4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
3P3PA 3OD4A 2WA3A 5JWPA 2Y0IA 3P3NA 1IZ3A 4JAAA 2ILMA 3D8CA 4NR1A 1H2KA 1YCIA 1MZEA 1H2NA 2YDEA 4BIOA 1H2MA 4AI8A 4Z2WA 2YC0A 4Z1VA 2CGNA 2CGOA 2XUMA 4B7KA 4QU2A 3KCYA 1MZFA 3KCXA 2W0XA 4B7EA 2WA4A 1H2LA
chains in the Genus database with same CATH superfamily
2R49A 4COUA 2BNNA 2BTVC 3SPJA 3MIGA 3UESA 1QLEC 3BVOA 2XUEA 4L0PA 3Q9OA 2GSMB 3FUOA 1RUE3 3RZLA 1VRH1 5I8YA 2WT0A 2XAHA 3AKRA 4A6OA 1N0JA 5IT6A 4KU7A 4R9DA 3UJQA 1VF5B 4CDWC 1KKCA 1D0GA 1Q81W 3HKCA 1IS4A 1P7BA 1P49A 4CDXC 2AACA 1AYM1 2B9UA 4QU1A 1YWKA 2BVVA 4JDNA 1A78A 4ABMA 1W6OB 1UIJA 3JBG3 1X4TA 1COV3 3A2FA 3AYDA 2JGDB 5FRAA 3FB5C 5EK0A 2CTPA 1ENVA 4I5SA 2BOCC 1Y9GA 3V0AA 4XF1A 3NR7A 1S2BA 2OIEA 2HEYF 3CMEV 2ARXA 4X20A 5JVVA 1JMKC 5FZGA 1UU5A 3LEIA 1ZLZA 1QBZA 5FLXN 2VZRA 1OUXA 5FMBA 1NY71 1URXA 2QM8A 4FFBA 2ADDA 1RHI1 2J1EA 2WC2A 3O1UA 1REFA 1IQDC 4DW0A 3MIDA 4ZHNA 5C8YB 1UZYA 2Q1ZB 3W58A 4AEDC 1ZRIA 4A7YA 1G6NA 4JI2O 3ZYPA 2JICA 2FZ2A 3CCEV 2VQTA 3ZHQA 2GP3A 3HOBA 1C1FA 1EAH1 3AM2A 3A23A 2OTLV 1SC5B 5L9BA 4QKDA 5AC93 2XOMA 1F31A 1GKFA 4XF3A 2PYJA 2YPJA 1U0AA 1VLNA 4LFBO 4CSWA 4MLOA 4DR5O 1GQHA 1HKDA 2WIIB 3N9PA 2WFF3 4PLNA 3JASA 1MVEA 2JJ1G 1UOJA 1LR5A 1PIV3 2ZEYA 1D2SA 4XBLA 2VMIA 3NJVA 4M3CF 2MK3A 4YVWA 4D0QA 1AI6A 4KG8A 4COYA 4B4QA 5FZMA 1IPSA 1ZRDA 3SEPA 3T0AA 3DUIA 4GJZA 2CTVA 2ZJCA 3Q8BA 1XMOO 2P17A 1E1QG 1LOBA 4B3SO 1VBC3 5T50A 3WDUA 4CDQC 1IS6A 2XXZA 2BCCH 4EWDA 4JYCA 1JR9A 1FS0G 4WVMB 1AR72 1UCXA 3OYWB 4YW7A 3TBDA 4R8CA 3CDZB 4FSJA 5F8PA 3I2HA 2VQFO 2VQEO 3D8CA 3ZRXA 3LEGA 4YW5A 1BL8A 1Z7S2 3LIHA 2DVGA 4EN9B 1J5EB 3THCA 5T5OA 4BQXA 4W8JA 3KF3A 5JAXA 3WFVA 2RR11 5FXZA 3RPQA 1GWKA 1C3HA 3PU8A 2F17A 3O14A 4P9YA 1L8DA 5IDJA 2A6ZA 4NVPA 3WB0A 5C8CC 3DN7A 1VF6A 5LBBA 3CB2A 1UKGA 5HXVA 4PT6A 1BGYH 4GWJA 4UUJC 4YJ3A 3E5QA 4RAIA 3PUQA 1WCDJ 4JAVA 3B40A 2CGOA 5EC1C 2WL1A 5EJ3A 4CCJA 2Z4FA 3H8RA 3RZGA 5FOJB 2OQ7A 1UZVA 3LOBA 4DR1O 1QJX3 4GX5A 4OXSA 1OC1A 4FFIA 2C9KA 3EVKA 2Q7EA 2JEUA 1YQ2A 3I3MA 2Q8CA 2DWRA 4YIOA 3RFRA 2EINB 1S4CA 2R6QA 1IDSA 1S77D 3FB8C 5DN2A 1TME1 1F15A 1AILA 2JKXA 5IYBO 5C4WC 1V6LA 3O0VA 3H1HH 2E26A 3H7JA 5C5UA 4O4LA 1IPJA 4QPYA 1H9PA 3UM7A 1GSLA 5ITZB 1EY2A 5JSRA 1W2OA 4DR6O 2Y6GA 1IS5A 1OLQA 1RVF3 2FDGA 2BOJA 2LO1A 2Z3YA 5L36A 5H9SA 5FZKA 3H1LH 4NIIA 4Q0SA 4QM9A 3IC9A 5LBQA 4CP9A 1L7LA 3C90A 4ZZ8A 1VB2A 2ZKLA 3P1IA 4CPBA 4I50B 4QAWA 1AXYA 2A3QA 5HFLA 2CSGA 4RGKA 4XQ4A 1GOGA 2H8PC 4UCVA 3BU7A 1Q6IA 4PI0A 2Y6FA 4DV4B 1AXZA 1JCHA 4YHHO 4D7TA 2IJKA 1W8ZA 2PI5A 5FPXA 5LEJA 1YYNA 1ZUQA 5FPAA 3ZXEA 2IC1A 1N1VA 4BU2A 1S0EA 4JKMA 3CYOA 3K5NA 3E8HA 2XVGA 2JDAA 4XDLA 4C1WA 2QQNA 5KAIZ 3VZLA 3AVSA 2PFWA 2DFCA 1YHFA 4JASA 4U7NA 2KM2A 2YFUA 4TWTA 1EN5A 3NNLA 4LIUA 5FY5A 3I97A 4A44A 3K0DA 1HRI3 5FMOS 2D6OX 3PTYA 2F23A 4ISRA 3FYEB 2ZACA 3MI8A 2NP0A 1NCRB 4GXLA 3W9AA 1VBD3 1V9U3 1ST8A 1NCQC 5DZFA 2WNOA 3W7WA 3GXUA 3UT0A 4DV1B 2HWB3 3H8XA 4PF5A 3BA8A 5L7OB 4CCOA 4X1IB 2AR6A 3H0OA 2LP7A 4CP1A 1NKDA 2NLRA 2LFRA 1QVGU 2XBO2 3WG4A 4LO8A 4JI7B 2WLJA 5IY5C 1ZBE1 5FZOB 1ZREA 3JD72 3RZHA 2UXDO 4WF9V 4D6QA 3I55V 4CCDA 3LSSA 2ITCC 4BAYA 3AP6A 1DYKA 1Y9MA 1UXZA 5E79Z 4TLFA 1SLAA 1SZBA 1F4MA 2ET1A 2BE3A 1MOFA 1C1LA 2CDOA 5C8WA 3OW2U 2K9ZA 3U4SA 3FFZA 4X6QB 5FQ0A 1XYNA 4Z92B 3UK9A 1LOAA 1D2DA 2LROA 1SS3A 2PHRA 4WBNA 2ARBA 1Q7YW 4H37A 3LEKA 1R091 2VVFA 2A06H 3CXHF 4X66B 4Q1RA 3AG1B 2ZMLA 5EWSA 4XFIA 4XOGA 3EYPA 2MEV3 3HKCB 1K4CC 2X6AA 4JCKA 2XAGA 5LBEA 1QOOA 3MHZA 4MGZE 2LW8A 1L1FA 1P4RA 3UT5A 2A6XA 1W9TA 1JH5A 3EJKA 4QDSA 4QXHA 1QJEA 2CGNA 4YVSA 4I0AA 1BKZA 1Q5OA 3MGUA 3V0AB 2YXHA 2OT5A 4ASUG 1W8UA 1JJOA 1Y76A 2MPFA 1CZTA 1ZM1A 3QO8A 4X20B 1C8M2 1W0OA 2BBAA 1G9DA 3OGGA 4Z8BA 3CKHA 2A9HA 5GJ6A 2F95B 2ID4A 4P9PA 3I59A 5JZGA 2HWF3 4FFBB 1O5UA 4RWUA 1S0BA 4CDUC 5DZEA 1BLZA 4Q4X1 4YGCA 4O2AA 3U75A 4CCLA 1UXXX 2DQ3A 1JZ4A 2X0LA 4HMZA 4BR6A 1ULDA 3B93A 2RM21 2Q0AA 3OUSA 1CD3G 2OXBA 4P5YA 2IJIA 1QCEA 2C26A 1JYTA 1M1KW 1ZWIC 5IK5A 4LF6O 1RUF3 1AR63 4X9QA 3KWVA 2R1DA 5DUUA 1XNQO 2ZZJA 3B69A 1O3RA 3JB8A 3D36C 2XL7A 4DXWA 2WYSA 5L3DA 2G9FA 3ZXAC 1EPWA 1UMHA 5DG1A 1OLRA 4DPNA 2VUCA 1RGSA 4G4FA 2W95A 2O14A 2BTQA 3OUIA 3M7MX 1K33A 4IT5A 3L75H 1X36A 2BGOA 3JASB 4QKNA 5CFCC 3IMMA 1HW7A 1DTOA 3ABKB 3NAPC 4YVWB 4MHUA 2SBAA 2IH3C 4G2KA 1SPPA 2A75A 4X64B 4GKYA 1VMJA 4OQ9A 3NV1A 3F7VC 4UVAA 2QKDA 5HCAA 1IGOA 1CPNA 5D8AC 3BTZA 2GNMA 4CU7A 5FY4A 5JXIA 5B4XA 1PV0A 1H4HA 2XLAA 1OPMA 5FZDA 1C57A 4QQLA 2WWSA 1EZJA 4LO4B 2UU9O 4HVQA 4UFZA 3WNMA 5DXDA 4INDA 2D5HA 4AAPA 1UPSA 4XDPA 5JXGA 2G9GA 1KS4A 4UI9L 1WJZA 1DK1A 4WFEA 2DVFA 2JDZA 4BLIA 4N9IA 3T2TA 2ZHLA 2VOKA 1FXVA 3IBMA 5IT9N 4A7KA 2Y60A 1RUI2 5LBCA 5T5PA 4RQEA 3AP9A 2EXIA 1S0CA 2R072 1DP0A 2DCZA 3DL3A 2WLMA 2C5DA 3E97A 3KT4A 4BIOA 1X82A 4XFFA 5LP6C 2P06A 3SDLA 1SLBA 2VMDA 2Y34A 2NMNA 4IEYA 2PHDA 2NMOA 2W0XA 1JOYA 4YJ3B 1H2LA 3PUIA 4DV5B 4TN7A 4WFAV 2JB4A 3LPGA 1MS5A 4U3JA 1D4M2 1NT0A 2VOWA 2RCVA 2ZXQA 2ENRA 1LGBA 2PAKA 4K3UA 1XSRA 4KGGA 4R6ZA 2RS13 3LNMB 3APOA 1VAKA 2IZWA 3H1WA 3V0BA 5BZBA 1WNSA 5FPOA 1KQRA 3L73H 4PI2A 3ABUA 3RI9A 4DR7O 3TK1A 2GNTA 4XIOA 2WS91 2YFZA 3S5QA 4N53C 5DN6G 4KWLA 3MLLA 4LO5B 1XMQO 1QR9A 5BXZA 1XE7A 2CWSA 2VZPA 3ZX7A 2JG8C 3WNLA 4O4LB 3K9SA 2E9QA 4K40A 3F7YC 2PZSA 1KDMA 1SCRA 1G1XB 3R05A 3Q8EA 1FMD3 3AEIA 4AQTA 1RUD2 1MZ6A 1ZRFA 4WVZA 1WUVA 1Z7S3 4GUNA 1D7PM 2IFWA 4Q8LA 2BP6A 2RJKA 4E9KA 1V6OA 1O7FA 1RUH2 3C8XA 3MFAA 2O0OA 2B42B 2YROA 5FZFA 3E2EA 3JQXA 2FMDA 3O0XA 4CP9B 3NNFA 3RJRA 3B2EE 4DK0A 1XE0A 3INAA 4DUWA 3POIA 4OQ8A 3O12A 5JCOA 4HZFA 3E8FA 5JXHA 2EIMC 2VUAA 5DUXA 2WRAA 3VD5A 4L87A 4GKJO 1NZ6A 1PZ9A 3RYHA 2CDYA 3AKSA 5A7WA 3OD4A 1QNMA 1BBT3 5T5LA 2ZT9B 4R9BA 2Q30A 1KEXA 2A6YA 2RQ6A 3APQA 4UB6Z 4LHSA 5ERLA 4K0KO 1UZ0A 3IFXA 5CB4A 5DECA 2GN7A 2Q69A 1PO23 5L73A 4GB32 4QX7A 3N27A 1HDJA 1Q56A 2XT9A 3EHBB 5AC91 4FZ0A 1IG3A 1R1A3 2VS0A 3SC7X 3AK1A 3T4HB 3ZYJB 5KUMA 5IJ0A 2YY1A 4NMIA 3C3VA 1QXJA 1OCRB 1EUTA 4DV7B 3JCUZ 1HNZB 1OXCA 1PIV1 3EB7A 3O1TA 4MXWA 4HYOA 1PGL1 4JGZA 5BNPC 5D5QA 4W6XA 3ZXLA 4HVRA 1EZVH 5IYZA 4FFGA 2P4EA 2GMEA 4QPIC 2VU9A 1AUYA 5F7UA 3ILRA 4H55A 3N35A 2KA3A 2VVEA 5JLVA 4RA0A 4WV8A 4AFAA 1PO13 1VBC1 2XASA 3J7AU 1VMHA 1I7FA 5JH7B 1JFFA 4OI0A 3HNYM 2JEMA 4XIKA 4B3RB 2ATFA 5J37A 4MV2A 5EJ1B 2G19A 2RG4A 3NV2A 3E5UA 3ACGA 2PAMA 2Y48A 2UUCB 2A6VA 2GALA 5K4LA 3ACLA 2A3YA 3DGTA 4FPCA 3OJBA 3POYA 5FQ0B 1S5LZ 3WW2A 5DZGA 4TSFG 4DV3B 3LA2A 4P00B 1JZ2A 1OI6A 4L92A 1F4HA 4WBNB 5GZFA 5IWAO 3L9DA 3BABA 1OKQA 4XACA 1UY3A 4BMEA 2XR4A 5F5CA 4YLZA 2JWPA 1RP3B 4FPOB 3OEEG 1K5MC 4YFZA 4LFCB 3IC7A 2ADEA 3ELNA 3BFRA 4YSFA 2AENA 4CS4A 3WG2A 3O1OA 4AWDA 1GMGA 2YDEA 4FT8A 5BY5A 4P9IA 2Y6KA 1PL4A 5FCCA 1H1MA 3E5XA 3UT5B 1GUIA 1OFNA 3T0BA 5L3FA 1ALYA 4JI3B 3ZXDA 2O8QA 3ST7A 2LW7A 1SDWA 4XCAA 3VBSC 1Q8VA 1OF4A 4FLYA 1SQVH 4LK6A 4Y33A 2IJJA 4YVSB 1P7GA 2HWD3 2AHYA 5KWRA 1EM1A 5K8SA 3KT1A 4BISA 4JAUA 3UQ8A 1H9WA 4F6RA 1CR7A 3BPSA 4NWWA 1Y76B 1DHKB 3CO2A 4D6RA 3P3NA 4HVOA 3HKDA 3WNKA 4RS5C 1OHHG 3DGEA 2R043 3F5TA 4D6SA 2IBZH 4GYCB 1S76D 3I59B 5JZGB 1MQTC 3FMGA 5FYIA 5J09A 2EIDA 3JD73 5KR7A 4JTDB 3UV9A 1TE1B 1VBB2 2UWCA 2W1UA 5BNOC 1RVF1 4O2AB 4A42A 4TT3G 2QQJA 3UYJA 3POEA 4TOIA 3FLTA 3N7KA 1SCSA 2YC2A 1NI8A 3TYJA 1H0BA 5CNAA 2QA4V 2NNUA 4GAZA 5KHGA 4QHOA 4JI0O 2ILMA 3DYOA 4CDWA 2XJUA 1MS0A 3E6BA 4LE3A 3OGCC 5J2TA 3ALQA 5TSWA 4CDXA 3ON7A 2BUKA 4JI8B 3BRCA 5FY8A 1Z78A 1C8NA 1W6PA 3NJXA 4CA9A 3SJAC 1L0NH 4PDWC 3RI8A 1MSWD 3BHPA 4IEXA 1KFUL 1NR7A 2AHZA 4COVA 4OX9O 3L72H 3THDA 3RYKA 2XAQA 4W65A 4BXSV 1AR82 4PIXA 5LY1A 4JKKA 1F8VA 2A79B 2HH9A 2E51A 5FK7A 1RUG2 1VE0A 2BV4A 1VQLV 1MEC2 3SQOA 4IW3A 3T09A 2AGSA 2W46A 1VB4A 1RPOA 2D6KA 4QX8A 1SPPB 4MS2A 2D3RA 1H4GA 3TCUA 3S3XA 1W6QA 3KMHA 2FKXA 5T3NA 1GN3A 1YFYA 2J1VA 1JI6A 1POQA 1N8RW 4LF4B 1VBD1 1V9U1 2RDSA 2YMZA 2EVXA 1NBMG 4CH5A 4UFKA 1COWG 2HWB1 1UW8A 2A70A 1O4ZA 4KBBA 2JS3A 3LB9A 4J25A 4UCRA 1C8M3 1CPYA 2Y38A 3CS5A 4GD4A 4PDLA 1BMV1 3WHTA 4AEDA 4HBNA 3ZHTA 4MUVA 4CH4A 2E3CA 2ZGQA 5CBHA 2V4DA 1OOPA 1I9RA 2ZINA 1OVPA 2EULA 3QH6A 5D5PA 4Q27A 5GONA 2DFBA 1WBFA 1IKQA 5LA1A 2DYSB 1DQ2A 2F4LA 1YVWA 1JX9A 1R082 1KB9F 4DFSA 4JV4A 2LQTA 4PLMA 1YI2V 5AVAA 4AG4A 4FMTA 1YJNV 3HNBM 2LRPA 3WINE 3PIGA 1LCLA 3ZN6A 3ZDSA 1WMXA 1HNWB 4IEZA 3NO8A 3LDBA 1ZVFA 1US3A 1WMFA 4D94A 4NYKA 3CMGA 5FP9A 1QIQA 2QQUA 4ZIBA 1RB8G 1DGSA 3ZXFA 4RFT0 3VD3A 5CFDC 1V6JA 2W0FC 4QHZA 3PN1A 3U37A 4NXMO 4MVOA 2WUHA 5A3NA 2ZIMA 1GQPA 2P4KA 3ZSLA 5CIRA 2MEV1 3V0BB 4ZS3A 2ZEZA 4UFJA 1M06G 2CDPA 4NAMA 1OA2A 1R3JC 3CLPA 1FJGB 4E4HA 1JZ7A 5M0TA 2W6IG 4KWUA 4UBHA 4FCAA 5J36A 3MIFA 5FLJA 3ZCCA 4XBFA 1R3IC 1ZAUA 1WCUA 4XXPA 3IJ4A 1PVXA 3BCCH 2X5IC 2N7GA 3LOIA 4EZHA 3P5BA 1VQOV 2OW4A 5FZIA 2P3IA 2LFSA 1TMF2 4AVVA 4OHYA 2F93B 5IFTA 4AFMA 4KXRA 1JOJA 3FYIB 1BK1A 4LQRA 1FPN3 2H0BA 3F2ZA 2IXIA 4JC1A 1QH6A 1N34O 3Q8FA 2HWF1 4LBQD 4DR2B 5GLWA 3KZ4C 3E22A 5B3SB 4OPHA 2KSDA 1HWYA 4WFFA 1RUI3 2CAZC 3M8AA 4RQPA 5DPNA 2ZE5A 3S30A 2AW9A 3WUCA 1NQTA 5FZHA 4JX0A 3LSDA 2HYKA 5HCBA 1BK0A 3RYHB 2BFUS 1RUF1 5A7WB 1AR61 1RUNA 2Y0PA 5IATA 3CZJA 5CB4B 4RO2A 3K3OA 4LOTA 1DF0A 1Z5VA 1HQWA 2KB1A 3WF2A 1WW4A 1Z0HA 1JHJA 3AKQA 2Q7HA 5IJ0B 4QX1A 3ZDVA 2PYTA 1TG7A 3ZYFA 4J1XA 5KXCA 4QMAA 2DUQA 5C4WA 1JYNA 2ZOEB 2DN9A 4B3MO 4P08A 4MXWB 2R062 3I2JA 4JGZB 2D6LX 2K0GA 2WWJA 3KM5A 1Y43B 5LXTA 3RG0A 2YIDA 2CK3G 5FTTC 5IYZB 1YTFB 2QZ3A 2Z5UA 2Y69B 1BQ0A 3DTUB 2TEPA 2QCSB 4AL9A 1MMMA 1IOAA 4KQ7A 4J7KA 1IXMA 4Z07A 1MVQA 3POSA 1LR1A 2UUAB 2ZE8A 3MLJA 2DURA 1JOBA 1I3HA 1JFFB 3WT3A 4DY3A 2H6BA 1H2GA 4UWDA 5I8SA 2VY0A 2WSSG 3FX7A 3IGAC 3SJQC 1YCIA 5LW9A 1NG0A 1W28A 1RUD3 1LHWA 4MVMA 2OT7A 3WEZA 1BEV2 3OPWA 2DTWA 4ZY9A 1U5XA 2ZR2A 2Q7GA 5DAPA 4X62O 5BXXA 5KXBA 1RC6A 1UZWA 4BWAA 2XWBB 1I5YA 5D21A 4NROA 3P6BA 2R9AA 4SLIA 3JCZA 3TN93 1XOUA 5A3UA 4WFBV 4QB1A 4TLGA 4AQ6A 3Q4HA 4CUCA 4UF0A 1AL22 2W92A 1OCOB 3EHKA 5FZ8A 3SPIA 4XDJA 1AYN2 2W91A 1ZL8A 2UUBO 1F7YA 5IVCA 3M7AA 2EX3A 1KYOF 1R1ZA 1F4NA 1SBDA 3STZC 2XKPA 3HBKA 5KLVH 2QJ1A 2GMPA 5LOVA 3JALA 3J7LA 4KU8A 3ZFEC 4IDZA 4DMIA 4PCRA 5FYZA 4C0HA 2G38A 2QTSA 1U5IA 4YM2A 1RINA 4KUMA 4O2BA 5CKMA 3M3CA 4JZGA 1HB4A 1CAXA 4CXXA 4F6RB 1H2SB 1WLDA 4O9EA 4H7MA 5T52A 4LHKA 4QQPA 1UYZA 5A3LA 4YJ2A 4JI5B 5AVPA 5IWFA 3N2KA 3HKDB 3ZYBA 4QM8A 1SLCA 1Y74A 2K1EA 5FP3A 1NLQA 4MGSA 2EIJC 3K5OA 4AI8A 5BMVA 3VDCA 1HJGA 4MXVA 1AR71 1MS1A 1GU3A 1ENRA 5A7PA 4IV3C 1GN4A 4HONA 4FXGB 5FZLA 1GNZA 1QLEB 2GDFA 4JAAA 3LE0A 3RNSA 1Z7S1 1UF2C 3STLC 4LF5B 3THTA 5DUVA 4H0LB 3HB3B 4TTGA 4CDWB 5J2TB 2ZABA 4QB2A 1QJZA 1FXHA 4CDXB 4OI4A 3S5AA 2Y8KA 2OCHA 1WCQA 1W6PB 4I7ZB 4CE8A 3I2IA 1I5XA 4LK7A 1OFSA 2VECA 2BSKB 3WP5A 4AXOA 3SH3A 4RYDA 3GHNA 1BBT1 4LFAO 5ACA3 5JJJB 3PUHA 1WLCA 2AEYA 4OZXA 1W9SA 4UFHA 4FPJA 1UOBA 2JE8A 1BZKA 4IL7A 4MVSA 2JDIG 4Y1ZA 2DU0A 3CRQA 3H8OA 1S0IA 1R1A1 4XJAA 5FUPA 2JGUA 4LR3A 2JD4A 4UV8A 2LGQA 5A3OA 3N9MA 3QF7A 1HJFA 1V55C 2A7WA 3JB4C 3MW2A 1W2NA 4QPWA 5DG2A 1W6QB 2OS2A 5GZCA 3B77A 2O8OA 3ME2A 3QO7A 1K5SA 5FP7A 1WLWA 1U5YA 3RYPA 4CDUA 2MW2B 2CNAA 2VOXA 2Q8OA 3SJCC 1O8PA 1VQ9V 2AH2A 3W7TA 1AZDA 4D6TH 1YIFA 4J41A 4AEDB 5EYYA 3J7MA 4IERA 1OOPB 1TVKA 3CEIA 2YV8A 3L74H 5GONB 2ZIOA 3SKVA 5B5EZ 1PD3A 2HLEA 1VBB3 4DRXA 2P1BA 2JDHA 4K8FA 3ECQA 3D36A 2Y6HA 1FFXA 1I08A 1HNXO 4FJCC 4I0WB 4DR3O 5CA3A 3ZR6A 1HW5A 4UFIA 4UW6A 2UWBA 3ZN6B 1Q82W 4MGYE 1IBKO 4O7XA 2YXYA 1OCCC 1KJRA 2ZGPA 5CFCA 1Q43A 2VTFA 1AYM3 4OHXA 3E6CC 3FN9A 1C28A 2YBKA 5FPBA 3CJIC 4Y26A 1I6XA 1KP3A 2A71A 2X29A 1GM7A 4NXNB 2VJXA 5B4NA 2VQFB 4WZCA 1N3QA 2KG7A 1PX4A 5D8AA 5I91A 3HPLC 1AR83 3K08A 4J9YB 1QY4A 4Y1UA 1KDKA 1UX6A 4BOWA 4P9XA 2FTKA 1RUG3 1MEC3 3WNNA 1LHUA 5FBZA 3ASIA 5FYHA 1W8OA 5CISA 5L19A 1OA3A 3GZEA 5IUQA 1VP6A 1R6TA 3D0SA 2CUGA 3IDCB 4P5HA 1D4VB 1GR3A 3IAQA 3ZEDA 5LMNO 3LA3A 2QGNA 2PF4E 2ZXWC 5C3PA 2Q4PA 5F3EA 4PA9A 3I2DA 1WW6A 4YY3O 4JV5O 2CH7A 2LJ2A 4IHJA 4BIUA 2VTXA 4ONUA 1SQFA 4COWA 3OUHA 1S0VA 3S57A 5F9TA 3T2MA 4P30A 1SACA 2HR3A 4M00A 5LP6A 2UXBO 1XU2A 3JD71 5CEHA 3E22B 4BA6A 2VAUA 4ZU7A 1OJHA 4LBKA 5LY2A 5K0UC 1L3JA 3RMYA 5KX5A 2W39A 2IU3A 1EAH3 1VQ8V 3VLBB 2B8MA 4RQPB 5EZWA 5KC6A 1M57B 1MA1A 3AK3A 3QNEA 3MF9A 4DXRA 3MPBA 5L9VA 3U4XA 4FPYA 5L3EA 1V6MA 4XBNA 4BZ4A 4AGVA 4AQYO 4OI1A 4DV6O 4ARYA 4AFCA 2Y0OA 3AP7A 2WNUC 3AG3C 5BNNA 3CL1A 5ANNA 2EIBA 3R65A 4N53A 5FREA 3VUOA 3ETQA 4ZKTB 4CXWA 4N7IA 1W8FA 5C4WB 1TUBA 2WQ8A 4C7UA 2CE4A 1NZCA 4E4SA 2JG8A 3QG5A 3M8LA 3HJRA 1H1AA 2AC1A 3POWA 1CX1A 5LXTB 3HEIA 3AFKA 3QTCA 3KHCA 5I93A 3IWZA 2CGPA 3WY6A 1ZRRA 3VKOA 3BTAA 1UPIA 4NUBA 4HG6B 1C8M1 2P90A 2C24A 1IX9A 3FFQA 4F4LA 4JZRA 5IVFA 1RXGA 5K9YA 1LKNA 3B8NA 4IYIA 1G86A 1JTZX 1NOVA 1LHOA 3PURA 2I07B 1GN2A 5A2QN 2ZS6B 3HQRA 3TEYA 2JIJA 5HCFA 1JUHA 1CAWA 3C7EA 3CZUA 2DWDC 1XOYA 1QLNA 1XREA 3NV4A 1FAFA 5A33A 1KECA 3WNXA 2VULA 3WP3A 1RUC2 3OD0A 3Q4HB 2PY5A 1OKOA 3OY8A 3CCUV 1LHVA 4BCUA 4UF0B 1UYPA 3D82A 1M4WA 2EF6A 2YYOA 4GWNA 1K5JA 2UWAA 1ZL8B 4W4LA 4AOCA 4NHYA 5BNPA 1O3TA 3JYCA 4UW5A 2EAAA 4QQOA 3ACIA 2LS6A 3HQUA 5FUNA 3VQWA 1U5ZA 4N7UA 1HR0B 3ITQA 1VRBA 4QPIA 3AKPA 4BHPA 3JALB 3SCFA 1O3SA 4TSVA 5HXMA 1OBNA 3NL1A 1TQ5A 2JD9A 4O2BB 4YGBA 2BU9A 2OWOA 5IY5B 5E16A 2NYYA 1PPJH 1CAXB 2ZGTA 3OR7C 2EAKA 1VP7A 4DEVA 3KT7A 2WLIA 4A41A 4P9LA 4JDOA 3THOA 1AP6A 4YJ2B 3N2KB 4Y5SA 2R1BA 5SV8A 1RUJ2 2XUMA 1Y74B 1B09A 2Y33A 4I09A 1DLBA 4GH4C 1T6BX 2Q67A 2VZUA 3I7DA 3WG7C 5BMVB 2IXLA 1JN2P 5ABJC 3MO4A 1LOFC 1FPN1 1GMMA 1GM9A 1K5MA 4GZ9A 2RJ2A 4LA3A 2FMYA 4H3WA 1WP7A 2PHTA 1XB9A 4WM7C 4LHNA 2JDNA 3ZX6A 2QQPA 2FDIA 2YGMA 1V6NA 4Q1PA 1KUQA 3OMIB 1RUI1 3FUQA 5C9AC 3M2MA 2A3XA 1J5EO 4R9AA 3JSLA 2R071 1NYWA 1SMVA 1WBLA 2VUDA 2ZD9A 2E5LO 4XF0A 1E1RG 2OQ6A 1K42A 3ABTA 1AL23 1HB1A 1SQGA 1PK6A 3VBSA 2H94A 1W8NA 3R6SA 4AVAA 1AYN3 4RUEA 3Q8AA 3IB3A 1QQP2 3B01A 5IFPA 1TNRA 4JRAA 4E27A 4ISQA 3RYCA 1GOFA 1D4M1 5EIBD 4FOYA 4NHKA 3U1XA 4Y4RA 4RS5A 1VQMV 4OHWA 2EINC 4K8XA 5CU1A 2VCBA 4QX3A 1PKXA 1MQTA 5GZGA 2XKOA 4CDUB 2GUZA 1ASJ2 5IHRA 4QX5A 3LUTB 4CXYA 2EJRA 1FKAO 4LF9B 4HK8A 2JRIA 3SLIA 4FAGA 4YXWG 2FL4A 4RHV2 3I56V 4B08A 5LMUB 3E83A 1ND3C 4XDKA 4L11A 4XXAA 5EBLC 3TGUH 1TVKB 1D0HA 3TB0A 4AK3A 3ETDA 1L0LH 1G7YA 2IM9A 4CH6A 4AR2A 2IFRA 5JUVA 1G8WA 4NPMA 3THPA 1JJ2U 4DRXB 1R093 5F2WA 4XURA 2D3PA 2F4VB 3IPVB 1JHNA 1RUD1 4PDWA 2HWE3 1FFXB 3SNMA 3KF5A 1RUH1 1JMUB 4XQWA 4O4IA 4JHZA 2R70A 3KVBA 4LBJA 1ONAA 5CFCB 4HNAA 4QB6A 5DAXA 3D3QA 2JE7A 4DR4B 1IBLB 2UU9B 4TYSA 4P9WA 3SCHA 4LKDA 5L3GA 2E53A 3MBWA 4TXWA 2ZCEA 5L3CA 3VKLA 2KG7B 1OLMA 5D8AB 1NH2B 4IEQA 1AR5A 4JI4B 3E89A 3M4FA 5BR8B 5DDJ2 4ZS2A 1VAVA 4DV4O 1Y3TA 3VHOA 1HV1A 5IVBA 1J3RA 4Y20A 5C71A 3BOPA 4CCNA 2YEVA 1W99A 4Q2FA 3HQXA 4FM1A 4CYDA 1SQPH 4XUTA 3ENRA 2J22A 2OCCC 1FAYA 5C33A 3OF1A 5CA6A 5EV7A 1QGLA 5JCTA 3LQCA 3H1JH 1UN1A 1J58A 2QQIA 1XHXA 4IHJB 3W7XA 4JPRA 5JOYA 3CJHA 1WZXA 2RM23 1D2QA 3VD4A 4DV1O 1MZ5A 1R1BA 2EICA 1PM7A 3O0WA 1HXS2 5LP6B 2L9LA 3N9OA 1K12A 4PA4A 2W1SA 1GTOA 2DMXA 4HSJA 4JF3A 4IGOA 3TEXA 5KX5B 2RV9A 4E4EA 4JI6B 1IPKA 4XEZA 2RMU2 5CFDA 2PXJA 4A5UB 2M6YA 3TNQA 1JZ3A 3U0ZA 2V4AA 3KCCA 4OHVA 2VQUA 3AG1C 2WR9A 1M4UA 3JARA 1AJNA 4AHXA 3WNOA 2ZGSA 2ZEWA 1PNKA 5D1IA 3OGRA 4ASKA 4YW2A 3EMRA 1OH3A 4ZOLA 5BNNB 4QXCA 5CG9A 1R3KC 4H44B 4N53B 3UKMA 5EP9A 1Q6UA 4X66O 4UW3A 3ZYRA 1DGRN 1ENSA 2HVJC 2X5IA 1TUBB 1S2EA 4I55A 4QKFA 2JG8B 1W8WA 5HV0A 1E5HA 4HKOA 3BODA 1DZTA 3WF4A 2YBPA 2Q5TA 3R0RA 5FZ1A 1F5JA 1UY4A 4Z2AA 3S3WA 2QQWA 5LK5A 2XAJA 1XBFA 1UU4A 3OBAA 2X7RB 4CPBD 2D44A 3ZKYA 3I54A 2VD7A 4K0KB 1DQ6A 4CU8A 5FZEA 4TV9A 5JVDA 2ZKNA 2QFEA 3OUJA 1QJY2 1YUDA 1VPHA 4O61A 3ABMB 4CZSA 4JYAB 3ZPYA 2EIMB 2CAVA 1ORQC 2EIKC 2CTWA 1RMU2 4EV0A 5DAWA 3B4SA 5CB7A 4AI9A 1H8TC 5FO8B 5F6LB 2R7EB 1VBB1 4NRPA 1WLEA 2W3JA 3KSCA 4Q4W2 1N0NA 1FNZA 1H2KA 1CAWB 1W3XA 4NWVA 1WB7A 3VZOA 1QOSA 5FMCA 2VMCA 3JUUA 3N7JA 1MNGA 5A33B 3T1YB 2D98A 3LF7A 1MS9A 1XEQA 3DXRA 2R0HA 3OY8B 1FYUA 3CC2V 3T2OA 5APAA 2RN9A 2K9PA 3FLPA 5LZ6A 3T0DA 3VBOC 4NOTA 1OZ0A 1H30A 4S2GA 5BNPB 3BTXA 1BE3H 3ZN0A 2ZHNA 3ABKC 2WS93 4J7ZA 4QPIB 3OB8A 4FOWA 4FLZA 3WQ1A 5EHDA 2QDNA 1AR81 3GWOA 4EE2A 2Y26A 3RZJA 3BOWA 3OCPA 1RUG1 1MEC1 1M56C 3V56A 5FYMA 4XJ9A 3DXUA 5FIXA 5A7SA 1RFYA 3ACHA 4IV1C 3ZLIA 3L71H 4UFLA 2WLIB 1FXZA 2UY8A 4LBMA 5FK8A 3ZN5A 2X6CA 5HBAA 2GZWA 4HXCA 3AZYA 2AZ2A 4P9OA 3SISA 3RVZA 3ZVXA 4FFHA 4BW9A 2QZ2A 4X64O 2JKBA 2ORZA 4NRQA 5ISLA 4L99A 4BDVB 1CAUB 2HKOA 5LGNA 1OCZB 3ZHVA 2OUJA 2ZMNA 5F39A 1QR8A 4K35A 1UIKA 1Q3EA 1CQ9A 3OFNG 2KQXA 3PVBB 5A6ZA 5EQUA 1K5MB 4DV0B 4YNIA 1JQ0A 2RHPA 1NR1A 4AVCA 2VZSA 1AR4A 2DJVA 1UYXA 5IJ9A 4B1LA 1R081 1ZRCA 2R72A 4TWKA 5L3BA 3AL5A 1CEZA 2RDRA 4P2ZA 4KH9A 5BYNA 1K9MW 1KXGA 4MVZA 1W8TA 3SEEA 4XAEA 3G80A 3ZFEA 4TQFA 3ABLC 2FD8A 2N74A 2P5BA 1YI9A 5FZ0A 1PK6B 3USUA 3VBSB 3J8F2 4Q4V2 4DZGA 3TAYA 1YIPA 5F6KA 4FFKA 5JIAA 3BGAA 4N90A 1S0GA 3RYCB 2P7TC 3CRCA 2DYRC 2V09A 1ZSPA 3UGGA 5B1AC 3VQYA 2FDFA 5LGUA 4RS5B 1N32B 3PVOA 5FMOL 1JBCA 3ZFFC 4Z1MG 2QQVA 2F43G 1MQTB 1X50A 4KL1A 1WW7A 3MDSA 4PBOA 2GUZB 3WQ0A 4OCTA 2P22C 2R30A 4IV3A 3AYCA 1X9PA 2ZX1A 5TISZ 3LAGA 4QE9A 2KR2A 1N36B 2VZQA 2YPDA 5A3PA 1YDXA 4FVVA 1X9TA 3PHMA 4MTFA 3AMNA 1F9KA 1LENA 4K21A 2XMLA 5FYTA 3N9NA 2BRTA 1Q8SA 1AI4A 1PNLA 2DCTA 2FQPA 5JOZA 3POGA 3RQ0A 1UOGA 2WLPA 3IIAA 3CEWA 4CS2A 4LTAA 4PDWB 4A7ZA 3SH4A 2UY9A 2WNVC 4ZU5A 1AVMA 3FJSA 3SYQA 4BPZA 1GQGA 4J11A 1NKGA 4O4IB 4F6EA 3RDIA 2UXCB 4G9SB 4HNAB 5FKBA 2QE7G 5C5TA 4BQ5A 4QGNA 5CG8A 3MIBA 1UAIA 2IXKA 5JPMB 4PQ9A 3L9JT 2VMEA 4AEKA 3G67A 2Q68A 4M4PA 5IK7A 1YSCA 1QQP3 2HEVF 3VD9A 4AI2A 4O4JA 2GH2A 2J1SA 5FYCA 3G71V 3N7MA 3DECA 4Y20B 5GLTA 3T4VA 2YEVB 1UZZA 1NVPB 3HN1A 3DSQA 1W59A 4RL7A 4LF7B 5J2UB 1W2AX 4PQQA 2ZX4A 5H9QA 3KS7A 3W7UA 4BQ2A 1ZZ7A 2R061 3FAVA 1R6KA 3RZMA 3K3NA 1DIWA 1NTKH 3AP5A 4DV7O 4LNUA 2VR4A 1ASJ3 2JIGA 1HNZO 1YF2A 2YU2A 4Q6GA 4GWMA 3CRMA 1YITV 4AFDA 2VZ3A 2DVDA 4RHV3 4NIDA 2VCMA 3CJHB 5HI0A 2DQ0A 2WA3A 5C70A 3OBRA 4F3JA 1RUE2 4XETA 3EO6A 3KCYA 4LXLA 3ZS8C 3GZTB 2PYLA 4FOVA 1UPGA 2ERFA 1JXNA 1WMEA 3CJIA 4Y1YA 3NXSA 2RS32 4B3RO 2D40A 1Z2GA 1TAEA 1BEV1 5CFDB 4EN6B 2D93A 3VGIA 2UUCO 3B94A 2CL2A 5KHJA 4RR3C 1MG1A 3JBG2 4XHXA 3ZYIB 3UJOA 3L2YA 4DXTA 5I0TA 5B1NA 3A4UA 1COV2 3JARB 4PHZA 4AVSA 3ZHRA 2QR4A 3AC0A 2D2CB 5FOBB 3W5NA 4KWJA 4ZOLB 1AL21 5LHGA 2JE9A 4LT5A 1CAVA 3VBBA 1EFRG 5LYJA 5FLHA 1N34B 1XL4A 1AYN1 4IGQA 3H42B 4LFCO 2BQPA 1W0NA 5DDJ3 4CCCA 2HEPA 2X5IB 2PLV2 4D3WA 1AXKA 2X09A 2GH8A 4HK9A 1KMIZ 4I55B 2AZ0A 2ZGNA 1GM8A 4FLWA 1Q8QA 3RBZA 1J95A 1KD1W 4Y22A 3L2HA 4V2WA 4XPVA 4LKFA 3ZIWA 1F5FA 2HYXA 1YJ9V 4JHTA 4DW1A 1OD5A 3KCXA 1S55A 4JI3O 4MTOA 1G4YB 1C4RA 3WXPA 3ZKUA 4XILA 1ACCA 2WSUA 4TV9B 3UNPA 1SQBH 4D69A 5JVDB 1XNAA 2ZCWA 3SPCA 2OIIA 3WDVA 1FV2A 3RT3C 3QH7A 1ZYBA 5FYBA 4J42A 2QDRA 4W6WA 4Y5Z0 5FAXA 4M3CA 2WAMA 2W5FA 4TV8A 1B35A 3AX4A 1W3VA 3C3TA 3K48A 1O4TA 1LNQA 2EIEA 1QKQA 2FDJA 4NN0A 4IE4A 2WFF2 2HWE1 1NA1C 2WNUA 4MTGA 2RMU3 4N8MA 3DYMA 2IWGB 1Q86W 4B3NA 3CQOA 1XBLA 4JTAB 4HSLA 3UKNA 3DXRB 3G7DA 1SBFA 3TRSB 1BXHA 2WZPP 4XFCA 1FXKC 3LNNA 1CIWA 1YTFD 5DMYA 2F1MA 3WW4A 2DOSA 5JWPA 1GAXA 2D6MA 1CXZB 1SZTA 5IK8A 3ZM8A 3AYAA 2LTNA 4Z82A 4JI8O 4B7KA 4JKLA 4AVTA 1XNBA 4MG2A 4JYBA 3OPTA 5FY1A 3QLQA 2JJ2G 3QVNA 3SKJE 1BHGA 3BN6A 3A0RA 3RVHA 5F37A 1ENQA 3VQXA 4EROA 4E4DX 5J48A 5K7PA 3WZ1A 3GGLA 3U11A 2BERA 3T1LA 1MABG 2UXXA 2IJHA 3SYPA 2PN5A 4CCMA 4EB6A 1S2KA 3KG2A 4DEQA 5EYPA 4CEYC 4ICGA 1GV9A 2YUEA 2QEXV 2J1TA 4LWSA 2JECA 4W4KA 2W94A 1BZWA 1XNKA 2UUBB 5GLVA 5FZ7A 1LOEA 1QJY3 2A7AA 2DUOA 4LF4O 2ZDIC 1O4YA 4UCTA 4WFGA 1HIXA 1RMU3 4MW8A 4GCZA 4RFRB 2PHFA 2IH1C 3MICA 3AKTA 4BIFA 1QJX2 2P2KA 5D2AA 1KJLA 3WP4A 1O8SA 5IJ9B 2VMFA 2VWJA 3AG4B 4XBQA 2OZ6A 2JS5A 5G05L 5H9PA 3MW4A 5LBFA 2PUSA 1WWYA 3E86A 2QDOA 2JDPA 4X8NA 2W9XA 4YG0A 2VE1A 3ZFEB 4R4XA 4UB8Z 3ZSEA 3USUB 4BM8A 3DPRC 2J1UA 4KHPB 4GMP3 3SH5A 4AZZA 2OPWA 1HNWO 4EYUA 1WMDA 2NR5A 3WW3A 4M0NA 3K58A 3VBRC 1GNYA 1CGPA 3GALA 1POV3 5FKCA 1BQZA 2A6WA 4IE0A 1W8HA 1PM9A 2RJZA 5FZ6A 1O9HA 5FBJA 4NE9A 4GH4A 3TEWA 1A6CA 1KD7A 1KS5A 5EBWC 3JZVA 2YC0A 3CE2A 3CHXA 4IV3B 4FPLA 5ABJA 4QIWF 1TA8A 1S0DA 1LOFA 4IQPA 1FJGO 1OH4A 3RVYA 4YZ2A 4WM7A 3JD1A 2WT2A 2WFPA 1LEDA 3SGIA 3TNPB 4A45A 2CTQA 2JDUA 2XHBA 4XFGA 4QPGA 5C9AA 2ES3A 3VL8A 2XLGA 4N43C 4P14A 4PD4F 2ZE6A 4KG0A 3OEAA 1V6IA 4LMFA 1K92A 5JCOC 4QGLA 2VW0A 3U78A 3RMXA 4AEMA 2TNFA 2YG0A 2FCUA 4OI2A 1MSDA 1UU6A 4DINB 3G6BA 1JYIA 3LWCA 4QDRA 1HRI2 1BSMA 3I2OA 4DR2O 3IDBB 4IIJA 4GKKB 3JAMN 2YGLA 5GW7A 2OZJA 4ARXA 2ZGRA 1NLRA 4XW3A 2JEXA 1AJOA 4AI0A 4S2FA 5C93A 2ZBJA 2PA7A 1V55B 1XL6A 3ZPOA 3CX5F 3E8BA 5IW0A 3U14A 5A7NA 4Q4V3 1IHMA 1DQ1A 2Y0IA 1JZ5A 1FI2A 1OSGA 2HJIA 4QDQA 4YW1A 1W39A 1QMJA 4O4JB 4FM2A 3S7IA 1AI7A 4X1KA 4JGZC 2DF7A 3SPGA 1DQ4A 4XJUA 2VVDA 5CKQA 3TJTA 4XYXA 5FLIA 1F4AA 1ND3A 5KHHA 4DB5A 3IDAA 1IBKB 2QWNB 3H1KH 2PHUA 3FAVB 2V4VA 1AR73 2W1QA 4Q0PA 3K3WA 4LNUB 1ZBA2 1HP8A 1XYPA 4IXLA 1Y66A 1Y9QA 2NN8A 3CCJV 5C3RA 4LUKA 4DIQA 2QSAA 3OMNB 1NAEA 4JGYA 3EXAA 5F5QA 4FLXA 4GX2A 3LGRA 2OTJV 1NX9A 3AMHA 3QCWA 4DUYB 3WD5A 3UO3A 3NRUA 5A70A 3K46A 3POBA 1BYHA 2BNMA 3D3IA 5E88A 1CVNA 3PJSK 5IAXA 5LRSA 2QKSA 5LCWL 4NPRA 5FZ3A 2O57A 3UGFA 2J1AA 2UUAO 2AZ5A 4J6GA 3G4SV 4HLTA 2K46A 3KGLA 3CJIB 4HOOA 1N3PA 2HHHB 3I3EA 1JU3A 2B5HA 5A9GA 2FDKA 5CYYA 1NXMA 3H1IH 2VTXJ 1R64A 3H3ZA 1GN6A 2XL9A 5LRRA 2Y6JA 1QWRA 1SZXA 5F3IA 1VQ6V 4META 1EP0A 3ZMTA 2Q0OC 1OT5A 2BDRA 4YWAA 1W2BU 2VZOA 4MSVA 5JOWA 5F2SA 2RMKB 3V65A 3CC4V 3VBFC 5JI9A 4XF9A 4GZRB 4AQ2A 2N05A 1CAVB 1LJ7A 3VBHC 5LYJB 3ZFGA 1VQ5V 2H3OA 2ZXWB 4OHZA 1MPXA 3FHQA 3HD8B 1I94B 2OYQA 3T4DA 1IBMB 3ZMVA 2YUAA 1NQJA 4Y22B 3S0MA 1XQ8A 4WZFA 4B3TO 2D43A 1IURA 5EBMC 5F5IA 4WM8C 4NTWA 1JOPA 3UETA 2P3KA 3RWNA 1E57A 2D97A 2YI9A 2PI4A 4Y1VA 2VW2A 2Q6AA 2C2AA 2ARHA 4OLLA 2WLKA 2IVIB 2LW1A 2E32A 1THZA 3WW1A 1NJIW 1RUJ1 5FO7B 2R9RB 1QXPA 5KMGA 4M3CB 5IVYA 4JI5O 4TV8B 1WPXA 1B35B 3W20A 4BXFA 2VZTA 3MZHA 1OA4A 3J7NA 5IAVA 3PUAA 3NJYA 2AEZA 3KV5A 3D3AA 2DBIA 2UURA 3SPHA 4NTYA 2RS33 4AGGA 3T3YA 2WNUB 3ZRSA 3MPPG 1K3IA 1XU1A 2XVLA 1V54C 3AG3B 5GLZA 4FQ4A 2PHXA 2YIBA 3K51A 2PHLA 5A6YA 3FBYA 3PDQA 2ZKOA 3KHBA 4LF8B 3VZKA 2LM3A 4YG3A 1N1TA 2YHJA 4CUGA 1VARA 2E7QA 4OUMA 4CRQA 2QWQB 4LF5O 2NN4A 4R4ZA 5FPRA 1G8MA 2L35A 5FZCA 3OEBA 3OTOB 1REDA 1YRZA 1PZ8A 3JXSA 1ZTEA 3WDYA 3AK0A 2QTWB 4JTNA 1XNRO 2VZVA 2QWRB 5B1OA 2ARAA 2ETEA 4KBZA 3IIIA 1C5HA 4MOAA 2VMHA 1XPWA 4XCBA 2VG9A 3GYDA 4PDRA 2ZM6B 3C2UA 5KA6A 3PJYA 4PLOA 1J3PA 1QQP1 3UGHA 3M70A 3N2GA 1YJWV 2ZGOA 2PLV3 4J7JA 3PMSA 3J80N 3QOPA 1WA6X 4JZ2A 4XUQA 4R8HA 2BGPA 2TBVA 4OUEA 4YRDA 2D6PA 2XBO3 3LDCA 4CUAA 3ETGA 4EB6B 3MFCA 2GV9A 1US2A 3SJBC 2YSUB 5EYPB 5LATA 4EJRA 5JOXA 1YEWA 1YLLA 2RDNA 1TNFA 3VZJA 4LWSB 1AI5A 2DWEC 1H8TA 1LUVA 2ZQMA 1K8AW 5IVEA 1OOPC 1ASJ1 1QDOA 3SYCA 4NRMA 5F3CA 4NAOA 3WCSA 4RHV1 4YZ5A 1R73A 2G1MA 4UBGA 1H8EG 1PGW2 1EYBA 1A3KA 1UWWA 2WO7A 3W59A 5JR7B 3N9LA 5FYSA 1K97A 3VBOA 2RS12 1UY1A 2W2IA 1GZCA 1VALA 1LU1A 1GBGA 4XAAA 3OBTA 1NE6A 1U97A 2XJQA 2WZR2 1OQ1A 3AL6A 1O5LA 3AYEA 2EZOA 4AILC 2BTQB 2VMGA 2BFUL 4H33A 5F32A 3NJZA 1QU7A 4JI1B 4JGSA 1YO8A 2PHWA 1Y4WA 4I3GA 3KQ4B 5BUVA 1EV12 1NTMH 2Y64A 3OT7A 4KMQA 5E1RA 1H2MA 4Z1VA 5FV3A 5GM0A 4IV1A 3DKWA 5CKNA 5F1RA 5K1XA 4LBLA 4IETA 1BVVA 1MS8A 4BQYA 5JMCA 4LEJA 3USSA 1W9FA 4NXNO 4BYYA 5DDJ1 1FMD2 2W68A 4CC6A 4M4RA 4ES8A 4GH4B 4P02B 2Q1MA 3WG7B 1AROP 1N33B 5FYUA 4I3PA 5T55A 3PVNA 5ABJB 2E5LB 4X65B 3ZXGA 2JDKA 4QD2A 1EN6A 3K57A 5A7OA 2I74A 4FPKA 4WM7B 4HKLA 1LGNA 3BALA 2RS52 1GANA 4DUZB 1WPBA 4L8QA 3I5DA 4PA7A 4I01A 3EBRA 2SLIA 1BBT2 4AHCA 2Z42A 4YM0A 4AVBA 4QPGB 5C9AB 1K7DA 4R7CA 2Y4UA 3VB9A 1PO22 2X10A 4LKEA 3PVEA 4RQPC 1DQ0A 1M57C 1HXS1 1R1A2 2YS8A 4QX0A 4HANA 3CRRA 4MZUA 4EQVA 1F35A 5CBFA 3MW3A 2EBOA 4U3JB 4IIJB 3PJQA 2RMU1 2YXSA 5BV6A 5A3TA 4E4ZA 1RXFA 3CWBH 3ASOC 4NHXA 5FL7G 1PVC2 3RZKA 3BIWE 3J7HA 1IVSA 5J96B 4CDQA 3ZFFA 5H9RA 3VN4A 1PNGA 1REEA 5GKAC 5FXVA 1GK9A 1VEWA 1J3QA 4H14A 4JVAA 4W4ZA 2OUHA 3IT8A 1PO12 4UVCA 1SLTA 3NNMA 1VF7A 2OA2A 3LSEA 4X1KB 2ZNIA 3I8TA 4BB3A 4FIPC 3I3DA 5H2FZ 3WB2A 2EA7A 2QQOA 4YGEA 5I0DA 1BMFG 4UXNA 3URFA 2YB7A 3R4UA 3OG2A 1ND3B 2ITDC 3O7OA 2XHNA 3VL9A 2BYVE 3CF6E 3CRAA 3SYOA 2DDUA 4LC1A 5FP4A 4D8MA 4HKWA 1RJ7A 5HV4A 1ULOA 1K4DC 5DQ0A 3SITA 4S2HA 5FPUA 2Z79A 4JGYB 5C8CA 1LULA 2WNVA 4NKGB 1H8HG 2B7YA 4BQ1A 2BOBC 2QNKA 2XJRA 4WBBA 4QJFB 1QJY1 3UL2A 3T1HB 3WDXA 3NKTA 4BW5A 2R073 2QM4A 2JG9C 1R6NA 1RMU1 2G4IA 1NH2D 3QD6A 1ULGA 3AG2B 1O9GA 2HP8A 5B1BC 4HN1A 4V1PA 1ENXA 1F23A 4XTMA 1V6KA 2WBKA 4K6BA 5LA9A 4Q4W1 3BI3A 3NQHA 1BCXA 1PM4A 2JJ6A 3O9OA 1SQXH 3MF6A 1G9BA 3BVCA 4U36A 1S5JA 1RM1B 3FB7C 4ZI7A 1HRV2 3K03A 2VBPA 2VQ0A 2HWD2 1D4M3 4YG6A 1NZIA 3RYRA 2RJLA 1QNYA 1STMA 5FXXA 1FT9A 3C7GA 2XOKG 2XNDG 2ZGMA 3B5LB 2CTRA 3HKBA 1PMHX 3ZFGB 2J1RA 2OCCB 4GMP1 5DAQA 1ZZBA 2R042 1SFPA 4RUFA 3G6EV 2ORXA 1A32A 2W6JG 3E8GA 4S2DA 5JH7A 2ZAAA 5E89A 5FY9A 4DO0A 4IE5A 1DQ5A 2P6JA 1VBE2 3B9IA 4IE6A 4LPLA 3O1MA 1POV1 1MZEA 3EFFK 1ULEA 4DNYA 3BTYA 1SESA 1HR0O 1AJKA 1E79G 4LH7A 4U3FH 1J83A 3HBZA 1HX6A 1Q6HA 4LKSA 3DXTA 1DLCA 1WA8A 2N04A 1QF3A 1ZBA3 3HWJA 2BWAA 4ZKIA 3HR0A 1N1YA 4XABA 2WO2A 2LGWA 3N9QA 3ASNC 3HT1A 2NLJC 1WLTA 2XQXA 1CESA 1RUH3 2WLQA 1R3LC 4MYEA 4A3ZA 5KMGB 2A1XA 4QGPA 2HG5C 4RR3A 4K8ZA 4JDMA 2OIGA 3K5LA 4GIQA 3CJXA 3PNAA 3LD8A 5H9CA 4UW4A 1AL0G 4XJWA 5G04L 2GNDA 1K3EA 3LDDA 2Q4SA 2VBBA 1UMIA 2VC9A 1VAMA 3C7OA 1XC6A 3FE5A 3ZMNA 4DRVA 1PNFA 2XG3A 3WF3A 3W7SA 2XJVA 2ZMKA 2ZX3A 5C6CA 4GB33 1NCQA 3DKQA 2IU0A 5EJZB 3OGIB 2RDCA 2ZTNA 3BIEA 3HAGA 3ZHSA 5KHIA 1FV3A 1W04A 3JATA 3KGZA 3LDKA 3IZOA 2YU1A 3ACFA 1LECA 2XAFA 5EZYA 2ZR3A 1UD1A 3PLQA 3J8F1 3VBUC 4CEWC 4Q4V1 3TXSA 4EZ4A 2GAUA 2UYAA 3N2GB 1PZ7A 3MV11 2FCVA 4OZOA 4G3YC 3MEPA 4QQ2A 1O6UA 2IXHA 3LSQA 3LEMA 4D7YA 2F4PA 4LOSA 1V70A 3OR6C 2D5FA 1SKVA 2EIKB 2PTMA 2D6NA 2B39A 1VJ2A 1EN4A 4CH3A 1X8MA 1UFIA 1H8TB 1LB2A 4R9CA 3KZIZ 2OPKA 5GTHZ 3WUDA 2ZHKA 5C3SA 2DBNA 3LPFA 1NA1A 2EALA 4FLTA 2Q8EA 5SV5A 2B4KA 3OE7G 1W06A 3NKGA 1URFA 3T1MA 4QE7A 4DYLA 4LF9O 5IE9A 1GWMA 1SLIA 4UAPA 3DCQA 2V5YA 1FXKA 5LMUO 1GRJA 1AX2A 3VBOB 4X88A 3WB1A 3ILNA 3GDBA 5FZBA 3K4ZA 4ZONA 3DC5A 2WA4A 4DV2O 2JDYA 2F4VO 2VPVA 2EXKA 1ND2C 3VOUA 2C1FA 1RL3A 2ZAHA 4NR1A 4A2UA 2FCTA 3I2GA 5KC5A 3ZO0B 1AHSA 3K9AA 2YZ4A 2EJ7A 3OPZA 2GC0A 4GKXA 2FYUH 4Y5TA 3LCPA 1M56B 3AMPA 3PMEA 2Q5ZA 3E1F1 2B5UA 1Y4MA 3ETEA 1NQDA 2P5OA 3A0BZ 4IV1B 2Y6LA 4O4HA 5FFOC 4DR4O 1IBLO 5FP8A 1TZOA 4UT5A 4CEYA 3RYIA 4JI2B 1NU1H 3E6DA 4BIZA 1FPN2 3ZRVA 3X2QC 3U07A 1JVMA 2R32A 1Q8PA 5A1FA 4I0XA 4PA6A 4JI4O 1HB3A 2E33A 4BWOA 3AVRA 2ZDIA 5BR8O 3K59A 2D3OW 4DUVA 5FWJA 4UXAA 4LFBB 4X6RB 4DR5B 4J10A 2EXJA 3ZJZA 4PIYA 4ASLA 2K2SA 1SETA 3BU0A 4FPHA 1S3JA 3P30A 4YARA 2EILC 4KNCA 2CWMA 4ZPIA 1T5EA 2BW8A 1RUOA 1SHWB 4EN0A 2FZ1A 1EPZA 1DZQA 4LBEC 3H50A 1XMOB 5FMDA 4RN5A 2VWKA 3ZSJA 3ABLB 1RUE1 1DGWA 2H0VA 4B3SB 1JYVA 3TEZA 5DAVA 1U96A 4QU2A 1OPOA 3GCWA 3DPRA 2W52A 1FD9A 4LE4A 3NAPA 1Y67A 4PDVA 2QE3A 1KGYA 5BY1A 2RS31 2WO1A 2D7FA 4MHRA 4TUYA 3SHRA 2XLFA 1HN0A 2FDHA 2VQEB 3J9SA 2VW1A 4GQ7A 1KITA 2WZR3 2DYRB 3VBRA 5B1AB 4QPJA 4JI6O 3JBG1 5BNNC 4MADA 5FYVA 3ZIAG 2WLHA 3K0GA 1COV1 5FUIA 4CDQB 3ZFFB 3CPWU 4QWNA 2ZPXA 1EV13 3MHHC 4IEOA 5IYCO 4H2AA 4AGRA 2AXTZ 2ATKC 3C7HA 4LLFA 3WDTA 4ZXKA 3KB5A 3ZN1A 2W47A 2F6BA 2BGCA 4EN8B 3FB6C 3K4DA 4LULA 4OMDA 2ADPA 3RYFA 5CMUA 5T5JA 3WSOA 4HZ3A 1G9FA 1YXBA 2PLV1 4FTBA 2E63A 2FMLA 1KQSU 3CU7A 2KD7A 3KV4A 4DR1B 4DXSA 4LIVA 3VDDC 4N43A 2XBO1 2VNVA 1AP5A 4ZXEA 3ABMC 5C8CB 1XILA 1WD4A 2WNVB 3TN92 4CCKA 4PF1A 3BUCA 1R083 2RS53 3MUY1 3NNGA 4QXKA 1XRUA 4NPLA 4WVVA 3N7LA 3JD3A 5LB6A 5F3GA 4FVMA 1Y7BA 3HKEA 1KU9A 1YHQV 4FZ1A 4PV1B 2V7QG 1PHMA 3OSDA 3MYXA 2WT1A 3RWKX 1V0AA 2GSYA 1LOGA 2HBTA 4JYAO 2QUOA 4MVRA 3C7FA 4ZHQA 3GBFA 3QBQA 5JR2A 1AX0A 4YZ3A 3H9VA 4PIZA 1DLLA 1NVPD 4ZBMA 4AHWA 4UCOA 5KHKA 2WFF1 3FLRA 4DR6B 2QQKA 1XSQA 4ZI7B 1N47A 1IQAA 3NV3A 3T2PA 4E2QA 2A5ZA 1GYKA 2JXAA 4FTSA 1QHDA 2KXLA 3RN4A 4YW4A 2DCJA 1E5RA 1XNTA 3HKBB 3KKYA 1PVC3 3T1YO 4IGPA 3MDPA 3MIEA 2ZGKA 1S0FA 5LA0A 1WAZA 4XQDA 1I1EA 1RIRA 2RNBA 1SQ4A 3QACA 3VDAA 5AG2A 1IZ3A 4YZ4A 1LRHA 3RGBA 4AF9A 1YQ6A 4LORA 2QTOA 1XDCA 1DBNA 1AR92 3M3QA 3VHNA 1MZFA 4AYUA 4YHHB 5E6HA 3ICXA 2C9AA 1JZ6A 4MGQA 3B8MA 1FOD2 3BCWA 1BHAA 1D5AA 2C4XA 4PA3A 3WU2Z 1LESA 3WCRA 2M7WA 2B45X 1TMF3 1YQ8A 3ATGA 4MVUA 1ZZ8A 2CYFA 1WA8B 1TEIA 2QQMA 2NQYA 1OCZC 2HVKC 4DOUA 4PDMA 1QJU2 1B3QA 4M01A 5FPLA 4FLUA 1DF4A 4L9BA 1VQKV 2GDSA 3W5MA 3H1YA 1OLME 4LLOA 2HJFC 5IVJA 1NTZH 3AG7A 4RR3B 1U12A 5IJRA 4FFFA 5ACA2 4I02A 1NUKA 2IVJA 2VL4A 1OHFA 1QOTA 1OD3A 3HNMA 3VD7A 3S6PA 4E8DA 5EFUA 4MW3A 2VUJA 2P3YA 3VBFA 1DYPA 4DQAA 4K7JA 1QJX1 2ZZQA 3VBHA 1GKBA 4R50A 4DK1A 4WFHA 1VBA2 2JIZG 1GNHA 4CU9A 4D7SA 5F2VO 1K5QA 5J7MA 2UXDB 1PK6C 4YPJA 4DV0O 1LEMA 3S7EA 4UOJA 3JAKA 1NCQB 1HRV3 2HWC2 4KP4A 3JATB 3NMBA 4Q4Y2 4V2VA 5J98B 1GFF2 4C1XA 5KXDA 1WP8A 5LOVB 2BPA2 3BY6A 5EZYB 1VIWB 3K2OA 2V1DA 2QM7A 4WM8A 1OV9A 5J1XA 1DDLA 3ZXJA 2R063 4LJHA 1RYYA 2P37A 4TQDA 1TVGA 5JQGA 4I4TA 5H6QA 1H38A 3M3OA 3R4DB 2YBSA 1VBE3 1HQLA 3ABZA 1JS9A 4N21A 4NTXA 3VHRA 4Z2WA 3VZNA 2DU1A 2NM1A 3WP6A 2DE0X 2V72A 4NJ4A 4C91A 1JA8A 4PELA 4K9SA 4OFGA 5K1PA 2WSVA 1VRH2 5A32A 4FLVA 1N32O 4FOQA 2XPJA 2B1GA 1NS1A 2GU9A 4EWEA 1W2UA 4B1MA 5E8AA 1NA1B 4Q8KA 3MAQA 3KLSA 1AYM2 1BEV3 1UY2A 2B46X 1G9AA 2C6SA 2QKAA 3SXWA 3ZIXA 2BSKA 1N36O 4AEJA 4U7OA 4XUNA 3NW4A 5LASA 1FXKB 1Q90D 3RS6A 3ZR5A 4IEPA 1LODA 1HV0A 1FPOA 4FPEA 3LDEA 4OMCA 3LKJA 4JQTA 4X1YA 4RGGA 5JJNB 3M1HA 2YIAA 4E2LA 1W2TA 1HRI1 1NY72 2XQRA 4N9HA 1ULCA 1RHI2 1ROPA 1UNBA 5I0RA 1PX3A 1BCCH 2UXCO 4OGQB 1GP5A 4O4HB 1QDCA 2OYZA 4LF6B 4CEYB 3AJZA 3WNPA 3RYIB 2ZHMA 1G9CA 3K06A 3LDRA 4KFMA 4NHMA 1XNQB 2PMWB 1X8EA 5BNOA 4I0XB 2ZGLA 3GZAA 2VXRA 2FB5A 1GZWA 4RGAA 1YIJV 4Q26A 4A4AA 1A8DA 5JSOA 1UJWB 4EWAA 3OGJA 3JD0A 2VM9A 4FP3A 3M3IA 1EAH2 4FQZA 2HJDA 4HN0A 5B66Z 4C8DA 1ULPA 1UQXA 2CV6A 4BK5A 4XHBA 4HL0A 4HPKA 4CVUA 1VQNV 5FDBA 2NPIA 3T30A 1WKYA 1OF3A 4NO4A 4QHBA 5J9PC 1SBEA 3OAAG 2H6CA 5H5NA 4LF7O 2XH6A 1SFYA 1ZBA1 3GF6A 2WWWA 2OVUA 3FHIB 4MX3A 2XWJB 3MUZ1 1FYJA 3B7MA 3BYWA 3B3QE 3WV6A 4W6YA 1HLCA 3F5WC 3CD6V 3OMAB 4QGMA 2RE9A 5J3UA 1BQPA 4GULA 4LH6A 2J42A 3ZSMA 2BJSA 4LBOA 3DPRB 1UL9A 1OUSA 1SFNA 3ZRWA 3NAPB 4EFEA 3K79A 3T4ZA 1TGOA 5GALA 4DRRA 3QO5A 2P6HA 2GC2A 4TUYB 4QXBA 2ODMA 2WDBA 3T08A 3VBRB 3KD4A 5FY7A 1RITA 3FL7A 5B2GB 3ZSKA 3A7QA 1H2NA 1MS3A 4L8JA 4GB31 4K3AA 2Q1FA 4LR4A 1AJPA 1NCRC 2GHYA 1YNAA 4QT6A 5LHHA 1GZTA 3OOXA 4COZA 1X7NA 1PL0A 3KV9A 4BE3A 5L7OC 2RR12 3HVDA 1OVSA 2ARCA 3WR0A 1YJKA 3RYFB 4GJYA 2CH7B 1JZ8A 1CX4A 4I0BA 4GX0A 1YFUA 3KQRA 1JYCA 3A0HZ 5GTIZ 1B06A 1XNDA 3DF0A 4Q5OA 4N43B 4G27B 1TUEB 2VNOA 1RTVA 3AZXA 2PQQA 2XJSA 3ZXKA 4XZUG 3CCLV 1ZA4A 4NIAA 4BQ4A 1F2NA 2ZE7A 4JI7O 1F51A 4XC9A 1KFXL 3VKMA 5A3WA 4DR7B 2XJPA 3N3HA 2UU8A 4GALA 2HFEC 3HKEB 4IE7A 4LA2A 5KUKA 4J9ZB 3V64A 3U10A 1T2XA 4YIPA 1XMQB 4PJYA 4IEUA 4IEVA 4Y3OA 2VZ1A 5CZKA 1GICA 4ZHQB 1DYOA 1BJQA 1TME2 4L97A 2BVBA 2DVBA 4ITCA 1OQDA 2QVSB 3X29B 3GJBA 4AHZA 3O5SA 3SCGA 1ZA7A 1N1SA 4UFMA 5A7QA 2WLLA 4QKBA 3GVMA 4FP2A 2ET7A 1JYWA 2CHHA 5EYXA 5LA2A 4MVTA 2GMMA 1H6YA 3EXUA 3BA9A 4AI3A 1APNA 3CC7V 2MNGA 3CCVV 2X6BA 4GKJB 2PQSA 3ZYGA 3GHMA 4QPKA 4AI1A 1L7RA 4K1ZA 3PU3A 1H6XA 4EFBA 5EIBC 1OMIA 3E35A 2WPDG 3PIJA 2B1IA 3OGVA 1IXBA 4Y24A 4XUOA 5CA1A 4YYOA 4IGGA 5LK7B 3FD9A 1NLSA 2VNRA 3CMAV 2E75B 4CP2A 1QQCA 2IW5A 3T2QA 3CCRV 2JG9A 5BNQA 4MVQA 3ZN4A 1UMZA 4EEQA 3CCQV 1D5NA 3B02A 1ZNPA 4XFBA 2VRZA 2P6CA 5C3QA 2D3SA 3I2FA 5JXJA 4Q0QA 2FBEA 3AG4C 4BJ0A 3NWKA 4I2OA 1RSOA 3D5OA 1PGW1 4B3TB 3AXEA 5A6XA 3VBFB 1YXWA 1AB3A 3L70H 3WQBA 3VBHB 4OVEA 2HLDG 2RS11 4L2NA 3NSTA 4JQRA 2UYBA 3JAKB 4O65A 3WOGA 1ZBE2 2BEOA 4YVWC 2WZR1 2DYCA 4URTA 1SRYA 1KC8W 1AF9A 1AX1A 1PNMA 4JTCB 5JI7A 3MIHA 5JDBA 4WM8B 3FZ3A 3MV01 1BS3A 4GWIA 2KKWA 1EV11 2Z69A 1VMGA 1W05A 4DXZA 1OURA 3CCSV 5IWAB 1WD3A 4FXKB 2Z0AA 3VQVA 5JQGB 4I4TB 1W0PA 4KHPO 4CBCA 3H3LA 1AR93 3FC0A 4CZZA 4H13B 4E2GA 5HFMA 1J84A 1R092 1FMD1 4GA9A 4B8EA 3B09A 1FOD3 1CWPA 2GC1A 2HWE2 2IXJA 3JAWA 2VQAA 2YICA 1PMIA 5JIUA 1W6MA 5A32B 2EXHA 1YI7A 2JK5C 3O1PA 4MGTA 3C3SA 1FX5A 2V73A 4E2SA 5IYYA 1XNRB 3DYPA 3AJYA 1QHTA 1HQNA 1MACA 4RQFA 2VOTA 4YGDA 5LWBA 1LTEA 1QJU3 3O1RA 4HFSA 2P4VA 5KA5A 4YFWA 1V54B 4Q0UA 3AB0A 1A8MA 2RDQA 3HT2A 3OEHG 1VQPV 2RS51 1VF6C 2A0LA 2X05A 5FY0A 1JYXA 1DGRA 1XE8A 3CSXA 1A34A 2OKXA 5HPOA 5EIYB 4NHLA 1DGLA 3LIGA 1PO21 1LU2A 1RUC3 3PTRB 1QVFU 3R4SA 4LO7A 1CP9A 1GP6A 5FO9B 4ET7A 3BEHA 1SF9A 2WABA 3VBUA 4CEWA 1DZRA 1SEFA 1VBA3 2E7TA 4X1YB 3M3EA 1S1AA 4YM3A 3KV6A 5CA0A 1LOCA 2V5DA 2HWC3 1XQNA 4Q4Y3 2W1WA 2VO5A 1SG3A 5I8TA 4DV5O 5LHIA 3ZMUA 4Q4X2 1FATA 5EC2C 3J4UH 4GKKO 1PVC1 4JI0B 4UCUA 1QJFA 3D6EA 4M3CE 1KP2A 2TUNA 1ZX3A 2RM22 4FPGA 1L7QA 2WKKA 3T1CA 1PO11 3WLUA 5BNOB 2B9VA 2QJVA 3N4MA 1GZWB 4YW3A 2LALA 5DABA 5FNVA 3JCIA 2AYHA 4OX9B 2BBVA 1XHZA 1RUJ3 3IPVA 4I9WA 1W6NA 5LA6A 1DCSA 4EN7B 1UX7A 4FTEA 4HPKB 1MS4A 1VRH3 2WNEA 3WQ7A 1TMF1 4C0BA 1O3QA 1I5ZA 5CBGA 2Y4TA 4E8CA 4XMAA 4M0HA 1J1LA 4YW6A 3LZZA 4F7ZA 4SBVA 4LBQA 1W0KG 5DEDA 1T6GC 2WYFA 4URAA 2Z2SB 3A22A 4UV9A 2UXNA 3A21A 5JPNB 3G6JB 1M9NA 4FI9A 1WGPA 4LO6B 1SA0A 1ND2A 5IYDO 1PP9H 4X8AA 5CADA 2XGXA 1JU4A 3ETPA 3GM8A 4DUYO 2CU5A 2Q8DA 3WVJA 2BWCA 3ZRWB 3TWIA 4Q0VA 4AHYA 4FPFA 2ETNA 1NXD1 5L9RA 5LGTA 1UKRA 4KWKA 4LCUC 3UKTA 4BMBA 1WW5A 2GNBA 4XVHA 1H8VA 3IAPA 1OCRC 2HHHO 5AFEA 4HAMA 2GTAA 4UVBA 4BK4A 1BT8A 1HRV1 2HWD1 2Q9LA 1SDDB 3PUSA 4G28B 2ZX0A 1JW6A 2JVDA 1RHI3 5FZ4A 1IKPA 3WDWA 1JODA 1K34A 3OGSA 2QWPB 3A8TA 4N23A 2EZPA 2ZEXA 2R041 2HKXA 3F95A 4HT1T 1G6UA 2J7MA 3BB6A 3HMYA 1CONA 1QU0A 3CNAA 4ATEA 4ZZ5A 4B7EA 1VBE1 4AFBA 1FNYA 5AFBA 4AW7A 1GLHA 1I94O 4IEWA 3A0NA 2YXLA 2WAAA 4CP0A 1IBMO 3UKVA 4NXMB 4FPPA 1GZ9A 5JJEB 1RJ8A 3JQWA 3H1MA 4Y1XA 2VGDA 3I3BA 2QWOB 3GWKC 1DFQA 2ADQB 3VKNA 4XFHA 1JPXA 3FX3A 1ODNA 2E31A 4QQHA 1B35C 2WQZC 2C0ZA 1O91A 1YFXA 4GLXA 5FPZA 1UYYA 1ZX5A 2RVAA 4A6SA 2VCAA 4OULA 2R16A 4AQSA 5FR3A 3P3PA 2WS92 1V00A 3ASOB 4U2AA 2JENA 1OQEA 5CN0A 3K04A 2GBOA 2DV9A 2G9ZA 4DS0A 4LBNA 1LNSA 1W9YA 3FWEA 5IK4A 3RW0A 3TOJA 4DV3O 3ML0A 3LFIA 3AK2A 3P32A 2AUYA 3SR2C 3H01A 2XHKA 1GP4A 3ZYHA 1P8JA 2WLLB 1CN1A 1KRIA 2QKCA 2DCYA 4YVSC 3GNEA 2A73B 5T54A 4HETA 1YJLA 4K8RB 2GP5A 3FBMA 4LF8O 1HDKA 4ZU4A 5CAZA 3VDDA 4BH9A 3OTOO 2WJSA 5FJKA 2RR13 3LSUA 3FKSG 1ODMA 4CTEA 3BKZA 3R66A 3JSNA 1W9WA 4NIGA 2E74B 1GWLA 5KAFZ 4FAHA 1J1TA 5JZGC 5K0UA 2ZM6O 1IS3A 5CA1B 3IDEA 3I49A 2BOIA 3J26N 2I45A 3CIHA 1WCKA 5GZDA 4LHLA 2XJTA 5ANQA 1AJQA 3WHUA 1S0JA 5FXWA 4X8PA 1EBOA 3POJA 2XONA 1V9PA 4AAXA 2GN3A 4KI5M 2JG9B 3HPNA 4XDQA 1UO9A 3BAAA 5AC92 1HB2A 3IKWA 1HXS3 4AE2A 4LUMA 5B1BB 3K4AA 4B3MB 4XF4A 4A3XA 3ZHUA 4RD7A 3ZMOA 2NZ9A 2B9ZA 1PIV2 4J1WA 4UYBA 4NIHA 2BTOA 1BVP1 3FHAA 1CIYA 1PGL2 1RSOB 5F5AA 1W6OA 3I4IA 2IXCA 4DUXA 5A80A 3H7YA 5H6RA 3GBGA 1LAJA 1NE4A 2W08A 4QX2A 2JGDA 1I0HA 4FM0A 1TME3 1ZZ6A 3MHSC 4PJ0Z 1O59A 5I0UA 5CVRA 3LA7A 1VIBA 1VBC2 3OM3B 3AZVA 1X33A 2WZEA 3ROUA 1ZZCA 4CS3A 3IAYA 2WO3A 2WN3A 4Y4YA 4UCSA 4MH0E 4K1YA 4OPAA 3K5MA 5A1AA 5FJHA 1VQ4V 3I3QA 4X62B 1DU3D 2P3JA 4XDOA 3J81N 4X89A 3APBA 3CCMV 2MHFA 2WWUA 1CAUA 4JI1O 3JU9A 1YFWA 2JX9A 1LHNA 2YC4A 5IVVA 1Q8IA 2AREA 1YQCA 2DUPA 5FPVA 4ES9A 5C8YA 2OX0A 3Q8CA 3ASNB 4GMP0 2E7AA 5KBFA 2WN2A 2CAUA 3JAWB 1W6MB 1KKDA 3ZMSA 3AFGA 3TXQA 1W0JG 2DYSC 1QXRA 3N36A 3K75B 1WN7A 2YIBD 1US6A 1XNCA 1POV0 1QNWA 4LNVA 4W50A 1DF5A 4QPGC 3RZZA 2VNGA 1W90A 1H1IA 3O65A 4CC5A 5GZEA 1N33O 1J59A 4MGKE 3DEMA 3WF1A 1GH6A 3MD0A 4X65O 5GLUA 4Q4W3 5LL6Y 2W87A 3H8UA 3UCSC 4OUSA 1Q8OA 3DV8A 3VHPA 3PL0A 3ZBHA 4FK5C 4JRLA 4CUBA 1SERA 4MO3M 4DUZO 3WG3A 3GZUC 2R9IA 1AR1B 1ZZ9A 3HIFA 3VV1A 2WZ8A 3AZWA 1VQ7V 3ES1A 3VBUB 4CEWB 1WA4A 5FYYA 5I0SA 4LITA 5CA0B 2PGGA 1M93A 1VR3A 3OUFA 4B4PA 4OYUA 5KXEA 3AZZA 3EQEA 4Q20A 1XYOA 1ZBE3 2E76B 1AVBA 4IESA 4WVMA 5JMOA 3OYWA 2FHRA 4I9QA 2WAOA 5LEKA 3D4KA 1RVF2 4ORFA 2EIGA 4ASMB 4BLJA 4XZPA 2EIJB 4O9GA 3ILFA 3POFA 3IMNA 1PMJX 4RSUA 1CZVA 1QH7A 3M99B 2BNOA 1SQQH 5EXOA 1CJPA 4MSWC 4QNHB 3SMHA 2ZNJA 2HEWF 4B29A 5FNVB 4LFAB 4DV2B 3CXCU 4MTXA 1W6NB 5LA6B 4JTOA 3B00A 4JGYC 1P84F 3IN9A 1LUWA 5E1AC 3VKFC 2DVAA 5B3SC 2ZA9A 4P9JA 4F8AA 4WCEV 3GBWA 3JD2A 2VCCA 1EUUA 3WX5A 3OBZA 3JD4A 4LBQB 2WINB 4IUGA 4J80A 5JSPA 4KGQA 1FFTB 1RPRA 5FZ9A 1CZSA 3W21A 2VOVA 3TN91 4DY5A 1YZBA 1WCSA 2F66C 1MR5A 1UOFA 3I2KA 1S5HC 3HR9A 3AG2C 3LFMA 1SA0B 3CP1A 1ND2B 3O1SA 3H9AA 4IL6Z 2Q73A 2CY6A 3A0KA 3O1VA 1DGWX 3H3UA 2R0FA 3WF0A 1PGSA 3RRDA 1VBD2 1V9U2 4Q29A 3VDBA 1B6QA 1RM1C 1WB8A 2ZX2A 3T1HO 1QEXA 1ULFA 2HWB2 4F83A 3J8F3 2A3WA 2QQLA 2IUWA 1M5IA 4BQWA 1N3OA 4XJZA 1JUIA 1BMV2 2E6VA 3NNJA 1XXNA 5J2UA 1M90W 1K73W 3VZMA 3ZFGC 3X2QB 2ZGUA 1KBHA 3BPZA 2XB6C 2VXJA 2DTYA 3RJ2X 3AMQA 3ES4A 1HNXB 3DC6A 2PAEA 2GC3A 2JB8A 5C7GA 5ITZA 3KVAA 4DR3B 4Q4X3 4YZ1A 2JDMA 4EKWA 2Y69C 1I5PA 5BPXA 2X53S 1BHBA 2WLNA 2O1QA 3ORJA 1DG6A 4XJ8A 3WG1A 2DCKA 1GOHA 3GJAA 2XDVA 3RSJA 2EILB 1XI1A 1AR91 4I50A 2P34A 4PBPA 4WVWA 4FBFA 3SYAA 3NVCA 4IYHA 4NB5A 2WQ4A 1FOD1 5DUWA 1N4CA 4R52A 1OCCB 2HBUA 2XTAA 3K77A 2I2SA 1YQ5A 4GX1A 1CPMA 2PELA 1IG0A 4K20A 2MEV2 5A6QA 3RWRD 1VMFA 4ATFA 4LP8A 1QJU1 3HN3A 4JYYA 1E5SA 3AMMA 4CCEA 1X59A 1LGCA 4GT1A 3GCXA 5LMNB 2AGAA 5EPAA 2Q8VA 3TETA 3GB7C 5A3MA 1OCOC 4H7LA 4YY3B 4JV5B 5ACA1 1C5IA 4XE9A 3ZMZA 1NCRA 1E5IA 1XUQA 1RUC1 1S72V 1CJDA 2L6LA 4MT8A 4XFAA 4I30A 3D0JA 2LUWA 1YC61 1Y6XA 3AP4A 5L7OA 1Z5WA 4X1IA 1VBA1 5A1LA 2UXBB 3IM0A 4B4RA 4CU6A 1K45A 5FWEA 4BQ3A 3ZOIA 1SLLA 2HWC1 2BZDA 2Z5WA 2HWF2 5FZOA 4Q4Y1 2X8KA 4XUPA 4P9GA 4MGIE 2P67A 4DO2A 3AXDA 4YM1A 1XJAA 5DM6V 3VDDB 1NT2B 1W03A 2QBXA 1HN1A 3CBNA 3UO2A 4FO9A 2DW4A 4XTPA 2GTSA 1UY0A 3OTFA 4TZDA 3B9CA 2VBDA 4AQYB 3MLKA 2XVKA 1B04A 4DV6B 1GO3F 2YI8A 5K0UB 2VH9A 5FZAA 5CBLA 5C3OA 1RUF2 4XMIA 4C90A 5HCHA 1AR62
chains in the Genus database with same CATH topology
4DOUA 2QDRA 4W6WA 4Y5Z0 5FAXA 1QJU2 2R49A 4M3CA 2BNNA 4COUA 2BTVC 3MIGA 5BXXA 4M01A 5KXBA 1B35A 3AX4A 1RC6A 4BHIA 4L9BA 3K48A 2XWBB 1O4TA 3Q9OA 3H1YA 1QKQA 3FUOA 4LLOA 4SLIA 1RUE3 4RR3B 1U12A 4NN0A 1VRH1 5I8YA 3TN93 2WT0A 2WFF2 3AKRA 4I02A 5ACA2 4AQ6A 5IT6A 2HWE1 1NA1C 1OHFA 4KU7A 4R9DA 2WNUA 3UJQA 4CDWC 2RMU3 1QOTA 1D0GA 1AL22 2IWGB 4B3NA 3S6PA 1IS4A 3EHKA 4HSLA 3UKNA 4CDXC 3O2GA 5EFUA 1AYN2 3G7DA 1SBFA 3TRSB 1BXHA 2WZPP 2VUJA 3VBFA 1AYM1 1DYPA 4DQAA 2B9UA 4XFCA 3M7AA 1YWKA 2BVVA 4JDNA 4K7JA 1GQWA 1A78A 1QJX1 2ZZQA 3VBHA 1GKBA 1W6OB 1CIWA 1R1ZA 1VBA2 1SBDA 1UIJA 3JBG3 1GNHA 2XKPA 3WW4A 4D7SA 5J7MA 5JWPA 1PK6C 2D6MA 2GMPA 1COV3 1LEMA 3S7EA 5IK8A 1NCQB 4KU8A 3ZFEC 1HRV3 3AYDA 3AYAA 4DMIA 2LTNA 2HWC2 4Z82A 4PCRA 5FRAA 4B7KA 4Q4Y2 4C0HA 5J98B 4C1XA 1GFF2 5KXDA 4AVTA 1XNBA 3V0AA 1U5IA 4YM2A 4XF1A 3QLQA 1RINA 2BPA2 1S2BA 2HEYF 1VIWB 3M3CA 2ARXA 4WM8A 1CAXA 5JVVA 1DDLA 1ENQA 1UU5A 4EROA 4E4DX 4M27A 3ZXJA 1WLDA 4O9EA 5J48A 3WZ1A 4H7MA 5K7PA 2R063 5T52A 4LHKA 3U11A 3T1LA 4QQPA 5A3LA 2P37A 5AVPA 1NY71 1URXA 4M26A 4QM8A 1SLCA 1RHI1 2PN5A 3M3OA 2WC2A 3R4DB 1S2KA 1VBE3 1HQLA 1REFA 4CEYC 1GV9A 3VHRA 2YUEA 1OS7A 4AI8A 4Z2WA 3VZNA 2DU1A 2NM1A 3WP6A 2JECA 4MXVA 3MIDA 1AR71 4C91A 1BZWA 1XNKA 1MS1A 5GLVA 1ENRA 4K9SA 4IV3C 4OFGA 1UZYA 2Q1ZB 2WSVA 4FXGB 3W58A 1VRH2 4AEDC 1GNZA 5A32A 1LOEA 1QJY3 2A7AA 2DUOA 2GDFA 4A7YA 1O4YA 4FOQA 2XPJA 4JAAA 3RNSA 1G6NA 1Z7S1 1UF2C 2GU9A 1HIXA 4EWEA 1W2UA 3THTA 2OG7A 1RMU3 5E8AA 1NA1B 5DUVA 2PHFA 4Q8KA 3KLSA 3ZYPA 2JICA 4CDWB 1AYM2 4BHGA 1BEV3 2FZ2A 2B46X 1G9AA 3MICA 2ZABA 1QJZA 1C1FA 1EAH1 3AKTA 3AM2A 4BIFA 1QJX2 3SXWA 2P2KA 4CDXB 1KJLA 4OI4A 3WP4A 3ZIXA 5AC93 4AEJA 1W6PB 4XBQA 1F31A 2OZ6A 5H9PA 3MW4A 4XF3A 3NW4A 1OFSA 2YPJA 3RS6A 1U0AA 2VECA 1VLNA 4X8NA 4MLOA 3WP5A 2WBQA 4YG0A 1GQHA 4AXOA 1HKDA 3SH3A 2WIIB 3GHNA 1BBT1 4IEPA 2WFF3 1LODA 4PLNA 1HV0A 1MVEA 5ACA3 1WLCA 1LR5A 3ZFEB 1PIV3 4XBLA 1D2SA 4R4XA 4OZXA 4FPEA 2VMIA 4FPJA 4M3CF 4YVWA 3PVJA 4KG8A 3ZSEA 4COYA 3USUB 4B4QA 4BM8A 4IL7A 3DPRC 1ZRDA 4Y1ZA 2DU0A 3LKJA 1S0IA 4RGGA 1R1A1 4GMP3 3DUIA 3M1HA 4XJAA 3SH5A 1HRI1 2CTVA 4BHFA 2ZJCA 2JD4A 1NY72 1WMDA 2P17A 4N9HA 1ULCA 3WW3A 1RHI2 3JB4C 3MW2A 1LOBA 4M0NA 5I0RA 5DG2A 1W6QB 3VBRC 1VBC3 5T50A 1CGPA 5GZCA 3WDUA 4CDQC 2O8OA 3ME2A 3GALA 1IS6A 1NX8A 1POV3 1WLWA 4EWDA 2A6WA 1U5YA 3RYPA 4CDUA 4WVMB