4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
2WA3A 2CGOA 4B7EA 3P3NA 3P3PA 2ILMA 4B7KA 3OD4A 3D8CA 1H2MA 1H2NA 1MZEA 4NR1A 1H2LA 2YC0A 1IZ3A 3KCYA 3KCXA 1YCIA 2W0XA 2CGNA 2XUMA 2Y0IA 4Z2WA 4QU2A 4JAAA 4Z1VA 5JWPA 1MZFA 1H2KA 2YDEA 4AI8A 4BIOA 2WA4A
chains in the Genus database with same CATH superfamily
4IYIA 1D2QA 1R3JC 2NNUA 1AUYA 4E4DX 2GNMA 3B40A 4D6RA 1M4WA 1PVC1 1AYN2 1UMIA 3NVCA 4TYSA 3HB3B 1I94O 5FZCA 4XBFA 4YNIA 3S5AA 2XBO2 2A3YA 4JYAB 4KG8A 2QTSA 3BALA 3WHUA 5FZAA 1R3KC 2WC2A 3UCSC 3T2MA 1J95A 3GHNA 3CC2V 1ZNPA 4CUGA 2OA2A 2B46X 2ZGNA 3FB7C 3CL1A 4P9JA 5IATA 3QTCA 2FDJA 2ZKLA 2E26A 1SETA 3HPLC 1YTFD 1IKPA 2RS12 4TUYA 2W0XA 4A6SA 3RYHA 2EULA 1D4M3 5CB7A 3GJBA 2DQ0A 3KLSA 2Q67A 4AI2A 2ZKOA 4D7SA 1GLHA 2VVEA 2AH2A 4XE9A 4RHV2 1AVBA 4EN6B 1KC8W 2QJVA 1W05A 3WB2A 4YXWG 3R0RA 4YJ2B 2OYZA 3RYRA 4HK8A 4CPBD 3B9CA 3ZN6B 2QKAA 4FLVA 1V55C 4YJ3A 3O12A 2W6JG 4RGKA 1SS3A 1TME1 2A5ZA 2DURA 1Q5OA 2BNOA 4PD4F 3ZSLA 2EIJB 3AG3C 4E2LA 2VMCA 4R6ZA 3GZTB 4GALA 1JS9A 2XJUA 2JE8A 3NAPC 2WZR3 1OCZC 1QCEA 3H3LA 1GP5A 4JPRA 1T2XA 3ASNC 4BIZA 4DR4B 5EBMC 3FN9A 4HKLA 3N9NA 2HWC2 1HB1A 4ZY9A 5LXTA 3N2GB 1OFSA 3M8AA 5JIAA 3TBDA 1EUTA 3N2KA 5LZ6A 2GDSA 3H1YA 5FWEA 1QEXA 4FPLA 2DVFA 1OLQA 2CE4A 1FMD3 4YM1A 1UKGA 4YW3A 3WNMA 3SYQA 4NE9A 1NUKA 4LF8B 1TQ5A 3CJIC 1HW7A 1J58A 3CRCA 4NYKA 1OH4A 2D98A 4KG0A 1C5IA 3ZXEA 4RR3A 4JGZC 3C7EA 5I0RA 1NG0A 3JD73 5LB6A 2CH7A 5LA6A 2UWAA 3U07A 5LRRA 4I3PA 3ZFGA 1NT2B 2FQPA 2EINB 1QLEB 5E1RA 2Q8DA 1NLSA 3AEIA 4OI1A 2GP5A 3ZMTA 1CONA 1RUH2 1YO8A 3A22A 3OTOB 3D5OA 2VNVA 4RYDA 5ANNA 2KB1A 3GF6A 4GX0A 1AYN1 4JZGA 4Y4RA 5C7GA 2MEV3 2HG5C 4IEPA 1PMHX 1CPMA 1JPXA 1QJX3 2P3IA 3FUQA 4FM2A 1Z7S2 3VBHA 4HXCA 2QQWA 4QDRA 3ZMUA 4YYOA 1XU1A 1O3QA 1TA8A 2NP0A 1QBZA 3OGCC 3KVBA 3T1YO 5A7QA 1AX0A 2A6WA 4LP8A 4IHJB 4GJZA 1M5IA 2P67A 2A71A 4IERA 2GDFA 1S0VA 1ENSA 1XQ8A 4CDUA 4QGLA 2HLEA 3AP5A 2WNUC 3OPTA 3ZCCA 3ETDA 3CC7V 5D21A 4L8QA 4Y3OA 4RHV1 3MPBA 3IPVA 1HQLA 1ZL8B 1JZ4A 2CTPA 1N36B 4XVHA 3AMHA 3B8MA 4G27B 4QQPA 1NA1B 2AGAA 1PVC3 4HKWA 5EXOA 1PO11 5LY1A 1P8JA 3VQVA 3TWIA 2YB7A 3CNAA 4BAYA 4GWMA 5JXIA 4G3YC 3R05A 5F39A 2WSUA 3WUDA 4J25A 1YHFA 4I0BA 2FDKA 5IK5A 1C8M1 2ZBJA 1XYOA 4LBQB 4PF5A 1JZ8A 5A3TA 4JAAA 3ACGA 5H9PA 2JDHA 5B4XA 5CZKA 2X53S 3I56V 1HQWA 3UO2A 3IC9A 4OMCA 2D44A 2Y26A 3C2UA 3RYPA 5K9YA 3NNGA 4XPVA 4IL6Z 1TME3 4DOUA 1Q7YW 2Y38A 3H0OA 3PVNA 2Y8KA 1K5QA 1KJRA 3CPWU 4XQDA 2PLV2 1QJEA 2KD7A 4PELA 2DV9A 4P14A 4TSFG 1K5MB 4Z2AA 2R9RB 1CN1A 3ORJA 5BNOB 3ZRXA 2WLLB 2B5HA 2WZ8A 2ZGUA 3OYWA 2YIDA 3ZYIB 4LO4B 5GONB 4JI6O 2PF4E 2JJ6A 1R1A3 4WM7A 4F83A 3MDSA 4FSJA 4IESA 5JUVA 4JI7O 1ULGA 4O61A 3L71H 3ICXA 5K7PA 4JC1A 1VBD1 1FKAO 3RDIA 1W90A 3J7NA 2TNFA 3S7IA 1YITV 3EVKA 1GOFA 4F7ZA 4A3ZA 4UW3A 4CXWA 4M4RA 4J42A 1BMV2 1QXRA 4QQOA 4JI4B 1YHQV 4D6SA 4B3SB 4AVVA 3T4DA 3KCXA 3JATB 3N9QA 4HSJA 3QG5A 5LA1A 5FKCA 4R50A 4K0KB 1E5HA 2VNOA 3B77A 1ZBA1 3OY8A 5BNNC 5LP6A 1GICA 1SA0B 1QVFU 3IWZA 2WQ8A 4J7JA 3LDCA 3CCJV 1B04A 2Z5WA 1XYPA 1YIJV 5EIYB 3D0SA 5JQGB 2K9PA 2R49A 3CEIA 3MBWA 5ABJC 3EMRA 3H1IH 4QPIC 2NMNA 3PMEA 2VZUA 4N53B 4DXSA 5A32A 3BCCH 4HZFA 4Q8LA 3IGAC 5JXHA 1SFNA 1MR5A 4JYAO 5F8PA 1Q8IA 3HQRA 1O3TA 4P9GA 2IXKA 1V54B 3JXSA 5GZGA 1N1TA 4N8MA 4YM2A 2IM9A 1QMJA 3RJ2X 5JOZA 1ALYA 3NJVA 2QQUA 4CSWA 3H7JA 4XDQA 3PTRB 3BVCA 1WA8A 2JG8A 3VHNA 1XU2A 4NPLA 5IVEA 2XVGA 3LEMA 2BBAA 2QGNA 1XNDA 5IVJA 1PO13 1BBT1 3KV4A 4UAPA 4LF4B 3E8GA 3UGFA 5IAXA 4QKFA 2XH6A 3OR6C 2IXLA 5J9PC 4YW6A 3BI3A 3PURA 1C8M3 4XF0A 3OF1A 4MGQA 4P02B 3AKRA 3KWVA 3A0HZ 2LROA 2QNKA 3KQRA 3JB4C 4CS3A 4XMAA 2ES3A 2EILB 4JTOA 3O1SA 1R6NA 4JKLA 1SMVA 2LGWA 1NY72 2JKBA 3AYCA 4YVSB 3RPQA 3H1LH 1H8TA 2RJKA 3H42B 1P84F 5IY5B 2ET7A 3O1MA 3AVSA 2BGCA 5KMGA 3S0MA 4O4LB 1RVF2 4J80A 1VF6A 4AI0A 3K3OA 5J37A 1WA4A 5C9AB 3JYCA 3UGHA 5E6HA 1XE7A 2GMMA 4LA3A 5FKBA 4AEMA 1J3RA 4K8RB 1VQ4V 2ENRA 3WDTA 3BOWA 3AMMA 3D6EA 3L73H 3DC6A 1WB8A 4L97A 2C6SA 1H2KA 5C70A 1S5JA 5IYCO 2VU9A 4LULA 3AC0A 1PO22 1CGPA 2P4KA 2DVDA 3DCQA 4FTEA 3B93A 1Z5WA 2YC2A 1YQ5A 4W4LA 4ZXKA 4GAZA 3AG2B 4BW5A 4LKEA 4Q27A 1YWKA 3ZYPA 5HCHA 4X65B 3G67A 2AW9A 2WPDG 2XOMA 3N35A 4FMTA 4CS4A 4YVWC 3BPSA 5FZ8A 3JBG2 1BL8A 2EXJA 3LDDA 3E6BA 1R3IC 3B5LB 5A9GA 1VBD3 3EB7A 3KHBA 2D43A 1NX9A 2B45X 3UNPA 3N27A 2YBKA 3R4SA 1UPGA 1W3VA 5FPOA 1XL6A 4GLXA 2VQUA 2WQZC 2VZQA 4LHNA 3UJOA 3ZN6A 1ZA4A 1IZ3A 4GCZA 3NNLA 3ZFFB 4LF6O 3SXWA 1ENQA 1CIYA 4YW2A 1ZBA3 4XUOA 1I5ZA 1RSOB 1UO9A 3OBAA 2GZWA 1XSRA 2WWJA 5CNAA 2D6LX 3CWBH 5CBGA 3KD4A 1I6XA 5BV6A 1DQ0A 3TYJA 1APNA 4Y1ZA 1X9PA 1TMF1 4GB31 4KGQA 2LALA 3B9IA 3ZXKA 3OSDA 1GN4A 2BOBC 1JUIA 2C9KA 3V0AA 4GMP1 1W6NB 4JTNA 2OCHA 3ZHUA 3D36A 1GM8A 1FAFA 3ZN0A 3B2EE 4O2AB 3HPNA 5B3SB 4NIAA 4HK9A 4ASKA 5FZEA 4D0QA 1BK1A 2RS51 4LKFA 3WG3A 4O9GA 1S3JA 4YW5A 2QBXA 4P08A 5T54A 3N36A 1QJY1 3ETEA 1NVPB 2Z2SB 1ENVA 3ASIA 2YG0A 2ADQB 1BBT3 4DK0A 1EPWA 1S0BA 4IGOA 4I9QA 1OC1A 1EP0A 4MGYE 1W59A 2D5HA 2Y4UA 1PO21 4DINB 1X7NA 4XCAA 5LMUB 1RHI2 1DG6A 2G38A 5JOXA 2VBDA 5I8YA 4DO0A 1W6OB 3JD4A 3LSDA 4IHJA 2CTRA 4W50A 4YHHB 3K0DA 2Q6AA 3BIWE 5H9SA 4IEUA 2C4XA 1CJPA 3VD7A 5C33A 1ULDA 4E2QA 4UFJA 4MW3A 3VZJA 4P9OA 1RUOA 3HAGA 1VBC3 1PK6C 2FCUA 3IZOA 1ZL8A 4NR1A 1UYXA 4BQ5A 2P1BA 5K0UB 1WPBA 5CA1A 3AG1B 2YY1A 1F7YA 5CFCC 2HFEC 1LENA 1XI1A 4WVZA 3T0DA 5KA5A 4ISQA 3FBYA 1F4AA 3M1HA 3F95A 3WFVA 2JG9B 1Q3EA 1AJQA 3K77A 2Q5TA 4QJFB 1W06A 2EZPA 3ILFA 2PA7A 4MOAA 5K1PA 1VAKA 1F31A 4AI9A 2VZ3A 1ASJ2 2BUKA 3T2QA 5JH7A 3S7EA 4Y33A 1COV2 2R062 1XNQB 4RN5A 5BNPA 3RN4A 1J1LA 5SV8A 2IW5A 5BUVA 1W8HA 1FV3A 4LR3A 2RJLA 4J41A 1B3QA 1V0AA 3G71V 3S5QA 3OCPA 3WDWA 3R65A 4LF9O 4MX3A 2DVGA 1RINA 1G9FA 1WZXA 1D0HA 1PMIA 2RDSA 1XMQO 2ADEA 2WSSG 4ZS2A 3BU0A 3N9PA 5JOWA 3RBZA 4DR6B 2LO1A 2DBNA 1MS0A 1IOAA 4YGBA 4IV1B 3FB5C 5AVPA 1ZRRA 4PA7A 5HFLA 2ARCA 1Y43B 4MTFA 1TEIA 2FMYA 5DAPA 3J4UH 5BNOA 4IT5A 1XMOO 3N4MA 5ITZA 1L7LA 2JKXA 1Z78A 2F17A 4MGKE 4V1PA 5I0SA 1N34O 3AFKA 2J1UA 3JAWB 1O59A 1VBA2 1SKVA 1W0NA 2ITCC 1AJPA 2Z3YA 3KQ4B 3EXAA 4R7CA 5EYPA 1TMF3 4GB33 1JZ5A 1RHI1 2V73A 1FPN2 1PM9A 4AR2A 3PUSA 1UOBA 2ZGMA 4LF4O 3GZAA 2I45A 1JR9A 1DZRA 1YCIA 1NQJA 5KC6A 1LRHA 1AR72 4Q29A 3BB6A 2ZMNA 4HKOA 2R7EB 5HV0A 2RS53 3V0BA 4TLFA 1OPMA 1YIFA 3SEEA 2RJ2A 1GMGA 4CDWC 4JI1O 4TV8B 4I3GA 4XETA 2GTSA 2BU9A 3LAGA 4FQZA 1QJY3 3IDBB 1OXCA 4LR4A 4BLIA 3JD0A 2Q7GA 2RN9A 1FPOA 3JCZA 1OQDA 1UN1A 1IBKB 1MPXA 4D8MA 3VD5A 4RL7A 3H01A 3WXPA 3RI9A 3MLKA 4YZ1A 5IE9A 4MLOA 3RWNA 3OB8A 5FXWA 1BEV2 3W21A 5JQGA 2XUMA 2Q8CA 1H30A 1LNQA 3B01A 2BNNA 1VB4A 4Y4YA 2ZXQA 1HB4A 4B3RB 2QZ3A 4K21A 3JU9A 3BA9A 4H37A 1JBCA 3WG2A 5DZFA 4N53A 1ZBE2 5AVAA 2P4EA 5E8AA 1COV1 1RPRA 3WR0A 1JI6A 2HYXA 4MVOA 1PL4A 1ULEA 3FYIB 2EIKC 3WUCA 2QQLA 4Q4W1 4S2DA 3FFZA 2JS3A 3P1IA 2ZS6B 3FYEB 3CRRA 4AQYB 4GX5A 4LHSA 1N33B 2M6YA 5EJ3A 5FZ3A 2VJXA 2GSYA 3RNSA 2JIJA 1RUI1 3W59A 1F35A 3CYOA 3SPGA 1SHWB 1HQNA 1DFQA 3FX7A 4M01A 2IXJA 1W2BU 1OBNA 3ILRA 4IE5A 4UW4A 2WWUA 1QQP2 1IS6A 5FZGA 2JB8A 2Y0IA 5BY1A 3IDCB 1E5SA 2KQXA 3NV3A 1GR3A 3HKDB 4CEYB 1UPSA 3APBA 5FZMA 5EHDA 3M3QA 1HXS2 3ILNA 2IFRA 1XNRB 1K92A 1A6CA 3ABZA 1UYPA 1VB2A 2F4VB 2ARXA 4XBLA 1XQNA 3LNMB 4YVSA 2BOCC 4O4JB 5F5QA 3K3WA 2AGSA 2HJDA 1SBEA 2ZMKA 4O4LA 5FUNA 1GTOA 4GH4A 4D3WA 2JJ2G 1AILA 3MGUA 3K79A 4AHWA 4W4ZA 2WFF1 4N21A 4Q4V1 2RNBA 1UD1A 1REFA 4LNUB 3ABKC 4BW9A 5IVYA 1BZWA 4CCLA 3VKLA 2A3XA 3POBA 2LFSA 2PUSA 4QDQA 1TNFA 1UXXX 1IURA 2BVBA 2CK3G 2X6CA 1UF2C 3BUCA 1W8NA 2PY5A 4GWJA 1YFXA 4NXMB 4X64O 2PYJA 4AI3A 4COUA 1KDKA 1IQDC 4OPHA 1BEV1 4LFCB 1HB3A 4CRQA 2R042 4X66B 4LBOA 4XBNA 4V2WA 2OZ6A 5ACA2 1KKDA 2JDPA 3ZXFA 3VBFA 4J1WA 4I55B 4JI0O 3NV1A 3C7HA 3RG0A 2JDKA 4ICGA 5FPVA 2C0ZA 2H0VA 4NAOA 1RUJ2 1WLWA 1HN0A 1SLIA 1XPWA 1KGYA 2OZJA 4HSLA 4NPMA 5HXVA 1SZXA 1TGOA 2IC1A 4XC9A 4BXFA 1ZX3A 2XASA 4DV7O 3BCWA 2YBPA 4LNVA 3ZFFA 1W2AX 4IEQA 5CU1A 2DW4A 1GU3A 4RQEA 4XJZA 2BZDA 1LR1A 4AHCA 1YJKA 1RUG2 1REDA 3HVDA 4QWNA 2HVKC 5FZDA 1HWYA 1UW8A 2XVLA 1XBLA 2WAAA 3RVHA 2N7GA 1BHBA 5CN0A 2RM22 4WBNB 2A70A 5IWFA 1J59A 3MLLA 1S55A 3KS7A 3WVJA 3AK2A 5A70A 2WLIB 1W6NA 1Q6UA 4A5UB 3D82A 4Y5SA 3WDUA 1UY2A 4Q4W3 3J8F2 4LH6A 4B4QA 4PJ0Z 5FZKA 1K33A 2XJTA 4TV9B 1ZZCA 4IV3C 1UWWA 4KU7A 4NB5A 1CPYA 4BXSV 4F3JA 1RUI3 1FS0G 1AROP 4XTPA 5FREA 2QFEA 5LATA 2WBKA 1OOPB 2Q1ZB 3OGVA 4FLXA 3AFGA 1STMA 3E83A 3ZRWA 2LW7A 2PI4A 5B1AB 1RUF2 1FT9A 5JDBA 4GKKB 1VRH1 5EBLC 5FPBA 3KCYA 4I50B 2GUZB 4UFZA 4BMEA 5FYIA 4Q2FA 1A78A 2UU9B 3VHRA 5IFTA 3B00A 1R1ZA 3IAQA 4TZDA 1AL23 1GANA 5LYJA 4NXNB 3WW1A 3DPRA 1XXNA 5FOJB 4OCTA 4Q0SA 1HNWB 1BCCH 3POEA 1NI8A 2R041 5BMVA 2XOKG 1URFA 1JUHA 3BOPA 5B2GB 1VLNA 4ISRA 4RD7A 1MS9A 3VDDB 2PHUA 1Y74A 2QDNA 1O91A 1LUVA 5D8AB 2FDFA 3IAYA 3ZBHA 1UQXA 4AEJA 2WFF3 4Q4V3 2D5FA 3O0VA 3L70H 4AGRA 5HCBA 2JG9A 5DABA 3VQXA 4X1KA 1HKDA 4K20A 3VOUA 2C1FA 3KZ4C 4L87A 1S4CA 2WO7A 1K73W 4J10A 1POV0 1RUG1 1UXZA 1D5AA 4JYBA 2WAMA 3HNYM 4UUJC 2NN8A 1NCQA 3POWA 2FYUH 4B29A 3DGTA 1NQTA 1UYZA 1M57B 3QH6A 1A8DA 3AZXA 1JOPA 3EYPA 1N3OA 4C1XA 4LBJA 4LA2A 5BPXA 3W7UA 4A44A 1BLZA 5L3CA 5GLWA 1V70A 3AM2A 4P2ZA 4ZKTB 1YJLA 5LHIA 2BDRA 5L9RA 4JGYB 1JZ7A 1PP9H 2R072 5JI9A 4RQPA 3X2QC 2YC0A 4XXPA 4PDWA 5JZGA 3J8F1 1V9U2 1L0NH 3T1HO 4Z1VA 3ENRA 3CCQV 5DDJ1 1GN2A 3VBUA 5E89A 1O4ZA 3S3WA 1NCRA 3O5SA 2PFWA 4U3JB 1CJDA 2WO1A 3UESA 4Q4X2 1JX9A 5T5JA 2UY8A 4BWOA 1HRI2 4HLTA 1HDJA 2WLJA 2A7AA 4YW4A 1VQPV 4GKYA 1KP3A 1N33O 2P6JA 5JJNB 1V6IA 1VPHA 1EV11 3TOJA 4M00A 1Y9QA 4LWSA 1SACA 4FFBB 4BISA 1NT0A 1W9TA 4GWIA 5A2QN 3SCFA 3SGIA 3U0ZA 3KB5A 2GC2A 2P4VA 4B3MB 2X29A 5CFDB 1SEFA 1IBMB 3OGSA 4ORFA 3OG2A 4DR5O 1LODA 2XG3A 4R4ZA 3GVMA 1SQPH 3H8XA 4K1YA 3WG1A 2F4LA 4CDXB 2BGPA 3E8FA 2WS93 3THTA 2JEMA 5FYSA 3WG7B 3JALA 2GU9A 1CVNA 1QJZA 3T09A 1SQQH 4QM9A 2Z4FA 4R9AA 5CISA 3SH4A 2V72A 4LMFA 2UUAB 3VBRA 3TNPB 4AG4A 2XHBA 1OHFA 5LW9A 4AFCA 1RUNA 2HEWF 3ZXAC 3A21A 2UXCB 5M0TA 4C0BA 5GLZA 4JV5B 1O3SA 4YGCA 3SJBC 4LQRA 2ZA9A 1NE6A 3SYAA 1E79G 1C1FA 2QQKA 4IDZA 4B1MA 3VL8A 1Y4WA 4YW1A 1K3IA 2I2SA 2DCYA 2E7QA 5FL7G 2B9ZA 2WT1A 4G28B 1X8MA 3AZVA 1ND3B 4Q4Y1 4XZPA 4EFBA 4KFMA 3NKTA 2JENA 1AXKA 2RHPA 2RMKB 4FLZA 3LD8A 4Q0UA 2LW8A 1DYKA 4BMBA 1ENRA 5GZDA 4QU2A 4DR2O 1V00A 3J7HA 5JCOC 4HBNA 1MEC1 2XJSA 4KUMA 2EINC 4NROA 1FXZA 2A75A 3WW4A 1JMUB 4XUTA 3ZMOA 3SPHA 4W4KA 5FMDA 2YICA 4XF9A 2XAQA 4KWJA 1ZVFA 3ROUA 4CEYA 3ON7A 2NM1A 4I4TB 1BHAA 4LOSA 2VMGA 2Q9LA 3WINE 1K4CC 5TSWA 1OFNA 2WRAA 1DF4A 1HDKA 1QXPA 3ZFEA 1YI7A 4P9YA 4YY3O 4YRDA 3FL7A 4PJYA 4UCVA 4AEDA 4IGPA 2WLKA 1DCSA 1FOD2 3CO2A 3NNFA 1I5PA 2XLGA 3BODA 5EIBD 1SQBH 5F6LB 5HXMA 3GALA 4JX0A 3WSOA 4CH4A 4C91A 4H7LA 4X1YA 1UY1A 2Z5UA 1QNMA 1W3XA 4Q0QA 3JASA 2D40A 4KHPB 4QDSA 2HWD2 2WNVC 1Z2GA 4XHBA 4DR7B 2VCAA 3PN1A 1YJNV 1NLRA 1NA1C 2E6VA 2DVAA 1LOBA 4WFGA 1VRBA 2WZPP 2O1QA 4AQTA 3K04A 1EV13 2IVIB 2KM2A 1RUE1 2OKXA 4JHZA 3K59A 3TGUH 4Z8BA 2WDBA 5FYTA 3I3DA 3KMHA 2ZE8A 4SLIA 3WNXA 4CXXA 4ATEA 4I55A 1R64A 4X62O 1MACA 5KC5A 4P5YA 1OLMA 3URFA 2DWEC 1NR1A 2YHJA 4IE6A 4LO8A 2DYRB 3JSNA 3PVEA 3M99B 2W1QA 1CIWA 1JMKC 3H3ZA 1RMU1 3W20A 3CQOA 2J7MA 1PPJH 4LOTA 2ZIOA 2X5IC 5EP9A 2EIMC 4CC6A 4X6QB 3KVAA 3T0BA 1KDMA 2QM4A 1BT8A 1ZSPA 4Q6GA 3THOA 3ZHSA 2GN7A 2F43G 2XB6C 1CAUA 4Q5OA 2UYBA 5KLVH 5A7NA 3ZSMA 4I7ZB 3E6CC 1B35C 5HPOA 1QNWA 1OCOB 4O4HB 4JI2B 2GMPA 2E5LO 1I9RA 4IIJB 3CJHB 1K5MC 5A1FA 4LFAB 3M3OA 1AZDA 2DTYA 4GX1A 3BVOA 1P4RA 3UT5B 4WVMA 1QF3A 5J2UA 1DLCA 3LOIA 2IU0A 4W65A 3SR2C 2BBVA 1K5JA 3B8NA 1R3LC 4CPBA 3RZLA 5FMOL 2XHNA 1LJ7A 3HT2A 2HHHO 2WLIA 3RZJA 4X1IB 4ZU4A 4KP4A 4Q4Y3 2H0BA 3MICA 3J80N 2LGQA 2ZE7A 5B5EZ 3N7MA 4HN1A 5I8TA 1HN1A 5DUXA 3I7DA 3ITQA 4RQFA 1ODNA 1MEC3 2X5IA 3POIA 2ATKC 4Z07A 3APQA 1YFUA 5CKMA 2RR12 2XMLA 1DTOA 3LE0A 1WD3A 4BIFA 1U5ZA 1RUC2 3Q8EA 3KCCA 2PHXA 1G9AA 2IXCA 4QPGC 1PZ8A 3BFRA 1GRJA 3AZYA 1VBE2 2OCCB 5EZWA 2JD9A 2RS31 4EWEA 1LHUA 2NYYA 3A4UA 3UV9A 2GUZA 3MFAA 1TAEA 2YUAA 5JSRA 5FAXA 2XHKA 5A7WB 1DGWX 4YFZA 1AR91 4UOJA 2CSGA 2ZQMA 2AHYA 3FFQA 1AJOA 4DEQA 4DRXB 3LSUA 1K42A 3CXHF 4K8ZA 3AB0A 4FFGA 3B7MA 4ES8A 1WN7A 3NMBA 3W58A 1OUXA 4WFBV 3KG2A 2HEYF 3BIEA 1BGYH 1V54C 3ABMB 5FPUA 5F7UA 5LA2A 3TXQA 3ZSJA 5F5AA 2QM7A 2DYSB 5DG1A 2ZX0A 3RWKX 5CB4B 5LBEA 1W28A 5IYZB 5KXEA 3ZX6A 4ASMB 1Y3TA 1UFIA 4L99A 2Q8VA 4B3MO 4FTSA 2CTVA 4QB2A 3AKQA 3ZMNA 5KX5A 2YIBD 2FDHA 4DR3B 4Y1YA 3RZZA 3JSLA 2WIIB 1S0IA 3I55V 4QPWA 1AHSA 1RIRA 2XGXA 2AENA 4JDOA 5J96B 4QPGA 3LOBA 1RUE3 2PYLA 1RP3B 5FZOB 5DQ0A 1ND2A 3VZLA 1UPIA 2ZXWC 5E16A 1KUQA 3OUIA 3AZWA 4JF3A 4EKWA 1YNAA 1T6BX 2H6BA 2WYFA 4Y1VA 1WCSA 4JGYA 2EILC 2D3SA 3ZPOA 1PNFA 2VY0A 1RMU3 1PL0A 1OD3A 1Y4MA 4ZZ8A 1REEA 4CS2A 4TUYB 4OI4A 5IY5C 1W03A 3RYHB 1CX4A 4BR6A 3U4SA 2OW4A 2WN2A 3ALQA 5C9AC 4I9WA 2XL9A 1UOJA 2KXLA 3RFRA 1HLCA 1O8PA 2HR3A 2Y6KA 3OGJA 1FJGB 5DMYA 2UUCO 5FP8A 2PI5A 3S3XA 3L9JT 4YJ3B 2RR11 2J1SA 3HD8B 4NJ4A 2WA4A 1L0LH 3MIBA 2H94A 2YROA 3WHTA 5C93A 4CCKA 3AG2C 2V4AA 1ZZ8A 1O5UA 5FXZA 1BQPA 1FNZA 3NSTA 3PTYA 3DSQA 3BN6A 1AYM1 4MVQA 4PIXA 1POV1 5H9QA 1XOUA 4XUNA 3N2KB 3ZYHA 3MIDA 5LBFA 2BCCH 5C8WA 3BTAA 1KEXA 4WZFA 5FLXN 3CC4V 4YZ4A 1EN5A 3P32A 2W87A 3IAPA 4ARYA 1PVXA 2QDRA 4RR3B 3ZXJA 4NO4A 4QT6A 5I0DA 3H7YA 2PHRA 1LU2A 2P3JA 4HANA 2E33A 1Q8PA 3E5XA 3VL9A 2VMDA 3SPCA 5C3OA 1S5LZ 2CWSA 3EHKA 1MS3A 3ZFGB 4XFCA 2OUJA 3WP5A 3K06A 2AEYA 3PUAA 4XMIA 3OOXA 1AVMA 1M56B 5FYBA 1W0OA 3CBNA 4M0NA 3POSA 1V55B 1SERA 1CAVA 4BZ4A 2KSDA 2Q69A 3AG3B 2YXSA 1AR93 5FP4A 1NYWA 4DO2A 2QQJA 5A6YA 2QWOB 3NAPB 4I0XA 3W5MA 1OCZB 5C4WC 4GJYA 5JSPA 1J5EB 3VBHB 1OZ0A 4KNCA 4Z92B 3JUUA 5FZ0A 1N1YA 4FZ1A 1D4M2 1GWMA 3WX5A 3VBSA 4LO5B 1QKQA 4AQ2A 4Q8KA 3I3BA 3SJCC 3FHIB 4YZ5A 2BTVC 4I30A 2A79B 3B09A 2C5DA 5B3SC 1AR61 1QDOA 4CDQC 4P9PA 4CDUB 1THZA 2WQ4A 4XAAA 1CD3G 3CS5A 4B1LA 3LCPA 3H1MA 1Z5VA 3B69A 1JODA 2VVFA 2WZR2 3IPVB 4NHKA 5EJZB 5FUPA 4MVRA 2DE0X 4E4ZA 1VQLV 2AACA 4DRVA 1G86A 5LA0A 1OCCB 5IJ0A 4X8AA 2ZGQA 1WLTA 2V5DA 5C3QA 2OTJV 1D0GA 1OD5A 5DZGA 2VW2A 1OLRA 2IBZH 2FCTA 3SJQC 4NHLA 1ULCA 3OPWA 2ZABA 4QHZA 1BS3A 1S76D 1MS8A 1LU1A 5KUKA 1PGW1 4DY3A 4BHPA 4XDLA 2Q73A 4E8DA 1FMD2 1QJU1 4E4HA 4DXRA 3RZMA 1A34A 4HOOA 3TN91 1Y66A 1ASJ3 3ZOIA 4FOYA 2ZE5A 5T55A 4CVUA 3JD72 3C90A 3WW2A 1IKQA 2R9IA 1W9YA 2Q4PA 4FPPA 1OQ1A 4K40A 3OAAG 5EK0A 1WMDA 2VVDA 1RM1B 3VBOA 5K0UC 4TXWA 3AG1C 2GC0A 1GP6A 1BKZA 2X10A 5DAQA 5J36A 3NQHA 3ZKUA 3VKOA 4CDQA 3I4IA 3PU3A 2GN3A 2HWB1 4AVCA 4MTOA 2F66C 3B94A 2EA7A 3QO7A 5EZYB 3C7OA 1PKXA 2IH1C 4NUBA 2VTXA 1HNXB 2DU0A 2MEV2 3TEZA 5FNVA 3CX5F 4GKJO 4FFFA 1KBHA 1QJX2 1JOJA 4Q20A 2JE9A 2VH9A 1AR1B 2RCVA 2KA3A 1AYM3 1POV3 3OYWB 3WDYA 1KJLA 2VMHA 4MXWA 4IW3A 5FZHA 4CCDA 3M3IA 3NJZA 2ID4A 2D2CB 4UXNA 1BMFG 1PGL2 2ZDIC 2UUBO 5A3OA 1D4M1 2JS5A 4IGGA 5FZ7A 1N1SA 3RZGA 5I91A 3FKSG 1JU4A 1Q56A 2Y48A 4Y1UA 4DV0B 1X82A 3ZIAG 1SESA 3OUSA 3IJ4A 4IV1C 1MQTC 4NRPA 2RQ6A 4FOQA 1FXVA 5LHHA 4MVTA 1PVC2 3TNQA 4N43A 5JLVA 1AR73 4GYCB 1AR5A 2BFUS 4IIJA 5F9TA 2LJ2A 1UY0A 2VTXJ 2W3JA 1OA4A 3P5BA 2WZR1 3UT5A 3CE2A 1F23A 5B1BC 5HCFA 3VQWA 3OY8B 4JZ2A 3OEAA 3AK3A 3DECA 2FB5A 5LP6B 5AG2A 5BXZA 3O1RA 2OUHA 2AZ0A 2IJHA 4P9XA 2QA4V 1WW5A 4LITA 4QGNA 1OUSA 3K3NA 4Y26A 1NR7A 3ZHVA 3G80A 2MK3A 4DV3O 3LDEA 1H2SB 3EFFK 4ASUG 3MLJA 3Q8FA 4MADA 5JMCA 1OCRB 1FMD1 4FPKA 1KS4A 5A32B 3USSA 3ZYFA 5L7OA 2DOSA 2ODMA 2HP8A 2CGPA 4N7UA 2O8OA 2AZ2A 4KWKA 2ZEWA 1TME2 3FE5A 3VZMA 1H2LA 3T0AA 5IVBA 1IX9A 1VMFA 4CCJA 3G6BA 1W2NA 4AFAA 1GZTA 4GA9A 4Z1MG 5IK4A 4LUKA 3JARA 4UFLA 4RS5A 3DC5A 4WZCA 1F4MA 1WA8B 2JG8B 2EBOA 1VQ7V 1W2UA 2W1SA 4QIWF 4H0LB 4MGIE 5BXXA 3T08A 1JYIA 1W39A 5LMNB 4LF5O 1UMZA 3CRAA 3KT4A 2VQFO 2DCZA 3UETA 4XZUG 4DZGA 3P30A 5DUVA 5IAVA 2K0GA 4NVPA 2IJKA 4DRXA 5DXDA 3AP7A 1EN4A 1XE0A 1H9WA 2FMDA 4WM8C 4WCEV 1ZZ9A 1SZBA 2W94A 4DW0A 4UCUA 1YSCA 4AYUA 2ZAAA 2SBAA 3RRDA 4QE9A 2O8QA 3IT8A 3TN93 3SDLA 1WCQA 1Y7BA 3JAKA 4ZIBA 1NZCA 2Q7EA 4CCNA 1UIJA 2JIGA 4QPIB 1DLBA 5FXVA 3PNAA 1GWKA 2VE1A 3ASOC 1PGL1 2ET1A 1H8TB 1QR8A 4FOVA 1HR0B 2BOIA 2J1EA 4XACA 5KMGB 3GWKC 2H6CA 5C6CA 5CKQA 3E22A 2HWB3 3ABLB 2EIEA 2E32A 2VMFA 1E57A 1S2KA 3GXUA 4BM8A 2G9GA 3JCUZ 5C8CA 1MZ6A 4W8JA 2RMU1 2X7RB 4LKSA 4F6RA 1OKOA 3ABTA 5FZOA 1S5HC 2B39A 1HNZB 2AC1A 3L2HA 3PUHA 1VQOV 1UNBA 1G9BA 4LE3A 1WCUA 4QX2A 1MS4A 5JR7B 2Y69C 2IVJA 1XNBA 4XFGA 5F2WA 5FMCA 2DWDC 4MTGA 3EJKA 4BOWA 4JI5O 5IWAO 3KF3A 3CRQA 5FPZA 4AVSA 1R083 1NAEA 1NKGA 1WMEA 4NKGB 4YARA 4AHXA 3KZIZ 2NMOA 3LA3A 3VZOA 3MW4A 4DR1O 4DXZA 5LEKA 5BR8B 4OVEA 3M3EA 5D2AA 3W7TA 1RTVA 1VAVA 5J7MA 4XQ4A 1SQGA 5L3FA 3PMSA 4ITCA 1PO12 4AFDA 4LBQD 5KXBA 3NNJA 3UYJA 4NTXA 4OHYA 1EN6A 1AX2A 1K9MW 3K5LA 1XRUA 2IZWA 4JAUA 2WLPA 1WAZA 1C8M2 3A0KA 4LBLA 4FM1A 2VQEO 4AI1A 4WFEA 3I3EA 1LKNA 2EF6A 3LDRA 3PIGA 1R1A1 2QZ2A 1R6TA 1JZ2A 4XW3A 4P00B 4UCSA 1NZIA 3TAYA 4WFFA 2Y6JA 5KAIZ 2WR9A 2LM3A 2EIGA 4XFAA 2RM23 1O9HA 1E5IA 1J3QA 1L1FA 4JI8B 3V0AB 3ZKYA 2YU1A 2B1GA 4B7KA 4FK5C 4K1ZA 4JI3B 3LNNA 3B02A 1K3EA 2Q68A 3N9MA 2C2AA 2D97A 2D6MA 3ATGA 4EYUA 3HNMA 4K7JA 5FYVA 2VNGA 3CSXA 1PMJX 3E5UA 3B3QE 2JGUA 3PHMA 1Q90D 3NAPA 3HOBA 5EJ1B 5KAFZ 4RO2A 4FM0A 3U4XA 1BSMA 1VBB1 4N23A 5CVRA 3MAQA 4NAMA 3E6DA 3U14A 1VBD2 3GM8A 4KXRA 3A8TA 5FPAA 2VQTA 1LULA 4BQXA 1ULPA 2EXIA 2ZCWA 3VDBA 2EIBA 1VJ2A 1BQZA 5I8SA 4IEVA 4LBNA 3AP4A 3PL0A 3K57A 3CJIA 2DUPA 1H1MA 3E97A 4JGZA 4AZZA 2J1TA 3HQXA 1DBNA 1OOPC 4DUYO 4CP0A 4QPKA 1ZBA2 1GFF2 4DV4O 5FY7A 5CA1B 1M4UA 2JDIG 1JOYA 2RMU3 1D7PM 1DIWA 2EJ7A 1TVGA 1R091 4XJ9A 4H7MA 4ABMA 5KHKA 3RQ0A 4Z82A 1H2MA 3WEZA 4FFKA 2I74A 1D5NA 2VC9A 3QD6A 4UBHA 3GYDA 3KHCA 1QH6A 2JVDA 4FVMA 4IUGA 2WYSA 1QWRA 2HKXA 2YEVB 1H2GA 2V1DA 5FY5A 5JH7B 2W47A 5EFUA 4CP9A 2DCJA 1OKQA 5BNPB 2QQPA 1SQ4A 2VMEA 3Q8CA 5B1NA 1DU3D 2F95B 4QGMA 3VDDC 3I2HA 1KKCA 5L36A 3HN3A 2UY9A 4KU8A 5CA3A 5D8AC 4UI9L 4MHRA 4M3CF 3K51A 1X8EA 2PTMA 2ZM6O 3ZDVA 2UXBB 1OF4A 1UY3A 2WNUA 1Y76A 2ZGLA 4MVUA 3F5TA 4OYUA 1G8WA 1BBT2 5EZYA 5A1AA 3JQWA 1V9U3 1PK6B 5GKAC 3HNBM 5FY4A 1KD1W 5JSOA 4RUEA 1IXMA 3C8XA 5FYZA 4LIUA 1X59A 4TQFA 3MYXA 4LORA 5EWSA 4MGSA 1L7QA 4LH7A 5IW0A 1Q6IA 1M57C 2PQQA 5ITZB 3QACA 4DV5B 4XDKA 4LCUC 1EAH1 2FHRA 2QCSB 5T5OA 1SG3A 2X05A 2GV9A 2JK5C 1IXBA 2HWE3 2OYQA 4D7YA 2V5YA 1KP2A 1WB7A 5EYPB 2D7FA 3GNEA 5DEDA 2KR2A 1K5SA 1GK9A 5LBBA 2UU8A 1EYBA 3NJYA 3O1PA 3H50A 2VPVA 2YSUB 4AL9A 5CA0A 1WNSA 1IBLO 2JJ1G 1ROPA 4A7YA 1MS1A 3NO8A 3WT3A 4XIKA 3W9AA 1SLBA 2BEOA 4MW8A 5FO7B 5FO9B 4NIIA 2R30A 1NKDA 1Q43A 3RYIB 1YYNA 3PIJA 3V0BB 1U96A 2RDNA 3LSEA 2R0FA 5F5CA 4OQ9A 1N4CA 1GYKA 1L8DA 3E1F1 5DN6G 2HEPA 5EC1C 2R16A 2P34A 3UJQA 4NN0A 4QX3A 5IYYA 5FYHA 4DV1B 3OD4A 1M93A 1RPOA 4UVCA 5JAXA 1N32O 4FAHA 4DV2O 3JD2A 4LEJA 2YI8A 5F3GA 3JCIA 1VBB3 2F93B 2NQYA 5FO8B 3T2TA 1DYOA 4LK7A 4FLWA 5FLIA 1UZVA 5CFDC 3CP1A 4B3TB 1FFXA 3WNPA 4BQWA 1XHZA 1TNRA 4ATFA 4I2OA 4QAWA 2YGLA 4LF7B 1U12A 1XHXA 5AC91 3TEWA 2DBIA 4QXHA 4Q0PA 2ETNA 4LFBB 3WG7C 2JEUA 1N1VA 2XONA 4U2AA 3H1KH 4NHMA 1VF7A 4X88A 2XR4A 4FPHA 3N3HA 5T50A 1IQAA 3L74H 3ETQA 1RJ7A 3E8HA 1LR5A 5GZEA 3STLC 2N05A 1R093 4JYCA 4RGAA 3PUIA 2PZSA 4K8FA 4PIZA 3NV4A 4HZ3A 4LUMA 3C7FA 4HG6B 5BNNA 4AQSA 2VZ1A 1JFFA 1GSLA 3D3IA 5CIRA 1JYNA 2ZKNA 1TMF2 4MVZA 1MSDA 3WP6A 4GB32 3MI8A 2AEZA 5A6XA 3MHSC 2QTWB 1T5EA 1DQ6A 2OIIA 2PAMA 4E27A 3GBFA 5A3NA 1ND3C 2VOVA 1XE8A 1M06G 5ABJA 5EBWC 4QPIA 4TTGA 1YUDA 4DR4O 2YC4A 2UXDB 3DYOA 3H8OA 1IVSA 4PI0A 4DYLA 3LF7A 1W99A 2RS52 4AGVA 2ZNJA 2VXJA 3WQ0A 5FPXA 4BH9A 1AR4A 2EIKB 3DN7A 1VBC1 1QJY2 5FLJA 2ZHNA 4GH4B 5DZEA 3ZDSA 3NKGA 4DRRA 1I94B 2EX3A 5FV3A 3WG4A 3ECQA 3VZKA 4JV4A 1WLEA 4WFAV 2VUDA 4GX2A 4LF8O 4JI8O 2VZPA 3KGZA 2XAGA 3I97A 4M0HA 2QJ1A 1OMIA 1JTZX 1V6OA 4C7UA 1LB2A 1GM9A 4CE8A 4J6GA 1XNAA 1OURA 2OIEA 1W8FA 4DXWA 4OZXA 5GZFA 1HIXA 2WABA 5GTHZ 2PHTA 1EAH3 5E79Z 4XF3A 5LOVB 4BJ0A 1CZSA 2CAVA 4J7ZA 4UT5A 3K46A 2WA3A 1JYXA 5LBQA 2CU5A 3OTOO 3HQUA 3LEKA 5IUQA 3LEGA 3VBFB 5FYYA 1W0KG 2B42B 4V2VA 4C1WA 2HWF1 1LOCA 4PDMA 4FVVA 1K7DA 3FC0A 1LOAA 3I2KA 1NOVA 5IVFA 3X29B 1XNKA 2NLRA 1TZOA 2TUNA 2W9XA 2IWGB 4Y22A 3MDPA 1NH2D 1CQ9A 2YFZA 1PNMA 4EQVA 4KMQA 1M90W 2JGDA 4LO6B 2J1VA 3OEBA 2B5UA 1XBFA 4FXGB 4TQDA 2ZGRA 1GZWA 3ZPYA 4EE2A 4QB6A 2WLMA 1U5YA 2BOJA 1F15A 3DXTA 1SLAA 5LGUA 5FZ9A 1UYYA 3ABKB 1DP0A 2D3OW 1UIKA 2JEXA 5JVDB 1YQ8A 4XFBA 3O7OA 3P3PA 1N36O 3OMNB 1MZEA 2K2SA 4MTXA 2KG7A 2VZSA 3O65A 3JQXA 1S0EA 4JZRA 4C90A 4H33A 1AI7A 3CCLV 1QOTA 3FLPA 4GXLA 3LB9A 2E53A 2DYRC 3RI8A 5G05L 4D69A 2AYHA 4YVWA 2ZX1A 4UV9A 5DPNA 5AC93 1DZQA 1ONAA 3H1HH 3MO4A 5LL6Y 1QVGU 3PJSK 3K9SA 3H8UA 3WQBA 3Q9OA 3U10A 4O2BA 3MEPA 4M3CB 2RG4A 1QHTA 3IFXA 1NZ6A 5CAZA 2UXXA 2XTAA 5CG9A 1KITA 3A0BZ 4JYYA 4XJ8A 2VOXA 4NTWA 2ADDA 2MHFA 4META 2IUWA 2OT7A 2A7WA 4JDNA 3AYAA 2VS0A 4IEYA 4U7OA 3BKZA 3ZRWB 3ME2A 2AHZA 4LBMA 1O9GA 3HKBB 2ZR3A 4AVTA 4DIQA 4CBCA 5GW7A 2BWCA 2W46A 1SBFA 2OTLV 3AJZA 2R1DA 3T1YB 2W39A 1PIV1 2JIZG 4K3UA 3I2OA 3UKNA 2PHDA 3DKWA 5IFPA 1WCKA 2BGOA 3RVZA 4QM8A 3K08A 5LYJB 3DPRB 3ETPA 4R8HA 2QWPB 1VMGA 3ZXGA 5BMVB 4QXBA 2FL4A 4ZU5A 1O6UA 2K9ZA 3EBRA 3T4VA 2VUAA 3KF5A 1FX5A 4IE0A 3MV01 3MUY1 2P2KA 1MVQA 3ZYGA 4LPLA 1Y74B 1GKBA 2JDZA 3F7VC 3ZMZA 4P5HA 4KQ7A 1IG3A 4OFGA 2JDMA 1ZRDA 3UGGA 5EIBC 1LOFC 4IV3B 4K6BA 3ZSKA 2QWQB 4D94A 2O57A 2OCCC 4X1KB 1NBMG 5L3EA 2HVJC 3STZC 5FY0A 1JHNA 3HJRA 1HRV1 2YEVA 1J3PA 3N7KA 4JI4O 2VG9A 1NCQB 2VUCA 4B3SO 2WWSA 2CL2A 4HMZA 4S2GA 4K0KO 1VQKV 2W08A 4I0WB 3CU7A 4Q4W2 3SCGA 4QD2A 4Y24A 4JHTA 2RDQA 4FO9A 4PDLA 2HWF3 3ABMC 1OPOA 4PLMA 4AXOA 4A42A 4MO3M 5C8YA 5HCAA 5CMUA 4HNAA 2CDYA 4TN7A 3RZKA 2ZT9B 3VGIA 4O9EA 3FX3A 5A3WA 4RQPB 1RUI2 3DL3A 5L9BA 4CCCA 1DQ5A 4PDWB 4O7XA 3GBWA 5JZGB 5JJJB 2ORXA 3KSCA 2BSKA 5E1AC 3VBUB 1WPXA 1PK6A 2R70A 4XXAA 1NCRB 1W6PA 3ZEDA 3RYCA 5CFCA 4U7NA 1XB9A 4ZOLA 4XQWA 1WWYA 2BQPA 4JI6B 1DF0A 1PZ7A 4XCBA 3CMEV 3ES4A 4XDPA 1W2OA 3ZSEA 2WLHA 3LA2A 3FLTA 1CESA 3T4ZA 1TUEB 2DWRA 2Y6LA 4L11A 4LWSB 4FFHA 4RAIA 3EQEA 2IJJA 3RVYA 1SPPA 2GMEA 1VQ8V 5D5QA 2A06H 1RITA 4BQ3A 3DTUB 4M4PA 5KWRA 2VOKA 3APOA 5CEHA 2VNRA 5IYBO 3FHQA 3CCMV 3VKMA 2WFF2 3ZYRA 4Q4V2 3RYIA 3AKSA 2HH9A 1TUBA 3RSJA 2OWOA 3D4KA 4YGDA 5FBJA 2PN5A 3L2YA 3JALB 3X2QB 1YJWV 2RJZA 4FLTA 2CV6A 1NXMA 2X0LA 3VBRB 3UKTA 4AAXA 2SLIA 5FMBA 3D8CA 1H9PA 2DCTA 2QSAA 2VRZA 4EEQA 3LSQA 4LIVA 4ZI7A 2P37A 4JCKA 1C28A 3NL1A 3GZUC 1PIV3 1BVP1 5A1LA 1AR81 3FJSA 3JAMN 1CAXA 1DQ1A 2ETEA 1Q8VA 1RUD3 5A3MA 4EV0A 5B1OA 3GZEA 4GMP0 1E1QG 4U36A 1VAMA 1U0AA 3QCWA 2GHYA 4MH0E 3ZXDA 5E88A 4YZ2A 2D93A 2VL4A 1YQCA 2FBEA 4W6YA 4RR3C 2OIGA 2DF7A 4X65O 1F51A 3LZZA 5IJ9A 2GC1A 2VBBA 4ZHNA 1KB9F 3SKJE 1LOGA 4BIOA 2ZCEA 2HEVF 3ZFGC 4PA6A 2LFRA 1C57A 4CDWA 1Y9GA 1UU6A 1M56C 4FP3A 3IB3A 1WW6A 3TETA 1MZFA 4XIOA 1HRV3 5C5UA 2LUWA 1Q6HA 4QPYA 3OD0A 4F8AA 3RGBA 2VR4A 3SHRA 1L3JA 4DUZB 3LGRA 5AFEA 3FAVA 3VBHC 3CMGA 4H14A 2W2IA 5EPAA 1AL21 3IMNA 5FZ1A 3RYFA 4H3WA 2Y6FA 1JN2P 2JE7A 3ZFEB 3ZR6A 2FDIA 1H8HG 4JRLA 3WP3A 1S2BA 2PYTA 3K75B 1ZUQA 2P6HA 5ANQA 4AEDB 3VQYA 2WS92 1O8SA 2WNEA 4UWDA 1G4YB 1HB2A 3PJQA 5LY2A 5FQ0B 5F3EA 2VCMA 1ZRCA 4DS0A 4Y20A 4CDUC 4X1YB 3QBQA 1I5XA 1LOEA 2BE3A 4YGEA 3JASB 2VULA 2HKOA 1KRIA 5H2FZ 1H8VA 3ZXLA 4AILC 3ES1A 1VRH2 3LFMA 2BPA2 1OCCC 3OGRA 1Q8SA 3ZYJB 4NMIA 1F2NA 5BNQA 4IEOA 4MVMA 2C24A 1YI9A 1X50A 5LOVA 1BCXA 1F8VA 2A6XA 5FUIA 4NIHA 3I59A 4QB1A 1GNYA 5G04L 4EZHA 1BJQA 3ELNA 2OPKA 3OT7A 2YIBA 2XBO1 3BTXA 3ZIWA 2ZGKA 2RDCA 2Q0OC 4L92A 4DY5A 3E8BA 3QO8A 4FT8A 3M7MX 4L9BA 1RC6A 4QX5A 5LMUO 1H38A 2YS8A 3I2GA 4LF6B 1RM1C 1GBGA 3J26N 3SQOA 4CEWC 2EJRA 1G6UA 3WNLA 1OVPA 2RS11 5A6QA 3PDQA 2DDUA 1CAUB 4AWDA 3HKCA 4YHHO 2J1AA 4MXVA 2CNAA 4UYBA 4FAGA 2WNVB 1YTFB 5JVDA 2JD4A 4EWAA 2AZ5A 2Z69A 1SLLA 1S2EA 1PM4A 4WVMB 5J2UB 1W6MA 5DG2A 2R72A 2XJQA 4CU6A 4UFHA 1AR83 3ZS8C 5GLUA 2Y0OA 2HJFC 4QQ2A 3M70A 2A1XA 2PELA 4WM7C 3ZN5A 4HFSA 1N8RW 5LCWL 4NRQA 2HWC1 3FLRA 3R6SA 1MMMA 1MSWD 5DAXA 2NPIA 2N04A 5DDJ2 2FDGA 3QO5A 1SFYA 4YG3A 1XNQO 4M3CA 2ZX2A 2WS91 3IKWA 4ZPIA 2VMIA 1W0PA 1PZ9A 1PX3A 1DGLA 4B8EA 5JPNB 2X5IB 2EIMB 1U5XA 2CY6A 5A6ZA 3OBZA 2VAUA 2CGNA 4IEWA 2NR5A 4CEWA 5J1XA 2WKKA 2A6VA 1EV12 3HKBA 3M7AA 4Q1PA 3K9AA 2YZ4A 2YXHA 4UCOA 4DR6O 5LP6C 4A6OA 2ILMA 5CYYA 1BVVA 1VIBA 4QU1A 1X9TA 1FXKC 1B35B 1KFUL 4IE4A 2XAJA 4YIPA 5ERLA 2GNDA 1RUH1 4I02A 1YXWA 3AXDA 3OMAB 4RA0A 3IM0A 4INDA 4OULA 1XEQA 1OCRC 3BA8A 4HPKA 4ZXEA 3NWKA 4X20B 5C5TA 4FPGA 4JKKA 1ZREA 3D3AA 1Z7S1 4DV6B 3UO3A 3ZHRA 3AK1A 4LBEC 4PA3A 1I1EA 1WA6X 3HKEA 1KQRA 4PA9A 3OBRA 4QX1A 2UWCA 5FWJA 1BZKA 1ST8A 2QQMA 3HBZA 1NTKH 4IV3A 1W04A 5KXCA 5CBFA 3WNNA 2R6QA 4Q1RA 1POQA 5FOBB 5KX5B 2JG8C 3ZHQA 3GWOA 3CHXA 5A33A 5LGNA 4DUWA 1AXYA 2AUYA 5F6KA 4NWWA 5APAA 4R52A 2CUGA 4QPGB 3T2PA 4PLNA 4JQRA 3OUFA 1JXNA 3W5NA 1ND2B 3AYEA 1AYN3 4Q4Y2 4LF9B 2GP3A 1FXKA 4FLUA 2EXKA 5L3DA 3ZN4A 2VWKA 1R6KA 2XBO3 4YFWA 4OX9B 3KV9A 2YU2A 1IBKO 1XMQB 1Q81W 3AG7A 1GP4A 4RFRB 3NW4A 4FXKB 4LHLA 3VBBA 4XTMA 3C3TA 3IN9A 3M8LA 4AQ6A 2LRPA 4HVRA 2Y6GA 5J2TA 2EZOA 2Q8OA 1WKYA 1MEC2 4B3RO 2E31A 1SDDB 3WF2A 1H8TC 4CA9A 2P7TC 4QHOA 3T1CA 4FTBA 2ZACA 2GC3A 4ZS3A 1EPZA 4CU7A 3KKYA 4QNHB 2PHFA 1VF6C 2RS13 3NR7A 4AHZA 3ABLC 1XMOB 1Z0HA 3K4AA 2CHHA 1DYPA 1UOGA 1EZJA 1N34B 2A6YA 4RHV3 1SFPA 4CZZA 2Q8EA 3IIAA 4AQYO 4HONA 4UF0A 1JYVA 5A3PA 2HJIA 1LUWA 2UURA 2XVKA 1P7BA 4HVQA 4DNYA 2VM9A 5GLVA 2PLV1 5GTIZ 3LWCA 1ZZ7A 3R4DB 3WF4A 5BZBA 4UW6A 1PNGA 3AG4B 5EQUA 2HWC3 2ZXWB 3HR0A 5JCTA 1QGLA 1MNGA 5LASA 3IMMA 3AP9A 4OI2A 1UY4A 1QLNA 4U3FH 4JI1B 2NLJC 4DUZO 2EVXA 2YXYA 3EXUA 2ZINA 3ZM8A 3K4ZA 1XNRO 4FBFA 1SZTA 3QNEA 1VP6A 1W0JG 3WD5A 2WT0A 5FZFA 4QXCA 3CCVV 1FD9A 2F4VO 2VZOA 1Y67A 5LBCA 4XILA 3L9DA 2ZGOA 1XC6A 2EIJC 2ZGPA 3AMPA 5CBHA 3JZVA 1JVMA 3TEXA 3OM3B 3ACIA 4E2GA 1BHGA 1RUE2 5CA6A 2A6ZA 1DGSA 3QLQA 1ZLZA 1BMV1 1RFYA 5T5PA 2VTFA 2X6AA 2IU3A 4FOWA 4EFEA 1CAVB 3OUJA 1RUH3 1GNZA 5A7SA 4I0XB 4EN0A 5F1RA 3ST7A 2BVVA 3CJXA 3TK1A 1RMU2 1KS5A 2JX9A 1W8OA 1DK1A 1LHNA 1KMIZ 1AF9A 1W9FA 1Z7S3 2XWJB 5LK5A 4NXMO 4J9ZB 1G8MA 3VBSB 4WFHA 5FK7A 3D36C 3POFA 2V7QG 2Z79A 2TBVA 3W7XA 4LFCO 3V64A 4X66O 1UX6A 3OMIB 3SPIA 4E8CA 1SCSA 1QLEC 3IDAA 4R4XA 4UFKA 1EY2A 4YJ2A 1QOOA 1PX4A 1G7YA 2ZMLA 4LTAA 2LTNA 2QVSB 1UZZA 5I0UA 4X8PA 5K4LA 4K9SA 5J98B 1QXJA 4AI8A 2EXHA 3AYDA 3H1WA 4O4IB 5IJ0B 4YM3A 2BERA 3KV6A 1HP8A 1JHJA 4XBQA 4OQ8A 4GWNA 4X8NA 2Y60A 3K5NA 3R4UA 3OE7G 3A0NA 4P9IA 5FBZA 2DTWA 4Y5Z0 1WP8A 1LAJA 3N2GA 2QEXV 4COZA 2X6BA 4YG0A 3GCWA 4C8DA 5C4WB 1NTMH 5FQ0A 2OT5A 1UZ0A 5F2SA 1ORQC 1S77D 3IBMA 2C9AA 4LKDA 2W92A 2RVAA 3MD0A 3CCSV 4OI0A 1UKRA 2M7WA 3T30A 5F3CA 1H6YA 2XJRA 1NQDA 5T3NA 2ERFA 3LPGA 3NV2A 2DJVA 4A7ZA 4LJHA 3FD9A 4RWUA 5L73A 3ZO0B 3U78A 3LSSA 3VBOB 4IEZA 1NY71 1ZZ6A 1A8MA 2RS32 5JCOA 3AKPA 4HYOA 2PXJA 1C5HA 4GULA 4CDQB 1CXZB 1QY4A 1W2TA 1GOHA 4X64B 1W6QB 3FB8C 3ZVXA 1RVF1 1AR92 2L35A 1F5FA 2YV8A 4LHKA 4J1XA 2VECA 1NLQA 2OVUA 3MF6A 3RT3C 5IVCA 5FNVB 4JI0B 4HL0A 2PLV3 4FFIA 1DDLA 4K8XA 4N9HA 5KR7A 1FNYA 4ZHQB 2ORZA 5BNPC 2A3WA 5GM0A 3AMQA 2DN9A 1VE0A 3NXSA 3EHBB 4CU8A 4MS2A 1BQ0A 2R1BA 4GKKO 4MXWB 4COYA 4R9CA 4DV7B 4BQ1A 5DAVA 5JPMB 2JDAA 2BW8A 3MFCA 2UU9O 2QUOA 3MHHC 2D3PA 3OW2U 3E86A 4CZSA 3D0JA 4NXNO 3JBG1 1O3RA 4MYEA 3WY6A 1HNWO 5H6RA 1AI6A 1XL4A 4J9YB 4FP2A 1V6KA 1G9CA 5JI7A 3G7DA 4WVWA 4N43B 4BPZA 2WNVA 4CCEA 2ZD9A 2W0FC 4DV6O 4L2NA 1L7RA 3LIHA 3KM5A 3DEMA 3VD4A 1FV2A 5LEJA 1MZ5A 1NA1A 5BNOC 1VQ6V 4KH9A 1W9WA 3GBGA 4N9IA 4QQLA 2A73B 4KBZA 3WDVA 1GAXA 4XHXA 4GKXA 4OGQB 4AVAA 1VR3A 2XAHA 1ZM1A 3E2EA 3S30A 1NH2B 3CLPA 3Q4HB 4JTAB 4R8CA 2VXRA 4DW1A 1S0FA 2ZOEB 1PD3A 4LBQA 5FTTC 3BGAA 1UX7A 1SQXH 2ARHA 2O0OA 1PHMA 4OHVA 2IFWA 1LHWA 2LQTA 5L7OB 2XQRA 1WLCA 3JD3A 2LP7A 4NTYA 1UU4A 2BTQB 2LW1A 2NN4A 4BQ4A 4CUAA 3CF6E 4OX9O 1H2NA 2E7TA 3NNMA 4JAVA 3JB8A 2CAZC 4QMAA 2VCBA 4TLGA 3HWJA 2WUHA 3CXCU 1AP6A 2GBOA 3JARB 3WNKA 4RS5B 4URAA 1MQTB 5L9VA 3AMNA 1W8WA 4SBVA 1B35A 3RMXA 1GUIA 3S6PA 5JXJA 5F5IA 1IGOA 2VZTA 2VOTA 4PIYA 4D7TA 4EB6B 4QPJA 1K5MA 5IT6A 1XNCA 3J7AU 3U1XA 1HJGA 1AYM2 2WLLA 3OGIB 1GQHA 2W68A 2YUEA 4S2FA 4FPCA 2XWBB 5GJ6A 5B1BB 1KECA 4A41A 2XNDG 4N53C 3USUB 4CH3A 4HETA 5GONA 4UB6Z 5GZCA 3SEPA 3H9AA 4X20A 2IJIA 3E5QA 4A4AA 5FK8A 3JAKB 1DQ2A 2IXHA 1M9NA 1ULFA 4BU2A 3MZHA 1JU3A 1H4GA 4R9BA 2ATFA 2Y64A 4K3AA 4GMP3 1OV9A 5KXDA 3OEEG 5HFMA 4L8JA 1LHOA 3CEWA 1W8UA 2ZAHA 5A7OA 1WBFA 2OX0A 2W1WA 2YXLA 1IBMO 1WW7A 2ZJCA 3E22B 3FMGA 3MIEA 5EYYA 1NU1H 2PAKA 4RUFA 3FBMA 3JATA 1RVF3 3V56A 3INAA 5JVVA 3E89A 5C8CB 2ZGTA 3BYWA 1HX6A 4F6RB 1GMMA 3HBKA 1SA0A 2F4PA 1Q8OA 2WLQA 4JRAA 1LEDA 3FZ3A 4FPJA 2UUAO 3BHPA 3LEIA 1PO23 5C3SA 4L0PA 4IYHA 1MVEA 3SNMA 4WM8B 3T1HB 1AR62 1ASJ1 2UXCO 2Q4SA 4YVSC 2HBUA 3M2MA 2R061 5JIUA 3WLUA 4JV5O 1I5YA 1NJIW 4FZ0A 5FZ4A 5FY1A 1OF3A 3JBG3 3G6JB 4GH4C 4E4SA 1UMHA 2I07B 2VQ0A 3ASOB 3S57A 2FCVA 4Q0VA 2OQ7A 3QH7A 2E3CA 1VALA 4F6EA 3WQ7A 4IL7A 5DN2A 3D3QA 5FR3A 4UCRA 1YFWA 2WAOA 2ZTNA 1YQ2A 4IGQA 5KA6A 3AJYA 2V4DA 1U97A 1SDWA 4BQYA 1PGW2 4PDRA 2RE9A 2AR6A 4XUPA 1QJU2 2QQIA 3J7LA 1W8TA 3NRUA 2ZIMA 4DR5B 2Q30A 4UW5A 1CAWB 4AVBA 3TN92 1UCXA 3DXRB 4B4RA 1C3HA 2WINB 3O0XA 2UYAA 1H6XA 3VBFC 4MGTA 1LCLA 4YPJA 1G9DA 2VOWA 5FPLA 1VBA1 3HR9A 4GD4A 5GALA 2Y69B 4XYXA 5LHGA 2DCKA 4MHUA 2CTWA 4ZZ5A 2Z0AA 3EO6A 2WFPA 5SV5A 1FPN1 2HWB2 3O1VA 3ZFFC 4LLFA 4XJUA 5IVVA 4FQ4A 2D6OX 4QKBA 2DYCA 5C9AA 1UL9A 1AR71 3HN1A 5A80A 2BWAA 1G1XB 3KV5A 2XXZA 3O1UA 1J83A 2VO5A 4C0HA 1ZRFA 5FZBA 2FMLA 4JQTA 4KHPO 1M1KW 2OXBA 1W9SA 1Q86W 2W6IG 4FPYA 3W7WA 1YDXA 4DR7O 3OPZA 3ASNB 1H1AA 2KKWA 3O14A 1U5IA 1R082 3WQ1A 1WW4A 1N47A 3F7YC 4AK3A 3GDBA 5KHIA 4DR2B 1RHI3 3QVNA 1TE1B 4XJAA 4CTEA 3OEHG 2Q1FA 1ZBE1 1VP7A 1WUVA 2BJSA 5GLTA 1AXZA 3U37A 1LGCA 1MABG 2CDOA 2WO2A 1TG7A 1IG0A 3CJIB 1EBOA 3SYCA 2WLNA 4A45A 4JGZB 3CB2A 1US2A 2G1MA 5C3RA 1QIQA 1DF5A 2YFUA 4O4IA 2PQSA 3UKMA 3ZR5A 4UXAA 1RSOA 2MNGA 3FWEA 4YY3B 2YIAA 4BK5A 5I93A 2G19A 3KGLA 2VGDA 3T1LA 1R1BA 2B9UA 3GGLA 2A9HA 1QQP1 4BE3A 3MF9A 4JI2O 5C4WA 1LTEA 4FCAA 1JCHA 3DPRC 5F32A 4CP9B 2GNBA 1D2DA 4LFAO 2NZ9A 2XLFA 1COV3 2R063 1Y6XA 4E9KA 3CIHA 1HXS1 1S0DA 3JD1A 2L6LA 1OH3A 3SLIA 3O1OA 3C3SA 2Z42A 2JDNA 2DFBA 3DYPA 2UWBA 4WVVA 1EM1A 2ZNIA 4O2AA 1V9PA 3MUZ1 1US3A 2QR4A 3SISA 2P5OA 1WBLA 1A3KA 1JQ0A 2QE7G 1OHHG 2FZ2A 2ITDC 4QKDA 2JG9C 1W6QA 1W8ZA 2WNUB 1Y76B 2W5FA 3CMAV 4Q26A 1G6NA 1QH7A 1VQMV 1K8AW 4GQ7A 4E2SA 4X62B 3POGA 1VARA 1NCQC 4ZHQA 1GZCA 4P9WA 3SC7X 2Q7HA 1GN6A 3LA7A 2PHWA 3CCUV 1C1LA 1JYCA 1V6JA 1AX1A 3I54A 4KWUA 3CD6V 3H1JH 1W6OA 2P90A 3A0RA 1ULOA 1VBA3 2PMWB 1R081 3TB0A 1NXD1 3MPPG 2D6KA 4OLLA 4S2HA 2VW1A 4RQPC 5CA0B 1K34A 2GAUA 1O7FA 2P3KA 1PNLA 4PDWC 5ACA1 5JZGC 1C8NA 1FPN3 1H0BA 2DMXA 2BP6A 1YEWA 4UFMA 2V4VA 4ZU7A 1S0CA 3BTZA 4AFBA 4URTA 1SC5B 2E5LB 4QXKA 4WBBA 1ZWIC 1WJZA 3VBUC 1RUJ1 2RMU2 1GNHA 1ZYBA 1NCRC 1O4YA 5K0UA 3N9LA 4CCOA 2K46A 2WJSA 3TJTA 4A7KA 1IPKA 2QTOA 1A32A 4I01A 2HHHB 4GIQA 5FYMA 2JRIA 1RYYA 1I7FA 4MT8A 5FP9A 3CKHA 4BWAA 2PGGA 1UAIA 4DR3O 3Q4HA 4PV1B 4G9SB 4DFSA 4I5SA 1BEV3 4JVAA 4M3CE 4EN9B 4MSWC 3M4FA 2B4KA 4OUSA 3OFNG 3ML0A 1FFXB 4DK1A 3MIFA 4H55A 2N74A 4XF1A 2RM21 3AKTA 3BPZA 5C3PA 3H8RA 3PU8A 1JW6A 1ZBE3 2ZEZA 2BTQA 1NS1A 2BNMA 4AF9A 3PLQA 3R66A 4QGPA 2ZDIA 3WF1A 2TEPA 3ZMVA 4PA4A 3I2IA 4UVBA 3WF0A 1LESA 2QKCA 1IS5A 1RXFA 3I2FA 1LNSA 1PGSA 4ZONA 2ZEYA 4G2KA 3M3CA 1IDSA 4YM0A 2MW2B 2VUJA 3V65A 4FJCC 4IV1A 1VQ9V 1MQTA 4JTCB 1AL0G 3VBRC 1KQSU 3VDAA 5D5PA 1OT5A 2JDYA 4EB6A 1V6MA 4H13B 2B7YA 3ZYBA 4DEVA 5L3BA 5JR2A 1R1A2 1SLCA 5BNNB 5FMOS 3WF3A 3ZIXA 2ZX3A 1FJGO 3USUA 1JFFB 3ZX7A 1QQP3 5IT9N 3JAWA 1KU9A 2HWE2 4OZOA 5EYXA 4MZUA 3T3YA 1RUF1 4QX0A 3DGEA 1MA1A 4I09A 1K45A 4BK4A 1VQNV 1EZVH 3OTFA 4Z2WA 3ZMSA 1ZAUA 5CADA 2YI9A 5ABJB 4KL1A 1HXS3 4KGGA 2H8PC 2D6NA 3A7QA 1PNKA 4MVSA 2P22C 5FLHA 4MUVA 3KT1A 2ZR2A 3AK0A 4TWTA 5LA9A 2X09A 1DGWA 4AHYA 4PLOA 3SH5A 3L72H 3GJAA 3SH3A 5K1XA 4W6WA 4TV8A 5LRSA 3OR7C 1S1AA 2XDVA 4J11A 3IIIA 4XF4A 1XJAA 5A3UA 4QX8A 2B8MA 4IQPA 2VZRA 4UB8Z 3W7SA 4CEYC 1VBB2 1RL3A 2Q1MA 1VIWB 2BTOA 4N90A 1COWG 4KBBA 1VRH3 4TOIA 5CG8A 2FTKA 3UL2A 4AOCA 1LHVA 3ZFEC 1US6A 3UM7A 1YLLA 1YZBA 4WM8A 2ZX4A 4UVAA 2QDOA 1OVSA 4MGZE 1XOYA 4AEDC 4PQQA 5B66Z 1DZTA 2Y0PA 2VZVA 5I0TA 3K03A 2WO3A 2R043 3MW3A 5DUWA 2UXNA 3AZZA 5ACA3 4PQ9A 1J5EO 2UUCB 3RWRD 2CAUA 5K8SA 5J48A 2EICA 5TISZ 2ZHLA 2D3RA 4WV8A 4J7KA 3SMHA 4XDJA 1WGPA 1RUJ3 1ZZBA 3K48A 4Y22B 3WU2Z 1QR9A 2OQ6A 5IHRA 2R071 3BABA 1R092 2LS6A 3K5MA 3HIFA 1SCRA 2XAFA 2EIDA 2EAAA 5FPRA 4B3NA 1V9U1 4COVA 2JGDB 1GZWB 3WB0A 4O65A 5L19A 3CRMA 1BXHA 1SQVH 4BLJA 2DU1A 4Q4X1 1I0HA 1RUG3 4YLZA 1CAWA 1AJKA 4H44B 3HKDA 2JB4A 4RSUA 1HRI1 3DXRA 3E35A 1YIPA 2OS2A 5F3IA 2QWNB 1YXBA 2HYKA 2KG7B 1OSGA 3G4SV 2HWE1 1JJOA 1RXGA 1OJHA 1GQGA 5FZ6A 4O4JA 1ZRIA 1JYWA 4YVWB 4CUCA 1DGRN 4X6RB 1DLLA 2CDPA 5H9RA 4XOGA 3T1MA 3O1TA 4FI9A 4O2BB 2IXIA 3ZN1A 1SF9A 4UCTA 3J8F3 2WNOA 2J22A 5KHGA 3MV11 1AI5A 3NJXA 3VB9A 5DDJ3 2P5BA 3N7JA 4LBKA 4LNUA 5JXGA 2HLDG 4EJRA 5KHJA 2Y34A 1UZWA 1BK0A 2WN3A 4CH5A 2AREA 1EAH2 3VHOA 4CP1A 3B4SA 2BFUL 5FCCA 3BAAA 3THPA 3Q8AA 3N7LA 3FHAA 3DV8A 1FATA 4TSVA 4BDVB 1DGRA 3IC7A 5FFOC 1RUF3 1IS3A 5FJHA 4OHZA 3A23A 3CZUA 2GTAA 4EZ4A 3VDCA 4D6QA 4DUXA 3FUOA 1QNYA 1CZTA 1HNXO 4DQAA 1KYOF 3POJA 3MIHA 1JZ3A 4YZ3A 4AW7A 2EAKA 4PCRA 1CP9A 4ONUA 1X33A 1HJFA 2GALA 2VQAA 3F2ZA 5DM6V 1V6NA 2GH2A 5EV7A 1NE4A 2VWJA 2E9QA 4B08A 4JKMA 5FZLA 3UKVA 1X36A 1VEWA 3H3UA 4BQ2A 4XFFA 4BYYA 2WZEA 3WV6A 4B4PA 5HBAA 4QKNA 2Q5ZA 1F4HA 5KBFA 1B6QA 3TRSB 1EUUA 2RV9A 4JTDB 4EN8B 5B1AC 2YPDA 2E75B 1LGBA 1X4TA 3I5DA 2WWWA 1VMJA 1WP7A 4DV0O 3SYOA 2ZZQA 2XPJA 3K2OA 1RJ8A 1FAYA 1GM7A 2PHLA 1CX1A 2CYFA 3ZHTA 1VF5B 4WBNA 4ASLA 3BRCA 4BA6A 1T6GC 3FB6C 1BYHA 2W95A 3CZJA 5AC92 2QKDA 5FYUA 3LDBA 2CTQA 4HVOA 1N0JA 2W1UA 2XL7A 1LEMA 4I0AA 1NTZH 3RJRA 3VUOA 2K1EA 1Q8QA 1GV9A 4K35A 3G6EV 1H1IA 1CWPA 3GCXA 5C8YB 4HNAB 4CXYA 4OUMA 4TV9A 1FOD1 2XT9A 1AJNA 1IHMA 4QHBA 2ZZJA 5J3UA 2G9ZA 2VW0A 3LUTB 2R073 2YGMA 4GKJB 4LC1A 3GHMA 5H9CA 1GQPA 2BSKB 3VN4A 4CU9A 1OOPA 4ET7A 1O5LA 5AFBA 1ACCA 3U11A 1W6PB 5IJRA 3RS6A 3RYCB 2DFCA 5KHHA 5CFCB 2DUQA 4ZOLB 3ACHA 3AX4A 1GO3F 2HWD1 4A3XA 5T52A 4Q4X3 5FXXA 1CPNA 1OLME 1HRI3 4IXLA 1ND2C 2RDRA 4LO7A 1QU7A 1ZA7A 5DAWA 3CCRV 4I50A 2ZEXA 5FRAA 3SPJA 4CP2A 5JOYA 1V6LA 1SBDA 2UUBB 4PHZA 4DPNA 3RZHA 3I2DA 1SPPB 5LMNO 4R9DA 4JGYC 3VLBB 3PVBB 1YF2A 5B4NA 4GT1A 1JJ2U 1YC61 1VBC2 2H3OA 3VDDA 4OXSA 1AI4A 2BYVE 2ARAA 1LGNA 2P17A 2Y6HA 1PV0A 2QM8A 1TUBB 5D8AA 2ARBA 2VCCA 1GWLA 5JMOA 4FPEA 1QQCA 1UJWB 1GH6A 1TVKB 5IK7A 3VD3A 4XEZA 3ABUA 3MHZA 3WCSA 2QWRB 1HR0O 5DECA 4GZ9A 4DV3B 2XKOA 1MOFA 4PI2A 4P30A 4ZI7B 2YDEA 1AB3A 2EALA 1N3PA 1K97A 3BEHA 3LPFA 4NWVA 3AG4C 4PF1A 4NHXA 4ZBMA 1CAXB 2HWF2 4XAEA 4FLYA 3VHPA 4ARXA 2Q0AA 5BYNA 3UQ8A 1HNZO 2GNTA 4IEXA 4CDXC 5FZIA 3LQCA 3AL6A 4OUEA 3ACLA 2DQ3A 1CZVA 2W91A 1OA2A 3RMYA 2OPWA 4NRMA 3PUQA 1HV1A 1E1RG 1R73A 4PDVA 2A0LA 5IJ9B 2XQXA 4LF5B 3I8TA 1H4HA 4OMDA 2E63A 3WDXA 2VQFB 4IE7A 2E74B 2CGOA 3WP4A 2FKXA 1FYJA 4U3JA 4NIDA 2ZGSA 4CDWB 1C4RA 4D6TH 1WCDJ 2WL1A 5BR8O 5JJEB 4Y1XA 1PM7A 3VZNA 1VMHA 4HAMA 1IS4A 4DB5A 1RUC1 5H5NA 4XFHA 3RW0A 3AVRA 2J1RA 4HT1T 1VBE1 2VBPA 4FFBA 5F37A 3FAVB 2O14A 1AP5A 4RGGA 2P3YA 3RYFB 3ZLIA 5LXTB 2R9AA 2G9FA 5HV4A 2YMZA 4LLOA 1NVPD 4EN7B 5CFDA 3VBSC 5LWBA 1XNTA 3J9SA 1S0JA 3VKFC 1FI2A 1P7GA 1D4VB 4CDXA 4UV8A 4JGSA 2R0HA 2WSVA 1FOD3 1MS5A 3K0GA 1RGSA 4Y20B 2ZHKA 2F23A 4CH6A 2MPFA 1J84A 5A3LA 4DXTA 1J1TA 2PAEA 3WZ1A 5DUUA 3CCEV 1DHKB 1KXGA 5D1IA 1F5JA 3UT0A 1K12A 3WB1A 3SYPA 2HBTA 2CH7B 5LA6B 3QF7A 1BE3H 2XLAA 1GKFA 4NPRA 4LK6A 1E5RA 1JYTA 3J81N 2G4IA 2BRTA 2HWD3 2ZE6A 2F1MA 1HW5A 1PIV2 4JI3O 4YSFA 3O9OA 2RS33 5KUMA 1RUD2 5BY5A 4JI5B 5IWAB 2QE3A 1WMXA 3DXUA 4HN0A 3I59B 3I2JA 4Y5TA 3WNOA 4DR1B 1ODMA 3WW3A 3ZRVA 4QX7A 4XURA 1ND3A 2D6PA 5FY9A 1D2SA 4LT5A 1WMFA 1YQ6A 1ZX5A 2BV4A 1HV0A 3L75H 2ZHMA 4PT6A 1SQFA 3T4HB 3VBOC 4EWDA 3TEYA 3VKNA 3A2FA 1XREA 3K5OA 4PBPA 5IYDO 1JH5A 3C7GA 4XJWA 1UZYA 3LKJA 1HRV2 3HKCB 1P49A 1XDCA 1OI6A 4JDMA 2P6CA 1IPJA 4AAPA 2VQEB 3F5WC 2FZ1A 1ENXA 2DUOA 5J09A 4BB3A 3TCUA 1WD4A 4YIOA 2ZPXA 3THCA 5H6QA 3K58A 2JDUA 5FP3A 4I4TA 2JWPA 1K4DC 1RB8G 1W6MB 3DKQA 5CBLA 3KT7A 1QU0A 4YW7A 4OPAA 5FY8A 5A7PA 5IK8A 1QJFA 2GH8A 2J42A 5FP7A 1YVWA 4NHYA 1FYUA 1YJ9V 1Y9MA 3DUIA 2XJPA 3POYA 4X9QA 4LE4A 5LK7B 2Y4TA 4XABA 4QE7A 3I49A 3SITA 1OA3A 3U75A 1B09A 1B06A 3ACFA 4A2UA 2QKSA 4N43C 4F4LA 3MIGA 1OCOC 3Q8BA 5T5LA 1CR7A 2V09A 3SJAC 4H2AA 5JWPA 4CEWB 4CC5A 2RR13 4DUVA 1RUC3 2UXBO 2FD8A 1O4TA 4AGGA 4ZKIA 4COWA 4CCMA 3IDEA 3VD9A 4X89A 1VBE3 2W52A 2E7AA 3TXSA 2P06A 3O0WA 1LECA 1RUD1 1F9KA 4YWAA 4NIGA 2JECA 4FIPC 2C26A 3MW2A 5IDJA 3BY6A 5ISLA 5FIXA 1N3QA 4E4EA 1XUQA 1IPSA 4W6XA 4HPKB 3I3QA 3AP6A 1EFRG 1KD7A 4DV5O 5L7OC 4WM7B 4DUYB 3N9OA 1JOBA 4DV4B 1YRZA 2ADPA 5LGTA 3WCRA 3HKEB 5HI0A 1CEZA 4RFT0 3CDZB 4OHWA 4UFIA 1F4NA 3I3MA 3ETGA 2R32A 4QQHA 5F2VO 4ES9A 2B1IA 4FPFA 1DQ4A 2GSMB 4RS5C 1KFXL 1MG1A 2F6BA 4GZRB 4GUNA 1H8EG 4O4HA 1FXHA 5A33B 1QHDA 3CJHA 3LFIA 2VD7A 1ZTEA 3ZRSA 1AR82 1YFYA 1OQEA 1S0GA 4EROA 2B9VA 5CKNA 3QOPA 3K4DA 1XILA 1JZ6A 1FXKB 2XJVA 4YG6A 5L3GA 4TT3G 4X1IA 4DV1O 4PBOA 4WF9V 3P6BA 2QQOA 2YPJA 1UU5A 3PVOA 3DF0A 2YYOA 4MV2A 3DYMA 2L9LA 1XYNA 3WOGA 2ZM6B 2DYSC 1I08A 2YBSA 3VV1A 3GB7C 2QQVA 4BCUA 5J2TB 2XUEA 3OBTA 3OGGA 3OUHA 3RYKA 4P9LA 4AEKA 1S72V 4AFMA 4KWLA 2A3QA 5C71A 3AXEA 5FDBA 3PJYA 1QOSA 1GOGA 1YI2V 4B3TO 3HEIA 4AE2A 4NOTA 3ZJZA 1AR63 3AL5A 3JD71 3HMYA 2E76B 4LF7O 1N0NA 3SKVA 1FFTB 4MG2A 3LDKA 4XUQA 1LOFA 5C8CC 1GZ9A 2E51A 4LFBO 4N7IA 1XSQA 4XFIA 4JASA 4OHXA 4UF0B 2CWMA 4JI7B 3T2OA 1AL22 1SLTA 2QQNA 4KI5M 5A7WA 1UOFA 4MSVA 3J7MA 4IETA 4BIUA 4FPOB 5FJKA 1JA8A 4CUBA 5FYCA 5EC2C 1IBLB 1URXA 2MEV1 1VQ5V 3P3NA 4XDOA 1QJX1 4G4FA 2X8KA 1QJU3 2DVBA 1QDCA 2XKPA 3THDA 4CYDA 2IH3C 2JXAA 4TWKA 2WT2A 1Q82W 1GN3A 2JICA 3BU7A 3HT1A 3SCHA 4B7EA 1WLDA 2Y33A 3C3VA 3BTYA 5CB4A 3LIGA 5IYZA 1TVKA 4DMIA 2UXDO 3H9VA 1SRYA 3OJBA 1I3HA 3UK9A 2AXTZ 1N32B 4LXLA 4DV2B 4UBGA
chains in the Genus database with same CATH topology
1RJ7A 1D2QA 3SNMA 4WM8B 1LR5A 1AUYA 4E4DX 5GZEA 1AR62 1ASJ1 2X29A 5CFDB 2GNMA 2Q4SA 4YVSC 1SEFA 1R093 3M2MA 2R061 5JIUA 3WLUA 4ORFA 4RGAA 1M4WA 1LODA 2XG3A 4R4ZA 4K8FA 1PVC1 1AYN2 3NVCA 4TYSA 4K1YA 4PIZA 3NV4A 4LUMA 4YNIA 3WG1A 4CDXB 5BNNA 2WS93 3JBG3 3THTA 2XBO2 4AQSA 2A3YA 3G6JB 4GH4C 4E4SA 1GSLA 2JEMA 1OIJA 4M2GA 4KG8A 5CIRA 3BALA 2ZKNA 1TMF2 3WHUA 3WP6A 2I07B 4GB32 2VQ0A 2WC2A 4Q0VA 3MI8A 2GU9A 5KEUA 1CVNA 3QH7A 1QJZA 1VALA 3GHNA 3WQ7A 4QM9A 1ZNPA 4IL7A 1DQ6A 2OIIA 2PAMA 4R9AA 2OA2A 4E27A 3GBFA 2B46X 2ZGNA 1ND3C 2VOVA 3SH4A 1XE8A 1GVGA 1YFWA 1M06G 5ABJA 3CL1A 4P9JA 4QPIA 1YUDA 2ZTNA 3VBRA 3TNPB 4AG4A 2ZKLA 3AJYA 4BGMA 1OHFA 1SDWA 1IKPA 1OTJA 1PGW2 4AFCA 1RUNA 2RS52 2RS12 2HEWF 2RE9A 4AGVA 2W0XA 3WQ0A 1D4M3 3ZXAC 2AR6A 1QJU2 5FPXA 2WBQA 5CB7A 4BH9A 3KLSA 4AI2A 4C0BA 5GLZA 1O3SA 4D7SA 1GLHA 4YGCA 2VVEA 2Q30A 1VBC1 2AH2A 3DN7A 4UW5A 1CAWB 1QJY2 4RHV2 4XE9A 1AVBA 2ZHNA 5FLJA 4AVBA 4EN6B 4GH4B 5DZEA 2ZA9A 1NE6A 2QJVA 3TN92 3ZDSA 3NKGA 1UCXA 4DRRA 1C1FA 4B4RA 3WG4A 3R0RA 3VL8A 3ECQA 2OYZA 1C3HA 3RYRA 4HK8A 2WINB 3O0XA 2UYAA 3B9CA 2I2SA 4YW1A 4JV4A 2DCYA 2E7QA 3VZKA 3VBFC 3ZN6B 4BHIA 2WT1A 1LCLA 3O12A 1G9DA 1X8MA 2A5ZA 1TME1 2VOWA 1ND3B 2DURA 3AZVA 4Q4Y1 1VBA1 1Q5OA 2BNOA 3HR9A 3KGZA 4XZPA 5GALA 3ZSLA 3GZTB 3NKTA 4M0HA 4GALA 4XYXA 1OMIA 2JENA 2DCKA 1AXKA 2RHPA 2XJUA 1JTZX 1V6OA 3NAPC 2WZR3 3EO6A 2WFPA 1LB2A 4J6GA 5SV5A 5GZFA 4OZXA 1HIXA 4Q0UA 1DYKA 1FPN1 2HWB2 4BMBA 1ENRA 4HKLA 2PHTA 5GZDA 2HWC2 1EAH3 4QU2A 3ZFFC 4XF3A 1V00A 2CAVA 4LLFA 4XJUA 4HBNA 1MEC1 2XJSA 4FQ4A 2D6OX 2DYCA 5C9AA 1UL9A 1AR71 2WA3A 1OFSA 3HN1A 5JIAA 5HSXA 3TBDA 1FXZA 2A75A 2BWAA 3WW4A 3H1YA 5IUQA 4C0HA 1ZRFA 3VBFB 3ZMOA 2B42B 4C1WA 4FPLA 2DVFA 1OLQA 2HWF1 4XF9A 1FMD3 4YM1A 1UKGA 4KWJA 1LOCA 4YW3A 1ZVFA 4FVVA 3ROUA 4CEYA 3FC0A 1LOAA 1NOVA 3X29B 1TQ5A 3CJIC 1J58A 4FPYA 2D98A 4KG0A 2NM1A 1XNKA 1C5IA 2NLRA 3ZXEA 3OPZA 4RR3A 2TUNA 4JGZC 1OIKA 5I0RA 3R1JA 1NG0A 2VMGA 2IWGB 3WINE 3JD73 1H1AA 4Y22A 5TSWA 3MDPA 1OFNA 2UWAA 3U07A 4NE0A 1CQ9A 5LRRA 1HDKA 1QXPA 3ZFEA 3O14A 1YI7A 4I3PA 4M26A 1U5IA 1R082 4P9YA 1WW4A 4YRDA 3WQ1A 1N47A 4AK3A 3ZFGA 5E1RA 2FQPA 4PJYA 4LO6B 1NLSA 4AEDA 5KHIA 4FXGB 2ZGRA 1GZWA 1FOD2 3CO2A 4OI1A 3ZPYA 1RHI3 1CONA 2XLGA 3BODA 1RUH2 5F6LB 1U5YA 1TE1B 4XJAA 1YO8A 3GALA 4CTEA 4M2EA 1SLAA 1ZBE1 1WUVA 5GLTA 3D5OA 1AXZA 1LGCA 1UIKA