1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
b'GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
3FVGA 3KSXA 3W15C 4FIPC 3PPPA 1B3EA 4YAHX 3I5OA 1XVYA 2V3QA 3PPOA 2GH9A 3PU5A 1ELJA 2RC7A 4OZ9A 4FEBA 4LZ8A 3LR1A 3CI8A 4IO2A 3V8XB 1NH8A 2ZYOA 3MHHC 4JGSA 2WKYA 2VOZA 3IOVA 1B46A 5CMCA 4QFKA 1UQWA 4IY6A 4LZ5A 4U1ZA 5KDTB 3K00A 2D21A 3EHUA 1JETA 2Q8JA 3OENA 4N21A 3PD9A 3SEUA 1MOFA 2XX7A 2G93A 2GHAA 3VXBA 3I6VA 3IOWA 3LC8A 2GFEA 1MPDA 3EPEA 2VP1A 1QBZA 4XIGQ 1IZ1A 2A5SA 2Y7WA 1AOVA 2XXUA 2ZYNA 3EHSA 2RCBA 5ISUA 2QMXA 4LZ7A 4EXKA 1IEJA 4POXA 3RT6B 1MH4A 2V84A 3C36A 5H9CA 5AA2D 2O69A 1O64A 5I2NA 4MBPA 2E0SA 5I57A 2A5TB 4AQ4A 3QUJA 1R9QA 3EHTA 4ELPA 4XKPA 3O6HA 4MH5A 3RT8A 1H3DA 1O63A 4R9GA 4YKPA 4F3PA 3K0VA 1I6QA 2YLNA 2Q88A 1FCKA 3C35A 4FK5C 3H01A 5HFLA 1B1XA 4DDDA 3HHGA 4YMBA 2LAOA 3UIFA 1Y3PA 3SETA 3HN0A 1QULA 3KGCA 2IEEA 2Y7KA 4OEUA 1XT8A 3L6HA 4PFUA 2V3UA 1JNFA 3PPNA 1LBCA 2F5XA 3FATA 3FASA 3RNNA 4HCYA 3KN3A 4OQOA 3V89B 3M3KA 3TEPA 4KQPA 4ZDMA 3N94A 1QW0A 1DPEA 4Q0CA 3CP1A 3FIRA 1EZOA 1DLBA 1B9JA 4N07A 4F2QA 2DVCA 1IQ7A 2DWAA 5H8QB 3K02A 3SDFA 1IIWA 3ZKLA 2I3VA 1SI1A 3VDFA 4U1OA 1QVSA 4IO7A 4G8MA 4KHZE 2EZOA 1MY4A 2Z8DA 3RTWB 4H1XA 4ELOA 3TQLA 5I84A 1Q1KA 1UTBB 1O7TA 2P0SA 3SEVA 2AIXA 1SW2A 5ICTA 1D4NA 1T0KA 3IB2A 3G3FA 1VR5A 4NF8B 1ATGA 3EQ1A 3BFTA 4OESA 1P1QA 4ONYA 1L5TA 4BLAA 2XXIA 2YPNA 1D3KA 1QKBA 3UA8A 3CG1A 4YMAA 3I3VA 1P1WA 5HPQA 2AL4A 1Y9UA 1OIBA 1JEUA 4Z0IA 3PGFA 1LFHA 4RK9A 3B77A 3EF7A 2DE4A 3W9WA 2I48A 4JSDA 5H8NB 3THIA 4O3AA 5ICQA 1B0LA 1MM6A 3LBSA 2DE3A 3N5LA 1D9YA 4JBZA 1ZJLA 4YZZA 4GRKA 3SESA 3MVYA 1TFDA 4BDOA 3FVOA 4R75A 5FHOA 1QR9A 2X7PA 1MY0A 4OXVA 3PUWE 3MAMA 3OSRA 1FTKA 4GL8A 1OQGA 3VLVA 4GOTA 2NVUB 4BDQA 1SYHA 1ZKBA 1H43A 1R1NA 4XKQA 4H5GA 3CFZA 3T22A 1NKXA 2F35A 2XXWA 4EQ7A 1MRPA 1SW4A 4ND9A 5F1QA 4I1DA 3CR9A 1SYIA 1II5A 3RPWA 3PMVA 1XHYA 3S2VA 5I59B 1NMUA 3PMXA 4DZ1A 4IO6A 1B5HA 1I69A 5I58B 4GIZA 4XKRA 2ESNA 4GQOA 3RUMA 3MPKA 1PB9A 4RYAA 4YKJA 2FA7A 1QJMA 3B7DA 1GGGA 3T9VA 4PQJA 4Z7EA 5DYHA 2QSXA 2OBGA 5KDTA 4F3SA 3TMGA 1CB6A 3B8MA 2QMWA 4R73A 2KLFA 1TWYA 1PB7A 3FV1A 1MG1A 4MLQA 4GLIA 5JEIA 1LFGA 2B3FA 4IGTA 1B2HA 3H6TA 4Q30B 2RCAA 4R2FA 1P1UA 1JW5A 1OVTA 1HSLA 4TOZA 3IX1A 3H6WA 3T9XB 3QXMA 3E13X 4TQUQ 1B7HA 5AA1A 3MVWA 3PD8A 1MXVA 3A3CA 4YKIA 4NF4A 1XS5A 4E0XA 3K6VA 5KCJB 4H8IA 5CMMA 3KBRA 4QF9A 2HCAA 3MZBA 3KZGA 1TT1A 1DOTA 1UIVA 1ANFA 2F8DA 2Q2AA 2ZNUA 4R9FA 1FTMA 3V83A 4X9TA 3OEKA 1LB8A 3K6UA 3OD7A 4OFOA 3IL1B 2Q9TA 3IK6B 3BBRA 4DXCA 1R6ZA 2A5TA 4AB5A 2MK3A 3CRBA 3FXUA 4F18A 5H8SA 1SD3A 3K1PA 5AA2B 3F11A 3ECRA 1URSA 2XXPA 1AMFA 1P99A 1AH5A 3VFJA 1A55A 5A5XA 2Z22A 3VE1B 2NWJA 1A40A 1JW1A 5HM4B 1EZ9A 1N0TA 3GWOA 1B4ZA 5J1DA 1UTHB 4E0WA 4NWCA 1OLCA 2XXYA 5CMKA 3FJGA 2ZYMA 4NF6B 3C31A 5TU0A 2FNCA 4N13A 5KA6A 4QFLA 2Z8EA 3CFXA 4FE8A 2OZZA 1FQBA 4LA9A 3TDJA 1B3GA 1LAHE 1AL3A 4E2LA 3TTRA 3OSQA 3KJ7A 3G3IA 1MXUA 2V93A 2H99A 3O29A 1Z7NE 3ODBA 4P0GA 4KD5A 3T9UA 3FVNA 1B32A 4ISUA 4EQBA 1M5FA 4KYEA 5B70A 2HAVA 5H8QA 3A09A 4QRZA 2ANJA 4F3BA 5I56B 3TKDA 4FEDA 4KR5A 2X26A 5AA4A 1LCFA 3C33A 4PFYA 1BP5A 4G8HA 1SDXA 4ZECA 4TLMB 3HSTA 1Y3NA 2HEUA 1MM7A 4GXAA 5IAIA 4EDPA 5FHMA 3RQTA 4H0WA 1YCJA 3G3GA 1B0HA 5CBSA 4PETA 5K2YA 3ZKKA 4JPRA 4OETA 1SW5A 2XXVA 2XHDA 3S4UA 3W9VA 3VV5A 3O6GA 1IXHA 1S9TA 3BKIB 1B3FA 3OOAA 3IOTA 3S9EA 4ECFA 5L8DA 3TUSA 3TODA 4POWA 1I6AA 2PT2A 2QS2A 3H3GA 3HV1A 3LSLA 2X7QA 2DE2A 3IORA 5F7VA 4L17A 5M2VA 4HS7A 2I58A 5H8NA 2R6GE 2UVHA 3CSBA 3RLFE 2XD3A 4RNSA 2O84X 3JV9A 1NNPA 5LOMA 1DSNA 5KA5A 2I49A 2QJEA 1MQHA 3Q25A 1F23A 2XD2A 2I3WA 4JF3A 4ELRA 5TPAB 3K01A 4NTLA 5EHMA 4XXUA 3Q28A 3GXAA 1IXIA 4XKNA 2OWSA 4M4GA 3FGSA 3DELB 4FAJA 4NF5B 1POTA 3CG3A 4G68B 1K33A 3Q26A 1EU8A 4H6DA 2OCUA 2NXOA 3T66A 1Y4TA 2I0CA 2ALUA 3OMBA 4AB6A 1MDP1 3M8UA 3USDA 3GBAA 3TCHA 4QSDA 4GXSB 3FUZA 3KN8A 1MPBA 2Y7PA 5I59A 1B7ZA 2H4IA 5I58A 4IY5A 3KOTA 4X1DA 4WKMA 2CZLA 2H25A 3O66A 1SW1A 3TCFA 2M8CA 3T96B 5BWJA 2RC8A 3FD3A 3V5AA 3GZGA 3PMWA 4GD5A 1A8EA 4JXIA 1H45A 3JZJA 1DF4A 2QRYA 2XXXA 1LGBC 2R9JA 1GTKA 2ONKE 2RC9A 2Y7IA 1CE2A 4F2OA 2R71A 3UN6A 3S9LC 1ZIUA 5L9SA 2P2AA 2XXQA 1B7UA 4N23A 4R6YA 1WDNA 1N76A 2REGA 1FQDA 1HSEA 4LVQA 1QCEA 4F1UA 2Y84A 3B6WA 1B52A 5KCJA 4ZE8A 1SBPA 4F22A 4KFQA 4MFIA 4M1VA 2ZNSA 1N7XA 4JB7A 1ZMGA 3TQWA 3JYRA 4IGRA 4LONB 5K2XA 2ZNTA 1AIVA 3PUZE 1LB9A 3CSGA 3P7IA 1N84A 2P1SA 2F36A 1PBQA 2G29A 1P1OA 3PPQA 4ZEIA 3HO7A 2RF1A 3FXQA 2VD3A 1SVXB 1A54A 4MF3A 3QIMA 4FJCC 1MDQA 1QUKA 3DP8A 5AA2A 1KWHA 4R6KA 3O6IA 3A3UA 1MXWA 1N04A 1ENVA 4QSCA 3ZSFA 3OELA 3VLWA 5H8HA 1EH3A 3FV2A 2CMOA 3OO9A 3UGWA 3C34A 4HCWA 1IUDA 1JVXA 1VFDA 3MPLA 2FYIA 2XXRA 2QS4A 3U94A 5I2NB 2W7YA 5I57B 4YB5A 2F7CA 3LSFB 3VLUA 4LATA 3ZS6A 1UTHA 1I5XA 3C9HA 4OFJA 1K34A 4ZEDA 1MPCA 1LLSA 3UP9A 4C0RA 4H5FA 1TFAA 1I6BA 4PP0A 4Q8RA 2D5WA 1N7WA 2DP8A 2F34A 4DE8A 1OLAA 5EHSA 2AL5A 5L9OA 3FJ7A 3QK6A 4U4XA 1DTZA 4DXUA 4NWDA 2OLBA 5I56A 3T93B 1B05A 1B58A 3O2AA 3AXFA 4NEDA 1MS7A 1RKMA 1N3WA 1MY3A 4HW8A 3IOUA 5CC2A 4GFRA 3DLNA 3IB0A 3MWBA 4G77A 5JTYB 3C32A 4IO5A 2HZLA 3MHSC 3IB1A 1EZPA 4OYVA 3B8NA 4H8JA 1Y66A 1H44A 3MJNA 2BJJX 3B6QA 3TZAA 3OO8A 1MQIA 2F97A 1D9VA 4G2KA 2H9BA 4QFPA 4OTEA 3SKPA 2PYYA 2ONSA 4XTCQ 2QL3A 5JK4A 4EXLA 1POY1 1IXCA 5TP9B 4F31B 4R74A 1QR8A 5DVIA 2QPQA 3U92A 2DS9A 4ZEBA 3HHFA 1MXYA 3MBPA 1P1NA 5CMUA 4JWOA 3RGYA 3U8QA 5CN0A 5I2KB 2OWTA 3DM0A 3WAFA 5TPAA 3OO6A 4IB2A 2XX8A 4KCDA 4GWOA 1A8FA 3M3FA 1NNFA 2F6PA 4BDRA 2NOOA 4ELQA 1S50A 1VE4A 4NF5A 3IJXB 3RN8A 5DEXB 4F3GA 4G68A 3IO4A 1B4HA 1J1NA 3LUYA 1LAXA 4FJPA 4PFWA 3WFVA 4X48A 2HAUA 1H76A 1B1HA 4U4SA 4THIA 1LAGE 4JSOA 4R72A 1NNTA 3VXCA 2UVGA 2RINA 4ESWA 1MQGA 3D4GA 4OEVA 1A7LA 2DSFA 3M99B 2I4BA 4PFTA 3SERA 3OXNA 3KG2A 1DPPA 2F78A 3PV0E 3G3HA 5H8FB 4GL0A 4EF2A 4FIMA 2THIA 3PUVE 3QYTA 2M7WA 3OEMA 4JWXA 2OJTA 1WODA 3VVFA 4RY1A 3Q27A 5DVFA 1JW4A 1A99A 3WAEA 4QFOA 2ZMBA 1Y4CA 4I62A 1BIYA 4LUBA 4RJZA 1GV8A 1ZLQA 3CFLA 1Z7ME 1UTBA 5FHNA 2H98A 4BDMA 4EUOA 4RK2A 2VD2A 2VHAA 4K3FA 5CI5A 2REJA 4NF8A 4P0IA 3MW0A 1XOCA 4UA8A 1TXFA 3K9AA 4R2BA 3QAXA 4I9DA 3N26A 3H6UA 2DYXA 2DOJA 1FTOA 2HFBA 3KSJA 2GRVA 1MH3A 5FTIA 3E4RA 2DVZA 2DQVA 3DP6A 1DMBA 4Q5TA 1B3HA 1SI0A 3O97A 3K1MA 1VFEA 3TPAA 4F29A 1QUIA 3U93A 4KYSA 4NF4B 2NUVA 3E3KA 1FQFA 1PDAA 5HBCA 1M5CA 3U72A 1RYOA 2I0BA 2V25A 4BDLA 5FTHA 3K1NA 4OVJA 4YU0A 4FECA 4F19A 1B6HA 4DCYA 1EBOA 3HPIA 3ILUB 3KJTA 1OMPA 1DTGA 4JWYA 2EZPA 4RXLA 3S9MC 4JDFA 4N6PA 4ZEFA 5KZTA 3OO7A 4QSEA 4MLVA 3CVGA 1Y4MA 2HZKA 4YB6A 1USYE 4EF1A 1PB8A 1JEVA 5CMBA 2O1LA 3MZ9A 4NE4A 1BTJA 4FATA 3PPRA 1US4A 5BUUA 3LSXA 3D4CA 4KI0E 2O1MA 5A5XB 3MVZA 2XXTA 2OT5A 4U23A 3MP1A 1JQ0A 3CYOA 1XVXA 3Q29A 1FTJA 1B3LA 4YB7A 3TTLA 4P11A 5B7DA 1YAEA 5CBRA 1XC1A 5AE4A 1B5IA 1URDA 3FVKA 1BKAA 2ZXTA 2B65A 5ITOA 2PMSA 2QS3A 3ILTB 3H4ZA 2Q89A 4OERA 4WEPA 3IJOB 2O7UA 4DXBA 4ESXA 1Y20A 4YICA 1MQJA 2O6AA 2I4CA 1M5EA 4C1TA 4G68C 5JTYA 1PEBA 1R9LA 2I6EA 1NH7A 2QS1A 3P30A 3FJMA 3KEIA 3KOSA 1LCTA 2PVUA 3VVDA 1MY1A 1MXXA 5DVJA 2F7BA 3G3JA 3KFMA 4LP2B 3BFUA 4U21A 3UORA 5AA4B 1WVJA 4OWDA 4IO3A 2UYEA 4OENA 2Q2CA 3ONMA 1BLFA 3QUFA 1GVCA 3IAZA 4NMYA 3TCGA 3K4UA 2O7IA 1HSJA 4KPTA 4F1VA 1OVBA 5TP9A 2YJPA 2IA4A 2ABHA 1B5JA 3TTNA 4ZZAA 2LP7A 1DF5A 1FW0A 2B3BA 3TTMA 1ZU0A 4G8NA 4EQ9A 3E9XA 4RPOA 2HQ0A 3MZ1A 2XX9A 5DT6A 3PUYE 5I2KA 2PT1A 1Y1MA 3K6WA 3R6UA 3R7XA 1JVYA 3IO6A 3C4MA 4UACA 3CIJA 3H6VA 4DIGA 4DCXA 4ZZEA 3R26A 3H03A 1MY2A 2F6GA 3MQ9A 2PX1A 3SEXA 3L6GA 3TYHA 4ZEKA 5DEXA 1N3XA 4LQ2A 4GF8A 3O9PA 1LSTA 2VGQA 2D3IA 4NF6A 3DP4A 3B6TA 5DTBA 4OFLA 4OHNA 3SEWA 2OK2A 4RA1A 2XXHA 1GR2A 1PBPA 4KYDA 3UK4A 2H5YA 2RKMA 1IXGA 3MP8A 4G2ZA 2DXRA 1JPXA 2X7RB 3KN7A 5H8FA 4DLDA 2PBWA 3T9HB 1M5BA 4O3BA 1YTVA 2UXAA 1YPNA 1RYXA 1ZBMA 2V3TA 3GBBA 4RPNA 1FQCA 4PE5B 2P6JA 5AA3A 5IKBA 4WXJA 1SQYA 3PUXE 3FZVA 1NNKA 2GHBA 4U22A 1OQHA 5ITPA 4LQ5A 4ZS9A 4OMBA 1MXZA 3VVEA 1VSOA 1NFTA 3SEYA 1M5DA 2HXWA 1US5A 1PC3A 4WEDA 1MQDA 2Z23A 3MP6A 3FXRA 2Y7RA 3TAJA 3S9NC 1QKAA 1LAFE 1SZTA 3U1OA 1I5YA 3H06B 3MUQA 1Y3QA 4QHQA 2EBOA 3LSWA 1LFIA 3RY3A 3MC2A 4ZE9A 3QSLA 2ZYKA 3HCQA 3EN3A 4QFNA 1URGA 4H65A 4O3CA 5HFMA 3RTFB 2F7AA 3N6TA 4U2RA 4FORA 3MVXA 4TLLB 4YKKA 2O51A 2UVIA 4HTGA 4I8CA 4F1YA 1Y1ZA 2O68A 4GVOA 1B51A 1JQFA 2UVJA 3K6XA 3TFLA 5CM6A 1IITA 1F9BA 3O28A 4BDNA 3IR1A 1B40A 1ZTYA 3TELA 2AYSA 4C1UA 1FQAA 3GLBA 5CRYA 5L9MA 3N6UA 4R6HA 1Q35A 3H7MA 4G4PA 1FQEA 2DWJA 1NL5A 2DWHA 3K2DA 5H8HB 1QUJA 3TTKA 5ELVA 1USYH 4X1BA 4KCCA 1LBBA 4IO4A 1S7YA 1FTLA 4F39A 2UYFA 2E1SA 3G3KA 3M3LA 1UIUA 2DWIA 2DXYA 2ONRA 4H67A 3G7WA 2Z8FA 5EYFA
chains in the Genus database with same CATH superfamily
2XHBA 4J9ZB 1PPJH 3FVGA 3KSXA 3W15C 3OMAB 4FIPC 3PPPA 4GLXA 5ET5A 1B3EA 4JZ2A 4GT1A 4YAHX 1JP4A 3I5OA 4DRXA 1NBMG 1XVYA 4N17A 4PGNA 3RFRA 5H5NA 2V3QA 1S76D 3PPOA 4EB6A 3IFAA 4O4HB 5LBQA 4FLXA 2GH9A 3PU5A 2RCVA 1ELJA 2RC7A 1P84F 4FEBA 4LZ8A 2GDSA 3LR1A 3CI8A 4OZ9A 5KHKA 3QO5A 3ZHTA 4IO2A 4P47A 3V8XB 1NH8A 5CA1B 3ZCCA 3D36C 2ZYOA 3ASOC 2YIBD 3MHHC 4JGSA 3D3IA 2UXCO 4N81A 4RUEA 1AJQA 3CB2A 4KUMA 2WKYA 1PV0A 4JASA 2VOZA 3IOVA 1H8HG 2KQXA 4OPHA 4X8AA 2YIAA 3RYCB 3RYFB 1B46A 5CMCA 3ROJA 4QFKA 4DR6O 2JVDA 1UQWA 1AP6A 3JAWB 3DGEA 1P7GA 1IMEA 2ODMA 2F3BA 4IY6A 4LZ5A 4U1ZA 5KDTB 1BK4A 3K00A 1AI7A 4FLZA 2D21A 2XNDG 3K5NA 1I08A 3EHUA 1JETA 2OWOA 2Q8JA 2H8PC 3OENA 4N21A 3PD9A 4I50A 2UXDB 3SEUA 1KP3A 1VARA 1H38A 1MOFA 5I3SA 2UUBO 2XX7A 2P4VA 4HNAA 3WG7B 5LXTB 1DCUA 1FPGA 4AS5A 1F7YA 4TV8B 5LMUB 2G93A 4X20A 3JSNA 4CH5A 2GHAA 3WB2A 1IMCA 3VXBA 3I6VA 4XFEA 3IOWA 2QVUA 4PFBA 3LC8A 2GFEA 1MPDA 1Q6IA 5FPRA 1FPDA 3EPEA 3QO8A 2VP1A 1QBZA 3DC5A 4CS2A 3UT5A 1IZ1A 1YXBA 2A5SA 4XIGQ 2UUAB 2Y7WA 4PDHA 1AOVA 3SYQA 1JMKC 2XXUA 2IH3C 2ZYNA 4NXNB 3EHSA 2RCBA 4H44B 1N32B 5ISUA 2QMXA 2L6LA 4LF4O 4LZ7A 4EXKA 3RVZA 3HKEB 1IEJA 3CXCU 1LUWA 4PDLA 4POXA 2HJDA 3RT6B 1H2KA 3LSQA 3W7SA 3CCSV 2CGOA 3CD6V 1Q6UA 5ET7A 1VF5B 1MH4A 4I5SA 1A32A 4XDLA 2Q0OC 2V84A 1IMAA 3C36A 3K3WA 5H9CA 1AWBA 4AILC 1JVMA 5H6QA 4LF5O 2DJVA 4O4JA 5AA2D 2O69A 1JJ2U 1O64A 2Q7EA 3CSXA 1KKDA 4IHJA 1PL4A 2RDCA 3AK2A 4IYHA 3WG7C 5I2NA 3QNEA 4MBPA 3A0BZ 3W7TA 4B3RO 2E0SA 5I57A 4HYOA 4H0LB 2A5TB 5IM2A 4AQ4A 3BY6A 3QUJA 1R9QA 3EHTA 4ELPA 1VQPV 4XKPA 3O6HA 4MH5A 1BS3A 4G27B 3RT8A 1WPBA 2ZT9B 1H3DA 1PNMA 4N15A 1O63A 4R9GA 4PI0A 2ZDIC 3OW2U 4YKPA 4F3PA 3K0VA 2P4KA 3WB1A 1BZKA 1I6QA 1YTFD 4J7JA 2YLNA 3UKMA 2Q88A 1FCKA 3G80A 2UXCB 3C35A 4LF9O 4FK5C 3H01A 5HFLA 4F4LA 1B1XA 2XUMA 1OCZB 1OHHG 2XAQA 3C90A 3R65A 2LAOA 3HHGA 3UIFA 4DDDA 4YMBA 2QTOA 2KG7B 1Y3PA 5IZ3B 3E78A 3SETA 3HN0A 4OA4A 4RQEA 2QKCA 1NI9A 2HFEC 3LDDA 1QULA 3KGCA 4LWSA 2OIGA 2IEEA 2ZE8A 4LH7A 2Y7KA 4DR6B 4OEUA 1YVWA 1XT8A 3BIGA 3L6HA 4TOIA 3MYUA 1AROP 4NTXA 2D3OW 4PFUA 2V3UA 1NT2B 1XQ8A 3B09A 4X1YB 1JNFA 3PPNA 3T1HO 1QLNA 3RBZA 1LBCA 2F5XA 3FATA 3FASA 4DYLA 3RNNA 2DOSA 3HPLC 4HCYA 1Y74A 4JI1O 3KN3A 2ZCEA 1W0JG 4OQOA 2Q9LA 5EIBD 4P3LA 1DK1A 3V89B 3M3KA 3IAYA 5IJ0A 4LBEC 1Q7YW 3FB7C 1FTAA 4O7MA 5JCOA 5IJ9B 3TEPA 1EYJA 2UUBB 2IH1C 1NKDA 4KQPA 3JATA 2CTWA 4R6ZA 4ZDMA 2WEFA 1SF9A 2QWRB 1OCRC 3N94A 4X8RA 1SS3A 5BY1A 3B50A 1WA8B 5FNVB 1QW0A 1DPEA 4JYAO 5IYZA 1FAFA 2CK3G 2IU3A 3CJHB 4Q0CA 5CBGA 2XAHA 3CP1A 3FIRA 3T1YO 1YZ0A 1DLBA 1CPYA 1SC5B 3W7UA 1EZOA 1B9JA 4N07A 4WFEA 4F2QA 2DWDC 5KX5A 2DVCA 1PD3A 1OCZC 5J16A 2XAJA 2L5VA 1QVGU 1IQ7A 2Q4PA 2DWAA 2FB5A 4MVSA 4LF4B 5H8QB 2QWPB 4NTWA 3K02A 5LHIA 3SDFA 2XAGA 1IIWA 1EZVH 5LGNA 1B06A 1P7BA 3ZKLA 2I3VA 4Q6GA 3CPWU 1YJNV 4KP4A 1Z2GA 1SI1A 1V55B 1D5NA 4TT3G 3K9SA 3VDFA 1BCCH 4U1OA 1QVSA 4IO7A 4G8MA 4KHZE 2EZOA 1MY4A 2Z8DA 3F5TA 3G6BA 4Z1VA 4LF5B 3RTWB 4H1XA 4ELOA 3TQLA 1MSDA 5I84A 1Q1KA 2PFZA 1WPXA 2ZIMA 5LGUA 1VQ9V 3ZRWA 1FFXA 1P49A 1F51A 1NTKH 4JI2O 1O7TA 1UTBB 4BWAA 2P0SA 3K04A 3SEVA 4B3RB 2AIXA 1FXKA 4QXDA 3D3QA 1SW2A 3JAKB 4PA7A 3CRCA 5ICTA 1D4NA 1T0KA 3IB2A 3G3FA 1VR5A 4NF8B 2W0FC 1ATGA 3EQ1A 1NV2A 2FYUH 5J2UA 3K59A 1NUWA 4ZI7A 3BFTA 4OESA 1GRJA 2H94A 1P1QA 4O2BB 4ONYA 1L5TA 4BLAA 2XXIA 4UCOA 2YPNA 5EC1C 1D3KA 3IFCA 5E1AC 1NV1A 1QKBA 4WFGA 1R73A 1RFYA 1E1QG 3UA8A 4PDMA 2YI8A 3G4SV 4WFHA 5CB4B 3CG1A 4JI5O 4YMAA 2DQ3A 3I3VA 1P1WA 4LF9B 5HPQA 4PD4F 2AL4A 1EFRG 1Y9UA 4JAUA 1OIBA 1QHTA 1O9HA 1NTMH 1JEUA 2WLIB 2PFYA 1GN3A 2VWJA 3WB0A 1FJ9A 3PGFA 2YEVB 2YXYA 2FVZA 4Z0IA 2MW2B 1LFHA 4RK9A 3B77A 3EF7A 1S5JA 4IGGA 2DE4A 1M93A 3W9WA 1GKFA 3H1IH 4DV3O 2I48A 2ZQMA 3B2EE 2VQFO 3T1HB 4JSDA 4DV5O 3N2GA 2BJIA 4CH4A 5H8NB 2LW7A 3THIA 4O3AA 3DC6A 2OCCC 1FS0G 5CBFA 2WWWA 5ICQA 1B0LA 1G4YB 3W7WA 1MM6A 3LBSA 2DE3A 4BW5A 3N5LA 1D9YA 1JOYA 1SZXA 2JGDB 5GONB 3JASA 4JBZA 1ZJLA 1TUBA 2VRZA 2ZR2A 2FHYA 4YZZA 4GRKA 4PV1B 4LN5A 1G0IA 3APQA 3SESA 3MVYA 2OIEA 1TFDA 2WA4A 1KA1A 4BDOA 3OUSA 1RDZA 3L70H 2A7WA 3FVOA 1WB8A 4JYAB 4R75A 2PY5A 5FHOA 1QR9A 3CCQV 2P06A 2JIZG 3NR7A 1MY0A 4LF7B 2X7PA 4OXVA 1AR5A 4YHHO 3PUWE 3T1YB 3MAMA 3OSRA 1S0VA 1FTKA 4GL8A 1M56B 3P3PA 1OQGA 3EHBB 3VLVA 2EIMC 4GOTA 4ZIBA 2NVUB 4MVUA 4BDQA 1SYHA 3ZHRA 2CGNA 1ZKBA 3H1LH 2VWKA 1H43A 1R1NA 4XKQA 3HB3B 4H5GA 3CFZA 2LJ2A 3T22A 1NKXA 1GN4A 2ZNIA 4QGPA 2F35A 2XXWA 4PELA 3T4DA 1MRPA 2XXKA 3EXAA 4EQ7A 3O9OA 1SW4A 2P67A 4ND9A 5F1QA 3MAQA 5LOVA 2DE0X 4I1DA 2E75B 4BW9A 2QA4V 4H37A 3CR9A 3KCYA 1SYIA 1II5A 4O4HA 4QPJA 2IW5A 3RPWA 3UO3A 2NN4A 4JI2B 3PMVA 2RJZA 4MMPA 5H6RA 5EYPB 1XHYA 1J5EO 3S2VA 1NMUA 5I59B 3AG4C 3PMXA 4DZ1A 4IO6A 1B5HA 4X88A 1YCIA 1MMMA 1I69A 5I58B 3KZIZ 2CAZC 3ETEA 4GIZA 1PNKA 4XKRA 2ESNA 4GQOA 4KFMA 3RUMA 2Q73A 4UB8Z 3MPKA 2XWKA 1PB9A 1BE3H 1FKAO 4RYAA 4YKJA 3RYCA 2FA7A 1QJMA 3B7DA 2AHZA 5EBLC 1GGGA 3MSTA 4JVDA 1K73W 3T9VA 4PQJA 2B9ZA 2OCHA 4Z7EA 3JAWA 4MVMA 5DYHA 2QSXA 1VQKV 2OBGA 4JI5B 4P8BA 4F3SA 3TMGA 5KDTA 2P90A 1CB6A 3ZRSA 1K5SA 1AI5A 3B8MA 3IC7A 4NQ8A 2QMWA 1EN6A 1K5QA 4TQDA 3B40A 4R73A 4P56A 1Q3EA 2ZNJA 2KLFA 2Z3YA 4X65O 3E79A 3SPJA 1TWYA 1PB7A 5ET6A 4FFKA 2A9HA 3FV1A 4TWKA 1MG1A 5B1BC 5LP6C 5BR8O 4MLQA 5LXTA 4NGUA 4GLIA 5ET8A 1LFGA 2B3FA 4IGTA 5B1AB 5JEIA 4DV3B 1B2HA 1N8RW 3H6TA 4N4UA 4TV8A 4YJ2B 4Q30B 5EQ8A 4R8CA 3ZHVA 4PA4A 5L3GA 2VQFB 2RCAA 1QGXA 4R2FA 1P1UA 3HKDB 5EBWC 4DV5B 1JW5A 1OVTA 5F24A 1V54B 5JCOC 1HSLA 2DYSC 3L71H 4PFIA 4TOZA 1SESA 3IX1A 2F66C 3JD4A 3H6WA 3T9XB 3QXMA 3E13X 4TQUQ 5IZZA 1B7HA 2HHMA 2QVRA 5AA1A 4K3AA 3MDSA 3MVWA 1VF7A 1MXVA 3PD8A 4P1LA 4OANA 3A3CA 4YKIA 4NF4A 2PYJA 1XS5A 5JJJB 3I56V 3SJQC 4E0XA 4JZGA 3K6VA 5KCJB 4H8IA 4FFBB 5CMMA 3KBRA 4QF9A 2HCAA 3MZBA 3KZGA 3ICXA 3HKEA 4DR2O 3E22A 4U3JB 1TT1A 4WBNA 1DOTA 4MSWC 1UIVA 1R3KC 1ANFA 4X1KB 2F8DA 3FKSG 2Q2AA 2ZNUA 4R9FA 1FTMA 3V83A 2EINC 3J81N 4DUYO 4X9TA 3OEKA 4ZHQB 3QMFA 3OMIB 4YJ3B 1GAXA 2L35A 1LB8A 3K6UA 3OD7A 4OFOA 2K1EA 2IJIA 3IL1B 4LCUC 2Q9TA 3UM7A 2FL4A 4Q20A 5JJNB 2YS8A 3IK6B 3BBRA 1NH2D 3CRRA 4DXCA 1R6ZA 1K4DC 3OUFA 2CH7B 5B1AC 1NV5A 2JEXA 2X0LA 4W4KA 2A5TA 4AB5A 4UUJC 4LR3A 2MK3A 4JI8O 4YIOA 3CRBA 5KHHA 3FXUA 3M7MX 2D2CB 1V54C 1Y6XA 2CTRA 1M57C 4F18A 4N6DA 1FJGO 5H8SA 5LHGA 3H1HH 1SD3A 3K1PA 5AA2B 3ZX6A 3F11A 1NS1A 1US6A 2Z5UA 3ML0A 4PHZA 1H2MA 3T1BA 4B3MO 3ECRA 3TXSA 1URSA 2XXPA 1J5EB 1KYOF 4JV5O 3CCUV 1AMFA 1OZ0A 1P99A 1KECA 3OE7G 3BVOA 1AH5A 3VFJA 1RPRA 3HFUA 1A55A 3E8GA 2P7TC 5A5XA 2Z22A 3ABMB 1J95A 1HNXB 2PCRA 4DW1A 1CXZB 3VE1B 2JK5C 5IZ3A 4P9OA 1D9QA 2NWJA 3ZMZA 1A40A 1JW1A 4AHCA 2WPDG 5HM4B 1EZ9A 4MW3A 4CC5A 1N0TA 3K06A 3GWOA 1ZLZA 4MVRA 2LGWA 1B4ZA 5J1DA 2XWVA 4X1YA 1UTHB 4E0WA 4NWCA 3L73H 1YTFB 3AG7A 2RNBA 3QG5A 1OLCA 2JJKA 2F43G 2XXYA 2Y5LA 5CMKA 4DV2O 4RWUA 3FJGA 2ZYMA 4YIPA 4NF6B 3OTOO 4X65B 5IGAA 4NAPA 4ZKIA 3C31A 5TU0A 2QSAA 2FNCA 1RP3B 3BFRA 5IYDO 2B4MA 5C8YB 4N13A 5KA6A 1O9GA 4QFLA 4JAVA 1Z5VA 2ITDC 2WAMA 2Z8EA 3CFXA 4FE8A 3FB6C 4JYCA 5BR8B 1SQQH 2OZZA 1FQBA 4LA9A 2DQ0A 2VQEB 3TDJA 2EULA 3BPZA 1IBLO 1FSAA 1B3GA 1LAHE 1XI6A 1AL3A 2KSDA 4E2LA 2XA5A 5LL6Y 3TTRA 1WA8A 4XBFA 4PCDA 3OSQA 2RN9A 1THZA 3KJ7A 5LA6B 1MXUA 3G3IA 4ZOLB 4CH6A 2H99A 2V93A 1BQ0A 3O29A 4GX4A 1Z7NE 4EEQA 3ODBA 3X2QB 4P0GA 2Y69B 4KD5A 2WX9A 3T9UA 1IX9A 1FPFA 1AJNA 4QIWF 3FVNA 1B32A 4ISUA 4EQBA 1M5FA 4KYEA 2AGAA 1LBWA 5B70A 4F6RA 2HAVA 1E1RG 2GBOA 5H8QA 1ZAUA 4DR2B 3A09A 4QRZA 1AVMA 2ANJA 4B3TO 1FPKA 4JI7O 4GWWA 3KCXA 4F3BA 3AG1B 5I56B 3TKDA 2Y0IA 4FEDA 4KR5A 2X26A 5AA4A 3ASNB 2ITCC 1LCFA 3C33A 3KBZA 4PFYA 4GX5A 4DUYB 1GH6A 2EJ7A 2RMKB 3H1KH 1BP5A 4G8HA 1SDXA 4ZECA 1LBYA 4RAIA 4PGPA 4PI2A 3HSTA 4DV0O 1DBZA 4TLMB 1Y3NA 2HEUA 1MM7A 4GXAA 1IMDA 1YYZA 5IAIA 4EDPA 4J9YB 5L3CA 1VQNV 5FHMA 4HE1A 4H0WA 3OD4A 3RQTA 1YCJA 4PAIA 5EC2C 4WFFA 3VQYA 3G3GA 1JFFB 1B0HA 4PETA 5K2YA 5CBSA 1KZ8A 2VPNA 5EZYB 3ZKKA 4JPRA 3AEIA 3JAKA 2NR5A 4OETA 4JI8B 3IGAC 2UXBO 3RYHB 4L87A 3JAMN 1SW5A 5B5EZ 1R6KA 2ZZWA 3SYCA 2XXVA 2XHDA 3S4UA 1FJGB 3W9VA 5EIBC 1F4MA 3VV5A 4OVSA 4P30A 3SPCA 3L9DA 2A3QA 1WLEA 1Q82W 5F2VO 3CC2V 3O6GA 1IXHA 1S9TA 2W0XA 4B3MB 2EIKB 2QDOA 1B3FA 3BKIB 3OOAA 3IOTA 5CB4A 2HVKC 4JV5B 3S9EA 1S5HC 1QLEB 4ECFA 5L8DA 3TUSA 1DGSA 3TODA 4X1IB 4R7CA 2NLJC 1HNWB 4POWA 4BAYA 4Z1MG 4TV9B 1KBHA 4JI6B 1RSOB 5EBMC 1I6AA 2YEVA 2PT2A 2QS2A 3SZPA 3H3GA 3TGUH 3JD1A 3HV1A 2GTSA 4I4TB 4A5UB 3LSLA 2X7QA 2DE2A 3IORA 5F7VA 4L17A 5M2VA 4HS7A 2I58A 2QWQB 4DV2B 5H8NA 2R6GE 1XBLA 2UVHA 3CSBA 3OTOB 3RLFE 3H1JH 2XD3A 1K8AW 3TXQA 4RNSA 2O84X 4N91A 3JV9A 1NNPA 5LOMA 2JGDA 5GONA 4WFAV 4AS4A 1DSNA 5KA5A 5E79Z 1VF6C 1MQHA 2I49A 2QJEA 3Q25A 1F23A 2KB1A 3QF7A 3E83A 3HKCB 2W6IG 5LGTA 2XD2A 1IBLB 2I3WA 4JF3A 4OXSA 2XAFA 2CZHA 4ELRA 4H33A 1LUVA 5TPAB 3K01A 4I55A 3DTUB 4NTLA 1EN5A 4IIJB 3OEHG 4NTYA 4JVCA 4XXUA 5EHMA 2EILB 3SDLA 1K97A 3Q28A 2IBZH 2LO1A 4NR1A 2QKAA 2B1GA 3ETGA 3GXAA 1XREA 1NQTA 1IXIA 1H2SB 1WP7A 3SJAC 2JS5A 4XKNA 2OWSA 4M4GA 2Q7HA 4O4LB 2WLJA 4PA6A 3DELB 3FGSA 4FAJA 5J2TA 4B3TB 5DECA 3CRMA 4JI7B 4PC9A 2ZM6O 4NF5B 4GWUA 1POTA 1TGOA 3J80N 3CG3A 4G68B 1K33A 3Q26A 1FD9A 1EU8A 3CHXA 5LP6A 4H6DA 4PA9A 2OCUA 2NXOA 1YJWV 3T66A 1Y4TA 1OCCB 4UVAA 4DV0B 1KKCA 2I0CA 2ALUA 1IDSA 5JH7B 5KAFZ 1S77D 1MDP1 3M8UA 3OMBA 4NX1A 4AB6A 2YI9A 4AQYO 3USDA 3GBAA 1ZL8B 3TCHA 4QSDA 4GXSB 1NZ6A 3FUZA 3KN8A 1MPBA 5EYPA 2Y7PA 5I59A 1B7ZA 2H4IA 1Q6HA 3DXRB 5I58A 2UXBB 4IY5A 2GUZB 3KOTA 4X1DA 4WKMA 3LDEA 2CZLA 2H25A 3O66A 1SW1A 3TCFA 2M8CA 3T96B 5BWJA 3CHGA 3WU2Z 5A2QN 2RC8A 3FD3A 3V5AA 2H3OA 3E35A 3JALA 3LSUA 2CEYA 1M4UA 2EJRA 3GZGA 3PMWA 4I9WA 4GD5A 3STZC 3IJ4A 1AILA 5C93A 1A8EA 2AHYA 4JXIA 1NV3A 2YIBA 1H45A 5A5LA 2WYPA 3CEIA 3JZJA 4EB6B 2PGGA 3P3NA 1DF4A 2OTLV 2QRYA 1E79G 2BCCH 2XXXA 2DDKA 2DN9A 5EK0A 1LGBC 1GTKA 2R9JA 2ONKE 3LSSA 2RC9A 3I5DA 2Y7IA 1KUQA 3SR2C 4I3EA 1OCCC 1CE2A 2FBPA 2R71A 4F2OA 4YJ2A 2A0LA 1KQSU 1MA1A 1WN7A 3N2KB 4LFBO 2G38A 3UN6A 3S9LC 1ZIUA 3CRAA 5L9SA 2P2AA 1IURA 1P4RA 4TSFG 2YICA 2XXQA 2CZKA 4MJOA 2LFRA 1B7UA 3PN1A 4N23A 4R6YA 4HZ3A 2Y4TA 4MEVA 1WDNA 1RDXA 1N76A 2REGA 1FQDA 1HSEA 4LVQA 1QCEA 4F1UA 2Y84A 3B6WA 2X6AA 3BEHA 1B52A 4MIJA 5KCJA 2CEXA 4ZE8A 4FFBA 1SBPA 2JDIG 1SETA 3T2MA 4F22A 1NUYA 2HLDG 4I50B 4U3JA 1HNZO 3QO7A 4KFQA 4MFIA 4M1VA 1Q8IA 3BHPA 3LV0A 2ZNSA 3HKBB 1N7XA 4JB7A 4FLTA 1ZMGA 3TQWA 3JYRA 1S72V 4IGRA 1XHZA 4MTXA 4GWYA 3APOA 4LONB 4DK1A 5K2XA 4ZHQA 4YJ3A 2C2AA 1NV7A 2ZNTA 1AIVA 3T0JA 2Q7GA 3PUZE 1LB9A 4KXPA 1OCOB 3ZEDA 3CSGA 3P7IA 1N84A 5KHGA 4JI4O 2YUAA 2P1SA 2F36A 1EN4A 2AZ2A 1AI6A 1VQLV 1NUZA 1PBQA 3TCUA 4LH6A 1V55C 2G29A 2BE3A 1P1OA 5D5QA 3PPQA 2YDEA 4ZEIA 1GN2A 3HO7A 2RF1A 2HG5C 2Q67A 3FXQA 2VD3A 3RYIB 1SVXB 1A54A 2HVJC 1VQ4V 3QIMA 4FJCC 1MDQA 4KHPO 1K3EA 4MF3A 1QUKA 2ZE5A 3OM3B 2ZE7A 5EQ9A 4JI1B 3DP8A 5AA2A 4UCSA 1VQ7V 1KWHA 4AQYB 4R6KA 4TUYA 2UUCO 3O6IA 3A3UA 1NH2B 1I7FA 1MXWA 1FXHA 1N04A 4X66O 5DW8A 1ENVA 5B3SB 4QSCA 3ZSFA 1UPGA 3OELA 1VQ8V 3VLWA 1YF2A 3ZMSA 1EH3A 2E74B 5H8HA 3FV2A 3RWRD 5EYHA 2X6BA 2CMOA 1VDWA 3OO9A 3UGWA 5EQ7A 5B1OA 3C34A 1XHXA 3ETQA 3F5WC 1W0KG 4O4JB 5KUMA 4D6TH 1AR1B 1IUDA 1JVXA 4LC1A 1VFDA 1TAEA 5T3JA 3U65A 3MPLA 2FYIA 2XXRA 1MZEA 2QS4A 3JD2A 3U94A 4XF5A 1TUEB 3VOUA 2QFLA 5I2NB 5IY5B 2W7YA 5I57B 3CX5F 4YB5A 2F7CA 3RVYA 1D5AA 3CC4V 1V9PA 3OR7C 3LSFB 4BR6A 4LATA 3VLUA 3ZS6A 1JR9A 1M90W 3UO2A 1UTHA 1U97A 5GW7A 2NNUA 2LW1A 2RQ6A 1I5XA 1BSMA 1SQVH 1XI1A 2YIDA 1F4NA 3T4ZA 2UXNA 3C9HA 3P32A 4OFJA 1K34A 4HE0A 5KHJA 4ZEDA 1YZBA 1MPCA 4X89A 4LNUB 1LLSA 4PF6A 3BRCA 3UP9A 1XUQA 2V1DA 2ZR3A 4C0RA 5H2FZ 5JJEB 1L8DA 3CCLV 4H5FA 4DV1O 3UQ8A 2EIJB 3ZMUA 4KXRA 2WLLB 4UFZA 4LFBB 4DR1O 1TFAA 1I6BA 4PP0A 5FLXN 1IMFA 4Q8RA 1I0HA 2D5WA 1SRYA 1N7WA 2DP8A 4DI3D 2F34A 4DE8A 4ZOLA 1H2GA 1Q5OA 1XOUA 1OLAA 4FLYA 5EHSA 2BTOA 4GUNA 5CA1A 4B08A 4GBVA 1Q90D 4LP8A 1B6QA 3FAVB 3FXBA 3T1CA 4J7ZA 2AL5A 3AG2B 3ETDA 2WLNA 5L9OA 4MHFA 3FJ7A 1YITV 3QK6A 4U4XA 4UVBA 2DYRB 4I40A 3ZN0A 1DTZA 3OTFA 1FPLA 4NWDA 4DXUA 1CNQA 4GKJO 1HNZB 2OLBA 3RYFA 1FBHA 5I56A 3T93B 1B05A 1U96A 1B58A 3AXFA 3O2AA 4NEDA 1M56C 1MS7A 3OGCC 1RKMA 1N3WA 1IBMO 1MY3A 4FLUA 4HW8A 4BIOA 3IOUA 2KQZA 5CC2A 5K1PA 4GFRA 3OFNG 3ZN1A 3DLNA 2R8TA 3IB0A 4JI4B 3A29A 3MWBA 4G77A 4FM1A 3K79A 5JTYB 1FPBA 3C32A 3THOA 4NF0A 5L3BA 2GV9A 1EM1A 4IO5A 3SJBC 3MD0A 1JFFA 4DV6O 2E3CA 2HZLA 3MHSC 3G71V 3FYEB 3RYHA 3IB1A 1FBDA 1Q9DA 1EZPA 3U11A 4UCUA 4KHPB 1NV4A 4OYVA 3QTCA 3B8NA 1Y66A 1H44A 1VF6A 3MJNA 4H8JA 3BCCH 5IT9N 5EQAA 2BJJX 1ZSPA 3B6QA 3JCZA 3OO8A 3TZAA 2ARHA 5KMGB 1MQIA 2F97A 2JEUA 2QM7A 3C3SA 3L74H 4JTCB 4CC6A 2UUCB 1D9VA 1N34O 4GX2A 4X66B 3RYDA 4G2KA 2JS3A 4PDDA 4ABMA 2H9BA 4QFPA 1SPIA 4OTEA 2DYRC 3SKPA 4DV7O 4X1IA 3E2EA 2PYYA 2ONSA 2ZXWB 1URFA 4XTCQ 3K08A 2QL3A 3ZRXA 2YC0A 5JK4A 2CTQA 3AG3B 2XT9A 4BIUA 3G6EV 4EXLA 3ZRWB 1R6NA 1FFXB 1POY1 3NXSA 1RSOA 1VQ6V 3SPGA 1IXCA 5TP9B 1GM8A 5GTHZ 4GKKO 1FXKB 4FZ0A 4OPAA 2BSKB 3OGIB 4YHHB 2GTAA 3RW0A 4JVIA 4F31B 4FM0A 4R74A 1QR8A 4PBQA 1KP2A 3JARB 5DVIA 5J2UB 5KHIA 4ZI7B 1QNMA 3ABLB 2QPQA 2WA3A 4HCWA 2ZKOA 3U92A 3L72H 2WBDA 2R70A 2DS9A 4RQFA 2P3VA 2Q6AA 4ZEBA 2Q68A 4P2ZA 4PFRA 3HHFA 4O2AB 1MXYA 1INPA 1IMBA 4WCEV 4O8MA 4DK0A 2JRIA 3TK1A 5KLVH 3CE2A 3MBPA 1P1NA 1WAZA 5CMUA 4JWOA 3RGYA 1BGYH 2XTAA 4DV1B 1RM1B 3U8QA 3N27A 5CN0A 3HKCA 4MS2A 5I2KB 1FXVA 3SPHA 2OWTA 3DM0A 4X04A 4GZRB 5B1NA 3WAFA 4DR1B 3JD0A 2O57A 4B3SO 4X9QA 5TPAA 3OO6A 4IB2A 3ZRVA 4I7ZB 4N8GA 1UJWB 4LFAO 4DR7O 2XX8A 4KCDA 1XL6A 1KA0A 2OTJV 4GWOA 1ORQC 1A8FA 3M3FA 3QVNA 1WJZA 1NNFA 2AZ0A 2ZXWC 3CRQA 5FBPA 3K0DA 4UABA 2JJ2G 4C7UA 2F6PA 3EVKA 4BDRA 4RO2A 3N2GB 4N6KA 1LNQA 2KG7A 3F7VC 4O4LA 5DN6G 2NOOA 4ELQA 4PDVA 4DXWA 5IE9A 4WFBV 1S50A 1VE4A 2HXRA 2W6JG 3U10A 4NF5A 3IJXB 2ADQB 3RN8A 2HKOA 5DEXB 3H9VA 1FBPA 4F3GA 5TISZ 4G68A 3IO4A 2CE4A 1B4HA 1J1NA 3LUYA 1LAXA 1IBMB 4FJPA 4PFWA 3WFVA 3BA8A 1FPOA 4MNPA 3ASOB 4X48A 2HAUA 4PDRA 1AP5A 2N74A 2UXXA 1H76A 1B1HA 1NTZH 4U4SA 3ZS8C 4THIA 1H2NA 1ZL8A 1LAGE 4I3YA 1NV0A 4JSOA 5IJ9A 2ILMA 3U0ZA 4R72A 2WYKA 2P5OA 4DV6B 5IDJA 1VP7A 3E8HA 4PBHA 5LTCA 3VBBA 5L3DA 1NNTA 3VXCA 1TVKB 2UVGA 2RINA 4ESWA 1MQGA 2GUZA 3R66A 1HR0O 3D4GA 4XEQA 4OEVA 1A7LA 1SQGA 2DSFA 3VQVA 5FNVA 2WLMA 3M99B 4PAFA 4PF8A 5AG2A 2I4BA 3HR0A 2GQ1A 1D2DA 3CJHA 4O4IB 4PFTA 3SERA 3ZIAG 5DEDA 4GX1A 3OXNA 1K9YA 4NYKA 1XEQA 2IJHA 3FD9A 2QR4A 3KG2A 1DPPA 2F78A 1N34B 3PV0E 3G3HA 3ABMC 5H8FB 2Q74A 4GL0A 1EZJA 1XNQO 4EF2A 4DV7B 5LOVB 2N04A 4DR5O 3OR6C 3EKIA 4IL6Z 2THIA 4FIMA 1JJOA 3PUVE 3QYTA 1H2LA 2BOCC 2M7WA 3OEMA 4JWXA 4FVMA 2OJTA 1WODA 3VVFA 1ZTEA 4RY1A 3Q27A 5DVFA 1N0JA 5ESYA 4ICGA 5DM6V 1JW4A 1A99A 5LYJB 1VQMV 3WAEA 4X64O 4GKKB 2DW4A 2BTQB 4QFOA 2ZMBA 4LFCO 2QKSA 5LDZA 4D7TA 3G67A 1FPIA 2OWZA 4PA3A 4LF8O 1Y4CA 4I62A 1BIYA 4GX3A 4UB6Z 4LUBA 2XASA 4RJZA 4FBPA 3N2KA 4IR8A 3BABA 4YY3O 1YI2V 5JQGB 3TETA 1GV8A 1ZLQA 4JI3O 3CFLA 4CZZA 4QPKA 1Z7ME 1UTBA 3J7AU 5IWAO 1XMOO 1AI4A 5FHNA 3OEEG 2H98A 4BDMA 4EUOA 4RK2A 3ISPA 2QM8A 3K57A 4MT8A 2VD2A 4FM2A 2VHAA 4K3FA 5CI5A 1QVFU 2PF4E 2REJA 1WP8A 1PNLA 4NF8A 1Z5WA 4P0IA 3RPLB 3MW0A 5JVDB 1XOCA 4OX9O 4UA8A 1TXFA 3K9AA 1BHAA 4O2BA 3QAXA 4R2BA 4B3SB 4I9DA 3N26A 3X2QC 3ABTA 3H6UA 2Y69C 2DYXA 3K5OA 3HKBA 2QVVA 1BQZA 4DR7B 4LFAB 4NXMO 1EYIA 1FTOA 3ZHSA 2DOJA 2HFBA 3AK3A 3KSJA 1G6UA 1MH3A 2GRVA 5FTIA 1WB7A 4H13B 2B5UA 1NUXA 3E4RA 2DVZA 2DQVA 3DP6A 1KMIZ 1GTOA 2WLKA 1DMBA 4Q5TA 1B3HA 1SI0A 3AG1C 4F6EA 2PUSA 2PI5A 2WLIA 3K1MA 3O97A 3ASNC 1VFEA 4U7NA 1IVSA 4XDJA 4WF9V 3TPAA 4F29A 5I5PA 1DK4A 4I0XB 1QUIA 3U93A 4KYSA 1BMFG 4NF4B 4NHBA 2QGNA 2NUVA 3E3KA 3RYIA 3F7YC 4DR3O 1FQFA 1PDAA 4J10A 5HBCA 3S3XA 1M5CA 3U72A 1RYOA 2I0BA 2V25A 4NG7A 3K0GA 3E22B 3I55V 4BDLA 4WBNB 5FTHA 3K1NA 4I9QA 4OVJA 4YU0A 1BL8A 3CMAV 4FECA 2R9IA 3ZHQA 1KC8W 4F19A 4DR4O 1B6HA 4DCYA 1EBOA 3HPIA 3ILUB 3KJTA 1OMPA 1R1BA 1DTGA 4JWYA 1XMQO 2EZPA 3E8BA 1HR0B 4RXLA 1ZUQA 4OVTA 1B04A 3S9MC 4JDFA 3K03A 4N6PA 4ZEFA 1PP9H 2EIKC 4FZ1A 1NVPD 3OO7A 5KZTA 2KR0A 4QSEA 4MLVA 3GVMA 1QLEC 2JGUA 1Y76B 3CXHF 3CVGA 1Y4MA 2HZKA 5CA0B 4YB6A 4JYBA 1USYE 4EF1A 1PB8A 4JTDB 1JEVA 5CMBA 1W59A 2P3NA 1XNQB 1SA0B 4DR5B 2EX3A 1SQFA 1BHBA 2VS0A 2O1LA 3LNMB 1HP8A 1NR7A 1OCRB 4HBNA 4K8XA 3MZ9A 4NE4A 1BTJA 1FBFA 4QBAA 1KB9F 4FATA 1CP9A 3PPRA 4LNUA 1US4A 1NV6A 2PI4A 4X64B 1VQOV 5BUUA 3Q4HB 3D4CA 4LFCB 3LSXA 4KI0E 2OX3A 1LR1A 1TA8A 5FL7G 2O1MA 2QE7G 3CCRV 4J41A 3PTYA 4MTOA 4LF8B 1VMGA 4K0KO 5A5XB 1LBZA 4U7OA 2XXTA 3MVZA 2WLLA 2OT5A 4U23A 1UFIA 2FTKA 3PJSK 4YY3B 1G1XB 2FIXA 1JQ0A 1LEVA 3MP1A 1K9ZA 5IYBO 1N33O 4GX6A 4JI3B 3STLC 3CYOA 1XVXA 4MNIA 4PJ0Z 5IWAB 3Q29A 1XMOB 1G8MA 1Y67A 1VQ5V 1B3LA 1FTJA 2YXHA 1XNRO 4P11A 4YB7A 3TTLA 4OVRA 1NU1H 1FBEA 5ITZB 5B7DA 1YAEA 1K4CC 5A9GA 3CC7V 5CBRA 3FAVA 1XC1A 4UXNA 1Q43A 5AE4A 1GN6A 5BMVB 1B5IA 1URDA 2R9RB 1VEWA 3FVKA 4CS3A 2B1IA 1WNSA 3SYPA 2WBBA 1BKAA 2ZXTA 3BA9A 4OX9B 2Q5ZA 2B65A 1FJ6A 5ITOA 3JCUZ 2PMSA 2QS3A 2EILC 4R50A 3ILTB 3H4ZA 2IM9A 2Q89A 4OERA 4PTKA 3CCVV 3SGIA 1SQPH 4WEPA 3RGBA 4NXMB 4LF6O 3IJOB 2O7UA 4DXBA 4ESXA 4NKGB 3BAAA 3GWKC 3W7XA 4K35A 4EFBA 2ZZXA 1Y20A 4DRXB 1NR1A 1ZX3A 4YICA 4KL1A 1MQJA 1I94O 2O6AA 2I4CA 4O94A 3SJCC 1M5EA 4C1TA 4G68C 5JTYA 1PEBA 1R9LA 2I6EA 1R6TA 3D1RA 4LF7O 5IYCO 2GHYA 1NH7A 2QS1A 2DWEC 1XL4A 3P30A 2LQTA 3FJMA 2QM4A 3KEIA 3KOSA 1LCTA 1L1FA 3C3TA 4DR3B 2PVUA 2IJJA 4F6RB 3VVDA 2IU0A 4X62O 3HKDA 3A2FA 2R9AA 4UCRA 1MY1A 1MXXA 5DVJA 4W4LA 4O7IA 2F7BA 3G3JA 1B3QA 3KFMA 4LP2B 2CUGA 2P22C 5KMGA 1ROPA 3BFUA 3ZBHA 4U21A 3UORA 2XWOA 5AA4B 1WVJA 4OWDA 4DV4O 2ZIOA 4IO3A 2HHHO 2UYEA 2Q2CA 4GWSA 4OENA 3ONMA 1BLFA 4UCTA 4DR4B 3QUFA 1GVCA 4MCOA 3IAZA 3GB7C 1XMQB 4UCVA 2QWOB 4NMYA 3TCGA 3K4UA 2O7IA 4MX6A 4CBCA 4GWXA 4OGQB 2PTMA 4JTAB 1HSJA 3KC1A 4KPTA 2V4DA 4GWZA 4F1VA 2F1MA 5LMNO 1OVBA 5TP9A 2OCCB 4X1KA 2YJPA 3E8FA 2UU9O 1MSWD 4HNAB 1RPOA 2BSKA 2IA4A 5CA3A 4DW0A 1GO3F 5B66Z 2ABHA 1B5JA 3TTNA 3VQWA 4X20B 4ZZAA 3JARA 2LP7A 2X6CA 1DF5A 1FW0A 4MAGA 1BT8A 1S5LZ 5KUKA 2B3BA 3TTMA 1GM7A 5EYGA 1ZU0A 2CH7A 4G8NA 4EQ9A 3E9XA 2ZM6B 4FLWA 1LBXA 4RPOA 4O2AA 2B4LA 3K5MA 3UT5B 3FBPA 2HQ0A 2FKXA 2XX9A 3MZ1A 3K58A 4UVCA 4OVPA 3AK1A 5DT6A 3SYAA 3PUYE 4PE3A 4H46A 5I2KA 3CMEV 3JSLA 4JAAA 4K0KB 2AXTZ 3KC0A 3B8BA 2PT1A 4P9PA 1YSCA 1Y1MA 3K6WA 3R6UA 3R7XA 1HDJA 1PM9A 1JVYA 1OV9A 3IO6A 3C4MA 1KD1W 3CIJA 4MTFA 4UACA 2EIMB 1N33B 1FPJA 3H6VA 1LBVA 4CH3A 1K9MW 2E5LO 1GMGA 4AI8A 4DIGA 4MW8A 1XNRB 4EKWA 2ZD9A 4DCXA 3RT3C 2CDYA 4J42A 5J9PC 4ZZEA 3R26A 4UV8A 4MVZA 3B4SA 3H03A 1X59A 1MY2A 4DUZO 2F6GA 4B7EA 3MQ9A 2PX1A 1N0NA 4PAKA 1QQCA 3EFFK 2LFSA 3E89A 4IHJB 3DSQA 1SQXH 3L6GA 3SEXA 1L0NH 5L3EA 3TYHA 4ZEKA 1XILA 4B7KA 4LF6B 5DEXA 1AB3A 3LDCA 1OCOC 4MVQA 1N3XA 4GF8A 4LQ2A 2XOKG 3FB5C 3O9PA 4G28B 1MABG 1K92A 5GTIZ 3ZMTA 3AG4B 3D36A 2OYQA 1LSTA 2VGQA 1MZFA 2D3IA 3CCJV 4NF6A 3DP4A 1I94B 5BZBA 1H8EG 4I55B 3B6TA 1HW7A 3JYCA 5C8YA 1JX9A 5DTBA 4OFLA 3CS5A 4N8YA 1FRPA 2PYLA 1HWYA 2HEPA 1DTOA 1KU9A 4OHNA 4GYCB 3SEWA 2OK2A 1NJIW 4J11A 1TVKA 4RA1A 2F23A 2XXHA 2ETNA 4UV9A 1GR2A 1PBPA 2Y0PA 3E86A 1SQBH 2AW9A 4X62B 1YDXA 4KYDA 2IJKA 2H5YA 3UK4A 3CCMV 5J2TB 2RKMA 1IXGA 3MP8A 5B3SC 4K8ZA 2F4VO 2HPGA 5LA6A 4O4IA 1VIBA 4LWSB 3O65A 4JI0O 1N36O 4G2ZA 2DXRA 1JPXA 4ASUG 2X7RB 3KN7A 1N4CA 1OJHA 1SKVA 5L3FA 5IZ1A 4DV4B 5H8FA 4DLDA 2HHHB 2ZZVA 2PBWA 5B1BB 3TJTA 1M5BA 3T9HB 4CS4A 4BIZA 5LP6B 2K9PA 3LUTB 4FPPA 4NB5A 2QTSA 4O3BA 1YTVA 2DMXA 2UXAA 1YPNA 1RYXA 1Y74B 2ADPA 1PL0A 1FBCA 5IY5C 1GM9A 2JJ1G 2A06H 2QJ1A 1ZBMA 2YXLA 3A0HZ 5IJ0B 1M9NA 5D5PA 2V3TA 4GX0A 3GBBA 2YSUB 4RPNA 2DYSB 3JD3A 1S3JA 5LMNB 1FQCA 4PE5B 2P6JA 5LYJA 2UU9B 2BTQA 2PZSA 1M1KW 1IZ3A 3JATB 5AA3A 5IKBA 4WXJA 3ABKB 1SQYA 1COWG 2Q8MA 2Q0AA 2V7QG 3PUXE 1HNXO 1RDYA 4MTGA 3FZVA 1NNKA 2GHBA 4U22A 5JQGA 5IYZB 1OQHA 3KKYA 1XDCA 1ZWIC 3ZMVA 3OT7A 5ITPA 1MNGA 3ABUA 4LQ5A 4ZS9A 1Q81W 4E4EA 4DO2A 1FYJA 3JALB 1YXIA 2EIJC 2LGQA 4OMBA 5KX5B 4QJFB 1MXZA 5FPOA 5EZYA 3ZJZA 3VVEA 1VSOA 1NFTA 2EINB 3SEYA 3RPLA 2MKZA 2ZE6A 2GSMB 5JVDA 1IBKO 4D7SA 5BXZA 4JYYA 1M5DA 3D8CA 2HXWA 4P9KA 4MVOA 4FMTA 1FFTB 1US5A 1JCHA 2R72A 1PC3A 1AR4A 4WEDA 1MQDA 1X4TA 2Z23A 4HE2A 2QWNB 3IC9A 4IT5A 2VT5A 3AG2C 3MP6A 3FXRA 2E5LB 4Z2WA 1T5EA 3K5LA 2Y7RA 3SYOA 3TAJA 3S9NC 4YXWG 2VQEO 1QKAA 4U3FH 1W2BU 4NN3A 1LAFE 2E76B 2M6YA 1SZTA 3U1OA 1I5YA 4IYIA 2HJFC 1YIJV 3LNNA 1YEWA 1FBGA 2N05A 3H06B 4DUZB 3MUQA 1GK9A 4TV9A 3L75H 2Z0AA 1Y3QA 4DI4B 2CZIA 4QHQA 1M57B 3FYIB 2EBOA 2Q69A 3LUZA 1PKXA 4QNHB 3LSWA 4XDKA 1YHQV 2F93B 5K1XA 2HP8A 3ABKC 2ZDIA 1R3LC 4I0XA 1LFIA 4I4TA 3MC2A 3RY3A 4J7KA 4ZE9A 3QSLA 2ZYKA 3FX7A 3HCQA 3EN3A 3ZHUA 1FPEA 3CCEV 4QFNA 1URGA 4H65A 2HR3A 4O3CA 3OMNB 2F95B 2FMLA 2V4CA 5HFMA 1G0HA 3RTFB 2F7AA 3N6TA 4U2RA 4FORA 1IXBA 3MVXA 4TLLB 4J80A 4YKKA 5LHHA 4FLVA 1M5IA 2O51A 2WLHA 2UVIA 4HTGA 4I8CA 4F1YA 1Y1ZA 2O68A 2Y5KA 3OAAG 2UXDO 1B51A 4ZBMA 1JQFA 4GVOA 2UVJA 3K6XA 4H45A 3TFLA 5CM6A 1IXMA 1IITA 2F4VB 4IIJA 1F9BA 3O28A 4BDNA 3RN4A 1Y76A 4OVQA 1N36B 4JI0B 3IR1A 1YJ9V 1B40A 2KKWA 1ZTYA 4QE9A 5CA0A 3SPIA 3TELA 3S3WA 2AYSA 3GYYA 4C1UA 4HAMA 1FQAA 1SERA 3GLBA 5CRYA 5LMUO 5L9MA 2BOBC 3AG3C 3VQXA 4G61A 3N6UA 1JA8A 2A79B 1SA0A 4R6HA 3NOHA 5JWPA 1Q35A 3H7MA 1L0LH 1FXKC 4GKJB 4G4PA 1FQEA 2Y48A 1NI8A 1NL5A 2DWHA 2DWJA 3A0RA 4TUYB 4MNCA 1CEZA 3JASB 4QE7A 1R3IC 4EFEA 1NVPB 3K2DA 1TUBB 2UUAO 2FIEA 5H8HB 3Q4HA 4NXNO 1QUJA 4GCZA 2XWIA 3TTKA 2WSSG 2Y4UA 3ABLC 5ELVA 1K7DA 1HNWO 5KAIZ 1N32O 1USYH 4X1BA 2ZINA 4KCCA 5CBHA 1EYKA 4JI6O 4P1EA 3BIHA 5JH7A 4RUFA 1LBBA 4IO4A 1QU7A 1S7YA 1Q86W 1FTLA 2VPOA 4F39A 1RM1C 3M8AA 1R3JC 2F3DA 2UYFA 2QEXV 3CWBH 4HXVA 5ITZA 4L8JA 2E1SA 3G3KA 3DXRA 3IFXA 2Q8VA 3M3LA 3FFQA 3FB8C 5BMVA 1UIUA 2DWIA 2DXYA 3A8TA 2CTPA 4TQFA 2ONRA 4H67A 3UCSC 3G7WA 1IBKB 2Z8FA 5EYFA 5I7IA 4NVPA 4GBWA 1AJPA 2ATKC
chains in the Genus database with same CATH topology
4J9ZB 3FVGA 3KSXA 3W15C 3OMAB 4FIPC 3PPPA 1B3EA 4GT1A 4YAHX 3I5OA 1NBMG 1XVYA 2V3QA 1S76D 3PPOA 5LBQA 2GH9A 3PU5A 1ELJA 2RC7A 4OZ9A 4FEBA 4LZ8A 3LR1A 3CI8A 3QO5A 4IO2A 3V8XB 1NH8A 3ZCCA 2ZYOA 3ASOC 3MHHC 4JGSA 3D3IA 4RUEA 1AJQA 4KUMA 2WKYA 4JASA 2VOZA 3IOVA 1H8HG 4X8AA 1B46A 5CMCA 4QFKA 1UQWA 3DGEA 4IY6A 4LZ5A 4U1ZA 5KDTB 3K00A 1AI7A 2D21A 2XNDG 3EHUA 1JETA 2Q8JA 2H8PC 3OENA 4N21A 3PD9A 3SEUA 1KP3A 1H38A 1MOFA 2XX7A 3WG7B 2G93A 2GHAA 3VXBA 3I6VA 3IOWA 3LC8A 2GFEA 1MPDA 3EPEA 3QO8A 2VP1A 1QBZA 4XIGQ 1IZ1A 2A5SA 2Y7WA 1AOVA 3SYQA 2XXUA 2IH3C 2ZYNA 3EHSA 2RCBA 5ISUA 2QMXA 4LZ7A 4EXKA 3RVZA 1IEJA 3CXCU 4PDLA 4POXA 3RT6B 3LSQA 3W7SA 3CCSV 3CD6V 1MH4A 4I5SA 4XDLA 2V84A 3C36A 3K3WA 5H9CA 1JVMA 5H6QA 5AA2D 2O69A 1JJ2U 1O64A 1KKDA 3WG7C 5I2NA 3QNEA 4MBPA 3W7TA 2E0SA 5I57A 4HYOA 2A5TB 4AQ4A 3BY6A 3QUJA 1R9QA 3EHTA 4ELPA 1VQPV 4XKPA 3O6HA 4MH5A 4G27B 3RT8A 1H3DA 1PNMA 1O63A 4R9GA 2ZDIC 3OW2U 4YKPA 4F3PA 3K0VA 1I6QA 1YTFD 2YLNA 3UKMA 2Q88A 1FCKA 3C35A 4FK5C 3H01A 5HFLA 4F4LA 1B1XA 1OCZB 1OHHG 2XAQA 3R65A 3HHGA 2LAOA 3UIFA 4DDDA 4YMBA 2QTOA 1Y3PA 3SETA 3HN0A 4RQEA 2HFEC 3LDDA 1QULA 3KGCA 2IEEA 2Y7KA 4OEUA 1XT8A 3L6HA 1AROP 2D3OW 4PFUA 2V3UA 1JNFA 3PPNA 1QLNA 3RBZA 1LBCA 2F5XA 3FATA 3FASA 3RNNA 3HPLC 4HCYA 3KN3A 1W0JG 4OQOA 3V89B 3M3KA 4LBEC 1Q7YW 3FB7C 3TEPA 2IH1C 1NKDA 4KQPA 4R6ZA 4ZDMA 1OCRC 3N94A 1QW0A 1DPEA 2CK3G 2IU3A 4Q0CA 5CBGA 2XAHA 3CP1A 3FIRA 1EZOA 1DLBA 1CPYA 3W7UA 1B9JA 4N07A 4WFEA 4F2QA 2DWDC 2DVCA 1PD3A 1OCZC 2XAJA 1QVGU 1IQ7A 2DWAA 4MVSA 5H8QB 3K02A 5LHIA 3SDFA 2XAGA 1IIWA 5LGNA 1P7BA 3ZKLA 2I3VA 3CPWU 1YJNV 4KP4A 1SI1A 1V55B 4TT3G 3VDFA 4U1OA 1QVSA 4IO7A 4G8MA 4KHZE 2EZOA 1MY4A 2Z8DA 3RTWB 4H1XA 4ELOA 3TQLA 5I84A 1Q1KA 1WPXA 5LGUA 1VQ9V 3ZRWA 1F51A 1UTBB 1O7TA 2P0SA 3K04A 3SEVA 2AIXA 1FXKA 1SW2A 4PA7A 5ICTA 1D4NA 1T0KA 3IB2A 3G3FA 1VR5A 4NF8B 2W0FC 1ATGA 3EQ1A 3BFTA 4OESA 2H94A 1P1QA 4ONYA 1L5TA 4BLAA 2XXIA 2YPNA 5EC1C 1D3KA 5E1AC 1QKBA 1R73A 4WFGA 1E1QG 3UA8A 4PDMA 3G4SV 4WFHA 3CG1A 4YMAA 2DQ3A 3I3VA 1P1WA 5HPQA 2AL4A 1EFRG 1Y9UA 4JAUA 1OIBA 1JEUA 2WLIB 4Z0IA 3PGFA 2YEVB 1LFHA 4RK9A 3B77A 3EF7A 2DE4A 3W9WA 1GKFA 2I48A 2ZQMA 4JSDA 5H8NB 3THIA 4O3AA 2OCCC 1FS0G 5CBFA 2WWWA 5ICQA 1B0LA 1G4YB 3W7WA 1MM6A 3LBSA 2DE3A 4BW5A 3N5LA 1D9YA 1JOYA 4JBZA 1ZJLA 2ZR2A 4YZZA 4GRKA 3SESA 3MVYA 1TFDA 4BDOA 3OUSA 3FVOA 4R75A 5FHOA 1QR9A 3CCQV 2JIZG 2X7PA 1MY0A 4OXVA 3PUWE 3MAMA 3OSRA 1S0VA 1FTKA 4GL8A 1M56B 1OQGA 3EHBB 3VLVA 2EIMC 4GOTA 2NVUB 4MVUA 4BDQA 1SYHA 1ZKBA 1H43A 1R1NA 4XKQA 3HB3B 4H5GA 3CFZA 3T22A 1NKXA 2XXWA 2F35A 4PELA 3T4DA 1MRPA 4EQ7A 1SW4A 2P67A 4ND9A 5F1QA 4I1DA 2QA4V 4H37A 3CR9A 1SYIA 1II5A 4QPJA 2IW5A 3RPWA 3PMVA 5H6RA 1XHYA 3S2VA 5I59B 1NMUA 3AG4C 3PMXA 4DZ1A 4IO6A 1B5HA 4X88A 1I69A 5I58B 3ETEA 4GIZA 1PNKA 4XKRA 2ESNA 4GQOA 4KFMA 3RUMA 3MPKA 1PB9A 4RYAA 4YKJA 2FA7A 1QJMA 3B7DA 2AHZA 5EBLC 1GGGA 1K73W 3T9VA 4PQJA 4Z7EA 4MVMA 5DYHA 2QSXA 1VQKV 2OBGA 5KDTA 4F3SA 3TMGA 2P90A 1CB6A 3ZRSA 1K5SA 1AI5A 3B8MA 3IC7A 2QMWA 1K5QA 4R73A 2KLFA 2Z3YA 3SPJA 1TWYA 1PB7A 2A9HA 3FV1A 4TWKA 1MG1A 5B1BC 4MLQA 4GLIA 5JEIA 1LFGA 2B3FA 4IGTA 5B1AB 1B2HA 1N8RW 3H6TA 4Q30B 4R8CA 4PA4A 5L3GA 2RCAA 4R2FA 1P1UA 5EBWC 1JW5A 1OVTA 1V54B 1HSLA 2DYSC 4TOZA 1SESA 3IX1A 3JD4A 3H6WA 3T9XB 3QXMA 3E13X 4TQUQ 1B7HA 5AA1A 3MVWA 3PD8A 1MXVA 3A3CA 4YKIA 4NF4A 1XS5A 3I56V 3SJQC 4E0XA 3K6VA 5KCJB 4H8IA 5CMMA 3KBRA 4QF9A 2HCAA 3MZBA 3KZGA 1TT1A 1DOTA 4MSWC 1UIVA 1R3KC 1ANFA 2F8DA 2Q2AA 3FKSG 2ZNUA 4R9FA 1FTMA 3V83A 2EINC 4X9TA 3OEKA 3OMIB 1LB8A 3K6UA 3OD7A 4OFOA 2K1EA 2IJIA 3IL1B 4LCUC 2Q9TA 3UM7A 4Q20A 3IK6B 3BBRA 1NH2D 4DXCA 1R6ZA 1K4DC 3OUFA 5B1AC 2JEXA 2X0LA 2A5TA 4AB5A 4UUJC 2MK3A 3CRBA 3FXUA 1V54C 1M57C 4F18A 5H8SA 5LHGA 1SD3A 3K1PA 5AA2B 3F11A 2Z5UA 3ML0A 3ECRA 1URSA 2XXPA 1AMFA 3CCUV 1OZ0A 1P99A 1KECA 3OE7G 1AH5A 3VFJA 1RPRA 1A55A 3E8GA 2P7TC 5A5XA 2Z22A 3ABMB 1J95A 3VE1B 2JK5C 4P9OA 2NWJA 3ZMZA 1A40A 1JW1A 2WPDG 5HM4B 1EZ9A 4MW3A 1N0TA 3K06A 3GWOA 4MVRA 1B4ZA 5J1DA 1UTHB 4E0WA 4NWCA 1YTFB 1OLCA 2F43G 2XXYA 5CMKA 3FJGA 2ZYMA 4NF6B 4ZKIA 3C31A 5TU0A 2FNCA 5IYDO 4N13A 5KA6A 4QFLA 4JAVA 2ITDC 2WAMA 2Z8EA 3CFXA 4FE8A 3FB6C 4JYCA 2OZZA 1FQBA 4LA9A 2DQ0A 3TDJA 1B3GA 1LAHE 1AL3A 4E2LA 3TTRA 4XBFA 3OSQA 1THZA 3KJ7A 3G3IA 1MXUA 2V93A 2H99A 3O29A 1Z7NE 3ODBA 3X2QB 4P0GA 2Y69B 4KD5A 3T9UA 1AJNA 4QIWF 3FVNA 1B32A 4ISUA 4EQBA 1M5FA 4KYEA 5B70A 2HAVA 1E1RG 5H8QA 3A09A 4QRZA 2ANJA 4F3BA 3AG1B 5I56B 3TKDA 4FEDA 4KR5A 2X26A 5AA4A 3ASNB 2ITCC 1LCFA 3C33A 4PFYA 4GX5A 1BP5A 4G8HA 1SDXA 4ZECA 4RAIA 4TLMB 3HSTA 1Y3NA 2HEUA 1MM7A 4GXAA 5IAIA 4EDPA 4J9YB 5L3CA 1VQNV 5FHMA 3RQTA 4H0WA 1YCJA 5EC2C 4WFFA 3G3GA 1B0HA 5CBSA 4PETA 5K2YA 3ZKKA 4JPRA 3AEIA 4OETA 3IGAC 4L87A 1SW5A 1R6KA 3SYCA 2XXVA 2XHDA 3S4UA 3W9VA 1F4MA 3VV5A 4P30A 3SPCA 1WLEA 1Q82W 3CC2V 3O6GA 1IXHA 1S9TA 3BKIB 2EIKB 1B3FA 3OOAA 3IOTA 2HVKC 3S9EA 1S5HC 1QLEB 4ECFA 5L8DA 3TUSA 3TODA 4POWA 4R7CA 2NLJC 4BAYA 4Z1MG 5EBMC 1I6AA 2YEVA 2PT2A 2QS2A 3H3GA 3JD1A 3HV1A 3LSLA 2X7QA 2DE2A 3IORA 5F7VA 4L17A 5M2VA 4HS7A 2I58A 5H8NA 2R6GE 2UVHA 3CSBA 3RLFE 2XD3A 1K8AW 4RNSA 2O84X 3JV9A 1NNPA 5LOMA 4WFAV 1DSNA 5KA5A 2I49A 2QJEA 1MQHA 3Q25A 1F23A 2KB1A 3E83A 2W6IG 5LGTA 2XD2A 2I3WA 4JF3A 4OXSA 2XAFA 4ELRA 4H33A 5TPAB 3K01A 4NTLA 3DTUB 3OEHG 5EHMA 4XXUA 2EILB 3Q28A 1K97A 2B1GA 3ETGA 3GXAA 1NQTA 1IXIA 4XKNA 2OWSA 4M4GA 3FGSA 2WLJA 4PA6A 3DELB 4FAJA 4NF5B 1POTA 3CG3A 4G68B 1K33A 3Q26A 1EU8A 4H6DA 4PA9A 2OCUA 2NXOA 1YJWV 3T66A 1Y4TA 1OCCB 4UVAA 2I0CA 2ALUA 1S77D 3OMBA 4AB6A 1MDP1 3M8UA 3USDA 3GBAA 3TCHA 4QSDA 4GXSB 3FUZA 3KN8A 1MPBA 2Y7PA 5I59A 1B7ZA 2H4IA 5I58A 4IY5A 3KOTA 4X1DA 4WKMA 3LDEA 2CZLA 2H25A 3O66A 1SW1A 3TCFA 2M8CA 3T96B 5BWJA 2RC8A 3FD3A 3V5AA 3E35A 2EJRA 3GZGA 3PMWA 4I9WA 4GD5A 3STZC 5C93A 1A8EA 2AHYA 4JXIA 1H45A 3JZJA 1DF4A 2QRYA 2OTLV 1E79G 2XXXA 2R9JA 5EK0A 1LGBC 1GTKA 2ONKE 3LSSA 2RC9A 2Y7IA 1OCCC 1CE2A 4F2OA 2R71A 2A0LA 1KQSU 3UN6A 3S9LC 1ZIUA 5L9SA 2P2AA 1P4RA 4TSFG 2XXQA 2LFRA 1B7UA 4N23A 4R6YA 4HZ3A 1WDNA 1N76A 2REGA 1FQDA 1HSEA 4LVQA 1QCEA 4F1UA 2Y84A 3B6WA 2X6AA 3BEHA 1B52A 5KCJA 4ZE8A 1SBPA 2JDIG 1SETA 3T2MA 4F22A 2HLDG 4KFQA 3QO7A 4MFIA 4M1VA 2ZNSA 1N7XA 4JB7A 1ZMGA 3TQWA 3JYRA 1S72V 4IGRA 4MTXA 4LONB 5K2XA 2C2AA 2ZNTA 1AIVA 3PUZE 1LB9A 1OCOB 3CSGA 3P7IA 1N84A 2P1SA 2F36A 1AI6A 1VQLV 1PBQA 3TCUA 1V55C 2G29A 1P1OA 3PPQA 4ZEIA 3HO7A 2RF1A 2HG5C 2Q67A 3FXQA 2VD3A 1SVXB 1A54A 2HVJC 1VQ4V 3QIMA 4FJCC 1MDQA 4MF3A 1K3EA 1QUKA 3OM3B 3DP8A 5AA2A 1VQ7V 1KWHA 4R6KA 3O6IA 3A3UA 1NH2B 1MXWA 1FXHA 1N04A 1ENVA 5B3SB 4QSCA 3ZSFA 3OELA 1VQ8V 3VLWA 3ZMSA 5H8HA 1EH3A 3FV2A 2X6BA 2CMOA 3OO9A 3UGWA 5B1OA 3C34A 3F5WC 1W0KG 1AR1B 5KUMA 1IUDA 1JVXA 4HCWA 4LC1A 1VFDA 3MPLA 2FYIA 2XXRA 2QS4A 3JD2A 3U94A 1TUEB 3VOUA 5I2NB 5IY5B 2W7YA 5I57B 4YB5A 2F7CA 3RVYA 3CC4V 3OR7C 3LSFB 3VLUA 4LATA 3ZS6A 1M90W 1UTHA 5GW7A 2NNUA 1I5XA 1F4NA 3T4ZA 2UXNA 3C9HA 3P32A 4OFJA 1K34A 4ZEDA 1MPCA 4X89A 1LLSA 3UP9A 2V1DA 2ZR3A 4C0RA 3CCLV 4H5FA 2EIJB 3ZMUA 2WLLB 1TFAA 1I6BA 4PP0A 4Q8RA 2D5WA 1SRYA 1N7WA 2DP8A 2F34A 4DE8A 1H2GA 1OLAA 5EHSA 4LP8A 1B6QA 3T1CA 2AL5A 3AG2B 3ETDA 2WLNA 5L9OA 3FJ7A 1YITV 3QK6A 4U4XA 4UVBA 2DYRB 3ZN0A 1DTZA 4NWDA 4DXUA 2OLBA 5I56A 3T93B 1B05A 1B58A 3O2AA 3AXFA 4NEDA 1M56C 1MS7A 3OGCC 1RKMA 1N3WA 1MY3A 4HW8A 3IOUA 5CC2A 4GFRA 3OFNG 3ZN1A 3DLNA 3IB0A 3MWBA 4G77A 3K79A 5JTYB 3C32A 5L3BA 4IO5A 3MD0A 2HZLA 3MHSC 3G71V 3FYEB 3IB1A 1EZPA 4OYVA 3B8NA 1Y66A 1H44A 3MJNA 4H8JA 2BJJX 3B6QA 3JCZA 3OO8A 3TZAA 1MQIA 2F97A 2JEUA 2QM7A 4JTCB 1D9VA 4GX2A 4G2KA 2H9BA 4QFPA 4OTEA 2DYRC 3SKPA 3E2EA 2PYYA 2ONSA 2ZXWB 4XTCQ 3K08A 2QL3A 3ZRXA 5JK4A 3AG3B 4EXLA 4BIUA 3G6EV 3ZRWB 1R6NA 1POY1 3NXSA 1VQ6V 3SPGA 1IXCA 5TP9B 1GM8A 1FXKB 3RW0A 4F31B 4R74A 1QR8A 1KP2A 5DVIA 3ABLB 2QPQA 3U92A 2DS9A 4RQFA 2Q6AA 4ZEBA 2Q68A 4P2ZA 3HHFA 1MXYA 4WCEV 3TK1A 3MBPA 1P1NA 5CMUA 4JWOA 3RGYA 1RM1B 3U8QA 5CN0A 4MS2A 5I2KB 1FXVA 3SPHA 2OWTA 3DM0A 5B1NA 3WAFA 3JD0A 5TPAA 3OO6A 4IB2A 3ZRVA 1UJWB 2XX8A 4KCDA 1XL6A 2OTJV 4GWOA 1ORQC 1A8FA 3M3FA 1NNFA 2ZXWC 3K0DA 2JJ2G 2F6PA 4BDRA 4RO2A 1LNQA 3F7VC 5DN6G 2NOOA 4ELQA 4PDVA 4DXWA 4WFBV 1S50A 1VE4A 2W6JG 4NF5A 3IJXB 3RN8A 2HKOA 5DEXB 4F3GA 4G68A 3IO4A 1B4HA 1J1NA 3LUYA 1LAXA 4FJPA 4PFWA 3WFVA 3ASOB 4X48A 2HAUA 4PDRA 2UXXA 1H76A 1B1HA 4U4SA 4THIA 1LAGE 4JSOA 4R72A 5IDJA 3E8HA 3VBBA 5L3DA 1NNTA 3VXCA 2UVGA 2RINA 4ESWA 1MQGA 3D4GA 4OEVA 1A7LA 2DSFA 2WLMA 3M99B 2I4BA 4PFTA 3SERA 3ZIAG 4GX1A 3OXNA 2IJHA 3KG2A 1DPPA 2F78A 3PV0E 3G3HA 3ABMC 5H8FB 4GL0A 1EZJA 4EF2A 3OR6C 4FIMA 2THIA 3PUVE 3QYTA 2BOCC 2M7WA 3OEMA 4JWXA 2OJTA 1WODA 3VVFA 4RY1A 3Q27A 5DVFA 5DM6V 1JW4A 1A99A 1VQMV 3WAEA 2DW4A 4QFOA 2ZMBA 2QKSA 4PA3A 1Y4CA 4I62A 1BIYA 4LUBA 4RJZA 2XASA 1YI2V 3TETA 1GV8A 1ZLQA 3CFLA 4CZZA 4QPKA 1Z7ME 1UTBA 1AI4A 5FHNA 3OEEG 2H98A 4BDMA 4EUOA 4RK2A 2QM8A 4MT8A 2VD2A 2VHAA 4K3FA 5CI5A 1QVFU 2REJA 4NF8A 1PNLA 4P0IA 3MW0A 1XOCA 4UA8A 1TXFA 3K9AA 1BHAA 3QAXA 4R2BA 4I9DA 3N26A 3X2QC 3ABTA 3H6UA 2Y69C 2DYXA 2DOJA 1FTOA 2HFBA 3KSJA 2GRVA 1MH3A 5FTIA 2B5UA 3E4RA 2DVZA 2DQVA 3DP6A 1GTOA 2WLKA 1DMBA 4Q5TA 1B3HA 1SI0A 3AG1C 2PI5A 2WLIA 3K1MA 3O97A 3ASNC 1VFEA 4U7NA 4XDJA 4WF9V 3TPAA 4F29A 1QUIA 3U93A 4KYSA 1BMFG 4NF4B 2NUVA 3E3KA 3F7YC 1FQFA 1PDAA 5HBCA 1M5CA 3U72A 2I0BA 1RYOA 2V25A 3K0GA 3I55V 4BDLA 5FTHA 3K1NA 4OVJA 4YU0A 1BL8A 3CMAV 4FECA 2R9IA 1KC8W 4F19A 1B6HA 4DCYA 1EBOA 3HPIA 3ILUB 3KJTA 1OMPA 1DTGA 4JWYA 2EZPA 3E8BA 4RXLA 3S9MC 4JDFA 3K03A 4N6PA 4ZEFA 2EIKC 1NVPD 3OO7A 5KZTA 4QSEA 4MLVA 1QLEC 3CVGA 1Y4MA 2HZKA 4YB6A 4JYBA 1USYE 4EF1A 1PB8A 4JTDB 1JEVA 5CMBA 1BHBA 2O1LA 3LNMB 1NR7A 1OCRB 3MZ9A 4NE4A 1BTJA 4FATA 1CP9A 3PPRA 1US4A 2PI4A 1VQOV 5BUUA 3LSXA 3D4CA 4KI0E 5FL7G 2O1MA 2QE7G 3CCRV 4MTOA 5A5XB 4U7OA 2XXTA 3MVZA 2WLLA 2OT5A 4U23A 2FTKA 3PJSK 3MP1A 1JQ0A 5IYBO 3STLC 3CYOA 1XVXA