3SR2C

Crystal structure of human xlf-xrcc4 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
b'MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC4
publication title XRCC4 Protein Interactions with XRCC4-like Factor (XLF) Create an Extended Grooved Scaffold for DNA Ligation and Double Strand Break Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 47
structure length 218
sequence length 224
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sr2C02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3sr2C01
1KU9A 4XA4A 1IK9A 3RWRA 1M5IA 3SR2C 5CHXA 1FU1A 3II6A 5CJ4A 2R9AA 5CJ0A 3SR2A 3MUDA 2QM4A 3RWRD
chains in the Genus database with same CATH superfamily
4JV5O 1ROPA 4H44B 1K33A 4DRXA 1URFA 1XOUA 4HYOA 5EZYB 1YCIA 4FIPC 3HKEA 2GTSA 4DUYB 1NQTA 3WB2A 1HNZO 3N27A 2RNBA 1PNLA 1AJQA 4FK5C 4TUYB 1HP8A 4FLYA 3IFXA 4LF7B 2DMXA 4XA4A 1T5EA 3RW0A 4DV0B 4LWSB 3K08A 1VF7A 4DXWA 3HR0A 2E5LB 3RT3C 3G67A 3ZRVA 2P22C 1IDSA 4UVBA 1KECA 3ZHUA 4ZBMA 4Z1MG 2QM8A 2JK5C 4DK0A 4D7SA 1VQ5V 2ZE5A 4R7CA 1K9MW 5IY5C 1K73W 2ZDIA 3RYHB 3JALB 4F6RB 3T4ZA 4WBNA 1SQQH 3B77A 1GK9A 2IJJA 2IBZH 1ZSPA 4IGGA 4JAVA 4O4HA 3HKBA 1MA1A 2F23A 4NTWA 3HKEB 3ZMSA 1THZA 4PHZA 1S0VA 1SS3A 3E8GA 5BR8O 3R65A 3IAYA 3H01A 1RP3B 3CYOA 2YICA 4X1KA 5KX5A 4J9ZB 5CBFA 2RN9A 3H1LH 3FB7C 1V54C 2LGQA 4R8CA 4X8AA 1PD3A 3ABKC 1P7GA 4DR5B 1EN6A 4DW1A 4JGSA 2JGDA 5B3SC 3E2EA 3RFRA 3QO5A 4CS4A 4QPJA 3ZEDA 3JD4A 4H37A 4HNAB 2ZIMA 4DUYO 4IT5A 4BW9A 3HKBB 1SKVA 4GEXA 5L3BA 3JD1A 2EIKB 2ZXWB 3TGUH 4LF7O 2OCCC 1GKFA 1Q43A 1OCZC 3JATB 4PDMA 4UUJC 4DV0O 2JRIA 2ZT9B 3DC5A 4CZZA 2B1GA 2E5LO 3W7WA 1Y6XA 3A0HZ 1K8AW 4X1KB 3BABA 2W6JG 3I5DA 1XILA 4IIJA 1SQBH 3P3PA 3ZCCA 2BOCC 1SF9A 4Q20A 1VF6C 1FXVA 3QG5A 1FFXA 1ZL8A 2GUZA 1NTMH 1F23A 1N32B 4U7NA 3P30A 1XREA 2AHYA 2EIMC 2RDCA 1KBHA 2AZ2A 1JJ2U 3KKYA 1A32A 3ZHRA 4EFEA 4JYBA 1Q82W 1VQLV 4JTAB 1L0LH 4YY3B 1SQXH 2YXLA 3P3NA 1NVPD 2QSAA 2L35A 5LMNB 2NR5A 1S5LZ 1BSMA 2OIGA 2VS0A 3OR6C 4WFGA 3L75H 3UO2A 3L71H 2BTQA 2OT5A 4RWUA 2JJ1G 3JCUZ 3L72H 4IIJB 2P06A 3ZHQA 2CH7A 1AVMA 4EB6A 4DR5O 3ABTA 2F1MA 4PDVA 2Q7EA 1KP3A 1FFXB 4ZKIA 1ZL8B 3C3TA 3F5WC 3KG2A 4F6EA 2EULA 4JPRA 1XNRB 1TA8A 3ASOC 4A5UB 1L8DA 4X65B 3L70H 4G28B 1BHBA 1I08A 4IYHA 3TK1A 3M8AA 1VQ6V 3Q0XA 3HB3B 4JYCA 2V4DA 3O9OA 2YXYA 3B40A 1M90W 5IYZA 1JJOA 2P67A 4JI2B 4U3JA 1L0NH 3TETA 3CRAA 5B1AC 2HR3A 4PA6A 2RCVA 3VQYA 5GTHZ 2BTQB 5H9CA 3CRQA 4FZ0A 3ABLB 3SPGA 1OCOC 1BL8A 1AR1B 2CH7B 4EB6B 1WLEA 1N32O 1GRJA 4K3AA 3QNEA 1NH2B 4X89A 3EXAA 2Q68A 4BIUA 4DUZB 4DR2B 4YIOA 4R50A 3DGEA 1HWYA 3QO7A 4YY3O 1AI5A 1AI7A 3OMIB 3N2KB 4LH6A 1S77D 3CP1A 2IW5A 5LMNO 3CD6V 4BW5A 1OCCC 5IYZB 1QLNA 4MTGA 3F7VC 4QJFB 1ORQC 2Q4PA 2GBOA 4DV6B 4WFAV 1MSDA 3I55V 4DR6B 1I0HA 3ZHTA 3RWRA 1IBMB 2X6CA 2Z5UA 1WP7A 2QTSA 4D7TA 4PA9A 4O4JA 1IX9A 1DLBA 4DO2A 3SYPA 4LP8A 4NXMO 4LF4B 4MVQA 2RJZA 3CRRA 3APQA 1QBZA 3LDEA 1BMFG 2OYQA 1XNRO 4YHHB 5EC1C 1HNXB 1SC5B 5KA5A 4GUNA 3CMAV 4X65O 1Z5WA 2XASA 4B3RB 2UXBB 5EIBD 3ZMZA 3X2QC 1VQMV 3WG7C 1N36B 3WU2Z 4PI2A 4CS2A 1K4CC 1XBLA 1J5EB 2B1IA 2K1EA 4BIOA 4QPKA 3AK1A 4JI2O 3DTUB 2IJKA 1Y76A 1K5SA 2A3QA 2WLIB 1FXKC 4GT1A 3VBBA 3IC7A 4QGPA 2IU3A 1XUQA 1Z2GA 3O65A 4TV8B 3UM7A 1FJGB 5KMGA 1Q86W 3QVNA 4JYYA 4O4JB 5B1NA 4F4LA 1HW7A 4DUZO 4CS3A 4DR2O 2QWRB 1GAXA 5ITZB 5LGUA 2XAJA 3ETEA 4YJ2A 2KKWA 1ZX3A 2LW7A 2HKOA 1N33B 2B5UA 1VQ7V 4WFEA 2UU9B 2LGWA 1BZKA 3CMEV 5LL6Y 2XAQA 3CCQV 1LUWA 3OFNG 5LP6C 3UO3A 2Y0PA 3AG2C 2HLDG 2N05A 4RUEA 4UB8Z 2XT9A 5LOVA 2CGOA 4NTYA 2VWJA 1S5JA 1Y76B 5HFLA 4OPAA 5B66Z 4FVMA 1AB3A 4DR6O 2K9PA 4ZI7B 2XAFA 1IBMO 4JZ2A 3BY6A 2ZNJA 4I50A 3K03A 3UKMA 1GO3F 4BIZA 5KMGB 1K7DA 2PF4E 1KKCA 1Q6IA 1QLEC 2EZPA 4KUMA 1SQVH 4G79A 1VIBA 4X1YA 1AP5A 4YHHO 2R72A 1HNXO 2CK3G 4IYIA 3K06A 4K8ZA 5KHGA 4B3RO 2UXBO 3SR2C 4YJ2B 3G6EV 2KB1A 5FPRA 1DK1A 2Y48A 1N36O 1ZUQA 1J5EO 1K92A 1LR1A 2ZE6A 2YIAA 3LNMB 4RQFA 3KCXA 3OTFA 2QWPB 3HKCA 1AR4A 3JASA 3LUTB 2NLJC 1PNKA 2EBOA 3F7YC 5AG2A 2Q69A 1YSCA 1FJGO 3BA9A 3WB1A 3RVYA 3JCZA 4ASUG 1COWG 3SYQA 2L6LA 1CPYA 1QCEA 3CC4V 1QNMA 2BSKA 3AEIA 4X1YB 1UJWB 4L87A 4X66O 2FTKA 1N33O 2A7WA 4RUFA 1N8RW 1CEZA 2UU9O 1M57B 1O9GA 1XL6A 2EZOA 4J9YB 2ARHA 2A79B 4P9OA 1AJNA 2F66C 1GN4A 5KHHA 3D8CA 5D5PA 2ZQMA 3B4SA 1BGYH 2R70A 2JGUA 3AG3B 3SDLA 4FLVA 1BQZA 3HKCB 3CSXA 3WFVA 3ZIAG 3JASB 5L3EA 2CUGA 4D6TH 5KAIZ 4TWKA 1V55B 1QVGU 5EBWC 3ETQA 2AGAA 2M6YA 4AILC 1JMKC 4PJ0Z 2WA4A 2HP8A 4NXNO 2QM7A 2N04A 3Q4HA 1P84F 5CB4A 1AI6A 2ADPA 2ODMA 2DQ0A 3B8NA 2BSKB 4NTXA 3RBZA 2X6AA 1RSOA 4X1IA 1WB8A 3AG4C 3ZHVA 1F4MA 2XAGA 1XMOB 1R6TA 2WLMA 3VQXA 4X20A 1KYOF 1B3QA 4WFFA 3SR2A 1SZTA 2EILC 2QTOA 3D3IA 1WA8A 4LCUC 3TCUA 1QVFU 5C8YB 4NR1A 3ASNB 3LSSA 4BWAA 1OCRB 5B1BB 1RM1B 1XL4A 3OGIB 4UCTA 4MTXA 3HKDA 5JCOC 2CE4A 2UXDB 4MT8A 2PZSA 4N23A 3Q4HB 4AHCA 4LBEC 2LFSA 2QE7G 3K5MA 5CBGA 3FB8C 4I9WA 1BHAA 5CA0A 3H1IH 1RSOB 1YHQV 4X1IB 4E2LA 3OM3B 4P9PA 4DRXB 2WA3A 5GW7A 2R9IA 4WCEV 1CXZB 1JR9A 1VQOV 4J42A 4JI7O 4GLXA 3CCRV 1OJHA 2F93B 2WLHA 1WA8B 3EVKA 4DR4O 5K1PA 4DV3B 1HNWB 2GDSA 4JASA 5LA6A 2Y69C 1MG1A 2ATKC 2LFRA 2XNDG 4P2ZA 3ZN0A 4B08A 2QWQB 1GM9A 3A0BZ 1QQCA 1F7YA 2UUAB 3OGCC 3HKDB 1OHHG 5BXZA 5EK0A 1H2NA 1VQ4V 4FLUA 1X4TA 1K97A 3K9AA 5GTIZ 3JD0A 5CA1A 3LSQA 1FD9A 3OE7G 4I5SA 1FXHA 4WBNB 5CJ4A 4Q6GA 2YIBD 5CA0B 3ZJZA 2EINC 1XMOO 4O4HB 1HR0B 4XDKA 4WFHA 4OX9B 3K9SA 2Q6AA 4JF3A 2H3OA 1NBMG 1IXBA 3OMAB 1SQPH 5JJJB 2DYRB 3J7AU 4UVAA 5FL7G 4PDRA 3M99B 2KQXA 4WF9V 3RYCA 3TXQA 3OMNB 3BRCA 5LA6B 1SESA 5C93A 4PA7A 3ABMB 2YC0A 1R6KA 5KX5B 1Y74A 1XNQO 2JS5A 2UXDO 3IGAC 3M7MX 4XBFA 5LHHA 3SJAC 4J11A 1TAEA 3W7TA 4JTCB 2R9RB 3KCYA 5H5NA 3UT5A 2JGDB 2P4KA 2BOBC 4OGQB 1ENVA 1EZVH 2ZD9A 2JJ2G 1YJ9V 1I7FA 2PI4A 1JFFA 3E8HA 1GH6A 4FLZA 4GX2A 5FNVA 2DQ3A 1EZJA 1VQ9V 4DV3O 1HNWO 3OD4A 3R66A 4BR6A 2CTWA 4TV9A 4X9QA 1AJPA 1JX9A 5EYPA 1W59A 3RYCB 1NI8A 4ABMA 1SQGA 1NS1A 4I55A 1WJZA 4UCUA 3CCEV 3SJQC 4IL6Z 3SPJA 4HBNA 1KP2A 3ZMTA 2UUAO 2E3CA 5BZBA 2B9ZA 1Y74B 2FB5A 3K0DA 1IURA 1XQ8A 3D36C 1N4CA 3VOUA 1R3IC 1R1BA 1S5HC 2Q7GA 3CCSV 2IU0A 2GUZB 3A0RA 4LFBB 4NXMB 1DF4A 1S72V 2HHHO 4ZOLA 3UT5B 2OWOA 3ZBHA 5IY5B 3DSQA 1YVWA 4PI0A 2UXNA 5LMUB 2XOKG 1HR0O 1Y67A 3K5OA 4O4IA 3UQ8A 4OX9O 1IBKB 1JPXA 1JFFB 2QKCA 1US6A 3W7XA 5CMUA 3BHPA 4OPHA 4GX1A 4FJCC 2N74A 3HPLC 2QKAA 5EYPB 2VQFB 3L9DA 4I55B 4H33A 4UV8A 4RQEA 2AZ0A 3T4DA 1GM8A 1Q8IA 4FMTA 2WSSG 4W4LA 3ZN1A 4JI5B 2Q7HA 2QKSA 4J10A 1VF6A 2YI9A 3JSNA 2ETNA 4ZOLB 2MK3A 3ABKB 2QDOA 4JAAA 5B3SB 3CWBH 2BTOA 1V9PA 1YTFB 2ZE7A 1R3LC 2W6IG 1BT8A 2ITCC 2LP7A 1NU1H 2PGGA 4MVZA 3E35A 2OIEA 4MVSA 5J2TA 2AHZA 1Y4MA 4U3JB 2DOSA 4DV5B 2OCCB 5H2FZ 5J2UA 1OCZB 4DR1B 1NTZH 4EEQA 2ZNIA 5L3DA 3ZRWA 3JARA 1FS0G 4LFBO 2Q67A 4GX5A 4LC1A 1NKDA 1PPJH 3B2EE 4QE7A 3SPHA 5LMUO 3N2GA 2Y0IA 3IJ4A 4UCVA 2X7RB 1IBKO 1XI1A 2EIMB 4DV2O 3K57A 1SA0A 1D5AA 3SYCA 1RPRA 4X64B 3H1HH 3CPWU 1YJWV 3K3WA 3JAWA 1Q3EA 1JCHA 4U7OA 1MSWD 3W7SA 1M1KW 4UXNA 1M56C 5J2TB 1VQPV 2VQFO 1SQFA 2DJVA 2XAHA 4W4KA 3K04A 2Y3VA 5J2UB 2A0LA 2GSMB 3BFRA 3J80N 2HJDA 3CB2A 3RYFA 3AG1C 1ZWIC 3ZRWB 2ZR2A 4JI5O 3JARB 1N0NA 2E76B 3THOA 1NR1A 3JAKA 4LF5B 2DYSC 3GVMA 5B1OA 5E1AC 3CCVV 1W2BU 1JQ0A 4CH5A 3N2GB 3ZHSA 4X66B 3PN1A 1PL0A 1G4YB 1SA0B 2HG5C 5LHIA 4JYAB 1U96A 1YDXA 4CH4A 4JI1B 1ZAUA 1QR9A 2ITDC 4GEUA 3JAWB 3T1HB 2PUSA 4FM0A 1AR5A 1H2SB 3OEEG 4O2AA 5KUKA 4I9QA 4DV5O 3SPIA 2NNUA 4DR1O 4DK1A 3E86A 1JOYA 2UXCO 2ZKOA 2KG7A 2A06H 5B1AB 2YIBA 3RYFB 3U11A 4NXNB 1WB7A 1EFRG 3ZMUA 2YDEA 4DW0A 4OXSA 2XUMA 2LW1A 3ETDA 2WLJA 3OUFA 4MVUA 4CH6A 3SJCC 1OCOB 4AQYB 1TVKA 4GCZA 1Q6UA 3CCUV 4KL1A 1GTOA 1NZ6A 4GX0A 2XHBA 4MS2A 3CX5F 2DW4A 2F43G 1H2MA 3RYIA 1LNQA 4UVCA 1B06A 4X64O 2IJIA 1EBOA 4PELA 3I56V 4EKWA 3BEHA 5A9GA 5LOVB 2Z0AA 4LF9O 2DWEC 3LDCA 3U0ZA 4Z2WA 2ZE8A 4O2BA 1NH2D 3QO8A 4UCSA 2P90A 1OCCB 5IYDO 5TISZ 1FXKA 1N34B 5LBQA 3GWOA 4I50B 2KG7B 5E79Z 3K59A 4KP4A 4X88A 1QR8A 5JQGA 1XMQB 5IT9N 1W0KG 4LF5O 2X0LA 1Q81W 3RN4A 3FB5C 4I0XA 2YIDA 5L3FA 2PI5A 3H1JH 1TVKB 2JS3A 2Q5ZA 2ZDIC 3P32A 1GN6A 1E1QG 2YSUB 2E74B 2Q73A 1H38A 4CH3A 4TQFA 1H8HG 4JYAO 4JI1O 1AROP 5BMVA 4JI7B 4UCOA 1RPOA 3T1HO 3WG7B 2EIKC 4LFAB 4DR4B 2EIJB 1OV9A 1FU1A 2ZXWC 3EHBB 5LP6A 1P7BA 5DEDA 4O2BB 2F4VB 1FKAO 3UCSC 3FFQA 3SPCA 4G27B 4TUYA 2ADQB 5HFMA 1H2LA 1FXKB 5IJ0A 4JTDB 2LQTA 5K1XA 5JJEB 4P30A 2HVKC 4FM1A 2EJ7A 4TQDA 4GFAA 1XHXA 1M93A 1W0JG 4I0XB 4AQYO 4L8JA 1EN4A 1NVPB 3MUDA 1S3JA 4QNHB 2QGNA 4X62B 4B3TB 4TOIA 3RYHA 3RVZA 4LH7A 4NB5A 1D5NA 3FKSG 3S3WA 4B3MB 5BMVB 2WWWA 4XDLA 2D3OW 3G80A 4DV7B 3LNNA 1XDCA 3ZS8C 1PP9H 5LP6B 5LGNA 3AG2B 3GWKC 1FAFA 1N34O 3OUSA 3JAMN 3ML0A 4GKKB 4XDJA 1H2KA 1XNQB 2Q9LA 3ZRSA 3OR7C 5IJ0B 3K0GA 1XMQO 1AP6A 2X6BA 5EC2C 3CS5A 4U3FH 3BCCH 3CE2A 3FAVA 1TGOA 3K5LA 4CC5A 5CB4B 1M9NA 1I94B 3T2MA 3BPZA 3T1CA 5IJ9A 1GN2A 1QLEB 5CBHA 1UFIA 1CP9A 3G71V 1KMIZ 5LGTA 1DTOA 3MHSC 1LUVA 1Q6HA 2P4VA 4X20B 3MD0A 1KC8W 4DR3B 5EBLC 1Y66A 4LFAO 1YEWA 4HNAA 2CTPA 4TT3G 1H8EG 2F4VO 2MW2B 2QWOB 2NN4A 3MDSA 4HAMA 4E4EA 2WLLA 4MW8A 5KHIA 5DN6G 3RGBA 1MABG 3IC9A 4FFKA 3F5TA 3ABUA 4B7EA 2EJRA 1VQNV 1ZLZA 5B5EZ 4YJ3A 1VQ8V 3JATA 1X59A 1F51A 2P6JA 3FAVB 2LO1A 3L74H 1AILA 3ABLC 2M7WA 4IHJA 2Y3WA 1WNSA 1F4NA 2HHHB 4ICGA 5IJ9B 3JYCA 1E79G 4X62O 4B3TO 1K3EA 3DXRA 1M4UA 4WFBV 1JA8A 4B3MO 3APOA 2EX3A 4C7UA 5IE9A 4DV7O 1NR7A 2WPDG 2CTQA 5JH7A 4Z1VA 4MTOA 1AI4A 4DV1B 1PV0A 1PL4A 4TSFG 2YXHA 3MAQA 3K58A 2UUBB 2OTLV 2F95B 2JEXA 3AK3A 3WB0A 1O9HA 4FFBA 2WLLB 1SETA 3GB7C 4GKKO 1EN5A 2BE3A 4QIWF 5CJ0A 2O57A 1PM9A 2YUAA 4YJ3B 3CRCA 1YJNV 3TJTA 1I94O 1OZ0A 5CA1B 3STLC 2IH1C 5JCOA 1VF5B 3JD3A 4IHJB 3FB6C 3CC2V 2VRZA 1FYJA 3C90A 2Y4UA 1BE3H 2A9HA 2QWNB 2H94A 3DXRB 4J80A 2GTAA 5FLXN 2P7TC 3AG4B 4DR3O 2QR4A 2WLKA 3BVOA 3VQWA 2ZIOA 4JI6B 2YS8A 5JH7B 4FLWA 2EILB 5IWAB 1WPXA 2YEVA 2HJFC 3OW2U 1KD1W 3CC7V 4FFBB 2FYUH 4KFMA 1KKDA 4PV1B 1FPOA 3E89A 1SERA 3EFFK 1I5YA 3D3QA 1NJIW 3DC6A 5J9PC 1ZTEA 4GKJB 3T1YB 4DV2B 3BA8A 4LF6B 4N21A 1NTKH 3ETGA 5KHKA 5BY1A 1M5IA 5LXTA 3LDDA 5FNVB 3B09A 5KA6A 1WP8A 2DWDC 4KHPB 4DV1O 4O4LA 4J41A 3JD2A 4UB6Z 4TV9B 2UUBO 2E75B 4K0KB 3N2KA 4UV9A 3QF7A 2PY5A 4CKPA 1PKXA 2YEVB 4PDLA 3SJBC 1B6QA 1UPGA 2Y69B 4DR7B 1DGSA 4G2KA 4K35A 2LJ2A 1NT2B 3NXSA 1EM1A 2Q0AA 1YIJV 1V54B 4B3SB 2RMKB 1D2DA 5JJNB 1R6NA 3G6BA 2CAZC 4FLTA 3CXHF 5LYJA 4LFCB 5JVDA 4O4IB 1KB9F 1N0JA 2W0XA 4J7ZA 1H2GA 4JI0B 4NVPA 2EINB 1XEQA 1YITV 5L3CA 1MOFA 4JI6O 5LXTB 1DF5A 3BAAA 3G4SV 5IWAO 4O4LB 4LNUA 1VP7A 5GONA 2DE0X 3AK2A 4PD4F 5KAFZ 1P49A 2ZR3A 2KSDA 2P5OA 5IDJA 4UCRA 2H8PC 2JEUA 2IJHA 1IBLB 4DV4B 2UXCB 1U97A 4J7JA 5FPOA 1IK9A 2G38A 4JAUA 2WLIA 1Z5VA 4QE9A 3OEHG 3D36A 1L1FA 1S76D 1RFYA 2WLNA 3LSUA 2OTJV 1FFTB 1P4RA 3FYIB 1JVMA 3A8TA 1KQSU 4TV8A 3OT7A 3W7UA 2HFEC 4GKJO 2CTRA 3A2FA 1TUEB 2QJ1A 4MW3A 4RO2A 3T1YO 5LYJB 2JVDA 2GV9A 3SYAA 4CBCA 5JVDB 4I4TA 4MTFA 3J81N 4LF6O 1R3JC 1QHTA 5F2VO 5ITZA 1M57C 3ZMVA 4KHPO 1K5QA 4FPPA 1YZBA 4K0KO 3CRMA 4LF9B 5JWPA 1K34A 4FM2A 4LNUB 1KUQA 5GONB 1BQ0A 4MSWC 3AG3C 4JI8B 4YXWG 2EIJC 3OTOB 1K4DC 4DR7O 5H6QA 4LF8B 3U10A 5IYBO 1V55C 1TUBA 3ICXA 3PJSK 5LHGA 1GMGA 1R73A 1I5XA 1HDJA 4B3SO 4GFCA 1B04A 3CEIA 3K79A 4H0LB 5CN0A 3FX7A 4ZI7A 5DECA 1Q5OA 2WAMA 1GN3A 3B8MA 4LFCO 3FYEB 4LR3A 5H6RA 3PYIA 2Y4TA 2QEXV 4B7KA 3S3XA 1BCCH 4I4TB 4JI0O 1MNGA 2UUCB 4J7KA 4NKGB 3ASOB 4CKMA 2IH3C 2XTAA 4H13B 3STZC 2HEPA 3E83A 3SYOA 1BS3A 2ZM6B 3ZRXA 1IBLO 4DV4O 5CA3A 2D2CB 1J95A 4EFBA 4JI4B 3ASNC 1MZEA 1OCRC 1E1RG 4I7ZB 4DYLA 2FL4A 4NYKA 5B1BC 2C2AA 1RM1C 2BCCH 3CXCU 1TUBB 4HZ3A 2JDIG 1IVSA 2VWKA 4DV6O 3JAKB 3H9VA 2VQEB 2W0FC 1G1XB 4UFZA 1VEWA 1KU9A 3C3SA 4YIPA 2FMLA 2V7QG 2Q8VA 5L3GA 4KXRA 4JI3B 1WN7A 4CKNA 3K5NA 4LF4O 1Q90D 1YI2V 4PA4A 2AW9A 3CCLV 1WAZA 2UXXA 4FZ1A 3MHHC 3E22A 1SZXA 4ZIBA 3CJHA 4BAYA 1VMGA 4JV5B 4R6ZA 4K8XA 1YXBA 2Z3YA 4O2AB 3E8BA 1YF2A 4JI8O 4MVOA 1G6UA 3OTOO 1HNZB 5KUMA 3CCJV 1PNMA 1IZ3A 4LF8O 1SRYA 3CCMV 1R3KC 1G8MA 3Q0YA 1YTFD 4AI8A 4ZHQA 4GYCB 5IYCO 3QTCA 1MMMA 2IM9A 1MZFA 5D5QA 4MVMA 3VQVA 3FD9A 2R9AA 3OAAG 3NR7A 1VARA 3H1KH 2FKXA 5DM6V 3AG7A 2UUCO 2DN9A 4GZRB 3RYIB 2PYJA 2AXTZ 3KZIZ 1XHZA 2ILMA 3X2QB 1WPBA 3E22B 4CC6A 3CJHB 2CDYA 2HVJC 5EZYA 2ZM6O 4PA3A 5KHJA 2DYRC 3SGIA 5KLVH 3TXSA 4JI4O 1M56B 2CGNA 2JIZG 2V1DA 4FLXA 4JZGA 5A2QN 2PTMA 4MVRA 1Q7YW 2GHYA 5BR8B 3CHXA 3ABMC 1VQKV 2YI8A 5C8YA 5EBMC 5JQGB 1QU7A 4ZHQB 4LWSA 2ZINA 2VQEO 2RQ6A 3AG1B 5CHXA 3II6A 3ZX6A 5EIBC 1GM7A 2Q0OC 2DYSB 2ZCEA 4JI3O 2PYLA 2QM4A 3JSLA 3E8FA 3JALA 4RAIA 2QA4V 2OCHA 4F6RA 3L73H 1IXMA 3RWRD
chains in the Genus database with same CATH topology
1V9PA 4YJ3B 4ZI7B 4DRXA 2PGGA 2ZNJA 5CA1B 5EZYB 4I50A 3HKEA 5JCOA 5KMGB 4DUYB 3WB2A 4IHJB 4FLYA 4TUYB 5J2TA 4U3JB 4X1YA 4DV5B 2R72A 2BTOA 4LF7B 5J2UA 4K8ZA 4DR1B 5KHGA 4XA4A 1T5EA 4EEQA 3SR2C 2ZNIA 4YJ2B 4DV0B 5FPRA 1VF7A 3JARA 3VQWA 2ZIOA 2E5LB 4JI6B 2P22C 5JH7B 4FLWA 2YIAA 5IWAB 4DK0A 4D7SA 3OTFA 3B2EE 3RYHB 3HKCA 3N2GA 4UCVA 4FFBB 3JALB 3JASA 1XI1A 4F6RB 4WBNA 3K57A 1SA0A 1D5AA 3BA9A 4X64B 4O4HA 3WB1A 3HKBA 3HKEB 3JAWA 1Q3EA 4PHZA 5J2TB 1SQFA 4GKJB 4X1YB 3T1YB 4DV2B 3BA8A 4LF6B 3IAYA 5J2UB 5KHKA 1M5IA 3CB2A 3RYFA 5LXTA 5FNVB 1O9GA 4X1KA 4KHPB 5KX5A 3JARB 4O4LA 4TV9B 3THOA 4K0KB 3JAKA 4LF5B 2F66C 5KHHA 3N2KA 3QF7A 5D5PA 2PY5A 2R70A 2JGUA 3SJBC 4DR5B 4FLVA 4CH5A 3HKCB 3N2GB 3CSXA 4X66B 3RFRA 3JASB 3PN1A 4DR7B 1DGSA 4CS4A 1SA0B 3ZEDA 1NT2B 2Q0AA 4JYAB 3ETQA 4CH4A 4JI1B 4HNAB 1ZAUA 4AILC 1JMKC 2ZIMA 4BW9A 3HKBB 1SKVA 4B3SB 3JAWB 5JJNB 3T1HB 2PUSA 4FM0A 1H2SB 5CB4A 2CAZC 4FLTA 4O2AA 4I9QA 5LYJA 4LFCB 5JVDA 4O4IB 1Q43A 3JATB 1RSOA 4DK1A 4X1IA 4JI0B 4NVPA 1XMOB 3VQXA 2YIBA 3RYFB 3U11A 4NXNB 5LXTB 3BAAA 4X20A 4X1KB 3BABA 3SR2A 4IIJA 4O4LB 4LNUA 5GONA 4CH6A 3QG5A 1P49A 3SJCC 4AQYB 2P5OA 1TVKA 4UCRA 1FFXA 1IBLB 4DV4B 1N32B 4KL1A 5C8YB 4BWAA 2UXCB 2XHBA 1IK9A 5FPOA 4EFEA 3RYIA 1Z5VA 4UCTA 3HKDA 4YY3B 2YXLA 5JCOC 2UXDB 2PZSA 5LOVB 5LMNB 4AHCA 4TV8A 3U0ZA 4O2BA 3A2FA 2QJ1A 4UCSA 5LYJB 2JVDA 2GV9A 5JVDB 4I4TA 3K5MA 1QHTA 5CA0A 4X1IB 1N34B 4DRXB 5ITZA 4I50B 3K59A 5JQGA 2BTQA 1XMQB 4GLXA 4LF9B 2F93B 4FM2A 4IIJB 4LNUB 5GONB 4EB6A 4JI8B 2F1MA 1TVKB 5K1PA 4DV3B 1HNWB 2Q7EA 1FFXB 3OTOB 5LA6A 4LF8B 3U10A 4B08A 1TUBA 4TQFA 4CH3A 3ICXA 1XNRB 1TA8A 1QQCA 2UUAB 1L8DA 5BMVA 4JI7B 4X65B 3HKDB 4UCOA 1B04A 4FLUA 1X4TA 4ZI7A 1Q5OA 4LFAB 4DR4B 5CA1A 2V4DA 1FU1A 5LP6A 4LR3A 4O2BB 2F4VB 5IYZA 3FFQA 4TUYA 4WBNB 5CJ4A 4I4TB 4Q6GA 1JJOA 2UUCB 2YIBD 4JI2B 4U3JA 5CA0B 5IJ0A 4O4HB 1HR0B 5K1XA 5JJEB 4OX9B 2HEPA 4FM1A 3VQYA 2BTQB 4TQDA 1XHXA 1M93A 2ZM6B 5JJJB 4L8JA 3MUDA 4EB6B 4EFBA 3RYCA 4JI4B 4X62B 3BRCA 5LA6B 4B3TB 4TOIA 4DUZB 4DR2B 3RYHA 4LH7A 1TUBB 5KX5B 2JS5A 4B3MB 5BMVB 2VWKA 3JAKB 3N2KB 3M7MX 4LH6A 2VQEB 4DV7B 3SJAC 3LNNA 1TAEA 4UFZA 3ZS8C 1KU9A 3UT5A 5LP6B 5IYZB 4JI3B 1WN7A 3K5NA 4GKKB 1XNQB 1I7FA 5IJ0B 1JFFA 3E22A 4DV6B 4ZIBA 4DR6B 4JV5B 1TGOA 3K5LA 3RWRA 4CC5A 1IBMB 5CB4B 4FLZA 4K8XA 1I94B 4O2AB 5FNVA 3BPZA 5IJ9A 4D7TA 4O4JA 1G6UA 1HNZB 4TV9A 5EYPA 4LF4B 1KMIZ 3RYCB 2RJZA 1SQGA 4I55A 4UCUA 2OYQA 4HBNA 4YHHB 1HNXB 4X20B 2E3CA 4ZHQA 1Z5WA 4B3RB 4GYCB 2UXBB 5EIBD 1XQ8A 2IM9A 3QTCA 5D5QA 3VQVA 4DR3B 1N36B 2R9AA 2Q7GA 1YEWA 4PI2A 4CS2A 1J5EB 4HNAA 4LFBB 4NXMB 4ZOLA 3UT5B 2OWOA 3DSQA 4PI0A 5KHIA 3RGBA 3RYIB 5LMUB 2PYJA 3K5OA 1XHZA 4O4IA 3UQ8A 1IBKB 4YJ3A 1WPBA 3JATA 1JFFB 3E22B 4CC6A 5EZYA 3BHPA 4TV8B 1FJGB 5KMGA 5KHJA 4IHJA 3SGIA 1WNSA 2HHHB 5IJ9B 4O4JB 1HW7A 4FLXA 4CS3A 5EYPB 2PTMA 5ITZB 1M4UA 2VQFB 5BR8B 3CHXA 4I55B 2YI8A 5C8YA 2KKWA 5JQGB 4YJ2A 4ZHQB 2EX3A 2ZINA 1N33B 1Q8IA 2RQ6A 2UU9B 5JH7A 5CHXA 3II6A 4JI5B 5EIBC 2Q7HA 4DV1B 5LP6C 3MAQA 2ZCEA 3K58A 2UUBB 2YI9A 2F95B 2PYLA 3JSNA 4ZOLB 5LOVA 2VWJA 3WB0A 2QM4A 1O9HA 1S5JA 3JSLA 4FFBA 3JALA 4F6RA 5CJ0A 4FVMA 3RWRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU9 A;  4XA4 A;  1IK9 A;  3RWR A;  1M5I A;  3SR2 C;  5CHX A;  1FU1 A;  3II6 A;  5CJ4 A;  2R9A A;  5CJ0 A;  3SR2 A;  3MUD A;  2QM4 A;  3RWR D; 
#chains in the Genus database with same CATH topology
 4JV5 O;  1ROP A;  4H44 B;  1K33 A;  4DRX A;  1URF A;  1XOU A;  4HYO A;  5EZY B;  1YCI A;  4FIP C;  3HKE A;  2GTS A;  4DUY B;  1NQT A;  3WB2 A;  1HNZ O;  3N27 A;  2RNB A;  1PNL A;  1AJQ A;  4FK5 C;  4TUY B;  1HP8 A;  4FLY A;  3IFX A;  4LF7 B;  2DMX A;  4XA4 A;  1T5E A;  3RW0 A;  4DV0 B;  4LWS B;  3K08 A;  1VF7 A;  4DXW A;  3HR0 A;  2E5L B;  3RT3 C;  3G67 A;  3ZRV A;  2P22 C;  1IDS A;  4UVB A;  1KEC A;  3ZHU A;  4ZBM A;  4Z1M G;  2QM8 A;  2JK5 C;  4DK0 A;  4D7S A;  1VQ5 V;  2ZE5 A;  4R7C A;  1K9M W;  5IY5 C;  1K73 W;  2ZDI A;  3RYH B;  3JAL B;  4F6R B;  3T4Z A;  4WBN A;  1SQQ H;  3B77 A;  1GK9 A;  2IJJ A;  2IBZ H;  1ZSP A;  4IGG A;  4JAV A;  4O4H A;  3HKB A;  1MA1 A;  2F23 A;  4NTW A;  3HKE B;  3ZMS A;  1THZ A;  4PHZ A;  1S0V A;  1SS3 A;  3E8G A;  5BR8 O;  3R65 A;  3IAY A;  3H01 A;  1RP3 B;  3CYO A;  2YIC A;  4X1K A;  5KX5 A;  4J9Z B;  5CBF A;  2RN9 A;  3H1L H;  3FB7 C;  1V54 C;  2LGQ A;  4R8C A;  4X8A A;  1PD3 A;  3ABK C;  1P7G A;  4DR5 B;  1EN6 A;  4DW1 A;  4JGS A;  2JGD A;  5B3S C;  3E2E A;  3RFR A;  3QO5 A;  4CS4 A;  4QPJ A;  3ZED A;  3JD4 A;  4H37 A;  4HNA B;  2ZIM A;  4DUY O;  4IT5 A;  4BW9 A;  3HKB B;  1SKV A;  4GEX A;  5L3B A;  3JD1 A;  2EIK B;  2ZXW B;  3TGU H;  4LF7 O;  2OCC C;  1GKF A;  1Q43 A;  1OCZ C;  3JAT B;  4PDM A;  4UUJ C;  4DV0 O;  2JRI A;  2ZT9 B;  3DC5 A;  4CZZ A;  2B1G A;  2E5L O;  3W7W A;  1Y6X A;  3A0H Z;  1K8A W;  4X1K B;  3BAB A;  2W6J G;  3I5D A;  1XIL A;  4IIJ A;  1SQB H;  3P3P A;  3ZCC A;  2BOC C;  1SF9 A;  4Q20 A;  1VF6 C;  1FXV A;  3QG5 A;  1FFX A;  1ZL8 A;  2GUZ A;  1NTM H;  1F23 A;  1N32 B;  4U7N A;  3P30 A;  1XRE A;  2AHY A;  2EIM C;  2RDC A;  1KBH A;  2AZ2 A;  1JJ2 U;  3KKY A;  1A32 A;  3ZHR A;  4EFE A;  4JYB A;  1Q82 W;  1VQL V;  4JTA B;  1L0L H;  4YY3 B;  1SQX H;  2YXL A;  3P3N A;  1NVP D;  2QSA A;  2L35 A;  5LMN B;  2NR5 A;  1S5L Z;  1BSM A;  2OIG A;  2VS0 A;  3OR6 C;  4WFG A;  3L75 H;  3UO2 A;  3L71 H;  2BTQ A;  2OT5 A;  4RWU A;  2JJ1 G;  3JCU Z;  3L72 H;  4IIJ B;  2P06 A;  3ZHQ A;  2CH7 A;  1AVM A;  4EB6 A;  4DR5 O;  3ABT A;  2F1M A;  4PDV A;  2Q7E A;  1KP3 A;  1FFX B;  4ZKI A;  1ZL8 B;  3C3T A;  3F5W C;  3KG2 A;  4F6E A;  2EUL A;  4JPR A;  1XNR B;  1TA8 A;  3ASO C;  4A5U B;  1L8D A;  4X65 B;  3L70 H;  4G28 B;  1BHB A;  1I08 A;  4IYH A;  3TK1 A;  3M8A A;  1VQ6 V;  3Q0X A;  3HB3 B;  4JYC A;  2V4D A;  3O9O A;  2YXY A;  3B40 A;  1M90 W;  5IYZ A;  1JJO A;  2P67 A;  4JI2 B;  4U3J A;  1L0N H;  3TET A;  3CRA A;  5B1A C;  2HR3 A;  4PA6 A;  2RCV A;  3VQY A;  5GTH Z;  2BTQ B;  5H9C A;  3CRQ A;  4FZ0 A;  3ABL B;  3SPG A;  1OCO C;  1BL8 A;  1AR1 B;  2CH7 B;  4EB6 B;  1WLE A;  1N32 O;  1GRJ A;  4K3A A;  3QNE A;  1NH2 B;  4X89 A;  3EXA A;  2Q68 A;  4BIU A;  4DUZ B;  4DR2 B;  4YIO A;  4R50 A;  3DGE A;  1HWY A;  3QO7 A;  4YY3 O;  1AI5 A;  1AI7 A;  3OMI B;  3N2K B;  4LH6 A;  1S77 D;  3CP1 A;  2IW5 A;  5LMN O;  3CD6 V;  4BW5 A;  1OCC C;  5IYZ B;  1QLN A;  4MTG A;  3F7V C;  4QJF B;  1ORQ C;  2Q4P A;  2GBO A;  4DV6 B;  4WFA V;  1MSD A;  3I55 V;  4DR6 B;  1I0H A;  3ZHT A;  3RWR A;  1IBM B;  2X6C A;  2Z5U A;  1WP7 A;  2QTS A;  4D7T A;  4PA9 A;  4O4J A;  1IX9 A;  1DLB A;  4DO2 A;  3SYP A;  4LP8 A;  4NXM O;  4LF4 B;  4MVQ A;  2RJZ A;  3CRR A;  3APQ A;  1QBZ A;  3LDE A;  1BMF G;  2OYQ A;  1XNR O;  4YHH B;  5EC1 C;  1HNX B;  1SC5 B;  5KA5 A;  4GUN A;  3CMA V;  4X65 O;  1Z5W A;  2XAS A;  4B3R B;  2UXB B;  5EIB D;  3ZMZ A;  3X2Q C;  1VQM V;  3WG7 C;  1N36 B;  3WU2 Z;  4PI2 A;  4CS2 A;  1K4C C;  1XBL A;  1J5E B;  2B1I A;  2K1E A;  4BIO A;  4QPK A;  3AK1 A;  4JI2 O;  3DTU B;  2IJK A;  1Y76 A;  1K5S A;  2A3Q A;  2WLI B;  1FXK C;  4GT1 A;  3VBB A;  3IC7 A;  4QGP A;  2IU3 A;  1XUQ A;  1Z2G A;  3O65 A;  4TV8 B;  3UM7 A;  1FJG B;  5KMG A;  1Q86 W;  3QVN A;  4JYY A;  4O4J B;  5B1N A;  4F4L A;  1HW7 A;  4DUZ O;  4CS3 A;  4DR2 O;  2QWR B;  1GAX A;  5ITZ B;  5LGU A;  2XAJ A;  3ETE A;  4YJ2 A;  2KKW A;  1ZX3 A;  2LW7 A;  2HKO A;  1N33 B;  2B5U A;  1VQ7 V;  4WFE A;  2UU9 B;  2LGW A;  1BZK A;  3CME V;  5LL6 Y;  2XAQ A;  3CCQ V;  1LUW A;  3OFN G;  5LP6 C;  3UO3 A;  2Y0P A;  3AG2 C;  2HLD G;  2N05 A;  4RUE A;  4UB8 Z;  2XT9 A;  5LOV A;  2CGO A;  4NTY A;  2VWJ A;  1S5J A;  1Y76 B;  5HFL A;  4OPA A;  5B66 Z;  4FVM A;  1AB3 A;  4DR6 O;  2K9P A;  4ZI7 B;  2XAF A;  1IBM O;  4JZ2 A;  3BY6 A;  2ZNJ A;  4I50 A;  3K03 A;  3UKM A;  1GO3 F;  4BIZ A;  5KMG B;  1K7D A;  2PF4 E;  1KKC A;  1Q6I A;  1QLE C;  2EZP A;  4KUM A;  1SQV H;  4G79 A;  1VIB A;  4X1Y A;  1AP5 A;  4YHH O;  2R72 A;  1HNX O;  2CK3 G;  4IYI A;  3K06 A;  4K8Z A;  5KHG A;  4B3R O;  2UXB O;  3SR2 C;  4YJ2 B;  3G6E V;  2KB1 A;  5FPR A;  1DK1 A;  2Y48 A;  1N36 O;  1ZUQ A;  1J5E O;  1K92 A;  1LR1 A;  2ZE6 A;  2YIA A;  3LNM B;  4RQF A;  3KCX A;  3OTF A;  2QWP B;  3HKC A;  1AR4 A;  3JAS A;  3LUT B;  2NLJ C;  1PNK A;  2EBO A;  3F7Y C;  5AG2 A;  2Q69 A;  1YSC A;  1FJG O;  3BA9 A;  3WB1 A;  3RVY A;  3JCZ A;  4ASU G;  1COW G;  3SYQ A;  2L6L A;  1CPY A;  1QCE A;  3CC4 V;  1QNM A;  2BSK A;  3AEI A;  4X1Y B;  1UJW B;  4L87 A;  4X66 O;  2FTK A;  1N33 O;  2A7W A;  4RUF A;  1N8R W;  1CEZ A;  2UU9 O;  1M57 B;  1O9G A;  1XL6 A;  2EZO A;  4J9Y B;  2ARH A;  2A79 B;  4P9O A;  1AJN A;  2F66 C;  1GN4 A;  5KHH A;  3D8C A;  5D5P A;  2ZQM A;  3B4S A;  1BGY H;  2R70 A;  2JGU A;  3AG3 B;  3SDL A;  4FLV A;  1BQZ A;  3HKC B;  3CSX A;  3WFV A;  3ZIA G;  3JAS B;  5L3E A;  2CUG A;  4D6T H;  5KAI Z;  4TWK A;  1V55 B;  1QVG U;  5EBW C;  3ETQ A;  2AGA A;  2M6Y A;  4AIL C;  1JMK C;  4PJ0 Z;  2WA4 A;  2HP8 A;  4NXN O;  2QM7 A;  2N04 A;  3Q4H A;  1P84 F;  5CB4 A;  1AI6 A;  2ADP A;  2ODM A;  2DQ0 A;  3B8N A;  2BSK B;  4NTX A;  3RBZ A;  2X6A A;  1RSO A;  4X1I A;  1WB8 A;  3AG4 C;  3ZHV A;  1F4M A;  2XAG A;  1XMO B;  1R6T A;  2WLM A;  3VQX A;  4X20 A;  1KYO F;  1B3Q A;  4WFF A;  3SR2 A;  1SZT A;  2EIL C;  2QTO A;  3D3I A;  1WA8 A;  4LCU C;  3TCU A;  1QVF U;  5C8Y B;  4NR1 A;  3ASN B;  3LSS A;  4BWA A;  1OCR B;  5B1B B;  1RM1 B;  1XL4 A;  3OGI B;  4UCT A;  4MTX A;  3HKD A;  5JCO C;  2CE4 A;  2UXD B;  4MT8 A;  2PZS A;  4N23 A;  3Q4H B;  4AHC A;  4LBE C;  2LFS A;  2QE7 G;  3K5M A;  5CBG A;  3FB8 C;  4I9W A;  1BHA A;  5CA0 A;  3H1I H;  1RSO B;  1YHQ V;  4X1I B;  4E2L A;  3OM3 B;  4P9P A;  4DRX B;  2WA3 A;  5GW7 A;  2R9I A;  4WCE V;  1CXZ B;  1JR9 A;  1VQO V;  4J42 A;  4JI7 O;  4GLX A;  3CCR V;  1OJH A;  2F93 B;  2WLH A;  1WA8 B;  3EVK A;  4DR4 O;  5K1P A;  4DV3 B;  1HNW B;  2GDS A;  4JAS A;  5LA6 A;  2Y69 C;  1MG1 A;  2ATK C;  2LFR A;  2XND G;  4P2Z A;  3ZN0 A;  4B08 A;  2QWQ B;  1GM9 A;  3A0B Z;  1QQC A;  1F7Y A;  2UUA B;  3OGC C;  3HKD B;  1OHH G;  5BXZ A;  5EK0 A;  1H2N A;  1VQ4 V;  4FLU A;  1X4T A;  1K97 A;  3K9A A;  5GTI Z;  3JD0 A;  5CA1 A;  3LSQ A;  1FD9 A;  3OE7 G;  4I5S A;  1FXH A;  4WBN B;  5CJ4 A;  4Q6G A;  2YIB D;  5CA0 B;  3ZJZ A;  2EIN C;  1XMO O;  4O4H B;  1HR0 B;  4XDK A;  4WFH A;  4OX9 B;  3K9S A;  2Q6A A;  4JF3 A;  2H3O A;  1NBM G;  1IXB A;  3OMA B;  1SQP H;  5JJJ B;  2DYR B;  3J7A U;  4UVA A;  5FL7 G;  4PDR A;  3M99 B;  2KQX A;  4WF9 V;  3RYC A;  3TXQ A;  3OMN B;  3BRC A;  5LA6 B;  1SES A;  5C93 A;  4PA7 A;  3ABM B;  2YC0 A;  1R6K A;  5KX5 B;  1Y74 A;  1XNQ O;  2JS5 A;  2UXD O;  3IGA C;  3M7M X;  4XBF A;  5LHH A;  3SJA C;  4J11 A;  1TAE A;  3W7T A;  4JTC B;  2R9R B;  3KCY A;  5H5N A;  3UT5 A;  2JGD B;  2P4K A;  2BOB C;  4OGQ B;  1ENV A;  1EZV H;  2ZD9 A;  2JJ2 G;  1YJ9 V;  1I7F A;  2PI4 A;  1JFF A;  3E8H A;  1GH6 A;  4FLZ A;  4GX2 A;  5FNV A;  2DQ3 A;  1EZJ A;  1VQ9 V;  4DV3 O;  1HNW O;  3OD4 A;  3R66 A;  4BR6 A;  2CTW A;  4TV9 A;  4X9Q A;  1AJP A;  1JX9 A;  5EYP A;  1W59 A;  3RYC B;  1NI8 A;  4ABM A;  1SQG A;  1NS1 A;  4I55 A;  1WJZ A;  4UCU A;  3CCE V;  3SJQ C;  4IL6 Z;  3SPJ A;  4HBN A;  1KP2 A;  3ZMT A;  2UUA O;  2E3C A;  5BZB A;  2B9Z A;  1Y74 B;  2FB5 A;  3K0D A;  1IUR A;  1XQ8 A;  3D36 C;  1N4C A;  3VOU A;  1R3I C;  1R1B A;  1S5H C;  2Q7G A;  3CCS V;  2IU0 A;  2GUZ B;  3A0R A;  4LFB B;  4NXM B;  1DF4 A;  1S72 V;  2HHH O;  4ZOL A;  3UT5 B;  2OWO A;  3ZBH A;  5IY5 B;  3DSQ A;  1YVW A;  4PI0 A;  2UXN A;  5LMU B;  2XOK G;  1HR0 O;  1Y67 A;  3K5O A;  4O4I A;  3UQ8 A;  4OX9 O;  1IBK B;  1JPX A;  1JFF B;  2QKC A;  1US6 A;  3W7X A;  5CMU A;  3BHP A;  4OPH A;  4GX1 A;  4FJC C;  2N74 A;  3HPL C;  2QKA A;  5EYP B;  2VQF B;  3L9D A;  4I55 B;  4H33 A;  4UV8 A;  4RQE A;  2AZ0 A;  3T4D A;  1GM8 A;  1Q8I A;  4FMT A;  2WSS G;  4W4L A;  3ZN1 A;  4JI5 B;  2Q7H A;  2QKS A;  4J10 A;  1VF6 A;  2YI9 A;  3JSN A;  2ETN A;  4ZOL B;  2MK3 A;  3ABK B;  2QDO A;  4JAA A;  5B3S B;  3CWB H;  2BTO A;  1V9P A;  1YTF B;  2ZE7 A;  1R3L C;  2W6I G;  1BT8 A;  2ITC C;  2LP7 A;  1NU1 H;  2PGG A;  4MVZ A;  3E35 A;  2OIE A;  4MVS A;  5J2T A;  2AHZ A;  1Y4M A;  4U3J B;  2DOS A;  4DV5 B;  2OCC B;  5H2F Z;  5J2U A;  1OCZ B;  4DR1 B;  1NTZ H;  4EEQ A;  2ZNI A;  5L3D A;  3ZRW A;  3JAR A;  1FS0 G;  4LFB O;  2Q67 A;  4GX5 A;  4LC1 A;  1NKD A;  1PPJ H;  3B2E E;  4QE7 A;  3SPH A;  5LMU O;  3N2G A;  2Y0I A;  3IJ4 A;  4UCV A;  2X7R B;  1IBK O;  1XI1 A;  2EIM B;  4DV2 O;  3K57 A;  1SA0 A;  1D5A A;  3SYC A;  1RPR A;  4X64 B;  3H1H H;  3CPW U;  1YJW V;  3K3W A;  3JAW A;  1Q3E A;  1JCH A;  4U7O A;  1MSW D;  3W7S A;  1M1K W;  4UXN A;  1M56 C;  5J2T B;  1VQP V;  2VQF O;  1SQF A;  2DJV A;  2XAH A;  4W4K A;  3K04 A;  2Y3V A;  5J2U B;  2A0L A;  2GSM B;  3BFR A;  3J80 N;  2HJD A;  3CB2 A;  3RYF A;  3AG1 C;  1ZWI C;  3ZRW B;  2ZR2 A;  4JI5 O;  3JAR B;  1N0N A;  2E76 B;  3THO A;  1NR1 A;  3JAK A;  4LF5 B;  2DYS C;  3GVM A;  5B1O A;  5E1A C;  3CCV V;  1W2B U;  1JQ0 A;  4CH5 A;  3N2G B;  3ZHS A;  4X66 B;  3PN1 A;  1PL0 A;  1G4Y B;  1SA0 B;  2HG5 C;  5LHI A;  4JYA B;  1U96 A;  1YDX A;  4CH4 A;  4JI1 B;  1ZAU A;  1QR9 A;  2ITD C;  4GEU A;  3JAW B;  3T1H B;  2PUS A;  4FM0 A;  1AR5 A;  1H2S B;  3OEE G;  4O2A A;  5KUK A;  4I9Q A;  4DV5 O;  3SPI A;  2NNU A;  4DR1 O;  4DK1 A;  3E86 A;  1JOY A;  2UXC O;  2ZKO A;  2KG7 A;  2A06 H;  5B1A B;  2YIB A;  3RYF B;  3U11 A;  4NXN B;  1WB7 A;  1EFR G;  3ZMU A;  2YDE A;  4DW0 A;  4OXS A;  2XUM A;  2LW1 A;  3ETD A;  2WLJ A;  3OUF A;  4MVU A;  4CH6 A;  3SJC C;  1OCO B;  4AQY B;  1TVK A;  4GCZ A;  1Q6U A;  3CCU V;  4KL1 A;  1GTO A;  1NZ6 A;  4GX0 A;  2XHB A;  4MS2 A;  3CX5 F;  2DW4 A;  2F43 G;  1H2M A;  3RYI A;  1LNQ A;  4UVC A;  1B06 A;  4X64 O;  2IJI A;  1EBO A;  4PEL A;  3I56 V;  4EKW A;  3BEH A;  5A9G A;  5LOV B;  2Z0A A;  4LF9 O;  2DWE C;  3LDC A;  3U0Z A;  4Z2W A;  2ZE8 A;  4O2B A;  1NH2 D;  3QO8 A;  4UCS A;  2P90 A;  1OCC B;  5IYD O;  5TIS Z;  1FXK A;  1N34 B;  5LBQ A;  3GWO A;  4I50 B;  2KG7 B;  5E79 Z;  3K59 A;  4KP4 A;  4X88 A;  1QR8 A;  5JQG A;  1XMQ B;  5IT9 N;  1W0K G;  4LF5 O;  2X0L A;  1Q81 W;  3RN4 A;  3FB5 C;  4I0X A;  2YID A;  5L3F A;  2PI5 A;  3H1J H;  1TVK B;  2JS3 A;  2Q5Z A;  2ZDI C;  3P32 A;  1GN6 A;  1E1Q G;  2YSU B;  2E74 B;  2Q73 A;  1H38 A;  4CH3 A;  4TQF A;  1H8H G;  4JYA O;  4JI1 O;  1ARO P;  5BMV A;  4JI7 B;  4UCO A;  1RPO A;  3T1H O;  3WG7 B;  2EIK C;  4LFA B;  4DR4 B;  2EIJ B;  1OV9 A;  1FU1 A;  2ZXW C;  3EHB B;  5LP6 A;  1P7B A;  5DED A;  4O2B B;  2F4V B;  1FKA O;  3UCS C;  3FFQ A;  3SPC A;  4G27 B;  4TUY A;  2ADQ B;  5HFM A;  1H2L A;  1FXK B;  5IJ0 A;  4JTD B;  2LQT A;  5K1X A;  5JJE B;  4P30 A;  2HVK C;  4FM1 A;  2EJ7 A;  4TQD A;  4GFA A;  1XHX A;  1M93 A;  1W0J G;  4I0X B;  4AQY O;  4L8J A;  1EN4 A;  1NVP B;  3MUD A;  1S3J A;  4QNH B;  2QGN A;  4X62 B;  4B3T B;  4TOI A;  3RYH A;  3RVZ A;  4LH7 A;  4NB5 A;  1D5N A;  3FKS G;  3S3W A;  4B3M B;  5BMV B;  2WWW A;  4XDL A;  2D3O W;  3G80 A;  4DV7 B;  3LNN A;  1XDC A;  3ZS8 C;  1PP9 H;  5LP6 B;  5LGN A;  3AG2 B;  3GWK C;  1FAF A;  1N34 O;  3OUS A;  3JAM N;  3ML0 A;  4GKK B;  4XDJ A;  1H2K A;  1XNQ B;  2Q9L A;  3ZRS A;  3OR7 C;  5IJ0 B;  3K0G A;  1XMQ O;  1AP6 A;  2X6B A;  5EC2 C;  3CS5 A;  4U3F H;  3BCC H;  3CE2 A;  3FAV A;  1TGO A;  3K5L A;  4CC5 A;  5CB4 B;  1M9N A;  1I94 B;  3T2M A;  3BPZ A;  3T1C A;  5IJ9 A;  1GN2 A;  1QLE B;  5CBH A;  1UFI A;  1CP9 A;  3G71 V;  1KMI Z;  5LGT A;  1DTO A;  3MHS C;  1LUV A;  1Q6H A;  2P4V A;  4X20 B;  3MD0 A;  1KC8 W;  4DR3 B;  5EBL C;  1Y66 A;  4LFA O;  1YEW A;  4HNA A;  2CTP A;  4TT3 G;  1H8E G;  2F4V O;  2MW2 B;  2QWO B;  2NN4 A;  3MDS A;  4HAM A;  4E4E A;  2WLL A;  4MW8 A;  5KHI A;  5DN6 G;  3RGB A;  1MAB G;  3IC9 A;  4FFK A;  3F5T A;  3ABU A;  4B7E A;  2EJR A;  1VQN V;  1ZLZ A;  5B5E Z;  4YJ3 A;  1VQ8 V;  3JAT A;  1X59 A;  1F51 A;  2P6J A;  3FAV B;  2LO1 A;  3L74 H;  1AIL A;  3ABL C;  2M7W A;  4IHJ A;  2Y3W A;  1WNS A;  1F4N A;  2HHH B;  4ICG A;  5IJ9 B;  3JYC A;  1E79 G;  4X62 O;  4B3T O;  1K3E A;  3DXR A;  1M4U A;  4WFB V;  1JA8 A;  4B3M O;  3APO A;  2EX3 A;  4C7U A;  5IE9 A;  4DV7 O;  1NR7 A;  2WPD G;  2CTQ A;  5JH7 A;  4Z1V A;  4MTO A;  1AI4 A;  4DV1 B;  1PV0 A;  1PL4 A;  4TSF G;  2YXH A;  3MAQ A;  3K58 A;  2UUB B;  2OTL V;  2F95 B;  2JEX A;  3AK3 A;  3WB0 A;  1O9H A;  4FFB A;  2WLL B;  1SET A;  3GB7 C;  4GKK O;  1EN5 A;  2BE3 A;  4QIW F;  5CJ0 A;  2O57 A;  1PM9 A;  2YUA A;  4YJ3 B;  3CRC A;  1YJN V;  3TJT A;  1I94 O;  1OZ0 A;  5CA1 B;  3STL C;  2IH1 C;  5JCO A;  1VF5 B;  3JD3 A;  4IHJ B;  3FB6 C;  3CC2 V;  2VRZ A;  1FYJ A;  3C90 A;  2Y4U A;  1BE3 H;  2A9H A;  2QWN B;  2H94 A;  3DXR B;  4J80 A;  2GTA A;  5FLX N;  2P7T C;  3AG4 B;  4DR3 O;  2QR4 A;  2WLK A;  3BVO A;  3VQW A;  2ZIO A;  4JI6 B;  2YS8 A;  5JH7 B;  4FLW A;  2EIL B;  5IWA B;  1WPX A;  2YEV A;  2HJF C;  3OW2 U;  1KD1 W;  3CC7 V;  4FFB B;  2FYU H;  4KFM A;  1KKD A;  4PV1 B;  1FPO A;  3E89 A;  1SER A;  3EFF K;  1I5Y A;  3D3Q A;  1NJI W;  3DC6 A;  5J9P C;  1ZTE A;  4GKJ B;  3T1Y B;  4DV2 B;  3BA8 A;  4LF6 B;  4N21 A;  1NTK H;  3ETG A;  5KHK A;  5BY1 A;  1M5I A;  5LXT A;  3LDD A;  5FNV B;  3B09 A;  5KA6 A;  1WP8 A;  2DWD C;  4KHP B;  4DV1 O;  4O4L A;  4J41 A;  3JD2 A;  4UB6 Z;  4TV9 B;  2UUB O;  2E75 B;  4K0K B;  3N2K A;  4UV9 A;  3QF7 A;  2PY5 A;  4CKP A;  1PKX A;  2YEV B;  4PDL A;  3SJB C;  1B6Q A;  1UPG A;  2Y69 B;  4DR7 B;  1DGS A;  4G2K A;  4K35 A;  2LJ2 A;  1NT2 B;  3NXS A;  1EM1 A;  2Q0A A;  1YIJ V;  1V54 B;  4B3S B;  2RMK B;  1D2D A;  5JJN B;  1R6N A;  3G6B A;  2CAZ C;  4FLT A;  3CXH F;  5LYJ A;  4LFC B;  5JVD A;  4O4I B;  1KB9 F;  1N0J A;  2W0X A;  4J7Z A;  1H2G A;  4JI0 B;  4NVP A;  2EIN B;  1XEQ A;  1YIT V;  5L3C A;  1MOF A;  4JI6 O;  5LXT B;  1DF5 A;  3BAA A;  3G4S V;  5IWA O;  4O4L B;  4LNU A;  1VP7 A;  5GON A;  2DE0 X;  3AK2 A;  4PD4 F;  5KAF Z;  1P49 A;  2ZR3 A;  2KSD A;  2P5O A;  5IDJ A;  4UCR A;  2H8P C;  2JEU A;  2IJH A;  1IBL B;  4DV4 B;  2UXC B;  1U97 A;  4J7J A;  5FPO A;  1IK9 A;  2G38 A;  4JAU A;  2WLI A;  1Z5V A;  4QE9 A;  3OEH G;  3D36 A;  1L1F A;  1S76 D;  1RFY A;  2WLN A;  3LSU A;  2OTJ V;  1FFT B;  1P4R A;  3FYI B;  1JVM A;  3A8T A;  1KQS U;  4TV8 A;  3OT7 A;  3W7U A;  2HFE C;  4GKJ O;  2CTR A;  3A2F A;  1TUE B;  2QJ1 A;  4MW3 A;  4RO2 A;  3T1Y O;  5LYJ B;  2JVD A;  2GV9 A;  3SYA A;  4CBC A;  5JVD B;  4I4T A;  4MTF A;  3J81 N;  4LF6 O;  1R3J C;  1QHT A;  5F2V O;  5ITZ A;  1M57 C;  3ZMV A;  4KHP O;  1K5Q A;  4FPP A;  1YZB A;  4K0K O;  3CRM A;  4LF9 B;  5JWP A;  1K34 A;  4FM2 A;  4LNU B;  1KUQ A;  5GON B;  1BQ0 A;  4MSW C;  3AG3 C;  4JI8 B;  4YXW G;  2EIJ C;  3OTO B;  1K4D C;  4DR7 O;  5H6Q A;  4LF8 B;  3U10 A;  5IYB O;  1V55 C;  1TUB A;  3ICX A;  3PJS K;  5LHG A;  1GMG A;  1R73 A;  1I5X A;  1HDJ A;  4B3S O;  4GFC A;  1B04 A;  3CEI A;  3K79 A;  4H0L B;  5CN0 A;  3FX7 A;  4ZI7 A;  5DEC A;  1Q5O A;  2WAM A;  1GN3 A;  3B8M A;  4LFC O;  3FYE B;  4LR3 A;  5H6R A;  3PYI A;  2Y4T A;  2QEX V;  4B7K A;  3S3X A;  1BCC H;  4I4T B;  4JI0 O;  1MNG A;  2UUC B;  4J7K A;  4NKG B;  3ASO B;  4CKM A;  2IH3 C;  2XTA A;  4H13 B;  3STZ C;  2HEP A;  3E83 A;  3SYO A;  1BS3 A;  2ZM6 B;  3ZRX A;  1IBL O;  4DV4 O;  5CA3 A;  2D2C B;  1J95 A;  4EFB A;  4JI4 B;  3ASN C;  1MZE A;  1OCR C;  1E1R G;  4I7Z B;  4DYL A;  2FL4 A;  4NYK A;  5B1B C;  2C2A A;  1RM1 C;  2BCC H;  3CXC U;  1TUB B;  4HZ3 A;  2JDI G;  1IVS A;  2VWK A;  4DV6 O;  3JAK B;  3H9V A;  2VQE B;  2W0F C;  1G1X B;  4UFZ A;  1VEW A;  1KU9 A;  3C3S A;  4YIP A;  2FML A;  2V7Q G;  2Q8V A;  5L3G A;  4KXR A;  4JI3 B;  1WN7 A;  4CKN A;  3K5N A;  4LF4 O;  1Q90 D;  1YI2 V;  4PA4 A;  2AW9 A;  3CCL V;  1WAZ A;  2UXX A;  4FZ1 A;  3MHH C;  3E22 A;  1SZX A;  4ZIB A;  3CJH A;  4BAY A;  1VMG A;  4JV5 B;  4R6Z A;  4K8X A;  1YXB A;  2Z3Y A;  4O2A B;  3E8B A;  1YF2 A;  4JI8 O;  4MVO A;  1G6U A;  3OTO O;  1HNZ B;  5KUM A;  3CCJ V;  1PNM A;  1IZ3 A;  4LF8 O;  1SRY A;  3CCM V;  1R3K C;  1G8M A;  3Q0Y A;  1YTF D;  4AI8 A;  4ZHQ A;  4GYC B;  5IYC O;  3QTC A;  1MMM A;  2IM9 A;  1MZF A;  5D5Q A;  4MVM A;  3VQV A;  3FD9 A;  2R9A A;  3OAA G;  3NR7 A;  1VAR A;  3H1K H;  2FKX A;  5DM6 V;  3AG7 A;  2UUC O;  2DN9 A;  4GZR B;  3RYI B;  2PYJ A;  2AXT Z;  3KZI Z;  1XHZ A;  2ILM A;  3X2Q B;  1WPB A;  3E22 B;  4CC6 A;  3CJH B;  2CDY A;  2HVJ C;  5EZY A;  2ZM6 O;  4PA3 A;  5KHJ A;  2DYR C;  3SGI A;  5KLV H;  3TXS A;  4JI4 O;  1M56 B;  2CGN A;  2JIZ G;  2V1D A;  4FLX A;  4JZG A;  5A2Q N;  2PTM A;  4MVR A;  1Q7Y W;  2GHY A;  5BR8 B;  3CHX A;  3ABM C;  1VQK V;  2YI8 A;  5C8Y A;  5EBM C;  5JQG B;  1QU7 A;  4ZHQ B;  4LWS A;  2ZIN A;  2VQE O;  2RQ6 A;  3AG1 B;  5CHX A;  3II6 A;  3ZX6 A;  5EIB C;  1GM7 A;  2Q0O C;  2DYS B;  2ZCE A;  4JI3 O;  2PYL A;  2QM4 A;  3JSL A;  3E8F A;  3JAL A;  4RAI A;  2QA4 V;  2OCH A;  4F6R A;  3L73 H;  1IXM A;  3RWR D; 
#chains in the Genus database with same CATH homology
 1V9P A;  4YJ3 B;  4ZI7 B;  4DRX A;  2PGG A;  2ZNJ A;  5CA1 B;  5EZY B;  4I50 A;  3HKE A;  5JCO A;  5KMG B;  4DUY B;  3WB2 A;  4IHJ B;  4FLY A;  4TUY B;  5J2T A;  4U3J B;  4X1Y A;  4DV5 B;  2R72 A;  2BTO A;  4LF7 B;  5J2U A;  4K8Z A;  4DR1 B;  5KHG A;  4XA4 A;  1T5E A;  4EEQ A;  3SR2 C;  2ZNI A;  4YJ2 B;  4DV0 B;  5FPR A;  1VF7 A;  3JAR A;  3VQW A;  2ZIO A;  2E5L B;  4JI6 B;  2P22 C;  5JH7 B;  4FLW A;  2YIA A;  5IWA B;  4DK0 A;  4D7S A;  3OTF A;  3B2E E;  3RYH B;  3HKC A;  3N2G A;  4UCV A;  4FFB B;  3JAL B;  3JAS A;  1XI1 A;  4F6R B;  4WBN A;  3K57 A;  1SA0 A;  1D5A A;  3BA9 A;  4X64 B;  4O4H A;  3WB1 A;  3HKB A;  3HKE B;  3JAW A;  1Q3E A;  4PHZ A;  5J2T B;  1SQF A;  4GKJ B;  4X1Y B;  3T1Y B;  4DV2 B;  3BA8 A;  4LF6 B;  3IAY A;  5J2U B;  5KHK A;  1M5I A;  3CB2 A;  3RYF A;  5LXT A;  5FNV B;  1O9G A;  4X1K A;  4KHP B;  5KX5 A;  3JAR B;  4O4L A;  4TV9 B;  3THO A;  4K0K B;  3JAK A;  4LF5 B;  2F66 C;  5KHH A;  3N2K A;  3QF7 A;  5D5P A;  2PY5 A;  2R70 A;  2JGU A;  3SJB C;  4DR5 B;  4FLV A;  4CH5 A;  3HKC B;  3N2G B;  3CSX A;  4X66 B;  3RFR A;  3JAS B;  3PN1 A;  4DR7 B;  1DGS A;  4CS4 A;  1SA0 B;  3ZED A;  1NT2 B;  2Q0A A;  4JYA B;  3ETQ A;  4CH4 A;  4JI1 B;  4HNA B;  1ZAU A;  4AIL C;  1JMK C;  2ZIM A;  4BW9 A;  3HKB B;  1SKV A;  4B3S B;  3JAW B;  5JJN B;  3T1H B;  2PUS A;  4FM0 A;  1H2S B;  5CB4 A;  2CAZ C;  4FLT A;  4O2A A;  4I9Q A;  5LYJ A;  4LFC B;  5JVD A;  4O4I B;  1Q43 A;  3JAT B;  1RSO A;  4DK1 A;  4X1I A;  4JI0 B;  4NVP A;  1XMO B;  3VQX A;  2YIB A;  3RYF B;  3U11 A;  4NXN B;  5LXT B;  3BAA A;  4X20 A;  4X1K B;  3BAB A;  3SR2 A;  4IIJ A;  4O4L B;  4LNU A;  5GON A;  4CH6 A;  3QG5 A;  1P49 A;  3SJC C;  4AQY B;  2P5O A;  1TVK A;  4UCR A;  1FFX A;  1IBL B;  4DV4 B;  1N32 B;  4KL1 A;  5C8Y B;  4BWA A;  2UXC B;  2XHB A;  1IK9 A;  5FPO A;  4EFE A;  3RYI A;  1Z5V A;  4UCT A;  3HKD A;  4YY3 B;  2YXL A;  5JCO C;  2UXD B;  2PZS A;  5LOV B;  5LMN B;  4AHC A;  4TV8 A;  3U0Z A;  4O2B A;  3A2F A;  2QJ1 A;  4UCS A;  5LYJ B;  2JVD A;  2GV9 A;  5JVD B;  4I4T A;  3K5M A;  1QHT A;  5CA0 A;  4X1I B;  1N34 B;  4DRX B;  5ITZ A;  4I50 B;  3K59 A;  5JQG A;  2BTQ A;  1XMQ B;  4GLX A;  4LF9 B;  2F93 B;  4FM2 A;  4IIJ B;  4LNU B;  5GON B;  4EB6 A;  4JI8 B;  2F1M A;  1TVK B;  5K1P A;  4DV3 B;  1HNW B;  2Q7E A;  1FFX B;  3OTO B;  5LA6 A;  4LF8 B;  3U10 A;  4B08 A;  1TUB A;  4TQF A;  4CH3 A;  3ICX A;  1XNR B;  1TA8 A;  1QQC A;  2UUA B;  1L8D A;  5BMV A;  4JI7 B;  4X65 B;  3HKD B;  4UCO A;  1B04 A;  4FLU A;  1X4T A;  4ZI7 A;  1Q5O A;  4LFA B;  4DR4 B;  5CA1 A;  2V4D A;  1FU1 A;  5LP6 A;  4LR3 A;  4O2B B;  2F4V B;  5IYZ A;  3FFQ A;  4TUY A;  4WBN B;  5CJ4 A;  4I4T B;  4Q6G A;  1JJO A;  2UUC B;  2YIB D;  4JI2 B;  4U3J A;  5CA0 B;  5IJ0 A;  4O4H B;  1HR0 B;  5K1X A;  5JJE B;  4OX9 B;  2HEP A;  4FM1 A;  3VQY A;  2BTQ B;  4TQD A;  1XHX A;  1M93 A;  2ZM6 B;  5JJJ B;  4L8J A;  3MUD A;  4EB6 B;  4EFB A;  3RYC A;  4JI4 B;  4X62 B;  3BRC A;  5LA6 B;  4B3T B;  4TOI A;  4DUZ B;  4DR2 B;  3RYH A;  4LH7 A;  1TUB B;  5KX5 B;  2JS5 A;  4B3M B;  5BMV B;  2VWK A;  3JAK B;  3N2K B;  3M7M X;  4LH6 A;  2VQE B;  4DV7 B;  3SJA C;  3LNN A;  1TAE A;  4UFZ A;  3ZS8 C;  1KU9 A;  3UT5 A;  5LP6 B;  5IYZ B;  4JI3 B;  1WN7 A;  3K5N A;  4GKK B;  1XNQ B;  1I7F A;  5IJ0 B;  1JFF A;  3E22 A;  4DV6 B;  4ZIB A;  4DR6 B;  4JV5 B;  1TGO A;  3K5L A;  3RWR A;  4CC5 A;  1IBM B;  5CB4 B;  4FLZ A;  4K8X A;  1I94 B;  4O2A B;  5FNV A;  3BPZ A;  5IJ9 A;  4D7T A;  4O4J A;  1G6U A;  1HNZ B;  4TV9 A;  5EYP A;  4LF4 B;  1KMI Z;  3RYC B;  2RJZ A;  1SQG A;  4I55 A;  4UCU A;  2OYQ A;  4HBN A;  4YHH B;  1HNX B;  4X20 B;  2E3C A;  4ZHQ A;  1Z5W A;  4B3R B;  4GYC B;  2UXB B;  5EIB D;  1XQ8 A;  2IM9 A;  3QTC A;  5D5Q A;  3VQV A;  4DR3 B;  1N36 B;  2R9A A;  2Q7G A;  1YEW A;  4PI2 A;  4CS2 A;  1J5E B;  4HNA A;  4LFB B;  4NXM B;  4ZOL A;  3UT5 B;  2OWO A;  3DSQ A;  4PI0 A;  5KHI A;  3RGB A;  3RYI B;  5LMU B;  2PYJ A;  3K5O A;  1XHZ A;  4O4I A;  3UQ8 A;  1IBK B;  4YJ3 A;  1WPB A;  3JAT A;  1JFF B;  3E22 B;  4CC6 A;  5EZY A;  3BHP A;  4TV8 B;  1FJG B;  5KMG A;  5KHJ A;  4IHJ A;  3SGI A;  1WNS A;  2HHH B;  5IJ9 B;  4O4J B;  1HW7 A;  4FLX A;  4CS3 A;  5EYP B;  2PTM A;  5ITZ B;  1M4U A;  2VQF B;  5BR8 B;  3CHX A;  4I55 B;  2YI8 A;  5C8Y A;  2KKW A;  5JQG B;  4YJ2 A;  4ZHQ B;  2EX3 A;  2ZIN A;  1N33 B;  1Q8I A;  2RQ6 A;  2UU9 B;  5JH7 A;  5CHX A;  3II6 A;  4JI5 B;  5EIB C;  2Q7H A;  4DV1 B;  5LP6 C;  3MAQ A;  2ZCE A;  3K58 A;  2UUB B;  2YI9 A;  2F95 B;  2PYL A;  3JSN A;  4ZOL B;  5LOV A;  2VWJ A;  3WB0 A;  2QM4 A;  1O9H A;  1S5J A;  3JSL A;  4FFB A;  3JAL A;  4F6R A;  5CJ0 A;  4FVM A;  3RWR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...