1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
5H8QA 1FTJA 3QSLA 1JW5A 1B4ZA 1Y66A 4LQ5A 3T9VA 1AMFA 3CFLA 3FJMA 4TLMB 4FEDA 3PGFA 4R2FA 4EDPA 4H65A 4L17A 2D5WA 4XKRA 1MOFA 1I6QA 1LAHE 3MZ1A 4LP2B 4RK9A 4RK2A 1LFIA 4UACA 4G68C 3CSBA 3KGCA 4QFKA 3RTWB 3T9HB 1USYE 4ELRA 1JEUA 2D21A 3VXCA 2DVZA 3FV1A 3TQLA 1MY1A 2XXUA 4H8IA 5BUUA 4DDDA 2F78A 5B7DA 3QUFA 1MH4A 4FAJA 1H44A 1MY2A 2DS9A 2F36A 1BLFA 1Y1ZA 1AH5A 1B5HA 2DYXA 2IA4A 2RF1A 2XXRA 3OO9A 3PD8A 4H5FA 4LZ5A 4OFJA 3C35A 3VLWA 5I84A 4X9TA 3GXAA 2ANJA 2V3QA 5AA3A 3FD3A 1LBBA 4G2KA 1MXUA 2HAUA 3IAZA 5I57A 3WAFA 2PYYA 4OZ9A 4U23A 4NF4B 3Q27A 3H6UA 4G8MA 5I2NB 2ZNSA 3PUVE 3MVWA 4PFTA 2V93A 3H03A 3JV9A 5TPAA 3FJGA 1QKAA 1RYOA 1XVYA 4Q30B 3SESA 4LZ8A 2O7UA 3U94A 1IQ7A 1QUJA 1ANFA 4NWDA 5HFLA 3V8XB 2ALUA 5H8HB 4F2QA 2F7BA 2QSXA 1XVXA 4AB6A 4F31B 4H8JA 3SEUA 1II5A 1JQFA 4ZE9A 5TP9A 5K2XA 3MZBA 2QL3A 3GBBA 3IOWA 4JWOA 5KCJB 4N6PA 2Y84A 5FHMA 5AE4A 4ISUA 4ZDMA 5L8DA 1OQHA 5CMKA 4DZ1A 3IO4A 4ELPA 4ZECA 1QR9A 1JW1A 4G2ZA 4KI0E 1P1QA 3ZKLA 2OLBA 2H99A 1PBQA 4JF3A 5EHSA 4NMYA 3CI8A 3U72A 2H98A 3PUXE 1MH3A 2F7AA 3K1PA 5CN0A 4OVJA 1EZOA 3S9NC 3UIFA 3TCGA 3LR1A 4P0IA 5H8NA 3HSTA 1POTA 3HN0A 3T9XB 1P1WA 3MHSC 3EF7A 2UVIA 5DVIA 3OENA 4U21A 4YB7A 1BTJA 3EHSA 4P0GA 3C34A 2XD3A 1DPEA 3KJ7A 4N13A 3TAJA 2Y7WA 1FTMA 4DCYA 1N7XA 5HFMA 3E4RA 2V84A 1HSEA 2AL4A 2QS4A 3QUJA 5TP9B 3U92A 3W9WA 1QUIA 3K1NA 3OOAA 5L9SA 4GOTA 3TZAA 1LBCA 1YTVA 4IO2A 3IK6B 3R6UA 1EU8A 1MXVA 1F23A 3GZGA 4IB2A 3O6GA 1JETA 1A40A 1NH7A 4JSOA 2H4IA 5CMCA 4C1UA 1CE2A 1QBZA 4IGTA 1LFHA 1US4A 4GIZA 2PVUA 1SQYA 4KYDA 4FATA 4R6HA 2KLFA 1JVXA 4MLQA 1DOTA 2RINA 4G77A 4EQBA 5AA2B 4EF1A 2VOZA 3K2DA 2XHDA 2E0SA 4AQ4A 1IITA 3CRBA 4F2OA 3VVFA 4YB5A 3N5LA 2RC9A 5H8SA 5HPQA 2AYSA 4XTCQ 3C9HA 2OCUA 2ONKE 5I58A 1ZJLA 4TQUQ 4Z7EA 2GRVA 4HTGA 3L6GA 4NE4A 1F9BA 1IXHA 2F5XA 2XXHA 4HS7A 1FTKA 5H8HA 1IXCA 1ZKBA 2ABHA 1QCEA 2GFEA 4G68B 5CMMA 5ITPA 3V83A 3O97A 2RKMA 4ZEFA 1OVBA 2P1SA 1EBOA 1Y3PA 1TXFA 1MXXA 5H9CA 1B2HA 1P1OA 2F8DA 2XX9A 2Z8EA 3PPRA 4FECA 3IO6A 1NKXA 1QUKA 1Y20A 4AB5A 1JEVA 4THIA 4DXBA 3D4GA 3KSXA 3MQ9A 4NWCA 1H45A 3V89B 2Q89A 1LSTA 3TQWA 1LB8A 1DF4A 1R1NA 2Y7PA 3IB2A 3A3CA 3IX1A 4O3BA 1FTOA 4FK5C 1M5CA 3FATA 3FVOA 4KCDA 4YU0A 3SEYA 1ZU0A 4RY1A 3B6TA 3S9LC 3QYTA 2O6AA 1BKAA 1H76A 2UVHA 4QFNA 2ZYOA 2OBGA 4XKNA 2XX8A 1NNFA 1LAGE 4GXAA 4Q8RA 3AXFA 3CP1A 3K9AA 1A7LA 1QJMA 3BBRA 3LSXA 1US5A 3TYHA 5AA4B 5TU0A 4LQ2A 3HO7A 1FQDA 2REGA 1H43A 2DWHA 2HEUA 3FV2A 3ODBA 1ATGA 1YCJA 4BLAA 4F19A 2DE3A 1NNPA 3I6VA 2XXVA 2YJPA 5AA2D 3ZS6A 3K4UA 1D9VA 3GLBA 2G29A 5ISUA 2XXWA 3TCFA 4NF6A 2DWIA 4EQ7A 4OQOA 5HM4B 2RCBA 1GR2A 1ELJA 1YAEA 2Q8JA 1H3DA 3K1MA 3VV5A 1B3HA 1Y4TA 4LATA 4YKKA 4R2BA 5JK4A 2CMOA 4ESWA 1EZ9A 3H6VA 4G8HA 1B46A 3IOTA 3G3KA 1UIVA 1Z7NE 2FNCA 2ZYKA 1VE4A 1B32A 3KSJA 3JZJA 4OENA 2H9BA 3C31A 1Z7ME 2VD3A 5AA1A 1A99A 3OEKA 1DSNA 4F1VA 1I6BA 5ELVA 1MS7A 2PBWA 1DTGA 3USDA 3B77A 2NXOA 3C32A 3VVDA 4FORA 1D3KA 3K01A 3R7XA 4F3SA 4FEBA 1MM7A 1Q35A 4N07A 4YMBA 1VR5A 1OQGA 5FHOA 3H7MA 3FXUA 3H6TA 1UTBA 4JGSA 1IZ1A 3FASA 5F1QA 1QKBA 1B05A 2X7QA 3G3FA 4RPOA 5HBCA 2HZKA 2ZMBA 4F1YA 1LB9A 1SDXA 2UVGA 3QXMA 5I58B 1DF5A 4XKQA 3S9EA 1VFEA 4QSEA 4R9FA 4P11A 5K2YA 1NMUA 1Y4CA 4KYSA 4YMAA 2XXXA 3RY3A 5H8NB 4U4XA 2P6JA 1I69A 2UYEA 3IJXB 1T0KA 2AIXA 1FQFA 2QS2A 1LAXA 1B5JA 1MPDA 2OWTA 4ZEKA 4YKJA 1Y9UA 3G3IA 3OXNA 3ZSFA 1MXYA 4TLLB 4ESXA 1N04A 3KFMA 3H4ZA 3Q29A 3VVEA 1A8FA 1MDP1 1N3XA 1QVSA 2EZPA 1SVXB 2QRYA 2X26A 3LC8A 3QAXA 4XIGQ 3TFLA 3ZKKA 1KWHA 1LCTA 2PX1A 2UYFA 2VD2A 3PV0E 2THIA 3DLNA 3RN8A 1URGA 3FGSA 3KOTA 3PMXA 4BDOA 5ICQA 3L6HA 1Y3QA 3T22A 2W7YA 2OJTA 2Y7IA 3MAMA 3FZVA 4KR5A 2X7RB 4YKIA 3VE1B 4JSDA 3P7IA 2E1SA 1UTHB 1AOVA 4OWDA 3FUZA 4NF8A 1R9LA 3KZGA 1XS5A 4BDRA 1P99A 3OMBA 1L5TA 3LSFB 1B7HA 2G93A 2R6GE 4ZE8A 4R75A 4YZZA 3M99B 2DOJA 2GHBA 1FCKA 3GBAA 5FHNA 3FVGA 3SEXA 4X1DA 4YKPA 4KCCA 4IY5A 5BWJA 4LUBA 1RYXA 5A5XA 2X7PA 4NEDA 3VDFA 4C1TA 1B51A 5CC2A 1IEJA 3KBRA 4KHZE 2V3UA 4EXLA 1LLSA 1P1NA 1ZBMA 2I49A 3DP6A 3FXQA 1B3FA 3PUZE 4KQPA 1MQJA 1RKMA 1XOCA 3CFXA 3CIJA 4PP0A 3MPLA 2ZXTA 4XXUA 3OD7A 3QK6A 1PB8A 4LONB 3SEWA 4QFLA 1SW4A 2O84X 4GFRA 5IAIA 4OMBA 1P1UA 2EBOA 2O1LA 2Q9TA 1PBPA 4OESA 1JPXA 2QS1A 2QMWA 3N6UA 1Y1MA 3CG1A 4LVQA 3DP4A 3PMVA 3K0VA 2UVJA 4IO5A 1A8EA 1IUDA 2VGQA 4X48A 3TELA 3VLUA 4IY6A 3VLVA 4DLDA 1IXGA 4U22A 4ZZAA 4F3GA 2ZYMA 3H06B 3SDFA 2XXPA 3EPEA 1MQIA 4Q5TA 5CM6A 1YPNA 1FTLA 4ZS9A 2DXRA 2REJA 3MVZA 3I5OA 2VP1A 3G3GA 5DTBA 3OO6A 2DE4A 4QHQA 3G7WA 2ONSA 4QF9A 4PQJA 3PMWA 5I2NA 2ZNTA 3B8MA 4KYEA 4DXUA 1ENVA 1N76A 1WDNA 2I6EA 3C36A 3CG3A 4H5GA 5M2VA 2HCAA 4HCWA 4N23A 1SI1A 2DWJA 4R74A 2B3BA 5DEXB 1LFGA 1B1XA 1R6ZA 1NL5A 5DVJA 4F18A 4ELOA 1S50A 1I6AA 5DYHA 4GVOA 4I1DA 1B9JA 3BKIB 2QJEA 3EHUA 2NUVA 2ESNA 1VFDA 2GH9A 4GL0A 3RGYA 4NF5A 5FTHA 1TWYA 4NF4A 4E0WA 4ONYA 2OWSA 1B52A 5KA6A 3IOUA 1QR8A 2PMSA 3EN3A 1B0LA 3CFZA 1HSLA 3ECRA 3F11A 4NF6B 3FIRA 4OYVA 4R6KA 3T96B 3TPAA 2VHAA 4BDQA 2NVUB 3ILUB 3K02A 3G3HA 1LCFA 1MPCA 2O69A 3OO8A 4GLIA 5F7VA 3TTKA 1NH8A 1MRPA 1MPBA 3PUWE 2DSFA 4R6YA 1NNTA 5CMBA 3TTLA 4F3BA 5JTYA 3B6WA 2F34A 4I62A 2O68A 4G8NA 1QW0A 4JWYA 5I56B 1ZTYA 2XXQA 3MC2A 4Q0CA 1AL3A 1J1NA 1POY1 2BJJX 3K00A 3UP9A 1D4NA 3BFUA 3G3JA 2ZYNA 5I59B 2DVCA 4BDNA 5CRYA 3O9PA 2Q88A 2A5SA 3KN3A 3PPQA 3IL1B 1NFTA 3K6XA 4HW8A 1M5BA 2IEEA 3GWOA 3IB1A 3IR1A 3RNNA 4ND9A 3U93A 4M4GA 3T9UA 5J1DA 3TEPA 1SW2A 3B8NA 3CVGA 3WAEA 4PETA 1XC1A 2ZNUA 5I2KA 3RTFB 1K33A 2RCAA 3HV1A 1MG1A 4IO7A 3IJOB 4K3FA 1Y4MA 2LP7A 4RYAA 4U1OA 2O7IA 4U2RA 4RA1A 4DXCA 5I57B 1N84A 1TFAA 3KEIA 5KA5A 4RJZA 3VXBA 1MY0A 3D4CA 3FXRA 1VSOA 3DM0A 3OSQA 2CZLA 2V25A 2MK3A 4XKPA 2B65A 2DQVA 1FQEA 5CMUA 3O66A 4FE8A 2I58A 4PFYA 1EH3A 1SW1A 3B7DA 3C4MA 3IORA 2I4CA 2Q2AA 3LBSA 4KPTA 5H8QB 3TCHA 4BDMA 4U1ZA 5A5XB 4H1XA 3TODA 1PB9A 3E13X 1DTZA 3FVKA 2D3IA 3N26A 2H25A 4YICA 5I2KB 4JXIA 4GD5A 2F35A 3M8UA 1MXZA 1LAFE 4GWOA 4F3PA 3E9XA 1PDAA 2QPQA 1IXIA 1URDA 4WEPA 4ZEIA 4C0RA 4NF8B 3MW0A 3TMGA 3V5AA 3S2VA 1DLBA 5DT6A 4M1VA 1SI0A 2XX7A 1WODA 1B3EA 1XHYA 2DE2A 2H5YA 3M3FA 2GHAA 4R72A 2YPNA 3RT8A 4QFOA 4ZEDA 1PC3A 1UTBB 5ITOA 3CR9A 4O3AA 2M7WA 2XXYA 4OERA 3TUSA 1B7UA 1UIUA 3ILTB 4GF8A 1MXWA 2Y7RA 5H8FA 3K6VA 3W15C 2FYIA 1PEBA 5H8FB 1S7YA 1M5FA 3MJNA 3N6TA 2QMXA 4R73A 5EHMA 3UGWA 4OETA 1SW5A 5L9OA 3EHTA 1OIBA 4OEUA 3HHFA 1UQWA 1XT8A 1FW0A 4O3CA 4MH5A 1JW4A 2M8CA 3K6UA 4I9DA 3MP8A 4EUOA 2HFBA 3MVYA 4GRKA 2XD2A 4QRZA 4BDLA 1IIWA 2DWAA 3H01A 3O2AA 4YB6A 4FIMA 4IGRA 4ZEBA 1BIYA 5JTYB 3S4UA 3SEVA 1GGGA 2I0BA 3LSWA 1GVCA 2I0CA 4U4SA 2LAOA 3U1OA 4DIGA 1QULA 2P0SA 1ZMGA 5CBSA 2A5TB 5ICTA 2I48A 4PFUA 4G4PA 1GTKA 2DP8A 3IOVA 4POWA 2HXWA 1O64A 1M5EA 2ONRA 1DMBA 2OZZA 3JYRA 1FQCA 1B58A 5JEIA 4FJCC 3RQTA 2HQ0A 1MM6A 1I5XA 4H6DA 1DPPA 3TDJA 1MDQA 1I5YA 1SBPA 2B3FA 1MY3A 4TOZA 4E0XA 1SD3A 5CBRA 5KZTA 3MBPA 4IO6A 2DXYA 1TT1A 1A55A 2Z8FA 3MHHC 4QSCA 4WEDA 3TTMA 3MP6A 3MP1A 3ONMA 2HAVA 4KFQA 1B7ZA 3RT6B 1JQ0A 3M3LA 5B70A 2I3WA 3FJ7A 3DELB 5L9MA 3M3KA 4NF5B 4RNSA 3THIA 3PD9A 3WFVA 4I8CA 1SZTA 1M5DA 1JNFA 2Y7KA 3PUYE 2OT5A 2NOOA 3HCQA 4KD5A 3U8QA 3VFJA 1HSJA 3UN6A 2Z8DA 1AIVA 3MUQA 2V3TA 1WVJA 4OHNA 3RLFE 3SKPA 1JVYA 1B4HA 1EZPA 5KDTA 5AA2A 2EZOA 1B3LA 1O63A 2O51A 1GV8A 5DVFA 1S9TA 1N3WA 3HHGA 2RC8A 1O7TA 3UK4A 1ZLQA 4H0WA 1ZIUA 3RUMA 4ECFA 3OELA 3R26A 5KCJA 4MLVA 2QS3A 4HCYA 3PPOA 4G68A 4JPRA 4RPNA 1NNKA 3N94A 2A5TA 5KDTB 1A54A 3CSGA 4LZ7A 3T66A 4WKMA 2Q2CA 1B5IA 3KJTA 4OXVA 3Q25A 2F7CA 1CB6A 1D9YA 3H3GA 2XXTA 4UA8A 4EQ9A 3MWBA 4POXA 4F39A 1B0HA 2HZLA 1OLCA 2Z23A 1B6HA 2P2AA 3I3VA 3HPIA 4Z0IA 2PT1A 5CI5A 3KN8A 3KN7A 4DCXA 4EF2A 4IO3A 3OO7A 2AL5A 4FIPC 3TTRA 3TTNA 5I59A 4ELQA 1B1HA 4F29A 3PU5A 4GL8A 3UA8A 1UTHA 2FA7A 4JBZA 4F1UA 2OK2A 2PT2A 3C33A 1URSA 3LSLA 2NWJA 4MFIA 4WXJA 3KG2A 4OFOA 2RC7A 3EQ1A 4H67A 3B6QA 4QFPA 5DEXA 2I3VA 4QSDA 3A09A 3KOSA 4JWXA 3SERA 5AA4A 3OSRA 4E2LA 4OTEA 1OLAA 4FJPA 4GQOA 4ZZEA 3P30A 2UXAA 1B40A 3PPPA 4NTLA 4RXLA 5IKBA 1OVTA 1LGBC 2F6PA 1FQBA 3DP8A 3LUYA 3OEMA 4PE5B 3S9MC 2R71A 5TPAB 4EXKA 4N21A 3O6HA 4YAHX 2F97A 1FQAA 1MQGA 1SYHA 1USYH 3FVNA 3SETA 3O29A 2YLNA 4X1BA 3BFTA 1N0TA 4GXSB 3IB0A 4IO4A 4OFLA 3K6WA 1SYIA 3H6WA 4PFWA 2XXIA 3Q26A 1MQDA 3MVXA 1PB7A 5LOMA 3O28A 3PPNA 5FTIA 3RPWA 3A3UA 2WKYA 5EYFA 5I56A 1Y3NA 3MPKA 4MF3A 3W9VA 3QIMA 1BP5A 2Z22A 3O6IA 3Q28A 3MZ9A 1Q1KA 2O1MA 4JB7A 1B3GA 4DE8A 4JDFA 1K34A 1MQHA 1N7WA 2I4BA 4R9GA 4F22A 1R9QA 1MY4A 3CYOA 1TFDA 4LA9A 3T93B 2R9JA 2F6GA 3UORA 4MBPA 3TKDA 4OEVA 3E3KA 1OMPA
chains in the Genus database with same CATH superfamily
4PDHA 1FTJA 2HPGA 1RDYA 1JW5A 4X1KB 4PF8A 4O7MA 4H65A 5BR8B 4O8MA 2ZD9A 1I6QA 3CMAV 3MZ1A 3B4SA 4UACA 4CS2A 3KGCA 2CH7B 2X6AA 4X9QA 1FXHA 2D21A 1MSWD 2DVZA 3FV1A 4PAFA 3VXCA 5J9PC 2F78A 3ABMB 2DYSC 1H44A 1MY2A 2DS9A 5F7VA 5JCOA 3PPNA 1SF9A 1HW7A 1AH5A 2DYXA 1OCRC 4OFJA 1NBMG 4LZ5A 4UV8A 3VLWA 1FRPA 2ANJA 4F4LA 3FB5C 5BXZA 5IYDO 3SPHA 4U23A 4EEQA 4YHHB 4N81A 4NF4B 3U10A 3H6UA 4XFEA 4P56A 3MVWA 4PFTA 4JI8B 3JD0A 1QKAA 1HNXO 1HP8A 1IXBA 1EN4A 5HFLA 2Z5UA 4K8XA 3L74H 5EBMC 4AB6A 1R3JC 1N36O 4DYLA 1II5A 2KQXA 5TP9A 2MW2B 3MZBA 2QL3A 3IOWA 1IBKO 5KCJB 2Y84A 4UV9A 4G27B 4ZDMA 1OQHA 5CMKA 4DZ1A 3LDCA 4FM1A 4KI0E 1DK4A 1WA8B 4DV1O 3A2FA 3B2EE 2CZHA 5IJ9A 3U72A 1MH3A 1BQZA 1EZOA 3I5DA 5CN0A 3UIFA 1VARA 2ZXWC 3RYCA 3JASA 4PDRA 2HR3A 1IXMA 3T9XB 1QVFU 1Q90D 4B3SO 5DVIA 4PHZA 2GUZA 1YDXA 1BMFG 1BTJA 4P0GA 3KJ7A 1AP5A 3OE7G 4JI7O 2GQ1A 2Y7WA 4H37A 1N7XA 3TEPA 4ZOLA 1HNZO 1Q86W 2V84A 3W9WA 3SPIA 5L9SA 4O2AA 4GOTA 4GWWA 1P84F 4FLZA 4FLWA 3R6UA 5B1AB 3FD9A 1F23A 3GZGA 5DECA 1JETA 4JSOA 5CMCA 2Y48A 1GTOA 1QBZA 1FPFA 4GIZA 3JD3A 4JI3O 4EQBA 1KQSU 3K2DA 2XHDA 1XNQB 4GKKB 4YB5A 3N5LA 1IMEA 3JAKA 2ONKE 3CCVV 2B1GA 2WLLA 4HTGA 4NF0A 4NE4A 3WG7C 5CBGA 4NHBA 4JI8O 4G68B 5CMMA 3X2QB 5FPRA 2ZIOA 1FPLA 2RKMA 4UXNA 3CCJV 1EBOA 1GN4A 1S5LZ 1MXXA 1NR7A 3PPRA 2Z8EA 4EXKA 3K06A 3IO6A 1Y20A 4MJOA 2V7QG 4DV5O 2R9IA 1IBKB 4QNHB 3MQ9A 2VPNA 1OCOB 1H45A 2VT5A 2PYLA 1LR1A 2Q89A 3IB2A 4TUYB 3L73H 1M5CA 1GN6A 1EN5A 2DQ3A 3FVOA 4KCDA 3QTCA 3QYTA 3IGAC 2EILC 1BKAA 5LA6B 4QFNA 4DV6O 1NV0A 2OBGA 4XKNA 1NNFA 3AXFA 1FPIA 1S5JA 3CP1A 5IDJA 3BBRA 1A7LA 4N17A 3CJHB 3OEHG 3LSXA 3TYHA 5TU0A 1K9MW 3HO7A 5IE9A 2REGA 1H43A 2DWHA 2GTSA 4AQYB 3ODBA 4XF5A 4F19A 4DW0A 2V4CA 1BSMA 2E3CA 1NNPA 3I6VA 2Q7EA 4WFFA 1D9VA 3RYDA 5ISUA 2XXWA 1XEQA 4HBNA 4X8RA 2Q73A 1NTKH 3RYHB 1ELJA 1YAEA 1SQGA 1H3DA 3K1MA 3PN1A 3VV5A 1Y4TA 5LXTA 4ESWA 3SYQA 4OENA 3ZMUA 1NV3A 4OGQB 2H9BA 1GMGA 5EIBD 2VD3A 3VBBA 1JJOA 1DSNA 2PTMA 5ELVA 4O7IA 3USDA 3APOA 3D3QA 5EBLC 4F3SA 1PPJH 4N07A 4YMBA 3CJHA 2PZSA 2YIBD 4MNCA 3H6TA 4JGSA 1IZ1A 3FASA 1QKBA 2BJIA 2X7QA 1JFFA 2JGDB 5I58B 4LH7A 4TUYA 2G38A 4PGNA 4R9FA 2DYRC 4O4HA 5K2YA 1NMUA 4YMAA 1KD1W 2P6JA 2AIXA 2QS2A 2JVDA 2OWTA 1MPDA 4ZEKA 4YKJA 4OVTA 1KB9F 4CC5A 4HNAB 2JS3A 1N04A 3KFMA 1SVXB 1SQVH 3MD0A 3TFLA 1KWHA 4I50B 1LUVA 1FBPA 2THIA 3FGSA 4BDOA 3L6HA 2Y7IA 3JYCA 3MAMA 2X7RB 4YKIA 4GWXA 2E1SA 4R72A 3WB1A 1AOVA 3FUZA 3ZMVA 1XS5A 1R1BA 4AQYO 1P49A 4G28B 1B7HA 2P7TC 4R75A 3M99B 2DOJA 3G71V 4O4HB 2CTQA 3JD2A 3L75H 5H6RA 4X1DA 1TVKA 4FLUA 5BWJA 1M9NA 4KHPO 5JQGB 2PGGA 1YITV 2YIAA 2X7PA 5LP6B 4C1TA 1B51A 1M56B 1IEJA 4KHZE 5DN6G 1P1NA 1ZL8B 2I49A 3DP6A 4FLVA 4J42A 1RKMA 4XXUA 1Q3EA 1AI5A 1OHHG 1SW4A 2O1LA 2EBOA 5LGNA 1JPXA 2QS1A 2QMWA 2NLJC 4P30A 1SC5B 4N6DA 4J7ZA 1ZUQA 1A8EA 4X48A 2LJ2A 4F3GA 5CA1B 1URFA 1R3IC 2REJA 1K3EA 1BZKA 2UU9O 4YIPA 2ONSA 3G7WA 4PQJA 1MNGA 4EKWA 5I2NA 1L0LH 2ZNTA 4KYEA 3BIHA 3C36A 5M2VA 1FD9A 4N23A 2B3BA 1YYZA 1R6ZA 5DVJA 4MTGA 3F7VC 1YCIA 1XMOB 4ELOA 2Y5LA 1S50A 1I6AA 4I1DA 4JTCB 4GKJO 2NUVA 3EHUA 4H0LB 2ZXWB 4OPHA 2IJHA 1IVSA 2JJ1G 4ONYA 4PDMA 5KA6A 2RMKB 1OCZC 3SGIA 2W6JG 3F11A 3TPAA 3FIRA 4BDQA 4H13B 3M7MX 2HJFC 1NH8A 5CMBA 1MPBA 1XUQA 1NNTA 2E5LO 4TSFG 2W0FC 1M93A 4R6ZA 2F34A 4KHPB 2XUMA 3A29A 4JZ2A 3MC2A 1POY1 1YHQV 5JCOC 3P3PA 3BFUA 5ET7A 4BDNA 5EC2C 3OGCC 4B3TB 2A5SA 2AGAA 4R8CA 3IL1B 3O65A 2D3OW 4P9KA 5B5EZ 1DCUA 3GWOA 2NNUA 1NV2A 3B09A 3U93A 2DJVA 4JI1O 5J1DA 2F23A 2AZ0A 4LF4O 1COWG 3B8NA 4LFBB 4CZZA 4IO7A 1H8EG 5KAIZ 2LP7A 4RYAA 2O7IA 4RA1A 3FAVA 4C7UA 1TFAA 2YEVA 5KA5A 3VXBA 3B50A 5LDZA 2HEPA 3OSQA 1T5EA 1QHTA 3TCUA 2DQVA 1FQEA 5CMUA 3O66A 1YJWV 2UU9B 4FE8A 1EH3A 3LBSA 3JARB 3IORA 1XILA 1WN7A 4WKMA 4BDMA 5H8QB 3OUFA 4HW8A 4I5SA 2JGUA 1G0IA 5KAFZ 3TODA 1FBCA 5LHGA 1PB9A 2PFZA 2XAQA 4JWXA 2CZIA 5I2KB 3ZRWB 4GWOA 1PDAA 4WEPA 1XMOO 4C0RA 3AG4B 3N27A 3SJCC 3VQYA 3MW0A 4NF8B 2EJ7A 3V5AA 3BAAA 4HAMA 2OCCC 1M1KW 4GKJB 1SI0A 4M1VA 2Q8MA 2GHAA 4LNUA 5KX5A 4DV7B 4ZEDA 2DE0X 3G80A 3CR9A 4PI2A 3RYFB 1UIUA 5EQAA 3AG2B 3R66A 1MXWA 3K6VA 2B4LA 2ZE6A 1S7YA 3N6TA 5EHMA 3W7XA 1JP4A 4YIOA 2E5LB 3TXSA 1SW5A 4JI4O 5L9OA 1IBMB 3JD1A 1UQWA 3HHFA 3K03A 4O3CA 2RQ6A 4GRKA 4PGPA 2XAGA 2HVKC 1IIWA 3H01A 2OTJV 4ZEBA 4FIMA 4IGRA 3SEVA 1K8AW 3LSWA 2JRIA 2WLNA 2X6CA 3D36C 2LAOA 4U4SA 1QULA 4DIGA 2VPOA 2HXWA 2GTAA 3G67A 1KUQA 4JI1B 1RDZA 2OZZA 1RP3B 4DW1A 1FQCA 2WX9A 1B58A 3IJ4A 5CBFA 5CBRA 3RPLB 1MY3A 5B3SC 3WG7B 1FPKA 3MHHC 2QVRA 1FXKC 5GW7A 3FJ7A 3E89A 3M3KA 1AJQA 2Q68A 3WFVA 1SZTA 3SDLA 1NJIW 3PUYE 2OT5A 1NR1A 4HE0A 4RUFA 3U8QA 4X1YB 2PF4E 1NUYA 2Z8DA 4CH3A 4I55B 3SKPA 4XDKA 1W0JG 5AA2A 5KDTA 1O63A 3K5OA 5DVFA 1S9TA 2CGOA 2IM9A 4LF8B 1O7TA 4WFHA 1N36B 5ESYA 3ASOC 3OELA 2QEXV 3R26A 1S5HC 2YDEA 4MLVA 4IR8A 4X20A 4QE9A 4HZ3A 1A54A 3T66A 3ZRXA 2DWEC 1PNKA 3E83A 3JALA 5EBWC 2Q2CA 3KJTA 4OXVA 2F7CA 3H3GA 2XXTA 4GT1A 3T1YO 4DV1B 1OLCA 2CEYA 3I3VA 4Z0IA 3HPIA 2PT1A 2EIKB 5C8YA 4RQEA 1NV4A 4UCSA 4BIOA 4EF2A 4FIPC 1NS1A 2Q6AA 5LMNB 5I59A 1K92A 1B1HA 1BS3A 1IBMO 3PU5A 1UTHA 2OK2A 3BCCH 2PT2A 3C33A 3TK1A 3EFFK 1BCCH 2GHYA 3I56V 3L71H 3KG2A 1AI7A 4JI7B 4QBAA 3B6QA 5L3DA 4DK0A 1PM9A 3SJAC 3A09A 1Y74B 3NR7A 3C3TA 4ZZEA 2UXAA 2BTQA 4NTLA 5A2QN 5FLXN 3CCUV 2UXBO 3DP8A 2GUZB 1X4TA 4HE2A 2WWWA 5TPAB 2QGNA 1R6NA 1RM1C 3T1HO 1NUXA 4H33A 4DR6B 3SETA 2EIJB 1IMCA 3RT3C 4GXSB 2CTRA 1XNQO 3VQXA 4GKKO 4LFAB 1SYIA 3H6WA 3Q26A 2CGNA 3JATB 4X65O 1MQDA 1PB7A 3E8HA 5FTIA 5EYFA 3TXQA 3JSLA 1Y3NA 1XOUA 2Z22A 3O6IA 4JB7A 3T4ZA 3ISPA 1K34A 2EIKC 1L0NH 3Q4HB 1K7DA 1MQHA 4GCZA 2F93B 1R9QA 1MY4A 4PA6A 3T93B 3IC7A 4MBPA 3TKDA 3E3KA 4DV5B 3H1KH 4E4EA 1S3JA 1YEWA 4TLMB 3OAAG 3AG1C 4XKRA 1MOFA 4D7SA 4FFBA 5EYPB 1LAHE 4RK9A 3A8TA 1D5AA 3CSBA 3T1YB 4QFKA 1USYE 2Q8VA 1PNMA 1JOYA 1SPIA 4PFRA 3ZHTA 1MY1A 2XXUA 3F5TA 3TQLA 1Y74A 2PCRA 3QUFA 3K08A 2Q67A 4FPPA 3IAYA 1BLFA 5BMVB 1B5HA 1Y1ZA 2XXRA 3OO9A 2A7WA 3PMVA 4H5FA 1HWYA 5EZYB 5GTHZ 3GXAA 5AA3A 1JCHA 4HNAA 1V9PA 1M4UA 2ITDC 1SQQH 2HAUA 3W7SA 4DV4B 1EM1A 1Z5VA 2ZNSA 3ABKB 4NTWA 4IIJB 4NXNO 3H03A 1RYOA 4LZ8A 2O7UA 3U94A 1IQ7A 3V8XB 2QM4A 4F2QA 2F7BA 2QSXA 4JYCA 3T1HB 4F31B 1DK1A 1VEWA 1JQFA 4OA4A 2D2CB 5CA0B 4KXPA 3SEUA 5K2XA 2QSAA 4FLYA 1E1RG 2ZIMA 4N6PA 2ZE7A 1FXKB 1QR9A 2VWJA 3ABKC 2OLBA 2H99A 2XAHA 3CI8A 5DEDA 4MVUA 2F7AA 2ZZWA 3K1PA 3K59A 1U96A 4GX3A 3TCGA 4PELA 5L3BA 5LXTB 4P0IA 2ZDIC 3OTOO 3MHSC 3OUSA 2IJKA 3RW0A 2UVIA 3EF7A 2Z0AA 2XHBA 2KKWA 4YB7A 4DCYA 4N13A 5B7DA 3QUJA 2RCVA 2HJDA 1VQNV 3U92A 4MS2A 3RPLA 1SQPH 4IO2A 2BTOA 1AR5A 3OM3B 1VQOV 5LP6A 3IK6B 3AK3A 4CS4A 2CE4A 1MXVA 3K04A 3U11A 3O6GA 4FBPA 5IZ1A 1NH7A 1U97A 4C1UA 1L1FA 2OWZA 1US4A 1SQYA 5L3CA 2RINA 2EINC 4MW3A 5IM2A 4EF1A 2VOZA 1IMFA 4AQ4A 1IITA 3CRBA 3SYPA 5HPQA 1TUBA 2RC9A 2AYSA 4LN5A 1AJPA 2QFLA 4DV4O 4TQUQ 4Z7EA 2GRVA 1IXHA 4HS7A 1AB3A 4NXNB 2GFEA 2AXTZ 4TV8A 4U3FH 4GUNA 2P1SA 1Y3PA 4PA9A 1TXFA 5H8HB 2QR4A 2XX9A 4J10A 1NKXA 1QUKA 1JEVA 5J2UA 4NWCA 2F95B 3STZC 1K97A 1BGYH 1R1NA 2KR0A 1FTOA 4FK5C 4PA4A 5ET6A 1RFYA 3ZRWA 3JCZA 3SEYA 5FBPA 1ZU0A 4DR1O 1CXZB 1FBGA 1MZEA 3G6BA 2X0LA 1NQTA 3K9AA 1US5A 4LQ2A 3OTOB 1R3KC 3FV2A 1ATGA 3J81N 4PE3A 2XXVA 2YJPA 3ZS6A 3QO5A 3K4UA 1FYJA 1UPGA 5IZ3B 2LGWA 4EQ7A 5HM4B 2XAFA 2Q8JA 3UT5B 5A9GA 5LGTA 4YKKA 4R2BA 1F51A 3LNMB 4G8HA 2ZCEA 4OVQA 2ZYKA 3KSJA 1VE4A 1B32A 1ZX3A 1A99A 3OEKA 2Y4UA 4LF9B 3RWRD 1DTOA 4DV3B 4O94A 3B77A 2NXOA 3C32A 3VVDA 1D3KA 4UVBA 2UXDO 1FPOA 1VR5A 5FHOA 1F7YA 3UO3A 4LCUC 3IFXA 4OVRA 2FTKA 3E35A 1B05A 5F1QA 4RPOA 1VQ8V 3E86A 2IU0A 2LGQA 2HZKA 3THOA 3UKMA 4EB6B 1SDXA 2UVGA 3QXMA 1TVKB 1DF5A 4Z2WA 1TUBB 4QSEA 4B3TO 1Y4CA 4IYHA 4N91A 5H8NB 3A0RA 1KYOF 3IJXB 4HYOA 3G3IA 4LF4B 1KC8W 3ZX6A 2YI8A 2WBBA 3H4ZA 1QVSA 3E2EA 4NTXA 1MDP1 3ZKKA 3H1LH 2QRYA 3LC8A 3PV0E 2UYFA 3DLNA 5ICQA 4WFAV 4DRXA 2WLLB 4ZOLB 3VE1B 4JSDA 3P7IA 2QKCA 3KZGA 3MDSA 4BDRA 1MMMA 2CK3G 5A5LA 1L5TA 1I7FA 4ZE8A 2IJIA 5L3EA 2A79B 3FVGA 5FHNA 1SQFA 4YKPA 4JV5B 4MVSA 4MEVA 2NN4A 1AR4A 3D8CA 1BQ0A 1NV7A 1LLSA 4KQPA 3FXQA 3PJSK 2C2AA 5I2NB 1M90W 3SEWA 2YSUB 3OD7A 3QK6A 4LF9O 4DV3O 4GX0A 1P1UA 2EJRA 2A0LA 3K5MA 1PBPA 4I55A 3CG1A 3DP4A 5LMUO 3K0VA 2UVJA 1IUDA 3VLUA 4PAKA 4Z1MG 4JI4B 4UUJC 4I3YA 2ZYMA 4U22A 1K4DC 2XXPA 2YC0A 1G1XB 4EFBA 4ZS9A 3BPZA 2DXRA 3MVZA 3RYHA 2VP1A 3G3GA 5DTBA 4H45A 1AILA 1AP6A 3H1IH 4MHFA 4MVZA 1ENVA 1SESA 2I6EA 3CG3A 3KC1A 2HCAA 4HCWA 1Q6IA 4R74A 5DEXB 1LFGA 4OANA 3UM7A 5H6QA 1B1XA 2B4MA 2ZZVA 4B3MB 4N8GA 1VQMV 5JVDB 4PDVA 4FM2A 1XBLA 5DYHA 2VS0A 4GVOA 1QLEB 1NUZA 2CEXA 3BKIB 2QJEA 4GWUA 1P4RA 2XWIA 2ESNA 1MZFA 4TWKA 2GBOA 3RGBA 4LF6O 5B1BC 2GH9A 1VQKV 2XWKA 4NF4A 4X1KA 3D3IA 2R72A 2OWSA 1CEZA 3ABUA 4J80A 1SETA 3CFZA 3ECRA 4F6RA 4R6KA 4GZRB 5I58A 2EINB 2NVUB 3OO8A 4BW5A 1LCFA 4GLIA 1Q43A 3ETEA 5KUKA 3TTLA 3PUWE 2DSFA 5EYHA 4F3BA 1JVMA 5JTYA 5EK0A 5LHIA 4NKGB 2VQFO 4JV5O 4YJ2A 1QW0A 4JWYA 2JEXA 4LF8O 4MVOA 1XHXA 3G3JA 1RSOA 2X6BA 4ZI7B 3O9PA 1Y76B 3PPQA 1RM1B 3BIGA 3ETGA 4DV2B 3RNNA 2P5OA 2W6IG 3WAEA 1B04A 4JZGA 1VIBA 3BABA 1XC1A 1N0NA 3RTFB 1FBFA 5LMUB 1MG1A 1BHBA 5LMNO 3ZMZA 4JVCA 4U1OA 5I57B 1YXIA 2Q0OC 1N84A 1XI6A 3ROJA 1N8RW 3CHGA 1AJNA 4YXWG 2H8PC 2Y0PA 2ZNIA 3DM0A 2V25A 2B65A 4GBVA 4PFYA 2WBDA 4Z1VA 1SW1A 4JYBA 4RK2A 2I4CA 5A5XB 3E78A 3FAVB 2PYJA 3DC6A 4H1XA 2ZM6O 4JVIA 2P90A 3CEIA 2IJJA 3N26A 4IHJB 2D3IA 1Y6XA 4GD5A 3M8UA 2UXBB 4B3MO 3RYCB 1VF6C 2LFSA 4IHJA 3HPLC 3HB3B 3TMGA 4DR6O 1DLBA 2QWOB 4X88A 3E79A 5EZYA 5I7IA 1WA8A 4O4LA 3OTFA 4OPAA 5IJ0B 2XX7A 4LFAO 2YI9A 4RAIA 3FX7A 3HKBA 3P32A 1UTBB 3GYYA 4X65B 2M7WA 3FB6C 3JAWA 2XXYA 1RPOA 1B7UA 4HXVA 4P47A 2WLJA 3UGWA 2HP8A 1CP9A 2ILMA 4OETA 1GM9A 2Q7GA 4K3AA 2VQFB 1OIBA 1BT8A 3OFNG 1JW4A 2M8CA 3QO8A 5B1AC 3K6UA 4I9DA 1QLNA 4MH5A 2HFBA 3FB7C 3OT7A 1KZ8A 4QRZA 3O2AA 4BDLA 4KUMA 1BIYA 3S4UA 1VF5B 4PA7A 2I0BA 2XT9A 2I0CA 1GVCA 3MAQA 3U1OA 5ICTA 4PFUA 4G4PA 2ADPA 2EIMB 4MSWC 4DV2O 3IOVA 1O64A 1YZ0A 4UCRA 4YJ2B 1DMBA 3JYRA 4AI8A 5JEIA 4FJCC 3CCLV 4NR1A 4I3EA 4X66O 2HQ0A 3BY6A 1MM6A 4H6DA 4NGUA 1DPPA 3RQTA 1I5YA 2IH1C 3CCMV 1G0HA 1K9YA 2B3FA 4E0XA 4GWYA 2DXYA 4O4LB 2UUCB 4QSCA 4JAUA 3MP6A 3MP1A 1KKDA 4W4KA 2DYRB 3ZHRA 1MABG 4RNSA 3THIA 4DR4O 3KCXA 3W7TA 2ZM6B 1M5DA 3VFJA 3HCQA 1R73A 3ABMC 4R7CA 1R6KA 3QF7A 1HSJA 3UN6A 3E22A 4WFEA 3AG2C 1AIVA 3OEEG 1B4HA 1MA1A 2EZOA 1EYIA 5EQ9A 3HHGA 2RC8A 2CUGA 3UK4A 4BIZA 1VQ7V 1ZIUA 5KCJA 2NR5A 2QS3A 3MYUA 1JMKC 3ML0A 1NNKA 1LBZA 3ZBHA 2A5TA 2VRZA 4GWZA 3Q25A 4JAVA 1D9YA 4P8BA 2ZINA 1NTMH 2Z23A 4DCXA 3RBZA 1EZVH 4RUEA 4IO3A 3CRMA 3OO7A 2P22C 1KA0A 4GL8A 3UA8A 4JBZA 4PCDA 5B1BB 2YIBA 2NWJA 4MFIA 4WXJA 3SJBC 2RC7A 1QLEC 3EQ1A 4LWSB 1NV6A 4UB6Z 2JEUA 1YJ9V 3CCQV 1Q81W 4QSDA 3S3XA 3L6GA 3G4SV 3KOSA 4E2LA 3LSQA 4H44B 1RDXA 5ET8A 1B40A 4RXLA 1LGBC 1W2BU 3LUYA 3S9MC 5LA6A 4IIJA 2R71A 4OX9B 4H46A 4PBQA 4N15A 1SYHA 5E1AC 1USYH 3FVNA 5JJEB 2YLNA 4X1BA 1N0TA 4OFLA 2YXYA 3MVXA 4YJ3A 1D9QA 3O28A 3ZCCA 3RPWA 3A3UA 2WKYA 3MPKA 4I50A 3QIMA 1BP5A 4WF9V 5B1OA 1Q1KA 2O1MA 4G61A 4DE8A 3K5NA 3D1RA 2CH7A 4JDFA 4NTYA 1N7WA 4F22A 3RYIA 3CS5A 3CXCU 2R9JA 3ZRVA 4OEVA 1OMPA 1LFHA 1VQLV 4UCUA 4B7EA 1B4ZA 4HE1A 3T9VA 3FJMA 2GV9A 4FEDA 3PGFA 4R2FA 4L17A 1NU1H 4B3RB 4LP2B 1WP7A 2H3OA 1YZBA 4G68C 3CRAA 4FLTA 2XWVA 2ADQB 1IMAA 3T9HB 4DR1B 3IFAA 4ELRA 4GX2A 4I4TB 1SA0A 4H8IA 4ZIBA 2XOKG 4DDDA 4NG7A 5JH7B 1MH4A 3OW2U 4FAJA 1NUWA 4Q8RA 2IA4A 2RF1A 2QTOA 3JATA 4I4TA 5EIBC 3C35A 1M5IA 3A0HZ 3APQA 2UUBB 3BA8A 1LBBA 1MXUA 3FD3A 3IAZA 1AROP 2UXCB 4OZ9A 2F4VB 3ZHQA 1N34O 4G8MA 4CC6A 1S0VA 1FPGA 2V93A 5TPAA 4Q30B 1XVYA 3SESA 2ZDIA 4K8ZA 2XAJA 1GKFA 3AG1B 4U3JB 4PTKA 4NWDA 1ANFA 5EQ8A 3W7UA 4OX9O 4X64B 3DC5A 1XVXA 5KHKA 4H8JA 4ZE9A 4AS5A 3GBBA 3SPJA 5FHMA 3SR2C 4ISUA 1GH6A 5L8DA 2ITCC 3IO4A 2UXDB 2YXLA 3U65A 1JW1A 3CPWU 4G2ZA 1P1QA 3ZKLA 4JF3A 5EHSA 2H98A 5C8YB 3ICXA 3CCEV 4DR5B 2HHHO 4OXSA 3S9NC 1N0JA 5J16A 4NXMO 3LR1A 3KKYA 3HSTA 3HN0A 4CBCA 1US6A 4IGGA 2FL4A 4ZI7A 1P1WA 3N2KB 1VDWA 4F18A 2XD3A 1DPEA 1YJNV 1FTMA 3E4RA 5HFMA 1HSEA 1H2GA 3K9SA 3K1NA 3OOAA 4ZHQB 1H2LA 4PAIA 1DGSA 1LUWA 3TZAA 1YTVA 3ZEDA 3CCRV 5L3GA 1EU8A 5LYJB 4O2BB 4DXWA 4IB2A 1YTFB 3SYOA 2OYQA 1R6TA 1CE2A 4IGTA 3P3NA 5GTIZ 2F3DA 4LR3A 1JVXA 4MLQA 1DOTA 4G77A 3AK2A 2E0SA 4MIJA 1G6UA 4F2OA 4DV0B 5EQ7A 3VVFA 5H8SA 2PY5A 2LO1A 1EZJA 3C9HA 2UXCO 1KP3A 5JVDA 2F4VO 1ZJLA 1N4CA 3STLC 4FM0A 1N34B 2F5XA 1FTKA 3DSQA 1IXCA 1ZKBA 2ABHA 3J80N 2PI4A 4MVRA 2FB5A 5H9CA 1B2HA 5IAIA 5K1XA 4AB5A 1TAEA 4QIWF 1LBYA 2WPDG 3KSXA 2ZNJA 3K5LA 1R3LC 1H2MA 3V89B 3L72H 1LSTA 3TQWA 1LB8A 4O3BA 3AEIA 3FATA 4RY1A 3ZMSA 4D7TA 1P7BA 2O6AA 3JALB 2N74A 2UVHA 2Q5ZA 4PBHA 1RPRA 2ZYOA 4DR5O 1S72V 2HHHB 2XX8A 1LAGE 4UABA 5IYZB 4GBWA 3FYEB 4AS4A 1O9GA 1QJMA 5AA4B 5LBQA 4WBNA 1FQDA 2HEUA 1YCJA 3CRRA 4DI3D 2DE3A 2OWOA 3RVYA 4NF6A 1FPEA 4OQOA 5LTCA 1Z2GA 1GR2A 4FFBB 4LF5B 5JK4A 3ETDA 2KQZA 4GYCB 3H6VA 1V54C 2HFEC 4OTEA 3IOTA 4LF6B 3A0BZ 4UCVA 4FVMA 1Z7ME 3JCUZ 5AA1A 2KSDA 2ZQMA 4J7KA 4X62B 1MS7A 5C93A 3ASNB 2WAMA 3HKDB 4O4JB 5IWAO 4FORA 4TT3G 2HLDG 1Q35A 1TUEB 1OQGA 3ASNC 3JAWB 5BY1A 1OV9A 3HKDA 4N4UA 5HBCA 4AHCA 2AHZA 2E76B 1LB9A 4GX1A 4XKQA 1V54B 5IZZA 5TISZ 2YIDA 2P06A 4KYSA 2QWRB 3SPCA 1GM7A 4WFBV 1I69A 2UYEA 4PJ0Z 1FQFA 1LAXA 1H38A 1OJHA 1Y9UA 3OXNA 4ESXA 1QU7A 1EFRG 2F66C 1MXYA 4F6EA 2P67A 1A8FA 1N3XA 4XIGQ 2EZPA 3QAXA 2CZKA 1PP9H 4I9QA 1LCTA 2PX1A 2VD2A 3KOTA 3J7AU 3PMXA 1Y3QA 1VQ4V 2W7YA 2OJTA 1X59A 4KR5A 3KBZA 3EXAA 1UTHB 1E1QG 4J7JA 1R9LA 2UXNA 2ZT9B 4K35A 4JI5O 1P99A 3OMBA 4FMTA 1OCCB 4GLXA 1ROPA 3SPGA 3ZRSA 1L8DA 1BK4A 2XNDG 1V55B 3GBAA 3SEXA 3FB8C 4TV9B 1E79G 4JI0B 4KCCA 4LUBA 1RYXA 5A5XA 4UVCA 1XMQO 4NEDA 3KBRA 2V3UA 2A06H 2WLIA 3C90A 1B3FA 2YEVB 3BA9A 1MQJA 1XOCA 3CFXA 3CIJA 4DO2A 2ZXTA 2GDSA 4PP0A 1PB8A 4LONB 4X04A 4QFLA 4YJ3B 2F1MA 4OMBA 5IWAB 4TLLB 4FFKA 4OESA 1NV5A 5EYPA 3WB0A 1D2DA 3N6UA 1ZAUA 3E8BA 4BR6A 2ARHA 2VGQA 3TELA 3D36A 4IY6A 2P3VA 3VLVA 2EILB 3I55V 1IXGA 1VQ5V 3SDFA 3W7WA 1MQIA 3RVZA 4JYAO 3I5OA 1J5EB 3OO6A 2DE4A 3BEHA 4QF9A 2DYSB 4QGPA 3PMWA 3ZHVA 1Y67A 4DXUA 1N76A 4TV8B 3HKBB 1FBHA 2DWJA 2OCHA 2RJZA 4LWSA 2WEFA 4UCOA 4PFIA 4LF7O 4X66B 2JJKA 4IT5A 5FPOA 2BOBC 4NB5A 1B9JA 2UUCO 1NH2D 4DUZO 1VFDA 4GL0A 3B8BA 3L70H 4MTOA 4XDLA 5LGUA 1B52A 4PDDA 1W0KG 2WSSG 1QR8A 2PMSA 3BFRA 1B0LA 3IOUA 4DR4B 4NF6B 3K57A 3T96B 3CB2A 4JI5B 4DI4B 3TTKA 1MPCA 2O69A 5KLVH 3AK1A 4JYYA 3B6WA 1SERA 4I62A 2IU3A 2O68A 2FIEA 1SQBH 3T1BA 5I56B 1ZSPA 3O9OA 3VQVA 1XMQB 4Q0CA 1AL3A 1J1NA 2BJJX 5KMGB 2AZ2A 4FZ0A 1FSAA 2JS5A 3K00A 2ZYNA 5I59B 2Q88A 1JA8A 2XXKA 1FTAA 2HG5C 1M5BA 3IB1A 3IR1A 4ND9A 1YTFD 3T9UA 1SW2A 1YF2A 2ZZXA 3CVGA 1XQ8A 5I2KA 1K33A 1PKXA 2ETNA 3RYIB 2RCAA 3HV1A 4K3FA 2EULA 4U2RA 1N32O 2XWOA 4NQ8A 2DWDC 3ZHSA 4JYAB 4YY3B 5TP9B 1J5EO 2I58A 1IMDA 1LBVA 3B7DA 1QGXA 4KPTA 1MSDA 2FMLA 3E13X 4I40A 5CB4A 2HHMA 3RN4A 4JXIA 1BE3H 2F35A 5GONB 4LF7B 5KHGA 4DUYB 1LAFE 5IT9N 1BHAA 1IXIA 1I0HA 1URDA 4JTDB 4ZEIA 1WPXA 4AILC 3HKEB 5DT6A 4DUZB 4L8JA 1HDJA 3M3FA 1KMIZ 2AHYA 3CRQA 1WB7A 3AG7A 4O3AA 4OERA 3TUSA 2WLIB 3ILTB 1OCRB 2WLKA 1VQ6V 2Y7RA 2FYIA 1JX9A 4OVPA 3EHTA 3SYCA 4OEUA 2OIGA 4U7NA 3TETA 1FW0A 4JI6O 4P3LA 5EYGA 3MP8A 4EUOA 5LL6Y 1P7GA 1K4CC 2CTWA 2JIZG 3DXRA 2XD2A 2OCCB 3MVYA 4YB6A 5GONA 5KHJA 1GGGA 2YUAA 2P0SA 5CB4B 3JSNA 4RWUA 4X1IA 3LDDA 2V4DA 1GTKA 1IDSA 4I0XA 4B3RO 4POWA 2O57A 3TGUH 4TQFA 5IY5B 2Y69B 1FXVA 4QXDA 1Q6UA 1FJGB 1SBPA 3TDJA 5KZTA 1B3QA 1QNMA 3MBPA 1TT1A 3CHXA 2Z8FA 4WEDA 4DR7B 3ONMA 4KFQA 4NX1A 3ZIAG 3RT6B 3M3LA 4YY3O 5B70A 2UUBO 2I3WA 3DELB 3OGIB 2LW1A 4MVMA 4LP8A 2RDCA 1GM8A 5LOVB 2DN9A 2P4VA 4I8CA 1JNFA 4MTXA 3S3WA 2Q69A 2Y7KA 1B6QA 3MUQA 3GB7C 1FBEA 1JJ2U 2V3TA 3RLFE 1HR0B 1OCZB 1JVYA 4NN3A 2JK5C 1UFIA 2E75B 5BMVA 5ITZB 2OTLV 2LW7A 2O51A 4LFCO 4X64O 4ECFA 1ZLQA 4MNPA 3RUMA 3N2GB 3PPOA 4RPNA 4MTFA 3N94A 3CSGA 4LZ7A 1IX9A 4UCTA 3X2QC 1CB6A 1KA1A 4UA8A 1NTZH 2HZLA 3UP9A 1B6HA 2P2AA 2Q9LA 3KN8A 3KN7A 5CI5A 5JJNB 5JJJB 2ZR2A 3TTRA 1Y76A 1VP7A 3T2MA 1A32A 4NXMB 4KFMA 3KC0A 1XDCA 4JI6B 4F1UA 4CS3A 5DM6V 1URSA 3H1HH 3LSSA 4H67A 5FL7G 1NI8A 4QFPA 3UO2A 4XBFA 5DEXA 4WBNB 3R65A 4ZHQA 1ZLZA 4BIUA 1KBHA 3HKCA 1EYKA 4QE7A 5J2TA 1LBXA 1OLAA 1TGOA 2FYUH 2V1DA 3P30A 1HNWB 3OSRA 4FJPA 4GQOA 4PI0A 2F6PA 3T4DA 1Q8IA 1FQBA 2DW4A 2FIXA 3ABTA 2GSMB 3ASOB 3LSUA 1YI2V 1FJGO 1K5SA 3DTUB 4N21A 3CRCA 2F97A 1FQAA 1GN2A 1XL4A 5FNVB 3UT5A 3O29A 3BFTA 4P1LA 1K5QA 4DV0O 1JR9A 5F2VO 2XXIA 5CBHA 1SQXH 2QTSA 1VMGA 5I56A 1FPBA 4MF3A 1TA8A 3Q28A 3MZ9A 1UJWB 1VF6A 3EVKA 2Q74A 2I4BA 4EFEA 1TFDA 2A9HA 4XDJA 2FBPA 2RNBA 4U3JA 2DE2A 2P3NA 2YICA 3QSLA 3UORA 1Y66A 4LQ5A 4EDPA 1AMFA 3CFLA 5KHIA 5IJ9B 2D5WA 1FPJA 3CXHF 1RSOB 2XA5A 1LFIA 5KMGA 1FXKA 5I5PA 3RTWB 1JEUA 4MCOA 1LNQA 4QPKA 4BWAA 5K1PA 3ZHUA 5BUUA 1F4NA 2IH3C 3RFRA 4CH4A 2F36A 4YICA 1CPYA 3PD8A 5AA2B 3CC2V 3LUTB 5I84A 4X9TA 2V3QA 5I57A 2WYPA 1M57B 4G2KA 1IURA 2PYYA 4MVQA 1NVPB 3OD4A 3Q27A 4DK1A 1Q7YW 3PUVE 3T0JA 2R70A 3JV9A 2WLHA 2DDKA 4LF5O 4I7ZB 3FJGA 1GN3A 2FKXA 1QUJA 3IFCA 2ALUA 1XI1A 5LYJA 4QPJA 4WCEV 2K9PA 1V55C 4X62O 2QDOA 4JWOA 1PNLA 3LUZA 5AE4A 2WA3A 1AVMA 2JDIG 1XREA 1YVWA 2LQTA 4J11A 3EHBB 4ELPA 4ZECA 2QM7A 3C3SA 4B7KA 5IJ0A 1H8HG 1PBQA 3JAKB 2Y4TA 3JD4A 4NMYA 3PUXE 1EYJA 4OVJA 5KUMA 1LEVA 2CTPA 3BHPA 2Y69C 2QM8A 1POTA 5IY5C 3OENA 4U21A 3EHSA 3C34A 3TAJA 1I08A 2KB1A 5IYCO 3QO7A 4MW8A 3WB2A 3JAMN 2BCCH 1QVGU 2AL4A 2QS4A 2P4KA 1LBWA 1FJ6A 1QUIA 3RYFA 2QA4V 1OCOC 5CA0A 2ZR3A 1LBCA 1N33B 1SA0B 4Q20A 3AG3C 4RQFA 3H1JH 1A40A 2H4IA 4KL1A 5I3SA 3OMIB 2PVUA 4KYDA 4FATA 4R6HA 2KLFA 2WA4A 3DXRB 4JVDA 4N8YA 3NOHA 1FAFA 4XTCQ 5J2UB 2OCUA 5D5PA 4IYIA 4CH5A 3OR7C 2BE3A 4JI0O 2PI5A 4DRXB 1F9BA 1FFTB 3SYAA 2XXHA 4P9PA 4QJFB 5H8HA 4X20B 5JH7A 1QCEA 3V83A 3QG5A 2R8TA 5ITPA 1GO3F 1AR1B 3O97A 4ZEFA 1INPA 3QVNA 2EX3A 1OVBA 1OZ0A 4O4JA 5B66Z 1FPDA 2XASA 1P1OA 2F8DA 4FECA 4LBEC 5H5NA 3CE2A 3IC9A 3CC7V 1AI4A 4THIA 3D4GA 4DXBA 3CSXA 4XEQA 3F5WC 5BR8O 1SKVA 1DF4A 2Y7PA 3E8GA 3A3CA 3IX1A 4YU0A 1THZA 1G4YB 3B6TA 3S9LC 2B9ZA 4KP4A 1H76A 4X8AA 4GXAA 1GRJA 2HXRA 2FVZA 4O2BA 2M6YA 3HKCB 3ZMTA 1NT2B 1Q9DA 4K0KO 4BLAA 4GX5A 1I94O 5AA2D 1SZXA 3GLBA 2G29A 3KCYA 5IYZA 3TCFA 2DWIA 3SJQC 2RCBA 1XHZA 3MSTA 1N33O 1B3HA 4LATA 5T3JA 5B1NA 5F24A 1HNXB 2CMOA 1EZ9A 1M56C 1B46A 1FFXB 5LP6C 3G3KA 2AW9A 1UIVA 1Z7NE 2FNCA 1Q6HA 4R50A 5IYBO 3CMEV 3JZJA 1FJ9A 3C31A 2KG7A 4X89A 4F1VA 1I6BA 1WNSA 2PBWA 4DR2B 1DTGA 2Y5KA 1BL8A 4NVPA 2CDYA 3K01A 3R7XA 4FEBA 3N2GA 1MM7A 2L35A 3H7MA 3FXUA 3FXBA 1UTBA 3G3FA 4MAGA 1ZTEA 2ZMBA 2RN9A 3CX5F 1O9HA 2PUSA 3OR6C 3JASB 3S9EA 1VFEA 4P11A 1FBDA 2XXXA 4ICGA 3RY3A 4U4XA 5H2FZ 1Q82W 1T0KA 4LH6A 1B5JA 1HNZB 5ET5A 1J95A 3VVEA 3Q29A 1K73W 5H8QA 4JI2O 1SS3A 2X26A 4W4LA 3RN8A 1N32B 1K9ZA 1URGA 1FS0G 4O4IA 3T22A 1S77D 3FZVA 2KG7B 3E22B 4NAPA 2IW5A 1OCCC 2F3BA 4X1IB 3ZN0A 4OWDA 4JI3B 2Q4PA 2B1IA 4NF8A 4JTAB 4DR3O 4K0KB 3CWBH 1I94B 2Y0IA 3OMNB 3LSFB 2XTAA 4I9WA 2G93A 2R6GE 2BSKA 4YZZA 4A5UB 3K79A 3E8FA 2GHBA 1FCKA 3WU2Z 4DUYO 3HFUA 4P9OA 4IY5A 1F4MA 1WB8A 1WJZA 3VDFA 4PFBA 5CC2A 4EXLA 1WLEA 1ZBMA 3PUZE 4R73A 4PD4F 5JTYB 3MPLA 1PV0A 4GFRA 4DR2O 2O84X 3QNEA 2Q9TA 2L6LA 1Y1MA 3HKEA 4LVQA 5KHHA 4IO5A 2QVVA 4DLDA 4ZZAA 1AI6A 3H06B 4PV1B 4N6KA 3EPEA 1WPBA 5CM6A 4DV6B 2DOSA 4Q5TA 1YPNA 1FTLA 3QMFA 2L5VA 4MX6A 1S76D 1QQCA 2CAZC 1KU9A 1ORQC 4JASA 1CNQA 3CD6V 4QHQA 4J9ZB 3ZJZA 1VQ9V 3B8MA 4O4IB 1WDNA 4H5GA 2B5UA 2Z3YA 3LV0A 1SI1A 3H9VA 5ITZA 2R9RB 2N04A 1NL5A 4JI2B 2Q7HA 3KZIZ 3G6EV 2A3QA 3GVMA 1EN6A 4DR7O 3RGYA 4NF5A 5FTHA 1TWYA 3HR0A 1FKAO 4E0WA 3EN3A 1NV1A 1HSLA 4OYVA 4DR3B 2VHAA 3ILUB 3K02A 3G3HA 3BVOA 3JARA 3T1CA 3L9DA 2QWQB 1MRPA 4R6YA 4GX6A 3M8AA 1YXBA 1HR0O 2DQ0A 4TQDA 4LFCB 4J9YB 4G8NA 2QVUA 4NYKA 4CH6A 1ZTYA 2XXQA 4PA3A 1D4NA 2DVCA 5CRYA 2QJ1A 3FKSG 1YSCA 4X1YA 1VQPV 4ASUG 4F6RB 1Z5WA 3KN3A 1NFTA 3K6XA 2IEEA 4MT8A 4U7OA 4KXRA 2QKSA 4M4GA 4PETA 2ZNUA 3ETQA 1NKDA 4GWSA 4GX4A 1YIJV 3K3WA 3IJOB 5H8FA 1Y4MA 4DXCA 5JWPA 2UUAO 3KEIA 4MMPA 4RJZA 1MY0A 1ZL8A 3CCSV 1VSOA 3D4CA 3FXRA 4XKPA 4RO2A 2CZLA 3WAFA 2MK3A 4UB8Z 2VQEB 4D6TH 2YS8A 3C4MA 5IGAA 2Q2AA 3DGEA 3TCHA 3FFQA 4U1ZA 2FHYA 1DTZA 4ABMA 4TOIA 1HNWO 3FVKA 2H25A 1FFXA 1WAZA 1MXZA 2YXHA 2MKZA 2H94A 1PD3A 3ZS8C 3E9XA 2JJ2G 2QPQA 4F3PA 2QKAA 3S2VA 4EB6A 3UCSC 1JFFB 2JGDA 1XNRB 4J41A 1H2NA 2K1EA 4ZBMA 5L3FA 1B3EA 1WODA 1XHYA 2H5YA 3Q4HA 2YPNA 3RT8A 4QFOA 1M57C 1PC3A 5ITOA 1H2KA 3LNNA 4JAAA 4O2AB 5CA3A 4GF8A 3W15C 5BZBA 4PC9A 1PEBA 4BW9A 3FBPA 4MNIA 5H8FB 1M5FA 3MJNA 2QMXA 2DMXA 2EIJC 2HVJC 5DW8A 4FZ1A 4TV9A 2PFYA 5CA1A 1XT8A 4UVAA 2DWAA 1IMBA 1DBZA 5CBSA 2EIMC 1ZMGA 1EZPA 4Q6GA 1NH2B 2A5TB 2I48A 2DP8A 1WP8A 4IL6Z 1M5EA 2ONRA 1IBLO 1GAXA 3NXSA 1I5XA 1MDQA 4WFGA 4TOZA 1G8MA 2ZE5A 3K0GA 2UUAB 1SD3A 4IO6A 4I0XB 1A55A 5JQGA 3TTMA 3ABLC 4BAYA 2HAVA 2LFRA 3N2KA 1B7ZA 1JQ0A 3F7YC 5FNVA 1ZWIC 2VQEO 1NVPD 5L9MA 4NF5B 3PD9A 1KP2A 2NOOA 4KD5A 2N05A 3OMAB 1WVJA 3TJTA 4OHNA 3UQ8A 5J2TB 1B3LA 1GV8A 4PDLA 1N3WA 2F43G 3PTYA 4H0WA 5AG2A 2ZE8A 4HCYA 1XNRO 4G68A 4JPRA 5KDTB 3FYIB 3LDEA 3VOUA 2R9AA 1B5IA 2QWNB 4L87A 1AWBA 2VWKA 2QWPB 3U0ZA 3SZPA 4UFZA 3EKIA 4EQ9A 2IBZH 3MWBA 4POXA 1B0HA 5H8NA 4F39A 3ZSFA 4LFBO 4ELQA 1D5NA 2BSKB 2AL5A 1SRYA 3TTNA 4LC1A 4F29A 2E74B 5B3SB 2FA7A 1KECA 3BRCA 2BTQB 1IZ3A 4B08A 2UXXA 3LSLA 4OVSA 3VQWA 4OFOA 5D5QA 1KKCA 2I3VA 1PL4A 4YHHO 3SERA 3AG3B 5AA4A 3PPPA 3ZN1A 2QE7G 5IKBA 2Q0AA 1IBLB 1OVTA 3K58A 3B40A 3OEMA 1H2SB 4PE5B 1W59A 3K0DA 5LOVA 3AG4C 3CC4V 2WLMA 3O6HA 4YAHX 1MQGA 2BOCC 2OIEA 2OX3A 2WYKA 5E79Z 1VF7A 3IB0A 4IO4A 5IZ3A 4DV7O 3K6WA 4P2ZA 4PFWA 1B06A 4ZKIA 1Q5OA 5LOMA 2ATKC 1NI9A 2W0XA 2HKOA 3W9VA 5EC1C 4FLXA 1GK9A 1B3GA 4PF6A 2ODMA 3GWKC 3ABLB 4LNUB 5KX5B 1XL6A 1NZ6A 4R9GA 2ZKOA 3CYOA 4LA9A 1PL0A 4B3SB 2F6GA 5LHHA 4F1YA 4P1EA
chains in the Genus database with same CATH topology
1FTJA 1JW5A 4H65A 2ZD9A 1I6QA 3CMAV 3MZ1A 4UACA 3KGCA 2X6AA 1FXHA 2D21A 1MSWD 2DVZA 3FV1A 3VXCA 5J9PC 2F78A 3ABMB 2DYSC 1H44A 1MY2A 2DS9A 5F7VA 3PPNA 1AH5A 2DYXA 1OCRC 4OFJA 1NBMG 4LZ5A 4UV8A 3VLWA 2ANJA 4F4LA 3FB5C 5IYDO 3SPHA 4U23A 4NF4B 3H6UA 3MVWA 4PFTA 3JD0A 1QKAA 5HFLA 2Z5UA 4AB6A 5EBMC 1R3JC 1II5A 5TP9A 3MZBA 2QL3A 3IOWA 5KCJB 2Y84A 4UV9A 4G27B 4ZDMA 1OQHA 5CMKA 4DZ1A 3LDCA 4KI0E 3U72A 1MH3A 1EZOA 5CN0A 3UIFA 2ZXWC 4PDRA 2HR3A 1IXMA 3T9XB 1QVFU 5DVIA 1BMFG 1BTJA 4P0GA 3KJ7A 3OE7G 2Y7WA 3TEPA 4H37A 1N7XA 2V84A 3W9WA 1Q86W 3SPIA 5L9SA 4GOTA 3R6UA 5B1AB 1F23A 3GZGA 1JETA 4JSOA 5CMCA 2Y48A 1GTOA 1QBZA 4GIZA 3JD3A 4EQBA 1KQSU 3K2DA 2XHDA 4YB5A 3N5LA 2ONKE 3CCVV 2B1GA 2WLLA 4HTGA 4NE4A 3WG7C 5CBGA 4G68B 5CMMA 3X2QB 2RKMA 4UXNA 3CCJV 1EBOA 1MXXA 1NR7A 3PPRA 2Z8EA 4EXKA 3K06A 3IO6A 1Y20A 2V7QG 2R9IA 4QNHB 3MQ9A 1OCOB 1H45A 2Q89A 3IB2A 1M5CA 4KCDA 2DQ3A 3FVOA 3QYTA 3IGAC 2EILC 1BKAA 4QFNA 2OBGA 4XKNA 1NNFA 3AXFA 3CP1A 5IDJA 3BBRA 1A7LA 3TYHA 3OEHG 3LSXA 5TU0A 1K9MW 3HO7A 2REGA 1H43A 2DWHA 3ODBA 4F19A 3I6VA 1NNPA 4WFFA 1D9VA 5ISUA 2XXWA 1ELJA 1YAEA 3VV5A 1H3DA 3K1MA 1Y4TA 4ESWA 3SYQA 4OENA 3ZMUA 2H9BA 1GMGA 2VD3A 3VBBA 1DSNA 5ELVA 3USDA 5EBLC 4F3SA 4N07A 4YMBA 3H6TA 4JGSA 1IZ1A 3FASA 1QKBA 2X7QA 5I58B 4R9FA 2DYRC 5K2YA 1NMUA 4YMAA 1KD1W 2P6JA 2AIXA 2QS2A 2OWTA 1MPDA 4ZEKA 4YKJA 1N04A 3KFMA 1SVXB 3MD0A 3TFLA 1KWHA 2THIA 3FGSA 4BDOA 3L6HA 2Y7IA 3JYCA 3MAMA 2X7RB 4YKIA 2E1SA 1AOVA 3FUZA 3ZMVA 1XS5A 4G28B 1B7HA 2P7TC 4R75A 3M99B 2DOJA 3G71V 5H6RA 3JD2A 4X1DA 5BWJA 1M9NA 1YITV 2X7PA 4C1TA 1B51A 1M56B 1IEJA 4KHZE 5DN6G 1P1NA 3DP6A 2I49A 1RKMA 4XXUA 1AI5A 1OHHG 1SW4A 2O1LA 2EBOA 5LGNA 1JPXA 2QS1A 2QMWA 2NLJC 4P30A 1A8EA 4X48A 4F3GA 1R3IC 2REJA 1K3EA 3G7WA 2ONSA 4PQJA 4EKWA 5I2NA 2ZNTA 4KYEA 3C36A 5M2VA 4N23A 2B3BA 1R6ZA 5DVJA 4MTGA 3F7VC 4ELOA 1S50A 1I6AA 4I1DA 4JTCB 3EHUA 2NUVA 2ZXWB 2IJHA 2JJ1G 4ONYA 4PDMA 5KA6A 1OCZC 2W6JG 3F11A 3TPAA 3FIRA 4BDQA 2HJFC 1NH8A 5CMBA 1MPBA 1NNTA 4TSFG 2W0FC 2F34A 4R6ZA 3MC2A 1POY1 1YHQV 3BFUA 4BDNA 5EC2C 3OGCC 2A5SA 4R8CA 3IL1B 2D3OW 3GWOA 2NNUA 3U93A 5J1DA 1COWG 3B8NA 4CZZA 4IO7A 1H8EG 2LP7A 4RYAA 2O7IA 4RA1A 1TFAA 2YEVA 5KA5A 3VXBA 3OSQA 3TCUA 2DQVA 1FQEA 5CMUA 3O66A 1YJWV 4FE8A 4WKMA 1EH3A 3LBSA 4HW8A 3IORA 4BDMA 5H8QB 3OUFA 4I5SA 3TODA 5LHGA 1PB9A 2XAQA 5I2KB 3ZRWB 4GWOA 1PDAA 4WEPA 4C0RA 3AG4B 4NF8B 3MW0A 3V5AA 4M1VA 4HAMA 2OCCC 1M1KW 1SI0A 2GHAA 4ZEDA 3CR9A 1UIUA 3AG2B 1MXWA 3K6VA 1S7YA 3N6TA 5EHMA 3W7XA 1SW5A 5L9OA 3HHFA 3JD1A 1UQWA 3K03A 4O3CA 4GRKA 2XAGA 2HVKC 1IIWA 3H01A 2OTJV 4ZEBA 4FIMA 4IGRA 3SEVA 1K8AW 3LSWA 2WLNA 2X6CA 4U4SA 2LAOA 4DIGA 1QULA 2HXWA 2OZZA 1FQCA 1B58A 5CBFA 5CBRA 1MY3A 5B3SC 3WG7B 3MHHC 1FXKC 5GW7A 3FJ7A 3E89A 3M3KA 1AJQA 2Q68A 3WFVA 1SZTA 1NJIW 3PUYE 2OT5A 1NR1A 3U8QA 4RUFA 2Z8DA 3SKPA 4XDKA 1W0JG 5AA2A 5KDTA 1O63A 5DVFA 1S9TA 1O7TA 4WFHA 3ASOC 3OELA 2QEXV 3R26A 1S5HC 4MLVA 4QE9A 4HZ3A 1A54A 3T66A 2DWEC 3ZRXA 1PNKA 3E83A 5EBWC 2Q2CA 3KJTA 4OXVA 2F7CA 3H3GA 2XXTA 4GT1A 4Z0IA 1OLCA 3I3VA 3HPIA 2PT1A 2EIKB 4EF2A 4RQEA 4FIPC 2Q6AA 5I59A 1K92A 1B1HA 3PU5A 1UTHA 2OK2A 2PT2A 3C33A 3TK1A 3EFFK 3I56V 2GHYA 3KG2A 1AI7A 3B6QA 5L3DA 3A09A 4ZZEA 2UXAA 4NTLA 3CCUV 3DP8A 5TPAB 2WWWA 1R6NA 1RM1C 4H33A 3SETA 2EIJB 4GXSB 1SYIA 3H6WA 3Q26A 1MQDA 1PB7A 3E8HA 5FTIA 5EYFA 1Y3NA 2Z22A 3O6IA 4JB7A 3T4ZA 1K34A 2EIKC 1MQHA 1K7DA 4GCZA 1R9QA 1MY4A 4PA6A 3T93B 3IC7A 4MBPA 3TKDA 3E3KA 1S3JA 4TLMB 3OAAG 3AG1C 4XKRA 1MOFA 1LAHE 4RK9A 3CSBA 4QFKA 1USYE 1PNMA 1JOYA 3TQLA 1MY1A 2XXUA 3QUFA 3K08A 2Q67A 4FPPA 1BLFA 1Y1ZA 3PMVA 1B5HA 2XXRA 3OO9A 4H5FA 1HWYA 3GXAA 5AA3A 1JCHA 2ITDC 2HAUA 3W7SA 2ZNSA 3ABKB 3H03A 1RYOA 4LZ8A 2O7UA 3U94A 1IQ7A 3V8XB 4F2QA 2F7BA 2QSXA 4JYCA 4F31B 3SEUA 1JQFA 5K2XA 1E1RG 4N6PA 1FXKB 1QR9A 3ABKC 2OLBA 2H99A 2XAHA 3CI8A 4MVUA 2F7AA 3K1PA 3TCGA 4PELA 5L3BA 4P0IA 2ZDIC 3MHSC 3OUSA 2IJKA 3RW0A 2UVIA 3EF7A 4YB7A 4DCYA 4N13A 5B7DA 3QUJA 1VQNV 3U92A 4MS2A 4IO2A 3OM3B 3IK6B 1VQOV 1MXVA 3K04A 3O6GA 1NH7A 4C1UA 1L1FA 1US4A 1SQYA 5L3CA 2RINA 2EINC 4MW3A 4EF1A 2VOZA 4AQ4A 1IITA 3CRBA 3SYPA 5HPQA 2RC9A 2AYSA 1AJPA 4TQUQ 4Z7EA 2GRVA 1IXHA 4HS7A 2GFEA 2P1SA 1Y3PA 4PA9A 1TXFA 5H8HB 2XX9A 1NKXA 1QUKA 1JEVA 4NWCA 3STZC 1K97A 1R1NA 1FTOA 4FK5C 4PA4A 3ZRWA 3SEYA 3JCZA 1ZU0A 2X0LA 1NQTA 3K9AA 1US5A 4LQ2A 1R3KC 3FV2A 1ATGA 2XXVA 2YJPA 3ZS6A 3QO5A 3K4UA 4EQ7A 5HM4B 2XAFA 2Q8JA 5LGTA 4YKKA 4R2BA 1F51A 3LNMB 4G8HA 2ZYKA 3KSJA 1VE4A 1B32A 1A99A 3OEKA 1DTOA 3B77A 2NXOA 3C32A 3VVDA 1D3KA 4UVBA 1VR5A 5FHOA 4LCUC 3IFXA 5F1QA 2FTKA 3E35A 1B05A 4RPOA 1VQ8V 3E86A 2IU0A 2HZKA 3UKMA 1SDXA 2UVGA 3QXMA 1DF5A 4QSEA 1Y4CA 5H8NB 3A0RA 3IJXB 4HYOA 3G3IA 1KC8W 3H4ZA 1QVSA 3E2EA 1MDP1 3ZKKA 2QRYA 3LC8A 3PV0E 2UYFA 3DLNA 5ICQA 4WFAV 2WLLB 3VE1B 4JSDA 3P7IA 3KZGA 4BDRA 2CK3G 1L5TA 4ZE8A 2IJIA 5L3EA 2A79B 3FVGA 5FHNA 4YKPA 4MVSA 1LLSA 4KQPA 3FXQA 3PJSK 2C2AA 5I2NB 1M90W 3SEWA 2YSUB 3OD7A 3QK6A 4GX0A 1P1UA 2EJRA 2A0LA 1PBPA 3CG1A 3DP4A 3K0VA 2UVJA 1IUDA 3VLUA 4Z1MG 4U22A 4UUJC 2ZYMA 1K4DC 2XXPA 4ZS9A 2DXRA 3MVZA 2VP1A 3G3GA 5DTBA 4MVZA 1ENVA 1SESA 2I6EA 3CG3A 2HCAA 4HCWA 5DEXB 4R74A 1LFGA 3UM7A 5H6QA 1B1XA 1VQMV 4PDVA 5DYHA 4GVOA 1QLEB 3BKIB 2QJEA 1P4RA 2ESNA 4TWKA 2GH9A 5B1BC 1VQKV 4NF4A 3D3IA 2OWSA 1CEZA 3ABUA 1SETA 3CFZA 3ECRA 4R6KA 5I58A 2EINB 2NVUB 3OO8A 4BW5A 1LCFA 4GLIA 3ETEA 5KUKA 3TTLA 3PUWE 2DSFA 4F3BA 1JVMA 5JTYA 5EK0A 5LHIA 1QW0A 4JWYA 2JEXA 4MVOA 3G3JA 2X6BA 3O9PA 3PPQA 1RM1B 3ETGA 3RNNA 2W6IG 3WAEA 1XC1A 3RTFB 1MG1A 1BHBA 3ZMZA 4U1OA 5I57B 1N84A 1N8RW 1AJNA 4YXWG 2H8PC 3DM0A 2V25A 2B65A 4PFYA 4RK2A 1SW1A 4JYBA 2I4CA 5A5XB 4H1XA 2P90A 2IJJA 3N26A 2D3IA 4GD5A 3M8UA 2LFSA 3HPLC 3HB3B 3TMGA 1DLBA 4X88A 2XX7A 4RAIA 1UTBB 3P32A 2M7WA 3FB6C 2XXYA 1RPOA 1B7UA 2WLJA 3UGWA 1CP9A 4OETA 1GM9A 1OIBA 3OFNG 1JW4A 2M8CA 3QO8A 5B1AC 3K6UA 4I9DA 1QLNA 4MH5A 2HFBA 3FB7C 4QRZA 4BDLA 3O2AA 4KUMA 1BIYA 3S4UA 4PA7A 2I0BA 1GVCA 2I0CA 3U1OA 5ICTA 4PFUA 4G4PA 4MSWC 2EIMB 3IOVA 1O64A 1DMBA 3JYRA 5JEIA 4FJCC 3CCLV 3RQTA 2HQ0A 3BY6A 1MM6A 4H6DA 1DPPA 1I5YA 2IH1C 3CCMV 2B3FA 4E0XA 2DXYA 4QSCA 4JAUA 3MP6A 3MP1A 1KKDA 2DYRB 1MABG 4RNSA 3THIA 3W7TA 1M5DA 3VFJA 3HCQA 1R73A 3ABMC 4R7CA 1R6KA 1HSJA 3UN6A 1AIVA 4WFEA 3AG2C 3OEEG 1B4HA 2EZOA 3HHGA 2RC8A 3UK4A 4BIZA 1VQ7V 1ZIUA 5KCJA 2QS3A 3ML0A 1NNKA 2A5TA 3Q25A 4JAVA 1D9YA 2Z23A 4DCXA 3RBZA 4RUEA 4IO3A 3OO7A 3UA8A 4GL8A 4JBZA 5B1BB 2NWJA 4MFIA 4WXJA 2RC7A 3EQ1A 1QLEC 2JEUA 1YJ9V 3CCQV 1Q81W 4QSDA 3G4SV 3KOSA 4E2LA 3LSQA 1B40A 4RXLA 1LGBC 1W2BU 3LUYA 3S9MC 2R71A 1SYHA 5E1AC 1USYH 3FVNA 4X1BA 2YLNA 1N0TA 4OFLA 3MVXA 3O28A 3ZCCA 3RPWA 3A3UA 2WKYA 3MPKA 3QIMA 1BP5A 4WF9V 5B1OA 1Q1KA 2O1MA 4DE8A 4JDFA 1N7WA 4F22A 3CXCU 2R9JA 3ZRVA 4OEVA 1OMPA 1LFHA 1VQLV 1B4ZA 3T9VA 3FJMA 4FEDA 3PGFA 4R2FA 4L17A 4LP2B 4G68C 3T9HB 4ELRA 4GX2A 4H8IA 2XOKG 4DDDA 1MH4A 3OW2U 4FAJA 4Q8RA 2IA4A 2RF1A 2QTOA 3C35A 3FD3A 1LBBA 1MXUA 3IAZA 1AROP 4OZ9A 4G8MA 1S0VA 2V93A 5TPAA 4Q30B 1XVYA 3SESA 2ZDIA 2XAJA 1GKFA 3AG1B 4NWDA 1ANFA 3W7UA 1XVXA 4H8JA 4ZE9A 3GBBA 3SPJA 5FHMA 4ISUA 5L8DA 2ITCC 3IO4A 1JW1A 3CPWU 4G2ZA 1P1QA 3ZKLA 4JF3A 5EHSA 2H98A 3CCEV 4OXSA 3S9NC 3LR1A 3HSTA 3HN0A 4CBCA 1P1WA 4F18A 2XD3A 1DPEA 1YJNV 1FTMA 3E4RA 5HFMA 1HSEA 1H2GA 3K1NA 3OOAA 3TZAA 1YTVA 3CCRV 5L3GA 1EU8A 4DXWA 4IB2A 1YTFB 3SYOA 1CE2A 4IGTA 1JVXA 4MLQA 1DOTA 4G77A 2E0SA 4F2OA 3VVFA 5H8SA 1EZJA 3C9HA 1KP3A 1ZJLA 3STLC 2F5XA 1FTKA 1IXCA 1ZKBA 2ABHA 2PI4A 4MVRA 5H9CA 1B2HA 5IAIA 4AB5A 4QIWF 2WPDG 3KSXA 1R3LC 3V89B 1LSTA 3TQWA 1LB8A 4O3BA 3AEIA 3FATA 4RY1A 3ZMSA 2O6AA 1P7BA 2UVHA 1RPRA 2ZYOA 1S72V 2XX8A 1LAGE 3FYEB 1QJMA 5AA4B 5LBQA 1FQDA 2HEUA 1YCJA 2DE3A 3RVYA 4NF6A 4OQOA 1GR2A 5JK4A 3ETDA 3H6VA 1V54C 2HFEC 3IOTA 1Z7ME 5AA1A 2ZQMA 1MS7A 5C93A 3ASNB 2WAMA 4FORA 4TT3G 2HLDG 1Q35A 1TUEB 1OQGA 3ASNC 5HBCA 2AHZA 1LB9A 4GX1A 4XKQA 1V54B 4KYSA 3SPCA 1GM7A 4WFBV 1I69A 2UYEA 1FQFA 1LAXA 1H38A 1Y9UA 3OXNA 4ESXA 1MXYA 1EFRG 2P67A 1A8FA 1N3XA 4XIGQ 2EZPA 3QAXA 1LCTA 2PX1A 2VD2A 3KOTA 3PMXA 1Y3QA 1VQ4V 2W7YA 2OJTA 4KR5A 1UTHB 1E1QG 1R9LA 2UXNA 1P99A 3OMBA 4FMTA 1OCCB 1ROPA 3SPGA 3ZRSA 2XNDG 1V55B 3GBAA 3SEXA 3FB8C 1E79G 4KCCA 4LUBA 1RYXA 5A5XA 4UVCA 4NEDA 3KBRA 2V3UA 2WLIA 1B3FA 2YEVB 1MQJA 1XOCA 3CFXA 3CIJA 4PP0A 4DO2A 2ZXTA 1PB8A 4LONB 4QFLA 4OMBA 4TLLB 4OESA 3N6UA 3E8BA 2VGQA 3TELA 3D36A 4IY6A 3VLVA 2EILB 3I55V 1IXGA 1VQ5V 3SDFA 3W7WA 1MQIA 3RVZA 3I5OA 3OO6A 2DE4A 3BEHA 4QF9A 2DYSB 3PMWA 4DXUA 1N76A 2DWJA 2BOBC 1B9JA 1NH2D 1VFDA 4GL0A 4MTOA 4XDLA 5LGUA 1B52A 1W0KG 2WSSG 1QR8A 2PMSA 3IOUA 1B0LA 4NF6B 3T96B 3TTKA 1MPCA 2O69A 3B6WA 1SERA 4I62A 2IU3A 2O68A 5I56B 4Q0CA 1AL3A 1J1NA 2BJJX 3K00A 2ZYNA 5I59B 2Q88A 2HG5C 1M5BA 3IB1A 3IR1A 4ND9A 1YTFD 3T9UA 1SW2A 3CVGA 5I2KA 1K33A 1PKXA 2RCAA 3HV1A 4K3FA 4U2RA 2DWDC 5TP9B 2I58A 3B7DA 4KPTA 3E13X 4JXIA 2F35A 1LAFE 1BHAA 1IXIA 1URDA 4JTDB 4ZEIA 1WPXA 5DT6A 3M3FA 2AHYA 4O3AA 4OERA 3TUSA 2WLIB 3ILTB 1OCRB 2WLKA 1VQ6V 2Y7RA 2FYIA 1JX9A 3EHTA 3SYCA 4OEUA 4U7NA 3TETA 1FW0A 3MP8A 4EUOA 2JIZG 1K4CC 2XD2A 3MVYA 2OCCB 4YB6A 1GGGA 2P0SA 3LDDA 1GTKA 4POWA 5IY5B 2Y69B 1FXVA 3TDJA 1SBPA 5KZTA 3MBPA 1TT1A 2Z8FA 4WEDA 3ONMA 4KFQA 3ZIAG 3RT6B 3M3LA 5B70A 2I3WA 3DELB 4MVMA 4LP8A 1GM8A 4I8CA 1JNFA 4MTXA 2Y7KA 2Q69A 1B6QA 3MUQA 3GB7C 2V3TA 1JJ2U 3RLFE 1EZPA 1JVYA 1OCZB 2JK5C 2OTLV 2O51A 4ECFA 1ZLQA 3RUMA 3PPOA 4RPNA 4MTFA 3N94A 3CSGA 4LZ7A 3X2QC 1CB6A 4UA8A 2HZLA 3UP9A 1B6HA 2P2AA 5CI5A 3KN8A 3KN7A 2ZR2A 3TTRA 3T2MA 4KFMA 4F1UA 5DM6V 1URSA 3LSSA 4H67A 5FL7G 5DEXA 4QFPA 4XBFA 3R65A 4BIUA 4JWXA 4QE7A 3OSRA 4OTEA 1OLAA 2V1DA 4FJPA 4GQOA 3P30A 2F6PA 3T4DA 1FQBA 2DW4A 3ABTA 2GSMB 3ASOB 1YI2V 1K5SA 3DTUB 4N21A 2F97A 1FQAA 1XL4A 3O29A 3BFTA 1K5QA 2XXIA 5CBHA 5I56A 4MF3A 3Q28A 3MZ9A 1UJWB 2I4BA 1TFDA 2A9HA 4XDJA 2DE2A 3QSLA 3UORA 1Y66A 4LQ5A 4EDPA 1AMFA 3CFLA 2D5WA 1LFIA 1FXKA