4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
1YCIA 2Y0IA 2WA4A 4Z1VA 3OD4A 1H2LA 1H2MA 3KCYA 3KCXA 2WA3A 2YC0A 2YDEA 1H2KA 4NR1A 4B7EA 2XUMA 4B7KA 1MZEA 4BIOA 5JWPA 2CGOA 3D8CA 3P3NA 2ILMA 1H2NA 4JAAA 3P3PA 1IZ3A 4AI8A 2CGNA 4QU2A 2W0XA 4Z2WA 1MZFA
chains in the Genus database with same CATH superfamily
4FIPC 2W94A 4XILA 1O4YA 1SFYA 1PNMA 3MLLA 1AR63 2F23A 3WXPA 1REEA 1RVF1 4PDLA 2GZWA 2XJRA 1NS1A 4N43A 3RZMA 3ABLC 4QKDA 3BB6A 2XQXA 3OEEG 4X66O 4Q26A 4XUOA 4E2SA 5JIAA 5EYPB 2FMDA 1VBB3 4CP0A 4IV3B 2FKXA 2RMKB 1K3EA 3NO8A 5HXMA 5FY5A 3T2MA 1A34A 2YBPA 5A3NA 4NO4A 1HQWA 1L7QA 1ZRFA 4DUXA 4BQ5A 1GZWB 1S0CA 4ZZ5A 2V5YA 1JYVA 1HIXA 1F5FA 4P5HA 3UO3A 2RJZA 4XQ4A 1R093 1QLNA 4XMIA 3LA3A 1SQBH 3CB2A 4LF4O 4XDOA 3EMRA 4A7KA 2JWPA 5E88A 2O57A 2CUGA 1AR73 1AI4A 4TSFG 2VUDA 3RZGA 1WCKA 3CPWU 5C7GA 1VBD3 2RDSA 2CH7A 4QX2A 3MLJA 3A0KA 4XBLA 2YMZA 1SZXA 4ZOLB 4LP8A 5DDJ1 1RUF3 4TQDA 2HG5C 1IBMB 3ASNC 5F3EA 4Q4W3 3L71H 1HXS2 4R4XA 3A7QA 3GHMA 2EINB 1VB4A 4ZHQA 5CEHA 1VR3A 3JD73 4JVAA 3VL9A 1Q43A 5EC2C 3DKQA 2TUNA 4B4QA 4WM7B 2UYBA 3VZJA 3PNAA 1W28A 1U12A 3VDAA 2E6VA 4Z2AA 4Z07A 2YIBD 5ISLA 4XPVA 2Y64A 4QKFA 3J7NA 1I0HA 4CH4A 4AW7A 1RUI3 1OOPB 4B8EA 3VQYA 5EBWC 4YIOA 1GQHA 2J1UA 2V5DA 5DABA 1VF7A 5JSRA 3R66A 5LA1A 3UM7A 2YG0A 4QPGB 4CPBD 3T09A 5CA0A 2VMDA 1L0LH 1S2KA 3SH3A 3SQOA 5IYZA 1DQ4A 3EQEA 3HQUA 5C4WC 3HKCB 4CCEA 1YJWV 1AR91 3RDIA 1BK1A 4B1MA 3M99B 5J7MA 2B9UA 4DV4B 1CR7A 5LB6A 3NNLA 3DXTA 1VBD1 4HONA 1UYZA 3MW4A 4EROA 4NPMA 4UVBA 4Q4V1 3O1PA 3ZKUA 1E5HA 3RYFB 4A45A 2BCCH 1OHFA 4RQPA 4DV7O 1NXD1 1HNXO 5GLTA 3L2YA 4AFBA 5GKAC 2XVKA 3RYRA 3L70H 1DHKB 4ZXKA 4P9YA 2IVJA 1YQ5A 4QX1A 2BBVA 4JI3O 3CJHB 4QD2A 4DIQA 1GOHA 1HQNA 4R8CA 3I54A 1H8VA 4H7MA 3NXSA 5F39A 4IESA 3NVCA 5CKQA 1GM7A 3ZFFA 1R1A2 3KMHA 1XNQO 5A3UA 3ACLA 1TVKB 3I49A 1B35B 2FCUA 1KKCA 4TOIA 5I91A 5BNPB 2E32A 2BOJA 4K6BA 2QM4A 4YZ3A 3OUSA 4CZSA 4JTNA 1FOD3 4BW9A 3K79A 2W1WA 4FP2A 3NAPB 2PQSA 1FJGB 4IGOA 5CG8A 4MUVA 2V72A 1DU3D 4LBJA 1JZ6A 4DMIA 2GSMB 4GALA 4HMZA 5FMBA 5A7QA 1NCQC 5IDJA 2D3RA 3LIHA 4OMDA 3UT5B 1QNWA 5BY5A 5ABJB 3CLPA 1UMIA 4ZZ8A 3AG1C 5KHHA 3EJKA 4NRQA 2BZDA 5L7OA 4N43B 3W7SA 1UXXX 3WCRA 2OIEA 1MS0A 4QX7A 1F4NA 3ZYBA 4E2GA 4DR7B 1LR5A 3OB8A 1BBT3 2QQNA 1LHUA 5H9RA 2CNAA 4YM1A 3FLTA 3OGVA 3WB2A 4PDWB 4YG3A 3E97A 3B01A 1AYN3 1S76D 2WJSA 3SEPA 3F7VC 3SGIA 1PK6B 1ST8A 2NMOA 5IK8A 2BSKB 5EXOA 2WFF1 1GZTA 4P02B 2IXLA 3JATB 2Q5ZA 2RS52 4IHJA 2HKXA 4IXLA 1O9GA 3AFGA 1JCHA 4GKYA 2RM22 2CAZC 2ZMLA 5C8CA 2ETEA 3PHMA 3S5AA 2FMLA 1M90W 2R9RB 3TYJA 1PL4A 2R9IA 2H6BA 1W8UA 5I0TA 1CESA 1DF5A 4EV0A 4HVQA 3RJ2X 1K4DC 1K5MB 2XAJA 3WT3A 3RI9A 4QHZA 2W68A 2WDBA 3LPGA 4YVSC 4CXXA 1NCRB 3K3OA 4TQFA 4P9XA 3MUY1 4YZ1A 1AYN1 5CB4B 1IS3A 2VBDA 2QWQB 4RQEA 1OZ0A 4Y24A 3CRRA 5J36A 3WHTA 1JMUB 1QOSA 4L92A 3IC9A 4EWDA 2W52A 2ZGUA 4MVSA 1K5MC 3W21A 4OHXA 3AL6A 2LW1A 2VZUA 3QH7A 4ZHQB 3AG4B 1RPRA 4E4EA 4DXZA 1WD3A 3VGIA 1Y9QA 3ZJZA 1KS5A 1VAVA 1FX5A 4FLZA 4JI2O 2RS53 3MUZ1 4DV6B 1QQP2 4A3XA 2JICA 2DMXA 4WFBV 3MHSC 4DV0B 3WLUA 1V6LA 1YJLA 2LUWA 2F4PA 2VZSA 5FAXA 1S1AA 4MLOA 1XC6A 1LECA 4XUQA 2VQFO 3RYHB 3MW3A 4AILC 1Q56A 4S2HA 1NLSA 2F4LA 3WQBA 3MIDA 1WBLA 5F9TA 2FB5A 1X9PA 1A78A 3TBDA 2ZNIA 2Z4FA 3EFFK 3FHAA 4X62O 1WW5A 2JDAA 2DUQA 5KHKA 3D82A 4HKLA 1LOCA 1NVPD 5IWAO 4JPRA 4JI1O 1QJEA 5FPLA 3DGTA 1O4ZA 3CCEV 2RS51 1RJ8A 3LDBA 3ZIWA 1VBE1 2IJHA 2RE9A 2C9KA 2DYSC 4YGCA 4F6EA 1TZOA 4M3CB 4O4LA 2IXKA 3O1UA 5LMNB 3W59A 4FVVA 2BW8A 2XVGA 2IM9A 2ZKLA 1FV3A 4KMQA 3T2PA 1RTVA 2P5BA 3KQ4B 5JOYA 3X2QC 1GNYA 1SLIA 3ZXJA 2ITCC 1AI6A 1TME2 2VE1A 1BHBA 1OFNA 2WNEA 2D6PA 3CJHA 3APQA 2Y6GA 4B7KA 3URFA 2D6NA 3PTYA 2DDUA 2HWF2 4Z92B 1N3PA 2YIAA 2HWD3 4NE9A 1QDOA 1NR1A 5JDBA 4AOCA 2KR2A 1F9KA 2Y4UA 3K46A 5A3PA 1HNZB 3CSXA 2VZTA 3T2QA 1RHI1 1L7RA 5DM6V 1OQDA 4Q4V2 3FBMA 3OG2A 2DYRC 4CA9A 4Z1MG 1OKOA 4FLTA 2LGWA 1C8M2 5FZKA 1N1VA 3H3UA 3ITQA 1EAH2 3QO7A 4CDUA 1MZ5A 2W91A 3A0NA 4LFAO 1SZTA 5C8WA 2A3XA 3VKOA 5EIBD 2FDFA 3QBQA 5KHIA 2CSGA 5IVEA 4DW1A 3TAYA 5L7OB 4D0QA 3JAWB 1BCCH 2WLLB 5DECA 1RP3B 3IC7A 4DR2B 3HMYA 1FJGO 2ZR3A 2Q4SA 4GWJA 1RUJ3 4Q27A 4QPGC 4RQFA 1PO12 3I3BA 4R9AA 4ORFA 4CSWA 4M4PA 3PUIA 1GUIA 1JJOA 5DPNA 3KV6A 4Q8LA 3W58A 3NKGA 4AHCA 1KKDA 4J42A 1J5EO 1T5EA 4MVMA 3V0AB 1E5RA 1W39A 4AEDA 1YIFA 4Q0PA 5A6YA 5BPXA 4PDVA 2BBAA 3ZXDA 2NLJC 1HXS1 5I93A 3ZN1A 5TISZ 4FPCA 2HEYF 1AP5A 3UKMA 2Q6AA 1OCRC 2GMMA 4AI9A 5CADA 4QXCA 1LR1A 2ENRA 3IFXA 3WEZA 4XJUA 2HWE1 5EV7A 1G86A 2QQKA 1IURA 1GR3A 3K9SA 4QPKA 5FLXN 1OLME 3HEIA 2JX9A 5GONB 4YZ5A 1AJKA 1CONA 3GJAA 5FXZA 4FFBB 3SYQA 1C8M1 1U5ZA 1W59A 2IZWA 4N9HA 4X1KB 4MT8A 2FL4A 4NR1A 3WF0A 2ZNJA 2DUOA 3L9JT 1XSRA 5FP8A 3UQ8A 1ZA4A 4FPPA 4FQZA 4QXKA 1AR1B 3ZRWA 3X29B 4NUBA 1OOPC 3WW3A 4RGKA 4MVQA 1OT5A 4LBQB 2VZ1A 3I2JA 1V0AA 1UQXA 4YARA 5C71A 4J9ZB 3FYIB 1K9MW 1RINA 2P6HA 4E9KA 1EN4A 3I2IA 2YU2A 2JDHA 2QZ2A 5DUVA 1XQ8A 2XT9A 1F4HA 4DXWA 2OTJV 1VQNV 2RCVA 3X2QB 5IJ0B 1KU9A 1SKVA 1HV0A 3ZXLA 4M00A 2ZQMA 5BNNA 1PNKA 2VCAA 3ZYPA 3MPPG 1ODNA 1CPMA 5L3BA 3PUSA 1Y76A 1ACCA 1EV13 4EFEA 5K9YA 5FY7A 1U97A 5FMDA 4A4AA 2RS31 1ND2A 4EN8B 1IS5A 1IG3A 3LF7A 1LHWA 1OLQA 3NV2A 5JPNB 3RVZA 1AR5A 4QQPA 3ABMB 4DPNA 1H0BA 4M3CF 4FO9A 4IGPA 4HANA 2HBUA 3WNKA 1TVGA 1WCDJ 3OUHA 2Y6KA 4LF6O 1A8MA 1PD3A 1F15A 3C3VA 1V54C 1C1FA 5FL7G 3SPJA 1IDSA 4FOQA 1RHI3 4L9BA 3VDDB 1QJU3 2R9AA 4K40A 4HKOA 3DUIA 2ADEA 1ZAUA 1RUF1 4NKGB 1AJNA 3P3NA 3VBHA 1NKGA 2JD9A 1OCCC 2JDNA 1RUC1 3ZIXA 4XJ9A 4RO2A 1TE1B 5KXCA 1POV1 4L0PA 1ULCA 1D4M2 4G9SB 3AG3C 5LP6A 5EJ3A 3RYIB 4OHZA 4Q0VA 1S4CA 5C6CA 4D7SA 2BFUL 5FV3A 2VCCA 4R4ZA 2I07B 4GB33 1KP3A 1GO3F 4CH5A 3AP6A 1NA1A 4PA4A 4Z82A 5ERLA 1I08A 3J7MA 4Q4Y1 4DXSA 4I2OA 4PIXA 5CBLA 3QOPA 2QQMA 1CZTA 2ARBA 1V6KA 1ZX5A 1BHAA 3OF1A 1D4M3 4HAMA 1M4WA 4DV0O 4JGZB 2QCSB 2QKAA 1W06A 3OBZA 4V2WA 4LKDA 4DV2B 2Y0OA 1DK1A 1V55B 4XYXA 1WA4A 3AZWA 5IWFA 4P9JA 1XRUA 4CEYB 4K7JA 2QQVA 3KCYA 5JOZA 4XJ8A 3T1MA 4N53B 3O0XA 2PAEA 4LT5A 3CXCU 1X9TA 1JODA 2UWAA 4QNHB 4FMTA 4LFCB 2ZDIA 4H44B 3INAA 1LGCA 5LOVB 2DF7A 3VKFC 2JDZA 1BKZA 1EUUA 3V0BB 1KYOF 3K03A 3Q8AA 3HBZA 4JYBA 4BM8A 4AL9A 1WMFA 3HVDA 1S72V 2OZ6A 4AZZA 4W6YA 2D5FA 2PHXA 1GOGA 4Z8BA 3V0AA 1VF6A 3ZHRA 3CEWA 1LOEA 3T2TA 2JS3A 4FLYA 5FYVA 1FXKC 2KM2A 4GH4A 5DG2A 1UFIA 1QDCA 4MVTA 1WLTA 3PL0A 3HN3A 3OM3B 4HETA 4DUYB 3JAMN 1ZBE2 4QPJA 1PPJH 1HRV1 1N8RW 4I55B 4MS2A 2B7YA 2JECA 4BIOA 3EYPA 2WT0A 5IFPA 1FPN2 2XAGA 2NNUA 1ODMA 4GMP0 2YBSA 5F2VO 2XB6C 5CB7A 4DEVA 4WBBA 3THCA 1WCSA 3M8LA 4AQSA 2IH1C 3BABA 4BQ2A 3NJZA 1AYM3 2HWB2 2R32A 1B35C 4HPKB 1BMV2 1PO21 4BWAA 5GM0A 5CFCA 2XUMA 4MGTA 1BVP1 5DAXA 1P4RA 3GZTB 3LOBA 2ZBJA 2A5ZA 2VVDA 2AW9A 3AJYA 2Q8CA 3MIBA 1P49A 3CCLV 1DQ5A 4JTDB 2WFF3 4INDA 1XMOO 1TQ5A 2VZVA 1J1TA 4PDWC 2ADDA 3P1IA 3LKJA 2E74B 4YY3O 4YVSB 3ZOIA 1O8PA 4LH7A 4O9EA 3NMBA 2YIDA 5BNNB 3DPRB 3MHZA 5CISA 4HYOA 4E4HA 4PDMA 4U2AA 4Q29A 4WZFA 3DF0A 3O0WA 1QIQA 5A1AA 1ND2B 4AK3A 4QB1A 3AYCA 1NT0A 4DV6O 3GBFA 3E8FA 5JSPA 2PI5A 3ZRSA 4DQAA 2EULA 1CGPA 4DUZO 4CDQB 2OYQA 5AFBA 2B5UA 3B5LB 4ZPIA 4YM0A 1AVBA 1NLRA 4DB5A 1RSOB 1AUYA 1QH6A 2BUKA 3HR0A 4PA9A 1ZBA1 3CL1A 1K92A 3CC4V 5IW0A 1V6MA 4MVUA 3IKWA 3J81N 2FD8A 2GN7A 4QWNA 1RJ7A 4XCBA 3E6CC 1VMJA 4OX9B 2XH6A 3DGEA 3MIHA 1D2QA 1X50A 2LGQA 1UN1A 4Y1ZA 3VBBA 4RR3B 3OOXA 5CIRA 4AQYB 3K57A 3SPCA 3CRMA 4LR4A 1SERA 1HN0A 3SH4A 1J3QA 4CCDA 1VBA2 3WG4A 1E79G 1NH2D 1W6NA 3AM2A 4XETA 5J3UA 3FHQA 4IQPA 4CDWC 5C9AC 1PVXA 5L3EA 4DXTA 5FKCA 2YFZA 3MFCA 5F8PA 5CA6A 1I3HA 2BYVE 2YFUA 4AVTA 3WB0A 4CTEA 4AVVA 5EBMC 4ONUA 2Y6JA 2AUYA 5CNAA 4AVBA 1NI8A 3H1YA 3S57A 3UETA 1M5IA 2I2SA 1S0EA 2PYTA 1F7YA 1QJFA 2N05A 4V1PA 4HNAB 2HLEA 2AZ0A 1KFUL 2XAQA 4JGZA 2ZJCA 1N34O 1W6QA 5SV8A 1MEC3 1Q8PA 3DXRB 1RL3A 2QE3A 2C24A 3WR0A 1QKQA 3CMAV 1XHXA 4IEOA 3BRCA 1KBHA 2QWPB 2WZ8A 4QGPA 2DU0A 5D21A 2A3YA 2VC9A 4A7YA 4NOTA 3ZRXA 1ULOA 2DCZA 4UB8Z 1IXBA 2OUJA 3D3QA 1CAWA 4EZHA 4DR6O 1RUH3 4F8AA 2QFEA 1LUVA 3QTCA 4K20A 1ZL8A 1ZYBA 1AXKA 3SJCC 2CTWA 3MDPA 4QJFB 5FPOA 4YHHB 3ROUA 1AI7A 4CEWB 2LW7A 4PA3A 3ABLB 2ZM6O 5IJRA 1D0GA 2OKXA 1FMD2 4F4LA 3CZJA 4UFHA 1SBDA 2XLGA 2Q8VA 3KKYA 1I7FA 2D44A 1NZ6A 1S0DA 1JQ0A 4AGVA 4Y20A 3ZMUA 4AYUA 4OI4A 1QLEC 3CMEV 3WX5A 3ZSEA 4P30A 1CZSA 1UZZA 4CXWA 3AKSA 2A6WA 3Q8BA 1CX4A 4LMFA 3B00A 1UZVA 4HPKA 5CFCB 4ZI7A 4XFAA 4HK9A 1VQMV 1OLMA 4PELA 4FPOB 1QJX1 2G9GA 3GHNA 2XR4A 2IH3C 3GBGA 2YB7A 2R042 2XBO1 4OFGA 2QA4V 1GFF2 4L97A 1XNBA 3ZN6B 2DYSB 2BNNA 4CDXA 3FX7A 1ZM1A 4CVUA 2B1IA 2J1AA 1VMHA 1IPJA 4ASUG 5K1PA 4GIQA 4QHOA 2ZGNA 4AVAA 2JDPA 4DV5O 2YV8A 5HPOA 2QSAA 3HB3B 3N9PA 2WSVA 3AVRA 1ULFA 1IZ3A 1I5YA 4G28B 2AZ2A 3AMQA 1MR5A 3AMMA 1QR8A 5LMUB 1JVMA 5BNOB 1DDLA 5FIXA 1MS1A 2DTWA 3AP9A 3MFAA 2P67A 1XBFA 1PMIA 4IE6A 1KDMA 4CDQA 4GMP3 2X10A 3T1CA 3S30A 2E76B 4URAA 4MXWA 1Y74B 3C3SA 2WZR2 3HKBA 4IEWA 1YCIA 4JI7B 1KGYA 5ANNA 5IK4A 4OPHA 4KG0A 1FNYA 5FK8A 4E8DA 2BERA 1QQP3 3NW4A 5GZFA 2E7TA 2HWE3 3AG4C 2VXJA 2WNUA 3O7OA 1LOFC 4RHV3 5JIUA 2Z5UA 3B94A 2YROA 2BWAA 2WS92 3HJRA 4DR1B 4TZDA 1HXS3 3K59A 1Q86W 2JB4A 4P14A 2W1UA 3ZFEB 3C7FA 2QJVA 2MEV3 5GLUA 4ZU5A 3BPSA 3ZXEA 4J6GA 1L0NH 4O2BB 3ZSMA 3SYOA 2OWOA 4PLNA 4Y1YA 4ASLA 3QNEA 1F4AA 1YVWA 2JXAA 3M4FA 1AX1A 4AE2A 1HJFA 2FYUH 3WP5A 4BR6A 5JMOA 2VS0A 4BYYA 1W8NA 3RS6A 2HH9A 3WCSA 4PQQA 1WA6X 1LNSA 1PGL2 5GZEA 3AFKA 2BJSA 3E5XA 4UXNA 4QGLA 3DV8A 4N7UA 4ZXEA 4D8MA 1J83A 1LULA 3MI8A 3BU0A 4PA7A 3SPIA 1OCOC 3JCUZ 1EN6A 2QDRA 2ZEXA 5F5QA 2RJ2A 4UV9A 4XHBA 5KX5B 3JD0A 2OIIA 2JKXA 3KCCA 1NKDA 1N33B 3THPA 1EYBA 3AZZA 3OD0A 4AHXA 4QXBA 2HR3A 3D6EA 1WMEA 1JPXA 2WA3A 3OGJA 2XAHA 3KD4A 2PZSA 2BOIA 5LBBA 1VQ7V 3T4ZA 2JJ6A 3W7XA 5T3NA 1ZRIA 4RYDA 1ENVA 2W92A 4NPLA 3D3AA 3VBSA 4LF4B 3IMNA 3JQXA 1N32O 2IU0A 1FPN3 5FPAA 4DS0A 4GZRB 4KXRA 4OZXA 3CHXA 4M01A 2EIKB 5C8CC 1CAWB 4OHYA 1H1MA 1CIYA 3AK2A 3F5WC 4XF1A 4Y4RA 1VJ2A 3WOGA 3V65A 1JZ2A 3B93A 1ZL8B 4DR3B 4JI1B 1Y66A 3ZIAG 2P22C 3C90A 5KWRA 2JG9B 1LHNA 1WMDA 1WCUA 4FM0A 2WFF2 2KSDA 4TUYA 3HPLC 3KV5A 2ZHLA 5EIYB 3CS5A 4MSWC 4TT3G 3ACGA 1CAXA 3N9LA 1PO11 3A21A 1YJNV 2XXZA 1I6XA 5IYYA 2GP3A 1NR7A 3K06A 4QU2A 3WW1A 4DY5A 4UW4A 4L11A 3I4IA 3ILNA 4MGIE 3CCRV 4Y20B 1O6UA 2CU5A 5B1BC 4S2FA 3ZXAC 2IC1A 4Y1XA 3V56A 3MF6A 3B77A 3CQOA 1D2DA 2LS6A 3E6BA 4D3WA 2B45X 5FR3A 2BU9A 3B3QE 1HWYA 3VBOC 3WDYA 1VRH1 3BTAA 1FFXA 3KZ4C 2O14A 3GB7C 4ZI7B 3O14A 1DGSA 1XU1A 4LQRA 1ZBA3 4SBVA 4YRDA 3BUCA 3H3LA 2JEMA 2PHTA 2GN3A 1N34B 2ZGTA 5JJJB 4JI0O 1I5ZA 1IXMA 3JAKA 1QJU1 2BOBC 2BTQA 4X8PA 1LODA 4NN0A 5FYSA 3SCHA 5LXTB 4FLWA 4AHZA 3JCZA 1VBE2 3TN92 4WM8B 4XDQA 1VF6C 2BGCA 2X6BA 2K9PA 4JYYA 1EPZA 3WUDA 3RVYA 2DFBA 4LBMA 3I7DA 4DY3A 1OD5A 2OCCB 1SETA 1RUE2 5CMUA 1Q8VA 3UGHA 3F2ZA 4P9LA 3KWVA 3QVNA 4OI2A 3U14A 3ETDA 3VZNA 1V9U3 3HT1A 5I8SA 4K0KO 4CDWA 3K04A 2F4VO 1JYWA 4ATEA 4FPGA 5LL6Y 2WNVC 5GZCA 2Y0PA 3DYPA 1XOUA 2HWB3 2VQEB 2AR6A 1S0GA 4X65B 3VHNA 3OBAA 1PM4A 2JIGA 2YPJA 4X8NA 4L99A 1VBA3 3U11A 2WNUB 4KHPB 2HWD2 3SEEA 4QM9A 1AYM1 2B8MA 3CBNA 4JKLA 1JHNA 4DFSA 5CFDC 3RZLA 4XTPA 2R7EB 2JEUA 2BGOA 1OSGA 4IDZA 1YI9A 1WPBA 3WF2A 5B1OA 2ARXA 5F7UA 1VBE3 5ITZA 4B3TB 3CEIA 3E86A 2ZXQA 3AP5A 3ILRA 3OTOB 4YWAA 1JBCA 5F5CA 1X82A 4QM8A 3P6BA 2VQEO 2P3JA 4N9IA 2RV9A 1GM9A 1GKBA 3L2HA 4IE5A 1N33O 1KRIA 3JYCA 3MPBA 4B4PA 3FMGA 2CH7B 4ES8A 5LYJA 2B9VA 1HNWO 4PJ0Z 2CDPA 2UXBB 3HWJA 3WNPA 2V1DA 2WZPP 4YZ4A 1UMHA 2VVEA 1XMOB 5FDBA 3OGRA 2WABA 2FQPA 1XSQA 2BGPA 2HWF3 5LBCA 4IT5A 4OLLA 2WRAA 5KAFZ 5DAWA 4OPAA 3W9AA 1M9NA 2VUCA 3AG2B 5BR8O 2YGMA 4IV3C 2UURA 2WUHA 1S0VA 2EILC 3SITA 4LFBB 4K8XA 2JKBA 4FPLA 3LA2A 1QOTA 3VLBB 2IW5A 4YJ3A 1ZZBA 4OI1A 2EZPA 1PX3A 2GC1A 2CTQA 2LM3A 5DUXA 1DZRA 4IV3A 2G4IA 2ZGLA 1AJPA 4XZPA 1SLCA 1R3KC 5CA0B 3K5NA 5CFDA 1UU4A 4QGNA 1Y9GA 3TEXA 1K97A 1H30A 1CAUB 5JAXA 5DZGA 5K4LA 3HKCA 3WG7C 4FOWA 1GNHA 1LUWA 2ZX2A 1LB2A 3UV9A 3D36C 3ZHSA 3R4UA 1GZWA 2WLJA 4IE4A 3VZOA 3PIGA 1M06G 4XE9A 2WLQA 4DR4B 5KMGB 3ORJA 1KJLA 3UKVA 1XUQA 5FZGA 1VF5B 4H13B 4DV3B 3Q4HA 4CCKA 4I4TB 1SZBA 2ZE6A 1OA3A 2WO1A 3K3WA 1AX0A 2XUEA 3G6BA 3AG2C 1I94O 1RHI2 4META 1V9U2 5F5IA 5HXVA 5T52A 3JASB 5LA0A 2B1GA 1L3JA 2A9HA 3Q8CA 3ZMZA 1RUG2 2HYXA 1DGLA 3WDTA 2E7AA 1J59A 1W04A 5EZWA 1FFXB 2GAUA 4KU7A 4DXRA 4BLIA 4ZOLA 1UY0A 3W20A 3OUJA 3ZFGC 3FKSG 1JH5A 2AH2A 2HJFC 1XB9A 5IY5B 4FXGB 2C26A 4XXPA 3CZUA 2XBO2 3B2EE 3RFRA 1C1LA 2WFPA 4NTXA 3HKDA 3JZVA 2PAKA 3NJVA 5GW7A 3ZPYA 1C4RA 1XBLA 1UZWA 3E83A 3VHRA 4X8AA 4XUTA 1YZBA 4YJ2A 4NB5A 2F4VB 1EZJA 2ILMA 2P90A 2HWF1 3W5MA 1OOPA 3UL2A 4FTEA 1Q90D 1HB2A 3TNPB 2Z79A 4HN0A 1G8WA 2WS91 4RUFA 1QXJA 5GLZA 2ZACA 5T55A 2VWJA 2BFUS 4F6RA 3TETA 1W0PA 3UGGA 1ND3A 2EXKA 2HWD1 3PUQA 4CDWB 1G6NA 2Q0OC 3VD4A 2BPA2 1DFQA 1NE4A 2V4DA 1VARA 1W9WA 1RUF2 5J2UB 3WF3A 2BSKA 1ZBE3 2G9ZA 4P5YA 2PLV3 1MS8A 2VW1A 4JAAA 1GM8A 3VQVA 2SBAA 2EVXA 1VQPV 1SBEA 3LCPA 2YXLA 3ICXA 3ZRVA 1EN5A 4Z1VA 4Q20A 3ZSLA 2XKPA 2ZS6B 3OGCC 1OBNA 1JW6A 3VD5A 4IIJB 1BYHA 1MG1A 1QHDA 4AAXA 4FLXA 1SEFA 3VBFA 2Q1ZB 1R082 1O3QA 4DV2O 3F95A 4IGQA 4O9GA 1YF2A 4UI9L 3ZPOA 4XF3A 5FYMA 2BVBA 1DCSA 2ZGKA 1K5MA 1DLBA 2C5DA 2PN5A 1W9YA 3WDUA 1MZEA 4ITCA 2WLNA 1BBT2 4UWDA 2FZ1A 1APNA 4TLFA 3JD4A 1VQKV 4OQ8A 4X64B 1W8HA 2X6CA 2WN2A 1BMV1 4P2ZA 2R0HA 5IYDO 3ECQA 2BE3A 5LHHA 3VB9A 1K45A 2NMNA 5J48A 4BMEA 3LNNA 5FXVA 5FPZA 4FLUA 4NHLA 2IUWA 4WFAV 3AX4A 3DPRC 4JZGA 4JHZA 4P9GA 3LA7A 1ALYA 4JI8O 4QKNA 5DEDA 4XABA 4YXWG 1R6TA 1UPIA 3VBOB 1H8TA 3CCUV 3UCSC 1A32A 2DCYA 3PMSA 4A6SA 1OCZC 3TK1A 3N7KA 1NE6A 1YLLA 4A7ZA 1EPWA 5FZ3A 2VG9A 5BMVA 4D6RA 5FYBA 3OMIB 2PHRA 4MZUA 1ULEA 3KGZA 1AYM2 3I2FA 3WUCA 4JI4O 3IDCB 4R8HA 2CY6A 2Y48A 1C5IA 1XHZA 3VBUB 3H7YA 4E4SA 1H9WA 2VUJA 1XE0A 3OY8B 3GNEA 2VTFA 2P1BA 3WG2A 4YG0A 3ZFGA 4PDWA 4YM3A 4RAIA 2IFWA 5FK7A 5B5EZ 4CU6A 4FVMA 4YW7A 1V6IA 1E57A 1BSMA 2YBKA 1KQRA 3CJIC 2PQQA 2ZX3A 1PIV3 1FPOA 5C8CB 5LRRA 1O9HA 2FCTA 2X05A 4KWUA 1UU5A 2YXSA 4M3CA 1YDXA 3E8GA 3IIAA 2KKWA 1UWWA 3B8MA 1M4UA 3J7HA 5A1FA 3SC7X 1EAH1 4NWVA 2JJ1G 4JDMA 3TN93 2R6QA 3L75H 4DR4O 2ZINA 4YSFA 5CN0A 4J7KA 2XOMA 1Q8SA 1BBT1 4BXFA 5IT9N 5GZDA 3A23A 3POIA 5L9RA 3WF1A 4DR1O 1NQJA 2JE9A 4GD4A 3JB4C 3FE5A 5JZGC 1I9RA 4FFGA 1H2NA 1XL4A 1J3RA 5DZEA 4I02A 5I0DA 5CAZA 1UD1A 3ZXGA 5DAVA 1KP2A 2ZE5A 4MTGA 1GRJA 3ZHUA 1HR0O 2XWBB 5JPMB 4YLZA 2JGDB 3WINE 1SPPA 1IPKA 1W90A 5FXWA 1VBB2 3L73H 5FZOA 3FAVA 3BOWA 2JG8B 3ES1A 5J9PC 4RGGA 4TSVA 5JVVA 5CKMA 2J1EA 5H2FZ 2ZX4A 4PT6A 1REDA 4TXWA 1R1A1 1DQ0A 3U4SA 1UMZA 2HWB1 3WNNA 4JI0B 3GALA 3E2EA 3VBFC 1R083 4LF8B 3IDEA 5FP3A 2X6AA 3LPFA 1PM9A 1AL23 4GX5A 1WUVA 4OUEA 4COWA 5SV5A 5C8YB 2WSSG 1ND3B 2K9ZA 3ME2A 2RNBA 2WLLA 4MGZE 4C1XA 1N4CA 3H1JH 3T1HB 3C7EA 3AP7A 3NJXA 5JOWA 1ND3C 2UXNA 1W9SA 1G7YA 1HNWB 2VWKA 1KS4A 1FMD3 3LQCA 5F3CA 5I8TA 3AZXA 3DC5A 3LFIA 2HKOA 3H8OA 4LLOA 1CIWA 3WG7B 3H8XA 5FPUA 2DVBA 2NZ9A 4XDLA 5LA2A 5JCTA 1MS4A 3GZEA 2DVDA 3GDBA 2NR5A 3ZBHA 1BLZA 2ZXWC 4XF4A 2EAAA 4IW3A 3OEBA 1H2MA 4LK7A 1UAIA 2O0OA 1O5UA 3VD9A 3IMMA 3ACFA 4JAUA 3ZR5A 4FQ4A 2YGLA 5KHJA 5IWAB 3USUA 4AQ2A 1JA8A 1AR81 2ATKC 3DECA 3E6DA 1Z2GA 5EYYA 1HDJA 4K8RB 2K2SA 3TEYA 3HPNA 1W2NA 5DDJ2 3JCIA 2VPVA 3N27A 3CRAA 5GONA 1WD4A 1V9U1 5GTIZ 2WNOA 3H9AA 4QDQA 5FO9B 2ES3A 4TV9A 4O4IA 4EB6B 1BQ0A 4J25A 2ZM6B 2XLAA 1O5LA 3G67A 3RYPA 5FXXA 1R091 5CU1A 4KGQA 2IXJA 4MGSA 1RUD3 1NQTA 4AI0A 4LOSA 1ZZCA 2WO2A 4YW1A 1VLNA 4FAGA 5FYZA 2ZEYA 2CGNA 1PVC3 2LQTA 1JYXA 4LCUC 2FMYA 1YUDA 4KL1A 3PJYA 2HHHB 2DCJA 1HN1A 1UY4A 4XDJA 4GJZA 4B3RB 2AYHA 2NP0A 1E1QG 1W0OA 2A7AA 3I3MA 1FI2A 5DG1A 2PELA 3N7LA 1GANA 3HQRA 1YJ9V 3APOA 3ZVXA 4ZONA 3H0OA 3B9CA 1DIWA 4XCAA 1M56C 3R6SA 4ZS3A 1JR9A 3H1HH 4GWIA 4OGQB 2OCCC 2VMHA 4JYCA 4COUA 4JZRA 3A0HZ 1I5XA 2GC3A 4GULA 3NWKA 1J95A 3S7EA 3UNPA 2VQ0A 1XNKA 2VUAA 4X1YA 1JYNA 1QCEA 1IOAA 3BCCH 1DYKA 5C9AB 5AFEA 3WP6A 4AHWA 1Y4WA 1TNFA 4Z2WA 4OYUA 2UWBA 1JUIA 3WV6A 5CBGA 2VZRA 5B4XA 1QR9A 3QLQA 3OYWB 4ISRA 3H1IH 2Q0AA 1OA4A 4M0NA 4UCSA 3VBRB 5LCWL 1V00A 3B40A 3PMEA 3E8HA 3WU2Z 2EJ7A 2DUPA 4X89A 3LDKA 2VGDA 1OI6A 1AR83 3K0GA 3OR6C 1F31A 5FOBB 3TOJA 3UYJA 3H01A 4HLTA 1ZRRA 4U36A 1MA1A 4CCLA 1GQGA 1S0FA 4KNCA 3OMAB 1K33A 4Q2FA 1YQ6A 4UFIA 2OIGA 1QJX2 3CCQV 4QHBA 1PIV1 5A32A 4UFJA 4PLOA 4QQHA 4TLGA 3RYIA 1KUQA 1YI2V 3HNBM 4JI5O 2W2IA 1WZXA 1WWYA 1VP7A 1RUJ1 4CPBA 1ASJ2 2QQUA 4I9WA 3CMGA 4G2KA 2PMWB 3FAVB 3ZX6A 3OE7G 3PLQA 4LWSA 1WLCA 2A79B 4WV8A 2MEV2 2DYRB 3PDQA 1J3PA 2XHNA 5C3SA 2VAUA 4AEMA 4B1LA 4J80A 2IXHA 3HN1A 1HB4A 3MF9A 2WC2A 2BEOA 2J1VA 3SDLA 2D6LX 1FXVA 2PHDA 4MW8A 4UW6A 1C5HA 4N53A 4UFZA 4QX0A 1YNAA 3R0RA 2RMU3 2RQ6A 2AZ5A 2QJ1A 4JV5B 1RC6A 2ZGRA 1FD9A 4DV7B 4QPYA 4I3GA 2VMCA 4LBQD 4XQDA 3UKNA 5FWJA 1S0BA 3KG2A 3SISA 3HIFA 3CE2A 1YIPA 5DDJ3 3ZKYA 2WO7A 3BPZA 4RL7A 4I50B 2XWJB 3VDDA 2IU3A 3LDDA 5L3CA 3ZYHA 3WD5A 1Q81W 1UOBA 3K4DA 1QQP1 4O4JA 2Y69B 4PF1A 3RMXA 5H5NA 4XEZA 4UFLA 1E1RG 4XAEA 5LRSA 2QZ3A 4X20B 2EICA 5IY5C 1EZVH 1DYOA 5DMYA 2F66C 1MQTA 2QTOA 3LNMB 4I30A 1TNRA 3LB9A 4MVRA 1H2LA 4I55A 5LP6B 1D5NA 3A0BZ 5FUIA 5K8SA 2ZZQA 2UUBO 2WWSA 3HBKA 2FDJA 1POV0 3S3WA 5FZLA 2YY1A 2QE7G 2OPWA 3WG1A 5I0RA 2UXXA 1PGL1 5FNVB 5CA1A 4YZ2A 2QQIA 3TJTA 4XBQA 3AMPA 3EVKA 1SDWA 1AR93 2JE7A 4JHTA 3N9QA 4NIGA 1MNGA 3FFQA 3K9AA 1U0AA 4CXYA 1JZ3A 4AAPA 5JH7B 5IK7A 1VB2A 3MGUA 2XPJA 4X1IB 4XXAA 2KB1A 4JDOA 3TXQA 1AVMA 4XC9A 4C8DA 1RUH1 3V64A 1KXGA 2EF6A 2TBVA 2VQAA 3LEIA 5K0UC 4CEYA 5BNOC 5A3OA 1W8TA 1JZ8A 1ZNPA 1WW4A 3OW2U 1LNQA 2V4VA 4NXMB 4RN5A 2JB8A 3BTYA 3BIWE 3BAAA 1OUSA 3D5OA 5KUMA 2Q4PA 3POGA 2CV6A 1SLLA 3FC0A 5HV0A 2YS8A 3GWOA 2YEVB 4XJAA 4L2NA 4JCKA 2ODMA 3CCMV 3WHUA 1HV1A 3AKRA 4XFCA 1LTEA 3I3QA 2FDIA 1ZRDA 4Q4X1 3ILFA 3VD7A 3SJQC 1RSOA 5DAPA 1P8JA 4BMBA 2JD4A 1JZ7A 1GLHA 4NPRA 4Q0SA 5LK5A 1SA0A 3VBRA 2Q8EA 4QPIC 2Y6HA 3NV1A 4EYUA 2RDQA 5CFCC 3GVMA 3JXSA 3R65A 1RUD2 2WZR1 3RZKA 4CS3A 3VDDC 3K4ZA 4J7ZA 4YPJA 2W46A 4MG2A 1MOFA 1BGYH 1MMMA 1RMU3 4CH6A 1V55C 3CRCA 2ZCWA 1J5EB 1MSDA 1G6UA 2I74A 3ZX7A 5IK5A 3SPGA 4JF3A 3ELNA 5G04L 3W5NA 2Q7EA 3ST7A 2RHPA 5D8AB 3I97A 2QQJA 2ZEWA 4LF8O 1R3JC 2BTOA 5ACA3 2DOSA 5EJ1B 3D36A 3TWIA 2CGOA 5AVAA 3ZSKA 5IJ9A 2EXIA 4NHYA 3O1SA 1IBLB 2UWCA 2VRZA 4CEWC 1NCQB 1AL21 3MW2A 4NHKA 1PGSA 2ZOEB 1QJY1 1XNTA 2BVVA 4LBOA 5BXZA 5L3DA 3BFRA 4HNAA 2EX3A 3ZM8A 2Y60A 2WNUC 2VW2A 5A33B 1PM7A 1XQNA 3J80N 3DXRA 2DFCA 1JMKC 2DVFA 1GNZA 3DC6A 4DINB 2YDEA 3PU3A 2B5HA 5JZGA 2ET7A 1EUTA 4XOGA 4PJYA 3N36A 1G4YB 2UUAB 4PCRA 1XMQB 1FYUA 4LKFA 2ZHMA 1FAYA 3G80A 1U5YA 1BMFG 3VZLA 1SG3A 5C3QA 3RYKA 2JRIA 2E31A 1H1IA 4JKMA 1JZ5A 4GAZA 4QT6A 4UCTA 2VZPA 2VOXA 2P2KA 1NJIW 1XNDA 1UPSA 4NROA 2P3IA 3NNJA 4JV5O 1LHVA 3GXUA 1SQGA 3OTOO 3I3EA 1Q3EA 1EAH3 2J1SA 5FBJA 1R3IC 1ZX3A 4ABMA 1KD7A 1FNZA 5LGTA 3Q8EA 5E89A 5FLHA 4IYIA 2HJIA 2WN3A 3IPVA 1XJAA 3K5LA 4X20A 2B4KA 3RZZA 3N35A 4OX9O 2F17A 1YQCA 1K73W 4LF5O 1A3KA 1VQ6V 4IEYA 1AROP 3R4SA 2A06H 5EYXA 2ZEZA 1ULGA 1HR0B 3D4KA 4X65O 2W6IG 4UFMA 5LBFA 3K58A 1VBC1 1IX9A 1WLWA 3U0ZA 2W1QA 1V9PA 4RA0A 5A1LA 1N1SA 4DRRA 5JXHA 4J1WA 1WB7A 4W8JA 3FHIB 2G38A 4LBLA 5JCOA 4YG6A 2QKCA 4YGEA 1AXYA 3JARB 3J8F2 4W6WA 4LF9O 1W9TA 1PZ8A 4CDQC 1RUI1 1ZZ9A 1YFYA 3FJSA 5KC5A 4HT1T 3F7YC 3RT3C 3ZXKA 4UOJA 1KC8W 4FTSA 1H8EG 1K5SA 3J8F3 3KHBA 1W0KG 4E2LA 5L36A 2LJ2A 3WNXA 5H9CA 2YC0A 3JD71 5FLIA 2OCHA 1YITV 1AP6A 4FPHA 1K5QA 3O9OA 2PHFA 1CAVA 1QU0A 2CE4A 2RM21 5E1AC 1C28A 3SJAC 2GSYA 3EO6A 4FXKB 5EK0A 1VIWB 1LU2A 1OV9A 4X88A 5FTTC 2BWCA 2E26A 1BHGA 2AGAA 4I0AA 1QMJA 3O1VA 1QJX3 1Q6HA 2UY9A 2BP6A 5CBFA 4RQPB 1AR92 1PNGA 4NXMO 5D5QA 4YVWB 4KWJA 2R061 5FPBA 5LASA 3I56V 5A70A 3K48A 2VOWA 3LDEA 1G9FA 4PBPA 1DZQA 1XNQB 1Y7BA 2R0FA 4LF6B 2BOCC 5AC92 4ASKA 2UU8A 5E6HA 5A7OA 1PO13 2KXLA 2UXDB 5LHIA 3ZFEA 5JI7A 3THDA 2R063 2L9LA 4Y22B 4CCMA 5FBZA 1JYCA 3ZN4A 4K8FA 1S3JA 2A7WA 1MVQA 1VBA1 1ORQC 2ZKOA 4JASA 2EBOA 2Q9LA 1MABG 5BNPA 4BHPA 3H42B 4AF9A 3OMNB 4XFFA 1BS3A 4LOTA 3JQWA 2ZGPA 2WIIB 1OKQA 5EIBC 1E5IA 3ETEA 1S55A 5IJ9B 5FZMA 5IVYA 3H50A 4Q1RA 4C0BA 2VQUA 4OUMA 4ZU7A 4IEQA 2R72A 2TNFA 2VVFA 1H4HA 3EHBB 3L72H 3KT1A 4IV1A 1Q6UA 3ABKB 4U3JB 3VQWA 1UX7A 4EN6B 5KXBA 2RVAA 4ARYA 2ATFA 4EWAA 5FZ8A 2Z69A 5A33A 2V73A 2E9QA 2QQOA 4S2GA 3JALB 2Y34A 2Y8KA 1K12A 1AF9A 2H94A 1TG7A 2UY8A 1Z0HA 5AVPA 2EAKA 1OLRA 3IDBB 2WLMA 1PO22 2GP5A 3APBA 3D8CA 1SFNA 4B08A 2VNVA 5FZCA 2DVAA 3NNGA 4CEYC 5BNOA 3OTFA 1RUE3 2LALA 3EXUA 3SH5A 4TWKA 3KS7A 1K7DA 2FCVA 1VMGA 2ZMKA 2OXBA 2HVJC 4B3SB 1VBC3 1XL6A 1O4TA 3KF3A 1FXKB 1YI7A 2VNOA 3CNAA 5F5AA 3DTUB 5LBEA 2NYYA 2JIJA 5DN6G 2JG9A 1PO23 2XMLA 4N43C 3N7MA 4BLJA 3POFA 5KA6A 1WLDA 4CCJA 2Y0IA 4AGGA 2MW2B 1VP6A 5KA5A 5DN2A 3OSDA 4BIFA 2WAMA 4O2BA 3LAGA 4D6SA 4LO5B 4M4RA 1GWMA 4XFHA 4XTMA 4NIIA 3JBG3 3KV4A 4K35A 2AGSA 5CB4A 3CYOA 2X09A 3NSTA 1MZ6A 3M3EA 4LHKA 5HCFA 4AFDA 4DRXA 5JLVA 4JI7O 1PL0A 2JDMA 3VDBA 3T1YO 1SQVH 2XL9A 4JI5B 1QLEB 5BR8B 3ABKC 4Y33A 3FBYA 2VNRA 5FO8B 3AK1A 5JI9A 3ZR6A 1SMVA 2G9FA 3S0MA 3JD1A 4OMCA 4E4ZA 2GC0A 2QTWB 1URFA 4P08A 2D3PA 2BTQB 4JZ2A 4NRMA 1NCRC 4DV3O 2RR11 5IVJA 1QNMA 1TAEA 1F5JA 3ZEDA 3RYHA 1SESA 4Y5SA 4JTAB 2EIJB 1RXGA 5FP9A 3MAQA 2PUSA 2A6VA 1Q5OA 4LITA 2P06A 1HKDA 1ZZ6A 4GB32 2CTVA 5DZFA 3BI3A 3IIIA 4WVMA 4AQ6A 3KF5A 2WQ4A 1W05A 1OCCB 1NU1H 2XJUA 2XBO3 1AR72 4A3ZA 4B3NA 4NTWA 2IXCA 3IJ4A 4EN9B 1RMU2 3RJRA 4N23A 1JJ2U 4UVCA 4YVWC 2CGPA 2P4EA 2WSUA 2YXYA 1JOYA 5IYZB 1SC5B 1LRHA 4XBNA 5IVCA 1YQ8A 4WFHA 1YIJV 4J1XA 3P30A 3A4UA 4BIUA 4LHLA 4LF7B 5KR7A 1CAXB 4LE4A 1FFTB 3OEAA 3K77A 2A6ZA 2DN9A 3VBRC 5IT6A 1OPMA 4LEJA 1IPSA 1W3XA 3MLKA 4WM7C 3SMHA 2Q7HA 1VE0A 4DK0A 4LNUB 5FO7B 1YEWA 3J26N 1JU4A 1YXWA 4X62B 2H0BA 1LOFA 5JXIA 3ZDSA 2HP8A 4R7CA 2OT7A 3NAPC 5F6LB 2HWC2 2VBPA 2B9ZA 1PP9H 1PHMA 2WPDG 2C2AA 5A2QN 2D7FA 2XJSA 2VOTA 5LYJB 4I3PA 4QKBA 1DGWX 2E3CA 1WLEA 2V4AA 1XMQO 1UY1A 2FTKA 1GN6A 4BAYA 4X6RB 3AL5A 3RZHA 1VRH2 3M3IA 4DR2O 2JDYA 1CN1A 2DBIA 1JTZX 4BOWA 1YRZA 5CBHA 4AR2A 3B8NA 3T1LA 4X64O 2B39A 5A3WA 1RB8G 4AXOA 1Y4MA 4WM8A 5L9VA 3ZMNA 4FT8A 5FUNA 5C3OA 4BQYA 2P34A 1NQDA 3LFMA 1PNFA 2F43G 3UT5A 4R6ZA 1BVVA 3ZHTA 4GXLA 4PF5A 2BRTA 2WO3A 5JWPA 1Z78A 5FY9A 4DR5B 3MO4A 4FSJA 1QVFU 3SKVA 4NXNO 1DP0A 2DWDC 1RYYA 5FREA 2FHRA 3VKMA 1OCRB 4XUPA 3MICA 2UUCB 1MEC2 5FY8A 1KEXA 3STLC 2D5HA 3WZ1A 2F1MA 3T4DA 4COZA 3VUOA 3H9VA 1CAUA 5GJ6A 1NBMG 1BQPA 2O1QA 4MTFA 4URTA 1M57B 1X8EA 1EV12 3FUOA 4I0WB 2W0FC 1DZTA 1FV2A 5IAXA 4W4ZA 4Q4V3 2DWEC 1K42A 1JUHA 1UOJA 4UUJC 3H8UA 5KMGA 3CCSV 4PHZA 3PJSK 4AEKA 5JVDB 3W7WA 1YJKA 3Q4HB 2XJPA 3U78A 3M8AA 3MV11 2Q7GA 4QQOA 4FPJA 3CC2V 1FATA 3NV3A 3UKTA 2JVDA 4QXHA 2W0XA 1G9DA 1NCRA 1UYPA 4C90A 1JI6A 1H38A 4LH6A 5B3SB 4IEUA 4A41A 3O1RA 4DV4O 4UW5A 1COV2 4FFFA 3ZCCA 3FWEA 4QMAA 2QGNA 3ZFFC 1I94B 3BIEA 3HNYM 5DQ0A 3SKJE 4YGDA 2XHKA 3AMHA 2ZGQA 4NAMA 3EBRA 4LE3A 2AEZA 2EIEA 2UXBO 4CC6A 1SQPH 4J41A 3UO2A 1W9FA 5JXGA 3DCQA 5JR7B 4IL7A 2B46X 2WBKA 1OXCA 2ZAHA 3C7OA 1YFWA 4TWTA 2ZHNA 1VQ8V 3ABZA 2XL7A 1T2XA 1WBFA 4UFKA 1GMGA 1DGRA 2QNKA 1C57A 1AL0G 3KGLA 2LROA 4WVMB 3ZHVA 2WAOA 4W4KA 1JYIA 2Q73A 1S77D 4AEDC 3C8XA 3R05A 2R043 1UO9A 1TMF2 4LHSA 4F6RB 3T2OA 1H2GA 2E63A 2ZGOA 3WNOA 2XGXA 5EBLC 1QU7A 4OI0A 5JQGB 2E7QA 4JRAA 2QEXV 4BPZA 3B9IA 3H1LH 2ARHA 4KHPO 1MPXA 3N2KA 1MQTC 3CWBH 4GX2A 5FPXA 1HW5A 4G27B 1GP6A 3JD2A 3HD8B 1HNXB 4KFMA 4FM2A 1LOAA 4JTCB 4NRPA 4B4RA 2VM9A 3AK0A 5H6RA 3UJOA 3SCFA 1CX1A 2VECA 2VOVA 2ZE8A 2WLHA 3VKLA 5LEKA 4QQ2A 2EXJA 5FFOC 3RVHA 4CS4A 4MSVA 2NLRA 2ZD9A 5FZHA 4K21A 3JD72 2X5IC 4FPYA 3CJIB 4NAOA 2C1FA 3OFNG 4RGAA 2BNOA 3KT4A 3LIGA 3MIFA 1NTZH 2BTVC 4UCVA 2VCBA 4I9QA 1G9CA 4CUAA 3HNMA 2FDKA 1GYKA 4ISQA 2LFRA 1L1FA 4WF9V 4FM1A 4B3TO 2QVSB 4ZHNA 3U4XA 4MYEA 1ZRCA 4NIHA 1QJU2 1FXZA 5FZ6A 2J7MA 4DV5B 2EXHA 1BT8A 2WWWA 5I8YA 4EZ4A 4MADA 2ORXA 2QBXA 4PI0A 1QOOA 3PVOA 1WP7A 4BJ0A 1ASJ1 4CRQA 1R73A 1D7PM 4GKJB 3O1OA 5LY2A 1Y3TA 1V54B 1AZDA 2LFSA 5J2TA 1IBMO 4DEQA 3ZS8C 1KDKA 1OPOA 2VL4A 3JAWA 2R062 4DUVA 3T0DA 2GTSA 1PVC1 2KA3A 3I8TA 2DJVA 5AC93 3V0BA 3MBWA 2WWJA 3FZ3A 2R30A 1OMIA 2WAAA 2WNVA 5ACA2 5J98B 1HW7A 3ZDVA 4K0KB 1NZIA 4JC1A 3RQ0A 5J2UA 1XI1A 2G19A 5LA6A 4NYKA 1PNLA 3OGGA 5DXDA 3TB0A 1UF2C 1PZ9A 3J7AU 5FZFA 4WFEA 3M2MA 5M0TA 4AEDB 2GNDA 1U96A 2HYKA 3HQXA 2GNBA 2E51A 4RHV1 4IL6Z 4GWNA 1COV3 4A6OA 1Z7S1 1WA8B 3LEMA 1AB3A 4N90A 5LGUA 1AYN2 1VQ5V 1J58A 4AI1A 4YNIA 2OPKA 1H4GA 1XYOA 3NR7A 1CP9A 1OJHA 1A8DA 4O2AB 4FJCC 1TA8A 1ONAA 1M57C 4XBFA 1UYYA 3LSDA 3RYCA 5T54A 3U10A 2XONA 4MVZA 1WW7A 3RMYA 1E5SA 5E1RA 1GK9A 3U07A 5C93A 4QDRA 1N36O 2HWC1 3T0AA 2GUZB 3W7TA 2NN4A 1D5AA 4P9OA 3RWKX 3KV9A 4GX1A 3ZRWB 1Z7S2 2QWRB 1LGNA 2ERFA 5T50A 4ZBMA 4RHV2 3SNMA 2JGDA 4QAWA 1SPPB 4W6XA 3ABTA 4BW5A 3PN1A 2GH2A 2JG8A 2GNTA 5C4WB 1JOJA 3VZKA 4QU1A 2GBOA 4YYOA 4MTOA 3GYDA 4WCEV 4CU9A 5IJ0A 3S7IA 1DQ2A 1O7FA 2UU9B 2DV9A 2W08A 2ZCEA 3N2GA 4OCTA 4YHHO 1GKFA 4O65A 2WT1A 1Y76B 3THOA 3OY8A 4DW0A 5LHGA 4O4HA 2YSUB 2WWUA 3P3PA 5C8YA 2Q67A 4Q1PA 1RXFA 3ZFGB 3CF6E 1Q8OA 1ZZ7A 5L19A 1STMA 2ZR2A 3AKPA 1REFA 3ML0A 3DXUA 4DUWA 1KITA 3SXWA 5F1RA 3N2KB 1FOD1 1NTKH 2ETNA 4NVPA 2AENA 1OURA 4QQLA 4AQYO 2DBNA 2EINC 1C8M3 2PXJA 4GT1A 3OGIB 3A22A 4TV8A 2C0ZA 2A73B 5B2GB 2VTXJ 2GV9A 3OPZA 5FZEA 4MGKE 1NZCA 3GJBA 3RBZA 3QG5A 5IVFA 1Z7S3 5IYBO 5KXDA 3GCXA 4J10A 4XUNA 2EJRA 1YQ2A 4V2VA 1N0JA 2Q5TA 1OUXA 1UX6A 4XZUG 3C7GA 5A6QA 4WBNB 1VBB1 2D98A 2QWNB 3VDCA 4RR3C 3OUIA 3OBRA 1LESA 2VJXA 5LBQA 5D8AC 1HRI2 1XYPA 2HWE2 3FUQA 4HVOA 4FFHA 1NVPB 3A2FA 2JEXA 5I0SA 3AZVA 3M1HA 3IAPA 2ZIOA 4GA9A 1RUH2 1HJGA 4O4IB 1IKPA 2V7QG 3QH6A 1LAJA 1NX9A 4UV8A 4Y26A 3POEA 4CC5A 1X36A 1RFYA 1POQA 2XDVA 2YUAA 5FPRA 1UYXA 1ZA7A 1G1XB 5FYIA 3BKZA 2R041 2CK3G 2WL1A 4QPIB 3ETGA 1OF4A 1W2OA 4UAPA 4D6TH 3E22A 1AJQA 4X66B 2H0VA 2R073 1BEV3 4AGRA 4ES9A 3U1XA 3S3XA 3N4MA 4HFSA 3AP4A 3JSLA 5FYUA 2D6MA 3ZYGA 2D3OW 2E53A 2YU1A 1BEV2 3IM0A 3I59B 4GJYA 1NYWA 4HBNA 2D93A 3SPHA 3OUFA 3ABUA 4I0XA 2ZTNA 3CDZB 4PQ9A 2Q68A 2L6LA 3NQHA 1TMF1 4JGYB 2JDUA 2NM1A 1ZLZA 3H7JA 4LUMA 4A44A 1H9PA 1SLAA 4NTYA 3MV01 2ZABA 5CG9A 2PI4A 4QGMA 4EN0A 1PGW2 2X7RB 1NY71 1KMIZ 4L87A 2JK5C 5L3FA 4CUCA 4LO4B 4XF0A 2LW8A 2UXDO 4Y5Z0 5F2SA 2Q1MA 2PHUA 4FOVA 3D0SA 1QJZA 3WNMA 3KB5A 3FLRA 1QGLA 1RM1C 5T5PA 4HN1A 4PIYA 3FD9A 4FZ1A 2YXHA 1YXBA 2EIMC 2VMEA 4UBHA 2EIJC 1F2NA 2Y33A 3BU7A 1UZ0A 4NJ4A 2X5IB 3U37A 3TEWA 1XDCA 2JIZG 4E27A 4RS5A 2ZPXA 4LC1A 1TME1 2EA7A 2Q8OA 4JQTA 4C1WA 1CJPA 4EB6A 4QX8A 5LP6C 2BNMA 2Z5WA 2D43A 2P3YA 5A32B 2W3JA 1SHWB 2R49A 4OULA 1JFFA 3HKEA 3DL3A 3OT7A 5KC6A 3OJBA 2ID4A 4W4LA 1RIRA 3ACHA 3B09A 3BY6A 1W6OB 2VD7A 3HAGA 1XE7A 2RM23 5DAQA 3K3NA 2WLIB 1X7NA 1J84A 2QR4A 5KAIZ 1SQXH 5A3MA 2VY0A 1Y9MA 2CDOA 2QUOA 1G9AA 5A7SA 4TTGA 1D4M1 4OHWA 4HXCA 1JOPA 2IFRA 3RZJA 4WZCA 2YICA 5IAVA 2P7TC 1LOBA 4UW3A 3ZXFA 1JS9A 1Q6IA 1UPGA 2UUCO 1N3QA 1PK6C 1UXZA 4GH4C 3AJZA 4K8ZA 4GX0A 1H6XA 3O1MA 3A8TA 5EYPA 3M7AA 3OAAG 1SACA 4GQ7A 4CP9A 1AR61 3ATGA 2QM7A 4J11A 2ADQB 3IB3A 3TGUH 5KBFA 3HKBB 2Z3YA 1J1LA 2P17A 4IETA 4PD4F 3WQ1A 3JUUA 3T0BA 4BB3A 5C9AA 2D97A 1HB3A 4DO2A 4WVWA 2GTAA 3J7LA 1MACA 2W6JG 1LENA 3BYWA 2YIBA 4PIZA 1YHQV 2Y38A 3OYWA 5FZ0A 4I01A 5LY1A 1VAKA 2WT2A 2XVLA 5F3IA 5K0UA 4QPWA 3Q8FA 3VV1A 2VNGA 5IUQA 4XF9A 2M6YA 1WMXA 3VHPA 4Y5TA 2VO5A 5LGNA 4P9WA 4W50A 4O4JB 1RUI2 3JU9A 1ULDA 4P9IA 3WDXA 2J1TA 2DWRA 1F51A 3POBA 4IEVA 1V6NA 1DF4A 1GTOA 1LU1A 5BNPC 4WBNA 2BDRA 3N9NA 1COWG 1SQFA 2CWMA 2YI8A 2P37A 1WW6A 3WW2A 4QDSA 4RQPC 1GZCA 3KCXA 2CL2A 1VBC2 5KX5A 4FFIA 2D2CB 2H8PC 1SCSA 4H3WA 4DR3O 3POYA 4FBFA 1D4VB 3E5UA 3CCVV 5FYHA 4QPIA 2P3KA 2A70A 2MPFA 5H9PA 4CDUC 5J09A 1Y67A 4WM7A 3KVAA 4WFGA 2RR12 3RPQA 1MS5A 3ALQA 1Q7YW 2Q30A 4XFIA 2CAVA 2NQYA 4HSLA 2Q69A 3C3TA 3K2OA 4NMIA 1R092 3RG0A 3RWNA 1ROPA 1TUEB 1OFSA 2OQ6A 4FK5C 4M0HA 1CJDA 4G3YC 2RR13 4YW4A 1GN2A 2OS2A 3VBSB 1VIBA 4UT5A 5D1IA 3CD6V 3NKTA 4LIVA 4XACA 1LCLA 2VZOA 1NT2B 2PYJA 1RUG1 3ASIA 4QPGA 3U75A 2GDSA 4F83A 3O12A 4AI3A 2EZOA 1M56B 5E79Z 2ZDIC 4BISA 1BEV1 2R071 4UVAA 5LW9A 1VRBA 3JD3A 3B02A 2YEVA 4JKKA 4MHUA 4Q8KA 4LUKA 4LPLA 1OH4A 1OC1A 2M7WA 3RYFA 4BU2A 4QX5A 3LGRA 3VD3A 5D2AA 1AI5A 4FFKA 2PGGA 2ZAAA 1W6PB 5LK7B 3BGAA 4QIWF 2FBEA 3AZYA 4NHXA 4WVZA 2X5IA 4A5UB 2GMEA 4RS5B 2K1EA 1GWKA 1VQ9V 2Z2SB 1IS4A 1LEMA 1O3TA 1N0NA 3UGFA 1ENXA 4JRLA 1AX2A 3RWRD 3K75B 1B09A 3ZHQA 2PHWA 5D8AA 1NG0A 4EWEA 3UK9A 3ZYIB 4CUBA 1JFFB 4LKEA 2CTRA 2AACA 4ZU4A 5JJNB 1VBD2 3NAPA 4QB6A 2HFEC 3JBG2 1ENQA 1XYNA 5LXTA 4ATFA 4B3MB 1OHHG 5FQ0B 1BCXA 1W6OA 4CBCA 3ZN6A 4CDXB 2GHYA 4CCOA 3UJQA 2WLKA 5ABJA 5A3LA 3AG7A 4AVCA 4DYLA 2VOKA 2HJDA 4L8QA 4U3FH 4XDKA 5LA9A 2ET1A 2N74A 1KD1W 5FZ7A 2X8KA 3WNLA 4DUYO 4H55A 4DUZB 4MW3A 2UXCB 5JUVA 1W6MA 4CP9B 1VEWA 2ZGSA 2YHJA 4L8JA 1PK6A 4U7OA 3P32A 2WA4A 1NXMA 4RSUA 3PU8A 1SBFA 4G4FA 4JI6B 4ICGA 5E16A 4IHJB 1O3SA 2D3SA 5HI0A 1Y74A 2MNGA 3M3QA 4X6QB 1RGSA 3GBWA 4D94A 3KSCA 4J7JA 1NOVA 2CTPA 5FZAA 5C70A 1YWKA 3FX3A 2IBZH 4LTAA 3OGSA 4OVEA 5K0UB 4HOOA 1PMHX 1AR71 4LFCO 2XTAA 3ZLIA 4H2AA 3IAYA 1WP8A 2GH8A 2HVKC 2QM8A 1GWLA 1UIKA 2W87A 4Y4YA 5GLWA 4C0HA 4PDRA 2PLV1 2PTMA 2AHZA 1RUNA 2PAMA 4FOYA 5K7PA 4B7EA 2ARCA 5FWEA 5FMOS 3EHKA 5A7NA 3TRSB 4AI8A 4O61A 5FZ9A 1PV0A 4LF9B 4QE7A 1S0JA 2Y26A 1CEZA 5FMOL 3PIJA 2XJVA 2PFWA 5A7WA 5TSWA 2K46A 1IS6A 4E8CA 3R4DB 3B4SA 1MVEA 4IUGA 1NCQA 1W0NA 4LK6A 1V6JA 1Q8IA 1QWRA 3CRQA 1HB1A 4BXSV 2JG8C 1K3IA 3OPTA 4KWKA 4AWDA 1W2UA 5T5JA 1JHJA 3NL1A 4F3JA 3QO5A 4H33A 4Q4Y3 4P9PA 4RD7A 3AEIA 2ITDC 3JARA 3RI8A 5IFTA 1QVGU 4ASMB 4CP2A 4Y1UA 1GP5A 4H7LA 5JZGB 4FPKA 1H6YA 3FB6C 2DQ3A 4KBBA 2F6BA 1WKYA 5FY0A 3MDSA 5CFDB 1YSCA 3JATA 4CYDA 1UL9A 3MIGA 1Z5WA 4EFBA 5CVRA 1CAVB 3BHPA 3L9DA 4H0LB 2W39A 3ACIA 4EQVA 1XILA 1LOGA 2VH9A 1GOFA 4WFFA 1BZKA 5F37A 2QQLA 5A6ZA 5FJKA 1V6OA 2YI9A 3OBTA 3ZYRA 3H8RA 5BUVA 5FZDA 5DUUA 5EQUA 3ZN5A 1QBZA 4I4TA 4P00B 2ZE7A 3LZZA 3IPVB 2DQ0A 4YVWA 1R64A 1NLQA 1Z5VA 4LO6B 1SLBA 2X0LA 2R1BA 3WDWA 1W6PA 1AILA 4Q4Y2 1CXZB 3JASA 5A7PA 3JSNA 4Q5OA 4KI5M 5B1AC 5FCCA 1MZFA 1X4TA 2FDHA 3WW4A 5EWSA 1XEQA 2XQRA 3L74H 2ZGMA 1QH7A 3CC7V 5F32A 2VR4A 3BN6A 3SLIA 1P7GA 1WCQA 4R9BA 4PA6A 5FJHA 3GM8A 5C33A 1HRI1 5A9GA 3JB8A 4PV1B 3F5TA 3VQXA 5T5LA 4EEQA 1QEXA 3HKDB 1ND2C 3NNFA 1W8WA 2XOKG 1XNAA 2BV4A 2D6OX 3H1WA 1W2TA 4CDUB 5FQ0A 3RW0A 4X9QA 5D5PA 5BNNC 3K4AA 5HCAA 2JE8A 1UY3A 3VHOA 4CE8A 5FP7A 1W8ZA 5BNQA 1IBLO 1U5IA 5JCOC 3LDRA 2ARAA 2LRPA 3AG1B 1PZ7A 3JALA 4JI6O 3RNSA 5ABJC 2Y69C 1FS0G 1G9BA 3MIEA 1WJZA 4Y3OA 4FPEA 3O65A 4UBGA 1W6MB 4YY3B 3LSQA 3A0RA 2XJTA 4D7YA 2R1DA 1IG0A 3JBG1 4BE3A 1OH3A 3POSA 4B3SO 4O4LB 1UKRA 5B1AB 1V70A 3MD0A 5I0UA 2VULA 4AHYA 1RUD1 4IIJA 1OA2A 3DYMA 3BTXA 5B1NA 1X59A 2UUBB 1X33A 2VZ3A 1FOD2 3E89A 4R9DA 3LE0A 3VN4A 2EIKC 4KGGA 3I5DA 1QJY2 4K3AA 2WZR3 4FPFA 5FY4A 1AL22 2OZJA 3SYPA 4RFT0 1ZVFA 3DKWA 5GZGA 3RRDA 3RN4A 2VMFA 2RMU2 4LLFA 2OTLV 3DSQA 1ZSPA 2KD7A 4AFCA 2GDFA 5L3GA 4Y22A 1GH6A 1JOBA 3GWKC 4LJHA 1YYNA 3HOBA 1COV1 1S5JA 5FZ1A 2P6CA 1JXNA 5ITZB 3SJBC 4X1KA 2V09A 1B3QA 3WQ7A 3AVSA 2UU9O 1G8MA 3PVBB 4CS2A 1XOYA 2VZQA 3IDAA 1KB9F 1L8DA 3T1HO 3B7MA 4FZ0A 3G71V 4JGSA 3VBHC 3KZIZ 1UCXA 2C6SA 4I09A 5A7WB 4LBQA 4MVOA 3TEZA 1I1EA 4XFGA 2XJQA 4LA3A 2HEPA 5C5TA 2KQXA 3WG3A 4DK1A 1W0JG 3GF6A 2J1RA 5HCHA 4R52A 1OCOB 2AXTZ 2CAUA 4IV1B 5DUWA 5BMVB 4U3JA 3H3ZA 2R16A 1NAEA 2RS13 1C3HA 1R6NA 4Q4X2 4S2DA 1SQ4A 1XNCA 4YM2A 4JDNA 5LMNO 3VBUA 4BQWA 3GZUC 5BYNA 3SR2C 5IHRA 1GICA 1PMJX 4UCOA 3POWA 1T6GC 4GCZA 1NY72 2UYAA 2VCMA 1GSLA 1MSWD 5T5OA 3WP3A 2I45A 2DVGA 1RPOA 1YC61 1ASJ3 4JI4B 1HRI3 1CVNA 3ZMOA 4YJ3B 3ETPA 3PVNA 3P5BA 5GTHZ 2VQTA 2WQ8A 3ZMSA 3I55V 4BWOA 4NHMA 1FXKA 4ZKTB 2A75A 3OEHG 2PA7A 3AXEA 2JENA 2WR9A 1DGRN 5G05L 1MS9A 3E5QA 2C9AA 3ZN0A 3KHCA 1UU6A 2J22A 3VL8A 3T4HB 1JYTA 4LFAB 1U5XA 1QNYA 2H3OA 3K0DA 4KH9A 1URXA 4LHNA 1HLCA 2XKOA 2XNDG 4UCRA 3PJQA 4FFBA 5IATA 4GYCB 5EC1C 2DW4A 5FKBA 2OA2A 2QDNA 1HNZO 3I2KA 2IWGB 1LJ7A 1ENRA 2YYOA 4R50A 2R70A 2A3WA 2OX0A 4JI2B 3OCPA 4LNUA 4LR3A 2OQ7A 2LTNA 1M1KW 4DRXB 3W7UA 2PY5A 4GKXA 1BL8A 2VW0A 1NA1B 3ABMC 2ZZJA 3IT8A 3WF4A 4O7XA 1EP0A 5C3PA 5L9BA 1UY2A 2N7GA 4I5SA 4RUEA 1NUKA 3I2OA 2W9XA 3LDCA 3CCJV 3K51A 4FLVA 3H1MA 3C2UA 3D3IA 3CX5F 4NIAA 1RVF3 4LBEC 2C4XA 3LSSA 1NA1C 1B04A 4MTXA 1VQLV 3AKQA 1R6KA 2UXCO 4KWLA 2H6CA 4YJ2B 1VAMA 5HCBA 1ULPA 3WSOA 1RUJ2 4LULA 2Y6LA 3AYDA 5B66Z 2Q8DA 3SCGA 5J37A 4BZ4A 1LGBA 3B69A 4JYAO 4XMAA 2LO1A 4YW2A 3EB7A 3O0VA 4MHRA 2P4KA 2ZXWB 2DCKA 4MV2A 3SHRA 1FKAO 2TEPA 1R1BA 5FY1A 1K5JA 2HEWF 1XE8A 2IXIA 1HP8A 3PVEA 4NIDA 2EALA 4MOAA 1K8AW 4COYA 1TEIA 3D0JA 2XAFA 5JJEB 5FYTA 1O3RA 5HFLA 1OVSA 5FZ4A 1UW8A 5F3GA 4AQTA 3PUAA 1AR62 2RS32 1GQPA 3CJXA 1EM1A 5E8AA 5GALA 1IVSA 2MEV1 5J1XA 4Q0UA 5EFUA 3VBUC 3CP1A 3BVCA 3VBHB 1F4MA 4AG4A 3USUB 3QF7A 5FZBA 4GKJO 1ZBA2 3KQRA 3WP4A 2MK3A 3NV4A 1Q8QA 1GP4A 3TCUA 2AEYA 2JDIG 5APAA 3VBFB 5EP9A 4N21A 2IVIB 3TN91 2PHLA 2OVUA 5JVDA 5BZBA 1UZYA 1B06A 1QHTA 4OZOA 4CZZA 2JJ2G 1BQZA 5JMCA 4LF5B 1W03A 3G7DA 1GN4A 3GGLA 1WPXA 3ZYFA 2VU9A 4IEXA 3BALA 5ANQA 1UOGA 3AXDA 1KJRA 4BQ4A 1ZZ8A 1BXHA 1TMF3 3J9SA 5J96B 5EJZB 1C8NA 1VPHA 4XVHA 1CPNA 5KUKA 1GZ9A 3LSUA 2JGUA 2HHHO 5L7OC 3WY6A 2RDNA 2DYCA 4RS5C 5FLJA 1HDKA 3M3CA 4LBNA 3LOIA 4BQ1A 3VBOA 2NN8A 1H8TB 2WZEA 4FI9A 1O59A 2L35A 5BV6A 4IERA 4JI8B 3SYAA 2WS93 3ASOC 1W8FA 2E33A 1UJWB 4BDVB 2RDRA 1PKXA 1JN2P 1US2A 4OHVA 2UUAO 1FYJA 5LOVA 5ACA1 1XREA 1PGW1 4WVVA 1XPWA 5FP4A 1FXHA 5F2WA 4Q4W2 2GALA 4JAVA 2HWC3 4LA2A 1AXZA 1XXNA 2GMPA 1WAZA 2DCTA 4LORA 3LEKA 1HRV2 2ZKNA 2QQWA 3AC0A 1MS3A 3USSA 3AK3A 1IBKO 5IVBA 1WNSA 2QWOB 2HLDG 4GH4B 2OUHA 3ZYJB 1LHOA 1GMMA 5HBAA 3VZMA 1DGWA 1H8TC 2VMIA 4E2QA 2YUEA 4N7IA 4UCUA 1DQ6A 4B3RO 1HX6A 3QO8A 2ORZA 1POV3 1H2KA 3K5OA 2A71A 4RR3A 3VBSC 4KP4A 2Z42A 1JZ4A 4SLIA 1ENSA 4Q4X3 2ZIMA 2XASA 4M3CE 2PYLA 4W65A 2G1MA 3E8BA 4DZGA 1OCZB 3GZAA 2EIGA 4RFRB 3OR7C 4BQ3A 3I2HA 3AYAA 5AG2A 1N1TA 3CJIA 2KG7A 3EXAA 2CDYA 3ENRA 3LWCA 3STZC 2J42A 5FOJB 2NPIA 5IVVA 4D69A 1EBOA 2QKDA 3M3OA 3VKNA 2E75B 2RDCA 1AR82 5AC91 2XLFA 2W47A 1N32B 1N47A 1N36B 3ZMVA 3KVBA 4LWSB 4B29A 1THZA 4JX0A 4PI2A 1LEDA 4YVSA 3IWZA 4I7ZB 4LFBO 2RS33 1O8SA 4B3MO 3DPRA 5FZOB 2YPDA 5K1XA 5A6XA 3S5QA 3NJYA 4D6QA 2IJIA 4Q4W1 3LUTB 2DE0X 2RN9A 1RM1B 1YFUA 5A80A 1QJY3 3TNQA 3CU7A 2P5OA 1F23A 1M93A 3K5MA 1VRH3 4K1ZA 4U7NA 4ET7A 4BIZA 2ZMNA 1GAXA 3N9OA 1S2BA 1YHFA 1T6BX 2IJKA 4KQ7A 5L73A 1FT9A 4J9YB 3WVJA 2F95B 4LXLA 1BZWA 2JS5A 2VQFB 2Y4TA 2QKSA 5JQGA 4XFBA 1SDDB 1A6CA 4NXNB 4UF0A 4K9SA 4LBKA 3ZFEC 4GB31 1N1YA 4EKWA 3ZSJA 3RGBA 1W3VA 4I50A 1X8MA 4XDPA 5LA6B 1ZUQA 2Y6FA 3QD6A 1DLLA 1AR4A 4RWUA 3WFVA 4CU8A 5CZKA 4YW5A 1QY4A 4LIUA 5JXJA 4XW3A 1CD3G 3OD4A 4R9CA 1MQTB 1R1ZA 2Q1FA 4IE7A 4ZIBA 4ARXA 1WB8A 1W6NB 4TYSA 4N53C 3T30A 4PBOA 1N3OA 1DQ1A 2RJLA 2BQPA 4HL0A 1SQQH 1GN3A 4H14A 4GZ9A 4O2AA 2FZ2A 3HT2A 3E35A 1KFXL 4DNYA 3J8F1 1QQCA 1TGOA 1CWPA 5LWBA 1FMD1 1OF3A 1S5HC 5IYCO 4JGYC 4TV9B 4MGYE 3FB5C 4DV1O 1R3LC 4JGZC 4H37A 4XAAA 1NTMH 4UXAA 1LKNA 5JH7A 2GUZA 2K0GA 1Y43B 3AYEA 2XHBA 1W6QB 5B4NA 2A6XA 4X1IA 4JYAB 2D40A 5C3RA 5FYYA 3BA9A 1D0HA 4CUGA 4C7UA 4BK5A 2P6JA 1EV11 4GKKB 2VBBA 1DYPA 4AVSA 2W5FA 3AKTA 5FUPA 1L7LA 5C4WA 4IGGA 1R081 3THTA 4GMP1 5J2TB 1UOFA 4LF7O 1R1A3 1XNRB 5H9QA 4FAHA 4BK4A 1RUG3 2CWSA 2YZ4A 1PX4A 4BCUA 1SFPA 3CIHA 1QXRA 3ETQA 4DOUA 4D7TA 5CYYA 4Q6GA 4DR7O 1IQAA 3PUHA 5FZIA 1K4CC 1RITA 1OVPA 4O4HB 4NWWA 4OUSA 2ZX0A 4F7ZA 1TME3 2WNVB 3BODA 3ZO0B 4K3UA 2N04A 1GV9A 1TUBA 4A2UA 5JR2A 1CQ9A 4Y1VA 4YFWA 4X1YB 5IE9A 3FL7A 3UT0A 3MYXA 4CEWA 2X29A 2QTSA 4UB6Z 4LNVA 1RVF2 1PVC2 4TN7A 3KM5A 1SA0B 1B6QA 2ZHKA 4AFMA 3SYCA 2DTYA 1QF3A 3MEPA 1DTOA 1IHMA 1YTFD 1AJOA 4IV1C 1S0IA 3N7JA 4TV8B 5JOXA 1SF9A 1WA8A 2EILB 2PF4E 3DN7A 2HBTA 2DU1A 3G4SV 4JI3B 1W8OA 3BEHA 4IYHA 2GU9A 2E5LO 4BH9A 3M7MX 3CKHA 3WDVA 4A42A 2QDOA 1Y6XA 4YW3A 1ZREA 3RYCB 2PLV2 2KG7B 3BVOA 4CCNA 3GCWA 4HK8A 1US6A 5CKNA 1Q82W 4DO0A 3T1YB 1DLCA 4CDXC 5H9SA 4HSJA 5EZYA 1GBGA 3CXHF 2AREA 4FCAA 2ADPA 5F6KA 3NRUA 3I3DA 3IBMA 2FDGA 1DBNA 1BE3H 3Q9OA 4QE9A 3MZHA 2VMGA 1VMFA 3E22B 3BTZA 4IEPA 3QCWA 1W99A 3FFZA 4MO3M 3AB0A 4LKSA 1WN7A 1VALA 4FP3A 2X53S 4OXSA 4YIPA 5LZ6A 1JU3A 4HKWA 3BA8A 1NH2B 4QX3A 3E1F1 2F93B 1F35A 2WYFA 3N2GB 1CPYA 1KQSU 2EIDA 1UKGA 4AI2A 5LATA 1W2AX 3IGAC 1FAFA 3FB7C 1IKQA 3ASNB 1H8HG 1SRYA 3CO2A 4MXWB 2OT5A 1RMU1 4I0XB 3QACA 3WQ0A 1UIJA 4JGYA 4UF0B 2RS12 2RG4A 4XIOA 1SLTA 1K34A 1SS3A 4HVRA 1IQDC 2MHFA 1RUOA 2O8QA 4ZS2A 4HZFA 1RUC3 4JV4A 4JTOA 5FMCA 5HFMA 2OW4A 1ZTEA 5EHDA 4C91A 3BOPA 4EN7B 1H1AA 5H6QA 4FTBA 2IJJA 3NNMA 2WKKA 4CU7A 4OQ9A 3J4UH 2A3QA 2WLPA 2R072 3FN9A 3AMNA 5CA3A 3KLSA 1GU3A 4LO7A 4KG8A 5KHGA 1WGPA 5BXXA 2CYFA 4WM8C 4EE2A 1JX9A 4N8MA 4MGQA 1D2SA 4COVA 2ZT9B 2VTXA 4IE0A 4GLXA 3O1TA 5KXEA 4IEZA 2CHHA 1I5PA 2B42B 5HV4A 4E4DX 3I2DA 5LEJA 2VXRA 3POJA 4ZY9A 1ZBE1 2WQZC 3LD8A 3RSJA 2Z0AA 2OYZA 1IGOA 2JG9C 1CZVA 4LO8A 3N3HA 3HR9A 4GUNA 2HEVF 5LMUO 4PLMA 3H1KH 3MHHC 5FNVA 5CA1B 1MEC1 4MXVA 2P4VA 4XQWA 3ZMTA 3T3YA 3HKEB 3S6PA 1BJQA 3FYEB 3ES4A 1BK0A 3M70A 5JSOA 3FLPA 4DV1B 1QXPA 4I0BA 3OPWA 1EY2A 1FPN1 3I2GA 5B1BB 4BQXA 4UYBA 2WLIA 1ZWIC 1S2EA 4CP1A 4CCCA 3ASOB 2XG3A 1OQEA 1P7BA 2RMU1 4DR5O 5FRAA 2RS11 1P84F 5EPAA 3IAQA 3DEMA 5FPVA 4XHXA 3DYOA 2DURA 3I59A 3T4VA 3T08A 4KU8A 2A1XA 2JDKA 2W1SA 1IBKB 3PTRB 2WYSA 3UESA 3KT7A 4EJRA 4Q0QA 3LSEA 4MX3A 3C7HA 1VQOV 1HQLA 4DRVA 4KBZA 1YFXA 2YC2A 3BCWA 1TUBB 5KLVH 1H2SB 4TUYB 1EFRG 3PURA 2A0LA 4GWMA 1XNRO 2O8OA 2RJKA 4HZ3A 1W2BU 1YO8A 3IZOA 2GNMA 2W95A 2YC4A 3ON7A 3VOUA 5A3TA 3TXSA 2AC1A 4JQRA 5GLVA 1O91A 2GC2A 2EIBA 2ZX1A 2SLIA 2AHYA 4ZKIA 4QB2A 1OQ1A 4AEJA 5FYCA 1OD3A 3O5SA 4YW6A 2ZA9A 3FB8C 1F8VA 4XJZA 4YGBA 4GKKO 1RUC2 1UNBA 2QQPA 3ZFFB 4XURA 4K1YA 4BA6A 1KECA 1XU2A 4DR6B 1PIV2 5BY1A 1HRV3 2EIMB 1TVKA 3G6EV 3AG3B 3G6JB 2LP7A 2E5LB 5B3SC 1B35A 1DG6A 3JAKB 4CH3A 3LEGA 3K08A 5EZYB 4XIKA 1AHSA 4AFAA 3N9MA 1S5LZ 4KUMA 1RUE1 3IN9A 2D6KA 4MH0E 3WB1A 1SCRA 4YFZA 2WINB 1DF0A 1US3A 1VQ4V 2A6YA 4XJWA 1YTFB 5C5UA 4HG6B
chains in the Genus database with same CATH topology
3THPA 1EYBA 3AZZA 3OD0A 4XILA 3ZN6A 4YGEA 4CDXB 1O4YA 1SFYA 1AXYA 3MLLA 1AR63 4AHXA 3WXPA 3J8F2 4W6WA 3UJQA 3D6EA 3OGJA 1WMEA 2WA3A 1PZ8A 1REEA 4CDQC 1RVF1 5ABJA 1RUI1 2GZWA 3KD4A 1ZZ9A 5A3LA 1YFYA 3FJSA 4AVCA 2XJRA 5KC5A 4HT1T 2JJ6A 4N43A 2VOKA 3ZXKA 4L8QA 4FTSA 3BB6A 3J8F3 2ET1A 5L36A 5T3NA 2X8KA 4Q26A 4E2SA 3WNXA 3VBSA 4H55A 5JIAA 2YC0A 3IMNA 3JD71 3JQXA 5FLIA 2FMDA 1W6MA 4FPHA 1FPN3 2PHFA 1CAVA 1QU0A 1VBB3 4CP0A 2RM21 4DS0A 4OZXA 2ZGSA 2YHJA 1C28A 2GSYA 4M01A 5C8CC 1CAWB 4IV3B 1PK6A 1H1MA 4OHYA 3EO6A 2WA4A 1VIWB 1NXMA 4FXKB 4RSUA 4XF1A 1LU2A 1SBFA 4G4FA 5E16A 1VJ2A 5FTTC 2BWCA 3WOGA 3V65A 1O3SA 3B93A 3NO8A 2D3SA 5HI0A 2MNGA 3M3QA 4X6QB 1RGSA 4I0AA 3GBWA 1QMJA 4D94A 5KWRA 2JG9B 3KSCA 1LHNA 1WMDA 4NO4A 1HQWA 1QJX3 1ZRFA 1NOVA 2UY9A 2WFF2 4RQPB 1YWKA 3FX3A 1AR92 2ZHLA 1PNGA 1GZWB 4LTAA 1S0CA 4OVEA 1CAXA 5K0UB 4YVWB 4KWJA 2R061 2V5YA 1AR71 1PO11 3K48A 2VOWA 1HIXA 1F5FA 4P5HA 1DRTA 1G9FA 1I6XA 4PBPA 1DZQA 4XQ4A 1R093 1Y7BA 2GH8A 2R0FA 4XMIA 3LA3A 4QU2A 3WW1A 4DY5A 1UIKA 4UW4A 4Y4YA 4L11A 5AC92 2UU8A 5GLWA 3I4IA 3ILNA 4MGIE 4A7KA 4C0HA 5E88A 1PO13 2KXLA 4Y20B 1AR73 3ZFEA 5JI7A 2R063 2PLV1 4S2FA 2PTMA 4Y22B 3ZXAC 2IC1A 1RUNA 5FBZA 4Y1XA 1JYCA 3V56A 2PAMA 3MF6A 4FOYA 3ZN4A 4K8FA 5K7PA 1WCKA 4B7EA 1NX4A 3E6BA 4D3WA 2B45X 1MVQA 1VBA1 5FMOS 3B3QE 1VBD3 3EHKA 3TRSB 4AI8A 3VBOC 3WDYA 1VRH1 5BNPA 3BTAA 4BHPA 1S0JA 2Y26A 1OIKA 3MLJA 4AF9A 4XFFA 4J5IA 3KZ4C 3A0KA 3O14A 2YMZA 4XBLA 3JQWA 2ZGPA 2WIIB 1XU1A 5FMOL 5DDJ1 1OKQA 1RUF3 2XJVA 1ZBA3 2PFWA 1S55A 4Q4W3 1HXS2 5TSWA 4SBVA 1IS6A 3H50A 4YRDA 4R4XA 2JEMA 2PHTA 4Q1RA 4C0BA 2GN3A 2ZGTA 4OUMA 3R4DB 1I5ZA 1MVEA 3GHMA 1NCQA 4ZU7A 1QJU1 1VB4A 4IEQA 2TNFA 1VR3A 2VVFA 1H4HA 3JD73 4JVAA 1V6JA 3VL9A 1Q43A 4X8PA 1QWRA 2TUNA 4IV1A 3KT1A 4B4QA 4WM7B 2UYBA 3VZJA 3PNAA 1U12A 1LODA 4NN0A 2E6VA 2JG8C 4KWKA 3SCHA 4AWDA 4Z07A 4AHZA 4EN6B 1VBE2 3TN92 1W2UA 5T5JA 5KXBA 4WM8B 4XDQA 2ATFA 4EWAA 3NL1A 4XPVA 4F3JA 2BGCA 2Z69A 4Q4Y3 2V73A 5A33A 2E9QA 4RD7A 4S2GA 4AW7A 1RUI3 1EPZA 3WUDA 1OOPB 3RI8A 4B8EA 2DFBA 4LBMA 3I7DA 4ASMB 4CP2A 4DY3A 4Y1UA 1OD5A 1AF9A 1RUE2 1Q8VA 1GQHA 4H7LA 4P9LA 2UY8A 1Z0HA 5AVPA 2EAKA 1OLRA 3IDBB 5JZGB 1PO22 4FPKA 4OI2A 5JSRA 3APBA 3VZNA 3D8CA 1SFNA 1V9U3 3HT1A 5I8SA 1OS7A 4CDWA 4KBBA 2F6BA 2DVAA 4CEYC 5BNOA 4QPGB 3OTFA 1RUE3 2LALA 4ATEA 4FPGA 5CFDB 3EXUA 1S2KA 3SH5A