2EIM C;  1G1X B;  4I4T A;  2ZR2 A;  1TA8 A;  1R6N A;  4R50 A;  1P7G A;  3M99 B;  4PJ0 Z;  4B3T B;  1M57 C;  3CXC U;  4WFA V;  4HBN A;  4BW9 A;  4LFA O;  1WA8 B;  1PNL A;  1NR7 A;  5F2V O;  4I0X A;  3A2F A;  1XQ8 A;  5KA6 A;  2YIA A;  1IBM B;  4XDJ A;  2QWP B;  2V1D A;  3CC7 V;  4GT1 A;  3T1Y B;  1R3K C;  1FJG O;  2QR4 A;  3SYO A;  5KX5 B;  2HVK C;  4X62 B;  3AK2 A;  2WLI B;  3ZHU A;  2QGN A;  3HKB B;  1U97 A;  4FLX A;  2LGW A;  3U10 A;  3JAS A;  2YDE A;  4MVM A;  3QNE A;  1RP3 B;  4JF3 A;  4CS3 A;  3ZJZ A;  1F51 A;  3ZRW B;  2ZKO A;  2IJH A;  3PN1 A;  5EZY A;  4MSW C;  4YIO A;  1BGY H;  1R6K A;  5FPO A;  3BPZ A;  1NVP B;  1V55 B;  1GN6 A;  1WPB A;  4GX5 A;  1D5A A;  5L3E A;  1COW G;  1XOU A;  3H1L H;  2K1E A;  5KUK A;  2LO1 A;  2CTP A;  2WA4 A;  2DMX A;  1L0N H;  2HEP A;  2K9P A;  3IFX A;  1B04 A;  3P32 A;  1VF6 A;  2QSA A;  4OXS A;  1JR9 A;  4CC6 A;  2V4D A;  2AZ0 A;  2HP8 A;  2AZ2 A;  3RYI A;  1V55 C;  1AR4 A;  3C90 A;  4W4L A;  3VQX A;  2YUA A;  4H37 A;  3E89 A;  2HFE C;  2QM8 A;  3OW2 U;  1QQC A;  4F6R A;  3W7U A;  1QLN A;  2XAG A;  2UUA B;  2CTW A;  3A0H Z;  1R73 A;  1MA1 A;  2QWR B;  1B06 A;  3O65 A;  1BHA A;  3FX7 A;  1S5J A;  2DQ3 A;  3OMI B;  3VBB A;  3T4Z A;  4MVU A;  1N33 B;  1S5H C;  1OV9 A;  4JYC A;  3OFN G;  4K8X A;  1YEW A;  4FK5 C;  2YIB D;  1J5E O;  1MNG A;  3ZMU A;  5L3C A;  4FIP C;  4OGQ B;  1OHH G;  1VMG A;  1F4N A;  3TXS A;  2YEV A;  5HFM A;  4LF8 B;  1GN2 A;  3I56 V;  3TET A;  4NXN O;  2H94 A;  1WB8 A;  4ZOL A;  4W4K A;  2DWE C;  2IH3 C;  2W6J G;  1M4U A;  4LF9 O;  3O9O A;  4J41 A;  2JEU A;  1BQZ A;  2QJ1 A;  1R3L C;  2ZE7 A;  4LCU C;  3SPH A;  4RWU A;  2UXC B;  5IYB O;  4GZR B;  5LYJ A;  1R3J C;  2PI5 A;  4MT8 A;  4WBN B;  4WFF A;  4DV0 B;  3OGI B;  4JGS A;  4BWA A;  3RFR A;  2JRI A;  4X64 O;  2AGA A;  3ZHV A;  2JJ2 G;  3ASN C;  5IT9 N;  1N36 B;  1N32 B;  4O2B B;  1BMF G;  3E8H A;  2CH7 A;  4PV1 B;  4J10 A;  4J80 A;  2JGU A;  4DV1 B;  1IUR A;  3IC7 A;  1AJP A;  4U7O A;  4JZ2 A;  3C3S A;  4PA7 A;  1NZ6 A;  4IGG A;  1I94 O;  1XUQ A;  5LL6 Y;  4JZG A;  5FL7 G;  3UM7 A;  5H6Q A;  4JI4 B;  4YXW G;  2CTR A;  3RN4 A;  1XNQ B;  1OJH A;  3VOU A;  3G67 A;  1N0J A;  1Y6X A;  1FFT B;  3OTO B;  3ETG A;  4GCZ A;  1PP9 H;  4FFB B;  5TIS Z;  4X1Y A;  3FB5 C;  2CAZ C;  4ZHQ B;  3AK1 A;  5FNV A;  1ZL8 A;  2EX3 A;  3HKC B;  4CS2 A;  1W0K G;  2IJI A;  2IU0 A;  1GAX A;  4TUY B;  4CH4 A;  1FFX A;  1Q90 D;  4PI0 A;  1DK1 A;  4DV6 O;  5LGU A;  1I0H A;  3E2E A;  3J80 N;  2UXX A;  3D36 A;  4UCU A;  4DUZ O;  5BMV A;  3BCC H;  2EZP A;  2Q67 A;  1QLE B;  4LFA B;  5LHH A;  1OZ0 A; 
#chains in the Genus database with same CATH homology
 4I0X A;  2KG7 B;  2DE0 X;  3FAV B;  4GZR B;  3GWK C;  3HR0 A;  3Q4H A;  1WA8 A;  4LWS B;  3G80 A;  3TXS A;  2KG7 A;  4ABM A;  2VS0 A;  4I0X B;  3TXQ A;  3FAV A;  3OGI B;  3FD9 A;  4LWS A;  3O9O A;  2AZ0 A;  2B9Z A;  2AZ2 A;  3ZBH A;  3GVM A;  1WA8 B;  2VRZ A;  3Q4H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...