4B7EA

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-leu peptide (20-mer)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
349
structure length
349
Chain Sequence
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 105
structure length 349
sequence length 349
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4b7eA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4b7eA01
2WA4A 4Z1VA 2Y0IA 4QU2A 1H2LA 1H2NA 2YDEA 1H2MA 2ILMA 4B7EA 3KCYA 4NR1A 3OD4A 2CGNA 2CGOA 3P3NA 5JWPA 1MZFA 4AI8A 2XUMA 1H2KA 1MZEA 2WA3A 3D8CA 3P3PA 2W0XA 4B7KA 1IZ3A 4JAAA 4BIOA 2YC0A 4Z2WA 1YCIA 3KCXA
chains in the Genus database with same CATH superfamily
1HNZB 1W8OA 1RUD2 1YQ8A 1YRZA 1SLBA 5T5PA 1THZA 3JAWA 5JI9A 2A79B 3K58A 4FFIA 4CVUA 4HN1A 1A8DA 5DUVA 3MBWA 3VZLA 3AK1A 3MLLA 5C4WB 1SDDB 4BWAA 3ZXAC 4ATEA 5FY1A 3S57A 5CKQA 4FOQA 2VD7A 1WWYA 2JE9A 3AKRA 4E2GA 4HAMA 3RYFA 4JI0O 4QIWF 1PGSA 1F51A 1POQA 4FP2A 2UY9A 4NHMA 1M4WA 4AF9A 4RWUA 4DO2A 1QOOA 4L2NA 4JI3O 3VZOA 1LJ7A 4B3MB 4AVAA 2XTAA 1S5JA 1GNZA 2JECA 1URXA 4BIOA 2G38A 3CZJA 3KT1A 3NQHA 5IT6A 5C4WC 3E2EA 2A06H 2XAGA 5FZCA 3WG2A 5IE9A 5E8AA 1W6PA 5FMCA 1H4GA 3OFNG 1W2OA 1NTKH 5A2QN 4FXGB 2WO3A 2DVDA 2NNUA 4JI6B 1QGLA 5IAVA 2VMHA 2E7TA 4YW3A 4QU2A 2VU9A 2ZINA 3ZSKA 3PDQA 5KHHA 2ZEZA 2QNKA 3ASOB 2BNNA 4DV5O 4QX3A 1CAVA 3CL1A 3EBRA 1JH5A 1UWWA 4LPLA 1GN6A 1Z2GA 5JIUA 5KAIZ 1NQJA 5FQ0A 2VZOA 1ZREA 1S5LZ 4LA3A 3ZN1A 4UFLA 1MS9A 4ES8A 3W7WA 2JE7A 2W1SA 4Y24A 5JDBA 4P9WA 3BU7A 2W0XA 2ZR3A 2WFPA 2O14A 4KHPO 4YPJA 2UYBA 2J1UA 1OXCA 2BDRA 2ARBA 3BA9A 1GZ9A 3JCUZ 3ZYJB 3ZYHA 1SEFA 2JK5C 2WS92 5I0DA 5EV7A 3CRQA 2A3YA 3NJXA 3ASNC 5CFDC 3VLBB 4NKGB 1QQP3 2UXBO 2VOVA 4R52A 1O59A 1LULA 3HT2A 1TMF3 4YHHB 3OD4A 2UXDB 1KP3A 1AL21 3O7OA 1XOYA 4FK5C 4OVEA 5IUQA 1J83A 4LK6A 2R49A 3DKQA 4UCOA 4UFIA 3LFMA 3EJKA 3QCWA 3T2MA 5J37A 3PUHA 1V6NA 5CB7A 1ZRDA 1S1AA 2X6BA 3M7AA 1V00A 3I3QA 3E22A 1DQ1A 5KHGA 2CAZC 1W05A 1OURA 1OBNA 1O9GA 4RR3C 2WFF3 4LE4A 1HB4A 1RP3B 1CR7A 1DFQA 5A6QA 1FXKA 2OYZA 3OTFA 5IK7A 1PVC1 4S2FA 2VO5A 3IIAA 3OGJA 1V6KA 3ZEDA 2HWC1 4JAUA 3L71H 1ENXA 1ODNA 3TNQA 5JAXA 1KXGA 4X62B 5FLXN 1OA3A 2YEVB 3AG4B 4V2WA 2BSKA 4EZ4A 1S3JA 1DF4A 3AB0A 4HZ3A 1HNXB 4DR1O 2XQXA 4YW5A 3FFZA 5DECA 1LHNA 4R4XA 5C3PA 1O7FA 4DFSA 4GX1A 1JHNA 5L9BA 5FUPA 4CXXA 3ZRSA 4K1ZA 3OBAA 3QNEA 5HBAA 2DVFA 1KGYA 3WP6A 2XL9A 5JVDA 2ODMA 2EIJB 1P4RA 4O2BA 2QR4A 2B5HA 3AMMA 2TEPA 3ROUA 1W8HA 2RDSA 3TEWA 2VNOA 1NR7A 1BCCH 4NWVA 3FBMA 5C3RA 1RYYA 2YIBA 2V73A 4C1XA 3CWBH 3K48A 1UZYA 4UVCA 4Q4X2 4AVTA 2WNVC 2X53S 1NVPD 4BU2A 4AQSA 2JS3A 4AHCA 3WUDA 5CMUA 4TV8B 4UW4A 4UCTA 1IG0A 1UYYA 4KMQA 1S0CA 4HFSA 4N90A 4BR6A 3CCEV 1JI6A 2EXHA 4NXNB 5JSPA 3P3PA 3W7UA 4JI3B 4DRVA 3VBHC 3DPRB 2ZT9B 4RGGA 4JI7O 2Y4UA 2W92A 5ABJB 1XSQA 5A3WA 2VZQA 3JARB 1GQGA 3DYOA 3HKDB 3LZZA 1M56C 4HVOA 4LH6A 4K0KO 5HCAA 1XSRA 1YSCA 4JDOA 1QJU1 4FLWA 1BE3H 3RYCA 3QLQA 2Z3YA 2VUAA 4B3TB 1SKVA 4F4LA 5KHKA 4NO4A 3PN1A 1W9SA 5JXJA 5H6QA 4AOCA 4R9DA 2JGDB 2VAUA 1Q7YW 4X1IA 5LA6B 1KS4A 5IAXA 3AJZA 1HN0A 4RD7A 1JX9A 4WM7C 3L9JT 2WLLA 2KG7B 2IXIA 2XJQA 2OTJV 2XVGA 3PTYA 1UZVA 2BWCA 1ORQC 2GHYA 3MFCA 3O1UA 4E4ZA 4GMP1 1S72V 5FKCA 5CA1A 5BUVA 1W2UA 2G4IA 1GICA 2Q0AA 4GWNA 1JXNA 1DQ2A 4A44A 1WBLA 4NHLA 3TETA 1M56B 4DUYB 3K4DA 2YU2A 4U3JA 2O8QA 3RZMA 1UXXX 4QX8A 4FTSA 5A3UA 4R50A 3NV2A 1H2MA 3W9AA 1OCCC 3EXAA 5GZDA 2WAMA 2GNDA 1GN4A 5EPAA 2EBOA 2YXHA 2CDPA 5FMOS 3C2UA 2PI5A 1B04A 1CWPA 3BTAA 1YUDA 4NE9A 1YJ9V 3FZ3A 4XACA 2BTVC 3K77A 1DGSA 1AL22 2X8KA 2YMZA 1NOVA 3ZN5A 5CA0B 1ODMA 3A0KA 3HKCB 2QJ1A 4AEDA 5LGNA 1EZVH 3TYJA 1VP7A 3NNLA 3TN93 3ZXEA 2NMOA 3PUAA 1ND3B 2HHHO 1VJ2A 3QF7A 3SH5A 1QJY1 4I4TB 5IJ9A 3IM0A 5J09A 1N47A 2JDMA 3W7SA 4UVAA 2BGCA 4YJ2A 2NYYA 4JYAB 1ENRA 2R32A 2FB5A 3ZN6B 2FHRA 1KITA 5HXVA 3NO8A 3G6JB 1YEWA 1NZIA 4NROA 1OZ0A 3OUIA 4XJ9A 3U1XA 2BU9A 2XHKA 3K3OA 1PNFA 1KC8W 5D8AC 1WMFA 4XDQA 5LA6A 2DBIA 1XNAA 3R4DB 4CS2A 3RYCB 3CC4V 5FPLA 3S7IA 4Q8KA 3W5MA 1QXPA 4M3CA 5LHGA 5FLJA 5AFBA 1NXD1 4Z1MG 5FRAA 2P17A 2XBO1 2WINB 1LOCA 1HIXA 4CDUC 4ZZ5A 1WLWA 2WWWA 4EJRA 4JGSA 4AILC 1XMQB 5HV4A 1R73A 1W9TA 3T2TA 5JWPA 4UB8Z 4BH9A 4UCVA 2DYRC 1IPJA 4Q4V3 4XJAA 1I5PA 1J95A 5F3EA 1PO11 3POBA 1O5UA 5DN2A 2N05A 1K5MC 1UU4A 2OCCB 1HRI2 3GYDA 4MW8A 1C8NA 1HW5A 1YC61 4CP9B 3O65A 4BQ1A 1X9TA 1VIWB 1QJU2 1W0NA 1FD9A 2V7QG 4CDXC 2VOTA 3CJIA 2WZR1 3J8F3 1EAH3 4YYOA 3JARA 3CKHA 3KD4A 4P30A 4JI4B 5BXZA 2QDOA 3T1MA 4XF3A 5JPNB 1JW6A 1F23A 4PIZA 4DXTA 2P6HA 2E31A 3I49A 3CSXA 1Q8IA 1O3RA 3OBTA 1U5XA 3IIIA 1JZ6A 4O9GA 3SYAA 2PHFA 3CEWA 4AE2A 2DJVA 4DK1A 1STMA 2F6BA 3SR2C 1NLRA 4LF8B 5LMUB 3CCQV 4XMAA 3JAKA 3USUB 1REDA 5LBCA 4BPZA 4W4LA 1NKGA 5A7PA 4XFAA 1PKXA 1O5LA 4R4ZA 2ZE5A 2Z5WA 4B4QA 2ZDIA 3O1TA 2HKXA 3HNBM 2D3OW 2WLIB 2W46A 3FLPA 1XL4A 3P30A 1KD1W 1YHFA 1DLLA 4WFFA 1WKYA 2FBEA 3ZHUA 4UWDA 1SMVA 2XJSA 3BOWA 2E51A 3VKNA 3PUIA 4NHYA 2BTQB 2EJRA 3ACFA 1W8UA 1R082 3HKEB 5BNPC 1EPZA 4LO4B 5IVEA 2JG8A 1IBLB 1ZZ6A 1BMV1 1SDWA 3BVOA 4YGEA 4Q20A 2YPDA 3D3QA 4C1WA 2EIKC 1WZXA 5JCOA 1DQ6A 3B69A 3FBYA 2XHNA 4FMTA 3FMGA 3VBBA 1Y74A 3LFIA 5A1AA 1OPOA 1V6IA 2V5YA 5FO9B 1YXWA 1M93A 1I5YA 2B9VA 4LCUC 1I7FA 3ZR6A 4TTGA 4I0XA 5FZKA 5FMBA 2HEPA 4H0LB 1YYNA 4KWKA 4PDVA 4QXBA 1ST8A 3ELNA 4JKMA 4QXCA 2FZ2A 3ZYRA 2P3IA 5FZOB 5I91A 4KWJA 4E4DX 1G86A 4K8RB 4NPLA 4KXRA 2GC2A 2PHWA 4IV3A 2DQ3A 5BY1A 2Z42A 2SLIA 2A3XA 1LHOA 3AG2C 4XAAA 3PURA 4DV2B 3IDCB 1QNWA 2VOWA 2ZGOA 2HWE1 4N53B 3K2OA 4EEQA 3UL2A 3ZLIA 1S2KA 1G9AA 4IEXA 2LJ2A 2QQPA 2Q5ZA 2RN9A 5LGUA 2VQAA 3THCA 4HANA 3RZGA 1KEXA 3M7MX 4PLNA 4TUYA 4ARYA 5F6KA 1A32A 2W47A 1L0LH 3CBNA 3ZJZA 1US2A 5C8YB 5CISA 3AMQA 2IWGB 2Q9LA 4G28B 3S7EA 2JDUA 4DR3O 2HJIA 4GJZA 4B08A 4DPNA 3UK9A 1W0KG 5EYPB 2KXLA 4FVMA 4AVCA 4IW3A 1HQLA 3ZXKA 5FO7B 3RRDA 1LENA 4IE0A 4KBBA 3LDEA 5ACA1 3T1CA 1UMHA 2D6KA 3PJQA 2Z0AA 1TZOA 1XQNA 2WZ8A 1DQ4A 4G27B 2VQTA 4PHZA 4LFAO 1ULDA 5JJNB 2C26A 3EMRA 2NQYA 4JI2B 3E5XA 3O1SA 3ZVXA 1VBE2 3UETA 1FPN3 2Y69C 2RJ2A 3B02A 4JQTA 3HN1A 4FLTA 3AL6A 1NCQA 4Y5SA 1H9WA 3OEHG 2QWNB 4FFGA 3HQXA 4ICGA 2WAOA 2DCKA 3JB8A 2CUGA 2H6BA 2HKOA 1YFXA 3TN91 2YC2A 4RO2A 1XC6A 4HPKA 5GLZA 3AL5A 3NAPB 4XCBA 2IVIB 2X05A 1M9NA 1AR63 3WDYA 5FZGA 4IV3C 2ZA9A 2G9ZA 1VBC2 1LNQA 2DWRA 1JQ0A 5D1IA 4NYKA 1ACCA 4AVSA 4UF0B 3G4SV 1DZQA 3ZYIB 2D43A 3SPGA 4OI2A 4P9YA 3RG0A 2XWBB 5JXGA 3T2QA 1K3EA 5FXZA 4COWA 1V0AA 2BTQA 2Y69B 4RUFA 1VQPV 5GLVA 2Q8VA 3PJYA 1F35A 3KV9A 3VN4A 1T5EA 3W5NA 4B7KA 2WNUA 2WN3A 4N7UA 1SS3A 2ATKC 3MD0A 3RW0A 2VTXJ 5JOYA 1M90W 1UOGA 1K33A 4EWEA 1AHSA 1RUF1 1PMJX 1VEWA 4CP0A 2ITDC 2AREA 3DKWA 3IWZA 3VKFC 1SETA 4EB6A 5F7UA 3LNNA 5FPVA 4JI5O 2WUHA 1R64A 4XZPA 4MTOA 1MS3A 2HWF2 1DTOA 2VQ0A 2GC1A 5ITZB 3O12A 2HVKC 4G2KA 1H8TB 1LEMA 1EV11 1DGRN 3M2MA 4FBFA 3K5LA 3W59A 1AVBA 2LGWA 4YM1A 2WR9A 3X29B 1BLZA 5EJZB 3ZXJA 4AQYB 5FP4A 4IV1B 4EV0A 1QKQA 4A41A 1OHHG 5LP6B 5KC6A 5F8PA 4ZXKA 1F4MA 3OGIB 2NP0A 5BZBA 1N34O 1C8M1 5SV5A 5LY1A 3CRMA 4YVWC 2E5LO 3SEPA 3LDDA 3RYKA 4I3PA 1RMU2 4Y22B 5L3GA 5F37A 2LTNA 4Q5OA 1XNDA 2FCTA 1LR1A 1AR91 4XHBA 2EX3A 1YJKA 2ARAA 3RDIA 1SQQH 5C9AB 3WQ7A 1W28A 4XQDA 3CJHA 4I5SA 1YTFD 3U11A 4O2AA 2QTWB 2JE8A 2UWBA 2PHTA 3MAQA 2HWF3 4WV8A 4UUJC 1W6PB 4X88A 4NOTA 4IEQA 3AP6A 2J22A 1CP9A 3PMEA 1POV1 4X1KA 1OUSA 3UGHA 4NIGA 1K92A 3OBZA 3AEIA 3ACLA 1TVKA 3OBRA 2EAKA 4B3SO 1QJX1 1QXRA 1D5AA 2VQEO 3J7NA 2VG9A 2HJFC 2VY0A 3NWKA 4AQ2A 2VR4A 5FY8A 2WRAA 4E4EA 4ZI7B 1O3TA 2PYTA 4CDUA 1RUI1 3TJTA 1FV3A 4PDMA 4R9CA 5A1LA 4HKLA 1DDLA 3I2KA 5FZLA 5IVYA 4W6YA 4QHZA 1JOPA 4DV3B 1V9U1 3SJCC 5FTTC 1RUJ3 2WFF1 1WW4A 4KU7A 5BY5A 5IK4A 1B35C 2JKXA 3NV4A 1XU1A 4LHSA 3ES1A 4UV9A 3B2EE 3OYWB 2OPWA 3SC7X 2MPFA 4TYSA 5GKAC 2F23A 3RSJA 3ZIAG 4TOIA 2LP7A 3SEEA 4MVZA 4DR7B 3IAPA 3PTRB 1D0HA 5BNOB 3G6EV 2FDHA 1ZZ9A 2YBKA 2ZMNA 3H8XA 3L72H 4V1PA 1KJLA 1UOJA 1I9RA 4RHV2 1S0FA 5LBBA 1XNRO 3KM5A 3F7VC 1XRUA 2Y60A 3VBSB 5K0UA 2ZGTA 2ZGNA 5A32A 4OMDA 1NCRA 5GJ6A 1GP5A 2HP8A 3ZPYA 1AI4A 4FPJA 5EQUA 2LW7A 2C0ZA 1AR82 3GVMA 4NHXA 4AEDC 2X0LA 4NRQA 5FPUA 4DV5B 5KXCA 3LQCA 1TUBB 4DUXA 2YB7A 4I0AA 4Q0QA 4FPGA 1NJIW 2E74B 4HETA 1MSWD 1NTMH 3SYPA 4MSWC 3HKDA 5A3TA 2QQWA 1QOTA 4J1WA 1IDSA 3O1OA 1JYIA 1PNLA 1ZZ7A 4B1MA 4HK9A 2DCZA 1JZ4A 4A3ZA 3ZN0A 4WFBV 2VZTA 5L7OB 4EWAA 1QY4A 1GOFA 4XBNA 1JZ5A 4HONA 4L9BA 4DV4B 4QU1A 2VNGA 2VVFA 3H1LH 4O4HB 3AG7A 4BW5A 1YF2A 1JCHA 2IVJA 4MO3M 1IVSA 4HXCA 3J9SA 5J2UA 3AM2A 3OM3B 4IETA 4AW7A 3UCSC 5F9TA 2GSMB 5CBFA 4BQ4A 3ZSJA 5EIYB 1UFIA 2RMU3 2NMNA 4LF8O 1VAVA 4ABMA 4CUCA 2X6CA 1AYM3 2OQ7A 5KHJA 2YROA 1N0JA 3A21A 3CRAA 4I9QA 2QM7A 5D21A 3CCVV 1A78A 1A8MA 5J2TA 3H9AA 4K9SA 4LUMA 3G80A 2JGUA 3MEPA 3ABMB 1K5SA 2GAUA 5FZ9A 3NL1A 3RN4A 3NJZA 2WNUC 1GBGA 4UAPA 1ND3A 1Z5VA 4J80A 1H38A 2V09A 2CYFA 4MZUA 4LC1A 2GTSA 3H9VA 2Q7HA 1SESA 5B3SB 1TMF1 1PVC2 5C8CC 1WCQA 3NKTA 2ILMA 4KHPB 1O4TA 4NHKA 1FAYA 1HV1A 2X09A 5FOBB 1ULGA 4IE6A 2RS32 1SHWB 2WA3A 3VBUC 1PGL1 3RPQA 5D2AA 3ZFFB 1QH7A 4P08A 4YIPA 3LGRA 5LXTA 3APBA 4DR5O 4PA3A 5IT9N 1EZJA 1COV1 5C93A 5IATA 1UYZA 2WNVA 2CY6A 4LBLA 1YJWV 3LKJA 4D3WA 1QVFU 1FPN1 4BM8A 4GKJO 3DXRB 4X6RB 3IMMA 3RI8A 3J7AU 1ALYA 1NLSA 1UCXA 4JRAA 4IGOA 3M3CA 3VDDB 5CFDB 3ABZA 2XVKA 4R8HA 1PVXA 2K9ZA 3PJSK 4AI0A 1B35A 1JOBA 4IEUA 4KGQA 2VUCA 1V6LA 4LK7A 3ZXFA 1DG6A 3BB6A 4CCJA 5BMVA 2W52A 3LSQA 5FNVA 3MPPG 5B1AC 4RQFA 4GH4B 2MHFA 3N9QA 2ZE8A 5EIBD 1O8PA 3C90A 1GZWA 1GZTA 4EN6B 3H1KH 1C57A 1PGW1 2DUOA 3SJBC 4B1LA 3SPHA 2EILC 4HZFA 5FY0A 4MGIE 2Q30A 4IEOA 2X5IB 4I30A 4DIQA 4WFAV 2Q69A 1IBMO 4LBEC 2AZ2A 3MHHC 3ZM8A 4PI2A 2IM9A 2Y6KA 2AACA 1DLCA 4QGLA 1JVMA 2XQRA 3I55V 1CAUA 5J2UB 1VBA2 3WG7B 3JBG1 1V9PA 2GDSA 1SBEA 2LUWA 1QHTA 5CB4B 5EZWA 1FYUA 1ZRRA 3AKTA 2VCBA 1HRV3 2D7FA 4E2SA 3B4SA 5C33A 3PMSA 1FS0G 4Q1PA 2HBTA 4H3WA 3LDBA 1UY2A 4MGSA 3WX5A 1UY4A 4GXLA 1JZ7A 2WT1A 4G9SB 4XPVA 2RS31 5KUMA 3RVHA 2J1VA 4YVWB 2EULA 3OEBA 3QO7A 4MGZE 1S76D 5F6LB 3VHPA 1NU1H 2PMWB 3B00A 2RR13 3THDA 2OCCC 1Z78A 4O65A 2QWOB 3AVRA 1OCRC 4DUYO 2R071 5BNOC 4PT6A 4OMCA 2LGQA 1GOHA 1W2TA 5F3IA 5K1XA 3WP4A 4TWKA 1SLTA 4Q4Y2 2WZR3 4AI9A 5GW7A 1TME3 3ZHSA 4BQ2A 1PX4A 2XJVA 4Q6GA 1PO21 5ABJA 4X65B 1A6CA 4ZOLB 1R1A1 3MV11 1XNBA 1GOGA 1HNWB 1VMFA 4QE9A 4JGZB 2EVXA 4X8NA 3MW4A 4DUVA 3BPZA 1W9YA 3ZIWA 1WNSA 1K5MA 4AFAA 5J36A 1VARA 3K4AA 4S2DA 1X8MA 3MI8A 1V55C 5LMNO 3EQEA 4PLMA 5I8SA 3B9CA 1WLDA 5KXDA 4PA7A 4YXWG 2R0FA 1KQSU 4RFRB 1UU6A 4CU6A 2QWPB 3RGBA 3CC2V 5CYYA 3FWEA 1JS9A 1LOAA 3O1VA 1VF6C 4DW1A 5I0TA 1ZX5A 2GZWA 5BMVB 5FL7G 4QMAA 5FYZA 4B4RA 1S2EA 2XLAA 1W03A 1VMGA 2CK3G 1OQEA 3M3IA 2ET7A 1LECA 4W4KA 1W59A 4DUWA 2RJLA 4JKLA 4YWAA 3PL0A 1ZZ8A 1R1A2 2VVDA 4BYYA 2UUCB 4Y20A 3DYPA 3ACIA 4LNUA 3SCGA 4DV1O 3H3LA 1AR5A 1SPPA 3RQ0A 1RITA 4QE7A 1VQNV 3IDEA 3OPZA 4W6XA 2J1EA 1ULCA 1A34A 1VBA1 2JB4A 1H1AA 1UKRA 1S4CA 2DCJA 4LXLA 4IGPA 4NPRA 1GNHA 2C9KA 5HFMA 4BIZA 3U07A 3E35A 4J7KA 3GHNA 5FWJA 4DNYA 3WDWA 3I59B 3KS7A 4DR1B 5FZ4A 1AR1B 2OUHA 4F8AA 1ZBE1 2SBAA 1SQ4A 2R062 3THOA 5A3PA 5EBWC 4TLFA 1PGW2 2XBO2 5FK8A 3N9MA 1LHUA 4LITA 3SH4A 3UGGA 4U3JB 1VBD1 1I3HA 4NRMA 2P7TC 4DV6O 5H9CA 4K1YA 1WW6A 3OY8A 2D5FA 1COV2 4AWDA 1REEA 3HBZA 1UN1A 1GP6A 1ZBE2 1QLNA 4P02B 1HQNA 1G9DA 1NE6A 5FPXA 1D5NA 3D3AA 4A6OA 4D0QA 4Z2AA 2R063 5FK7A 4GX2A 3ZRWB 5DAPA 4MGTA 2P90A 5DZFA 3A0HZ 3OJBA 1CAVB 1NKDA 4B7EA 3NNFA 1UXZA 4RAIA 2XDVA 1AILA 1MQTC 4U7NA 2O0OA 5JJEB 3RYRA 5M0TA 3SQOA 3N4MA 3G67A 2VUDA 3RT3C 3FB8C 2RM22 4TN7A 1CX4A 1HJFA 1VQ6V 4ZIBA 2G1MA 2X29A 4JKKA 3LIGA 2VZUA 4QWNA 2EIJC 2B39A 1OA2A 5FYYA 2VQFB 1BQZA 5IVJA 4XIOA 1SCRA 2HWE2 1EFRG 5DMYA 1Y6XA 2YXYA 2PHRA 2HLEA 2WO1A 1JMUB 1W99A 3E6CC 3NVCA 3JD72 5CIRA 1OA4A 5T50A 3OG2A 2CTRA 5A3NA 4YY3B 1XQ8A 1H8EG 4CH3A 1NS1A 4BLIA 1PO23 1WUVA 2G9FA 4LFCB 2JJ2G 1VQ9V 1N36B 2W87A 4KWUA 3VDDA 4NIDA 1HX6A 4X64O 4JC1A 4P9PA 4BLJA 5LBEA 1VMJA 4X1YB 1O4ZA 1RC6A 3ZHQA 2KM2A 3VD4A 4U36A 2ZGQA 2IXHA 3HPNA 2YSUB 1HB1A 1QNMA 4FTEA 4DR4O 1UD1A 2QUOA 5K0UC 3CCMV 1W8TA 1FJGB 3OMIB 1S0GA 4HKWA 1UX6A 4L8QA 1XBFA 1D2DA 3K0DA 1NA1B 5FZHA 4DRRA 2ADQB 4F6RA 3SDLA 4HLTA 1QH6A 1SF9A 3QO8A 1D7PM 1OOPA 3N2KA 4IIJB 4YARA 3D0SA 3OW2U 1H6YA 4KG0A 2ZX3A 2QDNA 5ISLA 3RVZA 2RDNA 5EYXA 3NJVA 4BXFA 1QLEB 3ORJA 1K7DA 3VD7A 5CKNA 2EXJA 4I55B 4ITCA 1VBE3 2JJ1G 2JDIG 1FAFA 1UKGA 5F32A 4OI0A 2ZMKA 4AHYA 3POWA 4WM8A 3E22B 1VQLV 4CDWC 3GJBA 3JQWA 1S0EA 5APAA 3HKBA 4N21A 2V5DA 4J9YB 4TV8A 4COYA 2DVBA 1W6NA 1N1SA 4DK0A 1NH2B 2VMFA 2JDAA 2BNMA 4PF1A 4YM2A 4OGQB 2ZMLA 4FPYA 2ZIOA 3ZO0B 2WWJA 1XNCA 5A7QA 4CA9A 3CU7A 1RUE2 4QPGC 1RUJ1 1JYCA 1NY71 4FIPC 1L7LA 3NJYA 2CAUA 1VAKA 1W8WA 5EXOA 1VMHA 4Z82A 4DUZB 4FJCC 2NLRA 3GXUA 4PI0A 2R072 1AJOA 5H9RA 4I7ZB 2Y6GA 1G8MA 3VKMA 1V6MA 4X20B 3CCSV 1V6OA 4X8PA 4KFMA 1RUC1 1RUNA 4XFBA 4HVRA 1YIPA 3M70A 4YVWA 1WB8A 5KBFA 4K8XA 4MVRA 4EB6B 1HNZO 1JFFA 3ZFEC 4QB2A 2XT9A 4N43C 4QQPA 2Q6AA 1N36O 4M3CF 1SZXA 4OHYA 2Z4FA 5BNQA 5JVDB 4J7JA 3B01A 3D3IA 3A22A 4CPBD 4HVQA 4P5HA 3A23A 3NV1A 3AMHA 1B06A 5J7MA 4YJ3B 2GUZA 2PI4A 3IN9A 1FOD2 2VMEA 1O6UA 3D0JA 4GWIA 5FYTA 1SERA 1CQ9A 2XR4A 3WF4A 3H50A 4XDLA 2UXCO 1SQFA 4LKSA 1JJOA 4XFHA 4Q26A 4OLLA 2D6MA 5A3OA 4ZHQA 4RFT0 5BNPA 5DUXA 1VQ8V 3VBOC 3S30A 1AJKA 5HCHA 5IJ9B 2ZACA 4MV2A 2BQPA 3TOJA 5EBLC 4I55A 2HEWF 5C3QA 1EYBA 1R092 5JJJB 2VZVA 1AXZA 3MGUA 1AR61 2RMU1 3CMAV 1J1LA 2AYHA 3ZRXA 1W39A 4I0WB 3ETQA 1NE4A 5LL6Y 1FI2A 4BZ4A 1ZSPA 2GC3A 3AXEA 1VRH3 3WV6A 5FREA 1XNRB 3A2FA 1TVKB 4U2AA 5CA1B 5HCFA 3S0MA 2BBVA 1GM7A 3TRSB 5JLVA 4LF4O 1Q8QA 2QTSA 1ULEA 5A80A 4DEVA 4DR7O 2BP6A 5CA6A 1QLEC 4N8MA 2JD9A 3B09A 4NRPA 1GKBA 2EIMB 4AHZA 1RUF2 2OA2A 4Q2FA 3SPIA 4YG3A 1Q81W 4XXAA 2ZHKA 2VMCA 3N7LA 1N32B 1WA8A 1R1BA 3SLIA 2FMDA 3T0BA 5JOXA 1WD4A 4CU7A 1DGWA 1CPNA 1XNKA 4XVHA 5F5IA 3OGRA 5FY4A 3VOUA 3ZYPA 1DYPA 3ZDSA 1PGL2 4WM7A 2XH6A 3CCJV 2OYQA 2OUJA 3C7HA 1V9U3 2K1EA 3JXSA 4K20A 2N74A 5DAQA 4TLGA 4IEZA 1KUQA 5LGTA 2Y0OA 5LBQA 1WP7A 3CCUV 1PM9A 1IX9A 3JALB 1SLAA 2VL4A 2MK3A 1MSDA 1HRI3 1PZ8A 3POYA 3VB9A 2PN5A 2CL2A 5LMNB 5KWRA 2IJJA 2PLV2 2FMYA 4I50A 2EINB 2AC1A 1YWKA 3NXSA 1WBFA 1OCZB 3Q8FA 3K75B 3S5QA 4Q4W2 4MVUA 5IVVA 4LJHA 1AJNA 2AENA 4O4LB 3RWNA 3IZOA 5FFOC 4WVMB 4AFMA 4MG2A 2UURA 3FHIB 4CCCA 3ETDA 2VW0A 4IGQA 4N7IA 1HB3A 2DF7A 4GALA 4A6SA 1QJY2 3TAYA 5CU1A 5FYIA 1AI6A 1QR8A 3RFRA 2BOJA 3VQWA 2Q8OA 3G7DA 2LFRA 4JYCA 1JOJA 5A3LA 4FSJA 4WBNB 4Q0PA 4XBLA 2EICA 3R6SA 3DXRA 5LWBA 3STLC 2KD7A 5FPAA 3GJAA 4E2LA 4QPGB 4FPHA 1NT0A 3I7DA 3VDAA 3BUCA 1D4M3 2RE9A 1CONA 1MVQA 3FLTA 4ZPIA 4GAZA 2HEYF 1ASJ3 1ASJ1 3JQXA 1I5ZA 3UNPA 2QQJA 4BQWA 3ZFGA 3CMGA 2IBZH 1WA4A 3JD1A 2WS91 3OOXA 1OD3A 4CDQA 3HIFA 3FJSA 3JCZA 1B09A 3NAPA 4LHLA 2BFUL 5FJKA 3RYIB 3WINE 2JG8C 3HAGA 4MSVA 5FLIA 2D6OX 4YNIA 4BK4A 5T54A 1M06G 2R041 1DYOA 4O7XA 4DV1B 4YIOA 4LBMA 4LORA 2WC2A 4LBQB 1K4CC 3BFRA 1EAH1 3F2ZA 4XFIA 5DXDA 1AR62 1F31A 3R66A 2ZEYA 3JD73 1BJQA 1LOEA 2IXLA 3APOA 2VZSA 1W3VA 3J8F1 1GMGA 5LBFA 4Y1UA 2CDYA 4META 1COWG 3KGZA 4COUA 1LGNA 3ZRVA 4YGCA 2JIJA 1FFTB 4RQPC 3RI9A 2A5ZA 3WCRA 1VF7A 5FZDA 2CGNA 5E1RA 4Q4X3 1BYHA 5J2TB 3M3EA 1ZUQA 3SPCA 5CFDA 1NX9A 4B8EA 2WQ8A 2YZ4A 3O1RA 4NAOA 2VRZA 2E75B 2AEYA 3CJIC 1QNYA 1UOBA 3WQBA 1OLMA 1HB2A 1MS4A 4Y33A 4BQ3A 1X82A 2WN2A 3AMPA 4N43A 5FP8A 1S2BA 4YW6A 1U5ZA 2H0BA 3Q8EA 4E8CA 3OR7C 2UUAO 1O8SA 4MYEA 5B1BB 2XHBA 1XJAA 3H0OA 1GP4A 1W6OB 4QHBA 1PIV3 1ULPA 1GU3A 4BJ0A 2QZ3A 3EHKA 2PQQA 3LSEA 1R3IC 3K03A 3UGFA 1RSOB 2ZNIA 3I4IA 3ILFA 4LFBB 2F4LA 3ZHRA 1CZVA 3KF3A 4IYHA 5T3NA 1AR72 4N43B 1R6NA 4NIIA 1DZRA 4BISA 1ULFA 5B1OA 1OLRA 5C3SA 3WW3A 1RUG1 5D5PA 3H1MA 2GALA 4BCUA 2DTWA 2QKAA 4M3CB 1RHI2 4GWJA 4LFCO 3OF1A 1PV0A 2WAAA 4K3AA 3I3BA 2RVAA 1PO12 5D8AA 2E76B 1SFPA 4OXSA 2Q1MA 4P9JA 5EHDA 4GLXA 5JVVA 3PVOA 1APNA 4CCNA 1XUQA 3W7XA 2PLV1 1IS5A 5B4XA 4JRLA 1XE0A 4CUAA 4WM7B 3Q9OA 2IU0A 1W0PA 3VZKA 4DZGA 1QWRA 4YW7A 4XJWA 4YSFA 3BAAA 2UU9B 4A2UA 4BW9A 4QT6A 3VUOA 4BIFA 1FXVA 4JTDB 1QQP2 1FOD3 4LR3A 1NTZH 4DV7O 2X6AA 1ND2B 2DCTA 1TA8A 2H6CA 4AEMA 1PL4A 1GM9A 5LMUO 2AEZA 1HXS3 5LATA 3NV3A 1HDKA 3ZR5A 1HV0A 3HKCA 2XAJA 1VR3A 3D5OA 2V4AA 5FY9A 2O8OA 3VKLA 1K5MB 1BEV2 4XXPA 2A73B 5FZ8A 1SLLA 3OCPA 3KCCA 2LROA 2FDGA 2LM3A 2ZKNA 1EP0A 4AHWA 3C7OA 1F5JA 3JBG2 1H0BA 4TV9A 3ZMTA 2WZEA 3ZMVA 3UM7A 2E32A 1W9WA 1HDJA 3WU2Z 2X5IC 2ZGKA 3AZZA 3PIGA 4OHXA 1KMIZ 4AQ6A 2PQSA 2A3WA 1NCQB 3JALA 2HWB3 4YZ3A 5HPOA 4XYXA 1IHMA 3M4FA 3OSDA 2EA7A 1V6JA 2VCCA 1LAJA 2VM9A 4FM0A 1M1KW 4F6RB 4EQVA 3HJRA 1FXHA 4X64B 3JCIA 2BUKA 2IUWA 1R083 2R6QA 4PDWC 4C90A 2P37A 2ZQMA 4DR4B 1R091 4DOUA 2Y48A 4Z2WA 5LP6A 2XUEA 1W8NA 4IV1C 2DYRB 2A6WA 4MGKE 5LW9A 2C24A 1QBZA 4JI2O 2A71A 4QQOA 1VPHA 5DAXA 1AXYA 4L97A 2RHPA 2PAMA 3TWIA 5KAFZ 4PQ9A 2RDRA 2PF4E 4O4HA 4QKFA 1XE7A 1ENVA 4TWTA 2DWDC 4M00A 1L0NH 2YC0A 1GUIA 2XAQA 4R9BA 1G9BA 2A7AA 5ANNA 3HR0A 1DF0A 2HWD1 2FDJA 4PJYA 3ZFGC 1OVPA 1DP0A 4YJ2B 3I54A 5CVRA 4GX0A 5KX5B 4XMIA 4Y20B 1OHFA 2WKKA 4XETA 2AHYA 1PK6C 5CN0A 2WO2A 3QH6A 3AG3C 4CCLA 2WWSA 2HWC3 1UU5A 3UKTA 2Y6HA 5FPOA 1ZZCA 3K5MA 4K8ZA 2ZAAA 4CEYC 3ZMUA 3SITA 2C1FA 2WO7A 4GX5A 1Q8VA 2JRIA 4NXNO 3GWKC 2FCVA 5C71A 4IERA 2WJSA 1F8VA 1OKQA 5JR2A 1XU2A 1F4HA 4LKEA 3VBSA 1W2BU 3FHAA 1M57B 4Q1RA 3ZS8C 3WHTA 1SPPB 1CZSA 1US6A 3E8BA 3KV4A 2WA4A 2P6CA 1XYNA 1HRV2 4UFMA 3BPSA 3C3VA 4YZ2A 1CAWA 3WD5A 4LOTA 4W4ZA 1UJWB 3H8RA 4CZSA 5KXBA 1FXKC 2YIAA 3KWVA 1VQKV 3BGAA 5FR3A 2FDFA 2DV9A 2HWF1 2WLJA 4W50A 3H1IH 3CPWU 3VBOA 3OT7A 2CDOA 5A32B 1UPGA 4FAGA 3USSA 5KR7A 3SYOA 3VBHA 1RUD1 1RUD3 5GLUA 1HNXO 1Q56A 4LF6O 3AG2B 1QU0A 4XFFA 1QOSA 3M1HA 2KR2A 3V0AB 1OLME 4YVSA 1Q3EA 4ZI7A 4CP1A 2ZX1A 5FXWA 3L70H 3JASA 2GDFA 1M4UA 1HP8A 1C28A 3GGLA 4GCZA 1SFYA 3B5LB 3I8TA 4AAPA 4V2VA 3ZHVA 5LEJA 2GUZB 1S77D 3DV8A 5FO8B 1PIV2 2AGSA 3JD2A 5CG9A 5AFEA 3A0RA 4OZXA 4FP3A 1VBD3 2XXZA 2RS52 4Y1ZA 2RQ6A 2L6LA 2PELA 3POSA 4DXWA 5B3SC 2BOIA 1GV9A 1K42A 5BPXA 3ZFEA 3H1HH 2ZABA 3AYDA 4WFGA 1VBC1 1BKZA 5GLWA 4DY3A 2J7MA 4RUEA 5JXHA 5DEDA 4IEYA 4I3GA 1LEDA 1H4HA 5EK0A 2MNGA 2EINC 1TE1B 1HQWA 2YHJA 4LF7B 3NR7A 3EB7A 3AZWA 2ZKOA 4IL6Z 2WSUA 1JA8A 5LHIA 4ZU5A 2IXCA 3H8OA 3FB7C 2RS13 1AVMA 1QMJA 3CX5F 3J7LA 1HNWO 1GZWB 1CJDA 4FVVA 3OGSA 3I3DA 1ZYBA 5JZGB 4RGAA 1GLHA 4WFHA 1J5EB 1VRH2 1UMIA 5J98B 2Y0PA 4AI1A 5FY5A 3BTXA 5DM6V 5IJRA 4OX9B 1SA0A 3CXCU 3WZ1A 2XKOA 2VOKA 5GLTA 1DZTA 1RUH1 5LA0A 1T6BX 3BODA 5T5LA 4BQYA 5K9YA 1CAUB 1ULOA 4L87A 3HOBA 4KGGA 1FATA 5IYCO 1N1TA 4LULA 1IPSA 3K5OA 2JEXA 2RCVA 5F3CA 2BVBA 3HNYM 2VPVA 2HBUA 4AI2A 4CDWA 3N9OA 1NAEA 5IJ0B 1IBMB 4WM8C 4XQWA 5FV3A 3ABMC 3N9LA 3RZJA 3QACA 2J1SA 2D3RA 1BGYH 1Q5OA 1P7BA 4AHXA 4JI1O 3B93A 3SJAC 3R0RA 1AX2A 2DOSA 1G4YB 3GZAA 1WCUA 2W95A 5JUVA 4D7YA 3JSLA 3K04A 1ZNPA 4K7JA 2WQ4A 5FBZA 1C8M3 1EAH2 2I74A 1SACA 4YFZA 4I0BA 2YG0A 5IFTA 4D6TH 2D44A 5T5JA 1UPSA 3AKQA 3CQOA 1YJNV 4W8JA 3LA7A 3OUJA 4ISRA 2CNAA 2XB6C 3JASB 4XHXA 4MT8A 2H8PC 2Z5UA 3I2IA 2EF6A 3CE2A 4BOWA 1AROP 4YY3O 3LDKA 4JI0B 2J42A 4MVOA 1XNQO 3DGTA 2J1AA 2CTVA 2ZGLA 4UXAA 2A3QA 3VDDC 2ITCC 1JHJA 1AUYA 2JVDA 3ATGA 2WL1A 1RB8G 1LNSA 4GKJB 4LOSA 1TNFA 3N9NA 3AG3B 3U75A 1EY2A 3POFA 5JPMB 1RUH2 4CYDA 4MTGA 2WIIB 2KKWA 3L73H 5I0RA 3ZX7A 4TQDA 1OQ1A 2WS93 2B1IA 3VKOA 1UL9A 3CDZB 5B66Z 4QDRA 3IPVB 4NR1A 1U97A 4HPKB 2IFWA 4E27A 4Q4V2 4I50B 1YQ2A 4FPKA 4H2AA 4ATFA 5BNNC 2HWB1 2PHDA 5C8YA 4GD4A 4D6RA 5A9GA 1ZBE3 1VB2A 2HH9A 4IGGA 5FYUA 2OXBA 2XOMA 4UBHA 2QFEA 3WUCA 3ZFEB 2F43G 1ZX3A 3H3UA 4FI9A 3MHZA 3ME2A 1GZCA 2R7EB 2HJDA 3IGAC 1P49A 3HT1A 5EWSA 4TV9B 3RYIA 3SKVA 1BVVA 1TME2 3HQRA 2P4EA 5KA5A 4LF6B 3U37A 3KG2A 2JIGA 5LEKA 1AP6A 1UPIA 4KH9A 3ST7A 4HNAB 1UOFA 2R0HA 3O0XA 2K2SA 1SBDA 2YU1A 4AR2A 2XJTA 4JHTA 1KBHA 1KKDA 1ZLZA 2YXLA 1HJGA 1UQXA 4XUPA 3NNGA 4BA6A 2BYVE 3Q8AA 3JSNA 1RUG2 1YLLA 3UO2A 3WF0A 3N35A 4DEQA 3POIA 4LA2A 1SQPH 3ABKB 2F66C 2ETEA 3F95A 1GQPA 2P4KA 2IXKA 4P9IA 3TXQA 2YXSA 2YY1A 2I2SA 3K79A 3SCFA 1OVSA 1SCSA 5ERLA 4IHJB 1CIYA 3R4UA 3VGIA 2VZPA 5G04L 4CCEA 4UFZA 1KDKA 4G4FA 4QPIC 5DG2A 1YJLA 4ZHNA 1IQAA 3D4KA 3LF7A 3QH7A 4YGBA 2E5LB 1LU2A 4Y3OA 3LEMA 4AGRA 2C4XA 2L35A 4F3JA 4B3SB 2HWC2 1AX0A 1I6XA 4TXWA 1HRI1 3PNAA 4WVWA 2OS2A 2YI8A 3MUY1 5B2GB 3K0GA 2ADDA 3JD71 4Z92B 4ASLA 1RUG3 3UESA 1AYM1 1WCDJ 2DUQA 2VBDA 2GBOA 5FYBA 4YZ1A 5IWAO 1J3RA 5DABA 2QQNA 2VXJA 4UXNA 4NMIA 2UXXA 1VBD2 5E88A 3DXTA 3IPVA 4Y1YA 4OFGA 4RS5C 4MLOA 4JZ2A 1H2SB 3CIHA 2R16A 5H9QA 3GBFA 2WLHA 4PIYA 4DXSA 2QTOA 5ANQA 4I01A 4PDRA 4CEWC 4FTBA 3WW1A 4YHHO 1EBOA 1K4DC 1GMMA 3WDVA 1L3JA 2QE3A 2AZ5A 3ALQA 2I07B 1WLEA 3N7JA 1LOFC 3MIBA 5ABJC 2ZJCA 1Y7BA 1YFYA 2VWJA 3IAYA 1VBB1 3RWKX 3ASNB 5EC2C 3GCWA 2BZDA 2VMIA 5IYBO 2FYUH 4NXMO 2P5OA 4CH6A 1RVF1 2GNBA 4TUYB 4CCOA 4CP9A 5JXIA 1IS3A 4LF5O 2ZXWB 2VQEB 3BI3A 2Q4SA 5AC91 4C91A 5BNNB 3MV01 4DR5B 3K9SA 2OIIA 3ACGA 1N32O 2H0VA 4GB32 3PHMA 1CPYA 1AB3A 2W6JG 1UY0A 2BOCC 3MICA 2ORXA 5CKMA 5FZIA 3WNNA 4IL7A 2Z79A 3X2QC 3KB5A 3UT5B 2MEV1 1RGSA 3E83A 3FAVA 5IDJA 5H6RA 1VBC3 3MLJA 5I0UA 4FT8A 3RYFB 3WEZA 4RR3A 4JI5B 1ENQA 1F5FA 2JD4A 3VBRA 3HQUA 2YV8A 3WCSA 2L9LA 4PV1B 1XOUA 3FYIB 4Q27A 4J42A 1W2AX 2XLGA 2JDZA 4Q4X1 3KKYA 2M7WA 3EHBB 1X8EA 4X1YA 4OULA 1GSLA 1D0GA 3MPBA 1WCKA 5KUKA 4FLZA 3P32A 1PM4A 5KC5A 1OH4A 4XURA 1I0HA 4I4TA 2DDUA 3E8FA 3K5NA 1VLNA 1YITV 1OCOC 2QJVA 4OX9O 4E4HA 3SPJA 1SG3A 1CD3G 5D5QA 4YW1A 5FIXA 3N2KB 2LW1A 4QDSA 1B3QA 4BMEA 4OYUA 2BE3A 5JSRA 1Y43B 2R70A 2ZPXA 4QGPA 5BNOA 4FLVA 3D8CA 3RYPA 4DRXB 5F2WA 1IBKB 2OX0A 1UY1A 4LF7O 1RUOA 1CIWA 2W68A 5IK8A 4AG4A 1FJGO 3JZVA 5FJHA 5A7NA 1D4VB 2K46A 3B8NA 2YPJA 4D69A 1X50A 4GH4A 2AZ0A 3M3QA 1NH2D 2CH7A 5EC1C 5L3BA 4CEYA 3FC0A 5FZ1A 5A7SA 2B46X 1GR3A 3ZDVA 5C5TA 4BHPA 3ZMSA 2LALA 1ZL8A 2IW5A 3FB5C 3D6EA 1RM1B 3I2FA 2OCHA 3IC7A 4X62O 2ZIMA 4CTEA 3WDUA 2LRPA 3POGA 1IGOA 4JYBA 3JU9A 5LK5A 3K06A 3CB2A 1W8ZA 3ABTA 3WY6A 4LF9O 3CC7V 5A6XA 4RS5A 1LOBA 3T0AA 5DDJ2 3VQYA 5A6ZA 5HI0A 2OQ6A 4IYIA 2ARCA 5LOVB 1BK0A 2EIMC 2A75A 3UKMA 1AR81 5FAXA 4FLYA 2FD8A 1N1YA 2F1MA 1POV0 1YQ6A 3V64A 1ZRCA 5FDBA 3AZXA 3H1JH 3QG5A 2D40A 3T4VA 1SBFA 4LIVA 4H33A 1AI5A 1EN6A 2J1RA 4MUVA 4ZKTB 1G8WA 4CCKA 4XDPA 3JB4C 4NIAA 1Z7S3 3C8XA 5DDJ3 4UT5A 4CS4A 5FYHA 2HG5C 1R3LC 3LSSA 5EZYA 2ZGPA 1COV3 3O1MA 4D7TA 3OMNB 4NN0A 4B3TO 4OI4A 3H42B 5E6HA 4BE3A 1QXJA 5K1PA 4AI8A 2GSYA 5CNAA 2E3CA 5J3UA 1UAIA 4UOJA 2GV9A 3H7YA 1UYXA 2YUAA 3QVNA 2V4VA 4J41A 4A7KA 4JV4A 3WP3A 3VBRB 4W6WA 3AMNA 4FXKB 1NVPB 1W6MB 4PA4A 1W06A 1ENSA 3AZYA 3J26N 5B1NA 3T3YA 2ZS6B 1W0OA 2MEV3 5JH7A 4WFEA 4S2HA 5FXVA 4XJZA 3OUSA 5FYCA 3RNSA 2WSVA 5JCOC 2ZBJA 2EALA 1FMD2 3OUFA 3BABA 4PBOA 2D3SA 5GTIZ 2BBAA 5FZ6A 1V54B 2YEVA 3GF6A 2VTXA 2VCAA 2ARXA 2M6YA 1F4AA 4ISQA 2ZZQA 3SJQC 1EM1A 4A7ZA 2UXDO 1IBLO 1NYWA 1EV13 4ZU7A 4JDMA 3GALA 3O5SA 3LD8A 2QQKA 1PNMA 1TNRA 1PVC3 4IQPA 2ZX2A 3BHPA 4I02A 1H8VA 4LIUA 1OQDA 1R1ZA 2UUBB 2QQVA 2OZ6A 3ZIXA 4RS5B 1AYN2 2IH3C 2DVGA 4D6QA 3FLRA 1YI7A 5BXXA 2HHHB 1RUC3 1AJQA 4MVSA 3KVAA 4FM2A 1IS6A 3UT0A 1PNKA 2W9XA 4BMBA 4AAXA 4AVBA 1AYM2 3UJOA 1GANA 3VBHB 3K57A 4EN9B 1JR9A 1L1FA 1YZBA 3OD0A 4FFHA 1RJ8A 4INDA 3EXUA 2VZ1A 2B42B 4A4AA 2ZXWC 1N3QA 4YW2A 2FTKA 4RQEA 1POV3 5KHIA 4FPEA 1OCOB 4QQHA 1CGPA 4QX5A 1AR71 1W6QB 1MEC3 3DXUA 2YIBD 4CDXB 4UYBA 3I2HA 5L7OC 4PBPA 1CX1A 2IJKA 4KQ7A 5TSWA 1XI1A 3AP4A 4UW6A 4QB6A 2ZM6B 1ZL8B 1VBE1 4HN0A 4H7MA 2F95B 1XL6A 3CJIB 3DN7A 2XGXA 1VQMV 1OH3A 2J1TA 5A7OA 2K9PA 1W0JG 5FZBA 1HRV1 2H3OA 3RZLA 4QNHB 4WVVA 1TUEB 2TUNA 1BK1A 4LKFA 5JCTA 1S55A 4Q29A 4E9KA 4Y1VA 3E86A 3J7MA 4L8JA 1MOFA 3VZNA 1UYPA 2W39A 2GMPA 1K3IA 5BR8O 4UBGA 3E89A 4N9IA 2JJ6A 4WM8B 1NA1C 3GZUC 1MA1A 3UO3A 4ET7A 1KDMA 2QKCA 2Q73A 1X33A 2DVAA 1KD7A 2AR6A 1AYN1 2Q1FA 2CAVA 3HD8B 4CS3A 4XUNA 1WLTA 2Q8EA 1WAZA 3O14A 2NZ9A 4LBJA 1IXBA 3AJYA 4JI7B 4XFCA 1FYJA 4CCMA 5L3DA 2DURA 3AFGA 1AP5A 3EO6A 5EZYB 2JKBA 2AGAA 4LF5B 1JPXA 5LYJA 1XYOA 2NLJC 4XOGA 1JZ8A 1AX1A 1NCRB 5JOWA 3N9PA 1FPN2 5FUNA 3MIGA 4DV0O 1RTVA 1BL8A 3BIEA 1O9HA 4JI4O 5JQGA 1MR5A 2W1UA 4JGYC 2XWJB 2AUYA 4X89A 2HFEC 3LEIA 1JTZX 2OKXA 1RM1C 5JIAA 2EXIA 3FB6C 2PYLA 2ZM6O 3C3TA 1W8FA 2A6XA 2VZRA 1AR92 2Y33A 1BQ0A 2LW8A 1N0NA 3OPWA 4QPYA 1YIFA 1XEQA 1LOFA 1PPJH 5CBHA 5K0UB 1SQXH 2PAEA 5IVFA 4K8FA 1GK9A 5HCBA 4QX7A 2A1XA 3U4XA 4JZRA 1FV2A 2RDQA 4C0HA 5F39A 2RR11 1OOPB 4QX0A 4CU8A 1DLBA 3G71V 1GWLA 1QJX3 4QGMA 4FQZA 2BOBC 1ZRFA 2UYAA 4AEJA 1Y67A 1U5IA 3K08A 3JD3A 1L8DA 1UX7A 4YVSC 5IJ0A 5A7WA 4PJ0Z 3USUA 3FX3A 4PIXA 1SQVH 3APQA 4JCKA 1LTEA 4M4PA 5LA9A 5F5AA 1KFXL 1YDXA 3B7MA 2WSSG 3AX4A 3J8F2 5C9AC 5FKBA 3JYCA 4FAHA 2ZEWA 4OI1A 3OAAG 1H2LA 4HL0A 4DV7B 4DR2O 3GNEA 5F5CA 4UFJA 4LBQA 1LHWA 1QEXA 2VTFA 5C3OA 1JN2P 2Y6LA 5E79Z 1LUWA 2R9AA 3C3SA 3DGEA 1LR5A 2RS51 3Q4HA 4CEYB 3QOPA 3ABLC 2B4KA 4BXSV 2AW9A 1R081 4O2AB 4ZS3A 5C5UA 4QQLA 1NY72 4UFHA 2D93A 4DV0B 4JAAA 4ZONA 3W7TA 1TQ5A 4XZUG 1PK6B 1W6QA 4XUTA 2D98A 3VDCA 4E4SA 3OYWA 1W2NA 4GUNA 4UI9L 3WG7C 4JQRA 2PFWA 2VE1A 5GZGA 3ZXGA 4QPJA 2ZE7A 5KA6A 4UFKA 1IOAA 3C7GA 4J1XA 5J96B 1XMQO 4SBVA 5JOZA 4UCRA 5I8TA 1QVGU 5J9PC 2BEOA 2BGOA 3LCPA 1OSGA 1RUJ2 3AXDA 2JX9A 3T2PA 2VW2A 5CFCA 2UWAA 1PK6A 4QX2A 1E1RG 4OZOA 3MZHA 1OFSA 1GWMA 2EAAA 1Q43A 2UUCO 3I97A 1PO22 2RDCA 3MYXA 3ZBHA 3AK3A 4UVBA 1H8TC 5FZMA 3VBFC 2JG8B 1ZA4A 1JZ2A 3U10A 1AL0G 3BALA 4KNCA 5JZGC 5BV6A 2H94A 2PAKA 2VQFO 3N27A 2VBPA 3DUIA 4URTA 4LO7A 1DGWX 3UV9A 1JYVA 5HFLA 1Q6IA 3A8TA 3WSOA 3WQ1A 2WLMA 5IWAB 1MABG 4JX0A 5FY7A 4JASA 1RUH3 2YFZA 1E79G 1XNTA 1Y74B 2VNRA 2WPDG 2JDNA 1PM7A 1RUI2 4AI3A 3CEIA 3TK1A 4CC6A 1KU9A 3TNPB 3T08A 1RUF3 1RPOA 4XDKA 5FYVA 4Y5Z0 4LBQD 5ACA2 1I94B 4EFEA 4AFCA 2NM1A 3BIWE 2Q1ZB 4O61A 2RMU2 3RWRD 3VBFB 5DPNA 3HN3A 1J59A 4COVA 4A45A 1VQOV 1TUBA 3GWOA 1QCEA 4ZS2A 3RYHA 5T55A 4F6EA 2JENA 1K9MW 2Y6JA 2X5IA 3X2QB 1JYTA 3MFAA 4BB3A 1V9U2 2R30A 3U78A 3DEMA 4QAWA 1WJZA 5ACA3 3K3NA 1XILA 1DYKA 5B1BC 5LA1A 2Y0IA 2YFUA 3LAGA 3E97A 1MMMA 2WLKA 4OCTA 2JDPA 3P6BA 4TZDA 1LODA 1PMIA 2A7WA 4D7SA 1TGOA 2DE0X 4AZZA 1XPWA 5FYMA 5IHRA 2QQMA 3RMXA 3JATB 1UZ0A 4I09A 2PA7A 2LS6A 3H01A 3UQ8A 4FCAA 4JI8O 1G9CA 4CPBA 2FDKA 4XABA 2BFUS 2YYOA 2VNVA 1F2NA 5AVPA 2Q4PA 4NJ4A 5FUIA 2WLIA 5I0SA 1O3QA 1J5EO 4YLZA 4MS2A 5IYZB 1KYOF 3D36A 1GRJA 5C4WA 1OF4A 4IHJA 4KI5M 2HWD2 3ASOC 3TEYA 4K0KB 1AL23 1GQHA 3IBMA 2ZR2A 5LYJB 4QD2A 1J84A 5JH7B 2A6YA 3IAQA 3I3EA 2VW1A 1OKOA 2JS5A 1ZAUA 3DC6A 2D6NA 2WABA 4GYCB 1ZBA2 2QQIA 2WZR2 2ZCWA 1QJFA 4B3RB 3PUQA 3D36C 1OMIA 4RR3B 4KL1A 1HW7A 2ZZJA 3ZOIA 2CTWA 2XNDG 2LFSA 5I8YA 2WLQA 4ZY9A 4C8DA 3FFQA 4LTAA 2UU8A 1TVGA 4TSVA 3THPA 4AVVA 3I5DA 4ZZ8A 5BYNA 5JZGA 1VP6A 4WZCA 4CDXA 4ORFA 4IE4A 3VBFA 3SHRA 4FFFA 1N33B 1RHI3 2AHZA 1C1LA 4UF0A 4XC9A 5FWEA 4DV6B 3RJ2X 1HKDA 4X1IB 2C5DA 5IVBA 1K5QA 2W08A 3RZZA 2PHLA 3FUOA 1WCSA 1DGRA 4FM1A 4YM3A 3HKBB 1H30A 2UY8A 2JIZG 2E7QA 2ZGUA 4QXKA 4LWSA 4EFBA 4N53C 3F5WC 2BSKB 1MS5A 2Z69A 1I08A 1SA0B 1Y3TA 3H1WA 3ZMOA 3D82A 3WW4A 3N2GB 1REFA 2JXAA 3OEAA 2QQLA 2XASA 2BTOA 3WQ0A 5IFPA 4M3CE 2PHXA 3OEEG 4BQ5A 4J10A 1D2SA 2ARHA 1XHXA 2R9IA 4SLIA 4AQYO 2ZEXA 1VIBA 5T5OA 5L9VA 1BHAA 1P7GA 1H2GA 3M8AA 4FPFA 4P9GA 3LDCA 2RS53 2P5BA 3QBQA 1FKAO 2DFCA 1BMFG 1QHDA 1UZWA 2NN8A 1LOGA 2W3JA 1QR9A 2IFRA 3QTCA 2VJXA 3SYCA 1GO3F 5F3GA 3TEZA 3TN92 4GB31 1RMU3 1PD3A 3ENRA 3JUUA 2Q67A 4H7LA 3VD3A 2RG4A 1RVF3 4EN8B 1FT9A 4HT1T 3TB0A 3SYQA 4J11A 4LHNA 3DPRA 1CJPA 2P4VA 4GZ9A 1S0DA 2P2KA 5KXEA 4XCAA 4BAYA 5A70A 1H8TA 2Q5TA 4WF9V 2ZE6A 2DFBA 2XPJA 3EVKA 3P5BA 3AP5A 3LA2A 4P2ZA 4N9HA 4DW0A 1MVEA 2YICA 1FX5A 1IBKO 4U7OA 2GN3A 4YGDA 1WMEA 1HWYA 3FUQA 2BV4A 3AG1B 3I3MA 3PVEA 4Q0VA 1I94O 2JG9A 3H7JA 5EJ3A 2GP5A 2FQPA 4XBQA 3KZ4C 4WBNA 4QXHA 5KLVH 2EIKB 2B5UA 3JD0A 4Y26A 1Y9QA 3SXWA 2Y38A 4Y4YA 5LB6A 1IKQA 4CXYA 2EILB 5L3CA 3GHMA 3HNMA 1J58A 2D2CB 3HEIA 2D3PA 3KT4A 3RVYA 1JUHA 2N7GA 2GC0A 4MGQA 4LR4A 4Q0SA 4GKKB 1LHVA 4Q4W3 5A3MA 1YTFB 4XJUA 1C8M2 5IYDO 3JATA 3OY8B 4N23A 3T1HO 3V0BA 4KU8A 4XTMA 1W6MA 3V0AA 3VL8A 2JDKA 4CSWA 4MH0E 4O4IA 4H13B 5AVAA 4F7ZA 2ZGSA 1R3JC 2F4PA 4DR2B 2UXCB 5FP9A 2QWRB 2VGDA 1MS8A 4QM8A 5IYYA 3AC0A 1WD3A 1W3XA 4EE2A 1NXMA 2E6VA 5E89A 2ZKLA 3CCLV 5JSOA 4YW4A 4DV4O 1BBT2 3ABKC 4L99A 2ET1A 2GP3A 1SZBA 4LE3A 1WB7A 5L3FA 5E1AC 3ZMZA 3H8UA 1Y4MA 1CAXB 3MIFA 3U0ZA 1QJEA 1X59A 2RS33 2OZJA 1SLCA 3EYPA 4EWDA 2OIEA 4B4PA 3J81N 4CP2A 3LEGA 2P3KA 3WT3A 3ON7A 4H55A 4CE8A 4PDWB 4JGYB 3DECA 3IT8A 2EIDA 3UJQA 3UKVA 3WF3A 3KCYA 1ZA7A 2BPA2 4ASMB 1R1A3 3LEKA 4IIJA 2CSGA 3CS5A 2XJRA 2D6LX 3NMBA 2CTPA 4ASUG 4IESA 2ADEA 3KGLA 2RM23 3TGUH 4RGKA 4GKXA 3ETGA 4JGYA 1N33O 2ETNA 4XDJA 4LBKA 2NR5A 1RXGA 2FDIA 1LUVA 5E16A 3KVBA 1NLQA 4E2QA 4H37A 3MIHA 4YVSB 3ICXA 4FLXA 4UW5A 1T2XA 1CEZA 1ZZBA 4RL7A 2ZTNA 1YI2V 4IV3B 2ENRA 2XLFA 4QKDA 4B3MO 3R65A 1XMOO 1OJHA 2V72A 5GONA 2BGPA 1VBB3 4LO8A 5FMDA 2DCYA 4QGNA 2Z2SB 2DUPA 2JDYA 3BCWA 3OPTA 4IXLA 5EBMC 2YI9A 2PXJA 4CEWA 5DQ0A 1S5HC 1VB4A 3S3XA 4P9OA 1EN5A 4O4IB 3M8LA 1K34A 3FD9A 1MEC2 1BZKA 2JG9B 2WQZC 3CP1A 3LIHA 3ABLB 3HPLC 1YFWA 3B77A 2VZ3A 2Q8DA 1E5IA 3INAA 2EZOA 4X20A 4QPKA 1WW5A 1WN7A 4O4JA 2ZGMA 2WT0A 2F4VO 4OUSA 4OHVA 2DQ0A 5CFCC 2YBSA 5FMOL 5H9SA 4EKWA 4AL9A 4JHZA 2QWQB 4PF5A 3DYMA 3T30A 3KV5A 3MHSC 4RN5A 3MDPA 5EJ1B 3PIJA 2PHUA 3AYCA 4IE7A 4FZ1A 3T1HB 3V0BB 2GH8A 2B8MA 1Y76A 3T4HB 1X36A 2XKPA 3ETPA 2P34A 3LPGA 2E63A 2YUEA 4P5YA 4DQAA 3CF6E 4QPIB 5LY2A 3FHQA 3L9DA 1VBA3 1UY3A 1Z7S2 1Q6HA 2Y26A 1UNBA 1CZTA 4GMP0 3AZVA 3DPRC 1AJPA 2DTYA 4MVTA 4DMIA 2D97A 3UT5A 2YGLA 3I59A 1Y4WA 1ROPA 2A6VA 4XW3A 1DGLA 4HSLA 4NVPA 2V4DA 1RUE3 2QQOA 3FL7A 1M5IA 3ASIA 3GB7C 5C8WA 1X7NA 3WDTA 5A33A 5HV0A 4HK8A 3CNAA 3W58A 2QKDA 4QQ2A 2XAHA 4DV3O 3BYWA 3TBDA 2R073 3VQVA 1RVF2 1RPRA 1S0IA 3M99B 4XDOA 1U12A 3CCRV 4RQPA 3OE7G 3GZTB 4K40A 2YDEA 2JWPA 2A0LA 2VOXA 4BWOA 4AXOA 2MEV2 1JODA 2OTLV 2RR12 3BTYA 4Q4Y3 4CCDA 1GWKA 4X9QA 1URFA 4J9ZB 1AR93 1Q82W 4HOOA 3B40A 3WF1A 2RJZA 4FFKA 1WLCA 2UXNA 3JBG3 3U14A 4JYAO 2PTMA 4DR6B 4P00B 2R042 2BVVA 2I45A 4JPRA 2IXJA 3AP9A 1PL0A 2Q7EA 4IEVA 2QEXV 3HR9A 2RS12 4R9AA 3CMEV 1NI8A 2W6IG 1VRBA 3IC9A 1IKPA 2VUJA 3AG4C 3ECQA 4Y5TA 5H9PA 4A42A 5LASA 3ZXLA 1JJ2U 2FL4A 2XBO3 1OT5A 3C7EA 2OW4A 1EV12 1HR0O 5EYPA 4Z8BA 1C3HA 1PO13 4CUGA 4ZHQB 4XILA 5FBJA 3H3ZA 3N7MA 2WNEA 1RMU1 1E5RA 3CJXA 1PZ7A 1OF3A 4Q4W1 1OLQA 4AGGA 5EYYA 1FNZA 3E1F1 4W65A 1MZEA 2ZD9A 5FYSA 1HXS1 3FN9A 5GM0A 2O1QA 4CDWB 2P6JA 4MX3A 2P3YA 5H2FZ 4P9XA 2KQXA 1G6NA 2ADPA 4CZZA 1Z7S1 2WT2A 4WBBA 2NN4A 5B1AB 4GULA 5C70A 4PA9A 2IZWA 1G7YA 5IY5C 5J48A 1DHKB 2DBNA 3BTZA 1OCRB 4FPPA 4XAEA 1VQ7V 1MEC1 2ZHNA 1MQTB 4LLOA 1Y9MA 2QE7G 3AKPA 4DB5A 2HLDG 1J3PA 1IURA 2Y64A 3K51A 3NRUA 5FZEA 4CH4A 2Q7GA 5IYZA 3MO4A 4EZHA 5CADA 4AFBA 4HG6B 4QJFB 3RMYA 1DK1A 1XMOB 4PLOA 1ND2C 1N4CA 3O9OA 2EJ7A 1BCXA 1YCIA 1VQ4V 2XOKG 1MQTA 4TT3G 2BJSA 3LSDA 5LRSA 1H2NA 2CWSA 1XHZA 3CZUA 1R6TA 3IB3A 1V54C 1XE8A 4RHV1 3I2DA 3V56A 4HBNA 1LKNA 2PYJA 5GALA 3BA8A 4OQ9A 3SISA 3SMHA 4L0PA 3IKWA 3WVJA 3LUTB 1T6GC 3LOIA 4FFBB 4X6QB 2K0GA 5CB4A 3ZFGB 1SQGA 5DUUA 1X9PA 4O9EA 2UXBB 1Y66A 2GMEA 1W9FA 2ERFA 4QHOA 3K59A 1YFUA 5J1XA 5JR7B 3KCXA 5FZ3A 3LE0A 5EP9A 5GONB 4PDLA 2PY5A 1BBT1 1BBT3 1TG7A 2WLPA 4YFWA 3J4UH 1SFNA 2E26A 4R7CA 4HYOA 4C0BA 3CD6V 3WNLA 4JV5O 4CRQA 4BIUA 4GH4C 2W2IA 2W94A 2WYSA 2GN7A 3BY6A 2IU3A 3M3OA 4QX1A 3DF0A 2JICA 4Q4Y1 4CUBA 4Y22A 1RINA 2F4VB 4QM9A 3CLPA 4IUGA 1QU7A 2B1GA 2CTQA 3ETEA 4LHKA 3ZN6A 2D6PA 4FOYA 3QD6A 1RUI3 2CGPA 3ZKUA 2IJHA 2VCMA 4EN7B 1H9PA 2R1BA 3MF6A 1QIQA 3VV1A 2QCSB 4OQ8A 3WFVA 5AC92 2PZSA 3WG1A 5CZKA 3VL9A 3WNXA 1ZM1A 1U96A 1VF6A 3CJHB 4I9WA 3HBKA 4OHWA 4AYUA 2RM21 3OUHA 2OWOA 2JB8A 3WNPA 2VXRA 1ASJ2 3OGGA 5CA0A 3SH3A 3E5UA 3MUZ1 2VQUA 4L11A 1NQTA 2TBVA 3ZSMA 4D94A 1N1VA 1FMD1 1FMD3 3ILRA 5L36A 1F4NA 1P8JA 4LP8A 3I2JA 2E33A 3STZC 3ZCCA 2XONA 1BZWA 2GNMA 4X1KB 1NBMG 4ZBMA 2WNUB 4IE5A 4MW3A 4YM0A 4GB33 4JTCB 2LO1A 3L75H 3GDBA 1TEIA 1QQCA 2C6SA 3S3WA 4TQFA 1TAEA 3HKEA 3SNMA 4PA6A 4A5UB 1SRYA 2XMLA 2ZHLA 1VBB2 2WLNA 3G6BA 1R6KA 5L9RA 5AC93 3PLQA 1QDCA 3OGVA 1RSOA 2XVLA 5F2SA 3WF2A 1RUE1 3ZFFC 4UV8A 4LFAB 2A9HA 1XNQB 3S6PA 3BU0A 1US3A 1OD5A 1Y76B 4XEZA 1NT2B 4GWMA 3FX7A 4RQPB 4GMP3 4Q8LA 4CEWB 2Y8KA 4XF9A 2ATFA 2OT5A 3JAKB 1DIWA 3UKNA 3GBGA 3GM8A 4A7YA 1N34B 2Q0OC 1S0VA 4DR3B 1JYWA 2HWD3 4OUMA 5SV8A 1HLCA 3FYEB 2WZPP 5A1FA 4AEKA 2R9RB 1IZ3A 2DU0A 1AYN3 2JDHA 4G3YC 4MOAA 1NCQC 2BNOA 2B9ZA 1ZTEA 1ZBA3 2WYFA 3TXSA 4FQ4A 1YVWA 2HEVF 4JVAA 4ES9A 3W21A 2G19A 5C9AA 1YNAA 3ZKYA 4ZXEA 1SLIA 1VAMA 5EFUA 3T4DA 2IJIA 2VWKA 4LWSB 3BKZA 1UIKA 4WVZA 2BCCH 3WLUA 1N3OA 3HB3B 1WA6X 4UCUA 2EIGA 5G05L 3E8HA 4HMZA 3L74H 4OPHA 1ZVFA 3K3WA 2PUSA 4FFBA 4DO0A 4MXWA 2QA4V 4MHUA 1PIV1 2OT7A 4YRDA 4KUMA 4KBZA 4B3RO 3VDBA 3BVCA 1BVP1 1RIRA 4Y4RA 3ZYGA 1BSMA 4LT5A 2VC9A 1L7QA 3N2GA 4XBFA 1WW7A 1NG0A 4XFGA 2KSDA 3RZKA 3WB0A 5LP6C 4MGYE 1OOPC 4JTNA 1F15A 3NKGA 2JG9C 4URAA 4QB1A 3L2YA 2EIBA 3ACHA 4XF0A 4CDQB 3I56V 3IMNA 4FPLA 1D4M1 3O0WA 1MACA 2P67A 3VZJA 2PGGA 1O91A 4L92A 1UZZA 1H8HG 3ZFFA 2DMXA 4Q0UA 4LKDA 2ID4A 2ZGRA 2VMDA 3ZX6A 1GTOA 3VZMA 2G9GA 5D8AB 3VD9A 4JF3A 3LNMB 3ZXDA 3MDSA 4LBOA 3KZIZ 5C8CA 5AG2A 1JZ3A 3WB1A 3E5QA 2YS8A 3T09A 1CAWB 1DBNA 5FNVB 4OUEA 3WNOA 4KG8A 1NCRC 4EROA 5IVCA 4LFBO 1PHMA 1BXHA 1ND3C 3LPFA 1NA1A 2VMGA 3OB8A 1OI6A 3WNMA 2E9QA 3B3QE 1HXS2 5FQ0B 4HNAA 1BEV3 3H1YA 2W91A 2C2AA 3MW3A 1VQ5V 3P3NA 3IJ4A 2Q68A 5DN6G 1MZFA 1AR73 1AR83 4IDZA 1B6QA 4Q4V1 1CVNA 5A6YA 2BWAA 1E57A 2QKSA 2VS0A 4DUZO 1R093 4YZ5A 1A3KA 3ZMNA 1LGBA 2XL7A 1DU3D 5K8SA 2Y4TA 3ZPOA 3W20A 2RMKB 5FZOA 4BQXA 4MHRA 1K73W 4I0XB 5LCWL 4X66O 1G9FA 1K45A 3MW2A 3PU8A 3WDXA 1IG3A 1O4YA 1GYKA 5JI7A 1JYNA 1UF2C 1JMKC 1GH6A 4COZA 3GBWA 4QKBA 1OFNA 4AK3A 1WP8A 1QJU3 2N04A 5L7OA 1Z0HA 2P3JA 5A7WB 3KT7A 4N53A 1JOYA 2AH2A 1UW8A 4ARXA 3ZRWA 4XQ4A 3K9AA 4H14A 3CRCA 2W1WA 4NWWA 2ORZA 3EFFK 3ILNA 3ABUA 4P9LA 1IQDC 1VE0A 2WFF2 1GN2A 3OTOB 3WG4A 3CO2A 1BQPA 2Y34A 2KA3A 4NPMA 2F17A 3ZSEA 5IWFA 1UMZA 4TSFG 3NW4A 1WA8B 4MXVA 3KF5A 4AGVA 5L73A 3DSQA 5L3EA 4R6ZA 4CBCA 2FCUA 2R061 4XF4A 3WOGA 5FZ0A 1WPBA 4MADA 1G1XB 4LO6B 4WCEV 3CXHF 3MF9A 3KHBA 1J1TA 1H1IA 2RV9A 1RUC2 2TNFA 1QQP1 3RYHB 5FXXA 3POEA 1YQCA 1E5SA 3HWJA 1OCZC 4GJYA 3A0BZ 1KECA 4Y1XA 2FZ1A 3SKJE 3ZYFA 4RHV3 5B5EZ 2WNOA 4R8CA 2A70A 5FZFA 4JDNA 2GU9A 4DY5A 1GKFA 1E5HA 1W6NB 1OPMA 4O4LA 4LO5B 2PLV3 2JEMA 1JU4A 4MTXA 2UUBO 1Q6UA 5CFCB 1ND2A 3U4SA 5DZGA 1QJY3 3VBUB 5HXMA 3VHRA 2NPIA 1TME1 4QPWA 3AG1C 4ZKIA 3RJRA 5FP7A 1UIJA 4X65O 5LK7B 5IW0A 1D4M2 2OPKA 4DS0A 2RJKA 4O4JB 2CV6A 1C5IA 2UWCA 1XYPA 1XBLA 5GTHZ 3N36A 1L7RA 3RZHA 3ITQA 3K46A 4A3XA 1XB9A 3KQ4B 2DYSB 3UYJA 1MNGA 3WXPA 2QM8A 3JAWB 2P22C 1LGCA 3T4ZA 4GKKO 1CAXA 1EN4A 2XUMA 2EXKA 4K21A 1AF9A 3BOPA 1MPXA 3Q8CA 1DCSA 5JMCA 1K12A 3OR6C 3T1YO 1KQRA 2HYXA 4OPAA 4RYDA 3KV6A 1AR4A 1V55B 5IK5A 2ZX4A 5FPBA 4JGZA 2XAFA 4ONUA 5DUWA 2BERA 3Q4HB 3JD4A 1ONAA 4EN0A 2VH9A 2B45X 2B9UA 4JI8B 1QJZA 1BEV1 3P1IA 3THTA 1GN3A 3O1PA 1OC1A 2MW2B 2XJPA 2BRTA 2KG7A 3TCUA 3O0VA 4DV2O 3GZEA 2E7AA 3ML0A 3AK0A 4K35A 4M4RA 2IH1C 4F83A 1WMXA 2IC1A 3VHOA 4K6BA 3IDBB 2QM4A 3JAMN 1H6XA 4NXMB 1KFUL 1W6OA 1S0BA 4LLFA 4BDVB 2QGNA 4QDQA 5T52A 5LHHA 1VF5B 1BHGA 3NNMA 4XE9A 1FPOA 2ZNJA 3BCCH 3RS6A 2V1DA 1HR0B 4QKNA 5F2VO 4ZOLA 4RA0A 3VBOB 1OUXA 4J25A 4BK5A 1JYXA 2DN9A 5CG8A 3PUSA 4YG6A 1YHQV 2VULA 1Q86W 5ITZA 2ZHMA 3AVSA 4UW3A 4NUBA 3IDAA 4X8AA 5DAWA 2ZXQA 4Z07A 3BRCA 4JI1B 5FLHA 2W0FC 3AP7A 2W1QA 1FNYA 1CXZB 5DZEA 1MS1A 1VALA 1H1MA 4XJ8A 3WW2A 3T1LA 2EIEA 1KJRA 3T2OA 4PD4F 2WBKA 1KP2A 1AI7A 3LWCA 1PMHX 4FPOB 4I2OA 3MIDA 2R72A 4MVQA 5GZFA 1YQ5A 2JGDA 4GA9A 4FPCA 4PQQA 1ZBA1 5A33B 3OMAB 4JTOA 1QDOA 1IPKA 3V65A 4DR6O 1GAXA 1B35B 1I1EA 1QF3A 2D5HA 4GKYA 1PZ9A 4JAVA 5C8CB 3DL3A 1KKCA 1LRHA 3CHXA 1BS3A 4IV1A 2QVSB 1DQ0A 4LNUB 3PU3A 3MLKA 4KP4A 1V70A 3L2HA 5GZCA 1EUTA 1PNGA 2QSAA 1IS4A 4JTAB 5CEHA 3CRRA 2P1BA 3J80N 1EPWA 3AK2A 1JUIA 4M01A 4QPIA 1QJX2 4YG0A 1OV9A 3I2OA 3OTOO 5L19A 3KHCA 5CA3A 4PELA 3VBSC 1NQDA 2CHHA 4B3NA 2KB1A 2LQTA 2ZAHA 4GQ7A 2AXTZ 3VBUA 3K4ZA 2VBBA 4D8MA 4GT1A 3ZYBA 1W04A 1CESA 3LB9A 4H44B 3VHNA 3IFXA 1N8RW 1EUUA 2GH2A 3AKSA 4FOWA 1LB2A 3A7QA 3KQRA 1OCCB 1NZ6A 1H2KA 1DF5A 3NNJA 2DYSC 3SGIA 5IY5B 4AEDB 3LDRA 5DG1A 2DU1A 1FFXB 1U5YA 3E6BA 5DAVA 4UB6Z 5EIBC 3VQXA 3Q8BA 2QQUA 3WR0A 2FMLA 4XTPA 1M57C 1TMF2 3VBRC 1UO9A 4HSJA 5FCCA 1KRIA 4C7UA 4J6GA 1RXFA 2VECA 4ZU4A 5F1RA 4NTXA 3FAVB 1NZCA 5K4LA 4NTYA 4YZ4A 1VRH1 2ZDIC 3DCQA 4FO9A 2YGMA 4CH5A 2YIDA 4NB5A 1D2QA 4NTWA 1C4RA 1SZTA 3E6DA 4FOVA 4DINB 2QZ2A 3LA3A 4CU9A 4NIHA 3GCXA 4WZFA 3A4UA 5KMGA 5CAZA 3HMYA 4LQRA 5LXTB 4CC5A 2CE4A 4M0HA 1K97A 2CU5A 4XIKA 1GFF2 2RS11 2F93B 2ES3A 3LSUA 3BN6A 2GTAA 1RL3A 3S5AA 5FP3A 4JGZC 3R4SA 1IXMA 2R1DA 3RBZA 1SC5B 1U0AA 4CDUB 3PVNA 3WP5A 4DRXA 4ASKA 5C7GA 2B7YA 4DXRA 3ZSLA 3AYAA 1WPXA 3KSCA 2DYCA 1KB9F 3N3HA 3ZHTA 1Q8OA 1Y9GA 4UCSA 2HWB2 3AYEA 1PX3A 4CXWA 3F7YC 4JYYA 4FZ0A 3FKSG 1XDCA 3BEHA 4MVMA 4S2GA 1HN1A 2WDBA 1FXKB 1RFYA 5K7PA 4LMFA 4QPGA 5CBGA 5CBLA 1O3SA 1ZWIC 2WNVB 3DC5A 4D6SA 5JQGB 5FPZA 5TISZ 2W5FA 4LEJA 4LH7A 1YXBA 1NUKA 3AFKA 2XG3A 3I2GA 1SQBH 1AXKA 3WB2A 5B4NA 3SCHA 1I5XA 1BT8A 4E8DA 4JZGA 1LU1A 4XUQA 1YIJV 1GM8A 4RSUA 3MIEA 1LESA 3B9IA 4XF1A 4WVMA 3TEXA 1NR1A 4LBNA 3URFA 1FXZA 2X7RB 1X4TA 4YJ3A 2C9AA 2UUAB 3B8MA 4B29A 2BW8A 4P14A 3NSTA 2WLLB 1FOD1 3POJA 1G6UA 3N7KA 2YC4A 1ZRIA 5JMOA 5F5QA 1XXNA 4OHZA 5FPRA 1GNYA 2XJUA 5LA2A 1AZDA 3HVDA 1R3KC 3J7HA 2JEUA 1MZ6A 5LRRA 5BNPB 1JFFB 4M0NA 2FKXA 1MZ5A 4Z1VA 3NAPC 3WG3A 3B94A 4LUKA 2GMMA 3ZN4A 1J3QA 2CGOA 4JV5B 1KS5A 1RJ7A 5FZAA 5KMGB 5GZEA 4KWLA 2OIGA 5KX5A 2ZOEB 5FZ7A 2R043 3QO5A 3KLSA 4DYLA 3PVBB 3T1YB 2HWE3 4GIQA 3FE5A 1E1QG 1CPMA 3KMHA 4AQTA 5BR8B 3WHUA 3WNKA 2WWUA 4K3UA 4LNVA 3C7FA 2O57A 1S0JA 1Q8SA 4IEWA 2QDRA 1BMV2 4HKOA 4PCRA 1K5JA 1P84F 1CN1A 3F5TA 4MTFA 1JU3A 4FLUA 1C5HA 4JI6O 4IEPA 4DXZA 2P06A 1C1FA 4J7ZA 5C6CA 5BNNA 2UU9O 4MXWB 1WGPA 1YO8A 3OGCC 5DDJ1 3ES4A 5LOVA 4NAMA 2Q8CA 1F9KA 3E8GA 2CWMA 5FOJB 1W90A 1Q90D 1FFXA 2GNTA 1YI9A 2HR3A 4PDWA 1N3PA 1MG1A 1XREA 2YBPA 4O2BB 1Q8PA 2QBXA 1PP9H 1DQ5A 1Z5WA 2A6ZA 4XUOA 4EYUA 2X10A 1BHBA 2DW4A 1LCLA 1MS0A 2OVUA 3CYOA 4X66B 2ZX0A 4GZRB 3DTUB 3T0DA 1F7YA 1WMDA 3LOBA 4LF9B 3A0NA 5LZ6A 4AFDA 5H5NA 1K8AW 2EZPA 2HVJC 4IT5A 1RHI1 2CH7B 2Y6FA 4U3FH 4LF4B 1JBCA 3R05A 2ZCEA 3VD5A 2HYKA 2RNBA 5I93A 2VVEA 2DWEC 4CDQC 2E53A
chains in the Genus database with same CATH topology
2ETEA 3M8LA 1RUD2 1MEC2 3FWEA 1YRZA 1LOAA 1SLBA 2IXKA 2JG9B 4P9IA 5I0TA 5T5PA 2YXSA 2YY1A 1ZX5A 2GZWA 2I2SA 2WQZC 5JI9A 1YFWA 3SCFA 4HN1A 1A8DA 5DUVA 3VZLA 3MLLA 5C4WB 4QMAA 1SCSA 4B4RA 3INAA 3ZXAC 3R4UA 4ATEA 2XLAA 3VGIA 1OQEA 1WW5A 2ZGMA 2WT0A 1KDKA 4FOQA 4G4FA 3M3IA 4QPIC 5DG2A 2ET7A 1YJLA 1LECA 1IQAA 3D4KA 2RJLA 4OUSA 4OHVA 5CFCC 2JE9A 3QH7A 4YGBA 1ZZ8A 5FMOL 1R1A2 1LU2A 3AKRA 4E2GA 2VVDA 4BYYA 5H9SA 4AGRA 4Y20A 1PGSA 3SCGA 3RQ0A 4F3JA 1RITA 2HWC2 1AX0A 4FP2A 1I6XA 3IDEA 3OPZA 4W6XA 1ULCA 2UY9A 4PF5A 4NHMA 1VBA1 1H1AA 1M4WA 1UKRA 1HRI1 2DCJA 4AF9A 3PNAA 4WVWA 1QOOA 3MDPA 4CWDA 4L2NA 3VZOA 5B2GB 2PHUA 1LJ7A 4NPRA 3AYCA 1GNHA 3U07A 4AVAA 1GNZA 3JD71 4Z92B 2JECA 3PVJA 1URXA 4ASLA 1RUG3 3V0BB 2GH8A 1AYM1 2B8MA 3GHNA 4BIOA 3WDWA 4DNYA 3I59B 3KS7A 1X36A 3KT1A 1WCDJ 2XKPA 2DUQA 5IT6A 5C4WC 2P34A 4YZ1A 3V17A 2OUHA 4F8AA 4M27A 3WG2A 1ZBE1 1J3RA 2E63A 2SBAA 1SQ4A 2YUEA 2R062 5E8AA 4TLFA 1W6PA 1PGW2 4DQAA 3CF6E 2XBO2 1H4GA 4QPIB 1LHUA 1VBD2 5E88A 1VBA3 4FXGB 3SH4A 3IPVA 4Y1YA 2DVDA 4OFGA 1Z7S2 1VBD1 4RS5C 4MLOA 1I3HA 1QGLA 4K1YA 2Y26A 1WW6A 4GMP0 1OIKA 2VMHA 3OY8A 3AZVA 3DPRC 2R16A 2E7TA 2D5FA 2DTYA 1COV2 4YW3A 5H9QA 4AWDA 4MVTA 1REEA 4QU2A 4DMIA 3HBZA 1UN1A 2VU9A 3ZSKA 2D97A 5KHHA 1ZBE2 3GBFA 2YGLA 2QNKA 1HQNA 4PIYA 1G9DA 1NE6A 3I59A 5FPXA 2BNNA 4I01A 1CAVA 2A6VA 3CL1A 4XW3A 1DGLA 4CEWC 4FTBA 3WW1A 4HSLA 3EBRA 1JH5A 3WDVA 1L3JA 4NVPA 2R063 1RUE3 2QE3A 3ASIA 2AZ5A 5C8WA 4M2GA 5JIUA 3ALQA 2I07B 1NQJA 1X7NA 3N7JA 3WDTA 1LOFC 3MIBA 5A33A 5ABJC 2ZJCA 5DZFA 3OJBA 1CAVB 1Y7BA 5FQ0A 1YFYA 1ZREA 4B7EA 1VBB1 4HK8A 4LA3A 3CNAA 3W58A 1MQTC 2QKDA 4QQ2A 2O0OA 1MS9A 4ES8A 2JE7A 4Y24A 5JDBA 4P9WA 3TBDA 2VMIA 2R073 3BU7A 3RYRA 2W0XA 1RVF2 3N4MA 2WFPA 1S0IA 2UYBA 1RVF1 1U12A 2GNBA 2RM22 4RQPA 1CX4A 3GZTB 2ARBA 1GZ9A 1IS3A 4K40A 3ZYJB 1OIJA 2YDEA 2VOXA 1SEFA 4BWOA 2X29A 4AXOA 2MEV2 2WS92 2RR12 2B39A 2Q4SA 5EV7A 5AC91 1OA2A 4OJ8A 4Q4Y3 4C91A 5BNNB 2A3YA 4XIOA 1AR93 1SCRA 2HWE2 5CFDC 2OIIA 3VLBB 2PHRA 1QQP3 1WLCA 2VOVA 2H0VA 4R52A 3JBG3 4GB32 1LULA 3PHMA 2PTMA 3E6CC 3HT2A 1TMF3 3NVCA 3JD72 5CIRA 3OD4A 1OA4A 2R042 2BVVA 2I45A 1AL21 3O7OA 2IXJA 5T50A 3AP9A 3MICA 4OVEA 4IEVA 3HR9A 4M2EA 2RS12 4IL7A 5IUQA 4R9AA 2Z79A 3KB5A 2MEV1 2R49A 1RGSA 1IKPA 1PO23 4BLIA 1WUVA 2VUJA 3EJKA 1VBC3 2G9FA 3MLJA 3QCWA 5J37A 3ECQA 5H9PA 4FT8A 5I0UA 3ZXLA