4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
b'MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
2Y0IA 3D8CA 2XUMA 2ILMA 4AI8A 1MZEA 4B7KA 4Z2WA 4NR1A 3KCYA 3KCXA 2YDEA 4B7EA 1IZ3A 2W0XA 1H2NA 1H2MA 1H2LA 4QU2A 4JAAA 3OD4A 2WA4A 1MZFA 2CGNA 5JWPA 4Z1VA 3P3PA 3P3NA 1YCIA 2WA3A 2CGOA 1H2KA 2YC0A 4BIOA
chains in the Genus database with same CATH superfamily
5FRAA 1PKXA 2WNUB 4LBLA 4LR4A 4JCKA 2DVFA 2Y26A 5L9BA 4LJHA 2W5FA 3M3QA 4RA0A 2VZPA 5BZBA 3WQ1A 1SLTA 3EHKA 3MF6A 3HMYA 3VL9A 1N32B 2Z79A 4GX1A 5K0UC 2LTNA 4LMFA 4XFBA 3T3YA 3NAPB 3ZDSA 2VBDA 3ROUA 2PAKA 3H3ZA 4J1WA 4AQSA 2RMU1 3LKJA 3UL2A 2EJ7A 5I0UA 3V0AB 5I0DA 1I5ZA 1ROPA 1A34A 2ZE8A 1VF6C 4NJ4A 1IG0A 2FQPA 1F5FA 1ZRDA 1N33B 1FPN1 2VMEA 1C1LA 1J83A 3T2QA 3TEYA 4GH4B 1UX7A 3D6EA 3VBUC 5CG8A 4AGVA 2XASA 3E8GA 2ARXA 1YFYA 1O4YA 1S4CA 2YXHA 1O3TA 4MUVA 5FIXA 1I5YA 2HEYF 3UKNA 3TN92 1MS0A 2DU0A 1L8DA 5IT6A 3B01A 1MQTC 3U10A 2GNTA 2DURA 4D94A 2F4VB 3CU7A 5M0TA 4NHMA 4EQVA 1HQLA 4EYUA 5A6YA 2GNMA 1SQGA 1OUXA 1K12A 1LOEA 3AJZA 5F5IA 4JAVA 1HB2A 1MA1A 3FC0A 1EBOA 4O7XA 4PDWA 3KVBA 2LW1A 1FJGB 1H6XA 2L35A 5GZGA 2XBO1 5LA6B 4IIJB 1SG3A 4ZIBA 3JSNA 4JI7B 2Y6GA 3MAQA 4JTAB 1PK6C 2WQZC 2CE4A 1TUEB 4AR2A 5B1AC 5CB7A 4FTBA 1WCDJ 1TG7A 1KP2A 3VQVA 4PJYA 3O1SA 1AYM2 3CCLV 4DK1A 3T1MA 1YXBA 4FPEA 3HWJA 1YJWV 1R091 2D6OX 4EE2A 3DPRC 4YM2A 1K5SA 2HBUA 3GWOA 4MTXA 1N33O 3KZIZ 2CGNA 2JG9C 2ZACA 1LGCA 4J7JA 5A7OA 2IXCA 4JGZA 4MVQA 1AR71 1HRI3 3EMRA 4QXBA 3PL0A 3UGHA 3ACIA 3OCPA 4MS2A 3K5LA 2X29A 3R05A 1BEV1 5EIBC 1KJLA 3RVHA 1YF2A 3N2KB 1CZSA 1LOFC 1X50A 4UFJA 5K8SA 2PF4E 1WGPA 5F7UA 1AXZA 1WA4A 3TJTA 4XBNA 1L7QA 5HCBA 3BUCA 2BBVA 2W3JA 2ZKNA 2F4VO 2IFRA 1BGYH 4M00A 3VKMA 4UFIA 1AROP 4DMIA 4OPHA 1K3EA 4LHKA 1AJKA 5IYZA 3ZXAC 4HANA 1Q8OA 2Q4PA 3PU8A 4IL6Z 3APOA 1VBD3 1XNRB 1OHHG 1AF9A 3ABKB 1VQ8V 1PVC3 3LF7A 4EV0A 4FPKA 1XNQO 2E3CA 5C70A 2R9RB 4N21A 1LHUA 4NWWA 3VB9A 4QM9A 4X1KB 1GZ9A 1Q86W 1APNA 5T5OA 1YJLA 1ZSPA 5FZKA 2R1DA 4JDNA 2P22C 3M3IA 5D8AB 1OCOC 1W6PB 2QTWB 4F6RB 2IJKA 3SJAC 4XFFA 3BN6A 1W05A 4DRXB 1ND3A 1OCCC 5LA2A 2UYAA 1W6NB 2JGUA 4S2FA 3QBQA 2H6BA 2ADQB 4HZFA 2VCAA 3WG7B 3PUAA 1O7FA 1ZTEA 1GWMA 3OD4A 2IJJA 2LROA 1JHNA 2HJIA 2VZQA 5HBAA 1V00A 4MVUA 5G05L 1JI6A 4K1ZA 3WZ1A 2P37A 3WG3A 4RGKA 2L6LA 5IVYA 4YG3A 4LKDA 2WLLB 3ZRWA 4V1PA 2YROA 2EF6A 2UXXA 2DCYA 3PIJA 5F5CA 1HRI2 1YDXA 4ONUA 1J1LA 2Y4UA 2GC3A 2WNOA 4TV8A 3OB8A 5GLVA 4X66O 2QWNB 4H44B 1UD1A 5FKCA 1BHGA 1MS3A 1CJDA 1VMFA 5CVRA 3ZFFC 4TUYB 5LP6B 5D5QA 4FZ0A 1YQ6A 4AI0A 2QCSB 3OYWA 5A32B 1JUHA 1XREA 1DCSA 1HV1A 4JGYB 3OMNB 1U96A 3LA3A 1FYUA 4YG0A 1VBD2 5LMNB 1ZBA3 4BMBA 3GXUA 3MI8A 3PIGA 4BK5A 4FPYA 5EJ3A 5I0SA 3AZWA 5CBGA 2LW8A 5C93A 1C28A 2ENRA 1QQCA 4O2BB 5J2TB 4EZHA 4O2AA 1PO11 3I2HA 3VL8A 3DC6A 4LKEA 1HWYA 3JD0A 2BOIA 4Z82A 1URFA 1V70A 2PELA 1I7FA 5KUMA 4HKOA 4A3ZA 1X82A 1V6NA 1YFUA 3RYIA 1U12A 2AXTZ 1JW6A 4UFHA 2OCHA 5T3NA 4QU2A 1GR3A 2V5DA 4KQ7A 5IJ9A 3ACFA 4UOJA 3RMYA 5HI0A 2VZRA 3PVBB 5HPOA 2B42B 2BYVE 1K92A 4A7KA 4LE4A 3M4FA 1W2AX 1XB9A 1TQ5A 1WMFA 1FNZA 1YFWA 4EFEA 2E31A 5FWEA 5B1BB 3LNMB 1SBFA 1NZCA 1CX4A 1QXJA 2VR4A 5CA0B 2I45A 5FPLA 3T2MA 5LMNO 3UT0A 1NQJA 3F5TA 2CH7A 3U0ZA 1H8TA 2AZ0A 4NXMB 5FNVA 1FX5A 2WBKA 1C1FA 3AVSA 1R3JC 4A2UA 1MMMA 4QWNA 1RUE1 1SLBA 2BPA2 1XYPA 2WKKA 2E7QA 1WP8A 2RMKB 3B4SA 1UZ0A 2RDCA 1QOSA 3BU0A 3K0DA 3H1JH 3RGBA 1YNAA 5FXZA 5IK7A 2EAAA 2YB7A 3J4UH 4YZ5A 3K5MA 2R32A 5ACA1 1H0BA 2CYFA 3SC7X 2BTVC 1ENSA 4NIGA 2V09A 2VTXA 5CMUA 4FOQA 3AG7A 3B94A 4DR3B 2D44A 2J1TA 3JARB 1ULGA 1ZBA2 4F3JA 2VJXA 5K9YA 1Z2GA 3POWA 3QVNA 2OIGA 4DEVA 3OF1A 1ASJ3 2EIDA 4PA7A 4HVOA 2FD8A 1W90A 3OBTA 4MV2A 3M8LA 4XXPA 4B4QA 3ZXGA 1GWKA 2UXCO 1RUD1 1IBLO 2PGGA 3B00A 1G9BA 1B35A 2Z0AA 2YC0A 2ZGTA 5C4WB 3U78A 1LHWA 3W5NA 3RYHA 4PJ0Z 2CDPA 2TNFA 1PP9H 4QE9A 3J7NA 3ZYRA 4NXMO 4O4LB 4PLMA 2A3XA 4A5UB 1A8DA 2ZGPA 3A4UA 4I5SA 2R041 4ZPIA 1QJZA 3BPZA 4E2SA 1JYCA 3B40A 4BQ3A 4UCVA 4IDZA 4DV6O 3VLBB 5HFMA 3HR0A 1JU3A 2HVKC 3G6BA 4AQTA 4JKMA 1N1TA 4OHVA 4DR3O 4AOCA 2ATKC 3OR6C 3JU9A 1M90W 5DZFA 3ZFEB 2EINC 2D97A 2XVKA 3P5BA 4HK9A 1WA8A 1MZ6A 2J1RA 4CDQC 1AR5A 4LR3A 4I55B 4FPGA 4K8ZA 1KMIZ 4GJZA 3BFRA 4PD4F 5CKNA 1BS3A 3AG3B 4CDXB 1W9SA 2JE8A 1UZYA 3H3LA 3JYCA 5FZOA 3U75A 2IW5A 3R4SA 1S0JA 3SH4A 5LATA 1M4UA 2VXJA 2RDNA 1RXGA 3E5UA 1F7YA 2XAFA 1VBB2 5LCWL 3FN9A 4P02B 2YU2A 1RHI1 4FVVA 1QBZA 4X65B 1K45A 2FZ2A 5EYYA 4W4ZA 2ZNIA 1IQDC 1J84A 2WA3A 2WIIB 2ZKLA 4LF8O 1OFNA 3MIEA 2KD7A 1WCQA 1DYOA 1ASJ2 4H13B 3ZHSA 2WS92 4FPHA 1D0HA 4B4RA 4YXWG 1QOTA 4FPJA 2J22A 3AG2B 3WY6A 3WP6A 5BNNC 5K0UA 5FZMA 3FYEB 4U7NA 1JYIA 3OR7C 1EUTA 3C7HA 2OZ6A 3BKZA 1RMU3 1OSGA 4BIUA 1QJX1 4QGLA 3E8FA 1KS5A 4QX1A 2EIMB 1WD4A 2DCTA 4ZU4A 1WP7A 4G28B 4Y24A 1W03A 5KA5A 1ND2B 4ARYA 2PMWB 3S3WA 2YC4A 2W0XA 1VF6A 3C7GA 2V4AA 2YIBA 4LQRA 2P6JA 4CA9A 4HAMA 4ZZ5A 5A9GA 5JR7B 2DU1A 5F2SA 3D82A 3KT4A 1XU2A 2GALA 2FL4A 2ZX3A 1FOD3 4UVAA 2WZPP 2BU9A 3N35A 1V6OA 3BALA 3J80N 4J6GA 2WLMA 3HQXA 3O0WA 3B3QE 2AR6A 4N53C 2FDIA 1F9KA 2XGXA 4NIHA 4KG0A 1E1QG 1V9PA 1RP3B 2ZAHA 5JMOA 2XAJA 1IXMA 2JDHA 3OTOO 3GDBA 3RZKA 4PDMA 2W6JG 5ANQA 4DR5B 3A0RA 1K4CC 3WNPA 2GTAA 3BU7A 4NROA 3W59A 3ZHTA 2CAVA 2JICA 5A2QN 1OCZB 1PX3A 1JJ2U 4Z2WA 1F23A 3L75H 3WNXA 1H2GA 3AXEA 2ZR3A 2Q5TA 1ZZBA 1PK6A 2GH2A 1QJY1 3ASNC 1JTZX 1DQ4A 2CV6A 3OD0A 2WZR3 3OEAA 4FAGA 1SLAA 5FYBA 1G6NA 5B3SC 4E4EA 5IYDO 5E8AA 5AC91 5FPUA 5DECA 2PA7A 5JIUA 1Y76B 1JU4A 1UY0A 3DPRA 1XNDA 2G9ZA 3STLC 4OUMA 5T5JA 2XHKA 2LRPA 1OURA 5I0RA 1O59A 1WCSA 3OBRA 2NP0A 3POBA 3K3OA 4IGPA 5FXVA 1JOBA 4OGQB 3O1VA 5HCFA 4YJ3A 2QJVA 2XWJB 4OX9B 4CXWA 2QSAA 5DDJ3 1I1EA 3WNMA 2KQXA 2F4LA 4QXKA 3OMAB 4O4IA 1RMU2 4FIPC 4JC1A 4LKFA 5FZ6A 5IK4A 1XE7A 2VVEA 2X6AA 3ZXJA 4FFKA 1KD1W 4HL0A 1HV0A 2Q1ZB 4H7MA 5DAPA 1RINA 4DR5O 3HBZA 3QOPA 4PDWB 1S0IA 4XF9A 5B4NA 1PMHX 2AENA 4IXLA 5FP3A 3CJIC 2IFWA 1H2NA 1OOPB 1X8MA 3ABMB 1MPXA 1QDCA 2XPJA 2KKWA 2F1MA 4K9SA 3C7OA 3N7KA 3MIDA 3KF5A 4M3CA 4BQXA 3ASOB 4RFRB 1LJ7A 2VAUA 4DV5B 5B5EZ 1NY71 3AJYA 5J7MA 4AVSA 3ZYGA 3AK3A 3H01A 3LSSA 5CA1A 1E79G 3WINE 1OQEA 2WT1A 4YVSC 1QH6A 1FMD3 3IT8A 5CBLA 4OX9O 5LOVA 2VTXJ 4AEDC 5D2AA 1YCIA 4DR4B 3ATGA 1IPJA 3UJQA 1LAJA 2PHWA 2X09A 2WZR2 2NPIA 3MFCA 2X5IC 1T5EA 1EM1A 3KSCA 4WM7C 4XJWA 2G9FA 2DUPA 5CFDC 1RUJ3 4J9YB 2JX9A 2Z69A 2UYBA 2WNVA 2B1GA 5F6KA 4YW2A 1IS6A 1VB2A 5F39A 1K5MC 1V54C 2BOCC 1SQPH 4A7ZA 2YHJA 3I8TA 1M56C 5F9TA 1AL23 3ZMOA 1RUOA 4I30A 1AJQA 1CPYA 4MGQA 4ATEA 1NI8A 3I4IA 1ENXA 5DDJ2 4KHPB 4HT1T 4DIQA 3PN1A 3B69A 5C8CA 1QJEA 5E1RA 5LEKA 5JDBA 2XT9A 5EJ1B 3ZFFA 3GZUC 2YICA 2ZGRA 1CAVA 1W9TA 2P3JA 4NOTA 3WX5A 4DV5O 3I3DA 3K57A 3J7AU 2Q4SA 4Q4W2 2P7TC 1IPSA 3N7LA 3ZN5A 5EP9A 2ZE6A 1GUIA 3PDQA 3PU3A 4GWNA 2FHRA 3W7SA 2A06H 2JEMA 2GN7A 2FKXA 1REFA 1OPMA 4CPBA 2WZEA 1E5RA 4Y22A 4DR4O 1O9GA 2A75A 5DABA 3LGRA 1JOPA 3PVOA 3WNOA 4X64O 3SH3A 5A3MA 2ZMKA 2VZOA 3AMQA 3ZRWB 4HSLA 4P5YA 2BSKA 4XJ8A 3T0BA 1PMJX 1UY2A 2WN3A 2WO1A 5CB4B 5A3LA 3CS5A 1LEDA 2JDAA 2HWF1 4FZ1A 1GP5A 4DV0O 4WVMA 2HKXA 1Q5OA 3JCZA 1OH3A 3ZM8A 1X8EA 4I7ZB 1FMD2 3VBBA 3VBSC 3AP6A 4ZS3A 4KHPO 4EN8B 1Y9GA 2ZABA 1GKFA 1IG3A 4W6WA 4XFGA 4K7JA 2JJ2G 1JJOA 3VDAA 1GM7A 3VD4A 2W1QA 1XL6A 1UYZA 1ZYBA 4Y5Z0 2W68A 2TUNA 2P6HA 1QQP3 2Q68A 3LPGA 2QQJA 4LT5A 1RUJ2 1FNYA 3FX3A 3SKVA 3G6JB 3GJAA 1HJFA 1STMA 1F4AA 4J25A 1UXZA 4HZ3A 1AL22 2W94A 2RJ2A 2ORXA 2XQRA 5BXXA 1MZEA 1F51A 1P7BA 4PIYA 4FXGB 4O2AB 1LECA 1XQNA 1JQ0A 2RR13 2B45X 3N9NA 2FTKA 3AYCA 4RAIA 5BR8B 1QWRA 3N9LA 3IAPA 4QNHB 3P1IA 4P9GA 2J1UA 3Q9OA 3RYIB 1JZ3A 3HKDA 1ULFA 2GNDA 5FZEA 5EPAA 1EV11 2ADEA 1AR91 1QLEB 4YGBA 4LHSA 3HPLC 5IJ9B 2IXLA 2QKCA 1KB9F 1NTZH 1NT2B 1XNAA 1RUC3 4Q27A 1W8NA 3P6BA 5K1PA 2A3WA 4YGCA 2ZGSA 4RQFA 1TVKA 5DN2A 4FLXA 4EJRA 3CCJV 2FMDA 4XDPA 5C5TA 5B66Z 2DW4A 5FZ9A 4D6SA 3IIAA 4LTAA 2OCCC 3HQRA 4JYYA 3W7XA 3I7DA 2DWEC 2CH7B 3APQA 3E5QA 1H8VA 3ASIA 2JK5C 1SQFA 3DUIA 3UKVA 5FNVB 5J9PC 4I3PA 4R6ZA 1NE4A 2AREA 1U5YA 2IJIA 1W0OA 4C1XA 1W06A 1OPOA 2Q67A 4OFGA 4Z1MG 3WNLA 1FYJA 1YQ2A 3POJA 1UMIA 3B9CA 5CA3A 5BR8O 2X0LA 1U97A 4UXNA 1QQP2 2GC1A 4XJ9A 1SZBA 5H6QA 1JFFB 3THDA 1W2TA 1LNQA 2Y0OA 4NHKA 4ITCA 1CAWA 1Z78A 2UWCA 3UGGA 1CP9A 1G9DA 1WB8A 1FXHA 4KU7A 1ZA7A 4B3TB 3MICA 5LRRA 4Q1PA 1YTFB 1AR73 5FK8A 2ITDC 3OGJA 1MEC3 4UI9L 3H8XA 1FFTB 4YRDA 3HKEA 2RR12 3A21A 4UT5A 2D6MA 1C8NA 2Q8OA 1OH4A 5A70A 1F31A 4GKXA 1X59A 4DY5A 1KEXA 3VDDB 4GD4A 4I02A 3BEHA 3ZFGC 4IESA 5EWSA 3ON7A 4AGGA 3NMBA 4WM8C 3OUHA 5IHRA 3VQWA 2OKXA 3MZHA 2VOKA 2VQFB 1MACA 4MVSA 1RUC2 2P2KA 2AC1A 4R4XA 4ZU5A 2EALA 1ZX3A 4I09A 1LENA 4IYIA 3LA7A 4HXCA 1R1A1 3TEZA 5A7PA 3O1RA 1RUNA 4DR7B 2VZSA 4QHBA 5HXMA 1IS3A 2RJZA 3H8OA 1GM8A 3OPWA 4RQPA 4PQ9A 3RDIA 1VP7A 2RQ6A 3B7MA 5A3OA 1SA0B 1NQDA 3RQ0A 3BIWE 4XFAA 3OPTA 2PUSA 1WA8B 4F7ZA 4ES8A 4QGPA 3BA9A 1I6XA 2ZGKA 1SACA 4MW3A 4RL7A 4B3TO 1US6A 1A32A 2CU5A 4PLNA 1GMMA 3WB2A 5A3WA 5FZCA 5FZOB 1AR61 1B6QA 1NX9A 3RYFB 1AP5A 3IMNA 2W1SA 3RYKA 3FL7A 1T6GC 3GF6A 1D0GA 3VBHB 2K0GA 4BXFA 4WZCA 4MGTA 4N53A 2TBVA 4P9OA 5EZYB 4WFHA 3POSA 3THPA 3CCVV 3BPSA 2QQUA 3E97A 3ZRXA 1RGSA 1XUQA 1R73A 3EYPA 4QJFB 3NWKA 1ZM1A 4DW1A 1AX0A 4ZBMA 5E89A 2DMXA 5LMUB 3AX4A 5C3SA 1DYPA 2VQFO 2XJVA 4DO2A 3AG1B 1AR72 4E4SA 2JRIA 4META 1MEC2 4OQ9A 2BGCA 3N27A 3RVYA 3Q4HA 3T4DA 1OF3A 4QAWA 4KBZA 5FZGA 2OPKA 1PX4A 4RHV2 1VQOV 4DR7O 3M3CA 3MYXA 1CAXA 1A78A 2VO5A 3WW1A 4QKNA 4ZHQB 5A1LA 1AB3A 3T4HB 4YARA 3ZKUA 5I8YA 2PI5A 2E75B 4GMP3 1Q8PA 3ZKYA 3KD4A 4QGNA 4I01A 4HVRA 4BMEA 1YIJV 4TN7A 2QBXA 2WLPA 4GB33 3WW2A 3OGIB 4K8FA 2JS3A 1L0LH 5SV8A 5KC5A 4L11A 4UAPA 2DFBA 4UFZA 4QX5A 2ZCWA 1XE8A 4X1IA 3UT5A 1JOJA 1UXXX 5LY2A 5GZDA 1PO13 1FV2A 3UM7A 5D21A 4WBBA 5GJ6A 2GP5A 4UCUA 2A5ZA 4DPNA 5LMUO 2F23A 1FFXA 1LRHA 3CSXA 5FCCA 4K8RB 1Q8VA 3UKMA 4OI2A 3VHNA 1NXMA 3CJIA 3OE7G 4MGSA 2RS51 3KCCA 4C1WA 1VBC1 3ZS8C 5JAXA 2JJ1G 3SPCA 1JPXA 2BCCH 5FY5A 2YBKA 1TGOA 5JVDB 2LFSA 1DIWA 1UIJA 4XJUA 2ZZJA 2IH1C 1PGL1 2ARHA 2PYTA 4CCKA 3KHCA 1C8M1 5C7GA 1YTFD 1SQBH 1OZ0A 3X2QB 1AUYA 4N7IA 4RR3C 3JD71 1GN4A 1NZIA 3IWZA 5JH7A 2Q73A 2R073 1HXS3 3FJSA 2DWDC 2W52A 4YVSA 5JIAA 1R083 4AEDA 4F6EA 4R8HA 4PDVA 5H9CA 1AI4A 2KXLA 2CUGA 2HR3A 2EIGA 1NAEA 5A6ZA 3VD3A 2QWQB 2HWC3 3ZO0B 5IVFA 2B4KA 1SHWB 4WCEV 1UZVA 4X8AA 5JXIA 3AZYA 2E74B 4IE4A 1B09A 4LK6A 3EVKA 4RGGA 4CEYB 5E16A 1GO3F 4D7TA 4AE2A 1ZBE3 4MVRA 1PGW1 1GRJA 4GB32 1JYXA 4NIAA 3WDWA 1GANA 4CS4A 3JAWA 5ABJB 4LOSA 3WF1A 1XNKA 2IXIA 5C6CA 3E86A 3ZOIA 4GWIA 3OUFA 4YVWB 1O91A 3GM8A 3GCWA 1BHAA 5LA0A 4BQ1A 4D6RA 1CESA 3T30A 3WR0A 1TMF3 3CL1A 3NJXA 3TBDA 1PO12 2V4VA 4MXWA 4FPFA 2IWGB 3ACHA 1KP3A 4OCTA 1KQRA 5CA1B 1KBHA 5KHJA 2A6XA 3KVAA 5LOVB 2WWWA 4AI2A 1VBA1 4MXVA 4I0BA 1PL4A 4YW5A 3CLPA 3Q8EA 5FMCA 2GN3A 5T5LA 3I56V 3BYWA 4YZ2A 1SCRA 2DTWA 2IBZH 5KWRA 2VMHA 4AGRA 3PURA 3O12A 2WNVB 2H6CA 3AK2A 5H6RA 4I9WA 1GTOA 1UWWA 3DV8A 4C7UA 3P3PA 2UUAO 2R072 1HXS2 4FFFA 2MNGA 3E22B 1SDDB 1MS4A 2A7WA 4KUMA 4DY3A 2H8PC 3VHOA 3VBSA 1R082 5C8CB 1GYKA 2VZTA 5A33A 1QH7A 2HWD1 3CRMA 3SH5A 1VRH1 3NNJA 2Y48A 3OY8B 2HWC2 3EFFK 1AR1B 4XUQA 3H8UA 1HLCA 5FXWA 3VKNA 3R66A 5AFEA 1TA8A 2WSVA 3MPPG 4FFGA 2ZEXA 5FDBA 3ZN4A 1OKQA 1ZBE2 1RHI3 3UQ8A 3BHPA 1UCXA 4RGAA 1IBKB 3ZPYA 3NJVA 2JDYA 1XOYA 4DNYA 4HVQA 5CKQA 1COV3 5EYPB 3RI9A 2VC9A 1KD7A 1DQ2A 2BNMA 4NO4A 2BERA 2AYHA 3GBWA 4J9ZB 1HNWO 4Y1VA 1S0FA 2VZUA 1TMF2 3F7YC 5CADA 4X89A 3ZYPA 1H1IA 3AM2A 4E27A 2ZEZA 4PLOA 1QJX3 4QPIB 1FPOA 2IC1A 3CE2A 5FK7A 1BBT1 3CMEV 4MLOA 4CUCA 1GQHA 2BGOA 1TE1B 1QKQA 3NRUA 3O5SA 1R3IC 1WUVA 2UWAA 1ENRA 1NXD1 4NHYA 2VMCA 5G04L 1EZJA 1GP6A 5FYYA 3IDBB 2D98A 4P9JA 2XHNA 3C7FA 1KQSU 5ITZB 4XAAA 3TEWA 4QXCA 4JYCA 3BGAA 2DF7A 2WFF1 2BE3A 2OUJA 1Y3TA 3H1LH 4LF4B 1RITA 3VKOA 1OCRB 4GUNA 4D7YA 4TLFA 2Z5WA 1YUDA 2Y69C 1TNFA 1IBKO 4QU1A 4B1MA 5FO9B 1V6KA 1VLNA 1O6UA 5CAZA 1Y67A 1CVNA 4CCCA 1RXFA 5GLUA 1OT5A 3WVJA 5E6HA 3JCIA 1PZ7A 5IVEA 4DB5A 1BHBA 2MEV1 4EFBA 1K7DA 2DYSB 3UV9A 3IZOA 4DK0A 3N9OA 5CG9A 1M93A 4U3JB 5DG2A 1Q8QA 5DEDA 1QJY3 2HWE1 2RM23 3WW3A 4EKWA 3NNMA 3HKDB 4JASA 3R4DB 1UOBA 2UWBA 4RS5A 4XOGA 4CBCA 1RHI2 3SJQC 5IVVA 3B8MA 2VWKA 4PBPA 4JI8O 1COV2 1KECA 3BTXA 2W91A 2ZTNA 2WYFA 4I0AA 3ZHQA 3VOUA 4NTYA 1LU2A 2ERFA 3RMXA 5F5AA 4I0XA 2YFUA 4ORFA 4HPKA 4NWVA 2DVAA 2ZM6B 2V7QG 4QPGA 5A3PA 3SJCC 4H3WA 3S57A 4JQRA 4GKKB 1POV3 1OQ1A 3SCHA 2L9LA 4GYCB 1D2DA 2K2SA 4CS3A 5ISLA 4ICGA 3ZSKA 3C90A 3H3UA 1WW4A 4K21A 4NMIA 1RUF1 2AZ5A 2PY5A 1Z0HA 1HB3A 4CP2A 2QTSA 1Z7S3 4CU9A 1HN1A 1MSDA 4XMIA 5FZDA 1PGSA 2C24A 2CAZC 2OW4A 4MZUA 3GALA 4JI6B 3HD8B 5GLZA 1VAMA 1WCUA 4PDRA 1BVVA 1K73W 4QQ2A 4NRQA 2QZ3A 3IDCB 3B09A 4KWLA 5KHKA 3D5OA 2DQ0A 1CAWB 1V6JA 1G8MA 4MSVA 4KI5M 2GSYA 1H4HA 4GIQA 4LULA 1HNZB 3ZRVA 3VBRA 3C3SA 2WAMA 2J1VA 4MO3M 4WFFA 2YPDA 2VCBA 4JI0B 3ECQA 3HKEB 4XFHA 5APAA 1NYWA 5C3QA 3ZMUA 3VBOC 4YZ1A 2ZJCA 1Q81W 4XQ4A 3ZN1A 4NXNO 4KU8A 4DINB 5C9AA 1OLME 2RM22 2UUBO 4GKKO 3ZEDA 4ZONA 5DG1A 2YU1A 1ZRRA 4B8EA 4QE7A 2F17A 1QIQA 4JI1B 4GT1A 5LXTA 3BI3A 1HQWA 2VM9A 2GZWA 2CTWA 3DGEA 1NA1B 3TNQA 1W8FA 2BEOA 5BMVB 5FY4A 2EIKB 3FHIB 2VOXA 3B77A 2JD9A 2WQ4A 4LXLA 4XBFA 1VQ5V 3H8RA 4JI6O 1BVP1 1SRYA 5FLXN 2W39A 4G2KA 1YIPA 4N23A 4RQPB 4CS2A 3GB7C 4CCLA 3O1MA 4PBOA 2W6IG 3FB8C 1W6MB 2D5FA 1HNZO 1WN7A 5TISZ 3ES4A 2Q30A 1Z7S2 1HW7A 1DZQA 2BOJA 4DXZA 2QQMA 3N9PA 5FZ0A 2YS8A 5FMDA 5JOXA 4JI3O 2XJTA 4JI0O 4LFAB 3NNGA 4UBGA 5H9RA 2P4KA 1UOGA 1QHDA 2QM7A 3ZVXA 4LBMA 4HG6B 1BCXA 1NCQC 3ZSMA 5DZGA 1JZ7A 4P9YA 1JOYA 1VALA 1H8HG 1EAH3 3CRCA 4UF0A 3DECA 3OFNG 3PHMA 4JI1O 4Q4Y3 4NAMA 1BMV2 5T50A 1UU4A 1N34B 3U1XA 1I3HA 1YI9A 3I3EA 4R4ZA 1Q6HA 2WSSG 1FD9A 1VAVA 3NNLA 1RYYA 2WNUC 3RZGA 1F8VA 5CZKA 3Q4HB 3ZPOA 4NE9A 3AXDA 1GNYA 1ZLZA 1OLQA 2CDYA 3VD5A 5EC1C 1NKDA 5JJNB 1CAXB 1BQ0A 1SMVA 1ZZ9A 3KF3A 4A6OA 5B3SB 2FCUA 1K42A 3DN7A 4JV4A 4OZOA 2Y0IA 3SKJE 4XUOA 3NAPC 1MS8A 2MHFA 1TZOA 1FXKA 1YZBA 3POIA 1LUWA 4OHWA 4RR3A 2VOVA 4Q4X1 4QQOA 1VQLV 1YI2V 3LIGA 4M0HA 4OUEA 4LFAO 1H8EG 1UF2C 4C91A 1WD3A 4GH4C 5T55A 1H4GA 4Q4V1 3DXRA 2RJKA 3BY6A 4O4HA 1ZRIA 3VBFB 4FPOB 5FO7B 3UT5B 3NV4A 2QE7G 1K9MW 1TUBB 1HRV1 2Y6KA 3A0KA 1O9HA 3TWIA 1BK0A 2A70A 3H1IH 3RG0A 2W95A 1N34O 1FFXB 1SFYA 2PLV3 2QDOA 1VPHA 1LU1A 5FMOS 1W3XA 4LLFA 1R3KC 4I3GA 2WT2A 2HWB1 4AQYO 3A23A 1AR93 1OD3A 4K0KB 4A44A 4AEMA 2WWSA 4YW4A 2VZ1A 5FLJA 5LWBA 4B7EA 1HN0A 4HFSA 3ITQA 3AFGA 3T4VA 5JR2A 5FYUA 1VMJA 1EAH2 4RN5A 4LNUB 1D2SA 3KT1A 1VBE1 1SFNA 4DEQA 1UZWA 1F35A 1GZWB 4Q4Y2 1JN2P 1W2UA 4RYDA 2V1DA 2VVDA 3MLLA 3IN9A 4FQ4A 4BJ0A 1YWKA 4BXSV 3B8NA 3IB3A 5IT9N 3FWEA 4LUKA 4FLVA 4DUYO 4X62B 4E8DA 1H6YA 2XDVA 1AR83 4INDA 3VHPA 1RSOA 2TEPA 5FV3A 3HKCB 1KUQA 5FYSA 4XIKA 2C9KA 3RBZA 3LA2A 3J26N 1IXBA 3BB6A 5C3OA 2R72A 1JZ5A 3WDXA 1GQGA 3LWCA 1NH2B 4Y4YA 1JXNA 3ILNA 3UK9A 5FZ8A 3RW0A 2Q0OC 2R1BA 4AVAA 3ZX7A 5E88A 2XJUA 2EIBA 4IE6A 5BNPA 3N3HA 4UVCA 3ABUA 2O1QA 1LCLA 4AYUA 2NZ9A 1T6BX 1SLLA 4ASKA 4PA6A 3DYOA 4K0KO 4RWUA 4GZ9A 3FYIB 4WBNB 4JI5B 3Q8CA 3ABKC 2EIJB 3MHHC 1WLTA 2ZKOA 3MIGA 3TN91 4BQ5A 4BIOA 3WT3A 2ZINA 4MXWB 3IC9A 1DLBA 3JB8A 5FJKA 3BODA 1N1VA 1FS0G 3WUDA 2HYKA 2WLHA 2PLV2 3G71V 1AYN3 2VUCA 2YY1A 2RE9A 1POQA 5D8AC 3JUUA 1KKCA 4X62O 3B02A 5J2UB 1URXA 3OSDA 1YEWA 4UXAA 4P9WA 2VMDA 2WL1A 5A80A 5FZ7A 4DXTA 1DHKB 1GFF2 2WLJA 2Y0PA 2V5YA 2OT5A 3WG7C 2DVDA 3N9MA 4GKJO 3CCUV 1WW6A 5A7WA 4JI2B 3H1YA 4CDWA 3POGA 1LHOA 3WP5A 2Z4FA 4A45A 3OUSA 1R1A3 4XCAA 3NXSA 5JZGB 1AYM1 1ACCA 1ENVA 5L7OB 5L3CA 1WWYA 4P30A 1AI6A 2MK3A 2X7RB 3DGTA 5KHGA 5LRSA 1ENQA 2CY6A 1R64A 5FOJB 2OZJA 1U0AA 3ZHUA 4ASLA 1AR82 2YSUB 1YYNA 4UFKA 1OD5A 2A0LA 3ZYBA 2QKDA 3AKQA 1YQ5A 4JI5O 2D3SA 3O14A 1DDLA 1S2KA 1IKPA 1Y66A 5FPZA 4CH3A 2A6VA 5A1FA 4CCEA 3S5QA 1AR63 3ZXEA 1QMJA 3ZSLA 4O65A 5FPOA 2K9ZA 3KMHA 4L87A 5LP6C 3ENRA 1DF0A 3LE0A 2A7AA 1NS1A 3IC7A 1SS3A 4LITA 3ZMVA 2PN5A 2Z2SB 2FDGA 2JKXA 1NQTA 4JGYC 4XHBA 1RJ7A 5KAFZ 2ZHKA 5LHIA 1N3PA 4XHXA 2VH9A 2B5UA 2IJHA 3K9SA 4XETA 2G19A 4H7LA 4LK7A 5CFCB 5FPRA 1AXYA 3EXUA 3KWVA 5H9SA 4JI2O 4YG6A 4M3CF 4L92A 3CC4V 2PHTA 2JG8B 1QNYA 2YIAA 5GZFA 3SGIA 1JYWA 1Y4WA 4V2WA 2LW7A 3EO6A 1ZNPA 3V0BB 1AYN2 3BIEA 3LDDA 2EILB 1W0NA 3C3TA 1PO21 4JI4B 4LBJA 5B1OA 2HHHO 2D6LX 1YHQV 1B06A 1THZA 4PHZA 2G4IA 5L36A 1D5AA 2E9QA 5IVBA 1IBMO 3GBGA 3JBG2 1AVMA 2VNVA 4YSFA 3CJHB 3BCWA 3K79A 4W4KA 4JKKA 4RFT0 4TWTA 1OHFA 3K06A 1G9CA 4GX5A 1Y4MA 2SBAA 4BQYA 1R1A2 2BVBA 5BNOB 4OI4A 5FZ1A 1D4M3 5DMYA 1O8SA 4N43B 4CCMA 2R16A 4LF5B 3ILFA 1DTOA 2VUDA 3ME2A 2YUAA 4AXOA 3EBRA 1B3QA 1WLDA 1KDMA 3A2FA 2FDJA 3OW2U 5B1BC 3NJZA 1HRI1 5AVPA 2QKAA 5LL6Y 4UW3A 3K4AA 3WP3A 4DV2O 1NH2D 4L8JA 2ADPA 3FZ3A 4XDJA 1N36B 3AYDA 3DEMA 4EWEA 3I2OA 3K77A 1RPRA 1SQQH 2RS53 5DAXA 4B3MB 1JCHA 2GUZA 2EXJA 1X9PA 4ZY9A 5AFBA 3I3BA 4KNCA 3RWRD 1GM9A 4I50A 4RS5B 4XAEA 4CSWA 4JI4O 1EPZA 1RUG3 2UY9A 2JECA 3ACGA 5DN6G 3LNNA 4D0QA 1P7GA 4ASMB 1VBD1 2JEUA 2WLIB 2P5OA 5D1IA 3U14A 1XEQA 1W8HA 3I49A 2PZSA 4DUXA 2WLQA 3CB2A 3ELNA 3MW4A 2HYXA 1YLLA 1XNQB 1ODMA 4I0XB 1AR4A 5A6QA 3VBOA 3M99B 4JZGA 4XC9A 4HLTA 4QPGB 1WLEA 4O4JA 3IM0A 3H7YA 4FOVA 4LF5O 1IVSA 2DYRB 4YZ4A 1Q6IA 3MLJA 2F93B 2P90A 2QVSB 4J41A 3I2KA 3IKWA 1BLZA 3CZJA 5C4WC 1DGRA 1IHMA 4GALA 3S30A 1Q56A 3F2ZA 4GX0A 2LALA 5FUIA 4LBNA 2R30A 4E8CA 2YFZA 1RVF3 4UWDA 5CBHA 3FB6C 1N36O 5F3GA 3L73H 3T4ZA 4B3MO 2Q7EA 4L9BA 1D4M2 1JVMA 3CP1A 4IEWA 5L3BA 3JATA 1ZWIC 1DQ6A 4XF0A 1WLCA 1JYVA 3W7UA 1DG6A 3FE5A 1ULEA 3WDVA 1NZ6A 3VBRB 5FYCA 4R9BA 4LBKA 5FBJA 1MZ5A 4L8QA 3M70A 2E51A 5DQ0A 1UPGA 3MHSC 4HNAA 2FB5A 3V65A 4GULA 1H2KA 4XTMA 4CRQA 5LHGA 3H9VA 3ZFEC 4X8NA 2WUHA 3V56A 3RZJA 5IJ0A 4ZXEA 4X66B 1FAYA 3QF7A 1RJ8A 5C9AB 2IH3C 1WLWA 5DUUA 5FLIA 3AG3C 4CDXC 3NKGA 2JE7A 3CCEV 2VQEB 3AVRA 4XZUG 3OOXA 1Y43B 5FZHA 2PTMA 2I74A 2WLNA 5LXTB 4XJZA 1RUG2 3SISA 4K20A 2QQKA 1PGL2 3WF3A 3G4SV 1ZBA1 5EHDA 1ALYA 4KGQA 3G7DA 3M7MX 4OQ8A 3J9SA 5GALA 3ZYJB 1NCRA 1SPPA 4HSJA 5CA6A 4JHTA 1XILA 3LSDA 5HCAA 5JSOA 3CCQV 3SMHA 1NE6A 2K9PA 3T1YO 5F1RA 3MIFA 3OGSA 3G67A 1W39A 1JA8A 1ZZ8A 4WZFA 2ZIOA 4HETA 1H30A 3JCUZ 5HXVA 3GVMA 2HWD3 5I93A 3ETDA 1ULDA 1VRH3 2C0ZA 1KDKA 3AG2C 1VF7A 2LO1A 3GCXA 3H42B 1VQ7V 4LF6B 4TV9A 4LF9O 2B46X 1KFUL 4AF9A 2EIMC 4QD2A 2OPWA 4V2VA 4UCOA 4BM8A 5CKMA 4TQFA 1W0KG 3K4ZA 1R6KA 1ND2C 5LBBA 1SBEA 1CAUB 3HNMA 4CUBA 5J37A 2ARCA 4FPPA 4PCRA 1G6UA 1VQNV 1RVF2 2D40A 4GH4A 5J3UA 2EIEA 1MS9A 2DOSA 3RJRA 4UF0B 1PV0A 5LHHA 2Q1MA 3VDCA 2VQEO 2XJSA 4NYKA 1WA6X 1SLIA 5IDJA 3JASB 2ID4A 5JCOA 2A6ZA 1CEZA 3ZXKA 2QR4A 4M4RA 2ZGMA 2AEYA 2P34A 1W6QA 4N9HA 1YJNV 3KS7A 1PVC2 1TME3 1KC8W 2Y8KA 2GDSA 1DGSA 3ZBHA 3J8F3 2P4VA 4RUFA 2VVFA 3I2JA 3O7OA 4XW3A 1RM1B 1ZUQA 1J5EO 4QQHA 4Y33A 3S6PA 1OCZC 1W3VA 5IAVA 4HONA 1VP6A 4FP2A 5LA6A 1QOOA 3KZ4C 4LF6O 1VBB1 4QMAA 3SHRA 2WFF3 1O3RA 3DXTA 1FXKB 4TTGA 2CL2A 5FP4A 3L9DA 4E9KA 4XPVA 4CEWA 2VBBA 5L3GA 4XVHA 4NB5A 1AX1A 4BB3A 4CC6A 3TETA 1ASJ1 2VU9A 2WS91 1I5XA 3DXRB 3OEHG 5FL7G 2RJLA 4YJ2A 3D4KA 1NT0A 3RZZA 3KHBA 4H14A 3THTA 5LGUA 2XUMA 2M6YA 3WOGA 1XOUA 1LR5A 3K08A 3N2KA 2UXCB 1QR9A 1I9RA 1IBLB 1GP4A 4K8XA 2X6CA 4IGGA 1XBFA 4TOIA 2ZD9A 2RVAA 4I4TB 4IT5A 2GNBA 2HWE3 3WDTA 1X4TA 3E89A 4B3NA 4QKDA 4J1XA 3SYQA 4FM2A 1HDJA 1GOFA 3BOWA 4IV1A 4LE3A 4PDWC 2JWPA 1O3SA 4OI1A 3RYRA 4KWJA 2B39A 1XQ8A 1V6MA 3SYCA 5FPBA 3ZYIB 4YYOA 2Z3YA 1OOPC 2ZA9A 3QH7A 1DZRA 3JZVA 2P3KA 2JDZA 3HT1A 2P67A 4DV6B 1REDA 4KGGA 4J7ZA 3T0DA 4FCAA 5IY5B 2LM3A 3CQOA 1BXHA 5FY1A 3O9OA 1V9U3 1GU3A 3L9JT 1W6PA 3AZZA 3ASOC 4LLOA 3KB5A 4F6RA 2P6CA 4PIZA 2VW2A 2Q7HA 1TME2 3ZIXA 5ANNA 4LIUA 4DRXA 3K5NA 1RUF3 1RSOB 5KMGA 3J8F2 1W6NA 3GZTB 5ERLA 2JDMA 4FLWA 3RZLA 4CP0A 2ZHMA 3TK1A 1CQ9A 3KM5A 5BXZA 2WINB 3L72H 4IV3A 2OVUA 3SCFA 4U2AA 2H3OA 3E2EA 4Y1UA 3FBMA 4B4PA 2W1WA 5BNPB 2QQWA 3LUTB 3CEWA 4LIVA 2GV9A 4ZI7B 4QHZA 3LDCA 4E4HA 5JQGA 3K3NA 4XMAA 2Y64A 4F83A 1ZZ7A 2BWCA 2ET7A 2C4XA 1C57A 4PDLA 4LBQA 2DDUA 2WZ8A 2D7FA 3QO7A 4LF8B 1BL8A 3B9IA 1YO8A 2AACA 4QX3A 2ZIMA 4EN7B 2HVJC 3PJSK 5DAVA 4IE0A 4XE9A 3NL1A 4AG4A 3RSJA 2W0FC 1RMU1 3HB3B 5H2FZ 3MW3A 2WPDG 4FFBA 4FAHA 1PIV3 1K8AW 2VXRA 5LP6A 3DF0A 4OHXA 1R6TA 2WSUA 2XMLA 2VW1A 4P5HA 3J7MA 4COZA 5A32A 2KSDA 5JOZA 2ZMNA 2YDEA 4JGYA 1MNGA 2VUJA 3QH6A 3LDEA 3KV4A 3A0HZ 3RT3C 4JYAO 4CDWB 4LBEC 4LO7A 3KV9A 2XB6C 1NBMG 2GTSA 2ZDIC 4F8AA 4O2BA 3QACA 2A1XA 3VZNA 4QPYA 4KWKA 4CXYA 2X53S 1P8JA 4FXKB 3BVCA 2R063 1V9U2 4AWDA 2YEVB 5IYBO 3OTOB 1F2NA 4CUGA 4PA3A 4DUZO 4YW6A 1N1YA 1XC6A 2Y6LA 4D6TH 3A8TA 4MVTA 1S1AA 3AMPA 5JXJA 4X20B 1XDCA 3G80A 1NR1A 2Y38A 4CC5A 2VG9A 2ET1A 2Q69A 4QPJA 4X1YB 3H1MA 2LJ2A 3CIHA 3WV6A 2EBOA 1IS5A 1HKDA 2WZR1 4EN6B 2GMPA 5IE9A 2J42A 1MABG 1D7PM 1VIBA 1T2XA 5DAWA 3OAAG 5IYYA 1RUI1 5JCTA 2VQ0A 3T1CA 2CNAA 3POFA 5F5QA 3HIFA 4QX2A 4ZKTB 3STZC 1MS1A 3D8CA 3VBUA 3J81N 3BTZA 1EZVH 5DDJ1 3CCSV 4J11A 4LHLA 2ZQMA 1S72V 2ZGLA 2ZXWB 4U7OA 1MQTA 1RUH3 4LO4B 3VDBA 4QHOA 5AVAA 1PIV2 3CX5F 1GBGA 4IW3A 1P4RA 4YFZA 5LBEA 4FLUA 3G6EV 4XEZA 4O9GA 1COWG 4CU8A 4Q4W1 5FOBB 1DF5A 5FMOL 3FB5C 1UKGA 4AFDA 4YM3A 4URAA 1NR7A 2Q8DA 1CX1A 4J80A 5FAXA 5EYXA 3IMMA 1Q43A 3JD1A 2XAHA 4D7SA 4P9IA 1QLEC 4LFBB 1JMKC 2UXDO 1UQXA 3PUQA 2IXJA 2GC2A 1O4TA 4YFWA 1QJFA 2DCZA 3LQCA 4DQAA 4CZSA 1YXWA 1G7YA 4A7YA 5TSWA 4YW3A 1YC61 1OMIA 1A3KA 1VARA 5H5NA 3IJ4A 4DYLA 2FDHA 2QTOA 2ZX4A 1G9AA 3THCA 4XF3A 2R062 3GYDA 1H9WA 5KLVH 1GWLA 1LUVA 4DZGA 1MZFA 1BJQA 4GX2A 4Y20A 2Y34A 2JG9A 1WNSA 2EZPA 5BY5A 2ZBJA 2HWB3 4MOAA 1FMD1 3OUJA 2BVVA 4NUBA 2P17A 1J59A 4O4LA 1LOFA 4XUNA 5L9RA 1YHFA 4LO8A 4XZPA 2GUZB 1VF5B 1S0EA 4CH5A 4UUJC 4I50B 1REEA 3HKBA 3K5OA 1V0AA 1QNWA 1NLRA 3LFMA 4L0PA 1RUJ1 1VEWA 4Q0UA 5FP8A 4PT6A 5C33A 2N74A 4L97A 2IUWA 1AL21 1AL0G 1NTKH 3TXSA 1QEXA 3RWKX 4LFBO 1FOD2 2HEWF 1PPJH 1TNRA 4LORA 5F2VO 4ZS2A 1XJAA 3PMEA 4DV3B 3AMMA 1RUH2 3Q8BA 2DCJA 2UUCB 2E6VA 5JPNB 5C3PA 4AEJA 2BGPA 2J7MA 1Q90D 1KJRA 1TAEA 1H38A 3VDDC 4OXSA 1BZKA 1Z5WA 4JGZB 5B2GB 2ILMA 3B2EE 2PQSA 4MGYE 3J7LA 1J1TA 1YSCA 1HX6A 4EEQA 4JZ2A 1PM4A 3NV1A 4I0WB 2PAEA 3L2YA 4UCTA 4Y4RA 1F4NA 2W46A 1CGPA 1F4HA 4AQ6A 3OG2A 5GLTA 1PZ9A 1K5QA 4F4LA 1FXVA 4BAYA 3JATB 4DXRA 5D5PA 1E5IA 4X64B 1JZ8A 1H2MA 3ZXFA 5IYZB 3WQBA 4D6QA 3MUZ1 2F43G 4B3RO 3EXAA 2YYOA 1QF3A 4Q2FA 2GH8A 4DV0B 1ND2A 3VKFC 3TYJA 2J1AA 3GJBA 2HWB2 4UYBA 4UFMA 5IJ0B 3W7WA 1NLSA 3KGZA 4N9IA 4XQWA 4ZU7A 4DV3O 2FMLA 4JHZA 4FO9A 4EWAA 2VQAA 3IPVA 4GMP0 5A7QA 5DM6V 1DLLA 2UUCO 2VNRA 4M3CE 3VBHC 1QQP1 2J1EA 4GCZA 5FTTC 2JD4A 1L7LA 2QM4A 4RQEA 1ND3B 2ZXQA 5KXCA 4JTNA 3QTCA 1FT9A 3RNSA 1GK9A 3LOBA 2RN9A 1NCRB 1SPPB 2QGNA 3ORJA 2RS33 1WMEA 2C1FA 3E35A 4BLIA 2GU9A 1MS5A 2O8OA 3H7JA 4Q0SA 3OMIB 3ZR6A 3MGUA 4FBFA 3EHBB 3N7MA 1SFPA 4PQQA 3AG1C 5IFPA 3MV01 1GZCA 4QGMA 2RR11 3KG2A 1UFIA 1RPOA 2HG5C 4TV9B 3RJ2X 1W0JG 5EJZB 2ATFA 5CEHA 5EC2C 1JZ2A 1Y7BA 2EVXA 4A4AA 2XR4A 2AH2A 2ZGOA 1Y76A 4TV8B 1S77D 1DLCA 2O8QA 1LKNA 1RUC1 3LEGA 3VZMA 4FI9A 4KMQA 4W65A 2DTYA 4DXWA 4A41A 3ABLB 3E6CC 4DOUA 3LOIA 2BZDA 1VMGA 3OYWB 3DTUB 4GKYA 2XLAA 2JB4A 4C90A 4DR1B 3POYA 2C2AA 4AI8A 4X88A 1W6QB 3UO2A 2XKOA 3D0SA 4LH6A 4IUGA 1YJ9V 1G8WA 1I08A 1PO23 1Q3EA 1UU6A 1ZRFA 1UIKA 4JAAA 2E63A 2EJRA 5I8TA 5HCHA 4QX7A 4X6RB 3SR2C 5EIYB 1W28A 1XL4A 1I94B 2HKOA 1J58A 3SYPA 5SV5A 1N32O 1OOPA 2K46A 1S3JA 4HBNA 2IM9A 1VQMV 5JWPA 3K46A 2VECA 1ZAUA 1IQAA 4EN0A 4X9QA 4CDUC 1CR7A 4CEWB 1XPWA 5E79Z 5DPNA 4OYUA 2RMU3 4NR1A 2ARBA 4FSJA 5F3IA 3HEIA 1OVPA 4Q0QA 2BV4A 2RS32 4TSVA 4P08A 2AHYA 1JUIA 2QQOA 2WR9A 1S0BA 3X2QC 1FPN3 4YJ2B 2RV9A 3ETGA 1MEC1 2R0HA 1LODA 4N8MA 5K1XA 1OA3A 5LZ6A 2VQUA 1TVGA 4RHV1 3WQ7A 1BKZA 1X7NA 3E1F1 4DR1O 2D6KA 4DW0A 5L9VA 5IW0A 5FZBA 1QGLA 3UESA 4AK3A 1H8TB 1LTEA 3ZDVA 4MGZE 1PNMA 3AB0A 4IEOA 2VMIA 4IV1B 4CEYC 1EPWA 3JD3A 5F3EA 4AAPA 1I94O 2QUOA 1P49A 4B1LA 1VR3A 1FJGO 4QKBA 5ABJC 4E4DX 1U5ZA 4Q6GA 4JI7O 2XBO3 2ZMLA 5K7PA 2VS0A 4YVWC 4LH7A 2VCMA 2RS11 3SXWA 4RSUA 2R6QA 4LUMA 3ETQA 2VOWA 1PO22 1JYNA 4W8JA 4FK5C 5KMGB 3CD6V 1R093 4DV7B 2LFRA 4XXAA 4CDQA 3LDRA 3WF4A 3LPFA 4IV3B 2ZR2A 3SPHA 2W9XA 3N2GA 1H9PA 2RCVA 3ES1A 2XONA 1HR0B 4D3WA 1BEV3 1BK1A 3W9AA 4QX0A 2OWOA 3BA8A 2ZDIA 1B35B 3PLQA 1XE0A 1KU9A 2EULA 5JQGB 1US3A 3HJRA 4EB6A 3RYHB 3LB9A 3OPZA 3RYPA 2RMU2 3A7QA 1OXCA 3NKTA 4BW9A 4LBQB 2QKSA 2YUEA 4YWAA 5J96B 2LS6A 3SEPA 2WNVC 5CB4A 2OIIA 2EX3A 1XNRO 1D2QA 3ST7A 3SCGA 1FPN2 4XUPA 2UU9B 4B7KA 3ZYFA 5BNQA 2PXJA 1NU1H 1R6NA 5LA1A 1RB8G 2AGSA 2YGLA 3IIIA 5GKAC 1AILA 5BNNA 5C8CC 4FFBB 4RD7A 3ZN0A 1LEMA 4YIPA 4OI0A 1W99A 4AVCA 4COUA 2OTLV 4JAUA 1V55B 4OULA 4GMP1 4U3FH 2FMYA 3ABZA 1F4MA 5DAQA 3PVNA 1S2EA 2WO7A 4DV7O 3K3WA 2XLGA 5FYTA 4XQDA 2A3QA 4GB31 3B5LB 3DKQA 2KR2A 2Q0AA 1XMQB 2YXSA 1HR0O 1KFXL 2ZNJA 2BBAA 4MHRA 1M57B 1ODNA 2DVBA 2P4EA 2XBO2 3MDSA 3CPWU 4XACA 2CHHA 4YZ3A 2WABA 5C3RA 2XQXA 1QU0A 4GXLA 2QE3A 4DRRA 2ZX0A 5C71A 3U11A 3WG1A 1NOVA 1R092 2WN2A 4QPIC 3F5WC 1N1SA 2E33A 4WVVA 2XTAA 3LFIA 2UU9O 3USUA 3OGRA 4BE3A 4ATFA 1WKYA 5EQUA 1BQPA 3VGIA 4CZZA 4IETA 4UW5A 3AFKA 1BEV2 5K0UB 5FZLA 1P84F 2YI8A 1UPSA 2XJPA 3T2OA 3PUIA 3MO4A 4Q26A 3UYJA 3K4DA 1PD3A 4X6QB 1CN1A 2YBSA 3SNMA 5LBCA 5LK7B 3KLSA 4MVMA 4K40A 4HN1A 4HKWA 1HJGA 1ZVFA 5J36A 3KQ4B 3ZYHA 1OCRC 1MVEA 5FY8A 4BLJA 3VBUB 5KHIA 4Y3OA 1PZ8A 3U37A 2R071 1HXS1 1CJPA 2IVJA 3LEMA 1XMQO 1IKQA 2JDUA 1BQZA 2QDRA 1R081 4UFLA 1SDWA 2PFWA 2G38A 4NIDA 1GV9A 3CRAA 5LGNA 4MT8A 1MQTB 1PM7A 3I54A 1POV0 2BOBC 1VIWB 1L1FA 2HWC1 5EV7A 2Q8EA 4IEVA 4PA4A 1QLNA 5JJJB 4PI2A 3TGUH 2F6BA 2DYSC 2H0VA 1G9FA 3AG4C 1O8PA 3OGVA 4L99A 4FPCA 1VBB3 4LO6B 1RIRA 4GZRB 1JFFA 1ZBE1 5LB6A 1JS9A 2NR5A 1W0PA 4CP9A 5FKBA 3VUOA 3W20A 2VGDA 3WW4A 3AP9A 3VZOA 2FDFA 2VMFA 1L0NH 3FFQA 3AKRA 5JI7A 2WS93 1PK6B 3FUOA 5B1AB 5B1NA 1QHTA 4KBBA 1ORQC 4Q0VA 3R65A 4UCRA 1TMF1 5FPVA 3VQXA 4N7UA 5I0TA 4E2QA 2K1EA 3QD6A 2F66C 4COWA 5CU1A 1SBDA 4NAOA 4I2OA 2NMNA 3IFXA 4J42A 3DPRB 4DV1B 4Y20B 5FMBA 2X10A 5FR3A 2ZHLA 4ZHNA 4MGIE 3VDDA 1UMHA 5GTHZ 2JG9B 3O1TA 4YIOA 2YI9A 1Y74A 4NKGB 4AVTA 3K2OA 4LP8A 2OTJV 4YJ3B 3RFRA 4R7CA 3EQEA 4P9LA 3FHAA 4QB1A 4BA6A 1J95A 1XXNA 5IK8A 4O4IB 4XDQA 1VAKA 1RUE3 2HLEA 2YBPA 1AJPA 2EZOA 2UU8A 1EYBA 3M3EA 2MPFA 5LYJA 3HKBB 2QM8A 4LBQD 2H0BA 2X5IA 4IEYA 1CONA 2I2SA 1QU7A 4XABA 2LGQA 3RVZA 5ACA3 3JQWA 2BQPA 4WM7A 2ZPXA 3JD2A 1UMZA 2ETEA 4GQ7A 4XIOA 5CFDA 4BWOA 1SA0A 3SPGA 3KV6A 1K5MA 4G27B 3UGFA 3QCWA 3H0OA 4TZDA 2UUAB 4Y1YA 4UBHA 1CIWA 2XLFA 5KBFA 2WO3A 3NJYA 1XRUA 5JJEB 1V6LA 3ETEA 2AGAA 4ISQA 4YW1A 2ADDA 5LASA 4KH9A 4M3CB 3RYFA 3I55V 2XHBA 5LA9A 1OCOB 4DFSA 3FB7C 1RUD3 2YC2A 2E5LB 1NG0A 3VBHA 3BCCH 3QO5A 5EZYA 1OCCB 4DV1O 3K75B 1W8ZA 3TB0A 2Z5UA 2JXAA 1R3LC 2R9AA 2GMEA 4Q8KA 3O65A 4NVPA 1PNGA 1COV1 2JJ6A 5JUVA 1NA1C 1E5SA 4TWKA 1ONAA 1SLCA 4YGEA 1A8MA 2EIKC 1N0NA 4N90A 3NV2A 3ZXLA 4DV4B 4QX8A 4C8DA 2CGPA 2R043 1HNWB 1FATA 4ZXKA 4A6SA 4UB6Z 4QB6A 1G1XB 4QQPA 3BVOA 3UO3A 1XU1A 3JALA 4RQPC 3SPIA 4AFBA 2OIEA 3OT7A 1XYOA 1N8RW 4BCUA 4ZHQA 3LCPA 2JB8A 4ISRA 1W6OA 4WVWA 1LGNA 1QVGU 2XAQA 3CJXA 4G4FA 1LOBA 2JDPA 5FXXA 3RI8A 3SDLA 3CNAA 2QJ1A 3CZUA 5J48A 1RUE2 4CCDA 1PNKA 4TXWA 3ZFFB 1S76D 3IPVB 5FWJA 5FUNA 4LA2A 2YIBD 4GJYA 1CAVB 3P3NA 2E5LO 4M4PA 4BYYA 5ACA2 2EXHA 2I07B 5T54A 3WXPA 1B04A 1M4WA 2BP6A 1AVBA 2XXZA 3JAKA 1GAXA 4AHCA 4FOYA 1SC5B 1CWPA 4X65O 1BZWA 3J7HA 3O1UA 3FHQA 2CK3G 1MVQA 4Y22B 1XNCA 2R49A 1DGWX 3KCYA 2QEXV 4DV4O 5FFOC 1PNLA 4CU6A 2KG7A 4MG2A 3CMGA 2C9AA 2J1SA 4HYOA 3IDEA 1AHSA 2YMZA 3WF2A 2O0OA 3E6DA 1RUD2 2BSKB 4O61A 2RM21 3BOPA 4L2NA 4AVBA 2GMMA 4CDUA 4FLTA 4XTPA 4KP4A 4WVMB 5JVDA 1QCEA 2WA4A 2JIGA 1RUI3 3HT2A 1WMXA 2PHRA 4MVOA 1S0VA 3AC0A 5IATA 5LBQA 3OBZA 4JI8B 1M1KW 1FV3A 4PF1A 5EBWC 2Q5ZA 2JDKA 2P3YA 2G9GA 2E76B 5BUVA 2R042 2WQ8A 1QNMA 4COYA 1OVSA 4XFCA 3UETA 4IEQA 4YY3B 4W6YA 3WHUA 2VZ3A 5F2WA 3FD9A 1WPXA 3VBFC 1VB4A 1POV1 5IWAB 5GONA 1L3JA 2OUHA 2BFUS 2LUWA 3LSQA 4IGOA 5EIBD 4BQ4A 2XKPA 2ZGQA 1HNXB 4OHYA 5FY7A 2XG3A 4Q4W3 4FMTA 2VY0A 1Z7S1 3O0VA 1E1RG 3SITA 4CEYA 4CU7A 3ZN6A 1UPIA 3VKLA 4P2ZA 4HK8A 2N05A 3AZXA 2UXNA 5ABJA 2ZEYA 1EN6A 3IAYA 3B93A 4LWSA 3JAMN 4YVWA 3IGAC 3POEA 1SKVA 5DUVA 2NLRA 3H1WA 4RUEA 4FVMA 2PYLA 4QQLA 1QXRA 1BMV1 1UZZA 3R0RA 4D8MA 5AC93 2IU0A 1MR5A 4FT8A 2QQVA 4BDVB 5JVVA 4BQ2A 5FREA 5FQ0A 2ZE7A 1DF4A 1XNTA 3IDAA 2DN9A 2NM1A 1GKBA 4MHUA 3O1OA 1SETA 4YY3O 2VTFA 2GAUA 3CO2A 1OKOA 3JD4A 1TVKB 4P14A 4NXNB 1WW7A 2Y6JA 4ASUG 5L3DA 5IWAO 1KYOF 5KR7A 5H9PA 2PQQA 1QJX2 2UUBB 2WAOA 1R1ZA 2QZ2A 3ZFGA 1HNXO 4XDLA 1RUI2 4GWMA 4WM8A 1OQDA 1YITV 2W92A 1UX6A 3BABA 3USSA 3E22A 5JOYA 4O9EA 3I2IA 2RG4A 3FBYA 3A0NA 2WAAA 3NQHA 1GN2A 3WCSA 1OJHA 4QXHA 2EIJC 1I5PA 1XSQA 3OY8A 3MV11 4BH9A 1DFQA 1QXPA 3WB0A 2E7TA 2A79B 2EINB 4PIXA 4XILA 3AP7A 3Q8AA 4CDQB 4KL1A 2HEPA 5KXDA 4IQPA 1W8UA 4QM8A 3N2GB 4JV5B 1SF9A 5EK0A 4IERA 2NMOA 4JI3B 2OXBA 4Y5SA 2W2IA 4DS0A 1ULCA 1SQXH 2JGDA 4WVZA 3I59A 3WUCA 5EYPA 2QNKA 3PNAA 4QIWF 1EAH1 2WT0A 3HN1A 3SQOA 5DUXA 4JVAA 4SBVA 5EFUA 1QJY2 3CEIA 1HDKA 4EB6B 4M0NA 4BW5A 4Q4Y1 2HFEC 3OGGA 1E5HA 4CPBD 1J3PA 5JZGC 5L7OC 5AC92 1W04A 5FZFA 1UU5A 4QPIA 4FOWA 2WFPA 3DC5A 3ZHRA 1KRIA 2WO2A 2CTPA 1IGOA 3D0JA 2B8MA 2AEZA 2NN4A 3AYAA 4R9AA 3CC7V 3QG5A 5DXDA 5BNNB 1W2OA 4XBLA 3TEXA 3ZSEA 2W47A 2VBPA 4MH0E 1LB2A 3CC2V 2YIDA 4XFIA 5FZ3A 3SYAA 3N36A 5ITZA 2XOKG 2ARAA 1R1BA 2FCTA 4WFGA 4BR6A 1OA2A 4G3YC 3VD9A 1Z5VA 3P32A 4Y1XA 2AZ2A 1W8OA 4JRAA 1SCSA 4AVVA 1GMGA 4JV5O 3VZKA 3T2TA 5CISA 3CKHA 4IE5A 2QA4V 4LC1A 4WFBV 1YI7A 2QDNA 4N53B 5FP7A 5CFCC 3A0BZ 3RPQA 2D3PA 1SEFA 1S5HC 4AI3A 5IK5A 2HLDG 4DRVA 2JG8C 2IVIB 5FO8B 2ORZA 4ZOLA 1LESA 4NHXA 2PLV1 4U3JA 1DGRN 3CYOA 1O5LA 4QPKA 1RL3A 2EILC 1NY72 3USUB 1X9TA 2HWF3 4JDOA 4AQYB 3DYPA 2BTQA 1YJKA 3ABTA 2XOMA 1D5NA 3H1HH 1UL9A 3M1HA 2P1BA 1OUSA 3RWNA 3ASNB 3E83A 5L3FA 1S5JA 1AI7A 3W7TA 2JENA 1JX9A 2C5DA 2VOTA 4AFAA 1JODA 1LHNA 3WD5A 5BNOC 1Q7YW 1GNZA 4N43C 2GSMB 4C0BA 2BWAA 1SESA 4LFCB 3WQ0A 2E32A 1DGWA 1H1AA 1AR81 4DUYB 3CXHF 1MOFA 1VQ6V 2BNNA 3ZMSA 4SLIA 1YVWA 4BIFA 2ZGUA 3LEKA 4X1IB 5JI9A 4XYXA 4TQDA 1W2NA 2CTQA 2VW0A 4YM1A 3A22A 2Y60A 1J3QA 4LBOA 1QJU1 4UCSA 2ES3A 4KG8A 4UVBA 3NNFA 1SERA 4EN9B 3L74H 4CP9B 2MW2B 3HN3A 4E2LA 4RS5C 1UAIA 1UY3A 3CJIB 2RHPA 1EV13 1W9FA 3I3MA 2VQTA 4CUAA 1K97A 2A9HA 1DZTA 4QDSA 2DE0X 3OM3B 2LQTA 2WC2A 3CDZB 2YXYA 2C6SA 5KX5A 4J10A 2D43A 3FAVA 4OPAA 3ICXA 4DR2B 5K4LA 3INAA 1EP0A 2HEVF 4RHV3 4QPGC 3S5AA 2XAGA 5E1AC 1C5HA 3M7AA 1AYN1 5LW9A 1JH5A 2R7EB 1Y74B 2DWRA 2DYRC 4LFCO 5DZEA 2E53A 2HWF2 4XCBA 4HOOA 5JH7B 1OI6A 3U07A 3MIHA 4YVSB 5LBFA 1NA1A 3JQXA 5BMVA 4AEDB 3JBG1 3D36C 1UOFA 4XBQA 3AYEA 5GZEA 4R9CA 5LYJB 4M01A 2OYZA 3LDKA 2X5IB 4GKJB 1AZDA 4Y26A 1K5JA 1VE0A 2EA7A 4WM7B 1GOGA 4UV9A 4DXSA 3VD7A 5CFDB 2RS13 1PL0A 2GC0A 1UNBA 1HB4A 3O1PA 1K5MB 1V54B 2NNUA 2QWRB 4YHHB 1ZREA 1M56B 3JAWB 5FUPA 1ZX5A 1W6MA 1W59A 3VBRC 1IS4A 2F95B 1M9NA 5A7SA 3IBMA 2AW9A 2W08A 1PNFA 3VQYA 1H2SB 4IGQA 2BUKA 3AKTA 2P5BA 3AEIA 3THOA 4IL7A 1YQCA 1SZTA 4DR2O 2PAMA 3L2HA 5A7NA 4BISA 2Q6AA 3OEEG 3HBKA 3CCRV 4BOWA 5EZWA 5C9AC 1PVXA 4DUWA 4MTFA 5FP9A 5KXEA 4LF7B 3MUY1 2GHYA 3QO8A 1AXKA 2VWJA 1UJWB 1EV12 3C2UA 1AR92 4Q1RA 5JLVA 5T5PA 3AL5A 2JIJA 2C26A 4UB8Z 1N0JA 2JVDA 3CHXA 3Q8FA 4BWAA 2JKBA 3TCUA 3SPJA 4IYHA 4A3XA 2D3RA 4KFMA 3JALB 1XI1A 3W5MA 4AILC 3HR9A 5BY1A 3HNBM 4GAZA 2EXKA 4K6BA 1W6OB 1BSMA 4CH4A 2VD7A 4YHHO 4NRMA 4FPLA 5A3TA 2HHHB 2HJFC 3D3IA 3VBSB 4GWJA 2Z42A 2Q8CA 3D3QA 1AI5A 3E8BA 2JS5A 4NRPA 3KCXA 4WF9V 4TYSA 3ZSJA 5A33B 4IHJA 1IBMB 4J7KA 4AHWA 3RRDA 4JKLA 4S2HA 1HQNA 3WDYA 5IUQA 1D4M1 3FLRA 3VBFA 4IEUA 1X33A 1EN5A 1TUBA 1ST8A 2RS12 3JAKB 3EB7A 4LF7O 3FUQA 5CYYA 3WHTA 3U4XA 4R52A 5JMCA 1WMDA 3LEIA 3WCRA 3I97A 2GP3A 4WV8A 5CIRA 2N7GA 4DV2B 2KG7B 4JX0A 4CCJA 1S5LZ 2VZVA 3WF0A 2VMGA 5IYCO 2ZAAA 1JBCA 1RM1C 2DJVA 2O57A 1XMOB 1M5IA 4FP3A 1ZL8A 3WP4A 3WLUA 3ALQA 3L70H 3T08A 5L3EA 4FLZA 4H37A 4CDUB 4AFCA 1VQKV 4LNUA 4OHZA 4DR6B 3BTAA 4B3SB 2RDSA 1RUG1 4U36A 3KGLA 3LAGA 3AMHA 2JDNA 4CCNA 4Y1ZA 3H1KH 1GZWA 1FXKC 1XNBA 5AG2A 1DK1A 1KGYA 5JSPA 2W1UA 4LKSA 4ARXA 2RDQA 2G1MA 2M7WA 3URFA 2Y6FA 3KV5A 4JTDB 3GZAA 4OVEA 1GNHA 3I2GA 3HKCA 3GBFA 3ZMZA 1U5XA 4G9SB 1AX2A 5A1AA 5GONB 3LZZA 1BMFG 1BT8A 2N04A 1HB1A 2OCCB 1IDSA 2RNBA 3E8HA 3ZMNA 4B29A 1Q82W 3C7EA 1GLHA 4JDMA 1K4DC 1IURA 1VJ2A 2XJRA 2B1IA 4P9XA 5FZ4A 1QDOA 1RTVA 3OBAA 4AHXA 3ZN6B 3HOBA 4AQ2A 2NYYA 3RYCA 4IE7A 2QQPA 4AEKA 1OLRA 1JR9A 2ZE5A 4MW8A 1RVF1 4BK4A 2V72A 1VQ9V 5C5UA 4LOTA 1OA4A 4K1YA 1VQPV 1AR62 3TOJA 4EZ4A 1SQ4A 4WBNA 1XMOO 4FFIA 2B9UA 2OYQA 1C5IA 4LWSB 3MIBA 2EICA 5KAIZ 1VBC3 1UN1A 4ET7A 3M8AA 4DR6O 2YG0A 2DFCA 3WG2A 1W8TA 2IXHA 4B3SO 3BTYA 5FY9A 5JOWA 4P00B 3H50A 1OV9A 1H1MA 4PI0A 2ZHNA 5IY5C 1C8M3 1U5IA 2DUOA 5FQ0B 4PF5A 4MVZA 1PVC1 3D3AA 3JD73 3UJOA 4H33A 5J2UA 3WNNA 5L19A 1A6CA 4HPKB 4Z8BA 4XF1A 3GWKC 2VPVA 2OX0A 3NSTA 1NVPB 3DL3A 2CAUA 2B5HA 2Q1FA 1NUKA 4K35A 3ZFGB 3L71H 1QR8A 1FI2A 4BPZA 1NJIW 4BU2A 2P3IA 3WU2Z 4CYDA 2Q9LA 4WM8B 5F32A 5BNPC 5JZGA 4WFAV 4LO5B 3GZEA 5L7OA 5C8YA 1DQ0A 3AMNA 2D93A 4NPLA 3ZHVA 4D69A 3MFAA 1CPMA 1E57A 1UO9A 2CSGA 2Y6HA 1PMIA 2AUYA 3JXSA 2ZX1A 3ZXDA 3T1YB 1LOCA 1YRZA 1W8WA 4BHPA 1G86A 3K04A 1IX9A 4LEJA 5BYNA 3MW2A 3AP5A 1CXZB 2WWJA 3UCSC 1DU3D 3MDPA 4TT3G 3N4MA 2B7YA 2VL4A 4GA9A 2R70A 2CTRA 1FAFA 1KKDA 5J09A 3W21A 3SEEA 1OF4A 4LF9B 4Z07A 2BW8A 4QT6A 5L73A 1ULOA 1ZA4A 5FY0A 3PVEA 2NQYA 1WBLA 5GTIZ 5FYMA 1N47A 3AL6A 2ZOEB 1MG1A 1RFYA 5HV4A 2JGDB 5JSRA 5J1XA 3I59B 3LSUA 3I3QA 4CH6A 1KITA 1NCQA 1VBA3 2Y33A 2RS52 5CFCA 3FMGA 3MEPA 4JQTA 2R9IA 1VBC2 2PHDA 1S2BA 4CDWC 3AK0A 3AP4A 1VMHA 1GN3A 2JG8A 1VQ4V 3TRSB 3ETPA 4CVUA 5FYVA 2P06A 3HAGA 1ZZCA 1BCCH 5CBFA 2NN8A 2IZWA 2D2CB 4CCOA 3V0BA 2BDRA 1C8M2 1UW8A 1TME1 5GM0A 4EROA 1AJOA 3J8F1 1XBLA 2ODMA 3PTYA 2WNUA 3JD72 2HP8A 1XHZA 2A6YA 2ITCC 5HFLA 5FYIA 4PV1B 2WRAA 3RZHA 1OFSA 3RS6A 1GH6A 1J5EB 3T0AA 2QQIA 3WEZA 3QLQA 2QFEA 3CJHA 1GQPA 1WJZA 2D6PA 4A42A 1W9YA 4QDRA 3R6SA 1EFRG 1NTMH 3GHNA 2VNOA 3NAPA 5BNOA 5KC6A 4AFMA 2XUEA 5CNAA 4LCUC 4N43A 4Y5TA 5LY1A 3QNEA 2EAKA 1AP6A 4JGSA 3E6BA 5EBMC 3V0AA 4QPWA 1PGW2 2OQ6A 3ZR5A 4W6XA 3OEBA 3HVDA 4HN0A 1OBNA 4MSWC 4YNIA 2OT7A 3K0GA 4R9DA 2Y4TA 2CWSA 1BYHA 4OZXA 5F3CA 2JE9A 1Y6XA 3LD8A 5IVCA 3AG4B 1Q8SA 3OGCC 4ZOLB 3AK1A 2BFUL 2ZXWC 2DYCA 4BZ4A 2RDRA 5KUKA 4FTEA 4JPRA 1DP0A 2GDFA 1PHMA 1C4RA 5LGTA 4AAXA 3LIHA 3K58A 4FM1A 2HJDA 1BBT3 3JB4C 3S0MA 3ZLIA 2BTQB 2XVGA 5DUWA 3SYOA 1QY4A 2WLIA 3ACLA 4BQWA 4IEZA 3T1LA 3CRRA 1JMUB 1VBA2 1K3IA 1LR1A 1QVFU 5LEJA 1WCKA 1NLQA 1LNSA 4FQZA 4IIJA 4ZKIA 3E5XA 1OLMA 2WYSA 2ZT9B 2HBTA 2VRZA 2ZEWA 3ZCCA 1CPNA 3JSLA 4LF4O 1V9U1 3SLIA 3S3XA 1VRBA 4Z92B 4RR3B 3T2PA 1XHXA 1GSLA 1UYYA 4CE8A 4LPLA 1F5JA 5EBLC 1N3OA 5FZAA 4YLZA 3ZIWA 1NVPD 2HH9A 4PA9A 3OTFA 1I0HA 4FLYA 3D36A 4O4HB 1UY4A 4TLGA 1EN4A 3VV1A 4Q29A 2HWD2 5FBZA 1VRH2 4IEPA 5FZIA 4K3AA 3ILRA 1J3RA 2MEV3 2YPJA 3AZVA 2JDIG 5A6XA 4UW6A 3M2MA 4UW4A 4Z1VA 5I8SA 1DQ5A 3DKWA 4QDQA 3C3VA 1CZTA 4W50A 1WZXA 1S0GA 1KXGA 5IFTA 4XURA 3FLPA 3GGLA 3ML0A 4H0LB 5KX5B 3BAAA 3MHZA 3FAVB 2O14A 3AKSA 1K34A 4HMZA 2UXBB 2IU3A 2Q8VA 4UV8A 3MF9A 4YM0A 1FXZA 1KS4A 2ZM6O 1PIV1 4NIIA 2VE1A 4X8PA 3ABMC 1YQ8A 2PHFA 5GZCA 4LA3A 3EJKA 3NW4A 4X1KA 4JTOA 3M3OA 3ZRSA 4DUVA 3UKTA 2DQ3A 1N4CA 2YZ4A 3O0XA 5D8AA 3HPNA 1BBT2 5GLWA 3DXUA 2IXKA 3GNEA 3S7IA 2XWBB 4JZRA 4XJAA 2FBEA 3RZMA 4JGZC 4AL9A 5FYHA 3KT7A 4LHNA 2XNDG 3FFZA 5JXHA 4JYAB 4BIZA 4XDOA 3MLKA 1ZRCA 1AJNA 2JEXA 3VN4A 2WFF2 1HIXA 4AI9A 5F6LB 2R061 1N3QA 3NO8A 3HNYM 4CXXA 2WLLA 2UY8A 3AKPA 2B9VA 4DUZB 2OQ7A 3PJQA 4IEXA 4OMDA 2Q7GA 1UY1A 2CDOA 2PYJA 3NR7A 2ZZQA 2VULA 1CAUA 3TAYA 1RC6A 1O3QA 2UXBO 1WBFA 3R4UA 4B08A 1GICA 2ZS6B 1ULPA 3VZLA 2MEV2 4JTCB 1LULA 1JZ6A 3WSOA 3CWBH 2ZGNA 4DO0A 5EXOA 4TUYA 3PJYA 5FLHA 2HWE2 1LHVA 1JYTA 4MGKE 3I5DA 2GBOA 2WDBA 3JASA 4FM0A 4MADA 1ND3C 3RN4A 2B9ZA 2FZ1A 1M06G 4JF3A 4OMCA 5KHHA 3MPBA 4XUTA 2AHZA 4AHYA 4OLLA 1NCRC 4Q20A 1FOD1 5KA6A 4S2DA 1SZXA 3KQRA 2PI4A 3SJBC 1HW5A 1UOJA 5A7WB 5FJHA 4R8CA 4Z2AA 1RUH1 1DGLA 2DUQA 1BE3H 1W9WA 3ZMTA 1ZZ6A 2JIZG 5J2TA 4GLXA 3I2DA 5CN0A 1CIYA 2X6BA 3DYMA 3MBWA 4NTWA 1LOAA 2ZCEA 4MTGA 3F7VC 2SLIA 3I2FA 4R50A 3ZIAG 4K3UA 1CD3G 2KA3A 1RUF2 3T1HB 4IHJB 1D4VB 2A6WA 4OUSA 3N7JA 3U4SA 3K51A 2VCCA 2UXDB 3UNPA 4KWUA 2CTVA 3NVCA 2LP7A 2D5HA 2QQLA 2PHUA 4CP1A 5BPXA 5HV0A 3ABLC 3CCMV 4I9QA 5IJRA 1SQVH 5T52A 3WG4A 2F4PA 5J98B 5JCOC 4Q8LA 4XF4A 2Y69B 2EXIA 4YW7A 4XDKA 1CZVA 4I4TA 1MSWD 3LSEA 1WAZA 3LDBA 4EWDA 5CA0A 4URTA 3K9AA 4E2GA 1EY2A 1TEIA 4E4ZA 5A3NA 3X29B 1XYNA 1ZL8B 4QKFA 2D3OW 2UURA 2X05A 2E26A 2KB1A 2QWPB 2FDKA 5BV6A 3MD0A 1IPKA 1DYKA 5KXBA 1K33A 3CF6E 2VNGA 4CEWC 3T1HO 1UYXA 1IOAA 4HKLA 2X8KA 3JARA 1O5UA 4TSFG 2XL7A 1Y9MA 3CXCU 4Q4X3 5IWFA 1UKRA 4RO2A 2XJQA 4ES9A 5FYZA 1WPBA 2OS2A 1H2LA 3KKYA 4Q4V3 2FCVA 2ZX2A 3K48A 2W87A 4AI1A 4C0HA 4MX3A 1YFXA 3WNKA 3IAQA 3BRCA 4NN0A 5F37A 1WB7A 2FYUH 1JZ4A 2OA2A 1HRV3 2BRTA 3PMSA 2BTOA 5F8PA 1G4YB 4Q0PA 3PUSA 3DCQA 1US2A 4S2GA 1QJU3 3F95A 3FLTA 4CTEA 1GN6A 4ZI7A 4JYBA 5C4WA 2NLJC 3RYCB 1DQ1A 1H8TC 4ZZ8A 1PM9A 5C8WA 1OC1A 1HP8A 4IV1C 2A3YA 4MYEA 1UYPA 4PELA 3OUIA 5LK5A 3VHRA 2E7AA 5B4XA 2A73B 2H94A 1Y9QA 4YPJA 3WDUA 2DVGA 4LNVA 3ZJZA 1VBE3 2QQNA 4W4LA 2A71A 5A3UA 1NKGA 4B3RB 2YV8A 3K59A 2CGOA 5IVJA 4NPRA 3S7EA 4KXRA 4Q5OA 4MTOA 3CBNA 3P30A 3ZFEA 3K03A 2XVLA 3VBOB 3H9AA 3JBG3 4O4JB 4IV3C 4I55A 1Q6UA 4H55A 5H9QA 4YGDA 2KM2A 4CDXA 2WWUA 4H2AA 4ABMA 1FKAO 3WFVA 2BNOA 3APBA 1O4ZA 1W2BU 2DCKA 4FTSA 5C8YB 3W58A 1B35C 2YXLA 1F15A 1XSRA 3PTRB 5I91A 4NPMA 2BJSA 1JHJA 4AZZA 2RS31 4AW7A 5JPMB 3PUHA 4QB2A 2YEVA 4Q4X2 3V64A 4AHZA 3HQUA 4WFEA 5GW7A 1EUUA 4P9PA 2WJSA 4Q4V2 3TNPB 4X20A 1C3HA 3OJBA 2V4DA 4JRLA 2DBNA 1S0DA 1GOHA 3TN93 1HRV2 4X1YA 3FX7A 2XH6A 2DV9A 3NV3A 1QJU2 5FPAA 3ZX6A 4HNAB 1X36A 1V55C 2PHXA 1DBNA 2WLKA 3GHMA 1Q8IA 2D6NA 2CWMA 1S0CA 2QWOB 2DBIA 2XL9A 1WW5A 3T09A 1GZTA 5FPXA 3TXQA 1NCQB 4COVA 4NHLA 1LOGA 2VUAA 3VZJA 3FKSG 2LGWA 3WB1A 5JXGA 4NTXA 2PHLA 1V6IA 3CMAV 2R0FA 1M57C 3CRQA 2ETNA 1VBE2 4FJCC 1IZ3A 3DSQA 4FFHA 2V73A 1LGBA 1S55A 3N9QA 1AYM3 1L7RA 2WNEA 1YIFA 2YGMA 5IAXA 3C8XA
chains in the Genus database with same CATH topology
5FRAA 1BXHA 4DS0A 1ULCA 1V9U3 3L9JT 4WVZA 1W6PA 2RS51 3AZZA 3I59A 3KCCA 4LLOA 3WUCA 3KB5A 2QNKA 4C1WA 1VBC1 3PNAA 1EAH1 2WT0A 2WNUB 4PIZA 2VW2A 3MS5A 1TME2 3HN1A 4LBLA 5DUXA 3ZIXA 5JAXA 4JVAA 4LR4A 4SBVA 1RUF3 1QJY2 4JCKA 5EFUA 2DVFA 2Y26A 3J8F2 1HDKA 1W6NA 4M0NA 3GZTB 3M3QA 4RA0A 1DIWA 2ZHMA 4CP0A 1UIJA 1CQ9A 3KM5A 4Q4Y1 3OGGA 2WINB 4XJUA 3WQ1A 2ZZJA 4IV3A 1SLTA 2OVUA 3EHKA 1PGL1 1J3PA 2PYTA 5JZGC 3MF6A 5L7OC 3SCFA 1C8M1 3HMYA 3VL9A 5AC92 1UU5A 4QPIA 4FOWA 2WFPA 2Z79A 1AUYA 5K0UC 4N7IA 2LTNA 4U2AA 4RR3C 4XFBA 3NAPB 1KRIA 3ZDSA 3JD71 3FBMA 4Y1UA 3ROUA 4B4PA 3IWZA 2PAKA 2R073 1IGOA 3D0JA 5BNPB 1HXS3 3H3ZA 2B8MA 3FJSA 2W52A 4YVSA 4J1WA 4AQSA 3CEWA 3AYAA 4R9AA 5JIAA 2RMU1 3LKJA 3UL2A 1R083 5DXDA 5BNNB 4AEDA 4XBLA 4XMAA 5I0UA 3V0AB 4R8HA 1I5ZA 3ZSEA 4F83A 1ZZ7A 2BWCA 2ET7A 2KXLA 1C57A 2FQPA 4MH0E 1F5FA 2EIGA 1LB2A 4LBQA 4XFIA 1ZRDA 1FPN1 3N36A 2HWC3 3ZO0B 1C1LA 4GH4B 2D7FA 3B9IA 3D6EA 3VBUC 1YO8A 5CG8A 4AGVA 3AZYA 2ARXA 4FFAA 1B09A 1YFYA 1O4YA 1O3TA 1OA2A 4MUVA 4G3YC 4EN7B 4RGGA 4CEYB 5E16A 1GY9A 4XE9A 2HEYF 3UKNA 3TN92 4Y1XA 1MS0A 2DU0A 3NL1A 4JRAA 4AG4A 4D7TA 3RSJA 1SCSA 4AE2A 1RMU1 3SWTA 5IT6A 3B01A 3MW3A 4AVVA 1ZBE3 1MQTC 3U10A 2GNTA 2DURA 3VZKA 1PGW1 4GB32 1PIV3 3T2TA 3WDWA 4FAHA 1GANA 2VXRA 4D94A 5ABJB 3CU7A 4NHMA 3DF0A 1XNKA 1HQLA 2IXIA 4OHXA 5C6CA 2WSUA 1YI7A 2GNMA 2VW1A 2QDNA 4N53B 4P5HA 3V15A 4COZA 4YVWB 5A32A 1LOEA 5CFCC 3AJZA 1O91A 2ZMNA 5JOZA 2YDEA 3RPQA 2D3PA 1SEFA 4JGYA 4AI3A 2VUJA 4BQ1A 1CESA 5IK5A 3QH6A 3FC0A 3WR0A 4DRVA 1TMF3 2JG8C 3CL1A 3TBDA 1PO12 5FO8B 4MXWA 4FPFA 1LESA 4PDWA 2PLV1 1DGRN 2IWGB 1O5LA 4CDWB 5GZGA 1RL3A 2XBO1 1NY72 4LO7A 3USUB 1KQRA 2XB6C 1PK6C 2WQZC 2HWF3 4JDOA 5KHJA 2A6XA 4F8AA 5CB7A 4FTBA 3QACA 1WCDJ 1YJKA 3VZNA 4PJYA 4QPYA 1AYM2 4KWKA 2X53S 3T1MA 4AI2A 4FXKB 1UL9A 4FPEA 2R063 1V9U2 1VBA1 3M1HA 4AWDA 5J92A 4BHIA 3HWJA 4MXVA 1R091 2D6OX 1F2NA 4I0BA 4YW5A 3RWNA 3CLPA 3DPRC 4YM2A 1N1YA 2GN3A 5T5LA 2CGNA 2JG9C 2ZACA 1LGCA 4YZ2A 2JENA 4C8RA 2C5DA 2IXCA 4AFAA 4MVTA 4JGZA 1AR71 1HRI3 1S1AA 3AMPA 1LHNA 1SCRA 2DTWA 3WD5A 5BNOC 3OCPA 5KWRA 2X29A 2VMHA 3R05A 1BEV1 4AGRA 1KJLA 2Y38A 1GNZA 3O12A 2WNVB 4N43C 2H6CA 2VG9A 1LOFC 1X50A 2ET1A 4C0BA 3H1MA 2BWAA 5K8SA 3WV6A 1WGPA 3WQ0A 1AXZA 1IS5A 1DGWA 1HKDA 1WA4A 2WZR1 4XBNA 3DV8A 4EN6B 1H1AA 2GMPA 5HCBA 1AR81 3P3PA 2R072 1HXS2 2BBVA 2ZKNA