4LWSB

Esxa : esxb (semet) hetero-dimer from thermomonospora curvata
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'SPSVSDYTRANFGGLSEGEAQFSMTARALLDELTDLEGKLRAKLDRWDGDAQAAYWNYQKEWDAAAKDMQNVVAQLGVAIREAHDNYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Substrates Control Multimerization and Activation of the Multi-Domain ATPase Motor of Type VII Secretion.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Unknown function
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4lwsB00
2KG7A 3GVMA 3G80A 3O9OA 2KG7B 3TXQA 1WA8A 2AZ0A 2DE0X 1WA8B 3ZBHA 2VRZA 2AZ2A 3Q4HA 2VS0A 3FAVA 4I0XA 3Q4HB 3HR0A 4LWSA 3FAVB 4I0XB 2B9ZA 4GZRB 4LWSB 3GWKC 3OGIB 3FD9A 3TXSA 4ABMA
chains in the Genus database with same CATH superfamily
1F7YA 1CPYA 1X59A 5JWPA 4TV8B 4PD4F 3BY6A 2IH3C 4JI7B 1XEQA 2IJIA 3OMNB 4QE9A 1AJQA 1H2SB 2IM9A 3ZRSA 4O4IA 5LHIA 3APOA 4FLTA 3L73H 1N34B 1SERA 4Z1VA 5KX5B 4B3RO 2WLLA 4BW5A 1EZVH 2P4KA 4LFCO 4FM0A 1ZUQA 5KHJA 1IBKB 3SPHA 1B06A 3LDDA 3F7YC 3K0GA 3K5MA 3CWBH 1K4CC 4TT3G 3N2GB 3OR7C 1M56C 2EULA 3QG5A 4JF3A 5EYPB 2JS5A 2YEVB 2JJ2G 2YXYA 4LBEC 3ETQA 4GKKB 5KAFZ 1K34A 1PD3A 2QM7A 4LFBO 4JYBA 3MAQA 4PA3A 4PDLA 4ZI7B 1RSOA 4I0XA 1N36B 3H1LH 3H1IH 1GN2A 1OCZC 2KKWA 1YTFB 1Y76B 3FB5C 5JCOC 1OJHA 1JFFB 2A9HA 4HAMA 3X2QB 3RYCA 3BPZA 4YY3O 1KP3A 3AG4C 1NS1A 1GN3A 4DW0A 4IYIA 4B3MB 4DR4O 2KB1A 4FM2A 1F51A 2ZE8A 2EILB 2QDOA 1NJIW 3R65A 4TV9B 4FLUA 2CE4A 1N4CA 2DYSB 3FB6C 5KMGB 3CCRV 1SQGA 3IGAC 1WPXA 4DR7O 1XL6A 1Q43A 2AZ0A 1VMGA 1XHZA 5FPOA 3AG2C 1KQSU 1SQPH 1GM9A 1MSDA 4E4EA 4JI4O 4OX9O 1Y66A 3Q4HB 2GV9A 3AG3C 3E89A 3UCSC 3SYCA 3ASNC 1SA0B 3CSXA 1WB8A 2DJVA 5LHGA 1AVMA 1G4YB 3E22B 4PA6A 1XL4A 1YVWA 2IBZH 3JCZA 4U3JA 4X1KB 3N27A 4X1YA 4DR5B 1IDSA 1RPOA 4GKJB 3CCSV 1AJNA 5H9CA 5IWAB 2HJDA 1FXKC 1AI5A 4LF6B 3JSLA 3BRCA 3M8AA 4UCTA 1AROP 1PNKA 5CN0A 4JI6O 2QM8A 2DN9A 4I7ZB 5LXTA 4UVCA 1SQBH 5JQGA 1PP9H 2Q0AA 3P30A 5D5PA 4JI2O 1LR1A 4MVMA 2NNUA 4FFBA 3ZX6A 5BMVA 2W6JG 3FX7A 5DN6G 4X20A 1Q6IA 3B4SA 4BR6A 1FKAO 1T5EA 1V55B 3G71V 3HPLC 3IC9A 2UU9O 4QNHB 1VIBA 2KG7B 2MK3A 4F6EA 4CBCA 1Y4MA 1P84F 4X1IA 1R3KC 3KZIZ 1GK9A 3W7XA 2QR4A 4JI1O 3CRRA 1IX9A 2EIJC 5IJ9B 3ZMSA 3NR7A 3RN4A 2BCCH 1KKCA 3VQWA 3WU2Z 1G1XB 2EBOA 2JIZG 1JVMA 5EC2C 3ZHUA 4DR6B 3CXHF 1RP3B 1F4NA 2UXDB 4O4HA 2RQ6A 2X0LA 1R1BA 1ZWIC 3CB2A 4PA9A 1XHXA 2BTQA 3D3QA 4JI5O 4JYCA 1H2GA 5EK0A 1VQ5V 1UJWB 2IU0A 5GW7A 4H13B 2F43G 2VQFO 4DV3B 1AILA 1I5XA 1S77D 2DYRC 2VWJA 1JQ0A 1XMQB 4IGGA 3FB8C 2QJ1A 3JYCA 1G8MA 4BIUA 1UPGA 3SYPA 1VEWA 4EB6A 1EFRG 4X65B 4WFGA 3OMAB 1VF6C 4JPRA 2XHBA 2Q7EA 5J2TA 1OCRC 3BHPA 4O2AB 3AK2A 1DGSA 2EIMC 3OT7A 2P5OA 1GO3F 3ZRWA 5D5QA 2HHHB 2LFRA 2QGNA 4PDVA 4XDJA 4BWAA 4NXMB 4FLYA 1W59A 2EZOA 5JVDA 4DV7O 1EN6A 5CBHA 2YIAA 4WFHA 4ZHQA 3IJ4A 4R8CA 3CXCU 4NXNB 1F23A 1URFA 1FXHA 2HJFC 4R7CA 2BE3A 5EBWC 3N2KA 2QWPB 2CTRA 4PDRA 2ATKC 4R50A 3JAMN 1K7DA 4GX0A 2UUCB 2ZE7A 1JJ2U 2C2AA 4GT1A 5BZBA 4DUYB 2PY5A 2CTPA 1N33B 4RQFA 3LSSA 3CCVV 4QPKA 1TA8A 4ASUG 3OM3B 4K35A 3K5OA 4LF5O 2P6JA 3OUFA 1XMOB 1K92A 2E5LO 3KG2A 2ZNJA 4WCEV 2YI8A 4JGSA 3L71H 3W7SA 2M7WA 4JTDB 4QGPA 4PHZA 4OPAA 4B3TB 3CJHA 3MD0A 4TUYB 1YITV 2GUZA 1HWYA 3OMIB 3AEIA 4CS3A 1AP5A 3ZHQA 1Q90D 4DR2B 2P4VA 1PL4A 2PZSA 1KP2A 4J9ZB 2CK3G 3UT5A 1W2BU 1WP8A 3UKMA 3T4ZA 5K1XA 3J7AU 5IYZB 1OCZB 2RCVA 4J42A 2HVKC 2HR3A 4K0KO 3BFRA 3ASOC 5L3BA 1QVGU 1GM8A 3ZMUA 4X64O 1XUQA 4LR3A 1S0VA 1GTOA 3AG4B 2RJZA 1J5EB 1WB7A 1Q81W 2DWDC 2EX3A 3JATB 3I5DA 2OTJV 4B3RB 2RDCA 1M4UA 2YIBA 4NVPA 2WLJA 4BIZA 2X6CA 1VQKV 2NN4A 3LSUA 2YICA 5FL7G 4EEQA 2ZR3A 3K03A 3GVMA 1JMKC 2QWOB 3BCCH 2Q5ZA 3JARA 1HR0B 4NYKA 2YSUB 2E3CA 2WLNA 1KUQA 4F6RA 4RUEA 4O2BB 3RYIA 4XBFA 3ASNB 3FFQA 4DV4O 1SQQH 2RMKB 4MVUA 4CC5A 3P3PA 5BR8B 3E35A 1OCOC 5LP6A 1B3QA 5LOVB 3K59A 5J2UB 4X62B 4LH7A 1RM1B 3H1KH 4LNUA 1FXKB 5A9GA 3LDCA 2QTOA 3MDSA 2WSSG 3CCLV 4I4TB 2V1DA 4YY3B 3HKDB 1QBZA 1BQ0A 1K5SA 5CA1A 4IT5A 3G80A 1IURA 1I7FA 4B3SB 3B8MA 4KL1A 4W4KA 4EKWA 4P30A 4CH6A 1Y67A 4P2ZA 4UV9A 4LH6A 4YJ3B 3U11A 1AI4A 2VQEO 2LJ2A 3E8HA 1P7BA 2PF4E 3SR2C 5KUKA 4DR7B 1S76D 3ABUA 4UCUA 4FFKA 2YI9A 2WLIA 3QO5A 4PA4A 4FZ1A 1JOYA 3RYFA 3WFVA 4UXNA 4QE7A 4G28B 1EBOA 4FM1A 1H38A 2EIJB 2DQ3A 3J81N 3RVYA 2M6YA 3ZHTA 4MS2A 3L75H 2K1EA 1ZL8A 3VOUA 4G2KA 1HNWB 5ITZB 3K58A 4DUZO 5IDJA 1V54C 4H37A 2YUAA 2P90A 2D2CB 2JEXA 2WWWA 3HKBB 1Z2GA 1AB3A 3IAYA 1E1QG 3JAKB 1SQVH 3RW0A 4WBNB 4JI6B 4AQYO 3K5NA 5KUMA 5JJEB 4LF7O 1Y74B 1L0LH 3AG1B 5L3DA 5CA3A 2DYRB 3K57A 5LMUB 4FLZA 3ZIAG 1V9PA 4RWUA 2CGNA 5CB4B 2VWKA 1WA8B 4PELA 1OCRB 2DWEC 1B04A 2EIMB 4LF8O 1VARA 2UUAB 4ZKIA 5CBFA 1QR8A 1OHHG 4DV2O 1TVKB 1D2DA 2XNDG 3VQXA 4MVSA 4JI1B 2YXLA 3JALB 3JD0A 1FFXB 1NBMG 4I9WA 2UXCO 4MT8A 1M90W 3S3WA 2JK5C 4RAIA 1XOUA 3ZMTA 4DR1B 4WFFA 2L35A 1QQCA 2F95B 2YEVA 4JI5B 1EM1A 3ABTA 3ABKB 1QHTA 4FIPC 4TOIA 3TETA 1Q5OA 4YHHB 3H1JH 1M1KW 1Q7YW 4ZI7A 3CC4V 2UXBO 1NTMH 4LFAB 3ABLC 5IJ0B 3G6EV 1L8DA 3JASB 1YEWA 1HNXO 5L3EA 3RT3C 4PI0A 3CX5F 1Y76A 3OW2U 1N0NA 1JFFA 2B1GA 4LCUC 5EBLC 2Q4PA 1K4DC 2MW2B 4ZOLB 4MTXA 1DF5A 4KHPB 4PV1B 4O4IB 2WA3A 5KLVH 4TV9A 2YDEA 1MZFA 3QNEA 4JYAB 4ZIBA 5KMGA 2OT5A 2H3OA 5GTIZ 1BHAA 3CHXA 1XNRB 1KMIZ 1JJOA 3BAAA 1Q6UA 4DR3B 4YIOA 2EZPA 4UVBA 3B2EE 3AK3A 4LP8A 1HNZB 4HBNA 3I56V 1SA0A 3ASOB 1O9GA 1XNQB 4IL6Z 3T1HO 2W0XA 1I94B 3O9OA 3ZCCA 2ZM6O 2NLJC 1MSWD 5IYCO 4GYCB 5FNVA 1BQZA 1E79G 3CRQA 3AK1A 2OYQA 5FLXN 3MHSC 5DEDA 2R72A 1I5YA 4JAAA 4G27B 4UCSA 3FKSG 4H0LB 5K1PA 2CAZC 1R73A 3K0DA 2HVJC 4OPHA 1N0JA 1WJZA 1VQMV 1K97A 4JASA 4J7KA 2BOBC 2ZDIC 3OTOB 3T1YB 1ZX3A 3OUSA 5EBMC 3RYCB 1ZAUA 4UV8A 2ITCC 5F2VO 2X6BA 3ZMZA 3K79A 1HW7A 3UM7A 5B1OA 2AW9A 1AJPA 2XAJA 1OCOB 2ADPA 1GN4A 2GTSA 2WAMA 2JDIG 4A5UB 4DV0O 1D5AA 3JD4A 4YXWG 5E1AC 1FJGO 1MZEA 4P9OA 1DTOA 4E2LA 1BCCH 4B08A 3CRMA 4JI0O 4K0KB 3CCMV 1IBMO 4QIWF 5IJ9A 3B77A 1QLNA 3NXSA 4HNAA 3SGIA 4BIOA 3LNNA 2LP7A 4J80A 1R6TA 2QKSA 3HKCB 1OCCC 2IH1C 2LGQA 5JH7A 3CCQV 5LP6C 3SPJA 2Q8VA 3E8GA 3F5TA 1AR5A 1S5HC 4U3JB 4X1YB 1US6A 2OTLV 1SF9A 1XQ8A 1M57C 2JRIA 5B1BC 2N04A 2YIBD 2DMXA 2EJRA 2XASA 4D7SA 3WG7C 2YXHA 5LXTB 2A3QA 3P32A 3TXQA 4X9QA 4EFEA 5JQGB 2LO1A 2QWQB 2DW4A 4DRXB 1UFIA 2ITDC 3RYHA 4R6ZA 3UQ8A 1VQLV 4JI7O 2X7RB 5CBGA 2E74B 4X20B 2B9ZA 1GRJA 1KECA 2ADQB 2O57A 3AG7A 1GH6A 1BL8A 3RGBA 1DLBA 1WN7A 1TAEA 3CMAV 1N34O 2ZT9B 4DV1O 1IVSA 2Y4UA 4WFAV 4DV5B 2ZINA 4U7OA 2BOCC 1KC8W 2N05A 4DW1A 3RWRD 3VBBA 1YCIA 1AP6A 5HFMA 5KHHA 1Q8IA 4O4HB 5EC1C 1M5IA 1JCHA 4Q6GA 2JGUA 2CTQA 3T4DA 1TGOA 2K9PA 2B1IA 4AILC 4AHCA 1R6KA 2JJ1G 2LW7A 3OAAG 4DV6B 4LF4B 2UXNA 2Q7GA 1N36O 5KA5A 1TUEB 2IW5A 3JD2A 5LMNB 2GDSA 5CMUA 1L0NH 4TUYA 1ORQC 3L9DA 3G6BA 2Q67A 5IE9A 4N23A 1SQXH 1IBLB 5J2TB 4JI8B 4X66B 1HDJA 2WLMA 4OGQB 3W7WA 3KCXA 1P7GA 1W0JG 2XAFA 4I5SA 2IJHA 3CRCA 4LC1A 2R9IA 1BHBA 2GTAA 5TISZ 2Q6AA 1BMFG 1VQOV 3ABLB 3CP1A 4JAUA 5EZYB 1FS0G 1YSCA 3E2EA 3N2KB 4MTFA 1M56B 3K3WA 5JCOA 1FFTB 4LF9O 1H2LA 2HEPA 3D3IA 4JV5B 3OE7G 3WB0A 2YS8A 3W7TA 2YIDA 2R70A 2GBOA 2F4VB 2ARHA 3KKYA 5H2FZ 2Q0OC 3STZC 1CXZB 2QTSA 3QO8A 4IIJB 5IY5C 3SYAA 4X89A 3ZN0A 4DR5O 4GKJO 2OWOA 5IWAO 2UXCB 5GONA 4MW3A 1S3JA 4YJ2A 4B7EA 2OIGA 1K9MW 1VQ9V 3ZRXA 5LGNA 1VP7A 3X2QC 4GX2A 5H6RA 3CJHB 1YDXA 2HG5C 4O2BA 1GAXA 3OEHG 3TGUH 4GX1A 4PJ0Z 1EN4A 4LFCB 2Z3YA 3G4SV 1KKDA 1O9HA 4X88A 5LBQA 1WNSA 3UT5B 2NR5A 1Q86W 2Y0IA 5BY1A 3AG2B 3ML0A 5B66Z 4HZ3A 1K33A 2PI4A 3CE2A 1NU1H 2Y48A 3AG3B 4I4TA 3HKDA 1I0HA 4CS2A 4Z1MG 4DXWA 3RVZA 5L3CA 4LFBB 1YZBA 1TUBB 5LL6Y 3SPCA 2JGDB 3B40A 4O4LA 2A79B 4JTCB 2ZXWC 4DR6O 4YJ3A 1W0KG 2XOKG 2UXDO 1K5QA 1YI2V 4O4JA 3QF7A 4QJFB 3FAVA 2LGWA 4WFEA 3SDLA 3HKEB 3EXAA 1FPOA 2B5UA 5C93A 3TJTA 1CP9A 4MW8A 1GKFA 3H9VA 1NVPD 1XILA 5LA6A 3JAWB 3SJCC 4DR4B 3ABMC 1SC5B 3JARB 4DV3O 4WFBV 1PNLA 2QWNB 1XMQO 3DSQA 3T1HB 1YJWV 4JZ2A 4F6RB 1Z5VA 1ZLZA 2ZM6B 2ODMA 4X65O 4N21A 1DF4A 4LWSB 4D7TA 1OCCB 3QO7A 1VF7A 4CZZA 3HKBA 5KHGA 1NR7A 2AHZA 2OCCC 4JI4B 4OX9B 1YF2A 2QEXV 4UB6Z 2WLKA 3C3TA 2HHHO 2KQXA 4UB8Z 4WBNA 1NT2B 4MVRA 2PTMA 2CDYA 4NXMO 1MNGA 3QTCA 2DOSA 1PV0A 1M57B 4CH4A 2VS0A 5B1BB 3BABA 3THOA 2ZR2A 4NTXA 3J80N 1NKDA 1YHQV 1Y74A 2P67A 4NXNO 3CYOA 2ETNA 3UO2A 3WG7B 1H2NA 1B6QA 1THZA 4I55B 3ZEDA 1NTZH 5CB4A 5CA1B 3CCUV 1WAZA 5CA0A 1VF6A 1WA8A 5GTHZ 4BAYA 4XDLA 2UUCO 5KHIA 5LGTA 4DUYO 2F66C 2PGGA 1N33O 3D36A 1GN6A 4DV0B 5AG2A 1NZ6A 1ROPA 4JI2B 2OCHA 3GB7C 1GMGA 3ETEA 3PJSK 3TXSA 4FMTA 4TV8A 4KFMA 2ZIMA 2WLIB 1FFXA 2BSKB 2ILMA 1SRYA 4TQFA 4J10A 2Q9LA 1K3EA 1P4RA 4NTYA 4MVOA 2UU9B 4B3TO 2Y4TA 2Y0PA 3E86A 1VQNV 3CEIA 4GUNA 2BTOA 2JS3A 5KX5A 1R6NA 3SJQC 2PYJA 3G67A 3E8BA 2FKXA 4QPJA 5HFLA 5C8YB 2R9RB 2CH7B 2HKOA 3IC7A 1JA8A 1L1FA 5IYDO 5IT9N 5IJ0A 2FL4A 1H8EG 1MG1A 1JPXA 1QU7A 4I50B 4IHJB 3SPGA 4GLXA 3WB2A 4J41A 3N2GA 1I08A 3T1CA 2WLHA 1NQTA 2QKCA 1U97A 1FYJA 1MABG 1YXBA 2A0LA 5EYPA 3PN1A 4FLVA 4C7UA 3KCYA 3SJAC 3L74H 3DXRB 3T2MA 5LGUA 3ZHRA 2DE0X 2VQFB 4DK0A 2CTWA 4TWKA 4ZOLA 5LYJB 2N74A 4FLXA 1J5EO 4IYHA 4MTGA 1J95A 4DV1B 3MHHC 3FYEB 4ZBMA 1VF5B 3C90A 3HB3B 2PUSA 4UUJC 1JR9A 1Q3EA 2ZQMA 1HR0O 4YIPA 2P7TC 4DV7B 1LUVA 4PI2A 5L3FA 3UO3A 1PL0A 2WLLB 5DM6V 1SS3A 4PDMA 3CCJV 3K9SA 5BR8O 2IU3A 3Q4HA 5IY5B 1G6UA 1KYOF 2F93B 1Q82W 4X62O 1AI7A 1S5LZ 3OGIB 4NB5A 1MMMA 4CH3A 4ABMA 2DQ0A 3F7VC 4J7ZA 2UUBO 2IJKA 2WPDG 1SZXA 3E22A 4LF5B 4X1KA 1QVFU 1VQ4V 1PNMA 2E5LB 2PYLA 4B3SO 1KBHA 1RSOB 4I0XB 1XBLA 4UCVA 1SZTA 3OFNG 5B1AC 5H6QA 2HLDG 1NVPB 3A0HZ 3LSQA 2G38A 1BGYH 1NR1A 3SPIA 2ZKOA 4LF9B 1EN5A 3DC5A 3STLC 3RBZA 1KU9A 3E8FA 3A8TA 1YJ9V 1PPJH 3BVOA 4J7JA 3HKCA 1SETA 2KG7A 1HNWO 2F1MA 3DC6A 2ZXWB 2F23A 4X8AA 5FNVB 4J9YB 2Q69A 4DO2A 1QR9A 1RM1C 1YIJV 4X64B 1QCEA 2H94A 5A2QN 4UFZA 4JI3O 2AXTZ 3R66A 4GZRB 1LUWA 3K06A 4JYYA 1XDCA 3ABMB 2XUMA 4OXSA 1HP8A 4DRXA 5LMUO 2XAQA 5JJNB 1BT8A 2ZIOA 4U3FH 1Z5WA 4FVMA 1H2KA 1IXMA 4TQDA 2EINC 4UCOA 3K5LA 3ZMVA 2Z0AA 3H1HH 3ETDA 2WA4A 2OCCB 4KXRA 3BA9A 1BS3A 2UUAO 1A32A 2Y69C 2RN9A 1WP7A 4DV4B 1N32O 1PM9A 4FFBB 4O2AA 3A0RA 3DGEA 3S3XA 5BMVB 2E75B 1FD9A 4HNAB 5JJJB 1V54B 4FLWA 3C3SA 2QE7G 1VQ7V 3EHBB 2AGAA 4DR1O 5IYBO 5B5EZ 2D3OW 3FB7C 5JH7B 2HFEC 4RO2A 1ENVA 4Z2WA 2EIKC 3OR6C 3EVKA 4X1IB 4NR1A 4EFBA 1WLEA 1COWG 3SJBC 4YHHO 1IBKO 1R3IC 4H44B 3GWKC 2QSAA 2R9AA 3B8NA 3JD3A 4LFAO 3AG1C 1S5JA 2L6LA 2ZE5A 1IZ3A 4UVAA 5B3SC 3M99B 1R3JC 3ZJZA 2VQEB 4NKGB 2W0FC 4Q20A 3TK1A 3K9AA 3A0BZ 3ZRVA 3ZHVA 2VRZA 2BTQB 2JVDA 4NTWA 3RYHB 1U96A 2QKAA 1ZTEA 3DTUB 4F4LA 4GKKO 3D36C 5BXZA 1QLEC 4WF9V 2RNBA 4KHPO 4CH5A 1M9NA 3IFXA 4I9QA 4MVZA 1NH2D 5EZYA 4JYAO 2CUGA 4EB6B 4KUMA 3F5WC 4DUZB 2QM4A 4FPPA 2IJJA 1XNRO 1Q6HA 4KP4A 1K8AW 2V4DA 2ZE6A 4MVQA 3TCUA 4DR3O 5EIBC 3ZRWB 4B3MO 3JSNA 1HNZO 3ABKC 4AQYB 2AHYA 5JVDB 2QA4V 3I55V 1DK1A 4LF7B 1XNQO 3APQA 5IYZA 4ZHQB 1I94O 4IIJA 2P22C 2AZ2A 2QWRB 2XAGA 1VQPV 4DYLA 4W4LA 2FYUH 3A2FA 2HP8A 2Z5UA 3LUTB 3FYIB 1N8RW 4LF8B 2V7QG 3QVNA 3P3NA 3L70H 2PI5A 3CS5A 3JATA 4DV2B 4JAVA 3CC7V 5KHKA 3OTOO 3T1YO 4L87A 3OEEG 3OTFA 5EIBD 2Q68A 4RUFA 1H2MA 1WPBA 4LF6O 5E79Z 1QNMA 1FXVA 4TSFG 5KAIZ 4FK5C 4GCZA 3ZBHA 2GUZB 1MOFA 2LFSA 3HR0A 4H33A 2XTAA 3SYQA 3D8CA 5H5NA 4JZGA 3K08A 1TUBA 2ZCEA 2ZDIA 2EILC 5DECA 2UXBB 2JGDA 2CGOA 5LOVA 2ZD9A 4K3AA 5J2UA 1LNQA 2DYSC 3WB1A 3U0ZA 2FMLA 2FTKA 2E76B 3OGCC 2OIEA 4GX5A 1BE3H 1HNXB 1FXKA 4CC6A 3M7MX 3HKEA 2GSMB 5B1AB 5L3GA 2Q7HA 1SQFA 4CS4A 1R3LC 3GWOA 4U7NA 4FJCC 3JAWA 1YTFD 5GONB 2Q73A 4YJ2B 2P06A 3CCEV 1F4MA 3ZN1A 1ZSPA 4P9PA 1KD1W 3CPWU 1AR1B 4LWSA 3ZHSA 3EFFK 3L72H 1K73W 2W6IG 5FPRA 3FD9A 4XDKA 2LQTA 1E1RG 2A06H 2GHYA 1D5NA 3JD1A 4MTOA 1MA1A 3W7UA 1PKXA 3E83A 4DK1A 1YJNV 2UUBB 1NTKH 5J9PC 4J11A 1X4TA 4AI8A 5ITZA 3RYIB 2YC0A 4DV5O 1V55C 4L8JA 4I55A 3LDEA 2UXXA 1OV9A 2A7WA 3SYOA 1KB9F 4RQEA 3CC2V 5LP6B 1BSMA 3JAKA 3U10A 4O4LB 4UCRA 3CMEV 1IXBA 1SESA 1H8HG 3B09A 3VQYA 4O4JB 2EINB 4HYOA 4LNUB 4D6TH 3FAVB 3BEHA 3ETGA 2BSKA 1AI6A 1NI8A 4B7KA 2Y69B 5LA6B 2ZNIA 1OZ0A 1VQ8V 4DV6O 4LF4O 3JCUZ 1Y6XA 5B1NA 4FZ0A 5LMNO 4MSWC 1S72V 3BA8A 2XT9A 2LW1A 1TVKA 2XAHA 1FJGB 1RFYA 2JEUA 1XREA 1IBLO 4JI0B 1IBMB 4JI8O 4X66O 3CD6V 3OD4A 5C8YA 3JALA 4ICGA 2X6AA 1GM7A 1XMOO 1M93A 2CH7A 3VQVA 2EJ7A 3RYFB 1NH2B 4JI3B 2EIKB 4BW9A 1EZJA 4I50A 4IHJA 1CEZA 1XI1A 2KSDA 4JTAB 1BZKA 1ZL8B 1SKVA 4K8ZA 5B3SB 1JX9A 3DXRA 1FAFA 3LNMB 4DR2O 3O65A 2FB5A 3ZS8C 5CA0B 4JV5O 4PA7A 1RPRA 5LYJA 3CRAA 3ICXA 5KA6A 3JASA 2F4VO 3K04A 1AR4A 3RFRA 1QLEB 2H8PC 4K8XA 1VQ6V 3H01A 1P49A 5LHHA 1N32B
chains in the Genus database with same CATH topology
2KG7A 3GVMA 3G80A 3O9OA 2KG7B 3TXQA 1WA8A 2AZ0A 2DE0X 1WA8B 3ZBHA 2VRZA 2AZ2A 3Q4HA 2VS0A 3FAVA 4I0XA 3Q4HB 3HR0A 4LWSA 3FAVB 4I0XB 2B9ZA 4GZRB 4LWSB 3GWKC 3OGIB 3FD9A 3TXSA 4ABMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG7 A;  3GVM A;  3G80 A;  3O9O A;  2KG7 B;  3TXQ A;  1WA8 A;  2AZ0 A;  2DE0 X;  1WA8 B;  3ZBH A;  2VRZ A;  2AZ2 A;  3Q4H A;  2VS0 A;  3FAV A;  4I0X A;  3Q4H B;  3HR0 A;  4LWS A;  3FAV B;  4I0X B;  2B9Z A;  4GZR B;  4LWS B;  3GWK C;  3OGI B;  3FD9 A;  3TXS A;  4ABM A; 
#chains in the Genus database with same CATH topology
 1F7Y A;  1CPY A;  1X59 A;  5JWP A;  4TV8 B;  4PD4 F;  3BY6 A;  2IH3 C;  4JI7 B;  1XEQ A;  2IJI A;  3OMN B;  4QE9 A;  1AJQ A;  1H2S B;  2IM9 A;  3ZRS A;  4O4I A;  5LHI A;  3APO A;  4FLT A;  3L73 H;  1N34 B;  1SER A;  4Z1V A;  5KX5 B;  4B3R O;  2WLL A;  4BW5 A;  1EZV H;  2P4K A;  4LFC O;  4FM0 A;  1ZUQ A;  5KHJ A;  1IBK B;  3SPH A;  1B06 A;  3LDD A;  3F7Y C;  3K0G A;  3K5M A;  3CWB H;  1K4C C;  4TT3 G;  3N2G B;  3OR7 C;  1M56 C;  2EUL A;  3QG5 A;  4JF3 A;  5EYP B;  2JS5 A;  2YEV B;  2JJ2 G;  2YXY A;  4LBE C;  3ETQ A;  4GKK B;  5KAF Z;  1K34 A;  1PD3 A;  2QM7 A;  4LFB O;  4JYB A;  3MAQ A;  4PA3 A;  4PDL A;  4ZI7 B;  1RSO A;  4I0X A;  1N36 B;  3H1L H;  3H1I H;  1GN2 A;  1OCZ C;  2KKW A;  1YTF B;  1Y76 B;  3FB5 C;  5JCO C;  1OJH A;  1JFF B;  2A9H A;  4HAM A;  3X2Q B;  3RYC A;  3BPZ A;  4YY3 O;  1KP3 A;  3AG4 C;  1NS1 A;  1GN3 A;  4DW0 A;  4IYI A;  4B3M B;  4DR4 O;  2KB1 A;  4FM2 A;  1F51 A;  2ZE8 A;  2EIL B;  2QDO A;  1NJI W;  3R65 A;  4TV9 B;  4FLU A;  2CE4 A;  1N4C A;  2DYS B;  3FB6 C;  5KMG B;  3CCR V;  1SQG A;  3IGA C;  1WPX A;  4DR7 O;  1XL6 A;  1Q43 A;  2AZ0 A;  1VMG A;  1XHZ A;  5FPO A;  3AG2 C;  1KQS U;  1SQP H;  1GM9 A;  1MSD A;  4E4E A;  4JI4 O;  4OX9 O;  1Y66 A;  3Q4H B;  2GV9 A;  3AG3 C;  3E89 A;  3UCS C;  3SYC A;  3ASN C;  1SA0 B;  3CSX A;  1WB8 A;  2DJV A;  5LHG A;  1AVM A;  1G4Y B;  3E22 B;  4PA6 A;  1XL4 A;  1YVW A;  2IBZ H;  3JCZ A;  4U3J A;  4X1K B;  3N27 A;  4X1Y A;  4DR5 B;  1IDS A;  1RPO A;  4GKJ B;  3CCS V;  1AJN A;  5H9C A;  5IWA B;  2HJD A;  1FXK C;  1AI5 A;  4LF6 B;  3JSL A;  3BRC A;  3M8A A;  4UCT A;  1ARO P;  1PNK A;  5CN0 A;  4JI6 O;  2QM8 A;  2DN9 A;  4I7Z B;  5LXT A;  4UVC A;  1SQB H;  5JQG A;  1PP9 H;  2Q0A A;  3P30 A;  5D5P A;  4JI2 O;  1LR1 A;  4MVM A;  2NNU A;  4FFB A;  3ZX6 A;  5BMV A;  2W6J G;  3FX7 A;  5DN6 G;  4X20 A;  1Q6I A;  3B4S A;  4BR6 A;  1FKA O;  1T5E A;  1V55 B;  3G71 V;  3HPL C;  3IC9 A;  2UU9 O;  4QNH B;  1VIB A;  2KG7 B;  2MK3 A;  4F6E A;  4CBC A;  1Y4M A;  1P84 F;  4X1I A;  1R3K C;  3KZI Z;  1GK9 A;  3W7X A;  2QR4 A;  4JI1 O;  3CRR A;  1IX9 A;  2EIJ C;  5IJ9 B;  3ZMS A;  3NR7 A;  3RN4 A;  2BCC H;  1KKC A;  3VQW A;  3WU2 Z;  1G1X B;  2EBO A;  2JIZ G;  1JVM A;  5EC2 C;  3ZHU A;  4DR6 B;  3CXH F;  1RP3 B;  1F4N A;  2UXD B;  4O4H A;  2RQ6 A;  2X0L A;  1R1B A;  1ZWI C;  3CB2 A;  4PA9 A;  1XHX A;  2BTQ A;  3D3Q A;  4JI5 O;  4JYC A;  1H2G A;  5EK0 A;  1VQ5 V;  1UJW B;  2IU0 A;  5GW7 A;  4H13 B;  2F43 G;  2VQF O;  4DV3 B;  1AIL A;  1I5X A;  1S77 D;  2DYR C;  2VWJ A;  1JQ0 A;  1XMQ B;  4IGG A;  3FB8 C;  2QJ1 A;  3JYC A;  1G8M A;  4BIU A;  1UPG A;  3SYP A;  1VEW A;  4EB6 A;  1EFR G;  4X65 B;  4WFG A;  3OMA B;  1VF6 C;  4JPR A;  2XHB A;  2Q7E A;  5J2T A;  1OCR C;  3BHP A;  4O2A B;  3AK2 A;  1DGS A;  2EIM C;  3OT7 A;  2P5O A;  1GO3 F;  3ZRW A;  5D5Q A;  2HHH B;  2LFR A;  2QGN A;  4PDV A;  4XDJ A;  4BWA A;  4NXM B;  4FLY A;  1W59 A;  2EZO A;  5JVD A;  4DV7 O;  1EN6 A;  5CBH A;  2YIA A;  4WFH A;  4ZHQ A;  3IJ4 A;  4R8C A;  3CXC U;  4NXN B;  1F23 A;  1URF A;  1FXH A;  2HJF C;  4R7C A;  2BE3 A;  5EBW C;  3N2K A;  2QWP B;  2CTR A;  4PDR A;  2ATK C;  4R50 A;  3JAM N;  1K7D A;  4GX0 A;  2UUC B;  2ZE7 A;  1JJ2 U;  2C2A A;  4GT1 A;  5BZB A;  4DUY B;  2PY5 A;  2CTP A;  1N33 B;  4RQF A;  3LSS A;  3CCV V;  4QPK A;  1TA8 A;  4ASU G;  3OM3 B;  4K35 A;  3K5O A;  4LF5 O;  2P6J A;  3OUF A;  1XMO B;  1K92 A;  2E5L O;  3KG2 A;  2ZNJ A;  4WCE V;  2YI8 A;  4JGS A;  3L71 H;  3W7S A;  2M7W A;  4JTD B;  4QGP A;  4PHZ A;  4OPA A;  4B3T B;  3CJH A;  3MD0 A;  4TUY B;  1YIT V;  2GUZ A;  1HWY A;  3OMI B;  3AEI A;  4CS3 A;  1AP5 A;  3ZHQ A;  1Q90 D;  4DR2 B;  2P4V A;  1PL4 A;  2PZS A;  1KP2 A;  4J9Z B;  2CK3 G;  3UT5 A;  1W2B U;  1WP8 A;  3UKM A;  3T4Z A;  5K1X A;  3J7A U;  5IYZ B;  1OCZ B;  2RCV A;  4J42 A;  2HVK C;  2HR3 A;  4K0K O;  3BFR A;  3ASO C;  5L3B A;  1QVG U;  1GM8 A;  3ZMU A;  4X64 O;  1XUQ A;  4LR3 A;  1S0V A;  1GTO A;  3AG4 B;  2RJZ A;  1J5E B;  1WB7 A;  1Q81 W;  2DWD C;  2EX3 A;  3JAT B;  3I5D A;  2OTJ V;  4B3R B;  2RDC A;  1M4U A;  2YIB A;  4NVP A;  2WLJ A;  4BIZ A;  2X6C A;  1VQK V;  2NN4 A;  3LSU A;  2YIC A;  5FL7 G;  4EEQ A;  2ZR3 A;  3K03 A;  3GVM A;  1JMK C;  2QWO B;  3BCC H;  2Q5Z A;  3JAR A;  1HR0 B;  4NYK A;  2YSU B;  2E3C A;  2WLN A;  1KUQ A;  4F6R A;  4RUE A;  4O2B B;  3RYI A;  4XBF A;  3ASN B;  3FFQ A;  4DV4 O;  1SQQ H;  2RMK B;  4MVU A;  4CC5 A;  3P3P A;  5BR8 B;  3E35 A;  1OCO C;  5LP6 A;  1B3Q A;  5LOV B;  3K59 A;  5J2U B;  4X62 B;  4LH7 A;  1RM1 B;  3H1K H;  4LNU A;  1FXK B;  5A9G A;  3LDC A;  2QTO A;  3MDS A;  2WSS G;  3CCL V;  4I4T B;  2V1D A;  4YY3 B;  3HKD B;  1QBZ A;  1BQ0 A;  1K5S A;  5CA1 A;  4IT5 A;  3G80 A;  1IUR A;  1I7F A;  4B3S B;  3B8M A;  4KL1 A;  4W4K A;  4EKW A;  4P30 A;  4CH6 A;  1Y67 A;  4P2Z A;  4UV9 A;  4LH6 A;  4YJ3 B;  3U11 A;  1AI4 A;  2VQE O;  2LJ2 A;  3E8H A;  1P7B A;  2PF4 E;  3SR2 C;  5KUK A;  4DR7 B;  1S76 D;  3ABU A;  4UCU A;  4FFK A;  2YI9 A;  2WLI A;  3QO5 A;  4PA4 A;  4FZ1 A;  1JOY A;  3RYF A;  3WFV A;  4UXN A;  4QE7 A;  4G28 B;  1EBO A;  4FM1 A;  1H38 A;  2EIJ B;  2DQ3 A;  3J81 N;  3RVY A;  2M6Y A;  3ZHT A;  4MS2 A;  3L75 H;  2K1E A;  1ZL8 A;  3VOU A;  4G2K A;  1HNW B;  5ITZ B;  3K58 A;  4DUZ O;  5IDJ A;  1V54 C;  4H37 A;  2YUA A;  2P90 A;  2D2C B;  2JEX A;  2WWW A;  3HKB B;  1Z2G A;  1AB3 A;  3IAY A;  1E1Q G;  3JAK B;  1SQV H;  3RW0 A;  4WBN B;  4JI6 B;  4AQY O;  3K5N A;  5KUM A;  5JJE B;  4LF7 O;  1Y74 B;  1L0L H;  3AG1 B;  5L3D A;  5CA3 A;  2DYR B;  3K57 A;  5LMU B;  4FLZ A;  3ZIA G;  1V9P A;  4RWU A;  2CGN A;  5CB4 B;  2VWK A;  1WA8 B;  4PEL A;  1OCR B;  2DWE C;  1B04 A;  2EIM B;  4LF8 O;  1VAR A;  2UUA B;  4ZKI A;  5CBF A;  1QR8 A;  1OHH G;  4DV2 O;  1TVK B;  1D2D A;  2XND G;  3VQX A;  4MVS A;  4JI1 B;  2YXL A;  3JAL B;  3JD0 A;  1FFX B;  1NBM G;  4I9W A;  2UXC O;  4MT8 A;  1M90 W;  3S3W A;  2JK5 C;  4RAI A;  1XOU A;  3ZMT A;  4DR1 B;  4WFF A;  2L35 A;  1QQC A;  2F95 B;  2YEV A;  4JI5 B;  1EM1 A;  3ABT A;  3ABK B;  1QHT A;  4FIP C;  4TOI A;  3TET A;  1Q5O A;  4YHH B;  3H1J H;  1M1K W;  1Q7Y W;  4ZI7 A;  3CC4 V;  2UXB O;  1NTM H;  4LFA B;  3ABL C;  5IJ0 B;  3G6E V;  1L8D A;  3JAS B;  1YEW A;  1HNX O;  5L3E A;  3RT3 C;  4PI0 A;  3CX5 F;  1Y76 A;  3OW2 U;  1N0N A;  1JFF A;  2B1G A;  4LCU C;  5EBL C;  2Q4P A;  1K4D C;  2MW2 B;  4ZOL B;  4MTX A;  1DF5 A;  4KHP B;  4PV1 B;  4O4I B;  2WA3 A;  5KLV H;  4TV9 A;  2YDE A;  1MZF A;  3QNE A;  4JYA B;  4ZIB A;  5KMG A;  2OT5 A;  2H3O A;  5GTI Z;  1BHA A;  3CHX A;  1XNR B;  1KMI Z;  1JJO A;  3BAA A;  1Q6U A;  4DR3 B;  4YIO A;  2EZP A;  4UVB A;  3B2E E;  3AK3 A;  4LP8 A;  1HNZ B;  4HBN A;  3I56 V;  1SA0 A;  3ASO B;  1O9G A;  1XNQ B;  4IL6 Z;  3T1H O;  2W0X A;  1I94 B;  3O9O A;  3ZCC A;  2ZM6 O;  2NLJ C;  1MSW D;  5IYC O;  4GYC B;  5FNV A;  1BQZ A;  1E79 G;  3CRQ A;  3AK1 A;  2OYQ A;  5FLX N;  3MHS C;  5DED A;  2R72 A;  1I5Y A;  4JAA A;  4G27 B;  4UCS A;  3FKS G;  4H0L B;  5K1P A;  2CAZ C;  1R73 A;  3K0D A;  2HVJ C;  4OPH A;  1N0J A;  1WJZ A;  1VQM V;  1K97 A;  4JAS A;  4J7K A;  2BOB C;  2ZDI C;  3OTO B;  3T1Y B;  1ZX3 A;  3OUS A;  5EBM C;  3RYC B;  1ZAU A;  4UV8 A;  2ITC C;  5F2V O;  2X6B A;  3ZMZ A;  3K79 A;  1HW7 A;  3UM7 A;  5B1O A;  2AW9 A;  1AJP A;  2XAJ A;  1OCO B;  2ADP A;  1GN4 A;  2GTS A;  2WAM A;  2JDI G;  4A5U B;  4DV0 O;  1D5A A;  3JD4 A;  4YXW G;  5E1A C;  1FJG O;  1MZE A;  4P9O A;  1DTO A;  4E2L A;  1BCC H;  4B08 A;  3CRM A;  4JI0 O;  4K0K B;  3CCM V;  1IBM O;  4QIW F;  5IJ9 A;  3B77 A;  1QLN A;  3NXS A;  4HNA A;  3SGI A;  4BIO A;  3LNN A;  2LP7 A;  4J80 A;  1R6T A;  2QKS A;  3HKC B;  1OCC C;  2IH1 C;  2LGQ A;  5JH7 A;  3CCQ V;  5LP6 C;  3SPJ A;  2Q8V A;  3E8G A;  3F5T A;  1AR5 A;  1S5H C;  4U3J B;  4X1Y B;  1US6 A;  2OTL V;  1SF9 A;  1XQ8 A;  1M57 C;  2JRI A;  5B1B C;  2N04 A;  2YIB D;  2DMX A;  2EJR A;  2XAS A;  4D7S A;  3WG7 C;  2YXH A;  5LXT B;  2A3Q A;  3P32 A;  3TXQ A;  4X9Q A;  4EFE A;  5JQG B;  2LO1 A;  2QWQ B;  2DW4 A;  4DRX B;  1UFI A;  2ITD C;  3RYH A;  4R6Z A;  3UQ8 A;  1VQL V;  4JI7 O;  2X7R B;  5CBG A;  2E74 B;  4X20 B;  2B9Z A;  1GRJ A;  1KEC A;  2ADQ B;  2O57 A;  3AG7 A;  1GH6 A;  1BL8 A;  3RGB A;  1DLB A;  1WN7 A;  1TAE A;  3CMA V;  1N34 O;  2ZT9 B;  4DV1 O;  1IVS A;  2Y4U A;  4WFA V;  4DV5 B;  2ZIN A;  4U7O A;  2BOC C;  1KC8 W;  2N05 A;  4DW1 A;  3RWR D;  3VBB A;  1YCI A;  1AP6 A;  5HFM A;  5KHH A;  1Q8I A;  4O4H B;  5EC1 C;  1M5I A;  1JCH A;  4Q6G A;  2JGU A;  2CTQ A;  3T4D A;  1TGO A;  2K9P A;  2B1I A;  4AIL C;  4AHC A;  1R6K A;  2JJ1 G;  2LW7 A;  3OAA G;  4DV6 B;  4LF4 B;  2UXN A;  2Q7G A;  1N36 O;  5KA5 A;  1TUE B;  2IW5 A;  3JD2 A;  5LMN B;  2GDS A;  5CMU A;  1L0N H;  4TUY A;  1ORQ C;  3L9D A;  3G6B A;  2Q67 A;  5IE9 A;  4N23 A;  1SQX H;  1IBL B;  5J2T B;  4JI8 B;  4X66 B;  1HDJ A;  2WLM A;  4OGQ B;  3W7W A;  3KCX A;  1P7G A;  1W0J G;  2XAF A;  4I5S A;  2IJH A;  3CRC A;  4LC1 A;  2R9I A;  1BHB A;  2GTA A;  5TIS Z;  2Q6A A;  1BMF G;  1VQO V;  3ABL B;  3CP1 A;  4JAU A;  5EZY B;  1FS0 G;  1YSC A;  3E2E A;  3N2K B;  4MTF A;  1M56 B;  3K3W A;  5JCO A;  1FFT B;  4LF9 O;  1H2L A;  2HEP A;  3D3I A;  4JV5 B;  3OE7 G;  3WB0 A;  2YS8 A;  3W7T A;  2YID A;  2R70 A;  2GBO A;  2F4V B;  2ARH A;  3KKY A;  5H2F Z;  2Q0O C;  3STZ C;  1CXZ B;  2QTS A;  3QO8 A;  4IIJ B;  5IY5 C;  3SYA A;  4X89 A;  3ZN0 A;  4DR5 O;  4GKJ O;  2OWO A;  5IWA O;  2UXC B;  5GON A;  4MW3 A;  1S3J A;  4YJ2 A;  4B7E A;  2OIG A;  1K9M W;  1VQ9 V;  3ZRX A;  5LGN A;  1VP7 A;  3X2Q C;  4GX2 A;  5H6R A;  3CJH B;  1YDX A;  2HG5 C;  4O2B A;  1GAX A;  3OEH G;  3TGU H;  4GX1 A;  4PJ0 Z;  1EN4 A;  4LFC B;  2Z3Y A;  3G4S V;  1KKD A;  1O9H A;  4X88 A;  5LBQ A;  1WNS A;  3UT5 B;  2NR5 A;  1Q86 W;  2Y0I A;  5BY1 A;  3AG2 B;  3ML0 A;  5B66 Z;  4HZ3 A;  1K33 A;  2PI4 A;  3CE2 A;  1NU1 H;  2Y48 A;  3AG3 B;  4I4T A;  3HKD A;  1I0H A;  4CS2 A;  4Z1M G;  4DXW A;  3RVZ A;  5L3C A;  4LFB B;  1YZB A;  1TUB B;  5LL6 Y;  3SPC A;  2JGD B;  3B40 A;  4O4L A;  2A79 B;  4JTC B;  2ZXW C;  4DR6 O;  4YJ3 A;  1W0K G;  2XOK G;  2UXD O;  1K5Q A;  1YI2 V;  4O4J A;  3QF7 A;  4QJF B;  3FAV A;  2LGW A;  4WFE A;  3SDL A;  3HKE B;  3EXA A;  1FPO A;  2B5U A;  5C93 A;  3TJT A;  1CP9 A;  4MW8 A;  1GKF A;  3H9V A;  1NVP D;  1XIL A;  5LA6 A;  3JAW B;  3SJC C;  4DR4 B;  3ABM C;  1SC5 B;  3JAR B;  4DV3 O;  4WFB V;  1PNL A;  2QWN B;  1XMQ O;  3DSQ A;  3T1H B;  1YJW V;  4JZ2 A;  4F6R B;  1Z5V A;  1ZLZ A;  2ZM6 B;  2ODM A;  4X65 O;  4N21 A;  1DF4 A;  4LWS B;  4D7T A;  1OCC B;  3QO7 A;  1VF7 A;  4CZZ A;  3HKB A;  5KHG A;  1NR7 A;  2AHZ A;  2OCC C;  4JI4 B;  4OX9 B;  1YF2 A;  2QEX V;  4UB6 Z;  2WLK A;  3C3T A;  2HHH O;  2KQX A;  4UB8 Z;  4WBN A;  1NT2 B;  4MVR A;  2PTM A;  2CDY A;  4NXM O;  1MNG A;  3QTC A;  2DOS A;  1PV0 A;  1M57 B;  4CH4 A;  2VS0 A;  5B1B B;  3BAB A;  3THO A;  2ZR2 A;  4NTX A;  3J80 N;  1NKD A;  1YHQ V;  1Y74 A;  2P67 A;  4NXN O;  3CYO A;  2ETN A;  3UO2 A;  3WG7 B;  1H2N A;  1B6Q A;  1THZ A;  4I55 B;  3ZED A;  1NTZ H;  5CB4 A;  5CA1 B;  3CCU V;  1WAZ A;  5CA0 A;  1VF6 A;  1WA8 A;  5GTH Z;  4BAY A;  4XDL A;  2UUC O;  5KHI A;  5LGT A;  4DUY O;  2F66 C;  2PGG A;  1N33 O;  3D36 A;  1GN6 A;  4DV0 B;  5AG2 A;  1NZ6 A;  1ROP A;  4JI2 B;  2OCH A;  3GB7 C;  1GMG A;  3ETE A;  3PJS K;  3TXS A;  4FMT A;  4TV8 A;  4KFM A;  2ZIM A;  2WLI B;  1FFX A;  2BSK B;  2ILM A;  1SRY A;  4TQF A;  4J10 A;  2Q9L A;  1K3E A;  1P4R A;  4NTY A;  4MVO A;  2UU9 B;  4B3T O;  2Y4T A;  2Y0P A;  3E86 A;  1VQN V;  3CEI A;  4GUN A;  2BTO A;  2JS3 A;  5KX5 A;  1R6N A;  3SJQ C;  2PYJ A;  3G67 A;  3E8B A;  2FKX A;  4QPJ A;  5HFL A;  5C8Y B;  2R9R B;  2CH7 B;  2HKO A;  3IC7 A;  1JA8 A;  1L1F A;  5IYD O;  5IT9 N;  5IJ0 A;  2FL4 A;  1H8E G;  1MG1 A;  1JPX A;  1QU7 A;  4I50 B;  4IHJ B;  3SPG A;  4GLX A;  3WB2 A;  4J41 A;  3N2G A;  1I08 A;  3T1C A;  2WLH A;  1NQT A;  2QKC A;  1U97 A;  1FYJ A;  1MAB G;  1YXB A;  2A0L A;  5EYP A;  3PN1 A;  4FLV A;  4C7U A;  3KCY A;  3SJA C;  3L74 H;  3DXR B;  3T2M A;  5LGU A;  3ZHR A;  2DE0 X;  2VQF B;  4DK0 A;  2CTW A;  4TWK A;  4ZOL A;  5LYJ B;  2N74 A;  4FLX A;  1J5E O;  4IYH A;  4MTG A;  1J95 A;  4DV1 B;  3MHH C;  3FYE B;  4ZBM A;  1VF5 B;  3C90 A;  3HB3 B;  2PUS A;  4UUJ C;  1JR9 A;  1Q3E A;  2ZQM A;  1HR0 O;  4YIP A;  2P7T C;  4DV7 B;  1LUV A;  4PI2 A;  5L3F A;  3UO3 A;  1PL0 A;  2WLL B;  5DM6 V;  1SS3 A;  4PDM A;  3CCJ V;  3K9S A;  5BR8 O;  2IU3 A;  3Q4H A;  5IY5 B;  1G6U A;  1KYO F;  2F93 B;  1Q82 W;  4X62 O;  1AI7 A;  1S5L Z;  3OGI B;  4NB5 A;  1MMM A;  4CH3 A;  4ABM A;  2DQ0 A;  3F7V C;  4J7Z A;  2UUB O;  2IJK A;  2WPD G;  1SZX A;  3E22 A;  4LF5 B;  4X1K A;  1QVF U;  1VQ4 V;  1PNM A;  2E5L B;  2PYL A;  4B3S O;  1KBH A;  1RSO B;  4I0X B;  1XBL A;  4UCV A;  1SZT A;  3OFN G;  5B1A C;  5H6Q A;  2HLD G;  1NVP B;  3A0H Z;  3LSQ A;  2G38 A;  1BGY H;  1NR1 A;  3SPI A;  2ZKO A;  4LF9 B;  1EN5 A;  3DC5 A;  3STL C;  3RBZ A;  1KU9 A;  3E8F A;  3A8T A;  1YJ9 V;  1PPJ H;  3BVO A;  4J7J A;  3HKC A;  1SET A;  2KG7 A;  1HNW O;  2F1M A;  3DC6 A;  2ZXW B;  2F23 A;  4X8A A;  5FNV B;  4J9Y B;  2Q69 A;  4DO2 A;  1QR9 A;  1RM1 C;  1YIJ V;  4X64 B;  1QCE A;  2H94 A;  5A2Q N;  4UFZ A;  4JI3 O;  2AXT Z;  3R66 A;  4GZR B;  1LUW A;  3K06 A;  4JYY A;  1XDC A;  3ABM B;  2XUM A;  4OXS A;  1HP8 A;  4DRX A;  5LMU O;  2XAQ A;  5JJN B;  1BT8 A;  2ZIO A;  4U3F H;  1Z5W A;  4FVM A;  1H2K A;  1IXM A;  4TQD A;  2EIN C;  4UCO A;  3K5L A;  3ZMV A;  2Z0A A;  3H1H H;  3ETD A;  2WA4 A;  2OCC B;  4KXR A;  3BA9 A;  1BS3 A;  2UUA O;  1A32 A;  2Y69 C;  2RN9 A;  1WP7 A;  4DV4 B;  1N32 O;  1PM9 A;  4FFB B;  4O2A A;  3A0R A;  3DGE A;  3S3X A;  5BMV B;  2E75 B;  1FD9 A;  4HNA B;  5JJJ B;  1V54 B;  4FLW A;  3C3S A;  2QE7 G;  1VQ7 V;  3EHB B;  2AGA A;  4DR1 O;  5IYB O;  5B5E Z;  2D3O W;  3FB7 C;  5JH7 B;  2HFE C;  4RO2 A;  1ENV A;  4Z2W A;  2EIK C;  3OR6 C;  3EVK A;  4X1I B;  4NR1 A;  4EFB A;  1WLE A;  1COW G;  3SJB C;  4YHH O;  1IBK O;  1R3I C;  4H44 B;  3GWK C;  2QSA A;  2R9A A;  3B8N A;  3JD3 A;  4LFA O;  3AG1 C;  1S5J A;  2L6L A;  2ZE5 A;  1IZ3 A;  4UVA A;  5B3S C;  3M99 B;  1R3J C;  3ZJZ A;  2VQE B;  4NKG B;  2W0F C;  4Q20 A;  3TK1 A;  3K9A A;  3A0B Z;  3ZRV A;  3ZHV A;  2VRZ A;  2BTQ B;  2JVD A;  4NTW A;  3RYH B;  1U96 A;  2QKA A;  1ZTE A;  3DTU B;  4F4L A;  4GKK O;  3D36 C;  5BXZ A;  1QLE C;  4WF9 V;  2RNB A;  4KHP O;  4CH5 A;  1M9N A;  3IFX A;  4I9Q A;  4MVZ A;  1NH2 D;  5EZY A;  4JYA O;  2CUG A;  4EB6 B;  4KUM A;  3F5W C;  4DUZ B;  2QM4 A;  4FPP A;  2IJJ A;  1XNR O;  1Q6H A;  4KP4 A;  1K8A W;  2V4D A;  2ZE6 A;  4MVQ A;  3TCU A;  4DR3 O;  5EIB C;  3ZRW B;  4B3M O;  3JSN A;  1HNZ O;  3ABK C;  4AQY B;  2AHY A;  5JVD B;  2QA4 V;  3I55 V;  1DK1 A;  4LF7 B;  1XNQ O;  3APQ A;  5IYZ A;  4ZHQ B;  1I94 O;  4IIJ A;  2P22 C;  2AZ2 A;  2QWR B;  2XAG A;  1VQP V;  4DYL A;  4W4L A;  2FYU H;  3A2F A;  2HP8 A;  2Z5U A;  3LUT B;  3FYI B;  1N8R W;  4LF8 B;  2V7Q G;  3QVN A;  3P3N A;  3L70 H;  2PI5 A;  3CS5 A;  3JAT A;  4DV2 B;  4JAV A;  3CC7 V;  5KHK A;  3OTO O;  3T1Y O;  4L87 A;  3OEE G;  3OTF A;  5EIB D;  2Q68 A;  4RUF A;  1H2M A;  1WPB A;  4LF6 O;  5E79 Z;  1QNM A;  1FXV A;  4TSF G;  5KAI Z;  4FK5 C;  4GCZ A;  3ZBH A;  2GUZ B;  1MOF A;  2LFS A;  3HR0 A;  4H33 A;  2XTA A;  3SYQ A;  3D8C A;  5H5N A;  4JZG A;  3K08 A;  1TUB A;  2ZCE A;  2ZDI A;  2EIL C;  5DEC A;  2UXB B;  2JGD A;  2CGO A;  5LOV A;  2ZD9 A;  4K3A A;  5J2U A;  1LNQ A;  2DYS C;  3WB1 A;  3U0Z A;  2FML A;  2FTK A;  2E76 B;  3OGC C;  2OIE A;  4GX5 A;  1BE3 H;  1HNX B;  1FXK A;  4CC6 A;  3M7M X;  3HKE A;  2GSM B;  5B1A B;  5L3G A;  2Q7H A;  1SQF A;  4CS4 A;  1R3L C;  3GWO A;  4U7N A;  4FJC C;  3JAW A;  1YTF D;  5GON B;  2Q73 A;  4YJ2 B;  2P06 A;  3CCE V;  1F4M A;  3ZN1 A;  1ZSP A;  4P9P A;  1KD1 W;  3CPW U;  1AR1 B;  4LWS A;  3ZHS A;  3EFF K;  3L72 H;  1K73 W;  2W6I G;  5FPR A;  3FD9 A;  4XDK A;  2LQT A;  1E1R G;  2A06 H;  2GHY A;  1D5N A;  3JD1 A;  4MTO A;  1MA1 A;  3W7U A;  1PKX A;  3E83 A;  4DK1 A;  1YJN V;  2UUB B;  1NTK H;  5J9P C;  4J11 A;  1X4T A;  4AI8 A;  5ITZ A;  3RYI B;  2YC0 A;  4DV5 O;  1V55 C;  4L8J A;  4I55 A;  3LDE A;  2UXX A;  1OV9 A;  2A7W A;  3SYO A;  1KB9 F;  4RQE A;  3CC2 V;  5LP6 B;  1BSM A;  3JAK A;  3U10 A;  4O4L B;  4UCR A;  3CME V;  1IXB A;  1SES A;  1H8H G;  3B09 A;  3VQY A;  4O4J B;  2EIN B;  4HYO A;  4LNU B;  4D6T H;  3FAV B;  3BEH A;  3ETG A;  2BSK A;  1AI6 A;  1NI8 A;  4B7K A;  2Y69 B;  5LA6 B;  2ZNI A;  1OZ0 A;  1VQ8 V;  4DV6 O;  4LF4 O;  3JCU Z;  1Y6X A;  5B1N A;  4FZ0 A;  5LMN O;  4MSW C;  1S72 V;  3BA8 A;  2XT9 A;  2LW1 A;  1TVK A;  2XAH A;  1FJG B;  1RFY A;  2JEU A;  1XRE A;  1IBL O;  4JI0 B;  1IBM B;  4JI8 O;  4X66 O;  3CD6 V;  3OD4 A;  5C8Y A;  3JAL A;  4ICG A;  2X6A A;  1GM7 A;  1XMO O;  1M93 A;  2CH7 A;  3VQV A;  2EJ7 A;  3RYF B;  1NH2 B;  4JI3 B;  2EIK B;  4BW9 A;  1EZJ A;  4I50 A;  4IHJ A;  1CEZ A;  1XI1 A;  2KSD A;  4JTA B;  1BZK A;  1ZL8 B;  1SKV A;  4K8Z A;  5B3S B;  1JX9 A;  3DXR A;  1FAF A;  3LNM B;  4DR2 O;  3O65 A;  2FB5 A;  3ZS8 C;  5CA0 B;  4JV5 O;  4PA7 A;  1RPR A;  5LYJ A;  3CRA A;  3ICX A;  5KA6 A;  3JAS A;  2F4V O;  3K04 A;  1AR4 A;  3RFR A;  1QLE B;  2H8P C;  4K8X A;  1VQ6 V;  3H01 A;  1P49 A;  5LHH A;  1N32 B; 
#chains in the Genus database with same CATH homology
 2KG7 A;  3GVM A;  3G80 A;  3O9O A;  2KG7 B;  3TXQ A;  1WA8 A;  2AZ0 A;  2DE0 X;  1WA8 B;  3ZBH A;  2VRZ A;  2AZ2 A;  3Q4H A;  2VS0 A;  3FAV A;  4I0X A;  3Q4H B;  3HR0 A;  4LWS A;  3FAV B;  4I0X B;  2B9Z A;  4GZR B;  4LWS B;  3GWK C;  3OGI B;  3FD9 A;  3TXS A;  4ABM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...