1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
4R74A 4ZE8A 4JWOA 4ELRA 4BLAA 1FQFA 3KN7A 1M5CA 2AYSA 2RKMA 1P1NA 2DVZA 2HAUA 1DSNA 4IB2A 3W15C 1A99A 3FJGA 3KSXA 4EUOA 5B70A 1R9LA 3OO7A 1II5A 1Y9UA 3KJTA 4ECFA 3N26A 4H8JA 3C31A 2DXYA 4I9DA 3UK4A 4RYAA 5JTYA 3MUQA 4PP0A 3ZSFA 4EF2A 1BKAA 3MBPA 2ZYKA 3C4MA 3K1PA 2V3TA 2F35A 2IA4A 2UYFA 3KFMA 3PUZE 1MQDA 4MF3A 4O3CA 1D3KA 3QXMA 1B05A 2RC8A 5AA3A 1RYOA 1Y20A 3B8MA 1IXCA 2XX8A 1P99A 2GHBA 3H6TA 4GQOA 4NEDA 3M3LA 3G7WA 1ANFA 1D4NA 4LA9A 4LONB 5H8HA 1QJMA 4PFTA 1OMPA 1PDAA 3G3FA 4UA8A 3O29A 4DDDA 4IO3A 5F1QA 5H9CA 4OESA 4QHQA 1MH4A 4F19A 1F23A 3I5OA 1QUJA 1PEBA 4LQ2A 5H8NB 1DTZA 2DE3A 1B1XA 3FVNA 1QBZA 2X7PA 2F78A 3MPLA 4HCYA 4MH5A 5TPAB 2XXQA 4BDOA 1ZTYA 1I69A 2XXVA 3N5LA 4OVJA 3DP8A 4JPRA 4OERA 2FYIA 4IO6A 2NWJA 4YICA 4LQ5A 3VLVA 4G2ZA 5H8HB 3HSTA 2ONSA 2DQVA 1MQGA 2XX7A 1J1NA 1JVXA 1MDQA 2F6PA 3G3KA 2Y7PA 4RPOA 2HZKA 1VFEA 4THIA 4F31B 3RQTA 1MQHA 4GLIA 3K6XA 2QJEA 1MXXA 3SEVA 1JETA 3JYRA 3N6TA 1IZ1A 1H44A 1O63A 3G3GA 4PQJA 4F29A 2PVUA 2Q2CA 3MJNA 2I3WA 3FJ7A 1BP5A 2PBWA 4IO2A 3TPAA 1N7XA 3T9HB 5AA4A 1FW0A 1M5DA 1Y3PA 1UTBB 2A5TB 2ZYNA 4PETA 4OETA 3SDFA 3R26A 4IY6A 1DF5A 1D9YA 1HSLA 2E0SA 2X7QA 4PFUA 3TKDA 1MPBA 3KOTA 4C1UA 4JB7A 1EZOA 1DMBA 1NNFA 4GF8A 4WXJA 1LFHA 5EHSA 3UN6A 3IOTA 3K9AA 1LBCA 1YTVA 3IOWA 4YKJA 4OTEA 4OENA 3O97A 3P30A 3OO9A 5L9OA 3OOAA 4P0GA 4XIGQ 3W9VA 1M5BA 3FD3A 5CBSA 4ESWA 4NF4B 2DOJA 3E3KA 3VDFA 3LSFB 3KOSA 1VSOA 4R9GA 3SETA 3ZKKA 2V93A 1H76A 3CG3A 2P1SA 1NMUA 1JVYA 3I6VA 2Y7IA 3IO4A 2AL4A 2G29A 4IGRA 4KYSA 4LATA 1OQGA 3GBBA 2Y7KA 1A55A 4QSDA 2VP1A 4BDQA 4R75A 1SI1A 3FASA 1DF4A 1HSJA 4GOTA 4HCWA 4G8HA 2ESNA 3PU5A 4JSOA 1UTHA 2REGA 1EH3A 2Y84A 1SW5A 2Z23A 1H45A 2ZMBA 2THIA 1NNKA 2DWIA 4MLQA 1MPCA 1TT1A 5DVFA 3BFUA 3FIRA 4EDPA 1ZKBA 4JF3A 3OSRA 4Q30B 1O64A 2DWHA 2O84X 2P0SA 3OO8A 3R6UA 4U22A 2OLBA 1PBPA 2QSXA 4U4SA 2ONKE 1B58A 1Q35A 1USYE 2O69A 2Z8EA 5L8DA 2R71A 1Y3NA 3JV9A 3K6WA 3O6HA 3MW0A 4JWYA 5EHMA 2D21A 5I58A 1OLAA 2XXIA 4G2KA 2ZNUA 3IB0A 4KD5A 1OVBA 2X26A 1EZPA 1JEVA 3U72A 4E0WA 3VLWA 4AB5A 3M99B 1A8FA 3TFLA 3TEPA 1HSEA 1ELJA 4XXUA 1SQYA 2EBOA 3H06B 2WKYA 3K1NA 3OXNA 1LB8A 2PMSA 3Q28A 4NF5A 3EQ1A 1AOVA 3S4UA 4U4XA 4YKKA 4ZDMA 3MVZA 4MBPA 3H3GA 3WFVA 3O2AA 1VFDA 5HFLA 1B4HA 4E2LA 2REJA 4FEBA 3TQWA 5I84A 2R9JA 3B7DA 4FAJA 5KDTA 3CG1A 4FIMA 4HTGA 4OYVA 4LVQA 2RCBA 4C1TA 2NUVA 2XXTA 4G8NA 3KGCA 2Q8JA 3PUXE 1UTBA 1K33A 3U94A 2H5YA 3H6VA 3VVEA 5FHNA 5FHMA 3PMWA 4ZZAA 4HW8A 2B3FA 5AA2B 4IO4A 4KYDA 1AMFA 2F6GA 4FEDA 3DLNA 3IL1B 4N07A 2VD3A 1DPEA 3GBAA 1I5YA 5H8QB 4DIGA 1LAGE 4M1VA 3RLFE 5KDTB 4G68B 4LZ7A 1ZIUA 2F8DA 3S9LC 4BDRA 1XOCA 2YLNA 2RCAA 4LZ5A 3B6WA 3UIFA 4C0RA 4FORA 3K02A 3KN3A 5ICTA 1N84A 1UIVA 3PMVA 2M7WA 3SEYA 3GWOA 3W9WA 4O3BA 3THIA 4ZEDA 2DWJA 1NFTA 2O7IA 3VVDA 1XVYA 1US4A 4HS7A 4AQ4A 1KWHA 4BDMA 1MXUA 1UTHB 4DXCA 4OFOA 2MK3A 1BIYA 2ZXTA 3KEIA 4G68C 1CE2A 1JW1A 4IO7A 4POXA 4Q0CA 3TZAA 1MM6A 3TDJA 1EBOA 3WAEA 2UVHA 1Y66A 1NL5A 4OFJA 2RC7A 3HN0A 4GWOA 1A40A 4YB6A 2Z8FA 3LSXA 4N6PA 3LSWA 4E0XA 4YMAA 4KFQA 1B7ZA 2VHAA 4WEPA 4ONYA 1IXHA 3FXQA 3MP8A 3PMXA 5JK4A 3PPPA 3DELB 5H8NA 4H1XA 2RINA 3A3CA 4NF4A 1WDNA 3P7IA 3RNNA 4N21A 3VVFA 5CBRA 3H6UA 1CB6A 4DLDA 3U1OA 4RA1A 3SESA 5JTYB 4RNSA 4QFPA 2F97A 5CMBA 2HXWA 4PE5B 4GL0A 2ZYMA 3IB1A 3IORA 2HEUA 1JQ0A 2OWSA 3CSGA 4G68A 5H8SA 2ZNSA 3T96B 3CRBA 2EZPA 2H99A 2XXHA 3OMBA 1ZLQA 4NE4A 5FTIA 3SEXA 2A5SA 1MH3A 3N94A 1ZMGA 1B51A 5HM4B 1B5JA 5I57A 1IUDA 1MXYA 5TP9B 3M3KA 3TTMA 4EQ7A 1TWYA 3D4CA 3VV5A 3K00A 4H65A 5BWJA 2PT2A 2XXRA 1SW1A 3JZJA 1MY1A 3C32A 4MFIA 1B52A 3L6GA 3VLUA 1A7LA 5ITPA 2HFBA 1R9QA 3B6QA 1B3FA 3LR1A 4R6HA 2HZLA 1M5FA 3A09A 4ZEFA 3U8QA 4EQBA 3C35A 4GL8A 2GFEA 5I58B 2QL3A 4JSDA 3EHSA 3UA8A 3QYTA 4IY5A 3KG2A 5F7VA 1AH5A 3MQ9A 4ZZEA 3UORA 2DE2A 3CR9A 2LAOA 4Q5TA 1TFDA 4YU0A 3FV1A 1QR9A 3ZKLA 2LP7A 3BFTA 4RPNA 4YAHX 5CMCA 1URSA 1OLCA 4F3SA 2YPNA 4ZEIA 1MOFA 1P1QA 1B6HA 1LBBA 2VGQA 2E1SA 3E4RA 3MVWA 5HBCA 4F18A 5I2NA 4QFOA 3RUMA 2HQ0A 5DYHA 1AIVA 1B4ZA 4KR5A 3R7XA 4EXLA 5I59B 2KLFA 3FGSA 3IJXB 2OJTA 3B6TA 5TPAA 4U1OA 1YAEA 3ECRA 1TXFA 1B2HA 1DOTA 3VXBA 1FQCA 3Q25A 1URGA 3KZGA 1H43A 4OZ9A 5K2YA 4GD5A 1B32A 4OQOA 1LCTA 4NWCA 5DVJA 1L5TA 1GR2A 4F2QA 5HPQA 3CFLA 3OELA 2D5WA 1FQEA 4FE8A 4GVOA 4WEDA 3Q29A 2NOOA 1MPDA 2QS1A 1PBQA 4R2FA 4ZECA 3T66A 3TAJA 2IEEA 1URDA 3ONMA 2O7UA 1FTLA 3QUJA 4ZS9A 3T9UA 3TTNA 4F1YA 4F3BA 1RYXA 3RT6B 1JW5A 3H6WA 1Y4TA 1SVXB 3RT8A 1JQFA 1FQBA 3T9VA 4FJPA 4NF6B 3FV2A 1B3LA 5M2VA 2O1MA 1RKMA 4Q8RA 1YPNA 1VE4A 1S50A 1S9TA 1Y4MA 1B40A 2G93A 1VR5A 3ILUB 3HCQA 4L17A 5CMMA 4YKIA 1DLBA 1B3EA 3KSJA 3CYOA 4DCYA 1B46A 5A5XA 3DM0A 1PB8A 3QIMA 3TELA 1JEUA 3BKIB 4I8CA 4JBZA 4WKMA 3S9EA 3CFXA 1FTMA 1N0TA 2F7CA 4X9TA 4GRKA 4KPTA 2DYXA 2GRVA 4YB7A 3L6HA 2QMWA 1YCJA 3G3JA 4XKNA 2QMXA 3B8NA 3MHHC 3H4ZA 3HHGA 3GXAA 1ZBMA 5CM6A 1A54A 4H67A 3PD8A 4F1VA 2V3UA 2OT5A 1Y1ZA 1EU8A 2I3VA 3PPQA 1SDXA 3IK6B 3TCHA 4YMBA 1N76A 1MY2A 1N04A 1XT8A 2YJPA 1MQJA 2F36A 3FUZA 2BJJX 1A8EA 1B7HA 1LFGA 2XXYA 3C34A 5CN0A 2W7YA 3O66A 3FVKA 5DVIA 4XKQA 5I2KB 3ZS6A 5I59A 4X1BA 3PV0E 3IO6A 3S9NC 1I6BA 4MLVA 3OENA 5DEXB 3RN8A 4F3PA 5JEIA 3A3UA 2DVCA 3SERA 1IXGA 3MHSC 2Y7WA 1XS5A 2P2AA 3K0VA 5TU0A 4F3GA 1N3WA 3KBRA 3TTLA 4QSEA 4JWXA 4O3AA 1SYIA 3CP1A 1XHYA 1UIUA 1SYHA 2ALUA 2I58A 2Q2AA 2I48A 4FK5C 2QS2A 1B5HA 3MZBA 3N6UA 5HFMA 2F7BA 4I62A 4IO5A 2VOZA 3OO6A 4OXVA 3HV1A 3VFJA 1GV8A 3PUYE 3RPWA 5TP9A 3GZGA 2O68A 4R2BA 3U93A 5I56B 3MPKA 4NF6A 1SBPA 2VD2A 3SEWA 2XX9A 2O1LA 1FQDA 1Y1MA 1Q1KA 3C33A 3ILTB 2RF1A 3IOUA 4EXKA 1IITA 2V84A 3EHTA 2DSFA 2PT1A 3MWBA 5H8QA 1LAHE 5CMUA 3S9MC 3O9PA 3IB2A 1I6QA 3CSBA 1JPXA 2HAVA 3Q27A 2R6GE 4NF5B 1LLSA 1NNTA 1MG1A 1SZTA 3IX1A 1SI0A 3K01A 2H25A 3HO7A 3MAMA 3TTKA 4ELOA 4NWDA 2DE4A 3F11A 1D9VA 2OCUA 2H9BA 4K3FA 2H98A 1B5IA 1PB9A 5J1DA 2B65A 4KQPA 2EZOA 1B7UA 2ANJA 2Q88A 3RTWB 2AIXA 5I56A 3QAXA 2OZZA 1FQAA 4DXUA 3QK6A 2P6JA 2UVIA 4OEVA 1LAXA 3O6IA 1FCKA 5DT6A 1QR8A 3H7MA 4KHZE 3TCGA 4R73A 3I3VA 3K2DA 5BUUA 1NNPA 2PYYA 1TFAA 1NH7A 4KYEA 1SD3A 2B3BA 4POWA 3TYHA 3G3HA 3TTRA 5ITOA 2Q9TA 4H5FA 3OD7A 1QULA 1MY3A 1LCFA 1BLFA 1Z7NE 2F34A 3AXFA 2GHAA 3IJOB 4F2OA 1H3DA 1LAFE 4R6YA 1DPPA 1N7WA 3MVYA 4BDLA 1QKAA 1WODA 2V25A 2QS4A 1QUKA 4OFLA 3Q26A 4M4GA 1SW4A 3H01A 3LSLA 3QSLA 5B7DA 5KA5A 3PPRA 3TUSA 3FVOA 3KN8A 1B3GA 3MZ1A 1GTKA 4PFWA 4QF9A 5FHOA 1QVSA 1GVCA 4ZE9A 3T9XB 4QFKA 2Q89A 4TLMB 2ZNTA 4NTLA 4NMYA 1NH8A 1GGGA 1MQIA 2DXRA 2I6EA 3H03A 3ODBA 4RXLA 5L9MA 3K1MA 3MVXA 4R72A 1B3HA 3CFZA 4G4PA 4H0WA 3TQLA 3UP9A 1FTJA 3MZ9A 1US5A 3B77A 4OEUA 4YZZA 5AA1A 3LBSA 4Z7EA 2DS9A 1ATGA 5CC2A 3CVGA 5A5XB 1IIWA 3FXRA 4BDNA 1LSTA 2V3QA 3D4GA 1OQHA 3M3FA 1QW0A 4Z0IA 3T93B 1WVJA 4P11A 5I57B 4OWDA 3HHFA 1DTGA 4U1ZA 3RY3A 1XVXA 2XXUA 4FATA 3DP4A 2XD3A 2Y7RA 1PC3A 1BTJA 1I6AA 5KCJA 4GXSB 5IAIA 4G77A 2GH9A 4QFLA 3OSQA 4GFRA 5K2XA 1IEJA 3FXUA 3TMGA 3BBRA 2XXPA 4F39A 2DWAA 5KZTA 4ESXA 2QS3A 2F7AA 3RTFB 3OEMA 5AA4B 1MY0A 4KCDA 2ONRA 1R1NA 3OEKA 1Y3QA 1B0HA 2I0CA 3IOVA 1OIBA 1S7YA 1Z7ME 1XC1A 1MY4A 1NKXA 2XD2A 3EHUA 1P1WA 5I2KA 2QPQA 4NF8B 4U21A 4R9FA 2D3IA 4RY1A 4KI0E 2Z22A 5AA2D 3FVGA 2H4IA 1MRPA 1F9BA 4P0IA 2AL5A 1ZJLA 3E9XA 2FNCA 4KCCA 4ELPA 1ENVA 4EF1A 2OK2A 5KA6A 3DP6A 5ICQA 3C36A 4R6KA 4DCXA 5IKBA 1LB9A 1MXWA 2UVGA 3E13X 3K4UA 4XKPA 3T22A 5L9SA 4XKRA 1T0KA 4X48A 1N3XA 3EN3A 1I5XA 4LP2B 5ISUA 1POTA 3LC8A 4ZEBA 4QSCA 3U92A 3VE1B 5KCJB 1K34A 4H8IA 3SKPA 3RGYA 4LUBA 3EPEA 5AA2A 5H8FA 4I1DA 2I49A 2DP8A 3O28A 3WAFA 1IQ7A 1MXZA 2M8CA 2NXOA 3V5AA 4DZ1A 5LOMA 4FJCC 4G8MA 4LZ8A 1B0LA 4X1DA 3O6GA 4H5GA 4RK9A 4YB5A 5CRYA 3MC2A 2XXXA 2UYEA 3IR1A 2FA7A 5CI5A 3CI8A 2QRYA 1FTKA 1LGBC 3TCFA 3MP6A 1O7TA 4OHNA 3EF7A 2UXAA 2OWTA 3USDA 3V8XB 4AB6A 1EZ9A 2X7RB 1QUIA 3PD9A 1QKBA 4U23A 1B1HA 1B9JA 3M8UA 4JGSA 2O6AA 2XXWA 4GIZA 4ND9A 4F1UA 1MXVA 3KJ7A 1M5EA 1MM7A 3MP1A 1PB7A 4RJZA 2F5XA 4U2RA 1MS7A 3IAZA 1UQWA 3PUVE 4XTCQ 1MDP1 3SEUA 2A5TA 3CIJA 2Z8DA 1OVTA 1SW2A 1POY1 4F22A 5ELVA 3V89B 3VXCA 2XHDA 2PX1A 5H8FB 5DEXA 4JDFA 3K6VA 1Y4CA 4ISUA 3S2VA 4DXBA 2HCAA 3PPNA 2ZYOA 1JNFA 1AL3A 4GXAA 1QCEA 4H6DA 1P1OA 3FATA 3UGWA 5CMKA 3G3IA 4JXIA 2UVJA 1IXIA 3V83A 4ELQA 2I4CA 4RK2A 3TODA 3PGFA 2CMOA 4NF8A 1ZU0A 4TOZA 1R6ZA 5EYFA 5FTHA 5I2NB 1P1UA 5DTBA 4N23A 3HPIA 4FECA 4UACA 4ZEKA 1JW4A 3GLBA 4DE8A 5AE4A 2OBGA 4YKPA 2I4BA 3FJMA 4OMBA 4PFYA 2I0BA 4QRZA 1FTOA 2CZLA 3FZVA 1LFIA 3PUWE 4TLLB 3LUYA 4IGTA 4FIPC 4N13A 4EQ9A 3K6UA 2ABHA 3PPOA 2NVUB 3QUFA 4TQUQ 4QFNA 3C9HA 2O51A 1USYH 2RC9A
chains in the Genus database with same CATH superfamily
3A29A 4DV2O 2OX3A 1I08A 4JYAO 4BLAA 1FQFA 2HAUA 2ZXWC 3FJGA 2ZZXA 1S0VA 3OO7A 1Y9UA 3N26A 4H8JA 2JGDB 3C31A 2GSMB 4DV4O 3UK4A 4PP0A 3QF7A 2E5LB 3CCSV 2ZYKA 4OANA 2UYFA 3KFMA 3E86A 4MF3A 4O3CA 4O7MA 3QXMA 1B05A 5AA3A 3R65A 4X9QA 3GYYA 3JSLA 2XOKG 2IJHA 2K9PA 2VRZA 1WAZA 4OX9O 3K3WA 3G3FA 2CZHA 2JGUA 4DDDA 2IJIA 1SQBH 3RFRA 4IO3A 5H9CA 5I2NA 4F19A 2KB1A 3I5OA 5KHHA 3TCUA 3CXCU 2DE3A 3AG2B 5TPAB 4OVRA 3FD9A 1ZTYA 3N5LA 1QU7A 4OPAA 4G2ZA 5H8HB 2DQVA 4YXWG 3ZMZA 2YXLA 3SJCC 4B3RO 1VFEA 1EYIA 2PUSA 4I3EA 1EFRG 4GLIA 1MXXA 2QGNA 4MJOA 3JYRA 5A5XB 1IZ1A 5TISZ 4MVUA 2PVUA 4O2AA 2BE3A 4JYCA 2I3WA 3MJNA 4PDHA 1N7XA 4CH6A 1XMOB 4FFKA 4ZKIA 1UTBB 1Y3PA 2ZYNA 4WBNB 1YZ0A 3APOA 1CXZB 1HSLA 2WLHA 4JI5O 4HE1A 1NNFA 5IT9N 1PL0A 5EHSA 3IOTA 3K9AA 1LBCA 1IX9A 3H1LH 5L9OA 4XDLA 4JI0B 3LNMB 5L3BA 2CTWA 1H76A 3BIGA 3CG3A 2X6CA 3I6VA 2Y7IA 2AL4A 4UCOA 5JQGB 1OQGA 1HR0B 4QSDA 1GN3A 1A55A 1HNZO 3OFNG 1M93A 4YY3O 1DF4A 1VQOV 1Q6HA 2ESNA 3CPWU 2Z23A 3JATB 5K1XA 4MLQA 3K0GA 4JI1B 3FIRA 4DR7O 4Q30B 1LR1A 2LGWA 4PA7A 4FFBB 3TDJA 3LNNA 2R9IA 2R71A 5LA6B 4JWYA 5B1AB 5EHMA 5D5PA 1OLAA 4UABA 1RSOB 4G2KA 2ZNUA 3IB0A 2DW4A 1F4NA 1XI6A 1JEVA 3TEPA 1ZL8A 4XXUA 3EKIA 4JVCA 1N0NA 3K1NA 3Q28A 4ZIBA 3ZHQA 1AOVA 4X1KA 4LF8O 4U4XA 4OVSA 2XASA 3MVZA 4DUZB 2JJKA 2AHZA 1G0HA 2WX9A 4H13B 1MMMA 2WA4A 2ZQMA 5IY5C 4E2LA 5I84A 2Q4PA 5EYPA 3ZMTA 3U0ZA 4KP4A 5F2VO 2RCBA 4OYVA 1AP6A 3KGCA 3H6VA 5L3CA 5FHNA 4ZHQB 4ZZAA 4PBHA 1AMFA 2F6GA 5H8QB 3DLNA 3IL1B 1DPEA 1N0JA 3RLFE 3CE2A 4IGGA 2JRIA 3CB2A 1ZIUA 2XWKA 4TQFA 3OTOO 1RPRA 4NXMB 2YLNA 4LZ5A 2YC0A 1SQVH 1NV4A 1GMGA 2UXDO 2R9AA 2WBBA 4P1EA 5EQ7A 1DBZA 2XA5A 5J2TB 4DUYO 2DWJA 1NFTA 4JI7O 2O7IA 3VVDA 1YDXA 4LF8B 4HS7A 2YXYA 3OMAB 4UUJC 1UTHB 2MK3A 4MS2A 1BIYA 4G68C 4QXDA 4POXA 2Q68A 4Q0CA 1GN6A 3TZAA 3IC9A 1Q43A 4O7IA 3E22A 4OFJA 1PNKA 4FLUA 2D3OW 1NR7A 3G80A 1A40A 2Z8FA 4KFQA 1B7ZA 3OMIB 3LSQA 5LHIA 2XHBA 1IXHA 3MP8A 3PMXA 1XEQA 4NF4A 3A3CA 4DI4B 5CBRA 4DLDA 5LGNA 4DK0A 5LMUO 4RA1A 3HKCB 2F97A 4PE5B 3RYIB 3STZC 3IORA 5JVDB 3CSGA 3CRBA 3TJTA 3JALB 4PA9A 2H99A 1ZLQA 2Y0PA 3ZN0A 2GV9A 5HM4B 4ZHQA 1B51A 3DTUB 4X1KB 3T0JA 3G6EV 4PAKA 1I0HA 2FIXA 2LQTA 4I5SA 1N36B 4QE9A 4LNUB 5BXZA 4MFIA 3L6GA 3ABMB 3VLUA 3ABUA 1A7LA 2HFBA 3DSQA 4PFBA 5ITPA 4DK1A 4LF9O 1B3FA 5JWPA 4R6HA 2UXCB 1M5FA 3ZHUA 3D36C 1VF5B 1VDWA 2F3BA 2L5VA 5EBMC 2QL3A 3UA8A 3QYTA 3KG2A 1NTZH 2DE2A 4Q5TA 3ZKLA 3A0BZ 2OCHA 3RYFA 3UT5A 4YAHX 1URSA 1OLCA 4BR6A 3UORA 3JSNA 3CSXA 1I94B 1B6HA 2E1SA 5HBCA 2IJKA 5B5EZ 4TV8B 4K8ZA 2HQ0A 3RUMA 4KR5A 1YSCA 2OJTA 4U1OA 1N33O 3VXBA 3Q25A 3QVNA 5K2YA 1H43A 3D36A 4OQOA 5JH7A 4G61A 1D5NA 1JJ2U 3S3XA 2NOOA 3K06A 2QS1A 4GBWA 3TAJA 5LP6B 1URDA 2O7UA 1FTLA 1HWYA 1JW5A 1Y4TA 1SVXB 1JQFA 2VT5A 1SPIA 1IDSA 2F4VB 3KC0A 2WLLA 1VQ4V 2UXXA 2G93A 1B40A 5T3JA 4F1UA 1VR5A 1P49A 4Z2WA 4YKIA 1DLBA 4QPKA 3CYOA 4LP8A 5A5XA 1T0KA 2ZNIA 5CBFA 3CFXA 2YEVA 1FTMA 1FPFA 4X9TA 3L6HA 2NN4A 5F24A 3MHHC 3HHGA 5CM6A 4O2AB 4PV1B 1ZBMA 3RBZA 1TVKA 5B1AC 2GUZA 1OV9A 3FFQA 1Y1ZA 1SDXA 4HE0A 5I56B 2ZR2A 1WA8B 1Z5WA 3C34A 5ESYA 5CN0A 1M5IA 5DVIA 1K92A 4XKQA 5ET8A 5I2KB 4X1BA 4MVOA 5B3SB 4DR4O 1I6BA 5L3EA 1BZKA 3RN8A 5JEIA 4JI0O 2DVCA 2Y7WA 4F3GA 3UT5B 4O3AA 2DWDC 1SYIA 1S72V 2VQEB 1UIUA 2Q2AA 1SA0A 4BW5A 2ALUA 4OESA 1ZX3A 4D7TA 2WLJA 4GX2A 3VFJA 4RQFA 2ZR3A 3ABTA 3L9DA 4HBNA 2VWJA 4PA3A 3PUYE 4JI5B 4NVPA 3MPKA 3IFCA 4NF6A 3QTCA 2P06A 1SBPA 3SEWA 4DR6O 1B6QA 2WLMA 1YI2V 1DK4A 1Q1KA 3C33A 1IITA 2V84A 2DSFA 2PT1A 1OCOC 3S9MC 1FPBA 3O9PA 4DV6B 4YJ2A 1ORQC 1DTOA 3DC5A 4B3RB 1N4CA 1WPBA 4CH4A 3BFRA 1NNTA 1SZTA 3DXRA 2H25A 2YICA 2YXHA 2YIBA 5J9PC 1XNQB 4H46A 5GONB 3TTKA 4AILC 4LF5O 1SQFA 3AG4B 3SJAC 5J1DA 3RYIA 4EKWA 2ANJA 3CJHA 1J5EB 2AIXA 4O4JA 1BQZA 2OZZA 5KMGA 2H3OA 2UVIA 4MW8A 3IAYA 4J7JA 2DYRC 1FJGO 3TCGA 1QR8A 4KHZE 1XHZA 4R73A 1NNPA 2PYYA 3I5DA 1PM9A 1N32O 1BSMA 5JTYA 1JVMA 1LBYA 3E22B 4RUEA 1LCFA 1GAXA 4F2OA 5DEDA 1QKAA 5KX5A 3ETDA 2E5LO 1SW4A 2GHYA 3VXCA 4ZE9A 1B3GA 5LXTA 5FHOA 1S5HC 4LFAB 4TLMB 4L87A 4LFCO 2P7TC 1LEVA 2DXRA 3ODBA 3H03A 5L9MA 4H44B 1AI7A 3MVXA 4PGNA 1B3HA 3CFZA 4H0WA 4LN5A 4R72A 1KBHA 3W7WA 3MZ9A 1KD1W 1US5A 4KHPO 3KCXA 1RDYA 3LBSA 5AA1A 1UFIA 1G6UA 1IIWA 1LSTA 4J9YB 4X8RA 4DV5O 3ZHRA 4OWDA 3HHFA 5EK0A 1IBLB 1XVXA 5LMNB 4DXWA 2XD3A 1PC3A 1I6AA 4G77A 4GFRA 1FRPA 4F39A 4C7UA 3HKEB 3JYCA 3OEMA 5EC2C 1B0HA 2V1DA 1NKXA 3QG5A 5I2KA 4R9FA 1WA8A 2Z22A 2QDOA 3ZRWB 4JAUA 1MRPA 1KMIZ 3WB2A 1Y67A 1ENVA 1IVSA 1L1FA 4LF5B 1ZTEA 2PI4A 2F4VO 5GTHZ 2PYLA 3FAVB 1N3XA 4LP2B 2CEXA 1HNXB 5KCJB 2QE7G 4QSCA 4J7KA 3FYIB 1FS0G 1NS1A 3E8HA 3JARA 5AA2A 1F4MA 1BL8A 4DR6B 1YIJV 2HPGA 4HNAA 4DZ1A 3V5AA 4MCOA 1QLNA 4G8MA 4LZ8A 1B0LA 1W0JG 4X1DA 1Q8IA 4RK9A 5CRYA 4JYYA 3JAWB 3PTYA 1N33B 1MZFA 2CEYA 3AG3C 2OTJV 2VQEO 4CC5A 2QRYA 3ZN1A 1LGBC 3N2KB 3TCFA 3BABA 1O7TA 3ROJA 4LF7B 3M8UA 2DOSA 3CHXA 4AS5A 3MP1A 2Y4TA 2F5XA 3AG7A 3IAZA 1UQWA 3QO7A 3SEUA 4NF0A 4AHCA 3CIJA 5CA0B 3V89B 3JARB 5LHGA 3W7XA 2ZKOA 4FLTA 3FKSG 3PPNA 3OE7G 5E1AC 4MIJA 1QCEA 4LF9B 4P1LA 3RYFB 4JXIA 2QA4V 3T1CA 1KA0A 2HVKC 1VQ7V 4JVIA 4NF8A 2Q73A 5I2NB 2RDCA 4TT3G 4UACA 4ZEKA 1M56C 1NKDA 2OBGA 1P7BA 2I0BA 1K5SA 2FYUH 1FFTB 2XAJA 4MHFA 3PUWE 2LJ2A 3NR7A 3K59A 5KAIZ 1NV6A 4AS4A 3L72H 3EXAA 1XNRO 3C9HA 1OZ0A 2K1EA 1Y6XA 2JS3A 1INPA 1IMFA 4QIWF 2EIJC 1M5CA 2AYSA 2ZE5A 1P1NA 4IB2A 4IIJB 1A99A 3ASOB 4EUOA 5B70A 1R9LA 3CRCA 3RN4A 2DWEC 4EB6B 4X1IB 3OAAG 4EFEA 1K73W 3MUQA 3MBPA 4NTYA 1OHHG 3C4MA 4FM1A 3K1PA 1U97A 2F35A 2XXKA 1MQDA 2RC8A 1RYOA 1Y20A 4NEDA 4GQOA 3ZHSA 5CA3A 4CH3A 1IMBA 4JI7B 4P47A 3U10A 1AVMA 2P90A 5LYJB 3ETGA 1OMPA 4UA8A 4NXNO 1ZUQA 4TV9A 1R6NA 3HFUA 4LQ2A 3VQVA 1K5QA 1DTZA 2GQ1A 5BWJA 4MH5A 3L70H 3E78A 2F3DA 5I3SA 4P9OA 4OVJA 4JPRA 4PE3A 4YICA 4DV1B 4LQ5A 1N36O 2BJIA 3VLVA 2A0LA 2XX7A 3S3WA 1TUBB 1Y74A 3JCUZ 2HZKA 1MQHA 2QJEA 1X4TA 1JETA 1IBKO 3N6TA 4PQJA 3O9OA 4MT8A 3N27A 4DUZO 2Q2CA 4IO2A 5DN6G 1BP5A 5AA4A 2GTAA 4DV3B 2A5TB 3OTFA 1XNRB 4PA4A 4BW9A 4OA4A 4DYLA 4FVMA 1GTOA 5LMUB 4C1UA 1DMBA 2Q0AA 2EJ7A 1AI5A 3IOWA 1H2NA 2QTSA 4D6TH 4OENA 2EIKB 3OOAA 4XEQA 1HP8A 4XIGQ 4ESWA 1L8DA 4GX6A 3LSFB 1WP7A 3KOSA 3SETA 3ZKKA 3UQ8A 3ZMUA 5C93A 1FBCA 1FXHA 3STLC 4LF4B 4YY3B 3LUZA 2F93B 3RYHA 1G4YB 1H2SB 1MABG 2VP1A 1O9GA 1SI1A 3FASA 1SKVA 1H2MA 1NR1A 2N74A 3PU5A 1P4RA 2UXDB 1EH3A 1FPIA 2ZMBA 3WB0A 2UUAB 5DVFA 4EDPA 3OSRA 2IBZH 2O84X 4LF7O 5A5LA 2OLBA 1PBPA 4O4LA 1Q35A 1Y3NA 5I58A 2FKXA 2ZIMA 3OT7A 1OVBA 4E0WA 3U72A 2BOBC 4AB5A 2QWOB 1V54B 3M99B 5CB4B 4X62B 1H8EG 4DR2O 2EBOA 2IM9A 2LFSA 3OXNA 3UO3A 1LBXA 3SGIA 2QWQB 4JI6B 1K9ZA 3H3GA 4I55B 1VFDA 2HJFC 4MX6A 2R9JA 2ETNA 1KB9F 4LVQA 2GBOA 2XNDG 1UTBA 1K33A 2WLLB 3U94A 3IGAC 3VVEA 5FHMA 4U3JA 4HW8A 1F51A 4IO4A 4N07A 4FEDA 3F5TA 2VD3A 3GBAA 4M1VA 3JAKB 1JX9A 4GWYA 4LZ7A 2CTRA 4JI2B 2B1IA 1XOCA 2RCAA 1P7GA 3B6WA 3UIFA 1NI8A 4C0RA 4FORA 2P5OA 5ICTA 2F23A 1N84A 1UIVA 3W9WA 4O3BA 1VQPV 1HR0O 1XVYA 3GB7C 1KWHA 2VPOA 4DXCA 3MAQA 4OFOA 4CS3A 1YXIA 5KUMA 2QKSA 2UVHA 2UXBO 1M4UA 1Y66A 1GM7A 1THZA 4E0XA 4YMAA 3LSWA 3LV0A 4P30A 2VHAA 4ONYA 3FXQA 5LBQA 2QEXV 3DELB 4PA6A 3K04A 3VVFA 3RNNA 3P7IA 1WNSA 4MVSA 4JYAB 4GKJB 3RPLA 2YI9A 5CMBA 2EX3A 2HXWA 4LFAO 2HEUA 3HB3B 4NKGB 5H8SA 2WLIA 3T96B 1GM9A 3E79A 2EZPA 1WP8A 2XXHA 3OMBA 1NBMG 1Q86W 5FTIA 2A5SA 1MH3A 3N94A 1ZMGA 1B5JA 1NV2A 4EQ7A 2HFEC 2Q74A 1EN5A 1YXBA 3W7TA 1TWYA 4H65A 1JA8A 1URFA 4B3TB 1B52A 4DR1B 1RPOA 2HZLA 2YUAA 3C35A 3K03A 5IZ3A 2GFEA 4P8BA 3CCQV 1L0LH 1J5EO 4HYOA 4OX9B 4RPNA 5CMCA 2LFRA 1NTKH 4X66O 2WWWA 1XNQO 4F3SA 1B3QA 2Q6AA 4ZEIA 1MOFA 1DGSA 4UV9A 1AIVA 2FBPA 4EXLA 3IJXB 1L0NH 2KQZA 5H2FZ 3CRMA 3ECRA 4DV4B 4X65B 1URGA 5L9SA 4OZ9A 1B32A 2KSDA 4NTWA 1GO3F 1QQCA 4NWCA 5B1OA 1L5TA 1EN4A 3SPHA 4FE8A 4GVOA 4WEDA 2Q7HA 2Q8VA 4U3JB 4NG7A 2RQ6A 1MPDA 1Q9DA 4G28B 1PBQA 4ZECA 3QUJA 4DV2B 3FXBA 1FXKC 4BIUA 3H6WA 1VF6C 4WF9V 3C3TA 2CGNA 2YSUB 4JZ2A 4Q8RA 1YPNA 1OJHA 3HKBA 1VE4A 3JD4A 1VQ8V 4DR5B 4DO2A 3DM0A 1PB8A 4NB5A 5EYPB 2PYJA 4I8CA 4JBZA 2UU9B 2ZD9A 5B1NA 3AK1A 2F7CA 4GRKA 3KZIZ 2DYXA 2GRVA 4NGUA 3G3JA 2KG7A 2F43G 4O4LB 4H67A 1XILA 1LUWA 4EFBA 1EYKA 2I3VA 3PPQA 3RVYA 4N6KA 1ZL8B 2QKAA 3IK6B 1MY2A 1N04A 2YJPA 4WKMA 4P9KA 2BJJX 1CPYA 3H1KH 2Q7EA 1K8AW 3O66A 5I59A 3S9NC 3HKDB 4PI0A 1S76D 2MW2B 3A0RA 4UV8A 1LBWA 4FFBA 5B3SC 4WFHA 4MLVA 2UXNA 1IXGA 2HHHB 3KBRA 4ZOLB 1AB3A 5I56A 4IO5A 2UUBB 1H38A 4OXVA 2VOZA 2JDIG 1AWBA 2EIJB 4R2BA 5ET6A 3HKBB 1AI6A 1SQGA 1BHBA 3N2GB 4IR8A 2VD2A 2X6BA 3VQXA 2VQFB 1S3JA 1FQDA 1Y1MA 2O1LA 1YCIA 3SPJA 1QNMA 1LAHE 4XFEA 1FPGA 3BY6A 1I6QA 2DQ0A 4X1YA 3Q27A 2R6GE 2JJ1G 2OYQA 4NF5B 3IX1A 3K01A 4DV0O 1T5EA 4NWDA 4IL6Z 2AGAA 1N34O 5IYZB 2H94A 1Y76A 4WBNA 3RTWB 2KKWA 1SETA 4DXUA 2GDSA 3QK6A 2P6JA 3L74H 1IXBA 2Q67A 1RDXA 1FCKA 3M7MX 3EHBB 5DT6A 4HE2A 2UXCO 2JS5A 2A9HA 2EINB 1NH7A 2B3BA 4POWA 2A7WA 3TYHA 4LH6A 1Q5OA 4LCUC 2Q9TA 1D9QA 2F34A 4B3MB 1H3DA 1LAFE 3MVYA 4R6YA 1KA1A 4MAGA 4BDLA 4TUYA 2V25A 2QS4A 1QUKA 3ZRWA 1IMEA 2P3NA 4M4GA 4OFLA 3H01A 3LSLA 3QSLA 3SJQC 3TUSA 3PPRA 4R8CA 1GVCA 4NAPA 1PL4A 2ZE6A 1NV7A 3T9XB 1D5AA 3SDLA 4QFKA 2ZNTA 1GGGA 4JTDB 2I6EA 1FBGA 3HKEA 4UB8Z 2CAZC 1JMKC 3UP9A 3P3PA 4Q6GA 4Z7EA 4OEUA 4IIJA 4YZZA 2QVRA 2WLNA 4BDNA 3IFXA 3JAMN 3M3FA 3T93B 4QJFB 4Z0IA 1WVJA 4P11A 2QFLA 2YDEA 1M90W 1DTGA 3RY3A 2ZT9B 1SC5B 2EIMB 4FZ0A 1W59A 2XXUA 4MTGA 2P3VA 2IW5A 3DP4A 4FATA 4DR1O 1BTJA 2GTSA 2HJDA 1IURA 1M57C 2GH9A 2XWOA 4QFLA 4GCZA 4RO2A 1H8HG 2KR0A 4AQYO 3G71V 2YIBD 1R1NA 2I0CA 3IOVA 3OM3B 1OIBA 1S7YA 1FPDA 3EHUA 1NVPB 2DYSC 4NF8B 1TA8A 1IBMO 4AI8A 4KI0E 5H6RA 3FVGA 2H4IA 1F9BA 1PNLA 3F5WC 4KCCA 4ELPA 4EF1A 3DP6A 4PHZA 5ICQA 3C36A 1V54C 3IJ4A 3K4UA 1BHAA 2UVGA 3T22A 2WYKA 4XKPA 4XKRA 5J2UA 3EN3A 3WG7B 1POTA 1FXVA 2CGOA 1VF7A 1K34A 2YIAA 3JD3A 1AR1B 4N81A 5KUKA 4PDDA 4WFFA 4GKKB 2I49A 2M8CA 2BSKA 2NXOA 2B4LA 1PV0A 4LBEC 2X0LA 3THOA 4YB5A 4QGPA 2QTOA 2Q0OC 2UYEA 2YIDA 3WU2Z 1E79G 4J11A 4P2ZA 5EQ9A 3EF7A 2UXAA 1QUIA 2X7RB 1QKBA 4CC6A 1FXKA 1B1HA 1B9JA 3ABKB 4JGSA 3KC1A 4GIZA 4ND9A 2BCCH 2W6IG 4RJZA 1Q7YW 1RDZA 1MS7A 4U7OA 5EC1C 1MDP1 2B4MA 1XHXA 5FLXN 3CD6V 2JK5C 4F6RB 1KP2A 2Z8DA 1KUQA 1WJZA 2QKCA 4F22A 1BE3H 2Q7GA 2XHDA 5H8FB 1EZVH 4ISUA 3S2VA 3T1BA 2PY5A 4DXBA 4GXAA 1J95A 2ZYOA 1JNFA 1AL3A 4H6DA 2N04A 2WAMA 1QHTA 1MSWD 2UVJA 4P56A 3V83A 2I4CA 4RK2A 3SYQA 3TODA 1R6ZA 1FPLA 1P1UA 5DTBA 3HPIA 4FECA 2R8TA 5IJ9A 4I0XA 4H37A 1K97A 1JW4A 3ZRXA 3GLBA 4XDJA 1E1RG 1K7DA 1LUVA 2I4BA 4X64O 3FJMA 4QRZA 1FTOA 2CZLA 4TLLB 1YJNV 4FIPC 3SR2C 3J7AU 3CMAV 4N13A 4N4UA 1OCZC 4EQ9A 5IJ0B 1Q82W 5DECA 2EILB 4OGQB 4K0KO 1USYH 2O51A 2O6AA 3B8BA 3PUVE 2HVJC 2PI5A 4R74A 4I50B 1XMQO 4RQEA 1HW7A 2PF4E 4JI4O 2RKMA 2ZCEA 2DVZA 1NUYA 4O4IA 3KJTA 3ZIAG 1NI9A 4PI2A 4ECFA 4I9DA 2JEUA 2WA3A 2OIEA 2XT9A 3TK1A 3UM7A 1QGXA 1GRJA 1BKAA 3QMFA 2AZ0A 4EF2A 4IT5A 5L3DA 4MTFA 5KLVH 1XL6A 3B8MA 5LP6C 1IXCA 1WB8A 2GHBA 5IYBO 3M3LA 1TUBA 1Y74B 1ZWIC 5LP6A 3WG7C 2BSKB 3I56V 1ANFA 1D4NA 4LONB 1QJMA 4MTXA 3F7YC 5C8YA 3JD2A 5EQ8A 3O29A 1AI4A 5F1QA 4QHQA 3WB1A 5H8NB 1F23A 2NLJC 1YJ9V 2WPDG 4I9WA 1B1XA 4HCYA 4BDOA 2A06H 4UCTA 4O2BB 4I4TB 1I69A 4UVBA 4PJ0Z 4KXRA 3DP8A 3P3NA 4IO6A 2DYSB 3RYDA 5BMVA 1NUWA 4DW1A 4LF6O 4YJ3A 4GUNA 3HSTA 2ONSA 1JVXA 4JASA 4THIA 5BR8B 4RPOA 2Y7PA 4ZBMA 3RQTA 1FAFA 1QVFU 4KXPA 3K6XA 1FJ9A 3G3GA 3DXRB 1O63A 4F29A 2QWNB 3FJ7A 2XAGA 2QM4A 4LFBO 4PTKA 4LWSB 2EIMC 4IHJA 4PETA 4OETA 3SDFA 5KHKA 3CC4V 4IY6A 1DF5A 2E0SA 3TKDA 4PFUA 4NYKA 3J81N 1YF2A 1OCOB 2AHYA 1EZOA 2OCCC 4WXJA 1LFHA 1BCCH 4YKJA 4TSFG 1M9NA 1QLEB 1FKAO 3P30A 3GVMA 3E8GA 1YTFB 4P0GA 4FLVA 3LSSA 3W9VA 5CBSA 2HEPA 2DOJA 3E3KA 3VDFA 1SA0B 3DC6A 4R9GA 2BTQB 1NMUA 3L73H 1JVYA 3IO4A 4LATA 2VS0A 3GBBA 1K9MW 3OEEG 4R75A 1KP3A 2RN9A 5K1PA 2VQFO 1HSJA 3TETA 4GOTA 5ITZB 1VQMV 1MZEA 4QNHB 4JSOA 2B9ZA 1SW5A 5B66Z 4TQDA 1IMCA 2IH3C 3K5MA 1JJOA 2THIA 2DWIA 1MPCA 1TT1A 3BFUA 4QBAA 1NH2B 1O64A 2P0SA 4U4SA 3R6UA 3ZCCA 5IDJA 2QSXA 4GWZA 2Z8EA 1TVKB 1B58A 2Y0IA 2NR5A 2XAFA 4YHHO 3O6HA 5L8DA 3G4SV 3ZSFA 3SYOA 3MW0A 1AR5A 4KD5A 1FYJA 2RCVA 2X26A 3E35A 1V55C 4NHBA 2YEVB 3TFLA 3W7SA 2WKYA 4PAIA 3RT3C 1LB8A 4NF5A 3EQ1A 1MNGA 4YKKA 1JFFA 3D1RA 2JJ2G 2Q5ZA 3D8CA 1FPKA 3L75H 5JJJB 3CCRV 3ABKC 3CRQA 3ZHVA 1YEWA 1KQSU 5LOVB 4JI8O 2REJA 2DJVA 3CG1A 4DV7O 4HTGA 4UVCA 3N2GA 2XXTA 1OCCB 3ETEA 2Q8JA 3PUXE 2AZ2A 4NTXA 4HNAB 4KUMA 1GM8A 1KZ8A 2UU9O 3PMWA 2B3FA 5AA2B 4KYDA 4I3YA 4H45A 1LAGE 3OMNB 1XUQA 5KHIA 1BS3A 4G68B 4E4EA 4N91A 2F66C 3S9LC 3A8TA 1Q6IA 4I7ZB 4PFRA 4DV0B 4BDRA 5IYCO 4TV8A 4J41A 2YS8A 2M7WA 3KBZA 3HKDA 4O94A 4WFEA 1XBLA 3THIA 4ZEDA 2F1MA 1US4A 4F4LA 3K9SA 1RSOA 3FB8C 2ZXTA 4IO7A 4DRXB 3ZRVA 2QR4A 5IJ9B 1EBOA 4PCDA 3WAEA 2QWRB 2KG7B 3E83A 4FLYA 1COWG 4MTOA 5EIBC 1NL5A 1AJPA 2Y5KA 4GWOA 4YB6A 4N6PA 3CHGA 2Y69B 2HHHO 2Z0AA 2RINA 1EZJA 1WDNA 4H1XA 4N21A 4UCRA 3H6UA 4JV5O 4QFPA 2HR3A 2EIKC 2ZYMA 1JQ0A 2OWSA 4G68A 3CCLV 2R70A 2W6JG 3SEXA 3H9VA 3G67A 1ZSPA 3CWBH 3X2QC 1MXYA 5TP9B 2X6AA 4MNCA 5EBWC 4GX0A 4FLXA 3VV5A 3K00A 3FB5C 3JZJA 1MY1A 1NUXA 3C32A 4DR5O 1R9QA 3B6QA 3D3IA 5LMNO 5EYGA 3U8QA 3T1YO 4EQBA 4JI3B 4GL8A 4JSDA 1US6A 1YVWA 5EBLC 4MVRA 3AK2A 4IY5A 3MQ9A 4ZZEA 1EN6A 4MVZA 1XI1A 4GKJO 3FV1A 1M57B 2YPNA 1P1QA 3ML0A 2ZIOA 2VGQA 3MVWA 3E4RA 4B7EA 4WFGA 1ROPA 3SYAA 4XDKA 3NOHA 5LYJA 3K58A 3R7XA 3EFFK 2KLFA 3CJHB 1FPJA 2WYPA 3B6TA 5TPAA 1B2HA 1DOTA 2UXBB 2HLDG 3M8AA 4ASUG 1K4DC 3QO8A 4GD5A 5DVJA 1LCTA 3T4ZA 4F2QA 1DK1A 1GR2A 3IC7A 3CFLA 2D5WA 1MA1A 2Z3YA 1FQEA 4JI8B 2LGQA 3U65A 5H5NA 5BZBA 4X66B 3T66A 4N15A 1N32B 4F1YA 2L6LA 3RT8A 1FQBA 2OWZA 3T9VA 3RW0A 1FJGB 1JCHA 4NF6B 5M2VA 2G38A 3HR0A 4HZ3A 2CZIA 1YHQV 1S50A 1XOUA 1Y4MA 3ILUB 3HCQA 4L17A 1GK9A 1M1KW 4NR1A 1B3EA 3KSJA 3C3SA 4N6DA 1HDJA 1NJIW 3QIMA 4YHHB 3BKIB 5LGUA 3S9EA 2A3QA 2D2CB 4X04A 4LWSA 5GW7A 2QMWA 1YCJA 4NX1A 3BCCH 4OPHA 3B8NA 3H4ZA 3RPLB 3GXAA 1JR9A 1A54A 2OCCB 3PD8A 4GWWA 4F1VA 4CZZA 2V3UA 1EU8A 3TCHA 2W0XA 4FLZA 1N76A 2DDKA 4JI6O 3FUZA 2F36A 2XXYA 1B7HA 2PFZA 3ZS6A 4K0KB 3IO6A 1NV0A 4Q20A 4F3PA 3Q4HB 5KHJA 3A3UA 3A0HZ 3E8BA 5TU0A 1XS5A 4IYHA 1N8RW 1FBFA 4QSEA 4JWXA 4CH5A 5IYZA 3OGCC 2QVUA 4PC9A 2RMKB 3TPAA 1SYHA 2I58A 3MZBA 4I62A 4FK5C 5B1BC 1B5HA 3N6UA 2RJZA 5HFMA 2F7BA 4CBCA 3OO6A 4PGPA 1WLEA 2HKOA 5C8YB 5TP9A 3GZGA 4GZRB 3B4SA 2O68A 3N2KA 2O57A 4D7SA 4DR4B 1VMGA 1SERA 2ILMA 2JEXA 3JAKA 4LF4O 3MWBA 2R72A 1NTMH 4OXSA 2OIGA 2QSAA 4W4KA 3CSBA 5BR8O 2CH7A 1LLSA 5FL7G 4O4IB 1MG1A 1VF6A 4RWUA 2CDYA 4PDLA 2H8PC 1H2KA 1NV3A 1SI0A 3MAMA 2DE4A 2OCUA 2H9BA 1B5IA 1PB9A 1ZLZA 2EZOA 1B7UA 3ZJZA 4TWKA 4I50A 3QAXA 2IJJA 1FQAA 4OEVA 4JTCB 5IJ0A 3K2DA 5BUUA 3B50A 1FTAA 3MYUA 4H0LB 1SD3A 4GKKO 1FBDA 5CBHA 1EYJA 3OD7A 4H5FA 5JJNB 1MY3A 3T1HO 1Z7NE 3AXFA 4I0XB 1SRYA 4UCSA 1N7WA 4N8YA 1OCZB 3LDEA 3AG1B 3SPIA 4DR2B 4X62O 5B7DA 3KKYA 3RGBA 3KN8A 4DV1O 1GTKA 3MZ1A 4QF9A 1QVSA 3BHPA 3IFAA 1FXKB 1Z2GA 3RYHB 4NMYA 2WEFA 1MQIA 4RXLA 2F95B 4JI4B 2UUAO 1FTJA 3SYCA 1VQ5V 2WLKA 2XUMA 2KQXA 3LUTB 3JD0A 1ATGA 2DS9A 2PTMA 4AQYB 3CVGA 3TXSA 5CC2A 3LDDA 5EZYB 2ZE7A 2V3QA 3D4GA 1OQHA 1QW0A 3HKCA 5I57B 4U1ZA 2A79B 1JP4A 4N17A 1RM1C 3ASOC 4O8MA 2B1GA 1BT8A 2Y7RA 4GXSB 2N05A 1UPGA 5IAIA 2EILC 3RYCB 3T1HB 5K2XA 3B2EE 5JCOA 1IEJA 1TGOA 2PGGA 2DWAA 5KZTA 5AA4B 2QS3A 4R50A 2F7AA 1MY0A 4KCDA 2ONRA 3BRCA 3OEKA 4BAYA 1KKCA 2XD2A 1MY4A 4OVTA 4P9PA 2ZNJA 3OUFA 1KC8W 5J2UB 5E79Z 5I7IA 4DV3O 2AL5A 2FNCA 1FFXB 3A2FA 1D2DA 3OGIB 5KA6A 5KMGB 5IZ3B 1IBKB 4GBVA 3K5NA 1MXWA 3E13X 2Q9LA 3CRAA 2EINC 5JCOC 4YIOA 2BTQA 4XF5A 2CZKA 4MEVA 1I5XA 3BA9A 3LC8A 1PP9H 5ITZA 3U92A 4H8IA 2CUGA 4QPJA 2ZDIC 3EPEA 2XTAA 4ABMA 4GX4A 2ZDIA 2VPNA 4U7NA 3MDSA 4X1IA 1MXZA 3O28A 1VQNV 1IMAA 1VQLV 2PCRA 2ZE8A 1OCCC 1V9PA 4UFZA 2E76B 1IXMA 4DUYB 3MC2A 5EQAA 3IR1A 1R3KC 2FA7A 3CI8A 3VQYA 5L3GA 3ISPA 2ADPA 2QJ1A 3USDA 1YJWV 4AB6A 2OWTA 4Z1VA 5A9GA 3PD9A 3SZPA 3D3QA 3OTOB 2XXWA 1K3EA 1MXVA 1M5EA 4QE7A 4KFMA 1XL4A 1MM7A 5FPOA 1XDCA 2ATKC 3CXHF 1PB7A 4N8GA 1NZ6A 1SQQH 3AG2C 4HXVA 4R7CA 3HPLC 1OVTA 1SW2A 1POY1 1IBMB 5ELVA 1RFYA 2PX1A 1M56B 3JCZA 3K6VA 1Y4CA 3T1YB 1VQ6V 2HCAA 3UGWA 3RVZA 5CMKA 3FATA 3JATA 4RUFA 4GX1A 4ELQA 3PGFA 1AILA 4JZGA 1PD3A 4TOZA 2IH1C 4GLXA 5FTHA 4N23A 3FB7C 3ICXA 1FPEA 3OUSA 3ABLC 1GN2A 4ICGA 4X20A 5JQGA 4DE8A 1Q90D 3ZRSA 4O2BA 4PELA 1SS3A 4PFYA 1RP3B 2XAQA 3FZVA 1LFIA 3APQA 3H1HH 1CEZA 3O65A 3LUYA 4IGTA 3F7VC 2RC9A 3K6UA 2ABHA 3PPOA 2NVUB 1AR4A 4PFIA 2DMXA 1PEBA 2ZINA 4ZE8A 4JV5B 4JWOA 4ELRA 3C90A 1S77D 3KN7A 1Y76B 3RYCA 3JAWA 2P22C 1DSNA 1FBPA 3E2EA 3W15C 3KSXA 3X2QB 1II5A 4JAVA 2E75B 1B04A 5FNVB 1W2BU 2DXYA 1SQPH 3ZS8C 4RYAA 1R73A 1K4CC 4FLWA 3PUZE 2RNBA 2V3TA 2IA4A 1D3KA 3VOUA 4FBPA 4B3MO 1NU1H 1IBLO 1P99A 4I55A 2XX8A 3H6TA 1GKFA 3G7WA 4LA9A 1FJ6A 4ZI7A 5H8HA 4GWXA 4PFTA 1PDAA 3BA8A 3GWKC 2ZZVA 3TXQA 1AROP 2XWIA 1MH4A 1QUJA 5LGTA 3FVNA 1KECA 1QBZA 1R3LC 3T2MA 2F78A 2X7PA 3MPLA 4ZOLA 2XXQA 3CEIA 2XXVA 2EULA 3BIHA 4OERA 2FYIA 1XMOO 2NWJA 3VQWA 3EVKA 4X65O 4UVAA 4MNPA 1MQGA 1J1NA 1MDQA 2F6PA 3G3KA 4F31B 4L8JA 3LDCA 5DM6V 2QM7A 3SEVA 3ABMC 4FAJA 1H44A 4W4LA 5IYDO 2LW1A 3CCMV 2MKZA 3NXSA 2PBWA 3T9HB 5JJEB 3I55V 1FW0A 1M5DA 1RM1B 2FHYA 5ET5A 2WSSG 3AG4C 3R26A 3LSUA 1D9YA 2X7QA 2CK3G 2Q8MA 1MPBA 3KOTA 4JB7A 4FMTA 4GF8A 4GT1A 1R1BA 3UN6A 1PNMA 1YTVA 1R3JC 5KAFZ 5I5PA 4OTEA 2BOCC 3O97A 1JFFB 4TOIA 3U11A 3OO9A 4I9QA 1M5BA 3FD3A 4NF4B 5KHGA 1VSOA 3R66A 2V93A 1VP7A 2P1SA 5A2QN 4X89A 4IGRA 2G29A 4KYSA 4UCUA 2Y7KA 3BPZA 4BDQA 1XQ8A 2DYRB 5GTIZ 4HCWA 4G8HA 1UTHA 3W7UA 2REGA 2Y84A 1H45A 4JAAA 5AG2A 4HAMA 1NNKA 3SJBC 3ZBHA 5EIBD 4JF3A 1VIBA 1ZKBA 3AK3A 4X20B 2DWHA 4U22A 3OO8A 1GN4A 2ONKE 1USYE 2O69A 3JV9A 3K6WA 4H33A 2D21A 2XXIA 1EZPA 1V55B 3T4DA 3VLWA 1A8FA 1HSEA 1ELJA 1SZXA 1SQYA 3H06B 1WPXA 3K57A 2PMSA 3UO2A 1VEWA 2W0FC 5IZ1A 3S4UA 4RAIA 4O4HA 4K35A 4ZDMA 3J80N 1VARA 4JTAB 1OCRB 4MBPA 1VQKV 3WFVA 4EB6A 3O2AA 4FEBA 5HFLA 3CCUV 1B4HA 1NH2D 3TQWA 1NUZA 3CCEV 3B7DA 5KDTA 1H2GA 2HP8A 4J7ZA 1UJWB 4FIMA 4C1TA 2NUVA 4G8NA 2E74B 2H5YA 1NQTA 4FZ1A 3CS5A 4WCEV 1HNWO 2V4CA 1G1XB 4DIGA 1I5YA 5L3FA 1MSDA 5KDTB 1NVPD 4DI3D 4DW0A 4FPPA 3BAAA 2PZSA 5B1BB 2F8DA 1R6TA 4OVQA 1P84F 4IHJB 1QLEC 4TUYB 3K02A 3CMEV 3KN3A 3FB6C 3K0DA 3PMVA 3SEYA 3GWOA 4X8AA 4I4TA 4AQ4A 2Q69A 4BDMA 1MXUA 2EJRA 3K79A 3KEIA 1IMDA 4YJ3B 4FM0A 1CE2A 1JW1A 1KYOF 3JD1A 2CTPA 4B3TO 1Q6UA 1MM6A 4PDMA 5BMVB 4GX3A 1R6KA 2AXTZ 1FFXA 1R3IC 4WFBV 2RC7A 3HN0A 2XWVA 3LSXA 3AG3B 2Y48A 4WEPA 2UUCB 5JK4A 1TAEA 1QVGU 1I94O 3PPPA 5H8NA 2GUZB 1XMQB 1CB6A 3H1IH 3U1OA 1OCRC 4X1YB 5JTYB 1U96A 4RNSA 3SESA 1CNQA 2P67A 4GL0A 3IB1A 4LFBB 4WFAV 2ZZWA 2ZNSA 4NN3A 5CBGA 4X64B 4NE4A 1CP9A 2JIZG 5I57A 4YIPA 1IUDA 3TTMA 2E3CA 3M3KA 5DW8A 3D4CA 4LF6B 2PT2A 2XXRA 1SW1A 3UCSC 1AJQA 3FAVA 3LR1A 3A09A 4ZEFA 5I58B 1TUEB 3EHSA 4PDRA 1KKDA 4MVMA 3MSTA 5CA1A 5F7VA 1AH5A 3E8FA 4UB6Z 3CR9A 2LAOA 4YU0A 2DE0X 1TFDA 1QR9A 2LP7A 3SYPA 3BFTA 3JASB 1EM1A 2QM8A 2R9RB 3CRRA 3ZEDA 4JI2O 1DCUA 4KL1A 1LBBA 4F18A 4QFOA 4PBQA 4DRXA 5DYHA 3K5OA 1FSAA 1B4ZA 5I59B 3FGSA 5IE9A 1YAEA 5IGAA 1TXFA 2ARHA 1FQCA 4J80A 3KZGA 4GX5A 5HPQA 3OELA 1FD9A 3Q29A 3K08A 4MMPA 1NT2B 2Z5UA 4F6EA 1Q3EA 2QWPB 4R2FA 3KCYA 1WN7A 2ODMA 2IEEA 3ONMA 3T9UA 4ZS9A 4F3BA 3TTNA 1RYXA 3JALA 3RT6B 1PKXA 1LBZA 4NXNB 4PF6A 4XBFA 4CS4A 4FJPA 2ITCC 3FV2A 1B3LA 2O1MA 1YZBA 1RKMA 4O4HB 3AG1C 1S9TA 2QVVA 5CMMA 2OWOA 4DCYA 1B46A 2CE4A 1YYZA 4UXNA 3TELA 1JEUA 2FIEA 1NV5A 3B40A 1N0TA 4KPTA 4YB7A 5J16A 4J10A 4PD4F 4XKNA 2FMLA 2QMXA 2HXRA 4J42A 1ZAUA 2OT5A 4YMBA 1AP5A 1XT8A 2ITDC 1MQJA 1A8EA 1LFGA 2W7YA 3FVKA 3QO5A 3PV0E 4JVDA 3OENA 5DEXB 2CTQA 3SERA 3MHSC 3K0VA 2P2AA 2M6YA 1N3WA 3TTLA 2PFYA 3MD0A 3CP1A 1XHYA 2QS2A 2I48A 5J2TA 1F7YA 1FBEA 1W0KG 2DN9A 3HV1A 1GV8A 4JI1O 2B5UA 3RPWA 3U93A 4UCVA 1YITV 4YJ2B 4O4JB 1E1QG 3PN1A 5FBPA 1LNQA 2XX9A 3IOUA 1HNZB 5GONA 3ILTB 2RF1A 4EXKA 3EHTA 4G27B 4MNIA 5H8QA 5CMUA 3IB2A 1JPXA 5EYHA 2HAVA 2L35A 1SESA 4ELOA 4NXMO 1BK4A 3HO7A 3F11A 2OTLV 2WLIB 1D9VA 3ZMSA 1S5LZ 1PPJH 2LO1A 4PDVA 4K3FA 2H98A 5ISUA 2ADQB 2B65A 4KQPA 2Q88A 5IZZA 4MW3A 1H2LA 4BWAA 1LAXA 5ET7A 3O6IA 3H7MA 4JI3O 2Y4UA 3I3VA 4I40A 3JASA 5LDZA 4R6ZA 1TFAA 4KYEA 3G3HA 3TTRA 5ITOA 4GWSA 5CA1B 1QULA 1BLFA 5LA6A 2GHAA 3IJOB 1DPPA 1WODA 2AW9A 4ZI7B 3Q26A 2IU0A 5KA5A 3K5LA 3FVOA 4PFWA 3BEHA 1VQ9V 4B7KA 3ABLB 2V7QG 2FTKA 4U3FH 3OEHG 1WB7A 1IZ3A 2Q89A 4NTLA 1NH8A 5CA0A 3TGUH 3CCJV 1FPOA 2P4KA 3K1MA 2IU3A 3TQLA 4G4PA 4DR7B 4NQ8A 2YI8A 5FNVA 3ZMVA 2UUBO 3B77A 2FL4A 2VWKA 3H1JH 3FXRA 3OR7C 3UKMA 5LL6Y 2HG5C 5EZYA 3FBPA 2ZXWB 1Z5VA 3RWRD 3ZX6A 2XAHA 3VBBA 5KCJA 5CB4A 5IM2A 3OSQA 1SQXH 4DV5B 1FBHA 3TMGA 2LW7A 3OW2U 3BBRA 4GYCB 3FXUA 2XXPA 1BGYH 4MSWC 1G0IA 4ESXA 3RTFB 1NV1A 5JH7B 4A5UB 1Y3QA 1AJNA 1Z7ME 1XC1A 3CCVV 4LC1A 3G6BA 1P1WA 2QPQA 4U21A 1BMFG 2D3IA 4RY1A 4B08A 4X88A 5AA2D 4LFCB 1S5JA 4P0IA 4J9ZB 4EEQA 3E89A 1ZJLA 3E9XA 1N34B 5H6QA 2OK2A 5IKBA 4R6KA 4DCXA 1SF9A 4DR3B 5FPRA 4CS2A 1LB9A 2NNUA 3L71H 4BIZA 2UUCO 1BQ0A 4X48A 4DV7B 4K8XA 1K9YA 5LHHA 4LH7A 4LNUA 4B3SB 4ZEBA 3VE1B 4K3AA 3RGYA 3SKPA 4LUBA 2JVDA 5H8FA 4IYIA 1GH6A 4I1DA 2DP8A 4F6RA 1YTFD 3WAFA 1IQ7A 5LOMA 2HHMA 4FM2A 4FJCC 3AEIA 2DQ3A 2WBDA 3O6GA 4H5GA 2FB5A 4OVPA 2ZM6B 3FX7A 5JVDA 4BIOA 2XXXA 3OD4A 2Y69C 5CI5A 2CH7B 1I7FA 1HNXO 2Y5LA 3ASNB 5IWAO 1A32A 1FTKA 1X59A 3SPGA 2JGDA 3MP6A 4OHNA 3V8XB 1EZ9A 4U23A 5IY5B 1Q81W 3B09A 3CX5F 5LOVA 1KU9A 3KJ7A 4GWUA 3DGEA 5LXTB 4U2RA 2C2AA 3P32A 3SPCA 5IWAB 4XTCQ 4LR3A 4DV6O 1HNWB 2A5TA 4PF8A 5D5QA 1G8MA 3PJSK 2ZM6O 4Z1MG 5DEXA 4JDFA 1LBVA 1O9HA 3QNEA 1P1OA 3G3IA 1IXIA 2FVZA 4MVQA 2CMOA 1ZU0A 5EYFA 3OR6C 5KX5B 3BVOA 3Q4HA 4B3SO 2V4DA 4JYBA 4P3LA 3ZHTA 3FYEB 4YKPA 5AE4A 3ASNC 1XREA 5BY1A 2P4VA 3CC2V 3CC7V 4DR3O 4OMBA 4PAFA 1JOYA 3ETQA 2BTOA 3QUFA 4TQUQ 4QFNA 4TV9B 5LTCA 4KHPB 1B06A
chains in the Genus database with same CATH topology
4BLAA 1FQFA 2HAUA 2ZXWC 3FJGA 1S0VA 3OO7A 1Y9UA 3N26A 4H8JA 3C31A 2GSMB 3UK4A 4PP0A 3CCSV 2ZYKA 2UYFA 3KFMA 3E86A 4MF3A 4O3CA 5AA3A 3QXMA 1B05A 3R65A 2XOKG 2IJHA 3K3WA 3G3FA 4DDDA 2IJIA 4IO3A 5I2NA 5H9CA 4F19A 2KB1A 3I5OA 3TCUA 3CXCU 2DE3A 3AG2B 5TPAB 1ZTYA 3N5LA 4G2ZA 5H8HB 2DQVA 4YXWG 3ZMZA 1VFEA 1EFRG 4GLIA 1MXXA 5A5XB 3JYRA 1IZ1A 2PVUA 4MVUA 3MJNA 2I3WA 4JYCA 1N7XA 1Y3PA 4ZKIA 1UTBB 2ZYNA 1HSLA 2WLHA 1NNFA 1PL0A 5EHSA 3IOTA 3K9AA 1LBCA 5L9OA 4XDLA 3LNMB 5L3BA 1H76A 3CG3A 2X6CA 3I6VA 2Y7IA 2AL4A 1OQGA 4QSDA 1A55A 3OFNG 1DF4A 1VQOV 2ESNA 3CPWU 2Z23A 4MLQA 3K0GA 3FIRA 4Q30B 4PA7A 3TDJA 2R9IA 2R71A 4JWYA 5B1AB 5EHMA 1OLAA 4G2KA 2ZNUA 3IB0A 2DW4A 1F4NA 1JEVA 3TEPA 4XXUA 3K1NA 3Q28A 1AOVA 4U4XA 2XASA 3MVZA 2AHZA 2ZQMA 5IY5C 5I84A 4E2LA 3ZMTA 4OYVA 4KP4A 2RCBA 3KGCA 3H6VA 5L3CA 5FHNA 4ZZAA 1AMFA 2F6GA 5H8QB 3DLNA 3IL1B 1DPEA 3RLFE 1ZIUA 2YLNA 1RPRA 4LZ5A 1GMGA 2DWJA 1NFTA 2O7IA 3VVDA 4HS7A 4UUJC 3OMAB 1UTHB 2MK3A 4MS2A 1BIYA 4G68C 4POXA 2Q68A 4Q0CA 3TZAA 4OFJA 1PNKA 2D3OW 1NR7A 1A40A 2Z8FA 4KFQA 1B7ZA 3OMIB 3LSQA 5LHIA 1IXHA 3MP8A 3PMXA 4NF4A 3A3CA 5CBRA 4DLDA 5LGNA 4RA1A 2F97A 4PE5B 3STZC 3IORA 3CSGA 3CRBA 4PA9A 2H99A 1ZLQA 5HM4B 3ZN0A 1B51A 3DTUB 3G6EV 4I5SA 4QE9A 4MFIA 3VLUA 3L6GA 3ABMB 5ITPA 3ABUA 1A7LA 2HFBA 1B3FA 4R6HA 1M5FA 2QL3A 5EBMC 3UA8A 3QYTA 3KG2A 2DE2A 4Q5TA 3ZKLA 4YAHX 1URSA 1OLCA 3UORA 1B6HA 2E1SA 5HBCA 2IJKA 3RUMA 2HQ0A 4KR5A 1YSCA 2OJTA 4U1OA 3VXBA 3Q25A 5K2YA 1H43A 3D36A 4OQOA 1JJ2U 2NOOA 3K06A 2QS1A 3TAJA 1URDA 2O7UA 1FTLA 1HWYA 1JW5A 1Y4TA 1SVXB 1JQFA 2WLLA 1VQ4V 2G93A 2UXXA 1B40A 4F1UA 1VR5A 4YKIA 1DLBA 4QPKA 3CYOA 4LP8A 5A5XA 1T0KA 5CBFA 3CFXA 2YEVA 1FTMA 4X9TA 3L6HA 3HHGA 3MHHC 5CM6A 1ZBMA 5B1AC 3RBZA 1Y1ZA 1SDXA 5I56B 2ZR2A 3C34A 5CN0A 5DVIA 1K92A 4XKQA 5I2KB 4X1BA 4MVOA 5B3SB 1I6BA 5L3EA 3RN8A 5JEIA 2DVCA 2Y7WA 4F3GA 4O3AA 2DWDC 1SYIA 1S72V 1UIUA 2Q2AA 2ALUA 4BW5A 4OESA 2WLJA 4GX2A 3VFJA 4RQFA 2ZR3A 3ABTA 3PUYE 4PA3A 3MPKA 4NF6A 1SBPA 3SEWA 2WLMA 1B6QA 1YI2V 1Q1KA 3C33A 1IITA 2V84A 2DSFA 2PT1A 1OCOC 3S9MC 3O9PA 1ORQC 1DTOA 1NNTA 1SZTA 2H25A 5J9PC 3TTKA 3AG4B 5J1DA 4EKWA 2ANJA 2AIXA 2OZZA 2UVIA 4MW8A 2DYRC 1QR8A 4KHZE 4R73A 1NNPA 2PYYA 1JVMA 4RUEA 1LCFA 4F2OA 1QKAA 3ETDA 1SW4A 2GHYA 3VXCA 4ZE9A 1B3GA 5FHOA 1S5HC 4TLMB 4L87A 2P7TC 2DXRA 3ODBA 3H03A 5L9MA 1AI7A 3MVXA 4R72A 1B3HA 3CFZA 4H0WA 3W7WA 3MZ9A 1KD1W 1US5A 5AA1A 3LBSA 1IIWA 1LSTA 4J9YB 4OWDA 3HHFA 5EK0A 1XVXA 4DXWA 2XD3A 1PC3A 1I6AA 4G77A 4GFRA 4F39A 3JYCA 3OEMA 5EC2C 1B0HA 2V1DA 1NKXA 5I2KA 4R9FA 2Z22A 3ZRWB 4JAUA 1MRPA 1ENVA 1L1FA 2PI4A 1N3XA 4LP2B 5KCJB 2QE7G 4QSCA 3FYIB 1FS0G 3E8HA 5AA2A 1F4MA 1BL8A 1YIJV 4DZ1A 3V5AA 1QLNA 4G8MA 4LZ8A 1B0LA 1W0JG 4X1DA 4RK9A 5CRYA 3AG3C 2OTJV 2QRYA 3ZN1A 1LGBC 3TCFA 1O7TA 3M8UA 3MP1A 2F5XA 3IAZA 1UQWA 3QO7A 3SEUA 3CIJA 3V89B 5LHGA 3W7XA 3FKSG 3PPNA 3OE7G 5E1AC 1QCEA 4JXIA 2QA4V 3T1CA 2HVKC 1VQ7V 4NF8A 5I2NB 4TT3G 4UACA 4ZEKA 1M56C 1NKDA 2OBGA 1P7BA 2I0BA 1K5SA 1FFTB 2XAJA 3PUWE 3C9HA 1OZ0A 2K1EA 4QIWF 2EIJC 1M5CA 2AYSA 1P1NA 4IB2A 1A99A 3ASOB 4EUOA 5B70A 1R9LA 2DWEC 3OAAG 1K73W 3MUQA 3MBPA 1OHHG 3C4MA 3K1PA 2F35A 1MQDA 2RC8A 1RYOA 1Y20A 4NEDA 4GQOA 5CA3A 2P90A 3ETGA 1OMPA 4UA8A 1R6NA 4LQ2A 1K5QA 1DTZA 5BWJA 4MH5A 4P9OA 4OVJA 4JPRA 4YICA 4LQ5A 3VLVA 2A0LA 2XX7A 2HZKA 1MQHA 2QJEA 1JETA 3N6TA 4PQJA 4MT8A 2Q2CA 4IO2A 5DN6G 1BP5A 5AA4A 2A5TB 4PA4A 1GTOA 4C1UA 1DMBA 1AI5A 3IOWA 4OENA 2EIKB 3OOAA 4XIGQ 4ESWA 3LSFB 3KOSA 3SETA 3ZKKA 3ZMUA 5C93A 1FXHA 3STLC 2VP1A 1G4YB 1MABG 1SI1A 3FASA 1NR1A 3PU5A 1P4RA 1EH3A 2ZMBA 5DVFA 4EDPA 3OSRA 2O84X 2OLBA 1PBPA 1Q35A 1Y3NA 5I58A 1OVBA 4E0WA 3U72A 2BOBC 4AB5A 3M99B 1V54B 1H8EG 2EBOA 2LFSA 3OXNA 3H3GA 1VFDA 2HJFC 2R9JA 4LVQA 2XNDG 1UTBA 1K33A 2WLLB 3U94A 3IGAC 3VVEA 5FHMA 4HW8A 1F51A 4IO4A 4N07A 4FEDA 2VD3A 3GBAA 4M1VA 1JX9A 4LZ7A 2B1IA 1XOCA 2RCAA 3B6WA 3UIFA 4C0RA 4FORA 5ICTA 1N84A 1UIVA 3W9WA 4O3BA 1VQPV 1XVYA 3GB7C 1KWHA 4DXCA 4OFOA 5KUMA 2QKSA 2UVHA 1Y66A 1GM7A 1THZA 4E0XA 4YMAA 3LSWA 4P30A 2VHAA 4ONYA 3FXQA 5LBQA 2QEXV 3DELB 4PA6A 3K04A 3VVFA 3RNNA 3P7IA 4MVSA 5CMBA 2HXWA 2HEUA 3HB3B 5H8SA 2WLIA 3T96B 1GM9A 2EZPA 2XXHA 3OMBA 1NBMG 1Q86W 5FTIA 2A5SA 1MH3A 3N94A 1ZMGA 1B5JA 4EQ7A 2HFEC 3W7TA 1TWYA 4H65A 1B52A 1RPOA 2HZLA 3C35A 3K03A 2GFEA 3CCQV 4HYOA 4RPNA 5CMCA 2LFRA 2WWWA 4F3SA 2Q6AA 4ZEIA 1MOFA 4UV9A 1AIVA 4EXLA 3IJXB 3ECRA 1URGA 5L9SA 4OZ9A 1B32A 4NWCA 1GO3F 1L5TA 5B1OA 3SPHA 4FE8A 4GVOA 4WEDA 1MPDA 4G28B 1PBQA 4ZECA 3QUJA 1FXKC 4BIUA 3H6WA 4WF9V 2YSUB 4Q8RA 1YPNA 1VE4A 3JD4A 1VQ8V 4DO2A 3DM0A 1PB8A 4I8CA 4JBZA 2ZD9A 5B1NA 2F7CA 4GRKA 2DYXA 2GRVA 3G3JA 2F43G 4H67A 2I3VA 3PPQA 3RVYA 3IK6B 1MY2A 1N04A 2YJPA 4WKMA 2BJJX 1CPYA 1K8AW 3O66A 5I59A 3S9NC 1S76D 3A0RA 4UV8A 4MLVA 5B3SC 4WFHA 2UXNA 1IXGA 3KBRA 5I56A 4IO5A 1H38A 4OXVA 2VOZA 2JDIG 2EIJB 4R2BA 1AI6A 1BHBA 2VD2A 2X6BA 1S3JA 1FQDA 1Y1MA 2O1LA 3SPJA 1LAHE 1I6QA 3BY6A 2DQ0A 3Q27A 2R6GE 2JJ1G 4NF5B 3IX1A 3K01A 4NWDA 2H94A 3RTWB 1SETA 4DXUA 3QK6A 2P6JA 2Q67A 1FCKA 3EHBB 5DT6A 2A9HA 2EINB 1NH7A 2B3BA 4POWA 3TYHA 4LCUC 2Q9TA 2F34A 1H3DA 1LAFE 4R6YA 3MVYA 4BDLA 2V25A 2QS4A 1QUKA 3ZRWA 4OFLA 4M4GA 3H01A 3LSLA 3QSLA 3SJQC 3TUSA 3PPRA 4R8CA 1GVCA 3T9XB 4QFKA 2ZNTA 1GGGA 4JTDB 2I6EA 3UP9A 4Z7EA 4OEUA 4YZZA 2WLNA 4BDNA 3IFXA 3M3FA 3T93B 4QJFB 4Z0IA 1WVJA 4P11A 1M90W 1DTGA 3RY3A 2EIMB 2XXUA 4MTGA 3DP4A 2IW5A 4FATA 1BTJA 2GH9A 4QFLA 1M57C 4GCZA 4RO2A 1H8HG 3G71V 1R1NA 2I0CA 3IOVA 3OM3B 1OIBA 1S7YA 3EHUA 1NVPB 2DYSC 4NF8B 4KI0E 5H6RA 3FVGA 2H4IA 1F9BA 1PNLA 3F5WC 4KCCA 4ELPA 4EF1A 3DP6A 5ICQA 3C36A 1V54C 3K4UA 3T22A 1BHAA 2UVGA 4XKPA 4XKRA 3EN3A 3WG7B 1POTA 1FXVA 1K34A 3JD3A 1AR1B 5KUKA 4WFFA 2I49A 2M8CA 2NXOA 4LBEC 2X0LA 4YB5A 2QTOA 2UYEA 1E79G 4P2ZA 3EF7A 2UXAA 1QUIA 2X7RB 1QKBA 1FXKA 1B1HA 1B9JA 3ABKB 4JGSA 4GIZA 4ND9A 2W6IG 4RJZA 1Q7YW 1MS7A 4U7OA 5EC1C 1MDP1 3CD6V 2JK5C 2Z8DA 1KP2A 4F22A 2XHDA 5H8FB 4ISUA 3S2VA 4DXBA 4GXAA 1J95A 2ZYOA 1JNFA 1AL3A 4H6DA 2WAMA 1MSWD 2UVJA 3V83A 2I4CA 4RK2A 3SYQA 3TODA 1R6ZA 1P1UA 5DTBA 3HPIA 4FECA 4H37A 1K97A 1JW4A 3ZRXA 3GLBA 4XDJA 1E1RG 3FJMA 2I4BA 1K7DA 4QRZA 1FTOA 2CZLA 4TLLB 1YJNV 4FIPC 3CMAV 4N13A 4EQ9A 1OCZC 1Q82W 2EILB 2O51A 1USYH 2O6AA 3PUVE 2PI5A 2HVJC 4R74A 4RQEA 2RKMA 2DVZA 3KJTA 3ZIAG 4ECFA 4I9DA 2JEUA 3TK1A 3UM7A 4EF2A 5JTYA 1BKAA 5L3DA 4MTFA 1XL6A 3B8MA 1IXCA 2GHBA 5IYBO 3M3LA 1ZWIC 3I56V 3WG7C 1ANFA 1D4NA 4LONB 1QJMA 4MTXA 3F7YC 3JD2A 3O29A 1AI4A 5F1QA 4QHQA 5H8NB 1F23A 2NLJC 1YJ9V 2WPDG 4I9WA 1B1XA 4HCYA 4BDOA 1I69A 4UVBA 3DP8A 4IO6A 2DYSB 3HSTA 2ONSA 1JVXA 4JASA 4THIA 4RPOA 2Y7PA 4ZBMA 3RQTA 1QVFU 3K6XA 3G3GA 1O63A 4F29A 3FJ7A 2XAGA 2EIMC 4PETA 4OETA 3SDFA 3CC4V 4IY6A 1DF5A 2E0SA 3TKDA 4PFUA 1OCOB 2AHYA 1EZOA 2OCCC 4WXJA 1LFHA 4YKJA 4TSFG 1M9NA 1QLEB 3P30A 3E8GA 1YTFB 4P0GA 3LSSA 3W9VA 5CBSA 2DOJA 3E3KA 3VDFA 4R9GA 1NMUA 1JVYA 3IO4A 4LATA 3GBBA 1K9MW 3OEEG 4R75A 1KP3A 1HSJA 3TETA 4GOTA 1VQMV 4QNHB 4JSOA 1SW5A 2THIA 2IH3C 2DWIA 1MPCA 1TT1A 3BFUA 1NH2B 1O64A 2P0SA 4U4SA 3R6UA 3ZCCA 5IDJA 2QSXA 2Z8EA 1B58A 5L8DA 3ZSFA 2XAFA 3O6HA 3G4SV 3SYOA 3MW0A 4KD5A 2X26A 3E35A 1V55C 2YEVB 3TFLA 3W7SA 2WKYA 1LB8A 4NF5A 3EQ1A 4YKKA 2JJ2G 3CCRV 3ABKC 1KQSU 2REJA 3CG1A 4HTGA 4UVCA 2XXTA 1OCCB 3ETEA 2Q8JA 3PUXE 4KUMA 1GM8A 3PMWA 2B3FA 5AA2B 4KYDA 1LAGE 3OMNB 4G68B 3S9LC 4BDRA 5IYCO 2M7WA 4WFEA 3THIA 4ZEDA 1US4A 4F4LA 3FB8C 2ZXTA 4IO7A 3ZRVA 1EBOA 3WAEA 3E83A 1NL5A 1COWG 4MTOA 1AJPA 4GWOA 4YB6A 4N6PA 2Y69B 4H1XA 2RINA 1EZJA 1WDNA 4N21A 3H6UA 4QFPA 2HR3A 2EIKC 2ZYMA 1JQ0A 2OWSA 4G68A 3CCLV 2W6JG 3SEXA 3X2QC 1MXYA 5TP9B 2X6AA 5EBWC 4GX0A 3VV5A 3K00A 3FB5C 3JZJA 1MY1A 3C32A 1R9QA 3B6QA 3D3IA 3U8QA 4EQBA 4GL8A 4JSDA 5EBLC 4MVRA 4IY5A 3MQ9A 4ZZEA 4MVZA 3FV1A 1M57B 2YPNA 1P1QA 3ML0A 2VGQA 3MVWA 3E4RA 4WFGA 1ROPA 3SYAA 4XDKA 3R7XA 3EFFK 2KLFA 3B6TA 5TPAA 1B2HA 1DOTA 2HLDG 4ASUG 1K4DC 3QO8A 4GD5A 5DVJA 1LCTA 3T4ZA 4F2QA 1GR2A 3IC7A 3CFLA 2D5WA 1FQEA 2Z3YA 5BZBA 3T66A 4F1YA 3RT8A 1FQBA 3T9VA 3RW0A 1JCHA 4NF6B 5M2VA 4HZ3A 1YHQV 1S50A 1Y4MA 3ILUB 3HCQA 4L17A 1GK9A 1M1KW 1B3EA 3KSJA 1NJIW 3QIMA 3BKIB 5LGUA 3S9EA 5GW7A 2QMWA 1YCJA 3B8NA 3H4ZA 3GXAA 1A54A 2OCCB 3PD8A 4F1VA 4CZZA 2V3UA 1EU8A 3TCHA 3FUZA 1N76A 2F36A 2XXYA 1B7HA 3ZS6A 3IO6A 4Q20A 4F3PA 3A3UA 3E8BA 5TU0A 1XS5A 1N8RW 4QSEA 4JWXA 3OGCC 3TPAA 1SYHA 2I58A 3MZBA 4I62A 4FK5C 5B1BC 1B5HA 3N6UA 5HFMA 2F7BA 4CBCA 3OO6A 1WLEA 2HKOA 5TP9A 3GZGA 2O68A 1SERA 2JEXA 3MWBA 4OXSA 3CSBA 1LLSA 5FL7G 1MG1A 3MAMA 1SI0A 4PDLA 2H8PC 2DE4A 2OCUA 2H9BA 1B5IA 1PB9A 2EZOA 1B7UA 3ZJZA 4TWKA 3QAXA 2IJJA 1FQAA 4OEVA 4JTCB 3K2DA 5BUUA 1SD3A 5CBHA 4H5FA 3OD7A 1MY3A 1Z7NE 3AXFA 1SRYA 1N7WA 1OCZB 3LDEA 3AG1B 3SPIA 5B7DA 3KN8A 3MZ1A 4QF9A 1GTKA 1QVSA 1FXKB 4NMYA 1MQIA 4RXLA 1FTJA 3SYCA 1VQ5V 2WLKA 3LUTB 3JD0A 1ATGA 2DS9A 3CVGA 5CC2A 3LDDA 2V3QA 3D4GA 1OQHA 1QW0A 5I57B 4U1ZA 2A79B 1RM1C 3ASOC 2B1GA 2Y7RA 4GXSB 5IAIA 2EILC 5K2XA 1IEJA 2DWAA 5KZTA 5AA4B 2QS3A 4R50A 2F7AA 1MY0A 4KCDA 2ONRA 3OEKA 4BAYA 2XD2A 1MY4A 4P9PA 1KC8W 3OUFA 2AL5A 2FNCA 5KA6A 1MXWA 3E13X 2EINC 1I5XA 3LC8A 3U92A 4H8IA 4QPJA 2ZDIC 3EPEA 2ZDIA 4U7NA 3O28A 1MXZA 1VQNV 1VQLV 1OCCC 1IXMA 3MC2A 3IR1A 1R3KC 2FA7A 3CI8A 5L3GA 3USDA 1YJWV 4AB6A 2OWTA 3PD9A 2XXWA 1K3EA 1MXVA 1M5EA 1MM7A 4KFMA 1PB7A 1XL4A 2ATKC 4QE7A 3TCGA 3AG2C 4R7CA 3HPLC 1OVTA 1SW2A 1POY1 5ELVA 2PX1A 1M56B 3JCZA 3K6VA 1Y4CA 1VQ6V 2HCAA 3UGWA 3RVZA 5CMKA 3FATA 4RUFA 4GX1A 4ELQA 3PGFA 1PD3A 4TOZA 2IH1C 5FTHA 4N23A 3FB7C 3OUSA 3ABLC 4DE8A 3ZRSA 4PELA 4PFYA 2XAQA 3FZVA 1LFIA 1CEZA 3LUYA 4IGTA 3F7VC 3K6UA 2ABHA 3PPOA 2NVUB 1PEBA 4ZE8A 4JWOA 4ELRA 1S77D 3KN7A 1DSNA 3W15C 3E2EA 3KSXA 3X2QB 1II5A 4JAVA 1W2BU 2DXYA 4RYAA 1R73A 1K4CC 3PUZE 2V3TA 2IA4A 1D3KA 3VOUA 2XX8A 1P99A 3H6TA 1GKFA 3G7WA 4LA9A 5H8HA 4PFTA 1PDAA 1AROP 1MH4A 1QUJA 5LGTA 3FVNA 1KECA 1QBZA 1R3LC 3T2MA 2F78A 2X7PA 3MPLA 2XXQA