3SR2C

Crystal structure of human xlf-xrcc4 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
224
structure length
218
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein XRCC4
publication title XRCC4 Protein Interactions with XRCC4-like Factor (XLF) Create an Extended Grooved Scaffold for DNA Ligation and Double Strand Break Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/protein binding
total genus 47
structure length 218
sequence length 224
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sr2C02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 3sr2C01
3SR2C 5CHXA 4XA4A 3RWRA 2R9AA 5CJ0A 3MUDA 3SR2A 2QM4A 3RWRD 1M5IA 3II6A 1IK9A 5CJ4A 1FU1A 1KU9A
chains in the Genus database with same CATH superfamily
3SYCA 2PTMA 1OCZB 1KU9A 4E4EA 3FKSG 1EZJA 2VRZA 2YIAA 5LBQA 4B7EA 3P3NA 4B3RO 4LP8A 3K5NA 1L0NH 2OTLV 1R3KC 5CA3A 1WB7A 4D6TH 1JJOA 3OEEG 4K3AA 4LFCB 2BE3A 5KHIA 4YJ2A 1WJZA 3SDLA 3VQYA 5C8YB 5HFLA 5GONB 3CRRA 2E5LB 3BA8A 1IBKO 2M6YA 3LDEA 1TUBA 4JI0B 4GUNA 4DV7B 2YIBD 2W0FC 4YHHB 3KZIZ 3ASNB 1IX9A 2ZNJA 2ADPA 4R50A 1JFFA 1PL0A 2BOBC 4RAIA 1VQ8V 3HR0A 1W0KG 1AB3A 4FMTA 2E74B 3VQXA 4O2AB 4YXWG 1GKFA 3X2QB 1TAEA 1IVSA 4NYKA 4FFBA 1AVMA 1N34O 1AI5A 1XQ8A 3K0GA 1GM8A 5LMNB 4I0XB 4JI4B 2ATKC 4X1IB 1DF4A 5JVDB 2XT9A 3OMAB 5IDJA 4GEXA 5ITZA 2BCCH 1M9NA 2AZ2A 1ZL8A 5DN6G 3HKBA 4YJ3B 1Q7YW 1NR7A 3STZC 5LOVB 1LUWA 4IYIA 3WB2A 2XUMA 1RSOA 4LF7O 1Q86W 3SPJA 4DV1B 2QSAA 2ZT9B 1HDJA 4ZOLB 3STLC 2WLHA 5LP6C 4RO2A 4G28B 3HKCA 2GTAA 2CGNA 4TV8B 4PJ0Z 3RYHA 2IM9A 1MNGA 1QCEA 1HWYA 1SQQH 1H2NA 4QIWF 2HG5C 2CTPA 2HHHO 4GKJB 5EC2C 1YTFB 3DXRB 5FLXN 3SPCA 1NS1A 1OCCC 3CP1A 3UT5B 2N74A 3IC7A 3OFNG 3APOA 1R3LC 4WFHA 2JK5C 1VMGA 2GUZA 3K5OA 4N23A 2MK3A 1AP6A 1S0VA 1O9GA 2WLJA 2AXTZ 3QG5A 4LF9B 4JTDB 2R70A 3PJSK 3II6A 3JATA 1HR0O 3P32A 2BSKA 2LGWA 3MD0A 4JV5O 3C90A 2R72A 4OPHA 1J5EO 3CCQV 4CBCA 1VQOV 4TUYB 4W4KA 1CP9A 2PUSA 1IK9A 2Q0AA 3RYFA 3N2GA 3OTFA 4J11A 4JI1B 2JGDA 4JI6O 5FPRA 1LUVA 1YEWA 2UXXA 3K57A 1QLEB 1H2MA 5LGUA 3JARA 1QQCA 1GN2A 2DYSC 4JI3O 2E75B 1E1QG 4K8XA 4FLVA 2Z5UA 2QEXV 2Q73A 3H9VA 3SR2C 3D36A 3L72H 4FK5C 5J2UA 3RGBA 5KAIZ 1JR9A 1U96A 4UVCA 3JASB 1RPOA 4DYLA 4LF6O 3CCEV 4BIOA 4X1KA 4JAAA 1G4YB 4H37A 3CE2A 5L3EA 4FLXA 2OTJV 4RQEA 2ZM6O 4BWAA 1RM1C 2A79B 1SZTA 2FB5A 2WLLA 4I50A 3K79A 2B5UA 3I55V 5IYZB 4Q20A 3KCXA 1FS0G 4MVQA 4EFEA 3J81N 4O4JB 2Q4PA 3ZRXA 1FXHA 4PA6A 5LXTA 3ETGA 2YICA 1N33B 4MTGA 5C93A 4CKPA 2NLJC 4JI2B 1VEWA 4DV3O 2Y69C 4I9WA 2X0LA 4QGPA 3H1KH 2QGNA 2RQ6A 3QO8A 2B1GA 1IXMA 4YIOA 3JAWA 3SYOA 5TISZ 3QNEA 4D7TA 2G38A 2AGAA 4PDVA 3ABKB 5BXZA 1HNWO 5EC1C 1I0HA 1JPXA 4UB6Z 3AG2C 1M4UA 4LF5O 4H44B 3GB7C 3JALA 1OZ0A 3QTCA 1PL4A 4FZ0A 2Q6AA 4B3MB 1VARA 1XMQB 4LWSA 5EYPA 4LNUA 1D5AA 2QJ1A 4J10A 1TVKB 3C3SA 4ASUG 2FYUH 2EZOA 2FL4A 3AG3C 3ZJZA 4U3JB 1SQVH 2GBOA 2YIDA 2QE7G 5E79Z 1XDCA 1SRYA 1IBLB 1VF6C 4Z2WA 2OCCC 5CBFA 3T4DA 3OR6C 1Y74A 1I7FA 2ZE7A 3E8FA 4EKWA 1I94B 1EN5A 4DR3B 3KCYA 1WPBA 3G67A 1HR0B 3TCUA 1FJGO 3ZRSA 1SQXH 3E8GA 4JGSA 1GMGA 1BS3A 4HAMA 2QWPB 2DWEC 4GFCA 2QA4V 1GRJA 3CMAV 1NZ6A 1FYJA 4X20A 5EBMC 2WWWA 2IH3C 4MTOA 2UUAB 5KUMA 4JI6B 3IAYA 4UCTA 1AP5A 1EZVH 2IU0A 5CBHA 1NTMH 3N2KB 4GZRB 3UM7A 2UXCO 5EZYB 2RJZA 2UXDB 3QO5A 4DR4O 5D5PA 1JJ2U 4B7KA 1WP8A 4LR3A 1BZKA 2CH7A 5H5NA 3LUTB 2W6IG 1HNZO 5AG2A 4HBNA 4NXMO 2KB1A 4IL6Z 1M5IA 2D2CB 1N32B 2L35A 2LO1A 5JJJB 2R9IA 4LH7A 1SZXA 4JASA 1EM1A 1KB9F 4H13B 1IBMB 5LP6B 3CB2A 5IWAO 1LNQA 4PI2A 1H2LA 4HNAA 1NU1H 2B9ZA 1NQTA 3M7MX 4ICGA 1K3EA 1M90W 1VQMV 5EBLC 2QWOB 1Z2GA 1WA8B 3FB7C 4CH5A 3CYOA 4CC5A 1OCCB 4BAYA 4DUYO 1P7GA 2E3CA 2KSDA 5IJ0B 2BTOA 3RVYA 4FLZA 1KBHA 2P6JA 5A9GA 1P4RA 4DV5B 3ABTA 3K59A 5BR8B 2JJ2G 4GYCB 3OMNB 2WAMA 3K04A 3DC6A 4J41A 3JAKB 2PI5A 5KX5A 3MDSA 4QPJA 4EEQA 2WLNA 4PA4A 2QM4A 1VF5B 2LFSA 5JCOA 2XAFA 3ZRWB 2AHZA 2IJJA 1VQ5V 2X6CA 3SJCC 2YI8A 4U7NA 3WB1A 1F23A 2IH1C 3JSLA 3WB0A 5GW7A 1BQZA 3ZMTA 3ZIAG 4CS2A 1XREA 4X65B 1G8MA 3FB8C 3JSNA 2RDCA 1VQKV 1WB8A 4MS2A 5KUKA 1UJWB 4LF4B 3E22A 3AK2A 1VP7A 4UUJC 4IYHA 1FFXA 4ZHQB 3OGCC 5KHKA 5B1BC 2DYSB 5JQGB 1JCHA 4JAUA 2YUAA 3BY6A 1HNXO 4JYBA 1YIJV 2ZDIA 2EILC 1F7YA 4K0KB 1VF7A 4DR1O 1DGSA 1LR1A 4BIUA 2RMKB 1E79G 4EFBA 2ZCEA 2DMXA 1B06A 2JDIG 4Z1VA 1EBOA 1KUQA 4J42A 1BCCH 2P5OA 1GN3A 3B2EE 1F4NA 3TXSA 2WA3A 1SA0A 4DK0A 1QVFU 3RYCA 1RM1B 3AG4C 4H0LB 3JAMN 5LA6B 2O57A 3CWBH 5KMGA 1Q6IA 5CA1A 1PD3A 1FXKC 1D2DA 1AJNA 2CAZC 4NXNO 2DYRC 2ARHA 2IJIA 1XNRO 4O4HB 2PYJA 1VQ4V 3FAVA 4WFAV 4CS3A 4DR4B 2P7TC 1VQ7V 2Y69B 4ZBMA 2P67A 1Y76A 5B1OA 5EIBC 2E76B 1SQFA 1KYOF 4B3TO 1F51A 3HKEA 1SQBH 4FM2A 4X62B 4P9OA 3L71H 1N36O 4NXMB 4O4LA 2OWOA 3RYIA 3SGIA 4DV2B 1K5SA 1X59A 3T1YB 3AG2B 1N0NA 5E1AC 3QVNA 4UXNA 3K3WA 4MVRA 2CE4A 1VQ9V 4KHPO 2CGOA 5LMUO 2OT5A 5H6RA 1BHAA 2XAHA 4LCUC 1OCRC 3FYIB 2UU9O 5F2VO 1Z5VA 1RFYA 2HP8A 3G80A 4YY3B 1XNQO 4OPAA 1OV9A 2K9PA 5BY1A 3AG3B 1SQPH 2EIJC 1DF5A 2ZIMA 1SF9A 4UVBA 2YI9A 1GAXA 2PY5A 1JQ0A 4MW3A 2QDOA 3O9OA 3APQA 3G71V 2PYLA 1QU7A 2OCCB 2Y0PA 4PV1B 4QE7A 3ZHQA 3D3IA 1IDSA 1DLBA 4FFKA 1S5JA 5IJ9A 5KHGA 2QKSA 4OX9O 2DN9A 4X64B 3DGEA 3AG1C 3LSQA 2WLIA 3MHSC 3ZEDA 2KG7B 3WFVA 2V4DA 3RBZA 3ZMUA 4MVUA 1R3IC 5GTHZ 1M57C 3TXQA 3JD0A 1MABG 2Q5ZA 4I55A 4B3SB 1P84F 2ZE6A 4F6RB 4CH4A 4MT8A 1MMMA 4JI7O 5IYBO 3MAQA 2ITCC 1GO3F 3LSSA 4Z1MG 4EB6A 1O9HA 1E1RG 4DRXA 1VQPV 4O4IB 2F95B 4FLUA 2EJRA 4JI8B 1Y6XA 3CCMV 1NJIW 1B6QA 5L3GA 1HP8A 2QWNB 5FL7G 3ZBHA 4DV4B 5CA0B 2WSSG 1YF2A 5KLVH 4DR7B 4BIZA 3PN1A 3SPGA 2EZPA 5EIBD 3B77A 4LC1A 3B8MA 1ZSPA 4GX2A 2UUBO 4RUFA 3BEHA 1NTZH 1PM9A 4JYCA 5LYJB 2EULA 4I7ZB 3T1CA 4LFAO 3L70H 4XDKA 2VS0A 4TV9A 3CRCA 3OMIB 1ZUQA 3BCCH 5BMVB 3M99B 2JJ1G 4HYOA 3OT7A 3BFRA 1M93A 2HVKC 1XNRB 4QNHB 1FFTB 3F5TA 2DJVA 3H01A 3H1JH 2DOSA 3C3TA 3CJHB 2IJHA 4X9QA 2BTQB 2HJDA 4B3RB 1G1XB 5J2TB 1YHQV 3UKMA 1KC8W 4X1YB 3ABMC 3CC2V 5CB4B 1BT8A 4I4TB 1K5QA 3G4SV 1S76D 2HLDG 2A0LA 4WBNB 4CKNA 1XMOO 1JVMA 5EBWC 4DR5O 1XEQA 2Q7HA 3A8TA 4DW0A 3CRAA 3E35A 4GKKO 1NKDA 2ZXWC 1IBKB 1A32A 4AILC 5JH7B 5LMUB 4UVAA 1IXBA 3HKDB 3ICXA 2UU9B 2NNUA 2JS5A 5C8YA 4DV0O 1EN4A 1WP7A 4DV6O 5GONA 4LF8O 5B1BB 3CRQA 2FTKA 3OAAG 4PI0A 3IJ4A 2F4VO 1UFIA 2Y4TA 2EILB 4IHJB 5KHJA 3EHBB 3CCUV 1L0LH 4AHCA 2YEVB 1QNMA 1N34B 1IURA 1N8RW 1FXVA 2A9HA 2QTOA 4K35A 1AR4A 3CRMA 5FNVB 2QM8A 1XL6A 4O2AA 4YIPA 2OCHA 2R9AA 3E86A 2HJFC 4NTWA 4LBEC 1DTOA 2RN9A 4R8CA 1PV0A 3AG4B 3D36C 2QKCA 4ABMA 2ZE5A 2F93B 5CMUA 3ZN1A 5B66Z 3OTOO 4I0XA 4X1IA 5JVDA 1COWG 3RWRA 4LF7B 1GTOA 5L3CA 2Z0AA 3LDCA 3JD3A 4ZI7B 3PYIA 1QVGU 3W7SA 1FXKB 3SPHA 4YJ3A 1YJ9V 3EVKA 4QE9A 5LOVA 3ML0A 1CEZA 4O2BB 1XI1A 3UCSC 2F1MA 4I9QA 3Q4HB 1FD9A 2HHHB 1M56C 2QM7A 2HVJC 1SS3A 4ZOLA 2Y3VA 2WA4A 2K1EA 4FLYA 4X66O 4TV8A 3R66A 5DEDA 1L1FA 1WN7A 1GN6A 1YI2V 4MTFA 1NH2D 4XDLA 4JI5O 1FAFA 2X6AA 3DXRA 3GWOA 4NVPA 4GX1A 1XUQA 1K34A 2R9RB 3OUSA 3UT5A 2EX3A 3U10A 4DUZO 1QR9A 4JV5B 3JD4A 1J5EB 4DR6O 2WPDG 1OCRB 2GTSA 1UPGA 4JYAO 4IT5A 4IIJB 2H3OA 1AROP 2UXBO 4FZ1A 1F4MA 2QWRB 3KKYA 2ZIOA 1NVPD 3RW0A 4LFAB 1WNSA 3BPZA 3A2FA 1MZFA 2PF4E 2IBZH 2P4KA 4TUYA 2Q9LA 1PNMA 2XOKG 3OD4A 5LHGA 1H8EG 2F43G 2EJ7A 1US6A 1VQLV 4NTYA 3CHXA 3CPWU 2VQEO 4KXRA 1S77D 3T4ZA 2CK3G 3F5WC 3H1IH 4JI3B 4G79A 1XILA 5B3SC 3ETEA 4R6ZA 3AG1B 3VOUA 2DQ0A 3FFQA 4YJ2B 1JA8A 1ORQC 1NBMG 2C2AA 3TGUH 3ZMZA 4C7UA 4QPKA 1M57B 1AJQA 4X8AA 2HEPA 4LF6B 2KQXA 2YIBA 1TUBB 3T1HO 5DECA 4LFCO 2CDYA 3ZHVA 4KP4A 1Y66A 2ZM6B 4WFBV 4TOIA 2DWDC 5A2QN 2Y3WA 1R6KA 3QO7A 3JASA 1AR5A 3ETDA 2E5LO 1JX9A 1JFFB 2A7WA 4JI0O 2LJ2A 2F4VB 4U7OA 4DV7O 2WLKA 4X88A 4YHHO 1NT2B 1AI7A 2A06H 3JCUZ 1GN4A 4JTAB 5L3DA 4H33A 4CH3A 2XHBA 4FFBB 4DV3B 5IYZA 2Q0OC 2A3QA 1Z5WA 3ASOC 3FB6C 5ITZB 3I5DA 1BE3H 4UV9A 4X89A 4O4JA 3Q0YA 1N4CA 1ZL8B 3HKBB 2GHYA 1Q81W 1HNWB 4NTXA 2RCVA 4PDRA 3D3QA 4J7ZA 5LMNO 1HW7A 4JI4O 1V55C 4LF5B 2DW4A 3OW2U 1RSOB 1R3JC 2ADQB 5IT9N 3B09A 3M8AA 5IE9A 2Y0IA 1H8HG 2XASA 1P7BA 1ROPA 3HKCB 2AHYA 4J9YB 3K9SA 1MZEA 4TQDA 5JJEB 3RYHB 1S72V 2EIKC 1S5LZ 1Q90D 4UV8A 1NH2B 1S5HC 1H2KA 3VBBA 2P06A 2ZE8A 5B1AC 4N21A 4DV1O 2N04A 3IC9A 1ZTEA 2X7RB 1KP2A 2ZD9A 3ABMB 5B5EZ 4WFFA 1B3QA 2ZQMA 4U3FH 2LW7A 1H2GA 2Q7GA 1JMKC 3R65A 3K9AA 1V54C 1TVKA 2GUZB 3CSXA 3T2MA 1XHZA 4UFZA 5KHHA 1NVPB 3UQ8A 3THOA 2FKXA 4JI5B 2ZXWB 3BA9A 3AG7A 4GKJO 4U3JA 1YJNV 1K73W 1BSMA 3CC4V 1FJGB 3JATB 2BSKB 1YVWA 3W7TA 5JCOC 3DSQA 2W0XA 3K58A 3ZCCA 3DC5A 3OUFA 5LGNA 3FX7A 4LF9O 3RYFB 2JIZG 2PGGA 1Q5OA 3N2GB 4G27B 3ZHSA 2JGDB 1ENVA 2EIMC 1YJWV 2LQTA 2Y48A 1PKXA 2OIGA 3IFXA 3TK1A 4TSFG 2UXCB 1XHXA 5D5QA 1WLEA 1QR8A 1QHTA 3NR7A 3SJQC 3UO3A 5IYDO 2GSMB 5LGTA 3JARB 4XDJA 3ABLC 3HPLC 5JJNB 4GFAA 1HNZB 2H8PC 4RWUA 3N2KA 1XOUA 4LH6A 2ZDIC 2Q69A 2XAGA 1TA8A 1ZX3A 5EZYA 1M1KW 1KQSU 5J2UB 3CCSV 4UCUA 1GM9A 3CCVV 1QLNA 3ZN0A 4DR2O 4L8JA 5H2FZ 4X1KB 1K97A 5H6QA 3T1HB 1OCOC 5IWAB 2XTAA 1T5EA 2JGUA 3A0HZ 5CBGA 3CEIA 4P30A 3P30A 2YDEA 4JZGA 3BVOA 2OYQA 2WLLB 4I50B 3AEIA 1AJPA 4F4LA 1M56B 2IW5A 1KP3A 3BHPA 3RN4A 5LP6A 2JS3A 3DTUB 1KKDA 3MUDA 2ZR3A 4UCSA 1R6TA 4DUYB 2Z3YA 4J7KA 3NXSA 5LXTB 3ABUA 3K08A 5IY5C 3CCLV 1WA8A 1SETA 1YITV 1IZ3A 2JEXA 3JAWB 4JYYA 5IJ0A 1OJHA 3OGIB 4FM0A 3WG7C 2XNDG 1N33O 5B1NA 2JRIA 2B1IA 3GVMA 2CTRA 4JI2O 1Y67A 4LFBO 3JAKA 3E83A 3L74H 2L6LA 3ZHRA 4F6EA 1S3JA 4PHZA 1RP3B 1AILA 3VQWA 1L8DA 3JALB 4NKGB 3B4SA 3LNMB 1Q43A 4DK1A 4OXSA 3ZRWA 5JWPA 2RNBA 1N0JA 2H94A 1PNKA 4FLWA 4LWSB 5EYPB 4LNUB 1OHHG 4OGQB 4J80A 4DXWA 1K92A 5CN0A 4G2KA 3JYCA 2ZR2A 5L3FA 1HNXB 1FU1A 4DW1A 1BGYH 4B3MO 5B3SB 1URFA 1XMQO 3CCJV 2HFEC 1Q6UA 1X4TA 3O65A 4CS4A 4PDLA 4DR1B 2DQ3A 1R73A 4E2LA 4ZHQA 3RVZA 1Y74B 5JQGA 4W4LA 4FIPC 2F23A 1MSDA 4UCRA 2YXLA 4NB5A 3ZHUA 1IBLO 1KKCA 3ZRVA 4TWKA 3RFRA 3ZMSA 1TGOA 3SR2A 1K4CC 1KECA 1Y4MA 2YXHA 3JD1A 4PDMA 2IJKA 4MVZA 3B8NA 4JF3A 2Q7EA 2NR5A 2D3OW 1I94O 4GT1A 4WFGA 4X20B 4DR3O 2P22C 5H9CA 3KG2A 1I5YA 1AR1B 3SYAA 4NXNB 5CHXA 3K03A 4PA3A 5LA6A 1CXZB 3E89A 2ODMA 4BW9A 2YSUB 2VQFO 1PNLA 4QJFB 1SESA 3E2EA 3ASOB 2VWKA 4B3TB 2UUAO 2QWQB 4KL1A 4TQFA 2CH7B 3I56V 1N36B 1U97A 4O4HA 3G6BA 4KFMA 4DO2A 2UXDO 4AQYO 4JPRA 1XBLA 2UUCO 4J7JA 3ETQA 1V55B 5J9PC 1MG1A 4MVSA 4UCOA 2EINC 1R6NA 4BW5A 4DR2B 1YCIA 4MW8A 4KHPB 4GLXA 4FVMA 4JTCB 3SYQA 4HNAB 2ILMA 2WLMA 2Y4UA 2EIKB 3RT3C 1N32O 4ZIBA 1SERA 1XNQB 5B1AB 2XAJA 3A0BZ 4WFEA 2IU3A 1IBMO 5L3BA 1K4DC 4FLTA 2V7QG 3FD9A 1YDXA 4CH6A 1V54B 3E8BA 1ZAUA 1TUEB 1W2BU 4GEUA 3BABA 1KD1W 2ZNIA 3W7WA 4MSWC 5KX5B 1XL4A 4L87A 4RQFA 1VQ6V 4OX9B 1OCZC 1VF6A 4DV5O 5LHHA 5BR8O 3ZS8C 1RPRA 5LHIA 5IYCO 3L9DA 1BL8A 4PA7A 4I5SA 2XAQA 2CUGA 4LFBB 1ZWIC 3U0ZA 2YS8A 2EIMB 2NN4A 3VQVA 1PPJH 1QBZA 2DYRB 1GM7A 1B04A 4JI7B 2YXYA 1MOFA 2V1DA 2KG7A 3E22B 2PZSA 1YXBA 1Q6HA 3Q0XA 1FFXB 3FYEB 1G6UA 5CJ0A 4XBFA 3FB5C 4X65O 4F6RA 2OIEA 1V9PA 3ABLB 3D8CA 1GH6A 5KA5A 3CC7V 4LF4O 1SKVA 1MA1A 1EFRG 1I5XA 4GCZA 1VQNV 3ASNC 3K5LA 2PI4A 4O4IA 3S3XA 3ZMVA 2CTQA 3LSUA 3AK1A 2EBOA 2VWJA 4R7CA 5K1XA 1YZBA 3S3WA 3OR7C 3OM3B 4PD4F 1OCOB 5GTIZ 3X2QC 5EK0A 4BR6A 2UUBB 4K0KO 1SA0B 5CA0A 3RYCB 1K9MW 1DK1A 1AI6A 3ZX6A 5KMGB 1ZLZA 5CA1B 1K33A 4NR1A 3CX5F 1P49A 3TJTA 2EIJB 4FPPA 1W0JG 1J95A 3MHHC 1W59A 1K7DA 3J7AU 5LYJA 3FAVB 1H38A 5CJ4A 5IY5B 2VQFB 4B08A 5LL6Y 3H1HH 3F7YC 4A5UB 2Q8VA 1Y76B 1FKAO 3B40A 2LP7A 4FJCC 5FPOA 1SC5B 2UXNA 5BMVA 3HKEB 3WU2Z 3WG7B 4O4LB 3W7XA 3RYIB 3OEHG 2MW2B 4MVOA 3SJAC 1EN6A 3CJHA 1XMOB 4K8ZA 2BTQA 4DR5B 4AQYB 5K1PA 5KAFZ 4XA4A 3A0RA 4GX0A 2UUCB 4GKKB 5J2TA 2QKAA 4X1YA 2CTWA 1PP9H 1H2SB 2X6BA 3LDDA 2Q68A 5CB4A 3H1LH 4I4TA 4X62O 1BHBA 3CMEV 2M7WA 4JAVA 2YC0A 4WBNA 4DV2O 3EFFK 1VIBA 4UCVA 2JVDA 3HB3B 3T1YO 3W7UA 4DV0B 1Q3EA 2N05A 2DE0X 4DV6B 4LF8B 1KMIZ 4CKMA 2GDSA 3K06A 3K0DA 5JH7A 1NI8A 5HFMA 3HKDA 1R1BA 2W6JG 1AI4A 3L73H 4AI8A 3E8HA 1THZA 4YY3O 4CC6A 1I08A 5IJ9B 1FPOA 3QF7A 1JOYA 1CPYA 4IHJA 3SYPA 1K8AW 3CXHF 3N27A 2WLIB 3P3PA 1QLEC 2GV9A 2QTSA 3CXCU 2BOCC 3J80N 2YEVA 3OTOB 3TETA 3F7VC 3ZHTA 5FNVA 1BQ0A 5KA6A 4I55B 4X64O 3LNNA 1MSWD 2QR4A 4RUEA 2JEUA 2Q67A 2HKOA 2ZINA 4TT3G 2AZ0A 4WCEV 4P9PA 4PELA 3UO2A 4IGGA 4CZZA 4EB6B 4ZI7A 4Q6GA 1D5NA 1FXKA 4DRXB 4B3SO 3RWRD 2P4VA 1WAZA 1GK9A 4WF9V 4D7SA 4X66B 4O2BA 3SJBC 4HZ3A 3U11A 3CD6V 3Q4HA 4J9ZB 3SPIA 2EINB 1Q8IA 3GWKC 4P2ZA 4JI8O 4KUMA 4PA9A 3AK3A 3EXAA 2ZKOA 4ZKIA 2ITDC 4DUZB 3CCRV 4DR6B 4JYAB 4DV4O 1BMFG 3BAAA 3CS5A 4UB8Z 4DR7O 2UXBB 3JD2A 3L75H 2AW9A 1SQGA 5BZBA 1YTFD 4TV9B 3JCZA 2KKWA 2HR3A 2ETNA 3ABKC 1WPXA 4GX5A 1YSCA 2FMLA 4MTXA 2LGQA 4IIJA 3IGAC 4JZ2A 1NR1A 3G6EV 3K5MA 3BRCA 1NTKH 2F66C 3OE7G 2LW1A 2LFRA 2P90A 2VQEB 5DM6V 4MVMA 4JI1O 4FM1A 1Q82W
chains in the Genus database with same CATH topology
4PI2A 5JQGA 2F93B 2PTMA 4HNAA 1KU9A 4X1IA 5JVDA 4UCRA 3M7MX 3RWRA 4LF7B 2YXLA 4ZI7B 4CH5A 3RFRA 4YJ3A 1TGOA 2YIAA 3SR2A 4CC5A 5LOVA 3K5NA 4O2BB 2Q7EA 2E3CA 5IJ0B 2BTOA 4FLZA 4DV5B 1XI1A 3K59A 4X20B 2F1MA 2P22C 5BR8B 4I9QA 2HHHB 1JJOA 4GYCB 4LFCB 5KHIA 4NXNB 4YJ2A 5CHXA 4ZOLA 3JAKB 5KX5A 4EEQA 3VQYA 5C8YB 5LA6A 4FLYA 4TV8A 2QM4A 5GONB 4BW9A 2E5LB 3BA8A 5JCOA 1WN7A 1TUBA 4JI0B 2VWKA 4B3TB 4DV7B 2YIBD 4KL1A 4TQFA 2YI8A 4NVPA 3SJCC 4YHHB 3WB1A 3JSLA 1N36B 3WB0A 4O4HA 3UT5A 2EX3A 3U10A 4CS2A 4JV5B 2ZNJA 4X65B 1J5EB 1JFFA 3JSNA 3ETQA 4IIJB 4LF4B 3VQXA 4UCOA 3E22A 2ZIOA 4O2AB 4LFAB 4DR2B 1TAEA 1WNSA 4KHPB 1FFXA 4ZHQB 4GLXA 5KHKA 4FFBA 3BPZA 3A2FA 4FVMA 1XQ8A 5JQGB 4HNAB 5LMNB 4JI4B 4X1IB 5JVDB 4TUYA 5ITZA 4ZIBA 1XNQB 4K0KB 3HKBA 3CHXA 4YJ3B 1VF7A 1DGSA 5LOVB 4FLTA 4JI3B 4EFBA 2ZCEA 3WB2A 1RSOA 4CH6A 1ZAUA 2P5OA 4DV1B 3B2EE 3FFQA 4YJ2B 3BABA 4ZOLB 4DK0A 1SA0A 2ZNIA 5LP6C 3RYCA 5KX5B 3HKCA 5LA6B 4TV8B 4OX9B 3RYHA 5KMGA 5CA1A 2IM9A 2HEPA 4LF6B 2YIBA 1TUBB 3ZS8C 4GKJB 2CAZC 2ZM6B 4LFBB 4TOIA 4O4HB 2PYJA 3UT5B 3U0ZA 4CS3A 3JASA 4DR4B 3VQVA 1JFFB 3K5OA 5EIBC 1O9GA 1SQFA 1B04A 4JI7B 2F4VB 3QG5A 3HKEA 3E22B 4LF9B 2PZSA 4FM2A 4X62B 1NT2B 2R70A 4NXMB 4O4LA 4CH3A 2XHBA 2OWOA 3RYIA 3JATA 3II6A 1FFXB 3SGIA 1G6UA 4FFBB 4DV3B 5IYZA 4DV2B 5CJ0A 2R72A 3T1YB 4F6RA 1Z5WA 1V9PA 4TUYB 5ITZB 2PUSA 1IK9A 4O4JA 2Q0AA 3RYFA 1SKVA 3HKBB 3N2GA 3K5LA 3OTFA 4JI1B 1HNWB 4O4IA 1HW7A 5FPRA 4LF5B 1Z5VA 2VWJA 5K1XA 1YEWA 3K57A 4YY3B 2UUBB 2ZIMA 1SA0B 5CA0A 2YI9A 3RYCB 2PY5A 3JARA 1QQCA 3HKCB 5JJEB 4TQDA 3RYHB 5KMGB 5CA1B 2PYLA 4K8XA 1P49A 4FLVA 3SR2C 5J2UA 1S5JA 3RGBA 5IJ9A 5KHGA 5LYJA 5CJ4A 3JASB 4X64B 2VQFB 2Q7GA 4B08A 1JMKC 1TVKA 3CSXA 4X1KA 1XHZA 4UFZA 5KHHA 3ZEDA 5FPOA 3UQ8A 3THOA 4JI5B 3BA9A 4FLXA 5BMVA 4U3JA 3HKEB 2V4DA 4BWAA 4I50A 4O4LB 1FJGB 3RYIB 3JATB 3SJAC 4I55A 5IYZB 4B3SB 1XMOB 5JCOC 4K8ZA 3DSQA 2BTQA 4DR5B 4AQYB 4F6RB 5K1PA 4XA4A 4CH4A 3K58A 2UUCB 4GKKB 5J2TA 4EFEA 4X1YA 4O4JB 3MAQA 3RYFB 1H2SB 2PGGA 5CB4A 1Q5OA 4I4TA 3N2GB 5LXTA 1N33B 4EB6A 4WBNA 1O9HA 4JI2B 4DRXA 4O4IB 2F95B 4FLUA 4UCVA 2JVDA 4JI8B 2RQ6A 3JAWA 4DV0B 1Q3EA 2UXCB 4DV6B 1XHXA 4D7TA 4LF8B 1KMIZ 5D5QA 1QHTA 4DV4B 5CA0B 4DR7B 5JH7A 3JARB 3PN1A 3HKDA 1M4UA 5JJNB 5EIBD 1HNZB 3N2KA 4LH6A 3JALA 1TA8A 5EZYA 3QTCA 4CC6A 5J2UB 4B3MB 5IJ9B 1XMQB 3QF7A 4UCUA 5LYJB 5EYPA 4LNUA 1D5AA 4IHJA 2QJ1A 1TVKB 4L8JA 4X1KB 4TV9A 3T1HB 5IWAB 2GV9A 1T5EA 5BMVB 2JGUA 4U3JB 3OTOB 1M93A 2OYQA 1XNRB 4I50B 5FNVA 4I55B 1IBLB 2BTQB 3LNNA 4B3RB 3BHPA 5J2TB 5LP6A 2ZINA 3MUDA 4X1YB 4UCSA 4DUYB 1I7FA 5CB4B 4I4TB 1I94B 5LXTB 4DR3B 1HR0B 1WPBA 4EB6B 4ZI7A 4Q6GA 4WBNB 4DRXB 3RWRD 2Q7HA 3JAWB 4D7SA 4X66B 4O2BA 3SJBC 5IJ0A 4FM0A 1IBKB 3U11A 4AILC 4X20A 5JH7B 5LMUB 2UUAB 4JI6B 3IAYA 4UCTA 1Q8IA 3HKDB 3JAKA 3ICXA 2UU9B 4PHZA 2JS5A 3N2KB 5C8YA 3VQWA 4DUZB 1L8DA 3JALB 5EZYB 5GONA 2RJZA 2UXDB 1Q43A 4DR6B 4DK1A 5D5PA 4JYAB 4PI0A 3BAAA 4FLWA 2UXBB 4LR3A 5EYPB 4LNUB 4IHJB 1SQGA 5KHJA 4HBNA 4TV9B 2KKWA 1N34B 4AHCA 1M5IA 1HNXB 1N32B 1FU1A 5JJJB 5FNVB 4IIJA 3K5MA 4LH7A 1X4TA 3BRCA 2F66C 4O2AA 4CS4A 2R9AA 4DR1B 2VQEB 1IBMB 5LP6B 4ZHQA 3CB2A 4FM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR2 C;  5CHX A;  4XA4 A;  3RWR A;  2R9A A;  5CJ0 A;  3MUD A;  3SR2 A;  2QM4 A;  3RWR D;  1M5I A;  3II6 A;  1IK9 A;  5CJ4 A;  1FU1 A;  1KU9 A; 
#chains in the Genus database with same CATH topology
 3SYC A;  2PTM A;  1OCZ B;  1KU9 A;  4E4E A;  3FKS G;  1EZJ A;  2VRZ A;  2YIA A;  5LBQ A;  4B7E A;  3P3N A;  4B3R O;  4LP8 A;  3K5N A;  1L0N H;  2OTL V;  1R3K C;  5CA3 A;  1WB7 A;  4D6T H;  1JJO A;  3OEE G;  4K3A A;  4LFC B;  2BE3 A;  5KHI A;  4YJ2 A;  1WJZ A;  3SDL A;  3VQY A;  5C8Y B;  5HFL A;  5GON B;  3CRR A;  2E5L B;  3BA8 A;  1IBK O;  2M6Y A;  3LDE A;  1TUB A;  4JI0 B;  4GUN A;  4DV7 B;  2YIB D;  2W0F C;  4YHH B;  3KZI Z;  3ASN B;  1IX9 A;  2ZNJ A;  2ADP A;  4R50 A;  1JFF A;  1PL0 A;  2BOB C;  4RAI A;  1VQ8 V;  3HR0 A;  1W0K G;  1AB3 A;  4FMT A;  2E74 B;  3VQX A;  4O2A B;  4YXW G;  1GKF A;  3X2Q B;  1TAE A;  1IVS A;  4NYK A;  4FFB A;  1AVM A;  1N34 O;  1AI5 A;  1XQ8 A;  3K0G A;  1GM8 A;  5LMN B;  4I0X B;  4JI4 B;  2ATK C;  4X1I B;  1DF4 A;  5JVD B;  2XT9 A;  3OMA B;  5IDJ A;  4GEX A;  5ITZ A;  2BCC H;  1M9N A;  2AZ2 A;  1ZL8 A;  5DN6 G;  3HKB A;  4YJ3 B;  1Q7Y W;  1NR7 A;  3STZ C;  5LOV B;  1LUW A;  4IYI A;  3WB2 A;  2XUM A;  1RSO A;  4LF7 O;  1Q86 W;  3SPJ A;  4DV1 B;  2QSA A;  2ZT9 B;  1HDJ A;  4ZOL B;  3STL C;  2WLH A;  5LP6 C;  4RO2 A;  4G28 B;  3HKC A;  2GTA A;  2CGN A;  4TV8 B;  4PJ0 Z;  3RYH A;  2IM9 A;  1MNG A;  1QCE A;  1HWY A;  1SQQ H;  1H2N A;  4QIW F;  2HG5 C;  2CTP A;  2HHH O;  4GKJ B;  5EC2 C;  1YTF B;  3DXR B;  5FLX N;  3SPC A;  1NS1 A;  1OCC C;  3CP1 A;  3UT5 B;  2N74 A;  3IC7 A;  3OFN G;  3APO A;  1R3L C;  4WFH A;  2JK5 C;  1VMG A;  2GUZ A;  3K5O A;  4N23 A;  2MK3 A;  1AP6 A;  1S0V A;  1O9G A;  2WLJ A;  2AXT Z;  3QG5 A;  4LF9 B;  4JTD B;  2R70 A;  3PJS K;  3II6 A;  3JAT A;  1HR0 O;  3P32 A;  2BSK A;  2LGW A;  3MD0 A;  4JV5 O;  3C90 A;  2R72 A;  4OPH A;  1J5E O;  3CCQ V;  4CBC A;  1VQO V;  4TUY B;  4W4K A;  1CP9 A;  2PUS A;  1IK9 A;  2Q0A A;  3RYF A;  3N2G A;  3OTF A;  4J11 A;  4JI1 B;  2JGD A;  4JI6 O;  5FPR A;  1LUV A;  1YEW A;  2UXX A;  3K57 A;  1QLE B;  1H2M A;  5LGU A;  3JAR A;  1QQC A;  1GN2 A;  2DYS C;  4JI3 O;  2E75 B;  1E1Q G;  4K8X A;  4FLV A;  2Z5U A;  2QEX V;  2Q73 A;  3H9V A;  3SR2 C;  3D36 A;  3L72 H;  4FK5 C;  5J2U A;  3RGB A;  5KAI Z;  1JR9 A;  1U96 A;  4UVC A;  3JAS B;  1RPO A;  4DYL A;  4LF6 O;  3CCE V;  4BIO A;  4X1K A;  4JAA A;  1G4Y B;  4H37 A;  3CE2 A;  5L3E A;  4FLX A;  2OTJ V;  4RQE A;  2ZM6 O;  4BWA A;  1RM1 C;  2A79 B;  1SZT A;  2FB5 A;  2WLL A;  4I50 A;  3K79 A;  2B5U A;  3I55 V;  5IYZ B;  4Q20 A;  3KCX A;  1FS0 G;  4MVQ A;  4EFE A;  3J81 N;  4O4J B;  2Q4P A;  3ZRX A;  1FXH A;  4PA6 A;  5LXT A;  3ETG A;  2YIC A;  1N33 B;  4MTG A;  5C93 A;  4CKP A;  2NLJ C;  4JI2 B;  1VEW A;  4DV3 O;  2Y69 C;  4I9W A;  2X0L A;  4QGP A;  3H1K H;  2QGN A;  2RQ6 A;  3QO8 A;  2B1G A;  1IXM A;  4YIO A;  3JAW A;  3SYO A;  5TIS Z;  3QNE A;  4D7T A;  2G38 A;  2AGA A;  4PDV A;  3ABK B;  5BXZ A;  1HNW O;  5EC1 C;  1I0H A;  1JPX A;  4UB6 Z;  3AG2 C;  1M4U A;  4LF5 O;  4H44 B;  3GB7 C;  3JAL A;  1OZ0 A;  3QTC A;  1PL4 A;  4FZ0 A;  2Q6A A;  4B3M B;  1VAR A;  1XMQ B;  4LWS A;  5EYP A;  4LNU A;  1D5A A;  2QJ1 A;  4J10 A;  1TVK B;  3C3S A;  4ASU G;  2FYU H;  2EZO A;  2FL4 A;  3AG3 C;  3ZJZ A;  4U3J B;  1SQV H;  2GBO A;  2YID A;  2QE7 G;  5E79 Z;  1XDC A;  1SRY A;  1IBL B;  1VF6 C;  4Z2W A;  2OCC C;  5CBF A;  3T4D A;  3OR6 C;  1Y74 A;  1I7F A;  2ZE7 A;  3E8F A;  4EKW A;  1I94 B;  1EN5 A;  4DR3 B;  3KCY A;  1WPB A;  3G67 A;  1HR0 B;  3TCU A;  1FJG O;  3ZRS A;  1SQX H;  3E8G A;  4JGS A;  1GMG A;  1BS3 A;  4HAM A;  2QWP B;  2DWE C;  4GFC A;  2QA4 V;  1GRJ A;  3CMA V;  1NZ6 A;  1FYJ A;  4X20 A;  5EBM C;  2WWW A;  2IH3 C;  4MTO A;  2UUA B;  5KUM A;  4JI6 B;  3IAY A;  4UCT A;  1AP5 A;  1EZV H;  2IU0 A;  5CBH A;  1NTM H;  3N2K B;  4GZR B;  3UM7 A;  2UXC O;  5EZY B;  2RJZ A;  2UXD B;  3QO5 A;  4DR4 O;  5D5P A;  1JJ2 U;  4B7K A;  1WP8 A;  4LR3 A;  1BZK A;  2CH7 A;  5H5N A;  3LUT B;  2W6I G;  1HNZ O;  5AG2 A;  4HBN A;  4NXM O;  2KB1 A;  4IL6 Z;  1M5I A;  2D2C B;  1N32 B;  2L35 A;  2LO1 A;  5JJJ B;  2R9I A;  4LH7 A;  1SZX A;  4JAS A;  1EM1 A;  1KB9 F;  4H13 B;  1IBM B;  5LP6 B;  3CB2 A;  5IWA O;  1LNQ A;  4PI2 A;  1H2L A;  4HNA A;  1NU1 H;  2B9Z A;  1NQT A;  3M7M X;  4ICG A;  1K3E A;  1M90 W;  1VQM V;  5EBL C;  2QWO B;  1Z2G A;  1WA8 B;  3FB7 C;  4CH5 A;  3CYO A;  4CC5 A;  1OCC B;  4BAY A;  4DUY O;  1P7G A;  2E3C A;  2KSD A;  5IJ0 B;  2BTO A;  3RVY A;  4FLZ A;  1KBH A;  2P6J A;  5A9G A;  1P4R A;  4DV5 B;  3ABT A;  3K59 A;  5BR8 B;  2JJ2 G;  4GYC B;  3OMN B;  2WAM A;  3K04 A;  3DC6 A;  4J41 A;  3JAK B;  2PI5 A;  5KX5 A;  3MDS A;  4QPJ A;  4EEQ A;  2WLN A;  4PA4 A;  2QM4 A;  1VF5 B;  2LFS A;  5JCO A;  2XAF A;  3ZRW B;  2AHZ A;  2IJJ A;  1VQ5 V;  2X6C A;  3SJC C;  2YI8 A;  4U7N A;  3WB1 A;  1F23 A;  2IH1 C;  3JSL A;  3WB0 A;  5GW7 A;  1BQZ A;  3ZMT A;  3ZIA G;  4CS2 A;  1XRE A;  4X65 B;  1G8M A;  3FB8 C;  3JSN A;  2RDC A;  1VQK V;  1WB8 A;  4MS2 A;  5KUK A;  1UJW B;  4LF4 B;  3E22 A;  3AK2 A;  1VP7 A;  4UUJ C;  4IYH A;  1FFX A;  4ZHQ B;  3OGC C;  5KHK A;  5B1B C;  2DYS B;  5JQG B;  1JCH A;  4JAU A;  2YUA A;  3BY6 A;  1HNX O;  4JYB A;  1YIJ V;  2ZDI A;  2EIL C;  1F7Y A;  4K0K B;  1VF7 A;  4DR1 O;  1DGS A;  1LR1 A;  4BIU A;  2RMK B;  1E79 G;  4EFB A;  2ZCE A;  2DMX A;  1B06 A;  2JDI G;  4Z1V A;  1EBO A;  1KUQ A;  4J42 A;  1BCC H;  2P5O A;  1GN3 A;  3B2E E;  1F4N A;  3TXS A;  2WA3 A;  1SA0 A;  4DK0 A;  1QVF U;  3RYC A;  1RM1 B;  3AG4 C;  4H0L B;  3JAM N;  5LA6 B;  2O57 A;  3CWB H;  5KMG A;  1Q6I A;  5CA1 A;  1PD3 A;  1FXK C;  1D2D A;  1AJN A;  2CAZ C;  4NXN O;  2DYR C;  2ARH A;  2IJI A;  1XNR O;  4O4H B;  2PYJ A;  1VQ4 V;  3FAV A;  4WFA V;  4CS3 A;  4DR4 B;  2P7T C;  1VQ7 V;  2Y69 B;  4ZBM A;  2P67 A;  1Y76 A;  5B1O A;  5EIB C;  2E76 B;  1SQF A;  1KYO F;  4B3T O;  1F51 A;  3HKE A;  1SQB H;  4FM2 A;  4X62 B;  4P9O A;  3L71 H;  1N36 O;  4NXM B;  4O4L A;  2OWO A;  3RYI A;  3SGI A;  4DV2 B;  1K5S A;  1X59 A;  3T1Y B;  3AG2 B;  1N0N A;  5E1A C;  3QVN A;  4UXN A;  3K3W A;  4MVR A;  2CE4 A;  1VQ9 V;  4KHP O;  2CGO A;  5LMU O;  2OT5 A;  5H6R A;  1BHA A;  2XAH A;  4LCU C;  1OCR C;  3FYI B;  2UU9 O;  5F2V O;  1Z5V A;  1RFY A;  2HP8 A;  3G80 A;  4YY3 B;  1XNQ O;  4OPA A;  1OV9 A;  2K9P A;  5BY1 A;  3AG3 B;  1SQP H;  2EIJ C;  1DF5 A;  2ZIM A;  1SF9 A;  4UVB A;  2YI9 A;  1GAX A;  2PY5 A;  1JQ0 A;  4MW3 A;  2QDO A;  3O9O A;  3APQ A;  3G71 V;  2PYL A;  1QU7 A;  2OCC B;  2Y0P A;  4PV1 B;  4QE7 A;  3ZHQ A;  3D3I A;  1IDS A;  1DLB A;  4FFK A;  1S5J A;  5IJ9 A;  5KHG A;  2QKS A;  4OX9 O;  2DN9 A;  4X64 B;  3DGE A;  3AG1 C;  3LSQ A;  2WLI A;  3MHS C;  3ZED A;  2KG7 B;  3WFV A;  2V4D A;  3RBZ A;  3ZMU A;  4MVU A;  1R3I C;  5GTH Z;  1M57 C;  3TXQ A;  3JD0 A;  1MAB G;  2Q5Z A;  4I55 A;  4B3S B;  1P84 F;  2ZE6 A;  4F6R B;  4CH4 A;  4MT8 A;  1MMM A;  4JI7 O;  5IYB O;  3MAQ A;  2ITC C;  1GO3 F;  3LSS A;  4Z1M G;  4EB6 A;  1O9H A;  1E1R G;  4DRX A;  1VQP V;  4O4I B;  2F95 B;  4FLU A;  2EJR A;  4JI8 B;  1Y6X A;  3CCM V;  1NJI W;  1B6Q A;  5L3G A;  1HP8 A;  2QWN B;  5FL7 G;  3ZBH A;  4DV4 B;  5CA0 B;  2WSS G;  1YF2 A;  5KLV H;  4DR7 B;  4BIZ A;  3PN1 A;  3SPG A;  2EZP A;  5EIB D;  3B77 A;  4LC1 A;  3B8M A;  1ZSP A;  4GX2 A;  2UUB O;  4RUF A;  3BEH A;  1NTZ H;  1PM9 A;  4JYC A;  5LYJ B;  2EUL A;  4I7Z B;  3T1C A;  4LFA O;  3L70 H;  4XDK A;  2VS0 A;  4TV9 A;  3CRC A;  3OMI B;  1ZUQ A;  3BCC H;  5BMV B;  3M99 B;  2JJ1 G;  4HYO A;  3OT7 A;  3BFR A;  1M93 A;  2HVK C;  1XNR B;  4QNH B;  1FFT B;  3F5T A;  2DJV A;  3H01 A;  3H1J H;  2DOS A;  3C3T A;  3CJH B;  2IJH A;  4X9Q A;  2BTQ B;  2HJD A;  4B3R B;  1G1X B;  5J2T B;  1YHQ V;  3UKM A;  1KC8 W;  4X1Y B;  3ABM C;  3CC2 V;  5CB4 B;  1BT8 A;  4I4T B;  1K5Q A;  3G4S V;  1S76 D;  2HLD G;  2A0L A;  4WBN B;  4CKN A;  1XMO O;  1JVM A;  5EBW C;  4DR5 O;  1XEQ A;  2Q7H A;  3A8T A;  4DW0 A;  3CRA A;  3E35 A;  4GKK O;  1NKD A;  2ZXW C;  1IBK B;  1A32 A;  4AIL C;  5JH7 B;  5LMU B;  4UVA A;  1IXB A;  3HKD B;  3ICX A;  2UU9 B;  2NNU A;  2JS5 A;  5C8Y A;  4DV0 O;  1EN4 A;  1WP7 A;  4DV6 O;  5GON A;  4LF8 O;  5B1B B;  3CRQ A;  2FTK A;  3OAA G;  4PI0 A;  3IJ4 A;  2F4V O;  1UFI A;  2Y4T A;  2EIL B;  4IHJ B;  5KHJ A;  3EHB B;  3CCU V;  1L0L H;  4AHC A;  2YEV B;  1QNM A;  1N34 B;  1IUR A;  1N8R W;  1FXV A;  2A9H A;  2QTO A;  4K35 A;  1AR4 A;  3CRM A;  5FNV B;  2QM8 A;  1XL6 A;  4O2A A;  4YIP A;  2OCH A;  2R9A A;  3E86 A;  2HJF C;  4NTW A;  4LBE C;  1DTO A;  2RN9 A;  4R8C A;  1PV0 A;  3AG4 B;  3D36 C;  2QKC A;  4ABM A;  2ZE5 A;  2F93 B;  5CMU A;  3ZN1 A;  5B66 Z;  3OTO O;  4I0X A;  4X1I A;  5JVD A;  1COW G;  3RWR A;  4LF7 B;  1GTO A;  5L3C A;  2Z0A A;  3LDC A;  3JD3 A;  4ZI7 B;  3PYI A;  1QVG U;  3W7S A;  1FXK B;  3SPH A;  4YJ3 A;  1YJ9 V;  3EVK A;  4QE9 A;  5LOV A;  3ML0 A;  1CEZ A;  4O2B B;  1XI1 A;  3UCS C;  2F1M A;  4I9Q A;  3Q4H B;  1FD9 A;  2HHH B;  1M56 C;  2QM7 A;  2HVJ C;  1SS3 A;  4ZOL A;  2Y3V A;  2WA4 A;  2K1E A;  4FLY A;  4X66 O;  4TV8 A;  3R66 A;  5DED A;  1L1F A;  1WN7 A;  1GN6 A;  1YI2 V;  4MTF A;  1NH2 D;  4XDL A;  4JI5 O;  1FAF A;  2X6A A;  3DXR A;  3GWO A;  4NVP A;  4GX1 A;  1XUQ A;  1K34 A;  2R9R B;  3OUS A;  3UT5 A;  2EX3 A;  3U10 A;  4DUZ O;  1QR9 A;  4JV5 B;  3JD4 A;  1J5E B;  4DR6 O;  2WPD G;  1OCR B;  2GTS A;  1UPG A;  4JYA O;  4IT5 A;  4IIJ B;  2H3O A;  1ARO P;  2UXB O;  4FZ1 A;  1F4M A;  2QWR B;  3KKY A;  2ZIO A;  1NVP D;  3RW0 A;  4LFA B;  1WNS A;  3BPZ A;  3A2F A;  1MZF A;  2PF4 E;  2IBZ H;  2P4K A;  4TUY A;  2Q9L A;  1PNM A;  2XOK G;  3OD4 A;  5LHG A;  1H8E G;  2F43 G;  2EJ7 A;  1US6 A;  1VQL V;  4NTY A;  3CHX A;  3CPW U;  2VQE O;  4KXR A;  1S77 D;  3T4Z A;  2CK3 G;  3F5W C;  3H1I H;  4JI3 B;  4G79 A;  1XIL A;  5B3S C;  3ETE A;  4R6Z A;  3AG1 B;  3VOU A;  2DQ0 A;  3FFQ A;  4YJ2 B;  1JA8 A;  1ORQ C;  1NBM G;  2C2A A;  3TGU H;  3ZMZ A;  4C7U A;  4QPK A;  1M57 B;  1AJQ A;  4X8A A;  2HEP A;  4LF6 B;  2KQX A;  2YIB A;  1TUB B;  3T1H O;  5DEC A;  4LFC O;  2CDY A;  3ZHV A;  4KP4 A;  1Y66 A;  2ZM6 B;  4WFB V;  4TOI A;  2DWD C;  5A2Q N;  2Y3W A;  1R6K A;  3QO7 A;  3JAS A;  1AR5 A;  3ETD A;  2E5L O;  1JX9 A;  1JFF B;  2A7W A;  4JI0 O;  2LJ2 A;  2F4V B;  4U7O A;  4DV7 O;  2WLK A;  4X88 A;  4YHH O;  1NT2 B;  1AI7 A;  2A06 H;  3JCU Z;  1GN4 A;  4JTA B;  5L3D A;  4H33 A;  4CH3 A;  2XHB A;  4FFB B;  4DV3 B;  5IYZ A;  2Q0O C;  2A3Q A;  1Z5W A;  3ASO C;  3FB6 C;  5ITZ B;  3I5D A;  1BE3 H;  4UV9 A;  4X89 A;  4O4J A;  3Q0Y A;  1N4C A;  1ZL8 B;  3HKB B;  2GHY A;  1Q81 W;  1HNW B;  4NTX A;  2RCV A;  4PDR A;  3D3Q A;  4J7Z A;  5LMN O;  1HW7 A;  4JI4 O;  1V55 C;  4LF5 B;  2DW4 A;  3OW2 U;  1RSO B;  1R3J C;  2ADQ B;  5IT9 N;  3B09 A;  3M8A A;  5IE9 A;  2Y0I A;  1H8H G;  2XAS A;  1P7B A;  1ROP A;  3HKC B;  2AHY A;  4J9Y B;  3K9S A;  1MZE A;  4TQD A;  5JJE B;  3RYH B;  1S72 V;  2EIK C;  1S5L Z;  1Q90 D;  4UV8 A;  1NH2 B;  1S5H C;  1H2K A;  3VBB A;  2P06 A;  2ZE8 A;  5B1A C;  4N21 A;  4DV1 O;  2N04 A;  3IC9 A;  1ZTE A;  2X7R B;  1KP2 A;  2ZD9 A;  3ABM B;  5B5E Z;  4WFF A;  1B3Q A;  2ZQM A;  4U3F H;  2LW7 A;  1H2G A;  2Q7G A;  1JMK C;  3R65 A;  3K9A A;  1V54 C;  1TVK A;  2GUZ B;  3CSX A;  3T2M A;  1XHZ A;  4UFZ A;  5KHH A;  1NVP B;  3UQ8 A;  3THO A;  2FKX A;  4JI5 B;  2ZXW B;  3BA9 A;  3AG7 A;  4GKJ O;  4U3J A;  1YJN V;  1K73 W;  1BSM A;  3CC4 V;  1FJG B;  3JAT B;  2BSK B;  1YVW A;  3W7T A;  5JCO C;  3DSQ A;  2W0X A;  3K58 A;  3ZCC A;  3DC5 A;  3OUF A;  5LGN A;  3FX7 A;  4LF9 O;  3RYF B;  2JIZ G;  2PGG A;  1Q5O A;  3N2G B;  4G27 B;  3ZHS A;  2JGD B;  1ENV A;  2EIM C;  1YJW V;  2LQT A;  2Y48 A;  1PKX A;  2OIG A;  3IFX A;  3TK1 A;  4TSF G;  2UXC B;  1XHX A;  5D5Q A;  1WLE A;  1QR8 A;  1QHT A;  3NR7 A;  3SJQ C;  3UO3 A;  5IYD O;  2GSM B;  5LGT A;  3JAR B;  4XDJ A;  3ABL C;  3HPL C;  5JJN B;  4GFA A;  1HNZ B;  2H8P C;  4RWU A;  3N2K A;  1XOU A;  4LH6 A;  2ZDI C;  2Q69 A;  2XAG A;  1TA8 A;  1ZX3 A;  5EZY A;  1M1K W;  1KQS U;  5J2U B;  3CCS V;  4UCU A;  1GM9 A;  3CCV V;  1QLN A;  3ZN0 A;  4DR2 O;  4L8J A;  5H2F Z;  4X1K B;  1K97 A;  5H6Q A;  3T1H B;  1OCO C;  5IWA B;  2XTA A;  1T5E A;  2JGU A;  3A0H Z;  5CBG A;  3CEI A;  4P30 A;  3P30 A;  2YDE A;  4JZG A;  3BVO A;  2OYQ A;  2WLL B;  4I50 B;  3AEI A;  1AJP A;  4F4L A;  1M56 B;  2IW5 A;  1KP3 A;  3BHP A;  3RN4 A;  5LP6 A;  2JS3 A;  3DTU B;  1KKD A;  3MUD A;  2ZR3 A;  4UCS A;  1R6T A;  4DUY B;  2Z3Y A;  4J7K A;  3NXS A;  5LXT B;  3ABU A;  3K08 A;  5IY5 C;  3CCL V;  1WA8 A;  1SET A;  1YIT V;  1IZ3 A;  2JEX A;  3JAW B;  4JYY A;  5IJ0 A;  1OJH A;  3OGI B;  4FM0 A;  3WG7 C;  2XND G;  1N33 O;  5B1N A;  2JRI A;  2B1I A;  3GVM A;  2CTR A;  4JI2 O;  1Y67 A;  4LFB O;  3JAK A;  3E83 A;  3L74 H;  2L6L A;  3ZHR A;  4F6E A;  1S3J A;  4PHZ A;  1RP3 B;  1AIL A;  3VQW A;  1L8D A;  3JAL B;  4NKG B;  3B4S A;  3LNM B;  1Q43 A;  4DK1 A;  4OXS A;  3ZRW A;  5JWP A;  2RNB A;  1N0J A;  2H94 A;  1PNK A;  4FLW A;  4LWS B;  5EYP B;  4LNU B;  1OHH G;  4OGQ B;  4J80 A;  4DXW A;  1K92 A;  5CN0 A;  4G2K A;  3JYC A;  2ZR2 A;  5L3F A;  1HNX B;  1FU1 A;  4DW1 A;  1BGY H;  4B3M O;  5B3S B;  1URF A;  1XMQ O;  3CCJ V;  2HFE C;  1Q6U A;  1X4T A;  3O65 A;  4CS4 A;  4PDL A;  4DR1 B;  2DQ3 A;  1R73 A;  4E2L A;  4ZHQ A;  3RVZ A;  1Y74 B;  5JQG A;  4W4L A;  4FIP C;  2F23 A;  1MSD A;  4UCR A;  2YXL A;  4NB5 A;  3ZHU A;  1IBL O;  1KKC A;  3ZRV A;  4TWK A;  3RFR A;  3ZMS A;  1TGO A;  3SR2 A;  1K4C C;  1KEC A;  1Y4M A;  2YXH A;  3JD1 A;  4PDM A;  2IJK A;  4MVZ A;  3B8N A;  4JF3 A;  2Q7E A;  2NR5 A;  2D3O W;  1I94 O;  4GT1 A;  4WFG A;  4X20 B;  4DR3 O;  2P22 C;  5H9C A;  3KG2 A;  1I5Y A;  1AR1 B;  3SYA A;  4NXN B;  5CHX A;  3K03 A;  4PA3 A;  5LA6 A;  1CXZ B;  3E89 A;  2ODM A;  4BW9 A;  2YSU B;  2VQF O;  1PNL A;  4QJF B;  1SES A;  3E2E A;  3ASO B;  2VWK A;  4B3T B;  2UUA O;  2QWQ B;  4KL1 A;  4TQF A;  2CH7 B;  3I56 V;  1N36 B;  1U97 A;  4O4H A;  3G6B A;  4KFM A;  4DO2 A;  2UXD O;  4AQY O;  4JPR A;  1XBL A;  2UUC O;  4J7J A;  3ETQ A;  1V55 B;  5J9P C;  1MG1 A;  4MVS A;  4UCO A;  2EIN C;  1R6N A;  4BW5 A;  4DR2 B;  1YCI A;  4MW8 A;  4KHP B;  4GLX A;  4FVM A;  4JTC B;  3SYQ A;  4HNA B;  2ILM A;  2WLM A;  2Y4U A;  2EIK B;  3RT3 C;  1N32 O;  4ZIB A;  1SER A;  1XNQ B;  5B1A B;  2XAJ A;  3A0B Z;  4WFE A;  2IU3 A;  1IBM O;  5L3B A;  1K4D C;  4FLT A;  2V7Q G;  3FD9 A;  1YDX A;  4CH6 A;  1V54 B;  3E8B A;  1ZAU A;  1TUE B;  1W2B U;  4GEU A;  3BAB A;  1KD1 W;  2ZNI A;  3W7W A;  4MSW C;  5KX5 B;  1XL4 A;  4L87 A;  4RQF A;  1VQ6 V;  4OX9 B;  1OCZ C;  1VF6 A;  4DV5 O;  5LHH A;  5BR8 O;  3ZS8 C;  1RPR A;  5LHI A;  5IYC O;  3L9D A;  1BL8 A;  4PA7 A;  4I5S A;  2XAQ A;  2CUG A;  4LFB B;  1ZWI C;  3U0Z A;  2YS8 A;  2EIM B;  2NN4 A;  3VQV A;  1PPJ H;  1QBZ A;  2DYR B;  1GM7 A;  1B04 A;  4JI7 B;  2YXY A;  1MOF A;  2V1D A;  2KG7 A;  3E22 B;  2PZS A;  1YXB A;  1Q6H A;  3Q0X A;  1FFX B;  3FYE B;  1G6U A;  5CJ0 A;  4XBF A;  3FB5 C;  4X65 O;  4F6R A;  2OIE A;  1V9P A;  3ABL B;  3D8C A;  1GH6 A;  5KA5 A;  3CC7 V;  4LF4 O;  1SKV A;  1MA1 A;  1EFR G;  1I5X A;  4GCZ A;  1VQN V;  3ASN C;  3K5L A;  2PI4 A;  4O4I A;  3S3X A;  3ZMV A;  2CTQ A;  3LSU A;  3AK1 A;  2EBO A;  2VWJ A;  4R7C A;  5K1X A;  1YZB A;  3S3W A;  3OR7 C;  3OM3 B;  4PD4 F;  1OCO B;  5GTI Z;  3X2Q C;  5EK0 A;  4BR6 A;  2UUB B;  4K0K O;  1SA0 B;  5CA0 A;  3RYC B;  1K9M W;  1DK1 A;  1AI6 A;  3ZX6 A;  5KMG B;  1ZLZ A;  5CA1 B;  1K33 A;  4NR1 A;  3CX5 F;  1P49 A;  3TJT A;  2EIJ B;  4FPP A;  1W0J G;  1J95 A;  3MHH C;  1W59 A;  1K7D A;  3J7A U;  5LYJ A;  3FAV B;  1H38 A;  5CJ4 A;  5IY5 B;  2VQF B;  4B08 A;  5LL6 Y;  3H1H H;  3F7Y C;  4A5U B;  2Q8V A;  1Y76 B;  1FKA O;  3B40 A;  2LP7 A;  4FJC C;  5FPO A;  1SC5 B;  2UXN A;  5BMV A;  3HKE B;  3WU2 Z;  3WG7 B;  4O4L B;  3W7X A;  3RYI B;  3OEH G;  2MW2 B;  4MVO A;  3SJA C;  1EN6 A;  3CJH A;  1XMO B;  4K8Z A;  2BTQ A;  4DR5 B;  4AQY B;  5K1P A;  5KAF Z;  4XA4 A;  3A0R A;  4GX0 A;  2UUC B;  4GKK B;  5J2T A;  2QKA A;  4X1Y A;  2CTW A;  1PP9 H;  1H2S B;  2X6B A;  3LDD A;  2Q68 A;  5CB4 A;  3H1L H;  4I4T A;  4X62 O;  1BHB A;  3CME V;  2M7W A;  4JAV A;  2YC0 A;  4WBN A;  4DV2 O;  3EFF K;  1VIB A;  4UCV A;  2JVD A;  3HB3 B;  3T1Y O;  3W7U A;  4DV0 B;  1Q3E A;  2N05 A;  2DE0 X;  4DV6 B;  4LF8 B;  1KMI Z;  4CKM A;  2GDS A;  3K06 A;  3K0D A;  5JH7 A;  1NI8 A;  5HFM A;  3HKD A;  1R1B A;  2W6J G;  1AI4 A;  3L73 H;  4AI8 A;  3E8H A;  1THZ A;  4YY3 O;  4CC6 A;  1I08 A;  5IJ9 B;  1FPO A;  3QF7 A;  1JOY A;  1CPY A;  4IHJ A;  3SYP A;  1K8A W;  3CXH F;  3N27 A;  2WLI B;  3P3P A;  1QLE C;  2GV9 A;  2QTS A;  3CXC U;  2BOC C;  3J80 N;  2YEV A;  3OTO B;  3TET A;  3F7V C;  3ZHT A;  5FNV A;  1BQ0 A;  5KA6 A;  4I55 B;  4X64 O;  3LNN A;  1MSW D;  2QR4 A;  4RUE A;  2JEU A;  2Q67 A;  2HKO A;  2ZIN A;  4TT3 G;  2AZ0 A;  4WCE V;  4P9P A;  4PEL A;  3UO2 A;  4IGG A;  4CZZ A;  4EB6 B;  4ZI7 A;  4Q6G A;  1D5N A;  1FXK A;  4DRX B;  4B3S O;  3RWR D;  2P4V A;  1WAZ A;  1GK9 A;  4WF9 V;  4D7S A;  4X66 B;  4O2B A;  3SJB C;  4HZ3 A;  3U11 A;  3CD6 V;  3Q4H A;  4J9Z B;  3SPI A;  2EIN B;  1Q8I A;  3GWK C;  4P2Z A;  4JI8 O;  4KUM A;  4PA9 A;  3AK3 A;  3EXA A;  2ZKO A;  4ZKI A;  2ITD C;  4DUZ B;  3CCR V;  4DR6 B;  4JYA B;  4DV4 O;  1BMF G;  3BAA A;  3CS5 A;  4UB8 Z;  4DR7 O;  2UXB B;  3JD2 A;  3L75 H;  2AW9 A;  1SQG A;  5BZB A;  1YTF D;  4TV9 B;  3JCZ A;  2KKW A;  2HR3 A;  2ETN A;  3ABK C;  1WPX A;  4GX5 A;  1YSC A;  2FML A;  4MTX A;  2LGQ A;  4IIJ A;  3IGA C;  4JZ2 A;  1NR1 A;  3G6E V;  3K5M A;  3BRC A;  1NTK H;  2F66 C;  3OE7 G;  2LW1 A;  2LFR A;  2P90 A;  2VQE B;  5DM6 V;  4MVM A;  4JI1 O;  4FM1 A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 4PI2 A;  5JQG A;  2F93 B;  2PTM A;  4HNA A;  1KU9 A;  4X1I A;  5JVD A;  4UCR A;  3M7M X;  3RWR A;  4LF7 B;  2YXL A;  4ZI7 B;  4CH5 A;  3RFR A;  4YJ3 A;  1TGO A;  2YIA A;  3SR2 A;  4CC5 A;  5LOV A;  3K5N A;  4O2B B;  2Q7E A;  2E3C A;  5IJ0 B;  2BTO A;  4FLZ A;  4DV5 B;  1XI1 A;  3K59 A;  4X20 B;  2F1M A;  2P22 C;  5BR8 B;  4I9Q A;  2HHH B;  1JJO A;  4GYC B;  4LFC B;  5KHI A;  4NXN B;  4YJ2 A;  5CHX A;  4ZOL A;  3JAK B;  5KX5 A;  4EEQ A;  3VQY A;  5C8Y B;  5LA6 A;  4FLY A;  4TV8 A;  2QM4 A;  5GON B;  4BW9 A;  2E5L B;  3BA8 A;  5JCO A;  1WN7 A;  1TUB A;  4JI0 B;  2VWK A;  4B3T B;  4DV7 B;  2YIB D;  4KL1 A;  4TQF A;  2YI8 A;  4NVP A;  3SJC C;  4YHH B;  3WB1 A;  3JSL A;  1N36 B;  3WB0 A;  4O4H A;  3UT5 A;  2EX3 A;  3U10 A;  4CS2 A;  4JV5 B;  2ZNJ A;  4X65 B;  1J5E B;  1JFF A;  3JSN A;  3ETQ A;  4IIJ B;  4LF4 B;  3VQX A;  4UCO A;  3E22 A;  2ZIO A;  4O2A B;  4LFA B;  4DR2 B;  1TAE A;  1WNS A;  4KHP B;  1FFX A;  4ZHQ B;  4GLX A;  5KHK A;  4FFB A;  3BPZ A;  3A2F A;  4FVM A;  1XQ8 A;  5JQG B;  4HNA B;  5LMN B;  4JI4 B;  4X1I B;  5JVD B;  4TUY A;  5ITZ A;  4ZIB A;  1XNQ B;  4K0K B;  3HKB A;  3CHX A;  4YJ3 B;  1VF7 A;  1DGS A;  5LOV B;  4FLT A;  4JI3 B;  4EFB A;  2ZCE A;  3WB2 A;  1RSO A;  4CH6 A;  1ZAU A;  2P5O A;  4DV1 B;  3B2E E;  3FFQ A;  4YJ2 B;  3BAB A;  4ZOL B;  4DK0 A;  1SA0 A;  2ZNI A;  5LP6 C;  3RYC A;  5KX5 B;  3HKC A;  5LA6 B;  4TV8 B;  4OX9 B;  3RYH A;  5KMG A;  5CA1 A;  2IM9 A;  2HEP A;  4LF6 B;  2YIB A;  1TUB B;  3ZS8 C;  4GKJ B;  2CAZ C;  2ZM6 B;  4LFB B;  4TOI A;  4O4H B;  2PYJ A;  3UT5 B;  3U0Z A;  4CS3 A;  3JAS A;  4DR4 B;  3VQV A;  1JFF B;  3K5O A;  5EIB C;  1O9G A;  1SQF A;  1B04 A;  4JI7 B;  2F4V B;  3QG5 A;  3HKE A;  3E22 B;  4LF9 B;  2PZS A;  4FM2 A;  4X62 B;  1NT2 B;  2R70 A;  4NXM B;  4O4L A;  4CH3 A;  2XHB A;  2OWO A;  3RYI A;  3JAT A;  3II6 A;  1FFX B;  3SGI A;  1G6U A;  4FFB B;  4DV3 B;  5IYZ A;  4DV2 B;  5CJ0 A;  2R72 A;  3T1Y B;  4F6R A;  1Z5W A;  1V9P A;  4TUY B;  5ITZ B;  2PUS A;  1IK9 A;  4O4J A;  2Q0A A;  3RYF A;  1SKV A;  3HKB B;  3N2G A;  3K5L A;  3OTF A;  4JI1 B;  1HNW B;  4O4I A;  1HW7 A;  5FPR A;  4LF5 B;  1Z5V A;  2VWJ A;  5K1X A;  1YEW A;  3K57 A;  4YY3 B;  2UUB B;  2ZIM A;  1SA0 B;  5CA0 A;  2YI9 A;  3RYC B;  2PY5 A;  3JAR A;  1QQC A;  3HKC B;  5JJE B;  4TQD A;  3RYH B;  5KMG B;  5CA1 B;  2PYL A;  4K8X A;  1P49 A;  4FLV A;  3SR2 C;  5J2U A;  1S5J A;  3RGB A;  5IJ9 A;  5KHG A;  5LYJ A;  5CJ4 A;  3JAS B;  4X64 B;  2VQF B;  2Q7G A;  4B08 A;  1JMK C;  1TVK A;  3CSX A;  4X1K A;  1XHZ A;  4UFZ A;  5KHH A;  3ZED A;  5FPO A;  3UQ8 A;  3THO A;  4JI5 B;  3BA9 A;  4FLX A;  5BMV A;  4U3J A;  3HKE B;  2V4D A;  4BWA A;  4I50 A;  4O4L B;  1FJG B;  3RYI B;  3JAT B;  3SJA C;  4I55 A;  5IYZ B;  4B3S B;  1XMO B;  5JCO C;  4K8Z A;  3DSQ A;  2BTQ A;  4DR5 B;  4AQY B;  4F6R B;  5K1P A;  4XA4 A;  4CH4 A;  3K58 A;  2UUC B;  4GKK B;  5J2T A;  4EFE A;  4X1Y A;  4O4J B;  3MAQ A;  3RYF B;  1H2S B;  2PGG A;  5CB4 A;  1Q5O A;  4I4T A;  3N2G B;  5LXT A;  1N33 B;  4EB6 A;  4WBN A;  1O9H A;  4JI2 B;  4DRX A;  4O4I B;  2F95 B;  4FLU A;  4UCV A;  2JVD A;  4JI8 B;  2RQ6 A;  3JAW A;  4DV0 B;  1Q3E A;  2UXC B;  4DV6 B;  1XHX A;  4D7T A;  4LF8 B;  1KMI Z;  5D5Q A;  1QHT A;  4DV4 B;  5CA0 B;  4DR7 B;  5JH7 A;  3JAR B;  3PN1 A;  3HKD A;  1M4U A;  5JJN B;  5EIB D;  1HNZ B;  3N2K A;  4LH6 A;  3JAL A;  1TA8 A;  5EZY A;  3QTC A;  4CC6 A;  5J2U B;  4B3M B;  5IJ9 B;  1XMQ B;  3QF7 A;  4UCU A;  5LYJ B;  5EYP A;  4LNU A;  1D5A A;  4IHJ A;  2QJ1 A;  1TVK B;  4L8J A;  4X1K B;  4TV9 A;  3T1H B;  5IWA B;  2GV9 A;  1T5E A;  5BMV B;  2JGU A;  4U3J B;  3OTO B;  1M93 A;  2OYQ A;  1XNR B;  4I50 B;  5FNV A;  4I55 B;  1IBL B;  2BTQ B;  3LNN A;  4B3R B;  3BHP A;  5J2T B;  5LP6 A;  2ZIN A;  3MUD A;  4X1Y B;  4UCS A;  4DUY B;  1I7F A;  5CB4 B;  4I4T B;  1I94 B;  5LXT B;  4DR3 B;  1HR0 B;  1WPB A;  4EB6 B;  4ZI7 A;  4Q6G A;  4WBN B;  4DRX B;  3RWR D;  2Q7H A;  3JAW B;  4D7S A;  4X66 B;  4O2B A;  3SJB C;  5IJ0 A;  4FM0 A;  1IBK B;  3U11 A;  4AIL C;  4X20 A;  5JH7 B;  5LMU B;  2UUA B;  4JI6 B;  3IAY A;  4UCT A;  1Q8I A;  3HKD B;  3JAK A;  3ICX A;  2UU9 B;  4PHZ A;  2JS5 A;  3N2K B;  5C8Y A;  3VQW A;  4DUZ B;  1L8D A;  3JAL B;  5EZY B;  5GON A;  2RJZ A;  2UXD B;  1Q43 A;  4DR6 B;  4DK1 A;  5D5P A;  4JYA B;  4PI0 A;  3BAA A;  4FLW A;  2UXB B;  4LR3 A;  5EYP B;  4LNU B;  4IHJ B;  1SQG A;  5KHJ A;  4HBN A;  4TV9 B;  2KKW A;  1N34 B;  4AHC A;  1M5I A;  1HNX B;  1N32 B;  1FU1 A;  5JJJ B;  5FNV B;  4IIJ A;  3K5M A;  4LH7 A;  1X4T A;  3BRC A;  2F66 C;  4O2A A;  4CS4 A;  2R9A A;  4DR1 B;  2VQE B;  1IBM B;  5LP6 B;  4ZHQ A;  3CB2 A;  4FM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...