4U3FH

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
68
structure length
68
Chain Sequence
b'EELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase/oxidoreductase inhibitor
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 22
structure length 68
sequence length 68
chains with identical sequence U
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 4u3fH00
3L70H 4PD4F 1SQPH 1BE3H 1L0NH 1KYOF 3L72H 2FYUH 3H1HH 3H1KH 1SQVH 1BGYH 3CXHF 3TGUH 2IBZH 3H1LH 1NTKH 5KLVH 1L0LH 3L71H 1KB9F 3H1JH 1NTZH 3CX5F 1NTMH 1SQQH 2A06H 3L75H 4D6TH 1SQBH 3CWBH 1EZVH 3L73H 3H1IH 4U3FH 1NU1H 1P84F 1BCCH 1PPJH 3L74H 3BCCH 2BCCH 1SQXH 1PP9H
chains in the Genus database with same CATH superfamily
1YZBA 4G2KA 1KMIZ 2QTSA 1VQKV 4J80A 3ASOB 1OCRB 4GKJB 2VRZA 1IXBA 1V54B 1TAEA 3LSSA 1JFFA 1N34O 3HKEB 4N21A 3OW2U 1E79G 2EBOA 1BHAA 4LF4O 1Y67A 3SJCC 4GKKB 2UXNA 1HNWB 4JAAA 1N0NA 2DOSA 2DQ0A 4P9PA 5EIBD 2CH7A 4DV2O 1WB8A 3NR7A 1BL8A 1VQ8V 4LF8B 4P9OA 4QPKA 3OR6C 4F6RB 2O57A 2M6YA 1VMGA 3CCQV 2XOKG 3Q4HA 2DWDC 3O9OA 3FB5C 3RW0A 1IDSA 4LBEC 4HNAB 2ZR3A 2Z0AA 3A0RA 3ZS8C 3OMAB 5C8YB 2E76B 4YIOA 4GX1A 1QHTA 4PD4F 3FD9A 2QM8A 4QNHB 4HNAA 3ASOC 1YVWA 3CC7V 1AVMA 3DTUB 1ZL8B 3ZN0A 1AI7A 5GW7A 1HR0B 1R1BA 1VF6C 2CH7B 4RO2A 4DUZB 1P7GA 4FLXA 1XL4A 3L74H 4DV7O 1IBLB 4DR2O 5J9PC 4K8XA 3CCEV 5FLXN 2DQ3A 3DXRB 5J2TA 2Q73A 2CTQA 4BW5A 2UXCB 1RM1B 1N34B 3ABLB 3UT5A 3FAVA 2H94A 3EXAA 1B06A 4UB6Z 4HAMA 5GTHZ 4L8JA 2HKOA 4QIWF 5EC2C 4X66B 4DV1B 4CH4A 3CCLV 1FD9A 2VS0A 4BIOA 4J9ZB 4I0XB 5D5PA 5FPRA 3STZC 3JAMN 1SQVH 5IY5B 4DV2B 2OCCC 3K9AA 3B2EE 3KZIZ 4GX2A 4GLXA 4FLTA 4JYYA 4JASA 3OMNB 3O65A 5LHIA 1CPYA 3M99B 2ITDC 3H01A 1J5EB 4KHPO 5EBLC 4TQDA 3C3SA 3KG2A 2GUZA 2JDIG 4WFBV 1H2LA 3JASB 1HP8A 4O2BB 1R73A 2XAQA 3JCUZ 3JD2A 4K3AA 5K1PA 2R9IA 3CRQA 3JATB 2CGOA 3U0ZA 1Q43A 3K0GA 2IU3A 5A2QN 4DR5O 4YJ2B 3OM3B 2W0XA 3WG7B 3ZMUA 3OMIB 4NYKA 2M7WA 4IYIA 4IL6Z 5CN0A 5J2TB 4ASUG 4XDJA 1H2MA 3H1JH 3LDEA 4TV9A 3TETA 4DK1A 3AG3C 2ITCC 1JCHA 4AILC 1NU1H 2HG5C 4FJCC 3OD4A 1IURA 3FB8C 1COWG 2UXCO 3T1CA 1NBMG 4NB5A 2YIAA 4WCEV 3OFNG 5BZBA 2QKSA 4B3RB 2QWPB 4ZI7A 3RVYA 4JI6O 1GMGA 2AXTZ 5LMNB 3H1IH 3ABUA 4OX9B 2BTQB 1XQ8A 4OGQB 2DJVA 3BABA 3K06A 5EYPB 4DV4O 4JZ2A 2R9AA 4OXSA 3E8FA 4CC6A 1S5JA 1YF2A 1IX9A 1N32B 3P32A 4UUJC 2ZM6B 3M7MX 3FKSG 5B1AC 3OUSA 2XAJA 3SPJA 3ASNB 2AW9A 2NNUA 4X65O 1QR8A 5J2UB 1OCZB 4HBNA 1JMKC 3RYHB 4YY3O 4K0KB 2JVDA 3UQ8A 4NTWA 2OWOA 1IBMB 3CCUV 3K5MA 1YEWA 1BQ0A 1JFFB 1V55C 2B5UA 3ABKB 1K4CC 3JD1A 1SZTA 3BRCA 4J7JA 3MD0A 4DR7B 1CEZA 1H8EG 2HVKC 4DR4O 3ZHVA 1YITV 2OT5A 3E22B 1H2SB 2ZE5A 3ZRWA 1OZ0A 4CH5A 2CTWA 5FNVA 1SQQH 3FYIB 3I55V 1RM1C 1M56C 4LWSB 2HEPA 3GVMA 3QNEA 1AI6A 3FB7C 3OTOB 4DXWA 4B3SO 2EIKB 2YUAA 2Y4TA 1BMFG 4FLWA 1TVKA 4Z1VA 4DV6B 3BY6A 4MVMA 1SERA 1S72V 3QF7A 3R66A 4NXMO 4PI2A 3G67A 4X20B 4O4JB 1MG1A 5B1NA 4FVMA 2QA4V 5KHGA 5B1BB 5LP6A 1XMQO 3LNNA 3BFRA 4PA7A 3CXCU 1K4DC 5H6RA 4CS3A 4FZ0A 2JEUA 3GB7C 5BXZA 3IC9A 2E3CA 3ABKC 1U96A 4X88A 4DRXA 4JI2O 4Z2WA 4JAVA 3GWOA 1CXZB 4PDMA 5LYJA 1V9PA 2EZPA 4HZ3A 5B3SC 1N4CA 3SPCA 4W4LA 1W0JG 4JV5O 2ZCEA 1NKDA 3SPIA 4DV5O 3JCZA 4DRXB 2D2CB 4DR3O 3T1HB 2ZT9B 3I56V 3AG3B 1J95A 4P30A 5KMGB 4GKKO 5LOVA 1M57B 3AK3A 1WP8A 4X65B 2P4KA 1PNMA 1XL6A 5F2VO 1W59A 4G27B 4RQEA 4YXWG 5CMUA 3ABMB 4LF5O 3ZRVA 4LFAB 2VQFO 3D3IA 3P3NA 4DW0A 2Q69A 2BTOA 1OCOC 5B66Z 3TXQA 4FK5C 2A9HA 4X1YA 4GYCB 4F4LA 5FNVB 4ICGA 1N0JA 5LYJB 2P7TC 5EZYA 1QLEC 4CBCA 1AR5A 3RN4A 1KB9F 3X2QB 5EBWC 2W0FC 1N33B 1Z2GA 4D7TA 4LF8O 2IH1C 4LFCO 1DGSA 5BR8O 1I08A 4W4KA 2LFSA 1D2DA 2GBOA 3VBBA 1URFA 1FXHA 2F66C 4JI4B 1K73W 3F5WC 1D5AA 1GH6A 3H1KH 2HLDG 2QR4A 3E2EA 5CA0A 2RQ6A 1CP9A 3SYOA 3T4ZA 4CS4A 2Y69B 4CH6A 1O9HA 1NTMH 1V54C 2UXXA 3LDDA 4IGGA 2F4VB 5LL6Y 2E5LO 3KKYA 4MSWC 4PA4A 1VIBA 2A0LA 1SQXH 5C8YA 5IYZA 4NXNO 4FPPA 3U10A 1JJOA 2EX3A 4JPRA 5KA6A 3KCXA 2BSKB 2R70A 4AHCA 1YJ9V 5LGNA 1YIJV 1F23A 1FAFA 4DV1O 4MTOA 1KP3A 2WA4A 3HKDA 3K04A 5LMUO 4JI0B 1NQTA 3WU2Z 3T1YO 1G1XB 1PV0A 4DR2B 3JD4A 3A2FA 3SYPA 2OTLV 2F1MA 1H2GA 1KP2A 4X1IA 3K9SA 5BY1A 4JI1O 1VQ7V 2KQXA 5KHJA 3N2GA 2RNBA 4KUMA 4H37A 1M4UA 1OHHG 2YDEA 3TJTA 5IWAB 4Q20A 4JI4O 5KAFZ 3CB2A 1J5EO 4KHPB 2Q8VA 3HKBB 2HVJC 1Q8IA 4JI3O 1ZUQA 3OT7A 1K97A 2YIBA 3HKEA 3DC6A 2EIJC 1WN7A 2JJ2G 3CEIA 2RJZA 5CA1A 5ITZA 1K34A 5KLVH 1GN2A 3K08A 3R65A 4DR3B 1WA8B 2UUBO 5K1XA 3B8NA 4P2ZA 4XDKA 4FLZA 3JALB 4PA9A 2MW2B 1HNXB 2IJJA 3B09A 1I94B 1BT8A 5ITZB 1K9MW 4Q6GA 2VQEB 4IHJA 3CHXA 4YJ2A 3UCSC 3G6EV 3E22A 4UCUA 2W6JG 2QGNA 1TUBA 2OIEA 4LCUC 2EIMB 5LGUA 1I0HA 4UFZA 4O2BA 1WPBA 3SJAC 2Q9LA 2UU9B 4TT3G 1NZ6A 1ZAUA 4DO2A 2KB1A 5DECA 1H2NA 2GTSA 3CSXA 3E8GA 1OCZC 4R6ZA 1YSCA 1BQZA 4B3RO 1QLNA 2EULA 1YDXA 1W0KG 4JI7B 1VQ5V 3RWRD 3LUTB 1T5EA 5JJEB 2EILC 3L73H 4LF7B 2LFRA 5GONA 2WLKA 4LFCB 4TSFG 4H0LB 1VF6A 1GO3F 3ABTA 3MDSA 4E4EA 4BIUA 2Z3YA 1R6TA 1K33A 2ZIOA 3ZHTA 3JAKB 3ICXA 3N27A 1V55B 2XUMA 4EEQA 1X4TA 1PL4A 2PYLA 1NVPD 3ZBHA 4J7KA 1VQ9V 3DC5A 5B5EZ 3JSLA 1XI1A 4K35A 3RFRA 1Q6UA 2ZNIA 2QM7A 1YJWV 3E8BA 1NH2B 2HJFC 1MABG 4I55A 4L87A 3JASA 2EJ7A 3RYHA 3SYCA 1N8RW 1BGYH 1ZSPA 3KCYA 3P30A 2YICA 1VF5B 4I4TB 4FIPC 5LGTA 2WLNA 2ZM6O 1AJPA 4GX5A 2GV9A 1Q86W 4HYOA 4X64O 2NR5A 3CYOA 4K0KO 4DR1B 1M9NA 1GAXA 5B1OA 3CS5A 2YXLA 3RVZA 1P7BA 1Q3EA 3L71H 1OCOB 1XMQB 4RAIA 4IHJB 3AK2A 2RDCA 3AEIA 1PPJH 4B3MB 2KG7B 3EHBB 3BA8A 5IT9N 4R7CA 4FZ1A 1AP6A 3TGUH 4CH3A 3C90A 3VQVA 3AG1B 2OTJV 4YIPA 1XBLA 1DF5A 5B1AB 1ENVA 3SPHA 1TUEB 3K3WA 4X89A 1KKCA 2ATKC 2X6BA 3OTOO 1JR9A 1QNMA 1F4NA 3TCUA 4GCZA 1QR9A 5EIBC 3ZJZA 2VQEO 4YHHO 4X1KB 4DV6O 2AZ0A 2QKAA 4U3JA 3RYFB 3D8CA 4UXNA 1SQBH 3N2KB 2IJHA 3UM7A 1AJNA 5DM6V 5JQGB 1Q90D 1US6A 3BPZA 1Y66A 2BTQA 2X7RB 4LR3A 5IDJA 1PKXA 2UU9O 3RYCA 3T1HO 1SETA 4QGPA 3GWKC 3RYIB 2CGNA 4K8ZA 1KYOF 1S77D 4TQFA 3X2QC 3T4DA 1UJWB 2CTRA 4LNUA 3D36A 5IYBO 1UFIA 4C7UA 3BA9A 5IYCO 1JJ2U 4NXMB 1P4RA 3IGAC 4CS2A 2X6AA 2PUSA 4LH6A 4JI8O 4DR6O 4DV5B 2WLMA 1EM1A 5KAIZ 3K0DA 3APQA 4DV3O 3N2GB 3BAAA 1KKDA 1EN6A 3C3TA 4NTYA 1PL0A 3LSQA 1EN4A 3JARA 4MVRA 4RUFA 3WB0A 3E8HA 5LMNO 1VEWA 1VQLV 3G4SV 2ILMA 4OX9O 4YJ3B 3H9VA 3ZRSA 3THOA 4X64B 5JH7A 2WLJA 4WBNA 1PM9A 5EC1C 3OR7C 3QO5A 4IIJA 4RUEA 5AG2A 1GM9A 5L3BA 4LFAO 4EB6B 2PGGA 2V7QG 3H1LH 3ETGA 1JA8A 4O4JA 4PDRA 1R3IC 4LF4B 4AI8A 5KX5A 3S3XA 1KECA 5KUKA 2P06A 2QWNB 4N23A 1YCIA 5EK0A 5L3EA 1B3QA 5KMGA 4UCTA 3K79A 3CCVV 2R72A 1KD1W 2ZR2A 4F6RA 3SYAA 3SR2C 3HKCB 4MVSA 3CCJV 2HJDA 1OV9A 3CMAV 1K5SA 3CCMV 1OCRC 5H5NA 1SS3A 5CA0B 1GTOA 3OAAG 4ZKIA 4X62B 2P5OA 4UCRA 1EZVH 1JVMA 1H38A 1RPRA 2L35A 4TWKA 4JTCB 3CRAA 4I9WA 3QTCA 4MW8A 2ADPA 2R9RB 3OEEG 2HR3A 5JCOC 2LW7A 1Q5OA 3ZHSA 2WLLA 3CMEV 1AB3A 3T2MA 2UXDO 4QJFB 3RGBA 4O4HB 4LH7A 2JGUA 4LF9B 1FYJA 3AK1A 2HFEC 3AG4C 3J7AU 1MSDA 4FFBB 4MTFA 1FXKB 1GK9A 1DF4A 3HB3B 4JTDB 3AG2C 1O9GA 1JPXA 4UVCA 4TUYA 4J9YB 5LOVB 1VQ4V 3QO7A 2Y4UA 2Z5UA 2ZE6A 2NN4A 5H2FZ 1MOFA 1X59A 5LXTB 1THZA 3UT5B 1B6QA 3OEHG 4JGSA 1VF7A 5L3GA 1XUQA 3FYEB 1XNQB 2PZSA 2YIDA 2PYJA 4KXRA 2F95B 2IH3C 2ZE7A 1UPGA 4YY3B 4NKGB 2AZ2A 2HP8A 1S5HC 2EZOA 2E74B 2DYRB 4U7NA 5CB4A 4X1YB 2PI4A 4FFKA 3ZN1A 1TA8A 2WLLB 5LHHA 4WF9V 2DYRC 3A0BZ 2A3QA 1OJHA 5IE9A 2GDSA 3MHHC 3PJSK 3B40A 4J10A 1FXKC 4WFFA 2ZKOA 1ZX3A 2ODMA 1ROPA 2EIMC 3IJ4A 3Q4HB 4RQFA 1QVGU 2ZINA 3QO8A 3ZMSA 3SJBC 4I0XA 2CK3G 1Q81W 3F7YC 3HKBA 5L3FA 4LF7O 4DUYB 1ZLZA 2IBZH 2KKWA 4JV5B 4LF5B 2ZXWB 3ZRXA 1FXKA 1JQ0A 1PNLA 2WA3A 1VQOV 2IM9A 2ZIMA 2F43G 1BCCH 2EINC 1SC5B 4CC5A 3VQXA 2L6LA 2E75B 3SYQA 2QE7G 2DYSC 2OCHA 5KUMA 2F23A 4LFBO 1WNSA 4BW9A 4NR1A 1MSWD 1BSMA 2XT9A 4H44B 1I5XA 4DYLA 2NLJC 4R50A 4O2AA 1FJGB 3BCCH 4I55B 3RYCB 1KBHA 4ZOLB 4B08A 5IJ9B 1NVPB 2UUCB 4TV8A 4X1IB 4UV8A 1IXMA 3FB6C 4LF9O 5JVDB 1S5LZ 3L75H 1SKVA 2X6CA 2IJIA 2ZD9A 4O4LB 5CA1B 3J80N 3ZX6A 4PA6A 2DW4A 4QE9A 5CBFA 4MT8A 5BMVB 1GM7A 4PELA 5B3SB 4ABMA 1VQMV 1R6KA 3ZHQA 4JYAB 4JTAB 4WFEA 4ZIBA 2LGQA 5LP6C 3MAQA 1D5NA 3CRMA 2QJ1A 1WP7A 2Y0IA 1VARA 2YI9A 3NXSA 1K8AW 1Q7YW 4LFBB 1Y74B 2DMXA 1I5YA 2WPDG 2V4DA 3CP1A 4EB6A 2QEXV 1NTKH 1FJGO 1ORQC 1N32O 3QG5A 4H13B 2GTAA 3QVNA 1XNQO 1RSOB 1AILA 1MNGA 1Y74A 1YTFB 4DR7O 1FXVA 2P90A 4E2LA 5GTIZ 2YEVB 2BCCH 4O4IA 4GKJO 4TV9B 1EBOA 4B3TO 2JS3A 2FYUH 4DUYO 1A32A 2JGDA 4DR6B 2XAHA 2IJKA 5JH7B 3E35A 4X9QA 1RP3B 2CAZC 4DR5B 2VWKA 3CC2V 1L8DA 1IZ3A 2DYSB 5E1AC 1H2KA 2K9PA 2XTAA 3K58A 3ZIAG 1FFXA 1VQNV 3W7WA 3A8TA 4J11A 1YI2V 2FMLA 1NR7A 1IBMO 4XDLA 4QPJA 5HFMA 2PTMA 2QM4A 2LJ2A 1M90W 1KQSU 5DEDA 4LWSA 2Q5ZA 5LA6B 4ZI7B 2Q0AA 3SPGA 1LUVA 2QKCA 4NTXA 2Q0OC 2Q6AA 2WWWA 4DUZO 1E1QG 3G80A 1L0LH 1QBZA 1XREA 1Y76A 1AROP 4DK0A 1KUQA 2ARHA 2YC0A 1RSOA 4UCSA 4XBFA 5CBGA 2LGWA 2PF4E 2UUAB 1K5QA 2ZXWC 1FPOA 3S3WA 2Q67A 1R3LC 2ETNA 1BZKA 4U3JB 4WBNB 2YEVA 2WLIA 2BOCC 4B7KA 1WAZA 4KL1A 5IJ0B 1ZTEA 5LP6B 1I94O 3N2KA 3IAYA 1QQCA 4IYHA 3APOA 1S76D 3G6BA 3STLC 1QU7A 2EILB 1I7FA 1RPOA 3CJHA 2G38A 5KX5B 2A7WA 3ETDA 5CB4B 4JAUA 3W7SA 1XDCA 5C93A 1ZWIC 2VQFB 1NR1A 1G4YB 3SDLA 3CXHF 3ABMC 3OUFA 1YXBA 1WLEA 3DGEA 4FLYA 4O4IB 1TGOA 2HHHB 4H33A 2PY5A 4X8AA 5KHHA 3WB2A 3OGIB 1SZXA 1G6UA 1AR4A 4J7ZA 3JARB 4FM2A 2BOBC 4B3TB 2UUAO 4F6EA 5JQGA 1WPXA 1XOUA 1GKFA 1LUWA 4LC1A 1WJZA 3RYFA 4PDVA 3SGIA 2A06H 2MK3A 4JI5B 1SESA 3FFQA 1FFXB 1DLBA 3K5NA 2UXDB 1GN6A 1K7DA 4GUNA 4LF6B 4FLVA 2QWRB 4ZHQB 3LDCA 4G28B 4U7OA 2JIZG 4JF3A 4JZGA 3JSNA 5LA6A 2AGAA 5BR8B 1IBKO 4ZHQA 1VQPV 4Z1MG 1Z5WA 5EBMC 3CRCA 2XASA 2BSKA 2N74A 3L70H 3AG2B 3ETQA 3TK1A 3M8AA 1R6NA 2YS8A 4YHHB 3EVKA 1EFRG 2RCVA 4GZRB 3E83A 5JVDA 1YHQV 4PA3A 3D36C 1MA1A 3CPWU 2E5LB 4O4LA 1JX9A 2PI5A 4AQYB 3CWBH 4UB8Z 2Q7HA 1NH2D 2AHYA 5JWPA 1GRJA 5E79Z 1LR1A 1P49A 4WFHA 2WLHA 1S0VA 4MTXA 2BE3A 3ASNC 4I9QA 4EFBA 4MTGA 3H1HH 2VWJA 3W7TA 4O2AB 1Z5VA 1K3EA 3HKCA 3ETEA 2YXHA 5IJ9A 1OCCB 4KFMA 3K5OA 3HKDB 2F4VO 3ZMZA 3FX7A 3D3QA 5EZYB 5A9GA 2B1IA 1Y6XA 1ZL8A 2N05A 1JOYA 2B1GA 4MVZA 2F93B 4WFGA 4TUYB 5BMVA 5L3CA 1NI8A 3VQWA 1EZJA 1AR1B 1R3KC 2DWEC 1N36O 1NT2B 4JYBA 1F7YA 3T1YB 2YXYA 4J41A 3CD6V 3RT3C 2LW1A 4LP8A 5LBQA 3W7XA 4X20A 1N33O 5CBHA 1WB7A 4JI8B 2LQTA 4DW1A 3AG7A 1AI4A 2JEXA 2QTOA 3AG1C 1L0NH 1IBKB 2UUBB 1F4MA 1M56B 2CTPA 3IFXA 3CX5F 1HNXO 4JI6B 5IWAO 1M5IA 4MVQA 1XMOB 1AJQA 4UCOA 1Q82W 4U3FH 3JALA 3ZHUA 2OCCB 4FM0A 2WSSG 3A0HZ 1SF9A 1W2BU 3EFFK 5KHIA 3WG7C 4FFBA 1MZFA 3UO2A 2OYQA 3I5DA 2CUGA 1FKAO 3ZHRA 5KHKA 1FFTB 1EN5A 3F7VC 4NXNB 1VP7A 3RBZA 4JI1B 3JATA 5KA5A 3L9DA 5TISZ 2LO1A 4I50A 4JI7O 1GN3A 4I5SA 4PJ0Z 2ZQMA 2ZDIA 3F5TA 5JJNB 3U11A 4D6TH 4EKWA 1XILA 4UVAA 1HNZB 1QCEA 1Q6IA 2QWQB 2EINB 3JD0A 3E86A 1PP9H 2UUCO 2C2AA 4I4TA 1PD3A 2EIJB 1HR0O 3JYCA 1KU9A 1XEQA 2LP7A 2Q7EA 5IY5C 2FL4A 4DV7B 1NTZH 2OIGA 3CRRA 3E89A 4TV8B 1OCCC 3UO3A 4TOIA 1TUBB 1LNQA 1MZEA 2P6JA 1WA8A 3BVOA 3MHSC 5FPOA 1XHXA 3CC4V 2P4VA 1XMOO 5FL7G 1KC8W 4FLUA 1R3JC 1HWYA 2FB5A 2XHBA 5EYPA 1IBLO 3PN1A 4YJ3A 1SRYA 4BWAA 1M1KW 5GONB 2H3OA 2Y48A 2XAFA 1F51A 4I50B 3JAWA 5L3DA 3VQYA 1DTOA 5IYZB 4X62O 2UXBO 1VQ6V 1BHBA 1RFYA 1BE3H 3ZMVA 1HNZO 3HPLC 3LSUA 4OPHA 4DV0O 3K59A 1XNRO 2JGDB 1IVSA 4RWUA 2GUZB 4IT5A 2V1DA 1U97A 2DN9A 2W6IG 3ABLC 5CA3A 3B8MA 3OTFA 2Y69C 2YIBD 1N36B 4JI2B 1M57C 4BIZA 4DR1O 3JD3A 1PNKA 2D3OW 1SQPH 3WFVA 1SA0A 2QSAA 2KSDA 3FAVB 3L72H 3CCSV 5IYDO 1B04A 4PHZA 2ADQB 3CCRV 4OPAA 2Q7GA 4D7SA 4MVOA 1L1FA 2FTKA 3SJQC 5JCOA 3JAKA 1QLEB 2WLIB 4B3MO 1SQFA 2H8PC 3ZCCA 1SQGA 5IJ0A 4LNUB 1Q6HA 1S3JA 3OGCC 2N04A 3DXRA 4NVPA 2YSUB 4I7ZB 4CZZA 4UCVA 3TXSA 4DV0B 3ZRWB 4DV3B 2JRIA 5D5QA 1FS0G 2B9ZA 4GT1A 2Q4PA 1YTFD 3VOUA 3JAWB 2FKXA 4JYCA 2CE4A 2JK5C 2IU0A 2EIKC 2DE0X 3BHPA 4DV4B 3OE7G 2KG7A 3ML0A 5HFLA 5JJJB 4IIJB 2GHYA 2JS5A 2Y0PA 3WB1A 2AHZA 5LHGA 3IC7A 5DN6G 4ZBMA 2K1EA 5J2UA 4X1KA 4JI5O 1SA0B 2YI8A 2A79B 4JI3B 3HR0A 3BEHA 2HHHO 4JI0O 5LMUB 2XAGA 1QVFU 1M93A 3UKMA 2P67A 4KP4A 1P84F 4AQYO 1E1RG 2UXBB 3LNMB 1K92A 3RYIA 4FM1A 1DK1A 3CJHB 3ZMTA 3K03A 3CE2A 2QWOB 1TVKB 1XHZA 4DR4B 4LF6O 5H6QA 4EFEA 2QDOA 4PI0A 2RMKB 4PDLA 2RN9A 4UV9A 2P22C 4UVBA 2WAMA 1AI5A 2IW5A 5B1BC 1MMMA 2ZNJA 2GSMB 3K5LA 2CDYA 4QE7A 2JJ1G 1XNRB 1NS1A 3W7UA 1Y76B 1H8HG 4B3SB 3AG4B 3P3PA 4X66O 2X0LA 4WFAV 4B7EA 1HW7A 2XNDG 1HNWO 3B4SA 3DSQA 1GN4A 5H9CA 1Y4MA 4MS2A 4BAYA 4GX0A 3J81N 1G8MA 1HDJA 2ZE8A 1AP5A 3ZEDA 2EJRA 1BS3A 1GM8A 4BR6A 2ZDIC 3G71V 2Q68A 4J42A 4MVUA 4PV1B 3K57A 4A5UB 4R8CA 4FMTA 1YJNV 4O4HA 5LXTA 4MW3A 4JYAO 3B77A 1NJIW 4ZOLA
chains in the Genus database with same CATH topology
3L70H 4PD4F 1SQPH 1BE3H 1L0NH 1KYOF 3L72H 2FYUH 3H1HH 3H1KH 1SQVH 1BGYH 3CXHF 3TGUH 2IBZH 3H1LH 1NTKH 5KLVH 1L0LH 3L71H 1KB9F 3H1JH 1NTZH 3CX5F 1NTMH 1SQQH 2A06H 3L75H 4D6TH 1SQBH 3CWBH 1EZVH 3L73H 3H1IH 4U3FH 1NU1H 1P84F 1BCCH 1PPJH 3L74H 3BCCH 2BCCH 1SQXH 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  4PD4 F;  1SQP H;  1BE3 H;  1L0N H;  1KYO F;  3L72 H;  2FYU H;  3H1H H;  3H1K H;  1SQV H;  1BGY H;  3CXH F;  3TGU H;  2IBZ H;  3H1L H;  1NTK H;  5KLV H;  1L0L H;  3L71 H;  1KB9 F;  3H1J H;  1NTZ H;  3CX5 F;  1NTM H;  1SQQ H;  2A06 H;  3L75 H;  4D6T H;  1SQB H;  3CWB H;  1EZV H;  3L73 H;  3H1I H;  4U3F H;  1NU1 H;  1P84 F;  1BCC H;  1PPJ H;  3L74 H;  3BCC H;  2BCC H;  1SQX H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 1YZB A;  4G2K A;  1KMI Z;  2QTS A;  1VQK V;  4J80 A;  3ASO B;  1OCR B;  4GKJ B;  2VRZ A;  1IXB A;  1V54 B;  1TAE A;  3LSS A;  1JFF A;  1N34 O;  3HKE B;  4N21 A;  3OW2 U;  1E79 G;  2EBO A;  1BHA A;  4LF4 O;  1Y67 A;  3SJC C;  4GKK B;  2UXN A;  1HNW B;  4JAA A;  1N0N A;  2DOS A;  2DQ0 A;  4P9P A;  5EIB D;  2CH7 A;  4DV2 O;  1WB8 A;  3NR7 A;  1BL8 A;  1VQ8 V;  4LF8 B;  4P9O A;  4QPK A;  3OR6 C;  4F6R B;  2O57 A;  2M6Y A;  1VMG A;  3CCQ V;  2XOK G;  3Q4H A;  2DWD C;  3O9O A;  3FB5 C;  3RW0 A;  1IDS A;  4LBE C;  4HNA B;  2ZR3 A;  2Z0A A;  3A0R A;  3ZS8 C;  3OMA B;  5C8Y B;  2E76 B;  4YIO A;  4GX1 A;  1QHT A;  4PD4 F;  3FD9 A;  2QM8 A;  4QNH B;  4HNA A;  3ASO C;  1YVW A;  3CC7 V;  1AVM A;  3DTU B;  1ZL8 B;  3ZN0 A;  1AI7 A;  5GW7 A;  1HR0 B;  1R1B A;  1VF6 C;  2CH7 B;  4RO2 A;  4DUZ B;  1P7G A;  4FLX A;  1XL4 A;  3L74 H;  4DV7 O;  1IBL B;  4DR2 O;  5J9P C;  4K8X A;  3CCE V;  5FLX N;  2DQ3 A;  3DXR B;  5J2T A;  2Q73 A;  2CTQ A;  4BW5 A;  2UXC B;  1RM1 B;  1N34 B;  3ABL B;  3UT5 A;  3FAV A;  2H94 A;  3EXA A;  1B06 A;  4UB6 Z;  4HAM A;  5GTH Z;  4L8J A;  2HKO A;  4QIW F;  5EC2 C;  4X66 B;  4DV1 B;  4CH4 A;  3CCL V;  1FD9 A;  2VS0 A;  4BIO A;  4J9Z B;  4I0X B;  5D5P A;  5FPR A;  3STZ C;  3JAM N;  1SQV H;  5IY5 B;  4DV2 B;  2OCC C;  3K9A A;  3B2E E;  3KZI Z;  4GX2 A;  4GLX A;  4FLT A;  4JYY A;  4JAS A;  3OMN B;  3O65 A;  5LHI A;  1CPY A;  3M99 B;  2ITD C;  3H01 A;  1J5E B;  4KHP O;  5EBL C;  4TQD A;  3C3S A;  3KG2 A;  2GUZ A;  2JDI G;  4WFB V;  1H2L A;  3JAS B;  1HP8 A;  4O2B B;  1R73 A;  2XAQ A;  3JCU Z;  3JD2 A;  4K3A A;  5K1P A;  2R9I A;  3CRQ A;  3JAT B;  2CGO A;  3U0Z A;  1Q43 A;  3K0G A;  2IU3 A;  5A2Q N;  4DR5 O;  4YJ2 B;  3OM3 B;  2W0X A;  3WG7 B;  3ZMU A;  3OMI B;  4NYK A;  2M7W A;  4IYI A;  4IL6 Z;  5CN0 A;  5J2T B;  4ASU G;  4XDJ A;  1H2M A;  3H1J H;  3LDE A;  4TV9 A;  3TET A;  4DK1 A;  3AG3 C;  2ITC C;  1JCH A;  4AIL C;  1NU1 H;  2HG5 C;  4FJC C;  3OD4 A;  1IUR A;  3FB8 C;  1COW G;  2UXC O;  3T1C A;  1NBM G;  4NB5 A;  2YIA A;  4WCE V;  3OFN G;  5BZB A;  2QKS A;  4B3R B;  2QWP B;  4ZI7 A;  3RVY A;  4JI6 O;  1GMG A;  2AXT Z;  5LMN B;  3H1I H;  3ABU A;  4OX9 B;  2BTQ B;  1XQ8 A;  4OGQ B;  2DJV A;  3BAB A;  3K06 A;  5EYP B;  4DV4 O;  4JZ2 A;  2R9A A;  4OXS A;  3E8F A;  4CC6 A;  1S5J A;  1YF2 A;  1IX9 A;  1N32 B;  3P32 A;  4UUJ C;  2ZM6 B;  3M7M X;  3FKS G;  5B1A C;  3OUS A;  2XAJ A;  3SPJ A;  3ASN B;  2AW9 A;  2NNU A;  4X65 O;  1QR8 A;  5J2U B;  1OCZ B;  4HBN A;  1JMK C;  3RYH B;  4YY3 O;  4K0K B;  2JVD A;  3UQ8 A;  4NTW A;  2OWO A;  1IBM B;  3CCU V;  3K5M A;  1YEW A;  1BQ0 A;  1JFF B;  1V55 C;  2B5U A;  3ABK B;  1K4C C;  3JD1 A;  1SZT A;  3BRC A;  4J7J A;  3MD0 A;  4DR7 B;  1CEZ A;  1H8E G;  2HVK C;  4DR4 O;  3ZHV A;  1YIT V;  2OT5 A;  3E22 B;  1H2S B;  2ZE5 A;  3ZRW A;  1OZ0 A;  4CH5 A;  2CTW A;  5FNV A;  1SQQ H;  3FYI B;  3I55 V;  1RM1 C;  1M56 C;  4LWS B;  2HEP A;  3GVM A;  3QNE A;  1AI6 A;  3FB7 C;  3OTO B;  4DXW A;  4B3S O;  2EIK B;  2YUA A;  2Y4T A;  1BMF G;  4FLW A;  1TVK A;  4Z1V A;  4DV6 B;  3BY6 A;  4MVM A;  1SER A;  1S72 V;  3QF7 A;  3R66 A;  4NXM O;  4PI2 A;  3G67 A;  4X20 B;  4O4J B;  1MG1 A;  5B1N A;  4FVM A;  2QA4 V;  5KHG A;  5B1B B;  5LP6 A;  1XMQ O;  3LNN A;  3BFR A;  4PA7 A;  3CXC U;  1K4D C;  5H6R A;  4CS3 A;  4FZ0 A;  2JEU A;  3GB7 C;  5BXZ A;  3IC9 A;  2E3C A;  3ABK C;  1U96 A;  4X88 A;  4DRX A;  4JI2 O;  4Z2W A;  4JAV A;  3GWO A;  1CXZ B;  4PDM A;  5LYJ A;  1V9P A;  2EZP A;  4HZ3 A;  5B3S C;  1N4C A;  3SPC A;  4W4L A;  1W0J G;  4JV5 O;  2ZCE A;  1NKD A;  3SPI A;  4DV5 O;  3JCZ A;  4DRX B;  2D2C B;  4DR3 O;  3T1H B;  2ZT9 B;  3I56 V;  3AG3 B;  1J95 A;  4P30 A;  5KMG B;  4GKK O;  5LOV A;  1M57 B;  3AK3 A;  1WP8 A;  4X65 B;  2P4K A;  1PNM A;  1XL6 A;  5F2V O;  1W59 A;  4G27 B;  4RQE A;  4YXW G;  5CMU A;  3ABM B;  4LF5 O;  3ZRV A;  4LFA B;  2VQF O;  3D3I A;  3P3N A;  4DW0 A;  2Q69 A;  2BTO A;  1OCO C;  5B66 Z;  3TXQ A;  4FK5 C;  2A9H A;  4X1Y A;  4GYC B;  4F4L A;  5FNV B;  4ICG A;  1N0J A;  5LYJ B;  2P7T C;  5EZY A;  1QLE C;  4CBC A;  1AR5 A;  3RN4 A;  1KB9 F;  3X2Q B;  5EBW C;  2W0F C;  1N33 B;  1Z2G A;  4D7T A;  4LF8 O;  2IH1 C;  4LFC O;  1DGS A;  5BR8 O;  1I08 A;  4W4K A;  2LFS A;  1D2D A;  2GBO A;  3VBB A;  1URF A;  1FXH A;  2F66 C;  4JI4 B;  1K73 W;  3F5W C;  1D5A A;  1GH6 A;  3H1K H;  2HLD G;  2QR4 A;  3E2E A;  5CA0 A;  2RQ6 A;  1CP9 A;  3SYO A;  3T4Z A;  4CS4 A;  2Y69 B;  4CH6 A;  1O9H A;  1NTM H;  1V54 C;  2UXX A;  3LDD A;  4IGG A;  2F4V B;  5LL6 Y;  2E5L O;  3KKY A;  4MSW C;  4PA4 A;  1VIB A;  2A0L A;  1SQX H;  5C8Y A;  5IYZ A;  4NXN O;  4FPP A;  3U10 A;  1JJO A;  2EX3 A;  4JPR A;  5KA6 A;  3KCX A;  2BSK B;  2R70 A;  4AHC A;  1YJ9 V;  5LGN A;  1YIJ V;  1F23 A;  1FAF A;  4DV1 O;  4MTO A;  1KP3 A;  2WA4 A;  3HKD A;  3K04 A;  5LMU O;  4JI0 B;  1NQT A;  3WU2 Z;  3T1Y O;  1G1X B;  1PV0 A;  4DR2 B;  3JD4 A;  3A2F A;  3SYP A;  2OTL V;  2F1M A;  1H2G A;  1KP2 A;  4X1I A;  3K9S A;  5BY1 A;  4JI1 O;  1VQ7 V;  2KQX A;  5KHJ A;  3N2G A;  2RNB A;  4KUM A;  4H37 A;  1M4U A;  1OHH G;  2YDE A;  3TJT A;  5IWA B;  4Q20 A;  4JI4 O;  5KAF Z;  3CB2 A;  1J5E O;  4KHP B;  2Q8V A;  3HKB B;  2HVJ C;  1Q8I A;  4JI3 O;  1ZUQ A;  3OT7 A;  1K97 A;  2YIB A;  3HKE A;  3DC6 A;  2EIJ C;  1WN7 A;  2JJ2 G;  3CEI A;  2RJZ A;  5CA1 A;  5ITZ A;  1K34 A;  5KLV H;  1GN2 A;  3K08 A;  3R65 A;  4DR3 B;  1WA8 B;  2UUB O;  5K1X A;  3B8N A;  4P2Z A;  4XDK A;  4FLZ A;  3JAL B;  4PA9 A;  2MW2 B;  1HNX B;  2IJJ A;  3B09 A;  1I94 B;  1BT8 A;  5ITZ B;  1K9M W;  4Q6G A;  2VQE B;  4IHJ A;  3CHX A;  4YJ2 A;  3UCS C;  3G6E V;  3E22 A;  4UCU A;  2W6J G;  2QGN A;  1TUB A;  2OIE A;  4LCU C;  2EIM B;  5LGU A;  1I0H A;  4UFZ A;  4O2B A;  1WPB A;  3SJA C;  2Q9L A;  2UU9 B;  4TT3 G;  1NZ6 A;  1ZAU A;  4DO2 A;  2KB1 A;  5DEC A;  1H2N A;  2GTS A;  3CSX A;  3E8G A;  1OCZ C;  4R6Z A;  1YSC A;  1BQZ A;  4B3R O;  1QLN A;  2EUL A;  1YDX A;  1W0K G;  4JI7 B;  1VQ5 V;  3RWR D;  3LUT B;  1T5E A;  5JJE B;  2EIL C;  3L73 H;  4LF7 B;  2LFR A;  5GON A;  2WLK A;  4LFC B;  4TSF G;  4H0L B;  1VF6 A;  1GO3 F;  3ABT A;  3MDS A;  4E4E A;  4BIU A;  2Z3Y A;  1R6T A;  1K33 A;  2ZIO A;  3ZHT A;  3JAK B;  3ICX A;  3N27 A;  1V55 B;  2XUM A;  4EEQ A;  1X4T A;  1PL4 A;  2PYL A;  1NVP D;  3ZBH A;  4J7K A;  1VQ9 V;  3DC5 A;  5B5E Z;  3JSL A;  1XI1 A;  4K35 A;  3RFR A;  1Q6U A;  2ZNI A;  2QM7 A;  1YJW V;  3E8B A;  1NH2 B;  2HJF C;  1MAB G;  4I55 A;  4L87 A;  3JAS A;  2EJ7 A;  3RYH A;  3SYC A;  1N8R W;  1BGY H;  1ZSP A;  3KCY A;  3P30 A;  2YIC A;  1VF5 B;  4I4T B;  4FIP C;  5LGT A;  2WLN A;  2ZM6 O;  1AJP A;  4GX5 A;  2GV9 A;  1Q86 W;  4HYO A;  4X64 O;  2NR5 A;  3CYO A;  4K0K O;  4DR1 B;  1M9N A;  1GAX A;  5B1O A;  3CS5 A;  2YXL A;  3RVZ A;  1P7B A;  1Q3E A;  3L71 H;  1OCO B;  1XMQ B;  4RAI A;  4IHJ B;  3AK2 A;  2RDC A;  3AEI A;  1PPJ H;  4B3M B;  2KG7 B;  3EHB B;  3BA8 A;  5IT9 N;  4R7C A;  4FZ1 A;  1AP6 A;  3TGU H;  4CH3 A;  3C90 A;  3VQV A;  3AG1 B;  2OTJ V;  4YIP A;  1XBL A;  1DF5 A;  5B1A B;  1ENV A;  3SPH A;  1TUE B;  3K3W A;  4X89 A;  1KKC A;  2ATK C;  2X6B A;  3OTO O;  1JR9 A;  1QNM A;  1F4N A;  3TCU A;  4GCZ A;  1QR9 A;  5EIB C;  3ZJZ A;  2VQE O;  4YHH O;  4X1K B;  4DV6 O;  2AZ0 A;  2QKA A;  4U3J A;  3RYF B;  3D8C A;  4UXN A;  1SQB H;  3N2K B;  2IJH A;  3UM7 A;  1AJN A;  5DM6 V;  5JQG B;  1Q90 D;  1US6 A;  3BPZ A;  1Y66 A;  2BTQ A;  2X7R B;  4LR3 A;  5IDJ A;  1PKX A;  2UU9 O;  3RYC A;  3T1H O;  1SET A;  4QGP A;  3GWK C;  3RYI B;  2CGN A;  4K8Z A;  1KYO F;  1S77 D;  4TQF A;  3X2Q C;  3T4D A;  1UJW B;  2CTR A;  4LNU A;  3D36 A;  5IYB O;  1UFI A;  4C7U A;  3BA9 A;  5IYC O;  1JJ2 U;  4NXM B;  1P4R A;  3IGA C;  4CS2 A;  2X6A A;  2PUS A;  4LH6 A;  4JI8 O;  4DR6 O;  4DV5 B;  2WLM A;  1EM1 A;  5KAI Z;  3K0D A;  3APQ A;  4DV3 O;  3N2G B;  3BAA A;  1KKD A;  1EN6 A;  3C3T A;  4NTY A;  1PL0 A;  3LSQ A;  1EN4 A;  3JAR A;  4MVR A;  4RUF A;  3WB0 A;  3E8H A;  5LMN O;  1VEW A;  1VQL V;  3G4S V;  2ILM A;  4OX9 O;  4YJ3 B;  3H9V A;  3ZRS A;  3THO A;  4X64 B;  5JH7 A;  2WLJ A;  4WBN A;  1PM9 A;  5EC1 C;  3OR7 C;  3QO5 A;  4IIJ A;  4RUE A;  5AG2 A;  1GM9 A;  5L3B A;  4LFA O;  4EB6 B;  2PGG A;  2V7Q G;  3H1L H;  3ETG A;  1JA8 A;  4O4J A;  4PDR A;  1R3I C;  4LF4 B;  4AI8 A;  5KX5 A;  3S3X A;  1KEC A;  5KUK A;  2P06 A;  2QWN B;  4N23 A;  1YCI A;  5EK0 A;  5L3E A;  1B3Q A;  5KMG A;  4UCT A;  3K79 A;  3CCV V;  2R72 A;  1KD1 W;  2ZR2 A;  4F6R A;  3SYA A;  3SR2 C;  3HKC B;  4MVS A;  3CCJ V;  2HJD A;  1OV9 A;  3CMA V;  1K5S A;  3CCM V;  1OCR C;  5H5N A;  1SS3 A;  5CA0 B;  1GTO A;  3OAA G;  4ZKI A;  4X62 B;  2P5O A;  4UCR A;  1EZV H;  1JVM A;  1H38 A;  1RPR A;  2L35 A;  4TWK A;  4JTC B;  3CRA A;  4I9W A;  3QTC A;  4MW8 A;  2ADP A;  2R9R B;  3OEE G;  2HR3 A;  5JCO C;  2LW7 A;  1Q5O A;  3ZHS A;  2WLL A;  3CME V;  1AB3 A;  3T2M A;  2UXD O;  4QJF B;  3RGB A;  4O4H B;  4LH7 A;  2JGU A;  4LF9 B;  1FYJ A;  3AK1 A;  2HFE C;  3AG4 C;  3J7A U;  1MSD A;  4FFB B;  4MTF A;  1FXK B;  1GK9 A;  1DF4 A;  3HB3 B;  4JTD B;  3AG2 C;  1O9G A;  1JPX A;  4UVC A;  4TUY A;  4J9Y B;  5LOV B;  1VQ4 V;  3QO7 A;  2Y4U A;  2Z5U A;  2ZE6 A;  2NN4 A;  5H2F Z;  1MOF A;  1X59 A;  5LXT B;  1THZ A;  3UT5 B;  1B6Q A;  3OEH G;  4JGS A;  1VF7 A;  5L3G A;  1XUQ A;  3FYE B;  1XNQ B;  2PZS A;  2YID A;  2PYJ A;  4KXR A;  2F95 B;  2IH3 C;  2ZE7 A;  1UPG A;  4YY3 B;  4NKG B;  2AZ2 A;  2HP8 A;  1S5H C;  2EZO A;  2E74 B;  2DYR B;  4U7N A;  5CB4 A;  4X1Y B;  2PI4 A;  4FFK A;  3ZN1 A;  1TA8 A;  2WLL B;  5LHH A;  4WF9 V;  2DYR C;  3A0B Z;  2A3Q A;  1OJH A;  5IE9 A;  2GDS A;  3MHH C;  3PJS K;  3B40 A;  4J10 A;  1FXK C;  4WFF A;  2ZKO A;  1ZX3 A;  2ODM A;  1ROP A;  2EIM C;  3IJ4 A;  3Q4H B;  4RQF A;  1QVG U;  2ZIN A;  3QO8 A;  3ZMS A;  3SJB C;  4I0X A;  2CK3 G;  1Q81 W;  3F7Y C;  3HKB A;  5L3F A;  4LF7 O;  4DUY B;  1ZLZ A;  2IBZ H;  2KKW A;  4JV5 B;  4LF5 B;  2ZXW B;  3ZRX A;  1FXK A;  1JQ0 A;  1PNL A;  2WA3 A;  1VQO V;  2IM9 A;  2ZIM A;  2F43 G;  1BCC H;  2EIN C;  1SC5 B;  4CC5 A;  3VQX A;  2L6L A;  2E75 B;  3SYQ A;  2QE7 G;  2DYS C;  2OCH A;  5KUM A;  2F23 A;  4LFB O;  1WNS A;  4BW9 A;  4NR1 A;  1MSW D;  1BSM A;  2XT9 A;  4H44 B;  1I5X A;  4DYL A;  2NLJ C;  4R50 A;  4O2A A;  1FJG B;  3BCC H;  4I55 B;  3RYC B;  1KBH A;  4ZOL B;  4B08 A;  5IJ9 B;  1NVP B;  2UUC B;  4TV8 A;  4X1I B;  4UV8 A;  1IXM A;  3FB6 C;  4LF9 O;  5JVD B;  1S5L Z;  3L75 H;  1SKV A;  2X6C A;  2IJI A;  2ZD9 A;  4O4L B;  5CA1 B;  3J80 N;  3ZX6 A;  4PA6 A;  2DW4 A;  4QE9 A;  5CBF A;  4MT8 A;  5BMV B;  1GM7 A;  4PEL A;  5B3S B;  4ABM A;  1VQM V;  1R6K A;  3ZHQ A;  4JYA B;  4JTA B;  4WFE A;  4ZIB A;  2LGQ A;  5LP6 C;  3MAQ A;  1D5N A;  3CRM A;  2QJ1 A;  1WP7 A;  2Y0I A;  1VAR A;  2YI9 A;  3NXS A;  1K8A W;  1Q7Y W;  4LFB B;  1Y74 B;  2DMX A;  1I5Y A;  2WPD G;  2V4D A;  3CP1 A;  4EB6 A;  2QEX V;  1NTK H;  1FJG O;  1ORQ C;  1N32 O;  3QG5 A;  4H13 B;  2GTA A;  3QVN A;  1XNQ O;  1RSO B;  1AIL A;  1MNG A;  1Y74 A;  1YTF B;  4DR7 O;  1FXV A;  2P90 A;  4E2L A;  5GTI Z;  2YEV B;  2BCC H;  4O4I A;  4GKJ O;  4TV9 B;  1EBO A;  4B3T O;  2JS3 A;  2FYU H;  4DUY O;  1A32 A;  2JGD A;  4DR6 B;  2XAH A;  2IJK A;  5JH7 B;  3E35 A;  4X9Q A;  1RP3 B;  2CAZ C;  4DR5 B;  2VWK A;  3CC2 V;  1L8D A;  1IZ3 A;  2DYS B;  5E1A C;  1H2K A;  2K9P A;  2XTA A;  3K58 A;  3ZIA G;  1FFX A;  1VQN V;  3W7W A;  3A8T A;  4J11 A;  1YI2 V;  2FML A;  1NR7 A;  1IBM O;  4XDL A;  4QPJ A;  5HFM A;  2PTM A;  2QM4 A;  2LJ2 A;  1M90 W;  1KQS U;  5DED A;  4LWS A;  2Q5Z A;  5LA6 B;  4ZI7 B;  2Q0A A;  3SPG A;  1LUV A;  2QKC A;  4NTX A;  2Q0O C;  2Q6A A;  2WWW A;  4DUZ O;  1E1Q G;  3G80 A;  1L0L H;  1QBZ A;  1XRE A;  1Y76 A;  1ARO P;  4DK0 A;  1KUQ A;  2ARH A;  2YC0 A;  1RSO A;  4UCS A;  4XBF A;  5CBG A;  2LGW A;  2PF4 E;  2UUA B;  1K5Q A;  2ZXW C;  1FPO A;  3S3W A;  2Q67 A;  1R3L C;  2ETN A;  1BZK A;  4U3J B;  4WBN B;  2YEV A;  2WLI A;  2BOC C;  4B7K A;  1WAZ A;  4KL1 A;  5IJ0 B;  1ZTE A;  5LP6 B;  1I94 O;  3N2K A;  3IAY A;  1QQC A;  4IYH A;  3APO A;  1S76 D;  3G6B A;  3STL C;  1QU7 A;  2EIL B;  1I7F A;  1RPO A;  3CJH A;  2G38 A;  5KX5 B;  2A7W A;  3ETD A;  5CB4 B;  4JAU A;  3W7S A;  1XDC A;  5C93 A;  1ZWI C;  2VQF B;  1NR1 A;  1G4Y B;  3SDL A;  3CXH F;  3ABM C;  3OUF A;  1YXB A;  1WLE A;  3DGE A;  4FLY A;  4O4I B;  1TGO A;  2HHH B;  4H33 A;  2PY5 A;  4X8A A;  5KHH A;  3WB2 A;  3OGI B;  1SZX A;  1G6U A;  1AR4 A;  4J7Z A;  3JAR B;  4FM2 A;  2BOB C;  4B3T B;  2UUA O;  4F6E A;  5JQG A;  1WPX A;  1XOU A;  1GKF A;  1LUW A;  4LC1 A;  1WJZ A;  3RYF A;  4PDV A;  3SGI A;  2A06 H;  2MK3 A;  4JI5 B;  1SES A;  3FFQ A;  1FFX B;  1DLB A;  3K5N A;  2UXD B;  1GN6 A;  1K7D A;  4GUN A;  4LF6 B;  4FLV A;  2QWR B;  4ZHQ B;  3LDC A;  4G28 B;  4U7O A;  2JIZ G;  4JF3 A;  4JZG A;  3JSN A;  5LA6 A;  2AGA A;  5BR8 B;  1IBK O;  4ZHQ A;  1VQP V;  4Z1M G;  1Z5W A;  5EBM C;  3CRC A;  2XAS A;  2BSK A;  2N74 A;  3L70 H;  3AG2 B;  3ETQ A;  3TK1 A;  3M8A A;  1R6N A;  2YS8 A;  4YHH B;  3EVK A;  1EFR G;  2RCV A;  4GZR B;  3E83 A;  5JVD A;  1YHQ V;  4PA3 A;  3D36 C;  1MA1 A;  3CPW U;  2E5L B;  4O4L A;  1JX9 A;  2PI5 A;  4AQY B;  3CWB H;  4UB8 Z;  2Q7H A;  1NH2 D;  2AHY A;  5JWP A;  1GRJ A;  5E79 Z;  1LR1 A;  1P49 A;  4WFH A;  2WLH A;  1S0V A;  4MTX A;  2BE3 A;  3ASN C;  4I9Q A;  4EFB A;  4MTG A;  3H1H H;  2VWJ A;  3W7T A;  4O2A B;  1Z5V A;  1K3E A;  3HKC A;  3ETE A;  2YXH A;  5IJ9 A;  1OCC B;  4KFM A;  3K5O A;  3HKD B;  2F4V O;  3ZMZ A;  3FX7 A;  3D3Q A;  5EZY B;  5A9G A;  2B1I A;  1Y6X A;  1ZL8 A;  2N05 A;  1JOY A;  2B1G A;  4MVZ A;  2F93 B;  4WFG A;  4TUY B;  5BMV A;  5L3C A;  1NI8 A;  3VQW A;  1EZJ A;  1AR1 B;  1R3K C;  2DWE C;  1N36 O;  1NT2 B;  4JYB A;  1F7Y A;  3T1Y B;  2YXY A;  4J41 A;  3CD6 V;  3RT3 C;  2LW1 A;  4LP8 A;  5LBQ A;  3W7X A;  4X20 A;  1N33 O;  5CBH A;  1WB7 A;  4JI8 B;  2LQT A;  4DW1 A;  3AG7 A;  1AI4 A;  2JEX A;  2QTO A;  3AG1 C;  1L0N H;  1IBK B;  2UUB B;  1F4M A;  1M56 B;  2CTP A;  3IFX A;  3CX5 F;  1HNX O;  4JI6 B;  5IWA O;  1M5I A;  4MVQ A;  1XMO B;  1AJQ A;  4UCO A;  1Q82 W;  4U3F H;  3JAL A;  3ZHU A;  2OCC B;  4FM0 A;  2WSS G;  3A0H Z;  1SF9 A;  1W2B U;  3EFF K;  5KHI A;  3WG7 C;  4FFB A;  1MZF A;  3UO2 A;  2OYQ A;  3I5D A;  2CUG A;  1FKA O;  3ZHR A;  5KHK A;  1FFT B;  1EN5 A;  3F7V C;  4NXN B;  1VP7 A;  3RBZ A;  4JI1 B;  3JAT A;  5KA5 A;  3L9D A;  5TIS Z;  2LO1 A;  4I50 A;  4JI7 O;  1GN3 A;  4I5S A;  4PJ0 Z;  2ZQM A;  2ZDI A;  3F5T A;  5JJN B;  3U11 A;  4D6T H;  4EKW A;  1XIL A;  4UVA A;  1HNZ B;  1QCE A;  1Q6I A;  2QWQ B;  2EIN B;  3JD0 A;  3E86 A;  1PP9 H;  2UUC O;  2C2A A;  4I4T A;  1PD3 A;  2EIJ B;  1HR0 O;  3JYC A;  1KU9 A;  1XEQ A;  2LP7 A;  2Q7E A;  5IY5 C;  2FL4 A;  4DV7 B;  1NTZ H;  2OIG A;  3CRR A;  3E89 A;  4TV8 B;  1OCC C;  3UO3 A;  4TOI A;  1TUB B;  1LNQ A;  1MZE A;  2P6J A;  1WA8 A;  3BVO A;  3MHS C;  5FPO A;  1XHX A;  3CC4 V;  2P4V A;  1XMO O;  5FL7 G;  1KC8 W;  4FLU A;  1R3J C;  1HWY A;  2FB5 A;  2XHB A;  5EYP A;  1IBL O;  3PN1 A;  4YJ3 A;  1SRY A;  4BWA A;  1M1K W;  5GON B;  2H3O A;  2Y48 A;  2XAF A;  1F51 A;  4I50 B;  3JAW A;  5L3D A;  3VQY A;  1DTO A;  5IYZ B;  4X62 O;  2UXB O;  1VQ6 V;  1BHB A;  1RFY A;  1BE3 H;  3ZMV A;  1HNZ O;  3HPL C;  3LSU A;  4OPH A;  4DV0 O;  3K59 A;  1XNR O;  2JGD B;  1IVS A;  4RWU A;  2GUZ B;  4IT5 A;  2V1D A;  1U97 A;  2DN9 A;  2W6I G;  3ABL C;  5CA3 A;  3B8M A;  3OTF A;  2Y69 C;  2YIB D;  1N36 B;  4JI2 B;  1M57 C;  4BIZ A;  4DR1 O;  3JD3 A;  1PNK A;  2D3O W;  1SQP H;  3WFV A;  1SA0 A;  2QSA A;  2KSD A;  3FAV B;  3L72 H;  3CCS V;  5IYD O;  1B04 A;  4PHZ A;  2ADQ B;  3CCR V;  4OPA A;  2Q7G A;  4D7S A;  4MVO A;  1L1F A;  2FTK A;  3SJQ C;  5JCO A;  3JAK A;  1QLE B;  2WLI B;  4B3M O;  1SQF A;  2H8P C;  3ZCC A;  1SQG A;  5IJ0 A;  4LNU B;  1Q6H A;  1S3J A;  3OGC C;  2N04 A;  3DXR A;  4NVP A;  2YSU B;  4I7Z B;  4CZZ A;  4UCV A;  3TXS A;  4DV0 B;  3ZRW B;  4DV3 B;  2JRI A;  5D5Q A;  1FS0 G;  2B9Z A;  4GT1 A;  2Q4P A;  1YTF D;  3VOU A;  3JAW B;  2FKX A;  4JYC A;  2CE4 A;  2JK5 C;  2IU0 A;  2EIK C;  2DE0 X;  3BHP A;  4DV4 B;  3OE7 G;  2KG7 A;  3ML0 A;  5HFL A;  5JJJ B;  4IIJ B;  2GHY A;  2JS5 A;  2Y0P A;  3WB1 A;  2AHZ A;  5LHG A;  3IC7 A;  5DN6 G;  4ZBM A;  2K1E A;  5J2U A;  4X1K A;  4JI5 O;  1SA0 B;  2YI8 A;  2A79 B;  4JI3 B;  3HR0 A;  3BEH A;  2HHH O;  4JI0 O;  5LMU B;  2XAG A;  1QVF U;  1M93 A;  3UKM A;  2P67 A;  4KP4 A;  1P84 F;  4AQY O;  1E1R G;  2UXB B;  3LNM B;  1K92 A;  3RYI A;  4FM1 A;  1DK1 A;  3CJH B;  3ZMT A;  3K03 A;  3CE2 A;  2QWO B;  1TVK B;  1XHZ A;  4DR4 B;  4LF6 O;  5H6Q A;  4EFE A;  2QDO A;  4PI0 A;  2RMK B;  4PDL A;  2RN9 A;  4UV9 A;  2P22 C;  4UVB A;  2WAM A;  1AI5 A;  2IW5 A;  5B1B C;  1MMM A;  2ZNJ A;  2GSM B;  3K5L A;  2CDY A;  4QE7 A;  2JJ1 G;  1XNR B;  1NS1 A;  3W7U A;  1Y76 B;  1H8H G;  4B3S B;  3AG4 B;  3P3P A;  4X66 O;  2X0L A;  4WFA V;  4B7E A;  1HW7 A;  2XND G;  1HNW O;  3B4S A;  3DSQ A;  1GN4 A;  5H9C A;  1Y4M A;  4MS2 A;  4BAY A;  4GX0 A;  3J81 N;  1G8M A;  1HDJ A;  2ZE8 A;  1AP5 A;  3ZED A;  2EJR A;  1BS3 A;  1GM8 A;  4BR6 A;  2ZDI C;  3G71 V;  2Q68 A;  4J42 A;  4MVU A;  4PV1 B;  3K57 A;  4A5U B;  4R8C A;  4FMT A;  1YJN V;  4O4H A;  5LXT A;  4MW3 A;  4JYA O;  3B77 A;  1NJI W;  4ZOL A; 
#chains in the Genus database with same CATH homology
 3L70 H;  4PD4 F;  1SQP H;  1BE3 H;  1L0N H;  1KYO F;  3L72 H;  2FYU H;  3H1H H;  3H1K H;  1SQV H;  1BGY H;  3CXH F;  3TGU H;  2IBZ H;  3H1L H;  1NTK H;  5KLV H;  1L0L H;  3L71 H;  1KB9 F;  3H1J H;  1NTZ H;  3CX5 F;  1NTM H;  1SQQ H;  2A06 H;  3L75 H;  4D6T H;  1SQB H;  3CWB H;  1EZV H;  3L73 H;  3H1I H;  4U3F H;  1NU1 H;  1P84 F;  1BCC H;  1PPJ H;  3L74 H;  3BCC H;  2BCC H;  1SQX H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...