4U3FH

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
EELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 22
structure length 68
sequence length 68
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4u3fH00
3CX5F 1SQQH 3H1HH 1NU1H 3L72H 4D6TH 1PPJH 3L75H 1BCCH 3H1KH 3CWBH 3L70H 3BCCH 3H1JH 1KB9F 3L71H 3H1LH 1L0NH 3L74H 1PP9H 3CXHF 5KLVH 1BGYH 1SQBH 2A06H 1EZVH 4PD4F 3H1IH 1KYOF 1P84F 1L0LH 1NTKH 2FYUH 1NTZH 1BE3H 3TGUH 4U3FH 1SQXH 2BCCH 1NTMH 1SQVH 3L73H 2IBZH 1SQPH
chains in the Genus database with same CATH superfamily
4WFBV 4LCUC 5EBMC 4UVAA 2Q7EA 1AJPA 1FFTB 1AR5A 3G80A 1SC5B 4LNUA 4LC1A 1KP3A 1EN6A 3ZHVA 4Z1MG 2Q7HA 3AG7A 4B08A 2UU9B 3K08A 4GKKB 4X8AA 4G27B 3MHHC 3RVYA 3K5LA 3W7SA 2KG7A 1V55B 3OGCC 4LFCO 1N8RW 1ZTEA 5CA1B 5L3FA 1OV9A 4DUYO 4MW8A 4BWAA 2YEVA 1K92A 5TISZ 4DV0B 4D7TA 3SJCC 2RNBA 1FPOA 3T1CA 1VIBA 1XNQB 3ZX6A 2EJRA 3OGIB 5DECA 2XAJA 4DV5O 3ZRWB 1OZ0A 4QJFB 4X1KA 2R9RB 3E89A 2CH7A 1Z5VA 2ODMA 2CDYA 3D3IA 1IBLO 5H2FZ 3C3SA 4B3SO 2DYRC 2GUZA 3RYHB 3QO8A 4U7OA 1H2MA 2UUBO 4JI5B 1UJWB 2WLLB 2FKXA 3ABUA 3SR2C 3LSSA 1FS0G 3L74H 1K9MW 2PYJA 2Q7GA 4JYAB 4O2AA 3CCMV 4B3TB 1GN2A 2FYUH 2ADQB 1K73W 5IJ9A 1NR7A 2C2AA 5IYZA 4JI8O 2QWNB 1KQSU 4WFEA 1AI6A 4ASUG 4ZHQA 5B66Z 5LL6Y 3OEEG 3SYPA 1FXHA 1IVSA 4NXMB 1SKVA 2Q0AA 2GSMB 1N32B 1KYOF 3FB6C 1S5LZ 4UCUA 2PI5A 2QM4A 2DWEC 5CBGA 2PZSA 2Q68A 5JH7B 1SQFA 1VEWA 4DR6O 4YJ3B 1VQ5V 1H2KA 4R7CA 3OR6C 4JI1B 3GB7C 5CA0B 1VF6A 1N0JA 3T1HO 1BHBA 2ZIMA 1XMOB 3B77A 1R6NA 2EJ7A 2QM8A 4MVRA 1XEQA 3IFXA 5BR8B 4MVOA 2AGAA 1MMMA 5J2UB 2JEUA 3NR7A 4TV9B 2P4VA 2F23A 4OXSA 1QR9A 5GONA 2UXNA 1CEZA 2Q67A 5LMUB 2BTOA 1VF6C 4ABMA 4X1YA 1KKDA 3DSQA 3SJAC 3OTOB 1NH2D 2XAQA 5H6RA 1FFXB 2H94A 5C8YB 3SYOA 3WB2A 3O9OA 2RQ6A 4WFGA 1D5AA 2H8PC 4IT5A 1MZFA 1CP9A 3CCJV 4H13B 3JD1A 4GX2A 1IURA 4JAUA 2YXHA 4FMTA 3BEHA 1PV0A 3JCZA 4O4HA 1VQMV 1Q6IA 5IDJA 1NH2B 5ITZB 1XI1A 2WA4A 3T1YO 1NU1H 2XNDG 3ZCCA 5B3SB 4JGSA 4NKGB 1SA0B 4W4KA 2YIAA 3MD0A 4EFEA 3JAKB 4ZOLB 3FFQA 2IJJA 1M57C 2W0FC 3LNMB 1L0LH 3CMAV 4LF4O 1SZTA 2BSKB 3TGUH 3DXRB 2EZPA 2WPDG 4UVBA 2R70A 3QNEA 5CB4B 1GMGA 3CC7V 4LF8O 4P2ZA 3JYCA 2P67A 4UCVA 3I56V 3ZHUA 4FZ0A 2JIZG 5BMVB 1H2LA 3CXCU 1R3JC 1JX9A 1Q90D 2PF4E 2QEXV 3JATB 2UXBO 4EEQA 3EHBB 2IU0A 3ZMZA 1TVKA 4KUMA 3VQWA 1BHAA 2AW9A 1I08A 4DO2A 1VQ8V 3BY6A 4LWSB 5IJ0A 1N36O 2Y0IA 3RYFA 2JGDB 3KG2A 1R1BA 3UO2A 1B3QA 2EIMB 2ZNJA 2E5LO 2CGNA 5H9CA 4NXNB 3SPIA 4C7UA 2OIEA 4J80A 3OMAB 2HHHB 4OX9O 4E4EA 4DUZB 1H8EG 2DYSC 2IW5A 4PDVA 2GTAA 2PI4A 4FLXA 3K04A 1FD9A 2LFSA 3E22B 4YY3B 1YSCA 1J5EO 4LFBB 4G28B 4I9QA 4J42A 1I94B 1JA8A 3E8BA 2OTLV 4K0KO 1KP2A 4X89A 3JARB 4OGQB 5FNVB 1TA8A 3IAYA 4MVUA 5LYJB 4X62B 2DOSA 4FIPC 4JYBA 1SZXA 3ASNB 1ENVA 3N2GB 2N04A 3SDLA 3ZRVA 1N4CA 3HKDB 4AHCA 3LUTB 4YJ2B 2V4DA 3WG7B 5LA6A 2X7RB 4UCSA 3OTFA 4DK0A 1MABG 1N33O 4NYKA 4UCOA 4EKWA 2YS8A 4O4JA 3ZMVA 2QJ1A 3ABMC 3HKBA 4DXWA 1Q3EA 2X6AA 1FXVA 3ZHQA 1EZJA 4Z1VA 2FL4A 2OCCC 3RYIA 2ITCC 4O2BB 4F4LA 5EIBC 1VF5B 2HG5C 4LFCB 1KB9F 4BW9A 1NQTA 2A0LA 2GHYA 5IYCO 3RFRA 4DUYB 4YXWG 5KHJA 5IWAB 3G6EV 4UFZA 3RBZA 1IXBA 1EN4A 3ZRXA 4H44B 3KKYA 5H5NA 1YZBA 1FKAO 1Z2GA 1XREA 4DV7O 3APOA 1OCZB 1WB7A 4O4LB 4DV5B 3CRCA 2N74A 1YCIA 2YICA 3KZIZ 1Q7YW 2YI8A 1M90W 4ICGA 5DN6G 5KMGA 4H0LB 1XNRB 2CK3G 4LFAO 1XHZA 3BRCA 3GVMA 1KUQA 1OCOB 2ZNIA 2ATKC 1BCCH 3AG2C 3JALA 5K1XA 2CE4A 3RYCB 2QTOA 1R3IC 4LF5B 4IIJA 1SQGA 3OW2U 3JD3A 4MTGA 5LP6B 1IBMO 4X20A 1GAXA 2CTPA 3JAMN 2F4VO 1IX9A 1MSWD 1MSDA 1V9PA 1FJGB 1QCEA 3K06A 3NXSA 4FK5C 4JI8B 2R9IA 3W7TA 1XMQO 3U11A 2WSSG 2Z0AA 2ZM6O 4DV6B 1QVGU 5JVDA 4JYYA 4KHPB 3ZHTA 2AHZA 3BPZA 3H1LH 1E79G 1NVPD 1WA8B 3HPLC 2FB5A 2ILMA 4QNHB 4I55B 1E1RG 2RJZA 3W7XA 4DR6B 1JR9A 2YSUB 3UT5B 4P9PA 5EZYB 5FPOA 3AG3B 2BOBC 2HFEC 3EFFK 4FLWA 5B1BC 1DF5A 3JCUZ 2UXCO 3H1IH 4BAYA 5JQGB 5CBFA 1NVPB 3E2EA 4B3MO 3BAAA 1SQVH 2R72A 3IGAC 5D5QA 1EFRG 4OPHA 1O9GA 3QF7A 2KB1A 2CTRA 3JAWA 2NLJC 3STLC 2FTKA 1OCCC 4B3RO 4FZ1A 3FKSG 3OAAG 4WFHA 3MDSA 4GX5A 5JCOA 1QLEC 4QPKA 3G67A 3K9AA 4GZRB 5LMNB 3SPJA 4PHZA 1HDJA 4DW0A 3ABKC 2EIJB 4JI4O 1ZWIC 3PN1A 4JTCB 3E8GA 1FAFA 5JCOC 3L70H 1M4UA 1RFYA 3BCCH 4LP8A 4YIOA 3FD9A 2ZQMA 4LF9O 2Q4PA 4GT1A 4U3JB 5LGNA 1FXKB 2Y69B 1AR1B 3T1YB 3CRMA 4I0XB 5J2TA 3SGIA 1M56B 4BIOA 1XOUA 2CTQA 2ZE6A 1EM1A 1XL6A 2WLNA 5KLVH 1IDSA 2WLLA 4I9WA 3UO3A 2VWJA 3ETDA 1KKCA 1HWYA 1WJZA 3K03A 2XHBA 1U96A 2DW4A 3A8TA 4PA7A 1S77D 4D7SA 4LF8B 2YXYA 2ZIOA 1NBMG 3ABLC 4TQFA 3P3NA 5GW7A 1RSOB 3HKEA 4B7KA 4KL1A 3E35A 4J9ZB 5LOVB 3UCSC 3A2FA 2E75B 2UXBB 3QVNA 2IH3C 3DGEA 2VQEO 4I50B 3RGBA 4CH3A 1W0JG 2LW1A 3TJTA 1M93A 4DV4O 3HR0A 3UQ8A 4GKJO 4AQYO 3L71H 4MS2A 1AROP 4BR6A 2A06H 4UUJC 1N36B 1GN3A 1V54B 4TUYB 4FJCC 4WBNB 4CS2A 4JAVA 4GUNA 5IYDO 4TQDA 3CCSV 1JFFB 3WFVA 2JRIA 1Q6HA 3CCUV 1R73A 3T4DA 2UUAO 2ZXWB 3J80N 4DYLA 5LHIA 3OR7C 4PV1B 3TXQA 1R3KC 4EFBA 5E79Z 4N21A 5IY5C 1HNZO 4OX9B 1ZL8A 2QKAA 4YIPA 5B1NA 4JF3A 4BW5A 2OTJV 2DWDC 3Q4HB 3ZS8C 4FLYA 4FLVA 2GTSA 3RWRD 5KX5A 2EBOA 2JS5A 4LNUB 2ARHA 2DE0X 5IE9A 2QDOA 4FLZA 4FFBA 3T2MA 2EZOA 3ZMSA 1Q8IA 3TK1A 1TAEA 1VQNV 4PDRA 3UM7A 4LF7O 3BA9A 1M1KW 5CA3A 1VQKV 4K8XA 2IU3A 2WLJA 3KCXA 3ETEA 2RCVA 3CPWU 2CAZC 3CC2V 3AG1C 4DR1O 1PPJH 3OUSA 4TWKA 3BVOA 4J11A 1N33B 3RVZA 1H2GA 1YIJV 1HR0B 2DYRB 1SA0A 3FAVA 3SPHA 2ADPA 2F43G 4X9QA 1Y76B 1X4TA 4X1KB 3BHPA 4LBEC 1SETA 2CH7B 4X65B 2BSKA 2YDEA 2M6YA 4YHHO 5B3SC 1A32A 1PNKA 2Q9LA 2EILC 3CEIA 2JJ2G 3ZMTA 4DR2O 2O57A 4JI3O 4K35A 2F66C 2K9PA 5JJNB 2Q8VA 4IL6Z 4EB6B 2X6BA 5BMVA 1AILA 1SQPH 2JS3A 4L87A 1IZ3A 5B1AC 5EYPA 1EBOA 3K59A 2VQFB 3TXSA 3P3PA 5A9GA 5IJ9B 1IBKB 2WLKA 4JI6O 4CH5A 3ICXA 4X88A 4ZHQB 3J7AU 5A2QN 3CCRV 2QA4V 1F23A 2VS0A 3G6BA 4LWSA 1ZUQA 2OT5A 3RT3C 3M99B 5EC2C 1N34O 2D3OW 1BL8A 2PTMA 1VQLV 2FMLA 1IBMB 2V1DA 4N23A 4K8ZA 1AR4A 3APQA 1J95A 1LR1A 3H01A 2P90A 3A0RA 4QE9A 2QWRB 1GM8A 2ZM6B 3F5WC 1NT2B 2ZE7A 3E22A 4PA6A 1YJNV 4WCEV 4DK1A 3JARA 2PYLA 5GONB 2UU9O 1TUBA 4GKKO 2Y4UA 1PL4A 3SPGA 2XT9A 4X1YB 3K5OA 2CUGA 2EINC 1SRYA 4NB5A 1W2BU 2IH1C 3N2GA 2W6IG 4G2KA 5KHKA 1WPBA 2OYQA 1YF2A 1F4NA 3TCUA 4YJ2A 2WLIA 4TSFG 4JTDB 1KU9A 1NI8A 1UFIA 2NNUA 2YIBD 3IC7A 4X64O 4B3RB 4O4HB 2XUMA 1S5HC 4DV2O 4DV1O 3H1JH 4MTXA 2WAMA 1M57B 3PJSK 1SQBH 5L3DA 4O2BA 2BOCC 4HNAB 1KD1W 3LSQA 3ZIAG 2YI9A 5DM6V 1BZKA 1RM1C 4HAMA 4JI7B 1QLNA 3QTCA 1I0HA 4TV8B 1Z5WA 1BQ0A 2BTQB 4MTOA 1JMKC 4RUFA 4CC6A 1NKDA 2QKSA 3B8NA 4LR3A 1JPXA 5KAIZ 3CCQV 2B1GA 2HKOA 3ETGA 2ZDIA 4P9OA 4DR4O 5KHIA 1G4YB 2B9ZA 1Q82W 3R66A 4I4TB 3S3XA 2XAFA 4UVCA 4F6EA 4F6RA 4O4LA 4JASA 3J81N 4UB8Z 1NTMH 2ZKOA 4JZGA 2ZDIC 2Y4TA 1VMGA 4DR5O 4NR1A 3CB2A 3JASA 1PKXA 2LGWA 4LH6A 2QR4A 2E76B 4GYCB 1EZVH 4J7ZA 2JVDA 1N32O 2HVJC 4O4IA 2HR3A 1XUQA 1NTZH 3LDEA 2P22C 2RDCA 5L3EA 1TVKB 4GLXA 2QTSA 1NS1A 4FPPA 3ASOC 5LP6A 2QWQB 1T5EA 3CX5F 5LHHA 1HNWO 1R6KA 3KCYA 5IJ0B 5CBHA 1AI5A 3FB8C 2JJ1G 2H3OA 1OCRC 2LO1A 4CH6A 1XMOO 2BE3A 4MVQA 4RO2A 2W0XA 1WA8A 3CCLV 2XAHA 2VQEB 3K58A 3C90A 1VARA 3K5MA 2GBOA 3ZMUA 3B09A 4AQYB 4X1IA 5KAFZ 1GK9A 3AG4C 3OTOO 3UT5A 3P30A 2QE7G 5EZYA 1KBHA 3GWOA 1IBLB 4B3SB 3AEIA 5EIBD 3N2KB 2EIKC 1GTOA 3G4SV 1GO3F 1M9NA 2KQXA 2UUBB 4I5SA 3LSUA 2ZT9B 3L75H 1CXZB 4RQEA 2QKCA 1HNZB 2EX3A 3ABMB 4DRXA 1YXBA 4JI2O 3I5DA 5L3CA 4ZI7A 1DLBA 3C3TA 2OCCB 5JJJB 1YITV 1IXMA 1BSMA 1PD3A 2AHYA 4O4JB 1K97A 3CWBH 1H38A 3HKBB 1PP9H 1KECA 4IHJB 4WF9V 2E3CA 2MK3A 4LF7B 3X2QC 1N0NA 4UXNA 3OM3B 2UUCO 3S3WA 2IM9A 2W6JG 4JYCA 3SYQA 3ML0A 1VF7A 3CRAA 1JCHA 1FXKA 4DR1B 1X59A 1WP8A 1R3LC 4FLTA 1VQ4V 2ZE5A 1WP7A 4KP4A 3CJHA 3SYAA 1VQ6V 5J9PC 4QIWF 1F7YA 3B2EE 1F51A 3T1HB 3OT7A 4H33A 5EBLC 2DJVA 1FXKC 4FM1A 1YDXA 1XDCA 2KKWA 4PA4A 2L35A 2YIDA 3M8AA 2ZINA 3ZEDA 3AG2B 3LDCA 3O65A 5KMGB 1K8AW 4Q20A 4J7KA 5KHHA 3ZBHA 2B5UA 1GKFA 3CMEV 2UXXA 2V7QG 2HVKC 4J41A 3CP1A 5CA1A 4IIJB 4I7ZB 1WB8A 3DTUB 3QO7A 4CS3A 2NR5A 1Y74B 3RN4A 4IYHA 1DF4A 1RPRA 4DR3O 2HHHO 4DUZO 4KXRA 1V55C 4JV5O 4UV8A 4ZIBA 3ZN0A 4U3FH 5LXTB 5JVDB 1LUVA 1URFA 2GDSA 3ZRWA 4YY3O 4HYOA 1P7GA 3HKCB 4TUYA 3SJBC 2AZ2A 3ABTA 1W0KG 3RYHA 5B1BB 1JFFA 2P06A 5KA6A 3BABA 2HJFC 4IGGA 5B1OA 2XASA 4LF4B 1I5YA 5KHGA 2CTWA 4FVMA 3FYIB 1QVFU 3OD4A 1Y66A 1B04A 4FM2A 1M5IA 1OCCB 2YUAA 3Q4HA 4X66O 1VQ9V 1K34A 2ZXWC 3CC4V 3K5NA 4UB6Z 3BA8A 1I5XA 1QLEB 1DGSA 2A3QA 5FL7G 1GH6A 2UXDO 1P49A 3OMNB 1TGOA 1NTKH 3JAWB 1NZ6A 4K3AA 3ABKB 1HW7A 1S3JA 4H37A 4A5UB 3D3QA 3K9SA 3THOA 3CS5A 2WWWA 3LDDA 5JH7A 1ZSPA 5IWAO 1AI4A 4YJ3A 3A0BZ 1GRJA 3OE7G 5DEDA 4MVMA 4J9YB 1AVMA 1ZX3A 2R9AA 2P5OA 1K7DA 4TOIA 5CA0A 3AK2A 2DMXA 2F1MA 2Q6AA 3H1HH 4X64B 2LFRA 2E5LB 1Y4MA 3B40A 4JAAA 3WU2Z 4DV2B 1QBZA 1K5QA 2MW2B 4PA9A 4TT3G 5L3GA 4DV1B 1Y76A 5BY1A 5J2UA 5AG2A 3STZC 4TV9A 1R6TA 1Q81W 4UV9A 1H2NA 3MHSC 4XDJA 5HFLA 1JQ0A 5J2TB 1CPYA 4LF6O 4FLUA 5D5PA 2WLHA 4FM0A 2B1IA 1XNRO 2XOKG 1J5EB 1FFXA 3ABLB 2QM7A 3EXAA 1AI7A 5C8YA 4RQFA 4XDKA 4EB6A 4MVSA 1K4CC 3CCVV 4DR4B 4K0KB 1HNXO 4HBNA 1L0NH 5EC1C 4LF5O 5GTHZ 5EBWC 3R65A 2VWKA 3G71V 3AK1A 2OWOA 2ZD9A 1FJGO 4MTFA 2DQ3A 4PDMA 2KG7B 1TUEB 2YXLA 3HKEB 3ZHSA 4DR5B 1QQCA 4IYIA 5ITZA 4DV6O 3F7VC 1G8MA 2YEVB 4DV3O 4KHPO 1YI2V 4JI0O 3WB0A 1D2DA 1PL0A 3E86A 3UKMA 4FFKA 5B5EZ 2L6LA 4PA3A 4AI8A 1B06A 4DR7O 3JAKA 3U0ZA 3JSLA 3W7WA 4ZOLA 2HJDA 3K79A 1US6A 1SERA 1XQ8A 1HNWB 4JTAB 1HP8A 3DXRA 5IY5B 2NN4A 5LBQA 1PM9A 3F7YC 2EULA 1H8HG 5CB4A 5EK0A 2GUZB 1EN5A 1GM9A 1WAZA 4GX1A 2M7WA 1XBLA 4ZBMA 3VOUA 1SQQH 1ZL8B 2ITDC 2QWOB 4PJ0Z 2JGUA 1DK1A 4R6ZA 4DV7B 3JATA 2LP7A 2OCHA 4O2AB 1Y6XA 1UPGA 1O9HA 5IYZB 5KX5B 5LMNO 3U10A 3D36A 4FFBB 1PNMA 3K57A 3SYCA 3H9VA 4LFAB 3AG1B 4Q6GA 3RW0A 4NTXA 4AILC 3FB5C 3FB7C 2PUSA 1ORQC 2HEPA 2JGDA 2IJIA 2Y0PA 3D36C 1BMFG 3CHXA 4JI2B 1FYJA 3QG5A 3OMIB 1QNMA 3JD2A 2F4VB 3FYEB 2ZE8A 1SESA 4QGPA 4QE7A 2QGNA 4HNAA 4RWUA 3AK3A 1I7FA 4R50A 1XMQB 3OFNG 1PNLA 4PI2A 3N27A 3JSNA 3FAVB 3P32A 2EILB 1YVWA 4TV8A 1Y67A 2BTQA 3HB3B 2EIMC 3SPCA 4UCRA 5JJEB 3M7MX 1LUWA 2UUCB 4RAIA 1E1QG 2F95B 2YIBA 3K0GA 4CBCA 4QPJA 1QU7A 4I4TA 3CE2A 5B1AB 5FNVA 1QR8A 5F2VO 1P4RA 5LYJA 3VQVA 1L1FA 3JD4A 1YJWV 2ETNA 1YJ9V 3HKDA 2G38A 2UXCB 3CCEV 3GWKC 4ZKIA 3CYOA 2RN9A 5EYPB 3E8FA 4B3MB 4DV0O 2D2CB 3ASNC 2OIGA 2P4KA 3IJ4A 1XNQO 2F93B 5KUKA 3H1KH 2WLMA 4W4LA 1BGYH 3WG7C 5CMUA 4PD4F 3VQXA 1WPXA 1S76D 2Q69A 1VQ7V 3CRQA 2RMKB 2Z3YA 4NTYA 4JI4B 4WFFA 2LJ2A 2WA3A 4JI5O 2JK5C 2XAGA 2DN9A 4XBFA 4DR3B 4LF9B 4JPRA 4JV5B 2CGOA 1AB3A 4KFMA 4JYAO 4E2LA 4B3TO 5JWPA 2EINB 5IT9N 1SS3A 1VP7A 1MOFA 1THZA 1JOYA 1S0VA 2A7WA 1WLEA 1W59A 5LGTA 3N2KA 3CRRA 1AP5A 2N05A 1TUBB 1OCZC 1VQOV 3D8CA 4R8CA 4OPAA 1RPOA 2AZ0A 3I55V 4NXMO 1H2SB 1XILA 1K5SA 2Z5UA 1JJ2U 4L8JA 1BE3H 3B4SA 3RYCA 3K3WA 2QWPB 1OJHA 3BFRA 3L72H 4X66B 2IJHA 2WLIB 1OCOC 1K33A 5K1PA 4J10A 3T4ZA 4JI1O 1VQPV 2DYSB 2Q0OC 4NTWA 3RYFB 2UXDB 1YHQV 4BIZA 1DTOA 1HR0O 1RM1B 5CN0A 5LP6C 5BZBA 3CSXA 5KUMA 4IHJA 4MVZA 1WNSA 3IC9A 5BR8O 2GV9A 5H6QA 1MZEA 4X65O 2HLDG 1K4DC 5BXZA 4I55A 3QO5A 1YEWA 1L8DA 3DC5A 4DV4B 4PELA 2KSDA 5LMUO 1OHHG 1XHXA 4GKJB 3FX7A 1BS3A 3VBBA 4XDLA 3E83A 2JDIG 2YC0A 1LNQA 1MG1A 5LHGA 4MW3A 1GM7A 4UCTA 1WN7A 1BQZA 5JQGA 2UUAB 4CH4A 2VQFO 1AP6A 4F6RB 5LGUA 4GX0A 1Q6UA 2P6JA 1Q5OA 2LW7A 1YTFD 3AG3C 4HZ3A 2Q5ZA 1JVMA 1GN4A 1IBKO 2K1EA 1BT8A 4MSWC 4LF6B 1ZAUA 4PI0A 3ASOB 1P7BA 1SQXH 2E74B 1MNGA 3JASB 4NVPA 5HFMA 2Y48A 5GTIZ 5LA6B 4D6TH 4O4IB 1RP3B 4CS4A 1SF9A 1HNXB 2X6CA 1OCRB 5E1AC 4Z2WA 2JEXA 5C93A 1YTFB 1ZLZA 4DW1A 1Y74A 1S5JA 3RYIB 2A79B 5FLXN 1AJNA 3B8MA 1NR1A 1U97A 5KA5A 1K3EA 3ZHRA 1D5NA 2LGQA 3TETA 3WB1A 4U3JA 2EIJC 5LXTA 1MA1A 3SJQC 4LH7A 4DV3B 1KMIZ 1QHTA 2LQTA 3AG4B 4JI0B 2Q73A 3HKCA 4I0XA 2PGGA 4GCZA 1KC8W 1B6QA 3MAQA 1P84F 3ETQA 2ZR2A 2EIKB 4DR7B 1F4MA 4CC5A 4X1IB 3OEHG 2ZCEA 1JJOA 1GN6A 1G6UA 2Y69C 2ZR3A 3LNNA 3CD6V 3ZN1A 4YHHB 1M56C 1NJIW 3F5TA 3CXHF 3W7UA 4DR2B 2X0LA 3A0HZ 4JI3B 2VRZA 5IYBO 3JD0A 1RSOA 4P30A 3JALB 4RUEA 4JZ2A 3ZJZA 4DRXB 2IJKA 5LOVA 4X20B 4ZI7B 3X2QB 4PDLA 4NXNO 4I50A 4JI6B 1Q43A 2AXTZ 4U7NA 2QSAA 2HP8A 2XTAA 3VQYA 4JI7O 3E8HA 2BCCH 4J7JA 5FPRA 2IBZH 1S72V 3EVKA 4BIUA 4MT8A 4LFBO 1XL4A 4WBNA 1AJQA 1N34B 1Q86W 2P7TC 1I94O 2PY5A 1ROPA 3ZRSA 1COWG 3K0DA 3OUFA 2DQ0A 4X62O 2A9HA 3DC6A 5L3BA 4B7EA 1V54C 4CZZA 4WFAV 3L73H 3L9DA 3CJHB 1G1XB
chains in the Genus database with same CATH topology
3CX5F 1SQQH 3H1HH 1NU1H 3L72H 4D6TH 1PPJH 3L75H 1BCCH 3H1KH 3CWBH 3L70H 3BCCH 3H1JH 1KB9F 3L71H 3H1LH 1L0NH 3L74H 1PP9H 3CXHF 5KLVH 1BGYH 1SQBH 2A06H 1EZVH 4PD4F 3H1IH 1KYOF 1P84F 1L0LH 1NTKH 2FYUH 1NTZH 1BE3H 3TGUH 4U3FH 1SQXH 2BCCH 1NTMH 1SQVH 3L73H 2IBZH 1SQPH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 F;  1SQQ H;  3H1H H;  1NU1 H;  3L72 H;  4D6T H;  1PPJ H;  3L75 H;  1BCC H;  3H1K H;  3CWB H;  3L70 H;  3BCC H;  3H1J H;  1KB9 F;  3L71 H;  3H1L H;  1L0N H;  3L74 H;  1PP9 H;  3CXH F;  5KLV H;  1BGY H;  1SQB H;  2A06 H;  1EZV H;  4PD4 F;  3H1I H;  1KYO F;  1P84 F;  1L0L H;  1NTK H;  2FYU H;  1NTZ H;  1BE3 H;  3TGU H;  4U3F H;  1SQX H;  2BCC H;  1NTM H;  1SQV H;  3L73 H;  2IBZ H;  1SQP H; 
#chains in the Genus database with same CATH topology
 4WFB V;  4LCU C;  5EBM C;  4UVA A;  2Q7E A;  1AJP A;  1FFT B;  1AR5 A;  3G80 A;  1SC5 B;  4LNU A;  4LC1 A;  1KP3 A;  1EN6 A;  3ZHV A;  4Z1M G;  2Q7H A;  3AG7 A;  4B08 A;  2UU9 B;  3K08 A;  4GKK B;  4X8A A;  4G27 B;  3MHH C;  3RVY A;  3K5L A;  3W7S A;  2KG7 A;  1V55 B;  3OGC C;  4LFC O;  1N8R W;  1ZTE A;  5CA1 B;  5L3F A;  1OV9 A;  4DUY O;  4MW8 A;  4BWA A;  2YEV A;  1K92 A;  5TIS Z;  4DV0 B;  4D7T A;  3SJC C;  2RNB A;  1FPO A;  3T1C A;  1VIB A;  1XNQ B;  3ZX6 A;  2EJR A;  3OGI B;  5DEC A;  2XAJ A;  4DV5 O;  3ZRW B;  1OZ0 A;  4QJF B;  4X1K A;  2R9R B;  3E89 A;  2CH7 A;  1Z5V A;  2ODM A;  2CDY A;  3D3I A;  1IBL O;  5H2F Z;  3C3S A;  4B3S O;  2DYR C;  2GUZ A;  3RYH B;  3QO8 A;  4U7O A;  1H2M A;  2UUB O;  4JI5 B;  1UJW B;  2WLL B;  2FKX A;  3ABU A;  3SR2 C;  3LSS A;  1FS0 G;  3L74 H;  1K9M W;  2PYJ A;  2Q7G A;  4JYA B;  4O2A A;  3CCM V;  4B3T B;  1GN2 A;  2FYU H;  2ADQ B;  1K73 W;  5IJ9 A;  1NR7 A;  2C2A A;  5IYZ A;  4JI8 O;  2QWN B;  1KQS U;  4WFE A;  1AI6 A;  4ASU G;  4ZHQ A;  5B66 Z;  5LL6 Y;  3OEE G;  3SYP A;  1FXH A;  1IVS A;  4NXM B;  1SKV A;  2Q0A A;  2GSM B;  1N32 B;  1KYO F;  3FB6 C;  1S5L Z;  4UCU A;  2PI5 A;  2QM4 A;  2DWE C;  5CBG A;  2PZS A;  2Q68 A;  5JH7 B;  1SQF A;  1VEW A;  4DR6 O;  4YJ3 B;  1VQ5 V;  1H2K A;  4R7C A;  3OR6 C;  4JI1 B;  3GB7 C;  5CA0 B;  1VF6 A;  1N0J A;  3T1H O;  1BHB A;  2ZIM A;  1XMO B;  3B77 A;  1R6N A;  2EJ7 A;  2QM8 A;  4MVR A;  1XEQ A;  3IFX A;  5BR8 B;  4MVO A;  2AGA A;  1MMM A;  5J2U B;  2JEU A;  3NR7 A;  4TV9 B;  2P4V A;  2F23 A;  4OXS A;  1QR9 A;  5GON A;  2UXN A;  1CEZ A;  2Q67 A;  5LMU B;  2BTO A;  1VF6 C;  4ABM A;  4X1Y A;  1KKD A;  3DSQ A;  3SJA C;  3OTO B;  1NH2 D;  2XAQ A;  5H6R A;  1FFX B;  2H94 A;  5C8Y B;  3SYO A;  3WB2 A;  3O9O A;  2RQ6 A;  4WFG A;  1D5A A;  2H8P C;  4IT5 A;  1MZF A;  1CP9 A;  3CCJ V;  4H13 B;  3JD1 A;  4GX2 A;  1IUR A;  4JAU A;  2YXH A;  4FMT A;  3BEH A;  1PV0 A;  3JCZ A;  4O4H A;  1VQM V;  1Q6I A;  5IDJ A;  1NH2 B;  5ITZ B;  1XI1 A;  2WA4 A;  3T1Y O;  1NU1 H;  2XND G;  3ZCC A;  5B3S B;  4JGS A;  4NKG B;  1SA0 B;  4W4K A;  2YIA A;  3MD0 A;  4EFE A;  3JAK B;  4ZOL B;  3FFQ A;  2IJJ A;  1M57 C;  2W0F C;  3LNM B;  1L0L H;  3CMA V;  4LF4 O;  1SZT A;  2BSK B;  3TGU H;  3DXR B;  2EZP A;  2WPD G;  4UVB A;  2R70 A;  3QNE A;  5CB4 B;  1GMG A;  3CC7 V;  4LF8 O;  4P2Z A;  3JYC A;  2P67 A;  4UCV A;  3I56 V;  3ZHU A;  4FZ0 A;  2JIZ G;  5BMV B;  1H2L A;  3CXC U;  1R3J C;  1JX9 A;  1Q90 D;  2PF4 E;  2QEX V;  3JAT B;  2UXB O;  4EEQ A;  3EHB B;  2IU0 A;  3ZMZ A;  1TVK A;  4KUM A;  3VQW A;  1BHA A;  2AW9 A;  1I08 A;  4DO2 A;  1VQ8 V;  3BY6 A;  4LWS B;  5IJ0 A;  1N36 O;  2Y0I A;  3RYF A;  2JGD B;  3KG2 A;  1R1B A;  3UO2 A;  1B3Q A;  2EIM B;  2ZNJ A;  2E5L O;  2CGN A;  5H9C A;  4NXN B;  3SPI A;  4C7U A;  2OIE A;  4J80 A;  3OMA B;  2HHH B;  4OX9 O;  4E4E A;  4DUZ B;  1H8E G;  2DYS C;  2IW5 A;  4PDV A;  2GTA A;  2PI4 A;  4FLX A;  3K04 A;  1FD9 A;  2LFS A;  3E22 B;  4YY3 B;  1YSC A;  1J5E O;  4LFB B;  4G28 B;  4I9Q A;  4J42 A;  1I94 B;  1JA8 A;  3E8B A;  2OTL V;  4K0K O;  1KP2 A;  4X89 A;  3JAR B;  4OGQ B;  5FNV B;  1TA8 A;  3IAY A;  4MVU A;  5LYJ B;  4X62 B;  2DOS A;  4FIP C;  4JYB A;  1SZX A;  3ASN B;  1ENV A;  3N2G B;  2N04 A;  3SDL A;  3ZRV A;  1N4C A;  3HKD B;  4AHC A;  3LUT B;  4YJ2 B;  2V4D A;  3WG7 B;  5LA6 A;  2X7R B;  4UCS A;  3OTF A;  4DK0 A;  1MAB G;  1N33 O;  4NYK A;  4UCO A;  4EKW A;  2YS8 A;  4O4J A;  3ZMV A;  2QJ1 A;  3ABM C;  3HKB A;  4DXW A;  1Q3E A;  2X6A A;  1FXV A;  3ZHQ A;  1EZJ A;  4Z1V A;  2FL4 A;  2OCC C;  3RYI A;  2ITC C;  4O2B B;  4F4L A;  5EIB C;  1VF5 B;  2HG5 C;  4LFC B;  1KB9 F;  4BW9 A;  1NQT A;  2A0L A;  2GHY A;  5IYC O;  3RFR A;  4DUY B;  4YXW G;  5KHJ A;  5IWA B;  3G6E V;  4UFZ A;  3RBZ A;  1IXB A;  1EN4 A;  3ZRX A;  4H44 B;  3KKY A;  5H5N A;  1YZB A;  1FKA O;  1Z2G A;  1XRE A;  4DV7 O;  3APO A;  1OCZ B;  1WB7 A;  4O4L B;  4DV5 B;  3CRC A;  2N74 A;  1YCI A;  2YIC A;  3KZI Z;  1Q7Y W;  2YI8 A;  1M90 W;  4ICG A;  5DN6 G;  5KMG A;  4H0L B;  1XNR B;  2CK3 G;  4LFA O;  1XHZ A;  3BRC A;  3GVM A;  1KUQ A;  1OCO B;  2ZNI A;  2ATK C;  1BCC H;  3AG2 C;  3JAL A;  5K1X A;  2CE4 A;  3RYC B;  2QTO A;  1R3I C;  4LF5 B;  4IIJ A;  1SQG A;  3OW2 U;  3JD3 A;  4MTG A;  5LP6 B;  1IBM O;  4X20 A;  1GAX A;  2CTP A;  3JAM N;  2F4V O;  1IX9 A;  1MSW D;  1MSD A;  1V9P A;  1FJG B;  1QCE A;  3K06 A;  3NXS A;  4FK5 C;  4JI8 B;  2R9I A;  3W7T A;  1XMQ O;  3U11 A;  2WSS G;  2Z0A A;  2ZM6 O;  4DV6 B;  1QVG U;  5JVD A;  4JYY A;  4KHP B;  3ZHT A;  2AHZ A;  3BPZ A;  3H1L H;  1E79 G;  1NVP D;  1WA8 B;  3HPL C;  2FB5 A;  2ILM A;  4QNH B;  4I55 B;  1E1R G;  2RJZ A;  3W7X A;  4DR6 B;  1JR9 A;  2YSU B;  3UT5 B;  4P9P A;  5EZY B;  5FPO A;  3AG3 B;  2BOB C;  2HFE C;  3EFF K;  4FLW A;  5B1B C;  1DF5 A;  3JCU Z;  2UXC O;  3H1I H;  4BAY A;  5JQG B;  5CBF A;  1NVP B;  3E2E A;  4B3M O;  3BAA A;  1SQV H;  2R72 A;  3IGA C;  5D5Q A;  1EFR G;  4OPH A;  1O9G A;  3QF7 A;  2KB1 A;  2CTR A;  3JAW A;  2NLJ C;  3STL C;  2FTK A;  1OCC C;  4B3R O;  4FZ1 A;  3FKS G;  3OAA G;  4WFH A;  3MDS A;  4GX5 A;  5JCO A;  1QLE C;  4QPK A;  3G67 A;  3K9A A;  4GZR B;  5LMN B;  3SPJ A;  4PHZ A;  1HDJ A;  4DW0 A;  3ABK C;  2EIJ B;  4JI4 O;  1ZWI C;  3PN1 A;  4JTC B;  3E8G A;  1FAF A;  5JCO C;  3L70 H;  1M4U A;  1RFY A;  3BCC H;  4LP8 A;  4YIO A;  3FD9 A;  2ZQM A;  4LF9 O;  2Q4P A;  4GT1 A;  4U3J B;  5LGN A;  1FXK B;  2Y69 B;  1AR1 B;  3T1Y B;  3CRM A;  4I0X B;  5J2T A;  3SGI A;  1M56 B;  4BIO A;  1XOU A;  2CTQ A;  2ZE6 A;  1EM1 A;  1XL6 A;  2WLN A;  5KLV H;  1IDS A;  2WLL A;  4I9W A;  3UO3 A;  2VWJ A;  3ETD A;  1KKC A;  1HWY A;  1WJZ A;  3K03 A;  2XHB A;  1U96 A;  2DW4 A;  3A8T A;  4PA7 A;  1S77 D;  4D7S A;  4LF8 B;  2YXY A;  2ZIO A;  1NBM G;  3ABL C;  4TQF A;  3P3N A;  5GW7 A;  1RSO B;  3HKE A;  4B7K A;  4KL1 A;  3E35 A;  4J9Z B;  5LOV B;  3UCS C;  3A2F A;  2E75 B;  2UXB B;  3QVN A;  2IH3 C;  3DGE A;  2VQE O;  4I50 B;  3RGB A;  4CH3 A;  1W0J G;  2LW1 A;  3TJT A;  1M93 A;  4DV4 O;  3HR0 A;  3UQ8 A;  4GKJ O;  4AQY O;  3L71 H;  4MS2 A;  1ARO P;  4BR6 A;  2A06 H;  4UUJ C;  1N36 B;  1GN3 A;  1V54 B;  4TUY B;  4FJC C;  4WBN B;  4CS2 A;  4JAV A;  4GUN A;  5IYD O;  4TQD A;  3CCS V;  1JFF B;  3WFV A;  2JRI A;  1Q6H A;  3CCU V;  1R73 A;  3T4D A;  2UUA O;  2ZXW B;  3J80 N;  4DYL A;  5LHI A;  3OR7 C;  4PV1 B;  3TXQ A;  1R3K C;  4EFB A;  5E79 Z;  4N21 A;  5IY5 C;  1HNZ O;  4OX9 B;  1ZL8 A;  2QKA A;  4YIP A;  5B1N A;  4JF3 A;  4BW5 A;  2OTJ V;  2DWD C;  3Q4H B;  3ZS8 C;  4FLY A;  4FLV A;  2GTS A;  3RWR D;  5KX5 A;  2EBO A;  2JS5 A;  4LNU B;  2ARH A;  2DE0 X;  5IE9 A;  2QDO A;  4FLZ A;  4FFB A;  3T2M A;  2EZO A;  3ZMS A;  1Q8I A;  3TK1 A;  1TAE A;  1VQN V;  4PDR A;  3UM7 A;  4LF7 O;  3BA9 A;  1M1K W;  5CA3 A;  1VQK V;  4K8X A;  2IU3 A;  2WLJ A;  3KCX A;  3ETE A;  2RCV A;  3CPW U;  2CAZ C;  3CC2 V;  3AG1 C;  4DR1 O;  1PPJ H;  3OUS A;  4TWK A;  3BVO A;  4J11 A;  1N33 B;  3RVZ A;  1H2G A;  1YIJ V;  1HR0 B;  2DYR B;  1SA0 A;  3FAV A;  3SPH A;  2ADP A;  2F43 G;  4X9Q A;  1Y76 B;  1X4T A;  4X1K B;  3BHP A;  4LBE C;  1SET A;  2CH7 B;  4X65 B;  2BSK A;  2YDE A;  2M6Y A;  4YHH O;  5B3S C;  1A32 A;  1PNK A;  2Q9L A;  2EIL C;  3CEI A;  2JJ2 G;  3ZMT A;  4DR2 O;  2O57 A;  4JI3 O;  4K35 A;  2F66 C;  2K9P A;  5JJN B;  2Q8V A;  4IL6 Z;  4EB6 B;  2X6B A;  5BMV A;  1AIL A;  1SQP H;  2JS3 A;  4L87 A;  1IZ3 A;  5B1A C;  5EYP A;  1EBO A;  3K59 A;  2VQF B;  3TXS A;  3P3P A;  5A9G A;  5IJ9 B;  1IBK B;  2WLK A;  4JI6 O;  4CH5 A;  3ICX A;  4X88 A;  4ZHQ B;  3J7A U;  5A2Q N;  3CCR V;  2QA4 V;  1F23 A;  2VS0 A;  3G6B A;  4LWS A;  1ZUQ A;  2OT5 A;  3RT3 C;  3M99 B;  5EC2 C;  1N34 O;  2D3O W;  1BL8 A;  2PTM A;  1VQL V;  2FML A;  1IBM B;  2V1D A;  4N23 A;  4K8Z A;  1AR4 A;  3APQ A;  1J95 A;  1LR1 A;  3H01 A;  2P90 A;  3A0R A;  4QE9 A;  2QWR B;  1GM8 A;  2ZM6 B;  3F5W C;  1NT2 B;  2ZE7 A;  3E22 A;  4PA6 A;  1YJN V;  4WCE V;  4DK1 A;  3JAR A;  2PYL A;  5GON B;  2UU9 O;  1TUB A;  4GKK O;  2Y4U A;  1PL4 A;  3SPG A;  2XT9 A;  4X1Y B;  3K5O A;  2CUG A;  2EIN C;  1SRY A;  4NB5 A;  1W2B U;  2IH1 C;  3N2G A;  2W6I G;  4G2K A;  5KHK A;  1WPB A;  2OYQ A;  1YF2 A;  1F4N A;  3TCU A;  4YJ2 A;  2WLI A;  4TSF G;  4JTD B;  1KU9 A;  1NI8 A;  1UFI A;  2NNU A;  2YIB D;  3IC7 A;  4X64 O;  4B3R B;  4O4H B;  2XUM A;  1S5H C;  4DV2 O;  4DV1 O;  3H1J H;  4MTX A;  2WAM A;  1M57 B;  3PJS K;  1SQB H;  5L3D A;  4O2B A;  2BOC C;  4HNA B;  1KD1 W;  3LSQ A;  3ZIA G;  2YI9 A;  5DM6 V;  1BZK A;  1RM1 C;  4HAM A;  4JI7 B;  1QLN A;  3QTC A;  1I0H A;  4TV8 B;  1Z5W A;  1BQ0 A;  2BTQ B;  4MTO A;  1JMK C;  4RUF A;  4CC6 A;  1NKD A;  2QKS A;  3B8N A;  4LR3 A;  1JPX A;  5KAI Z;  3CCQ V;  2B1G A;  2HKO A;  3ETG A;  2ZDI A;  4P9O A;  4DR4 O;  5KHI A;  1G4Y B;  2B9Z A;  1Q82 W;  3R66 A;  4I4T B;  3S3X A;  2XAF A;  4UVC A;  4F6E A;  4F6R A;  4O4L A;  4JAS A;  3J81 N;  4UB8 Z;  1NTM H;  2ZKO A;  4JZG A;  2ZDI C;  2Y4T A;  1VMG A;  4DR5 O;  4NR1 A;  3CB2 A;  3JAS A;  1PKX A;  2LGW A;  4LH6 A;  2QR4 A;  2E76 B;  4GYC B;  1EZV H;  4J7Z A;  2JVD A;  1N32 O;  2HVJ C;  4O4I A;  2HR3 A;  1XUQ A;  1NTZ H;  3LDE A;  2P22 C;  2RDC A;  5L3E A;  1TVK B;  4GLX A;  2QTS A;  1NS1 A;  4FPP A;  3ASO C;  5LP6 A;  2QWQ B;  1T5E A;  3CX5 F;  5LHH A;  1HNW O;  1R6K A;  3KCY A;  5IJ0 B;  5CBH A;  1AI5 A;  3FB8 C;  2JJ1 G;  2H3O A;  1OCR C;  2LO1 A;  4CH6 A;  1XMO O;  2BE3 A;  4MVQ A;  4RO2 A;  2W0X A;  1WA8 A;  3CCL V;  2XAH A;  2VQE B;  3K58 A;  3C90 A;  1VAR A;  3K5M A;  2GBO A;  3ZMU A;  3B09 A;  4AQY B;  4X1I A;  5KAF Z;  1GK9 A;  3AG4 C;  3OTO O;  3UT5 A;  3P30 A;  2QE7 G;  5EZY A;  1KBH A;  3GWO A;  1IBL B;  4B3S B;  3AEI A;  5EIB D;  3N2K B;  2EIK C;  1GTO A;  3G4S V;  1GO3 F;  1M9N A;  2KQX A;  2UUB B;  4I5S A;  3LSU A;  2ZT9 B;  3L75 H;  1CXZ B;  4RQE A;  2QKC A;  1HNZ B;  2EX3 A;  3ABM B;  4DRX A;  1YXB A;  4JI2 O;  3I5D A;  5L3C A;  4ZI7 A;  1DLB A;  3C3T A;  2OCC B;  5JJJ B;  1YIT V;  1IXM A;  1BSM A;  1PD3 A;  2AHY A;  4O4J B;  1K97 A;  3CWB H;  1H38 A;  3HKB B;  1PP9 H;  1KEC A;  4IHJ B;  4WF9 V;  2E3C A;  2MK3 A;  4LF7 B;  3X2Q C;  1N0N A;  4UXN A;  3OM3 B;  2UUC O;  3S3W A;  2IM9 A;  2W6J G;  4JYC A;  3SYQ A;  3ML0 A;  1VF7 A;  3CRA A;  1JCH A;  1FXK A;  4DR1 B;  1X59 A;  1WP8 A;  1R3L C;  4FLT A;  1VQ4 V;  2ZE5 A;  1WP7 A;  4KP4 A;  3CJH A;  3SYA A;  1VQ6 V;  5J9P C;  4QIW F;  1F7Y A;  3B2E E;  1F51 A;  3T1H B;  3OT7 A;  4H33 A;  5EBL C;  2DJV A;  1FXK C;  4FM1 A;  1YDX A;  1XDC A;  2KKW A;  4PA4 A;  2L35 A;  2YID A;  3M8A A;  2ZIN A;  3ZED A;  3AG2 B;  3LDC A;  3O65 A;  5KMG B;  1K8A W;  4Q20 A;  4J7K A;  5KHH A;  3ZBH A;  2B5U A;  1GKF A;  3CME V;  2UXX A;  2V7Q G;  2HVK C;  4J41 A;  3CP1 A;  5CA1 A;  4IIJ B;  4I7Z B;  1WB8 A;  3DTU B;  3QO7 A;  4CS3 A;  2NR5 A;  1Y74 B;  3RN4 A;  4IYH A;  1DF4 A;  1RPR A;  4DR3 O;  2HHH O;  4DUZ O;  4KXR A;  1V55 C;  4JV5 O;  4UV8 A;  4ZIB A;  3ZN0 A;  4U3F H;  5LXT B;  5JVD B;  1LUV A;  1URF A;  2GDS A;  3ZRW A;  4YY3 O;  4HYO A;  1P7G A;  3HKC B;  4TUY A;  3SJB C;  2AZ2 A;  3ABT A;  1W0K G;  3RYH A;  5B1B B;  1JFF A;  2P06 A;  5KA6 A;  3BAB A;  2HJF C;  4IGG A;  5B1O A;  2XAS A;  4LF4 B;  1I5Y A;  5KHG A;  2CTW A;  4FVM A;  3FYI B;  1QVF U;  3OD4 A;  1Y66 A;  1B04 A;  4FM2 A;  1M5I A;  1OCC B;  2YUA A;  3Q4H A;  4X66 O;  1VQ9 V;  1K34 A;  2ZXW C;  3CC4 V;  3K5N A;  4UB6 Z;  3BA8 A;  1I5X A;  1QLE B;  1DGS A;  2A3Q A;  5FL7 G;  1GH6 A;  2UXD O;  1P49 A;  3OMN B;  1TGO A;  1NTK H;  3JAW B;  1NZ6 A;  4K3A A;  3ABK B;  1HW7 A;  1S3J A;  4H37 A;  4A5U B;  3D3Q A;  3K9S A;  3THO A;  3CS5 A;  2WWW A;  3LDD A;  5JH7 A;  1ZSP A;  5IWA O;  1AI4 A;  4YJ3 A;  3A0B Z;  1GRJ A;  3OE7 G;  5DED A;  4MVM A;  4J9Y B;  1AVM A;  1ZX3 A;  2R9A A;  2P5O A;  1K7D A;  4TOI A;  5CA0 A;  3AK2 A;  2DMX A;  2F1M A;  2Q6A A;  3H1H H;  4X64 B;  2LFR A;  2E5L B;  1Y4M A;  3B40 A;  4JAA A;  3WU2 Z;  4DV2 B;  1QBZ A;  1K5Q A;  2MW2 B;  4PA9 A;  4TT3 G;  5L3G A;  4DV1 B;  1Y76 A;  5BY1 A;  5J2U A;  5AG2 A;  3STZ C;  4TV9 A;  1R6T A;  1Q81 W;  4UV9 A;  1H2N A;  3MHS C;  4XDJ A;  5HFL A;  1JQ0 A;  5J2T B;  1CPY A;  4LF6 O;  4FLU A;  5D5P A;  2WLH A;  4FM0 A;  2B1I A;  1XNR O;  2XOK G;  1J5E B;  1FFX A;  3ABL B;  2QM7 A;  3EXA A;  1AI7 A;  5C8Y A;  4RQF A;  4XDK A;  4EB6 A;  4MVS A;  1K4C C;  3CCV V;  4DR4 B;  4K0K B;  1HNX O;  4HBN A;  1L0N H;  5EC1 C;  4LF5 O;  5GTH Z;  5EBW C;  3R65 A;  2VWK A;  3G71 V;  3AK1 A;  2OWO A;  2ZD9 A;  1FJG O;  4MTF A;  2DQ3 A;  4PDM A;  2KG7 B;  1TUE B;  2YXL A;  3HKE B;  3ZHS A;  4DR5 B;  1QQC A;  4IYI A;  5ITZ A;  4DV6 O;  3F7V C;  1G8M A;  2YEV B;  4DV3 O;  4KHP O;  1YI2 V;  4JI0 O;  3WB0 A;  1D2D A;  1PL0 A;  3E86 A;  3UKM A;  4FFK A;  5B5E Z;  2L6L A;  4PA3 A;  4AI8 A;  1B06 A;  4DR7 O;  3JAK A;  3U0Z A;  3JSL A;  3W7W A;  4ZOL A;  2HJD A;  3K79 A;  1US6 A;  1SER A;  1XQ8 A;  1HNW B;  4JTA B;  1HP8 A;  3DXR A;  5IY5 B;  2NN4 A;  5LBQ A;  1PM9 A;  3F7Y C;  2EUL A;  1H8H G;  5CB4 A;  5EK0 A;  2GUZ B;  1EN5 A;  1GM9 A;  1WAZ A;  4GX1 A;  2M7W A;  1XBL A;  4ZBM A;  3VOU A;  1SQQ H;  1ZL8 B;  2ITD C;  2QWO B;  4PJ0 Z;  2JGU A;  1DK1 A;  4R6Z A;  4DV7 B;  3JAT A;  2LP7 A;  2OCH A;  4O2A B;  1Y6X A;  1UPG A;  1O9H A;  5IYZ B;  5KX5 B;  5LMN O;  3U10 A;  3D36 A;  4FFB B;  1PNM A;  3K57 A;  3SYC A;  3H9V A;  4LFA B;  3AG1 B;  4Q6G A;  3RW0 A;  4NTX A;  4AIL C;  3FB5 C;  3FB7 C;  2PUS A;  1ORQ C;  2HEP A;  2JGD A;  2IJI A;  2Y0P A;  3D36 C;  1BMF G;  3CHX A;  4JI2 B;  1FYJ A;  3QG5 A;  3OMI B;  1QNM A;  3JD2 A;  2F4V B;  3FYE B;  2ZE8 A;  1SES A;  4QGP A;  4QE7 A;  2QGN A;  4HNA A;  4RWU A;  3AK3 A;  1I7F A;  4R50 A;  1XMQ B;  3OFN G;  1PNL A;  4PI2 A;  3N27 A;  3JSN A;  3FAV B;  3P32 A;  2EIL B;  1YVW A;  4TV8 A;  1Y67 A;  2BTQ A;  3HB3 B;  2EIM C;  3SPC A;  4UCR A;  5JJE B;  3M7M X;  1LUW A;  2UUC B;  4RAI A;  1E1Q G;  2F95 B;  2YIB A;  3K0G A;  4CBC A;  4QPJ A;  1QU7 A;  4I4T A;  3CE2 A;  5B1A B;  5FNV A;  1QR8 A;  5F2V O;  1P4R A;  5LYJ A;  3VQV A;  1L1F A;  3JD4 A;  1YJW V;  2ETN A;  1YJ9 V;  3HKD A;  2G38 A;  2UXC B;  3CCE V;  3GWK C;  4ZKI A;  3CYO A;  2RN9 A;  5EYP B;  3E8F A;  4B3M B;  4DV0 O;  2D2C B;  3ASN C;  2OIG A;  2P4K A;  3IJ4 A;  1XNQ O;  2F93 B;  5KUK A;  3H1K H;  2WLM A;  4W4L A;  1BGY H;  3WG7 C;  5CMU A;  4PD4 F;  3VQX A;  1WPX A;  1S76 D;  2Q69 A;  1VQ7 V;  3CRQ A;  2RMK B;  2Z3Y A;  4NTY A;  4JI4 B;  4WFF A;  2LJ2 A;  2WA3 A;  4JI5 O;  2JK5 C;  2XAG A;  2DN9 A;  4XBF A;  4DR3 B;  4LF9 B;  4JPR A;  4JV5 B;  2CGO A;  1AB3 A;  4KFM A;  4JYA O;  4E2L A;  4B3T O;  5JWP A;  2EIN B;  5IT9 N;  1SS3 A;  1VP7 A;  1MOF A;  1THZ A;  1JOY A;  1S0V A;  2A7W A;  1WLE A;  1W59 A;  5LGT A;  3N2K A;  3CRR A;  1AP5 A;  2N05 A;  1TUB B;  1OCZ C;  1VQO V;  3D8C A;  4R8C A;  4OPA A;  1RPO A;  2AZ0 A;  3I55 V;  4NXM O;  1H2S B;  1XIL A;  1K5S A;  2Z5U A;  1JJ2 U;  4L8J A;  1BE3 H;  3B4S A;  3RYC A;  3K3W A;  2QWP B;  1OJH A;  3BFR A;  3L72 H;  4X66 B;  2IJH A;  2WLI B;  1OCO C;  1K33 A;  5K1P A;  4J10 A;  3T4Z A;  4JI1 O;  1VQP V;  2DYS B;  2Q0O C;  4NTW A;  3RYF B;  2UXD B;  1YHQ V;  4BIZ A;  1DTO A;  1HR0 O;  1RM1 B;  5CN0 A;  5LP6 C;  5BZB A;  3CSX A;  5KUM A;  4IHJ A;  4MVZ A;  1WNS A;  3IC9 A;  5BR8 O;  2GV9 A;  5H6Q A;  1MZE A;  4X65 O;  2HLD G;  1K4D C;  5BXZ A;  4I55 A;  3QO5 A;  1YEW A;  1L8D A;  3DC5 A;  4DV4 B;  4PEL A;  2KSD A;  5LMU O;  1OHH G;  1XHX A;  4GKJ B;  3FX7 A;  1BS3 A;  3VBB A;  4XDL A;  3E83 A;  2JDI G;  2YC0 A;  1LNQ A;  1MG1 A;  5LHG A;  4MW3 A;  1GM7 A;  4UCT A;  1WN7 A;  1BQZ A;  5JQG A;  2UUA B;  4CH4 A;  2VQF O;  1AP6 A;  4F6R B;  5LGU A;  4GX0 A;  1Q6U A;  2P6J A;  1Q5O A;  2LW7 A;  1YTF D;  3AG3 C;  4HZ3 A;  2Q5Z A;  1JVM A;  1GN4 A;  1IBK O;  2K1E A;  1BT8 A;  4MSW C;  4LF6 B;  1ZAU A;  4PI0 A;  3ASO B;  1P7B A;  1SQX H;  2E74 B;  1MNG A;  3JAS B;  4NVP A;  5HFM A;  2Y48 A;  5GTI Z;  5LA6 B;  4D6T H;  4O4I B;  1RP3 B;  4CS4 A;  1SF9 A;  1HNX B;  2X6C A;  1OCR B;  5E1A C;  4Z2W A;  2JEX A;  5C93 A;  1YTF B;  1ZLZ A;  4DW1 A;  1Y74 A;  1S5J A;  3RYI B;  2A79 B;  5FLX N;  1AJN A;  3B8M A;  1NR1 A;  1U97 A;  5KA5 A;  1K3E A;  3ZHR A;  1D5N A;  2LGQ A;  3TET A;  3WB1 A;  4U3J A;  2EIJ C;  5LXT A;  1MA1 A;  3SJQ C;  4LH7 A;  4DV3 B;  1KMI Z;  1QHT A;  2LQT A;  3AG4 B;  4JI0 B;  2Q73 A;  3HKC A;  4I0X A;  2PGG A;  4GCZ A;  1KC8 W;  1B6Q A;  3MAQ A;  1P84 F;  3ETQ A;  2ZR2 A;  2EIK B;  4DR7 B;  1F4M A;  4CC5 A;  4X1I B;  3OEH G;  2ZCE A;  1JJO A;  1GN6 A;  1G6U A;  2Y69 C;  2ZR3 A;  3LNN A;  3CD6 V;  3ZN1 A;  4YHH B;  1M56 C;  1NJI W;  3F5T A;  3CXH F;  3W7U A;  4DR2 B;  2X0L A;  3A0H Z;  4JI3 B;  2VRZ A;  5IYB O;  3JD0 A;  1RSO A;  4P30 A;  3JAL B;  4RUE A;  4JZ2 A;  3ZJZ A;  4DRX B;  2IJK A;  5LOV A;  4X20 B;  4ZI7 B;  3X2Q B;  4PDL A;  4NXN O;  4I50 A;  4JI6 B;  1Q43 A;  2AXT Z;  4U7N A;  2QSA A;  2HP8 A;  2XTA A;  3VQY A;  4JI7 O;  3E8H A;  2BCC H;  4J7J A;  5FPR A;  2IBZ H;  1S72 V;  3EVK A;  4BIU A;  4MT8 A;  4LFB O;  1XL4 A;  4WBN A;  1AJQ A;  1N34 B;  1Q86 W;  2P7T C;  1I94 O;  2PY5 A;  1ROP A;  3ZRS A;  1COW G;  3K0D A;  3OUF A;  2DQ0 A;  4X62 O;  2A9H A;  3DC6 A;  5L3B A;  4B7E A;  1V54 C;  4CZZ A;  4WFA V;  3L73 H;  3L9D A;  3CJH B;  1G1X B; 
#chains in the Genus database with same CATH homology
 3CX5 F;  1SQQ H;  3H1H H;  1NU1 H;  3L72 H;  4D6T H;  1PPJ H;  3L75 H;  1BCC H;  3H1K H;  3CWB H;  3L70 H;  3BCC H;  3H1J H;  1KB9 F;  3L71 H;  3H1L H;  1L0N H;  3L74 H;  1PP9 H;  3CXH F;  5KLV H;  1BGY H;  1SQB H;  2A06 H;  1EZV H;  4PD4 F;  3H1I H;  1KYO F;  1P84 F;  1L0L H;  1NTK H;  2FYU H;  1NTZ H;  1BE3 H;  3TGU H;  4U3F H;  1SQX H;  2BCC H;  1NTM H;  1SQV H;  3L73 H;  2IBZ H;  1SQP H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...