1N8RW

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/antibiotic
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1n8rW00
1VQ6V 1VQOV 1VQ8V 3CCSV 1YITV 1K8AW 4WFAV 1VQKV 1JJ2U 1VQ4V 2QEXV 1Q82W 1YJNV 3CXCU 1K73W 3CPWU 3CC4V 3CCRV 1Q81W 1M90W 2OTJV 3CC7V 1VQ7V 1YIJV 1YI2V 1KC8W 1VQ9V 1VQLV 1VQ5V 3CCMV 3G71V 1Q7YW 1KD1W 3CC2V 1QVFU 1YJWV 1YHQV 3I55V 3I56V 1YJ9V 3CCQV 1VQMV 3CCLV 2D3OW 3CCVV 2OTLV 1Q86W 3G4SV 3G6EV 1KQSU 3OW2U 5DM6V 1W2BU 4WCEV 3CD6V 1NJIW 4WFBV 1QVGU 1M1KW 1VQPV 1K9MW 3CCEV 3CCUV 1N8RW 1S72V 1VQNV 3CCJV 3CMEV 3CMAV 2QA4V 4WF9V 1R73A
chains in the Genus database with same CATH superfamily
4F6RA 2DYRC 4YJ2A 2B9ZA 3SJCC 2XAFA 3CRAA 2JK5C 3E89A 4IIJB 5LXTB 1HWYA 2QTOA 1NQTA 1EN4A 1XBLA 4JI2B 2Q8VA 1K5SA 5A9GA 2EJ7A 1KQSU 5IT9N 1TGOA 2M7WA 4LF9B 1IBMB 4RUFA 2XAHA 4WBNA 2Q5ZA 3CC4V 4DR5O 3Q4HA 1YI2V 3AEIA 1JR9A 5AG2A 1T5EA 2XOKG 1JJOA 3CJHA 3LNMB 3ZJZA 5KLVH 2Y69B 3L71H 4DR6O 4JI2O 1XNRO 4YJ2B 2XAGA 4X9QA 4WFEA 2FKXA 1VQKV 1DLBA 4U7OA 2UU9B 2R70A 2OYQA 3K5NA 4MW8A 3CS5A 3ASOC 3X2QC 2XASA 4NKGB 1S0VA 1NU1H 4PDVA 4UV8A 3ABKB 3CD6V 2Q69A 4FZ0A 3GVMA 3RT3C 4G2KA 4DRXA 1YDXA 5L3EA 4NXMB 1QR8A 3STZC 1AROP 4JI5B 3K79A 4D7TA 3TXSA 1RM1B 2PI4A 1GO3F 1SA0A 4ICGA 1URFA 1FFTB 3RWRD 4GCZA 5LL6Y 2QWNB 1XNQB 2W0XA 2HVJC 4LFCO 1AB3A 5D5QA 2QJ1A 2G38A 1NTKH 5BR8B 4FLVA 3JD3A 1E1RG 4JI0O 1YSCA 3GB7C 3H1IH 2EINC 3W7XA 4QPJA 1MOFA 1H2SB 2QTSA 1YHQV 1YJ9V 1FD9A 4KHPB 1W0KG 1AJPA 2XHBA 1Q6HA 5CA1A 1YCIA 1HR0B 2IH3C 2LO1A 3X2QB 5IE9A 4J7JA 3RYIA 5KHGA 2PTMA 4DV0B 5BMVA 4MVSA 2OCCC 2RN9A 4O2AB 3KKYA 4JV5O 3LSUA 1ROPA 1Q5OA 4N21A 1KD1W 1E79G 2EIJC 5KHHA 1PP9H 3GWOA 2BE3A 1NZ6A 1RM1C 2ZKOA 4DRXB 4J80A 5KHIA 3CCJV 2Q9LA 2GV9A 1ZSPA 4IHJA 5H9CA 1K8AW 1WJZA 1JJ2U 5LBQA 4JZGA 1Q6IA 1GM7A 1ZX3A 3G71V 3RGBA 4X62O 3PN1A 2XNDG 3K9SA 3FX7A 3CCVV 4X89A 2JGUA 2AZ0A 4NTXA 1W59A 1SF9A 1Y6XA 1NH2B 1S76D 4BR6A 1X4TA 3K5LA 5CB4B 4DK1A 4PI0A 2DQ3A 4MW3A 3JAWA 3JSNA 4DV5B 4UCUA 4B3MB 2RMKB 3OMNB 4ZI7A 1SRYA 4CC6A 3H1HH 2MW2B 4J41A 3JYCA 4J7KA 1X59A 1JA8A 1XL4A 3RYIB 5EIBC 1VQPV 3G67A 4GKJO 4FMTA 1VQ8V 3CCSV 4K8ZA 3CYOA 2EULA 3D3IA 3LNNA 1SZXA 3OGCC 3JD0A 2BTQA 4MTFA 4B3TB 2P7TC 3H1KH 4B3MO 4LWSA 4HYOA 5L3FA 4O4HA 1VP7A 2JEUA 3ZHTA 5DECA 2NR5A 1HNZB 1VQOV 1SC5B 4OPHA 3ASNC 3K0DA 1PL4A 1K4CC 2Q7GA 3FB6C 1S5JA 2YXHA 2ZDIC 2K9PA 3AK2A 3UCSC 5FNVB 1TAEA 4O4IB 3G6BA 1PM9A 3B8MA 4DUYO 3PJSK 4I5SA 4L87A 4AQYO 5BR8O 4P9OA 5BY1A 3P3NA 2Q4PA 4LF4O 4JF3A 4X8AA 2WA3A 2QDOA 4JGSA 3ETEA 3CPWU 5J2TB 3BHPA 5E1AC 1XNRB 1UFIA 1IX9A 3FB5C 4NVPA 4DW0A 2VQFO 3CE2A 3VQYA 4DV3O 5CBHA 1IBLO 2PGGA 4DR3O 4YIPA 3ASNB 4I0XA 3ZBHA 2WA4A 4QPKA 4PA9A 2Y0PA 2UUCB 1SS3A 4MVQA 5IYBO 4MT8A 1SZTA 1KC8W 4JV5B 2ZIMA 3J7AU 1BQZA 2CAZC 3OMAB 4TUYA 4O2BA 2WAMA 4F6RB 1AI4A 4YIOA 1ORQC 5EBMC 4Z2WA 2Q0OC 2RQ6A 1FXVA 5KAIZ 4CS3A 4U3JB 3SDLA 3A8TA 2YICA 1IBLB 5GONB 4JAVA 4UCVA 4TOIA 1I7FA 3ZX6A 2NLJC 2UUCO 3HKCB 2QWQB 3AG7A 3CX5F 2KQXA 1Q7YW 2BSKB 5B66Z 4JTCB 3FD9A 1S5LZ 4MVZA 3I55V 1S3JA 1Y76A 2AGAA 4FFBB 4LFAB 3SR2C 4JI1B 3QG5A 2ZR2A 2K1EA 4JYBA 2ZXWC 4PJ0Z 3NXSA 1GN2A 5IY5B 3WB2A 1XOUA 4I55B 1QLEB 3CP1A 2R72A 1UJWB 3OEHG 1L0NH 3F5WC 3JATB 4P30A 4DO2A 3ZMVA 4DUZO 5L3DA 1Q43A 2Q7HA 4U3JA 3A0HZ 3N2KA 4UCSA 4PA6A 4FVMA 2BCCH 1RP3B 2JGDB 2HG5C 1NBMG 2AHYA 1XMQO 4Z1MG 1HNWB 4QIWF 1IURA 4GYCB 1MA1A 4B3RB 1F51A 2HHHB 3RYHB 5LHIA 2CH7A 4FZ1A 1MSDA 1SESA 1B04A 4NTWA 3B09A 2E75B 4PA7A 2ZR3A 2AXTZ 4JYAB 2X6CA 1MG1A 4MSWC 2VS0A 3D3QA 1N8RW 1B3QA 2RDCA 1P84F 1V55C 4X62B 2QWPB 5EC2C 1XMQB 2Q6AA 3FAVB 5KMGA 3EFFK 4H33A 1K4DC 1EZJA 1QHTA 1R1BA 4QGPA 3AG4B 2ADQB 1Q6UA 1BCCH 5CN0A 1VQMV 2ZE5A 2JEXA 2GTAA 1VIBA 1WA8B 1EN6A 3BVOA 4JI7O 4JYAO 1AVMA 1R6KA 3DSQA 4DV2O 3U10A 5H6RA 3LDCA 5JJEB 3VQWA 1Z2GA 4BIOA 4QE7A 1W0JG 3HKEA 4TV9B 3STLC 4LF6B 1AI7A 3H9VA 4NR1A 2E76B 5IJ0A 4I9QA 2M6YA 5EZYA 3P30A 4W4LA 5BXZA 2CTWA 1TUEB 1EFRG 1HNXO 2V4DA 3ABUA 1V55B 3CC7V 4F4LA 3HKDB 2ETNA 1DF4A 3MHHC 3N2GA 5JH7B 1K33A 1Y67A 2WWWA 2CK3G 5C8YB 4WFFA 4GX1A 3CEIA 4XDKA 1BMFG 2LJ2A 1QQCA 1A32A 4HAMA 2IM9A 5IYDO 2RCVA 4JI6B 2O57A 5LGUA 1XEQA 1N0NA 3D36C 4B7EA 4X1IB 2ZIOA 5JQGB 1LR1A 4ZKIA 3W7WA 1THZA 3JCUZ 5J2UA 2P06A 1K34A 2F23A 4RWUA 4LF4B 2QKCA 3BA8A 3C3SA 1YEWA 1I94B 3OE7G 1RPOA 2VQEB 3G4SV 1M56C 1K97A 4JI4O 1NS1A 1KB9F 5ITZB 3T1HB 2RNBA 1NI8A 4DV1B 1KBHA 4JI8B 3ZMSA 4JAAA 1QBZA 4UXNA 3P32A 2UXNA 4PDLA 4DK0A 2FTKA 5EIBD 3ZHSA 3OUSA 1PD3A 3ETDA 4AILC 3B40A 4DR1O 1XMOB 3K59A 3QO7A 1TUBA 1JX9A 5JQGA 5L3BA 3E86A 2PZSA 1HNWO 3ABMB 3AG2B 3FFQA 2PI5A 4MTXA 3F7VC 2GUZB 3ETGA 4H13B 3K08A 4LCUC 3F5TA 4H0LB 4LR3A 5K1PA 2CTRA 4ZOLB 4MS2A 2W6JG 3LUTB 4RQFA 4LNUA 1Q3EA 1YXBA 2E5LB 2BTQB 4MVMA 2P4KA 5LGNA 4P9PA 3CRRA 3CC2V 5LOVB 4QNHB 1FS0G 5LXTA 4JYCA 2UXXA 3AG3C 1QNMA 3JARA 4FK5C 1QVGU 1JFFA 4CS4A 5IWAO 3BAAA 3R65A 4O4LA 4D7SA 3LDDA 4DV2B 4I50A 2HP8A 1FYJA 4DV6B 2Z3YA 5H6QA 4B7KA 1XHXA 1CEZA 4B3SB 2UXDO 4NYKA 4ASUG 1QU7A 3RW0A 1I0HA 3K57A 4LF6O 4FM2A 1E1QG 4RUEA 4DV4B 2JS3A 4J7ZA 5FPOA 1UPGA 3M8AA 2UUAB 2FB5A 4B08A 3OGIB 1P7BA 4NB5A 1ZAUA 1G6UA 2YC0A 4ZIBA 2ZD9A 5IWAB 2NNUA 2QKAA 4LC1A 4FM0A 3CCRV 5LOVA 3JD2A 3UKMA 2W0FC 4X64B 3HB3B 1VQ5V 1YTFB 3B77A 1SQFA 2LQTA 3HPLC 3HR0A 4JI3O 3T2MA 4MVUA 4KL1A 4UVAA 1W2BU 4JI6O 2H8PC 1QCEA 1OCOC 5BZBA 1OCZB 4F6EA 1B6QA 1I5YA 4Q6GA 3TETA 4JAUA 1DTOA 3ZMZA 4EEQA 2BTOA 2DJVA 5LYJB 1I94O 2UXCB 4I55A 2WLMA 3L70H 4BIZA 1XHZA 1K9MW 1SQBH 2XAJA 1WNSA 4WF9V 4JI8O 2LFRA 2QEXV 3E8GA 2W6IG 2ZE6A 2ZINA 2IJIA 2ZNIA 1OHHG 2XTAA 1M57C 4CS2A 1Z5VA 2ZDIA 2AW9A 4HBNA 4JASA 1NR7A 4JPRA 2IU0A 1HW7A 1RPRA 2XAQA 1K73W 3C3TA 5FNVA 4PD4F 1XREA 4X88A 2EILB 3JSLA 4LF7B 5EYPB 3CWBH 5BMVB 2F4VB 4JI5O 2JGDA 2ODMA 1FXHA 2YXYA 1Y76B 2FL4A 4FFBA 3HKBB 3CRMA 2LFSA 1H8HG 1M93A 2P5OA 1EM1A 5KX5B 4DV7B 1WAZA 3ZMTA 2IH1C 5JVDA 2QM8A 3JAWB 1VF7A 2UUBO 1NKDA 3KG2A 4IHJB 4Z1VA 1GN3A 3BCCH 1D5NA 2OTLV 4IL6Z 3UO2A 2V7QG 3KCYA 1BSMA 5B1NA 4IGGA 3K3WA 4GX5A 4RO2A 4TV8B 3E22A 5CA0B 3A0RA 1YF2A 4PI2A 4FLUA 3ABLB 1H8EG 1CP9A 1WLEA 3AG1B 4B3SO 2HFEC 4FLTA 4FJCC 2X7RB 4LF8O 3I56V 3CCLV 3APOA 4UUJC 2OCHA 1I08A 1R3LC 3SYCA 4I9WA 5LP6B 1JPXA 1G8MA 1VMGA 2N05A 3A2FA 4TSFG 3UM7A 3WFVA 4DR4O 1ZTEA 1BZKA 4DW1A 4CC5A 2E5LO 4DXWA 1NTZH 3J80N 4LF8B 2ZCEA 1FFXB 2N04A 2QWOB 2Y0IA 1JOYA 3MD0A 1GM9A 5B3SB 4B3RO 5EBWC 4MTOA 3OR6C 2GDSA 1BL8A 2MK3A 3UT5A 3TK1A 3SPJA 2JRIA 3T4ZA 4N23A 1L0LH 5EBLC 4OX9B 1M4UA 1BHAA 1SETA 1BE3H 3OFNG 3IJ4A 4CH3A 2QE7G 4YY3B 4MVOA 3ZS8C 3C90A 2CUGA 2YI9A 2H94A 5IYCO 4X1KB 2GHYA 3ETQA 1BS3A 3E8HA 4LBEC 2QKSA 4LF9O 3AG4C 3JCZA 3U11A 3BY6A 2ZM6O 3SYOA 1O9HA 5B1AC 3OW2U 2QM4A 1V54B 3CCEV 1VQNV 2LGQA 3M7MX 4R6ZA 1FKAO 3K9AA 3G80A 3CHXA 5EYPA 2EZPA 2F1MA 4OXSA 1J5EB 2VWKA 4YY3O 1VQ7V 4DR6B 4UCRA 5JJJB 1N32B 4PHZA 4FFKA 3WG7B 1M57B 2CE4A 4J9YB 3JD1A 1N33B 3LSQA 4E4EA 3CMEV 1HNXB 3ZN1A 3HKEB 5F2VO 2UXCO 3OMIB 4X20A 2WLLA 2CTPA 1SA0B 1R3JC 1SQPH 4MTGA 2EIKC 3SJBC 1KECA 1N36O 2DQ0A 2OT5A 5EZYB 3E22B 5CA0A 4O4JA 4NXMO 1IZ3A 3FYEB 4WCEV 1M1KW 1LUWA 2F95B 5B3SC 4GLXA 2L6LA 4NXNO 3N2GB 5JH7A 3ML0A 1RSOB 1GK9A 4X1KA 2EIMB 1OCZC 3JASA 1NVPB 2ILMA 2LW7A 4U3FH 2D3OW 3K58A 2VWJA 2EJRA 4DV1O 3JAKA 1NJIW 1YTFD 5B5EZ 4O4IA 4I0XB 1GTOA 1J95A 5C93A 1OCOB 3E2EA 2YS8A 3BPZA 5CBFA 3JALB 4IIJA 5LP6C 1L1FA 2UU9O 1OCRC 3FAVA 5LMNO 3ABKC 2HVKC 2NN4A 2IJJA 3IC9A 3SGIA 2EX3A 5GTHZ 4LFBO 1WN7A 1B06A 3SYPA 1R6TA 2UUBB 4LFAO 3AK3A 2ITCC 3B2EE 3CXHF 1PNLA 4OGQB 4DR2O 1M90W 4YHHO 3VQXA 4GX0A 4TQFA 4JZ2A 3OTFA 3H01A 4DR7O 2Y4UA 3Q4HB 2UXBB 1PPJH 1Q86W 3SYQA 3OAAG 1FFXA 1ZUQA 5FLXN 2E3CA 5IJ0B 4DUZB 2IW5A 2WLKA 1FXKB 1DGSA 4X65O 1AP6A 3UQ8A 2XT9A 3ZHRA 1COWG 4FIPC 2ZM6B 3JAKB 4Q20A 4BW9A 1AR5A 1GH6A 2A0LA 5KHJA 4DV5O 2QSAA 1NVPD 1ZL8A 1RFYA 1D5AA 2ZQMA 1KUQA 2UXDB 1QR9A 3JALA 1L8DA 3B8NA 3ABMC 3N27A 5GW7A 2BOCC 1VF6C 5EC1C 5LHGA 4X1YA 2BOBC 3R66A 3FB8C 1KU9A 4UFZA 2YIAA 2DMXA 1IBKB 3ZRWB 2EBOA 1PNMA 4LH7A 2FYUH 3N2KB 4WFAV 5IYZA 4IYHA 3ZN0A 4OX9O 1TA8A 1AP5A 3K03A 2E74B 4X66B 3WB0A 5KA6A 1SQQH 3BFRA 5KMGB 3EHBB 3D8CA 1YVWA 2JJ2G 2N74A 4X64O 2DW4A 1FAFA 5B1AB 3AK1A 1ZL8B 5DM6V 5CA1B 4EB6A 5LMUO 4CH5A 2PF4E 4NXNB 1AI6A 3MAQA 4LP8A 1QLEC 3RYFB 3CJHB 1KP2A 1SERA 3SPCA 3K5MA 3TGUH 5B1BB 3S3XA 3QNEA 4KXRA 1FXKC 4TV8A 3ZRWA 4X66O 4TWKA 3D36A 2OIGA 2JIZG 3IC7A 3OD4A 5CB4A 2KG7B 1N4CA 1GMGA 4G27B 1TUBB 1MNGA 4K35A 2VQFB 4GKJB 4LF5O 4K3AA 5LYJA 3W7TA 3FKSG 2GTSA 2C2AA 2A3QA 4RAIA 4LFCB 5LP6A 3S3WA 2WLIA 3KCXA 4LFBB 1IXBA 4K8XA 2L35A 1SKVA 1R6NA 4CH6A 2A06H 2D2CB 4J11A 2VQEO 1VQ4V 1JQ0A 4LF7O 1KMIZ 4YHHB 3QO8A 4UB8Z 1XL6A 4P2ZA 4ABMA 3O9OA 4FLZA 1AR4A 1OCRB 2F93B 3AG3B 4CZZA 2QM7A 1SQGA 3IGAC 3QO5A 3OTOO 1DF5A 2Y69C 2ZT9B 1Q8IA 2F4VO 4UVCA 1Y74B 3FYIB 1S5HC 2QA4V 1ENVA 4DR1B 1K7DA 3K0GA 1YZBA 3DTUB 2B5UA 2OTJV 4J9ZB 4FM1A 4DV7O 5B1OA 4KFMA 3SPGA 3K5OA 3OT7A 2DYSB 3BA9A 4O4HB 3L73H 3OTOB 3OR7C 4DR3B 1U97A 3E8BA 1EN5A 4PV1B 1M5IA 5LA6A 2ADPA 3E8FA 3L74H 2VRZA 4JI0B 1VF6A 3SJAC 3TXQA 3ZHQA 1DK1A 1IBKO 2ZE8A 2HEPA 5LHHA 3ABLC 1ZLZA 1I5XA 5B1BC 1N34B 2PYLA 1Q90D 1EZVH 3QVNA 4KHPO 2Q73A 1HDJA 3CXCU 2ITDC 4TV9A 5J9PC 2ZXWB 2CGOA 3CSXA 2WSSG 1BT8A 1WA8A 1S72V 4LH6A 3M99B 2ZE7A 4MVRA 5KUMA 2WPDG 4D6TH 2XUMA 1MZFA 1YIJV 2UUAO 3MDSA 4ZBMA 5KA5A 5IY5C 2YXLA 1LNQA 3CCQV 1O9GA 3J81N 3QTCA 2EILC 4L8JA 4JI7B 1M56B 3BRCA 4PDMA 5L3CA 5D5PA 3TCUA 1AJQA 4GKKO 5HFMA 2OWOA 4JI3B 1TVKA 3JASB 1NH2D 4LWSB 4BW5A 1H2KA 1H2LA 1WB8A 2EZOA 2LW1A 4I50B 2F66C 3HKCA 5JVDB 4ZHQB 2WLLB 3OM3B 1WP8A 3WB1A 5HFLA 4BIUA 4DYLA 1KKDA 4AHCA 3T1YO 3L75H 1SQVH 4PA3A 2JJ1G 2CH7B 5J2UB 3ZRSA 2A9HA 3ZCCA 2H3OA 1QLNA 1J5EO 1SQXH 1F4MA 2F43G 4R50A 4UV9A 1KYOF 3I5DA 2HR3A 5ITZA 1P4RA 3EVKA 2OIEA 4EKWA 1VQ6V 4IT5A 2WLHA 1H38A 4UVBA 4O2AA 1YJNV 2P6JA 3WU2Z 4AI8A 4FLWA 5IJ9A 4XDJA 3T1YB 1PL0A 4IYIA 1AILA 4ZOLA 4YJ3B 4LNUB 2YEVB 5DN6G 3RBZA 3CCUV 3U0ZA 3T1CA 2Y4TA 1K3EA 3KZIZ 3HKDA 2A79B 4TUYB 5GTIZ 4AQYB 1Y66A 1XMOO 2QWRB 4JYYA 1VQLV 1S77D 1XDCA 3L72H 2Z0AA 2Y48A 4JI1O 5IYZB 3G6EV 1JFFB 4WBNB 3AG1C 4X1IA 3ZMUA 4PELA 4JTDB 5KUKA 4GUNA 2R9IA 4DV3B 2EIMC 2DWEC 4EFBA 4ZI7B 1D2DA 5FL7G 3APQA 3RFRA 1AR1B 3RYCA 3AG2C 1GM8A 1M9NA 2QGNA 2Q7EA 2GUZA 4KP4A 5LGTA 2IU3A 2ARHA 1LUVA 3UT5B 4A5UB 2HJFC 4NTYA 1JMKC 4G28B 1CXZB 2DYRB 1XUQA 4JI4B 2EIKB 3CRQA 3DC6A 3W7SA 3ABTA 3TJTA 4DR7B 3CRCA 2HLDG 2BSKA 3RVYA 1WPBA 3GWKC 2CDYA 2FMLA 2GSMB 2P4VA 2DYSC 1HR0O 2X6BA 5KX5A 2OCCB 2YSUB 2UXBO 2WLNA 4YJ3A 2EIJB 4BWAA 5JCOA 3WG7C 1GN4A 2P90A 1R73A 1H2NA 5CMUA 4OPAA 1GAXA 2B1GA 4FPPA 3H1LH 4X65B 4ZHQA 2JDIG 1Q81W 2CTQA 1BHBA 3DXRB 1K5QA 3B4SA 2Q67A 2Q68A 1P49A 1R3IC 3SYAA 1N0JA 4O4JB 4XDLA 1F7YA 2AZ2A 2P67A 4J10A 3CB2A 4YXWG 4TQDA 4UCOA 5CA3A 3RYCB 1PNKA 2ZNJA 1US6A 1NTMH 2DOSA 3VQVA 4E2LA 3ICXA 5GONA 1BGYH 4TT3G 4GT1A 1AJNA 4EFEA 3H1JH 3ZRVA 3K04A 5KHKA 4FLYA 3DXRA 3THOA 2P22C 4DR4B 4DV6O 3VBBA 4QJFB 1RSOA 1WP7A 2IJHA 1VF5B 5LMUB 3HKBA 3IFXA 2KB1A 2YI8A 4DV4O 3ZHUA 1WPXA 4QE9A 3UO3A 3ZRXA 3ZIAG 1H2GA 4B3TO 2JVDA 1G4YB 5JWPA 2R9AA 1F4NA 2YUAA 3A0BZ 1MSWD 2DWDC 1H2MA 2HJDA 4EB6B 4XBFA 2LP7A 2YEVA 1HNZO 1Z5WA 3P3PA 4DR5B 5FPRA 4FLXA 3W7UA 1OZ0A 3OUFA 3T1HO 2AHZA 3NR7A 4I4TA 1JVMA 4RQEA 3JARB 4LF5B 4PDRA 4J42A 5LA6B 1FJGO 1Q82W 3E83A 4U7NA 3JATA 5EK0A 4X20B 4R7CA 2DN9A 5DEDA 4DUYB 1HP8A 1XQ8A 1MZEA 3SJQC 2KG7A 2PYJA 2X0LA 4HNAB 1CPYA 4R8CA 1GKFA 1EBOA 3OEEG 3L9DA 2WLJA 2CGNA 3DC5A 2QR4A 3JD4A 2GBOA 5JCOC 1V54C 2YIDA 5TISZ 4CBCA 1IBMO 2IJKA 3K06A 1N33O 2LGWA 3CMAV 2JS5A 2R9RB 3T4DA 2A7WA 3FB7C 1MABG 1BQ0A 4JTAB 4WFHA 5IDJA 4UB6Z 1N36B 1IVSA 1Y74A 4HNAA 5K1XA 4KUMA 4H44B 3SPHA 4I4TB 1Y4MA 1GN6A 4X1YB 1KKCA 5C8YA 5KAFZ 1MMMA 1OCCC 1R3KC 1KP3A 2HKOA 3DGEA 3JAMN 1XI1A 2KSDA 4GZRB 2B1IA 1XILA 1N34O 2ATKC 1K92A 4K0KB 1OV9A 3O65A 2YIBD 1WB7A 3RVZA 4BAYA 3QF7A 2EINB 4UCTA 3MHSC 4O2BB 2Q0AA 1PKXA 3SPIA 1F23A 2YDEA 2YIBA 3BABA 1FXKA 1G1XB 5J2TA 4I7ZB 5LMNB 3RYHA 3RYFA 1XNQO 1V9PA 3EXAA 1OCCB 4O4LB 4PA4A 2WLIB 4K0KO 2V1DA 3E35A 2KKWA 4C7UA 1OJHA 3VOUA 5IJ9B 5E79Z 3LDEA 5H2FZ 3LSSA 4DR2B 1VQ9V 4H37A 1VEWA 1IDSA 2HHHO 3CCMV 1QVFU 1YJWV 1JCHA 1VARA 1TVKB 1P7GA 3ZEDA 5A2QN 1ZWIC 3ASOB 1PV0A 1U96A 2PY5A 3BEHA 1YITV 4DV0O 5H5NA 2IBZH 1FJGB 3ZHVA 5JJNB 1N32O 3RN4A 4GKKB 3F7YC 1NR1A 1IXMA 2X6AA 4HZ3A 5L3GA 4WFGA 4W4KA 2Z5UA 3IAYA 5CBGA 2PUSA 4CH4A 4WFBV 4GX2A 2DE0X 1GRJA 1AI5A 1NT2B 2RJZA 1FPOA
chains in the Genus database with same CATH topology
2DYRC 1R6KA 3K9AA 2XAFA 2JK5C 3E89A 4PA3A 5H6RA 2JJ1G 3LDCA 2EZPA 4OXSA 1HWYA 3ZRSA 2QTOA 1VQ7V 1NQTA 2A9HA 3ZCCA 4QE7A 1W0JG 1QLNA 3STLC 1K5SA 3WG7B 1AI7A 1F4MA 1M57B 2F43G 1KQSU 4R50A 2M7WA 4UV9A 4J9YB 3JD1A 4RUFA 2HR3A 2XAHA 3LSQA 1P4RA 3CMEV 4EKWA 1VQ6V 3P30A 3ZN1A 2WLHA 1H38A 1TUEB 4UVBA 1EFRG 3OMIB 1YJNV 2WLLA 2P6JA 3ABUA 3CC4V 1V55B 1R3JC 3CC7V 4F4LA 1YI2V 3AEIA 4MTGA 1DF4A 3MHHC 2EIKC 4XDJA 1K33A 1PL0A 1KECA 2CK3G 2WWWA 2XOKG 4WFFA 2DQ0A 4GX1A 3LNMB 3ZJZA 2OT5A 4XDKA 1BMFG 2Y69B 4HAMA 3FYEB 5IYDO 4WCEV 2YEVB 5DN6G 1M1KW 3RBZA 5LGUA 3CCUV 3T1CA 2XAGA 1K3EA 5B3SC 4WFEA 1VQKV 1DLBA 3ML0A 4U7OA 2A79B 4ZKIA 1THZA 3W7WA 1GK9A 1K34A 2EIMB 1Y66A 1OCZC 1S77D 1VQLV 4MW8A 1NVPB 2Y48A 3ASOC 3X2QC 2D3OW 3OE7G 1RPOA 2XASA 2EJRA 3G4SV 1M56C 1K97A 3G6EV 1S0VA 4PDVA 3AG1C 3ABKB 4UV8A 3CD6V 1NJIW 2Q69A 3ZMUA 4PELA 4JTDB 5KUKA 1YTFD 4G2KA 5L3EA 1GTOA 2R9IA 1QR8A 1J95A 1AROP 3STZC 2EIMC 5C93A 1OCOB 3E2EA 2DWEC 3K79A 3ZMSA 1QBZA 4UXNA 3P32A 1GO3F 2UXNA 5FL7G 1AR1B 1RM1B 2PI4A 5CBFA 4PDLA 3AG2C 2FTKA 1GM8A 1M9NA 1FFTB 4GCZA 1L1FA 1OCRC 4KP4A 3OUSA 5LGTA 3ABKC 2IU3A 1PD3A 2HVKC 3ETDA 2HVJC 3QO7A 2IJJA 1JX9A 2HJFC 4G28B 5L3BA 3E86A 3JD3A 3SYPA 2DYRB 2EIKB 1E1RG 3ABMB 3AG2B 3W7SA 3ABTA 2ITCC 2PI5A 1YSCA 4MTXA 3GB7C 3F7VC 1PNLA 1M90W 2HLDG 3ETGA 2EINC 4GX0A 3RVYA 3W7XA 2GSMB 4QPJA 3H01A 1MOFA 3K08A 2DYSC 1YHQV 4LCUC 1YJ9V 2X6BA 2OCCB 1W0KG 3SYQA 1AJPA 1Q86W 3OAAG 2YSUB 2WLNA 2IH3C 2EIJB 3X2QB 3WG7C 4MS2A 2W6JG 3LUTB 4RQFA 2P90A 1R73A 2IW5A 5CMUA 2B1GA 4MVSA 4FPPA 2WLKA 4MVMA 2JDIG 1Q81W 1FXKB 5LGNA 2OCCC 4P9PA 1ROPA 4N21A 1KD1W 3CC2V 1BHBA 1E79G 2EIJC 1K5QA 4QNHB 1FS0G 3GWOA 1COWG 4FIPC 4JYCA 2Q67A 2Q68A 2UXXA 4Q20A 1R3IC 1RM1C 3AG3C 4FK5C 1QVGU 3SYAA 2A0LA 4XDLA 3R65A 1NVPD 3CCJV 3LDDA 2P67A 5H9CA 1K8AW 1JJ2U 4YXWG 5LBQA 2ZQMA 5CA3A 1QR9A 2Z3YA 3B8NA 5GW7A 3ABMC 5H6QA 1PNKA 1CEZA 2BOCC 1GM7A 4ASUG 3RW0A 3G71V 5EC1C 5LHGA 4E2LA 2XNDG 3CCVV 2BOBC 4X89A 1E1QG 4TT3G 3FB8C 4RUEA 4GT1A 1AJNA 1S76D 1NH2B 3ZRWB 2EBOA 1PNMA 3ZRVA 3K04A 2DQ3A 1P7BA 4MW3A 4WFAV 2ZD9A 3ZN0A 2NNUA 4LC1A 3K03A 3CCRV 3JD2A 3OMNB 3UKMA 2W0FC 5KA6A 3HB3B 1VQ5V 1YTFB 1SRYA 3B77A 3EHBB 3VBBA 4QJFB 3HPLC 2JJ2G 2IJHA 2DW4A 3T2MA 4MVUA 5B1AB 3JYCA 4UVAA 5DM6V 1W2BU 1XL4A 3IFXA 2KB1A 2H8PC 1QCEA 1VQPV 1OCOC 5BZBA 1OCZB 4FMTA 1B6QA 1I5YA 1WPXA 1VQ8V 3CCSV 4QE9A 1AI6A 4JAUA 3TETA 3CYOA 3ZRXA 1DTOA 4LP8A 3ZIAG 1QLEC 1KP2A 1H2GA 3D3IA 3SPCA 3ZMZA 1SERA 1G4YB 3OGCC 3JD0A 4MTFA 1F4NA 5B1BB 3QNEA 2P7TC 1MSWD 2DWDC 4HYOA 1FXKC 4XBFA 5L3FA 3ZRWA 2LP7A 4TWKA 3D36A 2YEVA 2JEUA 2WLMA 4BIZA 2JIZG 3W7UA 1OZ0A 3IC7A 3OUFA 2AHZA 1K9MW 2XAJA 1JVMA 4RQEA 4WF9V 4PDRA 1VQOV 1GMGA 4G27B 2LFRA 3ASNC 2QEXV 3K0DA 1KKDA 3E8GA 1K4CC 2W6IG 3FB6C 1Q82W 3E83A 4U7NA 3W7TA 5EK0A 2ZDIC 4R7CA 3FKSG 2C2AA 2IJIA 4RAIA 3SJQC 1OHHG 3B8MA 1M57C 3PJSK 4I5SA 4L87A 2WLIA 4P9OA 2ZDIA 2X0LA 4JF3A 1CPYA 1R6NA 4JASA 4R8CA 1NR7A 4X8AA 1GKFA 4JPRA 1EBOA 3OEEG 2IU0A 1VQ4V 4JGSA 1JQ0A 2WLJA 3ETEA 1RPRA 2XAQA 1K73W 3CPWU 5E1AC 4X88A 3QO8A 1XL6A 4P2ZA 3FB5C 3JD4A 2EILB 1V54C 1OCRB 3AG3B 4CZZA 2QM7A 5CBHA 3IGAC 3QO5A 1DF5A 2Y69C 4CBCA 3ASNB 4UVCA 1FXHA 2IJKA 3K06A 4QPKA 3FYIB 4PA9A 3CMAV 1S5HC 2QA4V 2R9RB 2LFSA 3T4DA 1ENVA 1K7DA 3K0GA 4MVQA 1H8HG 5IYBO 3FB7C 4MT8A 1MABG 3DTUB 1SZTA 3ZMTA 2B5UA 2IH1C 2OTJV 4J9ZB 1KC8W 4JTAB 2QM8A 1NKDA 4WFHA 5IDJA 5B1OA 3KG2A 3OMAB 4KFMA 3SPGA 2WAMA 1AI4A 2OTLV 1ORQC 5EBMC 2V7QG 2DYSB 4KUMA 5B1NA 1FXVA 3SPHA 3K3WA 4GX5A 4RO2A 1Y4MA 3A0RA 3OR7C 4JAVA 3E8BA 1OCCC 3ABLB 1R3KC 1KP3A 1H8EG 1CP9A 1WLEA 2HKOA 3AG1B 2NLJC 3DGEA 2HFEC 4FJCC 3E8FA 2X7RB 1Q7YW 4JTCB 3I55V 4MVZA 3I56V 1S3JA 2B1IA 3CCLV 4UUJC 2ATKC 1K92A 2K1EA 2ZR2A 4JYBA 2ZXWC 1R3LC 3SYCA 3NXSA 4I9WA 5LHHA 3ABLC 1I5XA 5B1BC 3RVZA 5IY5B 1JPXA 1G8MA 4BAYA 2EINB 4TSFG 3UM7A 3MHSC 3CXCU 1QLEB 3CP1A 1PKXA 2ITDC 3SPIA 1F23A 3WFVA 1UJWB 5J9PC 3OEHG 1FXKA 3F5WC 2ZXWB 4P30A 4DO2A 3ZMVA 5L3DA 4DXWA 4PA6A 1OCCB 2WSSG 1JOYA 4PA4A 3MD0A 1GM9A 1S72V 2HG5C 1NBMG 5B3SB 2AHYA 5EBWC 4Z1MG 2WLIB 4MTOA 2V1DA 3M99B 3E35A 3OR6C 4QIWF 4MVRA 3VOUA 1BL8A 2MK3A 5KUMA 1F51A 2WPDG 3LDEA 5LHIA 3LSSA 1SESA 3TK1A 1YIJV 1VQ9V 4H37A 4ZBMA 5KA5A 3SPJA 5IY5C 3CCMV 4PA7A 1QVFU 3T4ZA 4N23A 1YJWV 5EBLC 1LNQA 2ZR3A 3CCQV 1JCHA 1BHAA 2EILC 1SETA 1M56B 1ZWIC 2X6CA 3OFNG 1MG1A 4PDMA 3ASOB 4MSWC 5L3CA 2QE7G 1N8RW 3TCUA 4MVOA 1AJQA 1V55C 3BEHA 5HFMA 1YITV 1NH2D 5EC2C 2H94A 2Q6AA 3F7YC 1NR1A 1IXMA 2X6AA 2GHYA 4HZ3A 4BW5A 5IYCO 5L3GA 3EFFK 3E8HA 4H33A 4LBEC 4WFGA 1K4DC 2EZOA 1EZJA 2QKSA 2Z5UA 3AG4B 3AG4C 3JCZA 2WLLB 1VQMV 3BY6A 3OM3B 5CN0A 5HFLA 3SYOA 5B1AC 3OW2U 2JEXA 5CBGA 4BIUA 4WFBV 4GX2A 1V54B 3CCEV 1AI5A 1VQNV 4R6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 V;  1VQO V;  1VQ8 V;  3CCS V;  1YIT V;  1K8A W;  4WFA V;  1VQK V;  1JJ2 U;  1VQ4 V;  2QEX V;  1Q82 W;  1YJN V;  3CXC U;  1K73 W;  3CPW U;  3CC4 V;  3CCR V;  1Q81 W;  1M90 W;  2OTJ V;  3CC7 V;  1VQ7 V;  1YIJ V;  1YI2 V;  1KC8 W;  1VQ9 V;  1VQL V;  1VQ5 V;  3CCM V;  3G71 V;  1Q7Y W;  1KD1 W;  3CC2 V;  1QVF U;  1YJW V;  1YHQ V;  3I55 V;  3I56 V;  1YJ9 V;  3CCQ V;  1VQM V;  3CCL V;  2D3O W;  3CCV V;  2OTL V;  1Q86 W;  3G4S V;  3G6E V;  1KQS U;  3OW2 U;  5DM6 V;  1W2B U;  4WCE V;  3CD6 V;  1NJI W;  4WFB V;  1QVG U;  1M1K W;  1VQP V;  1K9M W;  3CCE V;  3CCU V;  1N8R W;  1S72 V;  1VQN V;  3CCJ V;  3CME V;  3CMA V;  2QA4 V;  4WF9 V;  1R73 A; 
#chains in the Genus database with same CATH topology
 4F6R A;  2DYR C;  4YJ2 A;  2B9Z A;  3SJC C;  2XAF A;  3CRA A;  2JK5 C;  3E89 A;  4IIJ B;  5LXT B;  1HWY A;  2QTO A;  1NQT A;  1EN4 A;  1XBL A;  4JI2 B;  2Q8V A;  1K5S A;  5A9G A;  2EJ7 A;  1KQS U;  5IT9 N;  1TGO A;  2M7W A;  4LF9 B;  1IBM B;  4RUF A;  2XAH A;  4WBN A;  2Q5Z A;  3CC4 V;  4DR5 O;  3Q4H A;  1YI2 V;  3AEI A;  1JR9 A;  5AG2 A;  1T5E A;  2XOK G;  1JJO A;  3CJH A;  3LNM B;  3ZJZ A;  5KLV H;  2Y69 B;  3L71 H;  4DR6 O;  4JI2 O;  1XNR O;  4YJ2 B;  2XAG A;  4X9Q A;  4WFE A;  2FKX A;  1VQK V;  1DLB A;  4U7O A;  2UU9 B;  2R70 A;  2OYQ A;  3K5N A;  4MW8 A;  3CS5 A;  3ASO C;  3X2Q C;  2XAS A;  4NKG B;  1S0V A;  1NU1 H;  4PDV A;  4UV8 A;  3ABK B;  3CD6 V;  2Q69 A;  4FZ0 A;  3GVM A;  3RT3 C;  4G2K A;  4DRX A;  1YDX A;  5L3E A;  4NXM B;  1QR8 A;  3STZ C;  1ARO P;  4JI5 B;  3K79 A;  4D7T A;  3TXS A;  1RM1 B;  2PI4 A;  1GO3 F;  1SA0 A;  4ICG A;  1URF A;  1FFT B;  3RWR D;  4GCZ A;  5LL6 Y;  2QWN B;  1XNQ B;  2W0X A;  2HVJ C;  4LFC O;  1AB3 A;  5D5Q A;  2QJ1 A;  2G38 A;  1NTK H;  5BR8 B;  4FLV A;  3JD3 A;  1E1R G;  4JI0 O;  1YSC A;  3GB7 C;  3H1I H;  2EIN C;  3W7X A;  4QPJ A;  1MOF A;  1H2S B;  2QTS A;  1YHQ V;  1YJ9 V;  1FD9 A;  4KHP B;  1W0K G;  1AJP A;  2XHB A;  1Q6H A;  5CA1 A;  1YCI A;  1HR0 B;  2IH3 C;  2LO1 A;  3X2Q B;  5IE9 A;  4J7J A;  3RYI A;  5KHG A;  2PTM A;  4DV0 B;  5BMV A;  4MVS A;  2OCC C;  2RN9 A;  4O2A B;  3KKY A;  4JV5 O;  3LSU A;  1ROP A;  1Q5O A;  4N21 A;  1KD1 W;  1E79 G;  2EIJ C;  5KHH A;  1PP9 H;  3GWO A;  2BE3 A;  1NZ6 A;  1RM1 C;  2ZKO A;  4DRX B;  4J80 A;  5KHI A;  3CCJ V;  2Q9L A;  2GV9 A;  1ZSP A;  4IHJ A;  5H9C A;  1K8A W;  1WJZ A;  1JJ2 U;  5LBQ A;  4JZG A;  1Q6I A;  1GM7 A;  1ZX3 A;  3G71 V;  3RGB A;  4X62 O;  3PN1 A;  2XND G;  3K9S A;  3FX7 A;  3CCV V;  4X89 A;  2JGU A;  2AZ0 A;  4NTX A;  1W59 A;  1SF9 A;  1Y6X A;  1NH2 B;  1S76 D;  4BR6 A;  1X4T A;  3K5L A;  5CB4 B;  4DK1 A;  4PI0 A;  2DQ3 A;  4MW3 A;  3JAW A;  3JSN A;  4DV5 B;  4UCU A;  4B3M B;  2RMK B;  3OMN B;  4ZI7 A;  1SRY A;  4CC6 A;  3H1H H;  2MW2 B;  4J41 A;  3JYC A;  4J7K A;  1X59 A;  1JA8 A;  1XL4 A;  3RYI B;  5EIB C;  1VQP V;  3G67 A;  4GKJ O;  4FMT A;  1VQ8 V;  3CCS V;  4K8Z A;  3CYO A;  2EUL A;  3D3I A;  3LNN A;  1SZX A;  3OGC C;  3JD0 A;  2BTQ A;  4MTF A;  4B3T B;  2P7T C;  3H1K H;  4B3M O;  4LWS A;  4HYO A;  5L3F A;  4O4H A;  1VP7 A;  2JEU A;  3ZHT A;  5DEC A;  2NR5 A;  1HNZ B;  1VQO V;  1SC5 B;  4OPH A;  3ASN C;  3K0D A;  1PL4 A;  1K4C C;  2Q7G A;  3FB6 C;  1S5J A;  2YXH A;  2ZDI C;  2K9P A;  3AK2 A;  3UCS C;  5FNV B;  1TAE A;  4O4I B;  3G6B A;  1PM9 A;  3B8M A;  4DUY O;  3PJS K;  4I5S A;  4L87 A;  4AQY O;  5BR8 O;  4P9O A;  5BY1 A;  3P3N A;  2Q4P A;  4LF4 O;  4JF3 A;  4X8A A;  2WA3 A;  2QDO A;  4JGS A;  3ETE A;  3CPW U;  5J2T B;  3BHP A;  5E1A C;  1XNR B;  1UFI A;  1IX9 A;  3FB5 C;  4NVP A;  4DW0 A;  2VQF O;  3CE2 A;  3VQY A;  4DV3 O;  5CBH A;  1IBL O;  2PGG A;  4DR3 O;  4YIP A;  3ASN B;  4I0X A;  3ZBH A;  2WA4 A;  4QPK A;  4PA9 A;  2Y0P A;  2UUC B;  1SS3 A;  4MVQ A;  5IYB O;  4MT8 A;  1SZT A;  1KC8 W;  4JV5 B;  2ZIM A;  3J7A U;  1BQZ A;  2CAZ C;  3OMA B;  4TUY A;  4O2B A;  2WAM A;  4F6R B;  1AI4 A;  4YIO A;  1ORQ C;  5EBM C;  4Z2W A;  2Q0O C;  2RQ6 A;  1FXV A;  5KAI Z;  4CS3 A;  4U3J B;  3SDL A;  3A8T A;  2YIC A;  1IBL B;  5GON B;  4JAV A;  4UCV A;  4TOI A;  1I7F A;  3ZX6 A;  2NLJ C;  2UUC O;  3HKC B;  2QWQ B;  3AG7 A;  3CX5 F;  2KQX A;  1Q7Y W;  2BSK B;  5B66 Z;  4JTC B;  3FD9 A;  1S5L Z;  4MVZ A;  3I55 V;  1S3J A;  1Y76 A;  2AGA A;  4FFB B;  4LFA B;  3SR2 C;  4JI1 B;  3QG5 A;  2ZR2 A;  2K1E A;  4JYB A;  2ZXW C;  4PJ0 Z;  3NXS A;  1GN2 A;  5IY5 B;  3WB2 A;  1XOU A;  4I55 B;  1QLE B;  3CP1 A;  2R72 A;  1UJW B;  3OEH G;  1L0N H;  3F5W C;  3JAT B;  4P30 A;  4DO2 A;  3ZMV A;  4DUZ O;  5L3D A;  1Q43 A;  2Q7H A;  4U3J A;  3A0H Z;  3N2K A;  4UCS A;  4PA6 A;  4FVM A;  2BCC H;  1RP3 B;  2JGD B;  2HG5 C;  1NBM G;  2AHY A;  1XMQ O;  4Z1M G;  1HNW B;  4QIW F;  1IUR A;  4GYC B;  1MA1 A;  4B3R B;  1F51 A;  2HHH B;  3RYH B;  5LHI A;  2CH7 A;  4FZ1 A;  1MSD A;  1SES A;  1B04 A;  4NTW A;  3B09 A;  2E75 B;  4PA7 A;  2ZR3 A;  2AXT Z;  4JYA B;  2X6C A;  1MG1 A;  4MSW C;  2VS0 A;  3D3Q A;  1N8R W;  1B3Q A;  2RDC A;  1P84 F;  1V55 C;  4X62 B;  2QWP B;  5EC2 C;  1XMQ B;  2Q6A A;  3FAV B;  5KMG A;  3EFF K;  4H33 A;  1K4D C;  1EZJ A;  1QHT A;  1R1B A;  4QGP A;  3AG4 B;  2ADQ B;  1Q6U A;  1BCC H;  5CN0 A;  1VQM V;  2ZE5 A;  2JEX A;  2GTA A;  1VIB A;  1WA8 B;  1EN6 A;  3BVO A;  4JI7 O;  4JYA O;  1AVM A;  1R6K A;  3DSQ A;  4DV2 O;  3U10 A;  5H6R A;  3LDC A;  5JJE B;  3VQW A;  1Z2G A;  4BIO A;  4QE7 A;  1W0J G;  3HKE A;  4TV9 B;  3STL C;  4LF6 B;  1AI7 A;  3H9V A;  4NR1 A;  2E76 B;  5IJ0 A;  4I9Q A;  2M6Y A;  5EZY A;  3P30 A;  4W4L A;  5BXZ A;  2CTW A;  1TUE B;  1EFR G;  1HNX O;  2V4D A;  3ABU A;  1V55 B;  3CC7 V;  4F4L A;  3HKD B;  2ETN A;  1DF4 A;  3MHH C;  3N2G A;  5JH7 B;  1K33 A;  1Y67 A;  2WWW A;  2CK3 G;  5C8Y B;  4WFF A;  4GX1 A;  3CEI A;  4XDK A;  1BMF G;  2LJ2 A;  1QQC A;  1A32 A;  4HAM A;  2IM9 A;  5IYD O;  2RCV A;  4JI6 B;  2O57 A;  5LGU A;  1XEQ A;  1N0N A;  3D36 C;  4B7E A;  4X1I B;  2ZIO A;  5JQG B;  1LR1 A;  4ZKI A;  3W7W A;  1THZ A;  3JCU Z;  5J2U A;  2P06 A;  1K34 A;  2F23 A;  4RWU A;  4LF4 B;  2QKC A;  3BA8 A;  3C3S A;  1YEW A;  1I94 B;  3OE7 G;  1RPO A;  2VQE B;  3G4S V;  1M56 C;  1K97 A;  4JI4 O;  1NS1 A;  1KB9 F;  5ITZ B;  3T1H B;  2RNB A;  1NI8 A;  4DV1 B;  1KBH A;  4JI8 B;  3ZMS A;  4JAA A;  1QBZ A;  4UXN A;  3P32 A;  2UXN A;  4PDL A;  4DK0 A;  2FTK A;  5EIB D;  3ZHS A;  3OUS A;  1PD3 A;  3ETD A;  4AIL C;  3B40 A;  4DR1 O;  1XMO B;  3K59 A;  3QO7 A;  1TUB A;  1JX9 A;  5JQG A;  5L3B A;  3E86 A;  2PZS A;  1HNW O;  3ABM B;  3AG2 B;  3FFQ A;  2PI5 A;  4MTX A;  3F7V C;  2GUZ B;  3ETG A;  4H13 B;  3K08 A;  4LCU C;  3F5T A;  4H0L B;  4LR3 A;  5K1P A;  2CTR A;  4ZOL B;  4MS2 A;  2W6J G;  3LUT B;  4RQF A;  4LNU A;  1Q3E A;  1YXB A;  2E5L B;  2BTQ B;  4MVM A;  2P4K A;  5LGN A;  4P9P A;  3CRR A;  3CC2 V;  5LOV B;  4QNH B;  1FS0 G;  5LXT A;  4JYC A;  2UXX A;  3AG3 C;  1QNM A;  3JAR A;  4FK5 C;  1QVG U;  1JFF A;  4CS4 A;  5IWA O;  3BAA A;  3R65 A;  4O4L A;  4D7S A;  3LDD A;  4DV2 B;  4I50 A;  2HP8 A;  1FYJ A;  4DV6 B;  2Z3Y A;  5H6Q A;  4B7K A;  1XHX A;  1CEZ A;  4B3S B;  2UXD O;  4NYK A;  4ASU G;  1QU7 A;  3RW0 A;  1I0H A;  3K57 A;  4LF6 O;  4FM2 A;  1E1Q G;  4RUE A;  4DV4 B;  2JS3 A;  4J7Z A;  5FPO A;  1UPG A;  3M8A A;  2UUA B;  2FB5 A;  4B08 A;  3OGI B;  1P7B A;  4NB5 A;  1ZAU A;  1G6U A;  2YC0 A;  4ZIB A;  2ZD9 A;  5IWA B;  2NNU A;  2QKA A;  4LC1 A;  4FM0 A;  3CCR V;  5LOV A;  3JD2 A;  3UKM A;  2W0F C;  4X64 B;  3HB3 B;  1VQ5 V;  1YTF B;  3B77 A;  1SQF A;  2LQT A;  3HPL C;  3HR0 A;  4JI3 O;  3T2M A;  4MVU A;  4KL1 A;  4UVA A;  1W2B U;  4JI6 O;  2H8P C;  1QCE A;  1OCO C;  5BZB A;  1OCZ B;  4F6E A;  1B6Q A;  1I5Y A;  4Q6G A;  3TET A;  4JAU A;  1DTO A;  3ZMZ A;  4EEQ A;  2BTO A;  2DJV A;  5LYJ B;  1I94 O;  2UXC B;  4I55 A;  2WLM A;  3L70 H;  4BIZ A;  1XHZ A;  1K9M W;  1SQB H;  2XAJ A;  1WNS A;  4WF9 V;  4JI8 O;  2LFR A;  2QEX V;  3E8G A;  2W6I G;  2ZE6 A;  2ZIN A;  2IJI A;  2ZNI A;  1OHH G;  2XTA A;  1M57 C;  4CS2 A;  1Z5V A;  2ZDI A;  2AW9 A;  4HBN A;  4JAS A;  1NR7 A;  4JPR A;  2IU0 A;  1HW7 A;  1RPR A;  2XAQ A;  1K73 W;  3C3T A;  5FNV A;  4PD4 F;  1XRE A;  4X88 A;  2EIL B;  3JSL A;  4LF7 B;  5EYP B;  3CWB H;  5BMV B;  2F4V B;  4JI5 O;  2JGD A;  2ODM A;  1FXH A;  2YXY A;  1Y76 B;  2FL4 A;  4FFB A;  3HKB B;  3CRM A;  2LFS A;  1H8H G;  1M93 A;  2P5O A;  1EM1 A;  5KX5 B;  4DV7 B;  1WAZ A;  3ZMT A;  2IH1 C;  5JVD A;  2QM8 A;  3JAW B;  1VF7 A;  2UUB O;  1NKD A;  3KG2 A;  4IHJ B;  4Z1V A;  1GN3 A;  3BCC H;  1D5N A;  2OTL V;  4IL6 Z;  3UO2 A;  2V7Q G;  3KCY A;  1BSM A;  5B1N A;  4IGG A;  3K3W A;  4GX5 A;  4RO2 A;  4TV8 B;  3E22 A;  5CA0 B;  3A0R A;  1YF2 A;  4PI2 A;  4FLU A;  3ABL B;  1H8E G;  1CP9 A;  1WLE A;  3AG1 B;  4B3S O;  2HFE C;  4FLT A;  4FJC C;  2X7R B;  4LF8 O;  3I56 V;  3CCL V;  3APO A;  4UUJ C;  2OCH A;  1I08 A;  1R3L C;  3SYC A;  4I9W A;  5LP6 B;  1JPX A;  1G8M A;  1VMG A;  2N05 A;  3A2F A;  4TSF G;  3UM7 A;  3WFV A;  4DR4 O;  1ZTE A;  1BZK A;  4DW1 A;  4CC5 A;  2E5L O;  4DXW A;  1NTZ H;  3J80 N;  4LF8 B;  2ZCE A;  1FFX B;  2N04 A;  2QWO B;  2Y0I A;  1JOY A;  3MD0 A;  1GM9 A;  5B3S B;  4B3R O;  5EBW C;  4MTO A;  3OR6 C;  2GDS A;  1BL8 A;  2MK3 A;  3UT5 A;  3TK1 A;  3SPJ A;  2JRI A;  3T4Z A;  4N23 A;  1L0L H;  5EBL C;  4OX9 B;  1M4U A;  1BHA A;  1SET A;  1BE3 H;  3OFN G;  3IJ4 A;  4CH3 A;  2QE7 G;  4YY3 B;  4MVO A;  3ZS8 C;  3C90 A;  2CUG A;  2YI9 A;  2H94 A;  5IYC O;  4X1K B;  2GHY A;  3ETQ A;  1BS3 A;  3E8H A;  4LBE C;  2QKS A;  4LF9 O;  3AG4 C;  3JCZ A;  3U11 A;  3BY6 A;  2ZM6 O;  3SYO A;  1O9H A;  5B1A C;  3OW2 U;  2QM4 A;  1V54 B;  3CCE V;  1VQN V;  2LGQ A;  3M7M X;  4R6Z A;  1FKA O;  3K9A A;  3G80 A;  3CHX A;  5EYP A;  2EZP A;  2F1M A;  4OXS A;  1J5E B;  2VWK A;  4YY3 O;  1VQ7 V;  4DR6 B;  4UCR A;  5JJJ B;  1N32 B;  4PHZ A;  4FFK A;  3WG7 B;  1M57 B;  2CE4 A;  4J9Y B;  3JD1 A;  1N33 B;  3LSQ A;  4E4E A;  3CME V;  1HNX B;  3ZN1 A;  3HKE B;  5F2V O;  2UXC O;  3OMI B;  4X20 A;  2WLL A;  2CTP A;  1SA0 B;  1R3J C;  1SQP H;  4MTG A;  2EIK C;  3SJB C;  1KEC A;  1N36 O;  2DQ0 A;  2OT5 A;  5EZY B;  3E22 B;  5CA0 A;  4O4J A;  4NXM O;  1IZ3 A;  3FYE B;  4WCE V;  1M1K W;  1LUW A;  2F95 B;  5B3S C;  4GLX A;  2L6L A;  4NXN O;  3N2G B;  5JH7 A;  3ML0 A;  1RSO B;  1GK9 A;  4X1K A;  2EIM B;  1OCZ C;  3JAS A;  1NVP B;  2ILM A;  2LW7 A;  4U3F H;  2D3O W;  3K58 A;  2VWJ A;  2EJR A;  4DV1 O;  3JAK A;  1NJI W;  1YTF D;  5B5E Z;  4O4I A;  4I0X B;  1GTO A;  1J95 A;  5C93 A;  1OCO B;  3E2E A;  2YS8 A;  3BPZ A;  5CBF A;  3JAL B;  4IIJ A;  5LP6 C;  1L1F A;  2UU9 O;  1OCR C;  3FAV A;  5LMN O;  3ABK C;  2HVK C;  2NN4 A;  2IJJ A;  3IC9 A;  3SGI A;  2EX3 A;  5GTH Z;  4LFB O;  1WN7 A;  1B06 A;  3SYP A;  1R6T A;  2UUB B;  4LFA O;  3AK3 A;  2ITC C;  3B2E E;  3CXH F;  1PNL A;  4OGQ B;  4DR2 O;  1M90 W;  4YHH O;  3VQX A;  4GX0 A;  4TQF A;  4JZ2 A;  3OTF A;  3H01 A;  4DR7 O;  2Y4U A;  3Q4H B;  2UXB B;  1PPJ H;  1Q86 W;  3SYQ A;  3OAA G;  1FFX A;  1ZUQ A;  5FLX N;  2E3C A;  5IJ0 B;  4DUZ B;  2IW5 A;  2WLK A;  1FXK B;  1DGS A;  4X65 O;  1AP6 A;  3UQ8 A;  2XT9 A;  3ZHR A;  1COW G;  4FIP C;  2ZM6 B;  3JAK B;  4Q20 A;  4BW9 A;  1AR5 A;  1GH6 A;  2A0L A;  5KHJ A;  4DV5 O;  2QSA A;  1NVP D;  1ZL8 A;  1RFY A;  1D5A A;  2ZQM A;  1KUQ A;  2UXD B;  1QR9 A;  3JAL A;  1L8D A;  3B8N A;  3ABM C;  3N27 A;  5GW7 A;  2BOC C;  1VF6 C;  5EC1 C;  5LHG A;  4X1Y A;  2BOB C;  3R66 A;  3FB8 C;  1KU9 A;  4UFZ A;  2YIA A;  2DMX A;  1IBK B;  3ZRW B;  2EBO A;  1PNM A;  4LH7 A;  2FYU H;  3N2K B;  4WFA V;  5IYZ A;  4IYH A;  3ZN0 A;  4OX9 O;  1TA8 A;  1AP5 A;  3K03 A;  2E74 B;  4X66 B;  3WB0 A;  5KA6 A;  1SQQ H;  3BFR A;  5KMG B;  3EHB B;  3D8C A;  1YVW A;  2JJ2 G;  2N74 A;  4X64 O;  2DW4 A;  1FAF A;  5B1A B;  3AK1 A;  1ZL8 B;  5DM6 V;  5CA1 B;  4EB6 A;  5LMU O;  4CH5 A;  2PF4 E;  4NXN B;  1AI6 A;  3MAQ A;  4LP8 A;  1QLE C;  3RYF B;  3CJH B;  1KP2 A;  1SER A;  3SPC A;  3K5M A;  3TGU H;  5B1B B;  3S3X A;  3QNE A;  4KXR A;  1FXK C;  4TV8 A;  3ZRW A;  4X66 O;  4TWK A;  3D36 A;  2OIG A;  2JIZ G;  3IC7 A;  3OD4 A;  5CB4 A;  2KG7 B;  1N4C A;  1GMG A;  4G27 B;  1TUB B;  1MNG A;  4K35 A;  2VQF B;  4GKJ B;  4LF5 O;  4K3A A;  5LYJ A;  3W7T A;  3FKS G;  2GTS A;  2C2A A;  2A3Q A;  4RAI A;  4LFC B;  5LP6 A;  3S3W A;  2WLI A;  3KCX A;  4LFB B;  1IXB A;  4K8X A;  2L35 A;  1SKV A;  1R6N A;  4CH6 A;  2A06 H;  2D2C B;  4J11 A;  2VQE O;  1VQ4 V;  1JQ0 A;  4LF7 O;  1KMI Z;  4YHH B;  3QO8 A;  4UB8 Z;  1XL6 A;  4P2Z A;  4ABM A;  3O9O A;  4FLZ A;  1AR4 A;  1OCR B;  2F93 B;  3AG3 B;  4CZZ A;  2QM7 A;  1SQG A;  3IGA C;  3QO5 A;  3OTO O;  1DF5 A;  2Y69 C;  2ZT9 B;  1Q8I A;  2F4V O;  4UVC A;  1Y74 B;  3FYI B;  1S5H C;  2QA4 V;  1ENV A;  4DR1 B;  1K7D A;  3K0G A;  1YZB A;  3DTU B;  2B5U A;  2OTJ V;  4J9Z B;  4FM1 A;  4DV7 O;  5B1O A;  4KFM A;  3SPG A;  3K5O A;  3OT7 A;  2DYS B;  3BA9 A;  4O4H B;  3L73 H;  3OTO B;  3OR7 C;  4DR3 B;  1U97 A;  3E8B A;  1EN5 A;  4PV1 B;  1M5I A;  5LA6 A;  2ADP A;  3E8F A;  3L74 H;  2VRZ A;  4JI0 B;  1VF6 A;  3SJA C;  3TXQ A;  3ZHQ A;  1DK1 A;  1IBK O;  2ZE8 A;  2HEP A;  5LHH A;  3ABL C;  1ZLZ A;  1I5X A;  5B1B C;  1N34 B;  2PYL A;  1Q90 D;  1EZV H;  3QVN A;  4KHP O;  2Q73 A;  1HDJ A;  3CXC U;  2ITD C;  4TV9 A;  5J9P C;  2ZXW B;  2CGO A;  3CSX A;  2WSS G;  1BT8 A;  1WA8 A;  1S72 V;  4LH6 A;  3M99 B;  2ZE7 A;  4MVR A;  5KUM A;  2WPD G;  4D6T H;  2XUM A;  1MZF A;  1YIJ V;  2UUA O;  3MDS A;  4ZBM A;  5KA5 A;  5IY5 C;  2YXL A;  1LNQ A;  3CCQ V;  1O9G A;  3J81 N;  3QTC A;  2EIL C;  4L8J A;  4JI7 B;  1M56 B;  3BRC A;  4PDM A;  5L3C A;  5D5P A;  3TCU A;  1AJQ A;  4GKK O;  5HFM A;  2OWO A;  4JI3 B;  1TVK A;  3JAS B;  1NH2 D;  4LWS B;  4BW5 A;  1H2K A;  1H2L A;  1WB8 A;  2EZO A;  2LW1 A;  4I50 B;  2F66 C;  3HKC A;  5JVD B;  4ZHQ B;  2WLL B;  3OM3 B;  1WP8 A;  3WB1 A;  5HFL A;  4BIU A;  4DYL A;  1KKD A;  4AHC A;  3T1Y O;  3L75 H;  1SQV H;  4PA3 A;  2JJ1 G;  2CH7 B;  5J2U B;  3ZRS A;  2A9H A;  3ZCC A;  2H3O A;  1QLN A;  1J5E O;  1SQX H;  1F4M A;  2F43 G;  4R50 A;  4UV9 A;  1KYO F;  3I5D A;  2HR3 A;  5ITZ A;  1P4R A;  3EVK A;  2OIE A;  4EKW A;  1VQ6 V;  4IT5 A;  2WLH A;  1H38 A;  4UVB A;  4O2A A;  1YJN V;  2P6J A;  3WU2 Z;  4AI8 A;  4FLW A;  5IJ9 A;  4XDJ A;  3T1Y B;  1PL0 A;  4IYI A;  1AIL A;  4ZOL A;  4YJ3 B;  4LNU B;  2YEV B;  5DN6 G;  3RBZ A;  3CCU V;  3U0Z A;  3T1C A;  2Y4T A;  1K3E A;  3KZI Z;  3HKD A;  2A79 B;  4TUY B;  5GTI Z;  4AQY B;  1Y66 A;  1XMO O;  2QWR B;  4JYY A;  1VQL V;  1S77 D;  1XDC A;  3L72 H;  2Z0A A;  2Y48 A;  4JI1 O;  5IYZ B;  3G6E V;  1JFF B;  4WBN B;  3AG1 C;  4X1I A;  3ZMU A;  4PEL A;  4JTD B;  5KUK A;  4GUN A;  2R9I A;  4DV3 B;  2EIM C;  2DWE C;  4EFB A;  4ZI7 B;  1D2D A;  5FL7 G;  3APQ A;  3RFR A;  1AR1 B;  3RYC A;  3AG2 C;  1GM8 A;  1M9N A;  2QGN A;  2Q7E A;  2GUZ A;  4KP4 A;  5LGT A;  2IU3 A;  2ARH A;  1LUV A;  3UT5 B;  4A5U B;  2HJF C;  4NTY A;  1JMK C;  4G28 B;  1CXZ B;  2DYR B;  1XUQ A;  4JI4 B;  2EIK B;  3CRQ A;  3DC6 A;  3W7S A;  3ABT A;  3TJT A;  4DR7 B;  3CRC A;  2HLD G;  2BSK A;  3RVY A;  1WPB A;  3GWK C;  2CDY A;  2FML A;  2GSM B;  2P4V A;  2DYS C;  1HR0 O;  2X6B A;  5KX5 A;  2OCC B;  2YSU B;  2UXB O;  2WLN A;  4YJ3 A;  2EIJ B;  4BWA A;  5JCO A;  3WG7 C;  1GN4 A;  2P90 A;  1R73 A;  1H2N A;  5CMU A;  4OPA A;  1GAX A;  2B1G A;  4FPP A;  3H1L H;  4X65 B;  4ZHQ A;  2JDI G;  1Q81 W;  2CTQ A;  1BHB A;  3DXR B;  1K5Q A;  3B4S A;  2Q67 A;  2Q68 A;  1P49 A;  1R3I C;  3SYA A;  1N0J A;  4O4J B;  4XDL A;  1F7Y A;  2AZ2 A;  2P67 A;  4J10 A;  3CB2 A;  4YXW G;  4TQD A;  4UCO A;  5CA3 A;  3RYC B;  1PNK A;  2ZNJ A;  1US6 A;  1NTM H;  2DOS A;  3VQV A;  4E2L A;  3ICX A;  5GON A;  1BGY H;  4TT3 G;  4GT1 A;  1AJN A;  4EFE A;  3H1J H;  3ZRV A;  3K04 A;  5KHK A;  4FLY A;  3DXR A;  3THO A;  2P22 C;  4DR4 B;  4DV6 O;  3VBB A;  4QJF B;  1RSO A;  1WP7 A;  2IJH A;  1VF5 B;  5LMU B;  3HKB A;  3IFX A;  2KB1 A;  2YI8 A;  4DV4 O;  3ZHU A;  1WPX A;  4QE9 A;  3UO3 A;  3ZRX A;  3ZIA G;  1H2G A;  4B3T O;  2JVD A;  1G4Y B;  5JWP A;  2R9A A;  1F4N A;  2YUA A;  3A0B Z;  1MSW D;  2DWD C;  1H2M A;  2HJD A;  4EB6 B;  4XBF A;  2LP7 A;  2YEV A;  1HNZ O;  1Z5W A;  3P3P A;  4DR5 B;  5FPR A;  4FLX A;  3W7U A;  1OZ0 A;  3OUF A;  3T1H O;  2AHZ A;  3NR7 A;  4I4T A;  1JVM A;  4RQE A;  3JAR B;  4LF5 B;  4PDR A;  4J42 A;  5LA6 B;  1FJG O;  1Q82 W;  3E83 A;  4U7N A;  3JAT A;  5EK0 A;  4X20 B;  4R7C A;  2DN9 A;  5DED A;  4DUY B;  1HP8 A;  1XQ8 A;  1MZE A;  3SJQ C;  2KG7 A;  2PYJ A;  2X0L A;  4HNA B;  1CPY A;  4R8C A;  1GKF A;  1EBO A;  3OEE G;  3L9D A;  2WLJ A;  2CGN A;  3DC5 A;  2QR4 A;  3JD4 A;  2GBO A;  5JCO C;  1V54 C;  2YID A;  5TIS Z;  4CBC A;  1IBM O;  2IJK A;  3K06 A;  1N33 O;  2LGW A;  3CMA V;  2JS5 A;  2R9R B;  3T4D A;  2A7W A;  3FB7 C;  1MAB G;  1BQ0 A;  4JTA B;  4WFH A;  5IDJ A;  4UB6 Z;  1N36 B;  1IVS A;  1Y74 A;  4HNA A;  5K1X A;  4KUM A;  4H44 B;  3SPH A;  4I4T B;  1Y4M A;  1GN6 A;  4X1Y B;  1KKC A;  5C8Y A;  5KAF Z;  1MMM A;  1OCC C;  1R3K C;  1KP3 A;  2HKO A;  3DGE A;  3JAM N;  1XI1 A;  2KSD A;  4GZR B;  2B1I A;  1XIL A;  1N34 O;  2ATK C;  1K92 A;  4K0K B;  1OV9 A;  3O65 A;  2YIB D;  1WB7 A;  3RVZ A;  4BAY A;  3QF7 A;  2EIN B;  4UCT A;  3MHS C;  4O2B B;  2Q0A A;  1PKX A;  3SPI A;  1F23 A;  2YDE A;  2YIB A;  3BAB A;  1FXK A;  1G1X B;  5J2T A;  4I7Z B;  5LMN B;  3RYH A;  3RYF A;  1XNQ O;  1V9P A;  3EXA A;  1OCC B;  4O4L B;  4PA4 A;  2WLI B;  4K0K O;  2V1D A;  3E35 A;  2KKW A;  4C7U A;  1OJH A;  3VOU A;  5IJ9 B;  5E79 Z;  3LDE A;  5H2F Z;  3LSS A;  4DR2 B;  1VQ9 V;  4H37 A;  1VEW A;  1IDS A;  2HHH O;  3CCM V;  1QVF U;  1YJW V;  1JCH A;  1VAR A;  1TVK B;  1P7G A;  3ZED A;  5A2Q N;  1ZWI C;  3ASO B;  1PV0 A;  1U96 A;  2PY5 A;  3BEH A;  1YIT V;  4DV0 O;  5H5N A;  2IBZ H;  1FJG B;  3ZHV A;  5JJN B;  1N32 O;  3RN4 A;  4GKK B;  3F7Y C;  1NR1 A;  1IXM A;  2X6A A;  4HZ3 A;  5L3G A;  4WFG A;  4W4K A;  2Z5U A;  3IAY A;  5CBG A;  2PUS A;  4CH4 A;  4WFB V;  4GX2 A;  2DE0 X;  1GRJ A;  1AI5 A;  1NT2 B;  2RJZ A;  1FPO A; 
#chains in the Genus database with same CATH homology
 2DYR C;  1R6K A;  3K9A A;  2XAF A;  2JK5 C;  3E89 A;  4PA3 A;  5H6R A;  2JJ1 G;  3LDC A;  2EZP A;  4OXS A;  1HWY A;  3ZRS A;  2QTO A;  1VQ7 V;  1NQT A;  2A9H A;  3ZCC A;  4QE7 A;  1W0J G;  1QLN A;  3STL C;  1K5S A;  3WG7 B;  1AI7 A;  1F4M A;  1M57 B;  2F43 G;  1KQS U;  4R50 A;  2M7W A;  4UV9 A;  4J9Y B;  3JD1 A;  4RUF A;  2HR3 A;  2XAH A;  3LSQ A;  1P4R A;  3CME V;  4EKW A;  1VQ6 V;  3P30 A;  3ZN1 A;  2WLH A;  1H38 A;  1TUE B;  4UVB A;  1EFR G;  3OMI B;  1YJN V;  2WLL A;  2P6J A;  3ABU A;  3CC4 V;  1V55 B;  1R3J C;  3CC7 V;  4F4L A;  1YI2 V;  3AEI A;  4MTG A;  1DF4 A;  3MHH C;  2EIK C;  4XDJ A;  1K33 A;  1PL0 A;  1KEC A;  2CK3 G;  2WWW A;  2XOK G;  4WFF A;  2DQ0 A;  4GX1 A;  3LNM B;  3ZJZ A;  2OT5 A;  4XDK A;  1BMF G;  2Y69 B;  4HAM A;  3FYE B;  5IYD O;  4WCE V;  2YEV B;  5DN6 G;  1M1K W;  3RBZ A;  5LGU A;  3CCU V;  3T1C A;  2XAG A;  1K3E A;  5B3S C;  4WFE A;  1VQK V;  1DLB A;  3ML0 A;  4U7O A;  2A79 B;  4ZKI A;  1THZ A;  3W7W A;  1GK9 A;  1K34 A;  2EIM B;  1Y66 A;  1OCZ C;  1S77 D;  1VQL V;  4MW8 A;  1NVP B;  2Y48 A;  3ASO C;  3X2Q C;  2D3O W;  3OE7 G;  1RPO A;  2XAS A;  2EJR A;  3G4S V;  1M56 C;  1K97 A;  3G6E V;  1S0V A;  4PDV A;  3AG1 C;  3ABK B;  4UV8 A;  3CD6 V;  1NJI W;  2Q69 A;  3ZMU A;  4PEL A;  4JTD B;  5KUK A;  1YTF D;  4G2K A;  5L3E A;  1GTO A;  2R9I A;  1QR8 A;  1J95 A;  1ARO P;  3STZ C;  2EIM C;  5C93 A;  1OCO B;  3E2E A;  2DWE C;  3K79 A;  3ZMS A;  1QBZ A;  4UXN A;  3P32 A;  1GO3 F;  2UXN A;  5FL7 G;  1AR1 B;  1RM1 B;  2PI4 A;  5CBF A;  4PDL A;  3AG2 C;  2FTK A;  1GM8 A;  1M9N A;  1FFT B;  4GCZ A;  1L1F A;  1OCR C;  4KP4 A;  3OUS A;  5LGT A;  3ABK C;  2IU3 A;  1PD3 A;  2HVK C;  3ETD A;  2HVJ C;  3QO7 A;  2IJJ A;  1JX9 A;  2HJF C;  4G28 B;  5L3B A;  3E86 A;  3JD3 A;  3SYP A;  2DYR B;  2EIK B;  1E1R G;  3ABM B;  3AG2 B;  3W7S A;  3ABT A;  2ITC C;  2PI5 A;  1YSC A;  4MTX A;  3GB7 C;  3F7V C;  1PNL A;  1M90 W;  2HLD G;  3ETG A;  2EIN C;  4GX0 A;  3RVY A;  3W7X A;  2GSM B;  4QPJ A;  3H01 A;  1MOF A;  3K08 A;  2DYS C;  1YHQ V;  4LCU C;  1YJ9 V;  2X6B A;  2OCC B;  1W0K G;  3SYQ A;  1AJP A;  1Q86 W;  3OAA G;  2YSU B;  2WLN A;  2IH3 C;  2EIJ B;  3X2Q B;  3WG7 C;  4MS2 A;  2W6J G;  3LUT B;  4RQF A;  2P90 A;  1R73 A;  2IW5 A;  5CMU A;  2B1G A;  4MVS A;  4FPP A;  2WLK A;  4MVM A;  2JDI G;  1Q81 W;  1FXK B;  5LGN A;  2OCC C;  4P9P A;  1ROP A;  4N21 A;  1KD1 W;  3CC2 V;  1BHB A;  1E79 G;  2EIJ C;  1K5Q A;  4QNH B;  1FS0 G;  3GWO A;  1COW G;  4FIP C;  4JYC A;  2Q67 A;  2Q68 A;  2UXX A;  4Q20 A;  1R3I C;  1RM1 C;  3AG3 C;  4FK5 C;  1QVG U;  3SYA A;  2A0L A;  4XDL A;  3R65 A;  1NVP D;  3CCJ V;  3LDD A;  2P67 A;  5H9C A;  1K8A W;  1JJ2 U;  4YXW G;  5LBQ A;  2ZQM A;  5CA3 A;  1QR9 A;  2Z3Y A;  3B8N A;  5GW7 A;  3ABM C;  5H6Q A;  1PNK A;  1CEZ A;  2BOC C;  1GM7 A;  4ASU G;  3RW0 A;  3G71 V;  5EC1 C;  5LHG A;  4E2L A;  2XND G;  3CCV V;  2BOB C;  4X89 A;  1E1Q G;  4TT3 G;  3FB8 C;  4RUE A;  4GT1 A;  1AJN A;  1S76 D;  1NH2 B;  3ZRW B;  2EBO A;  1PNM A;  3ZRV A;  3K04 A;  2DQ3 A;  1P7B A;  4MW3 A;  4WFA V;  2ZD9 A;  3ZN0 A;  2NNU A;  4LC1 A;  3K03 A;  3CCR V;  3JD2 A;  3OMN B;  3UKM A;  2W0F C;  5KA6 A;  3HB3 B;  1VQ5 V;  1YTF B;  1SRY A;  3B77 A;  3EHB B;  3VBB A;  4QJF B;  3HPL C;  2JJ2 G;  2IJH A;  2DW4 A;  3T2M A;  4MVU A;  5B1A B;  3JYC A;  4UVA A;  5DM6 V;  1W2B U;  1XL4 A;  3IFX A;  2KB1 A;  2H8P C;  1QCE A;  1VQP V;  1OCO C;  5BZB A;  1OCZ B;  4FMT A;  1B6Q A;  1I5Y A;  1WPX A;  1VQ8 V;  3CCS V;  4QE9 A;  1AI6 A;  4JAU A;  3TET A;  3CYO A;  3ZRX A;  1DTO A;  4LP8 A;  3ZIA G;  1QLE C;  1KP2 A;  1H2G A;  3D3I A;  3SPC A;  3ZMZ A;  1SER A;  1G4Y B;  3OGC C;  3JD0 A;  4MTF A;  1F4N A;  5B1B B;  3QNE A;  2P7T C;  1MSW D;  2DWD C;  4HYO A;  1FXK C;  4XBF A;  5L3F A;  3ZRW A;  2LP7 A;  4TWK A;  3D36 A;  2YEV A;  2JEU A;  2WLM A;  4BIZ A;  2JIZ G;  3W7U A;  1OZ0 A;  3IC7 A;  3OUF A;  2AHZ A;  1K9M W;  2XAJ A;  1JVM A;  4RQE A;  4WF9 V;  4PDR A;  1VQO V;  1GMG A;  4G27 B;  2LFR A;  3ASN C;  2QEX V;  3K0D A;  1KKD A;  3E8G A;  1K4C C;  2W6I G;  3FB6 C;  1Q82 W;  3E83 A;  4U7N A;  3W7T A;  5EK0 A;  2ZDI C;  4R7C A;  3FKS G;  2C2A A;  2IJI A;  4RAI A;  3SJQ C;  1OHH G;  3B8M A;  1M57 C;  3PJS K;  4I5S A;  4L87 A;  2WLI A;  4P9O A;  2ZDI A;  2X0L A;  4JF3 A;  1CPY A;  1R6N A;  4JAS A;  4R8C A;  1NR7 A;  4X8A A;  1GKF A;  4JPR A;  1EBO A;  3OEE G;  2IU0 A;  1VQ4 V;  4JGS A;  1JQ0 A;  2WLJ A;  3ETE A;  1RPR A;  2XAQ A;  1K73 W;  3CPW U;  5E1A C;  4X88 A;  3QO8 A;  1XL6 A;  4P2Z A;  3FB5 C;  3JD4 A;  2EIL B;  1V54 C;  1OCR B;  3AG3 B;  4CZZ A;  2QM7 A;  5CBH A;  3IGA C;  3QO5 A;  1DF5 A;  2Y69 C;  4CBC A;  3ASN B;  4UVC A;  1FXH A;  2IJK A;  3K06 A;  4QPK A;  3FYI B;  4PA9 A;  3CMA V;  1S5H C;  2QA4 V;  2R9R B;  2LFS A;  3T4D A;  1ENV A;  1K7D A;  3K0G A;  4MVQ A;  1H8H G;  5IYB O;  3FB7 C;  4MT8 A;  1MAB G;  3DTU B;  1SZT A;  3ZMT A;  2B5U A;  2IH1 C;  2OTJ V;  4J9Z B;  1KC8 W;  4JTA B;  2QM8 A;  1NKD A;  4WFH A;  5IDJ A;  5B1O A;  3KG2 A;  3OMA B;  4KFM A;  3SPG A;  2WAM A;  1AI4 A;  2OTL V;  1ORQ C;  5EBM C;  2V7Q G;  2DYS B;  4KUM A;  5B1N A;  1FXV A;  3SPH A;  3K3W A;  4GX5 A;  4RO2 A;  1Y4M A;  3A0R A;  3OR7 C;  4JAV A;  3E8B A;  1OCC C;  3ABL B;  1R3K C;  1KP3 A;  1H8E G;  1CP9 A;  1WLE A;  2HKO A;  3AG1 B;  2NLJ C;  3DGE A;  2HFE C;  4FJC C;  3E8F A;  2X7R B;  1Q7Y W;  4JTC B;  3I55 V;  4MVZ A;  3I56 V;  1S3J A;  2B1I A;  3CCL V;  4UUJ C;  2ATK C;  1K92 A;  2K1E A;  2ZR2 A;  4JYB A;  2ZXW C;  1R3L C;  3SYC A;  3NXS A;  4I9W A;  5LHH A;  3ABL C;  1I5X A;  5B1B C;  3RVZ A;  5IY5 B;  1JPX A;  1G8M A;  4BAY A;  2EIN B;  4TSF G;  3UM7 A;  3MHS C;  3CXC U;  1QLE B;  3CP1 A;  1PKX A;  2ITD C;  3SPI A;  1F23 A;  3WFV A;  1UJW B;  5J9P C;  3OEH G;  1FXK A;  3F5W C;  2ZXW B;  4P30 A;  4DO2 A;  3ZMV A;  5L3D A;  4DXW A;  4PA6 A;  1OCC B;  2WSS G;  1JOY A;  4PA4 A;  3MD0 A;  1GM9 A;  1S72 V;  2HG5 C;  1NBM G;  5B3S B;  2AHY A;  5EBW C;  4Z1M G;  2WLI B;  4MTO A;  2V1D A;  3M99 B;  3E35 A;  3OR6 C;  4QIW F;  4MVR A;  3VOU A;  1BL8 A;  2MK3 A;  5KUM A;  1F51 A;  2WPD G;  3LDE A;  5LHI A;  3LSS A;  1SES A;  3TK1 A;  1YIJ V;  1VQ9 V;  4H37 A;  4ZBM A;  5KA5 A;  3SPJ A;  5IY5 C;  3CCM V;  4PA7 A;  1QVF U;  3T4Z A;  4N23 A;  1YJW V;  5EBL C;  1LNQ A;  2ZR3 A;  3CCQ V;  1JCH A;  1BHA A;  2EIL C;  1SET A;  1M56 B;  1ZWI C;  2X6C A;  3OFN G;  1MG1 A;  4PDM A;  3ASO B;  4MSW C;  5L3C A;  2QE7 G;  1N8R W;  3TCU A;  4MVO A;  1AJQ A;  1V55 C;  3BEH A;  5HFM A;  1YIT V;  1NH2 D;  5EC2 C;  2H94 A;  2Q6A A;  3F7Y C;  1NR1 A;  1IXM A;  2X6A A;  2GHY A;  4HZ3 A;  4BW5 A;  5IYC O;  5L3G A;  3EFF K;  3E8H A;  4H33 A;  4LBE C;  4WFG A;  1K4D C;  2EZO A;  1EZJ A;  2QKS A;  2Z5U A;  3AG4 B;  3AG4 C;  3JCZ A;  2WLL B;  1VQM V;  3BY6 A;  3OM3 B;  5CN0 A;  5HFL A;  3SYO A;  5B1A C;  3OW2 U;  2JEX A;  5CBG A;  4BIU A;  4WFB V;  4GX2 A;  1V54 B;  3CCE V;  1AI5 A;  1VQN V;  4R6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...