1N8RW

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1n8rW00
1YJWV 1S72V 1YITV 2QA4V 1JJ2U 1VQ7V 3CCRV 1YIJV 3CC2V 1QVFU 1YHQV 1KC8W 1KD1W 3G4SV 5DM6V 2QEXV 3CMEV 1M1KW 1VQLV 3CCLV 1YI2V 3OW2U 1VQKV 1N8RW 1VQ8V 3CD6V 1Q7YW 4WFBV 3CCSV 3G6EV 3G71V 3I56V 1QVGU 1R73A 4WFAV 3CCJV 1K73W 1KQSU 1YJ9V 1K8AW 1YJNV 1VQPV 3CPWU 4WF9V 1VQMV 1Q81W 1NJIW 2OTJV 1VQ9V 2OTLV 1Q82W 1M90W 2D3OW 4WCEV 1VQOV 3CMAV 1W2BU 3CCUV 3CC7V 1VQNV 1Q86W 3I55V 1K9MW 1VQ6V 3CCQV 3CC4V 3CXCU 3CCVV 1VQ4V 3CCMV 3CCEV 1VQ5V
chains in the Genus database with same CATH superfamily
4X66B 1IX9A 1I0HA 2IBZH 2Q5ZA 3A0RA 3AG2B 4LFBO 5J2UA 4LH7A 3T2MA 1LUVA 1WPXA 2DE0X 2OCCB 4MS2A 3ZRXA 5JJEB 5AG2A 5EZYA 4F4LA 4FVMA 2FKXA 2DOSA 1VQMV 1K4CC 2E5LO 1KB9F 5LHHA 5EC2C 1K92A 1H2SB 2HVJC 1VARA 1ROPA 2FTKA 2YSUB 4I4TA 1Y4MA 2CAZC 2F95B 4QPKA 1J5EB 2KSDA 1F51A 2IM9A 4O4HA 4DK0A 2ZD9A 2XUMA 1JPXA 5LP6B 4JI7O 1RPRA 3AG4C 2HEPA 1PNLA 3E8BA 4FPPA 3CEIA 2ZM6B 4XDLA 2QKAA 2FYUH 1M4UA 4ZBMA 1QLEB 1MNGA 2DJVA 3OUFA 2P90A 2ZDIA 3CS5A 1IXBA 5GONB 2OCCC 4UUJC 4X88A 5LMNO 1VF5B 5CA0B 4U3JA 5A9GA 3CSXA 4B3RO 2WLKA 1W59A 4I0XB 2OYQA 3LDDA 5CB4B 3HKBA 1GMGA 4FIPC 1W2BU 4QGPA 1G4YB 2WSSG 4EB6B 3K04A 5GTIZ 4DR1B 1R6NA 5EK0A 2UXDB 3J80N 3ZMSA 5DECA 3ZMVA 1M1KW 4TUYA 3B09A 4HNAA 3OMIB 2VRZA 4D6TH 2LQTA 2GTAA 4YJ2B 1P7GA 1FKAO 2QM7A 1QLEC 3SYPA 1XHXA 3MHSC 1W0KG 3K03A 3JYCA 5JVDB 2UUAB 3A0HZ 2OWOA 2RCVA 3EXAA 1OCCB 3RGBA 1JJOA 2HG5C 3OT7A 4LF8B 3THOA 1CXZB 3AG7A 3N2KB 1Q5OA 3F7VC 3EFFK 3G67A 2UUBO 1MSWD 1E79G 4ICGA 1J95A 2WA4A 4BIUA 3DGEA 2E75B 5KUMA 2CUGA 4JV5O 4DV6O 2ADQB 1FYJA 3ASNB 5LBQA 1VQ7V 4LF5B 1Z2GA 2EIMB 3OEHG 2HJFC 2ZQMA 4PI2A 1SKVA 2EIKC 3E2EA 1Q90D 3JARB 4I9QA 1HNWO 2Q0AA 2KG7B 3D8CA 4UB8Z 3ABMB 4WBNA 3TJTA 1OCCC 2QKSA 3CRCA 1VIBA 3OEEG 3LUTB 4PA6A 4X1IB 1NZ6A 1JX9A 4H0LB 2QM8A 5IYCO 4KP4A 2OCHA 4UCVA 1JMKC 4PDLA 4TV9A 2EIMC 1SETA 5H5NA 2E76B 1JJ2U 4JI0O 3SDLA 4MVSA 3R65A 3G6BA 3H1LH 2QJ1A 4MVMA 5LYJA 3FYEB 3ZN1A 1PPJH 5D5QA 1HR0O 2PI4A 2Q67A 5IJ0B 4FLXA 4DV5O 5KHGA 1B6QA 4PA3A 3L71H 1XOUA 1BHBA 3ABMC 3H1KH 2HJDA 4IT5A 4NTXA 3I55V 2PY5A 3ZHUA 4FK5C 5KX5A 4B7KA 1S76D 4MSWC 4CBCA 5DM6V 4LF6B 5JH7A 1RSOB 4JAVA 1GM7A 4UV9A 5CMUA 1S5LZ 1ZL8B 1US6A 2QSAA 4O2AA 3SPGA 1GAXA 2HR3A 4YIPA 3ZMUA 2E3CA 3ETGA 4JI6O 4JZ2A 3DC5A 2VQFO 3L72H 1N0JA 2IH3C 3CYOA 3STLC 2FB5A 3FKSG 4DYLA 3UKMA 1VP7A 3HKCA 2XAHA 3RYIB 2Q69A 1VMGA 1N4CA 1XUQA 2F4VB 1I08A 3OR7C 4JI5B 5EYPB 5BR8B 3WB1A 3K5NA 3JCUZ 4JI1O 3T1YO 1N36O 3JSNA 3VQWA 1Q86W 1TUBA 4LFCB 3RFRA 4NR1A 3F7YC 3RYHA 3FYIB 2K9PA 5KA6A 4JGSA 2MK3A 2KQXA 2GSMB 3W7TA 1ZLZA 1AP5A 2F93B 1N33O 4NVPA 1THZA 3LSUA 4P2ZA 1WA8A 1TVKB 3OAAG 2JVDA 5LGTA 5KHKA 2UXCO 4LWSA 4K0KB 2IJHA 1YF2A 1URFA 3HKDA 1QR9A 4UVAA 1BT8A 2PGGA 4D7SA 5JQGB 2BSKB 3G71V 4OPAA 1AJPA 1NKDA 2ADPA 1UJWB 2JGDA 3QO8A 3CHXA 4K3AA 1FFXB 2IW5A 4O4LB 3LDEA 3KZIZ 3E8FA 5K1PA 4FM1A 1CP9A 2PF4E 5H2FZ 1WB7A 4DV7O 1IBLB 2B1IA 1X59A 5IYZB 1YJ9V 4O4IB 1FXHA 4OGQB 4N23A 2A7WA 2AHZA 2X6BA 1NH2D 2EJ7A 3CX5F 3IJ4A 4JYAB 2A06H 1H2MA 5F2VO 2CTQA 2Q8VA 4FLTA 5LA6B 4R50A 3H1HH 1Q43A 3UT5A 4LNUB 4DW1A 4X1KA 3P3PA 1E1QG 3ZHQA 1LNQA 4AQYO 3BCCH 4CH5A 4PA7A 4Z1MG 3B4SA 3JCZA 4ZOLB 3C3SA 1ZX3A 1NBMG 2GHYA 2P22C 1B04A 1MZFA 1Q6HA 4TV8B 4DUZB 4CH6A 1KYOF 1B3QA 1H2NA 4UFZA 1L0LH 3IGAC 4DR7B 4H33A 4X1YB 4GZRB 5E1AC 1KP3A 2UUCB 2A9HA 4B7EA 1AB3A 2Y48A 4PV1B 1N0NA 3OGCC 2Z3YA 3P30A 3K79A 2PYLA 1K9MW 1S5HC 4DK1A 1R3JC 1WP7A 4RUFA 2E74B 2W0FC 4LH6A 4UVCA 4P30A 3KCYA 1UPGA 1YZBA 3G6EV 4ABMA 3L9DA 3CJHA 2ZNJA 5L3FA 4IHJA 2XOKG 4UCUA 3K57A 1XL4A 2JS5A 3FAVA 3EVKA 4LC1A 1FAFA 1YIJV 5L3CA 1XMOO 4MW8A 4MTOA 1SF9A 4U3FH 2Q4PA 5ITZA 2YS8A 3APOA 1HW7A 1K73W 4DV3B 2YEVB 2JS3A 3K9AA 1EBOA 1FJGB 1AR5A 3RYCA 3JATB 4LBEC 3UO3A 1XDCA 2ATKC 3OE7G 4JASA 1BZKA 3K59A 1JCHA 4NTYA 1S72V 4B3MO 3E35A 1EZVH 1IXMA 1FS0G 4UVBA 3JAWA 1SA0B 4WFBV 3B2EE 4DRXB 5EBWC 2DYRB 3A0BZ 2GTSA 2AGAA 2PZSA 2JJ1G 1ZSPA 2CTRA 3ABLB 1BS3A 1GN4A 3ZHTA 1NTKH 4LF9B 2NLJC 2WLJA 4L87A 4X20A 1KU9A 5J2TA 2HVKC 2NR5A 5LL6Y 1IBKB 2WWWA 1IBMO 2XAFA 1YTFD 3OD4A 4FZ1A 4YJ3B 3UQ8A 1XNQB 3AEIA 2YC0A 4O4JA 2JRIA 3ZCCA 4K8ZA 1AP6A 1M90W 3JAMN 3CC7V 1I5XA 1N32O 2BE3A 4FJCC 4KHPB 4A5UB 3T1HB 3OFNG 4X65B 3QO7A 5JJNB 2YIDA 4DR3B 3ABLC 2QR4A 3IAYA 2XAGA 5IYDO 4Z1VA 2WLLA 3SR2C 5EBMC 3UCSC 1SQXH 2UU9O 1GM8A 4R8CA 3WG7B 2BTQB 4LFBB 2DN9A 3EHBB 5LXTA 3CMEV 4U7NA 3C3TA 1K5QA 2BOBC 1XBLA 2V7QG 4KUMA 3W7UA 1V54B 3ZRWA 5LOVB 4B3SO 3FFQA 2E5LB 4DUYO 2M6YA 1N34B 1R3LC 3AG1B 1AI7A 2X0LA 2QKCA 2Q73A 5CA1A 1VQ6V 3CCMV 1HNXO 2L6LA 3NXSA 3K58A 3OTFA 3JASA 3ASOB 5EC1C 4KFMA 1OHHG 4IL6Z 4MTFA 4JI7B 4YXWG 4DV2B 1NT2B 3P3NA 5C8YA 2HP8A 1VF6C 2Y0PA 3U0ZA 1Y76B 1EFRG 1MABG 4HZ3A 1HNZB 1V55B 1Y74B 3U11A 3CCQV 3CD6V 3CCJV 1JFFB 4AILC 3ZMZA 1YHQV 1V54C 4JTDB 2DWDC 5LMNB 1KUQA 2R72A 4B3RB 3AG1C 5L3DA 1AI6A 3LNMB 1BHAA 4I55B 2Q6AA 2ZR3A 3L70H 3AG2C 4O2BB 2WLHA 4DO2A 2O57A 1YEWA 2N04A 2LO1A 1TGOA 3KKYA 4X8AA 2KKWA 4CH4A 4U7OA 3JALA 3ETEA 2WLIB 3FB6C 1V55C 5C93A 2IJIA 3R66A 4JYBA 2X6CA 2XTAA 3AG3B 4FFBA 3CXCU 1MG1A 1H8HG 5IWAO 4UCTA 1NS1A 3CCRV 2ODMA 1ENVA 1YSCA 4PHZA 5LP6C 1CEZA 3E86A 2V1DA 2EILB 2ZE5A 1QVGU 2UUBB 1NVPB 3E22B 3JAKA 4DR5B 1CPYA 3SPHA 2Z5UA 5BMVB 2AHYA 3ETQA 2AW9A 1VQNV 4JV5B 5H9CA 4DV6B 2VQEO 3FB8C 1QHTA 1D5NA 1VEWA 4JF3A 4J42A 2YUAA 4F6RB 2N74A 2F43G 5CBFA 1B06A 2A3QA 4J7KA 2ZR2A 2G38A 2GV9A 1HNWB 3CRMA 3ETDA 4GX2A 5H6QA 4DR4O 2M7WA 1YCIA 4ZI7B 2AXTZ 3CCEV 4DV4O 3D36A 5B3SB 2EILC 5H6RA 3TETA 2UXDO 1KECA 3BRCA 1XMQB 3BY6A 2GDSA 4J10A 1R3IC 1Q7YW 1AJNA 1P7BA 1COWG 3FB7C 3HKEB 3L75H 4BIOA 4YY3O 1K97A 3ABKB 1M9NA 2A79B 1DF4A 1Q81W 2QDOA 4JTCB 1VF6A 1K4DC 5IJ9B 4WCEV 2C2AA 3GWOA 1YDXA 2W6IG 1AROP 1AI4A 4CC6A 1QVFU 5BY1A 3ZHRA 4AI8A 1HR0B 3SJAC 4X62O 4P9OA 2ILMA 4DV5B 2PTMA 3QVNA 1PKXA 2XAQA 4DW0A 3M8AA 2D2CB 3CPWU 2HHHO 2WA3A 5K1XA 1BGYH 5B3SC 3CMAV 3GB7C 3ASNC 3CCVV 1PD3A 3CC2V 2QTOA 1EM1A 1KC8W 2P5OA 2OIGA 5GTHZ 3ABKC 4TSFG 1D2DA 5KMGB 4J11A 4W4KA 3W7WA 3JD1A 1AVMA 1RFYA 4KL1A 4GKKO 5IT9N 2YI8A 3RYFB 1G1XB 4JI6B 2VQFB 5JWPA 1VQ5V 3VQYA 1SESA 4JI4O 3A2FA 4QIWF 1XNRO 1G8MA 3J81N 3VQXA 2ETNA 2QWOB 5LP6A 5B1BB 4JI1B 4E4EA 4ZHQB 3T1YB 4JI8B 1H2GA 1N36B 3WB0A 2R9RB 5IE9A 3Q4HB 3B8MA 4IGGA 4FM0A 3BEHA 1K7DA 3ZHVA 3T4DA 2P67A 1JR9A 1R1BA 2QTSA 3E89A 3ZJZA 2AZ2A 5GONA 2XASA 1ZAUA 3BFRA 5CA0A 4IIJB 4FLWA 4PA9A 2ZT9B 1N33B 1PL4A 1HWYA 4I0XA 3NR7A 5CB4A 1VQOV 1RM1B 2QE7G 1QLNA 3G80A 2VS0A 3QO5A 2ARHA 2IU3A 2UXCB 3ZRSA 4J80A 5FPOA 4EB6A 1Z5WA 4W4LA 3SYQA 3PN1A 3M7MX 3K5OA 5B1BC 3ZHSA 1MMMA 1P49A 3E8HA 3CCSV 1G6UA 4DV0O 1FPOA 4WFAV 2P06A 1ZTEA 2NN4A 4MVZA 1FD9A 3E8GA 3SJQC 5L3GA 4YJ2A 1K8AW 2R70A 5IY5B 3OR6C 1NJIW 5CN0A 1EZJA 2DMXA 2CH7B 3ZN0A 2CTPA 3O9OA 4RAIA 5JVDA 1FXKB 3UM7A 1BQZA 3H1JH 2YICA 3ZEDA 4EFEA 4DV7B 3OUSA 1N8RW 1P84F 1VF7A 3B77A 3ML0A 2XT9A 4H37A 1DGSA 2EIJB 4ZIBA 3N2KA 4GYCB 1RM1C 4JI5O 1NR7A 2JK5C 2YXYA 2BOCC 4H13B 1KBHA 4WFFA 4B3TO 2ZIMA 2Q0OC 4NXNB 1GRJA 3ICXA 2ZKOA 4WFEA 2OIEA 4CS4A 5IY5C 2UXBB 5FL7G 2IJJA 4AQYB 1NR1A 3RT3C 1H38A 1OV9A 3OTOO 2BCCH 3JARA 1FXKC 1F4NA 2KG7A 1NI8A 3SYCA 5FNVB 3ZMTA 2EIJC 4K0KO 3L74H 3JD4A 4X1IA 2H3OA 2QM4A 4HYOA 2R9IA 3N2GB 2RDCA 3VOUA 3M99B 3C90A 4X64B 4GX5A 3DC6A 1JOYA 4BWAA 4OX9B 3DXRA 4JTAB 3DTUB 2CGOA 2CGNA 5LHGA 5LMUO 2F23A 1EN5A 1OCZB 1LR1A 2ZCEA 1KKDA 4MTXA 5IJ0A 2IJKA 1ZUQA 4JZGA 4X9QA 2ZE6A 4YIOA 4EEQA 2B9ZA 4Q20A 3SPIA 1NU1H 5KUKA 3CC4V 1XMOB 1EN4A 5LHIA 4JYAO 1ZWIC 5J9PC 1MOFA 5J2UB 4CC5A 1KD1W 3RN4A 1AILA 1RSOA 1NH2B 1T5EA 4AHCA 1GTOA 4FZ0A 5EZYB 3T1CA 1ZL8A 4JAUA 4HBNA 2MW2B 3UO2A 4NXMB 4UCRA 4LP8A 4I4TB 1IURA 4B3MB 2GUZA 4GX1A 1QBZA 4O4HB 1OCZC 1OZ0A 2A0LA 3LNNA 4I7ZB 1IVSA 4B08A 2X7RB 3RYIA 3X2QB 4WFHA 1H2LA 4LFAB 4DXWA 5EYPA 1F23A 4XBFA 3O65A 1Q6IA 4J9YB 4MVRA 3D3IA 4JYCA 3RVZA 5JJJB 2WPDG 4UCSA 2F1MA 2EINB 5IYBO 1X4TA 4U3JB 3LDCA 3MHHC 2Y4UA 4NB5A 4GKJO 1NQTA 3ZIAG 4WF9V 1I94O 4NKGB 3HKBB 3SYOA 5DEDA 1F7YA 4I9WA 1TVKA 3RVYA 3X2QC 5EIBC 4TUYB 4HNAB 1JQ0A 4JAAA 1WB8A 3CXHF 5JQGA 2BSKA 1BQ0A 4OPHA 1R3KC 3QNEA 4UB6Z 2UU9B 3RWRD 2RMKB 2ZDIC 5KHJA 1FFXA 1OCRB 2UXNA 4O4LA 1SERA 4JI2O 3MD0A 2PI5A 4IYIA 1BMFG 1O9HA 4DR6B 3CP1A 2DYRC 4B3SB 3TGUH 1AI5A 2GBOA 4DUYB 2ZINA 5IYZA 4JPRA 1K3EA 4O4IA 1HNXB 1DK1A 1GKFA 1XI1A 4EFBA 2LJ2A 5EBLC 1SC5B 4LF7O 5L3BA 5LA6A 2Y69B 3E83A 1VQKV 3PJSK 4LNUA 4FLVA 2FMLA 3JD3A 3BVOA 1OCRC 4H44B 2LW7A 1IDSA 1QR8A 3K06A 2QWNB 3WFVA 4D7TA 2CK3G 4IYHA 1YTFB 2H8PC 4ZOLA 1NTZH 1S3JA 3BAAA 4WBNB 1VQ4V 1JVMA 3AK1A 2Q7HA 4F6EA 3W7SA 4KHPO 4DR2O 4TV8A 3T1HO 1W0JG 1GK9A 5JCOC 4PI0A 2ZE8A 4X65O 4FFKA 3B40A 4X1YA 2AZ0A 3I56V 1Q6UA 4LF4O 5CA3A 4Z2WA 1VQ9V 3WG7C 1M56B 2EZOA 1KMIZ 3BABA 4J7ZA 4JI3O 4TV9B 4UCOA 1MSDA 2Y69C 1IZ3A 5LYJB 4YHHO 4PA4A 4G28B 4GCZA 1GN2A 1BSMA 4NYKA 2DYSB 3IFXA 5E79Z 1N34O 1Q82W 5B66Z 2LP7A 4DV1O 5IWAB 3TCUA 2RQ6A 5KX5B 3ASOC 2XHBA 1NVPD 3STZC 2X6AA 2LGWA 3G4SV 4X66O 5JH7B 2P6JA 3H9VA 1JA8A 1BE3H 1OCOB 4DV2O 1M56C 1GN3A 5B1OA 4O2AB 2YEVA 1WNSA 1S77D 2DW4A 1HNZO 3JATA 1XEQA 2VQEB 1PNMA 2ZIOA 4MTGA 5LGNA 4I50A 4MVUA 2DYSC 1J5EO 4P9PA 4K35A 3HKCB 1SA0A 3LSSA 1ORQC 4PDRA 4DRXA 1QNMA 1KQSU 5LGUA 1KKCA 3HB3B 1D5AA 4DR4B 4J7JA 2QGNA 4DV4B 2ZM6O 2QA4V 3BPZA 1TUBB 2Q68A 2JIZG 2EBOA 1OCOC 2UXXA 3RYHB 3I5DA 4YY3B 2ITDC 4TOIA 3CCLV 1VQ8V 3J7AU 1DF5A 1WP8A 1YJNV 4YJ3A 3AG3C 3VBBA 2W0XA 2EIKB 1WA8B 2WLMA 2H94A 1P4RA 2LGQA 1YITV 3F5TA 4RQEA 4LWSB 4DR1O 3HKDB 4X62B 4FLUA 1SZTA 2YDEA 5JCOA 5GW7A 4CS2A 1R73A 4Q6GA 2HHHB 4R7CA 4DR5O 2JGDB 3OGIB 4BR6A 3IC7A 1Y67A 3CCUV 3FX7A 3WU2Z 1GH6A 2V4DA 2BTQA 4JI0B 1FXVA 2EULA 2HLDG 2UUAO 3F5WC 4LF8O 5LOVA 3H1IH 4CS3A 4GKKB 3DSQA 3K3WA 2YIBA 2OT5A 2WLNA 3TXQA 4QNHB 3P32A 1XILA 3FB5C 1L1FA 3QG5A 4BW9A 4JI4B 1XNRB 3HPLC 5KA5A 4LF5O 3CRAA 3CRQA 1XMQO 5FLXN 1L8DA 2RJZA 3UT5B 2EJRA 4TQDA 2LFSA 4ASUG 4X1KB 1OJHA 1SQVH 1Y76A 2DWEC 1SRYA 4NTWA 1Y74A 1M5IA 3DXRB 1MZEA 4RWUA 1O9GA 1JFFA 3HR0A 1TAEA 5IDJA 4PELA 1XREA 3A8TA 1K5SA 1AR1B 2ZE7A 5KAFZ 1M57B 2VWJA 3RBZA 2K1EA 4GUNA 4I55A 3CWBH 4FMTA 4XDKA 4O2BA 2Y4TA 4PJ0Z 5HFLA 1QCEA 3SGIA 4DV0B 3OW2U 2WLIA 5KAIZ 3CJHB 1AR4A 5HFMA 4IHJB 1SQGA 2GUZB 1I5YA 3FAVB 2RNBA 4PD4F 1YVWA 1XL6A 5BXZA 5ITZB 4LCUC 1M57C 4LF6O 2JEUA 2HFEC 3E22A 3W7XA 3RYCB 3LSQA 4JI8O 4TQFA 5BMVA 4C7UA 2Q7GA 5BZBA 1DLBA 1PM9A 4B3TB 4RUEA 4J9ZB 4X89A 3JAWB 1I7FA 4F6RA 3GVMA 1SQFA 4GLXA 2P4KA 3OTOB 2F4VO 4EKWA 5BR8O 3TK1A 1TUEB 2IU0A 5B1NA 5A2QN 4ZI7A 1SZXA 1YJWV 4X20B 5KHHA 4LFCO 3OMNB 3JD0A 5J2TB 5CBGA 4CZZA 4HAMA 3HKEA 1M93A 1SQQH 3SJCC 4O4JB 1KP2A 3D3QA 5B1AB 3RW0A 5IJ9A 3K5LA 3CE2A 4QJFB 1PNKA 2CDYA 4JYYA 2RN9A 3TXSA 5LMUB 3WB2A 1WJZA 4WFGA 1WLEA 2Y0IA 3BHPA 2WLLB 2JGUA 4ZKIA 4FM2A 4FLZA 3VQVA 3MDSA 2LW1A 1R6TA 4QE7A 5LXTB 3BA9A 3K08A 4J41A 3QTCA 2Q7EA 2ITCC 4NXNO 4GT1A 3ZRWB 5B1AC 5KHIA 5KMGA 2UXBO 1IBLO 1PP9H 3SPCA 2VWKA 1XQ8A 4G27B 1GO3F 2KB1A 3RYFA 5CA1B 4RO2A 4E2LA 4RQFA 4BIZA 4BW5A 5EIBD 4MW3A 4MVOA 3JASB 5FPRA 2IH1C 1WN7A 1YXBA 1NTMH 3GWKC 1V9PA 5C8YB 3FD9A 4XDJA 2FL4A 4L8JA 3K9SA 2QWPB 2XAJA 4FLYA 4ZHQA 3OMAB 1FFTB 2OTJV 2OTLV 1PL0A 1LUWA 2JEXA 2YXHA 3Q4HA 4X64O 3MAQA 3S3WA 3N27A 4OX9O 3ZRVA 2EX3A 1SS3A 1BL8A 2PUSA 5TISZ 4K8XA 4DUZO 3AK3A 3SPJA 2N05A 4QPJA 2PYJA 1PV0A 2EZPA 4GKJB 4IIJA 4DR7O 3K0GA 2WAMA 1I94B 1SQPH 2B1GA 2UUCO 4UXNA 1K33A 2Q9LA 2YIAA 5L3EA 1VQPV 2LFRA 1E1RG 1K34A 3CRRA 1S0VA 1YI2V 3JALB 1IBMB 2QWRB 4N21A 3S3XA 3OM3B 1RP3B 1U97A 3IC9A 1QQCA 2YI9A 1H8EG 5DN6G 2D3OW 4NXMO 1U96A 1N32B 3AK2A 3SYAA 4FFBB 2CH7A 4JI2B 1RPOA 1A32A 3KCXA 4I50B 4PDVA 2W6JG 1FXKA 4MT8A 3ZX6A 2F66C 1VQLV 1Z5VA 5D5PA 3JAKB 1TA8A 3ABTA 4LR3A 2HKOA 1WPBA 2ZXWB 2NNUA 4DV3O 4LFAO 2DQ3A 1DTOA 3SJBC 2ZNIA 1FJGO 4G2KA 3H01A 4LF7B 3KG2A 3JD2A 2EINC 4BAYA 2B5UA 2XNDG 2QEXV 1XHZA 5B5EZ 2BTOA 2YIBD 1Y6XA 2DQ0A 3L73H 3T4ZA 1UFIA 1GM9A 3K5MA 4QE9A 1SQBH 3APQA 4OXSA 4TT3G 2CTWA 4UV8A 2JJ2G 2P4VA 3QF7A 4KXRA 4DR2B 2YXLA 2QWQB 4LF9O 3ABUA 1QU7A 1F4MA 5FNVA 2CE4A 4I5SA 1EN6A 1Q8IA 3K0DA 1Y66A 2ZXWC 3B8NA 2Z0AA 1GN6A 4LF4B 2R9AA 1WAZA 3CB2A 4GX0A 3N2GA 4CH3A 1IBKO 1XNQO 4JI3B 2L35A 3ZS8C 1L0NH 5CBHA 1AJQA 4YHHB 3ZBHA 1BCCH 2JDIG 4PDMA 3JSLA 4MVQA 4DR6O 4TWKA 1Q3EA 3BA8A 4R6ZA 1HP8A 1H2KA 2P7TC 4DR3O 1MA1A 4DV1B 3D36C 3AG4B 3U10A 1HDJA 5KLVH 1S5JA 1R6KA
chains in the Genus database with same CATH topology
4RAIA 4LC1A 1FXVA 1FXKB 3AG2B 3A0RA 3UM7A 5L3CA 1YIJV 2HLDG 4MW8A 4MTOA 3OUSA 3T2MA 1N8RW 3B77A 3ML0A 4H37A 3F5WC 1WPXA 2OCCB 2EIJB 4MS2A 3ZRXA 1K73W 2YEVB 4F4LA 1RM1C 3K9AA 1NR7A 2JK5C 1EBOA 3K3WA 1VQMV 1K4CC 5LHHA 5EC2C 1K92A 4LBEC 2BOCC 2OT5A 2HVJC 2WLNA 2ATKC 3OE7G 4JASA 1ROPA 4QNHB 2FTKA 2YSUB 1Y4MA 3P32A 1JCHA 3FB5C 1L1FA 4QPKA 1S72V 4WFFA 1F51A 3E35A 3HPLC 1FS0G 1IXMA 4UVBA 5KA5A 2ZD9A 1JPXA 4WFEA 4WFBV 5IY5C 1RPRA 2EJRA 2LFSA 3AG4C 5EBWC 5FL7G 2DYRB 4ASUG 2IJJA 1PNLA 3E8BA 1NR1A 4FPPA 1H38A 2DWEC 2JJ1G 1SRYA 3ABLB 1FXKC 4XDLA 1F4NA 4ZBMA 1QLEB 2NLJC 3SYCA 2WLJA 3OUFA 4L87A 2P90A 2ZDIA 3ZMTA 5IDJA 2OCCC 4UUJC 4PELA 2EIJC 4X88A 2HVKC 1K5SA 2WWWA 3JD4A 1AR1B 2XAFA 1YTFD 4HYOA 2R9IA 1M57B 2WLKA 3AEIA 3ZCCA 3RBZA 3LDDA 2K1EA 3VOUA 3M99B 1M90W 1GMGA 4FIPC 1W2BU 3CC7V 1I5XA 4FMTA 4GX5A 4XDKA 1JOYA 1G4YB 2WSSG 4FJCC 3K04A 4JTAB 3DTUB 5HFLA 1R6NA 1QCEA 5EK0A 5LHGA 3ZMSA 3OFNG 3ZMVA 1M1KW 3OW2U 3QO7A 1OCZB 3OMIB 2WLIA 1KKDA 4MTXA 2IJKA 3ABLC 2XAGA 5IYDO 2WLLA 5HFMA 2QM7A 5EBMC 1QLEC 3SYPA 3MHSC 4Q20A 3SPIA 1GM8A 5KUKA 1I5YA 3CC4V 1W0KG 3K03A 4R8CA 3WG7B 3JYCA 3EHBB 5LHIA 1ZWIC 5J9PC 1MOFA 1KD1W 1XL6A 3CMEV 4U7NA 4LCUC 1M57C 1K5QA 1OCCB 1NH2B 2JEUA 2HG5C 2BOBC 2V7QG 4KUMA 3W7UA 2HFEC 1GTOA 1V54B 3ZRWA 3T1CA 3F7VC 4JAUA 3EFFK 3W7XA 1R3LC 1MSWD 1E79G 3AG1B 3LSQA 1AI7A 1J95A 4BIUA 2X0LA 3DGEA 5BZBA 4LP8A 1VQ6V 5KUMA 1DLBA 3CCMV 4GX1A 1QBZA 4RUEA 4J9ZB 1OCZC 3ASNB 5LBQA 1VQ7V 3NXSA 1OZ0A 2A0LA 4X89A 3ASOB 5EC1C 4KFMA 2EIMB 3OEHG 1OHHG 4MTFA 2HJFC 2X7RB 2ZQMA 4YXWG 3X2QB 4WFHA 4EKWA 4DXWA 1EFRG 1MABG 2EIKC 1F23A 4HZ3A 3TK1A 4XBFA 3E2EA 1TUEB 1V55B 2IU0A 5B1NA 4J9YB 4MVRA 3D3IA 4JYCA 3CCQV 3CD6V 3CCJV 3ABMB 3RVZA 1OCCC 1YJWV 3ZMZA 1YHQV 1V54C 3OMNB 2WPDG 3JD0A 2DWDC 4JTDB 5CBGA 2QKSA 4CZZA 2EINB 3OEEG 5IYBO 3LUTB 4PA6A 3AG1C 3LDCA 3MHHC 4HAMA 5L3DA 1JX9A 1AI6A 1NQTA 3LNMB 3ZIAG 4WF9V 1KP2A 1BHAA 5B1AB 2QM8A 5IYCO 4KP4A 3SYOA 3RW0A 2Q6AA 2ZR3A 4QJFB 1PNKA 3AG2C 4I9WA 4PDLA 2WLHA 4DO2A 2EIMC 1SETA 1JJ2U 4MVSA 3R65A 4X8AA 3RVYA 3X2QC 4MVMA 3FYEB 3ZN1A 1JQ0A 2PI4A 4U7OA 3ETEA 2WLIB 2Q67A 3FB6C 4WFGA 1V55C 1R3KC 1WLEA 3QNEA 1B6QA 4PA3A 5C93A 2WLLB 2IJIA 4JYBA 4ZKIA 1BHBA 3ABMC 2X6CA 2ZDIC 1OCRB 2UXNA 3AG3B 3I55V 3CXCU 1MG1A 4QE7A 4FK5C 1H8HG 1SERA 3K08A 3MD0A 3CCRV 2PI5A 1S76D 1ENVA 4MSWC 4CBCA 2ITCC 1YSCA 1BMFG 5DM6V 1CEZA 3CP1A 3E86A 2DYRC 2V1DA 2EILB 4GT1A 4JAVA 1GM7A 4UV9A 3ZRWB 5B1AC 1AI5A 5CMUA 1QVGU 1NVPB 4JPRA 1CPYA 1K3EA 3SPHA 3SPCA 2Z5UA 3SPGA 2AHYA 2HR3A 4G27B 1GO3F 2KB1A 1VQNV 3ZMUA 4RO2A 3ETGA 4E2LA 5H9CA 4RQFA 4BIZA 4BW5A 1GKFA 4MW3A 3FB8C 4MVOA 5EBLC 2IH1C 4JF3A 5L3BA 3STLC 2IH3C 3CYOA 3FKSG 3UKMA 2Y69B 3E83A 2F43G 1VQKV 5CBFA 3PJSK 4XDJA 2XAHA 2Q69A 3OR7C 2ZR2A 3JD3A 2XAJA 1OCRC 3OMAB 1FFTB 2OTJV 2OTLV 3ETDA 1PL0A 1QR8A 4GX2A 3K06A 5H6QA 3WFVA 2JEXA 2CK3G 2M7WA 1Q86W 1YTFB 2H8PC 1S3JA 1VQ4V 3CCEV 1JVMA 3D36A 5B3SB 3F7YC 2EILC 5H6RA 3ZRVA 3W7SA 1BL8A 1W0JG 3FYIB 1GK9A 3TETA 1KECA 3SPJA 3BY6A 5KA6A 4JGSA 4QPJA 1R3IC 1Q7YW 2EZPA 2MK3A 1AJNA 1P7BA 1COWG 2GSMB 3FB7C 3I56V 3K0GA 1K97A 2WAMA 3W7TA 3ABKB 1M9NA 2A79B 5CA3A 2B1GA 1DF4A 1Q81W 4JTCB 1VQ9V 3WG7C 4UXNA 1K33A 1K4DC 1M56B 1THZA 4WCEV 2C2AA 2EZOA 4P2ZA 5L3EA 3GWOA 1VQPV 2LFRA 3OAAG 2W6IG 1AROP 1E1RG 1AI4A 2Y69C 1K34A 5LGTA 1QVFU 4PA4A 2IJHA 4G28B 4UVAA 1S0VA 1QR9A 4GCZA 1YI2V 4P9OA 2DYSB 3G71V 1PKXA 2XAQA 3IFXA 4N21A 1AJPA 3OM3B 3CPWU 1NKDA 1UJWB 1Q82W 1H8EG 3QO8A 5DN6G 2D3OW 5B3SC 3CMAV 2IW5A 2LP7A 3GB7C 3SYAA 3ASNC 3TCUA 1RPOA 3CCVV 3LDEA 4PDVA 3ASOC 1NVPD 3STZC 1PD3A 2X6AA 2W6JG 3E8FA 3CC2V 1FXKA 1CP9A 2QTOA 1KC8W 3G4SV 2P6JA 4MT8A 1VQLV 3ABKC 4TSFG 1OCOB 2B1IA 1M56C 5B1OA 3JD1A 3W7WA 1YJ9V 2YEVA 3ABTA 1FXHA 4N23A 2HKOA 1S77D 2ZXWB 2NNUA 2DW4A 2DQ3A 1DTOA 2AHZA 2X6BA 1NH2D 4G2KA 1PNMA 3H01A 1VQ5V 4MTGA 5LGNA 3KG2A 3JD2A 2EINC 4BAYA 2B5UA 1SESA 2XNDG 4MVUA 2DYSC 4P9PA 4QIWF 2QEXV 1G8MA 4R50A 2DQ0A 3T4ZA 3LSSA 1ORQC 4PDRA 5B1BB 1GM9A 1KQSU 5LGUA 4QE9A 4OXSA 1E1QG 3HB3B 1H2GA 4TT3G 1LNQA 2R9RB 2JJ2G 4PA7A 4UV8A 4Z1MG 3B8MA 3JCZA 3BEHA 2QA4V 1K7DA 2Q68A 1NBMG 2GHYA 2JIZG 2EBOA 3T4DA 3ABUA 1OCOC 2UXXA 1F4MA 2P67A 3E89A 3ZJZA 4I5SA 2XASA 3IGAC 2ITDC 3CCLV 4H33A 1VQ8V 3K0DA 1Y66A 2ZXWC 3B8NA 4PA9A 1DF5A 4GX0A 5E1AC 1YJNV 1KP3A 2A9HA 1HWYA 2Y48A 3AG3C 3VBBA 3OGCC 1VQOV 2Z3YA 3P30A 3K79A 2EIKB 1RM1B 1K9MW 2QE7G 1QLNA 2WLMA 1S5HC 2H94A 3QO5A 1P4RA 5CBHA 2IU3A 3ZRSA 1AJQA 1R3JC 1YITV 4RUFA 4RQEA 2W0FC 3SYQA 4UVCA 2JDIG 4P30A 4PDMA 5B1BC 4MVQA 1SZTA 4TWKA 3E8HA 3CCSV 4R6ZA 5GW7A 3G6EV 1R73A 4WFAV 2P7TC 4MVZA 1K8AW 3E8GA 4R7CA 3SJQC 5L3GA 5IY5B 3OR6C 1NJIW 5L3FA 3AG4B 2XOKG 5CN0A 1EZJA 3IC7A 3CCUV 1XL4A 3ZN0A 1R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW V;  1S72 V;  1YIT V;  2QA4 V;  1JJ2 U;  1VQ7 V;  3CCR V;  1YIJ V;  3CC2 V;  1QVF U;  1YHQ V;  1KC8 W;  1KD1 W;  3G4S V;  5DM6 V;  2QEX V;  3CME V;  1M1K W;  1VQL V;  3CCL V;  1YI2 V;  3OW2 U;  1VQK V;  1N8R W;  1VQ8 V;  3CD6 V;  1Q7Y W;  4WFB V;  3CCS V;  3G6E V;  3G71 V;  3I56 V;  1QVG U;  1R73 A;  4WFA V;  3CCJ V;  1K73 W;  1KQS U;  1YJ9 V;  1K8A W;  1YJN V;  1VQP V;  3CPW U;  4WF9 V;  1VQM V;  1Q81 W;  1NJI W;  2OTJ V;  1VQ9 V;  2OTL V;  1Q82 W;  1M90 W;  2D3O W;  4WCE V;  1VQO V;  3CMA V;  1W2B U;  3CCU V;  3CC7 V;  1VQN V;  1Q86 W;  3I55 V;  1K9M W;  1VQ6 V;  3CCQ V;  3CC4 V;  3CXC U;  3CCV V;  1VQ4 V;  3CCM V;  3CCE V;  1VQ5 V; 
#chains in the Genus database with same CATH topology
 4X66 B;  1IX9 A;  1I0H A;  2IBZ H;  2Q5Z A;  3A0R A;  3AG2 B;  4LFB O;  5J2U A;  4LH7 A;  3T2M A;  1LUV A;  1WPX A;  2DE0 X;  2OCC B;  4MS2 A;  3ZRX A;  5JJE B;  5AG2 A;  5EZY A;  4F4L A;  4FVM A;  2FKX A;  2DOS A;  1VQM V;  1K4C C;  2E5L O;  1KB9 F;  5LHH A;  5EC2 C;  1K92 A;  1H2S B;  2HVJ C;  1VAR A;  1ROP A;  2FTK A;  2YSU B;  4I4T A;  1Y4M A;  2CAZ C;  2F95 B;  4QPK A;  1J5E B;  2KSD A;  1F51 A;  2IM9 A;  4O4H A;  4DK0 A;  2ZD9 A;  2XUM A;  1JPX A;  5LP6 B;  4JI7 O;  1RPR A;  3AG4 C;  2HEP A;  1PNL A;  3E8B A;  4FPP A;  3CEI A;  2ZM6 B;  4XDL A;  2QKA A;  2FYU H;  1M4U A;  4ZBM A;  1QLE B;  1MNG A;  2DJV A;  3OUF A;  2P90 A;  2ZDI A;  3CS5 A;  1IXB A;  5GON B;  2OCC C;  4UUJ C;  4X88 A;  5LMN O;  1VF5 B;  5CA0 B;  4U3J A;  5A9G A;  3CSX A;  4B3R O;  2WLK A;  1W59 A;  4I0X B;  2OYQ A;  3LDD A;  5CB4 B;  3HKB A;  1GMG A;  4FIP C;  1W2B U;  4QGP A;  1G4Y B;  2WSS G;  4EB6 B;  3K04 A;  5GTI Z;  4DR1 B;  1R6N A;  5EK0 A;  2UXD B;  3J80 N;  3ZMS A;  5DEC A;  3ZMV A;  1M1K W;  4TUY A;  3B09 A;  4HNA A;  3OMI B;  2VRZ A;  4D6T H;  2LQT A;  2GTA A;  4YJ2 B;  1P7G A;  1FKA O;  2QM7 A;  1QLE C;  3SYP A;  1XHX A;  3MHS C;  1W0K G;  3K03 A;  3JYC A;  5JVD B;  2UUA B;  3A0H Z;  2OWO A;  2RCV A;  3EXA A;  1OCC B;  3RGB A;  1JJO A;  2HG5 C;  3OT7 A;  4LF8 B;  3THO A;  1CXZ B;  3AG7 A;  3N2K B;  1Q5O A;  3F7V C;  3EFF K;  3G67 A;  2UUB O;  1MSW D;  1E79 G;  4ICG A;  1J95 A;  2WA4 A;  4BIU A;  3DGE A;  2E75 B;  5KUM A;  2CUG A;  4JV5 O;  4DV6 O;  2ADQ B;  1FYJ A;  3ASN B;  5LBQ A;  1VQ7 V;  4LF5 B;  1Z2G A;  2EIM B;  3OEH G;  2HJF C;  2ZQM A;  4PI2 A;  1SKV A;  2EIK C;  3E2E A;  1Q90 D;  3JAR B;  4I9Q A;  1HNW O;  2Q0A A;  2KG7 B;  3D8C A;  4UB8 Z;  3ABM B;  4WBN A;  3TJT A;  1OCC C;  2QKS A;  3CRC A;  1VIB A;  3OEE G;  3LUT B;  4PA6 A;  4X1I B;  1NZ6 A;  1JX9 A;  4H0L B;  2QM8 A;  5IYC O;  4KP4 A;  2OCH A;  4UCV A;  1JMK C;  4PDL A;  4TV9 A;  2EIM C;  1SET A;  5H5N A;  2E76 B;  1JJ2 U;  4JI0 O;  3SDL A;  4MVS A;  3R65 A;  3G6B A;  3H1L H;  2QJ1 A;  4MVM A;  5LYJ A;  3FYE B;  3ZN1 A;  1PPJ H;  5D5Q A;  1HR0 O;  2PI4 A;  2Q67 A;  5IJ0 B;  4FLX A;  4DV5 O;  5KHG A;  1B6Q A;  4PA3 A;  3L71 H;  1XOU A;  1BHB A;  3ABM C;  3H1K H;  2HJD A;  4IT5 A;  4NTX A;  3I55 V;  2PY5 A;  3ZHU A;  4FK5 C;  5KX5 A;  4B7K A;  1S76 D;  4MSW C;  4CBC A;  5DM6 V;  4LF6 B;  5JH7 A;  1RSO B;  4JAV A;  1GM7 A;  4UV9 A;  5CMU A;  1S5L Z;  1ZL8 B;  1US6 A;  2QSA A;  4O2A A;  3SPG A;  1GAX A;  2HR3 A;  4YIP A;  3ZMU A;  2E3C A;  3ETG A;  4JI6 O;  4JZ2 A;  3DC5 A;  2VQF O;  3L72 H;  1N0J A;  2IH3 C;  3CYO A;  3STL C;  2FB5 A;  3FKS G;  4DYL A;  3UKM A;  1VP7 A;  3HKC A;  2XAH A;  3RYI B;  2Q69 A;  1VMG A;  1N4C A;  1XUQ A;  2F4V B;  1I08 A;  3OR7 C;  4JI5 B;  5EYP B;  5BR8 B;  3WB1 A;  3K5N A;  3JCU Z;  4JI1 O;  3T1Y O;  1N36 O;  3JSN A;  3VQW A;  1Q86 W;  1TUB A;  4LFC B;  3RFR A;  4NR1 A;  3F7Y C;  3RYH A;  3FYI B;  2K9P A;  5KA6 A;  4JGS A;  2MK3 A;  2KQX A;  2GSM B;  3W7T A;  1ZLZ A;  1AP5 A;  2F93 B;  1N33 O;  4NVP A;  1THZ A;  3LSU A;  4P2Z A;  1WA8 A;  1TVK B;  3OAA G;  2JVD A;  5LGT A;  5KHK A;  2UXC O;  4LWS A;  4K0K B;  2IJH A;  1YF2 A;  1URF A;  3HKD A;  1QR9 A;  4UVA A;  1BT8 A;  2PGG A;  4D7S A;  5JQG B;  2BSK B;  3G71 V;  4OPA A;  1AJP A;  1NKD A;  2ADP A;  1UJW B;  2JGD A;  3QO8 A;  3CHX A;  4K3A A;  1FFX B;  2IW5 A;  4O4L B;  3LDE A;  3KZI Z;  3E8F A;  5K1P A;  4FM1 A;  1CP9 A;  2PF4 E;  5H2F Z;  1WB7 A;  4DV7 O;  1IBL B;  2B1I A;  1X59 A;  5IYZ B;  1YJ9 V;  4O4I B;  1FXH A;  4OGQ B;  4N23 A;  2A7W A;  2AHZ A;  2X6B A;  1NH2 D;  2EJ7 A;  3CX5 F;  3IJ4 A;  4JYA B;  2A06 H;  1H2M A;  5F2V O;  2CTQ A;  2Q8V A;  4FLT A;  5LA6 B;  4R50 A;  3H1H H;  1Q43 A;  3UT5 A;  4LNU B;  4DW1 A;  4X1K A;  3P3P A;  1E1Q G;  3ZHQ A;  1LNQ A;  4AQY O;  3BCC H;  4CH5 A;  4PA7 A;  4Z1M G;  3B4S A;  3JCZ A;  4ZOL B;  3C3S A;  1ZX3 A;  1NBM G;  2GHY A;  2P22 C;  1B04 A;  1MZF A;  1Q6H A;  4TV8 B;  4DUZ B;  4CH6 A;  1KYO F;  1B3Q A;  1H2N A;  4UFZ A;  1L0L H;  3IGA C;  4DR7 B;  4H33 A;  4X1Y B;  4GZR B;  5E1A C;  1KP3 A;  2UUC B;  2A9H A;  4B7E A;  1AB3 A;  2Y48 A;  4PV1 B;  1N0N A;  3OGC C;  2Z3Y A;  3P30 A;  3K79 A;  2PYL A;  1K9M W;  1S5H C;  4DK1 A;  1R3J C;  1WP7 A;  4RUF A;  2E74 B;  2W0F C;  4LH6 A;  4UVC A;  4P30 A;  3KCY A;  1UPG A;  1YZB A;  3G6E V;  4ABM A;  3L9D A;  3CJH A;  2ZNJ A;  5L3F A;  4IHJ A;  2XOK G;  4UCU A;  3K57 A;  1XL4 A;  2JS5 A;  3FAV A;  3EVK A;  4LC1 A;  1FAF A;  1YIJ V;  5L3C A;  1XMO O;  4MW8 A;  4MTO A;  1SF9 A;  4U3F H;  2Q4P A;  5ITZ A;  2YS8 A;  3APO A;  1HW7 A;  1K73 W;  4DV3 B;  2YEV B;  2JS3 A;  3K9A A;  1EBO A;  1FJG B;  1AR5 A;  3RYC A;  3JAT B;  4LBE C;  3UO3 A;  1XDC A;  2ATK C;  3OE7 G;  4JAS A;  1BZK A;  3K59 A;  1JCH A;  4NTY A;  1S72 V;  4B3M O;  3E35 A;  1EZV H;  1IXM A;  1FS0 G;  4UVB A;  3JAW A;  1SA0 B;  4WFB V;  3B2E E;  4DRX B;  5EBW C;  2DYR B;  3A0B Z;  2GTS A;  2AGA A;  2PZS A;  2JJ1 G;  1ZSP A;  2CTR A;  3ABL B;  1BS3 A;  1GN4 A;  3ZHT A;  1NTK H;  4LF9 B;  2NLJ C;  2WLJ A;  4L87 A;  4X20 A;  1KU9 A;  5J2T A;  2HVK C;  2NR5 A;  5LL6 Y;  1IBK B;  2WWW A;  1IBM O;  2XAF A;  1YTF D;  3OD4 A;  4FZ1 A;  4YJ3 B;  3UQ8 A;  1XNQ B;  3AEI A;  2YC0 A;  4O4J A;  2JRI A;  3ZCC A;  4K8Z A;  1AP6 A;  1M90 W;  3JAM N;  3CC7 V;  1I5X A;  1N32 O;  2BE3 A;  4FJC C;  4KHP B;  4A5U B;  3T1H B;  3OFN G;  4X65 B;  3QO7 A;  5JJN B;  2YID A;  4DR3 B;  3ABL C;  2QR4 A;  3IAY A;  2XAG A;  5IYD O;  4Z1V A;  2WLL A;  3SR2 C;  5EBM C;  3UCS C;  1SQX H;  2UU9 O;  1GM8 A;  4R8C A;  3WG7 B;  2BTQ B;  4LFB B;  2DN9 A;  3EHB B;  5LXT A;  3CME V;  4U7N A;  3C3T A;  1K5Q A;  2BOB C;  1XBL A;  2V7Q G;  4KUM A;  3W7U A;  1V54 B;  3ZRW A;  5LOV B;  4B3S O;  3FFQ A;  2E5L B;  4DUY O;  2M6Y A;  1N34 B;  1R3L C;  3AG1 B;  1AI7 A;  2X0L A;  2QKC A;  2Q73 A;  5CA1 A;  1VQ6 V;  3CCM V;  1HNX O;  2L6L A;  3NXS A;  3K58 A;  3OTF A;  3JAS A;  3ASO B;  5EC1 C;  4KFM A;  1OHH G;  4IL6 Z;  4MTF A;  4JI7 B;  4YXW G;  4DV2 B;  1NT2 B;  3P3N A;  5C8Y A;  2HP8 A;  1VF6 C;  2Y0P A;  3U0Z A;  1Y76 B;  1EFR G;  1MAB G;  4HZ3 A;  1HNZ B;  1V55 B;  1Y74 B;  3U11 A;  3CCQ V;  3CD6 V;  3CCJ V;  1JFF B;  4AIL C;  3ZMZ A;  1YHQ V;  1V54 C;  4JTD B;  2DWD C;  5LMN B;  1KUQ A;  2R72 A;  4B3R B;  3AG1 C;  5L3D A;  1AI6 A;  3LNM B;  1BHA A;  4I55 B;  2Q6A A;  2ZR3 A;  3L70 H;  3AG2 C;  4O2B B;  2WLH A;  4DO2 A;  2O57 A;  1YEW A;  2N04 A;  2LO1 A;  1TGO A;  3KKY A;  4X8A A;  2KKW A;  4CH4 A;  4U7O A;  3JAL A;  3ETE A;  2WLI B;  3FB6 C;  1V55 C;  5C93 A;  2IJI A;  3R66 A;  4JYB A;  2X6C A;  2XTA A;  3AG3 B;  4FFB A;  3CXC U;  1MG1 A;  1H8H G;  5IWA O;  4UCT A;  1NS1 A;  3CCR V;  2ODM A;  1ENV A;  1YSC A;  4PHZ A;  5LP6 C;  1CEZ A;  3E86 A;  2V1D A;  2EIL B;  2ZE5 A;  1QVG U;  2UUB B;  1NVP B;  3E22 B;  3JAK A;  4DR5 B;  1CPY A;  3SPH A;  2Z5U A;  5BMV B;  2AHY A;  3ETQ A;  2AW9 A;  1VQN V;  4JV5 B;  5H9C A;  4DV6 B;  2VQE O;  3FB8 C;  1QHT A;  1D5N A;  1VEW A;  4JF3 A;  4J42 A;  2YUA A;  4F6R B;  2N74 A;  2F43 G;  5CBF A;  1B06 A;  2A3Q A;  4J7K A;  2ZR2 A;  2G38 A;  2GV9 A;  1HNW B;  3CRM A;  3ETD A;  4GX2 A;  5H6Q A;  4DR4 O;  2M7W A;  1YCI A;  4ZI7 B;  2AXT Z;  3CCE V;  4DV4 O;  3D36 A;  5B3S B;  2EIL C;  5H6R A;  3TET A;  2UXD O;  1KEC A;  3BRC A;  1XMQ B;  3BY6 A;  2GDS A;  4J10 A;  1R3I C;  1Q7Y W;  1AJN A;  1P7B A;  1COW G;  3FB7 C;  3HKE B;  3L75 H;  4BIO A;  4YY3 O;  1K97 A;  3ABK B;  1M9N A;  2A79 B;  1DF4 A;  1Q81 W;  2QDO A;  4JTC B;  1VF6 A;  1K4D C;  5IJ9 B;  4WCE V;  2C2A A;  3GWO A;  1YDX A;  2W6I G;  1ARO P;  1AI4 A;  4CC6 A;  1QVF U;  5BY1 A;  3ZHR A;  4AI8 A;  1HR0 B;  3SJA C;  4X62 O;  4P9O A;  2ILM A;  4DV5 B;  2PTM A;  3QVN A;  1PKX A;  2XAQ A;  4DW0 A;  3M8A A;  2D2C B;  3CPW U;  2HHH O;  2WA3 A;  5K1X A;  1BGY H;  5B3S C;  3CMA V;  3GB7 C;  3ASN C;  3CCV V;  1PD3 A;  3CC2 V;  2QTO A;  1EM1 A;  1KC8 W;  2P5O A;  2OIG A;  5GTH Z;  3ABK C;  4TSF G;  1D2D A;  5KMG B;  4J11 A;  4W4K A;  3W7W A;  3JD1 A;  1AVM A;  1RFY A;  4KL1 A;  4GKK O;  5IT9 N;  2YI8 A;  3RYF B;  1G1X B;  4JI6 B;  2VQF B;  5JWP A;  1VQ5 V;  3VQY A;  1SES A;  4JI4 O;  3A2F A;  4QIW F;  1XNR O;  1G8M A;  3J81 N;  3VQX A;  2ETN A;  2QWO B;  5LP6 A;  5B1B B;  4JI1 B;  4E4E A;  4ZHQ B;  3T1Y B;  4JI8 B;  1H2G A;  1N36 B;  3WB0 A;  2R9R B;  5IE9 A;  3Q4H B;  3B8M A;  4IGG A;  4FM0 A;  3BEH A;  1K7D A;  3ZHV A;  3T4D A;  2P67 A;  1JR9 A;  1R1B A;  2QTS A;  3E89 A;  3ZJZ A;  2AZ2 A;  5GON A;  2XAS A;  1ZAU A;  3BFR A;  5CA0 A;  4IIJ B;  4FLW A;  4PA9 A;  2ZT9 B;  1N33 B;  1PL4 A;  1HWY A;  4I0X A;  3NR7 A;  5CB4 A;  1VQO V;  1RM1 B;  2QE7 G;  1QLN A;  3G80 A;  2VS0 A;  3QO5 A;  2ARH A;  2IU3 A;  2UXC B;  3ZRS A;  4J80 A;  5FPO A;  4EB6 A;  1Z5W A;  4W4L A;  3SYQ A;  3PN1 A;  3M7M X;  3K5O A;  5B1B C;  3ZHS A;  1MMM A;  1P49 A;  3E8H A;  3CCS V;  1G6U A;  4DV0 O;  1FPO A;  4WFA V;  2P06 A;  1ZTE A;  2NN4 A;  4MVZ A;  1FD9 A;  3E8G A;  3SJQ C;  5L3G A;  4YJ2 A;  1K8A W;  2R70 A;  5IY5 B;  3OR6 C;  1NJI W;  5CN0 A;  1EZJ A;  2DMX A;  2CH7 B;  3ZN0 A;  2CTP A;  3O9O A;  4RAI A;  5JVD A;  1FXK B;  3UM7 A;  1BQZ A;  3H1J H;  2YIC A;  3ZED A;  4EFE A;  4DV7 B;  3OUS A;  1N8R W;  1P84 F;  1VF7 A;  3B77 A;  3ML0 A;  2XT9 A;  4H37 A;  1DGS A;  2EIJ B;  4ZIB A;  3N2K A;  4GYC B;  1RM1 C;  4JI5 O;  1NR7 A;  2JK5 C;  2YXY A;  2BOC C;  4H13 B;  1KBH A;  4WFF A;  4B3T O;  2ZIM A;  2Q0O C;  4NXN B;  1GRJ A;  3ICX A;  2ZKO A;  4WFE A;  2OIE A;  4CS4 A;  5IY5 C;  2UXB B;  5FL7 G;  2IJJ A;  4AQY B;  1NR1 A;  3RT3 C;  1H38 A;  1OV9 A;  3OTO O;  2BCC H;  3JAR A;  1FXK C;  1F4N A;  2KG7 A;  1NI8 A;  3SYC A;  5FNV B;  3ZMT A;  2EIJ C;  4K0K O;  3L74 H;  3JD4 A;  4X1I A;  2H3O A;  2QM4 A;  4HYO A;  2R9I A;  3N2G B;  2RDC A;  3VOU A;  3M99 B;  3C90 A;  4X64 B;  4GX5 A;  3DC6 A;  1JOY A;  4BWA A;  4OX9 B;  3DXR A;  4JTA B;  3DTU B;  2CGO A;  2CGN A;  5LHG A;  5LMU O;  2F23 A;  1EN5 A;  1OCZ B;  1LR1 A;  2ZCE A;  1KKD A;  4MTX A;  5IJ0 A;  2IJK A;  1ZUQ A;  4JZG A;  4X9Q A;  2ZE6 A;  4YIO A;  4EEQ A;  2B9Z A;  4Q20 A;  3SPI A;  1NU1 H;  5KUK A;  3CC4 V;  1XMO B;  1EN4 A;  5LHI A;  4JYA O;  1ZWI C;  5J9P C;  1MOF A;  5J2U B;  4CC5 A;  1KD1 W;  3RN4 A;  1AIL A;  1RSO A;  1NH2 B;  1T5E A;  4AHC A;  1GTO A;  4FZ0 A;  5EZY B;  3T1C A;  1ZL8 A;  4JAU A;  4HBN A;  2MW2 B;  3UO2 A;  4NXM B;  4UCR A;  4LP8 A;  4I4T B;  1IUR A;  4B3M B;  2GUZ A;  4GX1 A;  1QBZ A;  4O4H B;  1OCZ C;  1OZ0 A;  2A0L A;  3LNN A;  4I7Z B;  1IVS A;  4B08 A;  2X7R B;  3RYI A;  3X2Q B;  4WFH A;  1H2L A;  4LFA B;  4DXW A;  5EYP A;  1F23 A;  4XBF A;  3O65 A;  1Q6I A;  4J9Y B;  4MVR A;  3D3I A;  4JYC A;  3RVZ A;  5JJJ B;  2WPD G;  4UCS A;  2F1M A;  2EIN B;  5IYB O;  1X4T A;  4U3J B;  3LDC A;  3MHH C;  2Y4U A;  4NB5 A;  4GKJ O;  1NQT A;  3ZIA G;  4WF9 V;  1I94 O;  4NKG B;  3HKB B;  3SYO A;  5DED A;  1F7Y A;  4I9W A;  1TVK A;  3RVY A;  3X2Q C;  5EIB C;  4TUY B;  4HNA B;  1JQ0 A;  4JAA A;  1WB8 A;  3CXH F;  5JQG A;  2BSK A;  1BQ0 A;  4OPH A;  1R3K C;  3QNE A;  4UB6 Z;  2UU9 B;  3RWR D;  2RMK B;  2ZDI C;  5KHJ A;  1FFX A;  1OCR B;  2UXN A;  4O4L A;  1SER A;  4JI2 O;  3MD0 A;  2PI5 A;  4IYI A;  1BMF G;  1O9H A;  4DR6 B;  3CP1 A;  2DYR C;  4B3S B;  3TGU H;  1AI5 A;  2GBO A;  4DUY B;  2ZIN A;  5IYZ A;  4JPR A;  1K3E A;  4O4I A;  1HNX B;  1DK1 A;  1GKF A;  1XI1 A;  4EFB A;  2LJ2 A;  5EBL C;  1SC5 B;  4LF7 O;  5L3B A;  5LA6 A;  2Y69 B;  3E83 A;  1VQK V;  3PJS K;  4LNU A;  4FLV A;  2FML A;  3JD3 A;  3BVO A;  1OCR C;  4H44 B;  2LW7 A;  1IDS A;  1QR8 A;  3K06 A;  2QWN B;  3WFV A;  4D7T A;  2CK3 G;  4IYH A;  1YTF B;  2H8P C;  4ZOL A;  1NTZ H;  1S3J A;  3BAA A;  4WBN B;  1VQ4 V;  1JVM A;  3AK1 A;  2Q7H A;  4F6E A;  3W7S A;  4KHP O;  4DR2 O;  4TV8 A;  3T1H O;  1W0J G;  1GK9 A;  5JCO C;  4PI0 A;  2ZE8 A;  4X65 O;  4FFK A;  3B40 A;  4X1Y A;  2AZ0 A;  3I56 V;  1Q6U A;  4LF4 O;  5CA3 A;  4Z2W A;  1VQ9 V;  3WG7 C;  1M56 B;  2EZO A;  1KMI Z;  3BAB A;  4J7Z A;  4JI3 O;  4TV9 B;  4UCO A;  1MSD A;  2Y69 C;  1IZ3 A;  5LYJ B;  4YHH O;  4PA4 A;  4G28 B;  4GCZ A;  1GN2 A;  1BSM A;  4NYK A;  2DYS B;  3IFX A;  5E79 Z;  1N34 O;  1Q82 W;  5B66 Z;  2LP7 A;  4DV1 O;  5IWA B;  3TCU A;  2RQ6 A;  5KX5 B;  3ASO C;  2XHB A;  1NVP D;  3STZ C;  2X6A A;  2LGW A;  3G4S V;  4X66 O;  5JH7 B;  2P6J A;  3H9V A;  1JA8 A;  1BE3 H;  1OCO B;  4DV2 O;  1M56 C;  1GN3 A;  5B1O A;  4O2A B;  2YEV A;  1WNS A;  1S77 D;  2DW4 A;  1HNZ O;  3JAT A;  1XEQ A;  2VQE B;  1PNM A;  2ZIO A;  4MTG A;  5LGN A;  4I50 A;  4MVU A;  2DYS C;  1J5E O;  4P9P A;  4K35 A;  3HKC B;  1SA0 A;  3LSS A;  1ORQ C;  4PDR A;  4DRX A;  1QNM A;  1KQS U;  5LGU A;  1KKC A;  3HB3 B;  1D5A A;  4DR4 B;  4J7J A;  2QGN A;  4DV4 B;  2ZM6 O;  2QA4 V;  3BPZ A;  1TUB B;  2Q68 A;  2JIZ G;  2EBO A;  1OCO C;  2UXX A;  3RYH B;  3I5D A;  4YY3 B;  2ITD C;  4TOI A;  3CCL V;  1VQ8 V;  3J7A U;  1DF5 A;  1WP8 A;  1YJN V;  4YJ3 A;  3AG3 C;  3VBB A;  2W0X A;  2EIK B;  1WA8 B;  2WLM A;  2H94 A;  1P4R A;  2LGQ A;  1YIT V;  3F5T A;  4RQE A;  4LWS B;  4DR1 O;  3HKD B;  4X62 B;  4FLU A;  1SZT A;  2YDE A;  5JCO A;  5GW7 A;  4CS2 A;  1R73 A;  4Q6G A;  2HHH B;  4R7C A;  4DR5 O;  2JGD B;  3OGI B;  4BR6 A;  3IC7 A;  1Y67 A;  3CCU V;  3FX7 A;  3WU2 Z;  1GH6 A;  2V4D A;  2BTQ A;  4JI0 B;  1FXV A;  2EUL A;  2HLD G;  2UUA O;  3F5W C;  4LF8 O;  5LOV A;  3H1I H;  4CS3 A;  4GKK B;  3DSQ A;  3K3W A;  2YIB A;  2OT5 A;  2WLN A;  3TXQ A;  4QNH B;  3P32 A;  1XIL A;  3FB5 C;  1L1F A;  3QG5 A;  4BW9 A;  4JI4 B;  1XNR B;  3HPL C;  5KA5 A;  4LF5 O;  3CRA A;  3CRQ A;  1XMQ O;  5FLX N;  1L8D A;  2RJZ A;  3UT5 B;  2EJR A;  4TQD A;  2LFS A;  4ASU G;  4X1K B;  1OJH A;  1SQV H;  1Y76 A;  2DWE C;  1SRY A;  4NTW A;  1Y74 A;  1M5I A;  3DXR B;  1MZE A;  4RWU A;  1O9G A;  1JFF A;  3HR0 A;  1TAE A;  5IDJ A;  4PEL A;  1XRE A;  3A8T A;  1K5S A;  1AR1 B;  2ZE7 A;  5KAF Z;  1M57 B;  2VWJ A;  3RBZ A;  2K1E A;  4GUN A;  4I55 A;  3CWB H;  4FMT A;  4XDK A;  4O2B A;  2Y4T A;  4PJ0 Z;  5HFL A;  1QCE A;  3SGI A;  4DV0 B;  3OW2 U;  2WLI A;  5KAI Z;  3CJH B;  1AR4 A;  5HFM A;  4IHJ B;  1SQG A;  2GUZ B;  1I5Y A;  3FAV B;  2RNB A;  4PD4 F;  1YVW A;  1XL6 A;  5BXZ A;  5ITZ B;  4LCU C;  1M57 C;  4LF6 O;  2JEU A;  2HFE C;  3E22 A;  3W7X A;  3RYC B;  3LSQ A;  4JI8 O;  4TQF A;  5BMV A;  4C7U A;  2Q7G A;  5BZB A;  1DLB A;  1PM9 A;  4B3T B;  4RUE A;  4J9Z B;  4X89 A;  3JAW B;  1I7F A;  4F6R A;  3GVM A;  1SQF A;  4GLX A;  2P4K A;  3OTO B;  2F4V O;  4EKW A;  5BR8 O;  3TK1 A;  1TUE B;  2IU0 A;  5B1N A;  5A2Q N;  4ZI7 A;  1SZX A;  1YJW V;  4X20 B;  5KHH A;  4LFC O;  3OMN B;  3JD0 A;  5J2T B;  5CBG A;  4CZZ A;  4HAM A;  3HKE A;  1M93 A;  1SQQ H;  3SJC C;  4O4J B;  1KP2 A;  3D3Q A;  5B1A B;  3RW0 A;  5IJ9 A;  3K5L A;  3CE2 A;  4QJF B;  1PNK A;  2CDY A;  4JYY A;  2RN9 A;  3TXS A;  5LMU B;  3WB2 A;  1WJZ A;  4WFG A;  1WLE A;  2Y0I A;  3BHP A;  2WLL B;  2JGU A;  4ZKI A;  4FM2 A;  4FLZ A;  3VQV A;  3MDS A;  2LW1 A;  1R6T A;  4QE7 A;  5LXT B;  3BA9 A;  3K08 A;  4J41 A;  3QTC A;  2Q7E A;  2ITC C;  4NXN O;  4GT1 A;  3ZRW B;  5B1A C;  5KHI A;  5KMG A;  2UXB O;  1IBL O;  1PP9 H;  3SPC A;  2VWK A;  1XQ8 A;  4G27 B;  1GO3 F;  2KB1 A;  3RYF A;  5CA1 B;  4RO2 A;  4E2L A;  4RQF A;  4BIZ A;  4BW5 A;  5EIB D;  4MW3 A;  4MVO A;  3JAS B;  5FPR A;  2IH1 C;  1WN7 A;  1YXB A;  1NTM H;  3GWK C;  1V9P A;  5C8Y B;  3FD9 A;  4XDJ A;  2FL4 A;  4L8J A;  3K9S A;  2QWP B;  2XAJ A;  4FLY A;  4ZHQ A;  3OMA B;  1FFT B;  2OTJ V;  2OTL V;  1PL0 A;  1LUW A;  2JEX A;  2YXH A;  3Q4H A;  4X64 O;  3MAQ A;  3S3W A;  3N27 A;  4OX9 O;  3ZRV A;  2EX3 A;  1SS3 A;  1BL8 A;  2PUS A;  5TIS Z;  4K8X A;  4DUZ O;  3AK3 A;  3SPJ A;  2N05 A;  4QPJ A;  2PYJ A;  1PV0 A;  2EZP A;  4GKJ B;  4IIJ A;  4DR7 O;  3K0G A;  2WAM A;  1I94 B;  1SQP H;  2B1G A;  2UUC O;  4UXN A;  1K33 A;  2Q9L A;  2YIA A;  5L3E A;  1VQP V;  2LFR A;  1E1R G;  1K34 A;  3CRR A;  1S0V A;  1YI2 V;  3JAL B;  1IBM B;  2QWR B;  4N21 A;  3S3X A;  3OM3 B;  1RP3 B;  1U97 A;  3IC9 A;  1QQC A;  2YI9 A;  1H8E G;  5DN6 G;  2D3O W;  4NXM O;  1U96 A;  1N32 B;  3AK2 A;  3SYA A;  4FFB B;  2CH7 A;  4JI2 B;  1RPO A;  1A32 A;  3KCX A;  4I50 B;  4PDV A;  2W6J G;  1FXK A;  4MT8 A;  3ZX6 A;  2F66 C;  1VQL V;  1Z5V A;  5D5P A;  3JAK B;  1TA8 A;  3ABT A;  4LR3 A;  2HKO A;  1WPB A;  2ZXW B;  2NNU A;  4DV3 O;  4LFA O;  2DQ3 A;  1DTO A;  3SJB C;  2ZNI A;  1FJG O;  4G2K A;  3H01 A;  4LF7 B;  3KG2 A;  3JD2 A;  2EIN C;  4BAY A;  2B5U A;  2XND G;  2QEX V;  1XHZ A;  5B5E Z;  2BTO A;  2YIB D;  1Y6X A;  2DQ0 A;  3L73 H;  3T4Z A;  1UFI A;  1GM9 A;  3K5M A;  4QE9 A;  1SQB H;  3APQ A;  4OXS A;  4TT3 G;  2CTW A;  4UV8 A;  2JJ2 G;  2P4V A;  3QF7 A;  4KXR A;  4DR2 B;  2YXL A;  2QWQ B;  4LF9 O;  3ABU A;  1QU7 A;  1F4M A;  5FNV A;  2CE4 A;  4I5S A;  1EN6 A;  1Q8I A;  3K0D A;  1Y66 A;  2ZXW C;  3B8N A;  2Z0A A;  1GN6 A;  4LF4 B;  2R9A A;  1WAZ A;  3CB2 A;  4GX0 A;  3N2G A;  4CH3 A;  1IBK O;  1XNQ O;  4JI3 B;  2L35 A;  3ZS8 C;  1L0N H;  5CBH A;  1AJQ A;  4YHH B;  3ZBH A;  1BCC H;  2JDI G;  4PDM A;  3JSL A;  4MVQ A;  4DR6 O;  4TWK A;  1Q3E A;  3BA8 A;  4R6Z A;  1HP8 A;  1H2K A;  2P7T C;  4DR3 O;  1MA1 A;  4DV1 B;  3D36 C;  3AG4 B;  3U10 A;  1HDJ A;  5KLV H;  1S5J A;  1R6K A; 
#chains in the Genus database with same CATH homology
 4RAI A;  4LC1 A;  1FXV A;  1FXK B;  3AG2 B;  3A0R A;  3UM7 A;  5L3C A;  1YIJ V;  2HLD G;  4MW8 A;  4MTO A;  3OUS A;  3T2M A;  1N8R W;  3B77 A;  3ML0 A;  4H37 A;  3F5W C;  1WPX A;  2OCC B;  2EIJ B;  4MS2 A;  3ZRX A;  1K73 W;  2YEV B;  4F4L A;  1RM1 C;  3K9A A;  1NR7 A;  2JK5 C;  1EBO A;  3K3W A;  1VQM V;  1K4C C;  5LHH A;  5EC2 C;  1K92 A;  4LBE C;  2BOC C;  2OT5 A;  2HVJ C;  2WLN A;  2ATK C;  3OE7 G;  4JAS A;  1ROP A;  4QNH B;  2FTK A;  2YSU B;  1Y4M A;  3P32 A;  1JCH A;  3FB5 C;  1L1F A;  4QPK A;  1S72 V;  4WFF A;  1F51 A;  3E35 A;  3HPL C;  1FS0 G;  1IXM A;  4UVB A;  5KA5 A;  2ZD9 A;  1JPX A;  4WFE A;  4WFB V;  5IY5 C;  1RPR A;  2EJR A;  2LFS A;  3AG4 C;  5EBW C;  5FL7 G;  2DYR B;  4ASU G;  2IJJ A;  1PNL A;  3E8B A;  1NR1 A;  4FPP A;  1H38 A;  2DWE C;  2JJ1 G;  1SRY A;  3ABL B;  1FXK C;  4XDL A;  1F4N A;  4ZBM A;  1QLE B;  2NLJ C;  3SYC A;  2WLJ A;  3OUF A;  4L87 A;  2P90 A;  2ZDI A;  3ZMT A;  5IDJ A;  2OCC C;  4UUJ C;  4PEL A;  2EIJ C;  4X88 A;  2HVK C;  1K5S A;  2WWW A;  3JD4 A;  1AR1 B;  2XAF A;  1YTF D;  4HYO A;  2R9I A;  1M57 B;  2WLK A;  3AEI A;  3ZCC A;  3RBZ A;  3LDD A;  2K1E A;  3VOU A;  3M99 B;  1M90 W;  1GMG A;  4FIP C;  1W2B U;  3CC7 V;  1I5X A;  4FMT A;  4GX5 A;  4XDK A;  1JOY A;  1G4Y B;  2WSS G;  4FJC C;  3K04 A;  4JTA B;  3DTU B;  5HFL A;  1R6N A;  1QCE A;  5EK0 A;  5LHG A;  3ZMS A;  3OFN G;  3ZMV A;  1M1K W;  3OW2 U;  3QO7 A;  1OCZ B;  3OMI B;  2WLI A;  1KKD A;  4MTX A;  2IJK A;  3ABL C;  2XAG A;  5IYD O;  2WLL A;  5HFM A;  2QM7 A;  5EBM C;  1QLE C;  3SYP A;  3MHS C;  4Q20 A;  3SPI A;  1GM8 A;  5KUK A;  1I5Y A;  3CC4 V;  1W0K G;  3K03 A;  4R8C A;  3WG7 B;  3JYC A;  3EHB B;  5LHI A;  1ZWI C;  5J9P C;  1MOF A;  1KD1 W;  1XL6 A;  3CME V;  4U7N A;  4LCU C;  1M57 C;  1K5Q A;  1OCC B;  1NH2 B;  2JEU A;  2HG5 C;  2BOB C;  2V7Q G;  4KUM A;  3W7U A;  2HFE C;  1GTO A;  1V54 B;  3ZRW A;  3T1C A;  3F7V C;  4JAU A;  3EFF K;  3W7X A;  1R3L C;  1MSW D;  1E79 G;  3AG1 B;  3LSQ A;  1AI7 A;  1J95 A;  4BIU A;  2X0L A;  3DGE A;  5BZB A;  4LP8 A;  1VQ6 V;  5KUM A;  1DLB A;  3CCM V;  4GX1 A;  1QBZ A;  4RUE A;  4J9Z B;  1OCZ C;  3ASN B;  5LBQ A;  1VQ7 V;  3NXS A;  1OZ0 A;  2A0L A;  4X89 A;  3ASO B;  5EC1 C;  4KFM A;  2EIM B;  3OEH G;  1OHH G;  4MTF A;  2HJF C;  2X7R B;  2ZQM A;  4YXW G;  3X2Q B;  4WFH A;  4EKW A;  4DXW A;  1EFR G;  1MAB G;  2EIK C;  1F23 A;  4HZ3 A;  3TK1 A;  4XBF A;  3E2E A;  1TUE B;  1V55 B;  2IU0 A;  5B1N A;  4J9Y B;  4MVR A;  3D3I A;  4JYC A;  3CCQ V;  3CD6 V;  3CCJ V;  3ABM B;  3RVZ A;  1OCC C;  1YJW V;  3ZMZ A;  1YHQ V;  1V54 C;  3OMN B;  2WPD G;  3JD0 A;  2DWD C;  4JTD B;  5CBG A;  2QKS A;  4CZZ A;  2EIN B;  3OEE G;  5IYB O;  3LUT B;  4PA6 A;  3AG1 C;  3LDC A;  3MHH C;  4HAM A;  5L3D A;  1JX9 A;  1AI6 A;  1NQT A;  3LNM B;  3ZIA G;  4WF9 V;  1KP2 A;  1BHA A;  5B1A B;  2QM8 A;  5IYC O;  4KP4 A;  3SYO A;  3RW0 A;  2Q6A A;  2ZR3 A;  4QJF B;  1PNK A;  3AG2 C;  4I9W A;  4PDL A;  2WLH A;  4DO2 A;  2EIM C;  1SET A;  1JJ2 U;  4MVS A;  3R65 A;  4X8A A;  3RVY A;  3X2Q C;  4MVM A;  3FYE B;  3ZN1 A;  1JQ0 A;  2PI4 A;  4U7O A;  3ETE A;  2WLI B;  2Q67 A;  3FB6 C;  4WFG A;  1V55 C;  1R3K C;  1WLE A;  3QNE A;  1B6Q A;  4PA3 A;  5C93 A;  2WLL B;  2IJI A;  4JYB A;  4ZKI A;  1BHB A;  3ABM C;  2X6C A;  2ZDI C;  1OCR B;  2UXN A;  3AG3 B;  3I55 V;  3CXC U;  1MG1 A;  4QE7 A;  4FK5 C;  1H8H G;  1SER A;  3K08 A;  3MD0 A;  3CCR V;  2PI5 A;  1S76 D;  1ENV A;  4MSW C;  4CBC A;  2ITC C;  1YSC A;  1BMF G;  5DM6 V;  1CEZ A;  3CP1 A;  3E86 A;  2DYR C;  2V1D A;  2EIL B;  4GT1 A;  4JAV A;  1GM7 A;  4UV9 A;  3ZRW B;  5B1A C;  1AI5 A;  5CMU A;  1QVG U;  1NVP B;  4JPR A;  1CPY A;  1K3E A;  3SPH A;  3SPC A;  2Z5U A;  3SPG A;  2AHY A;  2HR3 A;  4G27 B;  1GO3 F;  2KB1 A;  1VQN V;  3ZMU A;  4RO2 A;  3ETG A;  4E2L A;  5H9C A;  4RQF A;  4BIZ A;  4BW5 A;  1GKF A;  4MW3 A;  3FB8 C;  4MVO A;  5EBL C;  2IH1 C;  4JF3 A;  5L3B A;  3STL C;  2IH3 C;  3CYO A;  3FKS G;  3UKM A;  2Y69 B;  3E83 A;  2F43 G;  1VQK V;  5CBF A;  3PJS K;  4XDJ A;  2XAH A;  2Q69 A;  3OR7 C;  2ZR2 A;  3JD3 A;  2XAJ A;  1OCR C;  3OMA B;  1FFT B;  2OTJ V;  2OTL V;  3ETD A;  1PL0 A;  1QR8 A;  4GX2 A;  3K06 A;  5H6Q A;  3WFV A;  2JEX A;  2CK3 G;  2M7W A;  1Q86 W;  1YTF B;  2H8P C;  1S3J A;  1VQ4 V;  3CCE V;  1JVM A;  3D36 A;  5B3S B;  3F7Y C;  2EIL C;  5H6R A;  3ZRV A;  3W7S A;  1BL8 A;  1W0J G;  3FYI B;  1GK9 A;  3TET A;  1KEC A;  3SPJ A;  3BY6 A;  5KA6 A;  4JGS A;  4QPJ A;  1R3I C;  1Q7Y W;  2EZP A;  2MK3 A;  1AJN A;  1P7B A;  1COW G;  2GSM B;  3FB7 C;  3I56 V;  3K0G A;  1K97 A;  2WAM A;  3W7T A;  3ABK B;  1M9N A;  2A79 B;  5CA3 A;  2B1G A;  1DF4 A;  1Q81 W;  4JTC B;  1VQ9 V;  3WG7 C;  4UXN A;  1K33 A;  1K4D C;  1M56 B;  1THZ A;  4WCE V;  2C2A A;  2EZO A;  4P2Z A;  5L3E A;  3GWO A;  1VQP V;  2LFR A;  3OAA G;  2W6I G;  1ARO P;  1E1R G;  1AI4 A;  2Y69 C;  1K34 A;  5LGT A;  1QVF U;  4PA4 A;  2IJH A;  4G28 B;  4UVA A;  1S0V A;  1QR9 A;  4GCZ A;  1YI2 V;  4P9O A;  2DYS B;  3G71 V;  1PKX A;  2XAQ A;  3IFX A;  4N21 A;  1AJP A;  3OM3 B;  3CPW U;  1NKD A;  1UJW B;  1Q82 W;  1H8E G;  3QO8 A;  5DN6 G;  2D3O W;  5B3S C;  3CMA V;  2IW5 A;  2LP7 A;  3GB7 C;  3SYA A;  3ASN C;  3TCU A;  1RPO A;  3CCV V;  3LDE A;  4PDV A;  3ASO C;  1NVP D;  3STZ C;  1PD3 A;  2X6A A;  2W6J G;  3E8F A;  3CC2 V;  1FXK A;  1CP9 A;  2QTO A;  1KC8 W;  3G4S V;  2P6J A;  4MT8 A;  1VQL V;  3ABK C;  4TSF G;  1OCO B;  2B1I A;  1M56 C;  5B1O A;  3JD1 A;  3W7W A;  1YJ9 V;  2YEV A;  3ABT A;  1FXH A;  4N23 A;  2HKO A;  1S77 D;  2ZXW B;  2NNU A;  2DW4 A;  2DQ3 A;  1DTO A;  2AHZ A;  2X6B A;  1NH2 D;  4G2K A;  1PNM A;  3H01 A;  1VQ5 V;  4MTG A;  5LGN A;  3KG2 A;  3JD2 A;  2EIN C;  4BAY A;  2B5U A;  1SES A;  2XND G;  4MVU A;  2DYS C;  4P9P A;  4QIW F;  2QEX V;  1G8M A;  4R50 A;  2DQ0 A;  3T4Z A;  3LSS A;  1ORQ C;  4PDR A;  5B1B B;  1GM9 A;  1KQS U;  5LGU A;  4QE9 A;  4OXS A;  1E1Q G;  3HB3 B;  1H2G A;  4TT3 G;  1LNQ A;  2R9R B;  2JJ2 G;  4PA7 A;  4UV8 A;  4Z1M G;  3B8M A;  3JCZ A;  3BEH A;  2QA4 V;  1K7D A;  2Q68 A;  1NBM G;  2GHY A;  2JIZ G;  2EBO A;  3T4D A;  3ABU A;  1OCO C;  2UXX A;  1F4M A;  2P67 A;  3E89 A;  3ZJZ A;  4I5S A;  2XAS A;  3IGA C;  2ITD C;  3CCL V;  4H33 A;  1VQ8 V;  3K0D A;  1Y66 A;  2ZXW C;  3B8N A;  4PA9 A;  1DF5 A;  4GX0 A;  5E1A C;  1YJN V;  1KP3 A;  2A9H A;  1HWY A;  2Y48 A;  3AG3 C;  3VBB A;  3OGC C;  1VQO V;  2Z3Y A;  3P30 A;  3K79 A;  2EIK B;  1RM1 B;  1K9M W;  2QE7 G;  1QLN A;  2WLM A;  1S5H C;  2H94 A;  3QO5 A;  1P4R A;  5CBH A;  2IU3 A;  3ZRS A;  1AJQ A;  1R3J C;  1YIT V;  4RUF A;  4RQE A;  2W0F C;  3SYQ A;  4UVC A;  2JDI G;  4P30 A;  4PDM A;  5B1B C;  4MVQ A;  1SZT A;  4TWK A;  3E8H A;  3CCS V;  4R6Z A;  5GW7 A;  3G6E V;  1R73 A;  4WFA V;  2P7T C;  4MVZ A;  1K8A W;  3E8G A;  4R7C A;  3SJQ C;  5L3G A;  5IY5 B;  3OR6 C;  1NJI W;  5L3F A;  3AG4 B;  2XOK G;  5CN0 A;  1EZJ A;  3IC7 A;  3CCU V;  1XL4 A;  3ZN0 A;  1R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...