4U3FH

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
EELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 22
structure length 68
sequence length 68
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4u3fH00
1BCCH 1BE3H 1NTZH 4U3FH 1PP9H 2BCCH 3CWBH 1NTMH 1NU1H 1SQVH 1P84F 1KYOF 1NTKH 4PD4F 1BGYH 3L73H 3L72H 3L70H 3CXHF 1SQPH 1SQBH 3H1IH 2FYUH 3BCCH 1SQXH 1L0NH 3CX5F 3H1KH 3L71H 5KLVH 3TGUH 4D6TH 3L75H 2A06H 3H1LH 3H1JH 1L0LH 1PPJH 2IBZH 3H1HH 1KB9F 1SQQH 3L74H 1EZVH
chains in the Genus database with same CATH superfamily
4PA7A 1S5JA 1U97A 3FB6C 5IYBO 1H2KA 2XAFA 1Y6XA 4XDJA 1YITV 2H94A 2UU9O 3ASOB 1PNLA 1N36O 4LBEC 2HHHO 1KECA 5C8YB 3R65A 5BMVB 5GONA 5IYZA 2VRZA 1IX9A 3HPLC 3WU2Z 4LF6B 2ARHA 4O4LA 4UCOA 1EN5A 4X8AA 1M56B 2Q73A 4ZOLB 3F5WC 3ZIAG 4DRXB 4WBNB 3DGEA 5LHIA 2QEXV 1GM9A 1HNWB 2ZM6B 2PYLA 1F51A 2GHYA 3RW0A 1GO3F 1SZXA 4LCUC 2BTOA 1N4CA 3SYAA 1H2LA 1Z5VA 4UVBA 4JI2O 2CH7A 4JI7B 1G8MA 2ZIMA 3JALB 4LP8A 1JX9A 2LFSA 2WAMA 4GCZA 4C7UA 4LF9O 4YJ2A 4DW0A 2IJKA 2X6CA 3H1KH 3L71H 3THOA 3N2GA 2RDCA 2EILB 1PL4A 4J7ZA 1XL4A 1V54C 1I0HA 3GWKC 5DECA 1QHTA 2JGDB 4G2KA 3VQWA 1FXKC 3KG2A 1K73W 3W7UA 4X64B 4JI6O 1UFIA 3E8FA 1R3JC 2K1EA 1AP6A 4LF8B 4D7SA 3WB0A 1FPOA 4U7OA 2UXBO 4O4LB 3OEEG 4X1KA 5HFLA 4R7CA 1E1QG 1XBLA 3FAVA 4N21A 5JJJB 4I9QA 1AP5A 1VQOV 4IIJA 1XMQB 1H38A 2PZSA 3G67A 1NH2D 1XEQA 3E83A 1V55C 3ZN1A 3KCYA 1YTFB 2YXLA 4JI0O 1N34B 3MD0A 2EZOA 1OCZB 2D2CB 4HYOA 1JCHA 3UT5A 2LQTA 1K7DA 4CBCA 1GN4A 4DR7B 2M6YA 5D5PA 1V9PA 3AK2A 1SKVA 2VQFB 2HKOA 3CCRV 2PGGA 1CXZB 1LNQA 2QKAA 1R6NA 3H1IH 4YJ2B 1COWG 1JVMA 3K9SA 1LUWA 1XMOO 2VQEO 3JSLA 2KQXA 2UUBO 1NI8A 1MABG 3VQYA 3JALA 5FPRA 1GRJA 2JJ2G 1R6TA 2OYQA 1W0KG 3SYQA 2C2AA 2Y4TA 2BCCH 4MTXA 2EIKC 4FFBA 4A5UB 1EFRG 1S0VA 2BTQA 3JAKA 2DQ0A 5HFMA 2LW1A 1OCCC 5JJEB 2JK5C 3DXRA 1SZTA 1FD9A 4JI8O 3CS5A 4PDRA 4XBFA 3SPIA 4JI7O 3ZEDA 4O4IB 4QGPA 2Y69C 2XAHA 1P4RA 3QTCA 4DV7O 3CB2A 4GT1A 3CHXA 4DV7B 4DO2A 1YDXA 4LF7B 4FZ1A 3BAAA 2ZM6O 2WPDG 1NH2B 4OPAA 1HNWO 3G4SV 2WWWA 3F5TA 3K03A 4HNAA 5FPOA 4DR1O 1S76D 5H2FZ 4U3FH 2FTKA 4JTCB 1MZFA 5CBFA 3ZRWA 1M90W 3TJTA 4ZOLA 5IYDO 4YJ3A 1X4TA 3CCEV 1BHBA 2ZKOA 4G28B 4PA6A 5LMUB 4X20A 2MW2B 4FLUA 1SC5B 3JSNA 2ATKC 1FXVA 3ML0A 2Q7EA 1VQNV 1PL0A 1FKAO 3SPJA 2VQEB 4WFAV 4LF5B 3DC6A 4LF9B 4MVOA 1KP3A 4J80A 4NB5A 4MVSA 5C93A 1FXKA 3BRCA 1B6QA 2VQFO 1WB8A 1DLBA 2WLIB 3ETEA 4PA4A 4KP4A 1F23A 2P4VA 4BW5A 3CCJV 5B1NA 3F7VC 4DV3B 1E79G 1QLEB 1VQMV 2O57A 4CS2A 2CK3G 4I55B 2JIZG 3MDSA 1AB3A 4JI0B 3ASNC 2YEVB 3FYEB 4RQFA 2OCHA 1L0LH 5B1AC 4I50A 1SQQH 1W2BU 2UUAO 1CP9A 5IWAB 4UCRA 5IYZB 1Q8IA 1GK9A 1AI6A 1NT2B 3SYCA 1WPXA 3WG7C 1NTKH 2EULA 1G1XB 4HNAB 1SF9A 1GKFA 4MVRA 2CH7B 4W4LA 1K4DC 1OCRB 4CH6A 5FLXN 3BY6A 2FYUH 2WLLB 3IC7A 4KL1A 2JVDA 5FNVB 4U3JA 4NXNO 3ABKB 3OMAB 2QWRB 5KAFZ 4X64O 1YCIA 2H8PC 4NXMO 5CB4B 1CPYA 5IJ0A 1K9MW 4LH7A 2XAJA 5CA3A 5LOVA 3HB3B 4MVQA 4O4HB 1L1FA 2PI5A 1F4NA 4FVMA 4MVZA 1FXKB 1BSMA 2G38A 4X88A 3A0BZ 3AG3B 5CA1B 5KLVH 4GKJB 1N0JA 4D6TH 4D7TA 4DK1A 3U10A 1QVGU 1WNSA 2OTLV 2LGWA 4X65O 3UT5B 2E75B 5H5NA 1M57B 3OTFA 1TAEA 2UXNA 4WFHA 4UVCA 5GW7A 3RWRD 3K5NA 2EIMC 2F66C 4TUYB 4TV8B 1THZA 1XHXA 3G80A 3BEHA 1GTOA 3SPHA 1IBLO 1Q81W 1WA8B 4CH3A 3ZS8C 1S77D 4B3MB 1I94O 4P9OA 4PELA 4CZZA 3CC4V 4ZI7A 1TVKA 5AG2A 2P4KA 1KKCA 3C3SA 4O2AB 3VBBA 3E35A 4GKKO 2ADQB 2Q7GA 4FM2A 1MSDA 5EBLC 2QM4A 4ASUG 4O4IA 1NU1H 3K79A 3SJQC 4DR6O 4JI4O 2JDIG 4O4HA 4LFAB 5CN0A 2DWEC 3HKEA 1XHZA 4JZGA 1VQ4V 2ZNJA 5L3FA 1CEZA 1R3LC 2IJHA 3DXRB 3RFRA 2FL4A 2P06A 4AQYO 5JJNB 4FLWA 4LFBB 2QWNB 5KHKA 4X66O 5FNVA 2CDYA 2DQ3A 3NXSA 1H8HG 4DR3B 1SA0B 3JD2A 1SQBH 2EJ7A 1PNKA 3JAMN 4TQFA 3HKCB 1K92A 2IU0A 2JEUA 3OEHG 2X0LA 4E2LA 4DV1B 1P7GA 3M7MX 1IZ3A 3ABMC 5E1AC 1NVPD 3JARB 1Y4MA 4X20B 4PHZA 1OCOC 2Q0AA 1H2MA 3ZHRA 5LGNA 3CEIA 2AXTZ 4YHHB 2BTQB 3JAKB 1QNMA 5KA6A 2DJVA 2GDSA 3RYHA 4FZ0A 2W0XA 4TWKA 4MVMA 2QTOA 4DUZB 2ZDIA 4O2AA 4RAIA 4JTDB 2A9HA 4QPJA 1N32B 2KG7A 3FB5C 4Z1MG 4B3TO 1P49A 4OX9B 2ADPA 2PI4A 4F6RB 4MTFA 1YI2V 5LHHA 3AG7A 5EIBD 1XOUA 1TUEB 4GKKB 4LH6A 2Z0AA 3IFXA 4GYCB 3CCLV 2DMXA 2WSSG 5C8YA 4GX0A 3A2FA 2AZ2A 2OCCB 2HP8A 2OWOA 5EZYA 3SYOA 3JCUZ 1YXBA 1KMIZ 4QNHB 2P67A 2YUAA 3AG1C 2JGDA 1D2DA 1VARA 1BT8A 3ASOC 5F2VO 3OW2U 3RN4A 1AR1B 3B4SA 5B66Z 1Y74A 2OT5A 3CJHB 4KHPB 3RYFB 2Q0OC 2EINC 2BE3A 5KHGA 4F4LA 3H1LH 4LF4B 3JARA 2GV9A 1BE3H 3ZCCA 4J42A 2NNUA 4UUJC 2M7WA 1KKDA 3E22B 3CYOA 3OTOB 2Y48A 3LSUA 4YXWG 1BQ0A 1RM1C 5K1XA 2V1DA 2ETNA 2YI8A 3CCVV 3OE7G 3SPCA 2NR5A 1OJHA 2L35A 2E5LO 1Y67A 4I4TA 4OX9O 3WB2A 4NXMB 3HR0A 2ITCC 1BS3A 4ZHQB 3CRMA 3DC5A 5A2QN 4FFBB 3BCCH 2EIJC 3SJAC 3K59A 4FLVA 1JJOA 1J95A 3T1YO 4X1YB 3TK1A 4B3RO 2DOSA 3K9AA 3AG2B 5LA6B 2WLLA 4FM0A 1VQ6V 3CPWU 4RO2A 5B3SC 1GMGA 2Q69A 3K0GA 3APQA 5LMNO 1AI5A 2CTPA 4LFCB 3CCUV 2A06H 2JRIA 4CS3A 4QPKA 4DR3O 4EFEA 1NJIW 1HDJA 2KB1A 2LJ2A 2ZE5A 1RPOA 3D36A 3GVMA 5KX5B 3SDLA 4NTYA 2PUSA 4OPHA 1X59A 4K8ZA 2B1GA 2BSKA 3CJHA 1FFXA 3FX7A 3LUTB 4LFCO 3RBZA 4GX5A 5LXTB 2EZPA 2N74A 3IGAC 4PDVA 4UVAA 5EYPA 4JI4B 4JV5O 3STLC 2R9AA 3W7WA 5J9PC 4JI5B 1PP9H 2HJFC 3MHHC 2Q7HA 5A9GA 4GUNA 2DYSB 3CRAA 2VWJA 5CA1A 2LP7A 1SQPH 1OZ0A 4NTXA 1WB7A 4P2ZA 3U0ZA 3ZMZA 2NLJC 4NYKA 4BIUA 3BA8A 2E5LB 3VQVA 1Q86W 3E86A 4B3MO 1B04A 4FLXA 1KYOF 1ORQC 1UPGA 4LF7O 4IT5A 4AHCA 1MSWD 3QVNA 1LUVA 1FAFA 4BR6A 3ETDA 3OTOO 1OCCB 5DN6G 2LW7A 3WFVA 5JWPA 2A7WA 1H2SB 1JOYA 1B3QA 2GUZA 2R70A 3FYIB 1O9HA 3FB8C 1NZ6A 4X65B 4MVUA 1M56C 4H33A 4FIPC 2F23A 1ZL8B 3J81N 4Q6GA 2RNBA 4B08A 4QE9A 2MK3A 3L72H 3ABMB 4X1YA 4I55A 5IY5B 4WFBV 1GH6A 4UV9A 4ZBMA 3W7TA 2IM9A 1PM9A 1RPRA 1GN6A 3O65A 3JD3A 3K58A 1Z2GA 3K0DA 4TT3G 1RSOA 5DM6V 5LGTA 3C90A 1SQGA 3JASB 1TUBA 2WLHA 4ICGA 4L87A 2UUBB 2Q9LA 1MMMA 1H2GA 3GWOA 1M9NA 2XAQA 1R1BA 1NR1A 2DYRB 3KZIZ 2Q5ZA 3T4ZA 5EZYB 3JAWB 1YSCA 3OMIB 3I55V 3E8HA 3T1HO 3TXQA 4IYIA 1NTMH 1QCEA 2UUAB 1Q43A 3ETGA 4DR2B 4X1KB 5IDJA 2WLNA 4LNUA 1KUQA 3GB7C 4KXRA 3IC9A 5B1BB 4YHHO 4J9YB 3ABLC 4TQDA 2HVJC 1DGSA 3HKDA 5K1PA 4DV3O 1DF5A 4Z2WA 2E74B 1AROP 1EZJA 4X62O 4HBNA 3R66A 1GN3A 1H2NA 5BR8B 1QLNA 1J5EO 2YSUB 3LNNA 1ROPA 1YJ9V 4BIZA 2LGQA 5IJ9B 4PV1B 4F6RA 1ZWIC 5EK0A 3LSQA 4NR1A 1TUBB 4AQYB 4WF9V 3WG7B 5J2TB 4FPPA 1K97A 2HEPA 4X89A 4LR3A 1Y76B 4U7NA 4FJCC 2HFEC 3N2KB 4DR6B 3QG5A 3ABKC 3ZHUA 1JQ0A 3OFNG 4CH4A 1MOFA 1TGOA 3A0RA 4ZIBA 2PYJA 2A3QA 5ITZA 5H9CA 3HKBB 1QR9A 2X7RB 1BHAA 5ITZB 2XT9A 1WPBA 5B1OA 5B3SB 3AG3C 3QNEA 4AI8A 3LDEA 5J2UB 2QE7G 2ZINA 1XILA 3ZX6A 2P7TC 3UKMA 4HZ3A 4YY3O 4FM1A 3BPZA 4WFFA 3HKDB 1K5QA 1URFA 3H01A 2JS5A 2QWQB 1TVKB 1Q5OA 5EC1C 1AJNA 4DYLA 3CCSV 2Y69B 3OR6C 2HHHB 1N36B 5JVDA 4DRXA 4K0KB 3AEIA 3ZHQA 4DXWA 4IL6Z 3FAVB 2Y0IA 4WCEV 4GLXA 2H3OA 5L3DA 3FB7C 1FJGO 4QJFB 4DR4B 2UUCB 2KKWA 3AG4C 1Y74B 3L70H 4AILC 2ZDIC 1IDSA 2RMKB 1VF6A 4WFGA 4P30A 4TOIA 3X2QC 3SPGA 3BHPA 5JQGA 1IBMO 4UFZA 3E8BA 3KKYA 1HR0B 1PNMA 1F7YA 2WA3A 4XDLA 3PJSK 2XTAA 2GTAA 4DUZO 3CWBH 1JFFB 2HR3A 1E1RG 2YS8A 4KUMA 4JAUA 4JI3O 4GX1A 1EN4A 1OV9A 1W59A 1L0NH 3WB1A 3CE2A 2KG7B 3HKBA 2ZNIA 3QO7A 5CB4A 3K3WA 3K5LA 3J80N 2P22C 3CRQA 1MG1A 4DV2O 5KUMA 1XMQO 1KD1W 2RJZA 4DV1O 2JJ1G 1SQVH 4B3SO 5CMUA 1KQSU 2YXYA 4CH5A 4G27B 1I08A 1Q6HA 5KHIA 1R3IC 2QGNA 2XNDG 2X6BA 4LF8O 1B06A 2F4VO 5TISZ 2JS3A 5IY5C 3ZMVA 2IBZH 3DTUB 3E2EA 2Y0PA 1SS3A 4DV5O 4DW1A 4PDLA 2UXDO 1O9GA 2CTWA 4X1IA 3JYCA 4MT8A 2X6AA 3CD6V 2L6LA 1MNGA 4JI1O 2JGUA 2B5UA 3NR7A 1QQCA 3UM7A 2VWKA 3BVOA 2IU3A 5KAIZ 2DYRC 2XHBA 1JPXA 5LGUA 2UXDB 4DV5B 1DF4A 5LBQA 3HKEB 4PDMA 2W0FC 4J9ZB 5H6RA 4HAMA 4LNUB 1YTFD 5EYPB 4MW8A 4ABMA 3O9OA 3N27A 1IBKO 3F7YC 5LP6A 1ZLZA 3RYFA 1W0JG 5B1BC 1Q3EA 2R9IA 4B3SB 4I4TB 3OGCC 4DR1B 5JCOA 3JAWA 4Z1VA 1R3KC 1XI1A 4R6ZA 3ZN0A 2WLIA 4DV2B 1NR7A 4LF6O 2UXCB 4B7KA 1SETA 1HNZB 2P5OA 1BL8A 1ZX3A 3G6BA 3LDDA 2ZT9B 2RCVA 2WLMA 2P6JA 4RUFA 1ZSPA 3ICXA 1T5EA 4BW9A 1Z5WA 3OMNB 4R50A 5JCOC 1Y66A 1ENVA 1YIJV 4PA9A 2BSKB 1WAZA 1RM1B 2WLJA 3RVZA 2AW9A 3TGUH 4JI1B 4UXNA 1KP2A 1RFYA 3VQXA 2W6JG 2ZE7A 1FJGB 2F1MA 4QIWF 1I5YA 3CMAV 2ZQMA 3CRCA 1OCRC 4O4JB 1HP8A 4I0XB 3RYIB 4BIOA 2EJRA 5L3EA 4XDKA 3ZMTA 1XMOB 2OIGA 1DTOA 5FL7G 5IJ0B 2EIJB 2PF4E 4H37A 1IXMA 4FLZA 1HNZO 3P30A 2UXCO 1IURA 3SJCC 4X62B 4RWUA 4YY3B 4PI2A 2A79B 5IWAO 2YC0A 3CSXA 4WBNA 4ZKIA 1NQTA 1IBKB 1FFTB 4ZHQA 4LC1A 2CTRA 3FD9A 4JF3A 1N34O 3P3NA 4J7JA 3CCMV 2XAGA 2LO1A 2N04A 5KUKA 1PKXA 1M57C 3LSSA 1WP8A 1D5NA 1PD3A 5GTHZ 2B9ZA 1D5AA 2UXBB 4MTOA 2XASA 3K57A 3M99B 2DN9A 3TETA 3M8AA 1K5SA 2EIMB 3K5MA 4P9PA 4BWAA 2DW4A 2Z3YA 4OXSA 3JD4A 4JI6B 4JAVA 3EFFK 4JAAA 4MS2A 2F93B 3CCQV 1R73A 4O2BB 1VF5B 2ZXWC 2XOKG 1V55B 1VEWA 4DR5B 2ITDC 5LMUO 4ZI7B 4K0KO 2ZD9A 5JQGB 1OCZC 4JASA 3RT3C 4EB6A 1DK1A 3H1JH 4UCUA 1K3EA 1KU9A 1SERA 4DK0A 1GM8A 1JA8A 4IIJB 2QDOA 5B5EZ 1AJQA 1BQZA 2P90A 2JEXA 1N33O 4X1IB 4YJ3B 5KHHA 1VF6C 2HVKC 3U11A 1VIBA 4E4EA 3HKCA 4X9QA 4YIOA 1VP7A 1M1KW 2HG5C 2F95B 2AHYA 5KHJA 2QKSA 4I5SA 2BOBC 1U96A 4EEQA 4JI3B 4NTWA 5BXZA 1AR4A 3G71V 4DV0B 4JI8B 4DV6B 1US6A 3ZMUA 1HR0O 2FB5A 5KMGB 3C3TA 1AR5A 1BGYH 1S3JA 4JGSA 3RYCA 2Q4PA 3CC2V 1FXHA 2YICA 3B77A 5LP6B 3JCZA 3OM3B 5IYCO 3ASNB 2UUCO 4DR4O 4J11A 4F6EA 3FFQA 3AK1A 3IJ4A 3UQ8A 3KCXA 1J5EB 1SQXH 5KMGA 1VMGA 4EB6B 5CA0A 3I5DA 5BR8O 1AVMA 3MAQA 2XUMA 4CS4A 1YJNV 2CE4A 2R9RB 3VOUA 1K4CC 4TSFG 4DR7O 3QO8A 4K35A 5LYJB 2GBOA 4N23A 4CC6A 4MSWC 2V7QG 1JR9A 4UV8A 5LMNB 5BMVA 5L3GA 1Q6UA 2EILC 1MA1A 2OCCC 2YIBD 4DR2O 1EBOA 1V54B 3SYPA 3ZHSA 5BY1A 1XREA 1HW7A 2ZR3A 4KFMA 1BCCH 3T1HB 5L3BA 2CUGA 2ZE6A 2DE0X 3AG1B 3UO3A 2F43G 3RYHB 3ZHTA 3CXHF 3ZHVA 1K34A 2EINB 5LL6Y 1K8AW 3IAYA 3E89A 2QTSA 3EHBB 3D36C 2QA4V 2RQ6A 4J41A 3B40A 4NVPA 4JI5O 3T1CA 3ZRSA 5JVDB 3JATA 4PD4F 3Q4HA 2Q67A 4JV5B 2HJDA 1OHHG 4UCTA 4DV4B 1YJWV 4PJ0Z 5B1AB 3QO5A 2DWDC 2DYSC 3OT7A 3FKSG 2QSAA 3ETQA 3EXAA 1ZAUA 1PV0A 4JYYA 3ZMSA 4NKGB 3N2GB 5CBHA 5JH7B 4IGGA 4JI2B 1SRYA 5KX5A 2GSMB 5D5QA 1TA8A 1HWYA 2EBOA 2YEVA 5LHGA 5LYJA 4TV9A 1VQLV 4J10A 1HNXB 4H0LB 1WN7A 2Y4UA 3A8TA 2CAZC 1YEWA 5BZBA 2QKCA 1SESA 3ZRXA 4JYAB 5CA0B 3ABTA 4JYCA 1Q82W 4B3RB 2EIKB 3UCSC 1R6KA 1G6UA 1N8RW 3E8GA 3K04A 4JTAB 2FMLA 1AI4A 2UU9B 3EVKA 1AJPA 3H1HH 3JD1A 3D8CA 3L74H 4I50B 1VQ5V 1QVFU 3CXCU 2YIBA 1K33A 4DV6O 3T4DA 4B7EA 1P84F 3SJBC 1XQ8A 3QF7A 2N05A 1OCOB 3AG4B 3N2KA 3K06A 4H44B 3S3XA 3ZBHA 1Y76A 3OD4A 3P3PA 3PN1A 3I56V 3W7SA 5E79Z 1GM7A 2YIAA 4RQEA 2NN4A 2CGNA 5EBWC 4DUYB 5IJ9A 1IXBA 2Q6AA 4LF4O 3D3IA 4EKWA 1WA8A 2ZE8A 4DV4O 5LXTA 1PPJH 4Q20A 4K3AA 4TV8A 1KB9F 1NS1A 1MZEA 4X66B 2LFRA 1YVWA 3S3WA 1QR8A 1ZL8A 1SQFA 1BMFG 1FS0G 3B2EE 2FKXA 4OGQB 3T2MA 1EN6A 1UJWB 1BZKA 1M4UA 5GTIZ 2AHZA 1WJZA 3CP1A 1XUQA 3BFRA 3JASA 2WLKA 1FYJA 1XNQO 3SR2C 5J2UA 4O2BA 2QR4A 5LP6C 1M5IA 2YXHA 1ZUQA 2E76B 4B3TB 1N32O 3OR7C 5L3CA 2W6IG 4UB8Z 3TCUA 1QLEC 2Q68A 5KA5A 3TXSA 2ODMA 1XNQB 4UCVA 1YF2A 1H8EG 3ZJZA 3CX5F 3RYCB 2AZ0A 1XDCA 2CTQA 3DSQA 4R8CA 1I5XA 5EBMC 1NVPB 1S5LZ 1EZVH 3K5OA 1Q7YW 5H6QA 1VF7A 1I94B 1S72V 3RGBA 1KBHA 2IJJA 4PI0A 4KHPO 2PTMA 2OTJV 2QJ1A 2WA4A 3K08A 5GONB 3E22A 3STZC 3RVYA 3LNMB 4LWSB 2K9PA 1NTZH 1S5HC 2IW5A 2D3OW 1N0NA 4FLYA 4RUEA 1XL6A 4MW3A 3T1YB 1VQ7V 3RYIA 2YDEA 4JYBA 3OGIB 4JPRA 1Q90D 1ZTEA 3ABLB 1M93A 5J2TA 2KSDA 4W4KA 3CC7V 4FK5C 4PA3A 3AK3A 1XNRO 1QU7A 3ABUA 1XNRB 1RP3B 2R72A 4DV0O 3BA9A 5LA6A 4GX2A 3H9VA 5CBGA 4NXNB 4WFEA 1VQ8V 2Q8VA 1EM1A 5EC2C 1WP7A 4FLTA 4YIPA 3OUSA 4I7ZB 4IYHA 2IJIA 4FMTA 4IHJB 1N33B 4JYAO 2AGAA 2Z5UA 3W7XA 1WLEA 4JZ2A 3X2QB 5EIBC 2QM7A 1HNXO 2EX3A 1SA0A 3L73H 2GTSA 1IBLB 2V4DA 5LOVB 4LWSA 2VS0A 4EFBA 1VQ9V 1FFXB 1I7FA 2IH1C 1NBMG 2YIDA 3CRRA 4DR5O 2YI9A 3B09A 1G4YB 2BOCC 3G6EV 4I9WA 3JD0A 1P7BA 1QBZA 4U3JB 1KC8W 2ZIOA 2IH3C 3ZRWB 1IVSA 3BABA 4I0XA 2RN9A 3B8NA 4LFAO 3ZRVA 3L9DA 3AG2C 3UO2A 4MTGA 2QWOB 3LDCA 2B1IA 2E3CA 1GAXA 1JMKC 4BAYA 3Q4HB 1F4MA 4J7KA 2F4VB 4TV9B 4K8XA 3OAAG 3D3QA 2CGOA 4GZRB 1A32A 1Q6IA 4UB6Z 5IT9N 2GUZB 5IE9A 3A0HZ 1LR1A 1JFFA 3J7AU 4O4JA 2ZXWB 3SGIA 5JH7A 3P32A 4QE7A 1JJ2U 3CMEV 1VQKV 2PY5A 4IHJA 1GN2A 4FFKA 2A0LA 4DUYO 2ILMA 2QWPB 1AILA 5DEDA 3OUFA 1YZBA 1VQPV 3APOA 1AI7A 3JATB 4UCSA 4LFBO 2OIEA 4H13B 1IBMB 2ZCEA 1RSOB 4L8JA 4GKJO 1NKDA 3MHSC 4CC5A 4LF5O 3B8MA 1YHQV 3L75H 4TUYA 1L8DA 2HLDG 2ZR2A 2QM8A 2UXXA
chains in the Genus database with same CATH topology
1BCCH 1BE3H 1NTZH 4U3FH 1PP9H 2BCCH 3CWBH 1NTMH 1NU1H 1SQVH 1P84F 1KYOF 1NTKH 4PD4F 1BGYH 3L73H 3L72H 3L70H 3CXHF 1SQPH 1SQBH 3H1IH 2FYUH 3BCCH 1SQXH 1L0NH 3CX5F 3H1KH 3L71H 5KLVH 3TGUH 4D6TH 3L75H 2A06H 3H1LH 3H1JH 1L0LH 1PPJH 2IBZH 3H1HH 1KB9F 1SQQH 3L74H 1EZVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC H;  1BE3 H;  1NTZ H;  4U3F H;  1PP9 H;  2BCC H;  3CWB H;  1NTM H;  1NU1 H;  1SQV H;  1P84 F;  1KYO F;  1NTK H;  4PD4 F;  1BGY H;  3L73 H;  3L72 H;  3L70 H;  3CXH F;  1SQP H;  1SQB H;  3H1I H;  2FYU H;  3BCC H;  1SQX H;  1L0N H;  3CX5 F;  3H1K H;  3L71 H;  5KLV H;  3TGU H;  4D6T H;  3L75 H;  2A06 H;  3H1L H;  3H1J H;  1L0L H;  1PPJ H;  2IBZ H;  3H1H H;  1KB9 F;  1SQQ H;  3L74 H;  1EZV H; 
#chains in the Genus database with same CATH topology
 4PA7 A;  1S5J A;  1U97 A;  3FB6 C;  5IYB O;  1H2K A;  2XAF A;  1Y6X A;  4XDJ A;  1YIT V;  2H94 A;  2UU9 O;  3ASO B;  1PNL A;  1N36 O;  4LBE C;  2HHH O;  1KEC A;  5C8Y B;  3R65 A;  5BMV B;  5GON A;  5IYZ A;  2VRZ A;  1IX9 A;  3HPL C;  3WU2 Z;  4LF6 B;  2ARH A;  4O4L A;  4UCO A;  1EN5 A;  4X8A A;  1M56 B;  2Q73 A;  4ZOL B;  3F5W C;  3ZIA G;  4DRX B;  4WBN B;  3DGE A;  5LHI A;  2QEX V;  1GM9 A;  1HNW B;  2ZM6 B;  2PYL A;  1F51 A;  2GHY A;  3RW0 A;  1GO3 F;  1SZX A;  4LCU C;  2BTO A;  1N4C A;  3SYA A;  1H2L A;  1Z5V A;  4UVB A;  4JI2 O;  2CH7 A;  4JI7 B;  1G8M A;  2ZIM A;  3JAL B;  4LP8 A;  1JX9 A;  2LFS A;  2WAM A;  4GCZ A;  4C7U A;  4LF9 O;  4YJ2 A;  4DW0 A;  2IJK A;  2X6C A;  3H1K H;  3L71 H;  3THO A;  3N2G A;  2RDC A;  2EIL B;  1PL4 A;  4J7Z A;  1XL4 A;  1V54 C;  1I0H A;  3GWK C;  5DEC A;  1QHT A;  2JGD B;  4G2K A;  3VQW A;  1FXK C;  3KG2 A;  1K73 W;  3W7U A;  4X64 B;  4JI6 O;  1UFI A;  3E8F A;  1R3J C;  2K1E A;  1AP6 A;  4LF8 B;  4D7S A;  3WB0 A;  1FPO A;  4U7O A;  2UXB O;  4O4L B;  3OEE G;  4X1K A;  5HFL A;  4R7C A;  1E1Q G;  1XBL A;  3FAV A;  4N21 A;  5JJJ B;  4I9Q A;  1AP5 A;  1VQO V;  4IIJ A;  1XMQ B;  1H38 A;  2PZS A;  3G67 A;  1NH2 D;  1XEQ A;  3E83 A;  1V55 C;  3ZN1 A;  3KCY A;  1YTF B;  2YXL A;  4JI0 O;  1N34 B;  3MD0 A;  2EZO A;  1OCZ B;  2D2C B;  4HYO A;  1JCH A;  3UT5 A;  2LQT A;  1K7D A;  4CBC A;  1GN4 A;  4DR7 B;  2M6Y A;  5D5P A;  1V9P A;  3AK2 A;  1SKV A;  2VQF B;  2HKO A;  3CCR V;  2PGG A;  1CXZ B;  1LNQ A;  2QKA A;  1R6N A;  3H1I H;  4YJ2 B;  1COW G;  1JVM A;  3K9S A;  1LUW A;  1XMO O;  2VQE O;  3JSL A;  2KQX A;  2UUB O;  1NI8 A;  1MAB G;  3VQY A;  3JAL A;  5FPR A;  1GRJ A;  2JJ2 G;  1R6T A;  2OYQ A;  1W0K G;  3SYQ A;  2C2A A;  2Y4T A;  2BCC H;  4MTX A;  2EIK C;  4FFB A;  4A5U B;  1EFR G;  1S0V A;  2BTQ A;  3JAK A;  2DQ0 A;  5HFM A;  2LW1 A;  1OCC C;  5JJE B;  2JK5 C;  3DXR A;  1SZT A;  1FD9 A;  4JI8 O;  3CS5 A;  4PDR A;  4XBF A;  3SPI A;  4JI7 O;  3ZED A;  4O4I B;  4QGP A;  2Y69 C;  2XAH A;  1P4R A;  3QTC A;  4DV7 O;  3CB2 A;  4GT1 A;  3CHX A;  4DV7 B;  4DO2 A;  1YDX A;  4LF7 B;  4FZ1 A;  3BAA A;  2ZM6 O;  2WPD G;  1NH2 B;  4OPA A;  1HNW O;  3G4S V;  2WWW A;  3F5T A;  3K03 A;  4HNA A;  5FPO A;  4DR1 O;  1S76 D;  5H2F Z;  4U3F H;  2FTK A;  4JTC B;  1MZF A;  5CBF A;  3ZRW A;  1M90 W;  3TJT A;  4ZOL A;  5IYD O;  4YJ3 A;  1X4T A;  3CCE V;  1BHB A;  2ZKO A;  4G28 B;  4PA6 A;  5LMU B;  4X20 A;  2MW2 B;  4FLU A;  1SC5 B;  3JSN A;  2ATK C;  1FXV A;  3ML0 A;  2Q7E A;  1VQN V;  1PL0 A;  1FKA O;  3SPJ A;  2VQE B;  4WFA V;  4LF5 B;  3DC6 A;  4LF9 B;  4MVO A;  1KP3 A;  4J80 A;  4NB5 A;  4MVS A;  5C93 A;  1FXK A;  3BRC A;  1B6Q A;  2VQF O;  1WB8 A;  1DLB A;  2WLI B;  3ETE A;  4PA4 A;  4KP4 A;  1F23 A;  2P4V A;  4BW5 A;  3CCJ V;  5B1N A;  3F7V C;  4DV3 B;  1E79 G;  1QLE B;  1VQM V;  2O57 A;  4CS2 A;  2CK3 G;  4I55 B;  2JIZ G;  3MDS A;  1AB3 A;  4JI0 B;  3ASN C;  2YEV B;  3FYE B;  4RQF A;  2OCH A;  1L0L H;  5B1A C;  4I50 A;  1SQQ H;  1W2B U;  2UUA O;  1CP9 A;  5IWA B;  4UCR A;  5IYZ B;  1Q8I A;  1GK9 A;  1AI6 A;  1NT2 B;  3SYC A;  1WPX A;  3WG7 C;  1NTK H;  2EUL A;  1G1X B;  4HNA B;  1SF9 A;  1GKF A;  4MVR A;  2CH7 B;  4W4L A;  1K4D C;  1OCR B;  4CH6 A;  5FLX N;  3BY6 A;  2FYU H;  2WLL B;  3IC7 A;  4KL1 A;  2JVD A;  5FNV B;  4U3J A;  4NXN O;  3ABK B;  3OMA B;  2QWR B;  5KAF Z;  4X64 O;  1YCI A;  2H8P C;  4NXM O;  5CB4 B;  1CPY A;  5IJ0 A;  1K9M W;  4LH7 A;  2XAJ A;  5CA3 A;  5LOV A;  3HB3 B;  4MVQ A;  4O4H B;  1L1F A;  2PI5 A;  1F4N A;  4FVM A;  4MVZ A;  1FXK B;  1BSM A;  2G38 A;  4X88 A;  3A0B Z;  3AG3 B;  5CA1 B;  5KLV H;  4GKJ B;  1N0J A;  4D6T H;  4D7T A;  4DK1 A;  3U10 A;  1QVG U;  1WNS A;  2OTL V;  2LGW A;  4X65 O;  3UT5 B;  2E75 B;  5H5N A;  1M57 B;  3OTF A;  1TAE A;  2UXN A;  4WFH A;  4UVC A;  5GW7 A;  3RWR D;  3K5N A;  2EIM C;  2F66 C;  4TUY B;  4TV8 B;  1THZ A;  1XHX A;  3G80 A;  3BEH A;  1GTO A;  3SPH A;  1IBL O;  1Q81 W;  1WA8 B;  4CH3 A;  3ZS8 C;  1S77 D;  4B3M B;  1I94 O;  4P9O A;  4PEL A;  4CZZ A;  3CC4 V;  4ZI7 A;  1TVK A;  5AG2 A;  2P4K A;  1KKC A;  3C3S A;  4O2A B;  3VBB A;  3E35 A;  4GKK O;  2ADQ B;  2Q7G A;  4FM2 A;  1MSD A;  5EBL C;  2QM4 A;  4ASU G;  4O4I A;  1NU1 H;  3K79 A;  3SJQ C;  4DR6 O;  4JI4 O;  2JDI G;  4O4H A;  4LFA B;  5CN0 A;  2DWE C;  3HKE A;  1XHZ A;  4JZG A;  1VQ4 V;  2ZNJ A;  5L3F A;  1CEZ A;  1R3L C;  2IJH A;  3DXR B;  3RFR A;  2FL4 A;  2P06 A;  4AQY O;  5JJN B;  4FLW A;  4LFB B;  2QWN B;  5KHK A;  4X66 O;  5FNV A;  2CDY A;  2DQ3 A;  3NXS A;  1H8H G;  4DR3 B;  1SA0 B;  3JD2 A;  1SQB H;  2EJ7 A;  1PNK A;  3JAM N;  4TQF A;  3HKC B;  1K92 A;  2IU0 A;  2JEU A;  3OEH G;  2X0L A;  4E2L A;  4DV1 B;  1P7G A;  3M7M X;  1IZ3 A;  3ABM C;  5E1A C;  1NVP D;  3JAR B;  1Y4M A;  4X20 B;  4PHZ A;  1OCO C;  2Q0A A;  1H2M A;  3ZHR A;  5LGN A;  3CEI A;  2AXT Z;  4YHH B;  2BTQ B;  3JAK B;  1QNM A;  5KA6 A;  2DJV A;  2GDS A;  3RYH A;  4FZ0 A;  2W0X A;  4TWK A;  4MVM A;  2QTO A;  4DUZ B;  2ZDI A;  4O2A A;  4RAI A;  4JTD B;  2A9H A;  4QPJ A;  1N32 B;  2KG7 A;  3FB5 C;  4Z1M G;  4B3T O;  1P49 A;  4OX9 B;  2ADP A;  2PI4 A;  4F6R B;  4MTF A;  1YI2 V;  5LHH A;  3AG7 A;  5EIB D;  1XOU A;  1TUE B;  4GKK B;  4LH6 A;  2Z0A A;  3IFX A;  4GYC B;  3CCL V;  2DMX A;  2WSS G;  5C8Y A;  4GX0 A;  3A2F A;  2AZ2 A;  2OCC B;  2HP8 A;  2OWO A;  5EZY A;  3SYO A;  3JCU Z;  1YXB A;  1KMI Z;  4QNH B;  2P67 A;  2YUA A;  3AG1 C;  2JGD A;  1D2D A;  1VAR A;  1BT8 A;  3ASO C;  5F2V O;  3OW2 U;  3RN4 A;  1AR1 B;  3B4S A;  5B66 Z;  1Y74 A;  2OT5 A;  3CJH B;  4KHP B;  3RYF B;  2Q0O C;  2EIN C;  2BE3 A;  5KHG A;  4F4L A;  3H1L H;  4LF4 B;  3JAR A;  2GV9 A;  1BE3 H;  3ZCC A;  4J42 A;  2NNU A;  4UUJ C;  2M7W A;  1KKD A;  3E22 B;  3CYO A;  3OTO B;  2Y48 A;  3LSU A;  4YXW G;  1BQ0 A;  1RM1 C;  5K1X A;  2V1D A;  2ETN A;  2YI8 A;  3CCV V;  3OE7 G;  3SPC A;  2NR5 A;  1OJH A;  2L35 A;  2E5L O;  1Y67 A;  4I4T A;  4OX9 O;  3WB2 A;  4NXM B;  3HR0 A;  2ITC C;  1BS3 A;  4ZHQ B;  3CRM A;  3DC5 A;  5A2Q N;  4FFB B;  3BCC H;  2EIJ C;  3SJA C;  3K59 A;  4FLV A;  1JJO A;  1J95 A;  3T1Y O;  4X1Y B;  3TK1 A;  4B3R O;  2DOS A;  3K9A A;  3AG2 B;  5LA6 B;  2WLL A;  4FM0 A;  1VQ6 V;  3CPW U;  4RO2 A;  5B3S C;  1GMG A;  2Q69 A;  3K0G A;  3APQ A;  5LMN O;  1AI5 A;  2CTP A;  4LFC B;  3CCU V;  2A06 H;  2JRI A;  4CS3 A;  4QPK A;  4DR3 O;  4EFE A;  1NJI W;  1HDJ A;  2KB1 A;  2LJ2 A;  2ZE5 A;  1RPO A;  3D36 A;  3GVM A;  5KX5 B;  3SDL A;  4NTY A;  2PUS A;  4OPH A;  1X59 A;  4K8Z A;  2B1G A;  2BSK A;  3CJH A;  1FFX A;  3FX7 A;  3LUT B;  4LFC O;  3RBZ A;  4GX5 A;  5LXT B;  2EZP A;  2N74 A;  3IGA C;  4PDV A;  4UVA A;  5EYP A;  4JI4 B;  4JV5 O;  3STL C;  2R9A A;  3W7W A;  5J9P C;  4JI5 B;  1PP9 H;  2HJF C;  3MHH C;  2Q7H A;  5A9G A;  4GUN A;  2DYS B;  3CRA A;  2VWJ A;  5CA1 A;  2LP7 A;  1SQP H;  1OZ0 A;  4NTX A;  1WB7 A;  4P2Z A;  3U0Z A;  3ZMZ A;  2NLJ C;  4NYK A;  4BIU A;  3BA8 A;  2E5L B;  3VQV A;  1Q86 W;  3E86 A;  4B3M O;  1B04 A;  4FLX A;  1KYO F;  1ORQ C;  1UPG A;  4LF7 O;  4IT5 A;  4AHC A;  1MSW D;  3QVN A;  1LUV A;  1FAF A;  4BR6 A;  3ETD A;  3OTO O;  1OCC B;  5DN6 G;  2LW7 A;  3WFV A;  5JWP A;  2A7W A;  1H2S B;  1JOY A;  1B3Q A;  2GUZ A;  2R70 A;  3FYI B;  1O9H A;  3FB8 C;  1NZ6 A;  4X65 B;  4MVU A;  1M56 C;  4H33 A;  4FIP C;  2F23 A;  1ZL8 B;  3J81 N;  4Q6G A;  2RNB A;  4B08 A;  4QE9 A;  2MK3 A;  3L72 H;  3ABM B;  4X1Y A;  4I55 A;  5IY5 B;  4WFB V;  1GH6 A;  4UV9 A;  4ZBM A;  3W7T A;  2IM9 A;  1PM9 A;  1RPR A;  1GN6 A;  3O65 A;  3JD3 A;  3K58 A;  1Z2G A;  3K0D A;  4TT3 G;  1RSO A;  5DM6 V;  5LGT A;  3C90 A;  1SQG A;  3JAS B;  1TUB A;  2WLH A;  4ICG A;  4L87 A;  2UUB B;  2Q9L A;  1MMM A;  1H2G A;  3GWO A;  1M9N A;  2XAQ A;  1R1B A;  1NR1 A;  2DYR B;  3KZI Z;  2Q5Z A;  3T4Z A;  5EZY B;  3JAW B;  1YSC A;  3OMI B;  3I55 V;  3E8H A;  3T1H O;  3TXQ A;  4IYI A;  1NTM H;  1QCE A;  2UUA B;  1Q43 A;  3ETG A;  4DR2 B;  4X1K B;  5IDJ A;  2WLN A;  4LNU A;  1KUQ A;  3GB7 C;  4KXR A;  3IC9 A;  5B1B B;  4YHH O;  4J9Y B;  3ABL C;  4TQD A;  2HVJ C;  1DGS A;  3HKD A;  5K1P A;  4DV3 O;  1DF5 A;  4Z2W A;  2E74 B;  1ARO P;  1EZJ A;  4X62 O;  4HBN A;  3R66 A;  1GN3 A;  1H2N A;  5BR8 B;  1QLN A;  1J5E O;  2YSU B;  3LNN A;  1ROP A;  1YJ9 V;  4BIZ A;  2LGQ A;  5IJ9 B;  4PV1 B;  4F6R A;  1ZWI C;  5EK0 A;  3LSQ A;  4NR1 A;  1TUB B;  4AQY B;  4WF9 V;  3WG7 B;  5J2T B;  4FPP A;  1K97 A;  2HEP A;  4X89 A;  4LR3 A;  1Y76 B;  4U7N A;  4FJC C;  2HFE C;  3N2K B;  4DR6 B;  3QG5 A;  3ABK C;  3ZHU A;  1JQ0 A;  3OFN G;  4CH4 A;  1MOF A;  1TGO A;  3A0R A;  4ZIB A;  2PYJ A;  2A3Q A;  5ITZ A;  5H9C A;  3HKB B;  1QR9 A;  2X7R B;  1BHA A;  5ITZ B;  2XT9 A;  1WPB A;  5B1O A;  5B3S B;  3AG3 C;  3QNE A;  4AI8 A;  3LDE A;  5J2U B;  2QE7 G;  2ZIN A;  1XIL A;  3ZX6 A;  2P7T C;  3UKM A;  4HZ3 A;  4YY3 O;  4FM1 A;  3BPZ A;  4WFF A;  3HKD B;  1K5Q A;  1URF A;  3H01 A;  2JS5 A;  2QWQ B;  1TVK B;  1Q5O A;  5EC1 C;  1AJN A;  4DYL A;  3CCS V;  2Y69 B;  3OR6 C;  2HHH B;  1N36 B;  5JVD A;  4DRX A;  4K0K B;  3AEI A;  3ZHQ A;  4DXW A;  4IL6 Z;  3FAV B;  2Y0I A;  4WCE V;  4GLX A;  2H3O A;  5L3D A;  3FB7 C;  1FJG O;  4QJF B;  4DR4 B;  2UUC B;  2KKW A;  3AG4 C;  1Y74 B;  3L70 H;  4AIL C;  2ZDI C;  1IDS A;  2RMK B;  1VF6 A;  4WFG A;  4P30 A;  4TOI A;  3X2Q C;  3SPG A;  3BHP A;  5JQG A;  1IBM O;  4UFZ A;  3E8B A;  3KKY A;  1HR0 B;  1PNM A;  1F7Y A;  2WA3 A;  4XDL A;  3PJS K;  2XTA A;  2GTA A;  4DUZ O;  3CWB H;  1JFF B;  2HR3 A;  1E1R G;  2YS8 A;  4KUM A;  4JAU A;  4JI3 O;  4GX1 A;  1EN4 A;  1OV9 A;  1W59 A;  1L0N H;  3WB1 A;  3CE2 A;  2KG7 B;  3HKB A;  2ZNI A;  3QO7 A;  5CB4 A;  3K3W A;  3K5L A;  3J80 N;  2P22 C;  3CRQ A;  1MG1 A;  4DV2 O;  5KUM A;  1XMQ O;  1KD1 W;  2RJZ A;  4DV1 O;  2JJ1 G;  1SQV H;  4B3S O;  5CMU A;  1KQS U;  2YXY A;  4CH5 A;  4G27 B;  1I08 A;  1Q6H A;  5KHI A;  1R3I C;  2QGN A;  2XND G;  2X6B A;  4LF8 O;  1B06 A;  2F4V O;  5TIS Z;  2JS3 A;  5IY5 C;  3ZMV A;  2IBZ H;  3DTU B;  3E2E A;  2Y0P A;  1SS3 A;  4DV5 O;  4DW1 A;  4PDL A;  2UXD O;  1O9G A;  2CTW A;  4X1I A;  3JYC A;  4MT8 A;  2X6A A;  3CD6 V;  2L6L A;  1MNG A;  4JI1 O;  2JGU A;  2B5U A;  3NR7 A;  1QQC A;  3UM7 A;  2VWK A;  3BVO A;  2IU3 A;  5KAI Z;  2DYR C;  2XHB A;  1JPX A;  5LGU A;  2UXD B;  4DV5 B;  1DF4 A;  5LBQ A;  3HKE B;  4PDM A;  2W0F C;  4J9Z B;  5H6R A;  4HAM A;  4LNU B;  1YTF D;  5EYP B;  4MW8 A;  4ABM A;  3O9O A;  3N27 A;  1IBK O;  3F7Y C;  5LP6 A;  1ZLZ A;  3RYF A;  1W0J G;  5B1B C;  1Q3E A;  2R9I A;  4B3S B;  4I4T B;  3OGC C;  4DR1 B;  5JCO A;  3JAW A;  4Z1V A;  1R3K C;  1XI1 A;  4R6Z A;  3ZN0 A;  2WLI A;  4DV2 B;  1NR7 A;  4LF6 O;  2UXC B;  4B7K A;  1SET A;  1HNZ B;  2P5O A;  1BL8 A;  1ZX3 A;  3G6B A;  3LDD A;  2ZT9 B;  2RCV A;  2WLM A;  2P6J A;  4RUF A;  1ZSP A;  3ICX A;  1T5E A;  4BW9 A;  1Z5W A;  3OMN B;  4R50 A;  5JCO C;  1Y66 A;  1ENV A;  1YIJ V;  4PA9 A;  2BSK B;  1WAZ A;  1RM1 B;  2WLJ A;  3RVZ A;  2AW9 A;  3TGU H;  4JI1 B;  4UXN A;  1KP2 A;  1RFY A;  3VQX A;  2W6J G;  2ZE7 A;  1FJG B;  2F1M A;  4QIW F;  1I5Y A;  3CMA V;  2ZQM A;  3CRC A;  1OCR C;  4O4J B;  1HP8 A;  4I0X B;  3RYI B;  4BIO A;  2EJR A;  5L3E A;  4XDK A;  3ZMT A;  1XMO B;  2OIG A;  1DTO A;  5FL7 G;  5IJ0 B;  2EIJ B;  2PF4 E;  4H37 A;  1IXM A;  4FLZ A;  1HNZ O;  3P30 A;  2UXC O;  1IUR A;  3SJC C;  4X62 B;  4RWU A;  4YY3 B;  4PI2 A;  2A79 B;  5IWA O;  2YC0 A;  3CSX A;  4WBN A;  4ZKI A;  1NQT A;  1IBK B;  1FFT B;  4ZHQ A;  4LC1 A;  2CTR A;  3FD9 A;  4JF3 A;  1N34 O;  3P3N A;  4J7J A;  3CCM V;  2XAG A;  2LO1 A;  2N04 A;  5KUK A;  1PKX A;  1M57 C;  3LSS A;  1WP8 A;  1D5N A;  1PD3 A;  5GTH Z;  2B9Z A;  1D5A A;  2UXB B;  4MTO A;  2XAS A;  3K57 A;  3M99 B;  2DN9 A;  3TET A;  3M8A A;  1K5S A;  2EIM B;  3K5M A;  4P9P A;  4BWA A;  2DW4 A;  2Z3Y A;  4OXS A;  3JD4 A;  4JI6 B;  4JAV A;  3EFF K;  4JAA A;  4MS2 A;  2F93 B;  3CCQ V;  1R73 A;  4O2B B;  1VF5 B;  2ZXW C;  2XOK G;  1V55 B;  1VEW A;  4DR5 B;  2ITD C;  5LMU O;  4ZI7 B;  4K0K O;  2ZD9 A;  5JQG B;  1OCZ C;  4JAS A;  3RT3 C;  4EB6 A;  1DK1 A;  3H1J H;  4UCU A;  1K3E A;  1KU9 A;  1SER A;  4DK0 A;  1GM8 A;  1JA8 A;  4IIJ B;  2QDO A;  5B5E Z;  1AJQ A;  1BQZ A;  2P90 A;  2JEX A;  1N33 O;  4X1I B;  4YJ3 B;  5KHH A;  1VF6 C;  2HVK C;  3U11 A;  1VIB A;  4E4E A;  3HKC A;  4X9Q A;  4YIO A;  1VP7 A;  1M1K W;  2HG5 C;  2F95 B;  2AHY A;  5KHJ A;  2QKS A;  4I5S A;  2BOB C;  1U96 A;  4EEQ A;  4JI3 B;  4NTW A;  5BXZ A;  1AR4 A;  3G71 V;  4DV0 B;  4JI8 B;  4DV6 B;  1US6 A;  3ZMU A;  1HR0 O;  2FB5 A;  5KMG B;  3C3T A;  1AR5 A;  1BGY H;  1S3J A;  4JGS A;  3RYC A;  2Q4P A;  3CC2 V;  1FXH A;  2YIC A;  3B77 A;  5LP6 B;  3JCZ A;  3OM3 B;  5IYC O;  3ASN B;  2UUC O;  4DR4 O;  4J11 A;  4F6E A;  3FFQ A;  3AK1 A;  3IJ4 A;  3UQ8 A;  3KCX A;  1J5E B;  1SQX H;  5KMG A;  1VMG A;  4EB6 B;  5CA0 A;  3I5D A;  5BR8 O;  1AVM A;  3MAQ A;  2XUM A;  4CS4 A;  1YJN V;  2CE4 A;  2R9R B;  3VOU A;  1K4C C;  4TSF G;  4DR7 O;  3QO8 A;  4K35 A;  5LYJ B;  2GBO A;  4N23 A;  4CC6 A;  4MSW C;  2V7Q G;  1JR9 A;  4UV8 A;  5LMN B;  5BMV A;  5L3G A;  1Q6U A;  2EIL C;  1MA1 A;  2OCC C;  2YIB D;  4DR2 O;  1EBO A;  1V54 B;  3SYP A;  3ZHS A;  5BY1 A;  1XRE A;  1HW7 A;  2ZR3 A;  4KFM A;  1BCC H;  3T1H B;  5L3B A;  2CUG A;  2ZE6 A;  2DE0 X;  3AG1 B;  3UO3 A;  2F43 G;  3RYH B;  3ZHT A;  3CXH F;  3ZHV A;  1K34 A;  2EIN B;  5LL6 Y;  1K8A W;  3IAY A;  3E89 A;  2QTS A;  3EHB B;  3D36 C;  2QA4 V;  2RQ6 A;  4J41 A;  3B40 A;  4NVP A;  4JI5 O;  3T1C A;  3ZRS A;  5JVD B;  3JAT A;  4PD4 F;  3Q4H A;  2Q67 A;  4JV5 B;  2HJD A;  1OHH G;  4UCT A;  4DV4 B;  1YJW V;  4PJ0 Z;  5B1A B;  3QO5 A;  2DWD C;  2DYS C;  3OT7 A;  3FKS G;  2QSA A;  3ETQ A;  3EXA A;  1ZAU A;  1PV0 A;  4JYY A;  3ZMS A;  4NKG B;  3N2G B;  5CBH A;  5JH7 B;  4IGG A;  4JI2 B;  1SRY A;  5KX5 A;  2GSM B;  5D5Q A;  1TA8 A;  1HWY A;  2EBO A;  2YEV A;  5LHG A;  5LYJ A;  4TV9 A;  1VQL V;  4J10 A;  1HNX B;  4H0L B;  1WN7 A;  2Y4U A;  3A8T A;  2CAZ C;  1YEW A;  5BZB A;  2QKC A;  1SES A;  3ZRX A;  4JYA B;  5CA0 B;  3ABT A;  4JYC A;  1Q82 W;  4B3R B;  2EIK B;  3UCS C;  1R6K A;  1G6U A;  1N8R W;  3E8G A;  3K04 A;  4JTA B;  2FML A;  1AI4 A;  2UU9 B;  3EVK A;  1AJP A;  3H1H H;  3JD1 A;  3D8C A;  3L74 H;  4I50 B;  1VQ5 V;  1QVF U;  3CXC U;  2YIB A;  1K33 A;  4DV6 O;  3T4D A;  4B7E A;  1P84 F;  3SJB C;  1XQ8 A;  3QF7 A;  2N05 A;  1OCO B;  3AG4 B;  3N2K A;  3K06 A;  4H44 B;  3S3X A;  3ZBH A;  1Y76 A;  3OD4 A;  3P3P A;  3PN1 A;  3I56 V;  3W7S A;  5E79 Z;  1GM7 A;  2YIA A;  4RQE A;  2NN4 A;  2CGN A;  5EBW C;  4DUY B;  5IJ9 A;  1IXB A;  2Q6A A;  4LF4 O;  3D3I A;  4EKW A;  1WA8 A;  2ZE8 A;  4DV4 O;  5LXT A;  1PPJ H;  4Q20 A;  4K3A A;  4TV8 A;  1KB9 F;  1NS1 A;  1MZE A;  4X66 B;  2LFR A;  1YVW A;  3S3W A;  1QR8 A;  1ZL8 A;  1SQF A;  1BMF G;  1FS0 G;  3B2E E;  2FKX A;  4OGQ B;  3T2M A;  1EN6 A;  1UJW B;  1BZK A;  1M4U A;  5GTI Z;  2AHZ A;  1WJZ A;  3CP1 A;  1XUQ A;  3BFR A;  3JAS A;  2WLK A;  1FYJ A;  1XNQ O;  3SR2 C;  5J2U A;  4O2B A;  2QR4 A;  5LP6 C;  1M5I A;  2YXH A;  1ZUQ A;  2E76 B;  4B3T B;  1N32 O;  3OR7 C;  5L3C A;  2W6I G;  4UB8 Z;  3TCU A;  1QLE C;  2Q68 A;  5KA5 A;  3TXS A;  2ODM A;  1XNQ B;  4UCV A;  1YF2 A;  1H8E G;  3ZJZ A;  3CX5 F;  3RYC B;  2AZ0 A;  1XDC A;  2CTQ A;  3DSQ A;  4R8C A;  1I5X A;  5EBM C;  1NVP B;  1S5L Z;  1EZV H;  3K5O A;  1Q7Y W;  5H6Q A;  1VF7 A;  1I94 B;  1S72 V;  3RGB A;  1KBH A;  2IJJ A;  4PI0 A;  4KHP O;  2PTM A;  2OTJ V;  2QJ1 A;  2WA4 A;  3K08 A;  5GON B;  3E22 A;  3STZ C;  3RVY A;  3LNM B;  4LWS B;  2K9P A;  1NTZ H;  1S5H C;  2IW5 A;  2D3O W;  1N0N A;  4FLY A;  4RUE A;  1XL6 A;  4MW3 A;  3T1Y B;  1VQ7 V;  3RYI A;  2YDE A;  4JYB A;  3OGI B;  4JPR A;  1Q90 D;  1ZTE A;  3ABL B;  1M93 A;  5J2T A;  2KSD A;  4W4K A;  3CC7 V;  4FK5 C;  4PA3 A;  3AK3 A;  1XNR O;  1QU7 A;  3ABU A;  1XNR B;  1RP3 B;  2R72 A;  4DV0 O;  3BA9 A;  5LA6 A;  4GX2 A;  3H9V A;  5CBG A;  4NXN B;  4WFE A;  1VQ8 V;  2Q8V A;  1EM1 A;  5EC2 C;  1WP7 A;  4FLT A;  4YIP A;  3OUS A;  4I7Z B;  4IYH A;  2IJI A;  4FMT A;  4IHJ B;  1N33 B;  4JYA O;  2AGA A;  2Z5U A;  3W7X A;  1WLE A;  4JZ2 A;  3X2Q B;  5EIB C;  2QM7 A;  1HNX O;  2EX3 A;  1SA0 A;  3L73 H;  2GTS A;  1IBL B;  2V4D A;  5LOV B;  4LWS A;  2VS0 A;  4EFB A;  1VQ9 V;  1FFX B;  1I7F A;  2IH1 C;  1NBM G;  2YID A;  3CRR A;  4DR5 O;  2YI9 A;  3B09 A;  1G4Y B;  2BOC C;  3G6E V;  4I9W A;  3JD0 A;  1P7B A;  1QBZ A;  4U3J B;  1KC8 W;  2ZIO A;  2IH3 C;  3ZRW B;  1IVS A;  3BAB A;  4I0X A;  2RN9 A;  3B8N A;  4LFA O;  3ZRV A;  3L9D A;  3AG2 C;  3UO2 A;  4MTG A;  2QWO B;  3LDC A;  2B1I A;  2E3C A;  1GAX A;  1JMK C;  4BAY A;  3Q4H B;  1F4M A;  4J7K A;  2F4V B;  4TV9 B;  4K8X A;  3OAA G;  3D3Q A;  2CGO A;  4GZR B;  1A32 A;  1Q6I A;  4UB6 Z;  5IT9 N;  2GUZ B;  5IE9 A;  3A0H Z;  1LR1 A;  1JFF A;  3J7A U;  4O4J A;  2ZXW B;  3SGI A;  5JH7 A;  3P32 A;  4QE7 A;  1JJ2 U;  3CME V;  1VQK V;  2PY5 A;  4IHJ A;  1GN2 A;  4FFK A;  2A0L A;  4DUY O;  2ILM A;  2QWP B;  1AIL A;  5DED A;  3OUF A;  1YZB A;  1VQP V;  3APO A;  1AI7 A;  3JAT B;  4UCS A;  4LFB O;  2OIE A;  4H13 B;  1IBM B;  2ZCE A;  1RSO B;  4L8J A;  4GKJ O;  1NKD A;  3MHS C;  4CC5 A;  4LF5 O;  3B8M A;  1YHQ V;  3L75 H;  4TUY A;  1L8D A;  2HLD G;  2ZR2 A;  2QM8 A;  2UXX A; 
#chains in the Genus database with same CATH homology
 1BCC H;  1BE3 H;  1NTZ H;  4U3F H;  1PP9 H;  2BCC H;  3CWB H;  1NTM H;  1NU1 H;  1SQV H;  1P84 F;  1KYO F;  1NTK H;  4PD4 F;  1BGY H;  3L73 H;  3L72 H;  3L70 H;  3CXH F;  1SQP H;  1SQB H;  3H1I H;  2FYU H;  3BCC H;  1SQX H;  1L0N H;  3CX5 F;  3H1K H;  3L71 H;  5KLV H;  3TGU H;  4D6T H;  3L75 H;  2A06 H;  3H1L H;  3H1J H;  1L0L H;  1PPJ H;  2IBZ H;  3H1H H;  1KB9 F;  1SQQ H;  3L74 H;  1EZV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...