4U3FH

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
EELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 22
structure length 68
sequence length 68
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4u3fH00
1P84F 3L73H 1BE3H 3H1IH 1SQQH 3L70H 1SQBH 3CXHF 3H1KH 4PD4F 3TGUH 4U3FH 3L72H 1KYOF 1PP9H 1L0NH 3L71H 3H1HH 3H1LH 4D6TH 1EZVH 1PPJH 1SQXH 3BCCH 1NU1H 1SQPH 3CWBH 3L75H 3H1JH 1BGYH 1NTMH 3L74H 1NTZH 1NTKH 5KLVH 1L0LH 1BCCH 2BCCH 2IBZH 2A06H 1SQVH 3CX5F 1KB9F 2FYUH
chains in the Genus database with same CATH superfamily
5L3FA 5JQGB 2FMLA 3SYQA 3AK3A 3F7YC 4CC5A 5KX5A 4ZIBA 2P06A 2W6JG 1SESA 3ETDA 2KG7A 1HNZO 1PPJH 2UUCO 4PA7A 2Q69A 1OV9A 4PA6A 4MVQA 3IGAC 4QE9A 1TAEA 3ASNB 3N2GB 2JGDB 4DV1B 3PN1A 4CS4A 2VWKA 2P7TC 3CCEV 3B4SA 4FLUA 4UB8Z 3BA9A 3LNNA 5D5QA 3AG3C 4JI0O 4X65B 3ZMTA 2IH3C 4WBNB 3C3TA 4X1YB 2CH7B 2BOCC 1B6QA 4JASA 3T1CA 1EBOA 5IWAB 4WFHA 2RJZA 4B3MO 2EZOA 2D2CB 1ORQC 4YJ3B 3ZRVA 1BHBA 3CMEV 3F7VC 1W2BU 2PF4E 5JH7A 1VQ8V 2PYLA 1ROPA 4X88A 1SQXH 4EKWA 1YEWA 4YHHO 1MZFA 3DXRA 2MW2B 1MSWD 3DC5A 4BIUA 2QKSA 1RSOA 2JRIA 3ZHQA 5CBHA 5EBMC 2ATKC 1H2NA 1GMGA 1TVKA 3L73H 2IH1C 5GTHZ 5IT9N 1FFXA 4FLYA 2ILMA 5CN0A 5IYZA 3A0RA 5CA0A 1BL8A 1Q7YW 2IJKA 2QR4A 5LOVB 4LBEC 1FFTB 3HPLC 4IT5A 1Q6HA 4DK0A 2EJ7A 2HJDA 3QO5A 3UQ8A 1HNXO 4DR3O 2GHYA 1FKAO 3CMAV 4O4HA 4CS2A 5H6QA 1XREA 1KQSU 1SQBH 3AK2A 3K5OA 3KCYA 1P49A 1NKDA 5L3CA 5B1NA 4FFKA 1H2MA 2ADPA 2B9ZA 1F4MA 4TUYA 5C8YB 3M99B 2P6JA 4G27B 3ZHRA 3ICXA 4HAMA 4PA4A 1UFIA 3BABA 5IJ9A 3ZRXA 1THZA 4X20B 1K8AW 2QEXV 1VQ4V 3RGBA 4TT3G 2Z0AA 5LA6A 2CE4A 2K9PA 4ICGA 4UUJC 3FB6C 2QTOA 1B04A 4DR7B 4Z1VA 3AEIA 3SJBC 1RM1B 3ZEDA 2WA4A 3K58A 1SERA 4PDMA 1P84F 3JALB 5EZYA 2UXDB 2DWEC 2HJFC 2JEUA 2P5OA 4BIOA 3CSXA 4BW5A 1EZJA 4B3TO 1EZVH 1M9NA 5LGUA 1SKVA 4LWSB 1DLBA 4PV1B 2AGAA 4ZI7A 2LQTA 4JI2B 1AP5A 2W0FC 3CJHB 4UCTA 2ZIMA 2Q0OC 1KB9F 4UCUA 3BEHA 1VQ5V 3K06A 4U7NA 5AG2A 3AG1B 1SQQH 1K5SA 3FFQA 4CH5A 4LFAO 1D2DA 3G67A 2QWPB 1IURA 3JASA 5IJ0B 1KU9A 1TUBA 2R9AA 3OEHG 4Z2WA 5H6RA 2XHBA 3L74H 3OFNG 2VWJA 3ZHSA 1AP6A 3A8TA 3UO2A 1K92A 1G1XB 4ZKIA 4LFCB 3E83A 3FB8C 4YIOA 4O4JB 4CH4A 3C3SA 2Q0AA 3H1HH 4NKGB 4JI6O 3MHSC 1SQPH 3ABTA 1Y74B 3UM7A 4JTDB 5CB4B 1L0LH 2BCCH 4PA9A 1X59A 4YJ2B 4QPKA 5CBFA 3OUFA 4DV5O 1QR9A 4MSWC 5C93A 4RUFA 4HZ3A 3RYFA 1VQKV 4R50A 4CC6A 1YJ9V 5LMUO 1Q81W 3UO3A 5LHHA 4MTFA 2NN4A 2OIGA 3IAYA 3VQWA 1HP8A 3P3NA 2EIJB 2R70A 1VQPV 2YIDA 1XILA 1Q6UA 3VQVA 2DYSB 4I55A 3K79A 3D3QA 5KMGA 1R3JC 1M90W 4J10A 2PYJA 4EEQA 2R72A 2ITDC 3H9VA 4JYAO 3TK1A 2LGQA 2E3CA 2Z3YA 1Z2GA 4O2BA 5KA6A 5DN6G 3E8HA 4XDKA 4N21A 1RM1C 2WA3A 2F4VB 3K5MA 4UVBA 4DV3B 2IU3A 3BRCA 1K73W 1E1QG 2Q73A 4JTAB 3E8FA 3B8MA 3L71H 2EINB 1M57C 1YZBA 3VOUA 2Y69B 1CXZB 4JI8B 4O4IB 5KLVH 3M7MX 1IBMB 3OTFA 2X6BA 2JGDA 2PY5A 2Q67A 3NR7A 4JI5B 4LF5O 1IXBA 1Y76B 3S3WA 3HKDA 4GLXA 1YJNV 3SDLA 5HFLA 4UCSA 1F4NA 3FAVB 1P7BA 2JDIG 2F95B 1ZL8B 2A06H 4L87A 4UV8A 4I9WA 1AROP 4DR2O 4YJ3A 4IL6Z 5EC2C 4U7OA 2YEVB 3UT5B 1I5YA 1NVPB 3CRAA 3G6EV 5B1AB 3ZX6A 1KUQA 4TV9B 3BCCH 3RYCB 3QF7A 2CK3G 2WLLB 1GH6A 4YIPA 1R3KC 1QVFU 3E22B 1QQCA 1WP8A 4EFBA 3E89A 4HYOA 5LYJB 3SJCC 2YIBA 3SJAC 2ZQMA 2CTRA 3JCZA 2WAMA 3D3IA 3CCMV 4DRXB 5LOVA 1BZKA 2X0LA 4FMTA 4P9OA 4QNHB 1IZ3A 2FKXA 1BMFG 1K9MW 4NTWA 5IY5B 3OGIB 5KA5A 2DQ3A 1Q3EA 3QO8A 4O2AB 2ZR3A 1K34A 5CMUA 3KCXA 2VS0A 1Z5WA 4DV2O 2IU0A 2HEPA 2V4DA 1N33O 1ENVA 2B1GA 5C8YA 1GN2A 3LDDA 2XAGA 4DR1B 4NXNB 2ARHA 4R8CA 1ZLZA 3W7TA 1M1KW 1VQNV 4X66O 2WLHA 2EIKB 4WF9V 3SPGA 1NVPD 3VQYA 3D36C 3K9SA 3M8AA 1HNWO 4IIJB 2PTMA 1GM8A 3JAMN 1WPBA 2L6LA 4YHHB 2UUBB 3JAKB 3CWBH 3RBZA 2ZE5A 3ZN1A 2UXCO 3NXSA 5DEDA 5IYBO 4GKKO 4GX1A 4NB5A 4DV7B 1XMOB 2N05A 4PDLA 4JI1O 5BZBA 2WLJA 4U3FH 1N0JA 1LUVA 3H1LH 3F5WC 4LR3A 4JZGA 4LWSA 1V55B 4DV4O 4B3SO 1HNXB 4DR3B 3OR7C 5H9CA 4IGGA 1OJHA 3J80N 1OCRB 3ZIAG 2B5UA 3ZN0A 1W59A 1IBKO 1JMKC 2ZD9A 4LNUB 4TWKA 5B1BC 2DYRC 5EBLC 2QWNB 1PL4A 1N32B 1D5NA 2CDYA 1B3QA 4FFBB 5B1AC 5BY1A 1D5AA 4BAYA 4X1KB 1FPOA 5IYDO 4QJFB 1H8HG 2GUZA 5CBGA 4AQYB 3RFRA 4FM1A 4GKJO 3ZBHA 1GAXA 1XNQO 4LF6O 1Y6XA 4ZBMA 3FB5C 1MNGA 4E2LA 3ETGA 4O4JA 5JVDB 3TCUA 3DTUB 1EN6A 4KFMA 3LDCA 3RT3C 3OMAB 5TISZ 1Y74A 4RQFA 5CB4A 2P4KA 1PNLA 4MVSA 1I94B 2Q9LA 1Q43A 3ETEA 5IY5C 2WWWA 1WPXA 1BQ0A 2AZ2A 4FLWA 5CA3A 1S0VA 4UVCA 4B3TB 1RPOA 1QLEB 1YCIA 3SYOA 2E5LO 2HKOA 3T4DA 2QWOB 3GWKC 2LW7A 3HKBA 2JS5A 1M56C 2P90A 1IXMA 4JAAA 3SYAA 1OCZB 3STLC 2EIKC 3QO7A 4LFAB 3G4SV 3L9DA 4JV5O 5GW7A 4NR1A 4PA3A 3CD6V 3W7WA 4TQDA 2MK3A 1JFFB 4K0KO 4NXMO 2QA4V 3LUTB 3ABUA 4G28B 4QGPA 4JAUA 1GO3F 4OPHA 4X8AA 3ZRWA 1N8RW 1AR5A 5BR8B 3D36A 4UB6Z 3L70H 4FLXA 2IW5A 2P4VA 3JSLA 3FD9A 4FM0A 2JGUA 4DUZO 2W0XA 3HR0A 1FJGO 3Q4HB 1PL0A 4DK1A 4HNAB 4OX9O 4PI2A 4B3RO 4KHPO 1R6TA 1BGYH 4O4IA 4Q20A 4DV5B 3ZMVA 5FPRA 1QR8A 2WSSG 1K4CC 5H2FZ 4DR4O 1HDJA 3G71V 4JI4O 1EFRG 1AR4A 1OCRC 2Q68A 2QGNA 4DXWA 3N2KB 3K5NA 1Y76A 1XNRB 4RAIA 3W7UA 3H01A 3AG2C 2LFSA 2KSDA 3SPHA 5JJJB 4LF9O 4PJ0Z 3CB2A 4GX0A 1Q90D 4J9ZB 3WFVA 1YXBA 2AHZA 4K35A 3OM3B 4WFBV 3STZC 4JYAB 2BTQB 3FYEB 4I50B 1Y66A 1N36O 2YEVA 5IYCO 3E86A 1VF5B 4TV9A 2ZCEA 3RYCA 2WLLA 3HB3B 3WB2A 2UXBB 2ODMA 2F43G 3ZHUA 2Q5ZA 3CP1A 2CTPA 4FLTA 3E22A 2D3OW 4JF3A 4MVRA 4FLZA 1N34O 4XDLA 3T1YO 3JD2A 3IFXA 3ML0A 3A2FA 4DRXA 2E76B 3ETQA 2HFEC 2EJRA 2QM7A 3FKSG 1DF5A 1B06A 3QG5A 3CCRV 2QJ1A 2LO1A 4O2AA 1QBZA 3U0ZA 3H1IH 3THOA 4B7KA 1OCZC 4JI7B 2GDSA 1X4TA 1S77D 1K97A 4PDRA 4AHCA 3KG2A 1J5EO 2C2AA 1V54B 3O65A 2Q7HA 1AR1B 2YC0A 2ZDIC 1Q82W 1JJOA 2VQFO 2JS3A 4NTXA 3W7XA 1UJWB 1YDXA 3ASNC 1VMGA 2QWQB 4I0XB 3VBBA 4WFAV 5H5NA 2GBOA 3N27A 1G8MA 4GCZA 2CAZC 4FJCC 3JAKA 2HLDG 4OPAA 1MSDA 4J42A 1K33A 2XAQA 1J95A 1G4YB 2LW1A 3I5DA 4BIZA 1SF9A 3CEIA 4J80A 2N74A 1FAFA 3VQXA 2YUAA 1S72V 2PI5A 2UU9B 4J7JA 3WB0A 5IE9A 1AI5A 2LGWA 5EIBD 1XEQA 2YI9A 4RO2A 2XNDG 1NR1A 2ZKOA 3JD1A 2ITCC 4DR5B 5GONB 4LNUA 4O4LB 3CCSV 2QSAA 3B77A 3K3WA 1WA8B 2CTQA 5KUMA 1N33B 1CPYA 3AK1A 3G80A 4FFBA 1P7GA 3PJSK 3L75H 2FL4A 3FYIB 2ZNJA 4X1KA 4W4LA 3LDEA 3RYHB 4J7ZA 4I4TB 3K5LA 1MA1A 4DV1O 2RMKB 4K8ZA 5LMNO 2H94A 1HNWB 4R6ZA 3EFFK 5LXTB 1XBLA 3K03A 4JYCA 4F6RB 1VEWA 2N04A 4X65O 1JVMA 2UXCB 2X6AA 4N23A 4CBCA 5IWAO 3JATB 3ABKB 3BA8A 2EIMB 3T2MA 4GKKB 1AJQA 4CZZA 1YHQV 2OTLV 2IJHA 2Z5UA 4JYBA 2RCVA 3TJTA 3CRQA 1XI1A 1MABG 4IYHA 1LUWA 3E8BA 2R9RB 4DV4B 1XL4A 2YICA 3T1HB 4FPPA 2QM4A 1BQZA 5BMVA 2BE3A 5CA1B 5JQGA 3S3XA 5EK0A 4H37A 3P32A 5KX5B 1BHAA 2QDOA 4UCVA 3GWOA 2KG7B 4PHZA 4D6TH 2AHYA 1T5EA 2M7WA 1JFFA 1MG1A 2ZM6B 1URFA 2ZE6A 5L3BA 2HR3A 2ZDIA 4W4KA 3E35A 1JX9A 3BVOA 5HFMA 4OXSA 2KQXA 4DV0B 4LF6B 4DR6O 3N2GA 1ZWIC 4AI8A 2RDCA 2HVJC 3JD4A 4E4EA 1WB7A 2VQEO 3AG1C 1QCEA 2ZXWB 3SJQC 5LBQA 2Y4UA 1WAZA 1GM9A 2QTSA 1R6NA 2LJ2A 3A0HZ 1HR0O 2KB1A 4OGQB 4WBNA 4DV6B 4X1YA 2DWDC 5J2TB 2CH7A 5KHJA 1KP3A 2BOBC 2O57A 4D7TA 2JIZG 2OCCB 4EFEA 4GX2A 2X7RB 4LP8A 4DUYB 3LSUA 2E5LB 1YJWV 4DR7O 2F93B 2EILB 3GVMA 5B1OA 2Q7EA 4CS3A 2XTAA 1R73A 1RSOB 1HWYA 1BCCH 2AW9A 5FNVB 4X62O 5LHIA 3CX5F 4RWUA 3SPJA 1YSCA 1O9GA 3CRCA 3JCUZ 4JV5B 2BTQA 5F2VO 4I50A 2F23A 3AG7A 1WJZA 5CA0B 1HNZB 2UUCB 4K0KB 4NXMB 1HW7A 1NU1H 2EIJC 3E2EA 4J7KA 4D7SA 4JI2O 2K1EA 1PNMA 4MVOA 4UVAA 4ABMA 2DYSC 2YXYA 2EX3A 4I5SA 2YIAA 2WLIB 1EN4A 4KL1A 3ABKC 1O9HA 3LSSA 5B66Z 4JPRA 1SQGA 4JGSA 4KXRA 2ZIOA 1FJGB 4JI0B 4OX9B 4FIPC 1S3JA 1WLEA 4KHPB 1N4CA 1U97A 5EYPB 1KP2A 1NTMH 3MDSA 4MTXA 1RPRA 4LFBO 2XUMA 4DR4B 4WFGA 4H13B 4JI4B 4B3MB 4X20A 3IC7A 1NT2B 5LA6B 4BR6A 1IDSA 3ABMB 3CE2A 4FLVA 1AILA 3LNMB 5L3DA 1XMQO 1Z5VA 1BS3A 3ZS8C 1NH2D 4XBFA 2LFRA 4I9QA 2EINC 4LF9B 2IJIA 3RWRD 2BTOA 2Y69C 3G6BA 4MTOA 3I56V 2OYQA 1GK9A 2XASA 3JALA 2YXLA 1YTFB 3DGEA 1N36B 4I0XA 3X2QB 1KECA 5DECA 1S5JA 1R3LC 2ZXWC 4WFEA 2GTAA 1MOFA 1KBHA 1WP7A 3CJHA 1FS0G 4YY3O 2CTWA 4C7UA 1N34B 1NBMG 3HKEB 3T1YB 1QLNA 1W0JG 2OCCC 4K3AA 1K5QA 1ZUQA 1XDCA 2NNUA 2DOSA 1VQ7V 2F1MA 1E1RG 4QPJA 4BW9A 2HG5C 4TQFA 2ETNA 3TXSA 5L3GA 1SC5B 3UCSC 4YXWG 5IJ0A 2PI4A 1AI4A 2JK5C 3WU2Z 2BSKB 2CGOA 2EILC 2YI8A 2ZR2A 4H33A 3CHXA 2PUSA 2EULA 5KUKA 2JVDA 4DV3O 3JARB 5GONA 4FZ1A 4O4LA 3MD0A 3K04A 2B1IA 1EM1A 1GM7A 1M5IA 1GRJA 1SA0B 3F5TA 1JOYA 1OCOB 4IYIA 1SS3A 1NTZH 4JI8O 1FYJA 1YTFD 4YJ2A 1XHZA 1H38A 2VQFB 4X1IB 3RYHA 1IBMO 4F6EA 4I4TA 1Q86W 1NR7A 3K08A 3RN4A 5KHHA 4JI5O 2YSUB 2HVKC 1VQLV 5BXZA 5LXTA 5J9PC 2FTKA 3DSQA 4G2KA 5K1XA 2LP7A 5B3SB 2ZE8A 3T4ZA 2IBZH 5KHIA 2E75B 5IDJA 2HP8A 4I7ZB 4NVPA 3OTOO 1NS1A 4MVMA 3CXHF 1I5XA 4H0LB 1COWG 1YIJV 4J41A 4O2BB 3ABMC 4ZHQB 3ABLB 4LF8O 1WN7A 1FXKB 1M93A 1LNQA 1EN5A 1L1FA 2QKCA 4QIWF 5CA1A 3JD0A 3EHBB 3OR6C 1UPGA 4F4LA 5JJNB 4JI6B 3X2QC 1TA8A 3H1JH 2XAFA 4RUEA 1H2KA 3B09A 4X64O 1VARA 2ZINA 1V55C 3GB7C 2DW4A 1L8DA 2Y4TA 4FK5C 5LMUB 2NLJC 5LMNB 1Q8IA 3CCUV 4KP4A 3HKDB 1JA8A 1FXVA 1E79G 1BSMA 3SPCA 2A7WA 3FAVA 4DR1O 4NXNO 1G6UA 1ZL8A 1US6A 2FB5A 5J2TA 3BPZA 3ZJZA 2WLNA 1BE3H 2ZNIA 4H44B 3CC4V 3B8NA 2QE7G 3FX7A 3P30A 4J9YB 3UT5A 5KHGA 3CC7V 1VQ6V 4DO2A 2UUBO 1W0KG 4FM2A 1A32A 1AI6A 5ITZB 5FNVA 3D8CA 3RVZA 1OCOC 2FYUH 3BAAA 2UUAO 4DYLA 2HHHO 4B08A 3CPWU 3C90A 1VF7A 2W6IG 1QNMA 4DV7O 1XMOO 2ZE7A 1PNKA 5LYJA 5K1PA 4CH6A 4IHJB 1AVMA 3HKCB 3IC9A 2RQ6A 1JCHA 1QHTA 1R1BA 3QVNA 3MHHC 4JI3O 1QLEC 5KAFZ 3FB7C 2PGGA 5B3SC 4DR6B 1AB3A 1M4UA 2JEXA 2OTJV 4PELA 2WLIA 3JYCA 2CGNA 4LF5B 5LGNA 2VQEB 1OZ0A 1GN4A 1N32O 1VP7A 1SZTA 1HR0B 5EYPA 3SR2C 3ABLC 4TV8B 4LC1A 3APOA 1FXKC 3OEEG 1NJIW 1VF6C 4RQEA 4AQYO 1IVSA 1S76D 2R9IA 2GV9A 4LF7O 2UXXA 3O9OA 4DR2B 2L35A 4LF4O 1GKFA 4UFZA 4TSFG 3JAWB 3WG7B 4Z1MG 4IIJA 5E79Z 1U96A 2XAHA 2XT9A 4X9QA 3KZIZ 2Q8VA 4X62B 1H2LA 2IJJA 3B40A 1S5HC 3JSNA 2OCHA 1IBLO 1I94O 2YIBD 2YXHA 1SETA 4B7EA 3OAAG 4UCOA 2F66C 2DE0X 4P30A 3OMNB 1M57B 1QU7A 3CRMA 3LSQA 4JAVA 1TGOA 4MVZA 2OT5A 5D5PA 2A79B 2G38A 2V7QG 2OWOA 1JQ0A 5JJEB 2XAJA 1PV0A 3ZCCA 1I0HA 3HKEA 1PD3A 4DV2B 1NI8A 4EB6B 3J81N 1YITV 5A2QN 2A0LA 5KHKA 2AXTZ 2GUZB 4U3JB 3K59A 2BSKA 4LFBB 4Q6GA 4X66B 5BR8O 3ZHTA 5J2UB 5EC1C 1Q6IA 3K9AA 3JARA 3BFRA 1XMQB 1IX9A 2Q4PA 4PDVA 1XQ8A 5JVDA 2XOKG 3WB1A 1K7DA 5LGTA 1SA0A 3SYCA 1SQVH 4X1IA 2P22C 1H2GA 4ZOLB 3OE7G 5EIBC 4ASUG 4JI1B 5A9GA 1XL6A 2H3OA 2WLMA 5LP6B 1Y67A 3R65A 1NQTA 3R66A 3W7SA 1XNRO 3JD3A 3RYIB 3HKBB 4B3SB 4CH3A 1PKXA 1MZEA 1ZAUA 4YY3B 3CRRA 3K0DA 5L3EA 1JJ2U 2OIEA 1Y4MA 1TUEB 1I7FA 1V54C 3ZMSA 1IBKB 3QTCA 1GN6A 1YVWA 2EZPA 5KAIZ 5FLXN 3TGUH 1PP9H 4GX5A 3WG7C 4ZHQA 3OW2U 1RP3B 1FXKA 1GTOA 1VF6A 2UXBO 3ZRWB 1WB8A 1F7YA 2QKAA 4BWAA 4P2ZA 1KMIZ 4GKJB 4UV9A 1XNQB 3OGCC 3ZHVA 4QE7A 1VQMV 2RN9A 1SQFA 1OCCB 1XOUA 3Q4HA 3K0GA 2RNBA 4HNAA 5JCOC 2VRZA 1AJPA 5EBWC 1MMMA 4LH7A 3BY6A 4XDJA 1K4DC 5DM6V 2DJVA 3EVKA 3I55V 4JI7O 4LCUC 5JH7B 3N2KA 1R6KA 3CCJV 3DXRB 1I08A 3CC2V 3TETA 5FPOA 2Y48A 2GSMB 3AG4B 1SRYA 3CS5A 4LH6A 1NH2B 3P3PA 3OTOB 1TVKB 3DC6A 5B1BB 2DYRB 1FFXB 3CCQV 2UXDO 1K3EA 3CCVV 5IYZB 3QNEA 4TOIA 1KYOF 1F51A 3IJ4A 4LF8B 1SZXA 4FZ0A 2P67A 1VQOV 5ITZA 3OD4A 3CCLV 1QVGU 4HBNA 4MVUA 4O4HB 4UXNA 5LHGA 1AI7A 3KKYA 3ZMZA 1S5LZ 3ASOB 2A3QA 4JYYA 2EIMC 4DUZB 4K8XA 1L0NH 2UU9O 3ZRSA 4JZ2A 4IHJA 5LL6Y 1XUQA 4TUYB 1YF2A 5LP6C 3HKCA 4B3RB 1AJNA 1NTKH 5IJ9B 2Q6AA 4X64B 3MAQA 1ZX3A 3OMIB 2ADQB 5GTIZ 2Q7GA 4LFCO 3H1KH 4DR5O 2JJ2G 2CUGA 4P9PA 2QM8A 4GUNA 3A0BZ 1P4RA 3OT7A 5B5EZ 4WCEV 1JR9A 1M56B 4GT1A 4TV8A 3SGIA 2M6YA 1KD1W 1DGSA 2DMXA 4GZRB 5EZYB 1ZSPA 4DW1A 5E1AC 1FD9A 3JAWA 2DN9A 2AZ0A 4MS2A 1H2SB 3CXCU 4UCRA 2Y0PA 1OCCC 1VIBA 4ZI7B 2YDEA 3U10A 1V9PA 4JTCB 1NZ6A 4GYCB 3SPIA 2UUAB 1JPXA 1ZTEA 4MT8A 2HHHB 3RW0A 1CP9A 2IM9A 2GTSA 3AG3B 4J11A 1DF4A 3BHPA 5JCOA 3JASB 2WLKA 2WPDG 4MW3A 4NYKA 1TUBB 4JI3B 2JJ1G 3OUSA 1YI2V 3U11A 3T1HO 1GN3A 3B2EE 1WNSA 4A5UB 2NR5A 3AG4C 2F4VO 1R3IC 2ZT9B 4NTYA 4X89A 2KKWA 4PI0A 1KKCA 2DQ0A 3L72H 4EB6A 1H8EG 3AG2B 1KC8W 1WA8A 1OHHG 1PM9A 1RFYA 1J5EB 2X6CA 3CYOA 2ZM6O 2QWRB 4U3JA 2A9HA 3UKMA 2H8PC 1LR1A 4DV0O 4LF7B 5FL7G 3RYFB 4LF4B 4MTGA 3ZMUA 2Y0IA 2EBOA 2YS8A 5J2UA 4FVMA 1VQ9V 3ASOC 4F6RA 4WFFA 1XHXA 1Q5OA 2UXNA 1FXHA 4MW8A 3APQA 3J7AU 2PZSA 4DV6O 1IBLB 4AILC 4KUMA 3EXAA 4I55B 3TXQA 1BT8A 5KMGB 5JWPA 3JATA 4ZOLA 3E8GA 3K57A 4PD4F 4DUYO 2V1DA 2E74B 1KKDA 4L8JA 4R7CA 5LP6A 1DK1A 1N0NA 4DW0A 1DTOA 3SYPA 3RYIA 1CEZA 3RVYA 1F23A 5BMVB
chains in the Genus database with same CATH topology
1P84F 3L73H 1BE3H 3H1IH 1SQQH 3L70H 1SQBH 3CXHF 3H1KH 4PD4F 3TGUH 4U3FH 3L72H 1KYOF 1PP9H 1L0NH 3L71H 3H1HH 3H1LH 4D6TH 1EZVH 1PPJH 1SQXH 3BCCH 1NU1H 1SQPH 3CWBH 3L75H 3H1JH 1BGYH 1NTMH 3L74H 1NTZH 1NTKH 5KLVH 1L0LH 1BCCH 2BCCH 2IBZH 2A06H 1SQVH 3CX5F 1KB9F 2FYUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  3L73 H;  1BE3 H;  3H1I H;  1SQQ H;  3L70 H;  1SQB H;  3CXH F;  3H1K H;  4PD4 F;  3TGU H;  4U3F H;  3L72 H;  1KYO F;  1PP9 H;  1L0N H;  3L71 H;  3H1H H;  3H1L H;  4D6T H;  1EZV H;  1PPJ H;  1SQX H;  3BCC H;  1NU1 H;  1SQP H;  3CWB H;  3L75 H;  3H1J H;  1BGY H;  1NTM H;  3L74 H;  1NTZ H;  1NTK H;  5KLV H;  1L0L H;  1BCC H;  2BCC H;  2IBZ H;  2A06 H;  1SQV H;  3CX5 F;  1KB9 F;  2FYU H; 
#chains in the Genus database with same CATH topology
 5L3F A;  5JQG B;  2FML A;  3SYQ A;  3AK3 A;  3F7Y C;  4CC5 A;  5KX5 A;  4ZIB A;  2P06 A;  2W6J G;  1SES A;  3ETD A;  2KG7 A;  1HNZ O;  1PPJ H;  2UUC O;  4PA7 A;  2Q69 A;  1OV9 A;  4PA6 A;  4MVQ A;  3IGA C;  4QE9 A;  1TAE A;  3ASN B;  3N2G B;  2JGD B;  4DV1 B;  3PN1 A;  4CS4 A;  2VWK A;  2P7T C;  3CCE V;  3B4S A;  4FLU A;  4UB8 Z;  3BA9 A;  3LNN A;  5D5Q A;  3AG3 C;  4JI0 O;  4X65 B;  3ZMT A;  2IH3 C;  4WBN B;  3C3T A;  4X1Y B;  2CH7 B;  2BOC C;  1B6Q A;  4JAS A;  3T1C A;  1EBO A;  5IWA B;  4WFH A;  2RJZ A;  4B3M O;  2EZO A;  2D2C B;  1ORQ C;  4YJ3 B;  3ZRV A;  1BHB A;  3CME V;  3F7V C;  1W2B U;  2PF4 E;  5JH7 A;  1VQ8 V;  2PYL A;  1ROP A;  4X88 A;  1SQX H;  4EKW A;  1YEW A;  4YHH O;  1MZF A;  3DXR A;  2MW2 B;  1MSW D;  3DC5 A;  4BIU A;  2QKS A;  1RSO A;  2JRI A;  3ZHQ A;  5CBH A;  5EBM C;  2ATK C;  1H2N A;  1GMG A;  1TVK A;  3L73 H;  2IH1 C;  5GTH Z;  5IT9 N;  1FFX A;  4FLY A;  2ILM A;  5CN0 A;  5IYZ A;  3A0R A;  5CA0 A;  1BL8 A;  1Q7Y W;  2IJK A;  2QR4 A;  5LOV B;  4LBE C;  1FFT B;  3HPL C;  4IT5 A;  1Q6H A;  4DK0 A;  2EJ7 A;  2HJD A;  3QO5 A;  3UQ8 A;  1HNX O;  4DR3 O;  2GHY A;  1FKA O;  3CMA V;  4O4H A;  4CS2 A;  5H6Q A;  1XRE A;  1KQS U;  1SQB H;  3AK2 A;  3K5O A;  3KCY A;  1P49 A;  1NKD A;  5L3C A;  5B1N A;  4FFK A;  1H2M A;  2ADP A;  2B9Z A;  1F4M A;  4TUY A;  5C8Y B;  3M99 B;  2P6J A;  4G27 B;  3ZHR A;  3ICX A;  4HAM A;  4PA4 A;  1UFI A;  3BAB A;  5IJ9 A;  3ZRX A;  1THZ A;  4X20 B;  1K8A W;  2QEX V;  1VQ4 V;  3RGB A;  4TT3 G;  2Z0A A;  5LA6 A;  2CE4 A;  2K9P A;  4ICG A;  4UUJ C;  3FB6 C;  2QTO A;  1B04 A;  4DR7 B;  4Z1V A;  3AEI A;  3SJB C;  1RM1 B;  3ZED A;  2WA4 A;  3K58 A;  1SER A;  4PDM A;  1P84 F;  3JAL B;  5EZY A;  2UXD B;  2DWE C;  2HJF C;  2JEU A;  2P5O A;  4BIO A;  3CSX A;  4BW5 A;  1EZJ A;  4B3T O;  1EZV H;  1M9N A;  5LGU A;  1SKV A;  4LWS B;  1DLB A;  4PV1 B;  2AGA A;  4ZI7 A;  2LQT A;  4JI2 B;  1AP5 A;  2W0F C;  3CJH B;  4UCT A;  2ZIM A;  2Q0O C;  1KB9 F;  4UCU A;  3BEH A;  1VQ5 V;  3K06 A;  4U7N A;  5AG2 A;  3AG1 B;  1SQQ H;  1K5S A;  3FFQ A;  4CH5 A;  4LFA O;  1D2D A;  3G67 A;  2QWP B;  1IUR A;  3JAS A;  5IJ0 B;  1KU9 A;  1TUB A;  2R9A A;  3OEH G;  4Z2W A;  5H6R A;  2XHB A;  3L74 H;  3OFN G;  2VWJ A;  3ZHS A;  1AP6 A;  3A8T A;  3UO2 A;  1K92 A;  1G1X B;  4ZKI A;  4LFC B;  3E83 A;  3FB8 C;  4YIO A;  4O4J B;  4CH4 A;  3C3S A;  2Q0A A;  3H1H H;  4NKG B;  4JI6 O;  3MHS C;  1SQP H;  3ABT A;  1Y74 B;  3UM7 A;  4JTD B;  5CB4 B;  1L0L H;  2BCC H;  4PA9 A;  1X59 A;  4YJ2 B;  4QPK A;  5CBF A;  3OUF A;  4DV5 O;  1QR9 A;  4MSW C;  5C93 A;  4RUF A;  4HZ3 A;  3RYF A;  1VQK V;  4R50 A;  4CC6 A;  1YJ9 V;  5LMU O;  1Q81 W;  3UO3 A;  5LHH A;  4MTF A;  2NN4 A;  2OIG A;  3IAY A;  3VQW A;  1HP8 A;  3P3N A;  2EIJ B;  2R70 A;  1VQP V;  2YID A;  1XIL A;  1Q6U A;  3VQV A;  2DYS B;  4I55 A;  3K79 A;  3D3Q A;  5KMG A;  1R3J C;  1M90 W;  4J10 A;  2PYJ A;  4EEQ A;  2R72 A;  2ITD C;  3H9V A;  4JYA O;  3TK1 A;  2LGQ A;  2E3C A;  2Z3Y A;  1Z2G A;  4O2B A;  5KA6 A;  5DN6 G;  3E8H A;  4XDK A;  4N21 A;  1RM1 C;  2WA3 A;  2F4V B;  3K5M A;  4UVB A;  4DV3 B;  2IU3 A;  3BRC A;  1K73 W;  1E1Q G;  2Q73 A;  4JTA B;  3E8F A;  3B8M A;  3L71 H;  2EIN B;  1M57 C;  1YZB A;  3VOU A;  2Y69 B;  1CXZ B;  4JI8 B;  4O4I B;  5KLV H;  3M7M X;  1IBM B;  3OTF A;  2X6B A;  2JGD A;  2PY5 A;  2Q67 A;  3NR7 A;  4JI5 B;  4LF5 O;  1IXB A;  1Y76 B;  3S3W A;  3HKD A;  4GLX A;  1YJN V;  3SDL A;  5HFL A;  4UCS A;  1F4N A;  3FAV B;  1P7B A;  2JDI G;  2F95 B;  1ZL8 B;  2A06 H;  4L87 A;  4UV8 A;  4I9W A;  1ARO P;  4DR2 O;  4YJ3 A;  4IL6 Z;  5EC2 C;  4U7O A;  2YEV B;  3UT5 B;  1I5Y A;  1NVP B;  3CRA A;  3G6E V;  5B1A B;  3ZX6 A;  1KUQ A;  4TV9 B;  3BCC H;  3RYC B;  3QF7 A;  2CK3 G;  2WLL B;  1GH6 A;  4YIP A;  1R3K C;  1QVF U;  3E22 B;  1QQC A;  1WP8 A;  4EFB A;  3E89 A;  4HYO A;  5LYJ B;  3SJC C;  2YIB A;  3SJA C;  2ZQM A;  2CTR A;  3JCZ A;  2WAM A;  3D3I A;  3CCM V;  4DRX B;  5LOV A;  1BZK A;  2X0L A;  4FMT A;  4P9O A;  4QNH B;  1IZ3 A;  2FKX A;  1BMF G;  1K9M W;  4NTW A;  5IY5 B;  3OGI B;  5KA5 A;  2DQ3 A;  1Q3E A;  3QO8 A;  4O2A B;  2ZR3 A;  1K34 A;  5CMU A;  3KCX A;  2VS0 A;  1Z5W A;  4DV2 O;  2IU0 A;  2HEP A;  2V4D A;  1N33 O;  1ENV A;  2B1G A;  5C8Y A;  1GN2 A;  3LDD A;  2XAG A;  4DR1 B;  4NXN B;  2ARH A;  4R8C A;  1ZLZ A;  3W7T A;  1M1K W;  1VQN V;  4X66 O;  2WLH A;  2EIK B;  4WF9 V;  3SPG A;  1NVP D;  3VQY A;  3D36 C;  3K9S A;  3M8A A;  1HNW O;  4IIJ B;  2PTM A;  1GM8 A;  3JAM N;  1WPB A;  2L6L A;  4YHH B;  2UUB B;  3JAK B;  3CWB H;  3RBZ A;  2ZE5 A;  3ZN1 A;  2UXC O;  3NXS A;  5DED A;  5IYB O;  4GKK O;  4GX1 A;  4NB5 A;  4DV7 B;  1XMO B;  2N05 A;  4PDL A;  4JI1 O;  5BZB A;  2WLJ A;  4U3F H;  1N0J A;  1LUV A;  3H1L H;  3F5W C;  4LR3 A;  4JZG A;  4LWS A;  1V55 B;  4DV4 O;  4B3S O;  1HNX B;  4DR3 B;  3OR7 C;  5H9C A;  4IGG A;  1OJH A;  3J80 N;  1OCR B;  3ZIA G;  2B5U A;  3ZN0 A;  1W59 A;  1IBK O;  1JMK C;  2ZD9 A;  4LNU B;  4TWK A;  5B1B C;  2DYR C;  5EBL C;  2QWN B;  1PL4 A;  1N32 B;  1D5N A;  2CDY A;  1B3Q A;  4FFB B;  5B1A C;  5BY1 A;  1D5A A;  4BAY A;  4X1K B;  1FPO A;  5IYD O;  4QJF B;  1H8H G;  2GUZ A;  5CBG A;  4AQY B;  3RFR A;  4FM1 A;  4GKJ O;  3ZBH A;  1GAX A;  1XNQ O;  4LF6 O;  1Y6X A;  4ZBM A;  3FB5 C;  1MNG A;  4E2L A;  3ETG A;  4O4J A;  5JVD B;  3TCU A;  3DTU B;  1EN6 A;  4KFM A;  3LDC A;  3RT3 C;  3OMA B;  5TIS Z;  1Y74 A;  4RQF A;  5CB4 A;  2P4K A;  1PNL A;  4MVS A;  1I94 B;  2Q9L A;  1Q43 A;  3ETE A;  5IY5 C;  2WWW A;  1WPX A;  1BQ0 A;  2AZ2 A;  4FLW A;  5CA3 A;  1S0V A;  4UVC A;  4B3T B;  1RPO A;  1QLE B;  1YCI A;  3SYO A;  2E5L O;  2HKO A;  3T4D A;  2QWO B;  3GWK C;  2LW7 A;  3HKB A;  2JS5 A;  1M56 C;  2P90 A;  1IXM A;  4JAA A;  3SYA A;  1OCZ B;  3STL C;  2EIK C;  3QO7 A;  4LFA B;  3G4S V;  3L9D A;  4JV5 O;  5GW7 A;  4NR1 A;  4PA3 A;  3CD6 V;  3W7W A;  4TQD A;  2MK3 A;  1JFF B;  4K0K O;  4NXM O;  2QA4 V;  3LUT B;  3ABU A;  4G28 B;  4QGP A;  4JAU A;  1GO3 F;  4OPH A;  4X8A A;  3ZRW A;  1N8R W;  1AR5 A;  5BR8 B;  3D36 A;  4UB6 Z;  3L70 H;  4FLX A;  2IW5 A;  2P4V A;  3JSL A;  3FD9 A;  4FM0 A;  2JGU A;  4DUZ O;  2W0X A;  3HR0 A;  1FJG O;  3Q4H B;  1PL0 A;  4DK1 A;  4HNA B;  4OX9 O;  4PI2 A;  4B3R O;  4KHP O;  1R6T A;  1BGY H;  4O4I A;  4Q20 A;  4DV5 B;  3ZMV A;  5FPR A;  1QR8 A;  2WSS G;  1K4C C;  5H2F Z;  4DR4 O;  1HDJ A;  3G71 V;  4JI4 O;  1EFR G;  1AR4 A;  1OCR C;  2Q68 A;  2QGN A;  4DXW A;  3N2K B;  3K5N A;  1Y76 A;  1XNR B;  4RAI A;  3W7U A;  3H01 A;  3AG2 C;  2LFS A;  2KSD A;  3SPH A;  5JJJ B;  4LF9 O;  4PJ0 Z;  3CB2 A;  4GX0 A;  1Q90 D;  4J9Z B;  3WFV A;  1YXB A;  2AHZ A;  4K35 A;  3OM3 B;  4WFB V;  3STZ C;  4JYA B;  2BTQ B;  3FYE B;  4I50 B;  1Y66 A;  1N36 O;  2YEV A;  5IYC O;  3E86 A;  1VF5 B;  4TV9 A;  2ZCE A;  3RYC A;  2WLL A;  3HB3 B;  3WB2 A;  2UXB B;  2ODM A;  2F43 G;  3ZHU A;  2Q5Z A;  3CP1 A;  2CTP A;  4FLT A;  3E22 A;  2D3O W;  4JF3 A;  4MVR A;  4FLZ A;  1N34 O;  4XDL A;  3T1Y O;  3JD2 A;  3IFX A;  3ML0 A;  3A2F A;  4DRX A;  2E76 B;  3ETQ A;  2HFE C;  2EJR A;  2QM7 A;  3FKS G;  1DF5 A;  1B06 A;  3QG5 A;  3CCR V;  2QJ1 A;  2LO1 A;  4O2A A;  1QBZ A;  3U0Z A;  3H1I H;  3THO A;  4B7K A;  1OCZ C;  4JI7 B;  2GDS A;  1X4T A;  1S77 D;  1K97 A;  4PDR A;  4AHC A;  3KG2 A;  1J5E O;  2C2A A;  1V54 B;  3O65 A;  2Q7H A;  1AR1 B;  2YC0 A;  2ZDI C;  1Q82 W;  1JJO A;  2VQF O;  2JS3 A;  4NTX A;  3W7X A;  1UJW B;  1YDX A;  3ASN C;  1VMG A;  2QWQ B;  4I0X B;  3VBB A;  4WFA V;  5H5N A;  2GBO A;  3N27 A;  1G8M A;  4GCZ A;  2CAZ C;  4FJC C;  3JAK A;  2HLD G;  4OPA A;  1MSD A;  4J42 A;  1K33 A;  2XAQ A;  1J95 A;  1G4Y B;  2LW1 A;  3I5D A;  4BIZ A;  1SF9 A;  3CEI A;  4J80 A;  2N74 A;  1FAF A;  3VQX A;  2YUA A;  1S72 V;  2PI5 A;  2UU9 B;  4J7J A;  3WB0 A;  5IE9 A;  1AI5 A;  2LGW A;  5EIB D;  1XEQ A;  2YI9 A;  4RO2 A;  2XND G;  1NR1 A;  2ZKO A;  3JD1 A;  2ITC C;  4DR5 B;  5GON B;  4LNU A;  4O4L B;  3CCS V;  2QSA A;  3B77 A;  3K3W A;  1WA8 B;  2CTQ A;  5KUM A;  1N33 B;  1CPY A;  3AK1 A;  3G80 A;  4FFB A;  1P7G A;  3PJS K;  3L75 H;  2FL4 A;  3FYI B;  2ZNJ A;  4X1K A;  4W4L A;  3LDE A;  3RYH B;  4J7Z A;  4I4T B;  3K5L A;  1MA1 A;  4DV1 O;  2RMK B;  4K8Z A;  5LMN O;  2H94 A;  1HNW B;  4R6Z A;  3EFF K;  5LXT B;  1XBL A;  3K03 A;  4JYC A;  4F6R B;  1VEW A;  2N04 A;  4X65 O;  1JVM A;  2UXC B;  2X6A A;  4N23 A;  4CBC A;  5IWA O;  3JAT B;  3ABK B;  3BA8 A;  2EIM B;  3T2M A;  4GKK B;  1AJQ A;  4CZZ A;  1YHQ V;  2OTL V;  2IJH A;  2Z5U A;  4JYB A;  2RCV A;  3TJT A;  3CRQ A;  1XI1 A;  1MAB G;  4IYH A;  1LUW A;  3E8B A;  2R9R B;  4DV4 B;  1XL4 A;  2YIC A;  3T1H B;  4FPP A;  2QM4 A;  1BQZ A;  5BMV A;  2BE3 A;  5CA1 B;  5JQG A;  3S3X A;  5EK0 A;  4H37 A;  3P32 A;  5KX5 B;  1BHA A;  2QDO A;  4UCV A;  3GWO A;  2KG7 B;  4PHZ A;  4D6T H;  2AHY A;  1T5E A;  2M7W A;  1JFF A;  1MG1 A;  2ZM6 B;  1URF A;  2ZE6 A;  5L3B A;  2HR3 A;  2ZDI A;  4W4K A;  3E35 A;  1JX9 A;  3BVO A;  5HFM A;  4OXS A;  2KQX A;  4DV0 B;  4LF6 B;  4DR6 O;  3N2G A;  1ZWI C;  4AI8 A;  2RDC A;  2HVJ C;  3JD4 A;  4E4E A;  1WB7 A;  2VQE O;  3AG1 C;  1QCE A;  2ZXW B;  3SJQ C;  5LBQ A;  2Y4U A;  1WAZ A;  1GM9 A;  2QTS A;  1R6N A;  2LJ2 A;  3A0H Z;  1HR0 O;  2KB1 A;  4OGQ B;  4WBN A;  4DV6 B;  4X1Y A;  2DWD C;  5J2T B;  2CH7 A;  5KHJ A;  1KP3 A;  2BOB C;  2O57 A;  4D7T A;  2JIZ G;  2OCC B;  4EFE A;  4GX2 A;  2X7R B;  4LP8 A;  4DUY B;  3LSU A;  2E5L B;  1YJW V;  4DR7 O;  2F93 B;  2EIL B;  3GVM A;  5B1O A;  2Q7E A;  4CS3 A;  2XTA A;  1R73 A;  1RSO B;  1HWY A;  1BCC H;  2AW9 A;  5FNV B;  4X62 O;  5LHI A;  3CX5 F;  4RWU A;  3SPJ A;  1YSC A;  1O9G A;  3CRC A;  3JCU Z;  4JV5 B;  2BTQ A;  5F2V O;  4I50 A;  2F23 A;  3AG7 A;  1WJZ A;  5CA0 B;  1HNZ B;  2UUC B;  4K0K B;  4NXM B;  1HW7 A;  1NU1 H;  2EIJ C;  3E2E A;  4J7K A;  4D7S A;  4JI2 O;  2K1E A;  1PNM A;  4MVO A;  4UVA A;  4ABM A;  2DYS C;  2YXY A;  2EX3 A;  4I5S A;  2YIA A;  2WLI B;  1EN4 A;  4KL1 A;  3ABK C;  1O9H A;  3LSS A;  5B66 Z;  4JPR A;  1SQG A;  4JGS A;  4KXR A;  2ZIO A;  1FJG B;  4JI0 B;  4OX9 B;  4FIP C;  1S3J A;  1WLE A;  4KHP B;  1N4C A;  1U97 A;  5EYP B;  1KP2 A;  1NTM H;  3MDS A;  4MTX A;  1RPR A;  4LFB O;  2XUM A;  4DR4 B;  4WFG A;  4H13 B;  4JI4 B;  4B3M B;  4X20 A;  3IC7 A;  1NT2 B;  5LA6 B;  4BR6 A;  1IDS A;  3ABM B;  3CE2 A;  4FLV A;  1AIL A;  3LNM B;  5L3D A;  1XMQ O;  1Z5V A;  1BS3 A;  3ZS8 C;  1NH2 D;  4XBF A;  2LFR A;  4I9Q A;  2EIN C;  4LF9 B;  2IJI A;  3RWR D;  2BTO A;  2Y69 C;  3G6B A;  4MTO A;  3I56 V;  2OYQ A;  1GK9 A;  2XAS A;  3JAL A;  2YXL A;  1YTF B;  3DGE A;  1N36 B;  4I0X A;  3X2Q B;  1KEC A;  5DEC A;  1S5J A;  1R3L C;  2ZXW C;  4WFE A;  2GTA A;  1MOF A;  1KBH A;  1WP7 A;  3CJH A;  1FS0 G;  4YY3 O;  2CTW A;  4C7U A;  1N34 B;  1NBM G;  3HKE B;  3T1Y B;  1QLN A;  1W0J G;  2OCC C;  4K3A A;  1K5Q A;  1ZUQ A;  1XDC A;  2NNU A;  2DOS A;  1VQ7 V;  2F1M A;  1E1R G;  4QPJ A;  4BW9 A;  2HG5 C;  4TQF A;  2ETN A;  3TXS A;  5L3G A;  1SC5 B;  3UCS C;  4YXW G;  5IJ0 A;  2PI4 A;  1AI4 A;  2JK5 C;  3WU2 Z;  2BSK B;  2CGO A;  2EIL C;  2YI8 A;  2ZR2 A;  4H33 A;  3CHX A;  2PUS A;  2EUL A;  5KUK A;  2JVD A;  4DV3 O;  3JAR B;  5GON A;  4FZ1 A;  4O4L A;  3MD0 A;  3K04 A;  2B1I A;  1EM1 A;  1GM7 A;  1M5I A;  1GRJ A;  1SA0 B;  3F5T A;  1JOY A;  1OCO B;  4IYI A;  1SS3 A;  1NTZ H;  4JI8 O;  1FYJ A;  1YTF D;  4YJ2 A;  1XHZ A;  1H38 A;  2VQF B;  4X1I B;  3RYH A;  1IBM O;  4F6E A;  4I4T A;  1Q86 W;  1NR7 A;  3K08 A;  3RN4 A;  5KHH A;  4JI5 O;  2YSU B;  2HVK C;  1VQL V;  5BXZ A;  5LXT A;  5J9P C;  2FTK A;  3DSQ A;  4G2K A;  5K1X A;  2LP7 A;  5B3S B;  2ZE8 A;  3T4Z A;  2IBZ H;  5KHI A;  2E75 B;  5IDJ A;  2HP8 A;  4I7Z B;  4NVP A;  3OTO O;  1NS1 A;  4MVM A;  3CXH F;  1I5X A;  4H0L B;  1COW G;  1YIJ V;  4J41 A;  4O2B B;  3ABM C;  4ZHQ B;  3ABL B;  4LF8 O;  1WN7 A;  1FXK B;  1M93 A;  1LNQ A;  1EN5 A;  1L1F A;  2QKC A;  4QIW F;  5CA1 A;  3JD0 A;  3EHB B;  3OR6 C;  1UPG A;  4F4L A;  5JJN B;  4JI6 B;  3X2Q C;  1TA8 A;  3H1J H;  2XAF A;  4RUE A;  1H2K A;  3B09 A;  4X64 O;  1VAR A;  2ZIN A;  1V55 C;  3GB7 C;  2DW4 A;  1L8D A;  2Y4T A;  4FK5 C;  5LMU B;  2NLJ C;  5LMN B;  1Q8I A;  3CCU V;  4KP4 A;  3HKD B;  1JA8 A;  1FXV A;  1E79 G;  1BSM A;  3SPC A;  2A7W A;  3FAV A;  4DR1 O;  4NXN O;  1G6U A;  1ZL8 A;  1US6 A;  2FB5 A;  5J2T A;  3BPZ A;  3ZJZ A;  2WLN A;  1BE3 H;  2ZNI A;  4H44 B;  3CC4 V;  3B8N A;  2QE7 G;  3FX7 A;  3P30 A;  4J9Y B;  3UT5 A;  5KHG A;  3CC7 V;  1VQ6 V;  4DO2 A;  2UUB O;  1W0K G;  4FM2 A;  1A32 A;  1AI6 A;  5ITZ B;  5FNV A;  3D8C A;  3RVZ A;  1OCO C;  2FYU H;  3BAA A;  2UUA O;  4DYL A;  2HHH O;  4B08 A;  3CPW U;  3C90 A;  1VF7 A;  2W6I G;  1QNM A;  4DV7 O;  1XMO O;  2ZE7 A;  1PNK A;  5LYJ A;  5K1P A;  4CH6 A;  4IHJ B;  1AVM A;  3HKC B;  3IC9 A;  2RQ6 A;  1JCH A;  1QHT A;  1R1B A;  3QVN A;  3MHH C;  4JI3 O;  1QLE C;  5KAF Z;  3FB7 C;  2PGG A;  5B3S C;  4DR6 B;  1AB3 A;  1M4U A;  2JEX A;  2OTJ V;  4PEL A;  2WLI A;  3JYC A;  2CGN A;  4LF5 B;  5LGN A;  2VQE B;  1OZ0 A;  1GN4 A;  1N32 O;  1VP7 A;  1SZT A;  1HR0 B;  5EYP A;  3SR2 C;  3ABL C;  4TV8 B;  4LC1 A;  3APO A;  1FXK C;  3OEE G;  1NJI W;  1VF6 C;  4RQE A;  4AQY O;  1IVS A;  1S76 D;  2R9I A;  2GV9 A;  4LF7 O;  2UXX A;  3O9O A;  4DR2 B;  2L35 A;  4LF4 O;  1GKF A;  4UFZ A;  4TSF G;  3JAW B;  3WG7 B;  4Z1M G;  4IIJ A;  5E79 Z;  1U96 A;  2XAH A;  2XT9 A;  4X9Q A;  3KZI Z;  2Q8V A;  4X62 B;  1H2L A;  2IJJ A;  3B40 A;  1S5H C;  3JSN A;  2OCH A;  1IBL O;  1I94 O;  2YIB D;  2YXH A;  1SET A;  4B7E A;  3OAA G;  4UCO A;  2F66 C;  2DE0 X;  4P30 A;  3OMN B;  1M57 B;  1QU7 A;  3CRM A;  3LSQ A;  4JAV A;  1TGO A;  4MVZ A;  2OT5 A;  5D5P A;  2A79 B;  2G38 A;  2V7Q G;  2OWO A;  1JQ0 A;  5JJE B;  2XAJ A;  1PV0 A;  3ZCC A;  1I0H A;  3HKE A;  1PD3 A;  4DV2 B;  1NI8 A;  4EB6 B;  3J81 N;  1YIT V;  5A2Q N;  2A0L A;  5KHK A;  2AXT Z;  2GUZ B;  4U3J B;  3K59 A;  2BSK A;  4LFB B;  4Q6G A;  4X66 B;  5BR8 O;  3ZHT A;  5J2U B;  5EC1 C;  1Q6I A;  3K9A A;  3JAR A;  3BFR A;  1XMQ B;  1IX9 A;  2Q4P A;  4PDV A;  1XQ8 A;  5JVD A;  2XOK G;  3WB1 A;  1K7D A;  5LGT A;  1SA0 A;  3SYC A;  1SQV H;  4X1I A;  2P22 C;  1H2G A;  4ZOL B;  3OE7 G;  5EIB C;  4ASU G;  4JI1 B;  5A9G A;  1XL6 A;  2H3O A;  2WLM A;  5LP6 B;  1Y67 A;  3R65 A;  1NQT A;  3R66 A;  3W7S A;  1XNR O;  3JD3 A;  3RYI B;  3HKB B;  4B3S B;  4CH3 A;  1PKX A;  1MZE A;  1ZAU A;  4YY3 B;  3CRR A;  3K0D A;  5L3E A;  1JJ2 U;  2OIE A;  1Y4M A;  1TUE B;  1I7F A;  1V54 C;  3ZMS A;  1IBK B;  3QTC A;  1GN6 A;  1YVW A;  2EZP A;  5KAI Z;  5FLX N;  3TGU H;  1PP9 H;  4GX5 A;  3WG7 C;  4ZHQ A;  3OW2 U;  1RP3 B;  1FXK A;  1GTO A;  1VF6 A;  2UXB O;  3ZRW B;  1WB8 A;  1F7Y A;  2QKA A;  4BWA A;  4P2Z A;  1KMI Z;  4GKJ B;  4UV9 A;  1XNQ B;  3OGC C;  3ZHV A;  4QE7 A;  1VQM V;  2RN9 A;  1SQF A;  1OCC B;  1XOU A;  3Q4H A;  3K0G A;  2RNB A;  4HNA A;  5JCO C;  2VRZ A;  1AJP A;  5EBW C;  1MMM A;  4LH7 A;  3BY6 A;  4XDJ A;  1K4D C;  5DM6 V;  2DJV A;  3EVK A;  3I55 V;  4JI7 O;  4LCU C;  5JH7 B;  3N2K A;  1R6K A;  3CCJ V;  3DXR B;  1I08 A;  3CC2 V;  3TET A;  5FPO A;  2Y48 A;  2GSM B;  3AG4 B;  1SRY A;  3CS5 A;  4LH6 A;  1NH2 B;  3P3P A;  3OTO B;  1TVK B;  3DC6 A;  5B1B B;  2DYR B;  1FFX B;  3CCQ V;  2UXD O;  1K3E A;  3CCV V;  5IYZ B;  3QNE A;  4TOI A;  1KYO F;  1F51 A;  3IJ4 A;  4LF8 B;  1SZX A;  4FZ0 A;  2P67 A;  1VQO V;  5ITZ A;  3OD4 A;  3CCL V;  1QVG U;  4HBN A;  4MVU A;  4O4H B;  4UXN A;  5LHG A;  1AI7 A;  3KKY A;  3ZMZ A;  1S5L Z;  3ASO B;  2A3Q A;  4JYY A;  2EIM C;  4DUZ B;  4K8X A;  1L0N H;  2UU9 O;  3ZRS A;  4JZ2 A;  4IHJ A;  5LL6 Y;  1XUQ A;  4TUY B;  1YF2 A;  5LP6 C;  3HKC A;  4B3R B;  1AJN A;  1NTK H;  5IJ9 B;  2Q6A A;  4X64 B;  3MAQ A;  1ZX3 A;  3OMI B;  2ADQ B;  5GTI Z;  2Q7G A;  4LFC O;  3H1K H;  4DR5 O;  2JJ2 G;  2CUG A;  4P9P A;  2QM8 A;  4GUN A;  3A0B Z;  1P4R A;  3OT7 A;  5B5E Z;  4WCE V;  1JR9 A;  1M56 B;  4GT1 A;  4TV8 A;  3SGI A;  2M6Y A;  1KD1 W;  1DGS A;  2DMX A;  4GZR B;  5EZY B;  1ZSP A;  4DW1 A;  5E1A C;  1FD9 A;  3JAW A;  2DN9 A;  2AZ0 A;  4MS2 A;  1H2S B;  3CXC U;  4UCR A;  2Y0P A;  1OCC C;  1VIB A;  4ZI7 B;  2YDE A;  3U10 A;  1V9P A;  4JTC B;  1NZ6 A;  4GYC B;  3SPI A;  2UUA B;  1JPX A;  1ZTE A;  4MT8 A;  2HHH B;  3RW0 A;  1CP9 A;  2IM9 A;  2GTS A;  3AG3 B;  4J11 A;  1DF4 A;  3BHP A;  5JCO A;  3JAS B;  2WLK A;  2WPD G;  4MW3 A;  4NYK A;  1TUB B;  4JI3 B;  2JJ1 G;  3OUS A;  1YI2 V;  3U11 A;  3T1H O;  1GN3 A;  3B2E E;  1WNS A;  4A5U B;  2NR5 A;  3AG4 C;  2F4V O;  1R3I C;  2ZT9 B;  4NTY A;  4X89 A;  2KKW A;  4PI0 A;  1KKC A;  2DQ0 A;  3L72 H;  4EB6 A;  1H8E G;  3AG2 B;  1KC8 W;  1WA8 A;  1OHH G;  1PM9 A;  1RFY A;  1J5E B;  2X6C A;  3CYO A;  2ZM6 O;  2QWR B;  4U3J A;  2A9H A;  3UKM A;  2H8P C;  1LR1 A;  4DV0 O;  4LF7 B;  5FL7 G;  3RYF B;  4LF4 B;  4MTG A;  3ZMU A;  2Y0I A;  2EBO A;  2YS8 A;  5J2U A;  4FVM A;  1VQ9 V;  3ASO C;  4F6R A;  4WFF A;  1XHX A;  1Q5O A;  2UXN A;  1FXH A;  4MW8 A;  3APQ A;  3J7A U;  2PZS A;  4DV6 O;  1IBL B;  4AIL C;  4KUM A;  3EXA A;  4I55 B;  3TXQ A;  1BT8 A;  5KMG B;  5JWP A;  3JAT A;  4ZOL A;  3E8G A;  3K57 A;  4PD4 F;  4DUY O;  2V1D A;  2E74 B;  1KKD A;  4L8J A;  4R7C A;  5LP6 A;  1DK1 A;  1N0N A;  4DW0 A;  1DTO A;  3SYP A;  3RYI A;  1CEZ A;  3RVY A;  1F23 A;  5BMV B; 
#chains in the Genus database with same CATH homology
 1P84 F;  3L73 H;  1BE3 H;  3H1I H;  1SQQ H;  3L70 H;  1SQB H;  3CXH F;  3H1K H;  4PD4 F;  3TGU H;  4U3F H;  3L72 H;  1KYO F;  1PP9 H;  1L0N H;  3L71 H;  3H1H H;  3H1L H;  4D6T H;  1EZV H;  1PPJ H;  1SQX H;  3BCC H;  1NU1 H;  1SQP H;  3CWB H;  3L75 H;  3H1J H;  1BGY H;  1NTM H;  3L74 H;  1NTZ H;  1NTK H;  5KLV H;  1L0L H;  1BCC H;  2BCC H;  2IBZ H;  2A06 H;  1SQV H;  3CX5 F;  1KB9 F;  2FYU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...