1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
3K6VA 2OZZA 3QK6A 4BDMA 2I4BA 3CSBA 4LQ2A 4KYSA 1LB8A 2I58A 1MDQA 3BFUA 4X1DA 2OCUA 1NNKA 3LR1A 3QXMA 2Q9TA 1H44A 4RYAA 2W7YA 1B46A 4I62A 1LFGA 4EDPA 1FW0A 5F7VA 4RXLA 3TTLA 3KN7A 3PPNA 2P0SA 3MP6A 2I0CA 2OLBA 4F3PA 1XS5A 4UA8A 1XT8A 1LFIA 2V3UA 3FVNA 5AA4A 3TTNA 1II5A 2ZXTA 1M5BA 3ILTB 3O6IA 1LAXA 1ATGA 5I58A 5H8NB 4JSDA 5K2XA 3OO7A 4GQOA 2HCAA 3TFLA 5CBSA 3N94A 4IY6A 1DLBA 4MH5A 3T9HB 4KYDA 5A5XA 1USYE 1FTKA 2ZYMA 4PQJA 1IQ7A 3KZGA 4NF8B 4HS7A 2ESNA 3IX1A 3Q25A 4OFOA 1QULA 4QSEA 2LAOA 1KWHA 3IJXB 2XXVA 4G68C 4IO2A 4IB2A 1Y20A 1QUJA 1D3KA 1ZJLA 4JWYA 1A8FA 3OO8A 1M5FA 5TP9B 1QBZA 3OO9A 3PGFA 4NEDA 4GVOA 4G77A 4ZECA 3K4UA 1LSTA 2XXWA 4GXAA 1SI0A 3TODA 4ESWA 3RTWB 1FTMA 2HEUA 2DWJA 1JEVA 1DOTA 4PETA 3K0VA 2I4CA 1OQGA 4LZ5A 1MH4A 1AOVA 3H03A 3U1OA 1NKXA 5KCJA 5H8HB 4EQ9A 1AIVA 2V93A 3TYHA 3EPEA 4FK5C 4F2QA 3LC8A 1Y66A 4GD5A 1K33A 4H5FA 2DWHA 1GTKA 1FQCA 4RPNA 4GIZA 1YPNA 3PD9A 2QS1A 3H7MA 1MQGA 3HHGA 3K9AA 1FCKA 1UIUA 1AL3A 2HXWA 3FD3A 1B51A 2GHAA 1B7HA 4I8CA 4X9TA 3OEKA 1US4A 4XKQA 4F29A 5CMUA 3GBAA 4Z7EA 1A40A 2PX1A 5J1DA 1Y4CA 2HAUA 5I59A 1MM6A 3O6HA 2I0BA 4KFQA 1DTZA 1S50A 2R9JA 3O97A 4JB7A 1MXUA 4R6YA 4ZE8A 2AL5A 3ZKLA 1I5XA 4PFWA 1PB7A 4U1OA 2Y84A 4JWOA 4OHNA 2Q8JA 5I2NB 2PT2A 3RGYA 2X7RB 4QHQA 1F9BA 1B5JA 4KCCA 3TTMA 1ZBMA 3MHSC 4F3GA 3PMXA 3CFXA 4MLQA 3KBRA 3CRBA 3IORA 2AL4A 3T9VA 5DEXA 1J1NA 2FA7A 2QS3A 2V25A 1SI1A 1P99A 3BBRA 2LP7A 2B3BA 2X7PA 5HFMA 4P0GA 5DVIA 5FHNA 1H76A 1M5CA 3KN8A 4GXSB 4KD5A 4U4XA 1B1HA 4KR5A 2REGA 2ZNUA 2F6GA 4IO6A 1B4ZA 1VE4A 4QF9A 4R2BA 2RCAA 1B6HA 1SW5A 2V3TA 2Y7WA 5TPAB 2XXQA 5LOMA 1B58A 5EYFA 3T9XB 3MVWA 3EN3A 4TOZA 3IB1A 4ZEIA 1MPBA 1SZTA 1O7TA 3IJOB 2GFEA 2QS2A 3KOSA 3UA8A 4G8NA 4O3AA 1PDAA 4BLAA 1EZOA 1URGA 1K34A 3FVOA 5HM4B 1AMFA 1LAGE 3IL1B 4POWA 2I48A 1D4NA 1B5IA 4ZS9A 3FXQA 1P1QA 1B1XA 4O3BA 3EQ1A 3S2VA 1NNTA 4ZEKA 5H8FB 3VFJA 3RN8A 5I57B 5I2KA 1A55A 1UTHA 2M8CA 1SBPA 5L9SA 3H6TA 3FZVA 4MFIA 1NFTA 3T66A 4MF3A 2VGQA 5EHSA 2PBWA 4MLVA 4FEBA 5DTBA 4KPTA 5CN0A 2O7IA 4GLIA 3SEYA 4U4SA 3PUWE 3VE1B 1B7UA 4O3CA 3ODBA 1RYXA 4ISUA 3S9NC 4F1VA 1IXHA 4KI0E 2ZYNA 2RC7A 2THIA 2OK2A 2VD3A 2V3QA 3I5OA 4M1VA 1DSNA 3O28A 4PFTA 1DPEA 3S9LC 2ABHA 2RC8A 3CI8A 3H01A 4GWOA 1SQYA 1JETA 3TQWA 5FTHA 1ZMGA 4GRKA 2OWTA 4G68B 2QL3A 2RC9A 3RLFE 3LBSA 4H6DA 5ITPA 4H8JA 4YKIA 4YKJA 3OSQA 4C0RA 3W15C 4JSOA 3FUZA 4N23A 1PB9A 3M3LA 2F7AA 2R6GE 3RPWA 3K6UA 5H8QB 2ALUA 3IAZA 1VFEA 1FQEA 1N7WA 4N13A 2AIXA 2ZNSA 5JTYB 1Y4TA 5ELVA 4FE8A 4ZZAA 3M8UA 3Q26A 1H43A 4DXBA 2F36A 4OQOA 3MC2A 2QS4A 2B65A 2KLFA 3K02A 2D5WA 3SEUA 4R73A 1B3LA 3MVYA 2NWJA 4HCYA 1I69A 3K6WA 2Z23A 2UVGA 1LAHE 3KJ7A 2D3IA 1B0LA 2QMWA 1RKMA 4NF4A 4L17A 1POY1 4IY5A 1XVXA 3TAJA 2DVCA 1B7ZA 2XXHA 1JW1A 3KSJA 2Z8FA 1Y4MA 3N6TA 1DF4A 1A99A 2F7BA 1QR8A 2OWSA 3G3HA 2QSXA 1SDXA 5AA2D 2XXPA 2OJTA 4G2ZA 4IO3A 3K1MA 2F5XA 1YTVA 3K6XA 2H9BA 5KA5A 1NMUA 3QSLA 4R6HA 3KSXA 3EHTA 3I6VA 2DE2A 4OVJA 3HCQA 2QRYA 4JPRA 4FJCC 2HFBA 2O1MA 3UK4A 3C31A 3RQTA 3C36A 4ZDMA 3GZGA 4IO4A 4U1ZA 1BTJA 3FV1A 3SEXA 1O64A 1QUKA 4FATA 1PEBA 1Q35A 5ITOA 2RKMA 1B3GA 4TLMB 2DYXA 3HO7A 3C9HA 3OSRA 4RY1A 2XXTA 4N6PA 1SW4A 3RUMA 1POTA 3MW0A 4KCDA 3SDFA 3MPLA 2REJA 2EZPA 1RYOA 1LCTA 3GXAA 3JV9A 3FJGA 1EZ9A 1GR2A 4GF8A 1D9VA 3LSLA 2UXAA 4OXVA 5CRYA 4C1UA 4R9FA 3MWBA 2D21A 2HZKA 4Q30B 1QCEA 1LB9A 5H8SA 4DDDA 4ZEFA 4E2LA 4NF8A 4NF5B 4FEDA 2I3VA 2R71A 3G3IA 4BDQA 5CMCA 4U23A 3V89B 4R9GA 3V5AA 3THIA 1OQHA 4HW8A 4N07A 5CM6A 1B40A 1IXGA 2ONRA 1XHYA 1BKAA 5CMMA 2F78A 4ECFA 5CMBA 4EXLA 3TMGA 3C35A 3U93A 5TP9A 3O6GA 2X7QA 4BDRA 3E9XA 3OENA 3P30A 4G8MA 2H25A 4NTLA 1Z7ME 3A3UA 4QFLA 4G8HA 2MK3A 5HBCA 2UVJA 2VHAA 2RCBA 1YCJA 2P6JA 2O1LA 3M3FA 5FHMA 1DF5A 3Q27A 4EUOA 4OERA 1N3WA 3ILUB 5H8HA 5DT6A 3G3KA 2PVUA 2DWIA 3U94A 2DVZA 3WFVA 3UN6A 3D4GA 4PFYA 5AA1A 5KDTB 4ND9A 1MM7A 5KZTA 1JQ0A 2O84X 4NMYA 4ZE9A 3KEIA 1S7YA 2IEEA 5AA2A 3RT6B 4WXJA 3E3KA 3QUJA 1HSJA 3CYOA 3MAMA 4E0WA 2XXXA 2ONKE 4AQ4A 3ZSFA 2Q2CA 3GBBA 1MXYA 4TQUQ 4KHZE 3CIJA 1R6ZA 2XXRA 1QVSA 4H0WA 2GRVA 3DELB 2A5TB 4OEVA 4P11A 1URDA 5CMKA 4NE4A 3W9VA 1DTGA 3MZBA 3DP4A 2M7WA 5ICQA 2DXRA 3VXCA 3Q28A 2VOZA 4ELQA 2H5YA 4JXIA 3BFTA 3F11A 5I2NA 1FTLA 2F7CA 3MUQA 3CP1A 4F1YA 3S9EA 4QFNA 4WEDA 3PMWA 2XHDA 2V84A 4LZ7A 4EQ7A 1A7LA 3MVZA 4F22A 1N7XA 3T93B 3QAXA 2UVHA 1OIBA 1MQHA 1NNPA 2YJPA 4BDLA 1PC3A 3D4CA 1GGGA 3CR9A 1EU8A 4RA1A 2FNCA 1ENVA 4X48A 4YB6A 3TTKA 2FYIA 4EF2A 4IO5A 2DE4A 1A54A 1TXFA 4KQPA 4JBZA 1B05A 1UQWA 4LP2B 3MJNA 4RJZA 4RK9A 1Y1ZA 5KA6A 4GL8A 3GLBA 2BJJX 1PBQA 3CG3A 3TCFA 3TZAA 4Q8RA 5TPAA 3G3FA 2GH9A 4QFKA 5H9CA 2Y7IA 1F23A 2DP8A 4I9DA 3MHHC 2ZYKA 3FVKA 4EF1A 2P2AA 4LATA 4XTCQ 3B6TA 3VLUA 1UIVA 3R6UA 2O51A 3IB0A 2XXYA 5B70A 3E4RA 1SW1A 3O29A 2DOJA 3V83A 3G3GA 4FIPC 1GV8A 2DS9A 3C34A 4U2RA 1QR9A 2DQVA 2O7UA 3LSXA 4MBPA 3K2DA 5H8FA 5I57A 1H3DA 1HSEA 2E0SA 3K1PA 3H3GA 3TDJA 1EBOA 3CFZA 4HTGA 3UGWA 3LSFB 1JVXA 3VVFA 1B32A 3W9WA 4RNSA 1UTHB 3DP8A 2H99A 1FQBA 4NF6B 3TQLA 3PD8A 3KN3A 3TKDA 3M3KA 3FXRA 1R9LA 1IXCA 1ZTYA 3G3JA 4F39A 1CE2A 1XVYA 3DM0A 4UACA 4YICA 1IITA 3EF7A 3HN0A 1N76A 4G68A 4OESA 3JYRA 3PUYE 2NVUB 4QSCA 4DCYA 1R1NA 3FVGA 1UTBB 1Z7NE 3USDA 5K2YA 5L9OA 2F8DA 4F2OA 1QW0A 3VLWA 3K00A 4AB5A 2O68A 1IIWA 3A09A 3KG2A 4Q5TA 2HQ0A 3WAEA 5H8QA 3H6VA 4OWDA 1P1UA 1N0TA 2XD2A 3IO6A 5JTYA 1LBCA 3DP6A 2IA4A 1OVBA 3VXBA 3UORA 3R26A 1MH3A 1HSLA 2CMOA 2Q88A 2VP1A 4YKKA 1MXWA 3RT8A 3IR1A 1ANFA 5IKBA 2I49A 2UYEA 4QFPA 3FATA 1FQDA 2PYYA 3RNNA 1MY1A 4E0XA 1NH8A 4XKNA 2RF1A 3VDFA 4IGTA 2DWAA 4I1DA 5I56B 3T22A 3EHUA 4R6KA 4F3BA 1S9TA 4F18A 1QKBA 4TLLB 1MPDA 3SEVA 1SYHA 3OD7A 1B5HA 1OLCA 1O63A 1Q1KA 2ANJA 2XX9A 4THIA 4DE8A 3SESA 1DPPA 3CSGA 2QPQA 4H67A 1IZ1A 4QFOA 3V8XB 3N6UA 3H6WA 4R74A 3O66A 1P1WA 3VVEA 4LQ5A 3N26A 1SVXB 2Z8DA 4U22A 3FJ7A 2YLNA 4U21A 3B8NA 4QSDA 2UYFA 1MY0A 3A3CA 3PPQA 3EHSA 1NH7A 1ELJA 4LONB 3L6HA 2I6EA 3PPRA 3B7DA 1B0HA 1VR5A 2PT1A 5HPQA 1ZLQA 1WODA 3MQ9A 4F19A 5H8NA 4OFJA 3P7IA 2CZLA 3BKIB 4H1XA 4FJPA 2ZNTA 2DSFA 5JEIA 1JEUA 3FJMA 5AA4B 4OMBA 1B2HA 5ICTA 2RINA 4ELPA 3KGCA 1N84A 3K01A 4NF5A 3M99B 4YMAA 3OO6A 1I6QA 5I58B 1B9JA 2Z22A 3TELA 1MRPA 5CBRA 2Y7RA 2G29A 2VD2A 4FIMA 5JK4A 3PU5A 5CI5A 5A5XB 4ZEDA 3C32A 1MXZA 1MXVA 1FTJA 4FECA 3ECRA 1NNFA 1LAFE 2AYSA 2XX8A 3OXNA 4G2KA 1SYIA 4DLDA 4FAJA 1Y3QA 3TTRA 3KFMA 5L8DA 5L9MA 2Q2AA 1FTOA 2XXIA 3MP8A 3MBPA 1ZKBA 4YB7A 3ONMA 1GVCA 1I5YA 4Z0IA 3FGSA 2YPNA 1JNFA 5ISUA 2Z8EA 3H06B 3PV0E 3R7XA 4HCWA 3VV5A 3B8MA 2H98A 4DXCA 3H6UA 1I6AA 3U72A 3HSTA 5HFLA 2O6AA 2O69A 3WAFA 4KYEA 1CB6A 1P1OA 1ZIUA 1MPCA 5KDTA 3IOVA 4Q0CA 5B7DA 5KCJB 5CC2A 4R75A 1PBPA 3HHFA 1URSA 4PFUA 4R2FA 2OT5A 4BDNA 1MOFA 3KJTA 4OZ9A 4OETA 1H45A 1TT1A 5IAIA 4WKMA 1EZPA 2GHBA 3PUVE 4R72A 5BUUA 2G93A 3K1NA 1XC1A 4QRZA 4GOTA 2F6PA 4X1BA 1TFDA 5AA2B 1ZU0A 3I3VA 4OFLA 3O9PA 2A5TA 3L6GA 3C33A 1AH5A 3TCHA 4JGSA 2XX7A 2B3FA 1MQIA 4DIGA 3PPOA 4FORA 3FV2A 3B77A 3S4UA 5FHOA 1N3XA 3PPPA 4F1UA 5DVFA 5I59B 1MY3A 1JW4A 3FXUA 1JW5A 4M4GA 4XKPA 3Q29A 1OLAA 3HV1A 4POXA 4OENA 4IGRA 3PUXE 1IUDA 5TU0A 1B4HA 3RY3A 1JVYA 1BIYA 1BLFA 2Y7PA 4K3FA 3TUSA 3N5LA 1OVTA 5EHMA 2NXOA 1FQAA 1M5EA 4ESXA 5DEXB 3B6QA 4N21A 3GWOA 4NWDA 1USYH 2DXYA 1LCFA 3ZS6A 2F35A 2EBOA 1T0KA 3S9MC 2P1SA 1DMBA 1MQDA 1D9YA 3T9UA 4OYVA 4JF3A 4ELRA 1XOCA 3E13X 2PMSA 3UP9A 1R9QA 3DLNA 3PMVA 3AXFA 4ELOA 2OBGA 3MZ9A 5AA3A 4YZZA 4GL0A 4PE5B 2A5SA 2I3WA 1VSOA 2ZMBA 4F3SA 1BP5A 1B3FA 3MVXA 3TCGA 4DCXA 1TFAA 4YU0A 3MZ1A 4OEUA 3OEMA 4EQBA 1VFDA 3IOWA 4DZ1A 2QMXA 1JQFA 1P1NA 2XD3A 2ZYOA 1Y3PA 1QUIA 1LFHA 4XKRA 3VLVA 3U8QA 1MDP1 3ZKKA 4NWCA 1WVJA 2DE3A 3QYTA 3OELA 3MPKA 1A8EA 5I2KB 1B3HA 2E1SA 1MS7A 3OOAA 3JZJA 5DYHA 2NOOA 4NF6A 1MY2A 1SW2A 1N04A 4LA9A 3U92A 1US5A 2QJEA 4OTEA 4YMBA 1LLSA 1MQJA 1YAEA 3TPAA 4LZ8A 4XIGQ 3QUFA 4LUBA 3G7WA 3CFLA 3LSWA 1B52A 2EZOA 4BDOA 1FQFA 3IOUA 1TWYA 2NUVA 3UIFA 1IEJA 2WKYA 1LBBA 2ONSA 5AE4A 5BWJA 4WEPA 2X26A 1PB8A 3FASA 2UVIA 2XXUA 1UTBA 3HPIA 2Y7KA 3VVDA 4AB6A 3H4ZA 1EH3A 1JPXA 3LUYA 3IB2A 3MP1A 2F34A 3SETA 1WDNA 4PP0A 4F31B 4RPOA 3O2AA 1Y1MA 1MG1A 2HAVA 4H8IA 4IO7A 1M5DA 3B6WA 4YAHX 5DVJA 1NL5A 1LGBC 3T96B 5I84A 3IOTA 1OMPA 2HZLA 4DXUA 4ONYA 5F1QA 1Y9UA 3TEPA 1SD3A 3FIRA 3SEWA 3PUZE 4JWXA 4GFRA 2F97A 4H65A 4LVQA 4RK2A 4ZEBA 5I56A 4YB5A 4P0IA 3CG1A 4C1TA 4EXKA 2Q89A 1MY4A 3SERA 4JDFA 3C4MA 1I6BA 4NF4B 3QIMA 4XXUA 3CVGA 4YKPA 3KOTA 4ZZEA 1L5TA 3SKPA 1IXIA 3IK6B 2H4IA 1QKAA 1Y3NA 4G4PA 1QJMA 3OMBA 1MXXA 5FTIA 5M2VA 1B3EA 3IO4A 3RTFB 4H5GA
chains in the Genus database with same CATH superfamily
3K6VA 3GVMA 4RUFA 2UUBB 2OZZA 3QK6A 4BDMA 2I4BA 3HR0A 3CSBA 4LQ2A 4KYSA 3N2GA 3ZMZA 1IURA 3NR7A 1TAEA 4QPKA 1LB8A 1H8HG 3CRCA 1HP8A 4LN5A 3IC7A 4YJ3A 2I58A 3OEHG 1MDQA 1DGSA 2YIAA 3BFUA 3IFAA 4QNHB 5FLXN 2OYQA 1I08A 4B7KA 1YVWA 1P49A 1GN3A 4X1DA 2OCUA 1OCRC 1NNKA 3LR1A 2LFRA 1JFFB 5GONA 2UXNA 3CC7V 2HHHO 3IFCA 2Q9TA 3QXMA 2RQ6A 4R6ZA 2EIMB 2BOCC 3FD9A 4W4LA 1H44A 1QLEC 2Y4TA 4FM0A 1FBCA 1M1KW 4RYAA 2W7YA 1PD3A 3T1YB 4LP8A 5IZ3A 1B46A 4I62A 1LFGA 1XBLA 1XNRB 4EDPA 1NVPD 4GUNA 2R9RB 1FW0A 5F7VA 2QVUA 4RXLA 3I5DA 1M57B 3LDEA 4YXWG 3TTLA 3KN7A 5KUMA 1AJQA 2R8TA 1NV7A 3PPNA 3EKIA 2P0SA 1QQCA 3E78A 4LWSB 1VIBA 5LA6A 1H2LA 3RYIB 2X6CA 4NXMO 3GYYA 3MP6A 2I0CA 2JGDB 2OLBA 4F3PA 3ABKC 1VMGA 3BVOA 2AGAA 1XS5A 4ZHQA 4PFBA 1LBXA 1LFIA 2F23A 4BW5A 1XT8A 4UA8A 2V3UA 3AG7A 3FVNA 4FZ1A 5AA4A 2ITCC 2CTWA 3TTNA 4NYKA 1H2MA 1IBMB 4LF5B 1II5A 1W2BU 3CJHB 4Z1VA 1KBHA 1K73W 2ZXTA 3LV0A 3RYHA 5KMGB 1SQXH 1M5BA 3ILTB 3O6IA 2P22C 1LAXA 3UCSC 5D5QA 3PN1A 1ATGA 5I58A 5H8NB 4JSDA 2RNBA 5K2XA 2Q73A 1XHXA 1K5SA 3OO7A 4GQOA 2HCAA 3AG4C 3TFLA 5CBSA 3N94A 5IDJA 4IY6A 1SKVA 1DLBA 4XDKA 2V1DA 4MH5A 1YYZA 1BZKA 3CHGA 3T9HB 4B3RB 4KYDA 2LGQA 5A5XA 1USYE 1FTKA 2ZYMA 4PQJA 2KG7B 3ETQA 2PFZA 1IQ7A 1HR0B 4LFBO 3KZGA 2RMKB 3ABLC 4NF8B 5DN6G 3QG5A 5E79Z 4HS7A 4BWAA 4GWYA 2ESNA 2DDKA 2A06H 3FB5C 3IX1A 3Q25A 4OFOA 1FYJA 1QULA 4QSEA 2LAOA 3HKBA 4DV6O 4GX0A 1KWHA 5IYZA 1XMOO 3IJXB 2XXVA 4G68C 4K8ZA 1OJHA 3A0HZ 3LDCA 2YUAA 4IO2A 2EINB 4QE9A 2YICA 4IB2A 1Y20A 4L8JA 1FRPA 1Q6UA 1OCZB 1QUJA 1Q90D 3CCLV 2PYLA 1D3KA 3W7XA 1ZJLA 1EYIA 4JWYA 4DV3O 5EYGA 3X2QB 1A8FA 3OO8A 1VF7A 5EC1C 1M5FA 1BQZA 5TP9B 1IMFA 2EIKB 2W6IG 5DM6V 3CPWU 1QBZA 3OO9A 4KHPB 3PGFA 4NEDA 4ZI7A 1AWBA 4GVOA 4G77A 4ZECA 2RCVA 3K4UA 1LSTA 2XXWA 1Q6IA 4C7UA 2X6BA 3AEIA 4GXAA 1SI0A 2WPDG 3TODA 3HB3B 5JQGB 5IZZA 1Q8IA 3KCXA 1N8RW 4ESWA 3AG2C 3RTWB 4J7ZA 2QTSA 1FTMA 3TK1A 4DV1O 4CS3A 1HDJA 2HEUA 2DWJA 1JEVA 1DOTA 1XL6A 4PETA 4QPJA 3SYCA 1Q3EA 3K0VA 2E75B 2UXBO 2I4CA 1OQGA 4LZ5A 1MH4A 2OTJV 2VQEO 2FMLA 3G67A 1FPDA 1AOVA 4O8MA 2WWWA 4FM2A 3H03A 3U1OA 1NKXA 5KCJA 3A8TA 5H8HB 4EQ9A 1AIVA 1J5EB 2V93A 2Y69C 3TYHA 3EPEA 4FK5C 3UM7A 4F2QA 3FAVB 3LC8A 1TA8A 1Y66A 1YJWV 1FXKB 2Y4UA 3SYOA 4LFCO 4GD5A 3K04A 3NXSA 1K33A 4H5FA 2DWHA 1GTKA 1URFA 1FQCA 1BT8A 3CE2A 4RPNA 3W7SA 1LBYA 4GIZA 4IR8A 2ZE8A 3B4SA 1FKAO 1CPYA 1AR4A 4MNIA 3SPGA 1YPNA 3PD9A 3CCUV 2QS1A 3H7MA 1IBKB 1MQGA 2ZDIC 2ZE6A 2XWKA 2Q9LA 3HHGA 4F6RB 3K9AA 1FCKA 2CTPA 3K3WA 3FFQA 2BTQA 4NQ8A 1UIUA 1AL3A 4YJ2B 4JI2B 2HXWA 5TISZ 3FD3A 1Y67A 1FS0G 5EBMC 1B51A 5ET6A 2DE0X 2GHAA 2QFLA 4CH6A 1L1FA 2RJZA 5CBFA 1B7HA 4I8CA 4X9TA 3OEKA 4OGQB 1FPIA 1US4A 4XKQA 4F29A 5CMUA 3GBAA 4Z7EA 1A40A 3SPHA 3J81N 2PX1A 5J1DA 2ZR2A 1Y4CA 2HAUA 5I59A 2P90A 5IWAO 3OAAG 1U96A 1XMQB 4DUZO 1MM6A 3IGAC 1YHQV 3O6HA 4O2BB 3ZX6A 2I0BA 4KFQA 1DTZA 2B9ZA 4PA7A 1S50A 2R9JA 3O97A 1N0JA 3R65A 4DV0B 1HW7A 4JB7A 2KSDA 1MXUA 4R6YA 4ZE8A 2LO1A 1XEQA 2BTOA 2EIMC 2ZCEA 3AG3B 4JYAB 4WBNA 4PAIA 2AL5A 1KP2A 2VWJA 3ZHVA 3CC4V 3ZKLA 1I5XA 4HNAB 4PFWA 5EQAA 4FZ0A 1PB7A 4U1OA 2Y84A 3HKCB 2PUSA 4JWOA 4OHNA 2Q8JA 5I2NB 2PT2A 3RGYA 4X65O 5LXTA 1CP9A 2X7RB 4QHQA 1F9BA 1M57C 5H5NA 2A3QA 1VQ5V 4O4IB 3DXRA 1RFYA 1B5JA 4KCCA 3TTMA 4CBCA 4TQFA 3QF7A 1HNXB 1VF6C 4EB6B 1SERA 5A5LA 1ZBMA 5C8YB 3MHSC 4F3GA 3HKEB 3PMXA 2LW7A 2JJ2G 4GYCB 3CFXA 3RVYA 4MLQA 3KBRA 3CRBA 3IORA 2AL4A 1FTAA 3T9VA 1S3JA 5DEXA 1J1NA 4RQFA 2FA7A 2JEUA 3UT5A 2QS3A 4P8BA 2V25A 1SI1A 1P99A 3BBRA 2LP7A 1N33O 3EHBB 4UCTA 2Y48A 2B3BA 2X7PA 1B6QA 5HFMA 5LP6B 4P0GA 1D5NA 4JI8O 5DVIA 5FHNA 1BHAA 5LMUB 2QKCA 5LMNO 1H76A 4PFIA 3O9OA 3JATB 2Q69A 4X1IA 1M5CA 3KN8A 4IHJA 2Q0OC 2IBZH 4O4LB 2UUAO 4JZ2A 1F7YA 4GXSB 4KD5A 4P30A 4U4XA 2EILB 1B1HA 5ITZA 5L3BA 4DR2O 4KR5A 2REGA 2LW1A 3SYQA 2ZNUA 2F6GA 4IO6A 2DWDC 3K9SA 2GSMB 2VQFO 1B4ZA 1VE4A 4ZOLA 4QF9A 4K35A 4R2BA 2RCAA 1B6HA 5DW8A 4QIWF 1SW5A 1PM9A 4X20A 4LBEC 1S5JA 2E5LB 5A2QN 2V3TA 2Y7WA 1VQMV 5EYHA 4OX9B 1D2DA 2Y5LA 2FKXA 2Q8MA 5BZBA 2WBBA 5TPAB 3SJAC 3CCJV 2XXQA 3MSTA 4HYOA 1FXHA 5LOMA 1B58A 5EYFA 2JGUA 1S0VA 5L3CA 2BOBC 3T9XB 4FLTA 3MVWA 3MDSA 3EN3A 4TOZA 2O57A 2OIEA 3IB1A 4ZEIA 2EINC 1DCUA 2OWZA 3SZPA 4TQDA 3ETGA 1XUQA 1MPBA 1SZTA 1O9HA 4GKKO 4NXNB 1O7TA 3ABTA 3IJOB 1IBLO 3X2QC 4YY3B 2GFEA 2QS2A 3KOSA 4QXDA 3UA8A 2PI5A 2UU9O 1TVKB 4G8NA 4O3AA 2EIKC 1PDAA 4JTCB 1IMBA 3SPIA 2K1EA 3A0BZ 4O7IA 1WP7A 2R72A 1XREA 2A7WA 1OCRB 4BLAA 1EZOA 1FBEA 1URGA 1K34A 3BA8A 1JCHA 3FVOA 4X66O 5KAIZ 1HNZO 5HM4B 3H1HH 2DOSA 1QLEB 4GX6A 1AMFA 3C3SA 1LAGE 3IL1B 4POWA 2I48A 1D4NA 1SF9A 4MCOA 4DR1O 1B5IA 3IAYA 2W6JG 4ZS9A 3FXQA 1P1QA 4PE3A 1ROPA 4F4LA 1B1XA 4PF6A 4O3BA 3EQ1A 3S2VA 1NNTA 4ZEKA 5H8FB 1R6KA 1UFIA 2YS8A 3ICXA 3VFJA 3RN8A 5I57B 5I2KA 1A55A 1NV6A 4DRXB 1UTHA 2CAZC 4JI7B 4TWKA 1GH6A 4JAUA 4DR3B 1KA0A 3OR6C 2M8CA 1SBPA 1K7DA 4JVCA 3JALA 5L9SA 4RQEA 3ZHSA 1H2GA 3F7VC 2EJRA 1YJ9V 3H6TA 3FZVA 4MFIA 2EULA 2PF4E 1NFTA 3T66A 4I7ZB 2JJKA 4MF3A 3H1KH 4N15A 4PA9A 2VGQA 1XOUA 4N91A 5EHSA 2PBWA 3QMFA 4MLVA 4FEBA 5DTBA 4KPTA 3JSNA 4LF8B 5CN0A 2O7IA 4GLIA 3SEYA 5CB4A 2ZQMA 1SQPH 5J16A 4AQYO 4U4SA 3ZJZA 2F1MA 3JARA 2ZKOA 4IYHA 2GUZB 3PUWE 3AK2A 1MMMA 3BPZA 3VE1B 3K0GA 3I55V 1JJOA 4P1LA 1B7UA 2XXKA 4O3CA 3ODBA 1RYXA 1J95A 2ITDC 4ISUA 1S72V 3S9NC 1LR1A 3U10A 3RPLA 1KB9F 1IXHA 2P67A 4F1VA 1DK4A 3Q4HB 1N4CA 4UCSA 3WB1A 3SJBC 3I56V 4KI0E 2ZYNA 2RC7A 2THIA 2CH7A 4O94A 2OK2A 4DR5B 3T1HO 2VD3A 2V3QA 4RAIA 4UABA 3ZMUA 3STLC 3I5OA 4M1VA 1DSNA 2WSSG 5IE9A 3O28A 1DPEA 4PFTA 3S9LC 1SRYA 2ABHA 2RC8A 3CI8A 2HXRA 1VQ4V 3H01A 2HLDG 4GWOA 1AI4A 3DTUB 1SQYA 1JETA 3TQWA 4B3TO 5FTHA 1ZMGA 4GRKA 2JVDA 2NNUA 2GV9A 4MVSA 1NV4A 4NR1A 2OWTA 2QL3A 1YZ0A 2RC9A 4G68B 3APOA 5H6RA 2UUCO 3RLFE 2B4MA 4JAVA 4I5SA 5B1AB 1F4MA 4OVQA 3LBSA 4H6DA 5ITPA 1FBDA 4H8JA 4YKIA 1IMDA 4JI1B 4YKJA 3OSQA 4C0RA 3AG3C 2WAMA 3W15C 4JSOA 3FUZA 5ET8A 1Q43A 4N23A 2OIGA 1PB9A 3K06A 3OUFA 1B04A 3M3LA 2WLJA 1DBZA 2F7AA 5DEDA 2R6GE 2WEFA 2H3OA 2PZSA 3RPWA 2F4VO 5CA1B 3K6UA 2VPNA 5CA0A 1W0JG 3D3QA 4KUMA 5H8QB 2ALUA 3IAZA 1IVSA 2GQ1A 1VFEA 3AG2B 4IIJA 3K58A 1FQEA 1N7WA 1FFTB 4DV2B 2OWOA 4N13A 2AIXA 2ZNSA 3L73H 5JTYB 1Y4TA 5ELVA 2UXDO 2E76B 5EIBD 1I7FA 1IMEA 4FE8A 4ZZAA 4TUYB 3M8UA 3Q26A 1B06A 3ZHRA 2BE3A 1TUBB 1H43A 3ZHQA 4BIZA 4DXBA 3WB2A 4DV5B 5FBPA 2F36A 1NV1A 1NJIW 5F24A 3N2KB 3MC2A 4OQOA 1XNQB 2QS4A 3STZC 2B65A 2KLFA 3K02A 2D5WA 3SEUA 2IJHA 4R73A 1PL0A 1B3LA 1N36O 4PDVA 4GWZA 3MVYA 2YDEA 2NWJA 4HCYA 1IDSA 1I69A 3K6WA 2Z23A 2UVGA 4OXSA 1LAHE 1BGYH 3KJ7A 5KHKA 2BSKB 2Y5KA 5B1BB 2N04A 4UFZA 2D3IA 1H2NA 4HBNA 1B0LA 2QMWA 3BIGA 2EILC 1RKMA 4NF4A 4L17A 4HXVA 1V9PA 3HKDB 3JASA 3LNNA 1POY1 4IY5A 1NTMH 4GX5A 5EZYA 1XVXA 3RYDA 4X1YB 3TAJA 4Z1MG 2DVCA 1KZ8A 1IX9A 5B3SC 3THOA 1B7ZA 2XXHA 3CCSV 1Y74B 2IU0A 1JW1A 2XWVA 1NS1A 1OCOC 2Z8FA 3KSJA 2XAQA 1Y4MA 4NGUA 5F2VO 3N6TA 1DF4A 1NUYA 1RSOA 3T1BA 5JVDB 4WFBV 3ZN1A 2ZE5A 1A99A 1FPJA 3SJQC 3CC2V 2WYPA 2F7BA 1QR8A 1N34O 2OWSA 3G3HA 4O4HB 2OX3A 2F95B 2QSXA 4Z2WA 1SDXA 4XDLA 1R6NA 5AA2D 2XXPA 2OJTA 4G2ZA 4X88A 3CCVV 3RYCA 4X62B 4IO3A 3K1MA 2Q74A 1FJGO 4N8YA 2F5XA 5J9PC 5LGNA 1YTFB 1H8EG 1YTVA 3K6XA 4DUYO 1M9NA 3G6BA 3F5TA 2H9BA 2CUGA 1GM8A 3ML0A 5KA5A 1NMUA 5IJ9B 3QSLA 1FFXB 4MHFA 4R6HA 3KSXA 4PDRA 5LHGA 3EHTA 1KMIZ 3I6VA 2DE2A 4P3LA 2UUBO 4OVPA 4OVJA 2FTKA 4CC5A 5JJEB 3HCQA 2QRYA 4JASA 4JPRA 4MTXA 4FJCC 2HFBA 1JFFA 2O1MA 3ZRXA 1G1XB 3UK4A 4X8RA 5IM2A 3C31A 3RQTA 4LF6B 3C36A 4ZDMA 3GZGA 2PCRA 3CS5A 4B3SB 1NUXA 4IO4A 1GKFA 4U1ZA 1BTJA 3FV1A 1MNGA 3SEXA 1O64A 1IXMA 1QUKA 4FATA 3QO8A 4RWUA 1R3JC 1PEBA 4I55B 1Q35A 5ITOA 2HJFC 4DR7B 2RKMA 1XNRO 1R3IC 1PNLA 4UUJC 1B3GA 2DYXA 3HO7A 4TLMB 1IZ3A 3C9HA 3OSRA 4RY1A 4LWSA 2XXTA 1NR7A 3RYIA 3CD6V 1FBHA 4N6PA 3OTOB 5IZ3B 1SW4A 3RUMA 1POTA 4PC9A 2YIBA 2OTLV 3MW0A 5EQ8A 3E22A 4FLYA 4KCDA 3UO3A 4PF8A 1FAFA 3SDFA 1NTKH 5BR8O 3MPLA 4PCDA 2K9PA 2REJA 3CRRA 4NXMB 3CJHA 2P06A 2EZPA 1RYOA 5IJ0B 1LCTA 3GXAA 4RO2A 5KMGA 3JV9A 3OW2U 5LA6B 3K79A 2QTOA 2P4KA 4LF5O 2FYUH 1EZ9A 3FJGA 4GX3A 1GR2A 3SPJA 4DW1A 4GF8A 1P7GA 5IYCO 1D9VA 3LSLA 2UXAA 4H46A 4UV8A 4OXVA 5CRYA 4C1UA 4MTOA 3MWBA 4R9FA 3OTFA 2XAFA 2D21A 3ISPA 2LGWA 3T4ZA 5BMVB 2HZKA 5BY1A 4Q30B 1QCEA 1Q81W 1S77D 2KG7A 1LB9A 5H8SA 4DDDA 1NV2A 2LFSA 4ZEFA 4E2LA 4NF8A 4P9OA 4MVQA 4NF5B 4B3RO 4FEDA 1KD1W 2I3VA 2P4VA 1MSDA 1MZFA 2R71A 3G3IA 4NF0A 1NH2D 3ABMB 4BDQA 5CMCA 2ZXWB 4U23A 3V89B 4O2AB 3AK1A 1VQKV 4R9GA 3VOUA 4LFBB 3THIA 3V5AA 3AK3A 3RBZA 2XAGA 1OQHA 4H44B 4HW8A 1PV0A 3OD4A 4N07A 1AJPA 5CM6A 1ZL8B 5L3DA 1B40A 2Q68A 4J7JA 1WLEA 2L6LA 4HZ3A 5B1AC 5J2TB 2ZM6B 1IXGA 2ONRA 4RUEA 2E74B 1YDXA 2DYRC 1XHYA 3B8BA 3BFRA 1BKAA 4DV6B 5CMMA 2F78A 4ECFA 4NB5A 5CMBA 4EXLA 4JYBA 2GHYA 1P84F 1E1QG 3TMGA 3L75H 3C35A 2Q67A 3U93A 4MMPA 2YC0A 5TP9A 4DK0A 1KKDA 3L71H 3O6GA 1EZJA 5EBLC 5IYZB 2L35A 2X7QA 4BDRA 3BEHA 3E9XA 1PNMA 3OENA 3P30A 5H6QA 4FLUA 4G8MA 2H25A 4NTLA 3OEEG 1AI7A 1FPBA 1Z7ME 4KHPO 3U65A 5JQGA 3A3UA 4QFLA 5LOVB 4K8XA 1RPRA 1YEWA 4G8HA 4H0LB 2W0XA 2YXHA 2MK3A 1EYKA 3TGUH 4LF7B 5HBCA 4TOIA 2UVJA 2VHAA 1DTOA 2RCBA 2IM9A 1V55B 1YCJA 4H37A 2P6JA 4BW9A 2O1LA 1R1BA 3M3FA 5FHMA 1DF5A 3Q27A 4EUOA 1VQ6V 2D2CB 3S3WA 3E2EA 1GTOA 1JOYA 4OERA 1N3WA 1QLNA 3EVKA 1BMFG 1NZ6A 3ILUB 1KYOF 3ASNB 3APQA 5H8HA 5DT6A 4JI0B 1RM1C 1I94B 5L3EA 1NKDA 2RN9A 1TGOA 3FAVA 1LBZA 2AZ0A 3G3KA 2PVUA 1DK1A 2ADQB 1FXKA 2DWIA 1J5EO 5B1BC 3U94A 1AP6A 2DVZA 3WFVA 3CXHF 3UN6A 2ZIMA 4FFKA 2Q6AA 3UQ8A 4LFAB 1N32B 3D4GA 4PFYA 5AA1A 5KDTB 4ND9A 3JCUZ 1MM7A 1Y6XA 3L72H 1V54B 5KZTA 4PAKA 1G0HA 1JQ0A 2O84X 1MA1A 4KP4A 3RFRA 2ZNIA 4MNPA 4NMYA 1JX9A 4ZE9A 3KEIA 3D8CA 1S7YA 2IEEA 1AR1B 2AZ2A 1NR1A 1NBMG 5AA2A 1SA0B 1YSCA 4PDLA 4F6RA 1EM1A 3BA9A 3RT6B 4PDHA 4WXJA 1S5HC 5IZ1A 3E3KA 3QUJA 1HSJA 1IBKO 3CYOA 4YJ2A 4OPHA 3MAMA 4E0WA 1YJNV 2ONKE 4EKWA 2XXXA 4NAPA 4AQ4A 5LTCA 3ZSFA 2Q2CA 5IYBO 3GBBA 4NHBA 3K5NA 5CBGA 4JI2O 4PHZA 4DYLA 1MXYA 3JYCA 1VQOV 4TQUQ 3QO7A 4KHZE 3CIJA 4QE7A 1FBGA 1R6ZA 1NU1H 2XXRA 3ZMSA 1QVSA 4GBVA 4H0WA 2GRVA 4XDJA 3DELB 2XA5A 1HWYA 4O2BA 2A5TB 3SJCC 4PBQA 3ZHTA 3FYIB 4P9KA 4OEVA 4WCEV 4JI4B 1K9ZA 1RP3B 4P11A 1URDA 1FJ9A 5CMKA 4NE4A 3W9VA 5KUKA 4XF5A 1DTGA 3MZBA 3DP4A 2M7WA 4GWWA 5ICQA 2DXRA 3VXCA 4UCRA 3Q28A 4X89A 3QO5A 4DV0O 5EK0A 2VOZA 4ELQA 4I9WA 5J2UA 2H5YA 1G0IA 4WFAV 3ETEA 3P3PA 3HKCA 4W4KA 4TV8A 4JXIA 4J80A 4JYAO 4I50B 3BFTA 3F11A 1FSAA 5I2NA 1FTLA 5GTHZ 4YHHB 2F7CA 4PA3A 3MUQA 3CP1A 4TV9B 4PJ0Z 4O4IA 2DQ0A 4F1YA 1BS3A 3S9EA 4QFNA 1NVPB 3ZMVA 1EZVH 4WEDA 2HEPA 3PMWA 4DR6B 2XHDA 2QM7A 3HKEA 2V84A 4LZ7A 4EQ7A 1A7LA 4H13B 1SPIA 2KQZA 3KZIZ 5AG2A 1HNXO 4UXNA 1THZA 3MVZA 4F22A 2PI4A 1N7XA 3T93B 4MTGA 2XOKG 1PPJH 3QAXA 5LXTB 2UVHA 1OIBA 1MQHA 2JIZG 1MSWD 1NNPA 2YJPA 3E79A 4BDLA 3VBBA 3ZCCA 3AG1B 5LP6A 2QE7G 1PC3A 3D4CA 1ZWIC 1GGGA 1WA8B 3TXQA 3CR9A 3FB6C 1EU8A 4RA1A 4DO2A 2FNCA 1ENVA 3JATA 2PGGA 1BE3H 3L70H 2VPOA 2LJ2A 4X48A 4YB6A 5JCOC 3TTKA 2MKZA 4JI3B 4O4LA 3OMAB 5LMUO 1KC8W 4MJOA 2FYIA 4EF2A 4IO5A 2JJ1G 4JI8B 4X04A 3W7TA 2DE4A 4GWSA 1A54A 1TXFA 4KQPA 4GCZA 4JBZA 1B05A 1UQWA 4I9QA 4LP2B 2ZIOA 2Q0AA 3MJNA 4OPAA 4RJZA 4RK9A 1Y1ZA 2EX3A 5KA6A 4GL8A 1LUVA 1S76D 2YXLA 3GLBA 2BJJX 5B3SB 3E8BA 1PBQA 2E3CA 3CG3A 1OCOB 3TCFA 4NKGB 4R50A 3TZAA 1FPKA 4Q8RA 4PBHA 4Q20A 5TPAA 3ABMC 3CRQA 3B2EE 2ZXWC 2GH9A 3G3FA 2FIEA 4QFKA 3A29A 1K5QA 4N4UA 2E5LO 1GN6A 3E8FA 1R3LC 4OX9O 5H9CA 4ZBMA 2DYSC 2D3OW 1ZLZA 2Y7IA 2CK3G 1F23A 2DP8A 2PTMA 4I9DA 3MHHC 1M93A 4FPPA 1FD9A 2V4DA 2ZYKA 4XBFA 3FVKA 4EF1A 4LF4B 3CRAA 5FPRA 2P2AA 5DECA 4WFFA 1SQQH 3TXSA 1YF2A 4LATA 4XTCQ 3B6TA 2XNDG 5JH7B 3VLUA 1S5LZ 1TVKA 3WU2Z 4J42A 5KHIA 1UIVA 3K03A 3ZS8C 3R6UA 2O51A 4B3MB 3RVZA 3IB0A 4NXNO 2XXYA 2ODMA 3P32A 5B70A 1Q5OA 3E4RA 1SW1A 3ZN0A 4LNUB 2DOJA 3O29A 3G3GA 3V83A 4LF9B 4FIPC 1GV8A 2DS9A 4JTDB 2CTQA 4JI5B 4PA4A 3C34A 4NN3A 1QR9A 4U2RA 2QR4A 2Q7HA 2DQVA 1KECA 4PTKA 4MT8A 2DW4A 2O7UA 3LSXA 4LR3A 2H94A 1LBWA 2RDCA 4MBPA 2IJIA 3CCEV 1AILA 3K2DA 5H8FA 3LUZA 4PV1B 1V55C 5I57A 2WLIB 1H3DA 1HSEA 4DRXA 3OUSA 2KB1A 2E0SA 3K1PA 3MYUA 3LUTB 3H3GA 3TDJA 1EBOA 1QVGU 3QTCA 4B7EA 1JMKC 3CFZA 3FXBA 3ASNC 4HTGA 3M7MX 4DR3O 3UGWA 1GM7A 4K0KB 3B40A 3LSFB 2HHMA 1JVXA 3R66A 3VVFA 1B32A 3W9WA 4G27B 4DV4B 1AI6A 4FFBB 4J11A 4RNSA 1HNWB 1UTHB 3DP8A 1VP7A 5D5PA 1QNMA 2H99A 1VF5B 2IU3A 1QU7A 3UO2A 2YIBD 1FQBA 1SQVH 2GUZA 4NF6B 3TQLA 3ZRWB 2Z3YA 4MW3A 4DR4B 5LYJB 1V54C 3RT3C 1WPBA 4FLWA 1GRJA 2HP8A 3FB8C 3PD8A 4MX6A 4DI3D 1W0KG 1Y76B 3KN3A 3TKDA 3M3KA 2KKWA 4AQYB 1OCCB 2XAJA 3FXRA 1R9LA 3KC1A 2AHYA 3Q4HA 1IXCA 3JSLA 4X8AA 4UCOA 4GKJB 1ZTYA 3G3JA 1JJ2U 2IH1C 4F39A 1CE2A 2R70A 1XVYA 2WYKA 3DM0A 4UACA 3KBZA 4YICA 1IITA 2QVRA 3EF7A 3L74H 3KCYA 3JAMN 3HN0A 4DR5O 4MAGA 3RPLB 4X9QA 1YITV 2R9AA 3QNEA 1GK9A 2ZINA 3T1HB 1N76A 1NI9A 4G68A 1UPGA 4ZIBA 1NT2B 1NV3A 5LBQA 1KA1A 4OESA 5I7IA 3JYRA 3PUYE 2DJVA 2NVUB 2DYRB 4QSCA 2WLLB 1NUZA 4DCYA 1PP9H 1R6TA 5KX5B 1R1NA 1UTBB 1JVMA 3FVGA 1Z7NE 4O7MA 3USDA 2PFYA 1JR9A 5K2YA 3JAKB 4JI1O 4JV5O 5L9OA 2F8DA 4F2OA 1AVMA 1QW0A 2IH3C 1SZXA 3OGIB 3K00A 3VLWA 4AB5A 2QKAA 2O68A 1IIWA 5CA1A 3KG2A 3A09A 4Q5TA 1FPLA 1FPFA 2HQ0A 3BAAA 3WAEA 5H8QA 3H6VA 4OWDA 4MVOA 2Q7GA 4I4TB 4LC1A 2P5OA 1N0TA 2F93B 1P1UA 4JVDA 2XD2A 3IO6A 3G80A 1Q86W 5JTYA 1LBCA 3DP6A 4MVZA 4UB8Z 2F4VB 2IA4A 1OVBA 3VXBA 3UORA 4TUYA 4JI6B 4KXPA 4HAMA 2B5UA 4DV2O 3R26A 1MH3A 1O9GA 3C90A 1HSLA 2CMOA 1TUBA 2Q88A 3FB7C 2VS0A 3N2KA 3OGCC 4DV7B 2VP1A 4YKKA 1MXWA 3UKMA 2XAHA 5FNVB 3AG1C 4GWXA 3RT8A 3IR1A 1LUWA 4DV5O 3JAWB 1ANFA 5IKBA 1E79G 2DMXA 1RM1B 5FPOA 1YI2V 1XNQO 1TUEB 2I49A 4X64B 2Q5ZA 2UYEA 3ABUA 2Q4PA 1WP8A 4QFPA 1L0NH 3FATA 2BSKA 1FQDA 2P7TC 2PYYA 2ADPA 3RNNA 2XUMA 4LH6A 2BCCH 3P3NA 1LNQA 5B1OA 1EFRG 1M90W 4KXRA 1MY1A 4E0XA 3HKDA 2H8PC 3BRCA 3T0JA 4X1YA 4I0XB 1NH8A 4KL1A 4XKNA 2RF1A 1FBPA 3VDFA 1Y74A 4O4JB 3JD1A 4H45A 4IGTA 1WJZA 2DWAA 4PD4F 4I1DA 5I56B 3T22A 3EHUA 4R6KA 4F3BA 1KU9A 5JVDA 5IT9N 1S9TA 4X1KB 4AHCA 2HVKC 2ZDIA 3LSSA 5KAFZ 1EN6A 4F18A 2GTSA 4A5UB 3KC0A 5EYPB 4GWUA 1QKBA 4O4HA 4TLLB 2XTAA 4UVCA 1MPDA 3SEVA 5GW7A 2QWRB 2YEVB 1Q6HA 1B3QA 1SYHA 3OD7A 1B5HA 4LCUC 1Q82W 1OLCA 1O63A 1Q1KA 3VQVA 2ANJA 5C93A 1L8DA 2XX9A 3QVNA 4I3YA 1QHTA 3RYFB 5IJ9A 1UJWB 4P1EA 4THIA 4X62O 3SESA 1X59A 3MAQA 2ZE7A 4PI0A 1DPPA 4DE8A 2JEXA 3E89A 2NLJC 4P9PA 2UXCB 4G61A 4UCVA 3CSGA 2QPQA 4H67A 1FPEA 3E86A 1IZ1A 4QFOA 1I0HA 1K3EA 2HR3A 3V8XB 4DUYB 3N6UA 3H6WA 4R74A 4UB6Z 4YIOA 2MW2B 1K97A 1M56C 2ETNA 4U3JB 4EFEA 1P1WA 2CZKA 3O66A 3VVEA 3CMEV 2HPGA 1Q9DA 1KKCA 1FJ6A 4NTXA 5CBHA 4LQ5A 3DC5A 2P3NA 3N26A 1AROP 3N2GB 2FL4A 1RPOA 4B08A 1SVXB 4YJ3B 2Z8DA 2AW9A 4U22A 3FJ7A 3WB0A 4LF6O 2HHHB 1CNQA 2YLNA 4U21A 1GM9A 4I55A 3T1YO 4B3SO 2KR0A 3B8NA 4QSDA 4I3EA 1AI5A 2HFEC 5GONB 2UYFA 5IGAA 4I40A 3H1IH 3ROJA 1MY0A 3A3CA 3PPQA 3EHSA 1VF6A 1AJNA 3E35A 3OFNG 1EYJA 3FYEB 4DR7O 2XT9A 2P3VA 2QM8A 1US6A 1NH7A 2GBOA 2JGDA 1ELJA 4LONB 3ZHUA 3L6HA 2I6EA 3PPRA 3B7DA 3OTOO 1IMAA 3D1RA 1B0HA 1WB7A 3H1LH 3GWKC 1VR5A 4P2ZA 1E1RG 4BR6A 5IJ0A 2PT1A 3OM3B 4KFMA 5HPQA 1ZLQA 1WODA 3MQ9A 4OVRA 4BAYA 1X4TA 4YIPA 2EIJC 1K9MW 4F19A 4DI4B 3K5OA 5H8NA 1YZBA 1IBMO 1XQ8A 5BR8B 4OANA 3P7IA 4OFJA 4UCUA 5JCOA 3E8GA 5JJNB 3WG7B 2CEXA 2CZLA 3BKIB 2F3DA 2A0LA 4H1XA 3CCMV 1OCCC 3E22B 3E8HA 4FJPA 1MZEA 2ZR3A 2ZNTA 2DSFA 2BJIA 4ZHQB 5JEIA 5K1PA 1JEUA 4LH7A 5BMVA 1OZ0A 3FJMA 3JD0A 5AA4B 2WA4A 1QVFU 3IFXA 4OMBA 3BIHA 1B2HA 5ICTA 1COWG 3TCUA 2RINA 4ELPA 2F3BA 4WFEA 3KGCA 3RYHB 3PJSK 1N84A 3K01A 2B1IA 3M99B 4HE0A 4NF5A 4PAFA 3OO6A 4YMAA 1I6QA 1IXBA 5I58B 1B9JA 2WLMA 2Z22A 5IYDO 3TELA 1HR0O 4O2AA 1MRPA 5CBRA 2QWOB 2YXYA 3G71V 2Y7RA 2G29A 2VD2A 4FIMA 2DYSB 4NTYA 4MVUA 1WPXA 5JK4A 3PU5A 1PL4A 1ZL8A 4CZZA 5LHHA 5J2TA 5CI5A 4GBWA 5A5XB 4ZEDA 3C32A 1MXZA 3JCZA 1MXVA 1FTJA 4FECA 3ECRA 1XMOB 1NNFA 1XL4A 5H2FZ 3D36C 2ZM6O 4J9YB 1VQLV 1LAFE 1T5EA 3G6EV 2AYSA 2ZNJA 2XX8A 3OXNA 4G2KA 2HJDA 1SYIA 3HKBB 4DLDA 4FAJA 3ZEDA 2WLHA 1Y3QA 4JYCA 3HPLC 1VEWA 2C2AA 5EC2C 3IC9A 4GT1A 4DV3B 3TTRA 5KHGA 3KFMA 4MVMA 3CRMA 4EEQA 5LOVA 2L5VA 5L8DA 5L9MA 3OMIB 1CEZA 4N17A 1GN4A 4FVMA 4DXWA 3H1JH 1ZTEA 4R7CA 1F4NA 2Q2AA 3RWRD 1FTOA 2XXIA 3MP8A 1P4RA 1ZSPA 3MBPA 1ZKBA 1IMCA 4YB7A 4ZI7B 4PI2A 2KQXA 3VQYA 3ONMA 1I5YA 1GVCA 4Z0IA 3FBPA 4GX4A 4LF7O 3FGSA 2DQ3A 2YPNA 2QJ1A 1BK4A 4DV1B 1JNFA 2ARHA 3CB2A 2JDIG 5ISUA 2Z8EA 4J41A 2QWQB 3H06B 5K1XA 2UXBB 1OHHG 2QGNA 3PV0E 5EQ9A 3R7XA 1GMGA 1A32A 3F7YC 1YIJV 2VQEB 4HCWA 3VV5A 3HFUA 3B8MA 4D7TA 4JI0O 2QA4V 2H98A 1I94O 2PY5A 4DXCA 3H6UA 5GTIZ 1I6AA 2QSAA 1MABG 3U72A 3HSTA 5HFLA 2O6AA 4U7NA 2O69A 4MTFA 4MVRA 3WAFA 4KYEA 1WN7A 4FM1A 5KHHA 1CB6A 1P1OA 1ZIUA 1MPCA 5KDTA 3IOVA 2JS3A 4Q0CA 5B7DA 3CXCU 1P7BA 4ZKIA 2EJ7A 5CC2A 2QWPB 5KCJB 1NTZH 3K0DA 3RGBA 4LFCB 4FLZA 4R75A 1PBPA 4LFAO 3HHFA 4MW8A 1N32O 1URSA 3H9VA 3ZBHA 4PFUA 5FL7G 4H33A 4R2FA 2HG5C 2OT5A 2OCCC 4BDNA 1SA0A 4NX1A 1MOFA 3BHPA 3KJTA 4OZ9A 4OETA 3S3XA 5LDZA 1NV0A 1H45A 1TT1A 1U97A 5IAIA 1XI6A 4WKMA 1EZPA 5JJJB 2GHBA 3PUVE 3ASOC 3IJ4A 2CTRA 4R72A 1LEVA 5BUUA 2G93A 3K1NA 1XC1A 4QRZA 4GOTA 3CHXA 2F6PA 4G28B 4X1BA 2FVZA 1TFDA 5AA2B 1VQ7V 1ZU0A 1CXZB 3DC6A 1VQPV 3ETDA 3I3VA 1Z5WA 4OFLA 3O9PA 2BTQB 1YXIA 2A5TA 1VQNV 4XEQA 3L6GA 2GDSA 1N0NA 3C33A 3ZRSA 5L3GA 1AH5A 1SQGA 3TCHA 4AILC 4JGSA 1XMQO 1EN5A 2XX7A 2B3FA 1MQIA 5ET7A 4DIGA 4BIOA 3PPOA 5IWAB 1NQTA 4FORA 3VQXA 3FV2A 3K57A 2XHBA 4JI4O 4DUZB 2Q8VA 3B77A 3U0ZA 3S4UA 5FHOA 3MD0A 4HNAA 4JAAA 3D3IA 2CZIA 1N3XA 4J7KA 1K4CC 2ILMA 1F51A 3PPPA 4P47A 4F1UA 4IL6Z 5DVFA 1SS3A 1ORQC 1XHZA 5I59B 4I50A 1MY3A 1JW4A 3FXUA 4QGPA 5B1NA 1JW5A 4M4GA 4XKPA 2B4LA 5ESYA 2F66C 2YI8A 2ZZWA 4TV9A 2FIXA 2IJJA 2JS5A 3ZMTA 1OLAA 3JD4A 3Q29A 4MIJA 3HV1A 4PGPA 4POXA 4YHHO 4N8GA 3K08A 4EB6A 4OENA 4IGRA 2QM4A 5C8YA 4WBNB 3ZRVA 4E4EA 4X65B 3LNMB 3PUXE 1IUDA 1SQFA 5J2UB 3G4SV 3LSQA 5TU0A 4TV8B 1FBFA 4FBPA 4DR6O 1B4HA 5KLVH 1BQ0A 4XFEA 3J7AU 3RY3A 3BY6A 3F5WC 3BABA 4K3AA 1JVYA 2HVJC 2XWIA 1BIYA 1BLFA 3CSXA 1R73A 1PKXA 4WFHA 4NTWA 1SQBH 1W59A 1Z2GA 3DXRB 4F6EA 2Y7PA 3CCRV 1JP4A 4K3FA 3TUSA 1WA8A 1OVTA 3N5LA 4WFGA 5CA3A 2NXOA 5EHMA 5EQ7A 2M6YA 2GTAA 3T1CA 2CGOA 3PTYA 1G4YB 1FQAA 4N81A 1M5EA 3WG7C 4ESXA 4PELA 2CDYA 1N33B 2X0LA 3RW0A 5DEXB 3E83A 3FKSG 3B6QA 3UT5B 4N21A 1AP5A 3GWOA 4NWDA 5LMNB 1USYH 1FPOA 2VWKA 3CWBH 4JI3O 3FX7A 2FHYA 4UVBA 2WBDA 2DXYA 1LCFA 3ZS6A 4JZGA 2F35A 2DN9A 2UUAB 2FBPA 1INPA 2EBOA 4DR2B 1AB3A 4MS2A 2N05A 1T0KA 4X1IB 4HE2A 4N6DA 3S9MC 3M8AA 1KP3A 4IHJB 2P1SA 4IGGA 1DMBA 2NN4A 1MQDA 1D9YA 3T9UA 2VQFB 4OYVA 5ITZB 4JF3A 4PDDA 2AHZA 2XASA 4QJFB 3SPCA 2V7QG 4CS2A 4ELRA 4PA6A 1NH2B 1XOCA 3E13X 3DGEA 4ZOLB 2PMSA 4GX1A 4DK1A 3UP9A 4X20B 1R9QA 2V4CA 3DLNA 3PMVA 2CE4A 2UXXA 3AXFA 1NUWA 1FPGA 4ELOA 4CC6A 2OBGA 3MZ9A 3OT7A 4LF4O 5AA3A 5JH7A 4YZZA 2R9IA 5LGTA 3EFFK 4R8CA 4GL0A 3O65A 4PE5B 2A5SA 3VQWA 1YTFD 4YY3O 5IY5B 2I3WA 1VSOA 4AI8A 4OVSA 1BCCH 2ZMBA 4LNUA 4PFRA 4GX2A 4GKKB 1BHBA 1IBLB 3CX5F 2FB5A 1M56B 4B3MO 4F3SA 2UU9B 1OCZC 3SYAA 1XILA 3SGIA 1D5AA 2YI9A 1B3FA 1BP5A 3KKYA 1SETA 4JYYA 1L0LH 3MVXA 4GLXA 2G38A 3TCGA 4DCXA 1TFAA 4YU0A 3MZ1A 4OEUA 4LF9O 3OEMA 1GO3F 4EQBA 1H2KA 1VFDA 4JI5O 3IOWA 4DZ1A 2WLIA 2QMXA 4X66B 1HNZB 1JQFA 1P1NA 2XD3A 4DR1B 5EIBC 4AS5A 2ZYOA 3CEIA 2ZD9A 1ZX3A 1Y3PA 1QUIA 3NOHA 3SR2C 3CMAV 1LFHA 1K9YA 4JI7O 1QGXA 4JVIA 4XKRA 5LHIA 3VLVA 3U8QA 1MDP1 4HE1A 1XI1A 4CH4A 3ZKKA 4NWCA 1WVJA 2QDOA 1VQ9V 2DE3A 2IJKA 3QYTA 3OELA 3MPKA 4FFBA 1A8EA 5I2KB 1B3HA 4K0KO 2E1SA 2N74A 2WLNA 1MS7A 3OOAA 3RN4A 5T3JA 1XDCA 3B09A 1VDWA 3JZJA 5DYHA 2NOOA 3J80N 1R3KC 3JALB 4NF6A 4DV4O 3OE7G 3ZRWA 1WNSA 2QEXV 1MY2A 1SW2A 5LYJA 2CZHA 4LF8O 3K5MA 4IT5A 1HNWO 5I5PA 1N04A 2EIJB 4LA9A 5B66Z 3DSQA 3U92A 1Y76A 1US5A 2QJEA 4OTEA 4YMBA 4FMTA 1LLSA 1MQJA 4DR4O 1YAEA 1RDZA 4MEVA 1G8MA 1ZAUA 1OV9A 3ABKB 4NVPA 3TPAA 1FXKC 4LZ8A 4XIGQ 3QUFA 5CB4B 4LUBA 3CCQV 2A79B 4QBAA 3G7WA 4CH3A 3JARB 2F43G 1YCIA 4GZRB 2Y0PA 3CFLA 3LSWA 2A9HA 1B52A 4UV9A 1K4DC 3SYPA 4GKJO 1Z5VA 4UVAA 5A9GA 2EZOA 2ZZVA 4ASUG 4IYIA 3AG4B 4BDOA 1FQFA 3IOUA 4JTAB 2ATKC 4J9ZB 1TWYA 3A2FA 2VT5A 1M4UA 4Q6GA 2NUVA 4AS4A 3UIFA 4MSWC 2AXTZ 2CEYA 4D7SA 1IEJA 1RDXA 1FXVA 2VRZA 2CH7B 3B50A 3JD2A 2WKYA 1LBBA 3ABLB 2ONSA 2DWEC 3W7UA 4L87A 5AE4A 4WEPA 2CGNA 3K5LA 5BWJA 1PNKA 2WLLA 1LBVA 1PB8A 2X26A 3FASA 2UVIA 1WB8A 2XXUA 1WAZA 4B3TB 3D36A 1YXBA 5KHJA 5KX5A 1UTBA 3HPIA 2Y7KA 5E1AC 4PGNA 2UUCB 3VVDA 4AB6A 3H4ZA 3JAKA 1KQSU 1D9QA 4J10A 1AR5A 3ZIAG 3T2MA 1EH3A 1EN4A 4U3FH 2PYJA 3OMNB 4BIUA 2OCHA 1JPXA 2HKOA 2WA3A 3LUYA 4OVTA 3IB2A 3MP1A 2F34A 4NG7A 3SETA 1WDNA 4PP0A 4F31B 4RPOA 3O2AA 4I4TA 3U11A 1Y1MA 1MG1A 2HAVA 3OR7C 4FLVA 4H8IA 4JV5B 4IO7A 1GN2A 1M5DA 3B6WA 1H2SB 4YAHX 4N6KA 1JA8A 2Q7EA 2XWOA 1Q7YW 3A0RA 1NL5A 2ZZXA 5DVJA 2QWNB 1ZUQA 4PDMA 3W7WA 3JD3A 1LGBC 3T96B 5I84A 4FLXA 3GB7C 3IOTA 1OMPA 2HZLA 4TSFG 5CA0B 4JI6O 2W0FC 2YSUB 2ZT9B 4DXUA 2UXDB 2Z0AA 4P56A 4ONYA 5F1QA 2Y0IA 5FNVA 4CH5A 1Y9UA 4IIJB 3TEPA 3JAWA 5LL6Y 1G6UA 1SD3A 2Z5UA 3FIRA 4ABMA 4DV7O 3SEWA 3PUZE 4JWXA 4GFRA 4ICGA 4X64O 1N36B 2F97A 3SDLA 4H65A 4WF9V 4I0XA 4LVQA 5LP6C 4OA4A 4D6TH 4RK2A 4O4JA 2Y69B 3L9DA 4ZEBA 5I56A 1BSMA 4YB5A 1H38A 5LGUA 4P0IA 1KUQA 3CG1A 4C1TA 3LSUA 2B1GA 4EXKA 4X1KA 5EBWC 1M5IA 2OCCB 2Q89A 5ET5A 1MY4A 3SERA 1NI8A 4JDFA 3C4MA 1I6BA 1NV5A 1VARA 4NF4B 2YIDA 5EYPA 1RDYA 4DW0A 1K8AW 2QKSA 3JASB 3QIMA 3CVGA 4XXUA 4YKPA 1GAXA 5EZYB 4CS4A 3ASOB 2QVVA 2YEVA 5JWPA 1SC5B 5I3SA 2JRIA 3N27A 5BXZA 3KOTA 4ZZEA 1L5TA 3SKPA 1IXIA 3IK6B 3RYFA 4U7OA 1SESA 2NR5A 1RSOB 3BCCH 1N34B 2H4IA 4TT3G 1FFXA 2X6AA 3C3TA 3TETA 1VQ8V 1QKAA 2WX9A 1Y3NA 4G4PA 3LDDA 1QJMA 3OMBA 5L3FA 1MXXA 5FTIA 3TJTA 1FJGB 5M2VA 4EFBA 5IY5C 3EXAA 1B3EA 3IO4A 1K92A 2IW5A 5B5EZ 3RTFB 4H5GA 2WLKA 3K59A 2UXCO 3T4DA 4U3JA 4MNCA 3RYCB 2JK5C 2LQTA 1BL8A
chains in the Genus database with same CATH topology
3K6VA 4RUFA 2OZZA 3QK6A 4BDMA 2I4BA 3CSBA 4LQ2A 4KYSA 1LB8A 3ZMZA 4QPKA 1H8HG 3IC7A 2I58A 3OEHG 1MDQA 3BFUA 4QNHB 4X1DA 2OCUA 1OCRC 1NNKA 3LR1A 2LFRA 2UXNA 3CC7V 3QXMA 2Q9TA 4R6ZA 2EIMB 2BOCC 1H44A 1QLEC 1M1KW 4RYAA 2W7YA 1PD3A 4LP8A 1B46A 4I62A 1LFGA 4EDPA 1NVPD 2R9RB 1FW0A 5F7VA 4RXLA 1M57B 3LDEA 4YXWG 3TTLA 3KN7A 5KUMA 1AJQA 3PPNA 2P0SA 2X6CA 3MP6A 2I0CA 2OLBA 4F3PA 3ABKC 1XS5A 4UA8A 1XT8A 1LFIA 4BW5A 2V3UA 3FVNA 5AA4A 2ITCC 3TTNA 1II5A 1W2BU 1K73W 2ZXTA 1M5BA 3ILTB 3O6IA 1LAXA 1ATGA 5I58A 5H8NB 4JSDA 5K2XA 1K5SA 3OO7A 4GQOA 2HCAA 3AG4C 3TFLA 5CBSA 3N94A 5IDJA 4IY6A 1DLBA 4XDKA 2V1DA 4MH5A 3T9HB 4KYDA 5A5XA 1USYE 1FTKA 2ZYMA 4PQJA 1IQ7A 3KZGA 3ABLC 4NF8B 5DN6G 4HS7A 2ESNA 3FB5C 3IX1A 3Q25A 4OFOA 1QULA 4QSEA 2LAOA 4GX0A 1KWHA 3IJXB 2XXVA 4G68C 3LDCA 4IO2A 2EINB 4QE9A 4IB2A 1Y20A 1OCZB 1QUJA 3CCLV 1D3KA 3W7XA 1ZJLA 4JWYA 3X2QB 1A8FA 3OO8A 5EC1C 1M5FA 5TP9B 2EIKB 2W6IG 5DM6V 3CPWU 1QBZA 3OO9A 3PGFA 4NEDA 4GVOA 4G77A 4ZECA 3K4UA 1LSTA 2XXWA 2X6BA 3AEIA 4GXAA 1SI0A 2WPDG 3TODA 3HB3B 1N8RW 4ESWA 3AG2C 3RTWB 1FTMA 3TK1A 2HEUA 2DWJA 1JEVA 1DOTA 1XL6A 4PETA 4QPJA 3SYCA 3K0VA 2I4CA 1OQGA 4LZ5A 1MH4A 2OTJV 1AOVA 2WWWA 3H03A 3U1OA 1NKXA 5KCJA 5H8HB 4EQ9A 1AIVA 2V93A 2Y69C 3TYHA 3EPEA 4FK5C 3UM7A 4F2QA 3LC8A 1Y66A 1YJWV 1FXKB 3SYOA 4GD5A 3K04A 3NXSA 1K33A 4H5FA 2DWHA 1GTKA 1FQCA 4RPNA 3W7SA 4GIZA 1CPYA 3SPGA 1YPNA 3PD9A 3CCUV 2QS1A 3H7MA 1MQGA 2ZDIC 3HHGA 3K9AA 1FCKA 3K3WA 1UIUA 1AL3A 2HXWA 3FD3A 1FS0G 5EBMC 1B51A 2GHAA 1L1FA 5CBFA 1B7HA 4I8CA 4X9TA 3OEKA 1US4A 4XKQA 4F29A 5CMUA 3GBAA 4Z7EA 1A40A 3SPHA 2PX1A 5J1DA 2ZR2A 1Y4CA 2HAUA 5I59A 2P90A 3OAAG 1MM6A 3IGAC 1YHQV 3O6HA 2I0BA 4KFQA 1DTZA 4PA7A 1S50A 2R9JA 3O97A 3R65A 4JB7A 1MXUA 4R6YA 4ZE8A 2EIMC 3AG3B 2AL5A 1KP2A 3ZKLA 3CC4V 1I5XA 4PFWA 1PB7A 4U1OA 2Y84A 4JWOA 4OHNA 2Q8JA 5I2NB 2PT2A 3RGYA 1CP9A 2X7RB 4QHQA 1F9BA 1M57C 1VQ5V 1B5JA 4KCCA 3TTMA 4CBCA 1SERA 1ZBMA 3MHSC 4F3GA 3PMXA 3CFXA 2JJ2G 4MLQA 3RVYA 3KBRA 3CRBA 3IORA 2AL4A 3T9VA 1S3JA 5DEXA 1J1NA 4RQFA 2FA7A 2JEUA 2QS3A 2V25A 1SI1A 1P99A 3BBRA 2LP7A 3EHBB 2Y48A 2B3BA 2X7PA 1B6QA 5HFMA 4P0GA 5DVIA 5FHNA 1BHAA 1H76A 2Q69A 1M5CA 3KN8A 4GXSB 4KD5A 4P30A 4U4XA 2EILB 1B1HA 5L3BA 4KR5A 2REGA 3SYQA 2ZNUA 2F6GA 4IO6A 2DWDC 2GSMB 1B4ZA 1VE4A 4QF9A 4R2BA 2RCAA 1B6HA 4QIWF 1SW5A 4LBEC 2V3TA 2Y7WA 1VQMV 5BZBA 5TPAB 3CCJV 2XXQA 4HYOA 1FXHA 5LOMA 1B58A 5EYFA 1S0VA 5L3CA 2BOBC 3T9XB 3MVWA 3EN3A 4TOZA 3IB1A 4ZEIA 2EINC 3ETGA 1MPBA 1SZTA 1O7TA 3ABTA 3IJOB 3X2QC 2GFEA 2QS2A 3KOSA 3UA8A 2PI5A 4G8NA 4O3AA 2EIKC 1PDAA 4JTCB 3SPIA 2K1EA 1OCRB 4BLAA 1EZOA 1URGA 1K34A 1JCHA 3FVOA 5HM4B 1QLEB 1AMFA 1LAGE 3IL1B 4POWA 2I48A 1D4NA 1B5IA 2W6JG 4ZS9A 3FXQA 1P1QA 1ROPA 4F4LA 1B1XA 4O3BA 3EQ1A 3S2VA 1NNTA 4ZEKA 5H8FB 1R6KA 3VFJA 3RN8A 5I57B 5I2KA 1A55A 1UTHA 4TWKA 4JAUA 3OR6C 2M8CA 1SBPA 1K7DA 5L9SA 4RQEA 1H2GA 3F7VC 2EJRA 1YJ9V 3H6TA 3FZVA 4MFIA 1NFTA 3T66A 4MF3A 4PA9A 2VGQA 5EHSA 2PBWA 4MLVA 4FEBA 5DTBA 4KPTA 5CN0A 2O7IA 4GLIA 3SEYA 2ZQMA 4U4SA 3ZJZA 3PUWE 3VE1B 3K0GA 3I55V 1B7UA 4O3CA 3ODBA 1RYXA 1J95A 2ITDC 4ISUA 1S72V 3S9NC 4F1VA 1IXHA 2P67A 3I56V 4KI0E 2ZYNA 2RC7A 2THIA 2OK2A 2VD3A 2V3QA 4RAIA 3ZMUA 3STLC 3I5OA 4M1VA 1DSNA 2WSSG 3O28A 4PFTA 1DPEA 3S9LC 1SRYA 2ABHA 2RC8A 3CI8A 1VQ4V 3H01A 2HLDG 4GWOA 1AI4A 3DTUB 1SQYA 1JETA 3TQWA 5FTHA 1ZMGA 4GRKA 2NNUA 4MVSA 2OWTA 2QL3A 4G68B 2RC9A 5H6RA 3RLFE 4JAVA 4I5SA 5B1AB 1F4MA 3LBSA 4H6DA 5ITPA 4H8JA 4YKIA 4YKJA 3OSQA 4C0RA 3AG3C 2WAMA 3W15C 4JSOA 3FUZA 4N23A 1PB9A 3K06A 3OUFA 3M3LA 2WLJA 2F7AA 2R6GE 3RPWA 3K6UA 1W0JG 4KUMA 5H8QB 2ALUA 3IAZA 1VFEA 3AG2B 1FQEA 1N7WA 4N13A 1FFTB 2AIXA 2ZNSA 5JTYB 1Y4TA 5ELVA 4FE8A 4ZZAA 3M8UA 3Q26A 1H43A 4BIZA 4DXBA 2F36A 1NJIW 4OQOA 3MC2A 2QS4A 3STZC 2B65A 2KLFA 3K02A 2D5WA 3SEUA 2IJHA 4R73A 1PL0A 1B3LA 4PDVA 3MVYA 2NWJA 4HCYA 1I69A 3K6WA 2Z23A 2UVGA 4OXSA 1LAHE 3KJ7A 5B1BB 2D3IA 1B0LA 2QMWA 2EILC 1RKMA 4NF4A 4L17A 1POY1 4IY5A 4GX5A 1XVXA 3TAJA 4Z1MG 2DVCA 5B3SC 1B7ZA 2XXHA 3CCSV 2IU0A 1JW1A 3KSJA 1OCOC 2Z8FA 2XAQA 1Y4MA 3N6TA 1DF4A 4WFBV 3ZN1A 1A99A 3SJQC 3CC2V 2F7BA 1QR8A 2OWSA 3G3HA 2QSXA 1SDXA 4XDLA 1R6NA 5AA2D 2XXPA 2OJTA 4G2ZA 4X88A 3CCVV 4IO3A 3K1MA 2F5XA 5J9PC 5LGNA 1YTFB 1H8EG 1YTVA 3K6XA 1M9NA 2H9BA 1GM8A 3ML0A 5KA5A 1NMUA 3QSLA 4R6HA 3KSXA 4PDRA 5LHGA 3EHTA 3I6VA 2DE2A 4OVJA 2FTKA 3HCQA 2QRYA 4JASA 4JPRA 4MTXA 4FJCC 2HFBA 2O1MA 3ZRXA 3UK4A 3C31A 3RQTA 3C36A 4ZDMA 3GZGA 4IO4A 1GKFA 4U1ZA 1BTJA 3FV1A 3SEXA 1O64A 1IXMA 1QUKA 4FATA 3QO8A 1PEBA 1R3JC 1Q35A 5ITOA 2HJFC 2RKMA 1R3IC 1PNLA 4UUJC 1B3GA 2DYXA 3HO7A 4TLMB 3C9HA 3OSRA 4RY1A 2XXTA 1NR7A 3CD6V 4N6PA 1SW4A 3RUMA 1POTA 2OTLV 3MW0A 4KCDA 3SDFA 3MPLA 2REJA 2EZPA 1RYOA 1LCTA 3GXAA 4RO2A 3JV9A 3OW2U 3K79A 2QTOA 3FJGA 1EZ9A 1GR2A 3SPJA 4GF8A 5IYCO 1D9VA 3LSLA 2UXAA 4UV8A 4OXVA 5CRYA 4C1UA 4MTOA 3MWBA 4R9FA 2XAFA 2D21A 3T4ZA 2HZKA 4Q30B 1QCEA 1Q81W 1S77D 1LB9A 5H8SA 4DDDA 2LFSA 4ZEFA 4E2LA 4NF8A 4P9OA 4MVQA 4NF5B 4FEDA 1KD1W 2I3VA 2R71A 3G3IA 1NH2D 3ABMB 4BDQA 5CMCA 2ZXWB 4U23A 3V89B 4R9GA 1VQKV 3VOUA 3THIA 3V5AA 3RBZA 2XAGA 1OQHA 4HW8A 4N07A 1AJPA 5CM6A 5L3DA 1B40A 2Q68A 1WLEA 5B1AC 4HZ3A 1IXGA 2ONRA 4RUEA 1XHYA 2DYRC 1BKAA 5CMMA 2F78A 4ECFA 5CMBA 4EXLA 4JYBA 2GHYA 1E1QG 3TMGA 3C35A 2Q67A 3U93A 5TP9A 1KKDA 3O6GA 1EZJA 5EBLC 2X7QA 4BDRA 3BEHA 3E9XA 1PNMA 3OENA 3P30A 5H6QA 4G8MA 2H25A 4NTLA 3OEEG 1AI7A 1Z7ME 3A3UA 4QFLA 1RPRA 4G8HA 2MK3A 5HBCA 2UVJA 2VHAA 1DTOA 2RCBA 1V55B 1YCJA 4H37A 2P6JA 2O1LA 3M3FA 5FHMA 1DF5A 3Q27A 4EUOA 1VQ6V 3E2EA 1GTOA 1JOYA 4OERA 1N3WA 1QLNA 1BMFG 3ILUB 3ASNB 5H8HA 5DT6A 1RM1C 5L3EA 1NKDA 3G3KA 2PVUA 1FXKA 2DWIA 5B1BC 3U94A 2DVZA 3WFVA 3UN6A 2Q6AA 3D4GA 4PFYA 5AA1A 5KDTB 4ND9A 1MM7A 1V54B 5KZTA 1JQ0A 2O84X 4KP4A 4NMYA 1JX9A 4ZE9A 3KEIA 1S7YA 2IEEA 1AR1B 1NR1A 1NBMG 5AA2A 1YSCA 4PDLA 3RT6B 4WXJA 1S5HC 3E3KA 3QUJA 1HSJA 3CYOA 3MAMA 4E0WA 1YJNV 2ONKE 4EKWA 2XXXA 4AQ4A 3ZSFA 2Q2CA 5IYBO 3GBBA 5CBGA 1MXYA 3JYCA 1VQOV 4TQUQ 3QO7A 4KHZE 3CIJA 4QE7A 1R6ZA 2XXRA 3ZMSA 1QVSA 4H0WA 2GRVA 4XDJA 3DELB 1HWYA 2A5TB 3FYIB 4OEVA 4WCEV 4P11A 1URDA 5CMKA 4NE4A 3W9VA 5KUKA 1DTGA 3MZBA 3DP4A 2M7WA 5ICQA 2DXRA 3VXCA 3Q28A 4X89A 3QO5A 5EK0A 2VOZA 4ELQA 4I9WA 2H5YA 4WFAV 3ETEA 4JXIA 3BFTA 3F11A 5I2NA 1FTLA 2F7CA 4PA3A 3MUQA 3CP1A 2DQ0A 4F1YA 3S9EA 4QFNA 1NVPB 3ZMVA 4WEDA 3PMWA 2XHDA 2QM7A 2V84A 4LZ7A 4EQ7A 1A7LA 3MVZA 4UXNA 1THZA 4F22A 2PI4A 1N7XA 3T93B 4MTGA 2XOKG 3QAXA 2UVHA 1OIBA 1MQHA 2JIZG 1MSWD 1NNPA 2YJPA 4BDLA 3VBBA 3ZCCA 3AG1B 2QE7G 1PC3A 3D4CA 1GGGA 1ZWIC 3CR9A 3FB6C 1EU8A 4RA1A 4DO2A 2FNCA 1ENVA 4X48A 4YB6A 3TTKA 3OMAB 1KC8W 2FYIA 4EF2A 4IO5A 2JJ1G 3W7TA 2DE4A 1A54A 1TXFA 4KQPA 4GCZA 4JBZA 1B05A 1UQWA 4LP2B 3MJNA 4RJZA 4RK9A 1Y1ZA 5KA6A 4GL8A 1S76D 3GLBA 2BJJX 5B3SB 3E8BA 1PBQA 3CG3A 1OCOB 3TCFA 4R50A 3TZAA 4Q8RA 4Q20A 5TPAA 3ABMC 3G3FA 2ZXWC 2GH9A 4QFKA 1K5QA 3E8FA 1R3LC 5H9CA 4ZBMA 2DYSC 2D3OW 2Y7IA 2CK3G 1F23A 2DP8A 4I9DA 3MHHC 4FPPA 2ZYKA 4XBFA 3FVKA 4EF1A 2P2AA 4WFFA 4LATA 4XTCQ 3B6TA 2XNDG 3VLUA 1UIVA 3K03A 3R6UA 2O51A 3RVZA 3IB0A 2XXYA 3P32A 5B70A 3E4RA 1SW1A 3ZN0A 3O29A 2DOJA 3V83A 3G3GA 4FIPC 1GV8A 2DS9A 4JTDB 4PA4A 3C34A 4U2RA 1QR9A 2DQVA 1KECA 4MT8A 2DW4A 2O7UA 3LSXA 2H94A 4MBPA 2IJIA 3CCEV 3K2DA 5H8FA 5I57A 1V55C 2WLIB 1H3DA 1HSEA 3OUSA 2KB1A 2E0SA 3K1PA 3LUTB 3H3GA 3TDJA 1EBOA 1QVGU 3CFZA 3ASNC 4HTGA 3UGWA 1GM7A 3LSFB 1JVXA 3VVFA 1B32A 3W9WA 4G27B 1AI6A 4RNSA 1UTHB 3DP8A 2H99A 2IU3A 1FQBA 4NF6B 3TQLA 3ZRWB 2Z3YA 4MW3A 1V54C 3PD8A 3FB8C 1W0KG 3KN3A 3TKDA 3M3KA 1OCCB 2XAJA 3FXRA 1R9LA 2AHYA 1IXCA 4X8AA 1ZTYA 3G3JA 1JJ2U 2IH1C 4F39A 1CE2A 1XVYA 3DM0A 4UACA 4YICA 1IITA 3EF7A 3HN0A 1YITV 3QNEA 1GK9A 1N76A 4G68A 5LBQA 4OESA 3JYRA 3PUYE 2NVUB 2DYRB 4QSCA 2WLLB 4DCYA 1R1NA 3FVGA 1UTBB 1JVMA 1Z7NE 3USDA 5K2YA 5L9OA 2F8DA 4F2OA 1QW0A 3VLWA 2IH3C 3K00A 4AB5A 2O68A 1IIWA 3A09A 3KG2A 4Q5TA 2HQ0A 3WAEA 5H8QA 3H6VA 4OWDA 4MVOA 4LC1A 1P1UA 1N0TA 2XD2A 3IO6A 1Q86W 5JTYA 1LBCA 3DP6A 4MVZA 2IA4A 1OVBA 3VXBA 3UORA 4HAMA 2B5UA 3R26A 1MH3A 1HSLA 2CMOA 2Q88A 3FB7C 3OGCC 2VP1A 4YKKA 1MXWA 3UKMA 2XAHA 3AG1C 3RT8A 3IR1A 1ANFA 5IKBA 1E79G 1RM1B 1YI2V 1TUEB 2I49A 2UYEA 3ABUA 4QFPA 3FATA 1FQDA 2P7TC 2PYYA 3RNNA 1LNQA 5B1OA 1EFRG 1M90W 1MY1A 4E0XA 2H8PC 1NH8A 4XKNA 2RF1A 3VDFA 3JD1A 4IGTA 2DWAA 4I1DA 5I56B 3T22A 3EHUA 4R6KA 4F3BA 1S9TA 2HVKC 2ZDIA 3LSSA 4F18A 1QKBA 4TLLB 4UVCA 1MPDA 3SEVA 5GW7A 2YEVB 1SYHA 3OD7A 1B5HA 4LCUC 1Q82W 1OLCA 1O63A 1Q1KA 2ANJA 5C93A 2XX9A 1UJWB 4THIA 4DE8A 3SESA 1DPPA 2JEXA 3E89A 2NLJC 4P9PA 3CSGA 2QPQA 4H67A 3E86A 1IZ1A 4QFOA 1K3EA 2HR3A 3V8XB 3N6UA 3H6WA 4R74A 1M56C 1K97A 3O66A 1P1WA 3VVEA 3CMEV 5CBHA 4LQ5A 3N26A 1AROP 1RPOA 1SVXB 2Z8DA 4U22A 3FJ7A 2YLNA 4U21A 1GM9A 3B8NA 4QSDA 1AI5A 2HFEC 2UYFA 1MY0A 3A3CA 3PPQA 3EHSA 1AJNA 3E35A 3OFNG 3FYEB 2QM8A 1NH7A 1ELJA 4LONB 3L6HA 2I6EA 3PPRA 3B7DA 1B0HA 1VR5A 4P2ZA 1E1RG 2PT1A 3OM3B 4KFMA 5HPQA 1ZLQA 1WODA 3MQ9A 4BAYA 2EIJC 1K9MW 4F19A 5H8NA 4OFJA 3P7IA 3E8GA 2CZLA 3WG7B 3BKIB 4H1XA 2A0LA 3CCMV 1OCCC 3E8HA 4FJPA 2ZR3A 2ZNTA 2DSFA 5JEIA 1JEUA 3FJMA 1OZ0A 3JD0A 5AA4B 1QVFU 3IFXA 4OMBA 1B2HA 5ICTA 1COWG 3TCUA 2RINA 4ELPA 3KGCA 4WFEA 3PJSK 1N84A 3K01A 2B1IA 3M99B 4NF5A 4YMAA 3OO6A 1I6QA 5I58B 1B9JA 2WLMA 2Z22A 5IYDO 3TELA 1MRPA 5CBRA 3G71V 2Y7RA 2G29A 2VD2A 4FIMA 2DYSB 4MVUA 1WPXA 5JK4A 3PU5A 4CZZA 5LHHA 5CI5A 5A5XB 4ZEDA 3C32A 1MXZA 3JCZA 1MXVA 1FTJA 4FECA 3ECRA 1NNFA 1XL4A 1VQLV 4J9YB 1LAFE 3G6EV 2AYSA 2XX8A 3OXNA 4G2KA 1SYIA 4DLDA 4FAJA 2WLHA 1Y3QA 4JYCA 3HPLC 2C2AA 5EC2C 4GT1A 3TTRA 3KFMA 4MVMA 5L8DA 5L9MA 3OMIB 1CEZA 4DXWA 4R7CA 1F4NA 2Q2AA 1FTOA 2XXIA 3MP8A 1P4RA 3MBPA 1ZKBA 4YB7A 3ONMA 1GVCA 1I5YA 4Z0IA 3FGSA 2DQ3A 2YPNA 1JNFA 2JDIG 5ISUA 2Z8EA 3H06B 1OHHG 3PV0E 3R7XA 1GMGA 3F7YC 1YIJV 4HCWA 3VV5A 3B8MA 2QA4V 2H98A 4DXCA 3H6UA 1I6AA 1MABG 3U72A 3HSTA 5HFLA 2O6AA 4U7NA 2O69A 4MTFA