3SR2C

Crystal structure of human xlf-xrcc4 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/protein binding
molecule keywords DNA repair protein XRCC4
publication title XRCC4 Protein Interactions with XRCC4-like Factor (XLF) Create an Extended Grooved Scaffold for DNA Ligation and Double Strand Break Repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 218
sequence length 224
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sr2C02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3sr2C01
5CJ0A 2QM4A 4XA4A 3MUDA 3SR2A 3SR2C 1KU9A 3RWRA 2R9AA 1FU1A 1M5IA 5CHXA 5CJ4A 3RWRD 3II6A 1IK9A
chains in the Genus database with same CATH superfamily
2F4VO 5LGNA 3ZHVA 1IVSA 1MABG 4DYLA 4JASA 4D7TA 1NH2D 2ZE8A 4MVOA 2ZNJA 1MZFA 5IY5B 4X1IB 4X8AA 1N32O 3D36C 2RN9A 1VQ6V 1FPOA 1VF6A 5L3GA 1FXKB 1JA8A 1P7GA 1JPXA 1K34A 4NYKA 2GBOA 4LF8O 5CJ4A 3LSQA 5BY1A 1N0NA 1XREA 1PL4A 1YJ9V 4Z1VA 1P49A 3K5MA 4WFHA 3SGIA 4J9YB 3HKEB 1SQGA 4X1YA 3N2GB 1VQ5V 1MNGA 1HNWO 3OMAB 2BOCC 2JDIG 3SJBC 4X88A 1WN7A 1HW7A 1PNLA 2QEXV 4PI0A 3K5OA 4X62B 5LMUB 2EINC 3G80A 1GRJA 3MAQA 3S3WA 2DE0X 2WAMA 4J11A 3CCSV 4LFAB 4B7KA 2GDSA 4YIOA 2LW7A 5GONB 2IH3C 4X66B 3CX5F 2KSDA 2YEVA 2ADQB 1BS3A 1Q82W 5C8YA 4ZKIA 2DQ3A 4F6RB 2VWKA 1R6KA 1K33A 4JI3O 3SYPA 4ICGA 3APQA 2A7WA 4DV1B 3D3IA 4B3RO 2YUAA 2Q8VA 2ZINA 3K58A 4GZRB 1NVPD 2YI8A 3ZBHA 4N21A 1YHQV 5IY5C 1ZUQA 3E89A 3RWRD 1H8HG 3KKYA 4JI1O 3BHPA 3B09A 4GX2A 3AEIA 2NR5A 4JI0O 3OEHG 3QO8A 1JR9A 4MVMA 4L87A 2P5OA 2GHYA 3K3WA 3E86A 1OCOB 2JEUA 4GKJB 4X1IA 4D6TH 2DQ0A 1HR0B 1Q6HA 3CCVV 4CS4A 1FXKA 3JAKA 4X20B 3OTOB 1COWG 5E79Z 4FPPA 2UXXA 3AK3A 3BPZA 4BR6A 2ARHA 4AILC 4DW1A 1G8MA 4JI4O 2JJ1G 5DEDA 3IJ4A 4DXWA 1Q8IA 2IU0A 3L74H 3HKEA 3N2GA 1O9GA 4I55B 3ABTA 1N36O 3B77A 4HZ3A 5LMNO 2YIBD 4DV0O 1XNRB 2UU9O 2KKWA 5B5EZ 5EBMC 5KX5A 3L9DA 2ZR3A 1ENVA 2LFSA 1B04A 1EN6A 3UKMA 2OWOA 2Y69B 5IJ0B 2R9RB 3F5WC 4DV6O 1URFA 1ZX3A 5GONA 1V9PA 2QM7A 2QSAA 2AHYA 4LFCO 3CRAA 4TQFA 2Y4TA 2L6LA 1E1QG 1VQNV 4BIOA 4F6RA 5EYPA 4JYBA 3EHBB 5IJ9B 4PD4F 3OMNB 4LF4O 1IDSA 4R6ZA 2YI9A 1L1FA 4B3TB 1NJIW 1GTOA 3DGEA 4IT5A 1M90W 2XTAA 1G4YB 4JI7B 2XAHA 2R9AA 1ZTEA 2LO1A 5E1AC 1ZLZA 1YITV 5B1NA 4FJCC 2PGGA 5H5NA 1R3JC 3E22B 2WLIA 1PPJH 1KP3A 4K8ZA 4UCTA 1BGYH 5LHHA 1Q6UA 4O4HA 2EILB 4TV9B 3AG3B 1D5NA 1GM9A 5GTHZ 2E74B 3ZMSA 5IDJA 3CRCA 2Y0IA 4LCUC 3AK2A 5CBHA 1OZ0A 2KB1A 1FFXB 3SYQA 1VIBA 3R66A 1Q3EA 1K5QA 3ABLB 3CJHB 3JD0A 1RSOA 1FAFA 2Y3VA 1M57B 1AI6A 1Y74B 2EBOA 1VARA 4I55A 4KL1A 1N33O 2E76B 3C3SA 2DOSA 4NTYA 1ZL8B 1PL0A 4OX9O 2EZOA 3O9OA 4KXRA 2Q9LA 2ZT9B 4GX5A 3VBBA 3K59A 2QA4V 2IM9A 4I5SA 5EIBC 2HKOA 5IJ0A 1N0JA 5LHGA 2UUCO 1O9HA 4B3SB 4PA7A 1CEZA 4WBNB 2V4DA 1R6NA 4YY3B 3PJSK 2X6AA 4Q20A 2CDYA 4KFMA 1XMOB 3B4SA 5IJ9A 4ZBMA 2LFRA 1QVGU 1NTKH 5KAIZ 4JI8B 4YJ2A 1DLBA 4O2AB 1IBLB 3THOA 3N2KA 1SRYA 2Q5ZA 3T1YO 5BZBA 4LF9O 4DR5O 1WPXA 1I0HA 2NLJC 1KMIZ 3H1HH 1NR7A 4GLXA 4CH4A 4TT3G 1K7DA 2Z5UA 5CA1B 4MSWC 5LGUA 3GWOA 5EBLC 4MTXA 3F5TA 2HEPA 1RFYA 4UB8Z 4NXMB 1Z5VA 3K79A 1NS1A 1F7YA 4DV4O 5KHGA 3J80N 4AQYO 5IYBO 1NZ6A 3ZRXA 4JAVA 5IYZB 4TV9A 3ABLC 3K9SA 1MZEA 3ZHUA 2F1MA 5H6QA 4JTDB 4DR3B 4PI2A 3STLC 5CMUA 1RM1B 1JFFB 1F51A 4JTCB 3WG7B 4C7UA 3CXHF 2UXCO 1JX9A 2OTLV 4LF6B 3CRRA 1KD1W 1FFXA 4B3MO 3CJHA 3F7VC 1K4CC 1H2KA 2UUBB 4X65O 1Y74A 2RQ6A 5LXTA 5ITZB 3TXSA 4LH6A 4DV7B 3CRMA 3CEIA 2P67A 1E79G 2ZE7A 1GM7A 1OJHA 5JCOA 4P30A 1IZ3A 3T4ZA 1VF5B 4JF3A 2JRIA 3AG4C 3JD2A 4UVAA 3OEEG 2OIEA 1K73W 3ZRSA 1TA8A 4X9QA 2WA4A 3JSLA 1S76D 3E8FA 4CKNA 3CS5A 4TSFG 2FL4A 4UUJC 4DR7B 1XNQB 1QR8A 1PV0A 2A3QA 4FLTA 1XQ8A 1PNKA 2XAQA 2LW1A 5CA0B 4O2AA 2ZR2A 4FVMA 3OUSA 1KP2A 4KP4A 1U97A 2W0FC 5F2VO 4G2KA 3UCSC 3BEHA 4H37A 1BL8A 1WLEA 4DV3O 3W7XA 1YJWV 4MS2A 4JI6B 4MVZA 2IU3A 1RM1C 3QTCA 3ASOC 4X89A 2IJHA 5JH7B 1ROPA 4X1YB 1QU7A 4BW5A 5LOVA 5IYZA 3MHSC 4UVCA 4NTXA 2AZ0A 2UXBO 2PY5A 1VQKV 4JI5O 5KMGB 3I55V 2ZIOA 1AVMA 1EN4A 3CE2A 4RUFA 1JFFA 4UFZA 2DMXA 3S3XA 2WLMA 1VQLV 5B1AC 4NXNO 3QG5A 3L71H 5EC2C 2EX3A 1Q81W 1Z5WA 1B6QA 3U10A 1GKFA 3A0BZ 3IC9A 1AI7A 4DR2O 4K0KO 5B66Z 1QBZA 5ITZA 4JI4B 1BE3H 5DM6V 4JPRA 4TUYB 3SJAC 4A5UB 4JAAA 3DXRB 2PI5A 3CCMV 3JYCA 2EIJB 4X64B 1VQPV 2VRZA 3CWBH 4I0XB 5LMNB 2QWQB 1SC5B 3LDCA 4I50B 3AG1B 1BHAA 3CC4V 4UB6Z 2D3OW 1BQZA 2CTPA 2GUZB 2CK3G 3ZJZA 1DTOA 3X2QB 4UV9A 2ZDIA 1XOUA 1VF6C 3OMIB 1K8AW 2HR3A 2RMKB 1XHXA 5L3FA 5CA0A 2XASA 1TVKB 3ZRVA 1DF5A 4DUZB 2QDOA 4HYOA 2XT9A 2BTOA 2PF4E 3J7AU 2Y48A 3E2EA 1IBMO 1WA8B 4FLWA 3MUDA 3JAKB 1XI1A 3ASNB 3FB8C 5LP6B 1P4RA 1GH6A 3OUFA 4PA3A 3OW2U 1IBKO 5FPOA 1SQVH 3RN4A 3A8TA 3HKBB 5JH7A 4DO2A 2OCHA 4WCEV 4CC5A 1SQPH 2HHHO 3AG7A 2KG7A 3FB6C 5H2FZ 3SYAA 4PA6A 2QWOB 3CYOA 1HNZB 2OIGA 3SPIA 5KMGA 4WFBV 3N27A 2P4KA 5KX5B 1W59A 1B06A 4GT1A 4NVPA 3ZCCA 2YS8A 4HNAB 5BR8B 4LFBO 1M93A 1I5XA 3JCUZ 4G28B 1QNMA 4TUYA 2LGWA 3QVNA 3JASB 3ZN1A 3DXRA 4H13B 5EYPB 2A9HA 3C3TA 4FK5C 2BSKB 2P06A 3MDSA 3SDLA 3I5DA 3H01A 4FM0A 4QPJA 4I0XA 1QR9A 1H2NA 4I50A 2YC0A 4OX9B 5IYCO 3A0RA 5B1OA 2CGNA 1R3LC 2GUZA 3HKCB 2P6JA 4LF7O 2K9PA 4PA4A 4NTWA 3M99B 1XBLA 1EBOA 2ETNA 3Q0XA 1FXKC 1IXBA 3ASNC 3CB2A 3HPLC 2XAFA 3BAAA 4DR6B 1DF4A 3B40A 4U3JB 2WLIB 5LP6C 3TJTA 1TVKA 3CHXA 4W4KA 1QVFU 3PYIA 4JI2O 2VQEO 4WFFA 5DN6G 4MVSA 4LF5O 4DK1A 3ZN0A 2X6CA 4O4HB 1WA8A 4U3FH 2UXDO 2Y0PA 3SJCC 1WB8A 1AP5A 5CHXA 5LP6A 2AHZA 1NT2B 2A79B 1FJGO 3T1YB 1VQ4V 1N34O 4N23A 1M5IA 3CPWU 4DV5B 1WPBA 1TUEB 2CTQA 4DR5B 5JJEB 3QO5A 3HKBA 1RSOB 3NXSA 2WLKA 4GCZA 1GN6A 3ABMB 3U0ZA 1H38A 2F43G 1JOYA 3ZHQA 2PI4A 2VQFO 2MW2B 3D8CA 2HP8A 1YTFB 2FMLA 2B1IA 4BW9A 3K0DA 1A32A 1EN5A 4LR3A 4AQYB 4JTAB 1SZTA 4NR1A 1KU9A 4HNAA 3RT3C 1BQ0A 3Q4HB 2YICA 1W0JG 1Q7YW 1NU1H 3T1HB 1XEQA 4I9QA 2UUAB 3L72H 2GSMB 3JASA 1HNXB 4I4TA 5D5PA 1J5EO 4PV1B 5IWAO 1VQ9V 1JJOA 5EIBD 2BSKA 3H9VA 4X65B 3VQYA 4CZZA 4RQFA 1L8DA 4ZI7A 3K06A 1HDJA 4YJ2B 5IYDO 1K92A 1MG1A 1WB7A 1YVWA 3N2KB 5D5QA 2LQTA 2YIDA 2ZM6O 3JCZA 1OCOC 3DTUB 3GB7C 3HKCA 2E5LB 1JCHA 1SA0A 5A2QN 3SPGA 4LNUB 1JQ0A 2B5UA 2WLLA 1SERA 2JVDA 4U3JA 4RQEA 3FYEB 5EC1C 5CBGA 3T4DA 4DUYB 4DR1O 4XBFA 3OGCC 2DN9A 1H2LA 5LGTA 3ABMC 3CCLV 1Y76B 3M8AA 1KQSU 4X1KA 3JD4A 3VQWA 2XNDG 3KCYA 4O2BB 2EJ7A 1FXHA 2A0LA 2BTQB 2F66C 5LMUO 4W4LA 4DV3B 1RPRA 1Y66A 2QTSA 3CMAV 4JYYA 1YF2A 3ZMUA 3CXCU 1TGOA 5LXTB 4LFAO 1Z2GA 2Y69C 1V55B 1VMGA 5FNVB 3OD4A 1XMQO 4MT8A 4Q6GA 2ZNIA 1IURA 1VEWA 1U96A 4X66O 1H2SB 2IJJA 1GMGA 2E75B 4LWSA 4J7KA 2WLJA 2UXBB 4IYIA 4IYHA 3Q4HA 3OR7C 1F4MA 2ZQMA 1I94B 5LA6A 4QIWF 2IBZH 1KECA 3ZEDA 1DGSA 2ITCC 2QR4A 5CN0A 2ZXWB 1VP7A 1W0KG 5LYJA 1N8RW 2OYQA 4YIPA 3IGAC 5JJJB 2Q7GA 4IIJB 1Q90D 2X7RB 2CH7A 3W7UA 3ETDA 4JYAO 4LH7A 1SQFA 1OCRB 1K5SA 5FLXN 4PDVA 4H44B 4JGSA 3CCEV 4GKJO 5LBQA 3E8BA 1EZVH 4LNUA 2EILC 3K0GA 3II6A 2W6IG 3AG3C 3RBZA 5J9PC 3AG2B 1NTZH 3AK1A 2AZ2A 4CKMA 3OTOO 1IXMA 1OV9A 3BVOA 4E4EA 3B8MA 4DV2O 2QM8A 3LNNA 3UO2A 3OE7G 4KHPO 3G71V 4K3AA 5LOVB 4HBNA 2QJ1A 5B3SB 1M57C 3BCCH 4TV8B 2F4VB 2L35A 2JS3A 1S5LZ 3JAWB 1Y76A 2ITDC 1YIJV 4LBEC 1AP6A 1N32B 2BCCH 4LP8A 2M6YA 2Q7EA 1XNRO 4O2BA 2H3OA 2EIKB 2QKSA 2BTQA 3P32A 3ZMTA 4LF8B 5JCOC 2RNBA 2IW5A 2XUMA 1OCCB 5EBWC 3E83A 1QCEA 2QWNB 2LJ2A 4FFKA 4P9OA 4RAIA 5FNVA 4DW0A 1R1BA 1SF9A 1M1KW 3K57A 5H9CA 1GAXA 2ZE5A 2YXYA 4JV5O 1I7FA 2YIAA 2CGOA 3P30A 2ZXWC 1HNWB 4RUEA 1EM1A 3UO3A 3UQ8A 4GKKO 3L75H 2QWRB 3BY6A 3RGBA 4DR4O 1BT8A 4JZ2A 4B3TO 2PYLA 4JI7O 1OCRC 5HFLA 1XL4A 4OXSA 3JARA 1QQCA 4IIJA 1L0NH 4FZ1A 5JWPA 2RDCA 4J7ZA 1KKDA 1JJ2U 4E2LA 5KUKA 4MW3A 4ABMA 5CBFA 2VWJA 4UCRA 4UCVA 3L73H 2JK5C 4JI3B 2EIMB 4O4LB 3VQXA 1I08A 3SR2A 4EKWA 3VQVA 4B3RB 2XOKG 4ZOLA 2LGQA 2B9ZA 3ML0A 2RCVA 3ZRWB 4LF7B 2Q0OC 3ZHTA 2Y3WA 2PZSA 2AGAA 3TXQA 3QF7A 4JI1B 3WG7C 1HP8A 3TK1A 3SJQC 4XDLA 2QWPB 2KG7B 2N04A 4JI0B 1WAZA 1KYOF 2HFEC 4TV8A 2DWDC 3H1KH 2ODMA 3JAWA 1OCCC 5LHIA 3JAMN 2R9IA 3NR7A 1TUBA 3U11A 1S0VA 5JQGB 1VQ7V 1AJQA 1GK9A 4QNHB 1MA1A 2N05A 2UXDB 4J9ZB 4IGGA 2C2AA 5JJNB 2X0LA 3K5LA 4H0LB 4FLZA 1BZKA 4OGQB 3OAAG 4PJ0Z 3WB2A 3CC7V 1ORQC 1WP7A 2YDEA 2IH1C 4B3SO 2HJFC 2W0XA 4UXNA 1Q6IA 1XDCA 1N4CA 1N36B 1XL6A 2FB5A 1KKCA 2ZDIC 5CB4B 1AI4A 4DV0B 3TGUH 1YXBA 3FAVB 3EFFK 2UU9B 5L3DA 1AROP 5B1BB 3RYIA 4EFBA 4FLYA 2EINB 4JI8O 3DC5A 1SQBH 1IBLO 1H8EG 2BE3A 4GUNA 4JAUA 5JVDA 2JGUA 5TISZ 3E8GA 2EIMC 2EZPA 4DV6B 2Y4UA 2DYRB 3BFRA 3VOUA 4MVUA 1K9MW 3M7MX 3W7WA 3CRQA 4LFCB 1NQTA 3ZMVA 3K5NA 5DECA 4H33A 3SPJA 2F95B 5KHKA 1J5EB 1J95A 3EVKA 1BSMA 3K9AA 3CSXA 1D5AA 4R50A 4RWUA 2YXLA 3FYIB 3G4SV 4LF4B 3FB5C 4O4LA 2PTMA 5FPRA 3B8NA 1THZA 2HVKC 5KHIA 1EFRG 1MMMA 5C93A 5BXZA 3ZRWA 4XA4A 4DR3O 1KB9F 3PN1A 1NH2B 4TWKA 1VQ8V 1R73A 3APOA 3ZMZA 2HG5C 3LSUA 1RP3B 1RPOA 4LF6O 3SPHA 2GTAA 4AI8A 3P3NA 5KA6A 2UUBO 2ILMA 2MK3A 3RFRA 4DRXA 3CCJV 3FX7A 1Y4MA 4PDRA 4YJ3B 1S77D 4DR1B 4Z1MG 5KA5A 5JQGA 3D36A 2DWEC 4DV7O 3OT7A 1JVMA 4FFBA 1VF7A 1Q86W 1AB3A 5IE9A 2EIJC 1X4TA 4HAMA 4PHZA 1SKVA 3LSSA 4YXWG 1HWYA 4CS3A 3AG1C 3DSQA 2WSSG 3O65A 4I7ZB 5B1BC 1KUQA 3JATA 1CXZB 2N74A 3BA9A 3JSNA 4I4TB 5IT9N 2H94A 4CH3A 4DR7O 1XNQO 3X2QC 3RYCB 1N33B 1TAEA 5A9GA 4ZI7B 1BHBA 5CB4A 2DYRC 1XMQB 3E35A 4FLXA 3FAVA 4FIPC 3LDEA 2Q6AA 4B08A 4CS2A 2GTSA 1B3QA 2AW9A 1SA0B 1NBMG 3R65A 1AJPA 2UUCB 2JEXA 4OPHA 4L8JA 5BMVB 4F6EA 3STZC 3W7TA 3GVMA 2WLLB 1AILA 2P22C 2P7TC 2F23A 4WFEA 3OM3B 2BOBC 3SPCA 4JI6O 4GFCA 1NVPB 2IJKA 3WB1A 3CMEV 4U7OA 3KZIZ 4AHCA 4YHHO 2D2CB 2RJZA 4JYAB 3GWKC 2VS0A 3RYHB 1K3EA 2O57A 1GN3A 4LF9B 1H2MA 4X1KB 1GO3F 2QTOA 4UCUA 2FTKA 4D7SA 1Y67A 3ABKB 1WP8A 3H1LH 3LNMB 2OCCB 1S5JA 4FZ0A 1XILA 5EZYB 1T5EA 1YTFD 4DV2B 3W7SA 4QE9A 4IL6Z 1NI8A 2OTJV 5KHHA 1FD9A 4DV4B 1R3KC 3ETEA 4KHPB 2CE4A 1NTMH 4YJ3A 4GEXA 3FKSG 2FKXA 1FYJA 4FM1A 4GX0A 2DJVA 4OPAA 4LWSB 1SS3A 1K4DC 1H2GA 4PA9A 5GTIZ 2XAJA 4X64O 5K1XA 4DK0A 4BIZA 1E1RG 4QPKA 5LA6B 1YJNV 2V7QG 3BRCA 1UPGA 2UXCB 4QJFB 3ICXA 1WNSA 4B3MB 2HJDA 1LR1A 3FFQA 1F23A 1S72V 4BAYA 1MSDA 2K1EA 5LYJB 2XHBA 2JIZG 4R7CA 5KLVH 3RYCA 2Q69A 3IC7A 4CC6A 4J7JA 1M56B 4K35A 2CH7B 1QLEB 3FD9A 4U7NA 3B2EE 5J2TB 1MSWD 1WJZA 4JV5B 1XHZA 3OFNG 4TOIA 3Q0YA 4DUZO 4FLVA 4MVQA 2WLNA 4GKKB 1NKDA 2GV9A 3HKDB 4O4JB 5CA3A 5BMVA 4DR4B 2JGDB 1AJNA 4BIUA 1UJWB 2QKCA 2ZE6A 1S3JA 3BA8A 4O4IB 2EULA 1LNQA 3RWRA 3ABKC 1IX9A 2E3CA 2Z3YA 3HR0A 2QGNA 2OCCC 4EEQA 5KAFZ 5AG2A 5L3CA 1PKXA 1G1XB 3K03A 3JALB 3RYHA 3ZHRA 1HNZO 1Y6XA 5EK0A 3TCUA 1QHTA 3IAYA 1AI5A 1YSCA 1FKAO 3ETQA 1PNMA 3FB7C 4X62O 3F7YC 5J2UB 3SYOA 1Q5OA 1US6A 1DK1A 4X20A 4J10A 1Q43A 4XDKA 1AR1B 3G6EV 5EZYA 5BR8O 2EJRA 4FM2A 1NR1A 2ATKC 3OTFA 4GX1A 4FLUA 3WFVA 4ZIBA 3UM7A 4JI5B 3IFXA 1QLNA 1GN2A 4ZHQB 4NXNB 1M56C 1KBHA 4DV1O 1QLEC 1YEWA 2YIBA 1OHHG 2Q73A 2KQXA 1KC8W 4IHJB 4K0KB 3D3QA 4DR2B 1YDXA 3RYFB 1GN4A 1OCZB 1IK9A 3JARB 2PYJA 5CJ0A 4J41A 5LL6Y 5J2TA 2ZKOA 2WWWA 4DR6O 3DC6A 5KHJA 1L0LH 3OGIB 2P90A 1UFIA 4ZOLB 3K04A 3AG4B 1HR0O 3HKDA 4O4JA 3P3PA 2JGDA 4NKGB 1MOFA 3ZX6A 3WU2Z 4EFEA 2LP7A 4O4IA 1YI2V 2M7WA 5H6RA 4DV5O 1PM9A 4CH6A 1SESA 4JZGA 5KUMA 4EB6B 4GFAA 2Q0AA 3MD0A 4TQDA 3QNEA 3UT5B 3E22A 1TUBB 3JALA 1V55C 2B1GA 3T1CA 4FMTA 2Q68A 2HVJC 1IBMB 1FFTB 1FU1A 3MHHC 2NN4A 3OR6C 4I9WA 5J2UA 2HLDG 2WA3A 2ZD9A 1XUQA 3LUTB 4MTOA 2ZCEA 1W2BU 1IBKB 3HB3B 2DW4A 1PD3A 4QE7A 3T1HO 1BCCH 3ASOB 4MTGA 5FL7G 3CCQV 2HHHB 1ZWIC 2UUAO 3C90A 3LDDA 2NNUA 1AR5A 4QGPA 1HNXO 2QKAA 1ZSPA 3RVZA 1OCZC 4PELA 4B7EA 1P84F 1M9NA 2W6JG 3RYIB 2CTRA 4ZHQA 5B1AB 1YZBA 2WLHA 1ZL8A 3ZIAG 1CPYA 2YSUB 1GM8A 4GEUA 3I56V 5JVDB 4IHJA 4LFBB 1V54B 3J81N 3CC2V 1FXVA 3SR2C 1X59A 3RYFA 2E5LO 3ETGA 2Q7HA 4XDJA 2UXNA 1EZJA 2IJIA 3AG2C 3E8HA 4WBNA 2AXTZ 2FYUH 4UCOA 3CCRV 5HFMA 3G6BA 3K08A 4J80A 3TETA 4DUYO 1R3IC 4CH5A 4WF9V 1JMKC 4CKPA 2Q67A 2ADPA 4LC1A 3KCXA 5B3SC 4JYCA 5L3BA 2ZIMA 3BABA 1VQMV 4F4LA 1P7BA 4G79A 3ZS8C 2DYSB 1I5YA 3CP1A 1CP9A 4NB5A 4PDMA 2CTWA 4MVRA 1VQOV 4G27B 2EIKC 1AR4A 4EB6A 5GW7A 3JD1A 5CA1A 2Z0AA 4DRXB 3CD6V 3L70H 1SQQH 4JI2B 3UT5A 1K97A 2VQEB 4LF5B 4FFBB 1FS0G 4ASUG 4YHHB 2R70A 3CCUV 1PP9H 2JS5A 4BWAA 1R6TA 1FJGB 3WB0A 3QO7A 1N34B 2X6BA 5L3EA 3KG2A 3JATB 1I94O 1M4UA 1YCIA 5K1PA 2A06H 2WPDG 4K8XA 4YY3O 4GYCB 1S5HC 2VQFB 3H1JH 4KUMA 1V54C 3H1IH 1XMOO 4PDLA 2XAGA 2P4VA 3A0HZ 2YEVB 2PUSA 4P9PA 4UCSA 4WFGA 2JJ2G 1BMFG 3RVYA 3JD3A 5C8YB 2YXHA 2CAZC 4J42A 3SYCA 4WFAV 1LUWA 2QE7G 3G67A 4Z2WA 2G38A 3EXAA 3ABUA 4R8CA 2H8PC 2V1DA 1D2DA 3A2FA 4CBCA 1ZAUA 3T2MA 5IWAB 1SQXH 2CUGA 2Q4PA 4P2ZA 2OT5A 4NXMO 2DYSC 1LUVA 1G6UA 4UVBA 1F4NA 4RO2A 4UV8A 2R72A 2QM4A 3ZHSA 1SETA 1SZXA 2F93B 3RW0A 2ZM6B 4MW8A 4MTFA
chains in the Genus database with same CATH topology
1XNQB 5EZYB 1T5EA 4DV2B 4D7TA 2ZNJA 5KHHA 1XQ8A 4X1IB 4DV4B 4FLTA 1I94B 5LA6A 4KHPB 4YJ3A 4FM1A 3ZEDA 1DGSA 5CA0B 4O2AA 5CJ4A 4FVMA 5LYJA 5K1XA 4DK0A 2OYQA 5LA6B 5JJJB 2Q7GA 4IIJB 3BRCA 2UXCB 3ICXA 1WNSA 1P49A 3K5MA 4B3MB 3SGIA 3FFQA 3HKEB 1SQGA 4X1YA 3N2GB 4LH7A 1SQFA 5LYJB 4JI6B 2XHBA 3RYCA 4CC6A 3QTCA 3SJBC 1WN7A 5JH7B 1HW7A 4PI0A 3K5OA 4X62B 5LMUB 3B2EE 4LNUA 5J2TB 3II6A 3MAQA 4JV5B 4X1YB 5LOVA 1XHZA 5IYZA 4TOIA 2PY5A 4FLVA 4LFAB 5KMGB 2ZIOA 3LNNA 4GKKB 4UFZA 1JFFA 5GONB 2GV9A 3QG5A 3HKDB 4O4JB 4X66B 5BMVA 4DR4B 5LOVB 2EX3A 4HBNA 2QJ1A 4TV8B 1Z5WA 5C8YA 3U10A 2F4VB 4F6RB 2VWKA 3JAWB 3BA8A 4O4IB 1N32B 5ITZA 4JI4B 4DV1B 4TUYB 2Q7EA 3SJAC 4O2BA 3RWRA 2BTQA 2E3CA 2ZINA 4EEQA 3K58A 4LF8B 5JCOC 4X64B 2YI8A 3JALB 3RYHA 5LMNB 1QHTA 4I50B 5FNVA 3IAYA 3RWRD 3BHPA 3ETQA 3K57A 5J2UB 1I7FA 2YIAA 1Q5OA 4X20A 2P5OA 1Q43A 1HNWB 5EZYA 3UQ8A 4GKJB 4X1IA 1HR0B 3RGBA 4CS4A 1XHXA 4FM2A 3JAKA 4X20B 5CA0A 1TVKB 3OTOB 2PYLA 3OTFA 4DUZB 4FLUA 4ZIBA 4JI5B 3BPZA 4AILC 2BTOA 4ZHQB 4NXNB 3JARA 1QQCA 4IIJA 1YEWA 4FLWA 3MUDA 2YIBA 3JAKB 1XI1A 1Q8IA 2VWJA 4IHJB 4UCRA 4UCVA 3HKEA 5LP6B 3N2GA 4K0KB 4DR2B 1O9GA 4I55B 4JI3B 3RYFB 1IK9A 4O4LB 3JARB 3VQXA 3SR2A 2YIBD 3VQVA 1XNRB 5FPOA 4B3RB 2KKWA 3HKBB 5JH7A 2PYJA 4ZOLA 5CJ0A 5KX5A 4CC5A 5J2TA 4LF7B 5KHJA 1B04A 1HNZB 2OWOA 5IJ0B 2PZSA 5KMGA 3QF7A 4JI1B 5GONA 4ZOLB 1V9PA 5KX5B 3HKDA 4O4JA 4NVPA 4JI0B 4TQFA 4HNAB 4TV8A 4F6RA 5EYPA 5BR8B 1M93A 3JAWA 4EFEA 5IJ9B 4O4IA 1TUBA 3U11A 5JQGB 2YI9A 4CH6A 4TUYA 4EB6B 2UXDB 4B3TB 2Q0AA 3JASB 5EYPB 4JI7B 4TQDA 5JJNB 3K5LA 3UT5B 3E22A 4FLZA 2R9AA 4FM0A 1TUBB 3JALA 4I50A 3WB2A 1IBMB 4OX9B 1FU1A 5J2UA 2PGGA 3HKCB 3E22B 1N36B 2ZCEA 5CB4B 1IBKB 4DV0B 2UU9B 4K8ZA 3RYIA 4UCTA 4EFBA 4FLYA 2HHHB 3CB2A 4O4HA 4TV9B 3BAAA 4DR6B 4U3JB 5LP6C 1TVKA 3CHXA 5JVDA 2JGUA 4DV6B 3RYIB 4ZHQA 4DK1A 3M7MX 4O4HB 4LFCB 1FFXB 1Q3EA 3K5NA 3SJCC 2F95B 1RSOA 5KHKA 5JVDB 4IHJA 1J5EB 5CHXA 5LP6A 1NT2B 4LFBB 3CSXA 1D5AA 4KL1A 2YXLA 4I55A 3T1YB 3SR2C 3RYFA 4LF4B 1M5IA 4O4LA 4DV5B 1WPBA 2Q7HA 2PTMA 4DR5B 5FPRA 5JJEB 5KHIA 3HKBA 4WBNA 3U0ZA 4UCOA 3K59A 4XA4A 2IM9A 5EIBC 3PN1A 4BW9A 5IJ0A 4LR3A 1O9HA 4CH5A 4AQYB 4B3SB 1JMKC 4WBNB 2V4DA 4YY3B 1KU9A 2ZIMA 3BABA 4HNAA 3ZS8C 1XMOB 4DRXA 3RFRA 5IJ9A 3T1HB 4YJ3B 4DR1B 5JQGA 4I9QA 2UUAB 4JI8B 4FFBA 4YJ2A 4EB6A 4O2AB 1VF7A 1IBLB 3THOA 5CA1A 3JASA 1HNXB 3N2KA 4I4TA 5D5PA 1X4TA 4PHZA 1SKVA 4DRXB 1JJOA 5EIBD 4X65B 3VQYA 4JI2B 3UT5A 4CS3A 2VQEB 1L8DA 4ZI7A 4LF5B 3DSQA 1KMIZ 4FFBB 4YJ2B 3JATA 4GLXA 4CH4A 4YHHB 2R70A 5CA1B 3BA9A 3N2KB 3JSNA 4I4TB 2JS5A 5D5QA 4BWAA 4CH3A 1FJGB 3WB0A 3HKCA 3RYCB 1N33B 2E5LB 1TAEA 2HEPA 1N34B 4ZI7B 4NXMB 1Z5VA 1SA0A 5CB4A 1XMQB 4FLXA 5KHGA 3JATB 4LNUB 1M4UA 5K1PA 5IYZB 4TV9A 4K8XA 4GYCB 4B08A 4CS2A 2JVDA 2VQFB 4U3JA 2F1MA 1SA0B 4DR3B 4PI2A 1JFFB 4DUYB 2UUCB 4L8JA 5BMVB 2PUSA 4LF6B 4UCSA 1FFXA 2P22C 5C8YB 2CAZC 2UUBB 2RQ6A 5LXTA 5ITZB 3WB1A 4LH6A 4X1KA 3VQWA 4O2BB 4DV7B 2BTQB 3A2FA 2F66C 4AHCA 4DV3B 2RJZA 1ZAUA 4JYAB 5IWAB 1TGOA 5JCOA 3RYHB 5LXTB 4LF9B 4X1KB 5FNVB 4UCUA 1G6UA 4Q6GA 2ZNIA 4D7SA 2R72A 2QM4A 1H2SB 1TA8A 3JSLA 2F93B 2ZM6B 1S5JA 2UXBB 4DR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ0 A;  2QM4 A;  4XA4 A;  3MUD A;  3SR2 A;  3SR2 C;  1KU9 A;  3RWR A;  2R9A A;  1FU1 A;  1M5I A;  5CHX A;  5CJ4 A;  3RWR D;  3II6 A;  1IK9 A; 
#chains in the Genus database with same CATH topology
 2F4V O;  5LGN A;  3ZHV A;  1IVS A;  1MAB G;  4DYL A;  4JAS A;  4D7T A;  1NH2 D;  2ZE8 A;  4MVO A;  2ZNJ A;  1MZF A;  5IY5 B;  4X1I B;  4X8A A;  1N32 O;  3D36 C;  2RN9 A;  1VQ6 V;  1FPO A;  1VF6 A;  5L3G A;  1FXK B;  1JA8 A;  1P7G A;  1JPX A;  1K34 A;  4NYK A;  2GBO A;  4LF8 O;  5CJ4 A;  3LSQ A;  5BY1 A;  1N0N A;  1XRE A;  1PL4 A;  1YJ9 V;  4Z1V A;  1P49 A;  3K5M A;  4WFH A;  3SGI A;  4J9Y B;  3HKE B;  1SQG A;  4X1Y A;  3N2G B;  1VQ5 V;  1MNG A;  1HNW O;  3OMA B;  2BOC C;  2JDI G;  3SJB C;  4X88 A;  1WN7 A;  1HW7 A;  1PNL A;  2QEX V;  4PI0 A;  3K5O A;  4X62 B;  5LMU B;  2EIN C;  3G80 A;  1GRJ A;  3MAQ A;  3S3W A;  2DE0 X;  2WAM A;  4J11 A;  3CCS V;  4LFA B;  4B7K A;  2GDS A;  4YIO A;  2LW7 A;  5GON B;  2IH3 C;  4X66 B;  3CX5 F;  2KSD A;  2YEV A;  2ADQ B;  1BS3 A;  1Q82 W;  5C8Y A;  4ZKI A;  2DQ3 A;  4F6R B;  2VWK A;  1R6K A;  1K33 A;  4JI3 O;  3SYP A;  4ICG A;  3APQ A;  2A7W A;  4DV1 B;  3D3I A;  4B3R O;  2YUA A;  2Q8V A;  2ZIN A;  3K58 A;  4GZR B;  1NVP D;  2YI8 A;  3ZBH A;  4N21 A;  1YHQ V;  5IY5 C;  1ZUQ A;  3E89 A;  3RWR D;  1H8H G;  3KKY A;  4JI1 O;  3BHP A;  3B09 A;  4GX2 A;  3AEI A;  2NR5 A;  4JI0 O;  3OEH G;  3QO8 A;  1JR9 A;  4MVM A;  4L87 A;  2P5O A;  2GHY A;  3K3W A;  3E86 A;  1OCO B;  2JEU A;  4GKJ B;  4X1I A;  4D6T H;  2DQ0 A;  1HR0 B;  1Q6H A;  3CCV V;  4CS4 A;  1FXK A;  3JAK A;  4X20 B;  3OTO B;  1COW G;  5E79 Z;  4FPP A;  2UXX A;  3AK3 A;  3BPZ A;  4BR6 A;  2ARH A;  4AIL C;  4DW1 A;  1G8M A;  4JI4 O;  2JJ1 G;  5DED A;  3IJ4 A;  4DXW A;  1Q8I A;  2IU0 A;  3L74 H;  3HKE A;  3N2G A;  1O9G A;  4I55 B;  3ABT A;  1N36 O;  3B77 A;  4HZ3 A;  5LMN O;  2YIB D;  4DV0 O;  1XNR B;  2UU9 O;  2KKW A;  5B5E Z;  5EBM C;  5KX5 A;  3L9D A;  2ZR3 A;  1ENV A;  2LFS A;  1B04 A;  1EN6 A;  3UKM A;  2OWO A;  2Y69 B;  5IJ0 B;  2R9R B;  3F5W C;  4DV6 O;  1URF A;  1ZX3 A;  5GON A;  1V9P A;  2QM7 A;  2QSA A;  2AHY A;  4LFC O;  3CRA A;  4TQF A;  2Y4T A;  2L6L A;  1E1Q G;  1VQN V;  4BIO A;  4F6R A;  5EYP A;  4JYB A;  3EHB B;  5IJ9 B;  4PD4 F;  3OMN B;  4LF4 O;  1IDS A;  4R6Z A;  2YI9 A;  1L1F A;  4B3T B;  1NJI W;  1GTO A;  3DGE A;  4IT5 A;  1M90 W;  2XTA A;  1G4Y B;  4JI7 B;  2XAH A;  2R9A A;  1ZTE A;  2LO1 A;  5E1A C;  1ZLZ A;  1YIT V;  5B1N A;  4FJC C;  2PGG A;  5H5N A;  1R3J C;  3E22 B;  2WLI A;  1PPJ H;  1KP3 A;  4K8Z A;  4UCT A;  1BGY H;  5LHH A;  1Q6U A;  4O4H A;  2EIL B;  4TV9 B;  3AG3 B;  1D5N A;  1GM9 A;  5GTH Z;  2E74 B;  3ZMS A;  5IDJ A;  3CRC A;  2Y0I A;  4LCU C;  3AK2 A;  5CBH A;  1OZ0 A;  2KB1 A;  1FFX B;  3SYQ A;  1VIB A;  3R66 A;  1Q3E A;  1K5Q A;  3ABL B;  3CJH B;  3JD0 A;  1RSO A;  1FAF A;  2Y3V A;  1M57 B;  1AI6 A;  1Y74 B;  2EBO A;  1VAR A;  4I55 A;  4KL1 A;  1N33 O;  2E76 B;  3C3S A;  2DOS A;  4NTY A;  1ZL8 B;  1PL0 A;  4OX9 O;  2EZO A;  3O9O A;  4KXR A;  2Q9L A;  2ZT9 B;  4GX5 A;  3VBB A;  3K59 A;  2QA4 V;  2IM9 A;  4I5S A;  5EIB C;  2HKO A;  5IJ0 A;  1N0J A;  5LHG A;  2UUC O;  1O9H A;  4B3S B;  4PA7 A;  1CEZ A;  4WBN B;  2V4D A;  1R6N A;  4YY3 B;  3PJS K;  2X6A A;  4Q20 A;  2CDY A;  4KFM A;  1XMO B;  3B4S A;  5IJ9 A;  4ZBM A;  2LFR A;  1QVG U;  1NTK H;  5KAI Z;  4JI8 B;  4YJ2 A;  1DLB A;  4O2A B;  1IBL B;  3THO A;  3N2K A;  1SRY A;  2Q5Z A;  3T1Y O;  5BZB A;  4LF9 O;  4DR5 O;  1WPX A;  1I0H A;  2NLJ C;  1KMI Z;  3H1H H;  1NR7 A;  4GLX A;  4CH4 A;  4TT3 G;  1K7D A;  2Z5U A;  5CA1 B;  4MSW C;  5LGU A;  3GWO A;  5EBL C;  4MTX A;  3F5T A;  2HEP A;  1RFY A;  4UB8 Z;  4NXM B;  1Z5V A;  3K79 A;  1NS1 A;  1F7Y A;  4DV4 O;  5KHG A;  3J80 N;  4AQY O;  5IYB O;  1NZ6 A;  3ZRX A;  4JAV A;  5IYZ B;  4TV9 A;  3ABL C;  3K9S A;  1MZE A;  3ZHU A;  2F1M A;  5H6Q A;  4JTD B;  4DR3 B;  4PI2 A;  3STL C;  5CMU A;  1RM1 B;  1JFF B;  1F51 A;  4JTC B;  3WG7 B;  4C7U A;  3CXH F;  2UXC O;  1JX9 A;  2OTL V;  4LF6 B;  3CRR A;  1KD1 W;  1FFX A;  4B3M O;  3CJH A;  3F7V C;  1K4C C;  1H2K A;  2UUB B;  4X65 O;  1Y74 A;  2RQ6 A;  5LXT A;  5ITZ B;  3TXS A;  4LH6 A;  4DV7 B;  3CRM A;  3CEI A;  2P67 A;  1E79 G;  2ZE7 A;  1GM7 A;  1OJH A;  5JCO A;  4P30 A;  1IZ3 A;  3T4Z A;  1VF5 B;  4JF3 A;  2JRI A;  3AG4 C;  3JD2 A;  4UVA A;  3OEE G;  2OIE A;  1K73 W;  3ZRS A;  1TA8 A;  4X9Q A;  2WA4 A;  3JSL A;  1S76 D;  3E8F A;  4CKN A;  3CS5 A;  4TSF G;  2FL4 A;  4UUJ C;  4DR7 B;  1XNQ B;  1QR8 A;  1PV0 A;  2A3Q A;  4FLT A;  1XQ8 A;  1PNK A;  2XAQ A;  2LW1 A;  5CA0 B;  4O2A A;  2ZR2 A;  4FVM A;  3OUS A;  1KP2 A;  4KP4 A;  1U97 A;  2W0F C;  5F2V O;  4G2K A;  3UCS C;  3BEH A;  4H37 A;  1BL8 A;  1WLE A;  4DV3 O;  3W7X A;  1YJW V;  4MS2 A;  4JI6 B;  4MVZ A;  2IU3 A;  1RM1 C;  3QTC A;  3ASO C;  4X89 A;  2IJH A;  5JH7 B;  1ROP A;  4X1Y B;  1QU7 A;  4BW5 A;  5LOV A;  5IYZ A;  3MHS C;  4UVC A;  4NTX A;  2AZ0 A;  2UXB O;  2PY5 A;  1VQK V;  4JI5 O;  5KMG B;  3I55 V;  2ZIO A;  1AVM A;  1EN4 A;  3CE2 A;  4RUF A;  1JFF A;  4UFZ A;  2DMX A;  3S3X A;  2WLM A;  1VQL V;  5B1A C;  4NXN O;  3QG5 A;  3L71 H;  5EC2 C;  2EX3 A;  1Q81 W;  1Z5W A;  1B6Q A;  3U10 A;  1GKF A;  3A0B Z;  3IC9 A;  1AI7 A;  4DR2 O;  4K0K O;  5B66 Z;  1QBZ A;  5ITZ A;  4JI4 B;  1BE3 H;  5DM6 V;  4JPR A;  4TUY B;  3SJA C;  4A5U B;  4JAA A;  3DXR B;  2PI5 A;  3CCM V;  3JYC A;  2EIJ B;  4X64 B;  1VQP V;  2VRZ A;  3CWB H;  4I0X B;  5LMN B;  2QWQ B;  1SC5 B;  3LDC A;  4I50 B;  3AG1 B;  1BHA A;  3CC4 V;  4UB6 Z;  2D3O W;  1BQZ A;  2CTP A;  2GUZ B;  2CK3 G;  3ZJZ A;  1DTO A;  3X2Q B;  4UV9 A;  2ZDI A;  1XOU A;  1VF6 C;  3OMI B;  1K8A W;  2HR3 A;  2RMK B;  1XHX A;  5L3F A;  5CA0 A;  2XAS A;  1TVK B;  3ZRV A;  1DF5 A;  4DUZ B;  2QDO A;  4HYO A;  2XT9 A;  2BTO A;  2PF4 E;  3J7A U;  2Y48 A;  3E2E A;  1IBM O;  1WA8 B;  4FLW A;  3MUD A;  3JAK B;  1XI1 A;  3ASN B;  3FB8 C;  5LP6 B;  1P4R A;  1GH6 A;  3OUF A;  4PA3 A;  3OW2 U;  1IBK O;  5FPO A;  1SQV H;  3RN4 A;  3A8T A;  3HKB B;  5JH7 A;  4DO2 A;  2OCH A;  4WCE V;  4CC5 A;  1SQP H;  2HHH O;  3AG7 A;  2KG7 A;  3FB6 C;  5H2F Z;  3SYA A;  4PA6 A;  2QWO B;  3CYO A;  1HNZ B;  2OIG A;  3SPI A;  5KMG A;  4WFB V;  3N27 A;  2P4K A;  5KX5 B;  1W59 A;  1B06 A;  4GT1 A;  4NVP A;  3ZCC A;  2YS8 A;  4HNA B;  5BR8 B;  4LFB O;  1M93 A;  1I5X A;  3JCU Z;  4G28 B;  1QNM A;  4TUY A;  2LGW A;  3QVN A;  3JAS B;  3ZN1 A;  3DXR A;  4H13 B;  5EYP B;  2A9H A;  3C3T A;  4FK5 C;  2BSK B;  2P06 A;  3MDS A;  3SDL A;  3I5D A;  3H01 A;  4FM0 A;  4QPJ A;  4I0X A;  1QR9 A;  1H2N A;  4I50 A;  2YC0 A;  4OX9 B;  5IYC O;  3A0R A;  5B1O A;  2CGN A;  1R3L C;  2GUZ A;  3HKC B;  2P6J A;  4LF7 O;  2K9P A;  4PA4 A;  4NTW A;  3M99 B;  1XBL A;  1EBO A;  2ETN A;  3Q0X A;  1FXK C;  1IXB A;  3ASN C;  3CB2 A;  3HPL C;  2XAF A;  3BAA A;  4DR6 B;  1DF4 A;  3B40 A;  4U3J B;  2WLI B;  5LP6 C;  3TJT A;  1TVK A;  3CHX A;  4W4K A;  1QVF U;  3PYI A;  4JI2 O;  2VQE O;  4WFF A;  5DN6 G;  4MVS A;  4LF5 O;  4DK1 A;  3ZN0 A;  2X6C A;  4O4H B;  1WA8 A;  4U3F H;  2UXD O;  2Y0P A;  3SJC C;  1WB8 A;  1AP5 A;  5CHX A;  5LP6 A;  2AHZ A;  1NT2 B;  2A79 B;  1FJG O;  3T1Y B;  1VQ4 V;  1N34 O;  4N23 A;  1M5I A;  3CPW U;  4DV5 B;  1WPB A;  1TUE B;  2CTQ A;  4DR5 B;  5JJE B;  3QO5 A;  3HKB A;  1RSO B;  3NXS A;  2WLK A;  4GCZ A;  1GN6 A;  3ABM B;  3U0Z A;  1H38 A;  2F43 G;  1JOY A;  3ZHQ A;  2PI4 A;  2VQF O;  2MW2 B;  3D8C A;  2HP8 A;  1YTF B;  2FML A;  2B1I A;  4BW9 A;  3K0D A;  1A32 A;  1EN5 A;  4LR3 A;  4AQY B;  4JTA B;  1SZT A;  4NR1 A;  1KU9 A;  4HNA A;  3RT3 C;  1BQ0 A;  3Q4H B;  2YIC A;  1W0J G;  1Q7Y W;  1NU1 H;  3T1H B;  1XEQ A;  4I9Q A;  2UUA B;  3L72 H;  2GSM B;  3JAS A;  1HNX B;  4I4T A;  5D5P A;  1J5E O;  4PV1 B;  5IWA O;  1VQ9 V;  1JJO A;  5EIB D;  2BSK A;  3H9V A;  4X65 B;  3VQY A;  4CZZ A;  4RQF A;  1L8D A;  4ZI7 A;  3K06 A;  1HDJ A;  4YJ2 B;  5IYD O;  1K92 A;  1MG1 A;  1WB7 A;  1YVW A;  3N2K B;  5D5Q A;  2LQT A;  2YID A;  2ZM6 O;  3JCZ A;  1OCO C;  3DTU B;  3GB7 C;  3HKC A;  2E5L B;  1JCH A;  1SA0 A;  5A2Q N;  3SPG A;  4LNU B;  1JQ0 A;  2B5U A;  2WLL A;  1SER A;  2JVD A;  4U3J A;  4RQE A;  3FYE B;  5EC1 C;  5CBG A;  3T4D A;  4DUY B;  4DR1 O;  4XBF A;  3OGC C;  2DN9 A;  1H2L A;  5LGT A;  3ABM C;  3CCL V;  1Y76 B;  3M8A A;  1KQS U;  4X1K A;  3JD4 A;  3VQW A;  2XND G;  3KCY A;  4O2B B;  2EJ7 A;  1FXH A;  2A0L A;  2BTQ B;  2F66 C;  5LMU O;  4W4L A;  4DV3 B;  1RPR A;  1Y66 A;  2QTS A;  3CMA V;  4JYY A;  1YF2 A;  3ZMU A;  3CXC U;  1TGO A;  5LXT B;  4LFA O;  1Z2G A;  2Y69 C;  1V55 B;  1VMG A;  5FNV B;  3OD4 A;  1XMQ O;  4MT8 A;  4Q6G A;  2ZNI A;  1IUR A;  1VEW A;  1U96 A;  4X66 O;  1H2S B;  2IJJ A;  1GMG A;  2E75 B;  4LWS A;  4J7K A;  2WLJ A;  2UXB B;  4IYI A;  4IYH A;  3Q4H A;  3OR7 C;  1F4M A;  2ZQM A;  1I94 B;  5LA6 A;  4QIW F;  2IBZ H;  1KEC A;  3ZED A;  1DGS A;  2ITC C;  2QR4 A;  5CN0 A;  2ZXW B;  1VP7 A;  1W0K G;  5LYJ A;  1N8R W;  2OYQ A;  4YIP A;  3IGA C;  5JJJ B;  2Q7G A;  4IIJ B;  1Q90 D;  2X7R B;  2CH7 A;  3W7U A;  3ETD A;  4JYA O;  4LH7 A;  1SQF A;  1OCR B;  1K5S A;  5FLX N;  4PDV A;  4H44 B;  4JGS A;  3CCE V;  4GKJ O;  5LBQ A;  3E8B A;  1EZV H;  4LNU A;  2EIL C;  3K0G A;  3II6 A;  2W6I G;  3AG3 C;  3RBZ A;  5J9P C;  3AG2 B;  1NTZ H;  3AK1 A;  2AZ2 A;  4CKM A;  3OTO O;  1IXM A;  1OV9 A;  3BVO A;  4E4E A;  3B8M A;  4DV2 O;  2QM8 A;  3LNN A;  3UO2 A;  3OE7 G;  4KHP O;  3G71 V;  4K3A A;  5LOV B;  4HBN A;  2QJ1 A;  5B3S B;  1M57 C;  3BCC H;  4TV8 B;  2F4V B;  2L35 A;  2JS3 A;  1S5L Z;  3JAW B;  1Y76 A;  2ITD C;  1YIJ V;  4LBE C;  1AP6 A;  1N32 B;  2BCC H;  4LP8 A;  2M6Y A;  2Q7E A;  1XNR O;  4O2B A;  2H3O A;  2EIK B;  2QKS A;  2BTQ A;  3P32 A;  3ZMT A;  4LF8 B;  5JCO C;  2RNB A;  2IW5 A;  2XUM A;  1OCC B;  5EBW C;  3E83 A;  1QCE A;  2QWN B;  2LJ2 A;  4FFK A;  4P9O A;  4RAI A;  5FNV A;  4DW0 A;  1R1B A;  1SF9 A;  1M1K W;  3K57 A;  5H9C A;  1GAX A;  2ZE5 A;  2YXY A;  4JV5 O;  1I7F A;  2YIA A;  2CGO A;  3P30 A;  2ZXW C;  1HNW B;  4RUE A;  1EM1 A;  3UO3 A;  3UQ8 A;  4GKK O;  3L75 H;  2QWR B;  3BY6 A;  3RGB A;  4DR4 O;  1BT8 A;  4JZ2 A;  4B3T O;  2PYL A;  4JI7 O;  1OCR C;  5HFL A;  1XL4 A;  4OXS A;  3JAR A;  1QQC A;  4IIJ A;  1L0N H;  4FZ1 A;  5JWP A;  2RDC A;  4J7Z A;  1KKD A;  1JJ2 U;  4E2L A;  5KUK A;  4MW3 A;  4ABM A;  5CBF A;  2VWJ A;  4UCR A;  4UCV A;  3L73 H;  2JK5 C;  4JI3 B;  2EIM B;  4O4L B;  3VQX A;  1I08 A;  3SR2 A;  4EKW A;  3VQV A;  4B3R B;  2XOK G;  4ZOL A;  2LGQ A;  2B9Z A;  3ML0 A;  2RCV A;  3ZRW B;  4LF7 B;  2Q0O C;  3ZHT A;  2Y3W A;  2PZS A;  2AGA A;  3TXQ A;  3QF7 A;  4JI1 B;  3WG7 C;  1HP8 A;  3TK1 A;  3SJQ C;  4XDL A;  2QWP B;  2KG7 B;  2N04 A;  4JI0 B;  1WAZ A;  1KYO F;  2HFE C;  4TV8 A;  2DWD C;  3H1K H;  2ODM A;  3JAW A;  1OCC C;  5LHI A;  3JAM N;  2R9I A;  3NR7 A;  1TUB A;  3U11 A;  1S0V A;  5JQG B;  1VQ7 V;  1AJQ A;  1GK9 A;  4QNH B;  1MA1 A;  2N05 A;  2UXD B;  4J9Z B;  4IGG A;  2C2A A;  5JJN B;  2X0L A;  3K5L A;  4H0L B;  4FLZ A;  1BZK A;  4OGQ B;  3OAA G;  4PJ0 Z;  3WB2 A;  3CC7 V;  1ORQ C;  1WP7 A;  2YDE A;  2IH1 C;  4B3S O;  2HJF C;  2W0X A;  4UXN A;  1Q6I A;  1XDC A;  1N4C A;  1N36 B;  1XL6 A;  2FB5 A;  1KKC A;  2ZDI C;  5CB4 B;  1AI4 A;  4DV0 B;  3TGU H;  1YXB A;  3FAV B;  3EFF K;  2UU9 B;  5L3D A;  1ARO P;  5B1B B;  3RYI A;  4EFB A;  4FLY A;  2EIN B;  4JI8 O;  3DC5 A;  1SQB H;  1IBL O;  1H8E G;  2BE3 A;  4GUN A;  4JAU A;  5JVD A;  2JGU A;  5TIS Z;  3E8G A;  2EIM C;  2EZP A;  4DV6 B;  2Y4U A;  2DYR B;  3BFR A;  3VOU A;  4MVU A;  1K9M W;  3M7M X;  3W7W A;  3CRQ A;  4LFC B;  1NQT A;  3ZMV A;  3K5N A;  5DEC A;  4H33 A;  3SPJ A;  2F95 B;  5KHK A;  1J5E B;  1J95 A;  3EVK A;  1BSM A;  3K9A A;  3CSX A;  1D5A A;  4R50 A;  4RWU A;  2YXL A;  3FYI B;  3G4S V;  4LF4 B;  3FB5 C;  4O4L A;  2PTM A;  5FPR A;  3B8N A;  1THZ A;  2HVK C;  5KHI A;  1EFR G;  1MMM A;  5C93 A;  5BXZ A;  3ZRW A;  4XA4 A;  4DR3 O;  1KB9 F;  3PN1 A;  1NH2 B;  4TWK A;  1VQ8 V;  1R73 A;  3APO A;  3ZMZ A;  2HG5 C;  3LSU A;  1RP3 B;  1RPO A;  4LF6 O;  3SPH A;  2GTA A;  4AI8 A;  3P3N A;  5KA6 A;  2UUB O;  2ILM A;  2MK3 A;  3RFR A;  4DRX A;  3CCJ V;  3FX7 A;  1Y4M A;  4PDR A;  4YJ3 B;  1S77 D;  4DR1 B;  4Z1M G;  5KA5 A;  5JQG A;  3D36 A;  2DWE C;  4DV7 O;  3OT7 A;  1JVM A;  4FFB A;  1VF7 A;  1Q86 W;  1AB3 A;  5IE9 A;  2EIJ C;  1X4T A;  4HAM A;  4PHZ A;  1SKV A;  3LSS A;  4YXW G;  1HWY A;  4CS3 A;  3AG1 C;  3DSQ A;  2WSS G;  3O65 A;  4I7Z B;  5B1B C;  1KUQ A;  3JAT A;  1CXZ B;  2N74 A;  3BA9 A;  3JSN A;  4I4T B;  5IT9 N;  2H94 A;  4CH3 A;  4DR7 O;  1XNQ O;  3X2Q C;  3RYC B;  1N33 B;  1TAE A;  5A9G A;  4ZI7 B;  1BHB A;  5CB4 A;  2DYR C;  1XMQ B;  3E35 A;  4FLX A;  3FAV A;  4FIP C;  3LDE A;  2Q6A A;  4B08 A;  4CS2 A;  2GTS A;  1B3Q A;  2AW9 A;  1SA0 B;  1NBM G;  3R65 A;  1AJP A;  2UUC B;  2JEX A;  4OPH A;  4L8J A;  5BMV B;  4F6E A;  3STZ C;  3W7T A;  3GVM A;  2WLL B;  1AIL A;  2P22 C;  2P7T C;  2F23 A;  4WFE A;  3OM3 B;  2BOB C;  3SPC A;  4JI6 O;  4GFC A;  1NVP B;  2IJK A;  3WB1 A;  3CME V;  4U7O A;  3KZI Z;  4AHC A;  4YHH O;  2D2C B;  2RJZ A;  4JYA B;  3GWK C;  2VS0 A;  3RYH B;  1K3E A;  2O57 A;  1GN3 A;  4LF9 B;  1H2M A;  4X1K B;  1GO3 F;  2QTO A;  4UCU A;  2FTK A;  4D7S A;  1Y67 A;  3ABK B;  1WP8 A;  3H1L H;  3LNM B;  2OCC B;  1S5J A;  4FZ0 A;  1XIL A;  5EZY B;  1T5E A;  1YTF D;  4DV2 B;  3W7S A;  4QE9 A;  4IL6 Z;  1NI8 A;  2OTJ V;  5KHH A;  1FD9 A;  4DV4 B;  1R3K C;  3ETE A;  4KHP B;  2CE4 A;  1NTM H;  4YJ3 A;  4GEX A;  3FKS G;  2FKX A;  1FYJ A;  4FM1 A;  4GX0 A;  2DJV A;  4OPA A;  4LWS B;  1SS3 A;  1K4D C;  1H2G A;  4PA9 A;  5GTI Z;  2XAJ A;  4X64 O;  5K1X A;  4DK0 A;  4BIZ A;  1E1R G;  4QPK A;  5LA6 B;  1YJN V;  2V7Q G;  3BRC A;  1UPG A;  2UXC B;  4QJF B;  3ICX A;  1WNS A;  4B3M B;  2HJD A;  1LR1 A;  3FFQ A;  1F23 A;  1S72 V;  4BAY A;  1MSD A;  2K1E A;  5LYJ B;  2XHB A;  2JIZ G;  4R7C A;  5KLV H;  3RYC A;  2Q69 A;  3IC7 A;  4CC6 A;  4J7J A;  1M56 B;  4K35 A;  2CH7 B;  1QLE B;  3FD9 A;  4U7N A;  3B2E E;  5J2T B;  1MSW D;  1WJZ A;  4JV5 B;  1XHZ A;  3OFN G;  4TOI A;  3Q0Y A;  4DUZ O;  4FLV A;  4MVQ A;  2WLN A;  4GKK B;  1NKD A;  2GV9 A;  3HKD B;  4O4J B;  5CA3 A;  5BMV A;  4DR4 B;  2JGD B;  1AJN A;  4BIU A;  1UJW B;  2QKC A;  2ZE6 A;  1S3J A;  3BA8 A;  4O4I B;  2EUL A;  1LNQ A;  3RWR A;  3ABK C;  1IX9 A;  2E3C A;  2Z3Y A;  3HR0 A;  2QGN A;  2OCC C;  4EEQ A;  5KAF Z;  5AG2 A;  5L3C A;  1PKX A;  1G1X B;  3K03 A;  3JAL B;  3RYH A;  3ZHR A;  1HNZ O;  1Y6X A;  5EK0 A;  3TCU A;  1QHT A;  3IAY A;  1AI5 A;  1YSC A;  1FKA O;  3ETQ A;  1PNM A;  3FB7 C;  4X62 O;  3F7Y C;  5J2U B;  3SYO A;  1Q5O A;  1US6 A;  1DK1 A;  4X20 A;  4J10 A;  1Q43 A;  4XDK A;  1AR1 B;  3G6E V;  5EZY A;  5BR8 O;  2EJR A;  4FM2 A;  1NR1 A;  2ATK C;  3OTF A;  4GX1 A;  4FLU A;  3WFV A;  4ZIB A;  3UM7 A;  4JI5 B;  3IFX A;  1QLN A;  1GN2 A;  4ZHQ B;  4NXN B;  1M56 C;  1KBH A;  4DV1 O;  1QLE C;  1YEW A;  2YIB A;  1OHH G;  2Q73 A;  2KQX A;  1KC8 W;  4IHJ B;  4K0K B;  3D3Q A;  4DR2 B;  1YDX A;  3RYF B;  1GN4 A;  1OCZ B;  1IK9 A;  3JAR B;  2PYJ A;  5CJ0 A;  4J41 A;  5LL6 Y;  5J2T A;  2ZKO A;  2WWW A;  4DR6 O;  3DC6 A;  5KHJ A;  1L0L H;  3OGI B;  2P90 A;  1UFI A;  4ZOL B;  3K04 A;  3AG4 B;  1HR0 O;  3HKD A;  4O4J A;  3P3P A;  2JGD A;  4NKG B;  1MOF A;  3ZX6 A;  3WU2 Z;  4EFE A;  2LP7 A;  4O4I A;  1YI2 V;  2M7W A;  5H6R A;  4DV5 O;  1PM9 A;  4CH6 A;  1SES A;  4JZG A;  5KUM A;  4EB6 B;  4GFA A;  2Q0A A;  3MD0 A;  4TQD A;  3QNE A;  3UT5 B;  3E22 A;  1TUB B;  3JAL A;  1V55 C;  2B1G A;  3T1C A;  4FMT A;  2Q68 A;  2HVJ C;  1IBM B;  1FFT B;  1FU1 A;  3MHH C;  2NN4 A;  3OR6 C;  4I9W A;  5J2U A;  2HLD G;  2WA3 A;  2ZD9 A;  1XUQ A;  3LUT B;  4MTO A;  2ZCE A;  1W2B U;  1IBK B;  3HB3 B;  2DW4 A;  1PD3 A;  4QE7 A;  3T1H O;  1BCC H;  3ASO B;  4MTG A;  5FL7 G;  3CCQ V;  2HHH B;  1ZWI C;  2UUA O;  3C90 A;  3LDD A;  2NNU A;  1AR5 A;  4QGP A;  1HNX O;  2QKA A;  1ZSP A;  3RVZ A;  1OCZ C;  4PEL A;  4B7E A;  1P84 F;  1M9N A;  2W6J G;  3RYI B;  2CTR A;  4ZHQ A;  5B1A B;  1YZB A;  2WLH A;  1ZL8 A;  3ZIA G;  1CPY A;  2YSU B;  1GM8 A;  4GEU A;  3I56 V;  5JVD B;  4IHJ A;  4LFB B;  1V54 B;  3J81 N;  3CC2 V;  1FXV A;  3SR2 C;  1X59 A;  3RYF A;  2E5L O;  3ETG A;  2Q7H A;  4XDJ A;  2UXN A;  1EZJ A;  2IJI A;  3AG2 C;  3E8H A;  4WBN A;  2AXT Z;  2FYU H;  4UCO A;  3CCR V;  5HFM A;  3G6B A;  3K08 A;  4J80 A;  3TET A;  4DUY O;  1R3I C;  4CH5 A;  4WF9 V;  1JMK C;  4CKP A;  2Q67 A;  2ADP A;  4LC1 A;  3KCX A;  5B3S C;  4JYC A;  5L3B A;  2ZIM A;  3BAB A;  1VQM V;  4F4L A;  1P7B A;  4G79 A;  3ZS8 C;  2DYS B;  1I5Y A;  3CP1 A;  1CP9 A;  4NB5 A;  4PDM A;  2CTW A;  4MVR A;  1VQO V;  4G27 B;  2EIK C;  1AR4 A;  4EB6 A;  5GW7 A;  3JD1 A;  5CA1 A;  2Z0A A;  4DRX B;  3CD6 V;  3L70 H;  1SQQ H;  4JI2 B;  3UT5 A;  1K97 A;  2VQE B;  4LF5 B;  4FFB B;  1FS0 G;  4ASU G;  4YHH B;  2R70 A;  3CCU V;  1PP9 H;  2JS5 A;  4BWA A;  1R6T A;  1FJG B;  3WB0 A;  3QO7 A;  1N34 B;  2X6B A;  5L3E A;  3KG2 A;  3JAT B;  1I94 O;  1M4U A;  1YCI A;  5K1P A;  2A06 H;  2WPD G;  4K8X A;  4YY3 O;  4GYC B;  1S5H C;  2VQF B;  3H1J H;  4KUM A;  1V54 C;  3H1I H;  1XMO O;  4PDL A;  2XAG A;  2P4V A;  3A0H Z;  2YEV B;  2PUS A;  4P9P A;  4UCS A;  4WFG A;  2JJ2 G;  1BMF G;  3RVY A;  3JD3 A;  5C8Y B;  2YXH A;  2CAZ C;  4J42 A;  3SYC A;  4WFA V;  1LUW A;  2QE7 G;  3G67 A;  4Z2W A;  2G38 A;  3EXA A;  3ABU A;  4R8C A;  2H8P C;  2V1D A;  1D2D A;  3A2F A;  4CBC A;  1ZAU A;  3T2M A;  5IWA B;  1SQX H;  2CUG A;  2Q4P A;  4P2Z A;  2OT5 A;  4NXM O;  2DYS C;  1LUV A;  1G6U A;  4UVB A;  1F4N A;  4RO2 A;  4UV8 A;  2R72 A;  2QM4 A;  3ZHS A;  1SET A;  1SZX A;  2F93 B;  3RW0 A;  2ZM6 B;  4MW8 A;  4MTF A; 
#chains in the Genus database with same CATH homology
 1XNQ B;  5EZY B;  1T5E A;  4DV2 B;  4D7T A;  2ZNJ A;  5KHH A;  1XQ8 A;  4X1I B;  4DV4 B;  4FLT A;  1I94 B;  5LA6 A;  4KHP B;  4YJ3 A;  4FM1 A;  3ZED A;  1DGS A;  5CA0 B;  4O2A A;  5CJ4 A;  4FVM A;  5LYJ A;  5K1X A;  4DK0 A;  2OYQ A;  5LA6 B;  5JJJ B;  2Q7G A;  4IIJ B;  3BRC A;  2UXC B;  3ICX A;  1WNS A;  1P49 A;  3K5M A;  4B3M B;  3SGI A;  3FFQ A;  3HKE B;  1SQG A;  4X1Y A;  3N2G B;  4LH7 A;  1SQF A;  5LYJ B;  4JI6 B;  2XHB A;  3RYC A;  4CC6 A;  3QTC A;  3SJB C;  1WN7 A;  5JH7 B;  1HW7 A;  4PI0 A;  3K5O A;  4X62 B;  5LMU B;  3B2E E;  4LNU A;  5J2T B;  3II6 A;  3MAQ A;  4JV5 B;  4X1Y B;  5LOV A;  1XHZ A;  5IYZ A;  4TOI A;  2PY5 A;  4FLV A;  4LFA B;  5KMG B;  2ZIO A;  3LNN A;  4GKK B;  4UFZ A;  1JFF A;  5GON B;  2GV9 A;  3QG5 A;  3HKD B;  4O4J B;  4X66 B;  5BMV A;  4DR4 B;  5LOV B;  2EX3 A;  4HBN A;  2QJ1 A;  4TV8 B;  1Z5W A;  5C8Y A;  3U10 A;  2F4V B;  4F6R B;  2VWK A;  3JAW B;  3BA8 A;  4O4I B;  1N32 B;  5ITZ A;  4JI4 B;  4DV1 B;  4TUY B;  2Q7E A;  3SJA C;  4O2B A;  3RWR A;  2BTQ A;  2E3C A;  2ZIN A;  4EEQ A;  3K58 A;  4LF8 B;  5JCO C;  4X64 B;  2YI8 A;  3JAL B;  3RYH A;  5LMN B;  1QHT A;  4I50 B;  5FNV A;  3IAY A;  3RWR D;  3BHP A;  3ETQ A;  3K57 A;  5J2U B;  1I7F A;  2YIA A;  1Q5O A;  4X20 A;  2P5O A;  1Q43 A;  1HNW B;  5EZY A;  3UQ8 A;  4GKJ B;  4X1I A;  1HR0 B;  3RGB A;  4CS4 A;  1XHX A;  4FM2 A;  3JAK A;  4X20 B;  5CA0 A;  1TVK B;  3OTO B;  2PYL A;  3OTF A;  4DUZ B;  4FLU A;  4ZIB A;  4JI5 B;  3BPZ A;  4AIL C;  2BTO A;  4ZHQ B;  4NXN B;  3JAR A;  1QQC A;  4IIJ A;  1YEW A;  4FLW A;  3MUD A;  2YIB A;  3JAK B;  1XI1 A;  1Q8I A;  2VWJ A;  4IHJ B;  4UCR A;  4UCV A;  3HKE A;  5LP6 B;  3N2G A;  4K0K B;  4DR2 B;  1O9G A;  4I55 B;  4JI3 B;  3RYF B;  1IK9 A;  4O4L B;  3JAR B;  3VQX A;  3SR2 A;  2YIB D;  3VQV A;  1XNR B;  5FPO A;  4B3R B;  2KKW A;  3HKB B;  5JH7 A;  2PYJ A;  4ZOL A;  5CJ0 A;  5KX5 A;  4CC5 A;  5J2T A;  4LF7 B;  5KHJ A;  1B04 A;  1HNZ B;  2OWO A;  5IJ0 B;  2PZS A;  5KMG A;  3QF7 A;  4JI1 B;  5GON A;  4ZOL B;  1V9P A;  5KX5 B;  3HKD A;  4O4J A;  4NVP A;  4JI0 B;  4TQF A;  4HNA B;  4TV8 A;  4F6R A;  5EYP A;  5BR8 B;  1M93 A;  3JAW A;  4EFE A;  5IJ9 B;  4O4I A;  1TUB A;  3U11 A;  5JQG B;  2YI9 A;  4CH6 A;  4TUY A;  4EB6 B;  2UXD B;  4B3T B;  2Q0A A;  3JAS B;  5EYP B;  4JI7 B;  4TQD A;  5JJN B;  3K5L A;  3UT5 B;  3E22 A;  4FLZ A;  2R9A A;  4FM0 A;  1TUB B;  3JAL A;  4I50 A;  3WB2 A;  1IBM B;  4OX9 B;  1FU1 A;  5J2U A;  2PGG A;  3HKC B;  3E22 B;  1N36 B;  2ZCE A;  5CB4 B;  1IBK B;  4DV0 B;  2UU9 B;  4K8Z A;  3RYI A;  4UCT A;  4EFB A;  4FLY A;  2HHH B;  3CB2 A;  4O4H A;  4TV9 B;  3BAA A;  4DR6 B;  4U3J B;  5LP6 C;  1TVK A;  3CHX A;  5JVD A;  2JGU A;  4DV6 B;  3RYI B;  4ZHQ A;  4DK1 A;  3M7M X;  4O4H B;  4LFC B;  1FFX B;  1Q3E A;  3K5N A;  3SJC C;  2F95 B;  1RSO A;  5KHK A;  5JVD B;  4IHJ A;  1J5E B;  5CHX A;  5LP6 A;  1NT2 B;  4LFB B;  3CSX A;  1D5A A;  4KL1 A;  2YXL A;  4I55 A;  3T1Y B;  3SR2 C;  3RYF A;  4LF4 B;  1M5I A;  4O4L A;  4DV5 B;  1WPB A;  2Q7H A;  2PTM A;  4DR5 B;  5FPR A;  5JJE B;  5KHI A;  3HKB A;  4WBN A;  3U0Z A;  4UCO A;  3K59 A;  4XA4 A;  2IM9 A;  5EIB C;  3PN1 A;  4BW9 A;  5IJ0 A;  4LR3 A;  1O9H A;  4CH5 A;  4AQY B;  4B3S B;  1JMK C;  4WBN B;  2V4D A;  4YY3 B;  1KU9 A;  2ZIM A;  3BAB A;  4HNA A;  3ZS8 C;  1XMO B;  4DRX A;  3RFR A;  5IJ9 A;  3T1H B;  4YJ3 B;  4DR1 B;  5JQG A;  4I9Q A;  2UUA B;  4JI8 B;  4FFB A;  4YJ2 A;  4EB6 A;  4O2A B;  1VF7 A;  1IBL B;  3THO A;  5CA1 A;  3JAS A;  1HNX B;  3N2K A;  4I4T A;  5D5P A;  1X4T A;  4PHZ A;  1SKV A;  4DRX B;  1JJO A;  5EIB D;  4X65 B;  3VQY A;  4JI2 B;  3UT5 A;  4CS3 A;  2VQE B;  1L8D A;  4ZI7 A;  4LF5 B;  3DSQ A;  1KMI Z;  4FFB B;  4YJ2 B;  3JAT A;  4GLX A;  4CH4 A;  4YHH B;  2R70 A;  5CA1 B;  3BA9 A;  3N2K B;  3JSN A;  4I4T B;  2JS5 A;  5D5Q A;  4BWA A;  4CH3 A;  1FJG B;  3WB0 A;  3HKC A;  3RYC B;  1N33 B;  2E5L B;  1TAE A;  2HEP A;  1N34 B;  4ZI7 B;  4NXM B;  1Z5V A;  1SA0 A;  5CB4 A;  1XMQ B;  4FLX A;  5KHG A;  3JAT B;  4LNU B;  1M4U A;  5K1P A;  5IYZ B;  4TV9 A;  4K8X A;  4GYC B;  4B08 A;  4CS2 A;  2JVD A;  2VQF B;  4U3J A;  2F1M A;  1SA0 B;  4DR3 B;  4PI2 A;  1JFF B;  4DUY B;  2UUC B;  4L8J A;  5BMV B;  2PUS A;  4LF6 B;  4UCS A;  1FFX A;  2P22 C;  5C8Y B;  2CAZ C;  2UUB B;  2RQ6 A;  5LXT A;  5ITZ B;  3WB1 A;  4LH6 A;  4X1K A;  3VQW A;  4O2B B;  4DV7 B;  2BTQ B;  3A2F A;  2F66 C;  4AHC A;  4DV3 B;  2RJZ A;  1ZAU A;  4JYA B;  5IWA B;  1TGO A;  5JCO A;  3RYH B;  5LXT B;  4LF9 B;  4X1K B;  5FNV B;  4UCU A;  1G6U A;  4Q6G A;  2ZNI A;  4D7S A;  2R72 A;  2QM4 A;  1H2S B;  1TA8 A;  3JSL A;  2F93 B;  2ZM6 B;  1S5J A;  2UXB B;  4DR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...