4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
2WA4A 3KCXA 1H2MA 4NR1A 2WA3A 2W0XA 4QU2A 3KCYA 2CGNA 3P3PA 1YCIA 1H2KA 3P3NA 4AI8A 4BIOA 2Y0IA 4Z1VA 1MZEA 2XUMA 2CGOA 1H2NA 1IZ3A 2YDEA 2ILMA 1MZFA 4JAAA 4B7EA 3OD4A 3D8CA 1H2LA 5JWPA 4Z2WA 2YC0A 4B7KA
chains in the Genus database with same CATH superfamily
2YEVA 3CWBH 5GZEA 4LMFA 4IV3C 1AVBA 2VC9A 4B3RB 4A44A 4Q4X3 3HN1A 3WG4A 4FPCA 4IGGA 4Z1MG 5FWJA 2A6YA 4X62O 3OEAA 4JI7O 3RMYA 2ZNIA 1BBT2 1WW7A 1MVEA 2QCSB 2J1UA 4J9YB 5GLUA 2Y69C 3UGHA 1RUC1 5FP7A 2W1WA 1ZSPA 1DIWA 2HR3A 2CE4A 5EWSA 3LDKA 4BLIA 4HYOA 1OQEA 2Q5TA 3IC7A 3UK9A 3SCGA 1DP0A 3VL9A 3ME2A 3GBFA 2EINB 4DV3O 1DQ1A 4YW4A 4A6OA 2X0LA 3NJXA 4TV9B 3LEGA 5A3TA 1YDXA 2W1UA 3JATA 3WV6A 3K9SA 1LOBA 1AX0A 5JQGB 1P7GA 1RUJ2 5I0DA 1R1A1 3SR2C 1K8AW 1C5IA 2WLQA 4DXRA 2FTKA 2QTWB 3GALA 1CVNA 3HR0A 3G67A 3VDBA 1QLEB 1UN1A 1YNAA 1GN4A 3TNPB 5CISA 4DUZB 1V55B 2EIKB 4UXAA 3T0BA 1O4YA 2XMLA 4HFSA 1Q6UA 1NZ6A 4ARXA 1S2EA 3CJIB 3AG2B 1TVKA 4FQ4A 5FUPA 3SNMA 1XL4A 3DPRB 5LWBA 1UOBA 2P3YA 1YHFA 1ULEA 2FDIA 1K73W 4X62B 4CEYC 1JZ5A 3MBWA 3VGIA 2CK3G 5L3CA 3H0OA 4LBKA 2VU9A 1NCQA 4TQDA 4FFHA 4CDUB 1OLMA 2J1EA 1O7FA 1W6MB 2BGOA 2V09A 1Q6HA 3IM0A 3ASIA 2JD9A 2H6CA 4GJYA 1PMHX 5C6CA 3BB6A 4CS4A 3L71H 2DURA 2BGPA 1B09A 1IQAA 4EFBA 5FYHA 2HWC2 1R1BA 4AGGA 5CFDB 1K3EA 4O2BA 3ML0A 2P6JA 5FPXA 5B3SC 2G4IA 3WDYA 2Z3YA 4WM7A 2GAUA 1VQ8V 1LOEA 5C4WA 2RNBA 4X6QB 3OUSA 1W9FA 1X8MA 3CU7A 3OD4A 3ZSEA 3D8CA 3JALA 3CS5A 2XTAA 2IM9A 2B1GA 2NLJC 4E9KA 2W94A 2ZDIC 3W58A 1PM7A 5E8AA 3ZYHA 2WFPA 3ZN6B 2ORXA 4EB6B 2UUAB 3TEZA 4FPFA 4J1WA 2LGWA 3HKBB 3ETDA 1NY72 4G9SB 4B4QA 3TETA 1UXXX 5GALA 2KD7A 4O4LA 3H01A 1LECA 4X1YA 4KI5M 1QJY2 2O57A 2D3OW 3PL0A 2JEMA 4YYOA 2ET1A 4U3JA 4GMP3 4LITA 4Q0VA 1H2GA 1ZRFA 4EWAA 1NLQA 1JCHA 3H1HH 4LBLA 4CU6A 2JIJA 4J7JA 1BMV1 1SZXA 1NQDA 3FHAA 3EVKA 4UXNA 1GK9A 5E6HA 4IEOA 3IT8A 4XETA 5A80A 2EBOA 5J2UA 4JI4O 3OGIB 1IDSA 1ULPA 4AFDA 4UV8A 1YWKA 1I5ZA 1L7QA 2ZBJA 2QWNB 4LT5A 3JD3A 5EK0A 2D3PA 3T09A 4ZI7B 1W9TA 1JTZX 4K1ZA 3KV9A 2K0GA 2XOMA 1YVWA 4IL6Z 4WFHA 1H2KA 2XHNA 4DV1B 2J1SA 2D2CB 3C3SA 2ES3A 3J7LA 1N8RW 5FYYA 4LF8O 3HMYA 4MXWB 1CP9A 3K5OA 2OPKA 3BUCA 1XNRB 2RS33 1SHWB 4DUXA 4MVRA 5A6ZA 1QNMA 1G7YA 1CZVA 2QNKA 2XLAA 1HJGA 1UNBA 4FLYA 1Z7S3 3U37A 1KXGA 4E2SA 3DTUB 2EIMB 2VXRA 5EIBD 5EBWC 4IEXA 3PTYA 3FLTA 2W2IA 4X64B 5D5PA 1A8MA 5H9QA 1R082 4AAXA 3ZYBA 5DAQA 3FX3A 4AG4A 2VTXA 2D6MA 3K3NA 1JYVA 3FLRA 1K5SA 4JI4B 1UZ0A 2DV9A 3C90A 3U1XA 3N7MA 1LEDA 3T1YB 4M3CA 1ZX5A 2AW9A 4AE2A 4KP4A 5CB4A 4CBCA 5FP4A 4CDXA 3E6DA 5EXOA 2DUQA 2BWAA 3AXEA 3KCXA 2JDMA 1I5YA 1RP3B 4NXMB 1Q5OA 2XQRA 1H6YA 2WO3A 1Q6IA 1J1TA 2UWCA 2GC3A 4UCVA 5D8AB 4EN9B 1UKRA 2RMU3 5IJRA 3KV5A 2CYFA 4L9BA 1HQWA 4LR3A 5C8YB 4QX0A 3NRUA 3R05A 1FXKA 1QQCA 2P67A 1CX4A 1W0JG 3N7KA 4D8MA 1YFXA 3ZSLA 1OCRC 4Y26A 4NWVA 4DV0O 2GH8A 2ZEYA 2X53S 1GANA 1FXKC 5A1LA 2XT9A 1HX6A 3WF4A 2HWF2 2X5IC 2HWD2 1TEIA 3GBWA 4O4JA 4UBHA 4FOVA 3AX4A 3RYIB 1LHWA 5K0UB 1WLDA 1ZBA2 4I50A 4GWIA 1GMMA 1TUBB 2AH2A 1MA1A 5LXTA 5L73A 4Y20A 2WUHA 2KQXA 2W3JA 4IDZA 5BNPC 3TN92 4KMQA 3LPFA 1QF3A 2OKXA 3FD9A 2VOWA 1NR1A 1W6PA 3ZHTA 2VMHA 3ABKB 4PF1A 4H13B 1S55A 2XG3A 5L7OB 1NBMG 3LGRA 4CH5A 1X7NA 2VBDA 1VAMA 1XE7A 4I9WA 5FY8A 3BRCA 3WQBA 4RO2A 4HOOA 3MHZA 1UY1A 4DO0A 1YXWA 3B5LB 4DR3O 1A34A 3GCXA 4NB5A 5A7SA 1G9DA 3T0AA 3J8F2 1SETA 1K5MC 4JZ2A 1XNCA 4QJFB 4RQPB 1NX9A 4CP0A 2XAJA 1ZZ6A 4G2KA 1K5MB 4BISA 4GXLA 3TCUA 2QM4A 3N9PA 2BOIA 5JJEB 2YZ4A 2LW8A 4NMIA 2PN5A 1YQCA 2Q1FA 3NNMA 1N34B 1SLAA 4AI1A 2VCCA 3T1MA 2VUDA 1QCEA 2E5LO 2UUBB 3BTYA 3B94A 1JHNA 4C91A 1J5EB 4FO9A 4UB8Z 5EBMC 1UQXA 3JZVA 1JXNA 4Q4X2 4DXZA 2D93A 4YWAA 2W08A 3DXTA 1F4AA 5BNNC 2IXKA 1TMF3 5HPOA 2I07B 3FJSA 1PGW1 4DZGA 3LFIA 3MYXA 4XAAA 3G6JB 1UZVA 2I2SA 4CU8A 1AYN2 2EILB 4XMIA 4LR4A 3ZDVA 4JI0B 4O4HA 5LEKA 3NSTA 4QQLA 3BA9A 2WZEA 5LASA 1E57A 3HPLC 3L2HA 3UT0A 1JOYA 1SMVA 4EQVA 3PMEA 3IFXA 4I50B 1RGSA 5JVVA 4L92A 2WIIB 2JVDA 1G9FA 3PUHA 3THPA 3KHCA 1E5IA 3H8UA 3WG7C 3R4DB 1JZ8A 4MVTA 3Q8FA 4AVCA 3A0HZ 5A3PA 3MHHC 3GNEA 2HWE1 5T54A 2IVJA 1WMFA 1C8NA 1X59A 2X7RB 1BK0A 4GD4A 3OBRA 4YZ4A 4K8RB 3H1KH 4IHJA 2VJXA 3HOBA 4FLWA 2F1MA 1VQOV 1Y7BA 3GJAA 2WWJA 1LCLA 2HWB3 2GNBA 4AOCA 2Y6KA 5EYPA 1KGYA 3VBBA 1XBLA 5FBZA 3CXCU 1V54C 1UW8A 2XDVA 1A6CA 3LSUA 1SZTA 4X1IB 2ARXA 3DEMA 1ALYA 1HN1A 1W59A 2YS8A 4WZCA 1HW7A 4YJ3B 1IG3A 1OCCC 1L0NH 5BXXA 3WF0A 1WW6A 1PNLA 4I2OA 4XDQA 4IYIA 4GUNA 2QWOB 4EZHA 1PGL1 1IPKA 5DABA 1EFRG 1MQTC 1MZ6A 1FAFA 1NA1C 2MPFA 2HHHO 1GKBA 1XOUA 3K0GA 1X8EA 1H8HG 1OOPA 4QPYA 3ZMZA 3B9IA 1QNWA 1LGCA 4YZ2A 1S0EA 3VKFC 1UOGA 1UKGA 1SC5B 4TSFG 1IS4A 4Q4V3 4XZUG 2WQ4A 5I8TA 3ABLB 3RYFB 5HBAA 3GZTB 5A3WA 1CN1A 3JB4C 1XC6A 3C8XA 2WLLA 1ZZ7A 5J48A 2EXKA 4Z8BA 1AL21 3KGZA 1S5JA 5KHIA 4LXLA 2ZGRA 5H9CA 1OD5A 5FJHA 2W46A 3KM5A 2JDAA 4JI1O 3I4IA 1BGYH 1Y74B 1TMF1 2FHRA 5IFTA 4YPJA 5EPAA 1MABG 3MD0A 3USSA 1H4HA 3ZHQA 3DGEA 4KHPO 1HV0A 1W6NB 3WF1A 1UPSA 1AR61 3EO6A 1RM1C 4FFGA 3WDUA 1MS5A 3DXUA 4UUJC 5FP8A 2P37A 2XBO3 5KX5B 4K8ZA 2QKCA 3AZYA 3MDPA 5GTHZ 4MSWC 4ZI7A 1JMUB 4LLFA 4DR6O 3ZCCA 1EUUA 1VBD3 4YFZA 3PURA 4JYAB 1NG0A 4JPRA 2WN3A 4R7CA 3VBOB 3HQXA 1SDDB 5CIRA 1HNWB 3ETEA 2OZ6A 4K7JA 2KG7B 3ASNB 1OZ0A 4P5HA 3QNEA 3AMNA 3AG1B 5EYPB 4PA3A 4O4LB 1GM7A 4MUVA 3POJA 3CEWA 1JYIA 3NKGA 3PVNA 1XI1A 1BL8A 2ZGLA 4BQ1A 1NTZH 1FOD1 4I7ZB 1XNBA 3TK1A 2HBTA 1OV9A 2CH7A 4JRLA 4AGVA 3A4UA 1I5XA 1RUG1 4LOTA 1DZRA 2RQ6A 3QACA 1Y66A 1K42A 3IC9A 5J09A 1PX3A 4P5YA 2OCHA 4UFHA 1BQPA 1K92A 1ENSA 2R70A 1RJ8A 2OPWA 1K4DC 5IW0A 2VVEA 3B3QE 1EV12 1EY2A 4H37A 2YC4A 1QJX1 2QDNA 5FJKA 5IWAB 2WZ8A 4JCKA 5C4WC 1W0NA 4DINB 4AI2A 5C8WA 2GP3A 1XMOO 4A41A 1LOFA 2RS11 4AVSA 4FM0A 2PI4A 1Y9MA 1YFYA 4IL7A 5IVCA 2VY0A 5FPOA 1CR7A 4MGZE 3VZKA 1SFYA 2PHDA 2NN4A 2BGCA 5GZFA 1N33B 2E51A 3IDEA 3CC4V 3ES4A 4GWJA 2UWBA 5JSPA 4CCNA 2B5UA 3FN9A 3ZHUA 1GFF2 2CGNA 3SYCA 1OUXA 2Q69A 4X65O 3AP4A 3SYQA 1CAUA 5LBEA 4AXOA 2XLFA 3VBUB 2VGDA 2WT0A 2W87A 3RZKA 4QPIC 3OEBA 4RHV1 3D6EA 5F3CA 2JJ1G 3WW1A 1T6GC 5LOVB 4YJ2A 4DV7B 3CQOA 1RUD3 2QQLA 5B1AC 1K34A 3OAAG 3SPHA 5C5TA 4HNAB 3VQWA 4CUCA 1VE0A 3AM2A 1OCRB 2JB4A 1XNRO 5FMOL 3RYCA 3OY8A 3VOUA 4DR3B 2WJSA 1GWKA 2D6NA 3WF3A 5FZHA 3LWCA 4ZHQB 1WW5A 4YSFA 4AAPA 5JPMB 3BTXA 4GYCB 2WL1A 3FC0A 3ABZA 3FBMA 4LFAB 2DUOA 5TSWA 3LIGA 2C5DA 2OIEA 4PI2A 2K2SA 3AKRA 2EA7A 2F95B 2P3JA 4P9XA 4OPHA 1WD4A 3POWA 3PU3A 1RUH3 3S5AA 3P3NA 3Q8BA 1GOHA 2AHZA 5T55A 4E4EA 2R16A 3ACHA 3KVAA 3OTOO 4MADA 3OM3B 3OOXA 1V6JA 1SG3A 4FTSA 1FMD1 4NKGB 1CESA 2XH6A 4LFBB 4DUVA 1XHZA 3ZJZA 3VBRC 4URTA 1SACA 1FFXB 4DV7O 5KHKA 1UD1A 3VBHB 4AEDB 3HPNA 1QJY3 1ZTEA 3ZYGA 3RZZA 2YEVB 4FP2A 4RQEA 1O4TA 3AG4B 3SYPA 4SLIA 1NLRA 3ECQA 4MVZA 5E1RA 3ELNA 3WB0A 1YZBA 1HW5A 1PO13 4XQDA 4QAWA 1WMEA 4CYDA 4XUTA 3ZSKA 1RVF2 4UBGA 2HEVF 4QGNA 3SKJE 3D5OA 1NXMA 2F4VB 4A3ZA 2WSSG 2R49A 2Q8VA 3S7IA 3AEIA 4QPGC 5ABJC 3CB2A 4GMP0 1XJAA 5KUKA 2QUOA 5FWEA 4EKWA 3F7VC 1W6QA 1CQ9A 1D5AA 1GM8A 2RCVA 3PIJA 5DAVA 5BNPA 2B9UA 2HWC1 3JQWA 1OPMA 4JGSA 3KSCA 3U14A 3RRDA 4MGIE 1C1FA 3MLJA 2ZX2A 2VOVA 3MF6A 1CEZA 3AKQA 4W6YA 1AL23 1W8UA 2PAKA 1JFFA 4IIJB 1AXYA 4LIUA 4YM2A 3FHIB 3RVYA 3IKWA 5I0UA 1XPWA 2ODMA 1QGLA 2LFRA 1SQQH 2FMLA 3ZEDA 4WM7C 5JOXA 5LP6C 1W6QB 4P9GA 1R6TA 4QU2A 1AHSA 3MO4A 3WHTA 2ZE6A 3CXHF 1S0BA 3I2FA 2PLV2 2N05A 1CAXB 4N43B 4LF4B 5FY4A 3VD7A 4JGYA 3W7XA 1J5EO 3WCRA 5EZYB 1AL0G 2BVBA 2F4LA 2Y33A 4JVAA 3VZMA 1G6UA 4DV3B 3ACLA 5FREA 2Y34A 3WG7B 2AHYA 4CPBD 1HB1A 1TE1B 1AR5A 1K5QA 1EPZA 3P6BA 3ACIA 2QWQB 4O4IB 2AACA 5LBQA 4FLTA 4XF3A 3BODA 4IEQA 5LA2A 4A7ZA 3N36A 3POIA 4FPOB 3M1HA 4F6EA 5LBBA 3UQ8A 4NIGA 1G1XB 1QDCA 2DCTA 2XONA 4C0BA 5CKQA 1AR73 4W8JA 1W6OA 2ZHLA 1W90A 4ABMA 1B3QA 2V4VA 4I09A 4J6GA 3ZMOA 1LTEA 4CDWB 5JJNB 4AHWA 4FPYA 4KU7A 1RUG3 2LO1A 1S1AA 3OMAB 4BMBA 3NXSA 1VEWA 2PI5A 2VQUA 2GNTA 3W7TA 2Y60A 4XABA 1F51A 2DF7A 4FPHA 2D5HA 3LA7A 3FAVA 4XUNA 1BLZA 1SA0A 1H8TB 1KD1W 1DU3D 4FFBA 1AP6A 4RYDA 2ZPXA 4AI9A 4S2DA 5FPLA 4DYLA 4UW5A 4J10A 2KXLA 3WINE 2VMIA 3UJOA 2C4XA 1A78A 3H1IH 3TN93 5IJ9B 2ZGQA 1IX9A 1RUF2 3SMHA 4QHZA 3PJYA 1F7YA 3FYIB 1PHMA 2RHPA 3NV2A 3Q9OA 4OZOA 2JKBA 5IY5B 3ZOIA 4NIHA 1LU1A 5K1XA 2LTNA 3PN1A 1SFNA 1YJKA 3RZLA 4JDNA 3WW4A 4UFMA 5B1BC 1POQA 5FZEA 1S5LZ 1T6BX 4H0LB 5EJ1B 4COWA 4PDVA 1Y9GA 4MXWA 4NTWA 1URXA 3SQOA 1COV1 5LA1A 4QB6A 1FXHA 4DRXB 2P6CA 1VAKA 3IBMA 3HN3A 1HKDA 2P34A 4RUEA 5AC91 1VQ7V 4NXNB 5LA6A 3I55V 5DM6V 1HB2A 3AK1A 1XYOA 2X5IA 4PDWB 1AI4A 1AYN3 2ZXQA 3C2UA 1QVGU 1G9CA 2XXZA 1UMZA 1UYZA 4META 1IGOA 4RUFA 1RUJ3 5HCHA 2YXLA 2Z42A 4Y1ZA 2HWE2 2V4AA 4OMCA 2VNOA 1CPNA 5IE9A 2LUWA 3WFVA 4F6RB 1F31A 5DZGA 4TN7A 2A3YA 5FNVB 4LH6A 2ZGPA 5DDJ3 5C8CC 4XDKA 1TVGA 5F3EA 1XYNA 3IIIA 4JYYA 3SPGA 1A32A 1KDKA 1HRV3 1WCKA 1DTOA 3M8AA 5CKMA 3WY6A 4F83A 3GF6A 3ABKC 5FZLA 4YARA 2GN3A 1KU9A 2WLNA 5H9RA 1OKQA 2RVAA 2AR6A 5I91A 2IWGB 1N0JA 1XRUA 4KH9A 2A6WA 3VBRA 1M1KW 2RS32 4XUPA 2GNMA 1QJY1 1JYXA 1KB9F 3CBNA 3Q8EA 1FJGO 3CYOA 4RR3C 4J7KA 4FFIA 1BQZA 1SBFA 2XVKA 1HJFA 1ZBE2 3ZN6A 3VDDC 2CUGA 2EIDA 1V6IA 4AHZA 1CAUB 3WD5A 3GDBA 1H6XA 3PJQA 2ZMKA 2AZ2A 1IXMA 3STZC 2BNNA 4LHKA 3ACFA 5IFPA 1QH7A 2XHKA 4ITCA 4OX9B 4CA9A 5LA9A 1P8JA 5FZ0A 3G4SV 5FMDA 4GLXA 2ZEXA 3A21A 1W6OB 3R6SA 3K08A 4QX7A 2SLIA 4GH4B 5FBJA 2CDPA 3LOIA 4D7SA 3OGGA 5BYNA 2OUHA 5A7NA 2HVJC 3CJHA 4K40A 5JUVA 4R6ZA 2CSGA 1REFA 1GZCA 5GW7A 3JD2A 3MI8A 3ZX6A 4DQAA 3V0BA 1DHKB 1GICA 1X9TA 2JJ6A 4J9ZB 4DS0A 1WD3A 4QX5A 4R4XA 5JR7B 3K5LA 1EN4A 3T2TA 3BY6A 3RI9A 4KUMA 1MS9A 2IH1C 3WNNA 3HT1A 2R9RB 2ZINA 5JWPA 1RUD1 2XAFA 4HAMA 3DXRB 1NKGA 2YGMA 5T3NA 3NV1A 5CG8A 1GYKA 2WQZC 2NPIA 5J9PC 5IK7A 4KXRA 3LOBA 3U75A 5FDBA 3AK3A 3ZVXA 5J2TA 3I59B 3POYA 2VVDA 1JR9A 1WLWA 3D3AA 3ZBHA 5H6RA 2Q1MA 1W9SA 4MT8A 4K0KO 5LL6Y 2KG7A 4ZHNA 3PIGA 3WNKA 4CCJA 3NL1A 2HJDA 1Q8OA 3U4SA 1FS0G 3ZXGA 5JI9A 4D0QA 2F93B 5ACA3 1YQ6A 2E76B 2YXSA 1IKPA 4MGYE 4OZXA 2DDUA 2FCVA 4X8AA 2BTQB 4Y5Z0 1W8WA 2CV6A 3HKEA 3T3YA 2PZSA 2D5FA 4NROA 4NPRA 1BBT3 1H9PA 3ZN1A 2ORZA 3TWIA 4Y24A 2NR5A 2QQVA 4QXHA 5EBLC 3A23A 2ET7A 2ZR2A 4XJUA 1OF4A 2C1FA 1RPOA 4Y1XA 1J1LA 5CMUA 5CADA 5JR2A 1RL3A 3JCIA 3CCRV 1KP2A 1D0HA 2XL7A 2Y4TA 3VKOA 3M3OA 4Q8KA 3B40A 1NVPD 5CA6A 2RDCA 3B02A 2QSAA 5B66Z 2ZXWB 2OX0A 2HWF3 2AC1A 3E2EA 3WP3A 2UUAO 4BIUA 4FM1A 5A33A 1NA1B 4A6SA 3WOGA 2VG9A 4Q4W3 3ZXEA 5JCOA 1PO11 1KBHA 3JD1A 4JI8O 1FFXA 3AB0A 3ILRA 4AR2A 1VJ2A 1O8PA 3WQ1A 4L2NA 4B3TB 3BIEA 3FZ3A 3AG3C 4BQYA 4IE7A 1U97A 1SKVA 4X1KA 3ZYFA 5F2VO 4GH4A 5FZ1A 1M56B 4A42A 3DSQA 2JDYA 3VKLA 5B3SB 1VF5B 3C3TA 2E6VA 5IYZB 3CRAA 1AJNA 5TISZ 2EZPA 2P1BA 1XMOB 1ND3B 3K75B 4COZA 2YPDA 2QM7A 2ZD9A 3O1PA 5FZ6A 1MEC1 3HBZA 4MH0E 1DGWX 4BH9A 4R4ZA 1JZ6A 2ZGNA 3OSDA 1LUWA 1HQNA 4D94A 1IBLB 2GU9A 3OGCC 4X1IA 5IK4A 4DW0A 1CONA 1W28A 3JSNA 4OI0A 2K1EA 3F7YC 3TOJA 3UO2A 2BNMA 2BOCC 3LDRA 1YJWV 5KLVH 1ODNA 4YG0A 1IXBA 3IN9A 3VBFC 4NHKA 4LF9O 2HG5C 4TV8A 1RUJ1 3RNSA 5ANNA 3SPJA 5BNOA 4PDLA 4YW3A 2KR2A 2QJVA 2G1MA 1JOJA 1DQ2A 3CC7V 2XJVA 5JSOA 4B3RO 4XJWA 3VBOC 3ZFFC 2UXBB 3R4UA 4O4IA 1WB7A 2NNUA 1CAWA 1VBB1 4CEWA 3V0BB 3E22B 5IK5A 5ACA1 5FZKA 1JYNA 3GM8A 1ASJ1 4YZ1A 5J7MA 3RPQA 2HVKC 1TG7A 5EZYA 4YGDA 2F43G 4HKWA 4BQXA 2YBPA 3J81N 2BYVE 1SQ4A 2F17A 1YJLA 3PU8A 2ZACA 3W7WA 1KFXL 2XJSA 5ISLA 4LQRA 1LR1A 3GYDA 4EJRA 1PM4A 3HKCA 1VBA3 4X66O 3H3ZA 5DN2A 2GC1A 4AFCA 4ZY9A 4E2LA 1K97A 2PGGA 1UJWB 4QQHA 2LALA 4R8HA 1XNTA 4I0WB 1N4CA 2VZ1A 3W7UA 3KCCA 4KG0A 5LGTA 4M00A 1EZVH 1CD3G 4I0XA 3CZUA 5AVAA 4PIYA 1APNA 5GLTA 4XXPA 3M8LA 2YG0A 1VQ6V 1M5IA 2ZNJA 4XF0A 1EAH2 1OSGA 3RYCB 4Y5SA 1UCXA 2ADPA 5AVPA 1Q56A 4HETA 3AJZA 1J84A 3WUCA 2PUSA 3W5NA 4TV9A 4YW1A 4LO5B 5LOVA 1ZBA1 2R063 4RN5A 4P9YA 3VZNA 1H2SB 5C93A 4QPJA 1YCIA 3J7MA 2VW0A 3VDAA 4LKSA 5DUXA 3H3LA 2Y26A 2IJHA 2VL4A 3KHBA 2VWJA 4BZ4A 4LCUC 1E1QG 4RGKA 4INDA 5KWRA 5B4NA 2UY8A 5KXDA 1T5EA 3WB2A 3CCQV 4XZPA 5FNVA 5C33A 4LA3A 4NAMA 1BMV2 1HRI1 1ZA4A 4Y33A 1COV3 2RJZA 2ZGOA 2VZSA 2YHJA 1Y4MA 2A6XA 3A0BZ 1BEV2 2VQAA 1QJU2 1RHI2 2J1AA 1DLCA 3U78A 1SLBA 3THCA 5J36A 5JZGB 3N35A 3VBHA 4AEDA 3N4MA 2Q4PA 2A3QA 3ZXJA 4WVWA 1W2BU 5EJZB 2P17A 3HQUA 2JDIG 4QDQA 2BE3A 2R0HA 3EJKA 2YBKA 3AP5A 1ACCA 1AJPA 2V73A 2WSUA 4TXWA 2Y6LA 1AR63 1Q81W 2ZKLA 3AG4C 2R043 4Y20B 1ROPA 4XUOA 1EN6A 2QGNA 4BCUA 4CDUA 4QM9A 4UFLA 1NCQB 1OJHA 1ND2A 1SBDA 5H9PA 1DF4A 1NT2B 1AL22 2FDFA 1D2SA 1QBZA 1NOVA 2ARCA 1CX1A 4B4PA 4N43A 2XVGA 2NP0A 1VRBA 1R1A2 4FFKA 2VZPA 1B35A 1VQ4V 2DCZA 3ZRSA 3T1HO 1TMF2 4G4FA 2CTRA 1GWLA 1YC61 1N0NA 4LBQB 1OCOB 2P4KA 3FKSG 3AYCA 4B8EA 1XSQA 3BEHA 3EBRA 3PDQA 4LF6O 4DR2B 1WCQA 2A0LA 2HBUA 2CGOA 5DAPA 2DBNA 1W8OA 3VDDB 4LNUB 5FZBA 1QU0A 1NKDA 4XDLA 5JCOC 1OMIA 4DV6O 1GZ9A 4DR1O 4XJ8A 4WF9V 2GH2A 3VQVA 2OWOA 1BHGA 3UJQA 5J2TB 2F23A 4UWDA 1AP5A 3V56A 3JBG1 4D6RA 3SPCA 4KGQA 2HEWF 2X6BA 3JB8A 2IBZH 4NRQA 1RYYA 5K9YA 1IURA 2WAAA 1JMKC 1IG0A 1MQTA 4MOAA 1E79G 1XQ8A 4Q4V2 4ATFA 2VE1A 4XIKA 4BYYA 4XFBA 3IAPA 2IFRA 4GZRB 2GTAA 2E9QA 1ZUQA 1US3A 1X4TA 1NT0A 3USUA 3H8OA 3DPRC 3OPZA 4DO2A 1F4HA 2WLLB 4I3PA 1MQTB 3OGJA 3ASOB 1POV0 4CTEA 4DR2O 3I2IA 1YHQV 1IBMB 2P4EA 3SGIA 1IKQA 2QZ3A 4DEQA 3P3PA 2D6PA 1HXS3 2P7TC 5FAXA 3UKVA 1IHMA 5FLIA 3I49A 3HNMA 4CS3A 2LFSA 1M57B 1AR82 2WWUA 3K4DA 2JDUA 5H9SA 2E5LB 1RUF3 1XHXA 3GCWA 4UAPA 3CCJV 5FLHA 5A6QA 2FD8A 5FY5A 4OHWA 2XBO2 4I0BA 1C8M1 3M7AA 2WNUC 4B3TO 4QKFA 4JF3A 1YQ8A 3TXSA 1HN0A 5EFUA 4B1LA 4QPWA 4O9EA 4XC9A 2A3XA 1O91A 4YHHO 3GZUC 5G05L 5J96B 2DVGA 4WM8B 2ZGSA 3B93A 3K4AA 4FXKB 1BBT1 1ZA7A 5CA1A 4P9JA 4CDWC 2PELA 1UPGA 4J11A 2BOJA 2PHUA 4DV4B 3M3CA 4EE2A 2M6YA 1VQNV 5DECA 4LNVA 2ZM6O 5BMVA 1JZ3A 3BU0A 3VBSA 4OLLA 1VF6C 2D3SA 3OGRA 2DYCA 1P4RA 4KWJA 1PVC2 3CDZB 1DYKA 3KT1A 4HKLA 4IEWA 4DRRA 5AFBA 4FTBA 5BNOC 2NYYA 4Q4W1 1GP6A 5FZDA 3VBSC 2YY1A 2VZRA 4J80A 2OTLV 4RQFA 3H8RA 3JD0A 2VQFB 1LJ7A 1YYNA 4CH3A 1LEMA 2AGAA 3CCEV 4K35A 1XMQO 2VMCA 3MICA 3AG1C 1NZCA 1E5SA 5A3MA 2HLEA 2RJLA 3MIFA 4ASLA 3I7DA 4Q0QA 5JAXA 4NE9A 2ZCEA 1AR4A 4YVWC 3D3QA 2D40A 1RUE3 5LA6B 2JGUA 5IY5C 2VMDA 3N9LA 2E74B 4FLXA 4Z92B 3KQ4B 2B45X 3WU2Z 3OTFA 3OYWB 4B3MB 2JS3A 2V72A 3LD8A 2OQ6A 1W9YA 4YY3B 1WMDA 1HNWO 3AKPA 2RG4A 4YFWA 1W8TA 3PUIA 2C2AA 4O7XA 3W59A 1JOPA 1GOGA 3D0SA 2A1XA 4BE3A 4JTCB 1HRI3 1GO3F 2Q0AA 3WP4A 2KA3A 5DG2A 3WF2A 2VO5A 1U5ZA 5FP3A 4P9LA 3GZAA 1IQDC 1H1AA 3R4SA 4QB2A 1OLRA 5EJ3A 3OEHG 3JATB 1NI8A 4IQPA 3SC7X 5KMGB 2EULA 1GNHA 4ASKA 2YU1A 3S7EA 5ITZB 2DOSA 2ENRA 3G6EV 5LA0A 2WYSA 4E4HA 1LESA 3ZRVA 5CBHA 2WLJA 3D82A 1IZ3A 1PKXA 1JUIA 4YIOA 5JVDA 1YI2V 3K5MA 4XFIA 1D4M2 3H7JA 5FL7G 4DY3A 5CB4B 2VBPA 3JARB 5JXHA 1VPHA 3SITA 4PA4A 1LUVA 4IETA 1WN7A 5D2AA 4PIZA 2RS12 4QNHB 3C3VA 5T5PA 1XU1A 5KX5A 1AZDA 4BR6A 3A0NA 2WT1A 4QXBA 5FZFA 2A70A 4YY3O 4FSJA 1KS4A 4ATEA 2BVVA 3IDBB 4IV3B 5C4WB 2Z79A 3LKJA 4MW3A 1CJPA 2W0FC 2W5FA 4XPVA 3ABMB 4CPBA 1W2UA 1HLCA 1RITA 4LORA 4UVCA 2HH9A 3PUSA 4K20A 3I2JA 2R0FA 5J98B 2XHBA 3H50A 2FDHA 4UFIA 3A7QA 1ZZ8A 4M4PA 4P02B 2GV9A 1OURA 4HXCA 4CS2A 2QE7G 2ZE5A 2TUNA 1XMQB 2AEYA 2BFUL 3C7EA 4YGCA 4NN0A 1BQ0A 2R9IA 4AEJA 3ROUA 1IPSA 3H1LH 1ZBE1 2BDRA 2N7GA 2J1VA 2XASA 1Z2GA 1AXKA 1NVPB 1BKZA 5FZIA 1V6OA 2WWSA 1PK6B 4JI6O 3BOWA 4XOGA 1SCSA 3LAGA 4IV1C 4YW7A 3EHKA 1EZJA 3VKMA 2RV9A 1RUH2 1ZZBA 4QXKA 4Y3OA 3QBQA 1OFSA 2WT2A 5IJ9A 2C0ZA 1QWRA 5E79Z 3CCLV 2JK5C 2JGDA 4IV1A 4DV2O 2ZEZA 1SLIA 5IWFA 3WSOA 3N9OA 5IVYA 2Q6AA 2E26A 2CY6A 5I8SA 3FFZA 5JXJA 2VUJA 1G9AA 2QBXA 4Z2WA 4A7KA 4JGYC 1OH4A 1PV0A 1N34O 2WZR1 4IGOA 4IEPA 1RUI2 4FAGA 2XJRA 2DVFA 4C0HA 1Q8VA 4LPLA 4DR4B 2ZTNA 3ZMTA 5D5QA 2PHFA 3WDVA 2L6LA 2RDSA 1RUF1 3CE2A 1AI6A 3WX5A 1OCZB 2DQ3A 1TME1 4Q4Y2 1W6PB 2JD4A 1OA3A 3J4UH 3USUB 3CCSV 1FAYA 1MZEA 2YXYA 1N1TA 1DGWA 1RVF1 2RE9A 5KAIZ 1VBE3 4UW4A 2LROA 1FKAO 4LF7O 4XF4A 2BV4A 2VNGA 1POV1 4BXSV 1PMIA 3CZJA 2EF6A 3IGAC 3MLKA 3JD4A 4CH6A 1N3PA 1WA4A 2JIGA 2OQ7A 3ZMSA 2VRZA 4RGAA 3ZXAC 3FB7C 4JYAO 3KZ4C 4XDOA 1CAXA 2OVUA 1EAH1 3ZKUA 1FNZA 5J1XA 1SF9A 1S0VA 2WYFA 5JCTA 2DWEC 2ZXWC 4IGQA 2ATFA 4R9AA 2CTQA 5EV7A 5C8CA 3LA2A 4U7OA 1WWYA 2B39A 5J2UB 2EIJB 1RUC3 2HWE3 1JYCA 3OR7C 1N1YA 2DN9A 4ZPIA 2FQPA 4ZU5A 3X2QB 4O9GA 1JJ2U 1EYBA 2ZHMA 4WZFA 4UCRA 5FYBA 4QHOA 4W6XA 1HP8A 3E86A 3L73H 2D6LX 2DVBA 1ENQA 2BSKB 1ZNPA 1YIPA 1DFQA 3IJ4A 5A32B 2WABA 3LQCA 4YVSA 5BUVA 3BA8A 3RZGA 1GLHA 2P06A 2JDZA 1XUQA 2WS93 4CU9A 3K2OA 1BEV1 3RWKX 1FXZA 3LEKA 4D6TH 1WUVA 4EN6B 2ITDC 4YJ2B 3GVMA 4IHJB 5BZBA 4KQ7A 3THOA 2VQFO 2A79B 4IEVA 3RBZA 2WNOA 4LUKA 5BNNA 3KS7A 4KG8A 1UZWA 1W0PA 1D5NA 2LP7A 1VALA 5IYCO 4JTOA 5BR8B 2HEYF 1AJKA 4XCAA 5C3RA 2Q67A 4C90A 4N23A 2BERA 1EBOA 2E3CA 3A8TA 2OXBA 5DPNA 4AHCA 3CIHA 1XE8A 2LJ2A 1FJGB 3A22A 3QH6A 3AYAA 4GKKB 2VCBA 3UNPA 1YI9A 2CWSA 2ZCWA 3O0XA 4N53A 1JU3A 5FXWA 5F5QA 1U96A 3JU9A 4CCLA 1IPJA 1UXZA 1AR62 4GKJB 5GKAC 3MUZ1 1ZRRA 4XIOA 4N21A 1QQP2 3WP6A 3TEWA 1UU6A 3PLQA 2IVIB 4RFRB 4Z2AA 1W06A 4FLUA 2X29A 1PPJH 2DU0A 1S72V 1QLNA 5JMCA 2PXJA 3HBKA 1YLLA 2QQWA 2QKSA 4E4SA 2WPDG 2MNGA 3RYRA 1CWPA 5FZOB 4PA6A 2ZX0A 4MGTA 4AQSA 1GWMA 1DG6A 2BSKA 1P7BA 1Q82W 5FK7A 4RS5B 3OGSA 4HVQA 3ZR6A 3M7MX 2FMDA 2L9LA 1LOFC 1OH3A 4OI2A 2CGPA 4AQ6A 4QPIA 2YDEA 1DLBA 4BDVB 1V9PA 1UY0A 4D6SA 1R093 3VB9A 3OUHA 1HNXB 4YGEA 1N32O 1XL6A 5K0UC 3O12A 4X6RB 4YXWG 3I56V 5C8CB 3I2OA 2Q30A 1ZBE3 2WC2A 4JKLA 2YC2A 1J3PA 2R30A 5FYZA 4LBMA 1N1SA 3ES1A 2YFUA 2IZWA 3JALB 2EZOA 5KHGA 4F8AA 5DDJ2 4KHPB 4H14A 3J9SA 3BPSA 3HJRA 5T52A 5F1RA 5FYTA 1E1RG 1WA8B 3ZFEB 3ZIWA 1WA8A 1HNXO 4NIAA 3ENRA 5BR8O 5C9AA 2FMYA 3EQEA 4QPGA 5ABJA 2XJQA 2WDBA 5H2FZ 1NUKA 2LW7A 4AHYA 3J7NA 1OT5A 2JECA 3I97A 4MTOA 2BEOA 1Y76A 3RWNA 4GX1A 2WNVC 5FMBA 1HB4A 3QOPA 2QQUA 1V00A 4XEZA 3QTCA 3LDDA 5KAFZ 5BNNB 3J7HA 1W2OA 2CDYA 3C7OA 4JX0A 1X50A 3PMSA 4YLZA 4UCTA 1A3KA 3ZFGA 1V6MA 5DAWA 3K3WA 5BNQA 5CFCB 2UXCO 1S0GA 4HSJA 1XQNA 3RN4A 3DF0A 3K0DA 1QOTA 3EFFK 2RR12 3K59A 1AR83 4FFFA 2EXJA 4MTXA 5J3UA 2JG9C 3KG2A 5FZOA 3VD9A 3ETPA 1YEWA 1LOAA 2CU5A 4FCAA 5FR3A 2ZE8A 2VCMA 4KBBA 3ZIXA 2Q8EA 1AR1B 3ICXA 3LCPA 4AQTA 4S2FA 2ETNA 4LE3A 3T4HB 1H2LA 1YI7A 4DPNA 1GQGA 5FYVA 4IUGA 1PZ7A 2VW2A 1K12A 1UF2C 2GHYA 2H0BA 3UKNA 1OCOC 1FYUA 1HDKA 1LKNA 3E5QA 1US6A 4XFFA 4X1KB 1B35C 3MEPA 4LBJA 2PYLA 5IAXA 4H33A 1KQSU 5FY9A 2W39A 3HKBA 4NO4A 5F9TA 3JXSA 1L8DA 3N3HA 3HKDA 4PQQA 4AEMA 4DFSA 3LSSA 3M3QA 2FB5A 4PCRA 4D3WA 1QLEC 2LS6A 4CCMA 5CNAA 2RDQA 1V55C 3P1IA 3BYWA 3RT3C 1O3SA 5LHHA 1NU1H 4HZFA 5DUVA 3DYMA 1QKQA 2ARBA 3KMHA 4I30A 3MFCA 3WQ7A 2XQXA 4UFJA 2Q8DA 3E97A 4IV3A 1JI6A 4GH4C 4QX3A 2EINC 2VTXJ 4E4ZA 4LF6B 3HWJA 2Z5WA 3AJYA 4UF0B 2YICA 3JBG2 1FNYA 4FPEA 1LULA 5L3GA 2YC0A 3SYAA 3H1WA 1X33A 1H2MA 4JKMA 1QVFU 1KRIA 5CZKA 2AZ5A 2WNUB 1MZ5A 3AKTA 3IB3A 1ZBA3 2R061 4DK0A 1W8NA 5M0TA 4RL7A 2R071 4OX9O 1K45A 2VD7A 3BCWA 1SPPB 1WP8A 5LATA 1Z7S1 5GLWA 4YZ5A 1Y67A 3V0AA 4MYEA 4C8DA 2PQSA 5T5JA 3KZIZ 2PFWA 4FQZA 1WW4A 2ILMA 1FXVA 4JTDB 1WKYA 2R042 2Y38A 3RSJA 1GNYA 1D2DA 2GDFA 3WB1A 2YIAA 4RWUA 4BIZA 4ZZ8A 1OCCB 4BMEA 4XJAA 3UYJA 5JXGA 1Y3TA 1ZZ9A 2QWRB 4TLGA 4N90A 5F3GA 2Y6FA 4B4RA 3VHOA 3SH5A 1GUIA 2Z2SB 2UUBO 1AR81 1W04A 4OFGA 1S0FA 4GIQA 2DYRB 4M4RA 4WFEA 1Z5WA 4RHV2 2DMXA 4JI6B 4CCKA 2XKPA 3HNBM 1W8FA 3J8F3 5A6XA 1C4RA 1VLNA 3IPVA 5IK8A 1C8M2 4OPAA 1FV2A 1CIYA 4P2ZA 4FBFA 1UYXA 5HCAA 1UY3A 4QWNA 5FZCA 2GBOA 2UY9A 3G80A 4Z07A 4AK3A 2MEV1 3TB0A 5JZGA 3UGGA 4XILA 4HMZA 4R50A 2DTYA 5FXZA 3K46A 1N47A 4Q8LA 1UZZA 4PBOA 5L9BA 1O6UA 1AYM3 4N43C 5LY1A 1XILA 4ASUG 4QM8A 2WLIA 4JV4A 3FE5A 4LLOA 2LGQA 2WS92 4Q1RA 1EM1A 3HT2A 4AQ2A 3P32A 5GJ6A 1S2BA 1KYOF 1L3JA 3VZOA 2E7AA 1YO8A 5F6LB 1D4M3 4MVQA 1NTKH 1DQ0A 2C9AA 3OUFA 5IYDO 3APQA 3B01A 2VMGA 4RS5A 1CZTA 1E5HA 1WBFA 2WNEA 4C7UA 3WG1A 4Y1VA 4H55A 1UOJA 1NJIW 2ZS6B 4X64O 4NHMA 2F4PA 3AK0A 1O3RA 2VECA 4BPZA 1BHBA 1FPN3 1RMU3 4QMAA 5FZMA 4B7EA 2WKKA 5CBFA 3T2PA 2P90A 3DL3A 2V5DA 2FL4A 1SQFA 3ZYPA 5CKNA 5IYBO 2VH9A 1HXS2 3LZZA 4HK9A 2BPA2 4FPPA 4DIQA 2JX9A 3VBUA 2A7WA 4XAEA 3OJBA 4JDMA 4N8MA 4DK1A 3CRCA 1PP9H 3WVJA 1OLQA 1RB8G 2XAHA 2WO1A 5LK7B 4BQ3A 2YUAA 5H6QA 1LENA 4AI0A 5I0RA 2YIBA 2AREA 2QZ2A 2X09A 3AZXA 4Z82A 4O61A 1Q8QA 4QQOA 5DZFA 3CJHB 4LWSB 2RN9A 3BABA 2CL2A 3RS6A 1KJLA 3QF7A 1H1MA 2HJIA 4Q4V1 1RUI3 3IDCB 4XJ9A 1VMHA 4DOUA 4JI7B 3BALA 1GP5A 5K1PA 2Q4SA 2Q8OA 1SFPA 4YNIA 5GTIZ 4LEJA 1G9BA 1W2TA 3O1VA 3WG3A 1UO9A 2W1QA 4IEUA 1AR92 3S5QA 2HKOA 3CP1A 2X10A 5F5IA 3JARA 4K9SA 2RMU1 1O59A 1DF5A 3BVOA 1WBLA 2XGXA 3LNMB 5K0UA 3FLPA 4IT5A 5F3IA 4JI1B 4K0KB 2J7MA 3LF7A 5LCWL 2BJSA 3SHRA 1OHHG 4DR5B 4JASA 4LO7A 2XWJB 3TAYA 5FPVA 2H3OA 3ZM8A 5EC1C 1O5UA 5EIBC 1R6NA 5FXVA 3JASB 3NVCA 2XUEA 3B4SA 1QU7A 5FIXA 3N7JA 2Y69B 3TNQA 3ON7A 2XJTA 4ZU7A 5EIYB 2XBO1 4WM8A 1VP6A 2GSMB 4QDSA 5EQUA 1ONAA 3VQXA 2QEXV 4FFBB 4HK8A 4UCOA 1AXZA 1XB9A 1D0GA 1HRV1 1XNAA 1XYPA 4I0XB 3HD8B 3LE0A 4NOTA 3HVDA 4K21A 4MGKE 3LDEA 3AVRA 5LYJA 1UPIA 2G9FA 1BZKA 5K4LA 1ND3A 5JJJB 1QXRA 1YFUA 4IE0A 1EUTA 4WFAV 1H2NA 3W5MA 3DYOA 3HR9A 4OHZA 3TYJA 1FX5A 3OD0A 2LRPA 5FLJA 1GMGA 3MW2A 2X5IB 1VP7A 3I3BA 4FK5C 3K03A 3NW4A 2VBBA 4FLVA 2QQMA 2CWMA 3SKVA 2IH3C 5HV0A 1BSMA 3P30A 2N04A 3JAMN 3ATGA 4H7LA 1ZLZA 2RR13 4OMDA 1CAWB 1RUC2 2F66C 3SDLA 3IIAA 1GM9A 1KEXA 3H1YA 2A9HA 1WMXA 3I3EA 1LR5A 4QHBA 4JI3O 4K8FA 1RUNA 3TXQA 5CEHA 1H30A 3OR6C 2QVSB 3AG7A 1MSWD 4WM7B 1RXFA 4COUA 2Y0IA 3JAWB 2XL9A 3OPWA 5KR7A 5F5CA 4BW9A 1W9WA 3WT3A 1KC8W 3WUDA 5LZ6A 1JW6A 2D43A 2FCUA 1S2KA 2EJRA 4EFEA 5LBCA 2JB8A 4PLOA 1CGPA 1B06A 3B09A 3RDIA 3CHXA 2HWD3 1KECA 4PHZA 3HNYM 4P14A 4Q0SA 3NO8A 1H8TA 3FAVB 1COV2 3D3IA 1QXJA 3TRSB 4PT6A 1GN2A 3RMXA 1R64A 1NCRB 2XJPA 1N3QA 1ULCA 3QVNA 5EC2C 5LGNA 2J22A 3WP5A 1R73A 3OE7G 4P00B 2YFZA 3UETA 2IXLA 1PL4A 5A1FA 4I4TA 1K4CC 5FYUA 2YB7A 3QLQA 1GQPA 2A6ZA 2ADDA 3PTRB 4UFKA 5JXIA 1Z5VA 1U5XA 3ZX7A 1JZ4A 3BTAA 2UYBA 1RJ7A 5A3NA 1ZL8A 3R66A 3MGUA 1NH2B 3SH3A 2KSDA 4TOIA 1VQ9V 4OQ9A 1NXD1 2C26A 3B2EE 5A3UA 2O0OA 4YW5A 1CPMA 4B3SB 4PLNA 3A2FA 2VOKA 2PYJA 4YHHB 2W1SA 1NH2D 2K9ZA 1VBD1 1QNYA 1ND2B 3FL7A 1IBMO 4PJYA 5EP9A 5FPRA 4MGQA 5LEJA 4NPLA 5BPXA 3H9VA 5FOBB 3CO2A 3CRQA 2BFUS 1GZTA 2HWB1 1AJQA 3INAA 3IZOA 2VS0A 3LIHA 2VXJA 5FPUA 2IXCA 4GKJO 2PMWB 4WVZA 2NQYA 5FY0A 2GP5A 1Q3EA 2NZ9A 4CDQA 1VIWB 2P5BA 4CEWB 1BCCH 1KKCA 3ZRXA 2XLGA 5DN6G 4KWUA 1L7LA 3DN7A 3SCHA 4CEWC 2AYHA 3BFRA 2ZJCA 5FY1A 2VQEO 4CDXC 1ZRIA 3EMRA 4XUQA 5FQ0B 4JI5B 2P2KA 4ZHQA 3KD4A 5FZ9A 2VZVA 1J3RA 4B3SO 4NRMA 1VF7A 1I9RA 1CAVA 4GA9A 4N53C 5HCFA 1O5LA 3VBFA 4IE6A 4B3MO 5FKBA 4Q4Y3 2JGDB 2M7WA 1J59A 1JN2P 2YXHA 4EV0A 2RM22 3M70A 3TEYA 4BM8A 1SQPH 1UU4A 4JTAB 3DGTA 1PIV2 4AYUA 4E2GA 3PVEA 1HIXA 1KJRA 1LNSA 2A06H 4FAHA 1TA8A 1K5MA 1QJEA 3Q8AA 4FVMA 4LF5O 3MLLA 3MIEA 3L70H 1NYWA 2AXTZ 4V2VA 1OBNA 5B2GB 5C3SA 4I0AA 4LO4B 4NVPA 1REDA 3IAYA 2V1DA 2W9XA 4HPKB 1ORQC 1MNGA 4Y22B 3ABTA 5IYYA 1RVF3 1I0HA 1J95A 3RZJA 4Q6GA 4DV2B 3OYWA 1RINA 2N74A 3M99B 4MVUA 4DR7O 1QQP3 1R3LC 4NIIA 2E7QA 4PV1B 1RUG2 4OVEA 1LU2A 3S57A 1QXPA 1WP7A 4JQTA 1QOOA 4YVSC 2VMFA 5DG1A 1JJOA 1VR3A 1ENXA 3L2YA 3ZPOA 3T4ZA 4QDRA 5I0SA 2R72A 1RIRA 1ASJ3 1M90W 4L97A 4HONA 4LBNA 2W6JG 4HG6B 1BVP1 4Q0PA 2A3WA 4E4DX 1D4VB 2R062 2BNOA 5JOYA 3NWKA 3BAAA 2RS53 4AQYB 1WLTA 3OY8B 3WNLA 3I2KA 4HN0A 5FCCA 2Y6HA 1JOBA 1S0JA 3E1F1 4GX2A 4DXSA 5KMGA 1FYJA 1ZRDA 5LHIA 4UI9L 4ARYA 4LUMA 2PLV3 1PZ8A 1FI2A 4JKKA 4GX5A 1LOCA 2FDKA 3CC2V 5A7OA 3RGBA 3VZJA 2GC0A 3V0AB 2UURA 1GQHA 4RSUA 4XCBA 4O2AA 2PQQA 1SA0B 3ZN4A 2RS31 1AI5A 1COWG 2OW4A 1R3KC 2Y4UA 4E27A 4BOWA 1K33A 3VUOA 4ONUA 3CMAV 3T1HB 1JS9A 1OD3A 4KU8A 4LFBO 3U4XA 1NAEA 2CAZC 2VZQA 4D7TA 3KV4A 4XW3A 4LBQA 4FPGA 3ZYRA 4BA6A 3CKHA 4HLTA 1AR93 1N36B 1H8EG 1KMIZ 4D6QA 3NNGA 3WCSA 3GGLA 3RVZA 1MVQA 3X29B 4BIFA 4J42A 3N9MA 1YQ2A 3SISA 4JZGA 2JJ2G 1ULDA 3FFQA 2YI8A 2YMZA 5JMOA 4RHV3 4XQWA 1J83A 3E22A 1UY2A 5B1NA 3SEPA 1S3JA 2ETEA 3IAQA 4MVMA 5F8PA 1XU2A 3DC6A 2NM1A 3AMPA 2Z5UA 1PNFA 2ZGKA 5ANQA 3RW0A 4RGGA 1DZQA 1GKFA 1JZ2A 1SZBA 2GUZA 2E7TA 2JS5A 2O8OA 2YROA 2E53A 4B08A 4D69A 3LEIA 3QH7A 3S3XA 3P5BA 4ET7A 4HT1T 2TEPA 1NE4A 1QQP1 3K4ZA 4NJ4A 2OYQA 1V6LA 2HFEC 3O1RA 3GB7C 1IBLO 4GMP1 2WZR2 1OOPC 4QIWF 2QQPA 4R9BA 4Q2FA 1AYM2 4MGSA 4N7IA 1OVSA 3LSQA 3DUIA 1WCDJ 2ZHNA 5FZ4A 1S76D 1OKOA 3N2GA 1BMFG 1KS5A 4LNUA 2FZ2A 3VDDA 1SLLA 4QGLA 2EILC 2Q7HA 1TNRA 1AX2A 4K3UA 4DV5B 1IBKB 4QX2A 4LF4O 2EAKA 3AG3B 5C70A 5KA5A 5CFDC 3K79A 1UYYA 4FOWA 5CBLA 1O3TA 1ZREA 4IYHA 1R3JC 2B42B 2YIDA 1XNQO 4PDRA 1HWYA 5DXDA 2ARHA 4JI8B 5A1AA 1DLLA 1G8WA 2VOXA 2ADQB 2OZJA 2DCKA 2IJIA 4UCUA 2VUAA 4CEYB 5FYSA 1HQLA 1X82A 3X2QC 2FDJA 1A8DA 1W99A 4HN1A 1PMJX 4NR1A 4FOYA 1LB2A 2QQNA 3JBG3 3ZDSA 3I8TA 5GM0A 1V9U1 4MS2A 2WR9A 4JGYB 2B7YA 5LK5A 1RSOB 1V54B 2R072 3L74H 4CH4A 3OT7A 1C28A 3KF5A 3OMNB 5FZ8A 1M56C 3K48A 1AR91 4PELA 1UMIA 4OYUA 4WFFA 3KKYA 3K3OA 3POFA 3ACGA 2AUYA 3AG2C 2BOBC 3QO5A 1I08A 5BV6A 3ALQA 1C5HA 4XF9A 4W4KA 1DQ4A 3LA3A 3QCWA 4XFCA 1RXGA 2VZTA 1V70A 2OS2A 3SCFA 2G38A 3VKNA 1Q86W 3O9OA 5E89A 1X9PA 2O1QA 1W39A 4IIJA 3D36A 3WLUA 4O65A 4XACA 4I55B 2I74A 1VQPV 5L36A 4PJ0Z 5L3FA 2UYAA 4HVRA 1RM1B 4XDPA 3N9QA 2ID4A 4AFBA 1K7DA 3NV3A 4AL9A 4WBNA 4OHXA 4BQWA 3APOA 4E8CA 1LGNA 3VZLA 5JH7A 4EEQA 4TLFA 4XE9A 5A7PA 4DEVA 2MEV2 3K77A 1C8M3 2UU8A 1HNZO 5FP9A 1PVC1 1TZOA 2PTMA 2ZOEB 2R1DA 4LE4A 4C1XA 2W52A 1PO23 4Q4W2 1ST8A 5FKCA 2FZ1A 1US2A 4A5UB 3CD6V 1WNSA 4FPKA 1W05A 1P84F 3T2MA 5GONA 3C7FA 4IE4A 3F5WC 3GWKC 4DV4O 1XSRA 1OC1A 1ODMA 3MF9A 5LMNO 2QQIA 1BK1A 4AI8A 5A3OA 1T2XA 2VPVA 4KWLA 3JD72 1PZ9A 4U2AA 2EIMC 1FFTB 3AVSA 2ATKC 2D97A 2R9AA 2WSVA 4UOJA 5LW9A 5DEDA 1DQ5A 5A3LA 1NA1A 5A33B 4BWAA 2C6SA 3AZZA 3WDXA 5ACA2 1DGLA 2QKDA 5FO7B 4LFCB 2DWRA 4RR3A 3L9DA 1R081 1X36A 2DYSB 5IVBA 3UESA 1MOFA 1FPN2 2IXIA 3STLC 3MUY1 5BNOB 2JDPA 3ZMVA 5BMVB 1BJQA 3K06A 4ZKIA 1RUE1 1URFA 2ZA9A 5JH7B 1V9U3 1TME2 4Q4Y1 2WRAA 2BWCA 4CC6A 1BS3A 1MPXA 1DF0A 1F5JA 2RS13 3S6PA 3VHPA 5FZGA 3R65A 1CPYA 1UAIA 4X20A 4XJZA 1CAVB 4NUBA 4GT1A 2W47A 3B00A 3KWVA 1ZRCA 2A7AA 1SPPA 5A7WA 3VD3A 4DXTA 5BY5A 3JCZA 1NCQC 3UKTA 4NXNO 5DAXA 1YQ5A 2CDOA 5E16A 2ZE7A 1DGSA 2JEUA 2B8MA 5FLXN 4J1XA 2TBVA 2E33A 1YTFB 5FPZA 4AWDA 2Y6GA 4XVHA 4B1MA 1O4ZA 4OGQB 2I45A 2BP6A 5FK8A 1GZWB 2HYKA 1W6NA 2XAGA 3ZR5A 2QM8A 1VRH1 3ZRWB 3JSLA 1DQ6A 3RJ2X 5FPBA 4YZ3A 3ZLIA 5L9RA 3CLPA 4LF5B 3RYHA 4X65B 5LXTB 1KKDA 1PX4A 5L7OC 2ZIOA 2UU9O 3KF3A 4U36A 1HRI2 2OIIA 4ZKTB 5CG9A 3B9CA 2DQ0A 4ZXEA 3POBA 1XBFA 4UFZA 4CP2A 3RYHB 4ASMB 1SDWA 1BVVA 1JQ0A 1QHDA 5B5EZ 1VBE2 4TWKA 2JRIA 2WLPA 1MS3A 4EN7B 2CTWA 1M06G 1YTFD 1JH5A 1U5IA 3OTOB 4G3YC 4TV8B 2PHWA 1LGBA 4MTFA 1FMD3 5IVEA 2ZQMA 1PGSA 2JIZG 1D2QA 1Y9QA 5H5NA 2D44A 3I2GA 3CJXA 3LEMA 1FATA 2ZEWA 2Y8KA 2JG9B 2D6OX 4DV5O 1IBKO 1F9KA 2JE7A 1GRJA 1GAXA 4DUZO 2IC1A 3EXAA 2WFF2 2VTFA 3THDA 3SLIA 4JTNA 1WCSA 2JEXA 4AVTA 1Q43A 5CA3A 3QO7A 2WA4A 3ASOC 1KQRA 1QY4A 4CUGA 4MW8A 4TSVA 3E8HA 5J37A 3ZN0A 4XTPA 3JQXA 2VQEB 2SBAA 2VNVA 4PLMA 1PGW2 2GMEA 2DCJA 4PBPA 4CDWA 3ZXKA 3DXRA 3JAWA 3SH4A 1M57C 3JD71 2YI9A 1IS3A 4L11A 2GUZB 1RUI1 5C71A 5IJ0A 3E35A 1GNZA 4AGRA 3NAPB 4LHSA 2PAEA 1K9MW 1VMGA 2Y6JA 4JI3B 5GLVA 1MEC3 2HEPA 5KBFA 4XBNA 4CP1A 1CZSA 3NKTA 4QKBA 4J25A 3VV1A 4RQPC 5HXVA 1O9HA 2WZR3 4OXSA 1JA8A 4DRVA 1Y76B 2G19A 4B3NA 3O1TA 4AILC 4DR4O 3MIGA 5DMYA 3UT5A 1GR3A 3UT5B 4TYSA 3T4DA 3LFMA 4BIOA 3RZHA 3IMMA 4LWSA 3OMIB 4PDMA 3ZRWA 4DNYA 3U07A 1XREA 2BW8A 5JIAA 3B7MA 2UXDO 2PF4E 3N9NA 4IEYA 1GZWA 1OOPB 1UYPA 5GONB 5IT9N 2VVFA 2EIKC 1VRH3 4F3JA 5CYYA 4HPKA 3M3IA 4ES9A 2EVXA 3AMQA 2NLRA 4Q20A 1LHNA 1RMU2 4R9DA 3OUIA 1BYHA 4I3GA 2XKOA 4JDOA 1F4NA 1Q8IA 1TVKB 4MSVA 5L19A 3CJIA 2L35A 1BE3H 4PIXA 3AMHA 2EIEA 4UB6Z 2AZ0A 5JOZA 5IVJA 4IW3A 2DFBA 4OUSA 2X6CA 4U7NA 3ABLC 2WLHA 2Q9LA 3SJBC 1XDCA 2HP8A 4ZS3A 1ZVFA 5ERLA 1R1ZA 1JPXA 4CCCA 1TAEA 4MZUA 4V1PA 4DB5A 2OTJV 5IDJA 2ERFA 2RDNA 1OQ1A 4F7ZA 2ZR3A 4XHBA 3BVCA 1O8SA 3CEIA 4ZXKA 2RR11 4XURA 5IYZA 1JUHA 4L8QA 3OBTA 1QJX3 4XFGA 3W7SA 2W91A 1S0CA 5DUWA 3I2HA 2GNDA 2ZX3A 4I9QA 2DWDC 2YGLA 5FYMA 2VZOA 4PDWA 1DK1A 4RS5C 4XFAA 3H42B 1HR0O 4CUAA 1CJDA 4ICGA 4CXXA 5LRSA 3AMMA 4URAA 4UV9A 1W8ZA 3WQ0A 5FZ7A 5B1BB 1HDJA 2VW1A 1M9NA 5JIUA 2ZGUA 2A6VA 2P22C 5FFOC 4M0NA 1RPRA 4LO6B 2OT7A 3WDTA 2QWPB 5L3BA 4N9HA 3M3EA 3ASNC 3SJCC 4FZ1A 3FUQA 1WB8A 4FVVA 2P6HA 4A3XA 3OBAA 3VBSB 1J3QA 1HXS1 1W3XA 3B8NA 2VULA 4R9CA 1L7RA 2BBAA 2H0VA 2OYZA 3LDCA 1DCSA 3OGVA 5A32A 3OB8A 1SLCA 5SV5A 4EWDA 4K3AA 3HIFA 1VB2A 4QT6A 1STMA 1AYN1 4CCDA 2BTQA 4DUWA 1VB4A 2DJVA 4J41A 3IWZA 4L8JA 1PVC3 1NCRA 2KKWA 3MFAA 4BHPA 4JV5O 3CX5F 5FQ0A 3MIHA 4XYXA 2WLMA 1EN5A 2KB1A 2GDSA 5F6KA 2QJ1A 1AROP 3ZKYA 1VBC1 1M4WA 2BTVC 2QKAA 5G04L 4DR7B 2OIGA 2NMOA 3CRRA 5DQ0A 4E2QA 3T1CA 2CHHA 3ZO0B 1BCXA 3I2DA 4GZ9A 2X8KA 1F35A 3AYEA 5C9AC 3ZIAG 2KM2A 4XTMA 1VBA1 3O5SA 4OHVA 3A0KA 2Q73A 4X8NA 2DCYA 3BCCH 3FBYA 1ULOA 3NJZA 2RMU2 3OF1A 4LKFA 3VQYA 5E88A 2RS52 5JI7A 3VBUC 4DRXA 1I1EA 4LK7A 3T08A 3GWOA 2Y0PA 2C9KA 4BJ0A 5KHHA 2JG8C 3T4VA 1R083 4O4HB 4PA7A 2JENA 4CEYA 3U0ZA 4P08A 2WZPP 2XJUA 1SCRA 2W6IG 1QJU1 1RHI1 2EIGA 1AILA 1AF9A 4ZBMA 3GHNA 3RYFA 1LHVA 5D8AC 4HBNA 4H3WA 1C57A 3NAPA 2DFCA 2F4VO 4E8DA 3EB7A 3MV01 4LF8B 1UMHA 2W95A 4IXLA 1YJNV 2AENA 3TN91 1SBEA 2G9ZA 2WN2A 1DZTA 1ZL8B 1WGPA 5JPNB 4GB31 1MR5A 1RC6A 4YVWA 2EALA 4KGGA 5D21A 4W6WA 1EP0A 2DUPA 4DV6B 2HWC3 1W3VA 1WA6X 4YG6A 4KWKA 3BHPA 2WINB 4QE7A 2QR4A 2F6BA 5LYJB 2VQTA 1H0BA 1W2NA 3ZSJA 4MTGA 3ZHRA 3VBOA 4IV1B 5FY7A 4ORFA 1GBGA 5GLZA 1WPXA 4DY5A 1VQKV 2Y48A 2V5YA 5AC93 4WBNB 2Z69A 4UF0A 1WLEA 1JBCA 4XFHA 4CCEA 3VBHC 4AEDC 3RVHA 4W4LA 1FD9A 1U5YA 3MHSC 4JYCA 3ZXDA 3POGA 1YFWA 5F2SA 1GN3A 3CCMV 3NMBA 2VZUA 5HFLA 2K46A 1XNDA 4W65A 2ZZJA 1FMD2 4Q5OA 3J26N 4IESA 1H4GA 4WVMB 4QQ2A 4JGZC 2EJ7A 3MW4A 3AFGA 3E5XA 5L7OA 3HKCB 3WZ1A 4X88A 3NQHA 1VBC3 1MMMA 5JZGC 2ITCC 4HANA 1XXNA 3R0RA 5FTTC 2MHFA 2JDNA 4CDQC 3BTZA 1AR71 4ZIBA 3BI3A 4P30A 4X8PA 3FB6C 2D6KA 3W20A 1W2AX 1Y4WA 1UY4A 4WFGA 3CJIC 4Y5TA 2RM23 4FT8A 5IWAO 2YBSA 5LP6A 3SJAC 1JVMA 4DXWA 3T1LA 4YGBA 5JVDB 1UFIA 3MV11 2GZWA 1B04A 4EROA 3RQ0A 2BQPA 5FRAA 1FPOA 4GKYA 1GOFA 4P9PA 3HEIA 1WCUA 1Y6XA 1OA4A 1WLCA 1QOSA 4Y4RA 5F32A 4JC1A 1XNKA 4TWTA 4XXAA 4GKKO 4EN0A 4EN8B 2GTSA 1QJZA 5DZEA 2DW4A 2UUCB 4YM3A 1QJU3 1RHI3 3IDAA 4LC1A 2UU9B 1Z7S2 1S0IA 4IE5A 2QE3A 3FYEB 3PUAA 2E63A 4TQFA 2AEZA 4BXFA 3H1MA 3THTA 1R6KA 4NIDA 1ZWIC 4LP8A 1S4CA 3TEXA 3B77A 3DCQA 1QMJA 4OHYA 4LBQD 2R073 5HCBA 1JYWA 2B9ZA 2QQJA 3ILNA 2ZGMA 5IATA 1KUQA 2HWB2 1QH6A 1UU5A 5FUNA 2IU3A 2B9VA 4OUEA 1HRV2 1H8VA 4Q26A 4XBLA 4IERA 4ZU4A 2ZX1A 5LP6B 4RA0A 1L0LH 1PD3A 4H7MA 2EIBA 4QGMA 3WR0A 1IOAA 1DDLA 1NZIA 4MO3M 4FIPC 1WJZA 2ZMLA 5F37A 3LPGA 2FCTA 5T5LA 2QDRA 3SEEA 2UXXA 4TTGA 3LSDA 4OULA 4FM2A 5LRRA 3RWRD 4BK4A 2WLKA 1BT8A 4JYBA 4U3FH 4Q27A 3VL8A 4BQ2A 4CXWA 1DGRA 1VBE1 3FX7A 3O14A 3KCYA 1PIV1 1YJ9V 4QE9A 2H94A 4G28B 3B69A 2W92A 2FKXA 3RYIA 3VDCA 4LF7B 1C1LA 2RMKB 4CZSA 3SJQC 2MK3A 2PHXA 2ZIMA 1Q8SA 4Q4X1 1JODA 5LMUB 2R32A 1VBB3 4CXYA 2CH7B 4BW5A 1YITV 1BZWA 5KXBA 5JSRA 1HNZB 3MW3A 4COVA 4X9QA 4IGPA 3ZHVA 4WM8C 1CIWA 3NNJA 2HKXA 1I7FA 4OI1A 3AZVA 1F15A 1QJFA 3AFKA 1SRYA 3T2OA 4I4TB 3HKEB 4UYBA 3DKWA 2YV8A 2GMMA 1UX7A 1FOD3 2ZZQA 1JFFB 4X66B 1SESA 2DYSC 1E5RA 3N2GB 4AQYO 2CAVA 1Z0HA 3VN4A 4JAVA 1SEFA 1ULGA 2J1RA 4BU2A 3ST7A 3E8GA 2Q68A 1OFNA 4X20B 5LMNB 4AEKA 4A7YA 2JE8A 5FOJB 3EXUA 1FPN1 3TGUH 1ASJ2 4J7ZA 1VIBA 2G9GA 4PA9A 4CP9B 4GB33 1LOGA 4JHTA 3WNOA 5CU1A 1OLME 3GZEA 3GXUA 3MAQA 3WG2A 4AFMA 4AVVA 4GAZA 4XDJA 3PNAA 3HB3B 2YUEA 3ZS8C 5T5OA 2BTOA 1SQXH 5FUIA 4AVAA 3E6CC 4BK5A 1AX1A 3NJYA 1QEXA 2PHTA 4QKDA 4OCTA 2XPJA 3KV6A 1OPOA 4DUYB 1N1VA 5A9GA 1V9U2 1FT9A 2ZKNA 1TUBA 2DU1A 3WW2A 1NY71 1NQJA 4JAUA 2ZAHA 4PQ9A 4UVBA 2IUWA 5EYYA 1KFUL 2WBKA 3OEEG 2Z4FA 4DR6B 3B8MA 4AHXA 1JZ7A 4O4JB 5HFMA 5IVVA 4Q0UA 3NV4A 5CFCC 4ISQA 2XUMA 1YSCA 3AKSA 3MZHA 4TUYB 2V4DA 4WV8A 3I3DA 2JDKA 3V65A 2JKXA 2NN8A 1AI7A 2EAAA 2PHLA 4BQ4A 1VBD2 4YVSB 2WNVB 2ZGTA 2FDGA 1FXKB 1S77D 4QU1A 5C8YA 3H7YA 3FWEA 3LUTB 2EXHA 4HVOA 3ZHSA 3MPPG 4FZ0A 1Q8PA 3DYPA 4ZZ5A 5EZWA 5BY1A 4FTEA 3UL2A 1NE6A 4FPJA 1F4MA 2E32A 3J80N 3ILFA 3O7OA 3UO3A 1FV3A 3ZFFA 1AVMA 3OUJA 3L75H 3CMEV 2Q5ZA 3CPWU 4D7YA 3BIWE 3E83A 1RUH1 3ZXLA 5JQGA 4BAYA 1RFYA 3K04A 1SERA 2WQ8A 1V6KA 1Y43B 3VBRB 4M3CB 3ABUA 3QG5A 2YSUB 3K9AA 4HNAA 1B35B 4LIVA 1TGOA 2K9PA 2ZABA 3JASA 5A7QA 3VLBB 5F5AA 1TNFA 2A75A 1PK6C 3MPBA 1DYOA 4NHYA 1IS5A 3IMNA 2RM21 3AP9A 3BU7A 5C3OA 4UVAA 1VMJA 3NNFA 1F8VA 2WLIB 4Z1VA 2P4VA 2YYOA 4Y1YA 2R1BA 1Y74A 4ES8A 4ZS2A 5KXCA 4GCZA 1PO22 3VHRA 1OQDA 2JG8B 4AVBA 5GZDA 4CZZA 1DBNA 4GWNA 4HSLA 2IJJA 4MHRA 3VD5A 5KHJA 4JZRA 4S2GA 1M4UA 3HKDB 4ZOLA 1W8HA 3W9AA 4JQRA 1F5FA 5JLVA 3L9JT 2DBIA 4GQ7A 1RSOA 4L87A 5JOWA 2B46X 3U11A 4R8CA 1KITA 3CSXA 2VM9A 4CU7A 3NAPC 4L99A 4NTXA 4XMAA 3CRMA 3D36C 3JUUA 3BN6A 4DR1B 1HR0B 5FMCA 3CMGA 2Y64A 2QDOA 1W03A 2JDHA 4KFMA 4M3CE 2XAQA 2H6BA 2ZDIA 2ZHKA 1G86A 3I3MA 1B6QA 2QFEA 4TT3G 2Q7EA 3NNLA 2XB6C 4A45A 4CC5A 3SYOA 3APBA 1SQGA 4EYUA 4FJCC 5FPAA 3D0JA 4QX1A 4BWOA 4G27B 3F5TA 5IAVA 3ITQA 5AFEA 4FOQA 3H1JH 1F2NA 2RJ2A 2HWD1 3RYKA 2IXHA 5FZAA 1GN6A 1L1FA 2OT5A 5DUUA 2BCCH 4I01A 1GU3A 4I55A 4P9OA 2R041 2VZ3A 3RI8A 1G8MA 5FZ3A 2D3RA 3DECA 5CVRA 1PIV3 4EB6A 4PF5A 3WXPA 5FYIA 3T1YO 3UKMA 1K5JA 1QIQA 4QQPA 1U0AA 1VAVA 1WPBA 1NCRC 4JI2B 4Y4YA 4CSWA 3LB9A 4GJZA 1GV9A 1ZZCA 5FV3A 4I02A 3CNAA 3V64A 4M0HA 1LHOA 1THZA 1MS8A 2J1TA 3C7HA 2LW1A 4WVMA 1UZYA 4GKXA 2FYUH 5FMOS 2XWBB 1SS3A 5L9VA 3K5NA 1PO12 1N3OA 3VD4A 4JGZA 2RJKA 1H8TC 3E6BA 3I5DA 2DYRC 3G7DA 3WHUA 2LQTA 3WNXA 5KUMA 3UV9A 4V2WA 2PAMA 3E5UA 5CB7A 2PHRA 5IHRA 1H1IA 2ZAAA 2QQKA 2D98A 1KDMA 1ND2C 4LHNA 4W50A 2HJFC 2VOTA 2VCAA 1G4YB 2IW5A 4TZDA 1H9WA 2WS91 3OCPA 5LBFA 5B4XA 1BEV3 2DTWA 1VQ5V 5CA1B 5FO9B 1MS0A 1TUEB 1NR7A 4B7KA 3J7AU 4IEZA 5GZCA 4Q29A 5F7UA 3AXDA 4CUBA 4L0PA 3ZPYA 2PY5A 1N33O 1PM9A 4BB3A 3VBFB 2OA2A 3JD73 1V0AA 1ZX3A 2QTOA 2CAUA 4C1WA 3WNMA 5T50A 3H9AA 2TNFA 2WNUA 4JI0O 2B4KA 3A0RA 1IVSA 2EXIA 4CDXB 5C3QA 2WFF1 1VARA 2WNVA 1CXZB 5I8YA 5FXXA 2P5OA 3AC0A 4YVWB 3KB5A 4YIPA 4PDWC 4X1YB 1ENRA 3JYCA 2WO7A 4AZZA 3LDBA 3AYDA 3ZFGB 1QR8A 5CA0A 1OXCA 4LHLA 3BGAA 3WDWA 3H3UA 1ND3C 3ZFGC 3S3WA 2UWAA 3PVBB 2W68A 1VBB2 1YIJV 2FBEA 4LH7A 4LFCO 1MS4A 3O1UA 4DV0B 4JI2O 4QB1A 3JCUZ 4K8XA 3SXWA 4DV1O 3O0VA 4NTYA 4FMTA 2ZM6B 3F2ZA 3U10A 4K6BA 3NJVA 1LHUA 5C9AB 4Y1UA 2J42A 1QHTA 3WNPA 3G71V 3WW3A 4RD7A 5DDJ1 4NRPA 1FOD2 4S2HA 2P3KA 2YPJA 1VBC2 4AI3A 4QD2A 3FHQA 2MEV3 3URFA 4CP9A 2DE0X 5CBGA 4OQ8A 3N2KA 5AC92 4BLJA 1MSDA 1Q90D 4MVSA 1R091 4OUMA 4LBEC 4LKEA 4M01A 4LO8A 1MG1A 3I54A 2PYTA 2Q1ZB 1EV13 2GC2A 3ZFFB 5HV4A 3ZFEC 2Q8CA 1VRH2 5AG2A 1OF3A 3LSEA 3S30A 4YG3A 5K7PA 1H38A 1MS1A 4LBOA 3PVOA 4QPIB 1NS1A 4KNCA 1XNQB 2RS51 4YJ3A 2BZDA 1D4M1 2GMPA 5LMUO 2P3IA 3F95A 4UCSA 5B1AB 5IVFA 4CRQA 3BKZA 3Q4HA 5A6YA 4NPMA 2VWKA 4U3JB 1PGL2 3E8FA 3UM7A 4LOSA 1BHAA 2PLV1 4RAIA 4ISRA 1NLSA 4DUYO 4H44B 1R1A3 5BNPB 3CF6E 3I59A 4JAAA 1TQ5A 3ETGA 3GJBA 4FLZA 1F23A 1DYPA 3M2MA 1S5HC 4FPLA 1UX6A 3N7LA 5IT6A 4RQPA 5BXZA 4SBVA 1W0OA 3E8BA 4XHXA 3O1SA 3I3QA 3MIBA 1WZXA 4LTAA 3OG2A 1C3HA 2WAOA 1ZM1A 2GALA 4JGZB 1YRZA 1U12A 4CDUC 1MEC2 4NHXA 4K1YA 3VHNA 1P49A 3O1MA 2V7QG 3POSA 5IUQA 4CDQB 2O8QA 2WFF3 2VMEA 4QPGB 5ABJB 3CL1A 1SQVH 4O2BB 4HL0A 2XOKG 2IFWA 4NHLA 5FO8B 3TBDA 5CA0B 4KL1A 4JV5B 1RTVA 2Q7GA 2X6AA 3JAKB 2GN7A 4FP3A 4COYA 4GULA 1PVXA 1GH6A 1OI6A 2OUJA 2MW2B 3PUQA 2WA3A 3N27A 3GHMA 2ZX4A 2VR4A 5C5UA 2GSYA 3CCUV 2B1IA 5HI0A 3E89A 5JDBA 4NYKA 2XNDG 2UUCO 3GBGA 1R3IC 3UCSC 4W4ZA 1RUD2 3DKQA 1JX9A 1O3QA 5C7GA 2WWWA 5APAA 3ZMNA 2Z0AA 1QDOA 5ITZA 5K8SA 4DR5O 4AFAA 4MLOA 4Q1PA 4PD4F 2HHHB 5HXMA 1GTOA 5LGUA 2EX3A 1N36O 4YM0A 4EZ4A 1RUOA 3WEZA 1YF2A 3OW2U 2Q0OC 1OCZC 4QPKA 3DV8A 2E75B 3ZXFA 1M93A 4WBBA 4QXCA 4QX8A 1RUE2 2H8PC 5D8AA 4PI0A 1AR72 5CFCA 1O9GA 1WAZA 3BOPA 2HLDG 1LNQA 4YM1A 1EV11 1J58A 4FXGB 2UXNA 1UL9A 4FI9A 4LJHA 2HWF1 2X05A 1MZFA 4WCEV 3ZMUA 2A5ZA 4YW2A 4JHZA 5GZGA 2BBVA 2BUKA 2ZT9B 4F6RA 3T0DA 1PL0A 1OUSA 4N53B 1XE0A 2B5HA 3ETQA 2UXDB 1NQTA 4NXMO 2CTVA 2LM3A 4LK6A 1LAJA 2EIJC 1QR9A 3FUOA 2E31A 2CNAA 2ZMNA 3BPZA 4ZOLB 1RMU1 1AB3A 5CFDA 2A73B 1I6XA 1GSLA 4JI5O 1VMFA 3KLSA 1UOFA 3RFRA 1R092 1IS6A 1D7PM 1LODA 1UIKA 3T2QA 3QO8A 3MIDA 1G6NA 2DVAA 2VNRA 2XR4A 5IJ0B 1W6MA 3AZWA 1XEQA 5L3DA 1JYTA 1ZAUA 3AP6A 4LULA 3OFNG 3K58A 1AJOA 4XQ4A 4YW6A 3PHMA 2R7EB 3L72H 3O0WA 4NAOA 4OI4A 4LA2A 1ENVA 4RFT0 1PNKA 3RZMA 3KT4A 1VQLV 1JHJA 1ULFA 3RG0A 4MV2A 4GB32 5KXEA 4AW7A 1TME3 3UGFA 1OHFA 4WVVA 3J8F1 4CE8A 1PNGA 3D4KA 1HV1A 3MDSA 4B29A 3TJTA 4CVUA 1Z78A 1EPWA 5F2WA 1VF6A 3ZYIB 4YRDA 4UT5A 1VQMV 2WO2A 2JWPA 3HQRA 3AL5A 1SQBH 4JRAA 4UW3A 5EYXA 2JG9A 4A4AA 1V6NA 2ZKOA 4CCOA 4WFBV 2VAUA 1PK6A 2EICA 2YIBD 2YU2A 1HB3A 5E1AC 1EAH3 5I93A 2JE9A 4M3CF 1LRHA 3JAKA 4TUYA 2VQ0A 5KC5A 2VUCA 5C3PA 5F39A 4F4LA 3KVBA 1AYM1 3H8XA 1PO21 4GWMA 1PNMA 3ZYJB 4I5SA 3SPIA 1UIJA 5LB6A 4MX3A 3EYPA 2IXJA 2AGSA 2QTSA 3K51A 5FYCA 2JG8A 3HAGA 1REEA 3FB8C 3IPVB 1K3IA 4HZ3A 1OA2A 4N7UA 4NWWA 3KT7A 3AL6A 3POEA 4XBQA 1SLTA 3KGLA 3ZFEA 1S0DA 2PA7A 3K57A 5LY2A 3OPTA 4P9WA 4LKDA 2C24A 5D1IA 3O65A 4GX0A 4XF1A 3M4FA 3O1OA 5KC6A 2IJKA 1W0KG 3PJSK 5A2QN 2IU0A 1AUYA 2ARAA 4HKOA 2BU9A 3QD6A 4MHUA 1NTMH 4MXVA 1N32B 4Y22A 4DMIA 3ORJA 3Q4HB 4QGPA 2NMNA 4UW6A 5A7WB 3EHBB 3G6BA 4LF9B 1OVPA 4R52A 4H2AA 1QJX2 3C7GA 2RDRA 3DPRA 2JICA 2WAMA 2DVDA 3ZN5A 1MACA 2Y0OA 2BRTA 5LHGA 4O2AB 3ZSMA 1I3HA 5I0TA 5SV8A 1VBA2 4XBFA 1GP4A 2UXBO 1I94B 4DW1A 1ZYBA 4X89A 2JXAA 3OBZA 5CAZA 5KA6A 5EHDA 2A71A 4BQ5A 3CCVV 3RJRA 3FB5C 2QA4V 2QQOA 2XVLA 2HYXA 2UXCB 2W0XA 3RYPA 3Q8CA 2CTPA 5B1OA 5CN0A 3N2KB 1BXHA 2OCCC 1DGRN 3S0MA 4P9IA 2R6QA 3W21A 4RR3B 1YXBA 4ZONA 1YUDA 4MG2A 5L3EA 4MVOA 3AK2A 3ABMC 2D7FA 4A2UA 3LNNA 2OCCB 3NR7A 1JU4A 4AF9A 2O14A 3KQRA 4GALA 1I94O 1UWWA 2ADEA 3DC5A 4LFAO 5A70A 1I5PA 1KD7A 4N9IA 4QKNA 3FMGA 3T30A 4EWEA 3AP7A 1XOYA 1Q7YW 4KBZA 1YIFA 1KP3A 1POV3
chains in the Genus database with same CATH topology
1PVC3 3NL1A 1NCRA 1Q8OA 2UY9A 5GZEA 1JR7A 4Z07A 4AK3A 4IV3C 3MFAA 4BHPA 1AVBA 3ZXGA 5JI9A 2MEV1 3TB0A 5JZGA 5ACA3 4Q4X3 3HN1A 5FQ0A 4XILA 3WG4A 4HMZA 4FPCA 3MIHA 4XYXA 2YXSA 2DTYA 1IKPA 5F6KA 2A6YA 4MGYE 1N47A 3RMYA 4OZXA 1VBC1 1M4WA 4Q8LA 1BBT2 1UZZA 1MVEA 1WW7A 2BTVC 2QCSB 2NMOA 4PBOA 4Y5Z0 4E2QA 5GLUA 2CV6A 3ZO0B 1AYM3 1BCXA 3I2DA 4N43C 2D5FA 2X8KA 4NPRA 1BBT3 3AYEA 4QM8A 5C9AC 1H9PA 1RUC1 3TWIA 4JV4A 2KM2A 3FE5A 4Y24A 1DIWA 4LLOA 4XTMA 2WS92 5EWSA 4BLIA 4Q1RA 1VBA1 2ET7A 3HT2A 3O5SA 4OHVA 3A0KA 4XJUA 4AQ2A 1OQEA 2Q5TA 5GJ6A 2C1FA 4X8NA 1S2BA 3UK9A 2DCYA 3SCGA 1L3JA 1J1LA 4Y1XA 5CADA 3VZOA 2E7AA 1RL3A 1YO8A 3JCIA 3FBYA 5F6LB 3VL9A 1D4M3 3ME2A 1D0HA 1DQ0A 2C9AA 2XL7A 3GBFA 3VKOA 3M3OA 1DQ1A 4YW4A 4Q8KA 5CA6A 3B02A 3NJZA 2RMU2 3B01A 2VMGA 2HWF3 3OF1A 3WV6A 5E88A 2RS52 1LOBA 4RS5A 3WP3A 1AX0A 1WBFA 5JI7A 2WNEA 3VBUC 1I1EA 1RUJ2 3WG1A 4Y1VA 1R1A1 4H55A 5A33A 2ZS6B 1NA1B 4NHMA 3WOGA 2VG9A 4Q4W3 3ZXEA 1C5IA 2F4PA 2WLQA 3AK0A 1O3RA 5KHHA 2VECA 3GALA 1PO11 4BPZA 2JG8C 1CVNA 1R083 1UN1A 1YNAA 1FPN3 2JENA 3TNPB 1RMU3 4CEYA 4QMAA 3U0ZA 3AB0A 3ILRA 4B7EA 1VJ2A 2WKKA 2XJUA 2WZPP 1SCRA 4L2NA 4UXAA 3WQ1A 1O4YA 3FZ3A 4HFSA 1QJU1 1RHI1 3CJIB 3DL3A 2EIGA 1AF9A 3GHNA 1LHVA 5D8AC 4HBNA 4H3WA 1C57A 3NAPA 4FQ4A 2DFCA 3SNMA 3DPRB 3ZYPA 4M2IA 2VH9A 1YHFA 4IXLA 2AENA 3TN91 1HXS2 1SBEA 1ULEA 5JPNB 1DZTA 4CEYC 1WGPA 4GH4A 3LZZA 4HK9A 4GB31 3VGIA 1GVGA 2WBPA 1MR5A 2BPA2 1RC6A 4YVWA 3VKLA 3H0OA 2EALA 2JX9A 4LBKA 2VU9A 3VBUA 2E6VA 1NCQA 4KGGA 4CDUB 3OJBA 4JDMA 4W6WA 1O7FA 1W6MB 3WVJA 1EP0A 1OLQA 2DUPA 2V09A 1RB8G 2HWC3 5LK7B 3IM0A 3ASIA 1LENA 4AI0A 5I0RA 2AREA 2QZ2A 3AZXA 4YG6A 1ND3B 2H6CA 4Z82A 4KWKA 1Q8QA 4QQOA 4M26A 2WINB 5DZFA 4COZA 5C6CA 3BB6A 2DURA 2F6BA 1B09A 1H0BA 1IQAA 2CL2A 3RS6A 3SWTA 1MEC1 2HWC2 3ZSJA 1KJLA 3HBZA 4MH0E 1H1MA 2HJIA 1DGWX 4AGGA 4Q4V1 1RUI3 3IDCB 4BH9A 5CFDB 4R4ZA 4XJ9A 3VBOA 4DOUA 3BALA 5FPXA 2G4IA 3WDYA 2ZGNA 4IV1B 4WM7A 2GAUA 1HQNA 1Y0ZA 4D94A 4ORFA 2Q4SA 1GBGA 2Q8OA 5GLZA 4YNIA 1LOEA 2GU9A 4LEJA 5C4WA 4X6QB 1G9BA 4DY5A 2V5YA 5IK4A 1X8MA 3WG3A 5AC93 3CU7A 1CONA 3OD4A 2Z69A 4IEUA 3ZSEA 3D8CA 4OI0A 1AR92 3TOJA 2BNMA 4E9KA 1JBCA 3W58A 4XFHA 4YG0A 1PM7A 4K9SA 3IN9A 5E8AA 3VBFC 2RMU1 4NHKA 2WFPA 3ZN6B 3VBHC 4AEDC 1WBLA 2XGXA 5K0UA 3FLPA 4FPFA 4J1WA 1U5YA 1RUJ1 3RNSA 5BNOA 3SHRA 4YW3A 2QJVA 3ZXDA 4LO7A 1NY72