1N8RW

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1n8rW00
1S72V 1K9MW 1YJNV 1KQSU 1R73A 3CCEV 1VQMV 1VQ7V 1VQOV 1YI2V 1NJIW 3CMAV 3CCRV 1VQ9V 1YJWV 3CXCU 1KC8W 1KD1W 3CCSV 3CCMV 4WFBV 1K73W 1Q86W 3CD6V 3CC7V 3CCQV 2D3OW 3G71V 3CCVV 1Q7YW 1VQ6V 1JJ2U 1Q81W 1M1KW 4WCEV 1M90W 3CPWU 3CCUV 1YHQV 1VQ5V 1VQKV 3CCJV 2OTLV 1YIJV 1YITV 2QEXV 3I56V 2OTJV 1Q82W 1VQ8V 3CC2V 1QVFU 3CMEV 1VQNV 1W2BU 4WFAV 3OW2U 3CCLV 1VQPV 1N8RW 3G6EV 3I55V 1QVGU 2QA4V 1VQLV 4WF9V 1K8AW 1VQ4V 1YJ9V 3G4SV 5DM6V 3CC4V
chains in the Genus database with same CATH superfamily
1R6KA 2ZIMA 3MHSC 1D5NA 3ZHSA 4DUZO 5IJ0B 1RM1C 2VWJA 3CC7V 1S76D 4IIJB 3CJHB 1YXBA 2IBZH 2IJIA 4UB6Z 3KCYA 5KMGB 4YJ2A 1FAFA 2P5OA 2UXDB 2QKSA 4JYYA 1QU7A 1EN5A 1SC5B 1F51A 2PYJA 1H2LA 4DV1B 1AR1B 2H3OA 3CXHF 3BA9A 5LBQA 3ETGA 3K0GA 4DV6B 5IYBO 2ZM6B 1TUBB 4I9QA 1H38A 3QF7A 4I9WA 2YXYA 3K5MA 1QVGU 3QVNA 5LMNO 3AG4B 5IYZA 4BIZA 2AHZA 1VQOV 4JI7B 4WBNB 3K03A 3AG2B 1FXKB 1JJ2U 4O4HA 4G28B 4DR7O 3CPWU 4JI8O 3JD1A 5JJEB 5EC1C 4JAUA 3BY6A 3DSQA 1KB9F 4MW3A 4J7KA 4DV5B 3RYHB 4RQFA 3K5LA 4DRXB 3M8AA 3UKMA 3ZBHA 2NNUA 2PF4E 2UXBB 5L3BA 3JSLA 5GONA 2LGWA 3AEIA 4LF7O 2VQFB 4JI8B 1RFYA 1Q86W 2DQ3A 3ZS8C 4ZI7B 4UVBA 4GX5A 4TT3G 5B1BB 2WLNA 1M57B 4BAYA 2E74B 1Y76A 3LDEA 1N34O 1XREA 2AGAA 2DOSA 4LNUB 5L3EA 1NTZH 1K34A 2JEXA 4LF7B 4MS2A 5JCOA 4EKWA 2XTAA 1EZJA 1NS1A 2EIJB 5B3SB 3B2EE 4DR2B 1YIJV 1AVMA 4JZGA 1PNLA 1DF4A 1O9HA 4PA9A 2IU3A 1P4RA 2O57A 1VQPV 5LHGA 2E76B 4CS4A 4YHHB 1KBHA 2B9ZA 1US6A 5HFMA 3GWOA 2FKXA 3B4SA 4GKKO 2KG7A 2NN4A 3A0HZ 4FFBB 2UUCB 4NB5A 3T1YB 3STZC 2E5LB 2W0FC 1HR0B 1AI7A 2GTAA 3N2GB 4I50B 2F43G 1NH2B 2AW9A 4X1IA 3AG3B 1KP3A 1HP8A 1SA0B 4P9PA 2VRZA 2OIGA 3JAKB 2QSAA 4F6RA 1Q82W 4WFFA 3VQXA 2DYRC 5EK0A 2BE3A 2JS3A 3OUSA 3WFVA 4IIJA 1VQMV 3OEEG 3CJHA 1IBMB 5KX5B 5DN6G 1PNKA 5LHHA 2M7WA 3F5TA 2F4VB 4ZKIA 2A79B 3DGEA 5KMGA 5FPRA 4LWSB 3K9SA 1M90W 1MSWD 1VMGA 1P49A 3MDSA 3IC9A 1Y74B 4N23A 3APOA 3CRCA 1YTFD 1NKDA 2ZD9A 4LF8O 4K8ZA 5CMUA 1AJPA 4KHPB 1NU1H 1PP9H 1DGSA 1IXBA 5CBHA 1BMFG 2UUAO 2G38A 3F7VC 3AG1B 1TUBA 2N74A 4B08A 1J95A 1QLEB 5JH7B 4U3JB 3SYOA 2HLDG 2WLKA 4PA7A 3E8FA 5EBLC 4FM0A 2ITDC 2GHYA 1FXKA 1YJNV 1VP7A 4I5SA 4O4LB 3K58A 5L3FA 4CBCA 4BWAA 5B5EZ 3OTOO 2JGDB 2ZIOA 2RJZA 4Q20A 1L0NH 1KECA 4J9YB 4DRXA 2LJ2A 2ZDIC 3K04A 1VF6A 4KFMA 2DYSC 1IURA 2EINB 4WFAV 1RP3B 2EJRA 4JI3B 4UCOA 1G1XB 4ZI7A 1NJIW 3NR7A 3H1IH 1GN6A 5LGUA 4K0KO 3RT3C 4LFAB 3HR0A 3BPZA 5K1XA 1WPXA 4LNUA 3ABMC 4B3MO 2EIKB 5GW7A 1YDXA 1GAXA 2DW4A 3QO7A 1KUQA 4BW5A 2L35A 4K0KB 3UQ8A 5BMVB 3ZCCA 1VEWA 1IBLO 3BRCA 1M56C 3JARB 4O2AA 2EILC 4PV1B 1NTMH 4GX1A 1MSDA 3EXAA 1CXZB 2GTSA 4B7EA 2YEVB 4DV4B 2R9AA 1OCCC 3T1HO 2QJ1A 1TVKB 4CS2A 1AJNA 5CBGA 3LNMB 2ZNJA 4K35A 4AI8A 4FFBA 5EYPB 4TOIA 3OUFA 4DR3O 2PI5A 3FB7C 3JCUZ 1BT8A 5B1NA 1WP7A 3T1CA 1Q81W 3N2GA 4I50A 4LF4B 4OPAA 4WFGA 3I5DA 4I4TB 4C7UA 1OZ0A 1VARA 5KUKA 2OTJV 2DWDC 1JCHA 4J10A 5B1AB 3OMAB 1SA0A 3A8TA 1OCOC 3JAKA 1Z5WA 2CTRA 4BW9A 3AG7A 2HJFC 1ORQC 1S5LZ 2FL4A 3BHPA 1N36O 4B3TB 3ETEA 1BHAA 5KX5A 1IDSA 1BQ0A 3FAVA 4X9QA 2PUSA 4LWSA 4JI6O 4XDKA 2OYQA 4FM2A 4UB8Z 1GN4A 3A0RA 1Y74A 5L3DA 4HZ3A 4A5UB 4MVQA 4DYLA 4MVUA 2VQEO 2F1MA 3SJQC 4CC6A 2R72A 1S0VA 4PA3A 1VQ8V 3SYPA 5LGTA 3L9DA 3OE7G 1EN4A 2Y0PA 4NXNO 1U97A 3SDLA 4FM1A 1HNZO 3UT5B 4LF6B 4F4LA 4FLTA 1H2GA 5KAFZ 2JJ2G 1BZKA 1XHZA 4U3JA 4EB6B 4J11A 4J7ZA 4NVPA 4CS3A 4O2BA 1Y67A 1GN3A 2QM4A 1N0JA 4DV0B 1YCIA 2YI8A 4TWKA 4O4LA 3P30A 1URFA 2N04A 3AK1A 4UFZA 2JGDA 1HNWO 4YY3B 3DC5A 2P4KA 4ZBMA 2Y0IA 4NXMO 3ASNB 3IAYA 2UU9O 2A0LA 1SQQH 4AQYB 4X64B 2PTMA 5B1OA 1B06A 2QWPB 1NZ6A 1LNQA 1N4CA 2V1DA 1S3JA 3QG5A 4G27B 4X65O 4DUYB 2EZPA 5LYJB 3OGCC 1K5SA 2R9RB 5ITZB 3T2MA 3D36A 4JI2O 1EFRG 1AILA 2X6AA 4KL1A 3QTCA 4DW1A 4X8AA 1SRYA 4U3FH 1HNXO 2HP8A 4YIOA 5BMVA 2XAGA 4LF5B 3JARA 2IH3C 2JJ1G 2W6IG 1I94B 1ZSPA 4WFHA 3B09A 1X4TA 3JALB 4YJ3B 1K5QA 2YEVA 1AI4A 4X1YB 1TVKA 1B04A 2QDOA 3QNEA 2GDSA 3IFXA 1Z2GA 3CC2V 3W7SA 5EYPA 1SQXH 1GMGA 1FKAO 1FYJA 3ZMTA 4X62B 2Y69C 5IY5C 3J80N 1TA8A 4JI5B 2EZOA 1SQVH 2Q4PA 2XHBA 4I4TA 4JYAB 4J7JA 1H2KA 2Q5ZA 1H2MA 1YSCA 3OTFA 3J81N 2EIMB 1NVPB 4FLYA 2KG7B 4XDLA 3CMEV 4X66B 2DN9A 3ICXA 1YEWA 4H44B 4DV3O 1KP2A 3BEHA 2Z5UA 1ZWIC 2F66C 1W0JG 5KUMA 4LH7A 4NTXA 3AG2C 1MG1A 2YIBA 1MZFA 3E2EA 4JYBA 1WPBA 4EFBA 2BCCH 4K3AA 2X6CA 2ZXWB 3RW0A 2P90A 3SPJA 4PA6A 2QGNA 1N32B 2LO1A 3ZRWA 2LQTA 3OAAG 2Q68A 3OEHG 4IGGA 1Q3EA 1MZEA 2UXDO 4ZHQA 2X7RB 5FNVA 2GUZB 4LFBB 4DV1O 3CP1A 1AB3A 4I55A 2CAZC 4MVRA 3UT5A 2VWKA 4CH6A 1OCRB 4DV6O 3CWBH 2WWWA 4UV8A 2AXTZ 2OIEA 2ZM6O 3A2FA 4EB6A 1OCZB 3NXSA 1QCEA 5LA6A 4JTAB 2HEPA 4JI7O 1NR1A 2EIJC 5B3SC 3ZRSA 1XQ8A 4JYCA 4GZRB 2P67A 3SYAA 2E3CA 3H01A 4PDRA 4I0XA 3Q4HA 2Q9LA 3L75H 2LFSA 3VQVA 4DV5O 1TGOA 4TQFA 3O65A 3LSUA 3G80A 1K97A 2UXBO 4DR5B 1V54B 5FLXN 3DXRA 2VQFO 2Q69A 5LYJA 4L87A 4QGPA 3CRAA 5ITZA 3K59A 2QA4V 1GM7A 2XAFA 3CYOA 5L3GA 1S5HC 2CTQA 1V55B 1G6UA 4B7KA 3ZHRA 3OMNB 3ZIAG 4JI4B 4FLWA 3CS5A 4LR3A 1EN6A 4X20B 5J9PC 4K8XA 3CCLV 3JALA 4YJ3A 4DR2O 1K33A 4GCZA 2IJHA 4X1YA 3WG7C 4NR1A 1LUWA 4FZ1A 1QQCA 4YHHO 1XEQA 4LBEC 3APQA 2Y48A 4O2AB 2IJKA 3RYFB 4GX2A 1I5XA 3D3IA 2UUCO 2YI9A 3MD0A 4ABMA 4QNHB 3T1YO 2E5LO 2XAHA 1FJGB 3UO3A 1HR0O 1NH2D 4LC1A 4FIPC 1YJWV 1WJZA 3C90A 2F23A 1W0KG 4N21A 1GM8A 1JPXA 3AG1C 2D3OW 1SZTA 1M1KW 3MHHC 4PD4F 2Q8VA 3M7MX 5GTHZ 3HB3B 1UFIA 2RMKB 2HVJC 1XHXA 1AR5A 4QE7A 1BE3H 3K5OA 3W7TA 2PGGA 1F23A 4W4KA 3FYIB 2P06A 4L8JA 3ZHVA 1WAZA 3ABKB 2LGQA 1JR9A 1IBMO 5H5NA 2UXNA 1VQ5V 3ZEDA 1I7FA 2F4VO 2EINC 2FYUH 4I7ZB 5CN0A 1VQLV 4CH5A 2WPDG 3K0DA 2ZKOA 2MW2B 1Y6XA 2ZE5A 3VBBA 2GUZA 3FAVB 4FFKA 1SF9A 4D7SA 2CDYA 4KHPO 4FLXA 4IT5A 2YC0A 3CSXA 1VQKV 3CCJV 1KYOF 5GTIZ 3P3PA 3UM7A 1N8RW 1FS0G 2WLJA 2JRIA 5L3CA 4DK1A 1W59A 2HR3A 3CCEV 2ADQB 4G2KA 1E1QG 1U96A 1GK9A 1XNQB 2QWNB 4DR1B 3G67A 2OCHA 2YXLA 1M93A 5LL6Y 4CH4A 4WF9V 4O2BB 3D8CA 1SQGA 1RPOA 2YIDA 3A0BZ 1R6TA 4JI3O 4D7TA 4PA4A 2QTOA 4LFAO 2QKCA 3BVOA 4J41A 5B1AC 2OCCB 4TSFG 2ZCEA 5KA6A 2CK3G 3RN4A 2QE7G 1YI2V 2ODMA 1NI8A 2DWEC 4GUNA 2RQ6A 5KHKA 1GH6A 4X20A 3JATA 1MOFA 5H2FZ 2AZ2A 4JI0B 3KG2A 4MT8A 3MAQA 5LXTB 2DYRB 4CH3A 3X2QB 3G6EV 1MNGA 2ITCC 4DV4O 1FFXB 4FJCC 1KC8W 2C2AA 5H6QA 3ZX6A 2YDEA 3RYFA 3ZRVA 1H2SB 5K1PA 1N33B 4WCEV 4PHZA 2RNBA 3CCUV 3AK2A 3W7UA 3C3TA 1YITV 3LUTB 1FPOA 1EM1A 3H9VA 5DEDA 4LF4O 4LF9B 5JJJB 4DV2B 5DECA 1K9MW 2N05A 1IBKB 1F4NA 1KKCA 2ZE8A 5FL7G 3GWKC 2EBOA 5LOVB 4FLUA 2WAMA 1IXMA 4TV9B 4O4JB 3WB2A 2JS5A 3I56V 4D6TH 1K4CC 3OGIB 1K8AW 1VQ4V 1JOYA 1P7GA 3BA8A 4R6ZA 4B3TO 3FYEB 2B1IA 2XT9A 1R3KC 2CTWA 4P30A 4PI0A 4QE9A 1OV9A 3ASOB 3SJCC 3L74H 1IVSA 4H33A 4J80A 3ABLB 5J2TB 3ZHUA 4X88A 2AHYA 5EBWC 2DQ0A 2Q7GA 3EVKA 1VQ7V 1FFTB 2NLJC 3U0ZA 4DV7B 3ZRWB 2PYLA 5AG2A 2GBOA 3JD2A 2QR4A 4IL6Z 4JI1B 4LF6O 3ABMB 1H2NA 4OXSA 4B3SB 3FB8C 3JAMN 4ZHQB 2QEXV 5BR8O 1QR8A 4RWUA 5FNVB 2P22C 5KHIA 5D5PA 4DV0O 4I55B 3CRMA 3EFFK 2LP7A 2ADPA 4JV5B 1L1FA 2RN9A 1NTKH 5FPOA 2BSKA 4GKJB 1SERA 5BR8B 4YY3O 3KCXA 3PN1A 4J42A 4LFCB 1XOUA 5JCOC 1OCCB 5LA6B 2PY5A 1GM9A 1ZTEA 4AQYO 4X64O 3TXQA 3QO8A 3R66A 3B8NA 1SQPH 1SQBH 4FPPA 4H37A 5CA0B 3FX7A 4MTOA 4I0XB 1AI5A 4GT1A 3RVYA 3Q4HB 2IH1C 4DUYO 1L0LH 1ENVA 3B8MA 1AROP 3SPGA 3JD4A 1R6NA 2FTKA 4PJ0Z 2LW7A 3W7XA 3DXRB 1OCOB 2X0LA 3SPIA 2JK5C 2YICA 1DLBA 2IW5A 2P6JA 4PI2A 4E2LA 4LF5O 4HAMA 1XMQB 2QM8A 1X59A 5E79Z 4CC5A 3BCCH 4JTDB 1AP5A 4DR6B 4HBNA 4QJFB 5LXTA 1I94O 3BAAA 1B6QA 2Q73A 3E8BA 4OX9B 2ZXWC 1WP8A 4GX0A 2RDCA 4IYHA 1FFXA 3VOUA 2HHHB 3RWRD 2ETNA 1JFFB 3JSNA 4DXWA 1JQ0A 4QPKA 2YSUB 2FB5A 3TCUA 1AP6A 5KHGA 3SPHA 1R3JC 1SKVA 4X62O 3S3XA 3DTUB 3FKSG 4PDVA 1YHQV 4JI5O 4UV9A 4JYAO 1PM9A 3E8HA 4UCUA 3AK3A 1J5EB 2UUBB 5LHIA 5EBMC 5CA3A 2ZE7A 3KKYA 3HKBB 1O9GA 1PPJH 2XOKG 4X66O 3ETQA 3RVZA 5LOVA 1QLNA 4TV9A 4O4JA 2XNDG 3G71V 4LCUC 3P32A 2K9PA 4LH6A 1TUEB 4MTXA 5F2VO 2QWQB 3CRRA 1FD9A 2XUMA 4TV8B 3B40A 1D5AA 2ATKC 1SETA 1UJWB 4B3RB 3AG4C 3IGAC 4U7OA 2ZT9B 1N32O 1THZA 1SS3A 3CD6V 1K73W 2ZDIA 2A7WA 3N2KB 1FXKC 3LDDA 5J2TA 3WB1A 3ZMSA 4FLZA 3BABA 4UCSA 4GLXA 3O9OA 1OJHA 2XASA 1EZVH 5CBFA 1XNRB 4ZIBA 3T4DA 2GSMB 4LFBO 1S5JA 1VF6C 1FXHA 1G8MA 3RYCB 1V55C 4MVMA 4EEQA 4DR4B 5LMUB 3CCQV 1JVMA 3E86A 1WNSA 3PJSK 4PDLA 1T5EA 5JVDB 5B1BC 1SQFA 1M57C 5E1AC 1VF5B 1KU9A 4E4EA 1K7DA 3H1JH 4YIPA 2VS0A 2CGNA 1KQSU 3JASB 2UXCB 4JASA 3CCMV 3UO2A 2ILMA 2ARHA 3UCSC 1XMOB 5HFLA 4OPHA 4X89A 2CUGA 4DR5O 2ZR3A 1E1RG 5CA0A 4RQEA 2YXHA 3P3NA 4ZOLB 4DUZB 2Z0AA 2Y69B 4JGSA 1K3EA 5IY5B 4FZ0A 1WA8B 4PELA 5A2QN 3DC6A 1V9PA 3FB5C 1PD3A 1YZBA 4R8CA 1COWG 2QKAA 3ZN0A 2YUAA 1HDJA 1PKXA 3RYIA 3CE2A 2E75B 4RO2A 2Q0AA 2IU0A 3T4ZA 5A9GA 3SGIA 4JI4O 5LP6B 1QR9A 5H9CA 5J2UA 4KXRA 3RBZA 2FMLA 3AG3C 4WFBV 3ABKC 3LSSA 4MTGA 2Y4TA 3RGBA 1R3LC 5LMNB 1JFFA 1XILA 5KLVH 1VQNV 3FB6C 3JATB 3CEIA 2BTQB 3F7YC 3EHBB 5IE9A 1R3IC 5JJNB 2JEUA 3ZHTA 4NTWA 4DR7B 2ZNIA 1FJGO 3B77A 3L71H 1RM1B 2HJDA 3SJBC 3L70H 1Q6IA 2OTLV 1M5IA 1K4DC 1Q43A 3HKBA 2BOCC 1BQZA 3LSQA 2CE4A 3RFRA 3SYQA 3IJ4A 4FK5C 2BOBC 3K08A 1N34B 4TV8A 1Y66A 3CB2A 1XDCA 4HNAB 5EC2C 2OT5A 4DW0A 1P7BA 1QLEC 2BTOA 2WSSG 3OR7C 3J7AU 4XDJA 3CHXA 1M4UA 3N2KA 4U7NA 5KHHA 1GN2A 2A9HA 1XL4A 1PL4A 1Q6UA 3CRQA 4KP4A 3VQYA 3ZMVA 1ZUQA 1KKDA 1P84F 2OCCC 4UXNA 2V4DA 3RYCA 4GKKB 4JF3A 2EULA 5JQGB 3CCSV 2HVKC 4OGQB 3TK1A 5IT9N 5JVDA 1IZ3A 3FD9A 1TAEA 3LDCA 4XBFA 5LGNA 2CGOA 4MW8A 1UPGA 2K1EA 1GRJA 2WLLA 2EIKC 5IJ9B 3D36C 3IC7A 1HW7A 3JASA 1XNQO 1Q8IA 5DM6V 3X2QC 3I55V 4DR1O 1LR1A 5IJ0A 1Q6HA 2WA4A 2EJ7A 2NR5A 3WG7B 4QPJA 4NTYA 2DE0X 4FLVA 1Y4MA 4UVCA 2QWRB 3N27A 3W7WA 4H0LB 3ABTA 1VQ6V 1AI6A 1RPRA 1PV0A 2JDIG 4R50A 4ZOLA 3M99B 2BSKB 4MVOA 3R65A 1WA8A 3SPCA 4Z1VA 1BL8A 1YJ9V 4FMTA 3JYCA 5D5QA 1NBMG 1PL0A 4O4IB 3OD4A 1AR4A 3JD3A 1LUVA 2WA3A 2EX3A 5KHJA 3OT7A 1FXVA 4JTCB 4LF8B 5H6RA 4Q6GA 1YTFB 2HFEC 1K92A 5LP6A 3HKEB 2LW1A 4GYCB 4WBNA 2KQXA 5BY1A 4IHJB 2B5UA 4JI0O 5BZBA 2UUAB 3CC4V 2QWOB 1MMMA 3CMAV 1ROPA 2PZSA 1WB7A 3VQWA 5C93A 2Z3YA 3RYHA 4UCVA 3ASOC 5EIBC 2BTQA 2WLIB 2D2CB 1N33O 3ABLC 1D2DA 3K79A 1Q5OA 3ABUA 1JJOA 3OTOB 2YS8A 1YVWA 3SR2C 4LF9O 1QBZA 4TUYB 2KSDA 2Q7EA 3TETA 4DV2O 3JCZA 1IBKO 5CB4B 3ZHQA 5JWPA 1KMIZ 4F6RB 1ZL8B 3E35A 3ML0A 3ZJZA 1NT2B 5IDJA 1CEZA 4FVMA 3L72H 4AHCA 3OFNG 4NKGB 1VIBA 4B3MB 2CH7B 1JA8A 1XL6A 1SESA 5IYDO 4HNAA 2W6JG 3STLC 1BS3A 1OHHG 1I5YA 1RSOB 1M9NA 1EBOA 3K9AA 1N0NA 3QO5A 4F6EA 1L8DA 5IWAO 3BFRA 3HKDB 5EIBD 1IBLB 2YIBD 4J9ZB 2H94A 2ZQMA 1I0HA 4DO2A 2Q0OC 3SYCA 5CA1B 3LNNA 1QHTA 5IWAB 3ASNC 5EZYB 3T1HB 1Z5VA 3ZN1A 4DV7O 3GB7C 1MA1A 2JIZG 3K57A 4W4LA 1G4YB 2A06H 2H8PC 2JGUA 1S77D 4JI1O 5C8YB 2DYSB 5BXZA 1W2BU 5JQGA 2AZ0A 4EFEA 3K3WA 4B3SO 5KA5A 4DR3B 3E22B 1JMKC 3OR6C 4PDMA 4NYKA 1NQTA 5IJ9A 4JPRA 4X1KB 3CCVV 1Q7YW 4JV5O 2KKWA 3JAWB 3HKCB 4GKJO 1ZAUA 4LFCO 4MSWC 3CX5F 3G4SV 3U10A 1F7YA 1ZX3A 4KUMA 4UCTA 1M56B 2A3QA 4IYIA 2WLHA 2M6YA 1H8HG 3OMIB 2EILB 1N36B 3OM3B 1A32A 2Q67A 3FFQA 4CZZA 5TISZ 1Q90D 3U11A 4ASUG 3THOA 4JI6B 3OW2U 1BSMA 4O4IA 2WLMA 1WLEA 1NR7A 2R9IA 2XAJA 4YJ2B 1S72V 1VQ9V 3CCRV 4MTFA 3ZMZA 2X6BA 1KD1W 2VQEB 3ETDA 3G6BA 1F4MA 5JH7A 2R70A 1DTOA 3HKEA 4HYOA 1BCCH 2IM9A 2LFRA 1WB8A 1XMQO 3D3QA 4IHJA 4DR6O 4AILC 2EIMC 4NXNB 2Y4UA 1HNZB 4LP8A 3E89A 1H8EG 1WN7A 4JAVA 3RYIB 4OX9O 1XI1A 2HKOA 5B66Z 3ZRXA 1DK1A 3SJAC 1BGYH 1R73A 4UVAA 4JAAA 2HHHO 2P7TC 3CXCU 5KAIZ 1E79G 2DJVA 2Q7HA 4TQDA 2F93B 4BR6A 4YXWG 2WLIA 5IYZB 2HG5C 1GO3F 1XUQA 5J2UB 4DK0A 1QNMA 4ICGA 4P9OA 2PI4A 1HNWB 4QIWF 4O4HB 2ZE6A 4RUEA 4TUYA 3L73H 4NXMB 2OWOA 2UU9B 2W0XA 3JD0A 4MVZA 2UXXA 3WB0A 1J5EO 1GTOA 2UUBO 5CB4A 4JZ2A 4MVSA 2JVDA 1I08A 5GONB 1ZL8A 1CP9A 2P4VA 3H1LH 3GVMA 4X65B 1GKFA 2Q6AA 4P2ZA 1ZLZA 1NVPD 4R7CA 1OCRC 2CH7A 2QM7A 2YIAA 4JI2B 1Y76B 3S3WA 4RUFA 4UCRA 1RSOA 2XAQA 4H13B 3C3SA 1OCZC 4Z2WA 1R1BA 3H1HH 1HNXB 2KB1A 4B3RO 3KZIZ 3HKDA 2F95B 2L6LA 1VF7A 3H1KH 3K5NA 1MABG 3WU2Z 1QVFU 4RAIA 3E83A 2MK3A 5CA1A 3TXSA 5EZYA 2V7QG 1YF2A 2B1GA 1XNRO 1B3QA 1CPYA 4Z1MG 1XBLA 5C8YA 1V54C 4DR4O 1IX9A 1PNMA 1DF5A 1HWYA 5LMUO 3E22A 3K06A 2IJJA 5IYCO 5LP6C 4X1KA 2RCVA 2ZR2A 4BIOA 3TJTA 1AJQA 3JAWA 1SZXA 3ZMUA 3HKCA 3F5WC 4BIUA 4WFEA 4X1IB 2UXCO 2DMXA 4UUJC 2CTPA 4DV3B 1BHBA 3TGUH 3HPLC 1XMOO 1JX9A 2WLLB 2QTSA 3E8GA 2GV9A 2ZINA
chains in the Genus database with same CATH topology
4U7NA 1R6KA 4FJCC 1KC8W 2A9HA 3MHSC 4ZBMA 2C2AA 3ASNB 5H6QA 1XL4A 3CC7V 1RM1C 3ZRVA 1S76D 2A0LA 4KP4A 3ZMVA 4WCEV 3CCUV 2IJIA 3W7UA 5B1OA 1KKDA 1YITV 3LUTB 2OCCC 4UXNA 1LNQA 2V1DA 1S3JA 2QKSA 4G27B 4JF3A 1K9MW 2EZPA 1F51A 3OGCC 1K5SA 2R9RB 3CCSV 1F4NA 2HVKC 3T2MA 3TK1A 3D36A 1EFRG 1AR1B 5FL7G 3LDCA 2EBOA 4XBFA 5LGNA 4MW8A 2X6AA 2K1EA 2WAMA 1IXMA 2WLLA 5LBQA 3ETGA 3K0GA 2EIKC 4X8AA 5IYBO 1SRYA 3IC7A 3I56V 1H38A 2XAGA 3X2QC 4I9WA 1K4CC 3I55V 1QVGU 1K8AW 1VQ4V 1JOYA 2IH3C 3WG7B 3AG4B 2JJ1G 4R6ZA 4BIZA 2W6IG 2AHZA 4QPJA 3FYEB 1VQOV 2B1IA 4WFHA 3K03A 1Y4MA 1K5QA 4UVCA 3AG2B 2YEVA 1AI4A 3W7WA 1FXKB 1R3KC 3ABTA 1VQ6V 1AI6A 4P30A 1JJ2U 4QE9A 1RPRA 4G28B 3QNEA 3ASOB 3CPWU 3JD1A 5EC1C 3IFXA 4JAUA 2JDIG 4R50A 3BY6A 3M99B 4H33A 4MVOA 4MW3A 3CC2V 3R65A 3ABLB 3W7SA 4RQFA 4X88A 3UKMA 1GMGA 3SPCA 3ZMTA 1BL8A 2AHYA 1YJ9V 4FMTA 2NNUA 5EBWC 2DQ0A 2Y69C 5L3BA 3JYCA 1NBMG 1VQ7V 1FFTB 2NLJC 5IY5C 1PL0A 3ZRWB 3AEIA 2EZOA 3JD2A 3JD3A 1Q86W 2DQ3A 4UVBA 3ABMB 1YSCA 4GX5A 4TT3G 1FXVA 4JTCB 4OXSA 5B1BB 2WLNA 1M57B 2EIMB 3FB8C 4BAYA 5H6RA 1YTFB 1NVPB 2QEXV 2HFEC 1K92A 3LDEA 4XDLA 1QR8A 3CMEV 5L3EA 1K34A 2JEXA 2B5UA 5BZBA 1KP2A 3BEHA 3CC4V 2Z5UA 1ZWIC 1W0JG 3EFFK 2LP7A 3CMAV 1L1FA 5KUMA 1ROPA 4MS2A 3AG2C 4EKWA 1MG1A 1EZJA 1SERA 5C93A 2Z3YA 3E2EA 4JYBA 2EIJB 3ASOC 5B3SB 1OCCB 2X6CA 1YIJV 2ZXWB 2WLIB 2P90A 3RW0A 4PA6A 3SPJA 1PNLA 1DF4A 3ABLC 3ZRWA 4PA9A 1GM9A 3K79A 2IU3A 3QO8A 1P4RA 3OAAG 3B8NA 1VQPV 3ABUA 5LHGA 4FPPA 4H37A 2Q68A 3OEHG 4MTOA 1QBZA 5HFMA 1AI5A 3GWOA 4GT1A 3RVYA 2X7RB 2IH1C 3TETA 1ENVA 3B8MA 3JCZA 1AROP 3STZC 2W0FC 3CP1A 3SPGA 3JD4A 1R6NA 2FTKA 4MVRA 1AI7A 1OCRB 2F43G 3W7XA 3E35A 1NH2B 3ML0A 2WWWA 4UV8A 1OCOB 2X0LA 3SPIA 2JK5C 3ZJZA 1DLBA 5IDJA 2IW5A 2P6JA 1CEZA 4E2LA 1OCZB 3OFNG 4HAMA 2QM8A 3AG3B 5IYDO 1KP3A 1SESA 1XL6A 1QCEA 2W6JG 3NXSA 4JTDB 3STLC 1OHHG 1I5YA 4P9PA 4QJFB 4JTAB 1M9NA 1EBOA 3K9AA 3QO5A 1NR1A 2EIJC 5B3SC 3ZRSA 1B6QA 3E8BA 2ZXWC 4GX0A 4JYCA 1Q82W 2P67A 4WFFA 3SYAA 3VOUA 4PDRA 3H01A 2DYRC 5EK0A 4J9ZB 2H94A 2ZQMA 4DXWA 3OUSA 1JQ0A 4QPKA 2YSUB 3WFVA 1VQMV 3OEEG 2LFSA 3TCUA 4DO2A 3SPHA 3SYCA 1R3JC 5DN6G 1PNKA 1K97A 5LHHA 2M7WA 3ASNC 3DTUB 3FKSG 2A79B 3DGEA 4ZKIA 4PDVA 1V54B 3ZN1A 3GB7C 1M90W 2JIZG 1YHQV 4UV9A 1MSWD 1G4YB 2H8PC 1S77D 3E8HA 4N23A 2Q69A 1YTFD 2DYSB 1NKDA 1W2BU 4L87A 5LHIA 5EBMC 2ZD9A 3K3WA 2QA4V 5CA3A 5KA5A 1GM7A 2XAFA 3CYOA 5CMUA 1AJPA 3OR6C 2XOKG 5L3GA 1S5HC 3RVZA 4PDMA 1V55B 1QLNA 1NQTA 5CBHA 1BMFG 3F7VC 4JPRA 2XNDG 3OMNB 3AG1B 4LCUC 3G71V 3CCVV 1Q7YW 3P32A 3ZIAG 1TUEB 4MTXA 1J95A 1QLEB 3SYOA 2HLDG 2WLKA 4PA7A 3E8FA 5EBLC 5J9PC 2ATKC 3CCLV 4MSWC 1SETA 1K33A 2GHYA 2ITDC 4GCZA 1UJWB 2IJHA 3G4SV 1FXKA 3WG7C 1YJNV 3AG4C 3IGAC 4I5SA 4U7OA 4KUMA 1THZA 1M56B 2WLHA 1H8HG 3OMIB 5L3FA 4CBCA 2EILB 3CD6V 1K73W 2ZDIA 1FXKC 3LDDA 3OM3B 2Q67A 4Q20A 4CZZA 4LBEC 1KECA 4J9YB 2Y48A 3ZMSA 2IJKA 4ASUG 2ZDIC 3K04A 4GX2A 1I5XA 3D3IA 4KFMA 2DYSC 2XASA 2EINB 5CBFA 3MD0A 4WFAV 3OW2U 3T4DA 4QNHB 2GSMB 2WLMA 2XAHA 1WLEA 1NR7A 2R9IA 2EJRA 2XAJA 1NH2D 1S72V 1FXHA 4LC1A 1G8MA 1NJIW 1VQ9V 3CCRV 1V55C 4FIPC 2X6BA 4MTFA 4MVMA 3ZMZA 5LGUA 1YJWV 1KD1W 3ETDA 1W0KG 4N21A 1F4MA 1GM8A 1JPXA 3AG1C 3CCQV 2D3OW 1JVMA 1WPXA 1DTOA 4HYOA 1SZTA 1M1KW 2LFRA 3E86A 3PJSK 3ABMC 3MHHC 2EIKB 4PDLA 5GW7A 5B1BC 1M57C 2EIMC 5E1AC 4LP8A 3HB3B 3E89A 1H8EG 2DW4A 2HVJC 3QO7A 1K7DA 4JAVA 4QE7A 4BW5A 2HKOA 3W7TA 1KQSU 3ZCCA 3ZRXA 1F23A 1R73A 4UVAA 4JASA 1M56C 2P7TC 3FYIB 3CXCU 1E79G 3CCMV 2EILC 4GX1A 3ABKB 2WLIA 4YXWG 2HG5C 1GO3F 5HFLA 2UXNA 1VQ5V 2YEVB 4X89A 1OCCC 4P9OA 2PI4A 2ZR3A 2EINC 4QIWF 1E1RG 1AJNA 5CBGA 4RQEA 4RUEA 3LNMB 5CN0A 1VQLV 2Y69B 4JGSA 1K3EA 3JD0A 4MVZA 2UXXA 5IY5B 2WPDG 4PELA 1GTOA 3K0DA 3VBBA 3FB5C 3OUFA 4MVSA 1PD3A 2PI5A 3FB7C 4R8CA 1COWG 5B1NA 3ZN0A 3T1CA 1Q81W 1PKXA 4WFGA 1CP9A 1VQKV 3CCJV 4RO2A 1OZ0A 1GKFA 2IU0A 3T4ZA 2Q6AA 5KUKA 2OTJV 2DWDC 3UM7A 1JCHA 5B1AB 4P2ZA 1NVPD 4R7CA 3OMAB 1OCRC 1FS0G 1N8RW 2WLJA 2QM7A 1OCOC 5L3CA 4RUFA 1QR9A 2XAQA 2HR3A 3CCEV 5H9CA 3RBZA 1OCZC 4G2KA 1E1QG 3AG3C 4WFBV 3ABKC 2KB1A 3LSSA 4MTGA 1GK9A 2HJFC 1ORQC 1R3LC 1MABG 1QVFU 1VQNV 4RAIA 3FB6C 3E83A 3ETEA 1BHAA 2MK3A 3F7YC 4WF9V 3EHBB 2V7QG 1R3IC 2B1GA 2JEUA 4XDKA 1CPYA 1RPOA 4Z1MG 3A0RA 3B77A 1RM1B 4PA4A 5L3DA 2QTOA 4HZ3A 4MVQA 1V54C 4MVUA 1PNMA 3SJQC 2OTLV 1DF5A 1K4DC 1HWYA 1S0VA 4PA3A 1VQ8V 3K06A 2OCCB 4TSFG 5B1AC 3SYPA 2BOCC 5LGTA 2IJJA 3OE7G 5KA6A 5IYCO 2CK3G 3LSQA 2QE7G 3SYQA 1YI2V 4F4LA 2ZR2A 1H2GA 1AJQA 2DWEC 4FK5C 2JJ2G 3ZMUA 2BOBC 3F5WC 4BIUA 3K08A 4WFEA 1MOFA 1Y66A 4UUJC 5EC2C 2OT5A 1P7BA 3KG2A 1BHBA 4MT8A 1QLEC 3HPLC 4TWKA 2DYRB 3P30A 2WSSG 3X2QB 1JX9A 3OR7C 2WLLB 4XDJA 3G6EV 2ITCC 3E8GA 5DM6V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 V;  1K9M W;  1YJN V;  1KQS U;  1R73 A;  3CCE V;  1VQM V;  1VQ7 V;  1VQO V;  1YI2 V;  1NJI W;  3CMA V;  3CCR V;  1VQ9 V;  1YJW V;  3CXC U;  1KC8 W;  1KD1 W;  3CCS V;  3CCM V;  4WFB V;  1K73 W;  1Q86 W;  3CD6 V;  3CC7 V;  3CCQ V;  2D3O W;  3G71 V;  3CCV V;  1Q7Y W;  1VQ6 V;  1JJ2 U;  1Q81 W;  1M1K W;  4WCE V;  1M90 W;  3CPW U;  3CCU V;  1YHQ V;  1VQ5 V;  1VQK V;  3CCJ V;  2OTL V;  1YIJ V;  1YIT V;  2QEX V;  3I56 V;  2OTJ V;  1Q82 W;  1VQ8 V;  3CC2 V;  1QVF U;  3CME V;  1VQN V;  1W2B U;  4WFA V;  3OW2 U;  3CCL V;  1VQP V;  1N8R W;  3G6E V;  3I55 V;  1QVG U;  2QA4 V;  1VQL V;  4WF9 V;  1K8A W;  1VQ4 V;  1YJ9 V;  3G4S V;  5DM6 V;  3CC4 V; 
#chains in the Genus database with same CATH topology
 1R6K A;  2ZIM A;  3MHS C;  1D5N A;  3ZHS A;  4DUZ O;  5IJ0 B;  1RM1 C;  2VWJ A;  3CC7 V;  1S76 D;  4IIJ B;  3CJH B;  1YXB A;  2IBZ H;  2IJI A;  4UB6 Z;  3KCY A;  5KMG B;  4YJ2 A;  1FAF A;  2P5O A;  2UXD B;  2QKS A;  4JYY A;  1QU7 A;  1EN5 A;  1SC5 B;  1F51 A;  2PYJ A;  1H2L A;  4DV1 B;  1AR1 B;  2H3O A;  3CXH F;  3BA9 A;  5LBQ A;  3ETG A;  3K0G A;  4DV6 B;  5IYB O;  2ZM6 B;  1TUB B;  4I9Q A;  1H38 A;  3QF7 A;  4I9W A;  2YXY A;  3K5M A;  1QVG U;  3QVN A;  5LMN O;  3AG4 B;  5IYZ A;  4BIZ A;  2AHZ A;  1VQO V;  4JI7 B;  4WBN B;  3K03 A;  3AG2 B;  1FXK B;  1JJ2 U;  4O4H A;  4G28 B;  4DR7 O;  3CPW U;  4JI8 O;  3JD1 A;  5JJE B;  5EC1 C;  4JAU A;  3BY6 A;  3DSQ A;  1KB9 F;  4MW3 A;  4J7K A;  4DV5 B;  3RYH B;  4RQF A;  3K5L A;  4DRX B;  3M8A A;  3UKM A;  3ZBH A;  2NNU A;  2PF4 E;  2UXB B;  5L3B A;  3JSL A;  5GON A;  2LGW A;  3AEI A;  4LF7 O;  2VQF B;  4JI8 B;  1RFY A;  1Q86 W;  2DQ3 A;  3ZS8 C;  4ZI7 B;  4UVB A;  4GX5 A;  4TT3 G;  5B1B B;  2WLN A;  1M57 B;  4BAY A;  2E74 B;  1Y76 A;  3LDE A;  1N34 O;  1XRE A;  2AGA A;  2DOS A;  4LNU B;  5L3E A;  1NTZ H;  1K34 A;  2JEX A;  4LF7 B;  4MS2 A;  5JCO A;  4EKW A;  2XTA A;  1EZJ A;  1NS1 A;  2EIJ B;  5B3S B;  3B2E E;  4DR2 B;  1YIJ V;  1AVM A;  4JZG A;  1PNL A;  1DF4 A;  1O9H A;  4PA9 A;  2IU3 A;  1P4R A;  2O57 A;  1VQP V;  5LHG A;  2E76 B;  4CS4 A;  4YHH B;  1KBH A;  2B9Z A;  1US6 A;  5HFM A;  3GWO A;  2FKX A;  3B4S A;  4GKK O;  2KG7 A;  2NN4 A;  3A0H Z;  4FFB B;  2UUC B;  4NB5 A;  3T1Y B;  3STZ C;  2E5L B;  2W0F C;  1HR0 B;  1AI7 A;  2GTA A;  3N2G B;  4I50 B;  2F43 G;  1NH2 B;  2AW9 A;  4X1I A;  3AG3 B;  1KP3 A;  1HP8 A;  1SA0 B;  4P9P A;  2VRZ A;  2OIG A;  3JAK B;  2QSA A;  4F6R A;  1Q82 W;  4WFF A;  3VQX A;  2DYR C;  5EK0 A;  2BE3 A;  2JS3 A;  3OUS A;  3WFV A;  4IIJ A;  1VQM V;  3OEE G;  3CJH A;  1IBM B;  5KX5 B;  5DN6 G;  1PNK A;  5LHH A;  2M7W A;  3F5T A;  2F4V B;  4ZKI A;  2A79 B;  3DGE A;  5KMG A;  5FPR A;  4LWS B;  3K9S A;  1M90 W;  1MSW D;  1VMG A;  1P49 A;  3MDS A;  3IC9 A;  1Y74 B;  4N23 A;  3APO A;  3CRC A;  1YTF D;  1NKD A;  2ZD9 A;  4LF8 O;  4K8Z A;  5CMU A;  1AJP A;  4KHP B;  1NU1 H;  1PP9 H;  1DGS A;  1IXB A;  5CBH A;  1BMF G;  2UUA O;  2G38 A;  3F7V C;  3AG1 B;  1TUB A;  2N74 A;  4B08 A;  1J95 A;  1QLE B;  5JH7 B;  4U3J B;  3SYO A;  2HLD G;  2WLK A;  4PA7 A;  3E8F A;  5EBL C;  4FM0 A;  2ITD C;  2GHY A;  1FXK A;  1YJN V;  1VP7 A;  4I5S A;  4O4L B;  3K58 A;  5L3F A;  4CBC A;  4BWA A;  5B5E Z;  3OTO O;  2JGD B;  2ZIO A;  2RJZ A;  4Q20 A;  1L0N H;  1KEC A;  4J9Y B;  4DRX A;  2LJ2 A;  2ZDI C;  3K04 A;  1VF6 A;  4KFM A;  2DYS C;  1IUR A;  2EIN B;  4WFA V;  1RP3 B;  2EJR A;  4JI3 B;  4UCO A;  1G1X B;  4ZI7 A;  1NJI W;  3NR7 A;  3H1I H;  1GN6 A;  5LGU A;  4K0K O;  3RT3 C;  4LFA B;  3HR0 A;  3BPZ A;  5K1X A;  1WPX A;  4LNU A;  3ABM C;  4B3M O;  2EIK B;  5GW7 A;  1YDX A;  1GAX A;  2DW4 A;  3QO7 A;  1KUQ A;  4BW5 A;  2L35 A;  4K0K B;  3UQ8 A;  5BMV B;  3ZCC A;  1VEW A;  1IBL O;  3BRC A;  1M56 C;  3JAR B;  4O2A A;  2EIL C;  4PV1 B;  1NTM H;  4GX1 A;  1MSD A;  3EXA A;  1CXZ B;  2GTS A;  4B7E A;  2YEV B;  4DV4 B;  2R9A A;  1OCC C;  3T1H O;  2QJ1 A;  1TVK B;  4CS2 A;  1AJN A;  5CBG A;  3LNM B;  2ZNJ A;  4K35 A;  4AI8 A;  4FFB A;  5EYP B;  4TOI A;  3OUF A;  4DR3 O;  2PI5 A;  3FB7 C;  3JCU Z;  1BT8 A;  5B1N A;  1WP7 A;  3T1C A;  1Q81 W;  3N2G A;  4I50 A;  4LF4 B;  4OPA A;  4WFG A;  3I5D A;  4I4T B;  4C7U A;  1OZ0 A;  1VAR A;  5KUK A;  2OTJ V;  2DWD C;  1JCH A;  4J10 A;  5B1A B;  3OMA B;  1SA0 A;  3A8T A;  1OCO C;  3JAK A;  1Z5W A;  2CTR A;  4BW9 A;  3AG7 A;  2HJF C;  1ORQ C;  1S5L Z;  2FL4 A;  3BHP A;  1N36 O;  4B3T B;  3ETE A;  1BHA A;  5KX5 A;  1IDS A;  1BQ0 A;  3FAV A;  4X9Q A;  2PUS A;  4LWS A;  4JI6 O;  4XDK A;  2OYQ A;  4FM2 A;  4UB8 Z;  1GN4 A;  3A0R A;  1Y74 A;  5L3D A;  4HZ3 A;  4A5U B;  4MVQ A;  4DYL A;  4MVU A;  2VQE O;  2F1M A;  3SJQ C;  4CC6 A;  2R72 A;  1S0V A;  4PA3 A;  1VQ8 V;  3SYP A;  5LGT A;  3L9D A;  3OE7 G;  1EN4 A;  2Y0P A;  4NXN O;  1U97 A;  3SDL A;  4FM1 A;  1HNZ O;  3UT5 B;  4LF6 B;  4F4L A;  4FLT A;  1H2G A;  5KAF Z;  2JJ2 G;  1BZK A;  1XHZ A;  4U3J A;  4EB6 B;  4J11 A;  4J7Z A;  4NVP A;  4CS3 A;  4O2B A;  1Y67 A;  1GN3 A;  2QM4 A;  1N0J A;  4DV0 B;  1YCI A;  2YI8 A;  4TWK A;  4O4L A;  3P30 A;  1URF A;  2N04 A;  3AK1 A;  4UFZ A;  2JGD A;  1HNW O;  4YY3 B;  3DC5 A;  2P4K A;  4ZBM A;  2Y0I A;  4NXM O;  3ASN B;  3IAY A;  2UU9 O;  2A0L A;  1SQQ H;  4AQY B;  4X64 B;  2PTM A;  5B1O A;  1B06 A;  2QWP B;  1NZ6 A;  1LNQ A;  1N4C A;  2V1D A;  1S3J A;  3QG5 A;  4G27 B;  4X65 O;  4DUY B;  2EZP A;  5LYJ B;  3OGC C;  1K5S A;  2R9R B;  5ITZ B;  3T2M A;  3D36 A;  4JI2 O;  1EFR G;  1AIL A;  2X6A A;  4KL1 A;  3QTC A;  4DW1 A;  4X8A A;  1SRY A;  4U3F H;  1HNX O;  2HP8 A;  4YIO A;  5BMV A;  2XAG A;  4LF5 B;  3JAR A;  2IH3 C;  2JJ1 G;  2W6I G;  1I94 B;  1ZSP A;  4WFH A;  3B09 A;  1X4T A;  3JAL B;  4YJ3 B;  1K5Q A;  2YEV A;  1AI4 A;  4X1Y B;  1TVK A;  1B04 A;  2QDO A;  3QNE A;  2GDS A;  3IFX A;  1Z2G A;  3CC2 V;  3W7S A;  5EYP A;  1SQX H;  1GMG A;  1FKA O;  1FYJ A;  3ZMT A;  4X62 B;  2Y69 C;  5IY5 C;  3J80 N;  1TA8 A;  4JI5 B;  2EZO A;  1SQV H;  2Q4P A;  2XHB A;  4I4T A;  4JYA B;  4J7J A;  1H2K A;  2Q5Z A;  1H2M A;  1YSC A;  3OTF A;  3J81 N;  2EIM B;  1NVP B;  4FLY A;  2KG7 B;  4XDL A;  3CME V;  4X66 B;  2DN9 A;  3ICX A;  1YEW A;  4H44 B;  4DV3 O;  1KP2 A;  3BEH A;  2Z5U A;  1ZWI C;  2F66 C;  1W0J G;  5KUM A;  4LH7 A;  4NTX A;  3AG2 C;  1MG1 A;  2YIB A;  1MZF A;  3E2E A;  4JYB A;  1WPB A;  4EFB A;  2BCC H;  4K3A A;  2X6C A;  2ZXW B;  3RW0 A;  2P90 A;  3SPJ A;  4PA6 A;  2QGN A;  1N32 B;  2LO1 A;  3ZRW A;  2LQT A;  3OAA G;  2Q68 A;  3OEH G;  4IGG A;  1Q3E A;  1MZE A;  2UXD O;  4ZHQ A;  2X7R B;  5FNV A;  2GUZ B;  4LFB B;  4DV1 O;  3CP1 A;  1AB3 A;  4I55 A;  2CAZ C;  4MVR A;  3UT5 A;  2VWK A;  4CH6 A;  1OCR B;  4DV6 O;  3CWB H;  2WWW A;  4UV8 A;  2AXT Z;  2OIE A;  2ZM6 O;  3A2F A;  4EB6 A;  1OCZ B;  3NXS A;  1QCE A;  5LA6 A;  4JTA B;  2HEP A;  4JI7 O;  1NR1 A;  2EIJ C;  5B3S C;  3ZRS A;  1XQ8 A;  4JYC A;  4GZR B;  2P67 A;  3SYA A;  2E3C A;  3H01 A;  4PDR A;  4I0X A;  3Q4H A;  2Q9L A;  3L75 H;  2LFS A;  3VQV A;  4DV5 O;  1TGO A;  4TQF A;  3O65 A;  3LSU A;  3G80 A;  1K97 A;  2UXB O;  4DR5 B;  1V54 B;  5FLX N;  3DXR A;  2VQF O;  2Q69 A;  5LYJ A;  4L87 A;  4QGP A;  3CRA A;  5ITZ A;  3K59 A;  2QA4 V;  1GM7 A;  2XAF A;  3CYO A;  5L3G A;  1S5H C;  2CTQ A;  1V55 B;  1G6U A;  4B7K A;  3ZHR A;  3OMN B;  3ZIA G;  4JI4 B;  4FLW A;  3CS5 A;  4LR3 A;  1EN6 A;  4X20 B;  5J9P C;  4K8X A;  3CCL V;  3JAL A;  4YJ3 A;  4DR2 O;  1K33 A;  4GCZ A;  2IJH A;  4X1Y A;  3WG7 C;  4NR1 A;  1LUW A;  4FZ1 A;  1QQC A;  4YHH O;  1XEQ A;  4LBE C;  3APQ A;  2Y48 A;  4O2A B;  2IJK A;  3RYF B;  4GX2 A;  1I5X A;  3D3I A;  2UUC O;  2YI9 A;  3MD0 A;  4ABM A;  4QNH B;  3T1Y O;  2E5L O;  2XAH A;  1FJG B;  3UO3 A;  1HR0 O;  1NH2 D;  4LC1 A;  4FIP C;  1YJW V;  1WJZ A;  3C90 A;  2F23 A;  1W0K G;  4N21 A;  1GM8 A;  1JPX A;  3AG1 C;  2D3O W;  1SZT A;  1M1K W;  3MHH C;  4PD4 F;  2Q8V A;  3M7M X;  5GTH Z;  3HB3 B;  1UFI A;  2RMK B;  2HVJ C;  1XHX A;  1AR5 A;  4QE7 A;  1BE3 H;  3K5O A;  3W7T A;  2PGG A;  1F23 A;  4W4K A;  3FYI B;  2P06 A;  4L8J A;  3ZHV A;  1WAZ A;  3ABK B;  2LGQ A;  1JR9 A;  1IBM O;  5H5N A;  2UXN A;  1VQ5 V;  3ZED A;  1I7F A;  2F4V O;  2EIN C;  2FYU H;  4I7Z B;  5CN0 A;  1VQL V;  4CH5 A;  2WPD G;  3K0D A;  2ZKO A;  2MW2 B;  1Y6X A;  2ZE5 A;  3VBB A;  2GUZ A;  3FAV B;  4FFK A;  1SF9 A;  4D7S A;  2CDY A;  4KHP O;  4FLX A;  4IT5 A;  2YC0 A;  3CSX A;  1VQK V;  3CCJ V;  1KYO F;  5GTI Z;  3P3P A;  3UM7 A;  1N8R W;  1FS0 G;  2WLJ A;  2JRI A;  5L3C A;  4DK1 A;  1W59 A;  2HR3 A;  3CCE V;  2ADQ B;  4G2K A;  1E1Q G;  1U96 A;  1GK9 A;  1XNQ B;  2QWN B;  4DR1 B;  3G67 A;  2OCH A;  2YXL A;  1M93 A;  5LL6 Y;  4CH4 A;  4WF9 V;  4O2B B;  3D8C A;  1SQG A;  1RPO A;  2YID A;  3A0B Z;  1R6T A;  4JI3 O;  4D7T A;  4PA4 A;  2QTO A;  4LFA O;  2QKC A;  3BVO A;  4J41 A;  5B1A C;  2OCC B;  4TSF G;  2ZCE A;  5KA6 A;  2CK3 G;  3RN4 A;  2QE7 G;  1YI2 V;  2ODM A;  1NI8 A;  2DWE C;  4GUN A;  2RQ6 A;  5KHK A;  1GH6 A;  4X20 A;  3JAT A;  1MOF A;  5H2F Z;  2AZ2 A;  4JI0 B;  3KG2 A;  4MT8 A;  3MAQ A;  5LXT B;  2DYR B;  4CH3 A;  3X2Q B;  3G6E V;  1MNG A;  2ITC C;  4DV4 O;  1FFX B;  4FJC C;  1KC8 W;  2C2A A;  5H6Q A;  3ZX6 A;  2YDE A;  3RYF A;  3ZRV A;  1H2S B;  5K1P A;  1N33 B;  4WCE V;  4PHZ A;  2RNB A;  3CCU V;  3AK2 A;  3W7U A;  3C3T A;  1YIT V;  3LUT B;  1FPO A;  1EM1 A;  3H9V A;  5DED A;  4LF4 O;  4LF9 B;  5JJJ B;  4DV2 B;  5DEC A;  1K9M W;  2N05 A;  1IBK B;  1F4N A;  1KKC A;  2ZE8 A;  5FL7 G;  3GWK C;  2EBO A;  5LOV B;  4FLU A;  2WAM A;  1IXM A;  4TV9 B;  4O4J B;  3WB2 A;  2JS5 A;  3I56 V;  4D6T H;  1K4C C;  3OGI B;  1K8A W;  1VQ4 V;  1JOY A;  1P7G A;  3BA8 A;  4R6Z A;  4B3T O;  3FYE B;  2B1I A;  2XT9 A;  1R3K C;  2CTW A;  4P30 A;  4PI0 A;  4QE9 A;  1OV9 A;  3ASO B;  3SJC C;  3L74 H;  1IVS A;  4H33 A;  4J80 A;  3ABL B;  5J2T B;  3ZHU A;  4X88 A;  2AHY A;  5EBW C;  2DQ0 A;  2Q7G A;  3EVK A;  1VQ7 V;  1FFT B;  2NLJ C;  3U0Z A;  4DV7 B;  3ZRW B;  2PYL A;  5AG2 A;  2GBO A;  3JD2 A;  2QR4 A;  4IL6 Z;  4JI1 B;  4LF6 O;  3ABM B;  1H2N A;  4OXS A;  4B3S B;  3FB8 C;  3JAM N;  4ZHQ B;  2QEX V;  5BR8 O;  1QR8 A;  4RWU A;  5FNV B;  2P22 C;  5KHI A;  5D5P A;  4DV0 O;  4I55 B;  3CRM A;  3EFF K;  2LP7 A;  2ADP A;  4JV5 B;  1L1F A;  2RN9 A;  1NTK H;  5FPO A;  2BSK A;  4GKJ B;  1SER A;  5BR8 B;  4YY3 O;  3KCX A;  3PN1 A;  4J42 A;  4LFC B;  1XOU A;  5JCO C;  1OCC B;  5LA6 B;  2PY5 A;  1GM9 A;  1ZTE A;  4AQY O;  4X64 O;  3TXQ A;  3QO8 A;  3R66 A;  3B8N A;  1SQP H;  1SQB H;  4FPP A;  4H37 A;  5CA0 B;  3FX7 A;  4MTO A;  4I0X B;  1AI5 A;  4GT1 A;  3RVY A;  3Q4H B;  2IH1 C;  4DUY O;  1L0L H;  1ENV A;  3B8M A;  1ARO P;  3SPG A;  3JD4 A;  1R6N A;  2FTK A;  4PJ0 Z;  2LW7 A;  3W7X A;  3DXR B;  1OCO B;  2X0L A;  3SPI A;  2JK5 C;  2YIC A;  1DLB A;  2IW5 A;  2P6J A;  4PI2 A;  4E2L A;  4LF5 O;  4HAM A;  1XMQ B;  2QM8 A;  1X59 A;  5E79 Z;  4CC5 A;  3BCC H;  4JTD B;  1AP5 A;  4DR6 B;  4HBN A;  4QJF B;  5LXT A;  1I94 O;  3BAA A;  1B6Q A;  2Q73 A;  3E8B A;  4OX9 B;  2ZXW C;  1WP8 A;  4GX0 A;  2RDC A;  4IYH A;  1FFX A;  3VOU A;  2HHH B;  3RWR D;  2ETN A;  1JFF B;  3JSN A;  4DXW A;  1JQ0 A;  4QPK A;  2YSU B;  2FB5 A;  3TCU A;  1AP6 A;  5KHG A;  3SPH A;  1R3J C;  1SKV A;  4X62 O;  3S3X A;  3DTU B;  3FKS G;  4PDV A;  1YHQ V;  4JI5 O;  4UV9 A;  4JYA O;  1PM9 A;  3E8H A;  4UCU A;  3AK3 A;  1J5E B;  2UUB B;  5LHI A;  5EBM C;  5CA3 A;  2ZE7 A;  3KKY A;  3HKB B;  1O9G A;  1PPJ H;  2XOK G;  4X66 O;  3ETQ A;  3RVZ A;  5LOV A;  1QLN A;  4TV9 A;  4O4J A;  2XND G;  3G71 V;  4LCU C;  3P32 A;  2K9P A;  4LH6 A;  1TUE B;  4MTX A;  5F2V O;  2QWQ B;  3CRR A;  1FD9 A;  2XUM A;  4TV8 B;  3B40 A;  1D5A A;  2ATK C;  1SET A;  1UJW B;  4B3R B;  3AG4 C;  3IGA C;  4U7O A;  2ZT9 B;  1N32 O;  1THZ A;  1SS3 A;  3CD6 V;  1K73 W;  2ZDI A;  2A7W A;  3N2K B;  1FXK C;  3LDD A;  5J2T A;  3WB1 A;  3ZMS A;  4FLZ A;  3BAB A;  4UCS A;  4GLX A;  3O9O A;  1OJH A;  2XAS A;  1EZV H;  5CBF A;  1XNR B;  4ZIB A;  3T4D A;  2GSM B;  4LFB O;  1S5J A;  1VF6 C;  1FXH A;  1G8M A;  3RYC B;  1V55 C;  4MVM A;  4EEQ A;  4DR4 B;  5LMU B;  3CCQ V;  1JVM A;  3E86 A;  1WNS A;  3PJS K;  4PDL A;  1T5E A;  5JVD B;  5B1B C;  1SQF A;  1M57 C;  5E1A C;  1VF5 B;  1KU9 A;  4E4E A;  1K7D A;  3H1J H;  4YIP A;  2VS0 A;  2CGN A;  1KQS U;  3JAS B;  2UXC B;  4JAS A;  3CCM V;  3UO2 A;  2ILM A;  2ARH A;  3UCS C;  1XMO B;  5HFL A;  4OPH A;  4X89 A;  2CUG A;  4DR5 O;  2ZR3 A;  1E1R G;  5CA0 A;  4RQE A;  2YXH A;  3P3N A;  4ZOL B;  4DUZ B;  2Z0A A;  2Y69 B;  4JGS A;  1K3E A;  5IY5 B;  4FZ0 A;  1WA8 B;  4PEL A;  5A2Q N;  3DC6 A;  1V9P A;  3FB5 C;  1PD3 A;  1YZB A;  4R8C A;  1COW G;  2QKA A;  3ZN0 A;  2YUA A;  1HDJ A;  1PKX A;  3RYI A;  3CE2 A;  2E75 B;  4RO2 A;  2Q0A A;  2IU0 A;  3T4Z A;  5A9G A;  3SGI A;  4JI4 O;  5LP6 B;  1QR9 A;  5H9C A;  5J2U A;  4KXR A;  3RBZ A;  2FML A;  3AG3 C;  4WFB V;  3ABK C;  3LSS A;  4MTG A;  2Y4T A;  3RGB A;  1R3L C;  5LMN B;  1JFF A;  1XIL A;  5KLV H;  1VQN V;  3FB6 C;  3JAT B;  3CEI A;  2BTQ B;  3F7Y C;  3EHB B;  5IE9 A;  1R3I C;  5JJN B;  2JEU A;  3ZHT A;  4NTW A;  4DR7 B;  2ZNI A;  1FJG O;  3B77 A;  3L71 H;  1RM1 B;  2HJD A;  3SJB C;  3L70 H;  1Q6I A;  2OTL V;  1M5I A;  1K4D C;  1Q43 A;  3HKB A;  2BOC C;  1BQZ A;  3LSQ A;  2CE4 A;  3RFR A;  3SYQ A;  3IJ4 A;  4FK5 C;  2BOB C;  3K08 A;  1N34 B;  4TV8 A;  1Y66 A;  3CB2 A;  1XDC A;  4HNA B;  5EC2 C;  2OT5 A;  4DW0 A;  1P7B A;  1QLE C;  2BTO A;  2WSS G;  3OR7 C;  3J7A U;  4XDJ A;  3CHX A;  1M4U A;  3N2K A;  4U7N A;  5KHH A;  1GN2 A;  2A9H A;  1XL4 A;  1PL4 A;  1Q6U A;  3CRQ A;  4KP4 A;  3VQY A;  3ZMV A;  1ZUQ A;  1KKD A;  1P84 F;  2OCC C;  4UXN A;  2V4D A;  3RYC A;  4GKK B;  4JF3 A;  2EUL A;  5JQG B;  3CCS V;  2HVK C;  4OGQ B;  3TK1 A;  5IT9 N;  5JVD A;  1IZ3 A;  3FD9 A;  1TAE A;  3LDC A;  4XBF A;  5LGN A;  2CGO A;  4MW8 A;  1UPG A;  2K1E A;  1GRJ A;  2WLL A;  2EIK C;  5IJ9 B;  3D36 C;  3IC7 A;  1HW7 A;  3JAS A;  1XNQ O;  1Q8I A;  5DM6 V;  3X2Q C;  3I55 V;  4DR1 O;  1LR1 A;  5IJ0 A;  1Q6H A;  2WA4 A;  2EJ7 A;  2NR5 A;  3WG7 B;  4QPJ A;  4NTY A;  2DE0 X;  4FLV A;  1Y4M A;  4UVC A;  2QWR B;  3N27 A;  3W7W A;  4H0L B;  3ABT A;  1VQ6 V;  1AI6 A;  1RPR A;  1PV0 A;  2JDI G;  4R50 A;  4ZOL A;  3M99 B;  2BSK B;  4MVO A;  3R65 A;  1WA8 A;  3SPC A;  4Z1V A;  1BL8 A;  1YJ9 V;  4FMT A;  3JYC A;  5D5Q A;  1NBM G;  1PL0 A;  4O4I B;  3OD4 A;  1AR4 A;  3JD3 A;  1LUV A;  2WA3 A;  2EX3 A;  5KHJ A;  3OT7 A;  1FXV A;  4JTC B;  4LF8 B;  5H6R A;  4Q6G A;  1YTF B;  2HFE C;  1K92 A;  5LP6 A;  3HKE B;  2LW1 A;  4GYC B;  4WBN A;  2KQX A;  5BY1 A;  4IHJ B;  2B5U A;  4JI0 O;  5BZB A;  2UUA B;  3CC4 V;  2QWO B;  1MMM A;  3CMA V;  1ROP A;  2PZS A;  1WB7 A;  3VQW A;  5C93 A;  2Z3Y A;  3RYH A;  4UCV A;  3ASO C;  5EIB C;  2BTQ A;  2WLI B;  2D2C B;  1N33 O;  3ABL C;  1D2D A;  3K79 A;  1Q5O A;  3ABU A;  1JJO A;  3OTO B;  2YS8 A;  1YVW A;  3SR2 C;  4LF9 O;  1QBZ A;  4TUY B;  2KSD A;  2Q7E A;  3TET A;  4DV2 O;  3JCZ A;  1IBK O;  5CB4 B;  3ZHQ A;  5JWP A;  1KMI Z;  4F6R B;  1ZL8 B;  3E35 A;  3ML0 A;  3ZJZ A;  1NT2 B;  5IDJ A;  1CEZ A;  4FVM A;  3L72 H;  4AHC A;  3OFN G;  4NKG B;  1VIB A;  4B3M B;  2CH7 B;  1JA8 A;  1XL6 A;  1SES A;  5IYD O;  4HNA A;  2W6J G;  3STL C;  1BS3 A;  1OHH G;  1I5Y A;  1RSO B;  1M9N A;  1EBO A;  3K9A A;  1N0N A;  3QO5 A;  4F6E A;  1L8D A;  5IWA O;  3BFR A;  3HKD B;  5EIB D;  1IBL B;  2YIB D;  4J9Z B;  2H94 A;  2ZQM A;  1I0H A;  4DO2 A;  2Q0O C;  3SYC A;  5CA1 B;  3LNN A;  1QHT A;  5IWA B;  3ASN C;  5EZY B;  3T1H B;  1Z5V A;  3ZN1 A;  4DV7 O;  3GB7 C;  1MA1 A;  2JIZ G;  3K57 A;  4W4L A;  1G4Y B;  2A06 H;  2H8P C;  2JGU A;  1S77 D;  4JI1 O;  5C8Y B;  2DYS B;  5BXZ A;  1W2B U;  5JQG A;  2AZ0 A;  4EFE A;  3K3W A;  4B3S O;  5KA5 A;  4DR3 B;  3E22 B;  1JMK C;  3OR6 C;  4PDM A;  4NYK A;  1NQT A;  5IJ9 A;  4JPR A;  4X1K B;  3CCV V;  1Q7Y W;  4JV5 O;  2KKW A;  3JAW B;  3HKC B;  4GKJ O;  1ZAU A;  4LFC O;  4MSW C;  3CX5 F;  3G4S V;  3U10 A;  1F7Y A;  1ZX3 A;  4KUM A;  4UCT A;  1M56 B;  2A3Q A;  4IYI A;  2WLH A;  2M6Y A;  1H8H G;  3OMI B;  2EIL B;  1N36 B;  3OM3 B;  1A32 A;  2Q67 A;  3FFQ A;  4CZZ A;  5TIS Z;  1Q90 D;  3U11 A;  4ASU G;  3THO A;  4JI6 B;  3OW2 U;  1BSM A;  4O4I A;  2WLM A;  1WLE A;  1NR7 A;  2R9I A;  2XAJ A;  4YJ2 B;  1S72 V;  1VQ9 V;  3CCR V;  4MTF A;  3ZMZ A;  2X6B A;  1KD1 W;  2VQE B;  3ETD A;  3G6B A;  1F4M A;  5JH7 A;  2R70 A;  1DTO A;  3HKE A;  4HYO A;  1BCC H;  2IM9 A;  2LFR A;  1WB8 A;  1XMQ O;  3D3Q A;  4IHJ A;  4DR6 O;  4AIL C;  2EIM C;  4NXN B;  2Y4U A;  1HNZ B;  4LP8 A;  3E89 A;  1H8E G;  1WN7 A;  4JAV A;  3RYI B;  4OX9 O;  1XI1 A;  2HKO A;  5B66 Z;  3ZRX A;  1DK1 A;  3SJA C;  1BGY H;  1R73 A;  4UVA A;  4JAA A;  2HHH O;  2P7T C;  3CXC U;  5KAI Z;  1E79 G;  2DJV A;  2Q7H A;  4TQD A;  2F93 B;  4BR6 A;  4YXW G;  2WLI A;  5IYZ B;  2HG5 C;  1GO3 F;  1XUQ A;  5J2U B;  4DK0 A;  1QNM A;  4ICG A;  4P9O A;  2PI4 A;  1HNW B;  4QIW F;  4O4H B;  2ZE6 A;  4RUE A;  4TUY A;  3L73 H;  4NXM B;  2OWO A;  2UU9 B;  2W0X A;  3JD0 A;  4MVZ A;  2UXX A;  3WB0 A;  1J5E O;  1GTO A;  2UUB O;  5CB4 A;  4JZ2 A;  4MVS A;  2JVD A;  1I08 A;  5GON B;  1ZL8 A;  1CP9 A;  2P4V A;  3H1L H;  3GVM A;  4X65 B;  1GKF A;  2Q6A A;  4P2Z A;  1ZLZ A;  1NVP D;  4R7C A;  1OCR C;  2CH7 A;  2QM7 A;  2YIA A;  4JI2 B;  1Y76 B;  3S3W A;  4RUF A;  4UCR A;  1RSO A;  2XAQ A;  4H13 B;  3C3S A;  1OCZ C;  4Z2W A;  1R1B A;  3H1H H;  1HNX B;  2KB1 A;  4B3R O;  3KZI Z;  3HKD A;  2F95 B;  2L6L A;  1VF7 A;  3H1K H;  3K5N A;  1MAB G;  3WU2 Z;  1QVF U;  4RAI A;  3E83 A;  2MK3 A;  5CA1 A;  3TXS A;  5EZY A;  2V7Q G;  1YF2 A;  2B1G A;  1XNR O;  1B3Q A;  1CPY A;  4Z1M G;  1XBL A;  5C8Y A;  1V54 C;  4DR4 O;  1IX9 A;  1PNM A;  1DF5 A;  1HWY A;  5LMU O;  3E22 A;  3K06 A;  2IJJ A;  5IYC O;  5LP6 C;  4X1K A;  2RCV A;  2ZR2 A;  4BIO A;  3TJT A;  1AJQ A;  3JAW A;  1SZX A;  3ZMU A;  3HKC A;  3F5W C;  4BIU A;  4WFE A;  4X1I B;  2UXC O;  2DMX A;  4UUJ C;  2CTP A;  4DV3 B;  1BHB A;  3TGU H;  3HPL C;  1XMO O;  1JX9 A;  2WLL B;  2QTS A;  3E8G A;  2GV9 A;  2ZIN A; 
#chains in the Genus database with same CATH homology
 4U7N A;  1R6K A;  4FJC C;  1KC8 W;  2A9H A;  3MHS C;  4ZBM A;  2C2A A;  3ASN B;  5H6Q A;  1XL4 A;  3CC7 V;  1RM1 C;  3ZRV A;  1S76 D;  2A0L A;  4KP4 A;  3ZMV A;  4WCE V;  3CCU V;  2IJI A;  3W7U A;  5B1O A;  1KKD A;  1YIT V;  3LUT B;  2OCC C;  4UXN A;  1LNQ A;  2V1D A;  1S3J A;  2QKS A;  4G27 B;  4JF3 A;  1K9M W;  2EZP A;  1F51 A;  3OGC C;  1K5S A;  2R9R B;  3CCS V;  1F4N A;  2HVK C;  3T2M A;  3TK1 A;  3D36 A;  1EFR G;  1AR1 B;  5FL7 G;  3LDC A;  2EBO A;  4XBF A;  5LGN A;  4MW8 A;  2X6A A;  2K1E A;  2WAM A;  1IXM A;  2WLL A;  5LBQ A;  3ETG A;  3K0G A;  2EIK C;  4X8A A;  5IYB O;  1SRY A;  3IC7 A;  3I56 V;  1H38 A;  2XAG A;  3X2Q C;  4I9W A;  1K4C C;  3I55 V;  1QVG U;  1K8A W;  1VQ4 V;  1JOY A;  2IH3 C;  3WG7 B;  3AG4 B;  2JJ1 G;  4R6Z A;  4BIZ A;  2W6I G;  2AHZ A;  4QPJ A;  3FYE B;  1VQO V;  2B1I A;  4WFH A;  3K03 A;  1Y4M A;  1K5Q A;  4UVC A;  3AG2 B;  2YEV A;  1AI4 A;  3W7W A;  1FXK B;  1R3K C;  3ABT A;  1VQ6 V;  1AI6 A;  4P30 A;  1JJ2 U;  4QE9 A;  1RPR A;  4G28 B;  3QNE A;  3ASO B;  3CPW U;  3JD1 A;  5EC1 C;  3IFX A;  4JAU A;  2JDI G;  4R50 A;  3BY6 A;  3M99 B;  4H33 A;  4MVO A;  4MW3 A;  3CC2 V;  3R65 A;  3ABL B;  3W7S A;  4RQF A;  4X88 A;  3UKM A;  1GMG A;  3SPC A;  3ZMT A;  1BL8 A;  2AHY A;  1YJ9 V;  4FMT A;  2NNU A;  5EBW C;  2DQ0 A;  2Y69 C;  5L3B A;  3JYC A;  1NBM G;  1VQ7 V;  1FFT B;  2NLJ C;  5IY5 C;  1PL0 A;  3ZRW B;  3AEI A;  2EZO A;  3JD2 A;  3JD3 A;  1Q86 W;  2DQ3 A;  4UVB A;  3ABM B;  1YSC A;  4GX5 A;  4TT3 G;  1FXV A;  4JTC B;  4OXS A;  5B1B B;  2WLN A;  1M57 B;  2EIM B;  3FB8 C;  4BAY A;  5H6R A;  1YTF B;  1NVP B;  2QEX V;  2HFE C;  1K92 A;  3LDE A;  4XDL A;  1QR8 A;  3CME V;  5L3E A;  1K34 A;  2JEX A;  2B5U A;  5BZB A;  1KP2 A;  3BEH A;  3CC4 V;  2Z5U A;  1ZWI C;  1W0J G;  3EFF K;  2LP7 A;  3CMA V;  1L1F A;  5KUM A;  1ROP A;  4MS2 A;  3AG2 C;  4EKW A;  1MG1 A;  1EZJ A;  1SER A;  5C93 A;  2Z3Y A;  3E2E A;  4JYB A;  2EIJ B;  3ASO C;  5B3S B;  1OCC B;  2X6C A;  1YIJ V;  2ZXW B;  2WLI B;  2P90 A;  3RW0 A;  4PA6 A;  3SPJ A;  1PNL A;  1DF4 A;  3ABL C;  3ZRW A;  4PA9 A;  1GM9 A;  3K79 A;  2IU3 A;  3QO8 A;  1P4R A;  3OAA G;  3B8N A;  1VQP V;  3ABU A;  5LHG A;  4FPP A;  4H37 A;  2Q68 A;  3OEH G;  4MTO A;  1QBZ A;  5HFM A;  1AI5 A;  3GWO A;  4GT1 A;  3RVY A;  2X7R B;  2IH1 C;  3TET A;  1ENV A;  3B8M A;  3JCZ A;  1ARO P;  3STZ C;  2W0F C;  3CP1 A;  3SPG A;  3JD4 A;  1R6N A;  2FTK A;  4MVR A;  1AI7 A;  1OCR B;  2F43 G;  3W7X A;  3E35 A;  1NH2 B;  3ML0 A;  2WWW A;  4UV8 A;  1OCO B;  2X0L A;  3SPI A;  2JK5 C;  3ZJZ A;  1DLB A;  5IDJ A;  2IW5 A;  2P6J A;  1CEZ A;  4E2L A;  1OCZ B;  3OFN G;  4HAM A;  2QM8 A;  3AG3 B;  5IYD O;  1KP3 A;  1SES A;  1XL6 A;  1QCE A;  2W6J G;  3NXS A;  4JTD B;  3STL C;  1OHH G;  1I5Y A;  4P9P A;  4QJF B;  4JTA B;  1M9N A;  1EBO A;  3K9A A;  3QO5 A;  1NR1 A;  2EIJ C;  5B3S C;  3ZRS A;  1B6Q A;  3E8B A;  2ZXW C;  4GX0 A;  4JYC A;  1Q82 W;  2P67 A;  4WFF A;  3SYA A;  3VOU A;  4PDR A;  3H01 A;  2DYR C;  5EK0 A;  4J9Z B;  2H94 A;  2ZQM A;  4DXW A;  3OUS A;  1JQ0 A;  4QPK A;  2YSU B;  3WFV A;  1VQM V;  3OEE G;  2LFS A;  3TCU A;  4DO2 A;  3SPH A;  3SYC A;  1R3J C;  5DN6 G;  1PNK A;  1K97 A;  5LHH A;  2M7W A;  3ASN C;  3DTU B;  3FKS G;  2A79 B;  3DGE A;  4ZKI A;  4PDV A;  1V54 B;  3ZN1 A;  3GB7 C;  1M90 W;  2JIZ G;  1YHQ V;  4UV9 A;  1MSW D;  1G4Y B;  2H8P C;  1S77 D;  3E8H A;  4N23 A;  2Q69 A;  1YTF D;  2DYS B;  1NKD A;  1W2B U;  4L87 A;  5LHI A;  5EBM C;  2ZD9 A;  3K3W A;  2QA4 V;  5CA3 A;  5KA5 A;  1GM7 A;  2XAF A;  3CYO A;  5CMU A;  1AJP A;  3OR6 C;  2XOK G;  5L3G A;  1S5H C;  3RVZ A;  4PDM A;  1V55 B;  1QLN A;  1NQT A;  5CBH A;  1BMF G;  3F7V C;  4JPR A;  2XND G;  3OMN B;  3AG1 B;  4LCU C;  3G71 V;  3CCV V;  1Q7Y W;  3P32 A;  3ZIA G;  1TUE B;  4MTX A;  1J95 A;  1QLE B;  3SYO A;  2HLD G;  2WLK A;  4PA7 A;  3E8F A;  5EBL C;  5J9P C;  2ATK C;  3CCL V;  4MSW C;  1SET A;  1K33 A;  2GHY A;  2ITD C;  4GCZ A;  1UJW B;  2IJH A;  3G4S V;  1FXK A;  3WG7 C;  1YJN V;  3AG4 C;  3IGA C;  4I5S A;  4U7O A;  4KUM A;  1THZ A;  1M56 B;  2WLH A;  1H8H G;  3OMI B;  5L3F A;  4CBC A;  2EIL B;  3CD6 V;  1K73 W;  2ZDI A;  1FXK C;  3LDD A;  3OM3 B;  2Q67 A;  4Q20 A;  4CZZ A;  4LBE C;  1KEC A;  4J9Y B;  2Y48 A;  3ZMS A;  2IJK A;  4ASU G;  2ZDI C;  3K04 A;  4GX2 A;  1I5X A;  3D3I A;  4KFM A;  2DYS C;  2XAS A;  2EIN B;  5CBF A;  3MD0 A;  4WFA V;  3OW2 U;  3T4D A;  4QNH B;  2GSM B;  2WLM A;  2XAH A;  1WLE A;  1NR7 A;  2R9I A;  2EJR A;  2XAJ A;  1NH2 D;  1S72 V;  1FXH A;  4LC1 A;  1G8M A;  1NJI W;  1VQ9 V;  3CCR V;  1V55 C;  4FIP C;  2X6B A;  4MTF A;  4MVM A;  3ZMZ A;  5LGU A;  1YJW V;  1KD1 W;  3ETD A;  1W0K G;  4N21 A;  1F4M A;  1GM8 A;  1JPX A;  3AG1 C;  3CCQ V;  2D3O W;  1JVM A;  1WPX A;  1DTO A;  4HYO A;  1SZT A;  1M1K W;  2LFR A;  3E86 A;  3PJS K;  3ABM C;  3MHH C;  2EIK B;  4PDL A;  5GW7 A;  5B1B C;  1M57 C;  2EIM C;  5E1A C;  4LP8 A;  3HB3 B;  3E89 A;  1H8E G;  2DW4 A;  2HVJ C;  3QO7 A;  1K7D A;  4JAV A;  4QE7 A;  4BW5 A;  2HKO A;  3W7T A;  1KQS U;  3ZCC A;  3ZRX A;  1F23 A;  1R73 A;  4UVA A;  4JAS A;  1M56 C;  2P7T C;  3FYI B;  3CXC U;  1E79 G;  3CCM V;  2EIL C;  4GX1 A;  3ABK B;  2WLI A;  4YXW G;  2HG5 C;  1GO3 F;  5HFL A;  2UXN A;  1VQ5 V;  2YEV B;  4X89 A;  1OCC C;  4P9O A;  2PI4 A;  2ZR3 A;  2EIN C;  4QIW F;  1E1R G;  1AJN A;  5CBG A;  4RQE A;  4RUE A;  3LNM B;  5CN0 A;  1VQL V;  2Y69 B;  4JGS A;  1K3E A;  3JD0 A;  4MVZ A;  2UXX A;  5IY5 B;  2WPD G;  4PEL A;  1GTO A;  3K0D A;  3VBB A;  3FB5 C;  3OUF A;  4MVS A;  1PD3 A;  2PI5 A;  3FB7 C;  4R8C A;  1COW G;  5B1N A;  3ZN0 A;  3T1C A;  1Q81 W;  1PKX A;  4WFG A;  1CP9 A;  1VQK V;  3CCJ V;  4RO2 A;  1OZ0 A;  1GKF A;  2IU0 A;  3T4Z A;  2Q6A A;  5KUK A;  2OTJ V;  2DWD C;  3UM7 A;  1JCH A;  5B1A B;  4P2Z A;  1NVP D;  4R7C A;  3OMA B;  1OCR C;  1FS0 G;  1N8R W;  2WLJ A;  2QM7 A;  1OCO C;  5L3C A;  4RUF A;  1QR9 A;  2XAQ A;  2HR3 A;  3CCE V;  5H9C A;  3RBZ A;  1OCZ C;  4G2K A;  1E1Q G;  3AG3 C;  4WFB V;  3ABK C;  2KB1 A;  3LSS A;  4MTG A;  1GK9 A;  2HJF C;  1ORQ C;  1R3L C;  1MAB G;  1QVF U;  1VQN V;  4RAI A;  3FB6 C;  3E83 A;  3ETE A;  1BHA A;  2MK3 A;  3F7Y C;  4WF9 V;  3EHB B;  2V7Q G;  1R3I C;  2B1G A;  2JEU A;  4XDK A;  1CPY A;  1RPO A;  4Z1M G;  3A0R A;  3B77 A;  1RM1 B;  4PA4 A;  5L3D A;  2QTO A;  4HZ3 A;  4MVQ A;  1V54 C;  4MVU A;  1PNM A;  3SJQ C;  2OTL V;  1DF5 A;  1K4D C;  1HWY A;  1S0V A;  4PA3 A;  1VQ8 V;  3K06 A;  2OCC B;  4TSF G;  5B1A C;  3SYP A;  2BOC C;  5LGT A;  2IJJ A;  3OE7 G;  5KA6 A;  5IYC O;  2CK3 G;  3LSQ A;  2QE7 G;  3SYQ A;  1YI2 V;  4F4L A;  2ZR2 A;  1H2G A;  1AJQ A;  2DWE C;  4FK5 C;  2JJ2 G;  3ZMU A;  2BOB C;  3F5W C;  4BIU A;  3K08 A;  4WFE A;  1MOF A;  1Y66 A;  4UUJ C;  5EC2 C;  2OT5 A;  1P7B A;  3KG2 A;  1BHB A;  4MT8 A;  1QLE C;  3HPL C;  4TWK A;  2DYR B;  3P30 A;  2WSS G;  3X2Q B;  1JX9 A;  3OR7 C;  2WLL B;  4XDJ A;  3G6E V;  2ITC C;  3E8G A;  5DM6 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...