4LWSB

Esxa : esxb (semet) hetero-dimer from thermomonospora curvata
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
SPSVSDYTRANFGGLSEGEAQFSMTARALLDELTDLEGKLRAKLDRWDGDAQAAYWNYQKEWDAAAKDMQNVVAQLGVAIREAHDNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Substrates Control Multimerization and Activation of the Multi-Domain ATPase Motor of Type VII Secretion.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Unknown function
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4lwsB00
4LWSB 4I0XB 3TXQA 3FAVA 2VS0A 4LWSA 1WA8A 3FD9A 3G80A 4I0XA 4GZRB 3TXSA 3Q4HB 2KG7B 2AZ2A 3ZBHA 3OGIB 3O9OA 3GWKC 3Q4HA 2KG7A 4ABMA 2B9ZA 2AZ0A 3HR0A 2DE0X 3FAVB 3GVMA 2VRZA 1WA8B
chains in the Genus database with same CATH superfamily
2F95B 2QJ1A 2FMLA 3ABKC 2ZE5A 2FB5A 3MAQA 3B09A 2WLKA 2WLLA 3FKSG 1SQPH 4LNUA 3T1HB 1XQ8A 3E8FA 1PPJH 5H2FZ 4DR3O 1FJGB 2F4VB 1KECA 3ZRSA 1NT2B 1B6QA 3S3XA 2WLLB 3D36A 1NZ6A 3RT3C 1Z2GA 4LNUB 1VQ9V 5IWAB 4I5SA 2N04A 3FFQA 2QGNA 3M7MX 1NR1A 5EIBC 3FB7C 2EZPA 5B3SB 4J10A 3GVMA 1VQOV 4DUYO 4LFAO 1J95A 1QLEB 2WLNA 3ASOB 4O2AA 4PJ0Z 4DV5O 1IURA 1KP3A 2H3OA 5GONA 4UCUA 3HKDB 1E1QG 1BQ0A 1ZTEA 4MSWC 3GWKC 3OM3B 1K3EA 1GAXA 2PYJA 1HR0B 4YJ3B 4X62B 2PZSA 4FM2A 4BAYA 2P4KA 1KB9F 1P49A 1TUBA 5GONB 1BL8A 2VS0A 2GUZA 3CRAA 4FLZA 1Q43A 2IW5A 4K35A 5B5EZ 1FXKC 2CK3G 1I7FA 3G80A 4OGQB 1AP5A 4EKWA 4J9YB 1EN6A 1GMGA 1YF2A 4P9PA 4LFBB 4GX5A 5IYZA 5ITZA 2AHZA 4K8XA 4TV8A 3B77A 1TUBB 3JD4A 1XL6A 1G4YB 2GUZB 4CC5A 1Q7YW 2UUAO 1KBHA 4PDRA 4QGPA 2ZE7A 3HPLC 2YXLA 3W7UA 1RPOA 5IYZB 3DGEA 1SF9A 3KZIZ 5ITZB 4TV8B 3U11A 3OGIB 2UXNA 1UJWB 4GKJO 1PV0A 5KUKA 1JR9A 3AK1A 4TUYB 1FXHA 5BY1A 1YXBA 3PN1A 4FVMA 4YJ2A 2B1IA 1HP8A 3VQXA 1TGOA 1MOFA 2NLJC 2LP7A 4D6TH 1JX9A 4NXMB 3UO2A 2UUBB 4I7ZB 4J7JA 4J9ZB 2XNDG 5IDJA 4NYKA 4FLUA 4EFEA 4YJ2B 3B8NA 4I4TA 1ROPA 1VQ8V 1VQLV 3TK1A 1W0JG 3CCUV 4HBNA 4FFKA 1PL4A 1H2SB 2A7WA 2YSUB 4DR2O 4JI6O 3OW2U 4TSFG 3CS5A 4I4TB 1J5EO 4YHHO 2ADPA 2OIEA 3E86A 3CCEV 1I94O 5HFLA 2HJFC 2W6JG 4B3SO 5LP6C 4UB8Z 4DR1O 5EBLC 2R9RB 1MSDA 2ZIMA 3FYEB 3STZC 2QWRB 5J2UA 2UXBO 4OX9O 5FL7G 1V55B 5AG2A 2RNBA 2EX3A 3AK2A 2ITCC 3DXRA 4LF8B 3T1YO 4JI8O 5JWPA 1EFRG 4UVBA 1Z5VA 2BTOA 1W2BU 2Z5UA 4MVMA 1A32A 3NR7A 5J2UB 3LNMB 2EINB 3T2MA 3DXRB 4CH4A 5LGUA 4W4LA 4DV0B 3H1KH 4FMTA 2QTOA 3W7SA 5IE9A 3CXHF 2D3OW 4DW0A 1M56C 2EZOA 5LOVA 4QNHB 1XMOB 2E74B 1VEWA 3HKEA 4K0KB 4PA3A 1K4CC 2Y4TA 1WPXA 2X6CA 3JD0A 5KHGA 1M93A 4UVCA 3QVNA 4GX0A 1IBMB 1TUEB 1OCRB 2WWWA 5LOVB 1N33O 4DV6B 4I55A 5IYDO 4Q6GA 3HKEB 2UUCO 4JI5O 4NXNB 1TAEA 1QHTA 4R6ZA 2V1DA 4AHCA 2QDOA 4JAUA 5B1BC 2ZT9B 2QTSA 1YITV 1IZ3A 4JTDB 2PY5A 4JAVA 3SJBC 2HHHO 1ZSPA 4P2ZA 1NH2D 4MVZA 3ABMC 5KHJA 1V54C 5CB4A 1GM8A 1HNWO 3SYPA 3A8TA 4I55B 3A0BZ 5JQGA 3I5DA 2AGAA 1EBOA 4BIZA 3JSLA 4CH3A 1N36O 3SJAC 4DK0A 4DR5O 1NQTA 4DR3B 4FZ1A 2X6AA 5CB4B 4DK1A 5JQGB 3HR0A 1SERA 1M5IA 1B04A 1F7YA 4NTYA 2CTPA 2HKOA 1SZXA 1B06A 4LFCB 4D7SA 2DYRC 2H8PC 2JGDA 5LHIA 2PI5A 3ZHQA 3EFFK 1JMKC 1WJZA 3K59A 3FX7A 2WLMA 4WCEV 1SKVA 3C3SA 3BY6A 4MTFA 4RQEA 1VQ7V 1YJWV 5EIBD 2RJZA 4LF7O 3RW0A 1I08A 1NTKH 2FYUH 4JGSA 4CS3A 2VQEB 3G67A 5LXTB 2GDSA 4B3MO 3N27A 5LGNA 4O4JA 3RFRA 1F51A 2IU3A 4JI2O 2FL4A 3RYHA 3QO5A 4B3TB 2YIBD 2O57A 1X59A 4B7EA 4AQYO 3A2FA 1IBKO 3UQ8A 1RP3B 5K1PA 4JYYA 4MTXA 1GM7A 2KG7A 2NN4A 2PF4E 2BCCH 1BT8A 1PNMA 4RUEA 2JJ1G 3CYOA 3LDEA 4DV4O 1ZAUA 3RYHB 2PUSA 4FK5C 2V4DA 4KHPO 2HG5C 4DR7O 1KKDA 1P7GA 1Q5OA 1ZWIC 1PL0A 2XAFA 3FYIB 2P6JA 2KG7B 3ZMZA 1I0HA 3ZMVA 3AK3A 4DUZB 1R6TA 1XBLA 3RVYA 4UCRA 2XASA 5GTHZ 3ETQA 2GHYA 5TISZ 1QLNA 1FFXB 4GKJB 2E75B 1F4MA 3OTOO 2UXCB 3JAKA 3H9VA 5IJ9A 3G4SV 1MSWD 5BR8B 3CRRA 5FPRA 2KSDA 1X4TA 2B5UA 4P9OA 5GW7A 1OCZB 2AW9A 5IY5B 2ZQMA 3UT5A 5F2VO 3OR6C 1DTOA 5BXZA 1FS0G 3W7WA 1H2GA 3L9DA 4JV5B 2A79B 1PNKA 1QU7A 1ZX3A 2ZM6O 5KAIZ 1THZA 2EIKB 4BW9A 1VF7A 5LYJA 4X64B 1BQZA 1MA1A 3OUFA 4XDLA 5K1XA 4QIWF 3CCRV 4TV9A 3UT5B 3FD9A 5DECA 1US6A 1GKFA 2YEVA 3MHHC 3ZIAG 2QKCA 4B3RO 1WP7A 1IXBA 4MT8A 1SQXH 5CA3A 2NNUA 3SYOA 5LYJB 2W6IG 4TV9B 4JI6B 1UFIA 4H0LB 4X66O 2YEVB 1S77D 4DR4O 2X7RB 2QR4A 1DK1A 4I9WA 4ZOLA 3M99B 4J7KA 4DV1B 1LUWA 3JCUZ 1IBLO 4JYAO 4IHJA 5JCOA 4QPJA 4B3SB 1AVMA 3OT7A 5B1NA 1FPOA 3FB5C 1AB3A 3ABLB 4U7NA 4FM1A 3CC7V 1Y74A 1AJQA 3K06A 3KCXA 2LFRA 2ZXWC 4IYHA 3AG4B 4IHJB 4FFBA 2R72A 3ZN1A 2F93B 5KLVH 1H2LA 3PJSK 4G28B 2VQFO 4RWUA 1Y74B 2L6LA 5LHHA 2WAMA 4NVPA 2GBOA 1NTZH 1VQ5V 1VMGA 3OMNB 3ZN0A 2KB1A 3M8AA 4CS4A 4LBEC 1BCCH 4WFFA 3S3WA 1TVKA 4JTAB 2CAZC 5C8YA 1UPGA 1XDCA 4BW5A 3B40A 1RM1C 4KFMA 1N34O 1HNZO 2BSKA 3P30A 2F66C 4JZGA 3OMAB 4GZRB 3KG2A 4LCUC 1SQVH 2X6BA 1TVKB 2IJKA 2EILB 2EIJC 4TQFA 2YXHA 5C8YB 2BE3A 2DOSA 4PDLA 1G8MA 3OE7G 3BEHA 1QNMA 3WG7B 3AG2C 2OYQA 1T5EA 4L8JA 1V9PA 1NJIW 3CC2V 2UUCB 1WP8A 3ETGA 2DQ0A 4JI5B 2BSKB 1M90W 3ML0A 1VQNV 3N2GB 4QJFB 3CJHA 1ZUQA 1GO3F 1NH2B 2HLDG 1XNQB 2AZ2A 5JVDA 2OCHA 4HYOA 4DRXB 3D3QA 3CJHB 3IC7A 1BHBA 2P06A 4DR5B 2JVDA 2Q7HA 2YI9A 2XUMA 4F6RA 5JVDB 2F23A 5CMUA 5EBWC 4X1IA 4UV8A 4BR6A 1BZKA 2KQXA 2IM9A 4NB5A 1BHAA 3AG3C 4NTWA 4Q20A 4U3FH 3L73H 4NKGB 4LF6O 2YIBA 4MW3A 3CCSV 2OTLV 4F6RB 5JJJB 3TXQA 1YJNV 3H1JH 4LF7B 1CEZA 4X1IB 4GLXA 5D5QA 3JSNA 3CCLV 5KUMA 1OCOC 4FLVA 3CE2A 3SPHA 2P7TC 5B3SC 4DV3O 4I9QA 3R66A 2P4VA 1G1XB 1YI2V 1YCIA 4YY3B 1FXKA 2RCVA 2XOKG 1HWYA 3LNNA 1VIBA 4AQYB 2YXYA 4HZ3A 4O2AB 4JTCB 3U10A 3ZEDA 1YEWA 3FAVA 2YUAA 2JDIG 2E5LO 1SQQH 3UO3A 2PGGA 3BHPA 5LMUB 1K33A 3D8CA 1XHZA 2ZR3A 3I55V 1FXKB 1YTFD 2P67A 4JPRA 4X8AA 1EZJA 4PD4F 1ENVA 1XMQB 4WFEA 4LF5O 2AZ0A 4OXSA 3FAVB 2W0XA 3ZRWA 4PELA 3LSQA 5L3FA 2X0LA 2Q7GA 4NTXA 3AG7A 3CHXA 2H94A 1KP2A 3F7YC 4R7CA 3OFNG 2EIMB 3ZRWB 1HW7A 2OT5A 3QO7A 4J42A 4DV7O 4ASUG 4JI1B 5E79Z 4DV2B 4MVOA 3JYCA 2JRIA 3CCJV 4JF3A 2ODMA 2ZM6B 1OHHG 2JS5A 1YJ9V 2GTSA 4E2LA 1M57B 1SZTA 4GX2A 3K5LA 2VRZA 1PP9H 3CWBH 3NXSA 2P90A 3CEIA 4DR6O 3K5MA 2BOBC 4JI3O 3BRCA 3UM7A 1R6NA 4N21A 3RYCA 1AILA 2ZDIC 3CMAV 5LP6A 5LMNB 2ZR2A 1FFTB 3R65A 4CZZA 1EM1A 5JJNB 2EJ7A 5DM6V 4KUMA 2V7QG 2XAGA 3RYCB 2Q7EA 5C93A 5LP6B 2IJHA 1QR8A 2MW2B 5IT9N 1HNXO 4L87A 2N05A 1BS3A 1S3JA 4X1KA 3E22A 1BSMA 3VOUA 1KKCA 4PI0A 1P84F 4JAAA 2Q6AA 2ZCEA 4ZI7A 5J9PC 2VWKA 1Y67A 3TXSA 3E8BA 3K04A 3ETEA 2BOCC 3E22B 2XAHA 1NI8A 2CGOA 2ZINA 1P7BA 2Q67A 1SQBH 4PV1B 1RSOA 3E89A 1Q6UA 3SR2C 2Q4PA 1SQFA 3BA9A 4WBNA 4FM0A 4WF9V 4JI7B 1QVFU 3AG1B 1M56B 1Q8IA 2IU0A 3H1LH 4P30A 5H6RA 3BAAA 2GTAA 1OJHA 1WB8A 1RSOB 1R1BA 1K8AW 3K08A 2UXDO 2QM7A 4WBNB 2YDEA 3ASNC 4E4EA 4HAMA 2RDCA 4LC1A 2XAQA 2JS3A 3UCSC 3K0GA 4LF4O 3QTCA 1KD1W 1VF6C 4GKKO 3B8MA 3CD6V 4EEQA 5H5NA 4TWKA 4QPKA 3STLC 2B9ZA 3ZHSA 5B1BB 2AXTZ 4KXRA 4LF9O 3ABMB 3N2KA 3SYQA 5CBFA 4JYCA 1KU9A 1AI4A 3CB2A 5JH7A 5EZYA 4GT1A 1Y76A 4ZBMA 2B1GA 1DF4A 1AR5A 1MMMA 3APOA 5H9CA 2DWEC 4QE7A 3N2KB 2Y69C 1WPBA 4TT3G 1YSCA 3CRQA 4BIOA 4BIUA 3K9SA 3T1HO 3B2EE 3BABA 3CX5F 3WFVA 4I50A 1FJGO 1Y76B 3IAYA 4FLXA 2DYRB 2FKXA 4K8ZA 4ZHQA 3ZHVA 3KCYA 5L3DA 4DUYB 4LFAB 1Q90D 1NBMG 4ABMA 4DV5B 3TJTA 5IWAO 2JGDB 1SS3A 4YXWG 4I50B 2UU9O 3K5OA 1MNGA 2P22C 3JASA 1S0VA 1MABG 3EXAA 2QWNB 4ZHQB 3ZMUA 4LH6A 1AROP 4CS2A 1PM9A 3JAWA 4ZIBA 3F7VC 1Q3EA 4GX1A 1Y4MA 2Q0AA 4B08A 2LGWA 2E5LB 4O4JB 2DW4A 3O65A 3WB2A 1EN5A 1COWG 1GK9A 2JGUA 3A0HZ 2A3QA 1HR0O 5FPOA 1YTFB 4X62O 2R9IA 4CH6A 4BWAA 4KL1A 4LF5B 2QEXV 3RBZA 2OTJV 1JOYA 2UUAB 2DYSC 2IH1C 4XDKA 2W0FC 4X1YA 5BMVA 2JEUA 4LH7A 3H01A 1WAZA 1LR1A 3L74H 3ZHRA 4DW1A 1AJNA 4FLWA 2D2CB 3OD4A 4LFBO 2DMXA 3ICXA 1H8HG 3ZMSA 3DSQA 2HFEC 3DC5A 5BMVB 4PI2A 2CE4A 2FTKA 1AI6A 1SETA 4TQDA 1S5JA 5EC1C 3JCZA 1L0LH 1GM9A 3JAKB 5IJ9B 5IY5C 1WNSA 4CH5A 1E79G 1TA8A 2Q5ZA 1R73A 3ZX6A 3K57A 4I0XA 1JJ2U 1SRYA 5EYPA 3J81N 3LDCA 3J7AU 4UUJC 3I56V 2UUBO 4JI4O 1AR4A 1PD3A 4A5UB 4DR6B 4RO2A 2UXXA 1MG1A 2YIAA 2XTAA 4JI3B 4XBFA 4DR2B 1BE3H 5EBMC 4I0XB 5FNVA 3EVKA 1L0NH 5EYPB 1J5EB 2ZE8A 1AP6A 2QA4V 4YHHB 1XL4A 1AI7A 1YHQV 1I94B 5L3GA 5KA5A 3TCUA 4DR1B 1WN7A 5CN0A 2ETNA 2WLIA 4ZOLB 1HNXB 2UXBB 4OX9B 4ICGA 4GUNA 2Z0AA 1XOUA 3T1YB 4JI8B 2ZXWB 3VQVA 3LUTB 4G2KA 5KX5A 2WLIB 1LUVA 4YIOA 4HNAA 3SPJA 3VBBA 1Y66A 4N23A 2XT9A 4LF8O 4FFBB 1OCCC 1SA0A 2ILMA 4PA9A 1S76D 5DEDA 1NR7A 1FXVA 5KX5B 1Q81W 4FJCC 4HNAB 3QNEA 2NR5A 3ABTA 1P4RA 4IL6Z 3JALA 4AI8A 5LL6Y 1VQMV 1SA0B 5B1AB 4LWSA 1QCEA 3BFRA 4DV0O 2OCCC 3HKCA 2GV9A 5LA6A 2ZIOA 3JATA 3X2QC 5LHGA 5DN6G 3OUSA 4JYBA 4X9QA 1K5SA 3JALB 1ZL8A 2HVKC 4Z1VA 4O4HA 2EIJB 3ZMTA 1N33B 2Y48A 1QVGU 3QO8A 1FKAO 4FLYA 4LWSB 4K0KO 2YIDA 2QM4A 2EILC 5LA6B 5CBHA 1WA8A 3JATB 1NS1A 1I5YA 4J11A 1GTOA 2YI8A 2HHHB 3B4SA 1EN4A 1ZL8B 1IBMO 1E1RG 1LNQA 4O4HB 3ABKB 4UCVA 1HNWB 4DV6O 3LDDA 1L1FA 4DYLA 1W0KG 2LO1A 1PNLA 4NR1A 1WA8B 2CTQA 1N36B 3CRCA 3L71H 1N32O 2HVJC 1F23A 1XHXA 1M9NA 4X89A 1RPRA 4K3AA 2Q73A 2VWJA 3VQYA 4H13B 3DTUB 1Q82W 1N4CA 2Q68A 3OTFA 4TOIA 3AG3B 1ORQC 3SJQC 1IDSA 2E76B 5H6QA 1YDXA 4F4LA 3IC9A 3SYAA 4LFCO 4B3MB 1R3KC 4LP8A 1CPYA 4UXNA 3HKDA 1QQCA 2UU9B 1OCOB 4JI2B 4B7KA 2Q69A 1QLEC 1Q86W 3HB3B 3ASOC 3D36C 3G6EV 3JD3A 4YJ3A 1H2KA 2HEPA 1IBKB 5CBGA 1PKXA 2VQEO 4MVQA 1N0JA 1K4DC 2XHBA 2K9PA 4FLTA 4DV4B 4B3TO 5KAFZ 1Q6HA 3DC6A 3CP1A 2C2AA 4KHPB 1KMIZ 4DR7B 4JI0O 3TETA 1JVMA 2ARHA 2M6YA 2RQ6A 5BZBA 1N0NA 1VQ4V 3CPWU 1WLEA 3F5TA 1Q6IA 4F6EA 1SESA 1XNRO 2GSMB 4PDMA 2LW7A 2QKSA 2CTRA 1GN2A 1H38A 4U3JA 3OTOB 2ZD9A 3VQWA 1QR9A 3JAMN 4TUYA 1KUQA 4DUZO 4QE9A 3LSSA 4J80A 3SYCA 1KYOF 4OPHA 4UCSA 3H1HH 4ZKIA 2BTQA 3IGAC 1NKDA 3SDLA 2EIMC 1BMFG 1YIJV 4U3JB 4WFGA 2UXCO 4FIPC 3T1CA 1W59A 5B66Z 5BR8O 2QE7G 1JJOA 3ZJZA 5D5PA 2QWPB 3ABUA 5KHKA 1VQPV 1XEQA 4R50A 1KC8W 3IFXA 2P5OA 1JPXA 2BTQB 4JV5O 5L3BA 1NVPD 4B3RB 2ZDIA 1M57C 2DJVA 4JI4B 1R3LC 3K3WA 4X64O 4O4LA 4X66B 5KHHA 3W7TA 4DR4B 2ITDC 4G27B 2OIGA 2YICA 3HKBA 2WSSG 1DGSA 4PA6A 1IBLB 4JYAB 2QM8A 2DWDC 5CA0A 3P3PA 3JARA 4O4LB 3C90A 3ZRXA 1YZBA 4X65O 3GWOA 1OV9A 3QG5A 5L3CA 3L72H 3HKBB 4DV1O 3BCCH 1G6UA 3L70H 1CXZB 5HFMA 3TGUH 1S72V 1F4NA 5CA0B 1K97A 2A0LA 1D5NA 3JARB 2ZNIA 3BA8A 1MZFA 1VP7A 3SPCA 1AR1B 1M1KW 1HDJA 1V55C 5KA6A 2VQFB 4GYCB 4X1KB 2MK3A 3K58A 4PA7A 4IGGA 1ZLZA 5IYBO 4H44B 4O4IA 3ZCCA 4ZI7B 1FYJA 5J2TA 1JA8A 2JIZG 2EINC 2QKAA 3E8HA 4MVUA 3JD2A 3BVOA 4WFAV 2LQTA 3A0RA 2ZKOA 1K34A 3MDSA 1VQ6V 3BPZA 3CRMA 4O4IB 1HNZB 1N34B 5J2TB 3CMEV 3P32A 4PA4A 1QBZA 4PDVA 1VF6A 3CCQV 1NTMH 5JJEB 3CCVV 1JCHA 3AG1C 4MVSA 3SPGA 2LGQA 3G71V 1K7DA 2KKWA 3K79A 5E1AC 3ASNB 1IXMA 2WLJA 2Q8VA 3AEIA 4OPAA 5EC2C 2IJJA 2HP8A 2WA4A 1OCRC 3E8GA 2K1EA 2Y4UA 4FZ0A 2DN9A 2IBZH 4UVAA 4MVRA 1AJPA 4AILC 1JFFA 1V54B 4CBCA 1AI5A 2ATKC 1FD9A 3K0DA 1N32B 3RN4A 1GN4A 2CDYA 1XNQO 1IVSA 2PI4A 3ZHTA 1JFFB 2F1MA 3UKMA 1XUQA 1K73W 2XAJA 1MZEA 4DO2A 4Z2WA 3FB6C 2Y69B 5JH7B 5EZYB 3SPIA 3RGBA 5L3EA 4Z1MG 2F4VO 2PYLA 2Q9LA 3APQA 1O9HA 4JZ2A 3Q4HA 4LF6B 4EFBA 1Y6XA 2QWOB 3OMIB 5KMGA 3K03A 4C7UA 1NU1H 1H2MA 2JEXA 2JJ2G 2A06H 5LXTA 3K5NA 5FLXN 1VARA 1K9MW 4DV3B 5IJ0A 1GRJA 2L35A 3OEHG 1VQKV 2IJIA 1JQ0A 3Q4HB 1O9GA 4H37A 2LJ2A 3ETDA 3RYIA 5KMGB 3P3NA 2G38A 2ZNJA 1YVWA 4WFHA 1XILA 4MTGA 2M7WA 5IJ0B 1FAFA 2LFSA 3OEEG 3JASB 1BGYH 1B3QA 4U7OA 4YY3O 3RWRD 2WA3A 3RYIB 4EB6A 3JAWB 4JI0B 4H33A 4RAIA 2CGNA 4J41A 3D3IA 3WB1A 4JASA 2OWOA 2EJRA 5LMUO 3ZHUA 2YC0A 2DYSB 1XNRB 5CA1A 2QSAA 2CTWA 3CSXA 1XMQO 4EB6B 4W4KA 4GCZA 1VF5B 3E83A 3T4ZA 1FFXA 2F43G 2CUGA 2HJDA 1H8EG 3OGCC 1GN6A 4YIPA 4X1YB 4DV7B 5LGTA 1I5XA 1H2NA 2QWQB 2E3CA 1U97A 5CA1B 4MS2A 3G6BA 3RVZA 2N74A 4IIJA 5B1OA 4J7ZA 1OCZC 4FPPA 3THOA 4DXWA 2A9HA 1R3JC 1SC5B 4RUFA 1OZ0A 3KKYA 4IT5A 4XDJA 1DLBA 4JI1O 5A2QN 4DV2O 2CH7A 2EIKC 1NVPB 1URFA 1N8RW 1M4UA 1XI1A 1R6KA 4IIJB 3U0ZA 4NXMO 2DQ3A 1EZVH 5KHIA 4UFZA 5A9GA 1XREA 5LBQA 3J80N 4WFBV 2CH7B 3ZRVA 3OAAG 1SQGA 2IH3C 1DF5A 4IYIA 4PHZA 1R3IC 2WPDG 3OR7C 4MW8A 3SJCC 3QF7A 5FNVB 3WB0A 4RQFA 3LSUA 5LMNO 4O2BA 1GH6A 4X65B 3W7XA 3MD0A 2EBOA 3F5WC 5GTIZ 4LR3A 4UCOA 2LW1A 3C3TA 1CP9A 1RFYA 3ABLC 3EHBB 1KQSU 3RYFA 2PTMA 5EK0A 3MHSC 2JK5C 4O2BB 3ZS8C 4UV9A 3AG4C 5JCOC 4CC6A 3E35A 1K5QA 3RYFB 4X20A 3GB7C 2WLHA 2ZE6A 1K92A 1OCCB 2AHYA 2R70A 3CC4V 2EULA 1D5AA 3K9AA 1S5HC 2DE0X 4KP4A 1GN3A 2R9AA 2Z3YA 4MTOA 1S5LZ 3CXCU 4R8CA 4X88A 4D7TA 4X20B 1RM1B 2Y0PA 3ZBHA 3L75H 3SGIA 3O9OA 3FB8C 2OCCB 2HR3A 4JI7O 5B1AC 2Q0OC 2UXDB 3X2QB 4UCTA 1XMOO 2RN9A 2RMKB 1U96A 1D2DA 1Z5WA 4LF4B 3WU2Z 3E2EA 3T4DA 1WB7A 3AG2B 4GKKB 3HKCB 3N2GA 5IYCO 3WG7C 3CCMV 1IX9A 3JD1A 4LF9B 3IJ4A 2Y0IA 2YS8A 2ADQB 4NXNO 3H1IH 4DRXA 1L8DA 4UB6Z
chains in the Genus database with same CATH topology
4LWSB 4I0XB 3TXQA 3FAVA 2VS0A 4LWSA 1WA8A 3FD9A 3G80A 4I0XA 4GZRB 3TXSA 3Q4HB 2KG7B 2AZ2A 3ZBHA 3OGIB 3O9OA 3GWKC 3Q4HA 2KG7A 4ABMA 2B9ZA 2AZ0A 3HR0A 2DE0X 3FAVB 3GVMA 2VRZA 1WA8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWS B;  4I0X B;  3TXQ A;  3FAV A;  2VS0 A;  4LWS A;  1WA8 A;  3FD9 A;  3G80 A;  4I0X A;  4GZR B;  3TXS A;  3Q4H B;  2KG7 B;  2AZ2 A;  3ZBH A;  3OGI B;  3O9O A;  3GWK C;  3Q4H A;  2KG7 A;  4ABM A;  2B9Z A;  2AZ0 A;  3HR0 A;  2DE0 X;  3FAV B;  3GVM A;  2VRZ A;  1WA8 B; 
#chains in the Genus database with same CATH topology
 2F95 B;  2QJ1 A;  2FML A;  3ABK C;  2ZE5 A;  2FB5 A;  3MAQ A;  3B09 A;  2WLK A;  2WLL A;  3FKS G;  1SQP H;  4LNU A;  3T1H B;  1XQ8 A;  3E8F A;  1PPJ H;  5H2F Z;  4DR3 O;  1FJG B;  2F4V B;  1KEC A;  3ZRS A;  1NT2 B;  1B6Q A;  3S3X A;  2WLL B;  3D36 A;  1NZ6 A;  3RT3 C;  1Z2G A;  4LNU B;  1VQ9 V;  5IWA B;  4I5S A;  2N04 A;  3FFQ A;  2QGN A;  3M7M X;  1NR1 A;  5EIB C;  3FB7 C;  2EZP A;  5B3S B;  4J10 A;  3GVM A;  1VQO V;  4DUY O;  4LFA O;  1J95 A;  1QLE B;  2WLN A;  3ASO B;  4O2A A;  4PJ0 Z;  4DV5 O;  1IUR A;  1KP3 A;  2H3O A;  5GON A;  4UCU A;  3HKD B;  1E1Q G;  1BQ0 A;  1ZTE A;  4MSW C;  3GWK C;  3OM3 B;  1K3E A;  1GAX A;  2PYJ A;  1HR0 B;  4YJ3 B;  4X62 B;  2PZS A;  4FM2 A;  4BAY A;  2P4K A;  1KB9 F;  1P49 A;  1TUB A;  5GON B;  1BL8 A;  2VS0 A;  2GUZ A;  3CRA A;  4FLZ A;  1Q43 A;  2IW5 A;  4K35 A;  5B5E Z;  1FXK C;  2CK3 G;  1I7F A;  3G80 A;  4OGQ B;  1AP5 A;  4EKW A;  4J9Y B;  1EN6 A;  1GMG A;  1YF2 A;  4P9P A;  4LFB B;  4GX5 A;  5IYZ A;  5ITZ A;  2AHZ A;  4K8X A;  4TV8 A;  3B77 A;  1TUB B;  3JD4 A;  1XL6 A;  1G4Y B;  2GUZ B;  4CC5 A;  1Q7Y W;  2UUA O;  1KBH A;  4PDR A;  4QGP A;  2ZE7 A;  3HPL C;  2YXL A;  3W7U A;  1RPO A;  5IYZ B;  3DGE A;  1SF9 A;  3KZI Z;  5ITZ B;  4TV8 B;  3U11 A;  3OGI B;  2UXN A;  1UJW B;  4GKJ O;  1PV0 A;  5KUK A;  1JR9 A;  3AK1 A;  4TUY B;  1FXH A;  5BY1 A;  1YXB A;  3PN1 A;  4FVM A;  4YJ2 A;  2B1I A;  1HP8 A;  3VQX A;  1TGO A;  1MOF A;  2NLJ C;  2LP7 A;  4D6T H;  1JX9 A;  4NXM B;  3UO2 A;  2UUB B;  4I7Z B;  4J7J A;  4J9Z B;  2XND G;  5IDJ A;  4NYK A;  4FLU A;  4EFE A;  4YJ2 B;  3B8N A;  4I4T A;  1ROP A;  1VQ8 V;  1VQL V;  3TK1 A;  1W0J G;  3CCU V;  4HBN A;  4FFK A;  1PL4 A;  1H2S B;  2A7W A;  2YSU B;  4DR2 O;  4JI6 O;  3OW2 U;  4TSF G;  3CS5 A;  4I4T B;  1J5E O;  4YHH O;  2ADP A;  2OIE A;  3E86 A;  3CCE V;  1I94 O;  5HFL A;  2HJF C;  2W6J G;  4B3S O;  5LP6 C;  4UB8 Z;  4DR1 O;  5EBL C;  2R9R B;  1MSD A;  2ZIM A;  3FYE B;  3STZ C;  2QWR B;  5J2U A;  2UXB O;  4OX9 O;  5FL7 G;  1V55 B;  5AG2 A;  2RNB A;  2EX3 A;  3AK2 A;  2ITC C;  3DXR A;  4LF8 B;  3T1Y O;  4JI8 O;  5JWP A;  1EFR G;  4UVB A;  1Z5V A;  2BTO A;  1W2B U;  2Z5U A;  4MVM A;  1A32 A;  3NR7 A;  5J2U B;  3LNM B;  2EIN B;  3T2M A;  3DXR B;  4CH4 A;  5LGU A;  4W4L A;  4DV0 B;  3H1K H;  4FMT A;  2QTO A;  3W7S A;  5IE9 A;  3CXH F;  2D3O W;  4DW0 A;  1M56 C;  2EZO A;  5LOV A;  4QNH B;  1XMO B;  2E74 B;  1VEW A;  3HKE A;  4K0K B;  4PA3 A;  1K4C C;  2Y4T A;  1WPX A;  2X6C A;  3JD0 A;  5KHG A;  1M93 A;  4UVC A;  3QVN A;  4GX0 A;  1IBM B;  1TUE B;  1OCR B;  2WWW A;  5LOV B;  1N33 O;  4DV6 B;  4I55 A;  5IYD O;  4Q6G A;  3HKE B;  2UUC O;  4JI5 O;  4NXN B;  1TAE A;  1QHT A;  4R6Z A;  2V1D A;  4AHC A;  2QDO A;  4JAU A;  5B1B C;  2ZT9 B;  2QTS A;  1YIT V;  1IZ3 A;  4JTD B;  2PY5 A;  4JAV A;  3SJB C;  2HHH O;  1ZSP A;  4P2Z A;  1NH2 D;  4MVZ A;  3ABM C;  5KHJ A;  1V54 C;  5CB4 A;  1GM8 A;  1HNW O;  3SYP A;  3A8T A;  4I55 B;  3A0B Z;  5JQG A;  3I5D A;  2AGA A;  1EBO A;  4BIZ A;  3JSL A;  4CH3 A;  1N36 O;  3SJA C;  4DK0 A;  4DR5 O;  1NQT A;  4DR3 B;  4FZ1 A;  2X6A A;  5CB4 B;  4DK1 A;  5JQG B;  3HR0 A;  1SER A;  1M5I A;  1B04 A;  1F7Y A;  4NTY A;  2CTP A;  2HKO A;  1SZX A;  1B06 A;  4LFC B;  4D7S A;  2DYR C;  2H8P C;  2JGD A;  5LHI A;  2PI5 A;  3ZHQ A;  3EFF K;  1JMK C;  1WJZ A;  3K59 A;  3FX7 A;  2WLM A;  4WCE V;  1SKV A;  3C3S A;  3BY6 A;  4MTF A;  4RQE A;  1VQ7 V;  1YJW V;  5EIB D;  2RJZ A;  4LF7 O;  3RW0 A;  1I08 A;  1NTK H;  2FYU H;  4JGS A;  4CS3 A;  2VQE B;  3G67 A;  5LXT B;  2GDS A;  4B3M O;  3N27 A;  5LGN A;  4O4J A;  3RFR A;  1F51 A;  2IU3 A;  4JI2 O;  2FL4 A;  3RYH A;  3QO5 A;  4B3T B;  2YIB D;  2O57 A;  1X59 A;  4B7E A;  4AQY O;  3A2F A;  1IBK O;  3UQ8 A;  1RP3 B;  5K1P A;  4JYY A;  4MTX A;  1GM7 A;  2KG7 A;  2NN4 A;  2PF4 E;  2BCC H;  1BT8 A;  1PNM A;  4RUE A;  2JJ1 G;  3CYO A;  3LDE A;  4DV4 O;  1ZAU A;  3RYH B;  2PUS A;  4FK5 C;  2V4D A;  4KHP O;  2HG5 C;  4DR7 O;  1KKD A;  1P7G A;  1Q5O A;  1ZWI C;  1PL0 A;  2XAF A;  3FYI B;  2P6J A;  2KG7 B;  3ZMZ A;  1I0H A;  3ZMV A;  3AK3 A;  4DUZ B;  1R6T A;  1XBL A;  3RVY A;  4UCR A;  2XAS A;  5GTH Z;  3ETQ A;  2GHY A;  5TIS Z;  1QLN A;  1FFX B;  4GKJ B;  2E75 B;  1F4M A;  3OTO O;  2UXC B;  3JAK A;  3H9V A;  5IJ9 A;  3G4S V;  1MSW D;  5BR8 B;  3CRR A;  5FPR A;  2KSD A;  1X4T A;  2B5U A;  4P9O A;  5GW7 A;  1OCZ B;  2AW9 A;  5IY5 B;  2ZQM A;  3UT5 A;  5F2V O;  3OR6 C;  1DTO A;  5BXZ A;  1FS0 G;  3W7W A;  1H2G A;  3L9D A;  4JV5 B;  2A79 B;  1PNK A;  1QU7 A;  1ZX3 A;  2ZM6 O;  5KAI Z;  1THZ A;  2EIK B;  4BW9 A;  1VF7 A;  5LYJ A;  4X64 B;  1BQZ A;  1MA1 A;  3OUF A;  4XDL A;  5K1X A;  4QIW F;  3CCR V;  4TV9 A;  3UT5 B;  3FD9 A;  5DEC A;  1US6 A;  1GKF A;  2YEV A;  3MHH C;  3ZIA G;  2QKC A;  4B3R O;  1WP7 A;  1IXB A;  4MT8 A;  1SQX H;  5CA3 A;  2NNU A;  3SYO A;  5LYJ B;  2W6I G;  4TV9 B;  4JI6 B;  1UFI A;  4H0L B;  4X66 O;  2YEV B;  1S77 D;  4DR4 O;  2X7R B;  2QR4 A;  1DK1 A;  4I9W A;  4ZOL A;  3M99 B;  4J7K A;  4DV1 B;  1LUW A;  3JCU Z;  1IBL O;  4JYA O;  4IHJ A;  5JCO A;  4QPJ A;  4B3S B;  1AVM A;  3OT7 A;  5B1N A;  1FPO A;  3FB5 C;  1AB3 A;  3ABL B;  4U7N A;  4FM1 A;  3CC7 V;  1Y74 A;  1AJQ A;  3K06 A;  3KCX A;  2LFR A;  2ZXW C;  4IYH A;  3AG4 B;  4IHJ B;  4FFB A;  2R72 A;  3ZN1 A;  2F93 B;  5KLV H;  1H2L A;  3PJS K;  4G28 B;  2VQF O;  4RWU A;  1Y74 B;  2L6L A;  5LHH A;  2WAM A;  4NVP A;  2GBO A;  1NTZ H;  1VQ5 V;  1VMG A;  3OMN B;  3ZN0 A;  2KB1 A;  3M8A A;  4CS4 A;  4LBE C;  1BCC H;  4WFF A;  3S3W A;  1TVK A;  4JTA B;  2CAZ C;  5C8Y A;  1UPG A;  1XDC A;  4BW5 A;  3B40 A;  1RM1 C;  4KFM A;  1N34 O;  1HNZ O;  2BSK A;  3P30 A;  2F66 C;  4JZG A;  3OMA B;  4GZR B;  3KG2 A;  4LCU C;  1SQV H;  2X6B A;  1TVK B;  2IJK A;  2EIL B;  2EIJ C;  4TQF A;  2YXH A;  5C8Y B;  2BE3 A;  2DOS A;  4PDL A;  1G8M A;  3OE7 G;  3BEH A;  1QNM A;  3WG7 B;  3AG2 C;  2OYQ A;  1T5E A;  4L8J A;  1V9P A;  1NJI W;  3CC2 V;  2UUC B;  1WP8 A;  3ETG A;  2DQ0 A;  4JI5 B;  2BSK B;  1M90 W;  3ML0 A;  1VQN V;  3N2G B;  4QJF B;  3CJH A;  1ZUQ A;  1GO3 F;  1NH2 B;  2HLD G;  1XNQ B;  2AZ2 A;  5JVD A;  2OCH A;  4HYO A;  4DRX B;  3D3Q A;  3CJH B;  3IC7 A;  1BHB A;  2P06 A;  4DR5 B;  2JVD A;  2Q7H A;  2YI9 A;  2XUM A;  4F6R A;  5JVD B;  2F23 A;  5CMU A;  5EBW C;  4X1I A;  4UV8 A;  4BR6 A;  1BZK A;  2KQX A;  2IM9 A;  4NB5 A;  1BHA A;  3AG3 C;  4NTW A;  4Q20 A;  4U3F H;  3L73 H;  4NKG B;  4LF6 O;  2YIB A;  4MW3 A;  3CCS V;  2OTL V;  4F6R B;  5JJJ B;  3TXQ A;  1YJN V;  3H1J H;  4LF7 B;  1CEZ A;  4X1I B;  4GLX A;  5D5Q A;  3JSN A;  3CCL V;  5KUM A;  1OCO C;  4FLV A;  3CE2 A;  3SPH A;  2P7T C;  5B3S C;  4DV3 O;  4I9Q A;  3R66 A;  2P4V A;  1G1X B;  1YI2 V;  1YCI A;  4YY3 B;  1FXK A;  2RCV A;  2XOK G;  1HWY A;  3LNN A;  1VIB A;  4AQY B;  2YXY A;  4HZ3 A;  4O2A B;  4JTC B;  3U10 A;  3ZED A;  1YEW A;  3FAV A;  2YUA A;  2JDI G;  2E5L O;  1SQQ H;  3UO3 A;  2PGG A;  3BHP A;  5LMU B;  1K33 A;  3D8C A;  1XHZ A;  2ZR3 A;  3I55 V;  1FXK B;  1YTF D;  2P67 A;  4JPR A;  4X8A A;  1EZJ A;  4PD4 F;  1ENV A;  1XMQ B;  4WFE A;  4LF5 O;  2AZ0 A;  4OXS A;  3FAV B;  2W0X A;  3ZRW A;  4PEL A;  3LSQ A;  5L3F A;  2X0L A;  2Q7G A;  4NTX A;  3AG7 A;  3CHX A;  2H94 A;  1KP2 A;  3F7Y C;  4R7C A;  3OFN G;  2EIM B;  3ZRW B;  1HW7 A;  2OT5 A;  3QO7 A;  4J42 A;  4DV7 O;  4ASU G;  4JI1 B;  5E79 Z;  4DV2 B;  4MVO A;  3JYC A;  2JRI A;  3CCJ V;  4JF3 A;  2ODM A;  2ZM6 B;  1OHH G;  2JS5 A;  1YJ9 V;  2GTS A;  4E2L A;  1M57 B;  1SZT A;  4GX2 A;  3K5L A;  2VRZ A;  1PP9 H;  3CWB H;  3NXS A;  2P90 A;  3CEI A;  4DR6 O;  3K5M A;  2BOB C;  4JI3 O;  3BRC A;  3UM7 A;  1R6N A;  4N21 A;  3RYC A;  1AIL A;  2ZDI C;  3CMA V;  5LP6 A;  5LMN B;  2ZR2 A;  1FFT B;  3R65 A;  4CZZ A;  1EM1 A;  5JJN B;  2EJ7 A;  5DM6 V;  4KUM A;  2V7Q G;  2XAG A;  3RYC B;  2Q7E A;  5C93 A;  5LP6 B;  2IJH A;  1QR8 A;  2MW2 B;  5IT9 N;  1HNX O;  4L87 A;  2N05 A;  1BS3 A;  1S3J A;  4X1K A;  3E22 A;  1BSM A;  3VOU A;  1KKC A;  4PI0 A;  1P84 F;  4JAA A;  2Q6A A;  2ZCE A;  4ZI7 A;  5J9P C;  2VWK A;  1Y67 A;  3TXS A;  3E8B A;  3K04 A;  3ETE A;  2BOC C;  3E22 B;  2XAH A;  1NI8 A;  2CGO A;  2ZIN A;  1P7B A;  2Q67 A;  1SQB H;  4PV1 B;  1RSO A;  3E89 A;  1Q6U A;  3SR2 C;  2Q4P A;  1SQF A;  3BA9 A;  4WBN A;  4FM0 A;  4WF9 V;  4JI7 B;  1QVF U;  3AG1 B;  1M56 B;  1Q8I A;  2IU0 A;  3H1L H;  4P30 A;  5H6R A;  3BAA A;  2GTA A;  1OJH A;  1WB8 A;  1RSO B;  1R1B A;  1K8A W;  3K08 A;  2UXD O;  2QM7 A;  4WBN B;  2YDE A;  3ASN C;  4E4E A;  4HAM A;  2RDC A;  4LC1 A;  2XAQ A;  2JS3 A;  3UCS C;  3K0G A;  4LF4 O;  3QTC A;  1KD1 W;  1VF6 C;  4GKK O;  3B8M A;  3CD6 V;  4EEQ A;  5H5N A;  4TWK A;  4QPK A;  3STL C;  2B9Z A;  3ZHS A;  5B1B B;  2AXT Z;  4KXR A;  4LF9 O;  3ABM B;  3N2K A;  3SYQ A;  5CBF A;  4JYC A;  1KU9 A;  1AI4 A;  3CB2 A;  5JH7 A;  5EZY A;  4GT1 A;  1Y76 A;  4ZBM A;  2B1G A;  1DF4 A;  1AR5 A;  1MMM A;  3APO A;  5H9C A;  2DWE C;  4QE7 A;  3N2K B;  2Y69 C;  1WPB A;  4TT3 G;  1YSC A;  3CRQ A;  4BIO A;  4BIU A;  3K9S A;  3T1H O;  3B2E E;  3BAB A;  3CX5 F;  3WFV A;  4I50 A;  1FJG O;  1Y76 B;  3IAY A;  4FLX A;  2DYR B;  2FKX A;  4K8Z A;  4ZHQ A;  3ZHV A;  3KCY A;  5L3D A;  4DUY B;  4LFA B;  1Q90 D;  1NBM G;  4ABM A;  4DV5 B;  3TJT A;  5IWA O;  2JGD B;  1SS3 A;  4YXW G;  4I50 B;  2UU9 O;  3K5O A;  1MNG A;  2P22 C;  3JAS A;  1S0V A;  1MAB G;  3EXA A;  2QWN B;  4ZHQ B;  3ZMU A;  4LH6 A;  1ARO P;  4CS2 A;  1PM9 A;  3JAW A;  4ZIB A;  3F7V C;  1Q3E A;  4GX1 A;  1Y4M A;  2Q0A A;  4B08 A;  2LGW A;  2E5L B;  4O4J B;  2DW4 A;  3O65 A;  3WB2 A;  1EN5 A;  1COW G;  1GK9 A;  2JGU A;  3A0H Z;  2A3Q A;  1HR0 O;  5FPO A;  1YTF B;  4X62 O;  2R9I A;  4CH6 A;  4BWA A;  4KL1 A;  4LF5 B;  2QEX V;  3RBZ A;  2OTJ V;  1JOY A;  2UUA B;  2DYS C;  2IH1 C;  4XDK A;  2W0F C;  4X1Y A;  5BMV A;  2JEU A;  4LH7 A;  3H01 A;  1WAZ A;  1LR1 A;  3L74 H;  3ZHR A;  4DW1 A;  1AJN A;  4FLW A;  2D2C B;  3OD4 A;  4LFB O;  2DMX A;  3ICX A;  1H8H G;  3ZMS A;  3DSQ A;  2HFE C;  3DC5 A;  5BMV B;  4PI2 A;  2CE4 A;  2FTK A;  1AI6 A;  1SET A;  4TQD A;  1S5J A;  5EC1 C;  3JCZ A;  1L0L H;  1GM9 A;  3JAK B;  5IJ9 B;  5IY5 C;  1WNS A;  4CH5 A;  1E79 G;  1TA8 A;  2Q5Z A;  1R73 A;  3ZX6 A;  3K57 A;  4I0X A;  1JJ2 U;  1SRY A;  5EYP A;  3J81 N;  3LDC A;  3J7A U;  4UUJ C;  3I56 V;  2UUB O;  4JI4 O;  1AR4 A;  1PD3 A;  4A5U B;  4DR6 B;  4RO2 A;  2UXX A;  1MG1 A;  2YIA A;  2XTA A;  4JI3 B;  4XBF A;  4DR2 B;  1BE3 H;  5EBM C;  4I0X B;  5FNV A;  3EVK A;  1L0N H;  5EYP B;  1J5E B;  2ZE8 A;  1AP6 A;  2QA4 V;  4YHH B;  1XL4 A;  1AI7 A;  1YHQ V;  1I94 B;  5L3G A;  5KA5 A;  3TCU A;  4DR1 B;  1WN7 A;  5CN0 A;  2ETN A;  2WLI A;  4ZOL B;  1HNX B;  2UXB B;  4OX9 B;  4ICG A;  4GUN A;  2Z0A A;  1XOU A;  3T1Y B;  4JI8 B;  2ZXW B;  3VQV A;  3LUT B;  4G2K A;  5KX5 A;  2WLI B;  1LUV A;  4YIO A;  4HNA A;  3SPJ A;  3VBB A;  1Y66 A;  4N23 A;  2XT9 A;  4LF8 O;  4FFB B;  1OCC C;  1SA0 A;  2ILM A;  4PA9 A;  1S76 D;  5DED A;  1NR7 A;  1FXV A;  5KX5 B;  1Q81 W;  4FJC C;  4HNA B;  3QNE A;  2NR5 A;  3ABT A;  1P4R A;  4IL6 Z;  3JAL A;  4AI8 A;  5LL6 Y;  1VQM V;  1SA0 B;  5B1A B;  4LWS A;  1QCE A;  3BFR A;  4DV0 O;  2OCC C;  3HKC A;  2GV9 A;  5LA6 A;  2ZIO A;  3JAT A;  3X2Q C;  5LHG A;  5DN6 G;  3OUS A;  4JYB A;  4X9Q A;  1K5S A;  3JAL B;  1ZL8 A;  2HVK C;  4Z1V A;  4O4H A;  2EIJ B;  3ZMT A;  1N33 B;  2Y48 A;  1QVG U;  3QO8 A;  1FKA O;  4FLY A;  4LWS B;  4K0K O;  2YID A;  2QM4 A;  2EIL C;  5LA6 B;  5CBH A;  1WA8 A;  3JAT B;  1NS1 A;  1I5Y A;  4J11 A;  1GTO A;  2YI8 A;  2HHH B;  3B4S A;  1EN4 A;  1ZL8 B;  1IBM O;  1E1R G;  1LNQ A;  4O4H B;  3ABK B;  4UCV A;  1HNW B;  4DV6 O;  3LDD A;  1L1F A;  4DYL A;  1W0K G;  2LO1 A;  1PNL A;  4NR1 A;  1WA8 B;  2CTQ A;  1N36 B;  3CRC A;  3L71 H;  1N32 O;  2HVJ C;  1F23 A;  1XHX A;  1M9N A;  4X89 A;  1RPR A;  4K3A A;  2Q73 A;  2VWJ A;  3VQY A;  4H13 B;  3DTU B;  1Q82 W;  1N4C A;  2Q68 A;  3OTF A;  4TOI A;  3AG3 B;  1ORQ C;  3SJQ C;  1IDS A;  2E76 B;  5H6Q A;  1YDX A;  4F4L A;  3IC9 A;  3SYA A;  4LFC O;  4B3M B;  1R3K C;  4LP8 A;  1CPY A;  4UXN A;  3HKD A;  1QQC A;  2UU9 B;  1OCO B;  4JI2 B;  4B7K A;  2Q69 A;  1QLE C;  1Q86 W;  3HB3 B;  3ASO C;  3D36 C;  3G6E V;  3JD3 A;  4YJ3 A;  1H2K A;  2HEP A;  1IBK B;  5CBG A;  1PKX A;  2VQE O;  4MVQ A;  1N0J A;  1K4D C;  2XHB A;  2K9P A;  4FLT A;  4DV4 B;  4B3T O;  5KAF Z;  1Q6H A;  3DC6 A;  3CP1 A;  2C2A A;  4KHP B;  1KMI Z;  4DR7 B;  4JI0 O;  3TET A;  1JVM A;  2ARH A;  2M6Y A;  2RQ6 A;  5BZB A;  1N0N A;  1VQ4 V;  3CPW U;  1WLE A;  3F5T A;  1Q6I A;  4F6E A;  1SES A;  1XNR O;  2GSM B;  4PDM A;  2LW7 A;  2QKS A;  2CTR A;  1GN2 A;  1H38 A;  4U3J A;  3OTO B;  2ZD9 A;  3VQW A;  1QR9 A;  3JAM N;  4TUY A;  1KUQ A;  4DUZ O;  4QE9 A;  3LSS A;  4J80 A;  3SYC A;  1KYO F;  4OPH A;  4UCS A;  3H1H H;  4ZKI A;  2BTQ A;  3IGA C;  1NKD A;  3SDL A;  2EIM C;  1BMF G;  1YIJ V;  4U3J B;  4WFG A;  2UXC O;  4FIP C;  3T1C A;  1W59 A;  5B66 Z;  5BR8 O;  2QE7 G;  1JJO A;  3ZJZ A;  5D5P A;  2QWP B;  3ABU A;  5KHK A;  1VQP V;  1XEQ A;  4R50 A;  1KC8 W;  3IFX A;  2P5O A;  1JPX A;  2BTQ B;  4JV5 O;  5L3B A;  1NVP D;  4B3R B;  2ZDI A;  1M57 C;  2DJV A;  4JI4 B;  1R3L C;  3K3W A;  4X64 O;  4O4L A;  4X66 B;  5KHH A;  3W7T A;  4DR4 B;  2ITD C;  4G27 B;  2OIG A;  2YIC A;  3HKB A;  2WSS G;  1DGS A;  4PA6 A;  1IBL B;  4JYA B;  2QM8 A;  2DWD C;  5CA0 A;  3P3P A;  3JAR A;  4O4L B;  3C90 A;  3ZRX A;  1YZB A;  4X65 O;  3GWO A;  1OV9 A;  3QG5 A;  5L3C A;  3L72 H;  3HKB B;  4DV1 O;  3BCC H;  1G6U A;  3L70 H;  1CXZ B;  5HFM A;  3TGU H;  1S72 V;  1F4N A;  5CA0 B;  1K97 A;  2A0L A;  1D5N A;  3JAR B;  2ZNI A;  3BA8 A;  1MZF A;  1VP7 A;  3SPC A;  1AR1 B;  1M1K W;  1HDJ A;  1V55 C;  5KA6 A;  2VQF B;  4GYC B;  4X1K B;  2MK3 A;  3K58 A;  4PA7 A;  4IGG A;  1ZLZ A;  5IYB O;  4H44 B;  4O4I A;  3ZCC A;  4ZI7 B;  1FYJ A;  5J2T A;  1JA8 A;  2JIZ G;  2EIN C;  2QKA A;  3E8H A;  4MVU A;  3JD2 A;  3BVO A;  4WFA V;  2LQT A;  3A0R A;  2ZKO A;  1K34 A;  3MDS A;  1VQ6 V;  3BPZ A;  3CRM A;  4O4I B;  1HNZ B;  1N34 B;  5J2T B;  3CME V;  3P32 A;  4PA4 A;  1QBZ A;  4PDV A;  1VF6 A;  3CCQ V;  1NTM H;  5JJE B;  3CCV V;  1JCH A;  3AG1 C;  4MVS A;  3SPG A;  2LGQ A;  3G71 V;  1K7D A;  2KKW A;  3K79 A;  5E1A C;  3ASN B;  1IXM A;  2WLJ A;  2Q8V A;  3AEI A;  4OPA A;  5EC2 C;  2IJJ A;  2HP8 A;  2WA4 A;  1OCR C;  3E8G A;  2K1E A;  2Y4U A;  4FZ0 A;  2DN9 A;  2IBZ H;  4UVA A;  4MVR A;  1AJP A;  4AIL C;  1JFF A;  1V54 B;  4CBC A;  1AI5 A;  2ATK C;  1FD9 A;  3K0D A;  1N32 B;  3RN4 A;  1GN4 A;  2CDY A;  1XNQ O;  1IVS A;  2PI4 A;  3ZHT A;  1JFF B;  2F1M A;  3UKM A;  1XUQ A;  1K73 W;  2XAJ A;  1MZE A;  4DO2 A;  4Z2W A;  3FB6 C;  2Y69 B;  5JH7 B;  5EZY B;  3SPI A;  3RGB A;  5L3E A;  4Z1M G;  2F4V O;  2PYL A;  2Q9L A;  3APQ A;  1O9H A;  4JZ2 A;  3Q4H A;  4LF6 B;  4EFB A;  1Y6X A;  2QWO B;  3OMI B;  5KMG A;  3K03 A;  4C7U A;  1NU1 H;  1H2M A;  2JEX A;  2JJ2 G;  2A06 H;  5LXT A;  3K5N A;  5FLX N;  1VAR A;  1K9M W;  4DV3 B;  5IJ0 A;  1GRJ A;  2L35 A;  3OEH G;  1VQK V;  2IJI A;  1JQ0 A;  3Q4H B;  1O9G A;  4H37 A;  2LJ2 A;  3ETD A;  3RYI A;  5KMG B;  3P3N A;  2G38 A;  2ZNJ A;  1YVW A;  4WFH A;  1XIL A;  4MTG A;  2M7W A;  5IJ0 B;  1FAF A;  2LFS A;  3OEE G;  3JAS B;  1BGY H;  1B3Q A;  4U7O A;  4YY3 O;  3RWR D;  2WA3 A;  3RYI B;  4EB6 A;  3JAW B;  4JI0 B;  4H33 A;  4RAI A;  2CGN A;  4J41 A;  3D3I A;  3WB1 A;  4JAS A;  2OWO A;  2EJR A;  5LMU O;  3ZHU A;  2YC0 A;  2DYS B;  1XNR B;  5CA1 A;  2QSA A;  2CTW A;  3CSX A;  1XMQ O;  4EB6 B;  4W4K A;  4GCZ A;  1VF5 B;  3E83 A;  3T4Z A;  1FFX A;  2F43 G;  2CUG A;  2HJD A;  1H8E G;  3OGC C;  1GN6 A;  4YIP A;  4X1Y B;  4DV7 B;  5LGT A;  1I5X A;  1H2N A;  2QWQ B;  2E3C A;  1U97 A;  5CA1 B;  4MS2 A;  3G6B A;  3RVZ A;  2N74 A;  4IIJ A;  5B1O A;  4J7Z A;  1OCZ C;  4FPP A;  3THO A;  4DXW A;  2A9H A;  1R3J C;  1SC5 B;  4RUF A;  1OZ0 A;  3KKY A;  4IT5 A;  4XDJ A;  1DLB A;  4JI1 O;  5A2Q N;  4DV2 O;  2CH7 A;  2EIK C;  1NVP B;  1URF A;  1N8R W;  1M4U A;  1XI1 A;  1R6K A;  4IIJ B;  3U0Z A;  4NXM O;  2DQ3 A;  1EZV H;  5KHI A;  4UFZ A;  5A9G A;  1XRE A;  5LBQ A;  3J80 N;  4WFB V;  2CH7 B;  3ZRV A;  3OAA G;  1SQG A;  2IH3 C;  1DF5 A;  4IYI A;  4PHZ A;  1R3I C;  2WPD G;  3OR7 C;  4MW8 A;  3SJC C;  3QF7 A;  5FNV B;  3WB0 A;  4RQF A;  3LSU A;  5LMN O;  4O2B A;  1GH6 A;  4X65 B;  3W7X A;  3MD0 A;  2EBO A;  3F5W C;  5GTI Z;  4LR3 A;  4UCO A;  2LW1 A;  3C3T A;  1CP9 A;  1RFY A;  3ABL C;  3EHB B;  1KQS U;  3RYF A;  2PTM A;  5EK0 A;  3MHS C;  2JK5 C;  4O2B B;  3ZS8 C;  4UV9 A;  3AG4 C;  5JCO C;  4CC6 A;  3E35 A;  1K5Q A;  3RYF B;  4X20 A;  3GB7 C;  2WLH A;  2ZE6 A;  1K92 A;  1OCC B;  2AHY A;  2R70 A;  3CC4 V;  2EUL A;  1D5A A;  3K9A A;  1S5H C;  2DE0 X;  4KP4 A;  1GN3 A;  2R9A A;  2Z3Y A;  4MTO A;  1S5L Z;  3CXC U;  4R8C A;  4X88 A;  4D7T A;  4X20 B;  1RM1 B;  2Y0P A;  3ZBH A;  3L75 H;  3SGI A;  3O9O A;  3FB8 C;  2OCC B;  2HR3 A;  4JI7 O;  5B1A C;  2Q0O C;  2UXD B;  3X2Q B;  4UCT A;  1XMO O;  2RN9 A;  2RMK B;  1U96 A;  1D2D A;  1Z5W A;  4LF4 B;  3WU2 Z;  3E2E A;  3T4D A;  1WB7 A;  3AG2 B;  4GKK B;  3HKC B;  3N2G A;  5IYC O;  3WG7 C;  3CCM V;  1IX9 A;  3JD1 A;  4LF9 B;  3IJ4 A;  2Y0I A;  2YS8 A;  2ADQ B;  4NXN O;  3H1I H;  4DRX A;  1L8D A;  4UB6 Z; 
#chains in the Genus database with same CATH homology
 4LWS B;  4I0X B;  3TXQ A;  3FAV A;  2VS0 A;  4LWS A;  1WA8 A;  3FD9 A;  3G80 A;  4I0X A;  4GZR B;  3TXS A;  3Q4H B;  2KG7 B;  2AZ2 A;  3ZBH A;  3OGI B;  3O9O A;  3GWK C;  3Q4H A;  2KG7 A;  4ABM A;  2B9Z A;  2AZ0 A;  3HR0 A;  2DE0 X;  3FAV B;  3GVM A;  2VRZ A;  1WA8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...