4U3FH

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
EELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 22
structure length 68
sequence length 68
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4u3fH00
3H1IH 3H1KH 4D6TH 3H1HH 1PPJH 3L71H 3H1LH 3L75H 1KYOF 1PP9H 1L0LH 2IBZH 3CX5F 1BCCH 1NTKH 3L70H 3TGUH 1L0NH 1NTMH 1SQPH 1SQVH 1SQQH 1NU1H 1EZVH 2A06H 4PD4F 2FYUH 4U3FH 1SQBH 3BCCH 3L74H 3CWBH 3CXHF 1KB9F 2BCCH 3H1JH 1BGYH 1P84F 1SQXH 3L73H 3L72H 1NTZH 5KLVH 1BE3H
chains in the Genus database with same CATH superfamily
2VQFO 3W7SA 3RYFA 4DV7B 4I50A 1B3QA 4X1KB 2B5UA 3BFRA 4EB6A 3W7WA 5DN6G 1Q8IA 1PM9A 2QWQB 3UT5A 1OCRB 4PELA 2JDIG 4YHHB 2XHBA 1YTFB 3CJHB 1GH6A 2ZM6B 4FLUA 3ETEA 1GMGA 4PHZA 2CE4A 1NKDA 2C2AA 4DR6B 4CC5A 5JJJB 1BCCH 3IGAC 3N27A 2ITCC 1RPRA 4YJ3B 2ODMA 2A06H 1VQMV 4RWUA 3CXCU 2R72A 4MVMA 5KHKA 1Q5OA 2BSKA 2Q67A 2KKWA 2EZOA 3ZN0A 3M8AA 2QA4V 1Y66A 3S3WA 4ZBMA 1JCHA 4WCEV 3D36C 4TUYA 3LDCA 1MOFA 3IC9A 3K03A 1URFA 1NTZH 2YXYA 4I4TB 2PTMA 2LFSA 1SA0B 1MMMA 1G8MA 3C90A 3ML0A 4KXRA 2ZXWC 1ZL8A 3T1YO 1WA8B 3R65A 1L0NH 2P6JA 1S77D 4H0LB 4DRXA 5LHHA 2EX3A 4NYKA 1N32O 5H6RA 1SQXH 4JI0B 3OMNB 3HKCB 1AR1B 2HR3A 3T4ZA 3G6BA 2WSSG 1IZ3A 4DV4O 4B3SO 3RYHA 3ZBHA 4R8CA 1N4CA 5LP6C 4MW3A 1FXKA 2KQXA 2QJ1A 1H2MA 4PDRA 3SYAA 4GX2A 1H2KA 4B3TO 5CMUA 4KFMA 4JI2B 2DN9A 5HFLA 1N36O 2HVJC 4LNUB 4O4LA 1V55C 3OUFA 2F23A 2QWNB 3HR0A 3H01A 1B04A 3ASNC 2GV9A 2XAHA 2WAMA 5IYDO 4PDLA 1Y74B 2X6CA 5LYJA 4JV5O 4MVUA 2NR5A 3G67A 5GTIZ 2R9IA 3ZMVA 4R50A 3I55V 1MNGA 2R70A 1DLBA 2EINB 2ZCEA 3DXRB 4UB8Z 4LF7B 3GWOA 3ZHTA 2VWKA 2Q9LA 1TGOA 2IJKA 4MTFA 3SPIA 2BTQA 2V7QG 3RN4A 5KX5B 2UXNA 1IURA 3OMIB 3MHSC 4MW8A 4X1IB 4FLZA 1EZVH 5BMVA 2AHYA 2AXTZ 5KMGB 4FM0A 1H2GA 4X8AA 5IYBO 2JRIA 4NXNB 2QE7G 2OCCC 4K3AA 1HNWB 5BZBA 4TQFA 4DR2O 4FLTA 2UXBO 5DEDA 1N0JA 3HKEA 5ITZA 3QVNA 3KCXA 1IBMB 4DW0A 4C7UA 4JYBA 3Q4HA 2HLDG 1ZSPA 5CA3A 5GONA 3L74H 3CHXA 3MHHC 3E8BA 2P22C 1XMQB 4TV8A 4DK1A 1N33B 2VWJA 4MVZA 5LXTB 3J80N 2AZ2A 1PD3A 4NVPA 4DUZO 1Y4MA 2XAQA 3EFFK 2WPDG 2CTWA 2VS0A 3JATB 2VQEO 1S76D 2FB5A 1F7YA 1WJZA 2BE3A 3QTCA 3N2GB 3OTOO 2ZR2A 3JAKA 3D8CA 4JI8O 3OAAG 3GVMA 2QKAA 4DV5O 2ATKC 1R6TA 1K8AW 3OW2U 1NTMH 1XDCA 3D3IA 3SJBC 4Z1MG 4DV3B 2M6YA 1XHZA 1ZX3A 2QWOB 1VQ7V 4F4LA 4LCUC 2A9HA 3K9SA 3JALB 4LR3A 4UCRA 1YIJV 5LMNO 5B1BC 1M57C 1SQVH 2QWPB 2MK3A 3LDEA 4MTXA 5L3DA 2WLMA 2AW9A 4F6RA 4LF5O 1IBLB 4DR4O 1YTFD 2JGDA 1D5AA 2L35A 1XQ8A 4IL6Z 4LF4B 5IWAO 2ZR3A 3UCSC 3B77A 2DJVA 3J7AU 1EZJA 3E89A 3T1CA 2K1EA 2UXDO 2ARHA 4LP8A 5EZYB 2XT9A 3HKDB 5JH7A 4RO2A 4JV5B 2UU9B 1QR8A 3D36A 1NTKH 1YXBA 1VIBA 3M99B 1X59A 4B3RB 3ZHVA 5JWPA 4KHPB 1JR9A 2WLHA 4GZRB 5JJNB 4JYAB 1EN6A 1WPXA 3HB3B 3G80A 2QTOA 4J9ZB 4BIOA 4J11A 3FD9A 2OWOA 4JI6B 3BY6A 3DC6A 2AHZA 3AG1C 3A0RA 1K7DA 3T1HO 4IHJA 3CXHF 1R3JC 4MS2A 3K9AA 2Q8VA 4HNAA 3H1IH 3ZMZA 1E79G 2HJDA 4CH4A 2KSDA 5IYZA 2WLIA 1L1FA 3STZC 3RYIB 4JAVA 2P4VA 2QGNA 1L0LH 5L3EA 1PL4A 2GUZA 3CC7V 2EINC 3JD2A 4UCOA 3ZCCA 3SDLA 2UUAB 4P2ZA 2HJFC 4X62B 3CRCA 3OD4A 1XILA 2LJ2A 2HHHO 1BL8A 4DR1O 1FXKC 1P49A 1KD1W 1SC5B 2RN9A 5EBWC 5KHJA 1R3KC 1I94O 1ZUQA 1FKAO 2KB1A 1P4RA 3L73H 4LFBB 1SERA 2H94A 2JVDA 4U7NA 4JI8B 2UXCO 1YVWA 1W2BU 2JJ2G 4B7EA 3ICXA 3HKBA 1JFFB 5C8YA 4QE7A 1VQ5V 3JAMN 3K79A 2ZNIA 5FPOA 3U0ZA 5EYPA 1Z2GA 5KUKA 1K97A 4NTYA 4P30A 2ADPA 1K33A 1WPBA 2Y4TA 4LF6O 4BIUA 1F4MA 4B7KA 4E4EA 3FAVB 1MA1A 1Z5VA 2VRZA 1YEWA 4QPJA 2PI5A 4ZOLB 4I0XB 2N74A 4O4IA 3OUSA 1SS3A 4OX9O 4LF5B 2FKXA 3B09A 2P67A 5CA0B 1H38A 3CRRA 4CH6A 2Q0AA 2BOBC 3RYCA 4L8JA 4X64O 4D7SA 4FLXA 1P7BA 3O65A 4I55A 2WLKA 1AVMA 3ZRWB 1BQ0A 4OGQB 5C93A 4W4KA 3TXSA 4DR5O 4LFAB 1US6A 2V4DA 3FB5C 1VQ6V 4X20B 3LSSA 1FJGB 4BIZA 3FYEB 1RM1B 2YI9A 1HDJA 4X1KA 1QBZA 2H8PC 3ZHQA 2LO1A 4NXMB 2X7RB 4ZKIA 1KKDA 3BVOA 1QU7A 2CGOA 3ASOB 5K1PA 3I5DA 1SQGA 5L3BA 1VQ9V 3ETGA 4UB6Z 3CJHA 3F5TA 3ZRVA 2DW4A 4NTXA 3AG2B 4J7JA 1UPGA 2Q6AA 2F4VO 4YJ3A 4JI7O 3K5NA 2DQ3A 1HNZB 2MW2B 4P9OA 1YCIA 3X2QB 1COWG 2QDOA 2GSMB 2QR4A 1B6QA 1XI1A 2Q73A 3P3PA 4AHCA 1VQ8V 4GX0A 5D5PA 4RUEA 5KHGA 3DGEA 4GCZA 2IBZH 3SPJA 4YY3O 5FNVB 3VBBA 4ZIBA 4JI3O 4BW5A 1PNLA 4I4TA 1AP5A 2E76B 4GKKO 1U96A 3AK2A 3F5WC 1SA0A 4IYHA 4LFCO 3LSUA 4DR1B 4FLYA 1WA8A 4HYOA 4LF9B 4NB5A 3CP1A 3CCMV 3CCVV 1FFXB 2HG5C 4YXWG 1F51A 3HKCA 4UCSA 3RVZA 2RQ6A 4WFBV 1XUQA 3EVKA 1H2NA 4UCTA 3L72H 5KHHA 1Q43A 2N05A 1NZ6A 4K35A 5K1XA 3BPZA 2P5OA 2RCVA 1KKCA 1GN3A 2GDSA 4OPHA 4ZI7B 1BSMA 5JQGB 1ROPA 4P9PA 1XNQO 1IDSA 4LNUA 2Q7HA 1B06A 4J41A 1BHBA 2RMKB 4FZ0A 1Q6UA 5IY5B 1EFRG 5EBLC 3ZHRA 4FIPC 3IAYA 1Y74A 3SJAC 2K9PA 3J81N 3SYOA 4DV0B 4LF8O 3K5OA 5B1NA 1QLEB 4LC1A 3AK1A 2Y0IA 2Y69B 4DR3O 4B3MB 1YITV 1AROP 2EIJB 3DXRA 4WFGA 4PA3A 5B3SB 4NTWA 4MTOA 3A0BZ 2P90A 3E35A 1QLNA 5IJ0B 5KX5A 4PA4A 3TK1A 1FYJA 4DR5B 4X1IA 3JAWB 3SJQC 5KAIZ 3SYCA 4DUYB 3AK3A 3CCLV 5KMGA 4U3JB 1F4NA 4JI5O 2Q68A 2A7WA 3DC5A 4JYCA 1YDXA 3IJ4A 4ZHQB 1AP6A 4DR7B 2JS5A 1TVKB 2QKSA 3ZHSA 4FFBB 1YJWV 3UO3A 3OEEG 1SRYA 3CE2A 4E2LA 4O4JB 2ILMA 2W6JG 1K4CC 1MABG 2YXHA 2IJHA 2WLJA 4TOIA 2UUCO 2ZQMA 5LXTA 4PA6A 2W6IG 3H1HH 1XL6A 4X66B 4MT8A 3OGCC 3JATA 4K8ZA 1QVFU 4TV9B 4JI4B 4QGPA 2ZDIC 2YIAA 3N2GA 5LHGA 1O9GA 2IM9A 4J42A 1QHTA 3RFRA 4X65B 4TSFG 1YSCA 2LGQA 3ABKB 1VQKV 2VQFB 1IXMA 4TQDA 3JYCA 5LGUA 1U97A 3SPCA 3QO8A 1CP9A 1M90W 2XNDG 1O9HA 3RBZA 2DWEC 1G1XB 1AILA 2D2CB 1K3EA 1RSOB 2E3CA 2N04A 3CCRV 4U3FH 1IVSA 3AG2C 4JZGA 1OZ0A 1FXHA 1TUBB 4CH3A 3CCJV 4QPKA 2EJ7A 1V9PA 3JCZA 3JALA 3E8FA 2F95B 1WN7A 3JARB 1WB8A 3LNMB 4JPRA 5LA6B 1D2DA 1ZLZA 2YUAA 3E22B 1PNMA 1I5YA 5H6QA 2AZ0A 3R66A 1KP2A 1I7FA 1VF5B 5DECA 4FM2A 1PNKA 4G27B 1DGSA 2PI4A 1VF7A 3TETA 3K58A 4WBNB 5CBFA 2P4KA 4O2BB 2R9AA 4X9QA 1YJNV 1BS3A 1DF5A 3JASB 4I7ZB 1OCRC 3RVYA 3VOUA 1KUQA 4WFHA 2A79B 1YI2V 4GKJO 3GWKC 4DV6O 3ZMTA 5EZYA 3NR7A 3HKDA 5B66Z 3ABLB 3K5LA 1R3IC 2X0LA 5EC1C 1HWYA 4WF9V 4N23A 3T1YB 2LGWA 2PGGA 3ABUA 1KP3A 1WAZA 2GTSA 1N32B 1W0KG 3B8NA 4G28B 4IT5A 3K59A 4DV4B 4B3SB 2OYQA 3CS5A 2G38A 2IJIA 2QSAA 2CTPA 4UVCA 2YXLA 1N34O 3JD1A 1GAXA 3OEHG 1I0HA 1NT2B 4RQFA 4B3TB 5IY5C 3CB2A 4JI5B 4DYLA 1J5EO 1VP7A 2ZINA 3VQWA 2E5LO 1G4YB 2DMXA 1N36B 2CH7B 4YJ2B 3BEHA 4Q6GA 1AJNA 4LBEC 3O9OA 3RYIA 2IH3C 4MVSA 1BMFG 4GX5A 3PJSK 2RJZA 2YDEA 3FKSG 5B1OA 3CCEV 1VMGA 3BABA 4UV8A 3A2FA 2EIJC 2EIMB 3IFXA 5J2TB 2M7WA 5B3SC 2FYUH 3ZIAG 2B1GA 1KMIZ 1WP7A 4CS4A 2LQTA 3B2EE 3OR6C 1S5JA 1IBKO 1FD9A 5L3FA 1JQ0A 1J95A 3MAQA 2ZKOA 2JK5C 3LNNA 2DYSB 4TT3G 1AR5A 1SZTA 2YSUB 3K0DA 1M56B 1EM1A 4IIJB 4CC6A 5LBQA 2CGNA 3W7TA 3FX7A 5IYCO 3LDDA 3H1JH 4UCUA 1XMOO 3JD0A 4Z2WA 4DR2B 3ZX6A 3ETDA 2UXBB 1JFFA 1K5SA 4IGGA 2OCHA 2Q7GA 4HAMA 4QE9A 3F7VC 3F7YC 1NI8A 4YIPA 2F1MA 5EK0A 3DSQA 3JSLA 3U11A 3K08A 5H2FZ 2Y0PA 3ABTA 1R1BA 4K0KO 4UUJC 4DV2O 2XAFA 3FAVA 1EN4A 2WA3A 1K73W 4ZOLA 5EIBC 4QJFB 1GM7A 2E74B 4I0XA 3FYIB 4DV7O 2HP8A 4DUZB 4J9YB 1EN5A 5KAFZ 3L70H 2PZSA 1THZA 1M5IA 2VQEB 4UXNA 1SQPH 5CA0A 1HNXO 3OTOB 1LUWA 4EKWA 1FAFA 3B4SA 2GTAA 4HBNA 2X6BA 1JPXA 2ZM6O 4DV5B 1KQSU 1AI6A 3ZRWA 3ABMB 1DTOA 4DW1A 4DR6O 4X20A 2ZDIA 5EIBD 3CCSV 1S5HC 4CBCA 2OTLV 1SESA 3CCQV 4AILC 2BCCH 4MSWC 1AJQA 1SF9A 1XBLA 2CTQA 1NBMG 1XREA 3STLC 2DOSA 3ZHUA 2OTJV 1NR1A 1SETA 3C3TA 4QIWF 1UJWB 1HP8A 3THOA 1IX9A 5LMNB 1NJIW 3K0GA 5LP6B 2OIGA 1AR4A 5CA1B 3BRCA 4KUMA 2WLLB 1G6UA 1M93A 4DR4B 2ZE8A 1XNRO 3WU2Z 3A8TA 2UUBO 4PA9A 1N34B 2GHYA 1V55B 4WFFA 4GT1A 1QCEA 1K34A 3JSNA 4JTAB 2YC0A 5IJ9B 1GM9A 5IWAB 3G4SV 1TUEB 4KP4A 1GN4A 2Z5UA 3L9DA 1VEWA 1N0NA 1QQCA 3RT3C 5IDJA 3I56V 4D7TA 3OFNG 4H44B 2UXDB 1W59A 5J2UB 4MVQA 3AEIA 1OV9A 5F2VO 1K9MW 4A5UB 5FNVA 3SPHA 4ASUG 4O2AB 3U10A 1D5NA 3CX5F 5H9CA 2RNBA 2NN4A 2JEXA 1S72V 1RFYA 5LHIA 2YS8A 4JI2O 3VQYA 4FVMA 4QNHB 3CC4V 4LWSB 2AGAA 5LOVB 4WFEA 4JZ2A 2YEVB 4DV1O 1FFXA 3ZN1A 2FL4A 4DK0A 1SZXA 4PI0A 1MSWD 1WNSA 3T1HB 4K8XA 2HEPA 1AI7A 3RWRD 4OPAA 3CWBH 4PV1B 1BQZA 3CRMA 3WB1A 1XHXA 4ZI7A 2EIMC 5JQGA 4LF7O 3AG7A 4PDVA 1IXBA 5TISZ 4JGSA 4UFZA 4AI8A 2WWWA 3W7UA 4MTGA 2OIEA 2FTKA 2W0FC 2QEXV 4AQYO 2XTAA 1I5XA 2DQ0A 5BR8O 2KG7B 1Y76B 3SJCC 4BAYA 4MVOA 1XEQA 4NXNO 1KBHA 3RW0A 2DYSC 1HNWO 3ZJZA 2HHHB 5FLXN 1M56C 4UVBA 3CMAV 2EILB 4Z1VA 3KZIZ 1IBMO 1I94B 1HNXB 4FPPA 2B9ZA 2HKOA 4FJCC 1Q6IA 2Y4UA 1GM8A 4RAIA 3D3QA 3S3XA 3A0HZ 4G2KA 1Y6XA 5IJ0A 4J7KA 3B8MA 3N2KB 4X1YB 1VQOV 1H8EG 1XMQO 2UXCB 1ORQC 3OT7A 5L3GA 1R6NA 3JAWA 5CBGA 1N33O 3CMEV 5JCOC 3H1LH 4R7CA 3OTFA 4U3JA 4EFBA 3BA9A 1FS0G 4ZHQA 4O4HB 3SGIA 2L6LA 2PYJA 1GN2A 1W0JG 2H3OA 5CB4B 1TVKA 2ZE5A 5JVDB 4FFBA 1M57B 5B1BB 4LH6A 4LF6B 4JI1O 3WG7B 1YF2A 3FFQA 5B1AB 4O4JA 3CC2V 3RYFB 4FLWA 1QVGU 4CZZA 4DO2A 4I50B 3W7XA 3QF7A 1JA8A 4I9WA 1WB7A 4OX9B 4EB6B 1XNRB 5CBHA 2UUBB 5LGTA 1E1QG 2NLJC 3OM3B 3SYQA 3ABMC 4DV3O 1YJ9V 3UT5B 3PN1A 3CRAA 3UQ8A 4X64B 1XL4A 3WB2A 4TV9A 3K06A 1TA8A 2JEUA 1JOYA 1KYOF 1FXVA 4L87A 4I9QA 2QWRB 2JS3A 1JJOA 2ZNJA 4CS2A 4BR6A 1ZWIC 1NH2B 2Q5ZA 2HVKC 1JMKC 3G6EV 1BGYH 5B5EZ 2D3OW 1IBLO 4YIOA 3HPLC 5BXZA 2BSKB 2F93B 1RSOA 1Q86W 3ZMSA 2XUMA 2BOCC 1Q82W 4FMTA 2XAJA 4LF4O 3CEIA 3OR7C 3AG3B 1OCOB 1TUBA 4F6EA 4PD4F 3ZMUA 4TUYB 2YIBD 1TAEA 3GB7C 3JARA 3AG1B 1BE3H 5LA6A 2V1DA 4DV1B 1QNMA 1DF4A 3H1KH 4OXSA 2F4VB 5H5NA 3E22A 5KUMA 2BTOA 4JI7B 1KC8W 1N8RW 2UU9O 2JIZG 2EULA 1A32A 1WP8A 1RM1C 1ZL8B 4UVAA 2RDCA 4B3RO 2QM8A 3M7MX 1AB3A 1PL0A 4KHPO 4WBNA 4DRXB 2ZIOA 4KL1A 4O2BA 3ASOC 3SR2C 1K92A 3L71H 3JASA 4JYAO 2YIDA 2PYLA 2A0LA 4YY3B 4PA7A 3RYHB 4AQYB 4JI3B 3B40A 5BR8B 4JI6O 1FXKB 4GKKB 1NU1H 1NS1A 1ZAUA 4UV9A 1NR7A 1H8HG 1R6KA 1M4UA 4LFCB 5KLVH 4HZ3A 2EJRA 4O4LB 1OJHA 2XAGA 1GO3F 2PY5A 5J9PC 1S3JA 1Q81W 2QTSA 3ZEDA 1QR9A 1ENVA 1NVPB 5LYJB 3X2QC 1M1KW 1VQNV 4RUFA 1ZTEA 1YHQV 1M9NA 4FK5C 1VF6C 2UUAO 4JAAA 2IU0A 4X62O 5HFMA 1SKVA 2B1IA 1MZEA 1V54B 1KU9A 1XNQB 1L8DA 3K5MA 1R3LC 2LW7A 1GK9A 2CH7A 4J7ZA 3MDSA 2BTQB 5LGNA 4YJ2A 4EFEA 1OCCB 4J80A 2DE0X 2XASA 3ZRXA 4IYIA 4JASA 4XBFA 3TCUA 1RP3B 3QNEA 4JI1B 5D5QA 4LFBO 5BMVB 1LUVA 1PKXA 1NQTA 2EILC 4X89A 4H37A 4DXWA 5J2TA 2ZE7A 4LF8B 5EC2C 1KECA 4MVRA 5BY1A 4DR3B 3K3WA 4LH7A 3HKEB 2ETNA 4FFKA 1FFTB 5ITZB 2XOKG 4X88A 2Q4PA 3Q4HB 5LMUO 1CEZA 3TJTA 1UFIA 5GONB 1RPOA 3IC7A 4BW9A 3KKYA 4TV8B 3AG4B 3QG5A 3E86A 1SQFA 4JTDB 4IIJA 3UM7A 2DYRB 2Q0OC 4JAUA 4GUNA 3OGIB 1FPOA 4GYCB 1SQBH 1Y67A 1H2LA 3BCCH 2YICA 3E8HA 3WG7C 2Q7EA 1P84F 5B1AC 3QO7A 3CPWU 1VARA 1T5EA 1QLEC 4U7OA 2Y69C 4D6TH 5JCOA 3C3SA 3JAKB 3JD4A 4J10A 2JGUA 2Z3YA 3FB8C 3UKMA 1AI4A 1HW7A 2EIKB 1HR0O 4NKGB 3VQVA 4LFAO 2YI8A 2UUCB 1MG1A 3SPGA 2ADQB 1FJGO 2WA4A 3DTUB 4FZ1A 2NNUA 3MD0A 2LFRA 2R9RB 4RQEA 4CS3A 4NXMO 4NR1A 1OCZB 2EZPA 3P32A 2E75B 2IU3A 5GW7A 3EXAA 3E2EA 2PF4E 3TXQA 4XDLA 2CUGA 2Y48A 3G71V 1AJPA 5IE9A 1BHAA 2GBOA 2UXXA 1KB9F 4JYYA 2CTRA 2CAZC 3WFVA 3E8GA 2O57A 4F6RB 4GLXA 4H33A 2LW1A 2ZIMA 3AG3C 2X6AA 1OCOC 2JGDB 5KA5A 2CK3G 1Q6HA 4XDJA 2YIBA 3FB7C 1LNQA 3H9VA 1HNZO 1NH2D 3APQA 2QM7A 3LUTB 3WB0A 1LR1A 4PJ0Z 2WLNA 1JJ2U 1CXZB 3BA8A 1R73A 1CPYA 5LP6A 3JD3A 1EBOA 5CA1A 2PUSA 4JTCB 2JJ1G 1PV0A 5LL6Y 2WLLA 5JH7B 3ABKC 1P7GA 4Q20A 2ZE6A 1VQLV 2EBOA 4FM1A 4W4LA 4YHHO 5IJ9A 3OMAB 4H13B 1MSDA 1S0VA 2QKCA 3OE7G 3QO5A 2HFEC 3L75H 1X4TA 1Q3EA 4TWKA 5FPRA 4LF9O 3CD6V 4EEQA 4UCVA 5AG2A 2F43G 5J2UA 2ZXWB 5CN0A 5FL7G 4GKJB 2ZT9B 1H2SB 1K5QA 4DV6B 3EHBB 3CSXA 1K4DC 4ABMA 4FLVA 4IHJB 2P06A 1I08A 4O2AA 4B08A 4WFAV 2Q69A 3SYPA 1XOUA 1PPJH 5JJEB 4HNAB 5IT9N 1PP9H 3NXSA 1Q7YW 5IYZB 2WLIB 1WLEA 3RGBA 2DWDC 2IW5A 2OT5A 5LMUB 3JCUZ 3BHPA 1GRJA 4LWSA 2GUZB 3LSQA 5LOVA 1MZFA 2ITDC 1V54C 2YEVA 2P7TC 3K57A 5A2QN 1JX9A 3VQXA 4ICGA 1VQ4V 3K04A 3T4DA 4I5SA 1OCCC 3E83A 3ASNB 4DV0O 1J5EB 2E5LB 4R6ZA 4B3MO 2QM4A 4JF3A 1NVPD 2ZD9A 1Z5WA 1S5LZ 1SQQH 1F23A 4XDKA 3P30A 1AI5A 1VF6A 1OHHG 3ABLC 4JI0O 4CH5A 3T2MA 2LP7A 1E1RG 2W0XA 1HR0B 3FB6C 3CYOA 1Q90D 5L3CA 2KG7A 4DUYO 4N21A 3HKBB 3KG2A 5C8YB 1Y76A 1YZBA 5KHIA 1IBKB 1JVMA 3AG4C 5EYPB 1BT8A 4DR7O 2IH1C 2DYRC 2OCCB 1BZKA 4PI2A 2Z0AA 5GTHZ 5E1AC 3TGUH 1VQPV 3ZS8C 1GKFA 4X1YA 3N2KA 5E79Z 1GN6A 3CRQA 3ETQA 1DK1A 2CDYA 1XMOB 4O4IB 5A9GA 3BAAA 3APOA 2IJJA 1GTOA 4O4HA 3RYCB 2EIKC 3ZRSA 2FMLA 2A3QA 4PDMA 4X66O 5KA6A 5CB4A 3UO2A 5DM6V 3CCUV 4JI4O 2F66C 3P3NA 5JVDA 4I55B 4K0KB 3KCYA 5EBMC 4DV2B 4BWAA 4X65O 1OCZC 4GX1A
chains in the Genus database with same CATH topology
3H1IH 3H1KH 4D6TH 3H1HH 1PPJH 3L71H 3H1LH 3L75H 1KYOF 1PP9H 1L0LH 2IBZH 3CX5F 1BCCH 1NTKH 3L70H 3TGUH 1L0NH 1NTMH 1SQPH 1SQVH 1SQQH 1NU1H 1EZVH 2A06H 4PD4F 2FYUH 4U3FH 1SQBH 3BCCH 3L74H 3CWBH 3CXHF 1KB9F 2BCCH 3H1JH 1BGYH 1P84F 1SQXH 3L73H 3L72H 1NTZH 5KLVH 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I H;  3H1K H;  4D6T H;  3H1H H;  1PPJ H;  3L71 H;  3H1L H;  3L75 H;  1KYO F;  1PP9 H;  1L0L H;  2IBZ H;  3CX5 F;  1BCC H;  1NTK H;  3L70 H;  3TGU H;  1L0N H;  1NTM H;  1SQP H;  1SQV H;  1SQQ H;  1NU1 H;  1EZV H;  2A06 H;  4PD4 F;  2FYU H;  4U3F H;  1SQB H;  3BCC H;  3L74 H;  3CWB H;  3CXH F;  1KB9 F;  2BCC H;  3H1J H;  1BGY H;  1P84 F;  1SQX H;  3L73 H;  3L72 H;  1NTZ H;  5KLV H;  1BE3 H; 
#chains in the Genus database with same CATH topology
 2VQF O;  3W7S A;  3RYF A;  4DV7 B;  4I50 A;  1B3Q A;  4X1K B;  2B5U A;  3BFR A;  4EB6 A;  3W7W A;  5DN6 G;  1Q8I A;  1PM9 A;  2QWQ B;  3UT5 A;  1OCR B;  4PEL A;  2JDI G;  4YHH B;  2XHB A;  1YTF B;  3CJH B;  1GH6 A;  2ZM6 B;  4FLU A;  3ETE A;  1GMG A;  4PHZ A;  2CE4 A;  1NKD A;  2C2A A;  4DR6 B;  4CC5 A;  5JJJ B;  1BCC H;  3IGA C;  3N27 A;  2ITC C;  1RPR A;  4YJ3 B;  2ODM A;  2A06 H;  1VQM V;  4RWU A;  3CXC U;  2R72 A;  4MVM A;  5KHK A;  1Q5O A;  2BSK A;  2Q67 A;  2KKW A;  2EZO A;  3ZN0 A;  3M8A A;  2QA4 V;  1Y66 A;  3S3W A;  4ZBM A;  1JCH A;  4WCE V;  3D36 C;  4TUY A;  3LDC A;  1MOF A;  3IC9 A;  3K03 A;  1URF A;  1NTZ H;  2YXY A;  4I4T B;  2PTM A;  2LFS A;  1SA0 B;  1MMM A;  1G8M A;  3C90 A;  3ML0 A;  4KXR A;  2ZXW C;  1ZL8 A;  3T1Y O;  1WA8 B;  3R65 A;  1L0N H;  2P6J A;  1S77 D;  4H0L B;  4DRX A;  5LHH A;  2EX3 A;  4NYK A;  1N32 O;  5H6R A;  1SQX H;  4JI0 B;  3OMN B;  3HKC B;  1AR1 B;  2HR3 A;  3T4Z A;  3G6B A;  2WSS G;  1IZ3 A;  4DV4 O;  4B3S O;  3RYH A;  3ZBH A;  4R8C A;  1N4C A;  5LP6 C;  4MW3 A;  1FXK A;  2KQX A;  2QJ1 A;  1H2M A;  4PDR A;  3SYA A;  4GX2 A;  1H2K A;  4B3T O;  5CMU A;  4KFM A;  4JI2 B;  2DN9 A;  5HFL A;  1N36 O;  2HVJ C;  4LNU B;  4O4L A;  1V55 C;  3OUF A;  2F23 A;  2QWN B;  3HR0 A;  3H01 A;  1B04 A;  3ASN C;  2GV9 A;  2XAH A;  2WAM A;  5IYD O;  4PDL A;  1Y74 B;  2X6C A;  5LYJ A;  4JV5 O;  4MVU A;  2NR5 A;  3G67 A;  5GTI Z;  2R9I A;  3ZMV A;  4R50 A;  3I55 V;  1MNG A;  2R70 A;  1DLB A;  2EIN B;  2ZCE A;  3DXR B;  4UB8 Z;  4LF7 B;  3GWO A;  3ZHT A;  2VWK A;  2Q9L A;  1TGO A;  2IJK A;  4MTF A;  3SPI A;  2BTQ A;  2V7Q G;  3RN4 A;  5KX5 B;  2UXN A;  1IUR A;  3OMI B;  3MHS C;  4MW8 A;  4X1I B;  4FLZ A;  1EZV H;  5BMV A;  2AHY A;  2AXT Z;  5KMG B;  4FM0 A;  1H2G A;  4X8A A;  5IYB O;  2JRI A;  4NXN B;  2QE7 G;  2OCC C;  4K3A A;  1HNW B;  5BZB A;  4TQF A;  4DR2 O;  4FLT A;  2UXB O;  5DED A;  1N0J A;  3HKE A;  5ITZ A;  3QVN A;  3KCX A;  1IBM B;  4DW0 A;  4C7U A;  4JYB A;  3Q4H A;  2HLD G;  1ZSP A;  5CA3 A;  5GON A;  3L74 H;  3CHX A;  3MHH C;  3E8B A;  2P22 C;  1XMQ B;  4TV8 A;  4DK1 A;  1N33 B;  2VWJ A;  4MVZ A;  5LXT B;  3J80 N;  2AZ2 A;  1PD3 A;  4NVP A;  4DUZ O;  1Y4M A;  2XAQ A;  3EFF K;  2WPD G;  2CTW A;  2VS0 A;  3JAT B;  2VQE O;  1S76 D;  2FB5 A;  1F7Y A;  1WJZ A;  2BE3 A;  3QTC A;  3N2G B;  3OTO O;  2ZR2 A;  3JAK A;  3D8C A;  4JI8 O;  3OAA G;  3GVM A;  2QKA A;  4DV5 O;  2ATK C;  1R6T A;  1K8A W;  3OW2 U;  1NTM H;  1XDC A;  3D3I A;  3SJB C;  4Z1M G;  4DV3 B;  2M6Y A;  1XHZ A;  1ZX3 A;  2QWO B;  1VQ7 V;  4F4L A;  4LCU C;  2A9H A;  3K9S A;  3JAL B;  4LR3 A;  4UCR A;  1YIJ V;  5LMN O;  5B1B C;  1M57 C;  1SQV H;  2QWP B;  2MK3 A;  3LDE A;  4MTX A;  5L3D A;  2WLM A;  2AW9 A;  4F6R A;  4LF5 O;  1IBL B;  4DR4 O;  1YTF D;  2JGD A;  1D5A A;  2L35 A;  1XQ8 A;  4IL6 Z;  4LF4 B;  5IWA O;  2ZR3 A;  3UCS C;  3B77 A;  2DJV A;  3J7A U;  1EZJ A;  3E89 A;  3T1C A;  2K1E A;  2UXD O;  2ARH A;  4LP8 A;  5EZY B;  2XT9 A;  3HKD B;  5JH7 A;  4RO2 A;  4JV5 B;  2UU9 B;  1QR8 A;  3D36 A;  1NTK H;  1YXB A;  1VIB A;  3M99 B;  1X59 A;  4B3R B;  3ZHV A;  5JWP A;  4KHP B;  1JR9 A;  2WLH A;  4GZR B;  5JJN B;  4JYA B;  1EN6 A;  1WPX A;  3HB3 B;  3G80 A;  2QTO A;  4J9Z B;  4BIO A;  4J11 A;  3FD9 A;  2OWO A;  4JI6 B;  3BY6 A;  3DC6 A;  2AHZ A;  3AG1 C;  3A0R A;  1K7D A;  3T1H O;  4IHJ A;  3CXH F;  1R3J C;  4MS2 A;  3K9A A;  2Q8V A;  4HNA A;  3H1I H;  3ZMZ A;  1E79 G;  2HJD A;  4CH4 A;  2KSD A;  5IYZ A;  2WLI A;  1L1F A;  3STZ C;  3RYI B;  4JAV A;  2P4V A;  2QGN A;  1L0L H;  5L3E A;  1PL4 A;  2GUZ A;  3CC7 V;  2EIN C;  3JD2 A;  4UCO A;  3ZCC A;  3SDL A;  2UUA B;  4P2Z A;  2HJF C;  4X62 B;  3CRC A;  3OD4 A;  1XIL A;  2LJ2 A;  2HHH O;  1BL8 A;  4DR1 O;  1FXK C;  1P49 A;  1KD1 W;  1SC5 B;  2RN9 A;  5EBW C;  5KHJ A;  1R3K C;  1I94 O;  1ZUQ A;  1FKA O;  2KB1 A;  1P4R A;  3L73 H;  4LFB B;  1SER A;  2H94 A;  2JVD A;  4U7N A;  4JI8 B;  2UXC O;  1YVW A;  1W2B U;  2JJ2 G;  4B7E A;  3ICX A;  3HKB A;  1JFF B;  5C8Y A;  4QE7 A;  1VQ5 V;  3JAM N;  3K79 A;  2ZNI A;  5FPO A;  3U0Z A;  5EYP A;  1Z2G A;  5KUK A;  1K97 A;  4NTY A;  4P30 A;  2ADP A;  1K33 A;  1WPB A;  2Y4T A;  4LF6 O;  4BIU A;  1F4M A;  4B7K A;  4E4E A;  3FAV B;  1MA1 A;  1Z5V A;  2VRZ A;  1YEW A;  4QPJ A;  2PI5 A;  4ZOL B;  4I0X B;  2N74 A;  4O4I A;  3OUS A;  1SS3 A;  4OX9 O;  4LF5 B;  2FKX A;  3B09 A;  2P67 A;  5CA0 B;  1H38 A;  3CRR A;  4CH6 A;  2Q0A A;  2BOB C;  3RYC A;  4L8J A;  4X64 O;  4D7S A;  4FLX A;  1P7B A;  3O65 A;  4I55 A;  2WLK A;  1AVM A;  3ZRW B;  1BQ0 A;  4OGQ B;  5C93 A;  4W4K A;  3TXS A;  4DR5 O;  4LFA B;  1US6 A;  2V4D A;  3FB5 C;  1VQ6 V;  4X20 B;  3LSS A;  1FJG B;  4BIZ A;  3FYE B;  1RM1 B;  2YI9 A;  1HDJ A;  4X1K A;  1QBZ A;  2H8P C;  3ZHQ A;  2LO1 A;  4NXM B;  2X7R B;  4ZKI A;  1KKD A;  3BVO A;  1QU7 A;  2CGO A;  3ASO B;  5K1P A;  3I5D A;  1SQG A;  5L3B A;  1VQ9 V;  3ETG A;  4UB6 Z;  3CJH A;  3F5T A;  3ZRV A;  2DW4 A;  4NTX A;  3AG2 B;  4J7J A;  1UPG A;  2Q6A A;  2F4V O;  4YJ3 A;  4JI7 O;  3K5N A;  2DQ3 A;  1HNZ B;  2MW2 B;  4P9O A;  1YCI A;  3X2Q B;  1COW G;  2QDO A;  2GSM B;  2QR4 A;  1B6Q A;  1XI1 A;  2Q73 A;  3P3P A;  4AHC A;  1VQ8 V;  4GX0 A;  5D5P A;  4RUE A;  5KHG A;  3DGE A;  4GCZ A;  2IBZ H;  3SPJ A;  4YY3 O;  5FNV B;  3VBB A;  4ZIB A;  4JI3 O;  4BW5 A;  1PNL A;  4I4T A;  1AP5 A;  2E76 B;  4GKK O;  1U96 A;  3AK2 A;  3F5W C;  1SA0 A;  4IYH A;  4LFC O;  3LSU A;  4DR1 B;  4FLY A;  1WA8 A;  4HYO A;  4LF9 B;  4NB5 A;  3CP1 A;  3CCM V;  3CCV V;  1FFX B;  2HG5 C;  4YXW G;  1F51 A;  3HKC A;  4UCS A;  3RVZ A;  2RQ6 A;  4WFB V;  1XUQ A;  3EVK A;  1H2N A;  4UCT A;  3L72 H;  5KHH A;  1Q43 A;  2N05 A;  1NZ6 A;  4K35 A;  5K1X A;  3BPZ A;  2P5O A;  2RCV A;  1KKC A;  1GN3 A;  2GDS A;  4OPH A;  4ZI7 B;  1BSM A;  5JQG B;  1ROP A;  4P9P A;  1XNQ O;  1IDS A;  4LNU A;  2Q7H A;  1B06 A;  4J41 A;  1BHB A;  2RMK B;  4FZ0 A;  1Q6U A;  5IY5 B;  1EFR G;  5EBL C;  3ZHR A;  4FIP C;  3IAY A;  1Y74 A;  3SJA C;  2K9P A;  3J81 N;  3SYO A;  4DV0 B;  4LF8 O;  3K5O A;  5B1N A;  1QLE B;  4LC1 A;  3AK1 A;  2Y0I A;  2Y69 B;  4DR3 O;  4B3M B;  1YIT V;  1ARO P;  2EIJ B;  3DXR A;  4WFG A;  4PA3 A;  5B3S B;  4NTW A;  4MTO A;  3A0B Z;  2P90 A;  3E35 A;  1QLN A;  5IJ0 B;  5KX5 A;  4PA4 A;  3TK1 A;  1FYJ A;  4DR5 B;  4X1I A;  3JAW B;  3SJQ C;  5KAI Z;  3SYC A;  4DUY B;  3AK3 A;  3CCL V;  5KMG A;  4U3J B;  1F4N A;  4JI5 O;  2Q68 A;  2A7W A;  3DC5 A;  4JYC A;  1YDX A;  3IJ4 A;  4ZHQ B;  1AP6 A;  4DR7 B;  2JS5 A;  1TVK B;  2QKS A;  3ZHS A;  4FFB B;  1YJW V;  3UO3 A;  3OEE G;  1SRY A;  3CE2 A;  4E2L A;  4O4J B;  2ILM A;  2W6J G;  1K4C C;  1MAB G;  2YXH A;  2IJH A;  2WLJ A;  4TOI A;  2UUC O;  2ZQM A;  5LXT A;  4PA6 A;  2W6I G;  3H1H H;  1XL6 A;  4X66 B;  4MT8 A;  3OGC C;  3JAT A;  4K8Z A;  1QVF U;  4TV9 B;  4JI4 B;  4QGP A;  2ZDI C;  2YIA A;  3N2G A;  5LHG A;  1O9G A;  2IM9 A;  4J42 A;  1QHT A;  3RFR A;  4X65 B;  4TSF G;  1YSC A;  2LGQ A;  3ABK B;  1VQK V;  2VQF B;  1IXM A;  4TQD A;  3JYC A;  5LGU A;  1U97 A;  3SPC A;  3QO8 A;  1CP9 A;  1M90 W;  2XND G;  1O9H A;  3RBZ A;  2DWE C;  1G1X B;  1AIL A;  2D2C B;  1K3E A;  1RSO B;  2E3C A;  2N04 A;  3CCR V;  4U3F H;  1IVS A;  3AG2 C;  4JZG A;  1OZ0 A;  1FXH A;  1TUB B;  4CH3 A;  3CCJ V;  4QPK A;  2EJ7 A;  1V9P A;  3JCZ A;  3JAL A;  3E8F A;  2F95 B;  1WN7 A;  3JAR B;  1WB8 A;  3LNM B;  4JPR A;  5LA6 B;  1D2D A;  1ZLZ A;  2YUA A;  3E22 B;  1PNM A;  1I5Y A;  5H6Q A;  2AZ0 A;  3R66 A;  1KP2 A;  1I7F A;  1VF5 B;  5DEC A;  4FM2 A;  1PNK A;  4G27 B;  1DGS A;  2PI4 A;  1VF7 A;  3TET A;  3K58 A;  4WBN B;  5CBF A;  2P4K A;  4O2B B;  2R9A A;  4X9Q A;  1YJN V;  1BS3 A;  1DF5 A;  3JAS B;  4I7Z B;  1OCR C;  3RVY A;  3VOU A;  1KUQ A;  4WFH A;  2A79 B;  1YI2 V;  4GKJ O;  3GWK C;  4DV6 O;  3ZMT A;  5EZY A;  3NR7 A;  3HKD A;  5B66 Z;  3ABL B;  3K5L A;  1R3I C;  2X0L A;  5EC1 C;  1HWY A;  4WF9 V;  4N23 A;  3T1Y B;  2LGW A;  2PGG A;  3ABU A;  1KP3 A;  1WAZ A;  2GTS A;  1N32 B;  1W0K G;  3B8N A;  4G28 B;  4IT5 A;  3K59 A;  4DV4 B;  4B3S B;  2OYQ A;  3CS5 A;  2G38 A;  2IJI A;  2QSA A;  2CTP A;  4UVC A;  2YXL A;  1N34 O;  3JD1 A;  1GAX A;  3OEH G;  1I0H A;  1NT2 B;  4RQF A;  4B3T B;  5IY5 C;  3CB2 A;  4JI5 B;  4DYL A;  1J5E O;  1VP7 A;  2ZIN A;  3VQW A;  2E5L O;  1G4Y B;  2DMX A;  1N36 B;  2CH7 B;  4YJ2 B;  3BEH A;  4Q6G A;  1AJN A;  4LBE C;  3O9O A;  3RYI A;  2IH3 C;  4MVS A;  1BMF G;  4GX5 A;  3PJS K;  2RJZ A;  2YDE A;  3FKS G;  5B1O A;  3CCE V;  1VMG A;  3BAB A;  4UV8 A;  3A2F A;  2EIJ C;  2EIM B;  3IFX A;  5J2T B;  2M7W A;  5B3S C;  2FYU H;  3ZIA G;  2B1G A;  1KMI Z;  1WP7 A;  4CS4 A;  2LQT A;  3B2E E;  3OR6 C;  1S5J A;  1IBK O;  1FD9 A;  5L3F A;  1JQ0 A;  1J95 A;  3MAQ A;  2ZKO A;  2JK5 C;  3LNN A;  2DYS B;  4TT3 G;  1AR5 A;  1SZT A;  2YSU B;  3K0D A;  1M56 B;  1EM1 A;  4IIJ B;  4CC6 A;  5LBQ A;  2CGN A;  3W7T A;  3FX7 A;  5IYC O;  3LDD A;  3H1J H;  4UCU A;  1XMO O;  3JD0 A;  4Z2W A;  4DR2 B;  3ZX6 A;  3ETD A;  2UXB B;  1JFF A;  1K5S A;  4IGG A;  2OCH A;  2Q7G A;  4HAM A;  4QE9 A;  3F7V C;  3F7Y C;  1NI8 A;  4YIP A;  2F1M A;  5EK0 A;  3DSQ A;  3JSL A;  3U11 A;  3K08 A;  5H2F Z;  2Y0P A;  3ABT A;  1R1B A;  4K0K O;  4UUJ C;  4DV2 O;  2XAF A;  3FAV A;  1EN4 A;  2WA3 A;  1K73 W;  4ZOL A;  5EIB C;  4QJF B;  1GM7 A;  2E74 B;  4I0X A;  3FYI B;  4DV7 O;  2HP8 A;  4DUZ B;  4J9Y B;  1EN5 A;  5KAF Z;  3L70 H;  2PZS A;  1THZ A;  1M5I A;  2VQE B;  4UXN A;  1SQP H;  5CA0 A;  1HNX O;  3OTO B;  1LUW A;  4EKW A;  1FAF A;  3B4S A;  2GTA A;  4HBN A;  2X6B A;  1JPX A;  2ZM6 O;  4DV5 B;  1KQS U;  1AI6 A;  3ZRW A;  3ABM B;  1DTO A;  4DW1 A;  4DR6 O;  4X20 A;  2ZDI A;  5EIB D;  3CCS V;  1S5H C;  4CBC A;  2OTL V;  1SES A;  3CCQ V;  4AIL C;  2BCC H;  4MSW C;  1AJQ A;  1SF9 A;  1XBL A;  2CTQ A;  1NBM G;  1XRE A;  3STL C;  2DOS A;  3ZHU A;  2OTJ V;  1NR1 A;  1SET A;  3C3T A;  4QIW F;  1UJW B;  1HP8 A;  3THO A;  1IX9 A;  5LMN B;  1NJI W;  3K0G A;  5LP6 B;  2OIG A;  1AR4 A;  5CA1 B;  3BRC A;  4KUM A;  2WLL B;  1G6U A;  1M93 A;  4DR4 B;  2ZE8 A;  1XNR O;  3WU2 Z;  3A8T A;  2UUB O;  4PA9 A;  1N34 B;  2GHY A;  1V55 B;  4WFF A;  4GT1 A;  1QCE A;  1K34 A;  3JSN A;  4JTA B;  2YC0 A;  5IJ9 B;  1GM9 A;  5IWA B;  3G4S V;  1TUE B;  4KP4 A;  1GN4 A;  2Z5U A;  3L9D A;  1VEW A;  1N0N A;  1QQC A;  3RT3 C;  5IDJ A;  3I56 V;  4D7T A;  3OFN G;  4H44 B;  2UXD B;  1W59 A;  5J2U B;  4MVQ A;  3AEI A;  1OV9 A;  5F2V O;  1K9M W;  4A5U B;  5FNV A;  3SPH A;  4ASU G;  4O2A B;  3U10 A;  1D5N A;  3CX5 F;  5H9C A;  2RNB A;  2NN4 A;  2JEX A;  1S72 V;  1RFY A;  5LHI A;  2YS8 A;  4JI2 O;  3VQY A;  4FVM A;  4QNH B;  3CC4 V;  4LWS B;  2AGA A;  5LOV B;  4WFE A;  4JZ2 A;  2YEV B;  4DV1 O;  1FFX A;  3ZN1 A;  2FL4 A;  4DK0 A;  1SZX A;  4PI0 A;  1MSW D;  1WNS A;  3T1H B;  4K8X A;  2HEP A;  1AI7 A;  3RWR D;  4OPA A;  3CWB H;  4PV1 B;  1BQZ A;  3CRM A;  3WB1 A;  1XHX A;  4ZI7 A;  2EIM C;  5JQG A;  4LF7 O;  3AG7 A;  4PDV A;  1IXB A;  5TIS Z;  4JGS A;  4UFZ A;  4AI8 A;  2WWW A;  3W7U A;  4MTG A;  2OIE A;  2FTK A;  2W0F C;  2QEX V;  4AQY O;  2XTA A;  1I5X A;  2DQ0 A;  5BR8 O;  2KG7 B;  1Y76 B;  3SJC C;  4BAY A;  4MVO A;  1XEQ A;  4NXN O;  1KBH A;  3RW0 A;  2DYS C;  1HNW O;  3ZJZ A;  2HHH B;  5FLX N;  1M56 C;  4UVB A;  3CMA V;  2EIL B;  4Z1V A;  3KZI Z;  1IBM O;  1I94 B;  1HNX B;  4FPP A;  2B9Z A;  2HKO A;  4FJC C;  1Q6I A;  2Y4U A;  1GM8 A;  4RAI A;  3D3Q A;  3S3X A;  3A0H Z;  4G2K A;  1Y6X A;  5IJ0 A;  4J7K A;  3B8M A;  3N2K B;  4X1Y B;  1VQO V;  1H8E G;  1XMQ O;  2UXC B;  1ORQ C;  3OT7 A;  5L3G A;  1R6N A;  3JAW A;  5CBG A;  1N33 O;  3CME V;  5JCO C;  3H1L H;  4R7C A;  3OTF A;  4U3J A;  4EFB A;  3BA9 A;  1FS0 G;  4ZHQ A;  4O4H B;  3SGI A;  2L6L A;  2PYJ A;  1GN2 A;  1W0J G;  2H3O A;  5CB4 B;  1TVK A;  2ZE5 A;  5JVD B;  4FFB A;  1M57 B;  5B1B B;  4LH6 A;  4LF6 B;  4JI1 O;  3WG7 B;  1YF2 A;  3FFQ A;  5B1A B;  4O4J A;  3CC2 V;  3RYF B;  4FLW A;  1QVG U;  4CZZ A;  4DO2 A;  4I50 B;  3W7X A;  3QF7 A;  1JA8 A;  4I9W A;  1WB7 A;  4OX9 B;  4EB6 B;  1XNR B;  5CBH A;  2UUB B;  5LGT A;  1E1Q G;  2NLJ C;  3OM3 B;  3SYQ A;  3ABM C;  4DV3 O;  1YJ9 V;  3UT5 B;  3PN1 A;  3CRA A;  3UQ8 A;  4X64 B;  1XL4 A;  3WB2 A;  4TV9 A;  3K06 A;  1TA8 A;  2JEU A;  1JOY A;  1KYO F;  1FXV A;  4L87 A;  4I9Q A;  2QWR B;  2JS3 A;  1JJO A;  2ZNJ A;  4CS2 A;  4BR6 A;  1ZWI C;  1NH2 B;  2Q5Z A;  2HVK C;  1JMK C;  3G6E V;  1BGY H;  5B5E Z;  2D3O W;  1IBL O;  4YIO A;  3HPL C;  5BXZ A;  2BSK B;  2F93 B;  1RSO A;  1Q86 W;  3ZMS A;  2XUM A;  2BOC C;  1Q82 W;  4FMT A;  2XAJ A;  4LF4 O;  3CEI A;  3OR7 C;  3AG3 B;  1OCO B;  1TUB A;  4F6E A;  4PD4 F;  3ZMU A;  4TUY B;  2YIB D;  1TAE A;  3GB7 C;  3JAR A;  3AG1 B;  1BE3 H;  5LA6 A;  2V1D A;  4DV1 B;  1QNM A;  1DF4 A;  3H1K H;  4OXS A;  2F4V B;  5H5N A;  3E22 A;  5KUM A;  2BTO A;  4JI7 B;  1KC8 W;  1N8R W;  2UU9 O;  2JIZ G;  2EUL A;  1A32 A;  1WP8 A;  1RM1 C;  1ZL8 B;  4UVA A;  2RDC A;  4B3R O;  2QM8 A;  3M7M X;  1AB3 A;  1PL0 A;  4KHP O;  4WBN A;  4DRX B;  2ZIO A;  4KL1 A;  4O2B A;  3ASO C;  3SR2 C;  1K92 A;  3L71 H;  3JAS A;  4JYA O;  2YID A;  2PYL A;  2A0L A;  4YY3 B;  4PA7 A;  3RYH B;  4AQY B;  4JI3 B;  3B40 A;  5BR8 B;  4JI6 O;  1FXK B;  4GKK B;  1NU1 H;  1NS1 A;  1ZAU A;  4UV9 A;  1NR7 A;  1H8H G;  1R6K A;  1M4U A;  4LFC B;  5KLV H;  4HZ3 A;  2EJR A;  4O4L B;  1OJH A;  2XAG A;  1GO3 F;  2PY5 A;  5J9P C;  1S3J A;  1Q81 W;  2QTS A;  3ZED A;  1QR9 A;  1ENV A;  1NVP B;  5LYJ B;  3X2Q C;  1M1K W;  1VQN V;  4RUF A;  1ZTE A;  1YHQ V;  1M9N A;  4FK5 C;  1VF6 C;  2UUA O;  4JAA A;  2IU0 A;  4X62 O;  5HFM A;  1SKV A;  2B1I A;  1MZE A;  1V54 B;  1KU9 A;  1XNQ B;  1L8D A;  3K5M A;  1R3L C;  2LW7 A;  1GK9 A;  2CH7 A;  4J7Z A;  3MDS A;  2BTQ B;  5LGN A;  4YJ2 A;  4EFE A;  1OCC B;  4J80 A;  2DE0 X;  2XAS A;  3ZRX A;  4IYI A;  4JAS A;  4XBF A;  3TCU A;  1RP3 B;  3QNE A;  4JI1 B;  5D5Q A;  4LFB O;  5BMV B;  1LUV A;  1PKX A;  1NQT A;  2EIL C;  4X89 A;  4H37 A;  4DXW A;  5J2T A;  2ZE7 A;  4LF8 B;  5EC2 C;  1KEC A;  4MVR A;  5BY1 A;  4DR3 B;  3K3W A;  4LH7 A;  3HKE B;  2ETN A;  4FFK A;  1FFT B;  5ITZ B;  2XOK G;  4X88 A;  2Q4P A;  3Q4H B;  5LMU O;  1CEZ A;  3TJT A;  1UFI A;  5GON B;  1RPO A;  3IC7 A;  4BW9 A;  3KKY A;  4TV8 B;  3AG4 B;  3QG5 A;  3E86 A;  1SQF A;  4JTD B;  4IIJ A;  3UM7 A;  2DYR B;  2Q0O C;  4JAU A;  4GUN A;  3OGI B;  1FPO A;  4GYC B;  1SQB H;  1Y67 A;  1H2L A;  3BCC H;  2YIC A;  3E8H A;  3WG7 C;  2Q7E A;  1P84 F;  5B1A C;  3QO7 A;  3CPW U;  1VAR A;  1T5E A;  1QLE C;  4U7O A;  2Y69 C;  4D6T H;  5JCO A;  3C3S A;  3JAK B;  3JD4 A;  4J10 A;  2JGU A;  2Z3Y A;  3FB8 C;  3UKM A;  1AI4 A;  1HW7 A;  2EIK B;  1HR0 O;  4NKG B;  3VQV A;  4LFA O;  2YI8 A;  2UUC B;  1MG1 A;  3SPG A;  2ADQ B;  1FJG O;  2WA4 A;  3DTU B;  4FZ1 A;  2NNU A;  3MD0 A;  2LFR A;  2R9R B;  4RQE A;  4CS3 A;  4NXM O;  4NR1 A;  1OCZ B;  2EZP A;  3P32 A;  2E75 B;  2IU3 A;  5GW7 A;  3EXA A;  3E2E A;  2PF4 E;  3TXQ A;  4XDL A;  2CUG A;  2Y48 A;  3G71 V;  1AJP A;  5IE9 A;  1BHA A;  2GBO A;  2UXX A;  1KB9 F;  4JYY A;  2CTR A;  2CAZ C;  3WFV A;  3E8G A;  2O57 A;  4F6R B;  4GLX A;  4H33 A;  2LW1 A;  2ZIM A;  3AG3 C;  2X6A A;  1OCO C;  2JGD B;  5KA5 A;  2CK3 G;  1Q6H A;  4XDJ A;  2YIB A;  3FB7 C;  1LNQ A;  3H9V A;  1HNZ O;  1NH2 D;  3APQ A;  2QM7 A;  3LUT B;  3WB0 A;  1LR1 A;  4PJ0 Z;  2WLN A;  1JJ2 U;  1CXZ B;  3BA8 A;  1R73 A;  1CPY A;  5LP6 A;  3JD3 A;  1EBO A;  5CA1 A;  2PUS A;  4JTC B;  2JJ1 G;  1PV0 A;  5LL6 Y;  2WLL A;  5JH7 B;  3ABK C;  1P7G A;  4Q20 A;  2ZE6 A;  1VQL V;  2EBO A;  4FM1 A;  4W4L A;  4YHH O;  5IJ9 A;  3OMA B;  4H13 B;  1MSD A;  1S0V A;  2QKC A;  3OE7 G;  3QO5 A;  2HFE C;  3L75 H;  1X4T A;  1Q3E A;  4TWK A;  5FPR A;  4LF9 O;  3CD6 V;  4EEQ A;  4UCV A;  5AG2 A;  2F43 G;  5J2U A;  2ZXW B;  5CN0 A;  5FL7 G;  4GKJ B;  2ZT9 B;  1H2S B;  1K5Q A;  4DV6 B;  3EHB B;  3CSX A;  1K4D C;  4ABM A;  4FLV A;  4IHJ B;  2P06 A;  1I08 A;  4O2A A;  4B08 A;  4WFA V;  2Q69 A;  3SYP A;  1XOU A;  1PPJ H;  5JJE B;  4HNA B;  5IT9 N;  1PP9 H;  3NXS A;  1Q7Y W;  5IYZ B;  2WLI B;  1WLE A;  3RGB A;  2DWD C;  2IW5 A;  2OT5 A;  5LMU B;  3JCU Z;  3BHP A;  1GRJ A;  4LWS A;  2GUZ B;  3LSQ A;  5LOV A;  1MZF A;  2ITD C;  1V54 C;  2YEV A;  2P7T C;  3K57 A;  5A2Q N;  1JX9 A;  3VQX A;  4ICG A;  1VQ4 V;  3K04 A;  3T4D A;  4I5S A;  1OCC C;  3E83 A;  3ASN B;  4DV0 O;  1J5E B;  2E5L B;  4R6Z A;  4B3M O;  2QM4 A;  4JF3 A;  1NVP D;  2ZD9 A;  1Z5W A;  1S5L Z;  1SQQ H;  1F23 A;  4XDK A;  3P30 A;  1AI5 A;  1VF6 A;  1OHH G;  3ABL C;  4JI0 O;  4CH5 A;  3T2M A;  2LP7 A;  1E1R G;  2W0X A;  1HR0 B;  3FB6 C;  3CYO A;  1Q90 D;  5L3C A;  2KG7 A;  4DUY O;  4N21 A;  3HKB B;  3KG2 A;  5C8Y B;  1Y76 A;  1YZB A;  5KHI A;  1IBK B;  1JVM A;  3AG4 C;  5EYP B;  1BT8 A;  4DR7 O;  2IH1 C;  2DYR C;  2OCC B;  1BZK A;  4PI2 A;  2Z0A A;  5GTH Z;  5E1A C;  3TGU H;  1VQP V;  3ZS8 C;  1GKF A;  4X1Y A;  3N2K A;  5E79 Z;  1GN6 A;  3CRQ A;  3ETQ A;  1DK1 A;  2CDY A;  1XMO B;  4O4I B;  5A9G A;  3BAA A;  3APO A;  2IJJ A;  1GTO A;  4O4H A;  3RYC B;  2EIK C;  3ZRS A;  2FML A;  2A3Q A;  4PDM A;  4X66 O;  5KA6 A;  5CB4 A;  3UO2 A;  5DM6 V;  3CCU V;  4JI4 O;  2F66 C;  3P3N A;  5JVD A;  4I55 B;  4K0K B;  3KCY A;  5EBM C;  4DV2 B;  4BWA A;  4X65 O;  1OCZ C;  4GX1 A; 
#chains in the Genus database with same CATH homology
 3H1I H;  3H1K H;  4D6T H;  3H1H H;  1PPJ H;  3L71 H;  3H1L H;  3L75 H;  1KYO F;  1PP9 H;  1L0L H;  2IBZ H;  3CX5 F;  1BCC H;  1NTK H;  3L70 H;  3TGU H;  1L0N H;  1NTM H;  1SQP H;  1SQV H;  1SQQ H;  1NU1 H;  1EZV H;  2A06 H;  4PD4 F;  2FYU H;  4U3F H;  1SQB H;  3BCC H;  3L74 H;  3CWB H;  3CXH F;  1KB9 F;  2BCC H;  3H1J H;  1BGY H;  1P84 F;  1SQX H;  3L73 H;  3L72 H;  1NTZ H;  5KLV H;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...