4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
1H2MA 1YCIA 3KCYA 1MZFA 2WA4A 3KCXA 4NR1A 4QU2A 2ILMA 1IZ3A 1H2LA 4Z2WA 2YC0A 4B7EA 2Y0IA 1H2NA 4BIOA 3P3PA 2CGNA 2XUMA 4AI8A 4B7KA 5JWPA 2CGOA 1H2KA 1MZEA 3D8CA 3OD4A 4Z1VA 2WA3A 3P3NA 2W0XA 4JAAA 2YDEA
chains in the Genus database with same CATH superfamily
1J3QA 4AVBA 1JZ8A 5J98B 4W6XA 2Z42A 3MW2A 1PX4A 3ENRA 1F9KA 3LEMA 4XPVA 3JCZA 1SCSA 3JB8A 3IDBB 2DW4A 1XNRB 3F7VC 1I1EA 2ZKOA 2WQ4A 2X6AA 1UYYA 1K3EA 3KZ4C 4LFCB 1EZJA 3ZVXA 3ZXLA 1QQCA 1JUIA 3DYOA 5LBBA 1O9HA 1AYN3 4QKFA 5FY7A 3JD0A 3E83A 2HKXA 4DUZB 2P7TC 3QVNA 2E6VA 1E57A 3JALB 1O4ZA 2I74A 5FR3A 3J80N 1LB2A 5F3IA 4I02A 2XUEA 3OBAA 5BNNC 4DY3A 1W0PA 3H01A 3WLUA 5FRAA 3HKBA 3J8F2 4ASKA 1UWWA 3CU7A 4GALA 5IVJA 2IWGB 3OMAB 2UU9O 1RINA 1H0BA 3FJSA 3UGGA 3RT3C 3JBG3 4UCRA 2MEV3 2VBPA 3AZZA 4NTXA 4MHRA 4BYYA 1R3KC 5FPVA 1VQ8V 3MW4A 2Q30A 4PBPA 3AFKA 3WW2A 5H9PA 2Q73A 1AJQA 4ZONA 2Y69C 2DYRC 5A7QA 1A32A 2Q0OC 2W0XA 1GM7A 4HXCA 1D5NA 1JVMA 3D0JA 4BXSV 3LSUA 4TV9B 2K1EA 4X8NA 1PPJH 1RGSA 1F4NA 3BFRA 3C2UA 5FXXA 2W68A 5BPXA 4ZZ5A 1CAVA 4A7ZA 3G71V 2WA3A 2AYHA 1V9U1 4P9WA 1RPOA 3ZMSA 4FPJA 2WDBA 4AVAA 4X65O 3HOBA 4PA4A 4HVRA 4N21A 1F4AA 1U97A 4FOQA 2CAZC 3LD8A 1S77D 1UX7A 1MACA 3PU3A 4XUNA 1EM1A 3CQOA 2F93B 5KX5B 2ZPXA 4YJ2B 2EIJC 4FCAA 5FZBA 2HYXA 4ZOLB 4XQDA 4OZOA 2QDNA 2DUQA 1TZOA 2ZCWA 4MT8A 4XIOA 4WVVA 2D6OX 3VZJA 2XVLA 2ZE8A 4HSLA 4AQ6A 3OFNG 4FPHA 3ZSKA 5FNVB 1CPMA 1S0FA 4FSJA 4FPCA 1OCZB 1AR93 1XMQB 4CUAA 5KXCA 3ZHVA 2RV9A 4R52A 1AR4A 3DXRB 1XU2A 1AB3A 3ZYHA 1YXWA 1NBMG 2YXLA 4QX8A 2A75A 1VMFA 2WLPA 5JWPA 1AXYA 1NA1C 4QX2A 3ZMTA 2ZM6O 4Q20A 4WM7A 4XBQA 1FPN2 5F37A 4DXRA 1CX1A 2E53A 1GV9A 1EAH1 5C8CC 4B29A 3ZS8C 1WB8A 3AXDA 4A3XA 1OJHA 1RM1C 5JZGC 5FZOB 1DHKB 3POSA 3AP4A 5LK5A 4YWAA 3ETPA 5FY0A 3P3NA 1L8DA 2I45A 4GB31 3T08A 3DTUB 4ARYA 4XF9A 4LE3A 4PJ0Z 2HFEC 4CH4A 3UKMA 3CHXA 5FQ0B 5HXVA 1N33O 5LA9A 2Q8DA 2LS6A 2W1UA 3WF2A 5FYCA 1XYPA 3GZUC 4KNCA 1UZ0A 1NVPD 3FL7A 3M7MX 4JI0B 1BK0A 3HNBM 3LA3A 2A9HA 4XUTA 4CDQB 3RWKX 1DLCA 3VBSB 1GUIA 4K21A 3AK0A 5IWFA 1RUG2 2QQPA 4YFZA 2QM8A 5EIBD 1A6CA 4TV9A 4TSFG 1ULCA 2ZKNA 2ZXQA 4NUBA 5CB7A 2FMLA 1EPWA 4QX3A 5DPNA 4NPRA 1JOJA 3ILRA 3BOPA 2ZAAA 1CAUB 3GDBA 4NWWA 1V70A 3SKJE 1KU9A 2Y38A 4AQ2A 3UGFA 3P3PA 5FJKA 1ZSPA 3CYOA 2A1XA 2Y48A 4KU7A 3W9AA 3OBRA 4YVWC 3LSQA 5KX5A 4YJ2A 2YFUA 5A3MA 4QPYA 4ZOLA 2R072 4ES8A 1ZA7A 5GTHZ 1PGL2 4BMEA 5GZEA 3KGZA 1R092 3ZFGB 5T55A 1J59A 3RWRD 1BCCH 4X89A 1E5SA 4X20A 1TGOA 3I2KA 2VMIA 1NCRB 1S0EA 3H7JA 3BGAA 4AYUA 1ZTEA 3SPCA 2M7WA 4IEUA 1JZ5A 1H8VA 3OEBA 3DXRA 1DGRN 4DR5O 1FJGB 4Y5Z0 1G9DA 3ZFEC 2EILB 1RUE2 1WUVA 2C9KA 3RVYA 4G28B 4JTDB 4LWSB 3L75H 4XIKA 2ZDIC 2VNVA 3QH7A 2ZHKA 3CKHA 4XF3A 3PLQA 5FZOA 1RUF3 3K3OA 2QWOB 1AI6A 3ABMC 3IIIA 2VW1A 5FMOS 2YSUB 3DV8A 2QE3A 4YVSC 3TEWA 1PIV1 1DCSA 5FQ0A 5JH7B 2R1BA 1CR7A 3BYWA 5EJZB 5EWSA 1AVBA 1WCSA 4LULA 4CS2A 1US2A 2DV9A 5FUNA 4CH6A 3OSDA 2RMU2 3FFZA 1ENQA 2CAVA 4ZIBA 3M4FA 1CZSA 4CDQA 5DG2A 4ZZ8A 3HKDA 3VBSA 3JD72 5BXZA 4YHHB 2Q0AA 2IVJA 3O1SA 1VF6C 2YU1A 5CG8A 3S3WA 1MSWD 2HWC3 4LR4A 5C6CA 4PI2A 2VMEA 4FP2A 5AFBA 2YC2A 3JARB 4E2GA 1I94O 4BISA 3OBZA 1VB2A 2XAJA 1CAUA 2VTXA 4JDMA 1IBLO 4FTEA 4R4ZA 1HJFA 3AMHA 4Q5OA 5LP6C 5DZEA 4A5UB 2G9ZA 4OQ9A 4XDLA 1UL9A 1KDKA 2UWAA 3CMEV 4HAMA 1AYM1 2HEPA 1R1A2 1UZYA 4LBQB 2YG0A 2X6CA 4IL6Z 2HVJC 4LITA 1ZBA3 3KCXA 2F23A 3RMYA 3ZMUA 1NCRA 2ETEA 5JCOA 4Q4Y2 3AP9A 2RM21 5A7OA 3U1XA 1X4TA 4HG6B 4X1KB 5IVEA 4OI1A 3W7XA 4IV3B 1E1QG 5HCAA 3ASIA 5JJEB 3FWEA 3EYPA 1M06G 3KWVA 1CONA 3QO5A 5J37A 1SA0B 5HFMA 2WFF3 5DAXA 4LWSA 1V55B 3NAPC 4RHV2 3WUDA 4KWUA 3ALQA 4X9QA 2PAEA 5DUXA 1GANA 1QGLA 4X8AA 4AFMA 4ISRA 3FHAA 4FOWA 5LASA 1JZ3A 1OFSA 1YHQV 1ULFA 2X6BA 1PVC1 2XJPA 2XHNA 1C1LA 4NIDA 2CGOA 4AI9A 1S0DA 3SYQA 1YJLA 1R64A 5JH7A 1UFIA 5K0UC 1W2UA 2R30A 1DF5A 1P84F 3GBFA 5IFPA 3H3LA 5J09A 2GDFA 2Q5ZA 2HKOA 4TOIA 1LGCA 1MEC1 1W2AX 5BNPB 1SESA 3ELNA 4QPGB 3ASOB 4GX2A 2JJ1G 5GZFA 3L9DA 4QU2A 3UETA 1WD4A 1SQVH 3ZMNA 3U10A 2VCMA 3ETGA 1N1YA 1QNWA 4AVVA 1SZTA 3BI3A 1XMQO 3T2TA 2BNOA 1LECA 2GUZB 2HBTA 3N7MA 4M3CA 1W6MA 4YYOA 4QJFB 2WC2A 3JARA 4EROA 5FLXN 4CEWB 1JHJA 3KVAA 1RUC1 4Q4W1 4JC1A 4Z8BA 4Y33A 1Z7S3 1SQGA 2EA7A 4DV3B 4AEDC 2AHYA 1GKFA 2WO3A 4LHSA 3RRDA 3IKWA 2CTWA 3SYCA 3M8LA 3LDEA 4DR3O 1JYWA 4C7UA 1H8TC 1XI1A 5EV7A 4UFHA 3J8F3 1RUOA 2QWPB 2Q8CA 4LBQA 1ROPA 5I0UA 2JIGA 2MW2B 1D4M3 2JWPA 3M99B 5EHDA 1RUD1 4X1KA 3D3IA 1OLMA 4OHYA 4IV3A 2ZEYA 5C9AB 3ASNC 4GAZA 4A6SA 4BQYA 1SA0A 1UU5A 2OYZA 3O1MA 1ULPA 4EN9B 4COYA 1QQP1 1Q81W 1UW8A 3OGSA 1PZ8A 4BIFA 4QE7A 5IHRA 2XB6C 3G67A 1HB4A 3T1LA 3LSSA 2KA3A 5A2QN 2HHHB 4KBBA 4JYAO 3JYCA 4J1WA 3ZHUA 4Y5TA 4L99A 4O9EA 1IG0A 3WW4A 2WLNA 2R061 1GQHA 1WBFA 1RVF3 4R4XA 4DUVA 4O7XA 1HNXB 3NNJA 4PIXA 4I55B 2YMZA 4YPJA 4BMBA 3G7DA 2JG8C 4BQXA 4OX9B 2LRPA 3PJYA 1VBA3 2YS8A 2H0VA 5K8SA 1UMIA 1N3OA 1OOPB 3F2ZA 5FYIA 3B7MA 3DUIA 5GM0A 5JPMB 2CTPA 2WZR2 2XR4A 4HLTA 3APBA 3RYFB 3L2YA 5BNPA 2VOKA 1AP5A 2PTMA 3UO3A 2JECA 2WA4A 4QPGA 4LEJA 1VPHA 1QLNA 4D7YA 4R8HA 3B40A 3VD4A 3AK1A 2LUWA 4DIQA 1QR8A 4BE3A 4XUOA 4JI4B 2C4XA 2ZGLA 4AG4A 4X1IB 3CJHB 2GUZA 5A6ZA 3ITQA 4CEWA 3EXAA 5GZDA 5B1NA 3WD5A 4IYIA 3ECQA 5FYSA 3HD8B 3IAYA 3H50A 1K7DA 5B1AC 1LESA 5FOJB 4FLZA 3AP7A 4F3JA 2IXLA 2ILMA 1RMU2 1VBD2 4FLVA 1IGOA 2KM2A 2PLV1 3THCA 1S0GA 5A80A 1REEA 4E27A 4BHPA 1OD3A 2VVEA 1QH6A 4NYKA 1C3HA 5FPBA 5LBEA 3UM7A 1UXXX 1F51A 1BMV1 4F83A 1ZVFA 3LFIA 2Z79A 3K0GA 1B04A 3VZMA 1SQFA 2Y0IA 3ZXEA 1QY4A 4G9SB 3CSXA 1SC5B 3N7LA 1QHTA 2EVXA 2JDHA 3HN1A 1X50A 1ENVA 5C9AA 2V1DA 2P17A 3T1CA 1NXD1 3D82A 1UAIA 4EFEA 1MSDA 2WQZC 2LP7A 3OMNB 1I08A 2DCTA 5IK8A 2XBO2 4YHHO 4DW1A 4JAUA 1Q3EA 4TXWA 1RUG3 2F43G 1QOOA 5FYBA 2OS2A 1ASJ2 1VF7A 2Q9LA 1Y9QA 3VDCA 3GB7C 1JX9A 2DCJA 1VRH1 1XL6A 4B3TB 2VU9A 4Q4V2 3JD1A 4K0KO 1LOGA 4JQRA 3N9MA 3EFFK 4XDJA 2YHJA 2YGMA 2PHUA 2YC0A 3TEZA 1EN6A 3I2GA 4J6GA 5BNNB 1OOPA 2WZ8A 1MOFA 4LHLA 3D3QA 1SS3A 3RYFA 3N4MA 3HQXA 3USSA 1N3PA 2R073 2VMHA 4Y22B 2R043 4BLJA 3VKNA 3QTCA 1YQ6A 3SISA 4GA9A 3IPVB 3E2EA 2ET7A 1BGYH 5DQ0A 4PJYA 3ZDVA 1W2BU 1R3JC 3S5AA 3BABA 1FKAO 1IKQA 1M93A 2LFRA 2ZMKA 3CJHA 2BOBC 3LEGA 3L9JT 2QQVA 4J7ZA 4X88A 4KHPO 4XHBA 4A2UA 2Y69B 2DYRB 1I9RA 4IV1C 3JZVA 3ML0A 2A6YA 4ZU5A 2D93A 4DK0A 2ARCA 4P00B 3ZYFA 1FV2A 1B06A 4XYXA 3I3BA 5E79Z 5FZEA 4YZ2A 4NRPA 1U12A 2RMKB 3VB9A 1TVGA 4I5SA 2GNDA 4G3YC 4RL7A 4LNUB 2IU0A 1RC6A 3WQBA 3AK3A 5EIBC 2ZABA 3OMIB 3FLRA 3HBKA 3K9AA 3T2QA 4DRRA 2PN5A 5FZ8A 5F2SA 5D2AA 2Q1MA 3TB0A 3X2QC 4IHJB 1TAEA 2R6QA 3ACHA 2TBVA 3MPPG 3AKRA 1AR5A 1OCRC 5JR2A 4AFBA 2EIJB 4KQ7A 3IAQA 3C7EA 3MICA 2WWUA 4DOUA 1MZFA 3ON7A 3WNXA 1BYHA 4CS3A 1HIXA 1H1MA 3CXCU 1MS8A 4X64O 1M9NA 1Q8PA 2XASA 4NTWA 2XUMA 5IVBA 2YI9A 3VHOA 4EN6B 1RUH3 3JD73 1GH6A 3HQUA 1BKZA 4YZ4A 5B1BC 5HV4A 3BCCH 3CL1A 2KR2A 2VZQA 1PD3A 4N53B 3WB2A 1AX0A 3T3YA 2W3JA 3ST7A 1MABG 1HNWB 4LO5B 1WA8B 1ZRIA 3PVNA 1SHWB 5KHGA 5C8CB 2R9IA 3GVMA 4NMIA 4HFSA 3GBWA 3MIEA 1RM1B 2D5FA 5JZGB 1R3IC 5FKBA 3P32A 3WG3A 1SACA 5FFOC 5IW0A 1I7FA 2CAUA 3E5QA 2W94A 3I3EA 1GICA 1HR0O 1BSMA 4XMAA 2VS0A 3FUOA 4Y22A 3TEYA 3NNGA 1E1RG 4LJHA 2AZ2A 3MV11 5LCWL 4EWEA 4EN0A 1E5IA 2Y6JA 5GALA 3JCIA 1C5IA 3S3XA 2DF7A 4L92A 1VR3A 4FVMA 2CDPA 2XWJB 3VKMA 1FV3A 2WJSA 4GMP3 1YTFD 1RJ7A 1KS4A 2EXHA 4NHKA 5E1AC 4EFBA 4MUVA 3ES4A 2ORXA 3OY8B 4DQAA 1Y9MA 2J1EA 3VQWA 4XFFA 2C6SA 4JTNA 5EBWC 1B3QA 1ZUQA 5EC1C 4CU7A 1M1KW 5LBQA 4AILC 5FWJA 4WFBV 4B4PA 1GWLA 1DGWX 4KP4A 2PQQA 2ZAHA 4UUJC 3OJBA 1NJIW 1N34B 1IZ3A 4IE5A 4IL7A 4EN7B 1MQTC 5T3NA 2OQ6A 5FPXA 2JDKA 4IHJA 3POBA 5T5JA 1X59A 3D0SA 3AZXA 4UFMA 4AAPA 1COWG 2EIMC 1KFUL 4U3FH 4YVWB 4WFAV 3RQ0A 4TN7A 2D40A 2NMOA 2FCUA 4JI6B 4TT3G 4XFGA 1LAJA 3POYA 5FCCA 5FREA 3QO8A 4Z92B 1WW5A 5JJJB 5FZDA 4IE6A 1NU1H 1LTEA 2PHXA 3B9IA 1FXVA 2JJ6A 4LKDA 5H6RA 3ZYJB 1Q8OA 4Z2WA 1Q56A 2PGGA 4CZZA 5C93A 1QJEA 4CUGA 4MGYE 2RDNA 4N53A 5DZFA 2DWRA 3MIHA 3IDCB 4GYCB 2ATKC 1IX9A 1RHI1 1IBMO 1WA8A 1Y3TA 1LHNA 3RG0A 3I55V 4DV7O 3VOUA 5DDJ1 3N27A 4WV8A 1K73W 1MS0A 5C8CA 1XREA 4MVUA 1GZTA 1JYCA 5A6YA 4I3GA 1HQWA 4BXFA 3TWIA 3KM5A 2ZGQA 1YZBA 2C9AA 4Y20A 2EINC 1XPWA 1W3VA 3ZPOA 4QKNA 3C3SA 3TEXA 5LA1A 1WLEA 2RVAA 4MGIE 3ABMB 5KAFZ 3AJYA 5JMCA 2IXJA 3FD9A 2WLHA 2BP6A 2HWF1 3IC7A 1XNQB 2EJRA 4ZPIA 4AI0A 4W65A 3FHQA 3LA2A 5LYJB 3BCWA 4QX7A 1HRI2 2ZGSA 1ZWIC 3ETEA 2HWE1 1VBC1 1KJRA 2WSVA 1WA4A 4F6EA 3THDA 4OXSA 5CBGA 5BNOA 1F7YA 1JZ2A 2AC1A 4B3NA 3SQOA 4K8RB 2X09A 3OY8A 5C5TA 5F3EA 2BOIA 3JSLA 1UY2A 4LF7B 3IMNA 3VBUC 2QWNB 2VE1A 2B9ZA 4JI5O 4YW5A 3QLQA 1D4VB 4LT5A 5H9QA 5JQGA 5CU1A 1KEXA 3GF6A 5AC92 4B3TO 2RR11 2VBDA 1AR61 5SV5A 2R0HA 1D2SA 1XYNA 3K58A 2FMDA 4KFMA 5DAPA 4Q1PA 3VD9A 5LP6B 1UZZA 3THOA 1FXKC 2Q8EA 4YVWA 1JA8A 3WP4A 3WHUA 2PI4A 4CZSA 1IPSA 5CAZA 4HNAB 3E6DA 1ENSA 2FHRA 1NT0A 1WP7A 5FP7A 4QX1A 2WZPP 3POIA 1RUI2 1U5XA 3CRMA 1J84A 1V6JA 4YM1A 1CWPA 4HBNA 2BW8A 3MZHA 2R1DA 2H6BA 3WF4A 2WRAA 1JPXA 4JGYB 1JU4A 2FQPA 3B01A 3B3QE 2DUPA 2G1MA 3JATB 1J58A 1KFXL 2WIIB 5C3SA 4DR7B 4JQTA 1FFXB 1TEIA 4JZRA 3NAPB 1GBGA 2DVBA 5FZFA 4XETA 1OLQA 3RZMA 3K06A 3KS7A 1W8WA 5JLVA 3ABZA 3APOA 1EFRG 3VQVA 1BL8A 1JW6A 4NVPA 1GMGA 1KD7A 3I2FA 3IT8A 2DQ0A 4YGBA 4ZHNA 1QXPA 3CZUA 4YARA 3T0BA 2A7WA 2F66C 5CKQA 5LYJA 1SKVA 3J7NA 5K0UB 3MUY1 5F1RA 2VULA 5F6KA 3K04A 5FPZA 1K45A 2E7TA 3HPNA 2VQFB 4HSJA 3UK9A 4BA6A 4E4HA 1K5QA 2F4VB 4CCDA 3LWCA 4OUEA 5GLVA 4I0WB 5M0TA 1ZRCA 2XJTA 2ZJCA 1AYN1 4DXZA 1I5PA 4LKSA 2V5DA 4P5HA 1VF6A 2BV4A 2QQMA 5C3PA 1VMJA 2J1AA 3JD4A 1OF4A 2ZMNA 3SJBC 2JDYA 3B9CA 1Q43A 4N23A 4COUA 5FZIA 5CMUA 1JOYA 1K34A 4QM9A 1M5IA 4W4KA 1TME1 1BZWA 4LF4O 1AVMA 4UVAA 4MVTA 2BFUS 4D7SA 2WO1A 4QHZA 1MS1A 4AEDB 3JAMN 4XTMA 4U7OA 4XXAA 1ZZCA 3UKNA 5KA5A 4MYEA 4ATEA 5FMOL 4ZI7B 4IQPA 4D7TA 1ULOA 2XDVA 3JBG1 1LU2A 2MEV1 4FTSA 1KD1W 3HR0A 2G4IA 3N2GB 4HNAA 5IT6A 5JUVA 3GALA 4FOYA 1WW4A 2BTVC 2Y34A 1PVXA 5ABJC 3A22A 2OIIA 4GD4A 4QPIC 5LY2A 4CP0A 5IY5B 2IJIA 1EY2A 5EIYB 5F9TA 2RJZA 3PL0A 3ASNB 4JGYA 4CP2A 3OD0A 1IDSA 1QJY3 3JATA 2AGAA 5I0DA 2EAKA 3W59A 2PYTA 4Y4YA 1V6IA 2AZ5A 1DYOA 2UXCB 1FFXA 3A0BZ 1V9U2 2QVSB 4MGZE 1K5JA 3SLIA 2P4VA 1J5EB 1D0GA 2Y33A 4CCOA 3CCMV 3RZLA 2B1GA 2TNFA 4LBJA 1K92A 2XQXA 4OZXA 4ORFA 3OCPA 3ZN6B 5CBLA 5L73A 3WR0A 4DEVA 3L2HA 3J9SA 2ZX4A 4O4HB 3L72H 1OXCA 1NG0A 2R70A 3KKYA 5F5IA 4IGOA 3AB0A 3CJIC 2A0LA 3GZAA 2IVIB 3WB0A 3HPLC 4DZGA 3K03A 5K0UA 1YWKA 3E6BA 1IXMA 1DQ6A 3VDDC 1OPOA 3CCQV 4JV5O 2PQSA 4DINB 2WUHA 5CBHA 3T4DA 4H7LA 2M6YA 4TLFA 4UXNA 2AZ0A 5C70A 1S0IA 1O3QA 1JYXA 2KSDA 4QX0A 4UB6Z 2DVAA 4OFGA 3C90A 1Q6IA 4QAWA 4FXKB 3ZFFC 2PELA 3PUIA 5K9YA 4PQ9A 2R32A 5CZKA 5C5UA 1AR83 5BMVB 2VC9A 1X8MA 4UFIA 4GB32 3HBZA 3LNNA 5D8AA 1CVNA 2P6CA 3PIGA 5FZ1A 5B1AB 4AEDA 4HL0A 3TN91 4RA0A 5LMNO 2VL4A 4ZI7A 4I09A 1PP9H 1VMGA 2GC1A 3N2GA 2D98A 1D0HA 1KITA 3VD3A 1PNFA 1LENA 3AM2A 1QKQA 4UCVA 3OTOB 1XNKA 1X7NA 2R72A 4LKFA 1WLDA 4B4QA 2XONA 2CWSA 1T6BX 5IAXA 1NX9A 4KWLA 2UWBA 3WG7C 4AAXA 4C91A 3OBTA 1YJKA 4FI9A 1HB3A 2QDRA 1TVKB 4H37A 1ZX3A 2PAKA 1V54C 1WD3A 4MGTA 3OUSA 1WCQA 5LHIA 2PHDA 2JDMA 5LA0A 1BJQA 4AOCA 3ZN6A 1POQA 5AFEA 5GLUA 2OCCC 3C7HA 4HVOA 1QOTA 4O4HA 2XKOA 5FYHA 3MHHC 2H0BA 3GJAA 1YVWA 5FO7B 3ZMOA 4QB1A 3OUJA 3ZRVA 2A3WA 3RJRA 3VZNA 1PL4A 1PK6B 4P14A 1DYPA 3D3AA 4L9BA 1JMUB 3DYPA 3EO6A 2ZXWC 3SJCC 3NL1A 2QE7G 3M3QA 2YGLA 4QQ2A 1C8NA 3H1IH 4PDWC 5JI7A 2IXKA 3WFVA 5BR8O 4AHYA 1LCLA 4HOOA 1JYTA 4LFAB 5FY8A 3VHNA 1H1IA 3KSCA 1NZ6A 4HZ3A 4JDNA 3VV1A 1EN5A 2Q7HA 1YUDA 4NB5A 1OT5A 5BMVA 1NTMH 1TNFA 1GZCA 1RUF1 4ICGA 5LA2A 1ZAUA 4AWDA 4IV1B 2D6NA 2W2IA 1XUQA 1W8OA 1PIV2 4QKDA 3CE2A 3I3DA 4LIUA 4AR2A 2Q1FA 1JQ0A 2HH9A 5KR7A 3SYOA 4DW0A 4BIUA 1GRJA 2VQEO 4CPBD 4L8JA 5IYCO 1XYOA 3ETDA 4HYOA 2V72A 1RL3A 2JE7A 3AYCA 4CCMA 1W2NA 2DFCA 2ODMA 2FDJA 4A7YA 4FTBA 1RMU1 2X5IA 4HONA 1OCRB 4NIHA 4EN8B 3KT7A 1HRI3 5H6QA 2DWDC 2UYBA 1MR5A 4UW4A 3M70A 4H13B 3WF1A 1BHAA 1OQEA 1GP4A 4QXKA 2JEUA 1R081 4YZ5A 2HWC1 3L70H 4OYUA 1YJ9V 4BW5A 5FUIA 1TVKA 2MK3A 5FO9B 1ND2C 1SQXH 4MADA 4P9IA 1SCRA 4FXGB 5B1BB 1HV1A 4NOTA 4X8PA 1OHFA 2JDNA 2OZJA 5KUMA 2D3RA 4PLOA 4L2NA 4BQ5A 3I2JA 4R9BA 2VCBA 1PO23 4Q0VA 1SMVA 2VZOA 4QXCA 4LOTA 4N9IA 1AYM2 3ZN1A 2VWJA 1Q86W 1SLLA 3MEPA 1PK6A 5LZ6A 3KV4A 4X66O 3DGTA 5JXGA 4K8ZA 3OUIA 1UOGA 3CRQA 2RM22 4J7KA 4JI1B 2JDZA 3ME2A 4X62B 2BVVA 2PXJA 5FOBB 1FNYA 2QUOA 1LR1A 3J4UH 3AKPA 3WNLA 4RAIA 4QD2A 3UL2A 4MVQA 4K35A 4J7JA 3JQWA 2OYQA 2Y26A 5LHGA 1I5ZA 3TXSA 4PA9A 2E74B 1RUI3 2DOSA 3MD0A 2WFF1 1AROP 2JDUA 1LRHA 2ZS6B 3K4ZA 3WF0A 2VOTA 3MFAA 3BA8A 4ISQA 5L7OC 3O7OA 1ZZ9A 3CRAA 3BEHA 1V9PA 4N43A 3VL9A 1ULGA 1CAXB 5F3GA 2ZINA 4IV1A 4DR2B 4UCTA 1PVC2 4DB5A 5FZ7A 1F4MA 1PNKA 1VAVA 4L87A 5BUVA 5JOZA 3NV3A 2GTAA 5GLWA 2F95B 3CCLV 4LO6B 4E2LA 4TZDA 5GLTA 1ZL8B 2A73B 4XFIA 4NPMA 2QR4A 3HT1A 1MEC2 1W59A 2ZGMA 1MQTB 2P6HA 3A8TA 5IT9N 2WL1A 1VQPV 1UPGA 2TUNA 4BIOA 4PA3A 4WVMB 2RQ6A 1L7LA 4NHXA 4BQ4A 1WBLA 3LZZA 2EIMB 1LU1A 3CD6V 3AZVA 1QJFA 2DMXA 4AVCA 1W28A 3SXWA 3N9PA 2F1MA 3R05A 4A45A 2ZTNA 4QQPA 2FMYA 5JAXA 3ILNA 4UVCA 3ZX6A 2I2SA 3DCQA 4QQOA 4Q4W2 4QHBA 5B1OA 1EV13 4LHKA 4FM2A 2X7RB 1VQ6V 1O8SA 3H1MA 1Z7S1 3LNMB 1QMJA 4GX1A 5HCHA 4GLXA 4LLFA 3KB5A 1I5YA 1IS6A 1JOPA 5GLZA 4FFFA 5K1XA 1WCKA 4QB6A 1NKGA 3U07A 3AVRA 3M3OA 4A7KA 3BUCA 1S72V 4Q0PA 1BEV3 4Y1UA 5CVRA 1QWRA 3AMPA 2EINB 1R6NA 4JX0A 4QPKA 4B3RB 2RDRA 1RUD2 3OYWB 1D4M1 1XQ8A 1DF0A 1WMFA 1Y43B 5KMGB 2WNEA 4AW7A 2FDKA 1IBKB 2HP8A 2YYOA 3LOIA 4FFHA 2VZPA 1OHHG 1K42A 5E8AA 1RXFA 3QD6A 2R0FA 1UYXA 5EJ1B 1N1TA 1QJU1 1QQP2 3NKTA 5C4WC 1UYPA 2LGWA 4D6RA 3T1HO 3AP6A 3FAVB 2XMLA 3N2KB 4XMIA 2GNBA 3DPRC 4AI8A 1SDDB 3FB8C 4RQPC 2R062 1CAXA 5IYZB 5H2FZ 2E5LB 4AQTA 4N7IA 3HKEB 4WF9V 3MGUA 1M57C 4TUYB 4HKOA 1V9U3 1RVF1 1AL22 2YBPA 5J7MA 5CB4A 4LOSA 4KBZA 2RJLA 3VBUB 1PM9A 1UOJA 4FZ1A 1C57A 5JR7B 4ZKTB 2R16A 1VBA1 3ZSEA 1YCIA 4I0AA 1ZL8A 1ZM1A 5FZAA 5E88A 1O3TA 4CXYA 3D36C 3RNSA 4DUYB 1MQTA 2WAAA 4D6TH 3LDCA 4D94A 5L3BA 1HW7A 2AGSA 4WVMA 2A71A 1L7RA 1FXKB 4XURA 1FD9A 1BQPA 1FYUA 3DGEA 3T1MA 2JD9A 1US6A 4QPWA 3UJQA 2HWD3 1K4DC 3OG2A 3Q8BA 4ITCA 1AJKA 4OPHA 1JYIA 2EIGA 5JIUA 2JD4A 2PYJA 2OTJV 4LFAO 2P4EA 4UVBA 1EAH3 4GKJB 3H1JH 3VBHC 3PUHA 5FMDA 1RB8G 1X9TA 2JE9A 3ABKC 2PLV2 4R8CA 5LATA 3T0DA 4DMIA 4C1XA 1A3KA 3R6SA 2O1QA 1BMV2 3LA7A 1OVSA 1GQPA 5L3CA 4FP3A 4PDMA 4GKKB 2BPA2 2CDYA 2CGPA 2JICA 1F4HA 1ZBE2 1DLLA 4AQYO 5FYZA 5B2GB 3OYWA 2GNMA 1C8M3 2X8KA 1WNSA 5KMGA 1K5MB 1KKCA 1ENRA 1RUJ3 3WNOA 3VQXA 4MZUA 4NKGB 2JX9A 4RUEA 3LOBA 3MDPA 1REFA 1MG1A 3PU8A 1V6OA 3WW1A 3U11A 2IH1C 3FAVA 2D6KA 4CC6A 3N2KA 4CP1A 4AQSA 3E5XA 3WCSA 2Z0AA 3BIWE 1LHVA 2WS93 2UUBB 1KBHA 4FBFA 1Z0HA 5IYZA 1VRH2 1S2BA 4UFLA 4ET7A 1T6GC 3EHBB 4TUYA 3K59A 1QJX1 2Y4UA 2QWRB 4LK7A 2C26A 3ICXA 3SCHA 5L3EA 2XGXA 2AENA 3GHMA 2ARHA 2VBBA 4LH6A 4U2AA 2RS53 4PQQA 3JQXA 1RYYA 1CEZA 4P5YA 5AVPA 5HV0A 1FMD1 3AJZA 5A3WA 5J36A 4DV2B 2R041 1KP3A 1OC1A 2LM3A 3TGUH 5EQUA 2LROA 2E51A 1FXKA 5LRSA 3TETA 1YFYA 2E7AA 4MGQA 4P9XA 3JCUZ 2B39A 4U7NA 2Y6KA 2W92A 1TMF3 4X62O 4UFJA 4OHZA 2YEVB 3PUQA 2QKDA 1RTVA 4EZ4A 4HK8A 4YNIA 4QGNA 4GQ7A 5ABJB 3HNYM 3UKTA 1OUSA 3BVCA 2F4LA 1H6XA 2NZ9A 4XF1A 2RS13 4EZHA 1HRV3 4JRLA 5GJ6A 1PO13 4LBQD 3OEEG 5JSRA 5FXVA 2IFRA 5C3RA 2NP0A 4LBEC 4BQ2A 3W21A 4KGGA 5BXXA 4NR1A 4Z82A 1HNZB 2CHHA 1N4CA 2AUYA 3BIEA 3H7YA 4FPOB 1EUTA 3VLBB 1XNDA 4IGGA 3OGRA 1XOYA 3MIFA 1MMMA 2C5DA 2DE0X 1AHSA 5B5EZ 1E5HA 3WNMA 2VOVA 4AEKA 3ZXAC 4CU8A 2QWQB 5FZCA 2K0GA 2NM1A 5KC5A 3CRRA 2JXAA 1Q8VA 3FBMA 4AI1A 5DAWA 1XSQA 1UCXA 3GCWA 1FOD3 1K5MA 1UZWA 4XJZA 3QBQA 3CJIB 4I50B 1H2MA 3HQRA 4J9YB 4E4DX 3IC9A 1EBOA 4XILA 3C8XA 4QKBA 3FHIB 1N3QA 2VXRA 4RR3B 4J9ZB 1XOUA 4QT6A 1VEWA 4YG0A 3VDDB 1JMKC 1NOVA 3RN4A 3ZOIA 2B4KA 2BEOA 2DDUA 2WO7A 5ACA1 2YZ4A 3KHBA 1H4HA 5HFLA 1SBEA 1WZXA 4JI7O 4WFGA 2NN4A 2P4KA 3G4SV 4H7MA 1SERA 3ZFFB 1KQSU 5IWAB 3MLKA 3AL5A 2IXHA 1K33A 3NV2A 1Y4WA 1PM4A 4MV2A 1NYWA 3K08A 1B35C 5I8TA 5DMYA 1HQLA 1NQDA 4D0QA 1KXGA 4FO9A 3D4KA 1G7YA 4DUXA 4GZRB 3LKJA 1CZTA 3CCSV 3UYJA 5FMBA 2RM23 3CS5A 4OMDA 5CEHA 5A33B 4WCEV 4YM2A 3VBRC 2YEVA 5KHHA 3WEZA 2GC0A 5CG9A 1NXMA 3WDUA 1BT8A 4OULA 5EJ3A 1ZNPA 5A6XA 5ABJA 3KVBA 4BQWA 3WB1A 4GMP1 3AEIA 4XOGA 3AFGA 4YG3A 2P06A 4RQFA 2AACA 2QQWA 2YBSA 2QSAA 1ENXA 1RJ8A 1LUVA 2WR9A 4CRQA 1KB9F 4Z1MG 3WG7B 5DN6G 3WQ0A 1X8EA 2E5LO 2ZGPA 2ZMLA 1YSCA 4QQLA 1PVC3 1V54B 1XE8A 3WP6A 1VBE3 4I3PA 4FPFA 3AX4A 4CCNA 4LNVA 2BFUL 3RW0A 1WCUA 1Q8IA 2AXTZ 1YJNV 3BN6A 2ZHMA 3T4HB 4ZXKA 2WSUA 1XEQA 1DQ2A 2OCCB 1QCEA 1KQRA 1CJDA 4UFZA 1FFTB 1MEC3 1NR7A 3ZM8A 3CJIA 4I50A 3JXSA 1OD5A 2X0LA 4YZ1A 4M3CE 4MGSA 1OH3A 1IXBA 4RR3A 4WM7C 2VZ3A 1VARA 2ZXWB 3C3VA 2V73A 1YFUA 1H2SB 1UJWB 3VDDA 1GNYA 2E9QA 4CEYB 4EYUA 3I49A 4PDWB 3CJXA 2VM9A 4J80A 5FJHA 4QU1A 2JGDB 2O8OA 1POV3 2FDHA 4Q0QA 1RHI2 4K40A 2WLKA 2XG3A 1UY4A 4CH5A 3AKQA 1RUC3 4Q4W3 5DDJ2 1H2KA 3FB7C 2FD8A 1JOBA 3SYPA 3RPQA 1KJLA 3ACFA 2A3YA 1ACCA 3PMSA 4GKJO 2RS33 3A0NA 3UNPA 2UXBB 3SPGA 5AVAA 4WFEA 5HPOA 4YIOA 1D2DA 1W03A 3T30A 2G19A 1LNSA 1W0OA 3WNKA 1S5LZ 1AF9A 1W9WA 2YIDA 2YIBA 3KGLA 1YTFB 3UJOA 4PT6A 3ZN5A 1OLME 5FLIA 4YFWA 3JALA 3P5BA 2JEXA 2HWF2 1NQJA 4GKKO 5BY5A 1UMZA 3AZYA 4MTGA 5IJRA 2LGQA 3RZZA 4B3MB 1PHMA 5KXDA 3HWJA 2HWE2 5A33A 1VBC2 2W08A 3WDXA 4IYHA 3E35A 2YPDA 3I54A 1TE1B 3ZSLA 4G27B 5A1AA 4DR4O 3ZN4A 1W9FA 1CQ9A 4O2BB 1UXZA 1K12A 5TSWA 4PELA 4PLMA 2VW2A 4PDVA 2IFWA 2AEZA 1QIQA 3K5NA 4BJ0A 5FZLA 1W6QB 5LRRA 3WG2A 2UUBO 2UUCB 2BBVA 1R6TA 4PD4F 5L9VA 1W2OA 4MVSA 3ZDSA 5A3UA 3NJXA 2E76B 2RR12 5B4XA 2QQNA 1AR62 1ND2B 1YITV 3JAKB 2W47A 2FDIA 3WDWA 2VMFA 1BVVA 3I2OA 4R9CA 2VUAA 4LUKA 2Y60A 2G38A 3WXPA 5IYBO 3HT2A 4U3JB 2WLJA 3AVSA 3O9OA 1QDOA 1XSRA 3K5LA 4OHWA 4Q8KA 2Q7EA 1VBB1 4XXPA 1WGPA 1IVSA 1QBZA 3KQ4B 2F4PA 4MS2A 2VY0A 4MLOA 4HVQA 4CEYA 4H3WA 4PDWA 4D8MA 3IDEA 4P9GA 2XOKG 5FNVA 2P5BA 3NO8A 3OGJA 3T1YO 2XT9A 3JSNA 2BTOA 1YFWA 3PVEA 3AG7A 2DFBA 3QH6A 1VRBA 3VD7A 5L7OB 1KMIZ 5FZ0A 4CCLA 3LEKA 5FK7A 4LUMA 1WJZA 2PLV3 4DR1B 1NAEA 1SQ4A 4HKLA 1N32O 3S30A 3KCCA 4CTEA 2UY8A 3B8MA 5KHIA 4JI8B 4GJZA 2Z5WA 1CGPA 1VAKA 2XVGA 4DY5A 3NJZA 4KG8A 2E7QA 2FBEA 2GMMA 4CDQC 3T09A 4ATFA 1Y74B 3SC7X 3X29B 3SPHA 4XAEA 5A3LA 4GXLA 3V0AB 1LEDA 1VQNV 5LWBA 3I56V 1U5IA 3KF3A 1AYN2 5EBMC 4C90A 4O2BA 1OSGA 3NWKA 4CCCA 4BZ4A 1ZLZA 3UCSC 5FV3A 1W6QA 2D3SA 5FYUA 4R9DA 2UYAA 3RFRA 2QCSB 2HEWF 2VCCA 1TME2 4FQ4A 3TOJA 1ND2A 2BDRA 4JI2B 1ZA4A 2Z3YA 3HN3A 2EF6A 2XVKA 1XNRO 3SH4A 4ZS3A 4LFCO 1COV1 3JBG2 2R7EB 2MEV2 2V7QG 1JZ4A 2PYLA 5CA1B 5GONB 4CDUB 1NCRC 5JCOC 1CP9A 2J1SA 2ZHLA 5CKNA 4UV8A 3I7DA 4DUZO 2VZ1A 4U3JA 4EEQA 4M4PA 5JCTA 4Y1XA 5J96B 4MTXA 4H14A 4AVSA 1XNTA 2OCHA 4Y3OA 1VIWB 2E63A 3O14A 1S55A 3B94A 3ZR6A 1HN0A 3ROUA 2FDFA 1NLSA 2YY1A 2YUAA 3TBDA 1XBFA 2DYSC 2DVGA 3OF1A 3NW4A 1Z5VA 3ORJA 1QJY1 2W6IG 4DNYA 3ZFGA 3W5MA 2OA2A 3MFCA 4IEVA 4RFRB 1DQ4A 4CYDA 5C4WB 3RYIB 3IIAA 3LPFA 2WINB 1XBLA 2VVFA 2QQUA 3TRSB 1AP6A 3SPJA 3DPRB 1W9TA 5FZHA 3OEAA 4R6ZA 5L7OA 4TWKA 2WN3A 1HWYA 4RQPB 4M3CF 2HWB3 4Q26A 1DQ1A 1XMOB 3S7EA 1M57B 2UUAB 5FZ3A 1FXZA 4PLNA 4RS5C 1B09A 2WNVB 2K46A 3R65A 1NY71 1YRZA 4CC5A 4DRXB 2Y4TA 4WVWA 2WNUC 3A23A 4A44A 4BIZA 2IJHA 3QO7A 1Y74A 5GZCA 3LE0A 2Y0OA 5LL6Y 3ZHQA 5GTIZ 4Q0UA 3KV5A 2IXCA 3RYPA 2FCVA 3V0AA 2XOMA 1Q82W 1MNGA 4YSFA 2DQ3A 5IATA 1N0JA 1O6UA 1G1XB 2WQ8A 3UQ8A 4IE4A 4AHCA 1AJNA 1JUHA 4UCOA 4XHXA 4Z07A 1W0NA 3ACIA 1ULDA 2D3PA 1K9MW 1GOGA 5KXEA 3H3ZA 5C8YB 4XW3A 3SCFA 1YC61 1W90A 1O5LA 3L73H 2JB4A 1AR81 2VW0A 3RYRA 4B4RA 2QZ2A 2VH9A 1R1BA 5T5LA 4OVEA 1UOBA 4A41A 5FBZA 5FPOA 2XPJA 2WT2A 4DS0A 3TN92 1HN1A 4Q8LA 2UU9B 1XXNA 2ZEWA 3K5MA 4HK9A 2AHZA 3OOXA 4V1PA 1KDMA 1W3XA 4RN5A 4QNHB 3ABKB 1G86A 5GONA 4CDUA 2VWKA 2VZUA 2JS3A 1S2EA 3JB4C 4UWDA 4IV3C 2Q5TA 1DGSA 1QNMA 1VP7A 4E4SA 3MPBA 4GIQA 1H9PA 3POWA 4FIPC 3C7GA 4BWOA 1MZ6A 2W1WA 4GX5A 4B3MO 2WSSG 3Q9OA 4IETA 4DXWA 1W8ZA 2A7AA 4XDOA 4P9PA 1M56C 2WAOA 3I97A 1PMHX 1V6LA 4JPRA 5F5CA 1AJPA 2A6VA 3C7FA 3LDBA 4UT5A 5C4WA 3RYIA 2QM4A 5EYYA 4QIWF 5B4NA 1IS4A 1DG6A 4X65B 4OUMA 4CCJA 1SLBA 5CIRA 2IUWA 5FZ9A 4H2AA 1S76D 2UUCO 5KHKA 4GULA 2A6XA 2ZR3A 2GH8A 4JI0O 2L35A 2X10A 1NCQC 1CESA 2WNVA 1US3A 3LSEA 1YF2A 2BTQB 4DRXA 3LIGA 3C7OA 3MF9A 3AG2C 4DO2A 3AK2A 2ZBJA 3CWBH 1H8HG 3LDDA 2YI8A 5DEDA 3CMGA 2ZX0A 1OUXA 1VQ9V 3J7LA 4WZCA 3EB7A 4JASA 3URFA 1AILA 1AL21 2K9PA 2N7GA 5IAVA 2VQTA 3DSQA 4JGSA 4YG6A 4LC1A 5IUQA 3M2MA 3G80A 1SBFA 4J1XA 4FMTA 1SDWA 4UOJA 4K1YA 2ADEA 4F6RB 5DABA 1UMHA 3RBZA 2BGPA 1RUF2 2BSKB 5JOWA 2WBKA 4WBNB 3NSTA 1BBT1 1GU3A 3SR2C 5DDJ3 1QDCA 1Q5OA 5KLVH 5LA6B 3NV1A 4AK3A 3R4UA 2ZX2A 3ILFA 4Z1VA 4QB2A 1J1LA 2D6MA 5FUPA 4MVRA 4NRQA 1FJGO 4OUSA 4XF0A 2WT0A 4I01A 5K7PA 1N33B 4AXOA 2YXYA 1O3SA 2WYFA 3VZOA 2FCTA 1FPN3 3VKOA 4DR1O 4JF3A 4KWJA 5KAIZ 3H8OA 2QKAA 5L36A 5F2VO 1IKPA 4Y4RA 4LCUC 2V5YA 5FP3A 3OGCC 2EZOA 3HMYA 2ZGOA 4P08A 1XE7A 4W6YA 4F4LA 1V00A 1HW5A 3TXQA 3N3HA 1NT2B 3CPWU 2DUOA 5FKCA 1F15A 3T4VA 3RZGA 1G9FA 2VZSA 3I5DA 1R082 1O59A 2HWC2 1IPJA 3A0KA 1ZZBA 3NR7A 1F31A 1ZBE1 2F6BA 2JIZG 3BTYA 4NIIA 5BY1A 2OZ6A 4QDRA 1S0VA 4Q4X1 2EX3A 2B5UA 2QJ1A 1DGLA 1ZZ6A 3S0MA 4X6QB 1LR5A 3M3IA 3IBMA 2GMPA 4CXWA 3CMAV 5D1IA 4IE7A 1RUNA 1YQCA 3U4SA 2P3IA 2OT7A 1W6OB 4N90A 2QKCA 2BUKA 2QQLA 5LBCA 1PO21 1AR63 5EPAA 4NHLA 2Y6GA 4ZKIA 2BTQA 1AUYA 4W8JA 1O8PA 4Y26A 4BU2A 1FS0G 1EPZA 2QQJA 4LTAA 3AG3C 5E89A 5A3TA 3K3NA 3QF7A 3ABLC 4FPLA 1DU3D 1PV0A 1LNQA 4EV0A 3OR7C 4FPEA 1B35B 3UESA 4LF6B 3D5OA 4I55A 4J25A 2PHTA 2DWEC 4PF1A 1W8NA 2AREA 4CCEA 3OT7A 3AL6A 1GNZA 2WFF2 2G9GA 3WINE 1CD3G 3SCGA 5FP8A 4O2AB 3DF0A 4MH0E 3QNEA 1GWMA 3VBRB 1OBNA 3LFMA 3RSJA 3ZPYA 1M4UA 3CF6E 4Q1RA 4F6RA 4CDWC 3WNPA 2BSKA 4V2WA 2VAUA 2LW8A 4CA9A 3CBNA 5J3UA 2B9VA 3ZYRA 1R093 1LHWA 3SKVA 1S2KA 2BCCH 1PMIA 3KV6A 1SG3A 1MS3A 3IZOA 1M4WA 1BCXA 4C8DA 2A70A 4X1IA 3SHRA 2A3QA 1A78A 4MVMA 3AC0A 4NRMA 5JMOA 5IE9A 4MTOA 1RUE3 5FTTC 3O1OA 4QHOA 5FZ6A 3WHTA 3FC0A 4JGZC 3SDLA 2HYKA 5C3QA 3JU9A 3DXTA 4P02B 3W7WA 2FL4A 3ZRWB 3RJ2X 4JAVA 4GX0A 4B7KA 3N7KA 1HV0A 4LF5B 4JTCB 4LQRA 1PGSA 1WW7A 4IDZA 2VVDA 2HEYF 5JDBA 2NR5A 5EP9A 4LH7A 3ZKYA 1I94B 4ZY9A 1H2GA 2VMCA 3CCUV 4Q0SA 5AG2A 4WM7B 3PIJA 1GYKA 1EV11 1GZ9A 1IBLB 2ENRA 1HX6A 1Z7S2 4CUBA 3ZHRA 3BKZA 2LQTA 2EIEA 5LEJA 1OI6A 4R9AA 5IVVA 5BZBA 4OHXA 3VGIA 2RMU3 1QXRA 2DTYA 1VP6A 3E6CC 1TME3 1W6OA 2YC4A 1VMHA 3N35A 5D5QA 4KG0A 4AFAA 1XC6A 3H1KH 2IXIA 4HZFA 4FLWA 4P9JA 1HDJA 1BEV1 5FY4A 3DC5A 2EAAA 1HB1A 4PIYA 1KRIA 1D4M2 3M8AA 1NA1B 3N7JA 3FYEB 2BJSA 1B35A 4MXVA 1T5EA 3SGIA 1ST8A 3WQ7A 1BLZA 2ZEZA 3ZRXA 2QZ3A 4DV3O 2YV8A 3AZWA 4PF5A 1GK9A 1QJU2 3C3TA 3H8UA 3M3CA 1QEXA 2PY5A 5I91A 1X9PA 4CE8A 3POFA 1KS5A 2LW1A 5BNNA 4WFFA 4NJ4A 4O2AA 3ZHTA 5DAVA 1RSOB 3ACLA 3VBRA 2VNOA 3DXUA 4WBBA 4N9HA 3AYAA 4PHZA 1AXKA 4CPBA 4XACA 2JIJA 3WV6A 4I30A 1R1A3 2BNMA 1HDKA 4TLGA 5F32A 1RVF2 2XJVA 3IPVA 5FYMA 1YQ2A 1U0AA 2J42A 4ZXEA 2H8PC 2C1FA 3HEIA 4Q4Y3 1UU4A 2D44A 3RYHB 4IIJB 2ADPA 2ARBA 2JVDA 3ABUA 1DZRA 5A3PA 1VBA2 1UZVA 4F8AA 3IMMA 2ADDA 4XBNA 1QU7A 1W99A 2P67A 3UT0A 3MBWA 4RHV3 3RZHA 4MG2A 4LXLA 2FZ2A 3KT1A 2Q68A 1GQGA 2HHHO 1HLCA 2BERA 3BU0A 3DC6A 3FB6C 4IEOA 4ZHQB 3ZO0B 3ZRWA 2J1VA 4CP9B 1CZVA 5GKAC 4LNUA 4X20B 4AFDA 3MW3A 2CYFA 3F95A 3K0DA 4TSVA 2Z5UA 4C0BA 4UW5A 1E79G 4Q27A 4X1YB 2B7YA 1HNXO 3ZN0A 3TNQA 4G2KA 2HWD1 1I5XA 2ITDC 4N53C 4OX9O 1NE6A 1SPPB 1VJ2A 1NH2B 3HR9A 1R1ZA 3BTXA 3IJ4A 2EXKA 4P2ZA 2A6ZA 1DGRA 1AZDA 3RWNA 3G6JB 2GZWA 3OPTA 3JD3A 5F39A 4CSWA 3JAWB 2E33A 2W95A 4SLIA 4DR3B 4B8EA 4YGEA 1DZQA 3OD4A 1IPKA 2VJXA 4QX5A 2GP5A 2JENA 5CADA 2P1BA 4Y1VA 3AMMA 2VOXA 3TN93 4JI4O 1BVP1 1BZKA 4R7CA 3ZFEB 3H8XA 1C5HA 1UN1A 1NA1A 2Q69A 1GLHA 1F5JA 1C8M1 1YO8A 4DXTA 4URAA 3GZTB 2JE8A 2PAMA 4ES9A 1RUJ1 5JZGA 4QGLA 2OW4A 5FWEA 2N05A 1FI2A 1AR71 5BNOC 3HKDB 1DF4A 1RSOA 5J1XA 1UD1A 2Y6HA 2X53S 2GN7A 1UNBA 1UYZA 4JYAB 2WS91 5J2UB 2J1UA 1VAMA 1EN4A 4B3SB 3GWOA 2VR4A 3DL3A 4YVSB 1NR1A 2SLIA 4DV1B 2WZEA 4LO7A 4UCSA 4JYCA 2ZNIA 1QJX2 4WVZA 2BZDA 2FTKA 1QOSA 4LKEA 5FP4A 1G9BA 1LOFC 2Y8KA 1RIRA 4CCKA 4PCRA 3RYHA 5IFTA 3WY6A 4IIJA 1QH7A 2PHFA 4HKWA 3FFQA 4A42A 1V6MA 4QGPA 1JXNA 1IG3A 3OB8A 2X29A 2QTSA 1AJOA 2RS51 1FMD2 2XAQA 1XJAA 3PUSA 1XILA 3B4SA 2BNNA 2ID4A 2R042 1DQ5A 4XZUG 2L9LA 4COVA 5T52A 2DVDA 3K46A 4ZHQA 4CP9A 1QHDA 4OMCA 3KCYA 5LGTA 3D6EA 2ZGRA 1AR1B 5CFCC 3O5SA 4X1YA 1O9GA 1EZVH 1TMF1 2EXJA 1W9SA 3U78A 4LF6O 2ZZJA 3HIFA 4LBKA 1O91A 4XDPA 3VBFC 4LFBB 2BGCA 4L97A 2Q4PA 1SPPA 5LGNA 2RS11 1HRV1 4QM8A 5J9PC 1PO11 3IAPA 5LHHA 5L3FA 2WZR3 5A7NA 2DYSB 4IGPA 1VB4A 2GN3A 3JAWA 1D2QA 2HJIA 4O4IB 5HCBA 2F17A 2YU2A 4QE9A 4E2QA 3E5UA 1GMMA 3OGGA 1JZ7A 1W8HA 4UAPA 2BE3A 1R6KA 2DU1A 4YRDA 1HXS1 4JZGA 3BTAA 4N7UA 5LK7B 5I8YA 3K2OA 3EXUA 2UY9A 3KLSA 2D2CB 1B6QA 2DVFA 5A32B 3J7AU 4NWVA 3ZFEA 1O4YA 5CNAA 3TAYA 5FIXA 4MTFA 3WCRA 3IM0A 1VQ5V 3RZJA 2ES3A 3ZYBA 2W91A 4RS5B 4LF9B 2ZDIA 2IM9A 1FOD1 2B9UA 2ZGNA 3LB9A 1W39A 2ZHNA 2JGUA 2WNUB 1P4RA 2ZGTA 4META 1RMU3 4EWAA 3U4XA 2KKWA 1VBD3 1D7PM 4U36A 4CXXA 3CIHA 3QACA 1J1TA 1RUH2 5A1LA 3VBOC 3RVHA 4LF5O 3KZIZ 5J2UA 2J7MA 1R083 3FBYA 4YVSA 4XTPA 2ZEXA 4IESA 4M3CB 1W6MB 2OUHA 4YLZA 5L19A 2H94A 5ACA2 3SJQC 1R73A 1JZ6A 4LA3A 4V2VA 3R4DB 4FOVA 4FFKA 3KT4A 2OKXA 3BOWA 4K0KB 2XAGA 5L3GA 4IEWA 1MS9A 1F5FA 4GJYA 5FY9A 1RFYA 2O57A 4FLUA 2P34A 2ITCC 2W46A 3POGA 1NKDA 3J7HA 3H1YA 4JYYA 4A4AA 1ODMA 5EK0A 2XBO3 1EP0A 4O65A 2CUGA 4TTGA 4LMFA 1OURA 2P90A 3ZIAG 5FLJA 1KC8W 3FMGA 1P7BA 1ASJ3 3V0BB 2Q6AA 1J3PA 1HNWO 4DEQA 4MX3A 1N36B 2E75B 3B5LB 4Q4V3 1J83A 1VIBA 2DCYA 4JGYC 1AX1A 4KHPB 3SH3A 2PHWA 3W7TA 5LP6A 1JU3A 4E2SA 2Y0PA 3E8HA 1WMDA 1YIFA 3W7SA 5FO8B 3VL8A 5K1PA 1H8TB 3INAA 4BWAA 1M56B 5CA3A 3WG4A 4CVUA 1SFYA 4O4IA 4FJCC 1THZA 4A6OA 2WN2A 1HP8A 1JI6A 2CSGA 4UI9L 4D69A 4LBLA 1BHGA 2DBIA 3DKWA 3LCPA 4M00A 1T2XA 3WDVA 3ZXGA 1VBE1 3H9VA 5IVYA 1MZEA 3PUAA 2RJKA 5A32A 1PNMA 1MVEA 3ZMVA 5I0RA 4LP8A 2LTNA 3PVBB 3EQEA 4QDSA 4Z2AA 3NAPA 1NCQB 2QTWB 2NLRA 2MHFA 4FFIA 4RS5A 3R0RA 4X64B 5KUKA 5DECA 3NJVA 2VCAA 4AEMA 5F3CA 2WNUA 3AG2B 4JI3B 3K4AA 4QXHA 4I0XB 2HLDG 2GHYA 3SEPA 1N34O 1W8UA 2A79B 2JG8B 4JAAA 2ZA9A 2ARXA 2Y6LA 4NE9A 4MSVA 1POV1 4BW9A 1WW6A 2YROA 2BRTA 4NXNB 4Y1YA 5D8AC 2ARAA 3BA9A 2W0FC 1ZZ7A 1AR91 2OWOA 2DBNA 2IZWA 4JI6O 1JHNA 3N9OA 2A3XA 2DN9A 2RS31 4IEQA 4UXAA 2WYSA 4JKMA 1P7GA 2V4DA 4AZZA 2QBXA 4S2HA 1SFPA 2XKPA 1NZCA 4GKXA 4XJWA 1HR0B 2HVKC 1YI9A 1TA8A 1Q8SA 4HT1T 1RPRA 3RMXA 2CY6A 2ZR2A 1DP0A 2XLFA 3V0BA 1NLQA 3NXSA 3HVDA 4NIGA 1W0JG 2P5OA 5IY5C 5FXWA 4JHZA 4JTOA 3AMQA 4EJRA 1XRUA 1QJU3 3SPIA 4DV5B 3B8NA 2JEMA 3GWKC 1H8TA 2V4VA 1TUBB 4EWDA 3ZCCA 1SLCA 4I9WA 2CK3G 3ZBHA 1DQ0A 4JDOA 1LULA 5I0SA 4B3SO 2R49A 3OPZA 4DV1O 1XNQO 3VZKA 1AXZA 3OTFA 1F35A 2W39A 3IGAC 5I8SA 3H1LH 3WDYA 4XAAA 4COWA 3TK1A 3GHNA 5T54A 4ASLA 3GGLA 3LEIA 1EYBA 5JIAA 3K5OA 2UXXA 2LW7A 1VE0A 4Y24A 4GMP0 1NQTA 1GO3F 2JK5C 3OR6C 1NCQA 3I3MA 3MHSC 3TYJA 4M0HA 3BAAA 4XJAA 2VNGA 4LF7O 1VBB2 2WAMA 5F6LB 3OM3B 3AG3B 4GWIA 1LHUA 3ABLB 2BYVE 3W20A 5FZ4A 5FZGA 4RFT0 4I0XA 2ZT9B 5EZYB 1MZ5A 3K51A 4YGCA 4G4FA 2YICA 2I07B 2VMGA 4NROA 5B66Z 2RE9A 5GZGA 2JG8A 2H6CA 4OHVA 1VF5B 5FY5A 3PHMA 4LFBO 4AVTA 4PI0A 4LO8A 1IBMB 5BNQA 4LORA 4DV7B 3AKTA 2DURA 1SZXA 3KG2A 4BQ1A 2OIGA 2B8MA 3RDIA 1UY3A 2Y6FA 5A70A 3NMBA 4MHUA 1N1SA 3K4DA 4CDWB 4YIPA 1URFA 3O1VA 2AEYA 1O5UA 4XZPA 3U14A 2HLEA 2Z2SB 1OLRA 4K20A 3B77A 3NV4A 5J48A 1ZRFA 4K3AA 1MVQA 4GUNA 3I2HA 2BU9A 2X5IC 2SBAA 1OA2A 4QPJA 3T2OA 1GZWB 4DR7O 3PMEA 1NVPB 1DFQA 5LOVB 2CTRA 4INDA 4AHZA 4JGZB 2YBKA 4LF9O 5E16A 2L6LA 1ONAA 4B7EA 3HJRA 2GV9A 1H2NA 5C3OA 4FFBB 1LGBA 1G9CA 4JVAA 2QDOA 1FPOA 1JH5A 2ET1A 1C4RA 1TUBA 1S5HC 2GU9A 1SLAA 4JI5B 1LGNA 3POJA 4JRAA 3X2QB 4KL1A 4AHXA 2QEXV 1O7FA 4M01A 4XDQA 1YJWV 4TWTA 4BOWA 3A7QA 1Q8QA 4IEXA 1IS5A 1QJX3 2XWBB 3RYCB 2EIKC 2WWWA 2VQFO 2ZZQA 5DN2A 1COV2 3MIGA 1GN6A 4K8XA 3Q8AA 4GKYA 2F4VO 1PK6C 4IGQA 3DN7A 3ZIWA 2CTQA 1VQOV 5FZMA 2UURA 5EYPB 3CZJA 1FMD3 1N0NA 5FLHA 3RVZA 1Q6UA 2BVBA 3S7IA 3VDBA 3ZX7A 4GWMA 1YQ5A 3LUTB 4KH9A 2IU3A 2QTOA 5A7PA 5EZYA 1AI7A 1I0HA 1LOCA 5AC93 1N36O 4DRVA 2XXZA 1QJY2 2ZGUA 3EVKA 1XL4A 4N43C 2GH2A 1Z2GA 3O65A 2RHPA 2YIBD 3MV01 2HEVF 1OKQA 1ZBA1 2E3CA 1G4YB 3Q8CA 4PIZA 4H0LB 1UX6A 3B69A 4FQZA 1N8RW 1NTZH 5H9RA 1NTKH 1H2LA 1A8MA 4CDWA 3FKSG 4HETA 5H5NA 2VRZA 2QM7A 5GW7A 4CDXC 5F7UA 1GNHA 2VZTA 2WLIB 1QVGU 4L0PA 2HWB1 3PDQA 4JKLA 3FLTA 4ZS2A 1NY72 2ZKLA 1QXJA 2D3OW 3OGVA 1U5YA 5IDJA 2P22C 5FBJA 4R50A 5L9RA 3FZ3A 1GZWA 5JI9A 5EC2C 3ZIXA 1Z5WA 2UXCO 1CX4A 4ZU7A 5LOVA 4JGZA 3H0OA 3ZR5A 5JXJA 5KC6A 3OUFA 1J5EO 1W8TA 4TV8B 2VPVA 4NN0A 2RJ2A 1FT9A 1UIJA 4D6QA 1N1VA 2LALA 1VALA 4AE2A 3O0WA 4KUMA 5K4LA 4FFBA 4JI3O 2QQKA 4IERA 5CFDC 1PNGA 4BCUA 5IJ0B 3H1HH 4EKWA 1U96A 3A0HZ 3V65A 1AR82 4O4LB 1FATA 4IW3A 3CO2A 5ACA3 4J41A 1RITA 4LF4B 4FPGA 1LOAA 3GM8A 1UKGA 4NXNO 3RYCA 1O4TA 3WU2Z 4W4LA 1CPYA 1SLTA 3ZSJA 4TQFA 1KP2A 3BB6A 2AW9A 4Y20B 2IW5A 2O14A 2YFZA 2OVUA 5EYPA 1BQZA 4FZ0A 3N9NA 2OQ7A 5SV8A 2Q67A 2GSMB 4FAHA 1PX3A 1W6NB 1D5AA 3ZXFA 4DK1A 4RYDA 4UF0B 4E4ZA 4OPAA 3O1TA 3J8F1 4WFHA 4SBVA 3H1WA 1DTOA 1ZZ8A 3UT5B 4ONUA 3IDAA 3P1IA 4YW2A 4FPYA 1LOEA 3VN4A 4W4ZA 1OQ1A 2RDCA 2P3JA 2ZGKA 5BNOB 4DV5O 2P3YA 3VKFC 4P9OA 3MLLA 1OH4A 1TUEB 3I59B 4XBLA 1SRYA 3VQYA 4LLOA 3ZYPA 4JTAB 2WLIA 1GWKA 4NAMA 2VNRA 4LBNA 4KGQA 3OTOO 3I4IA 3ES1A 5CKMA 2VUCA 5JQGB 1PNLA 3WZ1A 4MSWC 1G8MA 1GTOA 1DDLA 4XC9A 3IWZA 3IN9A 1W2TA 1QR9A 2YB7A 3KQRA 3DECA 2PFWA 4MO3M 1OCCC 4WM8C 4NPLA 2W6JG 3Q4HB 1CXZB 3JUUA 1H1AA 4KWKA 4ABMA 5APAA 4TV8A 2Y64A 4JV5B 1S0JA 4AI2A 4LF8B 4K6BA 4O9GA 5JSOA 2XJQA 1OPMA 1F2NA 1WB7A 1IHMA 4KMQA 1GSLA 1QU0A 4XJ8A 4X6RB 3B93A 4ZBMA 3O1RA 4QQHA 3J26N 2A6WA 1L0LH 1XNCA 4O4JB 5FXZA 5CFCB 3ZLIA 3PVOA 3CB2A 5IJ0A 4UW6A 1YHFA 2XL7A 3STLC 2C24A 3RZKA 2VOWA 5CA6A 1Q6HA 3KD4A 4O4LA 3VBFB 3SITA 3HNMA 1BBT2 1W06A 5C8WA 2FDGA 4QGMA 5FYYA 1FX5A 3AYDA 2JG9C 3U0ZA 3E8FA 3ZJZA 1YI7A 3RS6A 1RXGA 5A7WB 1K4CC 5A6QA 4DR6B 3GBGA 3CC7V 5LMNB 5FYTA 1ZYBA 4JKKA 4FPPA 2GTSA 3DKQA 4XEZA 3PNAA 3PJQA 1KKDA 1LOBA 1DK1A 1FPN1 3CRCA 3THPA 3I8TA 4K9SA 4NXMB 5LXTB 5LMUB 4GT1A 4XFAA 1KGYA 3D8CA 4DV0B 4E8DA 4GWJA 2NLJC 1W6NA 4GB33 4URTA 1OKOA 4UF0A 1QVFU 3N9QA 1PGW2 4YXWG 2CU5A 2FKXA 3H42B 2VMDA 1YDXA 3UT5A 3QG5A 1YIPA 4TYSA 4DO0A 4Q4X2 3ABTA 5JVDB 3VBOB 2XTAA 1VQ4V 3I59A 3BU7A 5EZWA 2XJRA 3GXUA 1U5ZA 2B1IA 4UFKA 2DJVA 2VG9A 4RGKA 1VQLV 2YDEA 1UPSA 1KECA 1HB2A 4S2FA 5JJNB 3AG1C 3ZXKA 4YW6A 4Y5SA 5EXOA 3A21A 5BYNA 1PO22 4YGDA 4XDKA 3GYDA 1LOFA 1URXA 5H9SA 2XNDG 1DLBA 4K8FA 1RUG1 3MLJA 1W8FA 3MYXA 1ND3C 2UXDB 3K3WA 3OW2U 3HKEA 5CYYA 3Q4HA 2W1SA 1SEFA 4OGQB 4HANA 3VBUA 1IURA 3H9AA 1FXHA 3J7MA 1S0CA 2NYYA 3BVOA 1VBB3 5CA0B 2FYUH 5BR8B 3AG4C 1GM8A 4YJ3B 1J95A 4O4JA 1RP3B 5CFCA 4DV6B 1BQ0A 3ZRSA 4DYLA 4JYBA 3BPSA 1XDCA 3JASB 2R071 2EZPA 3VBFA 3P30A 1PGL1 3O1PA 3U75A 4KXRA 1DIWA 1QNYA 4GH4C 1R091 2J1TA 4J11A 5DUVA 3BRCA 3MHZA 4MGKE 1SZBA 4JI1O 5B3SC 1DBNA 2DYCA 5G04L 5D21A 5A7WA 2ZOEB 2QA4V 4CBCA 4EE2A 2E31A 4BDVB 3WOGA 1OCOC 2J22A 2P2KA 2VQEB 3CDZB 2YXSA 5FP9A 1RUE1 1BE3H 3A2FA 1X33A 4OI2A 4QPIB 4FT8A 2PMWB 1GAXA 2W9XA 4B1LA 4I2OA 1CIYA 1K5MC 5LXTA 2YPJA 2KB1A 5HI0A 2YIAA 1QF3A 4N8MA 2WLLB 4XJUA 4UB8Z 3BY6A 2KG7B 3THTA 1E5RA 4DR2O 1OQDA 4XF4A 4E4EA 1IOAA 1BK1A 4LPLA 1ALYA 1PIV3 2BWCA 4YW4A 3H8RA 3GNEA 5FL7G 4DV4B 2NPIA 1EV12 5JVDA 4QXBA 5ANQA 3VBOA 4H33A 2GSYA 1QJZA 4AGGA 1WWYA 3CCRV 1S4CA 3HKCB 3K79A 2VTXJ 3V56A 3OAAG 2RMU1 2BOJA 4BK5A 4TQDA 2KXLA 5T5OA 1QLEC 5D8AB 1GOHA 3MDSA 2VUDA 2O0OA 1RUH1 4CS4A 3JD71 1MS4A 1V6NA 4DXSA 3IB3A 3ZSMA 1BEV2 4ASUG 2VQ0A 1PKXA 1COV3 4X66B 3T2MA 3RI8A 4IXLA 4MW8A 2NQYA 1IQAA 3L71H 4LA2A 2AH2A 3GZEA 1SQPH 3OPWA 5TISZ 5JOXA 1XQNA 1JN2P 2EXIA 3MIDA 5CA0A 2ZQMA 1WLTA 4RUFA 1UO9A 3W5NA 4YJ3A 4QMAA 2D6LX 4ARXA 1ZREA 4OCTA 1PMJX 3VHRA 5HCFA 3E97A 1BXHA 1XHXA 1WAZA 4FVVA 3JASA 1AYM3 1XE0A 4RD7A 4IUGA 5JPNB 1JCHA 1SQQH 1R1A1 2HG5C 3OEHG 5L3DA 4Q2FA 5F2WA 3GCXA 5FDBA 3E89A 1OA3A 3JD2A 4B3RO 3USUB 1JS9A 4Q4Y1 2DU0A 3E8BA 3PURA 1CJPA 1IBKO 4JZ2A 1Y6XA 1W6PB 2W52A 1VQKV 2JRIA 3K57A 3LSDA 1ZRDA 1JODA 5IK5A 4QPIA 4I7ZB 1UU6A 4RHV1 3POEA 5T5PA 2WLLA 3WP3A 1I6XA 4BK4A 3Q8EA 4ASMB 2GALA 2KG7A 2GBOA 4RR3C 3EJKA 2K2SA 1W9YA 3NNLA 3BODA 1OV9A 1OF3A 3E22B 1K97A 1FAYA 4YW7A 4P9LA 2GNTA 2HWD2 3WVJA 3I2DA 1Q7YW 2ZCEA 4LE4A 3PJSK 4LF8O 4XFHA 1Y76B 5IYYA 1Z78A 2JDAA 2PA7A 4M0NA 1GFF2 3ZXDA 3B09A 1Y4MA 1EAH2 2DCZA 1AL0G 2YUEA 3WG1A 3WSOA 4DUYO 3B02A 3HKCA 3BALA 1L0NH 3ZYGA 1JFFB 5FPAA 3BHPA 4IEPA 2ZX1A 4UW3A 3VHPA 5KXBA 2RDQA 3BPZA 3O0VA 1IS3A 2X05A 3T4ZA 2BBAA 4FK5C 2XJUA 4LK6A 5F5AA 4HN0A 4BQ3A 1UOFA 5FYVA 5FPRA 1WLWA 2EIDA 1OVPA 2ZIMA 2XAFA 3F5TA 1L1FA 4DR6O 3W58A 1NI8A 4AL9A 1C8M2 4S2DA 4XUPA 4AFCA 4UBGA 1NE4A 5E1RA 1AI4A 4YM0A 3TNPB 1RUJ2 3ZFFA 4NXMO 3TCUA 2VZRA 2WNOA 5LMUO 2CTVA 4L11A 2DCKA 1AR72 4DV0O 1JTZX 2VECA 2X5IB 3T1HB 4LBMA 2EJ7A 2N74A 1XNBA 2QNKA 4IEZA 2A06H 2UWCA 2WS92 3OUHA 4NO4A 1F8VA 1WA6X 4COZA 3BTZA 4MXWB 1STMA 3PN1A 4CUCA 2GDSA 2RCVA 3I3QA 3KMHA 5I0TA 1WPBA 1WKYA 2V09A 3AKSA 2QQOA 3USUA 1RUD3 1I3HA 1NZIA 1H38A 1X36A 2EICA 4XCAA 1W6PA 2Q4SA 5FPLA 3LGRA 1SBDA 1SQBH 2RS52 4I0BA 1G6NA 3FLPA 2CGNA 2VUJA 1QQP3 5KWRA 5J2TB 2HJDA 2EIKB 2WLMA 3NRUA 3MIBA 3CEIA 2GC2A 3M7AA 4HPKB 3P6BA 2NNUA 3K77A 3SMHA 2EBOA 2NMNA 1Y66A 5KBFA 3AMNA 3K75B 3SJAC 2UXDO 2R063 3E22A 1W04A 1TMF2 5FMCA 1AL23 1C1FA 3CCVV 4CEYC 2P6JA 1JBCA 1S3JA 1Y76A 5C33A 2RS12 1J3RA 1HRV2 2WPDG 3FN9A 2BOCC 1PO12 3KF5A 1YYNA 2PHRA 1OCZC 2VZVA 1WN7A 2OX0A 4DV6O 2EULA 2GMEA 4BH9A 3Q8FA 1LJ7A 2JS5A 2WZR1 4RSUA 1UKRA 3J81N 1S5JA 1JFFA 4DV2O 2RG4A 3RYKA 4N43B 2YXHA 3ZMZA 3CCEV 4Q6GA 3WW3A 4W50A 1BBT3 5ANNA 4P9YA 4FAGA 1HXS2 4LIVA 4LBOA 3SNMA 2ZACA 2Q8OA 4H55A 1X82A 5A3OA 4YM3A 1CN1A 1GP5A 1REDA 2JGDA 1FNZA 4AQYB 4FM1A 4CDXB 4O61A 5A3NA 1V6KA 1FOD2 3R66A 1Y9GA 5F8PA 3NJYA 1TQ5A 1K5SA 3W7UA 2AR6A 2LFSA 5DAQA 4JHTA 4PBOA 1WMXA 5FK8A 1XU1A 1MPXA 1AI5A 2RNBA 3B2EE 1VBD1 3WP5A 1P8JA 1HNZO 2G9FA 5FPUA 1PL0A 4EB6B 3S57A 3ETQA 3FYIB 2UXNA 1LHOA 1UQXA 4MXWA 4C0HA 4XE9A 3ZEDA 2RN9A 2P37A 3LPGA 1ZBE3 5E6HA 5DUUA 5CFDB 3VBSC 4DV4O 1FAFA 4BAYA 2H3OA 4Q4X3 1YIJV 1GR3A 3TJTA 2ORZA 1ORQC 1BS3A 2NN8A 1V0AA 4B08A 2W1QA 4E9KA 2ZIOA 2E32A 3FUQA 4NIAA 4MOAA 1WP8A 4FM0A 2CNAA 5J2TA 1UPIA 4YW1A 2J1RA 1JJ2U 1K8AW 1DZTA 4UYBA 2XBO1 1A8DA 3LF7A 2ADQB 4HPKA 4C1WA 2OT5A 1BMFG 2BWAA 2JKBA 4AGRA 3M1HA 3HAGA 1VRH3 1ASJ1 3N36A 2W5FA 2JB8A 5FAXA 2R9RB 4BR6A 4F7ZA 2CH7B 1WLCA 3PTRB 3JAKA 4WZFA 2ZNJA 4Q4V1 5EBLC 2QKSA 1GN2A 2D43A 3ZFGC 5IWAO 3WX5A 3MAQA 2VO5A 2QJVA 1MS5A 2IJKA 3ACGA 2OUJA 5CISA 2D7FA 3LDKA 3AYEA 1ZRRA 1H8EG 4GZ9A 2HJFC 2LO1A 2N04A 4FLYA 1G8WA 3G6BA 2CV6A 1CAWB 5DUWA 2EILC 4P30A 1GP6A 1ZX5A 1VBE2 3FE5A 5CB4B 1VQMV 1LODA 4FPKA 1PZ9A 5G05L 4CDXA 4J42A 2UU8A 2C2AA 4ZU4A 3HB3B 4FFGA 5KHJA 5A7SA 3NNMA 3MF6A 5BV6A 1H30A 1F23A 1CPNA 2JJ2G 2VQAA 4YY3B 4M4RA 1CIWA 4PV1B 1OCCB 4FLXA 4WM8B 3RGBA 2Q8VA 1KUQA 2CE4A 2GAUA 2B5HA 4UV9A 4EB6A 3RI9A 4BB3A 2XL9A 1JJOA 3IFXA 3EMRA 5L9BA 3AXEA 4DUWA 2WWJA 5CBFA 4RO2A 3WT3A 4PA6A 1RUC2 2TEPA 5CFDA 4JI7B 3SEEA 1AR92 3UV9A 1JR9A 4RGAA 4NHYA 5IJ9B 3EBRA 3T0AA 4RGGA 2RS32 1PM7A 3LQCA 1Q90D 2ZE6A 3WF3A 1L7QA 3UKVA 3T2PA 2KD7A 3SYAA 1MA1A 5F5QA 4DFSA 4OQ8A 2QQIA 1YNAA 2B45X 2IBZH 2JG9B 4CDUC 3NVCA 3QOPA 5LEKA 2XQRA 1UY0A 5JOYA 5EFUA 1YFXA 2JDPA 3VD5A 2ZD9A 1NH2D 2O8QA 3CC2V 3S6PA 5A1FA 3CEWA 3E86A 5D5PA 2CH7A 1EUUA 2HBUA 4D6SA 4NHMA 4LR3A 4IE0A 1IQDC 4JV4A 4YW3A 4BLIA 3VBHB 4E8CA 1VLNA 3ZKUA 2EIBA 2FB5A 4XABA 2UXBO 3LIHA 3CC4V 2GC3A 3VUOA 5CA1A 1LUWA 3AP5A 1G6UA 2ZE7A 4I9QA 2CWMA 4XUQA 4IEYA 3V64A 4MW3A 1CAWA 1Y7BA 4XVHA 2A5ZA 1H9WA 4DPNA 1V55C 2RDSA 5LW9A 4QWNA 1HKDA 2W87A 3VDAA 3A0RA 1XHZA 2WNVC 2OPWA 5IVFA 4OLLA 3M3EA 3FX7A 4PDLA 1R3LC 2CDOA 1FYJA 3K9SA 2KQXA 5JXIA 3OGIB 3STZC 5H9CA 3AG1B 5A9GA 1ULEA 4GCZA 2OXBA 4HN1A 3DPRA 5LY1A 3F5WC 5HXMA 3CXHF 2ETNA 4RQPA 3E8GA 1ND3B 1SLIA 4QDQA 4WM8A 3WQ1A 4CU6A 2GP3A 1UF2C 2E26A 2EALA 2DTWA 4CH3A 3L74H 2VQUA 2PF4E 1HQNA 5LB6A 1GN3A 3CX5F 3KV9A 2WLQA 1APNA 3ATGA 5BNPC 3WNNA 4YZ3A 5LBFA 4QPGC 4RWUA 4LO4B 3WDTA 3ZXJA 3ASOC 2Z69A 3AG4B 5EYXA 4PDRA 3N9LA 3MUZ1 4A3ZA 2IH3C 2WKKA 4UCUA 1UY1A 5DZGA 4I4TB 5IJ9A 1YXBA 3D36A 1YQ8A 2BQPA 3FB5C 4H44B 3NQHA 5JVVA 2MPFA 5C7GA 4CEWC 5CN0A 4GH4B 2ZM6B 1AX2A 2BGOA 4L8QA 2JG9A 1OZ0A 2Q1ZB 4B1MA 3S5QA 1S0BA 3NNFA 5ITZB 1LKNA 5B3SB 2IJJA 2D5HA 4K3UA 4OI0A 1JYNA 1LEMA 5C8YA 2FZ1A 4LHNA 1W0KG 4PA7A 1YI2V 1YLLA 3UO2A 2V4AA 5C71A 1O3RA 4BPZA 2R9AA 4XFBA 1POV0 1RHI3 1OCOB 2XAHA 2WO2A 3LDRA 3VKLA 3I2IA 4MVZA 5IVCA 5FY1A 4OI4A 3VBHA 4DR4B 4XBFA 2P3KA 3OE7G 3E1F1 3O1UA 2WABA 1JYVA 4FLTA 2HR3A 1AR73 4J10A 1A34A 2XHBA 2OIEA 3APQA 2K9ZA 1YEWA 2XJSA 1NS1A 1SETA 1N47A 5C9AC 4JI8O 1P49A 1WPXA 1SFNA 3MI8A 5DM6V 2CL2A 4KU8A 1NUKA 2HWF3 3U37A 3F7YC 3UGHA 3VZLA 2QFEA 2XHKA 3SH5A 2LJ2A 2VD7A 3QCWA 4EQVA 5T50A 2C0ZA 2HWE3 1HRI1 1NLRA 1VBC3 2ERFA 3O0XA 2ATFA 3GJBA 4IT5A 1WCDJ 1G9AA 1PGW1 1TNRA 3MO4A 2WFPA 4XQ4A 1HJGA 4Y1ZA 3B00A 1QLEB 1H4GA 1XB9A 2PUSA 3G6EV 3EHKA 1DGWA 2B42B 4XJ9A 2QGNA 2ZE5A 5JXHA 1ND3A 2XLAA 4XFCA 2WWSA 3CNAA 4K1ZA 1OOPC 3H3UA 2RR13 2PHLA 3HKBB 4W6WA 3WUCA 3ZYIB 4NAOA 4JI2O 1GKBA 5AC91 5IK7A 5DXDA 2OTLV 1ODNA 3CLPA 4AF9A 3DYMA 4Q29A 2VXJA 2XLGA 1ZBA2 3NKGA 4K7JA 3T1YB 3ZHSA 2Q7GA 2B46X 4D3WA 4NTYA 4BM8A 4MVOA 4I4TA 3PTYA 4RQEA 1WMEA 5IYDO 1M90W 1TG7A 2PZSA 1KYOF 4DR5B 2Z4FA 4GH4A 3R4SA 3CCJV 4GWNA 2PI5A 2HWB2 1BHBA 1XNAA 2IC1A 2XH6A 5KA6A 1K3IA 1RUI1 4KI5M 1HXS3 1N32B 3LAGA 5ITZA 2JKXA 2OPKA 5FZKA 1DYKA 1L3JA 1GM9A 3K48A 5DG1A 1PZ7A 4XQWA 3VBBA 1VQ7V 4AHWA 3KHCA 3FX3A 2ZX3A 3CP1A 2VGDA 4XCBA 4S2GA 4UBHA 1Y67A 4WBNA 2JDIG 1OMIA 1S1AA 3DEMA 2WT1A 1SF9A 1W05A 4HMZA 5ISLA 1CAVB 3A4UA 5LA6A 3O12A 5LGUA 4YY3O 5I93A 4AI3A 2VTFA 4AEJA 1GOFA 1UIKA 5JSPA 2D6PA 2MNGA 1OFNA 1H6YA 1XMOO 2D97A 2UUAO 4AGVA 4JCKA 1OA4A 5HBAA 1C28A 1GN4A 4CU9A 5IK4A 5ERLA
chains in the Genus database with same CATH topology
3B94A 1NY72 2ZKLA 1J3QA 4AVBA 5J98B 1QXJA 4W6XA 2Z42A 3ROUA 3MW2A 3ENRA 4QM9A 1NLSA 2YY1A 1TME1 1F9KA 1BZWA 1U5YA 4MVTA 2BFUS 4XPVA 4CWDA 3TBDA 4D7SA 2DVGA 3OF1A 1MS1A 1SCSA 3NW4A 3JB8A 3FZ3A 3IDBB 1QJY1 4DNYA 3ZFGA 2OA2A 4AEDB 4XTMA 1GZWA 3MFCA 5JI9A 3ZIXA 1CX4A 4IEVA 1I1EA 1DQ4A 2WQ4A 4ZU7A 4XXAA 3KZ4C 1ZZCA 4JGZA 3H0OA 3UKNA 5KEUA 4MYEA 4CYDA 5C4WB 3IIAA 4ATEA 2WINB 5KC6A 5FMOL 3ZVXA 4IQPA 3ZXLA 4D7TA 1JUIA 2VPVA 4NN0A 2VVFA 3JBG1 1LU2A 2MEV1 1AYN3 1FT9A 1UIJA 3TRSB 1N1VA 4FTSA 3DPRB 5L7OA 2LALA 1VALA 4AE2A 3O0WA 2G4IA 5IT6A 2HKXA 4IERA 5CFDC 3GALA 4RQPB 4FOYA 4M3CF 2E6VA 1E57A 1PNGA 4BCUA 1WW4A 2BTVC 1O4ZA 2HWB3 2I74A 4Q26A 1LB2A 1DQ1A 1PVXA 5ABJC 3S7EA 2OIIA 1FXZA 4PLNA 4RS5C 3V65A 4I02A 1B09A 1AR82 4QPIC 1FATA 2WNVB 4CP0A 1NY71 5BNNC 4DY3A 1YRZA 1EY2A 3CO2A 5F9TA 5ACA3 1W0PA 3WLUA 1RITA 4FPGA 5FRAA 1LOAA 4WVWA 2WNUC 1UKGA 4JGYA 3J8F2 4CP2A 3OD0A 1QJY3 1O4TA 2EAKA 3CU7A 4GALA 5GZCA 3W59A 2IWGB 2PYTA 1SLTA 2Y0OA 1RINA 1H0BA 4Y4YA 1V6IA 2AZ5A 3ZSJA 3FJSA 4Q0UA 1V9U2 2IXCA 3EATX 2QVSB 3RYPA 4MGZE 3V0AA 3JBG3 3BB6A 2MEV3 3SLIA 3AZZA 4YSFA 1D0GA 5J92A 4Y20B 4BYYA 1JUHA 2OVUA 2TNFA 4LBJA 4XHXA 4OZXA 3MW4A 4Z07A 2Q30A 4PBPA 3AFKA 4ORFA 3WW2A 5H9PA 3OCPA 3ZN6B 5CBLA 5L73A 3WR0A 1ULDA 2D3PA 3L2HA 5SV8A 3J9SA 2ZX4A 5KXEA 3H3ZA 4XW3A 3SCFA 1NG0A 1O5LA 4FAHA 2W0XA 1AR81 3AB0A 3CJIC 1W6NB 2VW0A 3RYRA 4B4RA 2QZ2A 3ZXFA 2VH9A 5T5LA 4OVEA 3GZAA 3D0JA 4E4ZA 4DZGA 5FBZA 4X8NA 5K0UA 3J8F1 2XPJA 1YWKA 1RGSA 2WT2A 3E6BA 4DS0A 4SBVA 3H1WA 3C2UA 3TN92 1ZZ8A 4Q8LA 2W68A 4ONUA 5BPXA 1XXNA 4YW2A 1DQ6A 4FPYA 1LOEA 1CAVA 1OPOA 4HK9A 3VDDC 4A7ZA 3VN4A 2WA3A 2AYHA 4V1PA 1KDMA 1V9U1 1OQ1A 4P9WA 4FPJA 2P3JA 2ZGKA 5BNOB 4AVAA 4DINB 4YLMX 4H7LA 1G86A 4CDUA 3VKFC 4TLFA 4HVRA 3MLLA 1S0IA 1O3QA 3I59B 4FOQA 4XBLA 3JB4C 4IV3C 2DVAA 1MACA 2Q5TA 4OFGA 4LLOA 2ZPXA 3ZYPA 4E4SA 2VNRA 4FCAA 3MPBA 4FXKB 4GIQA 1H9PA 3POWA 4LBNA 3ZFFC 4KGQA 2PELA 3I4IA 3ES1A 4XQDA 5K9YA 4BWOA 4PQ9A 2R32A 1MZ6A 2QDNA 2DUQA 1AR83 2ZCWA 4XIOA 1X8MA 2D6OX 4WVVA 3WZ1A 3VZJA 2XVLA 4GB32 4HSLA 3HBZA 1DDLA 3Q9OA 4IETA 5D8AA 4AQ6A 2A7AA 3IWZA 3IN9A 4FPHA 1CVNA 3KQRA 3ZSKA 1CPMA 1V6LA 2PFWA 1S0FA 4FSJA 4FPCA 4WM8C 2A6VA 4AEDA 1AR93 5KXCA 4HL0A 3TN91 3JUUA 5C4WA 4RA0A 4R52A 1XU2A 1H1AA 4KWKA 4I09A 5EYYA 1S0JA 4AI2A 1YXWA 1IS4A 4K6BA 1DG6A 4O9GA 5JSOA 2A75A 2XJQA 4OUMA 1OPMA