3SR2C

Crystal structure of human xlf-xrcc4 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC4
publication title XRCC4 Protein Interactions with XRCC4-like Factor (XLF) Create an Extended Grooved Scaffold for DNA Ligation and Double Strand Break Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 47
structure length 218
sequence length 224
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sr2C02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3sr2C01
1FU1A 1M5IA 4XA4A 3RWRD 5CJ0A 2R9AA 3RWRA 2QM4A 5CJ4A 1KU9A 5CHXA 3SR2A 3SR2C 3MUDA 3II6A 1IK9A
chains in the Genus database with same CATH superfamily
4DV3O 4TV9B 3R66A 4GKKB 2QEXV 4X62B 4I0XA 3ASOB 4DR1B 1YXBA 1R3JC 3H01A 1W0KG 1VQ7V 3AK2A 5KHKA 1FAFA 2O57A 3E8FA 5DN6G 2DYRC 2DWEC 1N36O 4AQYB 3PN1A 5FLXN 3OTOB 4JI5B 2IU0A 2JRIA 4UUJC 2PUSA 2UUCO 4BIZA 4UCSA 1K92A 1XILA 3ABUA 2QWPB 3J80N 3CCUV 5LA6B 2YICA 2G38A 1Y66A 1L0LH 1Q43A 4DV6B 4DR6O 1Y76B 2H94A 3UO3A 5LBQA 4MVRA 1S5JA 4WFGA 1FXHA 1XI1A 2Y3WA 3SYOA 2PF4E 2ITDC 4TUYB 3CCJV 2P90A 1NH2B 5J2UA 3WU2Z 2LGQA 5A2QN 2L35A 5CA0B 1OCCB 2JJ2G 2R72A 4JTDB 5LMNO 4DR2B 1AI7A 2K9PA 4NXMO 1X4TA 3C3TA 4NVPA 4PDVA 1S5LZ 3ZCCA 2JEUA 4GFCA 2VQFO 3SJAC 5LYJB 1K3EA 3JARB 1JX9A 4DW0A 1UFIA 1T5EA 2ADPA 3II6A 2K1EA 2ZIMA 1NJIW 1OCRB 1HW7A 4J11A 1NKDA 4CS2A 4DV2B 2E5LB 3Q0XA 1JJOA 4JI3B 1JPXA 3VQYA 4ZHQB 4Z1VA 1PL0A 2EX3A 3TETA 4B3MB 1TA8A 1JQ0A 4PDLA 1AI5A 4OX9O 3UCSC 4GCZA 1M56B 1WA8A 3AG4B 4MVUA 2E3CA 1RPRA 2BCCH 5IYDO 4DR3B 4PDRA 1YTFD 3BVOA 1VQ8V 4KXRA 3CCLV 1Z5VA 2YIBA 4PA6A 4DV7B 1FFTB 4FLXA 2XAQA 2N74A 5IE9A 1IZ3A 4I50B 1NU1H 4LF9O 3ZMVA 1M4UA 4JI4O 2YEVB 1MG1A 3SJQC 3UM7A 3DTUB 5BMVB 4B3RO 4Q20A 4YHHB 1A32A 4PELA 3CRRA 5HFLA 4G27B 1FXKA 3RFRA 4FMTA 3U0ZA 3ABLC 1RM1B 2WLMA 3HKDB 1GM7A 5IYZB 1NBMG 1ROPA 4NKGB 1ZAUA 1PP9H 2UU9O 4EB6B 4FVMA 1VMGA 1MSDA 2ZIOA 3H1IH 3RYFB 4DV4B 1IX9A 3CC7V 1QR8A 4I7ZB 5CA3A 1N0NA 2ZDIC 3FD9A 2PYJA 2DYRB 2Q7EA 4KL1A 3Q4HB 4X66O 4QE9A 4KHPB 1VQNV 4N21A 5KUMA 3J7AU 3VOUA 2Y3VA 2OIEA 2VS0A 4CS3A 3RYCA 2UXXA 5B5EZ 3HR0A 2NR5A 4DRXA 4L87A 4FFBB 1XMOB 3ETEA 1JFFB 5JJNB 1U97A 5IJ9B 2FYUH 4U7OA 3K06A 4DK0A 2RN9A 1GN2A 4E4EA 3G80A 1E1QG 3LNMB 2UUBB 3RVYA 4CBCA 4UCTA 2Y69C 4TQDA 2UXBO 2JIZG 4I55A 4PV1B 5EBLC 2JDIG 1X59A 2Q7HA 3JAWA 3MD0A 3PYIA 1I5YA 3N2GB 1P49A 4B7EA 3ZMUA 1OZ0A 3IFXA 4LF8B 2ETNA 1FXVA 4WFFA 4UFZA 2BE3A 2IU3A 1KD1W 3DC6A 1F4NA 1GK9A 2R70A 3ZJZA 3QTCA 1P4RA 1B6QA 4JI2B 3G67A 5CBHA 5C93A 5KA5A 2V4DA 5LHGA 2P5OA 1H38A 5C8YB 3OW2U 1VQOV 4IT5A 4H33A 4JI1B 3JD3A 3K03A 3IAYA 2DQ0A 3U10A 4YY3B 4YJ2B 1HR0B 3E35A 2QWNB 3L73H 3GWKC 1ZUQA 2F23A 1MSWD 2DQ3A 3CRAA 3B8MA 1VIBA 2EJRA 1GRJA 1S77D 3P3NA 2Y4UA 3DGEA 4X1IB 5FPOA 4XDJA 4D6TH 2CAZC 5JCOC 3CXHF 2KKWA 1R3KC 4O4HA 2UXCB 1NT2B 3P3PA 4FLZA 3ZMSA 4O2BA 3LSUA 1J5EB 1THZA 5FPRA 4MT8A 5IWAB 1QBZA 4I4TA 3RT3C 5IJ0A 3OUFA 4NYKA 4GT1A 3TJTA 5LMUO 4H44B 3E89A 4MTFA 1V54C 4AILC 3MDSA 2Y0IA 4TV9A 5KHJA 4WBNB 4OXSA 4QPKA 1KQSU 4LFAB 3JAKB 2IW5A 1COWG 2QKAA 1NI8A 2P4VA 1HNZB 5B1OA 4X64B 3CCRV 3RYIB 5EZYB 1XNQB 1VQ4V 3JD4A 1DK1A 1BCCH 5CN0A 3SR2A 3L75H 3ABLB 2B1IA 4NR1A 4O4JB 4F6RA 2JGDB 4GEXA 3JATB 4J10A 5LA6A 4R8CA 1IDSA 4G2KA 2AHZA 1N33O 4DV1O 2RMKB 2WPDG 5J2TA 1W0JG 4DO2A 4XA4A 1Y76A 1XREA 2A9HA 1NTMH 5KX5B 3P32A 3S3WA 3WB0A 3K9SA 1XL4A 3JALB 2WWWA 1KBHA 4TUYA 1P7GA 2QSAA 2ZD9A 1CXZB 5KAIZ 1NQTA 3D36A 3ZN1A 4I9WA 5CA0A 4J7ZA 4TWKA 4W4KA 3PJSK 3AK1A 3O9OA 4TSFG 1YVWA 3AG2C 1SQQH 1R3LC 2GUZA 3MUDA 4R7CA 1GTOA 1WP8A 4Z1MG 2P7TC 4RWUA 5H6RA 1VQ5V 3AK3A 3L70H 1M9NA 1YTFB 3OUSA 5LYJA 4ZBMA 2Y69B 1R6KA 2CTQA 3JARA 4BIOA 1LR1A 4FFKA 5ITZB 1NR1A 2YIAA 5L3CA 2EINC 5DECA 1YHQV 1IBLO 1GM8A 2W0XA 2VRZA 1EFRG 1EN4A 4ZHQA 4J80A 1L1FA 3H1KH 3H1LH 2DYSC 2PI5A 3JSNA 2ZNIA 1IBMB 2N05A 1IXBA 3CCSV 4MTOA 2F66C 3W7XA 4DR5O 1YIJV 3UO2A 3KCXA 4ZI7B 1GN3A 4B3TO 1M90W 4OPHA 3G6EV 2W6JG 3CP1A 2WLLB 1HWYA 3CX5F 4GKKO 3SPCA 3ABMC 4X62O 4EFBA 4MVSA 4MTGA 4JYCA 3M8AA 4A5UB 2ARHA 4GX1A 2ZR2A 2N04A 1H2GA 1NTKH 4JI5O 2OYQA 1OJHA 1BQZA 4FLUA 2YEVA 5H5NA 3I56V 1RP3B 1JMKC 1R73A 2E74B 2M7WA 4L8JA 2OTLV 5BMVA 5FNVB 5LGNA 2YXLA 2PTMA 1Y74A 2IH1C 5EIBD 3SYCA 1IURA 4LR3A 1Y67A 3FB5C 4P2ZA 4DV6O 4MVMA 4R6ZA 1PNMA 5GTIZ 1WN7A 3B4SA 1QNMA 1V54B 2QWOB 2NLJC 2JEXA 3HKDA 3OGIB 5K1PA 2WLHA 5IYZA 5IY5C 2BSKB 2QGNA 2GTAA 2HLDG 1DLBA 4EB6A 2VQEB 3RYFA 4DW1A 2GHYA 1ZX3A 2X6AA 1Q6IA 3A2FA 4DR2O 2QKCA 2QDOA 1WPXA 5IT9N 3D8CA 1VF6C 3ETGA 2Q69A 5BXZA 4IIJB 2ZM6B 5GONA 3FB6C 4MVQA 4YJ3B 4PDMA 4O4LB 4DV0B 3CJHB 1N32B 4DUYO 4O2AB 4J7JA 4FFBA 3ZBHA 3HKCB 3E8GA 1VARA 4XDKA 3WB1A 3CMAV 1JFFA 5IJ9A 4MW8A 3B2EE 3E86A 1PM9A 3ZHTA 4AHCA 1KP3A 1B04A 1D5NA 3IGAC 4LFBO 5GW7A 1HP8A 4WCEV 1Q90D 3MAQA 4JI3O 3ZHQA 3AG7A 4K35A 3CWBH 3N2GA 4Q6GA 1F7YA 1R6NA 2DOSA 5KHIA 1DF5A 1H8EG 1L0NH 3APQA 4B08A 3AG2B 1M1KW 1H2NA 2QE7G 2UUAO 3F7VC 1UPGA 4U3JB 2WLIB 3OR7C 4I9QA 4LNUB 4LH7A 3ZHRA 4KFMA 2Q8VA 1XMQO 1YITV 5C8YA 3TXSA 3QO5A 4J9YB 1YI2V 2KB1A 4JI8B 3CHXA 1DF4A 4YJ2A 5KMGB 4CH6A 2EINB 3X2QC 3CD6V 4X20B 1H2SB 1SRYA 1EN5A 2YIBD 1SF9A 5CB4B 5H2FZ 2DYSB 4X1IA 3H1HH 1N34O 1GN4A 4BAYA 3ZRVA 1H2MA 2Q73A 1ENVA 1IXMA 4PD4F 4JYYA 4LBEC 2UXDB 5JH7B 1MZEA 1QVFU 1TUBB 2P4KA 4DV3B 1VEWA 1VQKV 1OV9A 3ABMB 2KG7B 5B1AC 4JI7B 1BE3H 2Z3YA 1ZWIC 2EZOA 4LF6O 1FJGO 4EEQA 3CYOA 1N36B 1BGYH 5L3BA 4IHJB 5D5PA 3B09A 1MZFA 2UUCB 3ABKC 2P06A 2ZR3A 4DR4B 3L72H 5CA1B 1SA0B 2EZPA 1QVGU 4KHPO 3JAKA 3ZRWB 4K8ZA 2AHYA 1QCEA 4JPRA 2AZ2A 1K8AW 4X1YB 3RYIA 5EZYA 2MW2B 2LP7A 4DR6B 3T2MA 3A8TA 4O4JA 4UXNA 1AVMA 4TV8B 4WFEA 4ZOLB 5EYPB 2JGDA 2AXTZ 2IJHA 3JATA 1QR9A 1BL8A 3HKBB 2UUBO 4XBFA 2ZT9B 4E2LA 1HNXB 2FTKA 2HJFC 2V7QG 3HKEA 3WB2A 5IY5B 3DC5A 1JA8A 2PI4A 3I5DA 5LMNB 4F4LA 2ZDIA 1XHXA 4NXMB 4LF8O 3E2EA 4PHZA 4WFAV 5EC1C 3SGIA 4JI2O 3K04A 3K5LA 2VQFB 3HPLC 4U3FH 4FJCC 3ZHSA 3CCQV 3CRMA 5EBWC 1AI6A 1ZL8B 1GM9A 1QLEC 4J9ZB 1KUQA 5JVDB 2PGGA 3OAAG 3VQXA 1OHHG 4YY3O 3A0RA 3SYQA 4GX5A 3QF7A 4JZ2A 3G4SV 3CCEV 4RUFA 2R9RB 2WAMA 3T1HB 2A3QA 4GUNA 5ITZA 4OX9B 3RWRD 1JVMA 3TGUH 4H37A 4QE7A 1S5HC 2Q67A 1Q82W 3L9DA 4BW5A 1BHAA 4PI2A 2Q0AA 3RYHB 3FAVB 5IWAO 1G8MA 1BZKA 4I0XB 2WA4A 4LWSB 4ZI7A 2CGNA 1AJNA 3ABTA 3OD4A 3CC4V 1EZJA 2YUAA 4JI6O 5GTHZ 3RW0A 4LF9B 5LHHA 3MHSC 1TGOA 4QGPA 3X2QB 2BTQB 4LF4B 2LFSA 2OCCC 4B3RB 4X8AA 3FFQA 3CRCA 5BY1A 1WNSA 5LHIA 1EN6A 5LGUA 4X64O 4JZGA 3BEHA 4JYBA 1Z5WA 5CHXA 5JCOA 3BRCA 1S3JA 3JYCA 2Z5UA 3E83A 5FNVA 2AZ0A 4JF3A 3R65A 1K4DC 2JJ1G 2F4VO 3A0BZ 3OM3B 3QVNA 5D5QA 3T1YB 1XBLA 4JV5O 2ODMA 2UU9B 2HHHO 3JD1A 5B1AB 3LUTB 5J2UB 3KKYA 3BA9A 4ZIBA 3F5WC 1VQ9V 1K73W 2DE0X 2Q0OC 1HDJA 2YI8A 1ZSPA 1K34A 2PY5A 1AP6A 4K0KO 3QO8A 3ABKB 4X66B 4U7NA 2RNBA 1SERA 2BSKA 2W0FC 3LNNA 4TT3G 4Z2WA 3ZEDA 2FMLA 3WG7C 5JJEB 1ZLZA 4GLXA 4DUZO 2YC0A 4DR7B 3E22B 2JVDA 4CH4A 4BW9A 2B9ZA 4GEUA 4IIJA 4FLYA 1K33A 2JGUA 3RGBA 2ZCEA 1IBKO 4YJ3A 1NH2D 2UXBB 4O4LA 4GKJO 2HJDA 3CJHA 3OMIB 2P22C 4JGSA 1AILA 4O2AA 4UVCA 3HKCA 3NR7A 2XUMA 2ZQMA 3JASB 3M7MX 4LP8A 1SETA 2YS8A 3ZRSA 2ZNJA 3N27A 4UCVA 4HNAB 1PD3A 2XAHA 3D3QA 5B3SC 2XAGA 2XTAA 1SQPH 4J42A 1HNWB 1WB8A 2QM8A 5BR8O 1K9MW 3UKMA 1QLEB 5H6QA 1KB9F 4OPAA 1GAXA 3ZX6A 3LSQA 4U3JA 2WLIA 4LF7O 3FB8C 3K59A 4PA9A 4LNUA 3VQWA 2QJ1A 1N8RW 3CSXA 4UCRA 4UV8A 1B06A 2V1DA 4JYAB 3K57A 2EILC 1N0JA 5KMGA 4ICGA 4O4IB 1K5QA 4LF5O 2CTPA 4NXNO 1QLNA 4KP4A 1PV0A 4BR6A 1WPBA 2CGOA 1AJQA 2X6CA 5CB4A 1WAZA 2ZINA 1K7DA 2QR4A 1KECA 4RO2A 1VQ6V 5CJ0A 5JQGB 5JH7A 1I0HA 2JK5C 1SS3A 1K97A 1TUBA 3G6BA 2P67A 5A9GA 1MABG 4DYLA 3STZC 4BIUA 1E79G 1AJPA 2XASA 3SJCC 1SESA 2KG7A 2KQXA 3ZHUA 3E8BA 2OCCB 1H2KA 4X65O 4QIWF 2NN4A 1W59A 2DN9A 2HP8A 4KUMA 4IHJA 2YIDA 3OFNG 4LFCO 4UV9A 4IYHA 5CA1A 1SA0A 1Y6XA 4FZ1A 1GH6A 5FL7G 3ZRWA 1Z2GA 2ZM6O 2FKXA 2WLKA 1N33B 3OTFA 4DV0O 3N2KB 4DR1O 1SQXH 3DSQA 4X1YA 4I55B 1FU1A 4B3SB 2EJ7A 1FKAO 2UXNA 2RCVA 2CK3G 3MHHC 1FD9A 4I50A 4AQYO 4TV8A 1Y4MA 4ZOLA 4JTCB 5EYPA 3S3XA 3OTOO 2YSUB 4DXWA 4EFEA 3HKBA 1SKVA 2X6BA 5EC2C 1NTZH 1RSOB 2E76B 3B8NA 4W4LA 1AR4A 1BQ0A 2Y0PA 2DWDC 4R50A 5CBFA 3WG7B 3HB3B 2WLNA 3JCUZ 5IDJA 1ZTEA 3CCMV 4QNHB 3ETDA 3B77A 1I94B 1RFYA 2WSSG 1AR5A 3VQVA 1VF6A 1FFXB 1KP2A 4ABMA 5CBGA 1F4MA 3CB2A 3IC9A 1AI4A 4CKNA 3K5OA 1ZL8A 4RAIA 1I5XA 2X7RB 1TUEB 2CE4A 4OGQB 5DM6V 1SQFA 1CP9A 3BA8A 2EIKC 5JVDA 1FS0G 2ADQB 2ZE6A 4UVBA 1Q81W 1XOUA 3W7SA 3Q4HA 1U96A 5L3GA 4O2BB 5B3SB 4G79A 1SZXA 1OCOC 1YSCA 2QKSA 4I4TB 3K0DA 4DR5B 3CC2V 4FLWA 1D2DA 2A0LA 1DTOA 2EBOA 4B3TB 4QPJA 2YDEA 2OCHA 2ZE8A 2R9AA 4G28B 2ZXWC 3RYHA 3EXAA 3FAVA 4CC5A 4DV2O 2E5LO 1PNLA 4X89A 1VF7A 1NZ6A 3B40A 4LWSA 2OWOA 4JI7O 1TVKB 3K9AA 1Q86W 2ZKOA 2A7WA 4B3MO 1WLEA 1XUQA 5LP6C 3OMNB 1G4YB 2MK3A 1L8DA 2Y4TA 2EILB 3C3SA 5TISZ 4DR4O 5E79Z 2BTQA 3AG1C 2LQTA 1K5SA 4F6RB 4DR3O 1H8HG 1QQCA 1IVSA 5KLVH 2ZE7A 1BT8A 5EIBC 2WLJA 2A79B 3W7UA 5J2TB 3BABA 3EHBB 5LXTB 4DV7O 1Q8IA 4JI0B 1LUVA 3CXCU 2IM9A 3FB7C 3FX7A 1B3QA 1AP5A 2LFRA 4DV5B 3P30A 2PZSA 3SPJA 2CH7B 1KYOF 2GBOA 2Q68A 3QG5A 3ZMTA 1HNXO 4H13B 3CEIA 3STLC 3W7WA 4XDLA 2D3OW 2ZE5A 1BMFG 4JASA 1N4CA 4YHHO 1KKCA 1PKXA 1V55C 1KC8W 1SQBH 1XNRB 5B1BC 2GUZB 3AEIA 4N23A 3NXSA 5LOVB 3JD0A 1QU7A 4WF9V 1CEZA 2R9IA 4PA4A 2HEPA 4TQFA 2F1MA 3WFVA 3O65A 4DUYB 3E22A 1US6A 5F2VO 4MSWC 3SPIA 2B5UA 4DV4O 2GTSA 2Q7GA 1YJWV 2EULA 1CPYA 5L3FA 3FYIB 1DGSA 2RDCA 2EIJC 2HKOA 1AROP 3F7YC 3H9VA 4WBNA 4LFBB 4EKWA 3SDLA 1M93A 1Q5OA 3H1JH 3T1HO 2GDSA 2RQ6A 4NTXA 3JASA 1I08A 4P9PA 2HG5C 1K4CC 4PA3A 3ZHVA 2FB5A 3FKSG 1SQGA 2CTRA 4HNAA 4X1KB 3U11A 1XMOO 1P7BA 1F23A 1NVPD 4K8XA 2UUAB 4MW3A 2X0LA 4RQEA 1S76D 2YXHA 4LH6A 2QWRB 1P84F 1XMQB 5KHHA 2QTSA 3UT5B 2IJIA 2JS5A 3LDEA 5KX5A 4J7KA 5E1AC 1ORQC 2EIKB 3JALA 2QM4A 3ASNC 2NNUA 2HFEC 2FL4A 4LF4O 3E8HA 4AI8A 3DXRB 1F51A 3TXQA 5B1NA 1Y74B 3SPGA 1OCOB 5KAFZ 4RQFA 2Q9LA 5J9PC 3CE2A 3ZIAG 1N34B 3BY6A 4NB5A 1SZTA 1EM1A 2VWJA 4O4IA 4PJ0Z 4CKMA 4GX0A 3OEEG 4GX2A 4JI1O 4CH3A 4HBNA 3TK1A 5BZBA 2H8PC 1GO3F 2ZXWB 1HR0O 2IJKA 1O9HA 2QWQB 4FZ0A 2QTOA 1YF2A 3THOA 1JOYA 4FLTA 3T1YO 2ITCC 2W6IG 4LF6B 1FJGB 5JQGA 1YZBA 4DK1A 1E1RG 1FXKC 1GMGA 5LP6B 2XAJA 4TOIA 2UXCO 4FPPA 3ZMZA 3TCUA 3AG1B 1J5EO 2AW9A 1Q6HA 5GONB 5HFMA 4UB6Z 2LGWA 3ZRXA 1KU9A 4J41A 2VWKA 2CUGA 4DR7O 5K1XA 4CKPA 3ICXA 1XQ8A 2EIMC 3RVZA 1SQVH 2Q6AA 2WLLA 4JI4B 4ZKIA 3OGCC 2OIGA 1XHZA 1XEQA 1M5IA 1YJ9V 1Q7YW 2C2AA 2AGAA 3N2KA 4UCUA 4LFAO 1KMIZ 2D2CB 4BWAA 2BTOA 1HNZO 1UJWB 5LGTA 5KHGA 2OT5A 1PPJH 1RPOA 3SYAA 1V55B 2RJZA 1XNQO 1PNKA 3AG3C 5B1BB 1RSOA 3K5NA 1URFA 3G71V 1XL6A 1HNWO 1S0VA 2QM7A 4FM2A 2A06H 4ASUG 3K58A 2Z0AA 5LL6Y 3RWRA 2XOKG 3J81N 2GSMB 2CDYA 3BFRA 1EZVH 1FFXA 2HVKC 4MS2A 5JWPA 1M57C 4FM0A 1BSMA 2EIJB 1BS3A 1VQMV 3OMAB 4K3AA 1LUWA 5EBMC 4F6EA 3K5MA 2E75B 4UCOA 5DEDA 4NTWA 3KCYA 4X88A 4FLVA 4JYAO 5L3EA 3LDDA 2F43G 5EK0A 4X9QA 3BHPA 1D5AA 3GWOA 2GV9A 2PYLA 1PL4A 5KA6A 3KG2A 1VP7A 5IYCO 1IK9A 3T1CA 2XT9A 2KSDA 3T4DA 4JI6B 3SJBC 1YCIA 2HR3A 1YJNV 3CPWU 4PA7A 1R3IC 3OR6C 1WA8B 2BOBC 3UQ8A 3ASNB 3CS5A 1O9GA 4JTAB 4CC6A 3JAMN 1FYJA 3IJ4A 1OCZC 2JS3A 1TVKA 3ML0A 3M99B 3ZS8C 2DMXA 2Q5ZA 1IBMO 1MA1A 1J95A 3F5TA 2CTWA 1YEWA 3OEHG 3K79A 1WB7A 4IGGA 1Q6UA 4IYIA 3RN4A 1WP7A 1YDXA 3A0HZ 1MMMA 3K3WA 2F4VB 1VF5B 3ASOC 5AG2A 1V9PA 3GVMA 3L74H 4JV5B 2HHHB 1MOFA 3HKEB 4YIPA 5LXTA 4B3SO 2P6JA 3QO7A 1H2LA 2L6LA 1FXKB 4K0KB 4PI0A 2CH7A 4P9OA 1FPOA 3APOA 3D3IA 3SR2C 4C7UA 4X20A 4FIPC 3GB7C 3LSSA 2WA3A 3VBBA 5IYBO 3QNEA 4MTXA 4JAAA 4FM1A 1BHBA 4DUZB 4GFAA 1W2BU 1JCHA 1AB3A 3JCZA 5LMUB 1R6TA 1I94O 4YXWG 3SYPA 1SC5B 5LOVA 2M6YA 4H0LB 2EIMB 4CZZA 2YI9A 4RUEA 2QA4V 3W7TA 1IBKB 1NVPB 2YXYA 3K0GA 1GN6A 4GKJB 1WJZA 3EFFK 3D36C 1S72V 3LDCA 4WFHA 1Q3EA 2VQEO 3T4ZA 4IL6Z 1OCCC 1KKDA 4NTYA 4D7SA 2H3OA 3RBZA 3RYCB 4P30A 4DRXB 5JJJB 3ETQA 2B1GA 2ILMA 4D7TA 2F93B 3AG3B 4JAVA 3CMEV 3SPHA 2Y48A 1TAEA 2ATKC 2LW7A 4DV1B 5BR8B 3BPZA 2LJ2A 4UVAA 1N32O 2LO1A 3JAWB 4B7KA 4X1KA 2HVJC 1G1XB 2BOCC 5H9CA 3L71H 1OCRC 1XDCA 4HYOA 1M57B 4LF7B 1VQLV 1EBOA 3OE7G 2IBZH 2IH3C 1I7FA 4LC1A 4GZRB 4MVZA 1AR1B 3UT5A 3I55V 4YIOA 1M56C 1R1BA 3KZIZ 4CS4A 3AG4C 1JJ2U 3CRQA 2IJJA 3Q0YA 4LF5B 1JR9A 1NS1A 3IC7A 4NXNB 5CJ4A 3ZN0A 3DXRA 2XAFA 4UB8Z 3OT7A 4GYCB 4FK5C 5L3DA 2OTJV 4HZ3A 4LCUC 1LNQA 5CMUA 4JI0O 4MVOA 3CCVV 3K08A 4JI8O 1GKFA 2XNDG 1IBLB 4O4HB 3JD2A 4DV5O 1MNGA 4CH5A 3C90A 2XHBA 3JSLA 2DW4A 3FYEB 4X65B 3EVKA 4I5SA 1OCZB 2LW1A 5KUKA 1NR7A 3BAAA 5IJ0B 4HAMA 2F95B 1G6UA 5LP6A 4LFCB 1QHTA 2Q4PA 4QJFB 1RM1C 4WFBV 1VQPV 4JAUA 1XNRO 2DJVA 2UXDO 5B66Z 3BCCH
chains in the Genus database with same CATH topology
4TV9B 4LH6A 4GKKB 4X62B 5D5QA 3T1YB 4DR1B 5LYJA 1XMQB 2UU9B 3JARA 5KHHA 3UT5B 5J2UB 5KHKA 2JS5A 5KX5A 3BA9A 4ZIBA 5ITZB 4AQYB 2YIAA 3PN1A 3OTOB 4JI5B 2YI8A 3JALA 2QM4A 2PUSA 2PY5A 4X66B 4ZHQA 3LNNA 4UCSA 3ZEDA 3JSNA 5JJEB 5LA6B 2ZNIA 1IBMB 2F66C 4GLXA 4DR7B 3E22B 1N34B 4ZI7B 2JVDA 2VWJA 1Q43A 4O4IA 4DV6B 4CH4A 4BW9A 4CH3A 4HBNA 1S5JA 4IIJA 4FLYA 2JGUA 3RGBA 2ZCEA 1O9HA 1XI1A 3THOA 4YJ3A 2UXBB 4O4LA 4FLTA 4TUYB 4EFBA 2P22C 4O2AA 5J2UA 4LF6B 1FJGB 5JQGA 3HKCA 5CA0B 3JASB 4DK1A 2R72A 3M7MX 5LP6B 4DR2B 2ZNJA 2OYQA 4TOIA 1X4TA 4UCVA 4FLUA 4HNAB 4NVPA 1JMKC 4L8JA 5BMVA 5FNVB 1HNWB 2YXLA 2PTMA 5GONB 3SJAC 5EIBD 1KU9A 5LYJB 2VWKA 3JARB 5K1XA 4LR3A 3ICXA 1T5EA 1XQ8A 3II6A 1WN7A 2ZIMA 4JI4B 4U3JA 3HKDA 4CS2A 1HW7A 4DV2B 1XHZA 5K1PA 1M5IA 2E5LB 5IYZA 1JJOA 3K59A 4JI3B 4LNUA 3VQYA 4ZHQB 3VQWA 3N2KA 2QJ1A 4UCUA 4EB6A 2VQEB 2EX3A 3CSXA 3RYFA 1KMIZ 4B3MB 1TA8A 4BWAA 2BTOA 4UCRA 5KHGA 4JYAB 3K57A 5KMGA 3A2FA 2RJZA 4O4IB 2E3CA 1RSOA 3K5NA 4IIJB 4DR3B 1WPBA 2ZM6B 5GONA 5CB4A 4YJ3B 2ZINA 4O4LB 4DV0B 4FM2A 1Z5VA 2YIBA 1N32B 4O2AB 4FFBA 3K58A 5CJ0A 4DV7B 5JQGB 3RWRA 4FLXA 3HKCB 3WB1A 5JH7A 1JFFA 5IJ9A 1FFXA 1TUBA 3B2EE 4I50B 4FM0A 1M4UA 4AHCA 1B04A 3SJCC 3MAQA 5BMVB 3K5MA 4UCOA 3N2GA 4YHHB 4Q6GA 4IHJA 5KHIA 4FLVA 3RFRA 4B08A 3U0ZA 5CA1A 1SA0A 3BHPA 1D5AA 2GV9A 4U3JB 2PYLA 3HKDB 4I9QA 5IYZB 4LNUB 1N33B 4LH7A 3OTFA 1ZAUA 3N2KB 3DSQA 4X1YA 4I55B 4EB6B 4FVMA 1IK9A 5C8YA 1FU1A 3RYFB 2ZIOA 4B3SB 4DV4B 4JI6B 3SJBC 4I50A 4TV8A 4ZOLA 5EYPA 2PYJA 4JI8B 3CHXA 4YJ2A 2Q7EA 4EFEA 5KMGB 4CH6A 3UQ8A 3HKBA 1SKVA 4KL1A 4X20B 1O9GA 4CC6A 4KHPB 1H2SB 1TVKA 2YIBD 3ZS8C 5CB4B 4X1IA 4CS3A 3RYCA 4DRXA 1YEWA 4FFBB 1XMOB 1I94B 2UXDB 5JH7B 1JFFB 3VQVA 5JJNB 5IJ9B 4DK0A 1TUBB 1FFXB 4DV3B 3CB2A 2F4VB 2UUBB 3K5OA 4UCTA 1V9PA 4TQDA 4JV5B 2HHHB 4I55A 4JI7B 3HKEB 2Q7HA 3JAWA 5LXTA 4EEQA 3N2GB 1P49A 1SQFA 1N36B 3BA8A 5JVDA 4IHJB 5D5PA 4LF8B 2UUCB 4K0KB 4PI0A 4DR4B 3SR2C 4X20A 5CA1B 1SA0B 4UFZA 4O2BB 2R70A 3QTCA 4JI2B 3JAKA 4I4TB 4K8ZA 4FM1A 4DUZB 4DR5B 4FLWA 2V4DA 4X1YB 3RYIA 5LMUB 5EZYA 2P5OA 4B3TB 4DR6B 5C8YB 4JI1B 5LOVA 3IAYA 2R9AA 3U10A 4O4JA 4TV8B 2YI9A 4ZOLB 5EYPB 3RYHA 4YY3B 4YJ2B 1HR0B 3JATA 1IBKB 4CC5A 3HKBB 4GKJB 1HNXB 1VF7A 3HKEA 3WB2A 2OWOA 1Q3EA 1TVKB 4D7SA 5LP6C 4X1IB 5FPOA 5LMNB 3RYCB 2CAZC 4DRXB 5JJJB 5JCOC 2KKWA 1XHXA 1L8DA 3ETQA 4O4HA 1NT2B 4NXMB 2UXCB 4D7TA 4FLZA 2F93B 4PHZA 2BTQA 4O2BA 1J5EB 5FPRA 4F6RB 5IWAB 1QQCA 4I4TA 1TAEA 3SGIA 3K5LA 2VQFB 4DV1B 5BR8B 3BPZA 5IJ0A 5EIBC 5J2TB 3JAWB 3BABA 5LXTB 1Q8IA 4JI0B 4X1KA 2IM9A 4AILC 5JVDB 2PGGA 3VQXA 4TV9A 4DV5B 4LF7B 5KHJA 2PZSA 4WBNB 3QF7A 3QG5A 1I7FA 4LFAB 3UT5A 3T1HB 3JAKB 1HNZB 5ITZA 4OX9B 3RWRD 4X64B 4CS4A 3RYIB 5EZYB 1XNQB 1XNRB 4LF5B 4NXNB 5LOVB 5CJ4A 3SR2A 4O4JB 4F6RA 4PI2A 2Q0AA 3RYHB 3JATB 5LA6A 2HEPA 4TQFA 2F1MA 4GYCB 4DUYB 3E22A 4ZI7A 5J2TA 4XA4A 2Q7GA 5KX5B 1DGSA 3WB0A 4LF9B 1IBLB 4O4HB 3JALB 4WBNA 4CH5A 4LFBB 1TGOA 4TUYA 2BTQB 4LF4B 2XHBA 3JSLA 4B3RB 4X65B 1M93A 1Q5OA 3FFQA 5CA0A 2RQ6A 3JASA 1WNSA 3BAAA 5IJ0B 2F95B 1G6UA 5LP6A 1Z5WA 4LFCB 5CHXA 1QHTA 5JCOA 3MUDA 1SQGA 3U11A 4HNAA 3BRCA 4X1KB 4K8XA 2UUAB 5FNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FU1 A;  1M5I A;  4XA4 A;  3RWR D;  5CJ0 A;  2R9A A;  3RWR A;  2QM4 A;  5CJ4 A;  1KU9 A;  5CHX A;  3SR2 A;  3SR2 C;  3MUD A;  3II6 A;  1IK9 A; 
#chains in the Genus database with same CATH topology
 4DV3 O;  4TV9 B;  3R66 A;  4GKK B;  2QEX V;  4X62 B;  4I0X A;  3ASO B;  4DR1 B;  1YXB A;  1R3J C;  3H01 A;  1W0K G;  1VQ7 V;  3AK2 A;  5KHK A;  1FAF A;  2O57 A;  3E8F A;  5DN6 G;  2DYR C;  2DWE C;  1N36 O;  4AQY B;  3PN1 A;  5FLX N;  3OTO B;  4JI5 B;  2IU0 A;  2JRI A;  4UUJ C;  2PUS A;  2UUC O;  4BIZ A;  4UCS A;  1K92 A;  1XIL A;  3ABU A;  2QWP B;  3J80 N;  3CCU V;  5LA6 B;  2YIC A;  2G38 A;  1Y66 A;  1L0L H;  1Q43 A;  4DV6 B;  4DR6 O;  1Y76 B;  2H94 A;  3UO3 A;  5LBQ A;  4MVR A;  1S5J A;  4WFG A;  1FXH A;  1XI1 A;  2Y3W A;  3SYO A;  2PF4 E;  2ITD C;  4TUY B;  3CCJ V;  2P90 A;  1NH2 B;  5J2U A;  3WU2 Z;  2LGQ A;  5A2Q N;  2L35 A;  5CA0 B;  1OCC B;  2JJ2 G;  2R72 A;  4JTD B;  5LMN O;  4DR2 B;  1AI7 A;  2K9P A;  4NXM O;  1X4T A;  3C3T A;  4NVP A;  4PDV A;  1S5L Z;  3ZCC A;  2JEU A;  4GFC A;  2VQF O;  3SJA C;  5LYJ B;  1K3E A;  3JAR B;  1JX9 A;  4DW0 A;  1UFI A;  1T5E A;  2ADP A;  3II6 A;  2K1E A;  2ZIM A;  1NJI W;  1OCR B;  1HW7 A;  4J11 A;  1NKD A;  4CS2 A;  4DV2 B;  2E5L B;  3Q0X A;  1JJO A;  4JI3 B;  1JPX A;  3VQY A;  4ZHQ B;  4Z1V A;  1PL0 A;  2EX3 A;  3TET A;  4B3M B;  1TA8 A;  1JQ0 A;  4PDL A;  1AI5 A;  4OX9 O;  3UCS C;  4GCZ A;  1M56 B;  1WA8 A;  3AG4 B;  4MVU A;  2E3C A;  1RPR A;  2BCC H;  5IYD O;  4DR3 B;  4PDR A;  1YTF D;  3BVO A;  1VQ8 V;  4KXR A;  3CCL V;  1Z5V A;  2YIB A;  4PA6 A;  4DV7 B;  1FFT B;  4FLX A;  2XAQ A;  2N74 A;  5IE9 A;  1IZ3 A;  4I50 B;  1NU1 H;  4LF9 O;  3ZMV A;  1M4U A;  4JI4 O;  2YEV B;  1MG1 A;  3SJQ C;  3UM7 A;  3DTU B;  5BMV B;  4B3R O;  4Q20 A;  4YHH B;  1A32 A;  4PEL A;  3CRR A;  5HFL A;  4G27 B;  1FXK A;  3RFR A;  4FMT A;  3U0Z A;  3ABL C;  1RM1 B;  2WLM A;  3HKD B;  1GM7 A;  5IYZ B;  1NBM G;  1ROP A;  4NKG B;  1ZAU A;  1PP9 H;  2UU9 O;  4EB6 B;  4FVM A;  1VMG A;  1MSD A;  2ZIO A;  3H1I H;  3RYF B;  4DV4 B;  1IX9 A;  3CC7 V;  1QR8 A;  4I7Z B;  5CA3 A;  1N0N A;  2ZDI C;  3FD9 A;  2PYJ A;  2DYR B;  2Q7E A;  4KL1 A;  3Q4H B;  4X66 O;  4QE9 A;  4KHP B;  1VQN V;  4N21 A;  5KUM A;  3J7A U;  3VOU A;  2Y3V A;  2OIE A;  2VS0 A;  4CS3 A;  3RYC A;  2UXX A;  5B5E Z;  3HR0 A;  2NR5 A;  4DRX A;  4L87 A;  4FFB B;  1XMO B;  3ETE A;  1JFF B;  5JJN B;  1U97 A;  5IJ9 B;  2FYU H;  4U7O A;  3K06 A;  4DK0 A;  2RN9 A;  1GN2 A;  4E4E A;  3G80 A;  1E1Q G;  3LNM B;  2UUB B;  3RVY A;  4CBC A;  4UCT A;  2Y69 C;  4TQD A;  2UXB O;  2JIZ G;  4I55 A;  4PV1 B;  5EBL C;  2JDI G;  1X59 A;  2Q7H A;  3JAW A;  3MD0 A;  3PYI A;  1I5Y A;  3N2G B;  1P49 A;  4B7E A;  3ZMU A;  1OZ0 A;  3IFX A;  4LF8 B;  2ETN A;  1FXV A;  4WFF A;  4UFZ A;  2BE3 A;  2IU3 A;  1KD1 W;  3DC6 A;  1F4N A;  1GK9 A;  2R70 A;  3ZJZ A;  3QTC A;  1P4R A;  1B6Q A;  4JI2 B;  3G67 A;  5CBH A;  5C93 A;  5KA5 A;  2V4D A;  5LHG A;  2P5O A;  1H38 A;  5C8Y B;  3OW2 U;  1VQO V;  4IT5 A;  4H33 A;  4JI1 B;  3JD3 A;  3K03 A;  3IAY A;  2DQ0 A;  3U10 A;  4YY3 B;  4YJ2 B;  1HR0 B;  3E35 A;  2QWN B;  3L73 H;  3GWK C;  1ZUQ A;  2F23 A;  1MSW D;  2DQ3 A;  3CRA A;  3B8M A;  1VIB A;  2EJR A;  1GRJ A;  1S77 D;  3P3N A;  2Y4U A;  3DGE A;  4X1I B;  5FPO A;  4XDJ A;  4D6T H;  2CAZ C;  5JCO C;  3CXH F;  2KKW A;  1R3K C;  4O4H A;  2UXC B;  1NT2 B;  3P3P A;  4FLZ A;  3ZMS A;  4O2B A;  3LSU A;  1J5E B;  1THZ A;  5FPR A;  4MT8 A;  5IWA B;  1QBZ A;  4I4T A;  3RT3 C;  5IJ0 A;  3OUF A;  4NYK A;  4GT1 A;  3TJT A;  5LMU O;  4H44 B;  3E89 A;  4MTF A;  1V54 C;  4AIL C;  3MDS A;  2Y0I A;  4TV9 A;  5KHJ A;  4WBN B;  4OXS A;  4QPK A;  1KQS U;  4LFA B;  3JAK B;  2IW5 A;  1COW G;  2QKA A;  1NI8 A;  2P4V A;  1HNZ B;  5B1O A;  4X64 B;  3CCR V;  3RYI B;  5EZY B;  1XNQ B;  1VQ4 V;  3JD4 A;  1DK1 A;  1BCC H;  5CN0 A;  3SR2 A;  3L75 H;  3ABL B;  2B1I A;  4NR1 A;  4O4J B;  4F6R A;  2JGD B;  4GEX A;  3JAT B;  4J10 A;  5LA6 A;  4R8C A;  1IDS A;  4G2K A;  2AHZ A;  1N33 O;  4DV1 O;  2RMK B;  2WPD G;  5J2T A;  1W0J G;  4DO2 A;  4XA4 A;  1Y76 A;  1XRE A;  2A9H A;  1NTM H;  5KX5 B;  3P32 A;  3S3W A;  3WB0 A;  3K9S A;  1XL4 A;  3JAL B;  2WWW A;  1KBH A;  4TUY A;  1P7G A;  2QSA A;  2ZD9 A;  1CXZ B;  5KAI Z;  1NQT A;  3D36 A;  3ZN1 A;  4I9W A;  5CA0 A;  4J7Z A;  4TWK A;  4W4K A;  3PJS K;  3AK1 A;  3O9O A;  4TSF G;  1YVW A;  3AG2 C;  1SQQ H;  1R3L C;  2GUZ A;  3MUD A;  4R7C A;  1GTO A;  1WP8 A;  4Z1M G;  2P7T C;  4RWU A;  5H6R A;  1VQ5 V;  3AK3 A;  3L70 H;  1M9N A;  1YTF B;  3OUS A;  5LYJ A;  4ZBM A;  2Y69 B;  1R6K A;  2CTQ A;  3JAR A;  4BIO A;  1LR1 A;  4FFK A;  5ITZ B;  1NR1 A;  2YIA A;  5L3C A;  2EIN C;  5DEC A;  1YHQ V;  1IBL O;  1GM8 A;  2W0X A;  2VRZ A;  1EFR G;  1EN4 A;  4ZHQ A;  4J80 A;  1L1F A;  3H1K H;  3H1L H;  2DYS C;  2PI5 A;  3JSN A;  2ZNI A;  1IBM B;  2N05 A;  1IXB A;  3CCS V;  4MTO A;  2F66 C;  3W7X A;  4DR5 O;  1YIJ V;  3UO2 A;  3KCX A;  4ZI7 B;  1GN3 A;  4B3T O;  1M90 W;  4OPH A;  3G6E V;  2W6J G;  3CP1 A;  2WLL B;  1HWY A;  3CX5 F;  4GKK O;  3SPC A;  3ABM C;  4X62 O;  4EFB A;  4MVS A;  4MTG A;  4JYC A;  3M8A A;  4A5U B;  2ARH A;  4GX1 A;  2ZR2 A;  2N04 A;  1H2G A;  1NTK H;  4JI5 O;  2OYQ A;  1OJH A;  1BQZ A;  4FLU A;  2YEV A;  5H5N A;  3I56 V;  1RP3 B;  1JMK C;  1R73 A;  2E74 B;  2M7W A;  4L8J A;  2OTL V;  5BMV A;  5FNV B;  5LGN A;  2YXL A;  2PTM A;  1Y74 A;  2IH1 C;  5EIB D;  3SYC A;  1IUR A;  4LR3 A;  1Y67 A;  3FB5 C;  4P2Z A;  4DV6 O;  4MVM A;  4R6Z A;  1PNM A;  5GTI Z;  1WN7 A;  3B4S A;  1QNM A;  1V54 B;  2QWO B;  2NLJ C;  2JEX A;  3HKD A;  3OGI B;  5K1P A;  2WLH A;  5IYZ A;  5IY5 C;  2BSK B;  2QGN A;  2GTA A;  2HLD G;  1DLB A;  4EB6 A;  2VQE B;  3RYF A;  4DW1 A;  2GHY A;  1ZX3 A;  2X6A A;  1Q6I A;  3A2F A;  4DR2 O;  2QKC A;  2QDO A;  1WPX A;  5IT9 N;  3D8C A;  1VF6 C;  3ETG A;  2Q69 A;  5BXZ A;  4IIJ B;  2ZM6 B;  5GON A;  3FB6 C;  4MVQ A;  4YJ3 B;  4PDM A;  4O4L B;  4DV0 B;  3CJH B;  1N32 B;  4DUY O;  4O2A B;  4J7J A;  4FFB A;  3ZBH A;  3HKC B;  3E8G A;  1VAR A;  4XDK A;  3WB1 A;  3CMA V;  1JFF A;  5IJ9 A;  4MW8 A;  3B2E E;  3E86 A;  1PM9 A;  3ZHT A;  4AHC A;  1KP3 A;  1B04 A;  1D5N A;  3IGA C;  4LFB O;  5GW7 A;  1HP8 A;  4WCE V;  1Q90 D;  3MAQ A;  4JI3 O;  3ZHQ A;  3AG7 A;  4K35 A;  3CWB H;  3N2G A;  4Q6G A;  1F7Y A;  1R6N A;  2DOS A;  5KHI A;  1DF5 A;  1H8E G;  1L0N H;  3APQ A;  4B08 A;  3AG2 B;  1M1K W;  1H2N A;  2QE7 G;  2UUA O;  3F7V C;  1UPG A;  4U3J B;  2WLI B;  3OR7 C;  4I9Q A;  4LNU B;  4LH7 A;  3ZHR A;  4KFM A;  2Q8V A;  1XMQ O;  1YIT V;  5C8Y A;  3TXS A;  3QO5 A;  4J9Y B;  1YI2 V;  2KB1 A;  4JI8 B;  3CHX A;  1DF4 A;  4YJ2 A;  5KMG B;  4CH6 A;  2EIN B;  3X2Q C;  3CD6 V;  4X20 B;  1H2S B;  1SRY A;  1EN5 A;  2YIB D;  1SF9 A;  5CB4 B;  5H2F Z;  2DYS B;  4X1I A;  3H1H H;  1N34 O;  1GN4 A;  4BAY A;  3ZRV A;  1H2M A;  2Q73 A;  1ENV A;  1IXM A;  4PD4 F;  4JYY A;  4LBE C;  2UXD B;  5JH7 B;  1MZE A;  1QVF U;  1TUB B;  2P4K A;  4DV3 B;  1VEW A;  1VQK V;  1OV9 A;  3ABM B;  2KG7 B;  5B1A C;  4JI7 B;  1BE3 H;  2Z3Y A;  1ZWI C;  2EZO A;  4LF6 O;  1FJG O;  4EEQ A;  3CYO A;  1N36 B;  1BGY H;  5L3B A;  4IHJ B;  5D5P A;  3B09 A;  1MZF A;  2UUC B;  3ABK C;  2P06 A;  2ZR3 A;  4DR4 B;  3L72 H;  5CA1 B;  1SA0 B;  2EZP A;  1QVG U;  4KHP O;  3JAK A;  3ZRW B;  4K8Z A;  2AHY A;  1QCE A;  4JPR A;  2AZ2 A;  1K8A W;  4X1Y B;  3RYI A;  5EZY A;  2MW2 B;  2LP7 A;  4DR6 B;  3T2M A;  3A8T A;  4O4J A;  4UXN A;  1AVM A;  4TV8 B;  4WFE A;  4ZOL B;  5EYP B;  2JGD A;  2AXT Z;  2IJH A;  3JAT A;  1QR9 A;  1BL8 A;  3HKB B;  2UUB O;  4XBF A;  2ZT9 B;  4E2L A;  1HNX B;  2FTK A;  2HJF C;  2V7Q G;  3HKE A;  3WB2 A;  5IY5 B;  3DC5 A;  1JA8 A;  2PI4 A;  3I5D A;  5LMN B;  4F4L A;  2ZDI A;  1XHX A;  4NXM B;  4LF8 O;  3E2E A;  4PHZ A;  4WFA V;  5EC1 C;  3SGI A;  4JI2 O;  3K04 A;  3K5L A;  2VQF B;  3HPL C;  4U3F H;  4FJC C;  3ZHS A;  3CCQ V;  3CRM A;  5EBW C;  1AI6 A;  1ZL8 B;  1GM9 A;  1QLE C;  4J9Z B;  1KUQ A;  5JVD B;  2PGG A;  3OAA G;  3VQX A;  1OHH G;  4YY3 O;  3A0R A;  3SYQ A;  4GX5 A;  3QF7 A;  4JZ2 A;  3G4S V;  3CCE V;  4RUF A;  2R9R B;  2WAM A;  3T1H B;  2A3Q A;  4GUN A;  5ITZ A;  4OX9 B;  3RWR D;  1JVM A;  3TGU H;  4H37 A;  4QE7 A;  1S5H C;  2Q67 A;  1Q82 W;  3L9D A;  4BW5 A;  1BHA A;  4PI2 A;  2Q0A A;  3RYH B;  3FAV B;  5IWA O;  1G8M A;  1BZK A;  4I0X B;  2WA4 A;  4LWS B;  4ZI7 A;  2CGN A;  1AJN A;  3ABT A;  3OD4 A;  3CC4 V;  1EZJ A;  2YUA A;  4JI6 O;  5GTH Z;  3RW0 A;  4LF9 B;  5LHH A;  3MHS C;  1TGO A;  4QGP A;  3X2Q B;  2BTQ B;  4LF4 B;  2LFS A;  2OCC C;  4B3R B;  4X8A A;  3FFQ A;  3CRC A;  5BY1 A;  1WNS A;  5LHI A;  1EN6 A;  5LGU A;  4X64 O;  4JZG A;  3BEH A;  4JYB A;  1Z5W A;  5CHX A;  5JCO A;  3BRC A;  1S3J A;  3JYC A;  2Z5U A;  3E83 A;  5FNV A;  2AZ0 A;  4JF3 A;  3R65 A;  1K4D C;  2JJ1 G;  2F4V O;  3A0B Z;  3OM3 B;  3QVN A;  5D5Q A;  3T1Y B;  1XBL A;  4JV5 O;  2ODM A;  2UU9 B;  2HHH O;  3JD1 A;  5B1A B;  3LUT B;  5J2U B;  3KKY A;  3BA9 A;  4ZIB A;  3F5W C;  1VQ9 V;  1K73 W;  2DE0 X;  2Q0O C;  1HDJ A;  2YI8 A;  1ZSP A;  1K34 A;  2PY5 A;  1AP6 A;  4K0K O;  3QO8 A;  3ABK B;  4X66 B;  4U7N A;  2RNB A;  1SER A;  2BSK A;  2W0F C;  3LNN A;  4TT3 G;  4Z2W A;  3ZED A;  2FML A;  3WG7 C;  5JJE B;  1ZLZ A;  4GLX A;  4DUZ O;  2YC0 A;  4DR7 B;  3E22 B;  2JVD A;  4CH4 A;  4BW9 A;  2B9Z A;  4GEU A;  4IIJ A;  4FLY A;  1K33 A;  2JGU A;  3RGB A;  2ZCE A;  1IBK O;  4YJ3 A;  1NH2 D;  2UXB B;  4O4L A;  4GKJ O;  2HJD A;  3CJH A;  3OMI B;  2P22 C;  4JGS A;  1AIL A;  4O2A A;  4UVC A;  3HKC A;  3NR7 A;  2XUM A;  2ZQM A;  3JAS B;  3M7M X;  4LP8 A;  1SET A;  2YS8 A;  3ZRS A;  2ZNJ A;  3N27 A;  4UCV A;  4HNA B;  1PD3 A;  2XAH A;  3D3Q A;  5B3S C;  2XAG A;  2XTA A;  1SQP H;  4J42 A;  1HNW B;  1WB8 A;  2QM8 A;  5BR8 O;  1K9M W;  3UKM A;  1QLE B;  5H6Q A;  1KB9 F;  4OPA A;  1GAX A;  3ZX6 A;  3LSQ A;  4U3J A;  2WLI A;  4LF7 O;  3FB8 C;  3K59 A;  4PA9 A;  4LNU A;  3VQW A;  2QJ1 A;  1N8R W;  3CSX A;  4UCR A;  4UV8 A;  1B06 A;  2V1D A;  4JYA B;  3K57 A;  2EIL C;  1N0J A;  5KMG A;  4ICG A;  4O4I B;  1K5Q A;  4LF5 O;  2CTP A;  4NXN O;  1QLN A;  4KP4 A;  1PV0 A;  4BR6 A;  1WPB A;  2CGO A;  1AJQ A;  2X6C A;  5CB4 A;  1WAZ A;  2ZIN A;  1K7D A;  2QR4 A;  1KEC A;  4RO2 A;  1VQ6 V;  5CJ0 A;  5JQG B;  5JH7 A;  1I0H A;  2JK5 C;  1SS3 A;  1K97 A;  1TUB A;  3G6B A;  2P67 A;  5A9G A;  1MAB G;  4DYL A;  3STZ C;  4BIU A;  1E79 G;  1AJP A;  2XAS A;  3SJC C;  1SES A;  2KG7 A;  2KQX A;  3ZHU A;  3E8B A;  2OCC B;  1H2K A;  4X65 O;  4QIW F;  2NN4 A;  1W59 A;  2DN9 A;  2HP8 A;  4KUM A;  4IHJ A;  2YID A;  3OFN G;  4LFC O;  4UV9 A;  4IYH A;  5CA1 A;  1SA0 A;  1Y6X A;  4FZ1 A;  1GH6 A;  5FL7 G;  3ZRW A;  1Z2G A;  2ZM6 O;  2FKX A;  2WLK A;  1N33 B;  3OTF A;  4DV0 O;  3N2K B;  4DR1 O;  1SQX H;  3DSQ A;  4X1Y A;  4I55 B;  1FU1 A;  4B3S B;  2EJ7 A;  1FKA O;  2UXN A;  2RCV A;  2CK3 G;  3MHH C;  1FD9 A;  4I50 A;  4AQY O;  4TV8 A;  1Y4M A;  4ZOL A;  4JTC B;  5EYP A;  3S3X A;  3OTO O;  2YSU B;  4DXW A;  4EFE A;  3HKB A;  1SKV A;  2X6B A;  5EC2 C;  1NTZ H;  1RSO B;  2E76 B;  3B8N A;  4W4L A;  1AR4 A;  1BQ0 A;  2Y0P A;  2DWD C;  4R50 A;  5CBF A;  3WG7 B;  3HB3 B;  2WLN A;  3JCU Z;  5IDJ A;  1ZTE A;  3CCM V;  4QNH B;  3ETD A;  3B77 A;  1I94 B;  1RFY A;  2WSS G;  1AR5 A;  3VQV A;  1VF6 A;  1FFX B;  1KP2 A;  4ABM A;  5CBG A;  1F4M A;  3CB2 A;  3IC9 A;  1AI4 A;  4CKN A;  3K5O A;  1ZL8 A;  4RAI A;  1I5X A;  2X7R B;  1TUE B;  2CE4 A;  4OGQ B;  5DM6 V;  1SQF A;  1CP9 A;  3BA8 A;  2EIK C;  5JVD A;  1FS0 G;  2ADQ B;  2ZE6 A;  4UVB A;  1Q81 W;  1XOU A;  3W7S A;  3Q4H A;  1U96 A;  5L3G A;  4O2B B;  5B3S B;  4G79 A;  1SZX A;  1OCO C;  1YSC A;  2QKS A;  4I4T B;  3K0D A;  4DR5 B;  3CC2 V;  4FLW A;  1D2D A;  2A0L A;  1DTO A;  2EBO A;  4B3T B;  4QPJ A;  2YDE A;  2OCH A;  2ZE8 A;  2R9A A;  4G28 B;  2ZXW C;  3RYH A;  3EXA A;  3FAV A;  4CC5 A;  4DV2 O;  2E5L O;  1PNL A;  4X89 A;  1VF7 A;  1NZ6 A;  3B40 A;  4LWS A;  2OWO A;  4JI7 O;  1TVK B;  3K9A A;  1Q86 W;  2ZKO A;  2A7W A;  4B3M O;  1WLE A;  1XUQ A;  5LP6 C;  3OMN B;  1G4Y B;  2MK3 A;  1L8D A;  2Y4T A;  2EIL B;  3C3S A;  5TIS Z;  4DR4 O;  5E79 Z;  2BTQ A;  3AG1 C;  2LQT A;  1K5S A;  4F6R B;  4DR3 O;  1H8H G;  1QQC A;  1IVS A;  5KLV H;  2ZE7 A;  1BT8 A;  5EIB C;  2WLJ A;  2A79 B;  3W7U A;  5J2T B;  3BAB A;  3EHB B;  5LXT B;  4DV7 O;  1Q8I A;  4JI0 B;  1LUV A;  3CXC U;  2IM9 A;  3FB7 C;  3FX7 A;  1B3Q A;  1AP5 A;  2LFR A;  4DV5 B;  3P30 A;  2PZS A;  3SPJ A;  2CH7 B;  1KYO F;  2GBO A;  2Q68 A;  3QG5 A;  3ZMT A;  1HNX O;  4H13 B;  3CEI A;  3STL C;  3W7W A;  4XDL A;  2D3O W;  2ZE5 A;  1BMF G;  4JAS A;  1N4C A;  4YHH O;  1KKC A;  1PKX A;  1V55 C;  1KC8 W;  1SQB H;  1XNR B;  5B1B C;  2GUZ B;  3AEI A;  4N23 A;  3NXS A;  5LOV B;  3JD0 A;  1QU7 A;  4WF9 V;  1CEZ A;  2R9I A;  4PA4 A;  2HEP A;  4TQF A;  2F1M A;  3WFV A;  3O65 A;  4DUY B;  3E22 A;  1US6 A;  5F2V O;  4MSW C;  3SPI A;  2B5U A;  4DV4 O;  2GTS A;  2Q7G A;  1YJW V;  2EUL A;  1CPY A;  5L3F A;  3FYI B;  1DGS A;  2RDC A;  2EIJ C;  2HKO A;  1ARO P;  3F7Y C;  3H9V A;  4WBN A;  4LFB B;  4EKW A;  3SDL A;  1M93 A;  1Q5O A;  3H1J H;  3T1H O;  2GDS A;  2RQ6 A;  4NTX A;  3JAS A;  1I08 A;  4P9P A;  2HG5 C;  1K4C C;  4PA3 A;  3ZHV A;  2FB5 A;  3FKS G;  1SQG A;  2CTR A;  4HNA A;  4X1K B;  3U11 A;  1XMO O;  1P7B A;  1F23 A;  1NVP D;  4K8X A;  2UUA B;  4MW3 A;  2X0L A;  4RQE A;  1S76 D;  2YXH A;  4LH6 A;  2QWR B;  1P84 F;  1XMQ B;  5KHH A;  2QTS A;  3UT5 B;  2IJI A;  2JS5 A;  3LDE A;  5KX5 A;  4J7K A;  5E1A C;  1ORQ C;  2EIK B;  3JAL A;  2QM4 A;  3ASN C;  2NNU A;  2HFE C;  2FL4 A;  4LF4 O;  3E8H A;  4AI8 A;  3DXR B;  1F51 A;  3TXQ A;  5B1N A;  1Y74 B;  3SPG A;  1OCO B;  5KAF Z;  4RQF A;  2Q9L A;  5J9P C;  3CE2 A;  3ZIA G;  1N34 B;  3BY6 A;  4NB5 A;  1SZT A;  1EM1 A;  2VWJ A;  4O4I A;  4PJ0 Z;  4CKM A;  4GX0 A;  3OEE G;  4GX2 A;  4JI1 O;  4CH3 A;  4HBN A;  3TK1 A;  5BZB A;  2H8P C;  1GO3 F;  2ZXW B;  1HR0 O;  2IJK A;  1O9H A;  2QWQ B;  4FZ0 A;  2QTO A;  1YF2 A;  3THO A;  1JOY A;  4FLT A;  3T1Y O;  2ITC C;  2W6I G;  4LF6 B;  1FJG B;  5JQG A;  1YZB A;  4DK1 A;  1E1R G;  1FXK C;  1GMG A;  5LP6 B;  2XAJ A;  4TOI A;  2UXC O;  4FPP A;  3ZMZ A;  3TCU A;  3AG1 B;  1J5E O;  2AW9 A;  1Q6H A;  5GON B;  5HFM A;  4UB6 Z;  2LGW A;  3ZRX A;  1KU9 A;  4J41 A;  2VWK A;  2CUG A;  4DR7 O;  5K1X A;  4CKP A;  3ICX A;  1XQ8 A;  2EIM C;  3RVZ A;  1SQV H;  2Q6A A;  2WLL A;  4JI4 B;  4ZKI A;  3OGC C;  2OIG A;  1XHZ A;  1XEQ A;  1M5I A;  1YJ9 V;  1Q7Y W;  2C2A A;  2AGA A;  3N2K A;  4UCU A;  4LFA O;  1KMI Z;  2D2C B;  4BWA A;  2BTO A;  1HNZ O;  1UJW B;  5LGT A;  5KHG A;  2OT5 A;  1PPJ H;  1RPO A;  3SYA A;  1V55 B;  2RJZ A;  1XNQ O;  1PNK A;  3AG3 C;  5B1B B;  1RSO A;  3K5N A;  1URF A;  3G71 V;  1XL6 A;  1HNW O;  1S0V A;  2QM7 A;  4FM2 A;  2A06 H;  4ASU G;  3K58 A;  2Z0A A;  5LL6 Y;  3RWR A;  2XOK G;  3J81 N;  2GSM B;  2CDY A;  3BFR A;  1EZV H;  1FFX A;  2HVK C;  4MS2 A;  5JWP A;  1M57 C;  4FM0 A;  1BSM A;  2EIJ B;  1BS3 A;  1VQM V;  3OMA B;  4K3A A;  1LUW A;  5EBM C;  4F6E A;  3K5M A;  2E75 B;  4UCO A;  5DED A;  4NTW A;  3KCY A;  4X88 A;  4FLV A;  4JYA O;  5L3E A;  3LDD A;  2F43 G;  5EK0 A;  4X9Q A;  3BHP A;  1D5A A;  3GWO A;  2GV9 A;  2PYL A;  1PL4 A;  5KA6 A;  3KG2 A;  1VP7 A;  5IYC O;  1IK9 A;  3T1C A;  2XT9 A;  2KSD A;  3T4D A;  4JI6 B;  3SJB C;  1YCI A;  2HR3 A;  1YJN V;  3CPW U;  4PA7 A;  1R3I C;  3OR6 C;  1WA8 B;  2BOB C;  3UQ8 A;  3ASN B;  3CS5 A;  1O9G A;  4JTA B;  4CC6 A;  3JAM N;  1FYJ A;  3IJ4 A;  1OCZ C;  2JS3 A;  1TVK A;  3ML0 A;  3M99 B;  3ZS8 C;  2DMX A;  2Q5Z A;  1IBM O;  1MA1 A;  1J95 A;  3F5T A;  2CTW A;  1YEW A;  3OEH G;  3K79 A;  1WB7 A;  4IGG A;  1Q6U A;  4IYI A;  3RN4 A;  1WP7 A;  1YDX A;  3A0H Z;  1MMM A;  3K3W A;  2F4V B;  1VF5 B;  3ASO C;  5AG2 A;  1V9P A;  3GVM A;  3L74 H;  4JV5 B;  2HHH B;  1MOF A;  3HKE B;  4YIP A;  5LXT A;  4B3S O;  2P6J A;  3QO7 A;  1H2L A;  2L6L A;  1FXK B;  4K0K B;  4PI0 A;  2CH7 A;  4P9O A;  1FPO A;  3APO A;  3D3I A;  3SR2 C;  4C7U A;  4X20 A;  4FIP C;  3GB7 C;  3LSS A;  2WA3 A;  3VBB A;  5IYB O;  3QNE A;  4MTX A;  4JAA A;  4FM1 A;  1BHB A;  4DUZ B;  4GFA A;  1W2B U;  1JCH A;  1AB3 A;  3JCZ A;  5LMU B;  1R6T A;  1I94 O;  4YXW G;  3SYP A;  1SC5 B;  5LOV A;  2M6Y A;  4H0L B;  2EIM B;  4CZZ A;  2YI9 A;  4RUE A;  2QA4 V;  3W7T A;  1IBK B;  1NVP B;  2YXY A;  3K0G A;  1GN6 A;  4GKJ B;  1WJZ A;  3EFF K;  3D36 C;  1S72 V;  3LDC A;  4WFH A;  1Q3E A;  2VQE O;  3T4Z A;  4IL6 Z;  1OCC C;  1KKD A;  4NTY A;  4D7S A;  2H3O A;  3RBZ A;  3RYC B;  4P30 A;  4DRX B;  5JJJ B;  3ETQ A;  2B1G A;  2ILM A;  4D7T A;  2F93 B;  3AG3 B;  4JAV A;  3CME V;  3SPH A;  2Y48 A;  1TAE A;  2ATK C;  2LW7 A;  4DV1 B;  5BR8 B;  3BPZ A;  2LJ2 A;  4UVA A;  1N32 O;  2LO1 A;  3JAW B;  4B7K A;  4X1K A;  2HVJ C;  1G1X B;  2BOC C;  5H9C A;  3L71 H;  1OCR C;  1XDC A;  4HYO A;  1M57 B;  4LF7 B;  1VQL V;  1EBO A;  3OE7 G;  2IBZ H;  2IH3 C;  1I7F A;  4LC1 A;  4GZR B;  4MVZ A;  1AR1 B;  3UT5 A;  3I55 V;  4YIO A;  1M56 C;  1R1B A;  3KZI Z;  4CS4 A;  3AG4 C;  1JJ2 U;  3CRQ A;  2IJJ A;  3Q0Y A;  4LF5 B;  1JR9 A;  1NS1 A;  3IC7 A;  4NXN B;  5CJ4 A;  3ZN0 A;  3DXR A;  2XAF A;  4UB8 Z;  3OT7 A;  4GYC B;  4FK5 C;  5L3D A;  2OTJ V;  4HZ3 A;  4LCU C;  1LNQ A;  5CMU A;  4JI0 O;  4MVO A;  3CCV V;  3K08 A;  4JI8 O;  1GKF A;  2XND G;  1IBL B;  4O4H B;  3JD2 A;  4DV5 O;  1MNG A;  4CH5 A;  3C90 A;  2XHB A;  3JSL A;  2DW4 A;  3FYE B;  4X65 B;  3EVK A;  4I5S A;  1OCZ B;  2LW1 A;  5KUK A;  1NR7 A;  3BAA A;  5IJ0 B;  4HAM A;  2F95 B;  1G6U A;  5LP6 A;  4LFC B;  1QHT A;  2Q4P A;  4QJF B;  1RM1 C;  4WFB V;  1VQP V;  4JAU A;  1XNR O;  2DJV A;  2UXD O;  5B66 Z;  3BCC H; 
#chains in the Genus database with same CATH homology
 4TV9 B;  4LH6 A;  4GKK B;  4X62 B;  5D5Q A;  3T1Y B;  4DR1 B;  5LYJ A;  1XMQ B;  2UU9 B;  3JAR A;  5KHH A;  3UT5 B;  5J2U B;  5KHK A;  2JS5 A;  5KX5 A;  3BA9 A;  4ZIB A;  5ITZ B;  4AQY B;  2YIA A;  3PN1 A;  3OTO B;  4JI5 B;  2YI8 A;  3JAL A;  2QM4 A;  2PUS A;  2PY5 A;  4X66 B;  4ZHQ A;  3LNN A;  4UCS A;  3ZED A;  3JSN A;  5JJE B;  5LA6 B;  2ZNI A;  1IBM B;  2F66 C;  4GLX A;  4DR7 B;  3E22 B;  1N34 B;  4ZI7 B;  2JVD A;  2VWJ A;  1Q43 A;  4O4I A;  4DV6 B;  4CH4 A;  4BW9 A;  4CH3 A;  4HBN A;  1S5J A;  4IIJ A;  4FLY A;  2JGU A;  3RGB A;  2ZCE A;  1O9H A;  1XI1 A;  3THO A;  4YJ3 A;  2UXB B;  4O4L A;  4FLT A;  4TUY B;  4EFB A;  2P22 C;  4O2A A;  5J2U A;  4LF6 B;  1FJG B;  5JQG A;  3HKC A;  5CA0 B;  3JAS B;  4DK1 A;  2R72 A;  3M7M X;  5LP6 B;  4DR2 B;  2ZNJ A;  2OYQ A;  4TOI A;  1X4T A;  4UCV A;  4FLU A;  4HNA B;  4NVP A;  1JMK C;  4L8J A;  5BMV A;  5FNV B;  1HNW B;  2YXL A;  2PTM A;  5GON B;  3SJA C;  5EIB D;  1KU9 A;  5LYJ B;  2VWK A;  3JAR B;  5K1X A;  4LR3 A;  3ICX A;  1T5E A;  1XQ8 A;  3II6 A;  1WN7 A;  2ZIM A;  4JI4 B;  4U3J A;  3HKD A;  4CS2 A;  1HW7 A;  4DV2 B;  1XHZ A;  5K1P A;  1M5I A;  2E5L B;  5IYZ A;  1JJO A;  3K59 A;  4JI3 B;  4LNU A;  3VQY A;  4ZHQ B;  3VQW A;  3N2K A;  2QJ1 A;  4UCU A;  4EB6 A;  2VQE B;  2EX3 A;  3CSX A;  3RYF A;  1KMI Z;  4B3M B;  1TA8 A;  4BWA A;  2BTO A;  4UCR A;  5KHG A;  4JYA B;  3K57 A;  5KMG A;  3A2F A;  2RJZ A;  4O4I B;  2E3C A;  1RSO A;  3K5N A;  4IIJ B;  4DR3 B;  1WPB A;  2ZM6 B;  5GON A;  5CB4 A;  4YJ3 B;  2ZIN A;  4O4L B;  4DV0 B;  4FM2 A;  1Z5V A;  2YIB A;  1N32 B;  4O2A B;  4FFB A;  3K58 A;  5CJ0 A;  4DV7 B;  5JQG B;  3RWR A;  4FLX A;  3HKC B;  3WB1 A;  5JH7 A;  1JFF A;  5IJ9 A;  1FFX A;  1TUB A;  3B2E E;  4I50 B;  4FM0 A;  1M4U A;  4AHC A;  1B04 A;  3SJC C;  3MAQ A;  5BMV B;  3K5M A;  4UCO A;  3N2G A;  4YHH B;  4Q6G A;  4IHJ A;  5KHI A;  4FLV A;  3RFR A;  4B08 A;  3U0Z A;  5CA1 A;  1SA0 A;  3BHP A;  1D5A A;  2GV9 A;  4U3J B;  2PYL A;  3HKD B;  4I9Q A;  5IYZ B;  4LNU B;  1N33 B;  4LH7 A;  3OTF A;  1ZAU A;  3N2K B;  3DSQ A;  4X1Y A;  4I55 B;  4EB6 B;  4FVM A;  1IK9 A;  5C8Y A;  1FU1 A;  3RYF B;  2ZIO A;  4B3S B;  4DV4 B;  4JI6 B;  3SJB C;  4I50 A;  4TV8 A;  4ZOL A;  5EYP A;  2PYJ A;  4JI8 B;  3CHX A;  4YJ2 A;  2Q7E A;  4EFE A;  5KMG B;  4CH6 A;  3UQ8 A;  3HKB A;  1SKV A;  4KL1 A;  4X20 B;  1O9G A;  4CC6 A;  4KHP B;  1H2S B;  1TVK A;  2YIB D;  3ZS8 C;  5CB4 B;  4X1I A;  4CS3 A;  3RYC A;  4DRX A;  1YEW A;  4FFB B;  1XMO B;  1I94 B;  2UXD B;  5JH7 B;  1JFF B;  3VQV A;  5JJN B;  5IJ9 B;  4DK0 A;  1TUB B;  1FFX B;  4DV3 B;  3CB2 A;  2F4V B;  2UUB B;  3K5O A;  4UCT A;  1V9P A;  4TQD A;  4JV5 B;  2HHH B;  4I55 A;  4JI7 B;  3HKE B;  2Q7H A;  3JAW A;  5LXT A;  4EEQ A;  3N2G B;  1P49 A;  1SQF A;  1N36 B;  3BA8 A;  5JVD A;  4IHJ B;  5D5P A;  4LF8 B;  2UUC B;  4K0K B;  4PI0 A;  4DR4 B;  3SR2 C;  4X20 A;  5CA1 B;  1SA0 B;  4UFZ A;  4O2B B;  2R70 A;  3QTC A;  4JI2 B;  3JAK A;  4I4T B;  4K8Z A;  4FM1 A;  4DUZ B;  4DR5 B;  4FLW A;  2V4D A;  4X1Y B;  3RYI A;  5LMU B;  5EZY A;  2P5O A;  4B3T B;  4DR6 B;  5C8Y B;  4JI1 B;  5LOV A;  3IAY A;  2R9A A;  3U10 A;  4O4J A;  4TV8 B;  2YI9 A;  4ZOL B;  5EYP B;  3RYH A;  4YY3 B;  4YJ2 B;  1HR0 B;  3JAT A;  1IBK B;  4CC5 A;  3HKB B;  4GKJ B;  1HNX B;  1VF7 A;  3HKE A;  3WB2 A;  2OWO A;  1Q3E A;  1TVK B;  4D7S A;  5LP6 C;  4X1I B;  5FPO A;  5LMN B;  3RYC B;  2CAZ C;  4DRX B;  5JJJ B;  5JCO C;  2KKW A;  1XHX A;  1L8D A;  3ETQ A;  4O4H A;  1NT2 B;  4NXM B;  2UXC B;  4D7T A;  4FLZ A;  2F93 B;  4PHZ A;  2BTQ A;  4O2B A;  1J5E B;  5FPR A;  4F6R B;  5IWA B;  1QQC A;  4I4T A;  1TAE A;  3SGI A;  3K5L A;  2VQF B;  4DV1 B;  5BR8 B;  3BPZ A;  5IJ0 A;  5EIB C;  5J2T B;  3JAW B;  3BAB A;  5LXT B;  1Q8I A;  4JI0 B;  4X1K A;  2IM9 A;  4AIL C;  5JVD B;  2PGG A;  3VQX A;  4TV9 A;  4DV5 B;  4LF7 B;  5KHJ A;  2PZS A;  4WBN B;  3QF7 A;  3QG5 A;  1I7F A;  4LFA B;  3UT5 A;  3T1H B;  3JAK B;  1HNZ B;  5ITZ A;  4OX9 B;  3RWR D;  4X64 B;  4CS4 A;  3RYI B;  5EZY B;  1XNQ B;  1XNR B;  4LF5 B;  4NXN B;  5LOV B;  5CJ4 A;  3SR2 A;  4O4J B;  4F6R A;  4PI2 A;  2Q0A A;  3RYH B;  3JAT B;  5LA6 A;  2HEP A;  4TQF A;  2F1M A;  4GYC B;  4DUY B;  3E22 A;  4ZI7 A;  5J2T A;  4XA4 A;  2Q7G A;  5KX5 B;  1DGS A;  3WB0 A;  4LF9 B;  1IBL B;  4O4H B;  3JAL B;  4WBN A;  4CH5 A;  4LFB B;  1TGO A;  4TUY A;  2BTQ B;  4LF4 B;  2XHB A;  3JSL A;  4B3R B;  4X65 B;  1M93 A;  1Q5O A;  3FFQ A;  5CA0 A;  2RQ6 A;  3JAS A;  1WNS A;  3BAA A;  5IJ0 B;  2F95 B;  1G6U A;  5LP6 A;  1Z5W A;  4LFC B;  5CHX A;  1QHT A;  5JCO A;  3MUD A;  1SQG A;  3U11 A;  4HNA A;  3BRC A;  4X1K B;  4K8X A;  2UUA B;  5FNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...