4LWSB

Esxa : esxb (semet) hetero-dimer from thermomonospora curvata
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
SPSVSDYTRANFGGLSEGEAQFSMTARALLDELTDLEGKLRAKLDRWDGDAQAAYWNYQKEWDAAAKDMQNVVAQLGVAIREAHDNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Substrates Control Multimerization and Activation of the Multi-Domain ATPase Motor of Type VII Secretion.
pubmed doi rcsb
source organism Thermomonospora curvata
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4lwsB00
3O9OA 4I0XB 2KG7B 2AZ0A 3HR0A 4LWSA 1WA8B 3GVMA 3FAVB 3TXQA 3ZBHA 4I0XA 2KG7A 3Q4HB 3FD9A 3TXSA 1WA8A 2AZ2A 2B9ZA 4GZRB 3OGIB 2VRZA 3FAVA 3G80A 4LWSB 3GWKC 2DE0X 3Q4HA 2VS0A 4ABMA
chains in the Genus database with same CATH superfamily
4TQDA 2JJ2G 4WFHA 1N34B 4WF9V 1VQPV 2LFSA 5KMGB 5CA1A 4YJ2A 3DC5A 1K34A 2DYSB 3CRAA 1KP2A 1RFYA 1N4CA 2RMKB 1RM1C 1TGOA 3ABMB 2PZSA 1K8AW 5IWAB 1O9HA 3JATA 3UT5B 2ZXWC 1I94B 1Z2GA 3KCYA 1GH6A 2GDSA 4U3JB 1WP7A 3ZCCA 3K3WA 1FYJA 1N33B 2ITDC 4GZRB 3OAAG 3RYCB 1XL6A 1YEWA 3HKCA 3HPLC 1N32O 1IVSA 3G67A 4BW5A 4LC1A 3ETDA 2PUSA 4O4JA 4XDLA 1ZUQA 4X65B 4DW0A 1X4TA 2IU0A 3ICXA 4OGQB 4QPJA 3K08A 4BAYA 3OEEG 3ASNC 2EIKB 2JVDA 5ITZA 1M56B 2YC0A 4J11A 1EFRG 4TUYA 2UXBB 1SQFA 2GSMB 3W7TA 1M90W 2MK3A 4X62B 3L72H 1MOFA 3MAQA 3H1LH 4FZ0A 2W0XA 2ZIOA 1S5HC 1VMGA 5GTHZ 2E74B 4UXNA 2EINB 3ASOC 3FAVA 3ZN0A 5EBLC 5FLXN 5LHGA 3WB2A 3LSQA 2QTOA 1WN7A 1DTOA 2XNDG 1THZA 3IAYA 2UU9O 2UXDO 1VQ4V 4FIPC 3SPHA 4KUMA 5K1PA 4PI2A 1I0HA 3IGAC 3D8CA 5JQGA 2DW4A 2VRZA 2ZIMA 1DK1A 5JJJB 1XOUA 1SQXH 1S76D 2P5OA 3TETA 4B3TB 5BMVB 2X6BA 3CCQV 3F7VC 4L87A 3SJAC 3OMIB 4LFCO 1Q90D 2YXHA 4X66O 1SF9A 3A0BZ 1IDSA 4DV5O 1W0KG 4N21A 1JX9A 1XNQO 4O4HA 2HHHB 1NJIW 1R6NA 4AHCA 3EFFK 1PD3A 2L6LA 4FZ1A 1SKVA 3B2EE 3J81N 5EK0A 3B8MA 4AI8A 4FFKA 1Q82W 3ABLC 1B6QA 2OTJV 5LA6A 4X8AA 4K35A 4DR5O 4CS4A 1SA0A 2XHBA 3HKDA 1YVWA 2UUBB 5D5PA 3WG7C 4UVCA 2CTRA 4ZIBA 1MZEA 3O65A 1YJNV 1BQZA 3CYOA 5EYPA 4UV8A 2JDIG 2Z0AA 4MS2A 3E89A 1RM1B 4IIJB 4D7TA 4GCZA 4BW9A 1KC8W 2CH7B 5JVDA 4LFAB 4LF7O 4DV7O 3RW0A 1GMGA 1SQQH 2RJZA 3FB7C 5C93A 2P90A 2BOBC 1Q5OA 3STLC 1ZL8A 2GV9A 4YJ3A 1FXHA 4JV5O 2E5LO 3OMAB 1HW7A 1XNRB 3HKBA 1IXMA 5B3SB 2GHYA 5GW7A 4DYLA 1N34O 2QWOB 1VQLV 1SETA 4BIOA 1PL4A 4LF9B 4O2BA 3E83A 4Q6GA 1QNMA 3CHXA 5GONB 3MDSA 3A0HZ 1DF4A 3CC7V 1KMIZ 5IWAO 3QVNA 2X7RB 5H6RA 3TGUH 2JS3A 1I94O 1JVMA 3D3IA 5L3BA 1VF7A 3BVOA 3ASOB 3K59A 4CC5A 2DQ3A 3E8FA 2QA4V 4K8XA 2CTQA 4MVUA 1EM1A 1KB9F 2BSKA 5EBWC 4JYBA 4X65O 1LUVA 4JI6B 3IC7A 2LGQA 5FNVB 3UM7A 4NXNO 3G4SV 4DV0B 5LMUB 1VQMV 1G4YB 4UVAA 2XOKG 2X6AA 1BT8A 2LO1A 2UXBO 1H38A 1BHAA 4F6EA 4X62O 4J41A 1URFA 1QR8A 3K5MA 2DYRC 1VQ7V 2YIBA 5CB4B 4GKKB 4UCSA 2LFRA 5BR8B 3ZRSA 1P7GA 4OXSA 2P7TC 4JI2B 3ABLB 4DXWA 3DGEA 3E22B 3Q4HB 1NR1A 5LHHA 4TV8B 1NTZH 2EZPA 2XAJA 1V55B 3FKSG 3HKEA 3KG2A 3D3QA 3FYIB 1QLEC 1I7FA 4X89A 3WG7B 3CJHB 4EB6A 2D2CB 3VQVA 2EJ7A 3HR0A 5H6QA 4MVMA 3CMEV 3J7AU 5B66Z 4B3TO 2AHZA 4GUNA 3EXAA 1N36B 2GBOA 3RYFA 1BMFG 1JMKC 5HFMA 1VQ6V 4IHJB 4UUJC 1NTKH 5KA5A 2Y0IA 2XT9A 3JYCA 4NB5A 4DV2O 2HHHO 4LWSA 1OHHG 3C3SA 4DR2B 3JASB 4K0KB 4J7JA 5AG2A 1GTOA 4QPKA 5B1BC 5CBGA 2N74A 4I9QA 3R65A 3CRCA 3RVZA 4Z1MG 4PDVA 4R50A 4CBCA 2UUBO 1B04A 2DN9A 1E1RG 3MHHC 1XMOB 5EC2C 2Q69A 5CA3A 1VIBA 4DUYB 4DR6B 3JD3A 2KKWA 3JCUZ 4X64O 3E8BA 1MSDA 4LFAO 1H2NA 4C7UA 4DR3B 4R6ZA 3JD4A 1Q3EA 5H5NA 1GN2A 5IJ9A 2PTMA 2B1IA 1SERA 3CCUV 1S3JA 2R9IA 2Q7EA 1E79G 4LNUA 3B40A 1K97A 3L75H 4JTAB 2A7WA 4DR4B 2P06A 4JI5B 2EZOA 2G38A 1XNRO 1IURA 3VOUA 1ROPA 2YUAA 1VQNV 3G80A 1R6TA 5EIBC 1CXZB 3AK2A 3CCLV 3FB6C 4B3MB 1QHTA 5KAFZ 4X1YA 3N2KB 3LSSA 5J2TB 4O4IB 1BCCH 3UO2A 3SGIA 1WA8B 3LNMB 4KXRA 4UB8Z 4DO2A 2P4KA 5IYZB 2EIJC 2NNUA 4LF9O 2Q8VA 5J2UB 4TT3G 5JCOC 1HP8A 4DW1A 2JS5A 4NYKA 4H33A 1YTFD 1COWG 1ZTEA 1Y67A 3I5DA 3BABA 3C90A 1JQ0A 4QE9A 4UCTA 3K0DA 2PF4E 2FB5A 2DYRB 1N8RW 4DV4B 2GUZB 5FL7G 1IZ3A 4CH6A 2YSUB 2ZM6O 2V1DA 4PDMA 1VF6A 4E4EA 3SYQA 1FKAO 1JFFA 4BWAA 1OCCB 5JJEB 3MD0A 4HZ3A 3ZHVA 1R6KA 3TXSA 1HDJA 4GX1A 3J80N 3SYCA 4PDLA 2ITCC 4JI0B 4EFBA 4JAVA 2B5UA 1X59A 5IY5C 2HR3A 4O2AB 1QLEB 3G6EV 4K8ZA 1N0NA 1ORQC 1FXKB 4EKWA 5DEDA 4LF5O 2YIAA 1AI6A 5LMUO 4D6TH 1AJNA 5TISZ 5L3FA 1GKFA 4CZZA 4RWUA 5IE9A 4YHHB 4MW3A 4UCUA 1VARA 2Q0OC 1XILA 4JYAB 2LGWA 5LXTA 4FFBA 1QBZA 5IDJA 4ZI7B 3QTCA 2OCCB 1NI8A 4RUEA 1K3EA 1K7DA 3A8TA 1MABG 5GTIZ 5IYCO 4BR6A 1Y4MA 4F6RA 1FFTB 4GKKO 3PN1A 2Q6AA 5H9CA 2PGGA 3JAWA 1K92A 4FJCC 2P4VA 5B1BB 1KD1W 2AW9A 1V9PA 3RWRD 5KLVH 1AR4A 1NH2B 2ZR2A 4FMTA 4MW8A 4A5UB 1Y6XA 4JGSA 1K5QA 1XDCA 1TVKB 1US6A 2QJ1A 4DV1B 4FLXA 2WLKA 2K1EA 3M99B 1H2SB 2ZR3A 4PA9A 4ZBMA 2UUCO 2CH7A 4X1KB 2CE4A 5LMNB 3CCEV 2ZDIA 4ICGA 3CRRA 1DLBA 1SC5B 2IJJA 1FS0G 1OCRC 3T1CA 4WCEV 4J7KA 4QIWF 1QR9A 2Q68A 3AG4C 1RSOB 3VQWA 4P9PA 3WB1A 2WLHA 1XMQB 1EN5A 3CCSV 2BCCH 4RQFA 3ABTA 4J7ZA 1BE3H 3SYAA 3SJQC 2F23A 2F1MA 3AG3B 1UJWB 2BTQB 1PKXA 2FL4A 2XAQA 2ZDIC 3JALA 5H2FZ 3L9DA 3DC6A 2Q67A 3WFVA 2WAMA 5C8YA 1PL0A 1OV9A 3H1IH 3RBZA 5LP6B 2EIJB 3U0ZA 1XMOO 4UVBA 3L74H 2W0FC 3JARB 1IX9A 3LDCA 2IJHA 3GWKC 4JPRA 4DUYO 4DR6O 3N2GA 4HAMA 3CP1A 4QJFB 4ABMA 4MTGA 1NZ6A 4JAAA 1J95A 1SQPH 4E2LA 1KUQA 2JRIA 4DR3O 1NH2D 5LBQA 3H9VA 3K04A 2HVJC 4TSFG 3T1YB 2WLLA 2YEVB 1TUBA 1AJPA 4DV6O 3X2QC 4I55B 3MHSC 3CE2A 2N04A 4DR4O 3WU2Z 5A9GA 2YI9A 3GVMA 3ZRWB 1TUEB 2L35A 4ZOLA 1AI4A 3OE7G 4B3MO 3LDEA 5JJNB 4OX9B 1AB3A 3K0GA 4JI3B 1D5NA 2Q7HA 5A2QN 1PNMA 3S3XA 2DJVA 4NKGB 4FLWA 3ZX6A 4FM1A 2EIMC 2JJ1G 3VQXA 1FD9A 3OR7C 1G6UA 5CA0B 5EIBD 1NBMG 5J9PC 1V54C 5IJ0B 2X0LA 4DV4O 4FLYA 2GTSA 1NVPB 1R1BA 3LDDA 4KHPB 2P6JA 3ABKC 2ADQB 2Q5ZA 3BAAA 1HR0B 5E79Z 4FLZA 5EZYB 5B1NA 4JI7B 2QWPB 3RYIA 3E86A 3RYHA 4IGGA 4WFGA 4JI0O 4NTYA 4QNHB 3FB5C 1Q6UA 1L0NH 4I4TA 5HFLA 4B3RB 5CMUA 2A0LA 4LBEC 4CH3A 4GX2A 3DXRB 1ZAUA 4YHHO 3SPIA 1HNWB 4JYAO 4KP4A 4X1IB 3AG2C 2FTKA 2CGNA 1Q6IA 2ZXWB 5FPRA 1Y74B 2QKAA 4GKJB 3W7UA 1Q7YW 1GN6A 4LF6B 2F4VO 2CUGA 4I50A 1Y66A 1YJWV 1CEZA 5EC1C 3IJ4A 3ML0A 4ZHQA 4DUZB 4CC6A 4YJ2B 5CA1B 4FK5C 4ZKIA 5JH7A 3L70H 3OTOB 1NS1A 1QCEA 3W7XA 2AHYA 3CC4V 1FFXA 1K9MW 2E76B 3HB3B 4J9ZB 3JATB 3LUTB 4DV1O 3ASNB 4LF4B 4WFBV 1NVPD 3K57A 3AG7A 3ZRXA 1R3LC 3O9OA 1GO3F 5LYJA 4G27B 1AI5A 5LMNO 2HFEC 4TWKA 1S72V 1Z5WA 1FPOA 3HKCB 3RVYA 3APQA 2CDYA 3E35A 4O4JB 4MTXA 1YI2V 2ZE6A 1DGSA 1WPXA 1XMQO 1PPJH 3H1JH 3X2QB 2OIEA 2NN4A 4LF8B 2UXCB 4I7ZB 1YCIA 4P30A 3NR7A 4DR1B 1N33O 2IJIA 2OCHA 4AILC 2DOSA 3B77A 1KP3A 3UCSC 3IFXA 1RPRA 4DK0A 1WA8A 4TUYB 4PELA 1NR7A 1Q86W 3SJCC 4X20A 1GM8A 1UPGA 1QU7A 4NXMB 4HNAB 3KCXA 2X6CA 1D2DA 1NT2B 3FAVB 4FVMA 1KBHA 5EBMC 3S3WA 2Z5UA 3TK1A 3A2FA 1F23A 1YSCA 3CXCU 5JWPA 2D3OW 1IBLB 3CCRV 4HYOA 3ZHTA 3T1YO 1LNQA 4L8JA 4AQYB 4PA4A 1YITV 2FYUH 4KFMA 1PNKA 1VQ8V 2YI8A 3RT3C 1OCZC 5JQGB 1KKCA 2CAZC 4JI4B 1XREA 4W4LA 1BSMA 5BZBA 2DWDC 1LR1A 4I0XA 4YXWG 1K4DC 5KUMA 2W6IG 4WBNA 3OT7A 2Z3YA 2JGDA 1FJGB 3W7SA 1M5IA 3W7WA 3N27A 4JI3O 2Y69C 4O4HB 2O57A 2V4DA 4PJ0Z 3TXQA 1CPYA 5BXZA 4O4LA 3B8NA 3QO8A 2OIGA 2KG7A 4DRXA 3CCVV 2Y4UA 4PA7A 3F5WC 3ABUA 4LH6A 5LOVA 3OUSA 4H37A 5LA6B 1XI1A 1EZJA 1BZKA 1SRYA 3JAKB 1H2KA 2ZE8A 2VS0A 4OPHA 1SA0B 1Y76A 1VEWA 3HKDB 1O9GA 3THOA 4KHPO 2F43G 1YXBA 2A3QA 5EYPB 3LNNA 4IL6Z 1YTFB 2PYLA 4JI7O 2LP7A 2MW2B 2XAGA 4IYIA 3VQYA 1TVKA 2H3OA 5KMGA 3PJSK 4NTXA 3T4ZA 4GX5A 3OMNB 2A06H 1EBOA 4PI0A 3CC2V 4B3RO 4PDRA 3K06A 3FYEB 1EZVH 1PV0A 2Q73A 1JJOA 1MA1A 2WSSG 1ZL8B 3UT5A 1HNWO 4YJ3B 3AG1C 2B9ZA 4Z1VA 2CTWA 3P3PA 4U3FH 5KX5B 3ZJZA 2XAHA 4JZ2A 2QWQB 4U3JA 1IBKB 3HKBB 1ENVA 3H1HH 4P9OA 4J80A 2VQEB 1AILA 5KAIZ 4LF6O 3RYCA 1MSWD 1SQGA 4MTOA 1QLNA 2DYSC 5L3EA 4DUZO 2VQFB 1JPXA 2P67A 2B1GA 3OTOO 4O2BB 1GM9A 1D5AA 1GN4A 3ZHSA 5LP6A 2XASA 1I08A 1W59A 4MVQA 1JJ2U 1YF2A 1Q43A 1RP3B 1R3KC 4TOIA 2Y4TA 3G6BA 4LF4O 4I5SA 4YIPA 3RFRA 5L3CA 1WJZA 3F7YC 4U7NA 1N0JA 2ZINA 2UXDB 4CH4A 3FB8C 4QE7A 4PA3A 3D36A 2ZE7A 2HJDA 3ZMUA 2ILMA 1VP7A 3SR2C 2WA4A 4TQFA 1L0LH 4EFEA 2HG5C 3ETQA 2EIKC 3F5TA 3UQ8A 4LF8O 4JZGA 1P49A 4DR1O 3H01A 4DR7B 2EBOA 3K03A 4LCUC 3FFQA 4X66B 4G2KA 2RN9A 1PNLA 2RQ6A 2ARHA 1S0VA 4RUFA 1YZBA 2ZD9A 3QNEA 2HLDG 4JI6O 1HNXB 2YS8A 2E75B 5DM6V 4Z2WA 5BMVA 2EINC 4NXMO 2HJFC 2IH3C 3CWBH 4DV0O 1U96A 4PV1B 1B06A 1VF6C 5CA0A 1AP5A 2KQXA 5IYBO 1LUWA 5KUKA 2RDCA 4CH5A 3ETGA 4FLUA 3QO7A 2HVKC 1M4UA 4WFEA 2QE7G 1IBLO 3HKEB 3QF7A 3P3NA 2K9PA 5BR8O 3I55V 1WNSA 1WAZA 4UV9A 4OPAA 4JI2O 1KYOF 2R72A 4JI4O 3CMAV 3L71H 4DV7B 1I5XA 4D7SA 4MTFA 3CRMA 1VQOV 3RYFB 4ASUG 2QWRB 4PD4F 2IW5A 2BOCC 4B7EA 1FJGO 4IIJA 4JV5B 4X1IA 2AZ2A 2ADPA 1XUQA 1XQ8A 4LWSB 4JASA 3AG1B 3TJTA 2EILC 1HWYA 3LSUA 1N36O 4LP8A 4MVSA 2LQTA 1H2GA 3CPWU 2YXYA 2UUAB 1MNGA 2Q7GA 2RCVA 1SZTA 4LH7A 3JD2A 4B7KA 3OUFA 1AJQA 2YIBD 4DR2O 1JR9A 1K33A 4K0KO 3OM3B 1GM7A 5D5QA 2WLMA 4B08A 4WFAV 2ZE5A 1JCHA 3KZIZ 3SYPA 1M9NA 5LGNA 2HP8A 4I9WA 5B1AC 2UXNA 3IC9A 5IJ9B 1MG1A 5GONA 1HNZB 4GX0A 5DN6G 4LNUB 4CS2A 5B3SC 3TCUA 3ZN1A 1OCOC 1H8HG 1IBKO 4NXNB 3C3TA 3AK3A 1TAEA 2IJKA 3ZMZA 2HEPA 5L3DA 3AK1A 2JGUA 3BHPA 4GT1A 2VQEO 4X1YB 3SDLA 1M57C 1B3QA 4HBNA 1EN6A 2Y0PA 4DV3B 3CB2A 2VQFO 3GWOA 5IT9N 1BS3A 2IU3A 4JI5O 3CCMV 4J10A 1L8DA 5FNVA 4HNAA 5IY5B 2A9HA 4BIZA 1F51A 1J5EB 2AGAA 4JYYA 3ZHQA 2AXTZ 2UXXA 3OR6C 3P32A 4BIUA 1S5LZ 4YY3B 2NR5A 3OEHG 1JFFB 3ZHUA 2OWOA 1VQ9V 2YICA 5CB4A 3T1HB 1NKDA 2ZKOA 3ZRVA 3A0RA 1JA8A 5DECA 1BL8A 1G8MA 5KHHA 4X9QA 4JI1B 4FM2A 3M7MX 1R3IC 4MT8A 3E22A 2PI4A 1AI7A 3Q4HA 3BY6A 4DR7O 3STZC 3DSQA 4TV8A 4B3SB 2Q0AA 4JTDB 2IH1C 3UKMA 5LXTB 4FFBB 1WB8A 3U10A 3CJHA 3I56V 1QVGU 2DMXA 3T2MA 4FM0A 1RPOA 4DV2B 4NR1A 1HNXO 2QWNB 3SPGA 2R9RB 5LGUA 2CGOA 3KKYA 3JD1A 2YIDA 2WLIB 1KQSU 2Q9LA 2CTPA 4F6RB 3E2EA 2EILB 3JAWB 1ZWIC 4IHJA 1BHBA 3ZMVA 3JAKA 2KSDA 1OCRB 1H2MA 2WWWA 2Q4PA 2QEXV 1V55C 2OTLV 2JK5C 3FD9A 4MVOA 3AG4B 4F4LA 1SZXA 3JASA 4IT5A 4TV9B 2LJ2A 1P84F 1WLEA 2VWKA 2F95B 3BA9A 3BFRA 2EJRA 1XBLA 3T4DA 4X64B 2IM9A 2FKXA 5CN0A 3FX7A 3NXSA 4XBFA 2FMLA 4N23A 1DF5A 2F66C 1IBMB 5B1AB 3EVKA 1H8EG 1SESA 3CS5A 1Z5VA 2QM4A 2BTOA 5KX5A 3K5LA 1H2LA 3SJBC 2C2AA 3UO3A 4LFBB 3QO5A 2PI5A 2V7QG 3APOA 1OCOB 3OFNG 3JAMN 1AR1B 3CSXA 1OJHA 1NQTA 3AEIA 3JALB 4JAUA 2UUAO 2N05A 1W2BU 5C8YB 1M57B 1BQ0A 2EULA 5LHIA 2HKOA 2Y48A 1YJ9V 1R3JC 5KA6A 4J42A 3OTFA 1MZFA 3E8HA 5ITZB 1S5JA 5KHGA 3N2KA 3N2GB 4FPPA 5J2TA 4O4IA 5KHJA 3CCJV 1TA8A 3B09A 3OD4A 5IYZA 2ZM6B 3RGBA 2DWEC 2LW1A 1E1QG 5J2UA 2QR4A 1HNZO 2WLLB 1TUBB 2QGNA 2YDEA 2EIMB 3WB0A 1L1FA 3OGCC 3U11A 5B5EZ 2GUZA 2ZNIA 4MVZA 2ZCEA 1FXVA 1V54B 3H1KH 4LR3A 1UFIA 1YDXA 4JI8B 4LF5B 4RQEA 4ZOLB 3ABKB 2WA3A 5LL6Y 2ZQMA 2P22C 4DV3O 1GAXA 5IYDO 5E1AC 3E8GA 1QQCA 2JEXA 3L73H 4O2AA 4GYCB 4Q20A 5CBFA 4XDJA 1AVMA 2BE3A 3SPJA 1FXKA 4MSWC 3ZMSA 1J5EO 4H44B 1S77D 1R73A 3BEHA 4OX9O 1W0JG 4JTCB 2M7WA 1OCCC 2AZ0A 1A32A 1GK9A 4ZI7A 2H8PC 2XUMA 4YY3O 3JD0A 3JSNA 4DK1A 5FPOA 3AG2B 3CX5F 2A79B 3RYIB 2VWJA 3RYHB 1YIJV 2DE0X 3T1HO 4PHZA 1QVFU 3ZEDA 1NTMH 1FXKC 4CS3A 2UUCB 4JI1O 1WP8A 1K4CC 5CBHA 4I4TB 3ZHRA 4GLXA 4K3AA 1HR0O 3K5OA 5LGTA 1JOYA 3K5NA 4X88A 4B3SO 2OCCC 1M1KW 3OGIB 1T5EA 5JVDB 3BRCA 1WPBA 4FLVA 4X1KA 2QM8A 4R7CA 3CXHF 1SS3A 1Q81W 1Q6HA 3SYOA 4FLTA 1N32B 4KL1A 4I50B 3QG5A 4ZHQB 4PA6A 2ATKC 1GRJA 5JH7B 1RSOA 2QM7A 1WB7A 2KB1A 1VQKV 3CRQA 2IBZH 1FFXB 2XAFA 4GKJO 2WLJA 1FAFA 2QTSA 4H0LB 4WFFA 3BPZA 1MMMA 2BTQA 4G28B 1F4MA 3ABMC 4RO2A 5LYJB 2H94A 5BY1A 1VF5B 4YIOA 2QDOA 1NU1H 3OW2U 1IBMO 4XDKA 3JARA 3BCCH 4QGPA 1ZLZA 4DV6B 5F2VO 4UCRA 5JCOA 2ODMA 1K73W 2CK3G 4NTWA 3ZBHA 4UCVA 3CD6V 5B1OA 3AG3C 1CP9A 3M8AA 2UU9B 4LFBO 2E3CA 4IYHA 2YEVA 4UCOA 3B4SA 2BSKB 4R8CA 2JEUA 1PM9A 3R66A 4I55A 2RNBA 5LP6C 2W6JG 5KHKA 1YHQV 4RAIA 4U7OA 2XTAA 4X20B 3VBBA 2UXCO 1OCZB 2PY5A 3RN4A 2ETNA 1M56C 3EHBB 1KU9A 3K9AA 4LFCB 3ZRWA 1Q8IA 1SQBH 1G1XB 1XHXA 3ZMTA 1XHZA 2JIZG 4DV5B 4J9YB 4JYCA 1XNQB 4MVRA 3JSLA 2ZT9B 3D36C 2R9AA 3ZIAG 3K79A 5KHIA 2PYJA 1F4NA 1XL4A 2Y69B 1OZ0A 5L3GA 1PP9H 4W4KA 5K1XA 1K5SA 1AP6A 1ZX3A 4H13B 1M93A 5IJ0A 2EX3A 4DR5B 1I5YA 1EN4A 2NLJC 1XEQA 4I0XB 3SPCA 1IXBA 4JI8O 1GN3A 2WPDG 4WBNB 4JF3A 3K9SA 1P4RA 2GTAA 1BGYH 4NVPA 5EZYA 4AQYO 2JGDB 3JCZA 2LW7A 2QKSA 4EB6B 1KKDA 2M6YA 3DTUB 4EEQA 3G71V 3GB7C 2ZNJA 3CEIA 1U97A 3P30A 2QSAA 4LF7B 4O4LB 3K58A 2KG7B 4DRXB 1P7BA 4UFZA 2WLIA 2F4VB 3DXRA 5LOVB 2WLNA 3ETEA 4UB6Z 2YXLA 1AR5A 1F7YA 2OT5A 2OYQA 1VQ5V 1Y76B 3ZS8C 2E5LB 2QKCA 2F93B 1ZSPA 1SQVH 3BA8A 2DQ0A 4P2ZA 2R70A 1Y74A 1KECA 1AROP 4TV9A
chains in the Genus database with same CATH topology
3O9OA 4I0XB 2KG7B 2AZ0A 3HR0A 4LWSA 1WA8B 3GVMA 3FAVB 3TXQA 3ZBHA 4I0XA 2KG7A 3Q4HB 3FD9A 3TXSA 1WA8A 2AZ2A 2B9ZA 4GZRB 3OGIB 2VRZA 3FAVA 3G80A 4LWSB 3GWKC 2DE0X 3Q4HA 2VS0A 4ABMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9O A;  4I0X B;  2KG7 B;  2AZ0 A;  3HR0 A;  4LWS A;  1WA8 B;  3GVM A;  3FAV B;  3TXQ A;  3ZBH A;  4I0X A;  2KG7 A;  3Q4H B;  3FD9 A;  3TXS A;  1WA8 A;  2AZ2 A;  2B9Z A;  4GZR B;  3OGI B;  2VRZ A;  3FAV A;  3G80 A;  4LWS B;  3GWK C;  2DE0 X;  3Q4H A;  2VS0 A;  4ABM A; 
#chains in the Genus database with same CATH topology
 4TQD A;  2JJ2 G;  4WFH A;  1N34 B;  4WF9 V;  1VQP V;  2LFS A;  5KMG B;  5CA1 A;  4YJ2 A;  3DC5 A;  1K34 A;  2DYS B;  3CRA A;  1KP2 A;  1RFY A;  1N4C A;  2RMK B;  1RM1 C;  1TGO A;  3ABM B;  2PZS A;  1K8A W;  5IWA B;  1O9H A;  3JAT A;  3UT5 B;  2ZXW C;  1I94 B;  1Z2G A;  3KCY A;  1GH6 A;  2GDS A;  4U3J B;  1WP7 A;  3ZCC A;  3K3W A;  1FYJ A;  1N33 B;  2ITD C;  4GZR B;  3OAA G;  3RYC B;  1XL6 A;  1YEW A;  3HKC A;  3HPL C;  1N32 O;  1IVS A;  3G67 A;  4BW5 A;  4LC1 A;  3ETD A;  2PUS A;  4O4J A;  4XDL A;  1ZUQ A;  4X65 B;  4DW0 A;  1X4T A;  2IU0 A;  3ICX A;  4OGQ B;  4QPJ A;  3K08 A;  4BAY A;  3OEE G;  3ASN C;  2EIK B;  2JVD A;  5ITZ A;  1M56 B;  2YC0 A;  4J11 A;  1EFR G;  4TUY A;  2UXB B;  1SQF A;  2GSM B;  3W7T A;  1M90 W;  2MK3 A;  4X62 B;  3L72 H;  1MOF A;  3MAQ A;  3H1L H;  4FZ0 A;  2W0X A;  2ZIO A;  1S5H C;  1VMG A;  5GTH Z;  2E74 B;  4UXN A;  2EIN B;  3ASO C;  3FAV A;  3ZN0 A;  5EBL C;  5FLX N;  5LHG A;  3WB2 A;  3LSQ A;  2QTO A;  1WN7 A;  1DTO A;  2XND G;  1THZ A;  3IAY A;  2UU9 O;  2UXD O;  1VQ4 V;  4FIP C;  3SPH A;  4KUM A;  5K1P A;  4PI2 A;  1I0H A;  3IGA C;  3D8C A;  5JQG A;  2DW4 A;  2VRZ A;  2ZIM A;  1DK1 A;  5JJJ B;  1XOU A;  1SQX H;  1S76 D;  2P5O A;  3TET A;  4B3T B;  5BMV B;  2X6B A;  3CCQ V;  3F7V C;  4L87 A;  3SJA C;  3OMI B;  4LFC O;  1Q90 D;  2YXH A;  4X66 O;  1SF9 A;  3A0B Z;  1IDS A;  4DV5 O;  1W0K G;  4N21 A;  1JX9 A;  1XNQ O;  4O4H A;  2HHH B;  1NJI W;  1R6N A;  4AHC A;  3EFF K;  1PD3 A;  2L6L A;  4FZ1 A;  1SKV A;  3B2E E;  3J81 N;  5EK0 A;  3B8M A;  4AI8 A;  4FFK A;  1Q82 W;  3ABL C;  1B6Q A;  2OTJ V;  5LA6 A;  4X8A A;  4K35 A;  4DR5 O;  4CS4 A;  1SA0 A;  2XHB A;  3HKD A;  1YVW A;  2UUB B;  5D5P A;  3WG7 C;  4UVC A;  2CTR A;  4ZIB A;  1MZE A;  3O65 A;  1YJN V;  1BQZ A;  3CYO A;  5EYP A;  4UV8 A;  2JDI G;  2Z0A A;  4MS2 A;  3E89 A;  1RM1 B;  4IIJ B;  4D7T A;  4GCZ A;  4BW9 A;  1KC8 W;  2CH7 B;  5JVD A;  4LFA B;  4LF7 O;  4DV7 O;  3RW0 A;  1GMG A;  1SQQ H;  2RJZ A;  3FB7 C;  5C93 A;  2P90 A;  2BOB C;  1Q5O A;  3STL C;  1ZL8 A;  2GV9 A;  4YJ3 A;  1FXH A;  4JV5 O;  2E5L O;  3OMA B;  1HW7 A;  1XNR B;  3HKB A;  1IXM A;  5B3S B;  2GHY A;  5GW7 A;  4DYL A;  1N34 O;  2QWO B;  1VQL V;  1SET A;  4BIO A;  1PL4 A;  4LF9 B;  4O2B A;  3E83 A;  4Q6G A;  1QNM A;  3CHX A;  5GON B;  3MDS A;  3A0H Z;  1DF4 A;  3CC7 V;  1KMI Z;  5IWA O;  3QVN A;  2X7R B;  5H6R A;  3TGU H;  2JS3 A;  1I94 O;  1JVM A;  3D3I A;  5L3B A;  1VF7 A;  3BVO A;  3ASO B;  3K59 A;  4CC5 A;  2DQ3 A;  3E8F A;  2QA4 V;  4K8X A;  2CTQ A;  4MVU A;  1EM1 A;  1KB9 F;  2BSK A;  5EBW C;  4JYB A;  4X65 O;  1LUV A;  4JI6 B;  3IC7 A;  2LGQ A;  5FNV B;  3UM7 A;  4NXN O;  3G4S V;  4DV0 B;  5LMU B;  1VQM V;  1G4Y B;  4UVA A;  2XOK G;  2X6A A;  1BT8 A;  2LO1 A;  2UXB O;  1H38 A;  1BHA A;  4F6E A;  4X62 O;  4J41 A;  1URF A;  1QR8 A;  3K5M A;  2DYR C;  1VQ7 V;  2YIB A;  5CB4 B;  4GKK B;  4UCS A;  2LFR A;  5BR8 B;  3ZRS A;  1P7G A;  4OXS A;  2P7T C;  4JI2 B;  3ABL B;  4DXW A;  3DGE A;  3E22 B;  3Q4H B;  1NR1 A;  5LHH A;  4TV8 B;  1NTZ H;  2EZP A;  2XAJ A;  1V55 B;  3FKS G;  3HKE A;  3KG2 A;  3D3Q A;  3FYI B;  1QLE C;  1I7F A;  4X89 A;  3WG7 B;  3CJH B;  4EB6 A;  2D2C B;  3VQV A;  2EJ7 A;  3HR0 A;  5H6Q A;  4MVM A;  3CME V;  3J7A U;  5B66 Z;  4B3T O;  2AHZ A;  4GUN A;  3EXA A;  1N36 B;  2GBO A;  3RYF A;  1BMF G;  1JMK C;  5HFM A;  1VQ6 V;  4IHJ B;  4UUJ C;  1NTK H;  5KA5 A;  2Y0I A;  2XT9 A;  3JYC A;  4NB5 A;  4DV2 O;  2HHH O;  4LWS A;  1OHH G;  3C3S A;  4DR2 B;  3JAS B;  4K0K B;  4J7J A;  5AG2 A;  1GTO A;  4QPK A;  5B1B C;  5CBG A;  2N74 A;  4I9Q A;  3R65 A;  3CRC A;  3RVZ A;  4Z1M G;  4PDV A;  4R50 A;  4CBC A;  2UUB O;  1B04 A;  2DN9 A;  1E1R G;  3MHH C;  1XMO B;  5EC2 C;  2Q69 A;  5CA3 A;  1VIB A;  4DUY B;  4DR6 B;  3JD3 A;  2KKW A;  3JCU Z;  4X64 O;  3E8B A;  1MSD A;  4LFA O;  1H2N A;  4C7U A;  4DR3 B;  4R6Z A;  3JD4 A;  1Q3E A;  5H5N A;  1GN2 A;  5IJ9 A;  2PTM A;  2B1I A;  1SER A;  3CCU V;  1S3J A;  2R9I A;  2Q7E A;  1E79 G;  4LNU A;  3B40 A;  1K97 A;  3L75 H;  4JTA B;  2A7W A;  4DR4 B;  2P06 A;  4JI5 B;  2EZO A;  2G38 A;  1XNR O;  1IUR A;  3VOU A;  1ROP A;  2YUA A;  1VQN V;  3G80 A;  1R6T A;  5EIB C;  1CXZ B;  3AK2 A;  3CCL V;  3FB6 C;  4B3M B;  1QHT A;  5KAF Z;  4X1Y A;  3N2K B;  3LSS A;  5J2T B;  4O4I B;  1BCC H;  3UO2 A;  3SGI A;  1WA8 B;  3LNM B;  4KXR A;  4UB8 Z;  4DO2 A;  2P4K A;  5IYZ B;  2EIJ C;  2NNU A;  4LF9 O;  2Q8V A;  5J2U B;  4TT3 G;  5JCO C;  1HP8 A;  4DW1 A;  2JS5 A;  4NYK A;  4H33 A;  1YTF D;  1COW G;  1ZTE A;  1Y67 A;  3I5D A;  3BAB A;  3C90 A;  1JQ0 A;  4QE9 A;  4UCT A;  3K0D A;  2PF4 E;  2FB5 A;  2DYR B;  1N8R W;  4DV4 B;  2GUZ B;  5FL7 G;  1IZ3 A;  4CH6 A;  2YSU B;  2ZM6 O;  2V1D A;  4PDM A;  1VF6 A;  4E4E A;  3SYQ A;  1FKA O;  1JFF A;  4BWA A;  1OCC B;  5JJE B;  3MD0 A;  4HZ3 A;  3ZHV A;  1R6K A;  3TXS A;  1HDJ A;  4GX1 A;  3J80 N;  3SYC A;  4PDL A;  2ITC C;  4JI0 B;  4EFB A;  4JAV A;  2B5U A;  1X59 A;  5IY5 C;  2HR3 A;  4O2A B;  1QLE B;  3G6E V;  4K8Z A;  1N0N A;  1ORQ C;  1FXK B;  4EKW A;  5DED A;  4LF5 O;  2YIA A;  1AI6 A;  5LMU O;  4D6T H;  1AJN A;  5TIS Z;  5L3F A;  1GKF A;  4CZZ A;  4RWU A;  5IE9 A;  4YHH B;  4MW3 A;  4UCU A;  1VAR A;  2Q0O C;  1XIL A;  4JYA B;  2LGW A;  5LXT A;  4FFB A;  1QBZ A;  5IDJ A;  4ZI7 B;  3QTC A;  2OCC B;  1NI8 A;  4RUE A;  1K3E A;  1K7D A;  3A8T A;  1MAB G;  5GTI Z;  5IYC O;  4BR6 A;  1Y4M A;  4F6R A;  1FFT B;  4GKK O;  3PN1 A;  2Q6A A;  5H9C A;  2PGG A;  3JAW A;  1K92 A;  4FJC C;  2P4V A;  5B1B B;  1KD1 W;  2AW9 A;  1V9P A;  3RWR D;  5KLV H;  1AR4 A;  1NH2 B;  2ZR2 A;  4FMT A;  4MW8 A;  4A5U B;  1Y6X A;  4JGS A;  1K5Q A;  1XDC A;  1TVK B;  1US6 A;  2QJ1 A;  4DV1 B;  4FLX A;  2WLK A;  2K1E A;  3M99 B;  1H2S B;  2ZR3 A;  4PA9 A;  4ZBM A;  2UUC O;  2CH7 A;  4X1K B;  2CE4 A;  5LMN B;  3CCE V;  2ZDI A;  4ICG A;  3CRR A;  1DLB A;  1SC5 B;  2IJJ A;  1FS0 G;  1OCR C;  3T1C A;  4WCE V;  4J7K A;  4QIW F;  1QR9 A;  2Q68 A;  3AG4 C;  1RSO B;  3VQW A;  4P9P A;  3WB1 A;  2WLH A;  1XMQ B;  1EN5 A;  3CCS V;  2BCC H;  4RQF A;  3ABT A;  4J7Z A;  1BE3 H;  3SYA A;  3SJQ C;  2F23 A;  2F1M A;  3AG3 B;  1UJW B;  2BTQ B;  1PKX A;  2FL4 A;  2XAQ A;  2ZDI C;  3JAL A;  5H2F Z;  3L9D A;  3DC6 A;  2Q67 A;  3WFV A;  2WAM A;  5C8Y A;  1PL0 A;  1OV9 A;  3H1I H;  3RBZ A;  5LP6 B;  2EIJ B;  3U0Z A;  1XMO O;  4UVB A;  3L74 H;  2W0F C;  3JAR B;  1IX9 A;  3LDC A;  2IJH A;  3GWK C;  4JPR A;  4DUY O;  4DR6 O;  3N2G A;  4HAM A;  3CP1 A;  4QJF B;  4ABM A;  4MTG A;  1NZ6 A;  4JAA A;  1J95 A;  1SQP H;  4E2L A;  1KUQ A;  2JRI A;  4DR3 O;  1NH2 D;  5LBQ A;  3H9V A;  3K04 A;  2HVJ C;  4TSF G;  3T1Y B;  2WLL A;  2YEV B;  1TUB A;  1AJP A;  4DV6 O;  3X2Q C;  4I55 B;  3MHS C;  3CE2 A;  2N04 A;  4DR4 O;  3WU2 Z;  5A9G A;  2YI9 A;  3GVM A;  3ZRW B;  1TUE B;  2L35 A;  4ZOL A;  1AI4 A;  3OE7 G;  4B3M O;  3LDE A;  5JJN B;  4OX9 B;  1AB3 A;  3K0G A;  4JI3 B;  1D5N A;  2Q7H A;  5A2Q N;  1PNM A;  3S3X A;  2DJV A;  4NKG B;  4FLW A;  3ZX6 A;  4FM1 A;  2EIM C;  2JJ1 G;  3VQX A;  1FD9 A;  3OR7 C;  1G6U A;  5CA0 B;  5EIB D;  1NBM G;  5J9P C;  1V54 C;  5IJ0 B;  2X0L A;  4DV4 O;  4FLY A;  2GTS A;  1NVP B;  1R1B A;  3LDD A;  4KHP B;  2P6J A;  3ABK C;  2ADQ B;  2Q5Z A;  3BAA A;  1HR0 B;  5E79 Z;  4FLZ A;  5EZY B;  5B1N A;  4JI7 B;  2QWP B;  3RYI A;  3E86 A;  3RYH A;  4IGG A;  4WFG A;  4JI0 O;  4NTY A;  4QNH B;  3FB5 C;  1Q6U A;  1L0N H;  4I4T A;  5HFL A;  4B3R B;  5CMU A;  2A0L A;  4LBE C;  4CH3 A;  4GX2 A;  3DXR B;  1ZAU A;  4YHH O;  3SPI A;  1HNW B;  4JYA O;  4KP4 A;  4X1I B;  3AG2 C;  2FTK A;  2CGN A;  1Q6I A;  2ZXW B;  5FPR A;  1Y74 B;  2QKA A;  4GKJ B;  3W7U A;  1Q7Y W;  1GN6 A;  4LF6 B;  2F4V O;  2CUG A;  4I50 A;  1Y66 A;  1YJW V;  1CEZ A;  5EC1 C;  3IJ4 A;  3ML0 A;  4ZHQ A;  4DUZ B;  4CC6 A;  4YJ2 B;  5CA1 B;  4FK5 C;  4ZKI A;  5JH7 A;  3L70 H;  3OTO B;  1NS1 A;  1QCE A;  3W7X A;  2AHY A;  3CC4 V;  1FFX A;  1K9M W;  2E76 B;  3HB3 B;  4J9Z B;  3JAT B;  3LUT B;  4DV1 O;  3ASN B;  4LF4 B;  4WFB V;  1NVP D;  3K57 A;  3AG7 A;  3ZRX A;  1R3L C;  3O9O A;  1GO3 F;  5LYJ A;  4G27 B;  1AI5 A;  5LMN O;  2HFE C;  4TWK A;  1S72 V;  1Z5W A;  1FPO A;  3HKC B;  3RVY A;  3APQ A;  2CDY A;  3E35 A;  4O4J B;  4MTX A;  1YI2 V;  2ZE6 A;  1DGS A;  1WPX A;  1XMQ O;  1PPJ H;  3H1J H;  3X2Q B;  2OIE A;  2NN4 A;  4LF8 B;  2UXC B;  4I7Z B;  1YCI A;  4P30 A;  3NR7 A;  4DR1 B;  1N33 O;  2IJI A;  2OCH A;  4AIL C;  2DOS A;  3B77 A;  1KP3 A;  3UCS C;  3IFX A;  1RPR A;  4DK0 A;  1WA8 A;  4TUY B;  4PEL A;  1NR7 A;  1Q86 W;  3SJC C;  4X20 A;  1GM8 A;  1UPG A;  1QU7 A;  4NXM B;  4HNA B;  3KCX A;  2X6C A;  1D2D A;  1NT2 B;  3FAV B;  4FVM A;  1KBH A;  5EBM C;  3S3W A;  2Z5U A;  3TK1 A;  3A2F A;  1F23 A;  1YSC A;  3CXC U;  5JWP A;  2D3O W;  1IBL B;  3CCR V;  4HYO A;  3ZHT A;  3T1Y O;  1LNQ A;  4L8J A;  4AQY B;  4PA4 A;  1YIT V;  2FYU H;  4KFM A;  1PNK A;  1VQ8 V;  2YI8 A;  3RT3 C;  1OCZ C;  5JQG B;  1KKC A;  2CAZ C;  4JI4 B;  1XRE A;  4W4L A;  1BSM A;  5BZB A;  2DWD C;  1LR1 A;  4I0X A;  4YXW G;  1K4D C;  5KUM A;  2W6I G;  4WBN A;  3OT7 A;  2Z3Y A;  2JGD A;  1FJG B;  3W7S A;  1M5I A;  3W7W A;  3N27 A;  4JI3 O;  2Y69 C;  4O4H B;  2O57 A;  2V4D A;  4PJ0 Z;  3TXQ A;  1CPY A;  5BXZ A;  4O4L A;  3B8N A;  3QO8 A;  2OIG A;  2KG7 A;  4DRX A;  3CCV V;  2Y4U A;  4PA7 A;  3F5W C;  3ABU A;  4LH6 A;  5LOV A;  3OUS A;  4H37 A;  5LA6 B;  1XI1 A;  1EZJ A;  1BZK A;  1SRY A;  3JAK B;  1H2K A;  2ZE8 A;  2VS0 A;  4OPH A;  1SA0 B;  1Y76 A;  1VEW A;  3HKD B;  1O9G A;  3THO A;  4KHP O;  2F43 G;  1YXB A;  2A3Q A;  5EYP B;  3LNN A;  4IL6 Z;  1YTF B;  2PYL A;  4JI7 O;  2LP7 A;  2MW2 B;  2XAG A;  4IYI A;  3VQY A;  1TVK A;  2H3O A;  5KMG A;  3PJS K;  4NTX A;  3T4Z A;  4GX5 A;  3OMN B;  2A06 H;  1EBO A;  4PI0 A;  3CC2 V;  4B3R O;  4PDR A;  3K06 A;  3FYE B;  1EZV H;  1PV0 A;  2Q73 A;  1JJO A;  1MA1 A;  2WSS G;  1ZL8 B;  3UT5 A;  1HNW O;  4YJ3 B;  3AG1 C;  2B9Z A;  4Z1V A;  2CTW A;  3P3P A;  4U3F H;  5KX5 B;  3ZJZ A;  2XAH A;  4JZ2 A;  2QWQ B;  4U3J A;  1IBK B;  3HKB B;  1ENV A;  3H1H H;  4P9O A;  4J80 A;  2VQE B;  1AIL A;  5KAI Z;  4LF6 O;  3RYC A;  1MSW D;  1SQG A;  4MTO A;  1QLN A;  2DYS C;  5L3E A;  4DUZ O;  2VQF B;  1JPX A;  2P67 A;  2B1G A;  3OTO O;  4O2B B;  1GM9 A;  1D5A A;  1GN4 A;  3ZHS A;  5LP6 A;  2XAS A;  1I08 A;  1W59 A;  4MVQ A;  1JJ2 U;  1YF2 A;  1Q43 A;  1RP3 B;  1R3K C;  4TOI A;  2Y4T A;  3G6B A;  4LF4 O;  4I5S A;  4YIP A;  3RFR A;  5L3C A;  1WJZ A;  3F7Y C;  4U7N A;  1N0J A;  2ZIN A;  2UXD B;  4CH4 A;  3FB8 C;  4QE7 A;  4PA3 A;  3D36 A;  2ZE7 A;  2HJD A;  3ZMU A;  2ILM A;  1VP7 A;  3SR2 C;  2WA4 A;  4TQF A;  1L0L H;  4EFE A;  2HG5 C;  3ETQ A;  2EIK C;  3F5T A;  3UQ8 A;  4LF8 O;  4JZG A;  1P49 A;  4DR1 O;  3H01 A;  4DR7 B;  2EBO A;  3K03 A;  4LCU C;  3FFQ A;  4X66 B;  4G2K A;  2RN9 A;  1PNL A;  2RQ6 A;  2ARH A;  1S0V A;  4RUF A;  1YZB A;  2ZD9 A;  3QNE A;  2HLD G;  4JI6 O;  1HNX B;  2YS8 A;  2E75 B;  5DM6 V;  4Z2W A;  5BMV A;  2EIN C;  4NXM O;  2HJF C;  2IH3 C;  3CWB H;  4DV0 O;  1U96 A;  4PV1 B;  1B06 A;  1VF6 C;  5CA0 A;  1AP5 A;  2KQX A;  5IYB O;  1LUW A;  5KUK A;  2RDC A;  4CH5 A;  3ETG A;  4FLU A;  3QO7 A;  2HVK C;  1M4U A;  4WFE A;  2QE7 G;  1IBL O;  3HKE B;  3QF7 A;  3P3N A;  2K9P A;  5BR8 O;  3I55 V;  1WNS A;  1WAZ A;  4UV9 A;  4OPA A;  4JI2 O;  1KYO F;  2R72 A;  4JI4 O;  3CMA V;  3L71 H;  4DV7 B;  1I5X A;  4D7S A;  4MTF A;  3CRM A;  1VQO V;  3RYF B;  4ASU G;  2QWR B;  4PD4 F;  2IW5 A;  2BOC C;  4B7E A;  1FJG O;  4IIJ A;  4JV5 B;  4X1I A;  2AZ2 A;  2ADP A;  1XUQ A;  1XQ8 A;  4LWS B;  4JAS A;  3AG1 B;  3TJT A;  2EIL C;  1HWY A;  3LSU A;  1N36 O;  4LP8 A;  4MVS A;  2LQT A;  1H2G A;  3CPW U;  2YXY A;  2UUA B;  1MNG A;  2Q7G A;  2RCV A;  1SZT A;  4LH7 A;  3JD2 A;  4B7K A;  3OUF A;  1AJQ A;  2YIB D;  4DR2 O;  1JR9 A;  1K33 A;  4K0K O;  3OM3 B;  1GM7 A;  5D5Q A;  2WLM A;  4B08 A;  4WFA V;  2ZE5 A;  1JCH A;  3KZI Z;  3SYP A;  1M9N A;  5LGN A;  2HP8 A;  4I9W A;  5B1A C;  2UXN A;  3IC9 A;  5IJ9 B;  1MG1 A;  5GON A;  1HNZ B;  4GX0 A;  5DN6 G;  4LNU B;  4CS2 A;  5B3S C;  3TCU A;  3ZN1 A;  1OCO C;  1H8H G;  1IBK O;  4NXN B;  3C3T A;  3AK3 A;  1TAE A;  2IJK A;  3ZMZ A;  2HEP A;  5L3D A;  3AK1 A;  2JGU A;  3BHP A;  4GT1 A;  2VQE O;  4X1Y B;  3SDL A;  1M57 C;  1B3Q A;  4HBN A;  1EN6 A;  2Y0P A;  4DV3 B;  3CB2 A;  2VQF O;  3GWO A;  5IT9 N;  1BS3 A;  2IU3 A;  4JI5 O;  3CCM V;  4J10 A;  1L8D A;  5FNV A;  4HNA A;  5IY5 B;  2A9H A;  4BIZ A;  1F51 A;  1J5E B;  2AGA A;  4JYY A;  3ZHQ A;  2AXT Z;  2UXX A;  3OR6 C;  3P32 A;  4BIU A;  1S5L Z;  4YY3 B;  2NR5 A;  3OEH G;  1JFF B;  3ZHU A;  2OWO A;  1VQ9 V;  2YIC A;  5CB4 A;  3T1H B;  1NKD A;  2ZKO A;  3ZRV A;  3A0R A;  1JA8 A;  5DEC A;  1BL8 A;  1G8M A;  5KHH A;  4X9Q A;  4JI1 B;  4FM2 A;  3M7M X;  1R3I C;  4MT8 A;  3E22 A;  2PI4 A;  1AI7 A;  3Q4H A;  3BY6 A;  4DR7 O;  3STZ C;  3DSQ A;  4TV8 A;  4B3S B;  2Q0A A;  4JTD B;  2IH1 C;  3UKM A;  5LXT B;  4FFB B;  1WB8 A;  3U10 A;  3CJH A;  3I56 V;  1QVG U;  2DMX A;  3T2M A;  4FM0 A;  1RPO A;  4DV2 B;  4NR1 A;  1HNX O;  2QWN B;  3SPG A;  2R9R B;  5LGU A;  2CGO A;  3KKY A;  3JD1 A;  2YID A;  2WLI B;  1KQS U;  2Q9L A;  2CTP A;  4F6R B;  3E2E A;  2EIL B;  3JAW B;  1ZWI C;  4IHJ A;  1BHB A;  3ZMV A;  3JAK A;  2KSD A;  1OCR B;  1H2M A;  2WWW A;  2Q4P A;  2QEX V;  1V55 C;  2OTL V;  2JK5 C;  3FD9 A;  4MVO A;  3AG4 B;  4F4L A;  1SZX A;  3JAS A;  4IT5 A;  4TV9 B;  2LJ2 A;  1P84 F;  1WLE A;  2VWK A;  2F95 B;  3BA9 A;  3BFR A;  2EJR A;  1XBL A;  3T4D A;  4X64 B;  2IM9 A;  2FKX A;  5CN0 A;  3FX7 A;  3NXS A;  4XBF A;  2FML A;  4N23 A;  1DF5 A;  2F66 C;  1IBM B;  5B1A B;  3EVK A;  1H8E G;  1SES A;  3CS5 A;  1Z5V A;  2QM4 A;  2BTO A;  5KX5 A;  3K5L A;  1H2L A;  3SJB C;  2C2A A;  3UO3 A;  4LFB B;  3QO5 A;  2PI5 A;  2V7Q G;  3APO A;  1OCO B;  3OFN G;  3JAM N;  1AR1 B;  3CSX A;  1OJH A;  1NQT A;  3AEI A;  3JAL B;  4JAU A;  2UUA O;  2N05 A;  1W2B U;  5C8Y B;  1M57 B;  1BQ0 A;  2EUL A;  5LHI A;  2HKO A;  2Y48 A;  1YJ9 V;  1R3J C;  5KA6 A;  4J42 A;  3OTF A;  1MZF A;  3E8H A;  5ITZ B;  1S5J A;  5KHG A;  3N2K A;  3N2G B;  4FPP A;  5J2T A;  4O4I A;  5KHJ A;  3CCJ V;  1TA8 A;  3B09 A;  3OD4 A;  5IYZ A;  2ZM6 B;  3RGB A;  2DWE C;  2LW1 A;  1E1Q G;  5J2U A;  2QR4 A;  1HNZ O;  2WLL B;  1TUB B;  2QGN A;  2YDE A;  2EIM B;  3WB0 A;  1L1F A;  3OGC C;  3U11 A;  5B5E Z;  2GUZ A;  2ZNI A;  4MVZ A;  2ZCE A;  1FXV A;  1V54 B;  3H1K H;  4LR3 A;  1UFI A;  1YDX A;  4JI8 B;  4LF5 B;  4RQE A;  4ZOL B;  3ABK B;  2WA3 A;  5LL6 Y;  2ZQM A;  2P22 C;  4DV3 O;  1GAX A;  5IYD O;  5E1A C;  3E8G A;  1QQC A;  2JEX A;  3L73 H;  4O2A A;  4GYC B;  4Q20 A;  5CBF A;  4XDJ A;  1AVM A;  2BE3 A;  3SPJ A;  1FXK A;  4MSW C;  3ZMS A;  1J5E O;  4H44 B;  1S77 D;  1R73 A;  3BEH A;  4OX9 O;  1W0J G;  4JTC B;  2M7W A;  1OCC C;  2AZ0 A;  1A32 A;  1GK9 A;  4ZI7 A;  2H8P C;  2XUM A;  4YY3 O;  3JD0 A;  3JSN A;  4DK1 A;  5FPO A;  3AG2 B;  3CX5 F;  2A79 B;  3RYI B;  2VWJ A;  3RYH B;  1YIJ V;  2DE0 X;  3T1H O;  4PHZ A;  1QVF U;  3ZED A;  1NTM H;  1FXK C;  4CS3 A;  2UUC B;  4JI1 O;  1WP8 A;  1K4C C;  5CBH A;  4I4T B;  3ZHR A;  4GLX A;  4K3A A;  1HR0 O;  3K5O A;  5LGT A;  1JOY A;  3K5N A;  4X88 A;  4B3S O;  2OCC C;  1M1K W;  3OGI B;  1T5E A;  5JVD B;  3BRC A;  1WPB A;  4FLV A;  4X1K A;  2QM8 A;  4R7C A;  3CXH F;  1SS3 A;  1Q81 W;  1Q6H A;  3SYO A;  4FLT A;  1N32 B;  4KL1 A;  4I50 B;  3QG5 A;  4ZHQ B;  4PA6 A;  2ATK C;  1GRJ A;  5JH7 B;  1RSO A;  2QM7 A;  1WB7 A;  2KB1 A;  1VQK V;  3CRQ A;  2IBZ H;  1FFX B;  2XAF A;  4GKJ O;  2WLJ A;  1FAF A;  2QTS A;  4H0L B;  4WFF A;  3BPZ A;  1MMM A;  2BTQ A;  4G28 B;  1F4M A;  3ABM C;  4RO2 A;  5LYJ B;  2H94 A;  5BY1 A;  1VF5 B;  4YIO A;  2QDO A;  1NU1 H;  3OW2 U;  1IBM O;  4XDK A;  3JAR A;  3BCC H;  4QGP A;  1ZLZ A;  4DV6 B;  5F2V O;  4UCR A;  5JCO A;  2ODM A;  1K73 W;  2CK3 G;  4NTW A;  3ZBH A;  4UCV A;  3CD6 V;  5B1O A;  3AG3 C;  1CP9 A;  3M8A A;  2UU9 B;  4LFB O;  2E3C A;  4IYH A;  2YEV A;  4UCO A;  3B4S A;  2BSK B;  4R8C A;  2JEU A;  1PM9 A;  3R66 A;  4I55 A;  2RNB A;  5LP6 C;  2W6J G;  5KHK A;  1YHQ V;  4RAI A;  4U7O A;  2XTA A;  4X20 B;  3VBB A;  2UXC O;  1OCZ B;  2PY5 A;  3RN4 A;  2ETN A;  1M56 C;  3EHB B;  1KU9 A;  3K9A A;  4LFC B;  3ZRW A;  1Q8I A;  1SQB H;  1G1X B;  1XHX A;  3ZMT A;  1XHZ A;  2JIZ G;  4DV5 B;  4J9Y B;  4JYC A;  1XNQ B;  4MVR A;  3JSL A;  2ZT9 B;  3D36 C;  2R9A A;  3ZIA G;  3K79 A;  5KHI A;  2PYJ A;  1F4N A;  1XL4 A;  2Y69 B;  1OZ0 A;  5L3G A;  1PP9 H;  4W4K A;  5K1X A;  1K5S A;  1AP6 A;  1ZX3 A;  4H13 B;  1M93 A;  5IJ0 A;  2EX3 A;  4DR5 B;  1I5Y A;  1EN4 A;  2NLJ C;  1XEQ A;  4I0X B;  3SPC A;  1IXB A;  4JI8 O;  1GN3 A;  2WPD G;  4WBN B;  4JF3 A;  3K9S A;  1P4R A;  2GTA A;  1BGY H;  4NVP A;  5EZY A;  4AQY O;  2JGD B;  3JCZ A;  2LW7 A;  2QKS A;  4EB6 B;  1KKD A;  2M6Y A;  3DTU B;  4EEQ A;  3G71 V;  3GB7 C;  2ZNJ A;  3CEI A;  1U97 A;  3P30 A;  2QSA A;  4LF7 B;  4O4L B;  3K58 A;  2KG7 B;  4DRX B;  1P7B A;  4UFZ A;  2WLI A;  2F4V B;  3DXR A;  5LOV B;  2WLN A;  3ETE A;  4UB6 Z;  2YXL A;  1AR5 A;  1F7Y A;  2OT5 A;  2OYQ A;  1VQ5 V;  1Y76 B;  3ZS8 C;  2E5L B;  2QKC A;  2F93 B;  1ZSP A;  1SQV H;  3BA8 A;  2DQ0 A;  4P2Z A;  2R70 A;  1Y74 A;  1KEC A;  1ARO P;  4TV9 A; 
#chains in the Genus database with same CATH homology
 3O9O A;  4I0X B;  2KG7 B;  2AZ0 A;  3HR0 A;  4LWS A;  1WA8 B;  3GVM A;  3FAV B;  3TXQ A;  3ZBH A;  4I0X A;  2KG7 A;  3Q4H B;  3FD9 A;  3TXS A;  1WA8 A;  2AZ2 A;  2B9Z A;  4GZR B;  3OGI B;  2VRZ A;  3FAV A;  3G80 A;  4LWS B;  3GWK C;  2DE0 X;  3Q4H A;  2VS0 A;  4ABM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...