1MG1A

Htlv-1 gp21 ectodomain/maltose-binding protein chimera
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
450
structure length
450
Chain Sequence
GKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMSLASGKSLLHEVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCCFLNITNSHVSILQERPPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HTLV-1 GP21 ECTODOMAIN/MALTOSE-BINDING PROTEIN CHIM
publication title Crystal structure of human T cell leukemia virus type 1 gp21 ectodomain crystallized as a maltose-binding protein chimera reveals structural evolution of retroviral transmembrane proteins.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
total genus 139
structure length 450
sequence length 450
ec nomenclature
pdb deposition date 1999-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1mg1A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1mg1A01
3SDFA 1MDP1 4FAJA 3KJ7A 2H5YA 4I9DA 4LONB 1IUDA 4F1VA 2QSXA 5DEXB 2W7YA 4EF2A 3ILTB 2M7WA 5FHOA 3KG2A 3FJGA 3IOWA 1USYH 3PPPA 3HN0A 4IGTA 4F19A 4POXA 4YU0A 3EHTA 3PU5A 1B3FA 2OWTA 2HCAA 3O28A 4YKKA 4F31B 3MBPA 1Y4MA 1S7YA 2R71A 2OK2A 3S9MC 1IXGA 2F6PA 1XS5A 5FTIA 3U92A 3TTLA 4QFOA 2I49A 3E13X 5A5XB 4IY6A 2GFEA 3TTKA 1MH4A 4OYVA 2H99A 3O6HA 3CIJA 2PX1A 1M5EA 4KYEA 1QUIA 4E0WA 1FQBA 3MUQA 1JW5A 5IKBA 3IX1A 4UA8A 1IEJA 1SD3A 3FV2A 5HFLA 3TTMA 4DCYA 3TAJA 3SEUA 1T0KA 1UTHA 3TEPA 5H8HA 1PC3A 4TQUQ 4R9FA 2F35A 1XVXA 5TP9A 3V89B 2AIXA 2FYIA 1I6BA 3VE1B 2V84A 4OMBA 3TZAA 4JSOA 1IZ1A 1UTBA 4NF4A 4F3GA 1YPNA 4F3SA 3KOTA 3MQ9A 4IO5A 4KHZE 4F2OA 5JTYB 4NF8B 3A3UA 5KDTA 3LR1A 5I84A 3C4MA 3M3FA 3W15C 1B3HA 1PDAA 1OLCA 2Z8EA 1TFDA 3H6TA 4TLLB 3MHHC 3T9UA 2X7QA 5H8NB 2LP7A 5TPAB 1DSNA 2DVCA 5ISUA 4EXKA 4YB7A 3U94A 5AA1A 5I58A 1TWYA 4R9GA 1P1QA 2OWSA 1LAGE 3CR9A 2AL4A 1A54A 2H98A 4FJPA 4RK9A 3D4CA 3GBBA 4AB6A 4ESWA 2F7BA 1B1XA 1GGGA 4ECFA 4BDLA 4R74A 2P2AA 3CFXA 1MQIA 3K1PA 4RJZA 1OMPA 4KI0E 1Y66A 1ZTYA 5KZTA 5EHSA 2I3VA 3CRBA 4P0GA 3VVEA 1D9YA 2QPQA 3SERA 4LP2B 4ELRA 4C1TA 1Q1KA 3IJXB 4N07A 3TDJA 5I57A 5AA2B 3IL1B 3HHFA 3TQWA 4GFRA 4ZS9A 5BWJA 3V5AA 1GR2A 2HQ0A 3A3CA 4NMYA 3ODBA 2QMXA 5CMKA 5I2KA 2ZNSA 1LAFE 5CRYA 2ONKE 1LBCA 3KSXA 3PUXE 2CZLA 3HCQA 4IO7A 3K6UA 1NNTA 3SETA 1URGA 4EUOA 5HPQA 1IXCA 2R9JA 4BLAA 1JEVA 2HFBA 4FIPC 1GVCA 1DTZA 3KN8A 1MY1A 3JYRA 4U2RA 3FVKA 4GL8A 1Z7NE 1P1NA 1VFDA 5H8QA 1LGBC 1KWHA 4GWOA 5AA2D 5I59B 3CYOA 1M5BA 3O6IA 3TFLA 2NOOA 3EN3A 1B5JA 2QS4A 3C31A 1MRPA 1Y1MA 4PFWA 3ONMA 5JK4A 1MS7A 1MM7A 4PP0A 4H65A 4JSDA 5CMCA 3MP6A 3E4RA 3Q28A 3EF7A 3Q27A 2OLBA 3M3LA 1RYOA 3FXUA 4GLIA 3MJNA 2RINA 4KD5A 4F2QA 4EDPA 4YZZA 1FTLA 4YKJA 3B6TA 4X9TA 2DWIA 3B8NA 1FTOA 2D3IA 1OIBA 3TCFA 3QAXA 4G68A 3P30A 4R6HA 4E2LA 4LA9A 1Y3PA 2QS1A 3AXFA 3MPLA 1R9LA 3PUZE 2R6GE 3TQLA 3B7DA 3MZ9A 1PBPA 5CN0A 3LSFB 3VVFA 2X26A 4XIGQ 1NNPA 2Y7IA 1VFEA 3OOAA 3MVXA 1I69A 1NH7A 3ZKLA 3MVZA 3H03A 2ONSA 2O84X 2XXTA 3T9XB 3OEKA 4FEDA 2UYEA 2ONRA 1N7WA 3OENA 3DELB 3OO9A 4NF6B 3HV1A 3V8XB 1JQ0A 2NVUB 2IEEA 1MG1A 1HSJA 1FQCA 4MBPA 2E0SA 3S9LC 4HTGA 3RTWB 2EZOA 1Q35A 1QBZA 3A09A 4N13A 1QR9A 1Y20A 4QSCA 3FD3A 3K6WA 1R6ZA 4G68C 4JWXA 2P1SA 2HZLA 3HSTA 2YLNA 1MXWA 3W9WA 1N3XA 3SKPA 3O29A 1SYIA 3DP6A 1NNFA 3R26A 1PBQA 3T93B 2XXUA 4ELPA 1S50A 4NTLA 4WEDA 3THIA 2UVGA 5LOMA 5DEXA 1MM6A 2Y84A 1DPEA 4X1DA 1B4ZA 1OVTA 3BKIB 5JEIA 1B4HA 5AA3A 2QMWA 4OFLA 2XXPA 1MXZA 3G3JA 3FASA 1VSOA 3VXBA 3ILUB 1POTA 4YB5A 3RT8A 3HO7A 3BFUA 3BFTA 4H67A 3GWOA 2Q2AA 4ZEFA 4QFLA 3FXRA 2M8CA 2A5TB 5HBCA 1XHYA 5AA4B 2QL3A 1QKAA 2LAOA 3MVYA 4DXUA 1WDNA 4FIMA 4R75A 3PD8A 4OWDA 2QRYA 3FZVA 3ZS6A 4EQ7A 1SW2A 2D5WA 1PB7A 2HXWA 2VOZA 5IAIA 3M3KA 1H45A 1H3DA 1Y4TA 1PEBA 2Y7PA 3UN6A 4ONYA 3LSLA 3QK6A 1FTJA 3KN7A 4IY5A 4BDRA 2PMSA 2FNCA 1ELJA 4H0WA 2O51A 4ZZEA 1B1HA 4MF3A 2Z22A 3ZSFA 1SVXB 4BDNA 5DTBA 3CSBA 3CFLA 3PPOA 3G7WA 3QUFA 2X7PA 3IJOB 2I0BA 4YKPA 2Q89A 2Q88A 1MXVA 1ENVA 3VLVA 3H6UA 4BDMA 1M5CA 1AL3A 5JTYA 3FIRA 4RNSA 4NF8A 3MWBA 4U21A 1JW4A 3H4ZA 5DVFA 3OEMA 3OSRA 4JBZA 2X7RB 4PETA 4YICA 1MXUA 4DCXA 1Y1ZA 1GTKA 1MPBA 4LZ7A 5ITOA 2Z23A 2XX7A 2PT2A 2PYYA 3SEXA 2H9BA 5TPAA 2F36A 2HEUA 3PD9A 2ZYKA 2XX8A 1CB6A 2OBGA 2B3FA 4HCWA 1MPDA 2Y7WA 2ZMBA 4OEUA 5BUUA 3IAZA 3PUVE 4G77A 3PUYE 1P1OA 1I5YA 1P1WA 3VLWA 1ANFA 1FQDA 3D4GA 4GXSB 4QHQA 4THIA 4ELQA 2XXWA 4QRZA 3RLFE 4PFUA 3TCGA 3CP1A 1LFIA 5FTHA 4TOZA 1B5IA 3LBSA 4RA1A 4H5FA 3EQ1A 1DTGA 1FQEA 4LATA 3IO4A 1MXXA 4U1ZA 3TELA 1A7LA 2Q2CA 3K6XA 5CMMA 3PMXA 4JB7A 1MY0A 1PB9A 4QFNA 2ALUA 1US4A 4P11A 1MY4A 1B05A 1Y3NA 2I6EA 3H06B 1A8EA 2V93A 4POWA 4Q30B 2O6AA 4NWCA 2I0CA 2A5SA 1S9TA 4MLQA 4O3BA 3K1NA 5H8SA 1B7ZA 3TPAA 2ANJA 1QUJA 1YCJA 5ICQA 1UIVA 1NKXA 4GF8A 4XKRA 2V3QA 3UORA 1I5XA 3IB0A 4E0XA 2PT1A 2YJPA 1K34A 2DE3A 4HCYA 3MVWA 4OZ9A 4XKPA 1EZOA 4WXJA 3N6TA 2F7CA 2I3WA 1HSEA 3CG3A 4FE8A 4GIZA 1LAHE 1SW5A 1SZTA 3OMBA 1JPXA 3OSQA 3G3IA 5DYHA 3QYTA 5EHMA 2E1SA 1IXIA 4EXLA 1WODA 4F3BA 1EZPA 1BP5A 1EZ9A 4H6DA 3MP8A 3T96B 3TUSA 5CMUA 3CSGA 5KDTB 4DDDA 3GBAA 1GV8A 1FW0A 1URSA 4G8MA 2F78A 3QXMA 1MH3A 2VD2A 4H5GA 1LFGA 1BKAA 3TCHA 3GLBA 2O1LA 3C34A 1NH8A 5H8FB 3CFZA 1DLBA 4WKMA 2XXIA 3O2AA 2DOJA 3K6VA 4N23A 5I2NB 2XXRA 3OO8A 4KCCA 3M8UA 4ZZAA 2OT5A 4FORA 4YB6A 1F23A 4M1VA 3GZGA 4ND9A 3C35A 3SEWA 3KN3A 3PMWA 2IA4A 3PV0E 3L6HA 4QFKA 5B7DA 4R72A 4QSDA 2PBWA 3LSXA 4PFYA 1QKBA 4OETA 3FVOA 1N3WA 1MPCA 5KA5A 2F8DA 1ZJLA 1P99A 1FQAA 5AE4A 5I56B 3IB2A 1B7HA 3DLNA 3L6GA 4NF6A 3FATA 2I4BA 1DPPA 2THIA 4JXIA 4HS7A 4LUBA 2UVHA 3QSLA 4UACA 3KFMA 1LSTA 2ABHA 1H43A 1AH5A 3MW0A 1B40A 2DXRA 2DQVA 1OLAA 1K33A 3JV9A 1BLFA 1URDA 4H1XA 3OD7A 4OFOA 4U22A 1LLSA 1MY2A 1D3KA 1B5HA 4N6PA 3I6VA 4JWYA 3RNNA 4KFQA 2HAUA 3I3VA 3S4UA 4GVOA 2XHDA 4OQOA 3K00A 4EQBA 3Q26A 4XXUA 3U1OA 2OCUA 4FATA 3TYHA 1N0TA 2DYXA 3W9VA 3B8MA 1LB9A 1XC1A 3I5OA 3N94A 5DVJA 4DXBA 4YKIA 5H8QB 1M5DA 3ECRA 1MDQA 5KCJB 4R2FA 4N21A 3H01A 1ATGA 2EZPA 5DT6A 2AL5A 2V3TA 3HHGA 2NXOA 4QFPA 3C9HA 2A5TA 1EH3A 2I58A 5AA4A 2RC9A 3S9EA 2GHAA 1YTVA 5DVIA 4XKNA 1B3LA 1B6HA 4ZE9A 2XXXA 1UIUA 3SESA 2P0SA 1M5FA 4ZDMA 5CM6A 1AOVA 1USYE 3PUWE 4F29A 4I1DA 3WAFA 2XXYA 1N76A 3DP4A 1SW4A 5L9MA 3B77A 4OESA 1MQJA 2ZYOA 1SQYA 4OHNA 3UK4A 3MC2A 4AQ4A 3LSWA 1LFHA 1NNKA 3VV5A 1JNFA 5CBSA 1SBPA 2ZNTA 2HZKA 2F97A 1LBBA 5FHMA 4LZ8A 1JETA 3DM0A 4Z7EA 2XXQA 3VLUA 2RC8A 3KJTA 3SEYA 1ZKBA 1SDXA 4NF5B 4U23A 2DXYA 1F9BA 2EBOA 2I4CA 1QW0A 3C36A 5CC2A 4GRKA 4MFIA 4XTCQ 5A5XA 1B9JA 3R6UA 3TKDA 2DWJA 1Y3QA 4LZ5A 1HSLA 4JWOA 2B65A 4IGRA 4F1UA 3IR1A 2QJEA 4BDQA 3FVGA 3T22A 1R9QA 3PGFA 3OELA 2B3BA 4RK2A 3N6UA 3HPIA 3ZKKA 5HM4B 1QULA 1B58A 1DF4A 4I8CA 2Y7KA 4HW8A 4RYAA 2XD2A 4PFTA 1JEUA 1B52A 2QS2A 3F11A 1FCKA 3O9PA 1BTJA 3E3KA 3H3GA 3LUYA 2RC7A 3KBRA 5L9OA 3VXCA 3S9NC 1POY1 1QUKA 2OZZA 3T9HB 3UGWA 3TMGA 3MZBA 1XT8A 2HAVA 2GH9A 1FTMA 1RYXA 1ZBMA 3G3FA 2VGQA 1B3GA 3UIFA 3RUMA 3K01A 3QUJA 4O3AA 1RKMA 4JDFA 3PPRA 5H8NA 5CI5A 3V83A 4RPOA 2XD3A 1QR8A 1EBOA 4ZEBA 4G8NA 1Y9UA 4G2KA 4GQOA 1II5A 3CVGA 2OJTA 4DIGA 1MOFA 1XVYA 5M2VA 3IK6B 1MQGA 4DZ1A 4PE5B 1DF5A 4F22A 3TTNA 4ZEIA 1L5TA 4RY1A 4F18A 1B2HA 3IOUA 2P6JA 4JF3A 3CG1A 1FTKA 1EU8A 3RQTA 1SI1A 4IO4A 1DMBA 5ITPA 4DXCA 2RCAA 3VVDA 3R7XA 1Y4CA 3RPWA 2ZXTA 3USDA 2UVIA 5AA2A 4KQPA 1OQGA 2I48A 3QIMA 4H8IA 2O1MA 2H25A 1Z7ME 3O97A 4AB5A 4MLVA 2ESNA 4QSEA 3K4UA 1B3EA 1LCTA 4NEDA 3RT6B 3TTRA 4EF1A 2REGA 2G29A 2DSFA 1R1NA 4MH5A 3CI8A 4U4SA 1B32A 1AIVA 3UA8A 3EHSA 5H8FA 3Q29A 3RGYA 2VHAA 1ZMGA 3Q25A 1PB8A 3S2VA 1A8FA 3FJMA 1OQHA 1J1NA 3SEVA 2VD3A 5I2NA 3KGCA 1LCFA 1UTHB 5H8HB 1D9VA 2DE2A 5ELVA 1VR5A 3G3KA 2F5XA 2MK3A 4F3PA 4ESXA 4YAHX 4X48A 4G4PA 3FVNA 1O7TA 2RF1A 5TP9B 5I59A 4I62A 1SW1A 5H9CA 1IQ7A 4ISUA 1UQWA 4OXVA 3C33A 1UTBB 4NF4B 1LAXA 4ELOA 5TU0A 3FGSA 1DOTA 3IO6A 3N26A 5I56A 5FHNA 4KYSA 2DP8A 2REJA 3K0VA 2VP1A 4IO2A 3MAMA 4GL0A 4LQ2A 1B7UA 4TLMB 3H7MA 1NL5A 1FQFA 1O64A 5CMBA 4Z0IA 1CE2A 1O63A 1B0HA 2UXAA 4PQJA 2O7UA 3U93A 3O66A 1BIYA 1A55A 1MXYA 1QCEA 3UP9A 3KEIA 1H76A 2CMOA 3VFJA 4RPNA 4GD5A 3WAEA 3B6QA 3LC8A 5I58B 4ZEDA 4XKQA 2RCBA 2UVJA 1B0LA 4OVJA 3IOTA 4OENA 4R6YA 4M4GA 4Q0CA 2DVZA 4IO3A 4WEPA 2BJJX 2D21A 1NMUA 3G3HA 5CBRA 1JQFA 4JPRA 4KYDA 3K2DA 5KCJA 2DWAA 1OVBA 2UYFA 5I57B 1SYHA 2PVUA 4OTEA 3OO6A 4R6KA 4U1OA 2G93A 3MHSC 4NE4A 2O69A 3B6WA 4OEVA 1SI0A 3TODA 3EHUA 1JVXA 4H8JA 4DE8A 2Y7RA 3BBRA 2V25A 5I2KB 3MP1A 1WVJA 3GXAA 4G8HA 3EPEA 2ZYNA 4K3FA 2F34A 3PPNA 1N04A 2Q9TA 1B46A 4KR5A 2Q8JA 1TT1A 1TFAA 3K9AA 2XXVA 4GXAA 3K02A 4F39A 2NWJA 5K2XA 2Z8DA 3RTFB 3KOSA 3DP8A 3G3GA 1LB8A 4YMBA 2QS3A 5K2YA 5F7VA 1VE4A 3E9XA 4C0RA 4DLDA 1A40A 2GRVA 4R2BA 3P7IA 4ZECA 1QVSA 5L8DA 2AYSA 4IB2A 3IOVA 4G2ZA 4C1UA 2DE4A 2WKYA 2F6GA 3O6GA 1P1UA 3T66A 3PMVA 4LVQA 4OERA 2O7IA 4NF5A 2NUVA 4EQ9A 1QJMA 4BDOA 1MQDA 3RY3A 4O3CA 3MZ1A 4JGSA 3IORA 5EYFA 3KZGA 2KLFA 4GOTA 3OXNA 3JZJA 4U4XA 1TXFA 4LQ5A 1A99A 5B70A 3FV1A 2RKMA 3IB1A 4FECA 1JVYA 4G68B 4ZEKA 4KCDA 3H6WA 5F1QA 1ZLQA 3PPQA 2DS9A 1N7XA 1MY3A 3H6VA 4NWDA 3WFVA 1ZIUA 4X1BA 4L17A 1XOCA 1JW1A 2O68A 4IO6A 1N84A 4QF9A 3N5LA 3U72A 3VDFA 4OFJA 3K1MA 5J1DA 3KSJA 2F7AA 2XX9A 1IXHA 1MQHA 1NFTA 3FJ7A 5KA6A 4FK5C 4ZE8A 3MPKA 1AMFA 1H44A 4R73A 4P0IA 2Z8FA 2GHBA 4FJCC 3RN8A 4FEBA 5ICTA 3FUZA 2V3UA 3M99B 3OO7A 4RXLA 2FA7A 2DWHA 3FXQA 1IITA 1B51A 2YPNA 4Q5TA 1IIWA 4Q8RA 1D4NA 2XXHA 2H4IA 3U8QA 5HFMA 2ZNUA 5L9SA 3T9VA 1YAEA 1I6AA 4F1YA 4YMAA 1I6QA 2ZYMA 1US5A 3C32A 1ZU0A 4KPTA
chains in the Genus database with same CATH superfamily
2QE7G 3SDFA 2JDIG 1SA0B 1N32O 4ICGA 1MDP1 4FAJA 3KJ7A 2H5YA 4XDLA 3LDEA 3SYOA 2EJRA 2YEVB 1S3JA 2WBDA 1PV0A 2BJIA 4I9DA 3ZMVA 2YC0A 4LONB 3A0RA 1IUDA 4YY3O 1J5EB 4F1VA 1AP5A 2QSXA 3K06A 5DEXB 2W7YA 3ABLB 3E22A 3CRRA 1M4UA 4EF2A 2QTOA 3ILTB 2M7WA 1NR1A 3GB7C 5FHOA 3KG2A 1MZEA 5LGUA 3FJGA 1RM1B 3IOWA 1USYH 3PPPA 5B3SB 2WA4A 3H9VA 4JTAB 4O2AB 3HN0A 3K59A 4IGTA 4F19A 2O57A 4Z2WA 1J95A 4POXA 4YU0A 3EHTA 3PU5A 1B3FA 4HE1A 2OWTA 3E2EA 2HCAA 3J81N 1FPIA 4OVTA 3O28A 4BIOA 4YKKA 4F31B 3MBPA 3K0GA 3K04A 2HJFC 4PDLA 3B09A 4DV5O 1Y4MA 1S7YA 2LGWA 2CZIA 1EYIA 2R71A 2OK2A 3S9MC 1IXGA 5EYPB 2F6PA 3QG5A 5KHHA 2XWIA 1XS5A 5FTIA 3U92A 3TTLA 3JALA 5IJ9A 5CBFA 5A2QN 1VQKV 2HHHB 1AB3A 2AHZA 4QFOA 5BY1A 3F7YC 2I49A 3E13X 3R65A 4LF5B 2Y0IA 5A5XB 2OTLV 4IY6A 2CEYA 2GFEA 5IDJA 2QKCA 4UB8Z 3TTKA 1MH4A 1XNQB 1AJNA 1UPGA 3A2FA 2OTJV 2Y48A 1QVGU 4OYVA 1OCRC 1SQBH 2H99A 3O6HA 5KHJA 3CIJA 5JVDB 4B3TO 3ABUA 2PX1A 4LF7O 2E74B 4IIJB 1M5EA 4KYEA 3HKCA 1QUIA 4H46A 2WLKA 3F7VC 4E0WA 5EK0A 2QR4A 1FQBA 2JK5C 3TETA 4LCUC 2F4VO 4JI3O 1S77D 1KUQA 2DMXA 3CPWU 3MUQA 1OCCB 1JFFA 1GTOA 1URFA 1JW5A 5IKBA 4JI6O 3KBZA 3IX1A 2MW2B 3SJCC 3SPIA 3K08A 2K1EA 4UA8A 1IEJA 1SD3A 3FV2A 4LF4B 5HFLA 3TTMA 4DCYA 4KFMA 3TAJA 1QLNA 1RPOA 2XASA 2RCVA 3BCCH 4QGPA 1UTHA 2Q74A 3SEUA 3TEPA 5H8HA 1AP6A 1PC3A 1T0KA 5LMNB 3TGUH 4BW9A 1NUWA 4O94A 4TQUQ 1TVKA 4X1IB 5IJ0B 1FXKB 3SDLA 4R9FA 1VEWA 4EFEA 3FFQA 5KX5B 2F35A 4NTXA 2Y5LA 1XVXA 5TP9A 2DYRB 3V89B 2AIXA 2FYIA 1I6BA 3VE1B 2RNBA 1SETA 2R8TA 2V84A 4OMBA 3TZAA 1HNXO 4JSOA 1IZ1A 3SYAA 4X66O 5CB4A 4LF9O 2P67A 4JI7O 1RDZA 1UTBA 3DC6A 4NF4A 4ZOLA 4F3GA 4B3SO 1IBMB 3K3WA 1S72V 4KHPB 4RQEA 3EKIA 1Q6IA 4JV5O 3CJHB 1WAZA 4PDMA 1YPNA 1OCOC 2ADPA 2ZD9A 4F3SA 4GWUA 3KOTA 3MQ9A 4IO5A 2P5OA 4KHZE 1YCIA 4F2OA 1IMEA 1EN4A 5JTYB 3U10A 2FVZA 1VP7A 3BHPA 4LWSA 4O4IA 4NF8B 2UUAB 3A3UA 2ZDIA 5KDTA 3LR1A 4XFEA 3T1HB 5I84A 4LR3A 3C4MA 3X2QC 3UKMA 3M3FA 3W15C 1B3HA 1PDAA 3D36A 2IJIA 1OLCA 4CC6A 1J5EO 2Z8EA 1TFDA 4I55A 2FBPA 3H6TA 4TLLB 3MHHC 1AR5A 3T9UA 3K5MA 2X7QA 5H8NB 1NU1H 3UO3A 1NVPD 2LP7A 1CNQA 5IZ3B 5TPAB 4J9ZB 4P2ZA 1K5SA 1DSNA 2DVCA 4P8BA 5ISUA 1N4CA 4EXKA 4UCVA 1YZ0A 1P84F 2EILC 2WLLB 4PFBA 4YB7A 3U94A 5IGAA 4DR3B 1H2LA 5IY5C 5AA1A 2K9PA 2F1MA 5I58A 3CRQA 1TWYA 5IY5B 4R9GA 1P1QA 2OWSA 2B4LA 1LAGE 3CR9A 2F3BA 4DW1A 4I4TA 4PFRA 1KU9A 1FPJA 3RT3C 2AL4A 3OTFA 1A54A 2YI8A 2H98A 2QVVA 4FJPA 1VQ6V 4RK9A 3D4CA 3GBBA 4AB6A 3P32A 5EQ7A 4ESWA 5ITZA 2F7BA 1B1XA 1MA1A 4B08A 1ZUQA 1GGGA 2X6AA 2UUCO 4ECFA 4BDLA 3H1IH 2VWJA 3FB8C 4R74A 3TXSA 1HNZB 4YJ2A 2P2AA 3S3WA 3CFXA 5D5QA 4R6ZA 5DECA 3JD2A 1IURA 1MQIA 3K1PA 4DV6O 4RJZA 1OMPA 4O7IA 1NI9A 4KI0E 4X1YB 5KAFZ 1Y66A 4NYKA 3OUSA 4U7OA 4GX3A 4IYIA 2GBOA 1ZTYA 2UUBB 2JIZG 4PAKA 5KZTA 5EHSA 2I3VA 1LBWA 3IGAC 3OW2U 1IBKO 4GCZA 1IMDA 2CGOA 1FPDA 4WFEA 3CRBA 4P0GA 3VVEA 1D9YA 2QPQA 3SERA 4LP2B 1LBVA 4ELRA 4C1TA 1Q1KA 3IJXB 2V4DA 4P1LA 4N07A 3K03A 5J2UB 1G1XB 3TDJA 5FBPA 5IZZA 1QHTA 5I57A 3S3XA 2EINB 5AA2B 5IYZA 2F23A 3IL1B 2BSKB 3HKEA 3HHFA 3RVYA 4GFRA 2ZDIC 3TQWA 4ZS9A 2W6JG 2LGQA 2QTSA 3ZRXA 2QWQB 5BWJA 3SR2C 2IBZH 3CRCA 4ZBMA 3RPLA 1JMKC 2F95B 3V5AA 1GR2A 3D36C 5EBWC 3SPGA 2HQ0A 3A3CA 1NV5A 2AXTZ 3UCSC 4NMYA 2XAFA 3ODBA 2QMXA 2WA3A 4LNUB 5CMKA 2F3DA 1DTOA 4P56A 5I2KA 5LGTA 2ZNSA 3ASNC 4CH3A 1LAFE 5CRYA 5EQ8A 2ONKE 5KHIA 4IGGA 4MVZA 3K5LA 5EZYA 1LBCA 5LA6A 2Q73A 3WB1A 3G6BA 5LMNO 2CZLA 3HCQA 3KSXA 3K6UA 3PUXE 4IO7A 4I3EA 2WLIB 1NNTA 4DR1O 3SETA 4OGQB 1S5JA 4LF8O 4DV3B 4IT5A 1URGA 4O4HB 1NV1A 3LSSA 2YXLA 1D2DA 1MSDA 1YVWA 4EUOA 2C2AA 2CZKA 5J2TA 4ZHQA 5HPQA 1IXCA 2R9JA 1N8RW 3J7AU 1GM9A 4BLAA 3LDDA 3B8BA 4DR5O 4OX9B 3H1JH 4GT1A 1JEVA 1XNRO 2V7QG 4UB6Z 2HFBA 5JQGB 3BVOA 4FIPC 4O4LB 4I50B 1GVCA 2DN9A 4WBNB 1DTZA 3KN8A 1GN4A 1MY1A 3JYRA 4FFBA 4O4JA 1JOYA 4U2RA 2X6CA 1F7YA 3R66A 4DYLA 3FVKA 4GL8A 1Z7NE 3QO7A 4MSWC 1P1NA 1VFDA 3VQYA 2R9IA 5H8QA 4OVQA 4DV1O 2W6IG 1LGBC 3SPHA 2YI9A 2Y4UA 3WU2Z 2B9ZA 2N04A 3T0JA 1KWHA 4GWOA 5AA2D 5I59B 4JI4O 1IXMA 1SRYA 3CYOA 1GAXA 1M5BA 3O6IA 3TFLA 4EKWA 2NOOA 3EN3A 1VQ5V 5ET8A 3B40A 2QM7A 4WFBV 3QO5A 1B5JA 2QS4A 3C31A 2P4VA 3Q4HB 1MRPA 1K92A 1Y1MA 2UXXA 3E83A 3DXRA 4PFWA 4JTCB 1TUBB 3ONMA 1XL6A 2JGUA 1IDSA 2ZIOA 2GUZB 5JK4A 1HWYA 2ZKOA 2P7TC 4PCDA 4WFFA 2QM4A 3AK3A 1MS7A 1S76D 1MM7A 1O9HA 4NF0A 4B7KA 4PP0A 1SZXA 4P1EA 1KECA 4I0XB 3OGIB 4H65A 1CXZB 2CTWA 4JSDA 5CMCA 2OIEA 4P30A 3MP6A 1X59A 3E4RA 3Q28A 1Q3EA 2XWOA 3EF7A 1IZ3A 3Q27A 1PM9A 4FM0A 2OLBA 3M3LA 1RYOA 3FXUA 2JVDA 4GLIA 3RYIB 4RAIA 3MJNA 1D9QA 2RINA 4KD5A 4NAPA 4MVQA 1YHQV 4F2QA 4EDPA 1FRPA 4YZZA 3W7SA 1FTLA 3T1YB 4YKJA 3OT7A 3B6TA 3OMIB 4X9TA 2DWIA 2LFSA 3HB3B 4PA4A 3SPJA 2JGDB 2Q69A 3B8NA 1FTOA 2D3IA 1OIBA 3TCFA 3QAXA 4G68A 3EXAA 3KC0A 3AK2A 4PA6A 3P30A 5H6RA 3JAWA 4YXWG 4R6HA 4E2LA 2HXRA 4LA9A 2DQ0A 1Y3PA 2FKXA 2QS1A 1Y76A 3AXFA 1HP8A 3MPLA 2ZXWB 3FXBA 1DBZA 1R9LA 1VQOV 3KZIZ 1LEVA 4NQ8A 3PUZE 4X64B 2R6GE 5A9GA 3JARB 2AW9A 1IMFA 3TQLA 3RN4A 3G6EV 3ETGA 1QU7A 3B7DA 3MZ9A 1I0HA 1CEZA 1PBPA 3A8TA 4PA7A 4PGNA 4PA9A 5CN0A 4FM1A 3LSFB 3VVFA 1N32B 2X26A 2FIEA 1FBGA 4XIGQ 4UUJC 1NNPA 4ZKIA 2Y7IA 1VFEA 2X6BA 3OOAA 3MVXA 3RFRA 1I69A 3D3IA 1NH7A 2ZM6O 3ZKLA 4NGUA 1Y6XA 2DJVA 3MVZA 2FYUH 1VF6A 3H03A 2ONSA 2O84X 2XXTA 1OZ0A 3T9XB 3OEKA 4FEDA 2UYEA 3JASB 2ONRA 1AI5A 1N7WA 1BZKA 3OENA 1H2SB 1D5AA 1SQXH 3STZC 2ZE5A 1YJNV 3SJQC 3DELB 3OO9A 1NH2D 4NF6B 3HV1A 3V8XB 1JQ0A 2EIJC 1PL4A 3FD9A 5C8YA 2NVUB 2GQ1A 2IEEA 1MG1A 1HSJA 1FQCA 4JVCA 4DW0A 4G28B 4MBPA 2E0SA 3S9LC 4HTGA 3RTWB 4ABMA 2EZOA 1Q35A 1QBZA 1FPGA 3A09A 4N13A 1QR9A 5IYCO 2RMKB 4K0KB 4DV5B 1Y20A 4QSCA 4JYAO 3FD3A 1B3QA 2JEUA 4X65B 3K6WA 1R6ZA 3AG7A 4G68C 3QNEA 4JWXA 4TOIA 2P1SA 5CBHA 2HZLA 1FAFA 3HSTA 4HE2A 2YLNA 1MXWA 1IMAA 3W9WA 2CUGA 3HFUA 1Y74B 5EYGA 1N3XA 3SKPA 3O29A 3ICXA 1SYIA 1SA0A 2CZHA 3DP6A 2VRZA 1M9NA 1L1FA 1NNFA 3WG7C 1KD1W 3R26A 3CCVV 2YEVA 4GX2A 4GX1A 1PBQA 3T93B 1FPOA 3L72H 4UV8A 4DR6O 3LNNA 2XXUA 4O8MA 4ELPA 1S50A 4NTLA 4WEDA 3THIA 2VWKA 4J41A 1RDXA 2UVGA 4B3TB 1KB9F 5LOMA 4D7SA 5IM2A 5DEXA 1MM6A 2Y84A 4LF7B 3RGBA 1B6QA 1DPEA 1KP2A 4KL1A 1KYOF 4X1DA 3AG3C 4FLVA 1B4ZA 4PDRA 2F4VB 2R72A 1OVTA 2YXYA 3BKIB 4JI3B 5JEIA 2MKZA 3E8BA 1B4HA 5AA3A 2QMWA 3O65A 4OFLA 2XXPA 1R1BA 1V54B 4O2AA 1ZL8B 2WLJA 4TSFG 1MXZA 3IFCA 2DYSC 3G3JA 1FPFA 4LFCB 2ITDC 3U0ZA 3FASA 1H2KA 1VSOA 4MCOA 2Y4TA 1ZAUA 3VXBA 3EVKA 3ZRWB 1H2MA 1US6A 2V4CA 2VT5A 2PI4A 4U3JB 3ILUB 1POTA 4YB5A 1KBHA 3RT8A 3HO7A 3BFUA 4NXNO 3BFTA 1RP3B 3BIGA 4H67A 1Q82W 3GWOA 2Q2AA 2ZZVA 4ZEFA 1OV9A 5LP6B 4QFLA 3FXRA 3RW0A 2M8CA 3C3SA 3TXQA 3AG1B 2A5TB 5EYPA 2XA5A 5HBCA 1XHYA 1S5LZ 1EYJA 5AA4B 4XEQA 2NN4A 1HNXB 2QL3A 3ROJA 1QKAA 2JEXA 2LAOA 4TQDA 3MVYA 1HW7A 4LF9B 4JI7B 3JCZA 4DXUA 1WDNA 4FIMA 3RVZA 4PF8A 1G6UA 3PD8A 4R75A 3SGIA 4OWDA 2Q67A 3N2GB 3T2MA 2QRYA 2KSDA 4UV9A 4GWXA 4R50A 1MABG 4JYCA 3K79A 4JV5B 3FZVA 4MVSA 3ZS6A 2R70A 4EQ7A 1SW2A 1LUWA 4FBPA 2D5WA 4H44B 1PB7A 4UFZA 2HXWA 2VOZA 5IAIA 1FSAA 3VQVA 3UT5B 4FLUA 3M3KA 5JVDA 1H45A 3JCUZ 1H3DA 4IIJA 1Y4TA 1PEBA 1XDCA 2WSSG 1PKXA 3RYFB 2Y7PA 1K5QA 3UN6A 4ONYA 3JATB 3LSLA 2WYPA 3ZN0A 3QK6A 1FTJA 3KN7A 2GHYA 1BMFG 4IY5A 4DK0A 3ASOB 4N6DA 4BDRA 3OMNB 3DC5A 2PMSA 4I5SA 3ABLC 3ZHSA 1ELJA 2FNCA 2CGNA 4H0WA 2IH3C 3MDSA 4J7JA 4NTWA 2O51A 2YIAA 4ZZEA 3CRMA 3FB7C 2L5VA 4B3RO 1RM1C 1B1HA 5B3SC 4MF3A 1OHHG 2Z22A 3ZSFA 1SVXB 3E89A 2JJKA 4BDNA 1KP3A 3EHBB 4X1IA 5IJ0A 2HVKC 1FXKA 2UXDO 3LDCA 5DTBA 2CAZC 2QKAA 1KKDA 3CSBA 5KX5A 3CFLA 3PPOA 3G7WA 2ITCC 4GYCB 5LHGA 4XF5A 2Y69B 3CHXA 4CS3A 1YXBA 3CCEV 3QUFA 2X7PA 3NR7A 3IJOB 3IFXA 2IH1C 2UUCB 1NV6A 2I0BA 4K0KO 4JI2O 4GKJO 4YKPA 5H2FZ 5T3JA 4JZ2A 2HR3A 4X65O 4DV6B 2P4KA 4XDKA 2Q89A 2Q88A 1MXVA 4JVIA 1IBLO 1ENVA 2YIBD 3IJ4A 3VLVA 3H6UA 5GW7A 1Z5WA 4BDMA 1DK4A 3JSNA 2Z3YA 1M5CA 4EEQA 1IBKB 1AL3A 5JTYA 3FIRA 2A06H 4RNSA 2H3OA 4NF8A 4OXSA 3DSQA 3MWBA 4U21A 1JW4A 3H4ZA 1JVMA 4W4LA 1WB8A 1FBEA 4GUNA 4JI0O 2AGAA 3OEMA 3OSRA 4JBZA 5DVFA 2X7RB 1VMGA 3DGEA 3FAVB 3L9DA 3UQ8A 2PI5A 4PETA 4YICA 1MXUA 4UVAA 3CXHF 4DCXA 1Y1ZA 1GTKA 1MPBA 4LZ7A 5ITOA 1V55B 3G67A 2Z23A 1XEQA 2XX7A 1P4RA 2PT2A 2PYYA 5KLVH 1BT8A 3SEXA 1T5EA 2ETNA 4WFGA 2H9BA 5IZ3A 4OANA 5TPAA 3G4SV 1NVPB 2YSUB 1XMOO 2F36A 2KG7B 3ETDA 2HEUA 3PD9A 2ZYKA 1OCCC 3WB0A 3FYIB 4GWWA 2WLLA 2XX8A 3BFRA 4DK1A 2QVUA 2PZSA 1CB6A 4L8JA 2OBGA 2BOCC 2B3FA 4LFCO 4HCWA 1MPDA 2VQFB 1VQLV 2QEXV 1BS3A 2Y7WA 2ZMBA 4D7TA 3LSUA 4CC5A 2HEPA 4OEUA 5BUUA 2EIMB 2QWRB 3IAZA 2Q7EA 5J9PC 1FXKC 4MT8A 4DR1B 3PUVE 4G77A 3PUYE 4LF8B 1P1OA 2E76B 4NG7A 2XXKA 1I5YA 1P1WA 4NHBA 2HG5C 2B5UA 2DYRC 2V1DA 5JCOC 2B4MA 3VLWA 1ANFA 1FQDA 1R3IC 3D4GA 4GXSB 4QHQA 4DI4B 4THIA 1FJ6A 4X1YA 2Z0AA 4ELQA 1YI2V 1I7FA 4DR5B 5FPRA 4H37A 5IE9A 4HAMA 3L75H 2XXWA 4QRZA 3RLFE 1XNRB 4PFUA 2A7WA 4PHZA 3TCGA 1B04A 3CP1A 5A5LA 2QWPB 1LFIA 5FTHA 1KA0A 3BA9A 5DM6V 4TOZA 2QVRA 1B5IA 3LBSA 4RA1A 5J2UA 4H5FA 1LNQA 3EQ1A 1DTGA 1XOUA 1FQEA 1R3KC 2BSKA 4AS4A 1H8HG 4LATA 4FLWA 1QGXA 3IO4A 1MXXA 2QJ1A 3OE7G 4U1ZA 4DV1B 3TELA 2RDCA 2EIKB 3CSXA 1S5HC 4DRXB 4AI8A 1A7LA 2Q2CA 3K6XA 4JI4B 3AG4B 5CMMA 5LYJB 3PMXA 1AR1B 5LMUO 4JB7A 3AK1A 1MY0A 2CTRA 2X0LA 1PB9A 1V9PA 4QFNA 4TWKA 3OEHG 5B5EZ 3ZCCA 2ALUA 4LNUA 4LBEC 1US4A 1MY4A 1B05A 4XDJA 1Y3NA 2I6EA 2Q7GA 3H06B 2AHYA 4P11A 2IJHA 4GKKO 2CE4A 1A8EA 2V93A 3CC2V 1HNWO 4POWA 4Q30B 2O6AA 4NWCA 2I0CA 4LF6O 5C93A 3TK1A 2PCRA 2A5SA 4O7MA 4AILC 1HDJA 2XHBA 1S9TA 2WLIA 4X88A 4MLQA 4O3BA 2PUSA 1GKFA 2YIDA 3K1NA 1VQ8V 4R7CA 3K9SA 4O4HA 5FPOA 5H8SA 4AQYO 3N2KB 1B7ZA 2P3VA 4JVDA 3TPAA 2ANJA 3OTOB 1ROPA 1QUJA 5JJEB 3SJBC 1YCJA 4UABA 4PV1B 4GWSA 2H8PC 2BOBC 1FPBA 5ICQA 1SQFA 3QVNA 4PAFA 3W7TA 2OYQA 1UIVA 1NKXA 4GF8A 4XKRA 2V3QA 4RWUA 4K8ZA 1NKDA 4WFHA 1E79G 4R8CA 2YS8A 4DV7O 5JQGA 2CDYA 3G80A 4MTGA 3UORA 1VQMV 4O4LA 2ARHA 4I50A 1I5XA 3IB0A 4E0XA 1JJOA 4WBNA 2PT1A 4N17A 4QPKA 3JAMN 5FNVB 1FPEA 1QLEB 2YJPA 1K34A 2DE3A 2FB5A 4CH5A 4HCYA 5LOVB 2HLDG 2E5LB 5JH7B 1XREA 3CCMV 1FBHA 1K4DC 2AZ2A 3MVWA 3ZMTA 4OZ9A 4XKPA 4BR6A 1FYJA 2ZE8A 3T4DA 1EZOA 4Q20A 4OPHA 5JJJB 4WXJA 3N6TA 2F7CA 2I3WA 1HSEA 3CG3A 4FE8A 4RUFA 4GIZA 2EINC 1LAHE 3E35A 1SW5A 1SZTA 3OMBA 3U65A 1JPXA 3OSQA 2PF4E 3G3IA 1SPIA 2IW5A 3JD0A 3QYTA 5DYHA 4O2BB 1R6TA 1K7DA 1YIJV 3Q4HA 4RO2A 2Q9LA 5CA1B 5EHMA 3ZMZA 1TUBA 4Z1MG 4GX5A 2E1SA 1E1RG 1IXIA 2ZM6B 1GM7A 2GUZA 4EXLA 1WODA 2FMLA 1PNMA 2Q8VA 3A0HZ 4F3BA 1EZPA 3ABMB 1BP5A 3OR6C 4I0XA 1EZ9A 4H6DA 3MP8A 3T96B 2Q6AA 1JJ2U 3PJSK 3TUSA 5CMUA 1G8MA 3CSGA 2GDSA 5KDTB 4DDDA 2VQFO 2VPNA 3GBAA 1GV8A 2P22C 5IYBO 1O9GA 4U3FH 4I7ZB 2GTAA 2L35A 2D3OW 1UJWB 1FW0A 1URSA 3JYCA 4UCTA 3RYIA 4G8MA 2F78A 1WPBA 1MSWD 4JAAA 4CS4A 3QXMA 1MH3A 5I3SA 1I08A 2VD2A 4H5GA 1BQZA 1LFGA 1INPA 4MW3A 1BKAA 1JR9A 1FBPA 3TCHA 2XT9A 3GLBA 1XILA 2O1LA 1OCZB 1FXHA 2JGDA 5LL6Y 3C34A 1NH8A 5EIBC 5H8FB 1OJHA 2JS3A 3SYCA 4PA3A 1AJQA 2BTQB 3CFZA 5FL7G 1YTFB 4B3MB 1DLBA 4WKMA 1QQCA 1CPYA 2XXIA 3L71H 5ET5A 4JYAB 3O2AA 3ABKB 2DOJA 5BMVB 1WB7A 4I9QA 1K9YA 1DGSA 5LTCA 3K6VA 4N23A 5I2NB 4ZI7B 3MD0A 2XXRA 3OO8A 3ZMUA 1PP9H 4KCCA 4N8YA 3M8UA 4ZZAA 2OT5A 3JARA 4MX6A 4X20B 4X1KB 4FORA 3BABA 1F23A 1ZLZA 4D6TH 4YB6A 5ET6A 2QFLA 4M1VA 1THZA 1N33O 1M5IA 3GZGA 4ND9A 3C35A 3SEWA 1VF7A 3KN3A 2LQTA 3PMWA 3A29A 2IA4A 3HKDB 3PV0E 3L6HA 5EQ9A 4QFKA 4UCOA 5B7DA 4DR4O 4R72A 4DR6B 2JJ1G 2F43G 4QSDA 5D5PA 4BWAA 3O9OA 3I56V 4LFBO 2PBWA 1ZX3A 2XNDG 3LSXA 4TV8B 3K0DA 4PFYA 2ZE7A 1QKBA 4OETA 3FVOA 4HNAB 1N3WA 2LO1A 1MPCA 5KA5A 2F8DA 5KHGA 4TV9B 1ZJLA 4P3LA 5L3DA 3JASA 2OWZA 1VQNV 1P99A 3RYHB 1FQAA 5AE4A 5I56B 2ZR3A 1NTMH 1NI8A 3IB2A 4F6RB 1FS0G 1B7HA 1FFXB 3STLC 2ZNJA 4UCSA 4J9YB 4NVPA 4NB5A 1AJPA 4J10A 5IYZB 1SQPH 3DLNA 3L6GA 3FATA 4NF6A 2I4BA 1GN6A 1NH2B 1DPPA 2THIA 3JD4A 2YXHA 1RSOB 1Z2GA 3RYCB 3OTOO 3CCJV 3LV0A 4N15A 1WLEA 4JASA 4JXIA 1M90W 4HS7A 4LUBA 2XAGA 1Q86W 4FPPA 2ZZWA 2UVHA 3QSLA 4NXNB 4UACA 3CWBH 2WX9A 3KFMA 4F6EA 5KHKA 4JI8O 1LSTA 2ABHA 2PFZA 4QBAA 2RJZA 1YTFD 5J16A 5K1PA 3ZIAG 4PF6A 3VBBA 1H43A 1YJ9V 1AH5A 3MW0A 5EC2C 1B40A 2DXRA 4IHJB 4G27B 1GK9A 1ZWIC 2E5LO 1Y74A 1K33A 1OLAA 2DQVA 3JV9A 2ZXWC 1WJZA 2OCHA 3CCLV 2Y5KA 1BLFA 1URDA 4H1XA 3OD7A 4OFOA 4PJ0Z 1F4NA 4U22A 4E4EA 1LLSA 1MY2A 4IR8A 1EZVH 4WF9V 2P06A 4TUYB 1D3KA 1B5HA 4N6PA 3I6VA 5KAIZ 3UO2A 1M56B 1BE3H 1FBFA 4JWYA 3RNNA 4KFQA 2HAUA 4HXVA 2ZZXA 3I3VA 4JI5B 3S4UA 2UXCO 1N34O 4GVOA 1K8AW 3ZS8C 3FYEB 2XHDA 4DV4O 4OQOA 2XAHA 3SYPA 2EX3A 5DEDA 4UVBA 1WP8A 3CC7V 3K00A 2OIGA 4EQBA 3Q26A 4XXUA 3U1OA 4X62O 4KP4A 2OCUA 4FATA 1NQTA 1Q90D 3TYHA 1N0TA 4DR2O 4X8RA 2DYXA 4MW8A 3W9VA 3B8MA 1LB9A 2KQZA 1ZL8A 4IYHA 4B7EA 1XC1A 2KKWA 4LH6A 5IT9N 3I5OA 3N94A 1Q6HA 5DVJA 4DXBA 1JP4A 4YKIA 5H8QB 5ET7A 4GX6A 2XOKG 4B3RB 1M5DA 3ZRWA 3ECRA 4U3JA 1MDQA 5KCJB 4R2FA 4H45A 4MVOA 4HYOA 3ZJZA 4OVRA 3ZRSA 5B1AC 4N21A 3ZN1A 3JD1A 5B1AB 3H01A 4GWYA 2UXDB 4JZGA 1ATGA 4FLYA 2EZPA 5LP6A 2PYLA 5DT6A 2AL5A 4K3AA 2V3TA 3HHGA 2NXOA 5EQAA 4QIWF 4QFPA 3C9HA 2A5TA 1JX9A 1EH3A 1NV2A 2I58A 5AA4A 4JI1O 2RC9A 5L3BA 4B3MO 3S9EA 1W2BU 4JI2B 5GTIZ 4GKJB 2GHAA 3OUFA 1YTVA 5DVIA 3UM7A 1B3LA 4XKNA 5JJNB 3CXCU 1B6HA 2BTOA 1BHBA 2XXXA 4ZE9A 1UIUA 1IBLB 1SQVH 3H1LH 2GV9A 1W59A 2VS0A 3OD4A 1BHAA 3LUTB 3SESA 1XQ8A 4J11A 1VDWA 2HPGA 1VQ9V 2P0SA 1M5FA 3KCYA 4ZDMA 5CM6A 1AOVA 3L70H 4PI2A 5I7IA 1USYE 4RQFA 5H5NA 3CCUV 3PUWE 4F29A 4GWZA 4I1DA 3WAFA 1N36O 1NBMG 1AR4A 2KB1A 5AG2A 2VQEO 2XXYA 4NKGB 3RYFA 1N76A 1SW4A 3DP4A 5L9MA 3B77A 3ETQA 4JI0B 3JATA 4OESA 4OVSA 1MQJA 4PDHA 2VPOA 3T1CA 1UFIA 2ZYOA 1SQYA 2FL4A 2RN9A 4OHNA 3UK4A 3MC2A 2KR0A 4AQ4A 3LSWA 4PTKA 3K5OA 4MS2A 1LFHA 2W0FC 3B2EE 4MJOA 1U97A 3CCSV 1NNKA 1R3JC 3VV5A 1XMOB 3PTYA 1W0KG 1JNFA 4OVPA 5CBSA 1V54C 4YJ3B 3I55V 1SBPA 2E3CA 4TT3G 2HZKA 2ZNTA 3AEIA 2F97A 1LBBA 5FHMA 4LZ8A 4DO2A 1KA1A 5L3FA 4DR7B 1JETA 3CB2A 3DM0A 4Z7EA 2XXQA 3VLUA 2RC8A 3KJTA 4QXDA 3SEYA 3BPZA 3HKBB 1ZKBA 2PTMA 2N74A 1SDXA 3GYYA 5LP6C 5F24A 1KC8W 1AI7A 1XMQB 4NF5B 4U23A 4CBCA 1K9MW 3AG1C 5DW8A 2IU3A 2DXYA 1F9BA 2EBOA 2I4CA 4PFIA 3TCUA 1QW0A 2WBBA 5LGNA 4IL6Z 1IMBA 3OMAB 2GSMB 3C36A 5CC2A 4GRKA 3CCRV 1GRJA 4N4UA 4MFIA 4J42A 4H33A 2YICA 4XTCQ 4OPAA 5A5XA 4YHHB 1XHXA 1B9JA 3R6UA 3TKDA 2DWJA 1LBYA 1Y3QA 4LZ5A 1HSLA 2XWVA 3AG2B 4JWOA 2B65A 5GONB 3KKYA 4DUZB 4IGRA 4F1UA 3FAVA 1VIBA 3IR1A 2QJEA 4BDQA 2ZT9B 4JI5O 3P3NA 1ORQC 1TUEB 3JAKB 3FVGA 4MMPA 4FMTA 5BXZA 1M57B 3CRAA 3T22A 1R9QA 5BZBA 3PGFA 1K3EA 1TGOA 2D2CB 3OELA 2CEXA 5KMGB 5LMUB 2KG7A 4FVMA 4GZRB 5LDZA 3ASOC 1F51A 4PBHA 4GBVA 3T4ZA 1PNLA 1FBDA 3C3TA 3ZHQA 2B3BA 5BR8O 1KQSU 4RK2A 4GKKB 3CX5F 1WA8B 3N6UA 5LHHA 1IVSA 3ZX6A 5JWPA 3RBZA 4MEVA 4I9WA 3HPIA 2DOSA 1HNWB 3ZKKA 4MTXA 5HM4B 4LF6B 1QULA 1B58A 4PI0A 1DF4A 3SPCA 1FBCA 4I8CA 2Y7KA 4MNIA 4I3YA 4HW8A 3ZEDA 1SQGA 5FLXN 3M7MX 2XD2A 4PFTA 4RYAA 5ESYA 4AQYB 1JEUA 2Y69C 1B52A 1WN7A 4DUYO 1BGYH 2DQ3A 4C7UA 4EB6B 2QS2A 5JCOA 3F11A 1FCKA 3L73H 5EBLC 2QWOB 1L8DA 3NOHA 1P7BA 1BTJA 3O9PA 2P90A 2EJ7A 3E3KA 3H3GA 1YITV 3LUYA 2QKSA 2RC7A 2UU9O 3KBRA 5L9OA 4DV7B 3VXCA 3S9NC 1POY1 1QUKA 1KMIZ 1I94O 3CJHA 3GWKC 1Q5OA 2DWEC 5LXTB 4MTFA 2QDOA 3L74H 2OZZA 3T9HB 3UGWA 1SC5B 3TMGA 3MZBA 1Q81W 1XT8A 2HAVA 4LFAO 5EYHA 2GH9A 2PGGA 1FTMA 4DRXA 1RYXA 1GO3F 1EZJA 1ZBMA 3G3FA 5LYJA 4RUEA 2VGQA 1B3GA 3UIFA 3RUMA 1K4CC 3A0BZ 3K01A 3QUJA 1GN2A 4O3AA 1V55C 3APQA 1RDYA 3W7XA 1RKMA 3ZRVA 3QF7A 4HE0A 3ZMSA 2PY5A 4JDFA 3PPRA 5CA0B 5H8NA 5CI5A 3V83A 3THOA 4RPOA 2XD3A 1QR8A 4QPJA 1EBOA 2CH7B 4ZEBA 3FKSG 4DV2B 1N0JA 4BW5A 3ETEA 4G8NA 1BQ0A 1Y9UA 4G2KA 4FFKA 4BAYA 4GQOA 1II5A 1WP7A 1YEWA 3FB6C 3CVGA 2OJTA 3E8HA 1OCRB 4BIUA 4DIGA 3PN1A 4LN5A 4DR7O 1B06A 1MOFA 3K57A 1G0IA 1XVYA 4PC9A 3N2KA 5M2VA 5B1OA 3IK6B 1JCHA 2DW4A 1G0HA 4QE7A 1MQGA 4NN3A 2EIMC 1H8EG 4PE5B 1IMCA 4DZ1A 1DF5A 5E79Z 4F22A 3TTNA 4ASUG 4ZEIA 2FTKA 1L5TA 4RY1A 4F18A 3VQWA 4A5UB 1B2HA 3IOUA 2UXBO 3E78A 4NXMO 2P6JA 4JF3A 3CG1A 2A9HA 1XMQO 2OX3A 1EM1A 1E1QG 2IM9A 3F5TA 1FTKA 2WLMA 1WPXA 1BCCH 3E22B 1EU8A 3RQTA 1SI1A 1D5NA 4IO4A 4J80A 3GVMA 5FNVA 4DV0B 1DMBA 5ITPA 1KKCA 4DXCA 2RCAA 5LOVA 3D3QA 5JH7A 4JAUA 1VF5B 1DCUA 4PDVA 1K97A 4WFAV 4YHHO 3IC9A 4FZ1A 3VVDA 2CK3G 2AZ0A 3R7XA 1Y4CA 3RPWA 4PD4F 4K35A 2ZXTA 3USDA 1LBXA 2Q68A 2ZCEA 3W7WA 2UVIA 4DUZO 4HZ3A 1N33B 3CE2A 5AA2A 4N81A 2B1GA 1FJGB 4KQPA 4O2BA 1OQGA 4AHCA 2EIKC 2I48A 1P49A 3QIMA 4H8IA 5CA1A 3AG4C 2Q4PA 4DR4B 4GBWA 1ZTEA 2O1MA 1AILA 1RFYA 2JJ2G 1VQPV 2N05A 4Z1VA 3JALB 5IJ9B 4LFBB 2H25A 4QNHB 1Z7ME 3O97A 4AB5A 1GH6A 1OCOB 4MLVA 2ESNA 3ZBHA 4QSEA 3K4UA 3P3PA 2ZNIA 1BL8A 3MAQA 1B3EA 1LCTA 4NEDA 3RT6B 5F2VO 3CC4V 3BAAA 5LHIA 4TQFA 3TTRA 3IAYA 4EF1A 3X2QB 4LP8A 5L3CA 2REGA 2G29A 2DSFA 1Z5VA 1R1NA 4KUMA 2A0LA 2E75B 1YJWV 4MH5A 5K1XA 3CI8A 4U4SA 2Y0PA 3HKCB 4MNPA 1B32A 1NV4A 3BEHA 3J80N 1AIVA 3UA8A 3EHSA 5H8FA 1XUQA 2L6LA 2QM8A 2BTQA 3DTUB 4P9OA 3Q29A 3RGYA 2VHAA 1YDXA 1ZMGA 1JFFB 4HBNA 3Q25A 1TAEA 1PB8A 1Q6UA 2EILB 3S2VA 2DDKA 5BMVA 4JI8B 1NV0A 3G71V 1A8FA 3FJMA 5H6QA 1OQHA 1J1NA 1Y67A 5LBQA 4ZI7A 1QLEC 2VD3A 3KGCA 3SEVA 5I2NA 2QA4V 3BA8A 1LCFA 1NV7A 4X20A 4X1KA 1YXIA 1R3LC 1UTHB 4PGPA 5H8HB 1D9VA 4NTYA 4FM2A 2DE2A 5ELVA 1VR5A 3G3KA 2F5XA 2MK3A 1TVKB 4F3PA 1PPJH 4ESXA 1NUYA 4YAHX 5I56A 4X48A 3HKDA 1NUZA 3OAAG 4G4PA 3IFAA 1FXVA 4MVMA 3CMEV 1O7TA 3FVNA 2RF1A 5TP9B 5I59A 4I62A 1SW1A 3CEIA 1NS1A 4KXRA 5H9CA 1Q9DA 1IQ7A 4MHFA 2CTQA 2HHHO 4TV8A 5CB4B 4ISUA 1UQWA 2UXCB 3B4SA 1N34B 4OXVA 3C33A 1UTBB 4NF4B 4ZOLB 4HNAA 1U96A 3JSLA 4DV4B 1LAXA 4NX1A 2DWDC 4TV9A 4LF5O 4ELOA 5TU0A 1VQ4V 2EULA 4DV2O 1DOTA 3FGSA 2QSAA 1NT2B 3RYHA 4BIZA 4X62B 1EYKA 3IO6A 3N26A 2ZINA 4FLZA 2BE3A 5FHNA 2NLJC 3ABMC 4F6RA 5DN6G 1FFXA 1NR7A 4DR2B 1XNQO 1RPRA 2XWKA 4KYSA 2DP8A 1XI1A 2REJA 3K0VA 4LWSB 4O4IB 3BIHA 5IZ1A 2VP1A 4IO2A 5IWAB 4W4KA 3MAMA 4GL0A 4LQ2A 1B7UA 4TLMB 3RYCA 1RSOA 4LC1A 3H7MA 1NL5A 2ILMA 1FQFA 1FTAA 1O64A 1MZFA 5CMBA 1PD3A 1R6NA 4CS2A 4I55B 4MTOA 5L3GA 4Z0IA 1CE2A 2OCCC 1B0HA 1O63A 2UXAA 1G4YB 1OCZC 1YSCA 2OCCB 4G61A 4PQJA 2O7UA 1NZ6A 3U93A 2IU0A 1M1KW 3O66A 4MIJA 3ASNB 1BIYA 2HHMA 2Q7HA 4JI1B 2Z5UA 1A55A 1MXYA 5EC1C 4LF4O 1NUXA 1QCEA 1YF2A 2NR5A 4DV0O 3UP9A 3KEIA 1H76A 1AI6A 3FB5C 2P3NA 2CMOA 4IHJA 3VFJA 3ABKC 4RPNA 4UXNA 4GD5A 3WAEA 3B6QA 3LC8A 5I58B 4J7ZA 4N6KA 4ZEDA 3CS5A 4XKQA 2RCBA 4I4TB 4X89A 2UVJA 2YDEA 4TUYA 2HFEC 2JS5A 1B0LA 1QNMA 4OVJA 3F5WC 4CH4A 5ITZB 1FJGO 3I5DA 3LSQA 2BCCH 2LJ2A 2A79B 4YIOA 3IOTA 4OENA 1PNKA 4R6YA 4YJ2B 1N36B 2VQEB 1IBMO 2FIXA 4M4GA 3EFFK 2YUAA 1Q8IA 4KHPO 4Q0CA 4GLXA 2DVZA 1AROP 4MAGA 4GX4A 4IO3A 4WEPA 3FBPA 2BJJX 2D21A 2WEFA 1NMUA 4N91A 4CZZA 3CHGA 2UUAO 3G3HA 4X04A 5CBRA 3T1HO 2HVJC 1JQFA 1LUVA 2ATKC 1HR0B 1FPLA 1H2GA 4JPRA 3E79A 4KYDA 3U11A 5B66Z 3W7UA 3K2DA 5KCJA 4LH7A 4FLXA 2DWAA 1OVBA 2UYFA 1XHZA 5I57B 1YZBA 2KQXA 2F66C 1SYHA 3HKEB 4I40A 4Q6GA 2PVUA 4OTEA 3OO6A 4R6KA 4U1OA 2G93A 3MHSC 3CMAV 3MYUA 4NE4A 2LW1A 2O69A 3B6WA 4OEVA 3K5NA 3RPLB 1SI0A 4P9PA 3ISPA 2OWOA 3M8AA 1ZSPA 3TODA 2XTAA 2WPDG 3EHUA 3E8GA 1JVXA 2RQ6A 4H8JA 4DE8A 2Y7RA 3BBRA 2V25A 4XBFA 2CTPA 1NJIW 4CH6A 3B50A 5I2KB 4DR3O 2R9AA 3RYDA 3MP1A 1WVJA 3GXAA 4G8HA 1W0JG 3EPEA 2ZYNA 4UCUA 2Q0OC 5I5PA 5IYDO 4K3FA 1N0NA 2F34A 3PPNA 5EZYB 1GM8A 1N04A 4PDDA 4DXWA 2A3QA 5LA6B 1BSMA 4DI3D 3D1RA 2Q9TA 3QO8A 1B46A 2JRIA 1A32A 3ABTA 4KR5A 3LNMB 4MVUA 2Q8JA 1TT1A 1TFAA 1HNZO 3K9AA 2XXVA 3SYQA 5J2TB 4ZHQB 4GXAA 1FD9A 1M56C 3OM3B 3K02A 2M6YA 5EIBD 4F39A 4FLTA 2NWJA 3N27A 5GTHZ 5K2XA 2Z8DA 3RTFB 2UUBO 3KOSA 2GTSA 3D8CA 4UVCA 1WNSA 2ODMA 2DE0X 1SERA 5KUMA 3DP8A 2WLNA 2ADQB 2ZE6A 3G3GA 4K8XA 4FZ0A 1LB8A 1L0NH 2IJKA 1R73A 4YMBA 4MVRA 3E86A 2QS3A 5K2YA 5F7VA 2WAMA 1PL0A 4FFBB 4O4JB 1VE4A 1IXBA 4YJ3A 3E9XA 4P47A 4C0RA 1BK4A 4DLDA 3H1HH 1A40A 2GRVA 4R2BA 3P7IA 4ZECA 5BR8B 1FKAO 5IWAO 1QVSA 5L8DA 2AYSA 4IB2A 4X9QA 3IOVA 2HJDA 2HP8A 4G2ZA 4C1UA 2DE4A 2WKYA 3HKBA 4J7KA 2F6GA 3HPLC 3KC1A 1JA8A 3O6GA 1NTZH 5CBGA 1P1UA 4YY3B 1COWG 3T66A 3PMVA 3ZHUA 2LFRA 3LUZA 4LVQA 3ML0A 4OERA 1SS3A 2O7IA 1AWBA 2NUVA 4NF5A 1M93A 2G38A 2PFYA 1K73W 4DUYB 1X4TA 3DXRB 1F4MA 4GX0A 4EQ9A 1QJMA 2XAQA 2Q8MA 4BDOA 4L87A 1VQ7V 2YIBA 1MQDA 3RY3A 2UU9B 4O3CA 5L3EA 3H1KH 3OR7C 3MZ1A 3QTCA 4JGSA 3IORA 5EYFA 3KZGA 3ZHVA 4JAVA 3N2GA 1XI6A 5TISZ 2WWWA 4DV3O 2KLFA 4GOTA 2ZIMA 2EIJB 4JYBA 4QE9A 1I94B 3JD3A 3OXNA 1H38A 1DK1A 1Q43A 2R9RB 3JZJA 1SKVA 5GONA 3IC7A 1TXFA 1EN5A 4U4XA 4OA4A 1GN3A 3WB2A 3UT5A 4OX9O 4LQ5A 1H2NA 4LFAB 1A99A 4PELA 5B70A 3JAKA 5CA3A 4F4LA 3TJTA 1IX9A 1L0LH 2HKOA 1S0VA 3BY6A 3FV1A 2RKMA 3IB1A 4FECA 1MNGA 1R6KA 2NNUA 4EFBA 5KMGA 1XBLA 1JVYA 3OEEG 4G68B 4KCDA 4ZEKA 1EFRG 3H6WA 5F1QA 1ZLQA 3PPQA 2DS9A 4MNCA 3OGCC 3JAWB 4N8GA 1FFTB 1N7XA 1TA8A 1Y76B 4QJFB 2IJJA 1WA8A 3WG7B 1HR0O 2Q0AA 1MY3A 4JTDB 5EBMC 3CD6V 3H6VA 4NWDA 1SESA 3WFVA 1ZIUA 4X1BA 5B1NA 4L17A 1EN6A 1XOCA 4ZIBA 1NV3A 3VOUA 1JW1A 2O68A 4IO6A 4JYYA 2XUMA 1N84A 4P9KA 3N5LA 4QF9A 3U72A 4AS5A 2UXNA 3VDFA 3C90A 4OFJA 5B1BC 3K1MA 5J1DA 1XL4A 3KSJA 5E1AC 3HR0A 4EB6A 2PYJA 5B1BB 1GMGA 1Q7YW 2ZR2A 4WCEV 1SQQH 2F7AA 2XX9A 1IXHA 1MQHA 3KCXA 1QVFU 3AG3B 1NFTA 3FJ7A 4KXPA 2QGNA 1VF6C 2UXBB 5KA6A 4NXMB 1CP9A 1MMMA 2QWNB 4FK5C 2H94A 4ZE8A 4JI6B 1YYZA 4YIPA 3MPKA 1AMFA 2DYSB 1H44A 3K58A 2WLHA 4R73A 3FX7A 4P0IA 2Z8FA 2GHBA 5KUKA 4FJCC 3RN8A 5LXTA 4FEBA 5ICTA 1K9ZA 4PAIA 1SF9A 4H13B 3FUZA 2ZQMA 2V3UA 4X8AA 1AI4A 4U7NA 3M99B 1P7GA 3OO7A 4RXLA 4NR1A 5C8YB 3T1YO 2FA7A 2DWHA 3FXQA 4PE3A 3AG2C 3MSTA 1IITA 3RWRD 1B51A 1LR1A 2W0XA 3APOA 3NXSA 4H0LB 3ZHRA 2YPNA 4Q5TA 1IIWA 4Q8RA 3QMFA 4PBQA 3BRCA 2Q5ZA 1D4NA 2XXHA 2H4IA 3SZPA 1LBZA 2B1IA 3SJAC 2XAJA 3U8QA 4X66B 1AVMA 2LW7A 1NTKH 5HFMA 2WYKA 2ZNUA 5L9SA 3T9VA 1M57C 3OFNG 5CA0A 1FJ9A 4B3SB 3VQXA 3ZHTA 1YAEA 1I6AA 4UCRA 3T1BA 2CH7A 4F1YA 4X64O 4YMAA 1VARA 1I6QA 2ZYMA 3E8FA 1FPKA 1US5A 2F93B 3CCQV 1ZU0A 3C32A 2FHYA 1KZ8A 4KPTA
chains in the Genus database with same CATH topology
2QE7G 3SDFA 2JDIG 1MDP1 4FAJA 3KJ7A 2H5YA 4XDLA 3LDEA 3SYOA 2EJRA 2YEVB 1S3JA 4I9DA 3ZMVA 4LONB 3A0RA 1IUDA 4F1VA 2QSXA 5DEXB 3K06A 2W7YA 3ABLB 4EF2A 2QTOA 3ILTB 2M7WA 1NR1A 3GB7C 5FHOA 3KG2A 5LGUA 3FJGA 1RM1B 3IOWA 1USYH 3PPPA 5B3SB 4JTAB 3HN0A 4IGTA 4F19A 1J95A 4POXA 4YU0A 3EHTA 3PU5A 1B3FA 2OWTA 3E2EA 2HCAA 3O28A 4YKKA 4F31B 3MBPA 3K0GA 3K04A 2HJFC 4PDLA 1Y4MA 1S7YA 2R71A 2OK2A 3S9MC 1IXGA 2F6PA 1XS5A 5FTIA 3U92A 3TTLA 4QFOA 5CBFA 1VQKV 2AHZA 3F7YC 2I49A 3E13X 3R65A 5A5XB 2OTLV 4IY6A 2GFEA 5IDJA 3TTKA 1MH4A 1AJNA 2OTJV 2Y48A 1QVGU 4OYVA 1OCRC 2H99A 3O6HA 3CIJA 3ABUA 2PX1A 1M5EA 4KYEA 1QUIA 2WLKA 3F7VC 4E0WA 5EK0A 1FQBA 2JK5C 3TETA 4LCUC 1S77D 3CPWU 3MUQA 1OCCB 1GTOA 1JW5A 5IKBA 3IX1A 3SPIA 3K08A 2K1EA 4UA8A 1IEJA 1SD3A 3FV2A 5HFLA 3TTMA 4DCYA 4KFMA 3TAJA 1QLNA 1RPOA 2XASA 3SEUA 1T0KA 1UTHA 3TEPA 5H8HA 1PC3A 4TQUQ 1FXKB 4R9FA 2F35A 1XVXA 5TP9A 2DYRB 3V89B 2AIXA 2FYIA 1I6BA 3VE1B 1SETA 2V84A 4OMBA 3TZAA 4JSOA 1IZ1A 3SYAA 2P67A 1UTBA 4NF4A 4F3GA 3K3WA 1S72V 4RQEA 4PDMA 1YPNA 1OCOC 2ZD9A 4F3SA 3KOTA 3MQ9A 4IO5A 4KHZE 4F2OA 5JTYB 4NF8B 3A3UA 2ZDIA 5KDTA 3LR1A 5I84A 3C4MA 3X2QC 3UKMA 3M3FA 3W15C 1B3HA 1PDAA 3D36A 2IJIA 1OLCA 2Z8EA 1TFDA 3H6TA 4TLLB 3MHHC 3T9UA 2X7QA 5H8NB 1NVPD 2LP7A 5TPAB 4J9ZB 4P2ZA 1K5SA 1DSNA 2DVCA 5ISUA 4EXKA 2EILC 2WLLB 4YB7A 3U94A 5IY5C 5AA1A 5I58A 1TWYA 5IY5B 4R9GA 1P1QA 2OWSA 1LAGE 3CR9A 2AL4A 1A54A 2H98A 4FJPA 1VQ6V 4RK9A 3D4CA 3GBBA 4AB6A 3P32A 4ESWA 2F7BA 1B1XA 1GGGA 2X6AA 4ECFA 4BDLA 3FB8C 4R74A 2P2AA 3CFXA 4R6ZA 3JD2A 1MQIA 3K1PA 4RJZA 1OMPA 4KI0E 1Y66A 3OUSA 4U7OA 1ZTYA 2JIZG 5KZTA 5EHSA 2I3VA 3IGAC 3OW2U 4GCZA 3CRBA 4WFEA 4P0GA 3VVEA 1D9YA 2QPQA 3SERA 4LP2B 4ELRA 4C1TA 1Q1KA 3IJXB 4N07A 3K03A 3TDJA 5I57A 2EINB 5AA2B 3IL1B 3HHFA 3TQWA 3RVYA 4GFRA 2ZDIC 4ZS9A 2W6JG 3ZRXA 5BWJA 4ZBMA 3V5AA 1GR2A 5EBWC 3SPGA 2HQ0A 3A3CA 4NMYA 2XAFA 3ODBA 2QMXA 5CMKA 5I2KA 1DTOA 5LGTA 2ZNSA 3ASNC 1LAFE 5CRYA 2ONKE 4MVZA 1LBCA 3KSXA 3PUXE 2CZLA 3HCQA 4IO7A 3K6UA 2WLIB 1NNTA 3SETA 1URGA 3LSSA 4EUOA 2C2AA 5HPQA 1IXCA 2R9JA 1N8RW 1GM9A 4BLAA 3LDDA 4GT1A 1JEVA 2V7QG 2HFBA 4FIPC 1GVCA 1DTZA 3KN8A 1MY1A 3JYRA 1JOYA 4U2RA 2X6CA 3FVKA 4GL8A 1Z7NE 3QO7A 4MSWC 1P1NA 1VFDA 2R9IA 5H8QA 2W6IG 1LGBC 3SPHA 1KWHA 4GWOA 5AA2D 5I59B 1IXMA 1SRYA 3CYOA 1M5BA 3O6IA 3TFLA 4EKWA 2NOOA 3EN3A 1VQ5V 2QM7A 4WFBV 3QO5A 1B5JA 2QS4A 3C31A 1MRPA 1K92A 1Y1MA 2UXXA 3E83A 4PFWA 4JTCB 3ONMA 1XL6A 5JK4A 1HWYA 2P7TC 4WFFA 1MS7A 1S76D 1MM7A 4PP0A 1KECA 4H65A 4JSDA 5CMCA 3MP6A 4P30A 3E4RA 3Q28A 3EF7A 3Q27A 2OLBA 3M3LA 1RYOA 3FXUA 4GLIA 4RAIA 3MJNA 2RINA 4KD5A 4MVQA 1YHQV 4F2QA 4EDPA 4YZZA 3W7SA 1FTLA 4YKJA 3B6TA 3OMIB 4X9TA 2DWIA 2LFSA 3HB3B 4PA4A 3SPJA 2Q69A 3B8NA 1FTOA 2D3IA 1OIBA 3TCFA 3QAXA 4G68A 4PA6A 3P30A 5H6RA 4YXWG 4R6HA 4E2LA 4LA9A 2DQ0A 1Y3PA 2QS1A 3AXFA 3MPLA 2ZXWB 1R9LA 1VQOV 3PUZE 2R6GE 3TQLA 3G6EV 3B7DA 3ETGA 3MZ9A 1CEZA 1PBPA 4PA7A 4PA9A 5CN0A 3LSFB 3VVFA 2X26A 4XIGQ 4UUJC 1NNPA 4ZKIA 2Y7IA 1VFEA 2X6BA 3OOAA 3MVXA 1I69A 3D3IA 1NH7A 3ZKLA 3MVZA 3H03A 2ONSA 2O84X 2XXTA 1OZ0A 3T9XB 3OEKA 4FEDA 2UYEA 2ONRA 1AI5A 1N7WA 3OENA 3STZC 1YJNV 3SJQC 3DELB 3OO9A 1NH2D 4NF6B 3HV1A 3V8XB 1JQ0A 2EIJC 2NVUB 2IEEA 1MG1A 1HSJA 1FQCA 4G28B 4MBPA 2E0SA 3S9LC 4HTGA 3RTWB 2EZOA 1Q35A 1QBZA 3A09A 4N13A 1QR9A 5IYCO 1Y20A 4QSCA 3FD3A 2JEUA 3K6WA 1R6ZA 4G68C 3QNEA 4JWXA 2P1SA 5CBHA 2HZLA 3HSTA 2YLNA 1MXWA 3W9WA 1N3XA 3SKPA 3O29A 1SYIA 3DP6A 1M9NA 1L1FA 1NNFA 3WG7C 1KD1W 3R26A 3CCVV 2YEVA 4GX2A 4GX1A 1PBQA 3T93B 4UV8A 2XXUA 4ELPA 1S50A 4NTLA 4WEDA 3THIA 2UVGA 5LOMA 5DEXA 1MM6A 2Y84A 1B6QA 1DPEA 1KP2A 4X1DA 3AG3C 1B4ZA 4PDRA 1OVTA 3BKIB 5JEIA 3E8BA 1B4HA 5AA3A 2QMWA 4OFLA 2XXPA 1V54B 2WLJA 4TSFG 1MXZA 2DYSC 3G3JA 2ITDC 3FASA 1VSOA 3VXBA 3ZRWB 2PI4A 3ILUB 1POTA 4YB5A 3RT8A 3HO7A 3BFUA 3BFTA 4H67A 1Q82W 3GWOA 2Q2AA 4ZEFA 4QFLA 3FXRA 3RW0A 2M8CA 3AG1B 2A5TB 5HBCA 1XHYA 5AA4B 2QL3A 1QKAA 2JEXA 2LAOA 3MVYA 3JCZA 4DXUA 1WDNA 4FIMA 3RVZA 4R75A 3PD8A 4OWDA 2Q67A 3T2MA 2QRYA 4UV9A 4R50A 1MABG 4JYCA 3K79A 3FZVA 4MVSA 3ZS6A 4EQ7A 1SW2A 2D5WA 1PB7A 2HXWA 2VOZA 5IAIA 3M3KA 1H45A 1H3DA 1Y4TA 1PEBA 2WSSG 1PKXA 2Y7PA 1K5QA 3UN6A 4ONYA 3LSLA 3ZN0A 3QK6A 1FTJA 3KN7A 2GHYA 1BMFG 4IY5A 3ASOB 4BDRA 3OMNB 2PMSA 4I5SA 3ABLC 2FNCA 1ELJA 4H0WA 2IH3C 2O51A 4ZZEA 3FB7C 1RM1C 1B1HA 5B3SC 4MF3A 1OHHG 2Z22A 3ZSFA 1SVXB 3E89A 4BDNA 1KP3A 3EHBB 2HVKC 1FXKA 3LDCA 5DTBA 3CSBA 1KKDA 3CFLA 3PPOA 3G7WA 2ITCC 5LHGA 2Y69B 3CCEV 3QUFA 2X7PA 3IJOB 3IFXA 2IH1C 2I0BA 4YKPA 2HR3A 4XDKA 2Q89A 2Q88A 1MXVA 1ENVA 3VLVA 3H6UA 5GW7A 4BDMA 2Z3YA 1M5CA 1AL3A 5JTYA 3FIRA 4RNSA 4NF8A 4OXSA 3MWBA 4U21A 1JW4A 3H4ZA 1JVMA 3OEMA 3OSRA 4JBZA 5DVFA 2X7RB 3DGEA 4PETA 2PI5A 4YICA 1MXUA 4UVAA 4DCXA 1Y1ZA 1GTKA 1MPBA 4LZ7A 5ITOA 1V55B 2Z23A 2XX7A 1P4RA 2PT2A 2PYYA 3SEXA 4WFGA 2H9BA 5TPAA 3G4SV 1NVPB 2YSUB 2F36A 3ETDA 2HEUA 3PD9A 2ZYKA 1OCCC 3FYIB 2WLLA 2XX8A 1CB6A 2OBGA 2BOCC 2B3FA 4HCWA 1MPDA 1VQLV 2QEXV 2Y7WA 2ZMBA 4OEUA 5BUUA 2EIMB 3IAZA 5J9PC 1FXKC 4MT8A 3PUVE 4G77A 3PUYE 1P1OA 1I5YA 1P1WA 2HG5C 2B5UA 2DYRC 2V1DA 3VLWA 1ANFA 1FQDA 1R3IC 3D4GA 4GXSB 4QHQA 4THIA 4ELQA 1YI2V 4H37A 4HAMA 2XXWA 4QRZA 3RLFE 4PFUA 3TCGA 3CP1A 1LFIA 5FTHA 5DM6V 4TOZA 1B5IA 3LBSA 4RA1A 4H5FA 1LNQA 3EQ1A 1DTGA 1FQEA 1R3KC 1H8HG 4LATA 3IO4A 1MXXA 3OE7G 4U1ZA 3TELA 2EIKB 1S5HC 1A7LA 2Q2CA 3K6XA 3AG4B 5CMMA 3PMXA 1AR1B 4JB7A 1MY0A 2X0LA 1PB9A 4QFNA 4TWKA 3OEHG 3ZCCA 2ALUA 4LBEC 1US4A 1MY4A 1B05A 2I6EA 4XDJA 1Y3NA 3H06B 4P11A 2AHYA 2IJHA 1A8EA 2V93A 3CC2V 4POWA 4Q30B 2O6AA 4NWCA 2I0CA 5C93A 3TK1A 2A5SA 1S9TA 2WLIA 4X88A 4MLQA 4O3BA 1GKFA 3K1NA 1VQ8V 4R7CA 5H8SA 1B7ZA 3TPAA 2ANJA 1QUJA 1ROPA 1YCJA 2H8PC 2BOBC 5ICQA 3W7TA 1UIVA 1NKXA 4GF8A 4XKRA 2V3QA 1NKDA 4WFHA 1E79G 4R8CA 4MTGA 3UORA 1VQMV 1I5XA 3IB0A 4E0XA 2PT1A 4QPKA 1QLEB 2YJPA 1K34A 2DE3A 4HCYA 2HLDG 3CCMV 1K4DC 3MVWA 3ZMTA 4OZ9A 4XKPA 3T4DA 1EZOA 4Q20A 4WXJA 3N6TA 2F7CA 2I3WA 1HSEA 3CG3A 4FE8A 4RUFA 4GIZA 2EINC 1LAHE 3E35A 1SW5A 1SZTA 3OMBA 1JPXA 3OSQA 3G3IA 5DYHA 2IW5A 3JD0A 3QYTA 1K7DA 1YIJV 4RO2A 5EHMA 3ZMZA 4Z1MG 4GX5A 2E1SA 1E1RG 1IXIA 1GM7A 4EXLA 1WODA 1PNMA 4F3BA 1EZPA 3ABMB 1BP5A 3OR6C 1EZ9A 4H6DA 3MP8A 3T96B 2Q6AA 1JJ2U 3PJSK 3TUSA 5CMUA 1G8MA 3CSGA 5KDTB 4DDDA 3GBAA 1GV8A 5IYBO 2D3OW 1UJWB 1FW0A 1URSA 3JYCA 4G8MA 2F78A 1MSWD 3QXMA 1MH3A 2VD2A 4H5GA 1LFGA 4MW3A 1BKAA 3TCHA 3GLBA 2O1LA 1OCZB 1FXHA 3C34A 1NH8A 5H8FB 3SYCA 4PA3A 1AJQA 3CFZA 5FL7G 1YTFB 1DLBA 4WKMA 1CPYA 2XXIA 3O2AA 3ABKB 2DOJA 3K6VA 4N23A 5I2NB 3MD0A 2XXRA 3OO8A 3ZMUA 4KCCA 3M8UA 4ZZAA 2OT5A 4FORA 4YB6A 1F23A 4M1VA 1THZA 3GZGA 4ND9A 3C35A 3SEWA 3KN3A 3PMWA 2IA4A 3PV0E 3L6HA 4QFKA 5B7DA 4R72A 2JJ1G 2F43G 4QSDA 3I56V 2PBWA 2XNDG 3LSXA 3K0DA 4PFYA 1QKBA 4OETA 3FVOA 1N3WA 1MPCA 5KA5A 2F8DA 1ZJLA 5L3DA 1VQNV 1P99A 1FQAA 5AE4A 5I56B 2ZR3A 3IB2A 1FS0G 1B7HA 3STLC 4J9YB 1AJPA 3DLNA 3L6GA 4NF6A 3FATA 2I4BA 1NH2B 1DPPA 2THIA 3JD4A 3CCJV 1WLEA 4JASA 4JXIA 1M90W 4HS7A 4LUBA 2XAGA 1Q86W 4FPPA 2UVHA 3QSLA 4UACA 3KFMA 1LSTA 2ABHA 1YTFD 3ZIAG 3VBBA 1H43A 1YJ9V 1AH5A 3MW0A 5EC2C 1B40A 2DXRA 4G27B 1GK9A 1ZWIC 2DQVA 1OLAA 1K33A 3JV9A 2ZXWC 3CCLV 1BLFA 1URDA 4H1XA 3OD7A 4OFOA 1F4NA 4U22A 1LLSA 1MY2A 4WF9V 1D3KA 1B5HA 4N6PA 3I6VA 1M56B 4JWYA 3RNNA 4KFQA 2HAUA 3I3VA 3S4UA 4GVOA 1K8AW 3FYEB 2XHDA 4OQOA 2XAHA 3SYPA 3K00A 4EQBA 4UVBA 3CC7V 3Q26A 4XXUA 3U1OA 4KP4A 2OCUA 4FATA 1NQTA 3TYHA 1N0TA 2DYXA 4MW8A 3W9VA 3B8MA 1LB9A 1XC1A 3I5OA 3N94A 5DVJA 4DXBA 4YKIA 5H8QB 2XOKG 1M5DA 3ZRWA 3ECRA 1MDQA 5KCJB 4R2FA 4MVOA 4HYOA 3ZJZA 3ZRSA 5B1AC 4N21A 3ZN1A 3JD1A 5B1AB 3H01A 1ATGA 2EZPA 5DT6A 2AL5A 2V3TA 3HHGA 2NXOA 4QIWF 4QFPA 3C9HA 2A5TA 1JX9A 1EH3A 2I58A 5AA4A 2RC9A 5L3BA 3S9EA 1W2BU 2GHAA 3OUFA 1YTVA 5DVIA 3UM7A 1B3LA 4XKNA 3CXCU 1B6HA 1BHBA 4ZE9A 2XXXA 1UIUA 1BHAA 3LUTB 3SESA 1VQ9V 2P0SA 1M5FA 4ZDMA 5CM6A 1AOVA 1USYE 4RQFA 3CCUV 3PUWE 4F29A 4I1DA 3WAFA 1NBMG 2KB1A 2XXYA 1N76A 3DP4A 1SW4A 5L9MA 3B77A 4OESA 1MQJA 3T1CA 2ZYOA 1SQYA 4OHNA 3UK4A 3MC2A 4AQ4A 3LSWA 4MS2A 1LFHA 2W0FC 3CCSV 1NNKA 1R3JC 3VV5A 1W0KG 1JNFA 5CBSA 1V54C 3I55V 1SBPA 4TT3G 2ZNTA 2HZKA 3AEIA 2F97A 1LBBA 5FHMA 4LZ8A 4DO2A 5L3FA 1JETA 3DM0A 4Z7EA 2XXQA 3VLUA 2RC8A 3KJTA 3SEYA 1ZKBA 1SDXA 1KC8W 1AI7A 4NF5B 4U23A 4CBCA 1K9MW 3AG1C 2IU3A 2DXYA 1F9BA 2EBOA 2I4CA 3TCUA 1QW0A 5LGNA 3OMAB 2GSMB 3C36A 5CC2A 4GRKA 3CCRV 4MFIA 4H33A 4XTCQ 5A5XA 1B9JA 3R6UA 3TKDA 2DWJA 1Y3QA 4LZ5A 1HSLA 4JWOA 3AG2B 2B65A 4IGRA 4F1UA 3IR1A 2QJEA 4BDQA 3FVGA 1ORQC 1TUEB 4FMTA 1M57B 3T22A 1R9QA 5BZBA 3PGFA 1K3EA 3OELA 3ASOC 1F51A 3T4ZA 1PNLA 2B3BA 1KQSU 4RK2A 3N6UA 5LHHA 3RBZA 4I9WA 3HPIA 3ZKKA 4MTXA 5HM4B 1QULA 1B58A 1DF4A 3SPCA 4I8CA 2Y7KA 4HW8A 4RYAA 2XD2A 4PFTA 1JEUA 2Y69C 1B52A 2DQ3A 2QS2A 3F11A 1FCKA 5EBLC 3O9PA 1P7BA 1BTJA 2P90A 3E3KA 3H3GA 1YITV 3LUYA 2QKSA 2RC7A 3KBRA 5L9OA 3VXCA 3S9NC 1POY1 1QUKA 2DWEC 4MTFA 2OZZA 3T9HB 3UGWA 3TMGA 3MZBA 1Q81W 1XT8A 2HAVA 2GH9A 1FTMA 1RYXA 1GO3F 1EZJA 1ZBMA 3G3FA 4RUEA 2VGQA 1B3GA 3UIFA 3RUMA 1K4CC 3K01A 3QUJA 4O3AA 1V55C 3W7XA 1RKMA 3ZRVA 3ZMSA 4JDFA 3PPRA 5H8NA 5CI5A 3V83A 4RPOA 2XD3A 1QR8A 4QPJA 1EBOA 4ZEBA 3FKSG 4BW5A 3ETEA 4G8NA 1Y9UA 4G2KA 4BAYA 4GQOA 1II5A 3FB6C 3CVGA 2OJTA 3E8HA 1OCRB 4BIUA 4DIGA 1MOFA 1XVYA 5M2VA 5B1OA 3IK6B 1JCHA 2DW4A 4QE7A 1MQGA 2EIMC 1H8EG 4PE5B 4DZ1A 1DF5A 4F22A 3TTNA 4ASUG 4ZEIA 2FTKA 1L5TA 4RY1A 4F18A 1B2HA 3IOUA 2P6JA 4JF3A 3CG1A 2A9HA 1E1QG 1FTKA 2WLMA 1WPXA 1EU8A 3RQTA 1SI1A 4IO4A 1DMBA 5ITPA 4DXCA 2RCAA 4JAUA 4PDVA 1K97A 4WFAV 3VVDA 2CK3G 3R7XA 1Y4CA 3RPWA 2ZXTA 3USDA 2Q68A 3W7WA 2UVIA 4HZ3A 5AA2A 2B1GA 4KQPA 1OQGA 2EIKC 2I48A 3QIMA 4H8IA 3AG4C 2O1MA 2JJ2G 1VQPV 2H25A 4QNHB 1Z7ME 3O97A 4AB5A 1OCOB 4MLVA 2ESNA 4QSEA 3K4UA 1BL8A 1B3EA 1LCTA 4NEDA 3RT6B 3CC4V 5LHIA 3TTRA 4EF1A 3X2QB 4LP8A 5L3CA 2REGA 2G29A 2DSFA 1R1NA 4KUMA 2A0LA 1YJWV 4MH5A 3CI8A 4U4SA 1B32A 1AIVA 3BEHA