1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
3K6VA 2HEUA 1QBZA 1J1NA 3QYTA 1VFEA 3A3CA 2XXHA 4N6PA 3P7IA 2NVUB 1MQIA 2X26A 1HSLA 3T9XB 1US5A 3PUZE 1I5XA 1PBPA 4R6HA 3VDFA 3GLBA 1MXXA 3THIA 4LQ5A 2O6AA 3EHSA 2NWJA 4GF8A 5H8FB 2DP8A 1Y3QA 1URSA 1DLBA 5KCJA 3K6WA 3QXMA 2DQVA 4OQOA 1N3XA 3CR9A 1H43A 1NFTA 3N94A 1B0HA 4R9GA 5DT6A 1Y9UA 4FIMA 1LAGE 3UIFA 3Q25A 2M7WA 3KSJA 4OENA 3SERA 1JNFA 4HW8A 2QRYA 1MH4A 4RXLA 3DP4A 3VXCA 5KZTA 4WKMA 4IY6A 1SW5A 2I6EA 1ZJLA 5FTHA 1FQBA 3KOSA 2F8DA 2P6JA 4NWDA 2Q89A 3QK6A 2UXAA 2O1MA 1YPNA 5B7DA 2HFBA 3MZ9A 4DIGA 3TTLA 2E1SA 3CFXA 1LB8A 2X7RB 4L17A 3I5OA 5DEXA 1XT8A 3IOUA 5KDTB 3M3FA 1A40A 2ZYOA 1FCKA 4I62A 3CVGA 5EHSA 5DTBA 2AL4A 5L9MA 5I2NB 4ZE9A 1IITA 4NF8B 2P2AA 3WFVA 5H8QA 3MPKA 3IJXB 1B51A 5ICTA 4NF4B 4JXIA 4OERA 4KI0E 4GQOA 5FHMA 3MP8A 2LAOA 1MY0A 4GXAA 1Y66A 1POY1 3U92A 3SEYA 1GGGA 4NMYA 1K33A 1MPDA 4F29A 1OVBA 1NL5A 5BWJA 1DOTA 1Y4CA 2V93A 3W9WA 3TUSA 4QFPA 4FJCC 5IKBA 4R2BA 3HCQA 4GFRA 2V3UA 1B6HA 2H25A 3FV1A 3GZGA 5CBSA 4KCCA 4RJZA 2ZNUA 2NXOA 2XX9A 2P0SA 3Q29A 4MFIA 2CZLA 1P1WA 3G3GA 2FNCA 4RYAA 1NH8A 4G8NA 2Y7IA 3PU5A 3TTNA 2DOJA 3PMVA 4UA8A 3C31A 1WDNA 1MY3A 2OBGA 1MY4A 1OQGA 1SI1A 1B7ZA 2PT2A 2OK2A 4LATA 3S9LC 5CMUA 2REJA 3GWOA 4N13A 2PBWA 5JK4A 2QS4A 3RTWB 3ZSFA 3V8XB 3P30A 3TTKA 3PMXA 1B05A 3FXRA 3SEVA 1QUIA 3PGFA 1MQHA 4JSDA 2EBOA 1I5YA 2XHDA 4UACA 2VOZA 1N3WA 5I59A 3UK4A 5AA2B 2X7QA 3LSFB 1XC1A 4YICA 3CRBA 5I2KA 4DDDA 4H67A 2R71A 4EXKA 2OWSA 3JYRA 3TEPA 2YPNA 3KGCA 3RQTA 3SKPA 3OOAA 4F22A 2OCUA 1B3FA 4FECA 2ABHA 3MWBA 1XOCA 3KBRA 4MLVA 3MP6A 4NF5B 3TPAA 1MXWA 4KPTA 5H9CA 4U1ZA 4BDNA 2W7YA 4C1TA 5HM4B 2ZNSA 1XVXA 4PFUA 4ZE8A 4XTCQ 2XXTA 4P0GA 5H8FA 1B7HA 3FVOA 1H44A 3D4CA 4OHNA 1P99A 1JEUA 2B3BA 3PPPA 1QW0A 4FE8A 5K2YA 2UYFA 3BKIB 5IAIA 2DXRA 2V25A 3FVGA 2PVUA 2EZPA 2VGQA 3KEIA 3TCGA 3LSLA 3C4MA 3HV1A 3W9VA 1EU8A 3H06B 4U2RA 2AL5A 1JEVA 2IA4A 4ONYA 1DF4A 2MK3A 3G3HA 4YKPA 1F9BA 3C9HA 3HPIA 4GOTA 5H8HB 3IR1A 1OLCA 1IZ1A 4R74A 3PUWE 3CFZA 3IJOB 1AH5A 5TPAB 4OMBA 1HSEA 4IO4A 2F5XA 2F6PA 4O3CA 2D3IA 4ELRA 3RGYA 2YJPA 3HN0A 1S9TA 2DWJA 1VFDA 3FIRA 4YB7A 1VE4A 5I2NA 1QR9A 4H8JA 4ZEDA 4DCXA 4R73A 1PB8A 4NF8A 3VLVA 2H9BA 3E4RA 1CE2A 5F7VA 4H6DA 2O68A 2P1SA 3KSXA 4BDQA 1IXIA 3KZGA 4NF4A 1GTKA 4AQ4A 3CI8A 5L8DA 2REGA 2X7PA 1TT1A 4POWA 2ZMBA 1A55A 3KN7A 3TTMA 1UTBB 4F3SA 3MZBA 5B70A 1GR2A 5HFLA 1B9JA 1B3GA 3S2VA 3VXBA 3Q26A 2Z8DA 3VLUA 4JGSA 2XXYA 2V3TA 1MRPA 3LSWA 1LBBA 3DM0A 2XXQA 2I3WA 1IXHA 1S7YA 3OSRA 4BDRA 3RNNA 5L9SA 3BFUA 2F34A 2AIXA 1I6QA 1IXCA 3WAFA 1BLFA 1MH3A 5CBRA 1JVXA 3S4UA 4C0RA 4YKJA 1MXUA 3TCFA 3K02A 1SD3A 1NNKA 3TTRA 5KA5A 3KN8A 2YLNA 2XX7A 2RCAA 1I6BA 1B4HA 4HTGA 1GVCA 4H1XA 4ECFA 1R9LA 4ISUA 4BDOA 3RPWA 1OQHA 4ZECA 1QKAA 4GL8A 3HO7A 4FAJA 3WAEA 1TWYA 1N84A 1FTJA 4OYVA 1OIBA 1ATGA 1B0LA 3OSQA 1D9YA 1UIVA 2DWAA 3PPOA 4NF5A 4KQPA 3C32A 3MW0A 4G68C 1WODA 4QFLA 3IO6A 1A99A 1LCTA 2DWIA 2HAVA 3L6HA 1OVTA 4XXUA 4ZZEA 1MS7A 3U1OA 3FVKA 1QJMA 5HPQA 3B6WA 2XXRA 1A54A 3T9HB 2VP1A 3JV9A 3VVDA 1MXVA 1M5DA 2F35A 3H6VA 4FK5C 3MQ9A 4N21A 2XX8A 4YKIA 2GHAA 2ONSA 1SBPA 1IEJA 1MXZA 3RT6B 2DWHA 3QIMA 2GRVA 1AL3A 1NH7A 1M5FA 4G4PA 3N5LA 4U1OA 2RINA 4FJPA 4F19A 1FTOA 4BDMA 3V83A 2RCBA 1D9VA 4DLDA 5H8HA 3T9UA 4TLMB 4EF2A 1ZTYA 1FQFA 5TPAA 3EHUA 1Z7NE 3TYHA 2E0SA 4R6KA 3N6TA 3RUMA 3PMWA 1PEBA 1MQGA 2Y84A 4QHQA 2RF1A 3OXNA 1DMBA 4FORA 3UA8A 3K01A 4XKQA 3K6UA 1DSNA 3OEKA 2O51A 4KHZE 4E0XA 1IXGA 5FHOA 4E0WA 3B6TA 2Y7RA 4GWOA 1MQJA 3K1MA 2OWTA 1FQAA 4QSCA 4F1VA 1TFDA 1B5HA 1AOVA 3OD7A 2NUVA 1JW5A 3M3LA 2NOOA 3TELA 1M5BA 1BP5A 1PC3A 4U4SA 1UTBA 1LSTA 3PD8A 2Z8EA 3DLNA 1B1XA 3QUFA 1H45A 4LZ8A 1USYE 3O6HA 1AMFA 4IO6A 2RKMA 4F3PA 4GLIA 5EYFA 3CSGA 3OELA 2Q9TA 1POTA 3LUYA 5AA4B 2A5SA 1II5A 4XKRA 2RC9A 3B8MA 1Y1MA 5ICQA 5ITOA 2ZYNA 2BJJX 1ZIUA 3RY3A 2HZLA 4U4XA 1MM6A 1UIUA 2LP7A 1SDXA 1XS5A 5AA3A 2QSXA 4U23A 4K3FA 4TQUQ 5DVFA 2GH9A 3T96B 3USDA 1NNPA 2XXUA 3M8UA 4NTLA 4F2QA 1NNTA 2Q8JA 1B3EA 1LCFA 5CMCA 5I56B 4GVOA 3FXUA 4X9TA 5CMMA 1ZBMA 3R26A 4HS7A 2WKYA 1B52A 1I69A 4NE4A 1USYH 1O64A 4WEDA 4GRKA 1SQYA 2B3FA 2H98A 1NNFA 3O6GA 3FVNA 4YAHX 4XKPA 2XXIA 3SEWA 2V3QA 3RN8A 3K4UA 3K9AA 5DYHA 4ELPA 4RA1A 3FASA 3VE1B 1NKXA 1H76A 3S9MC 3H7MA 3E9XA 2Z22A 3DP8A 5AA2D 3PPNA 1B40A 3EQ1A 4TLLB 2DE4A 4NWCA 5JEIA 2I3VA 4LUBA 5K2XA 4Z0IA 1QCEA 3IL1B 3EF7A 5ISUA 1Y20A 4EQBA 3FUZA 3VV5A 1RKMA 4I1DA 1VR5A 4OTEA 4ZEBA 4QRZA 4MLQA 4NEDA 1FQEA 2I0CA 2XXPA 3S9NC 3CSBA 1KWHA 1N0TA 4H8IA 5I57B 4JPRA 2QS1A 4U22A 4MH5A 2THIA 1RYXA 4XKNA 1SI0A 4GL0A 1M5CA 5CM6A 2QJEA 3MZ1A 3EHTA 2V84A 3OMBA 2PMSA 5EHMA 4LZ7A 5CC2A 3Q27A 4E2LA 4OFLA 4YZZA 3EPEA 3GXAA 2HZKA 1URGA 4DCYA 1FTMA 2H99A 4EDPA 3CG1A 3G7WA 5ITPA 3MHSC 4Q0CA 1LFIA 4AB6A 1B46A 3TDJA 4H0WA 4IY5A 2RC7A 4ZS9A 2AYSA 4G2ZA 4IO3A 4ZEIA 2ANJA 1OLAA 1A8EA 2I4CA 1TXFA 1O7TA 3BBRA 3LC8A 1FTLA 3JZJA 5AA4A 5JTYB 1LFHA 4G8MA 5CI5A 3TZAA 4WEPA 1LFGA 3MVWA 3PV0E 4RY1A 4BDLA 5AA1A 3ODBA 4R75A 4OESA 3H3GA 2ZYMA 3KOTA 3K1PA 2UVJA 2DE2A 3I6VA 1ZMGA 4DZ1A 3F11A 3R6UA 2QMWA 3B6QA 5TU0A 1WVJA 1PDAA 4LONB 4ZEKA 4MF3A 3S9EA 4OFOA 1YAEA 1B2HA 5TP9B 3SESA 5HFMA 3K6XA 3PUXE 1JVYA 2F7CA 5I56A 4G68B 4THIA 1D4NA 4OVJA 1Y4TA 3HHFA 3PUVE 1EBOA 4LA9A 4GD5A 2DYXA 1BKAA 4QSDA 2F78A 1SZTA 1JQFA 4KYDA 4EQ9A 4N23A 4PQJA 4HCWA 4JB7A 4R6YA 4ELQA 1B5JA 5FHNA 1GV8A 5F1QA 4RPOA 2XXXA 4OXVA 3MUQA 1Y3PA 3UGWA 5H8NB 2Q2CA 1A7LA 3V5AA 1MDQA 4G2KA 3VVEA 3IOTA 4XIGQ 3B8NA 4Q8RA 3KN3A 3O29A 4POXA 5L9OA 1IIWA 1QVSA 4OWDA 3HHGA 4PFTA 4ZEFA 5CMBA 1P1OA 4IO7A 2DSFA 2EZOA 3H6UA 3TKDA 3MJNA 1A8FA 3OO8A 3IB2A 1QUJA 4FIPC 3A09A 3M99B 1M5EA 3IB1A 2HXWA 1B3LA 3B77A 4RK9A 3L6GA 3RTFB 5DVIA 1ANFA 3O97A 3IK6B 4EF1A 1OMPA 1ZLQA 2XD2A 4MBPA 3CYOA 5HBCA 3FV2A 3FZVA 3FATA 3IAZA 4JWOA 2Y7KA 4GXSB 5I57A 4EQ7A 1BTJA 1LAXA 4R9FA 2ZXTA 3ECRA 5CN0A 3CP1A 3ONMA 4M1VA 5CMKA 1DTGA 1TFAA 2A5TA 2VHAA 1B32A 2O1LA 3SEUA 2OZZA 1ZU0A 3MVYA 1B7UA 1MXYA 4P11A 3K2DA 4GIZA 1B1HA 1JW4A 2OLBA 3K00A 2UVHA 4BLAA 2VD3A 1SYHA 5I58A 3MAMA 1N7XA 2UVIA 4ZZAA 3DELB 2CMOA 4C1UA 1ELJA 1JW1A 3G3KA 1US4A 2DVCA 4H5GA 3TFLA 3W15C 1EZOA 1L5TA 4YKKA 3G3FA 3O6IA 4LQ2A 4KD5A 4QF9A 3O66A 1MQDA 5BUUA 1PBQA 3UORA 3UN6A 4F3GA 4JWYA 3C35A 4IB2A 1FQCA 3MVXA 1QUKA 5JTYA 3IOWA 1FTKA 3OENA 1MG1A 3IB0A 2PT1A 5H8SA 4ESXA 1LB9A 3ZKKA 3ILUB 2Q88A 3VFJA 4ZDMA 1R6ZA 2F6GA 2ONRA 2Y7PA 4NF6B 1CB6A 1NMUA 2QPQA 5ELVA 2D5WA 3IO4A 2XD3A 2XXVA 3Q28A 4JBZA 3G3IA 3T66A 5TP9A 3G3JA 3DP6A 2DE3A 5A5XA 3IORA 3IX1A 4H65A 1AIVA 4RNSA 1JQ0A 4Q30B 4G68A 4U21A 2F36A 1DPEA 4OFJA 2DS9A 4F39A 2GFEA 4O3AA 1BIYA 4OETA 2O7UA 3FD3A 2F97A 3C34A 2H5YA 2ZYKA 1DPPA 2ESNA 3T93B 3FXQA 3O2AA 4F3BA 2I49A 1XVYA 1LLSA 4R72A 1UTHB 4YU0A 4X1DA 3TQLA 3OO9A 3TCHA 4PETA 3FJ7A 4F2OA 4ELOA 1SVXB 1HSJA 5H8NA 3I3VA 4LVQA 3PPRA 5AE4A 4OZ9A 3A3UA 3H03A 1LAHE 4RK2A 2HQ0A 1Q35A 1MDP1 4DE8A 1ENVA 3C36A 1FQDA 2PYYA 2O84X 1Z7ME 1N76A 4IO5A 1B5IA 4Q5TA 1MPBA 2UVGA 2KLFA 3FGSA 4TOZA 4JWXA 3TODA 5M2VA 4Z7EA 2OT5A 3GBBA 1I6AA 4G77A 2Y7WA 3D4GA 2QL3A 4P0IA 2G29A 2QS2A 3KJ7A 3BFTA 2O7IA 4X48A 1Y4MA 3E13X 3OEMA 1URDA 4DXBA 4OEVA 1R1NA 3LBSA 2I0BA 1DF5A 1MPCA 3QUJA 3PD9A 4YB6A 5KA6A 3MVZA 1B3HA 2M8CA 1D3KA 2DVZA 4JSOA 4G8HA 1R9QA 3B7DA 5I84A 2RC8A 2DXYA 1RYOA 2F7BA 1QULA 4DXUA 1N7WA 2IEEA 2A5TB 2F7AA 1S50A 3KFMA 4AB5A 1FW0A 2FA7A 1MY2A 4IO2A 3E3KA 3MHHC 4ESWA 1QKBA 5LOMA 1LBCA 3MBPA 3PUYE 3N26A 4M4GA 5KCJB 2B65A 2R6GE 4YMBA 5I58B 2H4IA 4IGRA 4LP2B 1YTVA 1UQWA 4YB5A 3SEXA 3V89B 3K1NA 4DXCA 4EXLA 1SW1A 3H01A 2ZNTA 5KDTA 3H4ZA 4OEUA 4F31B 3O9PA 3UP9A 4KYEA 2Z8FA 4FEBA 2GHBA 2Q2AA 1SYIA 3AXFA 3CIJA 3FJMA 4NF6A 3PPQA 4FATA 1N04A 3C33A 1QR8A 3RLFE 1EH3A 4KFQA 3T22A 3KG2A 1XHYA 4PE5B 2VD2A 1PB9A 5DEXB 1EZPA 1LGBC 1ZKBA 1IUDA 3CG3A 1MOFA 4RPNA 4N07A 3MP1A 1IQ7A 3HSTA 4QFNA 3ZS6A 1DTZA 4QFOA 3U72A 3IOVA 3U93A 4X1BA 1PB7A 1YCJA 4I9DA 5H8QB 2I58A 2Z23A 3MC2A 4PFYA 5A5XB 3O28A 4H5FA 1P1QA 2HCAA 4QSEA 1UTHA 1P1NA 1LAFE 1F23A 3K0VA 1VSOA 4I8CA 4ND9A 4YMAA 3ZKLA 4QFKA 4JDFA 3LSXA 5J1DA 3RT8A 3MPLA 4FEDA 3T9VA 1Q1KA 3VLWA 4EUOA 4F18A 4F1UA 4KCDA 3SETA 1H3DA 4PFWA 4JF3A 3EN3A 3TQWA 1Y3NA 3R7XA 3M3KA 1MY1A 3OO6A 2PX1A 3KJTA 1EZ9A 2FYIA 2QMXA 2QS3A 3N6UA 4R2FA 5DVJA 3TMGA 4KYSA 4O3BA 3ILTB 4KR5A 4LZ5A 1B58A 4PP0A 1T0KA 3U94A 3OO7A 2ALUA 2ONKE 1MM7A 2UYEA 5AA2A 3QSLA 5CRYA 3H6WA 2XXWA 1K34A 4WXJA 4IGTA 3QAXA 2D21A 3U8QA 1P1UA 2O69A 3SDFA 3H6TA 1JETA 4HCYA 1JPXA 3TAJA 3LR1A 3VVFA 1O63A 1B4ZA 2I48A 1SW2A 5I59B 2OJTA 5FTIA 5I2KB 2G93A 3GBAA 4F1YA 3FJGA 1Y1ZA 2HAUA 1SW4A 2R9JA 3CFLA 2I4BA
chains in the Genus database with same CATH superfamily
3RYIA 3K6VA 2HEUA 1QBZA 1J1NA 1FTAA 3QYTA 5DN6G 1VFEA 3A3CA 1HNWB 2XXHA 3OR7C 4N6PA 1FPOA 1VQ7V 1FJ6A 1JP4A 3OUSA 3P7IA 3D36A 3Q4HA 4U3JA 1MQIA 2X26A 1HSLA 4MAGA 3CCLV 2NVUB 3T9XB 5IDJA 1US5A 3PUZE 4EB6B 1I5XA 4RAIA 1PBPA 1XL6A 2DWEC 1JFFA 4XBFA 4R6HA 3VDFA 1LUWA 2AXTZ 3GLBA 4B08A 5ET6A 4GX4A 1MXXA 3THIA 4GX1A 3FB8C 2AZ2A 4LQ5A 2O6AA 3D1RA 3EHSA 3QO5A 2NWJA 4FLWA 4GF8A 1GMGA 3JD2A 4TV8A 2DP8A 5ET8A 5H8FB 5GW7A 1Y3QA 1URSA 1DLBA 5KCJA 3K6WA 3QXMA 2DQVA 1OCOB 4OQOA 3AG3B 1N3XA 1B6QA 3D8CA 1LNQA 1FPBA 4UB8Z 4JI6B 1H43A 1NFTA 1AROP 1B0HA 3CR9A 3N94A 4R9GA 5DT6A 1Y9UA 2V4CA 4FIMA 1LAGE 3UIFA 3Q25A 2M7WA 4G61A 3KSJA 4OENA 2UXCB 3OUFA 3SERA 3BFRA 1ZL8A 1JNFA 1G4YB 4HW8A 3LV0A 3OMNB 1V54B 1Q6IA 2Q68A 2UXNA 1MH4A 4O4JA 2QRYA 4RXLA 1Y74B 2HJFC 1VQKV 1NJIW 3SR2C 5LBQA 5KHIA 3DP4A 3VXCA 3H1KH 2UXBB 3RYCB 5KZTA 5FPRA 4WKMA 4IY6A 2EINC 1SW5A 1NVPD 3QTCA 3SJQC 2MKZA 2I6EA 1NV3A 1ZJLA 2V4DA 2XOKG 5FTHA 4LFAO 1FQBA 2X6AA 3ZN0A 3G71V 3KOSA 1GAXA 2F8DA 3SPHA 4EKWA 2P6JA 4NWDA 4QJFB 2W6JG 2Q89A 3QK6A 2UXAA 2HEPA 2O1MA 1KECA 1YPNA 1N33B 5B7DA 2LGQA 2HFBA 4GKJB 3ASOB 3MZ9A 2L6LA 4DIGA 3X2QB 3JARA 3TTLA 1EZVH 2F4VO 2E1SA 3CFXA 4MNPA 1LB8A 4PDVA 4GZRB 4K3AA 4O94A 4I0XB 2X7RB 4L17A 3I5OA 3OTFA 3C90A 3JYCA 4JV5B 1SQPH 1SQQH 4MT8A 5DEXA 1XT8A 3IOUA 1YVWA 5KDTB 2BTOA 1VARA 2Q5ZA 1CP9A 3GWKC 3M3FA 1A40A 2ZYOA 1FCKA 4PA7A 3QG5A 4I62A 3CVGA 1OCOC 5EHSA 2YC0A 4PDLA 5LDZA 2M6YA 5DTBA 1FBGA 5LYJA 2AL4A 4YY3B 5L9MA 1GN6A 5I2NB 4YJ2B 4ZE9A 5B66Z 1IITA 4NF8B 5IZ3B 1V54C 2UUBB 2P2AA 3WFVA 4PFIA 5H8QA 1AR5A 4NR1A 3MPKA 3C3TA 3QMFA 3IJXB 4LNUB 5JCOC 4O8MA 5EYPA 4P2ZA 1BQ0A 3ZBHA 1QVFU 1B51A 4CC5A 5IWAO 1K4CC 1R1BA 3OE7G 5ICTA 4NF4B 1NUYA 4JXIA 4OERA 1EN5A 5DM6V 2JK5C 1R3JC 1Z5WA 4NTYA 3J81N 4KI0E 4GQOA 1PKXA 5FHMA 4FLUA 3MP8A 2BTQA 4GWSA 1XI6A 2LAOA 1MY0A 4GXAA 1MZEA 1Y66A 2LFRA 1POY1 3U92A 3SEYA 4DV6O 4I3EA 4H13B 1FS0G 1GGGA 1P4RA 4NMYA 1K33A 5GONA 4I55A 1MPDA 4F29A 4UCSA 1OVBA 5CA1A 1NL5A 5BWJA 1Q5OA 1DOTA 1Y4CA 2V93A 1GN4A 1Q3EA 3W9WA 1KUQA 3TUSA 3ASOC 1J5EO 4QFPA 3X2QC 4FJCC 2UUCB 3JSNA 1LBYA 4OVPA 5IKBA 1M56C 4R2BA 1E1RG 1VF5B 1SA0B 3HCQA 4GFRA 4N17A 4J7JA 2V3UA 4DV2B 1B6HA 1IXBA 2H25A 3A8TA 1Y67A 3FV1A 4DR1O 3GZGA 5CBSA 1KZ8A 3B8BA 1AVMA 1HNXO 1FAFA 4KCCA 4RJZA 2YXHA 2ZNUA 2ZD9A 4PA6A 2NXOA 2XX9A 2WLLA 2QWPB 2WLKA 1KA1A 5LMUO 2P0SA 3Q29A 4DV5B 4MFIA 2CZLA 1P1WA 3JAWB 3G3GA 2FNCA 2QWQB 5B3SB 1NH8A 4G8NA 4RYAA 2Y7IA 3SZPA 3PU5A 3TTNA 1K8AW 1VF6C 3ZMVA 2DOJA 3PMVA 2XTAA 4DV4B 4UA8A 3RGBA 2XAGA 4DR7B 3M8AA 1LBVA 4FVMA 2ZCEA 3C31A 1RDZA 3GYYA 4UV8A 1Q81W 1WDNA 1MY3A 2OBGA 4X04A 2Y69B 3JSLA 1MY4A 1OQGA 1SI1A 3ABMB 4LF9B 4NTWA 4MTOA 1B7ZA 2OK2A 2PT2A 4LATA 2PFZA 3S9LC 5CMUA 2REJA 3GWOA 4N13A 1R6TA 3LNMB 2PBWA 4DUYB 5JK4A 2QS4A 1SQFA 1SC5B 3RTWB 4ZOLA 1IMEA 3I5DA 3ZSFA 3GB7C 3V8XB 1TVKB 1OCZB 1MSDA 3P30A 4OGQB 3TTKA 4OPAA 3R66A 4HE1A 1FJGB 3PMXA 3T4ZA 1B05A 3FXRA 3SEVA 2CDYA 1QUIA 3PGFA 1MQHA 4JSDA 4GX0A 1NV1A 2EBOA 5FLXN 1I5YA 5EZYB 2XHDA 4JZ2A 2DYRB 4PBQA 1M57C 3MYUA 4UACA 1LEVA 1AB3A 5H6RA 4HNAA 1L0LH 1IZ3A 3L9DA 4X1YA 2YI9A 4GKKO 2VOZA 4HE0A 3HKDB 1N3WA 4DO2A 2EILB 3UK4A 5I59A 2VWJA 4OA4A 5AA2B 5FNVB 2X7QA 3LSFB 1XC1A 4YICA 1K5QA 3CRBA 4NN3A 4PCDA 5I2KA 2EIKB 4DDDA 4H67A 2DMXA 4PF6A 2YXYA 2R71A 4EXKA 4I3YA 1DTOA 2OWSA 3JYRA 3TEPA 1NUXA 2YPNA 3KGCA 3RQTA 3SKPA 3OOAA 5CBGA 3CJHB 4RWUA 1RSOA 4F22A 2OCUA 2Y4TA 3E8HA 3ZRVA 1B3FA 2ABHA 5B3SC 4FECA 5DECA 3MWBA 1XOCA 2MW2B 3KBRA 3D3IA 4MLVA 4PAKA 4FLTA 4NAPA 3MP6A 4NF5B 3TPAA 1MXWA 3BIHA 2X6CA 4KPTA 5H9CA 5KHKA 4D6TH 1WNSA 2VPNA 4LP8A 3ABTA 4U1ZA 4BDNA 2Y69C 4CS4A 1FPFA 2QM8A 2R70A 3HKBB 2ATKC 4IIJB 4DR3B 2W7YA 1GN3A 4C1TA 4EB6A 3K06A 3ABMC 1EM1A 5HM4B 4DRXA 2ZNSA 1XVXA 1G8MA 4DXWA 1SQXH 3OGIB 4IR8A 4PFUA 4ZE8A 4XDKA 3CCQV 2HHHB 3PTYA 2XASA 4ZKIA 1K9YA 4XTCQ 4WBNA 1OJHA 2XXTA 1EN4A 4P0GA 5EK0A 5K1PA 5H8FA 3F5WC 3OMIB 1FPIA 1OCZC 1YXBA 4JAAA 2CAZC 2B9ZA 4P1LA 1B7HA 3FVOA 1H44A 4TQDA 4B7EA 1RM1C 4X65B 2FIEA 3D4CA 1P99A 4OHNA 4CZZA 1JEUA 1XBLA 1TUBA 2B3BA 2LFSA 3PPPA 2OWZA 1QW0A 4U7OA 4FE8A 2N74A 2AHYA 3CCEV 5K2YA 2UYFA 3BKIB 5IAIA 1IDSA 2DXRA 3MD0A 3BHPA 1YITV 3FD9A 2V25A 3FVGA 1YTFB 2UXDB 4JI3B 1O9HA 2EZPA 2FB5A 4I9QA 2PVUA 5IY5B 2VGQA 3KEIA 2EILC 3WG7B 4HXVA 1IVSA 4LBEC 3G6BA 1AR1B 3C4MA 4FLVA 3LSLA 3U65A 3OGCC 3HV1A 3W9VA 1EU8A 1FPKA 3H06B 4X64O 2QE7G 4LN5A 1GH6A 2IU3A 1FXVA 3W7UA 1LBZA 4JI0B 3ETGA 4TV8B 3RYCA 4U2RA 1NR7A 2RMKB 3OFNG 3G4SV 2AL5A 1JEVA 2N04A 4JYAO 2IA4A 1AI6A 2YIAA 3G67A 4BR6A 4ONYA 1DF4A 5I3SA 2MK3A 3G3HA 4YKPA 2CK3G 1F9BA 3C9HA 3HPIA 5KHHA 4GOTA 1Q43A 5H8HB 3IR1A 1OLCA 1ZL8B 1S77D 1IZ1A 4R74A 3PUWE 3CFZA 3IJOB 1XNRB 2YIDA 4BW5A 1E1QG 1ZWIC 3P3NA 2FBPA 1AH5A 4JI8B 5TPAB 4OMBA 4PGNA 4LFBO 2HVJC 3LSSA 1HSEA 1KP2A 4I0XA 1PL4A 1VEWA 4E4EA 2CTQA 2DE0X 4LF5O 4IO4A 4LF4B 4LF7O 2F5XA 2F6PA 4O3CA 2D3IA 4AS4A 1RP3B 4FLZA 4ELRA 3RGYA 2G38A 2YJPA 4IYIA 3HN0A 1S9TA 4K35A 2IU0A 1VFDA 2DWJA 2ZNJA 3FIRA 1VQPV 4YB7A 4ICGA 1M4UA 2OCHA 3LUZA 5JJEB 1QU7A 1VE4A 5I2NA 3DSQA 1QR9A 4H8JA 1EYKA 4ZEDA 4I7ZB 4DCXA 2BE3A 1SPIA 4UV9A 4R73A 4X62B 1JX9A 1PB8A 4NF8A 5LGNA 2WWWA 5IZ3A 3VLVA 1VF6A 1AI4A 2WPDG 2H9BA 3SPCA 3RWRD 3NOHA 3CRMA 2EIJC 3CRRA 4PHZA 2PYJA 1K9ZA 2E75B 3E4RA 4MNIA 5IY5C 3JARB 1CE2A 3WG7C 5F7VA 4O2AB 2GDSA 2BCCH 3AEIA 4L87A 4BIUA 1KBHA 4LNUA 3SDLA 2O68A 4H6DA 2P1SA 3KSXA 4BDQA 1IXIA 2RNBA 3KZGA 2UUAB 4NF4A 1GTKA 1NR1A 4DV7O 4AQ4A 1HR0B 4MW8A 2B1GA 1NU1H 2QWRB 5FPOA 3MAQA 2LQTA 1DBZA 3CI8A 5L8DA 4TT3G 2REGA 4OVRA 1BHBA 4WF9V 3ZHUA 5IZ1A 2X7PA 1TT1A 4B3RO 2ZZVA 3RT3C 4POWA 2ZMBA 1L0NH 2XWIA 4NGUA 3WB0A 4CS2A 1A55A 1YYZA 1NI8A 3KN7A 4LCUC 2PCRA 4H45A 3TTMA 3G6EV 4NXNB 1UTBB 4F3SA 1I0HA 1NTKH 2A06H 1N34B 3MZBA 1XNQO 5B70A 1AP5A 1GR2A 5HFLA 2P3NA 1B9JA 4NKGB 4UVAA 3CB2A 1B3GA 3S2VA 3VXBA 1PM9A 1SA0A 3Q26A 2Z8DA 2ZZXA 2Q73A 4G27B 5I5PA 3VLUA 4JGSA 2XXYA 2V3TA 1YEWA 4IGGA 5KHGA 2ARHA 1MRPA 3W7WA 3FKSG 4QE9A 2OIEA 3LSWA 5E1AC 3IC7A 4FLYA 4O4IB 5GTHZ 2QWOB 1LBBA 2B5UA 3JAWA 4JI1B 4DR2B 2XXQA 3DM0A 4X66B 2I3WA 3K9SA 1IXHA 1S7YA 1H2NA 2O57A 3F5TA 2B1IA 3APOA 5LOVB 3OSRA 1VQNV 4BDRA 3RNNA 5KHJA 4N6DA 5L9SA 2AGAA 3BFUA 3UO3A 2CEXA 2F34A 5B1OA 4N8YA 5EIBC 4PC9A 1M1KW 2AIXA 1I6QA 3BIGA 1IXCA 3WAFA 1BLFA 1MH3A 5CBRA 1JVXA 3S4UA 4C0RA 2Z3YA 4YKJA 3CRQA 4JV5O 3JD0A 1MXUA 3TCFA 2CGNA 4GYCB 1F4NA 4P30A 3K02A 1MABG 1KQSU 1NNKA 1SD3A 3TTRA 5KA5A 3KN8A 3SPGA 4RQEA 2YLNA 3IFAA 1TVKA 3K08A 5LTCA 2CH7B 3ETDA 3U0ZA 1ROPA 5L3BA 4LF6O 1YJ9V 2XX7A 1INPA 2RCAA 4JI2B 1I6BA 1B4HA 4HTGA 3K03A 1GVCA 2Q4PA 2IW5A 5EZYA 2P5OA 4K0KB 4H1XA 5IM2A 4ECFA 3OTOO 1R9LA 4ISUA 3WB2A 2Q9LA 4BDOA 3RPWA 4JAVA 1OQHA 4ZECA 1QKAA 4GL8A 4O4LA 2FYUH 3HO7A 4FAJA 3QO7A 1WPXA 3DXRB 3FB5C 1P49A 5FNVA 2P4KA 5AG2A 5JVDA 1TWYA 3E8GA 3WAEA 1N84A 2EIMC 3U11A 1FTJA 1URFA 4OYVA 1N36O 4GBVA 1OIBA 1IMFA 4JVCA 3K5NA 1ATGA 3KC0A 4YXWG 1WJZA 4J9YB 3L73H 1B0LA 4H44B 3OSQA 1SKVA 2Q7EA 1D9YA 1FBHA 4JVIA 1UIVA 4PDHA 2DWAA 4J7KA 1BGYH 3PPOA 3ZMUA 1COWG 4NF5A 4KQPA 3C32A 4KHPB 3MW0A 1FXKC 4G68C 3APQA 3DC5A 4QGPA 1WODA 1CXZB 4QFLA 4N91A 1OCCC 2WYPA 3HKBA 4IIJA 3IO6A 1A99A 1S0VA 1LCTA 2DWIA 2HAVA 3L6HA 2F95B 4MTFA 1OVTA 3EKIA 4NVPA 2FHYA 2PI5A 4XXUA 4ZZEA 3I55V 1MS7A 4I4TB 3U1OA 3FVKA 4W4KA 1QJMA 1W0JG 5HPQA 1P7BA 1N32B 3B6WA 2XXRA 2NR5A 4Z2WA 2Q0AA 4DI4B 1A54A 3T9HB 4YHHB 4JI7O 1RSOB 4P1EA 3E89A 2VP1A 5JQGA 2EINB 3JV9A 3VVDA 4NXMO 1MXVA 1M5DA 2F35A 1YZBA 4FK5C 3H6VA 3MQ9A 1XREA 1VQ9V 5ET5A 4N21A 3LNNA 4B3TO 2XX8A 4GWWA 1R3KC 4J10A 2JJKA 4YKIA 1KP3A 1DK4A 3ZHVA 2GHAA 4WFGA 2BOBC 2GTAA 2VQFB 1SBPA 2ONSA 3IFCA 5B5EZ 3H1IH 1IEJA 1MXZA 3RT6B 4XDJA 2DWHA 1Q6UA 3QIMA 4DRXB 4NX1A 3T1YB 1FYJA 2GRVA 4U3FH 2OYQA 2Q8JA 4RO2A 2OCCC 1AL3A 2JEUA 1WLEA 1KYOF 1NZ6A 4UB6Z 1NH7A 1M5FA 3N2GB 4G4PA 4DV0B 4GLXA 2A0LA 2HPGA 4WBNB 3N5LA 4U1OA 2RINA 2Q67A 1N0NA 1WPBA 3FBPA 3EXAA 1AI7A 1BMFG 4FJPA 4F19A 2QVVA 1N0JA 4PI2A 1FTOA 2EULA 1XUQA 2ZE8A 4UCOA 4BDMA 3V83A 2RCBA 3ETEA 1TUBB 4WFBV 1D9VA 4UCVA 4DLDA 5H8HA 3ZCCA 4DR4O 4IL6Z 3T9UA 1XL4A 3FB7C 4LC1A 4TLMB 4EF2A 4OVQA 1ZTYA 3AG4C 2JJ1G 2B4MA 3FXBA 2RJZA 1IMBA 1FQFA 4O2BB 4R8CA 5EQ8A 5TPAA 3H1LH 3EHUA 4N6KA 2WA3A 1Z7NE 4UCUA 3T1HB 3TYHA 4ZHQA 2PI4A 3A2FA 4OX9O 2E0SA 4R6KA 1VF7A 4PD4F 3N6TA 3RUMA 1D9QA 3PMWA 1PEBA 1MQGA 1OV9A 2P3VA 2Y84A 4QHQA 2YS8A 1NV7A 2RF1A 3OXNA 1DMBA 3E79A 3K5OA 3HPLC 4FORA 3UA8A 5ITZB 2ZINA 5C8YB 3K01A 1IXMA 4LFCB 2JGDB 2F3DA 1H2MA 1H2SB 4XKQA 2ILMA 3K6UA 1YI2V 1DSNA 1FPDA 3OEKA 3T2MA 2O51A 4P3LA 1RDXA 1DK1A 5EQ7A 2FMLA 4B3SO 2YIBA 4KHZE 4E0XA 1I94O 2R9IA 1IXGA 5FHOA 3SPJA 4E0WA 4O2AA 4UXNA 3IGAC 3B6TA 1SZXA 2XWKA 1M56B 2QKCA 2Y7RA 4GWOA 1IBMO 1MQJA 2XWVA 2ZKOA 3K1MA 2OWTA 1FQAA 4QSCA 4F1VA 1TFDA 4MVMA 1B5HA 3C34A 4XFEA 1AOVA 2QJ1A 3OD7A 2NUVA 2CTPA 1JW5A 4MJOA 3H1JH 2AHZA 4PDRA 3M3LA 4KL1A 2NOOA 3TELA 1M5BA 1BP5A 1PC3A 4QIWF 1UTBA 4U4SA 3FFQA 2NLJC 1LSTA 3PD8A 1XMQB 2Z8EA 3ZJZA 3DLNA 1WN7A 1XOUA 2FVZA 1HWYA 3AK2A 4GWYA 2I4BA 1B1XA 2RCVA 2ZE6A 3QUFA 4O4HB 1H45A 4LZ8A 1USYE 1ZLZA 4YIPA 3O6HA 1AMFA 3EFFK 2JRIA 4IO6A 2FIXA 2RKMA 1IBLO 4F3PA 4GLIA 5EYFA 3CSGA 1Q7YW 2Q9TA 3OELA 4PI0A 1AILA 1POTA 4FM2A 3LUYA 5AA4B 2ZIMA 5CA0A 1XILA 2A5SA 3RVZA 4X1IB 1II5A 4DV3O 4O4IA 4XKRA 3ICXA 4JI0O 5LMNB 2RC9A 3B8MA 5TISZ 1Y1MA 1V55B 1R73A 5JJJB 5ICQA 4KXRA 5ITOA 3OEHG 3VQVA 5LOVA 2XAFA 4PA3A 2ZYNA 3GVMA 1XHXA 2E76B 1YIJV 3PN1A 3CHGA 2CEYA 2BJJX 1FXKA 1ZIUA 2Q74A 2HZLA 3RY3A 1M57B 4DV1O 4U4XA 1MM6A 1H2LA 2LO1A 3BRCA 1UIUA 5A9GA 1S72V 3E83A 2LP7A 1SDXA 1XS5A 2BSKB 2QSXA 1VQ6V 5AA3A 2ZM6B 4U23A 3ZX6A 1K3EA 3E22B 4K3FA 4L8JA 2P06A 4TQUQ 1WB7A 5DVFA 3JAKA 3RPLB 1HNZB 2GH9A 3T96B 1E79G 3USDA 3EVKA 1NNPA 4H33A 2UU9O 2Y5KA 2HVKC 2XXUA 3ETQA 1TGOA 3M8UA 4NTLA 4F2QA 2CH7A 4JI4B 4B3MO 4BWAA 3W7TA 3EHBB 3QF7A 1B3EA 1LCFA 1NNTA 4PE3A 5CMCA 1X4TA 3CXHF 4MCOA 1IBKB 1G0HA 4JAUA 2QGNA 5LA6B 5I56B 4GVOA 3ZIAG 4IHJB 2IJHA 3FXUA 4EFEA 5IE9A 1RFYA 4X62O 4X9TA 3QNEA 3BVOA 4F6RB 1Z2GA 4MVZA 1LBXA 4MEVA 1ZBMA 3R26A 5CMMA 2P7TC 4HS7A 2WKYA 1B52A 1I69A 1Q9DA 4NE4A 3SYQA 1USYH 3DXRA 1TUEB 3M7MX 2E3CA 5J2UB 1O64A 4WEDA 4GRKA 5A5LA 5FBPA 1SQYA 3VQWA 1PL0A 1XMOO 2B3FA 2H98A 1P7GA 2D3OW 1NNFA 2Z5UA 4CH3A 3O6GA 4JASA 1JR9A 3ABKC 3FVNA 1V55C 4YAHX 5J16A 1KD1W 1NV2A 4XKPA 2BJIA 2XXIA 2V3QA 3SEWA 2JGUA 1AP6A 4QNHB 3RN8A 1RM1B 2P67A 4AQYO 3CD6V 3K4UA 5JWPA 4WFAV 3R65A 2PZSA 4K8XA 1FBFA 4AHCA 4R6ZA 5H2FZ 1N34O 3K9AA 2F23A 4O4LB 3TETA 5DYHA 2GUZB 4RA1A 3FASA 4ELPA 4KP4A 3IC9A 2C2AA 1U97A 3VE1B 2E5LO 5JVDB 1NKXA 3MDSA 5D5QA 1GTOA 1LR1A 2Q6AA 3JD3A 4WFFA 1H76A 4MHFA 4I4TA 3S9MC 3H7MA 5B1AC 3B4SA 3E9XA 2Z22A 2XT9A 3DP8A 5BR8O 4PTKA 4DR5O 5AA2D 4BAYA 3PPNA 1VQOV 2KG7B 1B40A 3EQ1A 4TLLB 2DWDC 2DE4A 2ODMA 2P4VA 2R8TA 4NWCA 1IX9A 1GRJA 4JI5O 5JEIA 4MIJA 2I3VA 1H2KA 1MMMA 1FPJA 4LUBA 5K2XA 4Z0IA 2Q69A 1QCEA 3IL1B 4LFAB 1SS3A 2EJ7A 3EF7A 5ISUA 3AK3A 1AWBA 1QNMA 2QFLA 3ZMSA 1Y20A 4EQBA 3ASNB 1D5AA 4F4LA 2OTJV 2ADQB 3KKYA 2ZNIA 3N2GA 2OTLV 1VDWA 4PJ0Z 1UPGA 1M90W 1BT8A 5IYZB 4P9PA 3FUZA 3VV5A 1RKMA 4I1DA 1VR5A 2F4VB 1BQZA 3W7SA 5JQGB 4OTEA 4ZEBA 1YSCA 4LWSB 4GWZA 1S5HC 2ITCC 4QRZA 4MLQA 4NEDA 1FQEA 2VPOA 2F66C 4MTGA 2CZHA 3IJ4A 5EBMC 4JVDA 2B4LA 2I0CA 1WB8A 4JYBA 1KKDA 2XXPA 3CSBA 3S9NC 1KA0A 3LSUA 4FFBB 4EEQA 2VT5A 4CBCA 1KWHA 2PGGA 1PNLA 2EIJB 1N0TA 3BA8A 4H8IA 2P90A 5I57B 3K0GA 4O2BA 4JPRA 1UJWB 2QS1A 4U22A 5JCOA 3ZHTA 1VIBA 1K7DA 2THIA 4MH5A 1RYXA 3TXSA 4XKNA 4QPJA 1SI0A 4GL0A 1M5CA 3FAVB 3JD4A 1CPYA 5CM6A 2ZR3A 2QJEA 1YTFD 2W0FC 3MZ1A 5IWAB 4DR6O 4FM1A 3EHTA 2V84A 3OMBA 5ITZA 3OT7A 2PMSA 5EHMA 2RN9A 1FD9A 5C8YA 5IZZA 3CC7V 4LZ7A 2JGDA 4PFRA 5CC2A 2Q7GA 3Q27A 3BABA 4UCTA 4E2LA 3E86A 1FBCA 1FFTB 1HDJA 4OFLA 4J42A 4DV6B 3EPEA 4YZZA 3GXAA 4DUZO 4P47A 3CCRV 5L3CA 2ZE5A 4NB5A 2HZKA 1URGA 3OD4A 4DCYA 3ASNC 1FTMA 1SRYA 2AW9A 4YIOA 4LF8O 2FKXA 3LDCA 2H99A 2LW7A 1J5EB 3F7YC 4ZHQB 2WLHA 5LP6C 4EDPA 2Q8MA 4TQFA 3CG1A 3IAYA 1AR4A 1M5IA 3G7WA 5ITPA 3MHSC 4Q0CA 5H6QA 1LFIA 3VQXA 3KBZA 1B46A 4AB6A 3TDJA 4W4LA 4DR1B 4H0WA 4NHBA 4IY5A 2PFYA 1HNXB 2RC7A 4ZS9A 2VQEO 2AYSA 5T3JA 4G2ZA 4GCZA 3CPWU 3RFRA 5LMUB 5BMVA 1NT2B 5IYBO 1HNWO 4IO3A 4ZBMA 1F7YA 4ZEIA 2YI8A 3CCUV 2ANJA 4O4HA 4ASUG 2IH1C 2X0LA 1OLAA 1L8DA 1YJNV 1A8EA 3CMAV 4NG7A 2I4CA 1Y6XA 1SERA 1TXFA 4BW9A 3UO2A 3LUTB 3T0JA 1O7TA 1BCCH 3ZS8C 4HZ3A 2YIBD 5J9PC 3JD1A 1RPRA 3HKCA 3BBRA 3LC8A 1FTLA 3JZJA 5AA4A 4MNCA 3DGEA 5JTYB 1JMKC 1LFHA 2Q0OC 4X1IA 3SJCC 4G8MA 4GWUA 5CI5A 4WEPA 3TZAA 3LDEA 3I56V 4B7KA 1LFGA 3MVWA 5IJ9B 3PV0E 4RY1A 1PP9H 1NV4A 4BDLA 5LXTB 2FL4A 5AA1A 5CBHA 4JI6O 3ODBA 4R75A 4OESA 3H3GA 2ZYMA 1FRPA 1H8EG 3AG1B 3KOTA 3K1PA 5LHHA 4RQFA 2UXCO 2UVJA 1GM8A 2DE2A 1WAZA 3I6VA 2BSKA 2YEVB 1HP8A 1ZMGA 4DZ1A 3E22A 1YXIA 3F11A 3R6UA 2QMWA 3B6QA 5TU0A 1WVJA 1PDAA 4LONB 2EIMB 3RPLA 3K79A 4ZEKA 4MF3A 1SQGA 5CA0B 3F7VC 3S9EA 4GKKB 4OFOA 1YAEA 3T1HO 4YJ3B 1B2HA 5TP9B 2UXBO 4OPHA 4MVUA 3SESA 3B40A 1XHZA 2W0XA 4RUFA 1TAEA 5HFMA 5KUKA 1VQ4V 2ZQMA 1YZ0A 1NUWA 3K6XA 1B04A 2JDIG 3PUXE 1NTMH 2LW1A 2WLMA 1JVYA 4AILC 2F7CA 5LA6A 1AI5A 4JYYA 5I56A 1AJQA 1FXKB 4G68B 1S5JA 4IHJA 3CCMV 1D2DA 3O65A 3H1HH 5F2VO 1D4NA 4THIA 4OVTA 4OVJA 1W59A 1OCCB 1Y4TA 2HJDA 1EBOA 4D7TA 1N33O 3HHFA 3PUVE 4LA9A 1Q8IA 4F6RA 1G0IA 5B1BB 4GKJO 4GD5A 1FSAA 3E78A 1VP7A 3C3SA 2WLNA 3JAKB 2DYXA 4G28B 1BKAA 4QSDA 5J2UA 2F78A 1ZSPA 1SZTA 1JQFA 1NKDA 5BZBA 4KYDA 4EQ9A 4N23A 4PQJA 5J2TB 4HCWA 4JB7A 4R6YA 4ELQA 2A7WA 2JS5A 1B5JA 5FHNA 1GV8A 2RDCA 5F1QA 1VQMV 3ZN1A 1K92A 1NH2D 4NTXA 4DW0A 4PAFA 4RPOA 1KC8W 4YY3O 1Q6HA 1ZAUA 2V7QG 3AG1C 3FB6C 2A79B 1ZX3A 2XXXA 5KX5B 4LR3A 1T5EA 4OXVA 2N05A 2UUBO 2DQ3A 2GUZA 3MUQA 1LBWA 1Y3PA 4PGPA 2F43G 2OCCB 3UGWA 5EBWC 5H8NB 2Q2CA 1A7LA 3V5AA 4PA4A 1EYJA 1MDQA 4G2KA 4ZIBA 1GO3F 3VVEA 3IOTA 2F1MA 5BXZA 4XIGQ 3JATB 3B8NA 4Q8RA 3KN3A 3O29A 3JASB 3ZRWB 2PY5A 4ABMA 3WU2Z 2DYSC 3THOA 3ISPA 1BZKA 4N81A 4POXA 1K9MW 4X64B 5L9OA 1IIWA 3MSTA 4HYOA 1FKAO 1QVSA 3JALB 4OWDA 3BAAA 1SQBH 3HHGA 4PFTA 4ZEFA 5CMBA 4C7UA 2KG7A 1P1OA 4IO7A 5B1NA 1NI9A 2DSFA 4JYAB 4KUMA 2EZOA 1DGSA 3H6UA 3TKDA 3ZHSA 1VMGA 4QXDA 3H9VA 1K5SA 3AG4B 3MJNA 1EN6A 5B1BC 1A8FA 2UXXA 1BE3H 3IB2A 1QUJA 2WLIB 3OO8A 4FIPC 2K9PA 3A09A 1GN2A 4QE7A 3M99B 5C93A 2CTWA 2UUCO 1KMIZ 4DW1A 2JJ2G 1M5EA 5ET7A 3IB1A 2HXWA 1B3LA 5IYZA 3B77A 4RK9A 3L6GA 3RTFB 5LP6A 2A3QA 4TSFG 4DV2O 1OCRB 4AS5A 4LFBB 1ANFA 5DVIA 4LWSA 3O97A 3IK6B 2WSSG 1NBMG 4LF5B 2H3OA 4I50B 4LF7B 3CRAA 4EF1A 1OMPA 1ZLQA 2CGOA 4Z1MG 4DV5O 2XD2A 3AG7A 2KQZA 4MBPA 3CYOA 3CC4V 1F4MA 3OR6C 1Z5VA 5HBCA 1FBPA 2KSDA 3FV2A 3FZVA 5L3FA 3FATA 4JI4O 3IAZA 4JWOA 2D2CB 2K1EA 2Y7KA 4FFBA 4GXSB 1FBDA 1IURA 2ITDC 3CWBH 5I57A 4DV4O 5L3EA 4DR7O 4EQ7A 1BTJA 3K59A 1LAXA 2ZXTA 3ECRA 4R9FA 3HKEB 5CN0A 3RYHB 3CP1A 3ONMA 5JH7B 3AK1A 4M1VA 5CMKA 3FAVA 4LF9O 2BOCC 1DTGA 1TFAA 1BHAA 5EYGA 4N15A 2A5TA 2VHAA 1B32A 4DUYO 2ZZWA 1G1XB 1G6UA 4DV7B 1VQ5V 5ESYA 4P56A 2A9HA 2O1LA 3SEUA 2OZZA 1ZU0A 3MVYA 4UVCA 3S3XA 1JVMA 1US6A 4WCEV 1B7UA 1L1FA 4B3RB 1MXYA 4P11A 3K2DA 1FJGO 2XXKA 4GIZA 2QEXV 5CBFA 1B1HA 1ZUQA 1JW4A 2OLBA 3K00A 3S3WA 2UVHA 3LDDA 1A32A 1OHHG 4BLAA 4EFBA 5KLVH 2PUSA 2CTRA 1R6KA 2VD3A 3ABLB 1SYHA 3KCXA 3L72H 1XNQB 5I58A 5LHGA 4IT5A 4GX5A 4BIOA 3MAMA 1JOYA 1N7XA 1OCRC 4FZ0A 2UVIA 4ZZAA 4UVBA 4IYHA 3P3PA 1F51A 4H0LB 4JTCB 3DELB 2CMOA 3CCSV 2FTKA 4C1UA 2PF4E 1ELJA 1JW1A 2V1DA 3SPIA 5I7IA 1PNMA 2GHYA 3TK1A 2YDEA 1NVPB 2CZKA 3G3KA 1US4A 2DVCA 3PJSK 4H5GA 1EZJA 3ZEDA 3TFLA 3W15C 4BIZA 1EZOA 1BS3A 1L5TA 4YKKA 3G3FA 3O6IA 4LQ2A 1XDCA 2QVRA 3TJTA 4KD5A 4QF9A 1PD3A 3ML0A 1AJPA 1R3LC 3O66A 3OAAG 4H46A 1MQDA 5BUUA 4MTXA 1PBQA 3UORA 3UN6A 4F3GA 3CMEV 1D5NA 4JWYA 2Q7HA 3SYPA 5K1XA 3RVYA 4DR3O 1NUZA 3C35A 2OIGA 4IB2A 4J41A 1FQCA 1SQVH 4WFEA 3MVXA 3E2EA 2ZXWB 3B50A 4Z1VA 1QUKA 5JTYA 2HHHO 3IOWA 1FTKA 5KAIZ 2LJ2A 3J7AU 3OM3B 2L35A 2QSAA 3OENA 1MG1A 5KMGB 1X59A 2H94A 3CRCA 3T4DA 3UQ8A 5IJ9A 2OX3A 3IB0A 5LXTA 2PT1A 1RPOA 5H8SA 4ESXA 5BMVB 2YSUB 3QO8A 4X65O 1LB9A 3ZKKA 3ILUB 2Q88A 3VFJA 2RQ6A 3N2KB 3K3WA 2IBZH 4O7IA 1BK4A 4LF6B 1R6ZA 4LH7A 4ZDMA 3ABLC 5LL6Y 3K5LA 3AG3C 2F6GA 2ONRA 2DN9A 4CH5A 2Y7PA 1QGXA 4MX6A 2YEVA 4TUYB 2UXDO 2KQXA 4JI3O 4NF6B 2IM9A 1CB6A 3JCUZ 4X89A 2F93B 4A5UB 3OTOB 1NMUA 2QPQA 5ELVA 1S76D 1WA8A 4X20B 3HKCB 4PELA 2D5WA 3IO4A 2XD3A 2XXVA 1O9GA 3Q28A 3T1CA 1LUVA 1M93A 5L3GA 3CC2V 4JBZA 4YJ3A 3K58A 3G3IA 4XEQA 5TP9A 3T66A 3ABKB 4U7NA 4HE2A 3G3JA 3DP6A 2DE3A 5A5XA 1OZ0A 3HR0A 4KFMA 3IORA 1N36B 3IX1A 2IJIA 4H65A 2VWKA 1AIVA 3OEEG 4HAMA 2GV9A 1JQ0A 4RNSA 4Q30B 4TWKA 1FBEA 3TXQA 4XDLA 4G68A 4FM0A 2Y0IA 4U21A 2F36A 1DPEA 4FBPA 1TA8A 4OFJA 2DS9A 5IYCO 4F39A 2GFEA 1KU9A 2NNUA 4OANA 4O3AA 1BIYA 3SJAC 1XNRO 1JJOA 3OMAB 4OETA 2O7UA 2ZDIC 3FD3A 4JI8O 2F97A 3ZMZA 4J80A 2ZIOA 4DYLA 5CB4B 2H5YA 1DPPA 2KR0A 4PA9A 2ZYKA 2ZXWC 3L71H 2ESNA 4MVSA 3T93B 3B2EE 3FXQA 5B1AB 4LF4O 2AZ0A 3STLC 4F6EA 2LGWA 3O2AA 1BL8A 4F3BA 5J2TA 2I49A 3G80A 1I08A 1I7FA 3NXSA 1MZFA 1XVYA 1LLSA 4R72A 1K4DC 3ZHQA 4JI7B 4UABA 1UTHB 3CXCU 3TCGA 4YU0A 4NXMB 4X1DA 1FFXB 3TQLA 2QVUA 3OO9A 1SESA 3TCHA 5KX5A 4PETA 4B3TB 2XHBA 1Y76A 3B09A 4TOIA 3FJ7A 5LGUA 1Q82W 2WEFA 4F2OA 4ELOA 1SVXB 1HSJA 5H8NA 2CE4A 3I3VA 4X8AA 1YHQV 4LVQA 1W0KG 3BA9A 3PPRA 2UUAO 4MVOA 4HBNA 1GM9A 1HR0O 5AE4A 1PV0A 4ZI7B 3JATA 5EC1C 4OZ9A 1S5LZ 5JJNB 3JASA 3ZRWA 3A3UA 3H03A 1LAHE 4PF8A 4RK2A 1NTZH 2HQ0A 3P32A 1Q35A 1MDP1 4DE8A 3JALA 3LSQA 2WYKA 2R9RB 2NN4A 4NXNO 1ENVA 4PAIA 3VOUA 1R6NA 2IJJA 3UCSC 3C36A 3K0DA 4DK1A 1FQDA 1PNKA 4GX6A 2HG5C 1QLEB 2WLIA 4PFBA 5KAFZ 1WP7A 2PYYA 4DR4B 4NF0A 3RYDA 4MVQA 2WA4A 1NV5A 2O84X 1Z7ME 2Y0PA 1B3QA 3UKMA 1N76A 2R9AA 2CZIA 4IO5A 4AI8A 1B5IA 4TV9B 4Q5TA 1MPBA 2UVGA 2H8PC 3E8FA 1H8HG 3L74H 3BY6A 1GK9A 3O9OA 2KLFA 1DCUA 3RYFA 3ROJA 4R7CA 4I50A 3FGSA 4OX9B 4TOZA 1FPEA 4DR2O 4JI1O 4JWXA 2DOSA 5M2VA 3TODA 4X66O 4Z7EA 2OT5A 3GBBA 4QBAA 1I6AA 4G77A 4KXPA 5EBLC 1JA8A 3L75H 2Y48A 2Y7WA 3D4GA 2QL3A 4FFKA 1EFRG 2JVDA 4P0IA 1QHTA 3HKEA 3RYHA 2XAQA 2G29A 2KB1A 2QS2A 2CUGA 4B3SB 5JH7A 3KJ7A 5D5PA 5IJ0B 2Z0AA 5LP6B 2QTSA 2O7IA 2HP8A 4JTDB 1I94B 3BFTA 4X48A 1XI1A 3T1BA 1Y4MA 3DTUB 5EC2C 3CCJV 2ZE7A 3E13X 2IH3C 3HFUA 3OEMA 4I40A 1URDA 4DXBA 1IBMB 4OEVA 4P9OA 3VQYA 5H5NA 5FL7G 4FPPA 1R1NA 3LBSA 2I0BA 5EQ9A 2WAMA 1DF5A 1MPCA 4GWXA 3QUJA 1MA1A 3PD9A 4X1KB 4YB6A 2ETNA 2DW4A 2W6IG 1H2GA 3SGIA 1S3JA 5KA6A 3MVZA 2XAHA 3SJBC 1B3HA 4K8ZA 1NV6A 4JI2O 3FX7A 2M8CA 1EYIA 1N4CA 3UT5B 1D3KA 4MW3A 1QLEC 4K0KO 2DVZA 4JSOA 1W2BU 4G8HA 3RYIB 1R9QA 3BPZA 3K04A 3SYOA 3B7DA 5I84A 2RC8A 2VS0A 5DEDA 1B06A 2DXYA 1RYOA 4I5SA 3VBBA 3UM7A 1VQLV 2F7BA 4PDDA 3N27A 1QULA 4DXUA 2DQ0A 1N8RW 1N7WA 2HKOA 4MS2A 1IMCA 2DYRC 2VRZA 3Q4HB 4U3JB 2IEEA 5GTIZ 2ZR2A 1IMAA 2A5TB 2EX3A 3ABUA 2F7AA 4X8RA 3K57A 1IBLB 1S50A 3KFMA 1JFFB 1Y74A 2DJVA 1K97A 1IMDA 4AB5A 3CEIA 3L70H 1FW0A 2FA7A 1MY2A 4IO2A 5EQAA 3E3KA 2EIKC 3J80N 3MHHC 4FZ1A 4DV3B 3A0RA 4ESWA 1QKBA 5LOMA 1LBCA 3MBPA 3PUYE 2GTSA 2Q8VA 3SYAA 3N26A 4KHPO 4M4GA 5KCJB 4I9WA 2B65A 1YJWV 2R6GE 4YMBA 5I58B 2H4IA 2HHMA 3STZC 4IGRA 1YTVA 4LP2B 1UQWA 3IFXA 5IGAA 4DV1B 2ZDIA 4YB5A 3SEXA 3V89B 4DI3D 3RW0A 3K1NA 4DXCA 4EXLA 2Y5LA 3BCCH 4P9KA 4O4JB 2IJKA 3A0BZ 1N32O 5KUMA 1Q86W 1SW1A 4FMTA 3DC6A 4YHHO 1Q90D 2EJRA 5KMGA 2QWNB 2L5VA 3H01A 5BY1A 4PDMA 1VQ8V 2UU9B 2ZNTA 5KDTA 3H4ZA 4LH6A 4OEUA 4CC6A 3N2KA 1CNQA 2HLDG 4UCRA 4B3MB 4F31B 2QKSA 3O9PA 2VQFO 3TCUA 3UP9A 4KYEA 3QVNA 2Z8FA 4FEBA 2YUAA 2GHBA 2Q2AA 4TUYA 1SYIA 1AJNA 3AXFA 3CIJA 3FJMA 4NF6A 3PPQA 4YJ2A 3T1YO 4FATA 1N04A 3C33A 1QR8A 1J95A 3D36C 4OXSA 3RLFE 4X20A 5L3DA 3ZRXA 1EH3A 4KFQA 4DV0O 4JYCA 3FYEB 3T22A 3W7XA 5EIBD 3KG2A 2R72A 2ZT9B 4D7SA 1XHYA 4R50A 4PE5B 4CH6A 2VD2A 2YICA 1PB9A 4MMPA 5DEXB 4WFHA 3CCVV 1XMOB 1KB9F 1EZPA 1LGBC 1ZKBA 1IUDA 3CG3A 1MOFA 2GQ1A 2P22C 2GSMB 1KKCA 3TGUH 3MP1A 4N07A 4RPNA 3E35A 1P84F 3OW2U 1IQ7A 3HSTA 4QFNA 3ZS6A 4XF5A 3E8BA 3ZMTA 3CHXA 4AQYB 1DTZA 4QFOA 5LYJB 3U72A 3ZHRA 3IOVA 3RN4A 3U93A 4X1BA 1PB7A 1SETA 5F24A 4Q6GA 1U96A 1MSWD 3RBZA 1WA8B 5CB4A 1YCJA 2HXRA 5E79Z 4NQ8A 4I9DA 3SYCA 3ZRSA 2QA4V 1YCIA 5H8QB 1NQTA 2I58A 2Z23A 4P8BA 1XQ8A 2QR4A 3MC2A 4PFYA 2E5LB 2ADPA 2WBDA 3CS5A 2DYSB 5EYPB 3U10A 5A5XB 3O28A 4Q20A 3WB1A 4H5FA 5DW8A 2JEXA 1WP8A 1P1QA 2HCAA 4QSEA 1RDYA 1NS1A 4QPKA 4RUEA 4GX3A 1UTHA 1P1NA 4LFCO 1LAFE 1PPJH 3KC1A 2BTQB 1F23A 5BR8B 1FFXA 4DR5B 3K0VA 1R3IC 2DDKA 3CSXA 1MNGA 2YXLA 4OVSA 1VSOA 4I8CA 4ND9A 4I55B 5GONB 4YMAA 3ZKLA 4JI5B 4QFKA 5CA1B 4MSWC 1H38A 4JDFA 3LSXA 5J1DA 3JCZA 2OWOA 4H37A 3RT8A 3BEHA 3KCYA 3MPLA 4FEDA 4J11A 3T9VA 1Q1KA 4N4UA 1SF9A 4ZI7A 5EYHA 4X88A 3VLWA 1M9NA 2HFEC 4EUOA 4F18A 1ORQC 4J9ZB 1QQCA 2WBBA 4F1UA 3HB3B 4KCDA 3SETA 1H3DA 4PFWA 4JF3A 3EN3A 3TQWA 1Y3NA 4MVRA 1NH2B 2QM4A 1K73W 1JCHA 4CS3A 4NYKA 3R7XA 1XMQO 5LGTA 3M3KA 2WLLB 4UFZA 2X6BA 3AG2B 1Y76B 1MY1A 3A29A 3OO6A 1NV0A 2PX1A 3KJTA 1GKFA 1EZ9A 2FYIA 2QMXA 2QS3A 3N6UA 4R2FA 1QLNA 5DVJA 3CX5F 4TV9A 3TMGA 1UFIA 1CEZA 2XWOA 2QM7A 1YF2A 4JTAB 4KYSA 1FPGA 4GUNA 3FYIB 4O3BA 3ILTB 4KR5A 4LZ5A 2F3BA 2KKWA 4GT1A 1B58A 4PP0A 1T0KA 3U94A 3OO7A 3KZIZ 3HKDA 2ALUA 2ONKE 4FLXA 1MM7A 1YDXA 1THZA 2UYEA 5AA2A 5LMNO 3QSLA 2Y4UA 5CRYA 1FJ9A 3H6WA 4DR6B 1V9PA 2XXWA 1K34A 3NR7A 4WXJA 4IGTA 1GM7A 4ZOLB 2WX9A 3QAXA 1QVGU 2QTOA 3CE2A 2D21A 4N8GA 3U8QA 1P1UA 3CJHA 5A2QN 2O69A 3H6TA 3SDFA 2JIZG 1JETA 4UUJC 5LHIA 5IT9N 4HCYA 1JJ2U 1JPXA 4DUZB 3TAJA 1BSMA 2ZM6O 2WLJA 5IJ0A 3LR1A 3VVFA 4GX2A 1FXHA 2PTMA 1O63A 4JZGA 1B4ZA 4LF8B 1FPLA 4HNAB 4J7ZA 2GBOA 1HNZO 2PYLA 2I48A 3JAMN 3RYFB 4X1YB 2QKAA 3K5MA 2E74B 1SW2A 5CA3A 5I59B 2OJTA 1ZTEA 2JS3A 4DK0A 5FTIA 2XUMA 3A0HZ 2HR3A 2XNDG 4X1KA 5I2KB 5IYDO 2G93A 3GBAA 1HW7A 4O7MA 2XAJA 1XEQA 3D3QA 3AG2C 1IBKO 4PV1B 4F1YA 4X9QA 3UT5A 2XA5A 3FJGA 1Y1ZA 2HAUA 1SW4A 2R9JA 4PBHA 4GBWA 3CFLA 2VQEB 2QDOA 4CH4A
chains in the Genus database with same CATH topology
3K6VA 2HEUA 1QBZA 1J1NA 3QYTA 5DN6G 1VFEA 3A3CA 2XXHA 3OR7C 4N6PA 1VQ7V 3OUSA 3P7IA 3D36A 1MQIA 2X26A 2NVUB 1HSLA 3T9XB 3CCLV 5IDJA 1US5A 3PUZE 1I5XA 4RAIA 1PBPA 1XL6A 2DWEC 4XBFA 4R6HA 3VDFA 3GLBA 1MXXA 3THIA 4GX1A 3FB8C 4LQ5A 2O6AA 3EHSA 3QO5A 2NWJA 4GF8A 1GMGA 3JD2A 5H8FB 2DP8A 5GW7A 1Y3QA 1URSA 1DLBA 5KCJA 3K6WA 3QXMA 2DQVA 1OCOB 4OQOA 3AG3B 1N3XA 1B6QA 1LNQA 3CR9A 1H43A 1NFTA 3N94A 1AROP 1B0HA 4R9GA 5DT6A 1Y9UA 4FIMA 1LAGE 3UIFA 3Q25A 2M7WA 3KSJA 4OENA 3OUFA 3SERA 1JNFA 1G4YB 4HW8A 3OMNB 1V54B 2Q68A 2UXNA 1MH4A 2QRYA 4RXLA 2HJFC 1VQKV 1NJIW 5LBQA 3DP4A 3VXCA 5KZTA 4WKMA 4IY6A 2EINC 1SW5A 1NVPD 3SJQC 2I6EA 1ZJLA 2XOKG 5FTHA 1FQBA 2X6AA 3ZN0A 3G71V 3KOSA 2F8DA 3SPHA 4EKWA 2P6JA 4NWDA 4QJFB 2W6JG 2Q89A 3QK6A 2UXAA 2O1MA 1KECA 1YPNA 5B7DA 2HFBA 3ASOB 3MZ9A 4DIGA 3X2QB 3TTLA 2E1SA 3CFXA 1LB8A 4PDVA 2X7RB 4L17A 3I5OA 3JYCA 4MT8A 5DEXA 1XT8A 3IOUA 5KDTB 1CP9A 3M3FA 1A40A 2ZYOA 1FCKA 4PA7A 4I62A 3CVGA 1OCOC 5EHSA 4PDLA 5DTBA 2AL4A 5L9MA 5I2NB 4ZE9A 1IITA 4NF8B 1V54C 2P2AA 3WFVA 5H8QA 3MPKA 3IJXB 4P2ZA 1QVFU 1B51A 1K4CC 3OE7G 5ICTA 4NF4B 4JXIA 4OERA 5DM6V 2JK5C 1R3JC 4KI0E 4GQOA 1PKXA 5FHMA 3MP8A 2LAOA 1MY0A 4GXAA 1Y66A 1POY1 2LFRA 3U92A 3SEYA 1FS0G 1GGGA 1P4RA 4NMYA 1K33A 1MPDA 4F29A 1OVBA 1NL5A 5BWJA 1DOTA 1Y4CA 2V93A 3W9WA 3TUSA 3ASOC 4QFPA 3X2QC 4FJCC 5IKBA 1M56C 4R2BA 1E1RG 3HCQA 4GFRA 2V3UA 1B6HA 2H25A 3FV1A 3GZGA 5CBSA 4KCCA 4RJZA 2ZNUA 2ZD9A 4PA6A 2NXOA 2XX9A 2WLLA 2WLKA 2P0SA 3Q29A 4MFIA 2CZLA 1P1WA 3G3GA 2FNCA 5B3SB 4RYAA 1NH8A 4G8NA 2Y7IA 3PU5A 3TTNA 1K8AW 3ZMVA 2DOJA 3PMVA 4UA8A 2XAGA 3C31A 4UV8A 1Q81W 1WDNA 1MY3A 2OBGA 2Y69B 1MY4A 1OQGA 1SI1A 3ABMB 4MTOA 1B7ZA 2OK2A 2PT2A 4LATA 3S9LC 5CMUA 2REJA 3GWOA 4N13A 3LNMB 2PBWA 5JK4A 2QS4A 3RTWB 3ZSFA 3GB7C 3V8XB 1OCZB 3P30A 3TTKA 3PMXA 3T4ZA 1B05A 3FXRA 3SEVA 1QUIA 3PGFA 1MQHA 4JSDA 4GX0A 2EBOA 1I5YA 2XHDA 2DYRB 1M57C 4UACA 5H6RA 2VOZA 1N3WA 4DO2A 2EILB 3UK4A 5I59A 5AA2B 2X7QA 3LSFB 1XC1A 4YICA 1K5QA 3CRBA 5I2KA 2EIKB 4DDDA 4H67A 2R71A 4EXKA 1DTOA 2OWSA 3JYRA 3TEPA 2YPNA 3KGCA 3RQTA 3SKPA 3OOAA 5CBGA 4F22A 2OCUA 3E8HA 3ZRVA 1B3FA 4FECA 2ABHA 5B3SC 3MWBA 1XOCA 3KBRA 3D3IA 4MLVA 3MP6A 4NF5B 3TPAA 1MXWA 2X6CA 4KPTA 5H9CA 4LP8A 3ABTA 4U1ZA 4BDNA 2Y69C 2W7YA 2QM8A 2ATKC 4C1TA 3K06A 3ABMC 5HM4B 2ZNSA 1XVXA 1G8MA 4DXWA 4PFUA 4ZE8A 4XDKA 3CCQV 2XASA 4ZKIA 4XTCQ 2XXTA 4P0GA 5EK0A 5H8FA 3F5WC 3OMIB 1OCZC 1B7HA 3FVOA 1H44A 1RM1C 3D4CA 4OHNA 1P99A 4CZZA 1JEUA 2B3BA 2LFSA 3PPPA 1QW0A 4U7OA 4FE8A 3CCEV 2AHYA 5K2YA 2UYFA 3BKIB 5IAIA 2DXRA 3MD0A 1YITV 2V25A 3FVGA 1YTFB 2PVUA 2EZPA 2VGQA 3KEIA 3TCGA 5IY5B 2EILC 3WG7B 4LBEC 3LSLA 1AR1B 3C4MA 3OGCC 3HV1A 3W9VA 1EU8A 3H06B 2QE7G 2IU3A 1FXVA 3W7UA 4U2RA 3ETGA 1NR7A 3OFNG 3G4SV 2AL5A 1JEVA 2IA4A 1AI6A 4ONYA 1DF4A 2MK3A 3G3HA 4YKPA 2CK3G 1F9BA 3C9HA 3HPIA 4GOTA 5H8HB 3IR1A 1OLCA 1S77D 1IZ1A 4R74A 3PUWE 3CFZA 3IJOB 4BW5A 1E1QG 1ZWIC 1AH5A 5TPAB 4OMBA 2HVJC 3LSSA 1HSEA 1KP2A 4IO4A 2F5XA 2F6PA 4O3CA 2D3IA 4ELRA 3RGYA 2YJPA 3HN0A 1S9TA 2IU0A 1VFDA 2DWJA 3FIRA 1VQPV 4YB7A 1VE4A 5I2NA 1QR9A 4H8JA 4ZEDA 4DCXA 4UV9A 4R73A 1JX9A 1PB8A 4NF8A 5LGNA 2WWWA 3VLVA 1AI4A 2WPDG 2H9BA 3SPCA 2EIJC 3E4RA 5IY5C 1CE2A 3WG7C 5F7VA 4L87A 3AEIA 4BIUA 4H6DA 2O68A 2P1SA 3KSXA 4BDQA 1IXIA 3KZGA 4NF4A 1GTKA 1NR1A 4AQ4A 4MW8A 2B1GA 3CI8A 5L8DA 4TT3G 2REGA 1BHBA 4WF9V 2X7PA 1TT1A 4POWA 2ZMBA 1A55A 3KN7A 4LCUC 3TTMA 3G6EV 1UTBB 4F3SA 3MZBA 5B70A 1GR2A 5HFLA 1B9JA 4UVAA 1B3GA 3S2VA 3VXBA 3Q26A 2Z8DA 4G27B 3VLUA 4JGSA 2XXYA 2V3TA 1MRPA 3W7WA 3FKSG 4QE9A 3LSWA 5E1AC 3IC7A 1LBBA 2B5UA 3DM0A 2XXQA 2I3WA 1IXHA 1S7YA 2B1IA 3OSRA 1VQNV 4BDRA 3RNNA 5L9SA 3BFUA 2F34A 5B1OA 1M1KW 2AIXA 1I6QA 1IXCA 3WAFA 1BLFA 1MH3A 5CBRA 1JVXA 3S4UA 4C0RA 2Z3YA 4YKJA 1MXUA 3JD0A 3TCFA 1F4NA 4P30A 3K02A 1MABG 1KQSU 1NNKA 1SD3A 3TTRA 5KA5A 3KN8A 3SPGA 4RQEA 2YLNA 3K08A 3ETDA 1ROPA 5L3BA 2XX7A 1YJ9V 2RCAA 1I6BA 1B4HA 4HTGA 3K03A 1GVCA 2IW5A 4H1XA 4ECFA 1R9LA 4ISUA 4BDOA 3RPWA 4JAVA 1OQHA 4ZECA 1QKAA 4GL8A 3HO7A 4FAJA 3QO7A 1WPXA 3FB5C 3WAEA 1TWYA 3E8GA 1N84A 2EIMC 1FTJA 4OYVA 1OIBA 1ATGA 4YXWG 4J9YB 1B0LA 3OSQA 1D9YA 1UIVA 2DWAA 3PPOA 3ZMUA 1COWG 4NF5A 4KQPA 3C32A 3MW0A 1FXKC 4G68C 1WODA 4QFLA 1OCCC 3IO6A 1A99A 1S0VA 1LCTA 2DWIA 2HAVA 3L6HA 4MTFA 1OVTA 2PI5A 4XXUA 4ZZEA 3I55V 1MS7A 3U1OA 3FVKA 1QJMA 1W0JG 5HPQA 1P7BA 3B6WA 2XXRA 1A54A 3T9HB 3E89A 2VP1A 2EINB 3JV9A 3VVDA 1MXVA 1M5DA 2F35A 3H6VA 4FK5C 3MQ9A 1VQ9V 4N21A 2XX8A 1R3KC 4YKIA 1KP3A 2GHAA 4WFGA 2BOBC 2ONSA 1SBPA 1IEJA 1MXZA 3RT6B 4XDJA 2DWHA 3QIMA 2GRVA 4RO2A 2OCCC 1AL3A 2JEUA 1WLEA 1NH7A 1M5FA 4G4PA 2A0LA 3N5LA 4U1OA 2RINA 2Q67A 1AI7A 1BMFG 4FJPA 4F19A 1FTOA 4BDMA 3V83A 2RCBA 3ETEA 4WFBV 1D9VA 4DLDA 5H8HA 3ZCCA 3T9UA 1XL4A 3FB7C 4LC1A 4TLMB 4EF2A 1ZTYA 3AG4C 2JJ1G 1FQFA 4R8CA 5TPAA 3EHUA 1Z7NE 3TYHA 2PI4A 2E0SA 4R6KA 3N6TA 3RUMA 3PMWA 1PEBA 1MQGA 2Y84A 4QHQA 2RF1A 3OXNA 1DMBA 3HPLC 4FORA 3UA8A 3K01A 1IXMA 4XKQA 3K6UA 1YI2V 1DSNA 3OEKA 3T2MA 2O51A 4KHZE 4E0XA 2R9IA 1IXGA 5FHOA 3SPJA 4E0WA 4UXNA 3IGAC 3B6TA 1M56B 2Y7RA 4GWOA 1MQJA 3K1MA 2OWTA 1FQAA 4QSCA 4F1VA 1TFDA 4MVMA 1B5HA 1AOVA 3OD7A 2NUVA 1JW5A 2AHZA 4PDRA 3M3LA 2NOOA 3TELA 1M5BA 1BP5A 1PC3A 4QIWF 1UTBA 4U4SA 2NLJC 1LSTA 3PD8A 2Z8EA 3ZJZA 3DLNA 1HWYA 1B1XA 3QUFA 1H45A 4LZ8A 1USYE 3O6HA 1AMFA 3EFFK 4IO6A 2RKMA 4F3PA 4GLIA 5EYFA 3CSGA 1Q7YW 2Q9TA 3OELA 1POTA 3LUYA 5AA4B 2A5SA 3RVZA 1II5A 4XKRA 2RC9A 3B8MA 1Y1MA 1V55B 1R73A 5ICQA 5ITOA 3OEHG 2XAFA 4PA3A 2ZYNA 1YIJV 2BJJX 1FXKA 1ZIUA 3RY3A 2HZLA 1M57B 4U4XA 1MM6A 1UIUA 1S72V 3E83A 2LP7A 1SDXA 1XS5A 5AA3A 2QSXA 1VQ6V 4U23A 1K3EA 4K3FA 4TQUQ 5DVFA 2GH9A 3T96B 1E79G 3USDA 1NNPA 4H33A 2HVKC 2XXUA 3M8UA 4NTLA 4F2QA 1NNTA 2Q8JA 3W7TA 3EHBB 1B3EA 1LCFA 5CMCA 4JAUA 5I56B 4GVOA 3ZIAG 2IJHA 3FXUA 4X9TA 3QNEA 4MVZA 5CMMA 1ZBMA 3R26A 2P7TC 4HS7A 2WKYA 1B52A 1I69A 4NE4A 3SYQA 1USYH 1TUEB 1O64A 4WEDA 4GRKA 1SQYA 1PL0A 2B3FA 2H98A 2D3OW 1NNFA 2Z5UA 3O6GA 4JASA 3ABKC 3FVNA 1V55C 4YAHX 1KD1W 4XKPA 2XXIA 3SEWA 2V3QA 4QNHB 3RN8A 1RM1B 2P67A 3CD6V 3K4UA 4WFAV 3R65A 4R6ZA 3K9AA 3TETA 5DYHA 4ELPA 4RA1A 3FASA 4KP4A 2C2AA 3VE1B 1NKXA 1GTOA 3JD3A 2Q6AA 4WFFA 1H76A 3S9MC 3H7MA 5B1AC 3E9XA 2Z22A 3DP8A 5AA2D 4BAYA 3PPNA 1VQOV 1B40A 3EQ1A 4TLLB 2DWDC 2DE4A 4NWCA 5JEIA 2I3VA 4LUBA 5K2XA 4Z0IA 2Q69A 1QCEA 3IL1B 3EF7A 5ISUA 3ZMSA 1Y20A 4EQBA 3ASNB 4F4LA 2OTJV 2OTLV 1M90W 4P9PA 3FUZA 3VV5A 1RKMA 4I1DA 1VR5A 3W7SA 4OTEA 4ZEBA 1YSCA 1S5HC 2ITCC 4QRZA 4MLQA 4NEDA 1FQEA 4MTGA 5EBMC 2I0CA 4JYBA 1KKDA 2XXPA 3CSBA 3S9NC 4CBCA 1KWHA 1PNLA 2EIJB 1N0TA 4H8IA 5I57B 2P90A 3K0GA 4JPRA 1UJWB 2QS1A 4U22A 4MH5A 1K7DA 2THIA 1RYXA 4XKNA 4QPJA 1SI0A 4GL0A 1M5CA 3JD4A 1CPYA 5CM6A 2ZR3A 2QJEA 1YTFD 2W0FC 3MZ1A 3EHTA 2V84A 3OMBA 2PMSA 5EHMA 3CC7V 4LZ7A 5CC2A 3Q27A 4E2LA 3E86A 1FFTB 4OFLA 4YZZA 3EPEA 3GXAA 3CCRV 5L3CA 2HZKA 1URGA 4DCYA 3ASNC 1FTMA 1SRYA 2H99A 3LDCA 3F7YC 4EDPA 2WLHA 3CG1A 3G7WA 5ITPA 3MHSC 4Q0CA 5H6QA 1LFIA 4AB6A 1B46A 3TDJA 4H0WA 4IY5A 2RC7A 4ZS9A 2AYSA 4G2ZA 4GCZA 3CPWU 5IYBO 4IO3A 4ZBMA 4ZEIA 3CCUV 2ANJA 4ASUG 2IH1C 2X0LA 1OLAA 1YJNV 1A8EA 3CMAV 2I4CA 1SERA 1TXFA 3LUTB 1O7TA 4HZ3A 5J9PC 3JD1A 1RPRA 3BBRA 3LC8A 1FTLA 3JZJA 5AA4A 3DGEA 5JTYB 1LFHA 4G8MA 5CI5A 3TZAA 4WEPA 3LDEA 3I56V 1LFGA 3MVWA 3PV0E 4RY1A 4BDLA 5AA1A 5CBHA 3ODBA 4R75A 4OESA 3H3GA 2ZYMA 1H8EG 3AG1B 3KOTA 3K1PA 5LHHA 4RQFA 2UVJA 1GM8A 2DE2A 3I6VA 2YEVB 1ZMGA 4DZ1A 3F11A 3R6UA 2QMWA 3B6QA 5TU0A 1WVJA 1PDAA 4LONB 2EIMB 3K79A 4ZEKA 4MF3A 3F7VC 3S9EA 4OFOA 1YAEA 1B2HA 5TP9B 4MVUA 3SESA 5HFMA 4RUFA 5KUKA 1VQ4V 2ZQMA 3K6XA 2JDIG 3PUXE 2WLMA 1JVYA 2F7CA 1AI5A 5I56A 1AJQA 1FXKB 4G68B 3CCMV 4THIA 1D4NA 4OVJA 1Y4TA 1OCCB 3HHFA 3PUVE 1EBOA 4LA9A 5B1BB 4GD5A 2WLNA 2DYXA 4G28B 1BKAA 4QSDA 2F78A 1SZTA 1JQFA 1NKDA 5BZBA 4KYDA 4EQ9A 4N23A 4PQJA 4HCWA 4JB7A 4R6YA 4ELQA 1B5JA 5FHNA 1GV8A 5F1QA 1VQMV 3ZN1A 1K92A 1NH2D 4RPOA 1KC8W 2V7QG 3AG1C 3FB6C 2A79B 2XXXA 4OXVA 2DQ3A 3MUQA 1Y3PA 2F43G 2OCCB 3UGWA 5EBWC 5H8NB 2Q2CA 1A7LA 3V5AA 4PA4A 1MDQA 4G2KA 1GO3F 3VVEA 3IOTA 4XIGQ 3B8NA 4Q8RA 3KN3A 3O29A 3ZRWB 2DYSC 4POXA 1K9MW 5L9OA 1IIWA 4HYOA 1QVSA 4OWDA 3HHGA 4PFTA 4ZEFA 5CMBA 1P1OA 4IO7A 5B1NA 2DSFA 4KUMA 2EZOA 3H6UA 3TKDA 1K5SA 3AG4B 3MJNA 5B1BC 1A8FA 2UXXA 3OO8A 3IB2A 1QUJA 2WLIB 4FIPC 3A09A 4QE7A 3M99B 5C93A 2JJ2G 1M5EA 3IB1A 2HXWA 1B3LA 3B77A 4RK9A 3L6GA 3RTFB 4TSFG 1OCRB 1ANFA 5DVIA 3O97A 3IK6B 2WSSG 1NBMG 4EF1A 1OMPA 1ZLQA 4Z1MG 2XD2A 4MBPA 3CYOA 3CC4V 1F4MA 3OR6C 5HBCA 3FV2A 3FZVA 5L3FA 3FATA 3IAZA 4JWOA 2Y7KA 2K1EA 4GXSB 2ITDC 5I57A 5L3EA 4EQ7A 1BTJA 1LAXA 4R9FA 2ZXTA 3ECRA 5CN0A 3CP1A 3ONMA 4M1VA 5CMKA 1DTGA 2BOCC 1TFAA 1BHAA 2A5TA 2VHAA 1B32A 1VQ5V 2A9HA 2O1LA 3SEUA 2OZZA 1ZU0A 3MVYA 4UVCA 1JVMA 4WCEV 1B7UA 1L1FA 1MXYA 4P11A 3K2DA 4GIZA 2QEXV 5CBFA 1B1HA 1JW4A 2OLBA 3K00A 2UVHA 3LDDA 1OHHG 4BLAA 1R6KA 2VD3A 3ABLB 1SYHA 5I58A 5LHGA 4GX5A 3MAMA 1JOYA 1N7XA 1OCRC 2UVIA 4ZZAA 4UVBA 1F51A 4JTCB 3DELB 2CMOA 3CCSV 2FTKA 4C1UA 1ELJA 1JW1A 2V1DA 3SPIA 1PNMA 2GHYA 3TK1A 1NVPB 3G3KA 1US4A 2DVCA 3PJSK 4H5GA 1EZJA 3TFLA 3W15C 4BIZA 1EZOA 1L5TA 4YKKA 3G3FA 3O6IA 4LQ2A 4KD5A 4QF9A 1PD3A 3ML0A 1AJPA 1R3LC 3O66A 3OAAG 1MQDA 5BUUA 4MTXA 1PBQA 3UORA 3UN6A 4F3GA 3CMEV 4JWYA 3SYPA 3RVYA 3C35A 4IB2A 1FQCA 4WFEA 3MVXA 3E2EA 2ZXWB 1QUKA 5JTYA 3IOWA 1FTKA 3OM3B 3OENA 1MG1A 2H94A 3T4DA 3IB0A 2PT1A 1RPOA 5H8SA 4ESXA 2YSUB 3QO8A 1LB9A 3ZKKA 3ILUB 2Q88A 3VFJA 3K3WA 4ZDMA 1R6ZA 3ABLC 2F6GA 3AG3C 2ONRA 2Y7PA 2YEVA 4NF6B 1CB6A 4X89A 1NMUA 2QPQA 5ELVA 1S76D 4PELA 2D5WA 3IO4A 2XD3A 2XXVA 3Q28A 3T1CA 5L3GA 3CC2V 4JBZA 3G3IA 3T66A 5TP9A 3ABKB 4U7NA 3G3JA 3DP6A 2DE3A 5A5XA 1OZ0A 3IORA 4KFMA 3IX1A 2IJIA 4H65A 1AIVA 3OEEG 4HAMA 4RNSA 1JQ0A 4Q30B 4TWKA 4XDLA 4G68A 4U21A 2F36A 1DPEA 4OFJA 2DS9A 5IYCO 4F39A 2GFEA 2NNUA 4O3AA 1BIYA 3OMAB 4OETA 2O7UA 2ZDIC 3FD3A 2F97A 3C34A 3ZMZA 2H5YA 2ZYKA 1DPPA <