4GZRB

Crystal structure of the mycobacterium tuberculosis h37rv esxop (rv2346c-rv2347c) complex in space group c2221
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
77
Chain Sequence
RFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQLDTMAQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ESAT-6-like protein 6
publication title Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 33
structure length 77
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4gzrB00
3HR0A 3GVMA 2VS0A 3FAVA 3FD9A 4GZRB 3O9OA 3FAVB 2B9ZA 3Q4HA 3Q4HB 2DE0X 2KG7A 3TXQA 2AZ2A 1WA8A 3GWKC 2KG7B 4LWSA 4I0XA 1WA8B 3TXSA 3ZBHA 4LWSB 4I0XB 2AZ0A 3OGIB 4ABMA 2VRZA 3G80A
chains in the Genus database with same CATH superfamily
1ZAUA 4MS2A 5FNVB 4K35A 1AJQA 2LJ2A 1KD1W 1NBMG 2YI8A 2EZPA 1GM9A 2ARHA 1E1QG 2E5LO 3WB2A 1VQ7V 4JI7O 4O4JA 1MA1A 3OMIB 4GKJO 2YS8A 3JD0A 2X7RB 1XHXA 2WLIB 1UJWB 4X62O 5BXZA 3WB0A 4UCRA 3OTFA 3EXAA 2P6JA 4DR4B 1PP9H 4HYOA 4BW9A 1N34O 1Y76A 2KQXA 1PPJH 4PELA 4FM1A 4JYAO 5IWAO 3K9SA 4EFBA 3ZIAG 1FXKC 4O4HA 2AXTZ 4O4IB 3IAYA 4MVZA 4LP8A 1S77D 4RUFA 4GZRB 4Z2WA 1Z2GA 4U3JA 4LF8B 2YI9A 2ZE7A 4X89A 4UCVA 2A79B 3ZRSA 2QEXV 3BRCA 1OCRB 4OPHA 3ML0A 1AR1B 5LYJB 1NH2B 2P5OA 2UUBB 1GM7A 1E79G 1XUQA 4YJ3A 4OX9O 5EC2C 4WF9V 2JGUA 4DW0A 2QE7G 2OCCC 4QIWF 1BQZA 3MD0A 5B1NA 1SQXH 2R72A 4ZIBA 5IYZA 4X1YA 3K5MA 4I9QA 4GLXA 3T4DA 3N2GB 3P3NA 4UUJC 2AGAA 1H2SB 3M8AA 3RYIA 3OW2U 4DR2B 3SJBC 3TJTA 3AG1C 3ZMVA 3K06A 5H9CA 2WA4A 3T1CA 4UCTA 1US6A 2H94A 4DV5O 2LQTA 4R50A 3HPLC 4LFCO 1Z5WA 4XDLA 5JH7A 1XNRO 5KAFZ 4NYKA 4I4TA 3FYEB 2Q7EA 1THZA 1XMQB 3VQYA 2VQEO 3NXSA 2UXBB 2VQFB 4O2AB 3B8NA 4ZI7B 2ATKC 4RAIA 4KL1A 4Q20A 3RYFA 1D2DA 4X66B 1OCRC 1EZVH 5LGTA 5JCOA 5LMUO 4J7KA 1F51A 1TVKB 5EYPB 4DR5B 3T1HB 5FLXN 4DR6B 2QR4A 4DUZO 3WU2Z 1WA8A 1RSOB 1L8DA 3CCJV 4MVQA 1NTKH 1HP8A 1NVPB 4EKWA 3E8BA 5D5QA 2E76B 1QU7A 3AG4B 5JJEB 2UU9O 1AI6A 4R8CA 5L3GA 4K8XA 5BY1A 1SC5B 4CS4A 3CRRA 1SA0B 1SF9A 4WFBV 1OCOB 1HNZO 5LOVB 1FFXA 3C90A 2R9RB 2WA3A 4FMTA 4HZ3A 4KHPB 1XNQO 4LF9B 2HLDG 3WG7B 5B66Z 4J80A 4RQEA 1EFRG 3VQXA 4DV4B 5LL6Y 1Q86W 3MHSC 4I50B 4FFBB 1R6KA 4FZ1A 5KHGA 2HJDA 3ZN0A 3G71V 5FPRA 2IJHA 2RCVA 1FAFA 2OTLV 1VQ9V 1FFTB 4OXSA 5KUMA 3OE7G 3CEIA 1Q6UA 1MMMA 3ZX6A 3ZHRA 4HBNA 2YEVB 2AZ2A 2F4VB 2A3QA 5H6QA 1GKFA 4PJ0Z 3AG4C 3OAAG 1S5JA 3JD4A 1W0JG 2CH7A 2Q68A 2W6IG 1HR0B 4X9QA 1OJHA 3RGBA 2E5LB 4XDKA 1Q8IA 4B3SB 2E74B 3BA9A 1VIBA 1PV0A 1V54B 1CXZB 2MK3A 3BABA 5IYBO 3L73H 1OCZB 1IBLB 4QPJA 3KKYA 3CPWU 1IXMA 1N34B 2ETNA 1WN7A 4MSWC 1K8AW 1BL8A 4IYHA 5TISZ 1AJPA 1FKAO 4J9ZB 3SR2C 3THOA 4CC5A 2Y4UA 3GWKC 1VF6C 4O4JB 4MVSA 1VF7A 1MSDA 2FMLA 4N23A 4X64B 1WB8A 3DC6A 3FX7A 5FNVA 1OCCB 1VQKV 1KP2A 5LA6A 1CP9A 2A7WA 5CB4A 1JA8A 1BE3H 4PDRA 1NU1H 1Y76B 4OX9B 1QHTA 2JEXA 2JIZG 1HNWO 1I5XA 4LWSA 5EBWC 3J81N 4JI4O 4JI6O 3CXCU 1YF2A 1D5NA 2VWJA 2HHHB 1GM8A 1FYJA 4O4HB 3MDSA 4JZ2A 2JRIA 2HVJC 4LH6A 1SZXA 2KKWA 1V54C 1NH2D 1HNXO 3ABLB 1EN4A 2V4DA 4DR3O 2YICA 1NKDA 1OCZC 4FPPA 1KU9A 2QTOA 1KKDA 3HKEA 1WNSA 1I94B 4YJ3B 4MT8A 4DV0O 2V1DA 4LFCB 4JI5O 2YIBA 1L1FA 4JI8O 1K92A 2VS0A 2X6CA 3FAVA 2HJFC 3CCRV 2Q0OC 5IYZB 4X1YB 4QE7A 1RM1C 3H1KH 4E4EA 3BEHA 2AHZA 1I0HA 2D2CB 4EFEA 3I56V 5LMNO 1BCCH 4U7OA 3LUTB 4H44B 1EN6A 1N33O 1OCCC 2ZE8A 4TOIA 4WFFA 2Q5ZA 1J95A 1Q3EA 4PA9A 1KB9F 1XHZA 3ZN1A 1WJZA 2ADPA 3RFRA 2BCCH 2XASA 4ZOLA 2CGNA 4NB5A 5JH7B 4GUNA 2QTSA 4Z1MG 1Q82W 1IBKB 1AR4A 4I4TB 3L9DA 3OFNG 3IJ4A 3CCMV 3UT5A 1MABG 3E8HA 2FKXA 3KCXA 4LF6O 3AK3A 5A9GA 4FLYA 4BIUA 1P7BA 3UKMA 3FYIB 2CTWA 3A0HZ 4K3AA 3D3IA 4U3FH 1G6UA 1NVPD 2EIJB 2KG7A 1T5EA 1K73W 1WA8B 2ZIMA 5DEDA 1R73A 4MVRA 3OGCC 4GX5A 4NKGB 3W7WA 3CX5F 4LCUC 4HNAA 3CRCA 3R66A 1GK9A 5L3CA 4UB6Z 1LUWA 5LHGA 2Q67A 2EIMB 5KHJA 4BW5A 1YTFB 1ZL8A 4B3TO 3U0ZA 1FFXB 1ZSPA 1E1RG 3K9AA 4UVCA 4YHHO 2VRZA 1RPOA 3CCQV 3G80A 3CWBH 3D36A 1JVMA 2WSSG 2PZSA 2UXDO 3QO5A 5FPOA 1Q6HA 4O4LA 1BT8A 2JK5C 3JALA 1XEQA 4LFBB 5L3FA 2ZM6O 3QO8A 4I5SA 4JI1B 4YXWG 3TGUH 4X65O 1I7FA 1YITV 4JAAA 1KECA 5L3EA 4FLWA 1QR9A 5KLVH 3MAQA 2HFEC 2DWDC 3SJAC 4JI3O 1VF6A 1N32O 4NXMO 2Z5UA 3OT7A 4DK1A 2CH7B 4TUYA 1ZWIC 2EIMC 2RDCA 1SQQH 5BR8B 1U96A 2R9AA 4MVOA 3QTCA 3APQA 2YEVA 1K5SA 1K33A 3CRQA 1NTMH 3CC7V 3OR7C 1JPXA 2ZQMA 3VQWA 4ZHQA 1AILA 2XT9A 1OV9A 2HKOA 3O9OA 4CBCA 2ZINA 4L87A 2FYUH 4PDMA 4HAMA 3E22A 2A9HA 4QE9A 2DJVA 2W0FC 2PYLA 5IE9A 3DSQA 3F5WC 4KXRA 3JAWA 1N8RW 4UCUA 3DGEA 4TWKA 2IU0A 2LFRA 4CH6A 1ORQC 5L3DA 1DGSA 3L75H 5LA6B 1VQ5V 2OCCB 2EULA 5CB4B 1D5AA 3P32A 2UXXA 4PI2A 2LFSA 1FXHA 3AK1A 2MW2B 3H1HH 4DV0B 1XL6A 4NTWA 1VQ6V 2DW4A 4I0XA 4LWSB 2ZR2A 1QVGU 3SYOA 1MNGA 4DUYO 4AILC 4PDVA 3JCZA 4GCZA 5K1XA 1AI5A 2GV9A 1QLNA 3CCEV 2ZNIA 3OMAB 2Q73A 5JJJB 1AVMA 3AG1B 1VQ4V 4LBEC 2UXCB 2QWNB 4PA6A 3TXQA 2Y48A 2ZDIC 2PGGA 3GB7C 1WB7A 2DYRC 3HKEB 4DR7B 1AB3A 1SETA 2Z0AA 1H38A 1BGYH 5CBHA 1IDSA 1HDJA 4LNUA 4NTYA 3FAVB 4IGGA 1SQFA 2WLJA 1R3JC 1QLEC 5ITZA 4UCOA 3I5DA 1J5EO 3DTUB 1GTOA 3O65A 2PI4A 4LFAO 4R7CA 1XMOB 4IYIA 1YVWA 4CH4A 3RW0A 4ABMA 1IBMB 3LSQA 3N2KA 4B7KA 3K57A 5KHHA 2CTRA 5K1PA 2CK3G 1GO3F 2OIEA 4ZOLB 1YIJV 3OR6C 4LF4O 3JD1A 3ZMZA 2QJ1A 1IURA 3CP1A 1GN3A 1SQGA 4JV5O 5GTHZ 4KFMA 1FXVA 2K1EA 4FIPC 4FLVA 3ZRVA 3UT5B 5J9PC 5IY5B 4DV7B 1XOUA 3FD9A 5KAIZ 1PKXA 3APOA 4F4LA 3IC7A 4TSFG 1YHQV 5DN6G 2KG7B 3UO2A 4DV3O 2XAGA 3A2FA 2R9IA 2IH1C 3W7TA 4LC1A 3JASB 2CUGA 4AQYB 2IJJA 3ABMB 4HNAB 3UO3A 4N21A 1Y6XA 2UUAO 1JMKC 4P2ZA 2QGNA 1YTFD 2ZIOA 3OMNB 4D7TA 3G6BA 1LNQA 2ZM6B 4J9YB 2EINB 1OHHG 1DF5A 1ZL8B 2UUCO 3ZHUA 4X65B 4F6RA 3JD2A 2WLNA 4JPRA 2WAMA 2YSUB 4MVUA 3QO7A 1VQLV 2ITDC 2X6BA 5KX5A 1N0JA 5CBFA 3ABKB 1YJWV 4O4LB 3CD6V 2NLJC 1XI1A 3K79A 2UXNA 3JALB 1L0NH 3K58A 1FJGO 1M57C 5IY5C 2A06H 3SYAA 1JCHA 4KP4A 4H0LB 1YDXA 3E35A 2XOKG 1GN2A 1BS3A 4P9OA 2PY5A 1PNMA 1S3JA 4JYBA 4WCEV 4FLXA 4JI2O 4X1IA 3ZCCA 1BMFG 3B8MA 1VQNV 5A2QN 3CYOA 2Q6AA 4JZGA 2QWOB 3ZMUA 2P90A 2JJ2G 1XREA 4LF5O 3JSLA 2PTMA 5D5PA 3DXRA 3ABMC 2JEUA 3CCUV 1K3EA 1X59A 1TUBA 2GBOA 3A8TA 2XAQA 4LF7O 4TUYB 5JVDA 4G27B 2EINC 5LP6C 1NI8A 4JTDB 1TA8A 4GKKO 5EIBC 1VQPV 2FB5A 4FLUA 3ZHVA 4DV1B 2LO1A 1M4UA 5FL7G 2Y69C 1SZTA 4JYYA 3U10A 1K97A 2VWKA 5EBLC 3D36C 4DO2A 4ZHQB 3ZHTA 4UV9A 1F23A 3ABKC 2IJKA 4TV9A 3SJQC 5CA1A 1B06A 2EX3A 4WBNA 2IH3C 2K9PA 5LGNA 4JI7B 4GKJB 4B3RO 3E22B 1ZX3A 1A32A 1H2GA 1V55B 4DUYB 4UVAA 4X62B 2Q7GA 3A0BZ 1S0VA 3JAWB 1ZLZA 1XILA 2EILC 1GMGA 1ROPA 2BSKA 2Y4TA 2ZDIA 3AG7A 3J7AU 3W7UA 4JYAB 2XAFA 4PV1B 5IWAB 4GYCB 4IHJB 5GTIZ 5IJ9A 3OTOO 4C7UA 1BHAA 3RYCA 5B3SB 2IU3A 3SDLA 3VBBA 3TXSA 4I0XB 1RM1B 1HW7A 4FZ0A 2GDSA 4MTOA 4B7EA 1W0KG 2H8PC 2NN4A 3ZS8C 4RQFA 1J5EB 4YY3O 2LGWA 3CC4V 1BHBA 1M9NA 2RQ6A 3ASNC 4DW1A 1VEWA 2FTKA 5AG2A 5B1BB 2YIBD 1S5HC 4CH3A 2PI5A 2CTQA 1Q81W 1P49A 2LGQA 3AK2A 1R3KC 3K5NA 1WPBA 2M7WA 4YIPA 4LF4B 5BMVA 1IXBA 1UFIA 4U7NA 2AW9A 2XHBA 4B3MO 4LNUB 1V55C 4DV2O 2YC0A 5GONA 5ITZB 4BIOA 4UVBA 4K0KO 4EEQA 4F6EA 4WFAV 2XTAA 2BOBC 2XAJA 2B1GA 3OEHG 3SGIA 2XUMA 4Z1VA 3LDDA 4JI0O 1Y74A 4DV5B 1XNRB 2C2AA 3N2KB 4FLTA 5B5EZ 1S5LZ 3HKBA 4QGPA 4CC6A 4X8AA 1QBZA 3D8CA 3W7SA 5B3SC 2WWWA 2QA4V 3D3QA 1LUVA 1H2MA 2OYQA 3TK1A 2QSAA 2VQEB 2H3OA 3LSUA 2QKAA 1I5YA 4PA4A 1YJNV 3CHXA 2BTOA 5LBQA 3BFRA 3AEIA 5LMUB 4JAVA 2CE4A 1O9HA 4DUZB 5EZYA 1XDCA 2W0XA 5CBGA 2ZE5A 3C3SA 4DR4O 1KMIZ 2P67A 4ASUG 1TGOA 3E83A 5B1BC 2Q4PA 3FKSG 2W6JG 2UU9B 2ZR3A 3ZRWA 1PD3A 4CS2A 3CCVV 5KMGA 1M5IA 2AHYA 2LP7A 2P22C 1HNZB 2Q9LA 2F23A 3LNMB 2L6LA 4LF8O 1TUEB 3CCSV 4TQDA 2YDEA 2WLMA 1XNQB 2WPDG 3ZBHA 1SESA 3LNNA 5JWPA 1F4NA 2V7QG 1VMGA 1KYOF 2UUBO 2QWPB 2ZXWC 5J2UA 4F6RB 1Y67A 3JASA 3H01A 3K5OA 1KBHA 1KQSU 1PL4A 3STLC 5IJ0A 5KX5B 1YEWA 3RWRD 4A5UB 3BAAA 5LP6A 3G67A 3UQ8A 4PA7A 4W4KA 3RN4A 1URFA 1M56B 3ZHQA 5B1OA 1JJ2U 3B2EE 4LF7B 1WLEA 3E89A 3ABTA 1K4CC 2DQ0A 3ETGA 2LW1A 4DR2O 2DN9A 3CC2V 4H37A 2EIKB 2F93B 3Q4HA 1H2KA 1HWYA 1QVFU 3OUSA 5CA0B 3T4ZA 4X1IB 3ZJZA 4MW8A 4BR6A 3JAMN 1OZ0A 3CCLV 3VOUA 3SYPA 4MTFA 1XMQO 2ZE6A 3DXRB 2PYJA 1VQOV 4NVPA 3A0RA 4NTXA 2UXBO 1VQ8V 3J80N 1TUBB 1JJOA 4QJFB 1H2NA 2IBZH 4IIJA 5JVDB 4J10A 2EBOA 3JARA 4X66O 2QKCA 1DTOA 2P4KA 3T1HO 4DR5O 4FVMA 3K0GA 2YXLA 3HB3B 3JAKA 3SPGA 3E2EA 1YI2V 2JJ1G 1K7DA 2Q7HA 4RO2A 3P30A 4TV9B 5CA1B 1SQVH 2ZCEA 3ZHSA 4WBNB 1M56C 1VARA 4WFHA 1YXBA 1CEZA 1R1BA 1JFFA 4JF3A 3RVZA 1U97A 4FFKA 1AP5A 1KP3A 3BVOA 2YIDA 2PF4E 3SPJA 2XNDG 2EIKC 3B77A 1SRYA 2BSKB 2GUZA 4KHPO 2DYRB 1I08A 2F1MA 3W7XA 2GTAA 4LH7A 3ICXA 1AI4A 4LF9O 1R6TA 1HNWB 2IM9A 4JI4B 4JI6B 2OT5A 5IJ9B 2QWRB 3RYCB 3FB8C 4ICGA 4IT5A 1M90W 1QLEB 4DV4O 2F66C 4G2KA 3HKDA 1M93A 1F4MA 1H8EG 1TAEA 4DV2B 1HNXB 3WFVA 3GVMA 3OM3B 3K03A 4DR3B 4AI8A 4IHJA 4DR1O 4PA3A 1IZ3A 1F7YA 3PN1A 3IC9A 3T2MA 1SERA 2ILMA 5BZBA 4JI5B 5IDJA 5DM6V 4JI8B 2F4VO 2M6YA 2N74A 5HFMA 1W2BU 2Z3YA 1XL4A 4B08A 4YIOA 2WLLA 5BMVB 2QKSA 4DYLA 2JS5A 1HR0O 5F2VO 5GONB 5LMNB 4WFEA 1N33B 4B3SO 4RWUA 3UCSC 3JCUZ 3AG2B 5EK0A 2QWQB 1Y74B 1B04A 2HR3A 1IBLO 1EN5A 2ADQB 2YUAA 2GTSA 2WLKA 3AG3B 3HKBB 5KA6A 1Q90D 1Y4MA 2ZT9B 3SPCA 4DV6O 2IJIA 3K59A 2FL4A 4FJCC 4JGSA 4TV8A 1JQ0A 4LF6B 5CMUA 2DQ3A 2G38A 1NT2B 2Y0IA 4BIZA 1GH6A 1SS3A 5B1AC 3KCYA 3OUFA 4X64O 1IX9A 2DOSA 5EZYB 1KKCA 1SQPH 2KSDA 1MSWD 1K9MW 3EHBB 4EB6B 4I9WA 1DLBA 1YZBA 4WFGA 2B1IA 1COWG 2HP8A 2BTQA 3ZRWB 1PNKA 1M57B 2HHHO 3H1JH 4LR3A 1EM1A 1Q7YW 1KUQA 5KMGB 3ASOB 3FB6C 2QDOA 4CZZA 4B3TB 2F43G 1W59A 2HVKC 1B3QA 5L3BA 3AG2C 1EBOA 4YHHB 1AR5A 1MZFA 2ITCC 4JYCA 3KZIZ 3M7MX 5LGUA 5E1AC 2UXDB 3AG3C 1I94O 4JASA 5J2UB 1K34A 2NR5A 1G4YB 4P9PA 2P06A 2HEPA 3IGAC 5IJ0B 1BZKA 5H6RA 3ZRXA 4QPKA 3IFXA 5LP6B 1N36O 1WP7A 3WB1A 1S76D 2ODMA 1BQ0A 2Y69B 2ZKOA 4BAYA 2OWOA 3FFQA 3BA8A 2OTJV 4J7JA 5LHIA 3L71H 3JATB 5JQGA 3E86A 4X20A 2Q8VA 3Q4HB 3DC5A 2P7TC 4ZKIA 4JI3B 1IBKO 1N32B 4NXMB 5IYCO 4I55A 1R6NA 2XAHA 4UXNA 3L74H 3CRAA 3ASOC 5J2TA 3SPIA 1XBLA 4O2BA 4G28B 2EILB 4DRXA 3BHPA 4IIJB 2Q0AA 2PUSA 3JARB 3UM7A 4W4LA 2EJ7A 5CA0A 1X4TA 2KB1A 4NXNO 2LW7A 3QF7A 2EJRA 2ZNJA 3B40A 3RYHA 5C8YA 3H1LH 4PDLA 3JAKB 2A0LA 1NZ6A 3K0DA 1PNLA 3CMEV 1EZJA 2X0LA 4P30A 3P3PA 4YJ2A 2N04A 4UV8A 4J11A 4CH5A 3BY6A 3X2QB 3CMAV 3TCUA 1JFFB 3OD4A 4UB8Z 1H2LA 3ASNB 2E3CA 3EFFK 4DXWA 2CAZC 2X6AA 3HR0A 5LXTA 4DR1B 1QQCA 2GUZB 4MTGA 1FD9A 1YCIA 4Q6GA 2QM4A 1Q6IA 1AROP 2JVDA 2YXHA 3HKCB 2Y0PA 2OCHA 4QNHB 3H1IH 4GX0A 1JOYA 4LFBO 3HKDB 1SQBH 3JD3A 4L8JA 1AJNA 4UCSA 5EBMC 1OCOC 4JI1O 4X1KA 2OIGA 4PD4F 4UFZA 3F5TA 1N4CA 3T1YO 3RBZA 4I7ZB 1Q5OA 3CXHF 3K3WA 4GX2A 3WG7C 4FM0A 1YSCA 1RPRA 1FXKA 5JJNB 3X2QC 3STZC 1BSMA 2L35A 4DV6B 2JS3A 2WLLB 4GT1A 5IT9N 3OEEG 3CB2A 3QG5A 4TQFA 1GRJA 4LFAB 2JGDA 3PJSK 5BR8O 1N0NA 1ENVA 4J42A 3CJHA 4MVMA 4AHCA 2QM8A 5E79Z 1R3LC 3G6EV 3F7YC 3L70H 5IYDO 1MG1A 4JV5B 5KA5A 1P84F 4OPAA 3MHHC 1QNMA 4TV8B 3M99B 2WLIA 2CGOA 2YXYA 1WPXA 1G1XB 1G8MA 1NJIW 4NR1A 3TETA 1K5QA 3CRMA 1ZTEA 4U3JB 2B9ZA 2ZXWB 3ETEA 1GN6A 4DV3B 1GN4A 2GSMB 5GW7A 4JTAB 4JTCB 5DECA 3SYCA 3FB7C 3JYCA 4JAUA 3K04A 4O4IA 1R3IC 3F7VC 2UUAB 2BTQB 4PI0A 1QCEA 1NR1A 1FS0G 1L0LH 1S72V 3E8FA 5KUKA 3FB5C 1AI7A 3G4SV 3SJCC 3QVNA 3QNEA 1N36B 5LYJA 2UUCB 1VQMV 2UXCO 4DK0A 4EB6A 1NS1A 3RYIB 1QR8A 2CDYA 2DMXA 1NQTA 3RVYA 4TT3G 1AP6A 1MZEA 4DR7O 5KHIA 5C93A 4CS3A 4ZBMA 5HFLA 1FJGB 2DWEC 3N2GA 4K8ZA 4E2LA 5EIBD 1V9PA 3EVKA 2F95B 4MTXA 5H5NA 3CE2A 3ETQA 5CA3A 1Y66A 4PHZA 4FM2A 3ABLC 1XMOO 2ZD9A 3VQVA 4FK5C 2P4VA 1JX9A 2BOCC 3RYFB 3ZMSA 4JI2B 1Z5VA 1IBMO 2D3OW 4NXNB 5CN0A 5JQGB 4X20B 4RUEA 1WAZA 4LF5B 5LHHA 5H2FZ 1ZUQA 4O2AA 3LSSA 3ETDA 4I55B 4IL6Z 4ZI7A 1GAXA 3OGIB 2R70A 1PM9A 1UPGA 1CPYA 1RFYA 3SYQA 3S3WA 5J2TB 1Q43A 1DK1A 1FPOA 2DYSB 3BPZA 4R6ZA 4GKKB 4DV7O 1P4RA 1TVKA 4O2BB 5EYPA 1K4DC 3JATA 4DRXB 2E75B 1P7GA 1XQ8A 3LDEA 4D7SA 1RSOA 2NNUA 3KG2A 1SKVA 1NR7A 1O9GA 4D6TH 1VP7A 3RYHB 5C8YB 2HG5C 2RMKB 3B4SA 3CSXA 2VQFO 4YJ2B 4B3RB 3L72H 4OGQB 4AQYO 1SA0A 4X88A 1DF4A 2YIAA 5LOVA 1YJ9V 3BCCH 2CTPA 3NR7A 4DR6O 3SPHA 3CS5A 2BE3A 2JDIG 4XDJA 4J7ZA 3I55V 1IVSA 5JCOC 3RT3C 2RJZA 1PL0A 5KHKA 5LXTB 3ZMTA 2EIJC 3OTOB 3T1YB 3E8GA 1H8HG 1WP8A 3ABUA 3H9VA 4MW3A 4I50A 4GX1A 4FFBA 2B5UA 3ZEDA 2Q69A 2WLHA 2DYSC 2QM7A 5EC1C 1M1KW 4YY3B 2EZOA 2IW5A 3LDCA 1VF5B 1JR9A 4X1KB 1B6QA 4BWAA 3B09A 1RP3B 4H13B 3HKCA 4KUMA 3C3TA 2N05A 2RNBA 3K5LA 2AZ0A 1MOFA 4B3MB 1FXKB 3K08A 2O57A 3JSNA 4K0KB 3GWOA 3U11A 4J41A 5B1AB 3N27A 2JGDB 2DE0X 1NTZH 2RN9A 2GHYA 4FLZA 4JI0B 3CJHB 1KC8W 4DV1O 4H33A 3S3XA 3R65A 1LR1A 4XBFA
chains in the Genus database with same CATH topology
3HR0A 3GVMA 2VS0A 3FAVA 3FD9A 4GZRB 3O9OA 3FAVB 2B9ZA 3Q4HA 3Q4HB 2DE0X 2KG7A 3TXQA 2AZ2A 1WA8A 3GWKC 2KG7B 4LWSA 4I0XA 1WA8B 3TXSA 3ZBHA 4LWSB 4I0XB 2AZ0A 3OGIB 4ABMA 2VRZA 3G80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HR0 A;  3GVM A;  2VS0 A;  3FAV A;  3FD9 A;  4GZR B;  3O9O A;  3FAV B;  2B9Z A;  3Q4H A;  3Q4H B;  2DE0 X;  2KG7 A;  3TXQ A;  2AZ2 A;  1WA8 A;  3GWK C;  2KG7 B;  4LWS A;  4I0X A;  1WA8 B;  3TXS A;  3ZBH A;  4LWS B;  4I0X B;  2AZ0 A;  3OGI B;  4ABM A;  2VRZ A;  3G80 A; 
#chains in the Genus database with same CATH topology
 1ZAU A;  4MS2 A;  5FNV B;  4K35 A;  1AJQ A;  2LJ2 A;  1KD1 W;  1NBM G;  2YI8 A;  2EZP A;  1GM9 A;  2ARH A;  1E1Q G;  2E5L O;  3WB2 A;  1VQ7 V;  4JI7 O;  4O4J A;  1MA1 A;  3OMI B;  4GKJ O;  2YS8 A;  3JD0 A;  2X7R B;  1XHX A;  2WLI B;  1UJW B;  4X62 O;  5BXZ A;  3WB0 A;  4UCR A;  3OTF A;  3EXA A;  2P6J A;  4DR4 B;  1PP9 H;  4HYO A;  4BW9 A;  1N34 O;  1Y76 A;  2KQX A;  1PPJ H;  4PEL A;  4FM1 A;  4JYA O;  5IWA O;  3K9S A;  4EFB A;  3ZIA G;  1FXK C;  4O4H A;  2AXT Z;  4O4I B;  3IAY A;  4MVZ A;  4LP8 A;  1S77 D;  4RUF A;  4GZR B;  4Z2W A;  1Z2G A;  4U3J A;  4LF8 B;  2YI9 A;  2ZE7 A;  4X89 A;  4UCV A;  2A79 B;  3ZRS A;  2QEX V;  3BRC A;  1OCR B;  4OPH A;  3ML0 A;  1AR1 B;  5LYJ B;  1NH2 B;  2P5O A;  2UUB B;  1GM7 A;  1E79 G;  1XUQ A;  4YJ3 A;  4OX9 O;  5EC2 C;  4WF9 V;  2JGU A;  4DW0 A;  2QE7 G;  2OCC C;  4QIW F;  1BQZ A;  3MD0 A;  5B1N A;  1SQX H;  2R72 A;  4ZIB A;  5IYZ A;  4X1Y A;  3K5M A;  4I9Q A;  4GLX A;  3T4D A;  3N2G B;  3P3N A;  4UUJ C;  2AGA A;  1H2S B;  3M8A A;  3RYI A;  3OW2 U;  4DR2 B;  3SJB C;  3TJT A;  3AG1 C;  3ZMV A;  3K06 A;  5H9C A;  2WA4 A;  3T1C A;  4UCT A;  1US6 A;  2H94 A;  4DV5 O;  2LQT A;  4R50 A;  3HPL C;  4LFC O;  1Z5W A;  4XDL A;  5JH7 A;  1XNR O;  5KAF Z;  4NYK A;  4I4T A;  3FYE B;  2Q7E A;  1THZ A;  1XMQ B;  3VQY A;  2VQE O;  3NXS A;  2UXB B;  2VQF B;  4O2A B;  3B8N A;  4ZI7 B;  2ATK C;  4RAI A;  4KL1 A;  4Q20 A;  3RYF A;  1D2D A;  4X66 B;  1OCR C;  1EZV H;  5LGT A;  5JCO A;  5LMU O;  4J7K A;  1F51 A;  1TVK B;  5EYP B;  4DR5 B;  3T1H B;  5FLX N;  4DR6 B;  2QR4 A;  4DUZ O;  3WU2 Z;  1WA8 A;  1RSO B;  1L8D A;  3CCJ V;  4MVQ A;  1NTK H;  1HP8 A;  1NVP B;  4EKW A;  3E8B A;  5D5Q A;  2E76 B;  1QU7 A;  3AG4 B;  5JJE B;  2UU9 O;  1AI6 A;  4R8C A;  5L3G A;  4K8X A;  5BY1 A;  1SC5 B;  4CS4 A;  3CRR A;  1SA0 B;  1SF9 A;  4WFB V;  1OCO B;  1HNZ O;  5LOV B;  1FFX A;  3C90 A;  2R9R B;  2WA3 A;  4FMT A;  4HZ3 A;  4KHP B;  1XNQ O;  4LF9 B;  2HLD G;  3WG7 B;  5B66 Z;  4J80 A;  4RQE A;  1EFR G;  3VQX A;  4DV4 B;  5LL6 Y;  1Q86 W;  3MHS C;  4I50 B;  4FFB B;  1R6K A;  4FZ1 A;  5KHG A;  2HJD A;  3ZN0 A;  3G71 V;  5FPR A;  2IJH A;  2RCV A;  1FAF A;  2OTL V;  1VQ9 V;  1FFT B;  4OXS A;  5KUM A;  3OE7 G;  3CEI A;  1Q6U A;  1MMM A;  3ZX6 A;  3ZHR A;  4HBN A;  2YEV B;  2AZ2 A;  2F4V B;  2A3Q A;  5H6Q A;  1GKF A;  4PJ0 Z;  3AG4 C;  3OAA G;  1S5J A;  3JD4 A;  1W0J G;  2CH7 A;  2Q68 A;  2W6I G;  1HR0 B;  4X9Q A;  1OJH A;  3RGB A;  2E5L B;  4XDK A;  1Q8I A;  4B3S B;  2E74 B;  3BA9 A;  1VIB A;  1PV0 A;  1V54 B;  1CXZ B;  2MK3 A;  3BAB A;  5IYB O;  3L73 H;  1OCZ B;  1IBL B;  4QPJ A;  3KKY A;  3CPW U;  1IXM A;  1N34 B;  2ETN A;  1WN7 A;  4MSW C;  1K8A W;  1BL8 A;  4IYH A;  5TIS Z;  1AJP A;  1FKA O;  4J9Z B;  3SR2 C;  3THO A;  4CC5 A;  2Y4U A;  3GWK C;  1VF6 C;  4O4J B;  4MVS A;  1VF7 A;  1MSD A;  2FML A;  4N23 A;  4X64 B;  1WB8 A;  3DC6 A;  3FX7 A;  5FNV A;  1OCC B;  1VQK V;  1KP2 A;  5LA6 A;  1CP9 A;  2A7W A;  5CB4 A;  1JA8 A;  1BE3 H;  4PDR A;  1NU1 H;  1Y76 B;  4OX9 B;  1QHT A;  2JEX A;  2JIZ G;  1HNW O;  1I5X A;  4LWS A;  5EBW C;  3J81 N;  4JI4 O;  4JI6 O;  3CXC U;  1YF2 A;  1D5N A;  2VWJ A;  2HHH B;  1GM8 A;  1FYJ A;  4O4H B;  3MDS A;  4JZ2 A;  2JRI A;  2HVJ C;  4LH6 A;  1SZX A;  2KKW A;  1V54 C;  1NH2 D;  1HNX O;  3ABL B;  1EN4 A;  2V4D A;  4DR3 O;  2YIC A;  1NKD A;  1OCZ C;  4FPP A;  1KU9 A;  2QTO A;  1KKD A;  3HKE A;  1WNS A;  1I94 B;  4YJ3 B;  4MT8 A;  4DV0 O;  2V1D A;  4LFC B;  4JI5 O;  2YIB A;  1L1F A;  4JI8 O;  1K92 A;  2VS0 A;  2X6C A;  3FAV A;  2HJF C;  3CCR V;  2Q0O C;  5IYZ B;  4X1Y B;  4QE7 A;  1RM1 C;  3H1K H;  4E4E A;  3BEH A;  2AHZ A;  1I0H A;  2D2C B;  4EFE A;  3I56 V;  5LMN O;  1BCC H;  4U7O A;  3LUT B;  4H44 B;  1EN6 A;  1N33 O;  1OCC C;  2ZE8 A;  4TOI A;  4WFF A;  2Q5Z A;  1J95 A;  1Q3E A;  4PA9 A;  1KB9 F;  1XHZ A;  3ZN1 A;  1WJZ A;  2ADP A;  3RFR A;  2BCC H;  2XAS A;  4ZOL A;  2CGN A;  4NB5 A;  5JH7 B;  4GUN A;  2QTS A;  4Z1M G;  1Q82 W;  1IBK B;  1AR4 A;  4I4T B;  3L9D A;  3OFN G;  3IJ4 A;  3CCM V;  3UT5 A;  1MAB G;  3E8H A;  2FKX A;  3KCX A;  4LF6 O;  3AK3 A;  5A9G A;  4FLY A;  4BIU A;  1P7B A;  3UKM A;  3FYI B;  2CTW A;  3A0H Z;  4K3A A;  3D3I A;  4U3F H;  1G6U A;  1NVP D;  2EIJ B;  2KG7 A;  1T5E A;  1K73 W;  1WA8 B;  2ZIM A;  5DED A;  1R73 A;  4MVR A;  3OGC C;  4GX5 A;  4NKG B;  3W7W A;  3CX5 F;  4LCU C;  4HNA A;  3CRC A;  3R66 A;  1GK9 A;  5L3C A;  4UB6 Z;  1LUW A;  5LHG A;  2Q67 A;  2EIM B;  5KHJ A;  4BW5 A;  1YTF B;  1ZL8 A;  4B3T O;  3U0Z A;  1FFX B;  1ZSP A;  1E1R G;  3K9A A;  4UVC A;  4YHH O;  2VRZ A;  1RPO A;  3CCQ V;  3G80 A;  3CWB H;  3D36 A;  1JVM A;  2WSS G;  2PZS A;  2UXD O;  3QO5 A;  5FPO A;  1Q6H A;  4O4L A;  1BT8 A;  2JK5 C;  3JAL A;  1XEQ A;  4LFB B;  5L3F A;  2ZM6 O;  3QO8 A;  4I5S A;  4JI1 B;  4YXW G;  3TGU H;  4X65 O;  1I7F A;  1YIT V;  4JAA A;  1KEC A;  5L3E A;  4FLW A;  1QR9 A;  5KLV H;  3MAQ A;  2HFE C;  2DWD C;  3SJA C;  4JI3 O;  1VF6 A;  1N32 O;  4NXM O;  2Z5U A;  3OT7 A;  4DK1 A;  2CH7 B;  4TUY A;  1ZWI C;  2EIM C;  2RDC A;  1SQQ H;  5BR8 B;  1U96 A;  2R9A A;  4MVO A;  3QTC A;  3APQ A;  2YEV A;  1K5S A;  1K33 A;  3CRQ A;  1NTM H;  3CC7 V;  3OR7 C;  1JPX A;  2ZQM A;  3VQW A;  4ZHQ A;  1AIL A;  2XT9 A;  1OV9 A;  2HKO A;  3O9O A;  4CBC A;  2ZIN A;  4L87 A;  2FYU H;  4PDM A;  4HAM A;  3E22 A;  2A9H A;  4QE9 A;  2DJV A;  2W0F C;  2PYL A;  5IE9 A;  3DSQ A;  3F5W C;  4KXR A;  3JAW A;  1N8R W;  4UCU A;  3DGE A;  4TWK A;  2IU0 A;  2LFR A;  4CH6 A;  1ORQ C;  5L3D A;  1DGS A;  3L75 H;  5LA6 B;  1VQ5 V;  2OCC B;  2EUL A;  5CB4 B;  1D5A A;  3P32 A;  2UXX A;  4PI2 A;  2LFS A;  1FXH A;  3AK1 A;  2MW2 B;  3H1H H;  4DV0 B;  1XL6 A;  4NTW A;  1VQ6 V;  2DW4 A;  4I0X A;  4LWS B;  2ZR2 A;  1QVG U;  3SYO A;  1MNG A;  4DUY O;  4AIL C;  4PDV A;  3JCZ A;  4GCZ A;  5K1X A;  1AI5 A;  2GV9 A;  1QLN A;  3CCE V;  2ZNI A;  3OMA B;  2Q73 A;  5JJJ B;  1AVM A;  3AG1 B;  1VQ4 V;  4LBE C;  2UXC B;  2QWN B;  4PA6 A;  3TXQ A;  2Y48 A;  2ZDI C;  2PGG A;  3GB7 C;  1WB7 A;  2DYR C;  3HKE B;  4DR7 B;  1AB3 A;  1SET A;  2Z0A A;  1H38 A;  1BGY H;  5CBH A;  1IDS A;  1HDJ A;  4LNU A;  4NTY A;  3FAV B;  4IGG A;  1SQF A;  2WLJ A;  1R3J C;  1QLE C;  5ITZ A;  4UCO A;  3I5D A;  1J5E O;  3DTU B;  1GTO A;  3O65 A;  2PI4 A;  4LFA O;  4R7C A;  1XMO B;  4IYI A;  1YVW A;  4CH4 A;  3RW0 A;  4ABM A;  1IBM B;  3LSQ A;  3N2K A;  4B7K A;  3K57 A;  5KHH A;  2CTR A;  5K1P A;  2CK3 G;  1GO3 F;  2OIE A;  4ZOL B;  1YIJ V;  3OR6 C;  4LF4 O;  3JD1 A;  3ZMZ A;  2QJ1 A;  1IUR A;  3CP1 A;  1GN3 A;  1SQG A;  4JV5 O;  5GTH Z;  4KFM A;  1FXV A;  2K1E A;  4FIP C;  4FLV A;  3ZRV A;  3UT5 B;  5J9P C;  5IY5 B;  4DV7 B;  1XOU A;  3FD9 A;  5KAI Z;  1PKX A;  3APO A;  4F4L A;  3IC7 A;  4TSF G;  1YHQ V;  5DN6 G;  2KG7 B;  3UO2 A;  4DV3 O;  2XAG A;  3A2F A;  2R9I A;  2IH1 C;  3W7T A;  4LC1 A;  3JAS B;  2CUG A;  4AQY B;  2IJJ A;  3ABM B;  4HNA B;  3UO3 A;  4N21 A;  1Y6X A;  2UUA O;  1JMK C;  4P2Z A;  2QGN A;  1YTF D;  2ZIO A;  3OMN B;  4D7T A;  3G6B A;  1LNQ A;  2ZM6 B;  4J9Y B;  2EIN B;  1OHH G;  1DF5 A;  1ZL8 B;  2UUC O;  3ZHU A;  4X65 B;  4F6R A;  3JD2 A;  2WLN A;  4JPR A;  2WAM A;  2YSU B;  4MVU A;  3QO7 A;  1VQL V;  2ITD C;  2X6B A;  5KX5 A;  1N0J A;  5CBF A;  3ABK B;  1YJW V;  4O4L B;  3CD6 V;  2NLJ C;  1XI1 A;  3K79 A;  2UXN A;  3JAL B;  1L0N H;  3K58 A;  1FJG O;  1M57 C;  5IY5 C;  2A06 H;  3SYA A;  1JCH A;  4KP4 A;  4H0L B;  1YDX A;  3E35 A;  2XOK G;  1GN2 A;  1BS3 A;  4P9O A;  2PY5 A;  1PNM A;  1S3J A;  4JYB A;  4WCE V;  4FLX A;  4JI2 O;  4X1I A;  3ZCC A;  1BMF G;  3B8M A;  1VQN V;  5A2Q N;  3CYO A;  2Q6A A;  4JZG A;  2QWO B;  3ZMU A;  2P90 A;  2JJ2 G;  1XRE A;  4LF5 O;  3JSL A;  2PTM A;  5D5P A;  3DXR A;  3ABM C;  2JEU A;  3CCU V;  1K3E A;  1X59 A;  1TUB A;  2GBO A;  3A8T A;  2XAQ A;  4LF7 O;  4TUY B;  5JVD A;  4G27 B;  2EIN C;  5LP6 C;  1NI8 A;  4JTD B;  1TA8 A;  4GKK O;  5EIB C;  1VQP V;  2FB5 A;  4FLU A;  3ZHV A;  4DV1 B;  2LO1 A;  1M4U A;  5FL7 G;  2Y69 C;  1SZT A;  4JYY A;  3U10 A;  1K97 A;  2VWK A;  5EBL C;  3D36 C;  4DO2 A;  4ZHQ B;  3ZHT A;  4UV9 A;  1F23 A;  3ABK C;  2IJK A;  4TV9 A;  3SJQ C;  5CA1 A;  1B06 A;  2EX3 A;  4WBN A;  2IH3 C;  2K9P A;  5LGN A;  4JI7 B;  4GKJ B;  4B3R O;  3E22 B;  1ZX3 A;  1A32 A;  1H2G A;  1V55 B;  4DUY B;  4UVA A;  4X62 B;  2Q7G A;  3A0B Z;  1S0V A;  3JAW B;  1ZLZ A;  1XIL A;  2EIL C;  1GMG A;  1ROP A;  2BSK A;  2Y4T A;  2ZDI A;  3AG7 A;  3J7A U;  3W7U A;  4JYA B;  2XAF A;  4PV1 B;  5IWA B;  4GYC B;  4IHJ B;  5GTI Z;  5IJ9 A;  3OTO O;  4C7U A;  1BHA A;  3RYC A;  5B3S B;  2IU3 A;  3SDL A;  3VBB A;  3TXS A;  4I0X B;  1RM1 B;  1HW7 A;  4FZ0 A;  2GDS A;  4MTO A;  4B7E A;  1W0K G;  2H8P C;  2NN4 A;  3ZS8 C;  4RQF A;  1J5E B;  4YY3 O;  2LGW A;  3CC4 V;  1BHB A;  1M9N A;  2RQ6 A;  3ASN C;  4DW1 A;  1VEW A;  2FTK A;  5AG2 A;  5B1B B;  2YIB D;  1S5H C;  4CH3 A;  2PI5 A;  2CTQ A;  1Q81 W;  1P49 A;  2LGQ A;  3AK2 A;  1R3K C;  3K5N A;  1WPB A;  2M7W A;  4YIP A;  4LF4 B;  5BMV A;  1IXB A;  1UFI A;  4U7N A;  2AW9 A;  2XHB A;  4B3M O;  4LNU B;  1V55 C;  4DV2 O;  2YC0 A;  5GON A;  5ITZ B;  4BIO A;  4UVB A;  4K0K O;  4EEQ A;  4F6E A;  4WFA V;  2XTA A;  2BOB C;  2XAJ A;  2B1G A;  3OEH G;  3SGI A;  2XUM A;  4Z1V A;  3LDD A;  4JI0 O;  1Y74 A;  4DV5 B;  1XNR B;  2C2A A;  3N2K B;  4FLT A;  5B5E Z;  1S5L Z;  3HKB A;  4QGP A;  4CC6 A;  4X8A A;  1QBZ A;  3D8C A;  3W7S A;  5B3S C;  2WWW A;  2QA4 V;  3D3Q A;  1LUV A;  1H2M A;  2OYQ A;  3TK1 A;  2QSA A;  2VQE B;  2H3O A;  3LSU A;  2QKA A;  1I5Y A;  4PA4 A;  1YJN V;  3CHX A;  2BTO A;  5LBQ A;  3BFR A;  3AEI A;  5LMU B;  4JAV A;  2CE4 A;  1O9H A;  4DUZ B;  5EZY A;  1XDC A;  2W0X A;  5CBG A;  2ZE5 A;  3C3S A;  4DR4 O;  1KMI Z;  2P67 A;  4ASU G;  1TGO A;  3E83 A;  5B1B C;  2Q4P A;  3FKS G;  2W6J G;  2UU9 B;  2ZR3 A;  3ZRW A;  1PD3 A;  4CS2 A;  3CCV V;  5KMG A;  1M5I A;  2AHY A;  2LP7 A;  2P22 C;  1HNZ B;  2Q9L A;  2F23 A;  3LNM B;  2L6L A;  4LF8 O;  1TUE B;  3CCS V;  4TQD A;  2YDE A;  2WLM A;  1XNQ B;  2WPD G;  3ZBH A;  1SES A;  3LNN A;  5JWP A;  1F4N A;  2V7Q G;  1VMG A;  1KYO F;  2UUB O;  2QWP B;  2ZXW C;  5J2U A;  4F6R B;  1Y67 A;  3JAS A;  3H01 A;  3K5O A;  1KBH A;  1KQS U;  1PL4 A;  3STL C;  5IJ0 A;  5KX5 B;  1YEW A;  3RWR D;  4A5U B;  3BAA A;  5LP6 A;  3G67 A;  3UQ8 A;  4PA7 A;  4W4K A;  3RN4 A;  1URF A;  1M56 B;  3ZHQ A;  5B1O A;  1JJ2 U;  3B2E E;  4LF7 B;  1WLE A;  3E89 A;  3ABT A;  1K4C C;  2DQ0 A;  3ETG A;  2LW1 A;  4DR2 O;  2DN9 A;  3CC2 V;  4H37 A;  2EIK B;  2F93 B;  3Q4H A;  1H2K A;  1HWY A;  1QVF U;  3OUS A;  5CA0 B;  3T4Z A;  4X1I B;  3ZJZ A;  4MW8 A;  4BR6 A;  3JAM N;  1OZ0 A;  3CCL V;  3VOU A;  3SYP A;  4MTF A;  1XMQ O;  2ZE6 A;  3DXR B;  2PYJ A;  1VQO V;  4NVP A;  3A0R A;  4NTX A;  2UXB O;  1VQ8 V;  3J80 N;  1TUB B;  1JJO A;  4QJF B;  1H2N A;  2IBZ H;  4IIJ A;  5JVD B;  4J10 A;  2EBO A;  3JAR A;  4X66 O;  2QKC A;  1DTO A;  2P4K A;  3T1H O;  4DR5 O;  4FVM A;  3K0G A;  2YXL A;  3HB3 B;  3JAK A;  3SPG A;  3E2E A;  1YI2 V;  2JJ1 G;  1K7D A;  2Q7H A;  4RO2 A;  3P30 A;  4TV9 B;  5CA1 B;  1SQV H;  2ZCE A;  3ZHS A;  4WBN B;  1M56 C;  1VAR A;  4WFH A;  1YXB A;  1CEZ A;  1R1B A;  1JFF A;  4JF3 A;  3RVZ A;  1U97 A;  4FFK A;  1AP5 A;  1KP3 A;  3BVO A;  2YID A;  2PF4 E;  3SPJ A;  2XND G;  2EIK C;  3B77 A;  1SRY A;  2BSK B;  2GUZ A;  4KHP O;  2DYR B;  1I08 A;  2F1M A;  3W7X A;  2GTA A;  4LH7 A;  3ICX A;  1AI4 A;  4LF9 O;  1R6T A;  1HNW B;  2IM9 A;  4JI4 B;  4JI6 B;  2OT5 A;  5IJ9 B;  2QWR B;  3RYC B;  3FB8 C;  4ICG A;  4IT5 A;  1M90 W;  1QLE B;  4DV4 O;  2F66 C;  4G2K A;  3HKD A;  1M93 A;  1F4M A;  1H8E G;  1TAE A;  4DV2 B;  1HNX B;  3WFV A;  3GVM A;  3OM3 B;  3K03 A;  4DR3 B;  4AI8 A;  4IHJ A;  4DR1 O;  4PA3 A;  1IZ3 A;  1F7Y A;  3PN1 A;  3IC9 A;  3T2M A;  1SER A;  2ILM A;  5BZB A;  4JI5 B;  5IDJ A;  5DM6 V;  4JI8 B;  2F4V O;  2M6Y A;  2N74 A;  5HFM A;  1W2B U;  2Z3Y A;  1XL4 A;  4B08 A;  4YIO A;  2WLL A;  5BMV B;  2QKS A;  4DYL A;  2JS5 A;  1HR0 O;  5F2V O;  5GON B;  5LMN B;  4WFE A;  1N33 B;  4B3S O;  4RWU A;  3UCS C;  3JCU Z;  3AG2 B;  5EK0 A;  2QWQ B;  1Y74 B;  1B04 A;  2HR3 A;  1IBL O;  1EN5 A;  2ADQ B;  2YUA A;  2GTS A;  2WLK A;  3AG3 B;  3HKB B;  5KA6 A;  1Q90 D;  1Y4M A;  2ZT9 B;  3SPC A;  4DV6 O;  2IJI A;  3K59 A;  2FL4 A;  4FJC C;  4JGS A;  4TV8 A;  1JQ0 A;  4LF6 B;  5CMU A;  2DQ3 A;  2G38 A;  1NT2 B;  2Y0I A;  4BIZ A;  1GH6 A;  1SS3 A;  5B1A C;  3KCY A;  3OUF A;  4X64 O;  1IX9 A;  2DOS A;  5EZY B;  1KKC A;  1SQP H;  2KSD A;  1MSW D;  1K9M W;  3EHB B;  4EB6 B;  4I9W A;  1DLB A;  1YZB A;  4WFG A;  2B1I A;  1COW G;  2HP8 A;  2BTQ A;  3ZRW B;  1PNK A;  1M57 B;  2HHH O;  3H1J H;  4LR3 A;  1EM1 A;  1Q7Y W;  1KUQ A;  5KMG B;  3ASO B;  3FB6 C;  2QDO A;  4CZZ A;  4B3T B;  2F43 G;  1W59 A;  2HVK C;  1B3Q A;  5L3B A;  3AG2 C;  1EBO A;  4YHH B;  1AR5 A;  1MZF A;  2ITC C;  4JYC A;  3KZI Z;  3M7M X;  5LGU A;  5E1A C;  2UXD B;  3AG3 C;  1I94 O;  4JAS A;  5J2U B;  1K34 A;  2NR5 A;  1G4Y B;  4P9P A;  2P06 A;  2HEP A;  3IGA C;  5IJ0 B;  1BZK A;  5H6R A;  3ZRX A;  4QPK A;  3IFX A;  5LP6 B;  1N36 O;  1WP7 A;  3WB1 A;  1S76 D;  2ODM A;  1BQ0 A;  2Y69 B;  2ZKO A;  4BAY A;  2OWO A;  3FFQ A;  3BA8 A;  2OTJ V;  4J7J A;  5LHI A;  3L71 H;  3JAT B;  5JQG A;  3E86 A;  4X20 A;  2Q8V A;  3Q4H B;  3DC5 A;  2P7T C;  4ZKI A;  4JI3 B;  1IBK O;  1N32 B;  4NXM B;  5IYC O;  4I55 A;  1R6N A;  2XAH A;  4UXN A;  3L74 H;  3CRA A;  3ASO C;  5J2T A;  3SPI A;  1XBL A;  4O2B A;  4G28 B;  2EIL B;  4DRX A;  3BHP A;  4IIJ B;  2Q0A A;  2PUS A;  3JAR B;  3UM7 A;  4W4L A;  2EJ7 A;  5CA0 A;  1X4T A;  2KB1 A;  4NXN O;  2LW7 A;  3QF7 A;  2EJR A;  2ZNJ A;  3B40 A;  3RYH A;  5C8Y A;  3H1L H;  4PDL A;  3JAK B;  2A0L A;  1NZ6 A;  3K0D A;  1PNL A;  3CME V;  1EZJ A;  2X0L A;  4P30 A;  3P3P A;  4YJ2 A;  2N04 A;  4UV8 A;  4J11 A;  4CH5 A;  3BY6 A;  3X2Q B;  3CMA V;  3TCU A;  1JFF B;  3OD4 A;  4UB8 Z;  1H2L A;  3ASN B;  2E3C A;  3EFF K;  4DXW A;  2CAZ C;  2X6A A;  3HR0 A;  5LXT A;  4DR1 B;  1QQC A;  2GUZ B;  4MTG A;  1FD9 A;  1YCI A;  4Q6G A;  2QM4 A;  1Q6I A;  1ARO P;  2JVD A;  2YXH A;  3HKC B;  2Y0P A;  2OCH A;  4QNH B;  3H1I H;  4GX0 A;  1JOY A;  4LFB O;  3HKD B;  1SQB H;  3JD3 A;  4L8J A;  1AJN A;  4UCS A;  5EBM C;  1OCO C;  4JI1 O;  4X1K A;  2OIG A;  4PD4 F;  4UFZ A;  3F5T A;  1N4C A;  3T1Y O;  3RBZ A;  4I7Z B;  1Q5O A;  3CXH F;  3K3W A;  4GX2 A;  3WG7 C;  4FM0 A;  1YSC A;  1RPR A;  1FXK A;  5JJN B;  3X2Q C;  3STZ C;  1BSM A;  2L35 A;  4DV6 B;  2JS3 A;  2WLL B;  4GT1 A;  5IT9 N;  3OEE G;  3CB2 A;  3QG5 A;  4TQF A;  1GRJ A;  4LFA B;  2JGD A;  3PJS K;  5BR8 O;  1N0N A;  1ENV A;  4J42 A;  3CJH A;  4MVM A;  4AHC A;  2QM8 A;  5E79 Z;  1R3L C;  3G6E V;  3F7Y C;  3L70 H;  5IYD O;  1MG1 A;  4JV5 B;  5KA5 A;  1P84 F;  4OPA A;  3MHH C;  1QNM A;  4TV8 B;  3M99 B;  2WLI A;  2CGO A;  2YXY A;  1WPX A;  1G1X B;  1G8M A;  1NJI W;  4NR1 A;  3TET A;  1K5Q A;  3CRM A;  1ZTE A;  4U3J B;  2B9Z A;  2ZXW B;  3ETE A;  1GN6 A;  4DV3 B;  1GN4 A;  2GSM B;  5GW7 A;  4JTA B;  4JTC B;  5DEC A;  3SYC A;  3FB7 C;  3JYC A;  4JAU A;  3K04 A;  4O4I A;  1R3I C;  3F7V C;  2UUA B;  2BTQ B;  4PI0 A;  1QCE A;  1NR1 A;  1FS0 G;  1L0L H;  1S72 V;  3E8F A;  5KUK A;  3FB5 C;  1AI7 A;  3G4S V;  3SJC C;  3QVN A;  3QNE A;  1N36 B;  5LYJ A;  2UUC B;  1VQM V;  2UXC O;  4DK0 A;  4EB6 A;  1NS1 A;  3RYI B;  1QR8 A;  2CDY A;  2DMX A;  1NQT A;  3RVY A;  4TT3 G;  1AP6 A;  1MZE A;  4DR7 O;  5KHI A;  5C93 A;  4CS3 A;  4ZBM A;  5HFL A;  1FJG B;  2DWE C;  3N2G A;  4K8Z A;  4E2L A;  5EIB D;  1V9P A;  3EVK A;  2F95 B;  4MTX A;  5H5N A;  3CE2 A;  3ETQ A;  5CA3 A;  1Y66 A;  4PHZ A;  4FM2 A;  3ABL C;  1XMO O;  2ZD9 A;  3VQV A;  4FK5 C;  2P4V A;  1JX9 A;  2BOC C;  3RYF B;  3ZMS A;  4JI2 B;  1Z5V A;  1IBM O;  2D3O W;  4NXN B;  5CN0 A;  5JQG B;  4X20 B;  4RUE A;  1WAZ A;  4LF5 B;  5LHH A;  5H2F Z;  1ZUQ A;  4O2A A;  3LSS A;  3ETD A;  4I55 B;  4IL6 Z;  4ZI7 A;  1GAX A;  3OGI B;  2R70 A;  1PM9 A;  1UPG A;  1CPY A;  1RFY A;  3SYQ A;  3S3W A;  5J2T B;  1Q43 A;  1DK1 A;  1FPO A;  2DYS B;  3BPZ A;  4R6Z A;  4GKK B;  4DV7 O;  1P4R A;  1TVK A;  4O2B B;  5EYP A;  1K4D C;  3JAT A;  4DRX B;  2E75 B;  1P7G A;  1XQ8 A;  3LDE A;  4D7S A;  1RSO A;  2NNU A;  3KG2 A;  1SKV A;  1NR7 A;  1O9G A;  4D6T H;  1VP7 A;  3RYH B;  5C8Y B;  2HG5 C;  2RMK B;  3B4S A;  3CSX A;  2VQF O;  4YJ2 B;  4B3R B;  3L72 H;  4OGQ B;  4AQY O;  1SA0 A;  4X88 A;  1DF4 A;  2YIA A;  5LOV A;  1YJ9 V;  3BCC H;  2CTP A;  3NR7 A;  4DR6 O;  3SPH A;  3CS5 A;  2BE3 A;  2JDI G;  4XDJ A;  4J7Z A;  3I55 V;  1IVS A;  5JCO C;  3RT3 C;  2RJZ A;  1PL0 A;  5KHK A;  5LXT B;  3ZMT A;  2EIJ C;  3OTO B;  3T1Y B;  3E8G A;  1H8H G;  1WP8 A;  3ABU A;  3H9V A;  4MW3 A;  4I50 A;  4GX1 A;  4FFB A;  2B5U A;  3ZED A;  2Q69 A;  2WLH A;  2DYS C;  2QM7 A;  5EC1 C;  1M1K W;  4YY3 B;  2EZO A;  2IW5 A;  3LDC A;  1VF5 B;  1JR9 A;  4X1K B;  1B6Q A;  4BWA A;  3B09 A;  1RP3 B;  4H13 B;  3HKC A;  4KUM A;  3C3T A;  2N05 A;  2RNB A;  3K5L A;  2AZ0 A;  1MOF A;  4B3M B;  1FXK B;  3K08 A;  2O57 A;  3JSN A;  4K0K B;  3GWO A;  3U11 A;  4J41 A;  5B1A B;  3N27 A;  2JGD B;  2DE0 X;  1NTZ H;  2RN9 A;  2GHY A;  4FLZ A;  4JI0 B;  3CJH B;  1KC8 W;  4DV1 O;  4H33 A;  3S3X A;  3R65 A;  1LR1 A;  4XBF A; 
#chains in the Genus database with same CATH homology
 3HR0 A;  3GVM A;  2VS0 A;  3FAV A;  3FD9 A;  4GZR B;  3O9O A;  3FAV B;  2B9Z A;  3Q4H A;  3Q4H B;  2DE0 X;  2KG7 A;  3TXQ A;  2AZ2 A;  1WA8 A;  3GWK C;  2KG7 B;  4LWS A;  4I0X A;  1WA8 B;  3TXS A;  3ZBH A;  4LWS B;  4I0X B;  2AZ0 A;  3OGI B;  4ABM A;  2VRZ A;  3G80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...