4LWSB

Esxa : esxb (semet) hetero-dimer from thermomonospora curvata
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
SPSVSDYTRANFGGLSEGEAQFSMTARALLDELTDLEGKLRAKLDRWDGDAQAAYWNYQKEWDAAAKDMQNVVAQLGVAIREAHDNYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Substrates Control Multimerization and Activation of the Multi-Domain ATPase Motor of Type VII Secretion.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Unknown function
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 4lwsB00
2VRZA 3Q4HB 2DE0X 4ABMA 3OGIB 2KG7A 3O9OA 4LWSA 2AZ2A 2B9ZA 1WA8A 2VS0A 3FD9A 3G80A 3TXSA 4I0XA 3FAVA 4LWSB 4GZRB 2KG7B 3Q4HA 3GVMA 3ZBHA 1WA8B 3HR0A 2AZ0A 3GWKC 3TXQA 3FAVB 4I0XB
chains in the Genus database with same CATH superfamily
1FD9A 1P49A 2GBOA 2Y0IA 2DW4A 4F6EA 2QJ1A 4FFBB 3ZHVA 5IYZB 3B77A 1FJGO 2P5OA 2DN9A 4LH6A 2EILC 3WG7B 4EFBA 4B3MB 1WP8A 1ROPA 1BE3H 1SRYA 4RAIA 4DV7O 1BT8A 2C2AA 4TUYB 5IT9N 1U97A 4X20B 3OTOO 4GKJB 4U7OA 3H9VA 2BSKA 1N32O 1IX9A 5CA1A 4PJ0Z 2CH7A 3T1HB 4CZZA 4UV9A 5E1AC 3KCYA 1V54B 2P06A 4TV9B 3PN1A 2WA3A 1WP7A 3AG7A 2VQEB 1RM1C 4X89A 4DYLA 5FPRA 3R66A 5EIBC 4HAMA 2ZXWB 4FLXA 1ZL8B 5KA6A 4ABMA 2UUAB 2Q8VA 3W7WA 3K5NA 1SQPH 1QR9A 4B3TO 4JZGA 5KX5A 2Q7GA 1NS1A 5JH7B 2IU3A 2B1IA 1E79G 1Q82W 1VQ8V 4GYCB 2ZM6B 1SS3A 1WNSA 2A0LA 4MTXA 5B1BB 1HNZO 4J10A 4D6TH 2EJRA 3H1LH 2UXDO 1R6KA 3DSQA 3RYHA 1V55B 4GX2A 3CCEV 1IBLB 3F7VC 4J80A 4OX9O 1LNQA 3CD6V 3K08A 3AG2C 1NH2D 2V1DA 5L3DA 1JVMA 4UCVA 2AW9A 1FFXA 3TGUH 5EZYA 3J7AU 3S3WA 2HVKC 2G38A 5L3BA 4PA7A 2W0XA 5J2TA 4F6RA 2W6JG 4JI4O 4WFAV 3Q4HB 4Q20A 4GKKO 1N0JA 1XBLA 4RWUA 4UCRA 4B7EA 2P22C 2Z3YA 5J9PC 3RWRD 4AI8A 5KX5B 3LNNA 1AI6A 2WLLB 4BAYA 1F23A 4PA9A 4GX1A 3CC2V 3G67A 3RGBA 3JSNA 5F2VO 2F43G 1JCHA 4LWSA 1PD3A 2WLMA 2RN9A 4PDRA 1YVWA 3RYIA 2XTAA 1FXKA 1NVPD 1NU1H 1THZA 3RYCA 2IH3C 3SPIA 4GZRB 1K34A 2B1GA 4JTAB 4YIOA 1XI1A 2PTMA 3SPGA 2BTOA 4HYOA 5EZYB 4C7UA 2ZDIA 1B6QA 1S5JA 4KFMA 1W59A 1XMQB 4JYCA 4X1YA 3S3XA 3MDSA 4DUYO 4F6RB 2ZKOA 3ZN1A 2KB1A 3ZRWA 3K0DA 4Z1MG 1AJQA 3CP1A 3HKEB 3VQYA 3MD0A 4FPPA 3AG2B 5CA0B 5J2UA 4LF6B 4QE9A 4GCZA 5K1XA 3BPZA 1H8EG 1XNRB 5JJJB 2QM4A 4XBFA 2UXNA 3H01A 3CCUV 1VF7A 3E8FA 2VWJA 4JI2B 4LWSB 1Y76B 3RYIB 2FKXA 1R1BA 3HB3B 1VQLV 4LFCO 1JA8A 1K5SA 1AR4A 2E74B 4K3AA 4JYYA 1YIJV 2ZIMA 2P90A 3D36C 4MVMA 3U11A 3OFNG 2DYRC 3RN4A 3FAVA 4FLYA 1K8AW 5IWAB 4YJ3B 4JI6O 4GT1A 3H1IH 1HNWB 5HFMA 5LOVA 4ASUG 3IAYA 1VF5B 2KQXA 1GKFA 2LQTA 2A9HA 3E8HA 1VQPV 3ABTA 3AK2A 3OMNB 3QNEA 4JAUA 3JATA 1MMMA 2YDEA 2A7WA 1AP5A 1SC5B 1L1FA 5B66Z 4H13B 1XDCA 4I50A 4NR1A 2Y4TA 4DW0A 3DGEA 4O4HA 1YJWV 1GM9A 4DW1A 3TCUA 3OAAG 1QVGU 4IL6Z 2VS0A 1DK1A 4F4LA 1WLEA 3SGIA 1SETA 4HNAB 1KU9A 1D2DA 1PL4A 2AHZA 1VF6C 2MW2B 3FAVB 4G2KA 4I9QA 4LF5O 3QO8A 3K9AA 4XDKA 3QO7A 1COWG 4O4IB 2LFSA 1YI2V 4ZOLA 5A9GA 1XMOO 4GUNA 5LHGA 5FPOA 1NI8A 3H1HH 4FM1A 1G4YB 1Q7YW 4RQFA 1GAXA 2DYRB 2QM8A 5L3FA 3H1KH 1GMGA 2YXLA 4NKGB 4LF8O 3UQ8A 2KKWA 4JAVA 4O4HB 4TWKA 2BE3A 3G80A 4CS2A 4LCUC 1Z2GA 5IYCO 5ITZA 3RW0A 1Z5WA 2AHYA 3ABUA 1JJ2U 2ZNJA 4J9YB 3G6EV 4L8JA 2WPDG 3D3IA 1SERA 1GO3F 3K57A 2IW5A 2DWEC 1PNKA 2D2CB 2IM9A 3T1CA 4YHHO 1BCCH 3B4SA 1XEQA 5JQGA 1BQ0A 4MTFA 3TXSA 3IC7A 2JJ2G 2Q73A 2ZINA 1MA1A 1QR8A 4FMTA 4DRXB 1XOUA 4BWAA 4GKJO 4O2AA 3WB2A 5D5PA 2IBZH 3T1HO 4KXRA 2PY5A 1IURA 3RFRA 2GSMB 3TK1A 4X9QA 5HFLA 3VQXA 1SZXA 3WU2Z 4U3JA 3CRQA 2VQEO 3E22A 1YJ9V 5EYPA 5H9CA 5EBLC 1XL6A 2ZD9A 4DR5O 1XREA 1YZBA 2WA4A 3BEHA 2UUAO 2XAHA 1GRJA 1I08A 4G28B 5LGNA 2ZM6O 4JAAA 2B5UA 5B1NA 3ZS8C 4JI1B 2A06H 4OPHA 2GTAA 2JGDA 4H33A 2YSUB 2P7TC 1IBLO 4MS2A 2QTOA 1CXZB 2F4VB 3CC4V 4YY3B 3WFVA 4YXWG 5JQGB 3ZMSA 4MSWC 4JASA 1HWYA 1YTFD 2HVJC 2UUBB 3N2GA 1KKCA 2X6BA 4PI2A 2YUAA 4LFAB 1OCZB 4NVPA 1R3KC 1VQKV 2H3OA 4X64B 4I55B 1F4NA 3EXAA 2Q4PA 5IJ0A 1GN4A 2CAZC 1A32A 2RNBA 3E22B 3B2EE 4HZ3A 3LUTB 4JYAB 1PP9H 2KSDA 3FX7A 1QLNA 3UO2A 1H8HG 3E89A 4DXWA 4X62B 1XILA 2WLNA 2N04A 5B1AC 3U0ZA 3FFQA 1M1KW 3BA8A 3CEIA 5C8YA 4BIOA 5LMNB 1I0HA 3JD4A 3UM7A 3ABLC 4DR7B 3ZHUA 1Y6XA 3JCUZ 3RYFA 1JQ0A 5E79Z 5CBFA 1R3LC 2WLHA 1N33O 2Q67A 1RFYA 5LYJB 1S0VA 3NR7A 3HKBB 1QHTA 4QE7A 5CB4B 2UUCB 1XMQO 1VQ6V 2KG7B 3W7SA 2XT9A 1O9GA 1KBHA 4JYBA 4TQFA 1KUQA 3J80N 4WFGA 3RBZA 1X4TA 2LW7A 1BHBA 3CRRA 4UCUA 5IJ0B 2AGAA 5L3EA 4DR6B 1FPOA 1KB9F 4NB5A 1IZ3A 4BW5A 2MK3A 3CYOA 3GWOA 2RDCA 4LF6O 4JF3A 2PUSA 3JAKB 4N21A 3K79A 1M93A 1B06A 1XNRO 2OYQA 3KG2A 1W0JG 2ADPA 4CC5A 1YITV 1XNQB 4LF4O 1JR9A 2A3QA 4JI2O 1NH2B 4KHPB 3L73H 4QPKA 5B1BC 4J7KA 2E76B 2ZNIA 4O2BA 1IBMB 4TT3G 3SR2C 2WAMA 4MT8A 4DK1A 2L35A 4I0XB 2Q6AA 2P67A 1BSMA 1TUBA 2XUMA 1S77D 2H94A 1EN5A 3UKMA 5BMVB 5IWAO 2UXBO 4CH4A 3ABLB 2V4DA 1HNWO 4DR3B 4PDMA 1D5AA 3STLC 1IVSA 2ZCEA 3ZEDA 1KECA 4IYHA 1T5EA 3ETEA 3R65A 1KP3A 1DF4A 1RPRA 4X1KB 4PELA 1M57C 4TQDA 2JEXA 1BL8A 3RVYA 5FNVA 5GTHZ 3L72H 4HBNA 2X6AA 3AK1A 2IJHA 2ZR3A 4WFBV 4JV5B 1BHAA 1SKVA 3F5TA 4UUJC 1E1RG 3CCRV 3OEEG 4O2BB 3QTCA 4DV2B 4PDLA 4FZ1A 4TV8A 4J42A 1PNLA 1J95A 2CUGA 1OHHG 4J7JA 2EIJC 1Q81W 3LDDA 1TAEA 2P4KA 2JGUA 1O9HA 1GM8A 5EK0A 1I5XA 1PKXA 5BR8O 2BCCH 4P2ZA 2R72A 5GONA 2Y48A 1P4RA 4D7TA 3G4SV 4BIZA 4DUZB 3ETDA 5DN6G 2QM7A 4E2LA 1S5LZ 1JFFA 2R70A 3QO5A 4FIPC 3K59A 1SESA 2DJVA 3W7XA 3ASOC 2YICA 3OW2U 4B3SB 2BSKB 5CA1B 1KYOF 2GUZA 2CH7B 1N36O 2IJKA 1S76D 5LMUB 2PF4E 1Y67A 1AJNA 2ZE7A 1KC8W 2BTQA 4CBCA 1GTOA 4JGSA 1FXKC 1ORQC 4MVRA 1M57B 3CE2A 3LDEA 4TV8B 4J7ZA 3L70H 4LF7O 2YI9A 3DXRA 4NXNB 5LL6Y 4K35A 3JAWA 4JI0O 2ZDIC 3SYOA 1AILA 2EX3A 1VIBA 1JPXA 3ZCCA 4ZHQA 3AK3A 3BY6A 2AZ2A 1HDJA 1EBOA 4FLTA 3F7YC 1ZLZA 1G1XB 3RYHB 3GVMA 2EIJB 4FLUA 1JFFB 2AZ0A 2AXTZ 3ABMC 4YIPA 1FFXB 2LP7A 1YF2A 1CP9A 4KL1A 1MZFA 4O4LA 1PV0A 4FLWA 5KHJA 1J5EB 4FK5C 2JS3A 1K92A 3ZMVA 1UPGA 1P84F 2GUZB 3K5LA 5J2TB 4NXMB 1S72V 1R6TA 3ZMZA 1AR1B 3CHXA 1UFIA 3UT5A 3CWBH 1H2LA 2IJIA 3A2FA 4CC6A 4JI1O 4AQYB 3MHSC 2UXCB 1S5HC 3DXRB 3ASOB 4YY3O 3SJBC 2PGGA 4TSFG 1ZWIC 4H0LB 4XDLA 3JAWB 3C90A 4JTDB 3FB5C 2UUBO 4LFAO 3BABA 2OIEA 1FXKB 4DO2A 3RYCB 1M9NA 3L9DA 4X64O 1GN3A 3SJQC 5EC2C 4CS3A 3KKYA 3ZMUA 1ZX3A 2R9IA 3E8BA 3LSUA 1TGOA 2YIAA 3QVNA 4JYAO 2A79B 3DC5A 4PD4F 1QCEA 1Q90D 4X1YB 2QGNA 1MZEA 1Q6IA 4MVQA 1ZSPA 5IJ9A 2EBOA 3E35A 3P3PA 4LBEC 3ZHSA 5B1OA 3ZRWB 2UU9O 1OCCB 4DV1B 3UT5B 2HP8A 5LMNO 1H2NA 2QKAA 2Q5ZA 1OCOC 3ABMB 5J2UB 4DV3B 3X2QB 2HKOA 2IU0A 5CN0A 2ILMA 4X8AA 1EFRG 3JALA 1LUVA 5KAIZ 2CTPA 2DQ0A 2DYSB 2CTRA 2ZT9B 3SYQA 3IC9A 1M90W 4JI7B 3O9OA 4JI3B 4R7CA 2QR4A 4BW9A 1NKDA 3JASA 1VQMV 4J9ZB 3ZRXA 3JD3A 4WFFA 1H2KA 3CB2A 4PHZA 4BIUA 3CPWU 2DWDC 3JD1A 3LSQA 1KKDA 5EIBD 3OTOB 5FL7G 2BOCC 1Y74A 3JAMN 2N74A 2M7WA 2ZE6A 3H1JH 2EJ7A 5IJ9B 2V7QG 2X6CA 4BR6A 4ZIBA 4PA6A 1XHXA 1N0NA 1YEWA 2F93B 5LOVB 3QF7A 1G6UA 1XNQO 4PI0A 4WCEV 2XHBA 4AILC 1YTFB 4DK0A 1R6NA 1DGSA 5LA6A 4D7SA 3JATB 5LGUA 3E2EA 1IBMO 4I50B 4W4KA 3T2MA 5LXTA 1FKAO 3JALB 1AI5A 1HNXO 3ZHRA 1IDSA 4W4LA 2F23A 1QBZA 2UXDB 3APOA 3TJTA 2IJJA 2QTSA 2WWWA 4X66B 3JASB 5GTIZ 5K1PA 1OCOB 2ETNA 3ZRVA 4I4TA 4DR3O 3N27A 1W2BU 3BCCH 2Q9LA 1OCZC 2ARHA 4AHCA 5CBHA 3JCZA 2PYJA 1Y74B 1N34B 4B3MO 1K3EA 2X7RB 2K1EA 4MW8A 1N4CA 1VQ7V 4DV4B 5CMUA 3OEHG 2QA4V 5JCOC 4JI5B 5LHHA 4ZOLB 4I9WA 1NJIW 4K0KB 3CRAA 2L6LA 5EC1C 3ZX6A 1I5YA 1FFTB 1PNMA 2YIDA 3D3QA 3OMAB 2VQFB 5LA6B 1JOYA 1XHZA 4WBNA 3FB6C 3CX5F 2Y4UA 3L75H 1MOFA 3JSLA 2ITDC 4H37A 1P7BA 5LXTB 5JCOA 4RO2A 2HJFC 3BFRA 5DM6V 5B3SC 1XL4A 1M56B 4JZ2A 3BRCA 1OV9A 3L71H 2OTJV 5ITZB 4YJ2A 3RT3C 2LFRA 1B04A 3M8AA 3OGCC 4I4TB 3O65A 3CJHA 2XAJA 3SJCC 3P30A 2YI8A 1IBKB 4LH7A 3OM3B 2GV9A 3ZRSA 5KAFZ 3CXCU 2Q0AA 4DUZO 2FMLA 1IXMA 3E8GA 4N23A 3K58A 4OPAA 2ZQMA 4E4EA 3MHHC 1G8MA 4FLVA 5KHGA 3OGIB 2BOBC 4G27B 4O2AB 1DLBA 3FD9A 3MAQA 3I55V 1GM7A 4FVMA 4WBNB 1OCRC 2QWPB 1L0LH 4U3JB 2E5LB 2XAGA 2Z0AA 5EYPB 5GW7A 4NTXA 5JJEB 1WJZA 3DC6A 3B09A 1K73W 3CC7V 1H2SB 4LFCB 2JEUA 2PI5A 5JVDA 4UXNA 2JRIA 1K97A 1LUWA 3T4ZA 2JGDB 4DR1B 1ZUQA 1M4UA 2ZE8A 4IIJA 1AB3A 3JYCA 3UCSC 2CTQA 3OMIB 4U3FH 3K5OA 3STZC 5B3SB 2DOSA 2CE4A 3ZMTA 1QLEB 3N2GB 4JI8B 3M99B 2VWKA 2HR3A 1MNGA 1BMFG 4DV0B 4NXMO 4LR3A 2HHHB 5H2FZ 1JX9A 3HKDA 4LC1A 1LR1A 2YEVA 4AQYO 4TOIA 5LP6A 4CH5A 2QEXV 2UXCO 4CH6A 1DF5A 4UV8A 1BGYH 1SQVH 5H6QA 1U96A 4JTCB 3ABKC 3N2KA 5KHIA 5C8YB 2QWQB 2D3OW 2DQ3A 5KA5A 1NT2B 1OCRB 1HP8A 1XUQA 4IIJB 3RYFB 2CK3G 4DV6B 1SQGA 4I7ZB 1UJWB 1AROP 4X20A 2RJZA 3HR0A 1VMGA 2FL4A 4DV5B 4LNUA 1K5QA 2K9PA 4XDJA 3CCSV 4FM2A 1HW7A 4DV1O 3A0HZ 3JD2A 3APQA 2EIMC 1P7GA 1Q6UA 2FB5A 1JJOA 1ZAUA 2XAFA 2EINC 4DV3O 4Q6GA 1D5NA 2Q0OC 5JH7A 1TUEB 2DE0X 4IGGA 1NVPB 3N2KB 3ICXA 5L3GA 2LO1A 2IH1C 2EULA 1E1QG 2PI4A 1URFA 1Q86W 4JI7O 2YIBD 4YHHB 4JI3O 2RMKB 3ETQA 2JS5A 2RCVA 4I5SA 3L74H 1MSWD 1R3JC 5KHHA 5C93A 2F95B 5LBQA 3T1YB 3K9SA 4DR2B 2XAQA 1F7YA 4RQEA 2QSAA 2NLJC 3ABKB 2X0LA 4LNUB 1TUBB 1YDXA 5BY1A 1OZ0A 1VEWA 1K4DC 1QVFU 3Q4HA 1CPYA 3ZJZA 5A2QN 2YC0A 3JD0A 3SPCA 5TISZ 3CSXA 5DEDA 5JWPA 2LGWA 4DR5B 1KP2A 3P32A 2P6JA 3J81N 2WLJA 4JPRA 1Y66A 2WLLA 3SJAC 4RUEA 3BHPA 5FNVB 1AJPA 2XOKG 3BAAA 3LSSA 3M7MX 2QE7G 4QJFB 2XNDG 2WLIA 4CH3A 1GH6A 3ZIAG 2EIMB 4B08A 4X66O 1KQSU 2LW1A 2EINB 4O4JA 1VQ5V 4GX0A 4OGQB 4IHJA 1NTZH 3VOUA 3BVOA 5KLVH 2ADQB 4UB8Z 2O57A 1HR0B 1N34O 4LP8A 2OIGA 4MVUA 2E75B 4DV4O 2EILB 3SYPA 1PPJH 5CBGA 4JI5O 3HKEA 4UVCA 3SPHA 3IGAC 4WF9V 1Q8IA 4L87A 1K4CC 5CA0A 2JVDA 4K0KO 5GONB 1BQZA 1OCCC 3A8TA 5L3CA 3K03A 1RSOA 2VQFO 1IXBA 2OTLV 5LHIA 3K0GA 1VARA 2QKCA 3B40A 3FKSG 4DR4B 5AG2A 3X2QC 4PDVA 4UVAA 1V9PA 3TETA 1I94B 1Y76A 3THOA 1WPBA 4U7NA 3ASNC 3W7UA 1RM1B 1US6A 2B9ZA 4A5UB 1Q6HA 4LF9B 2HG5C 3E83A 4QNHB 2ODMA 2WLIB 1VP7A 2DYSC 2BTQB 2QWOB 1SA0A 1N33B 4O4JB 4PA3A 3FB7C 4IHJB 1IBKO 4UCTA 1PM9A 3AG1C 4UB6Z 1F4MA 2FTKA 3C3TA 2F4VO 1F51A 4YJ3A 3KZIZ 3FYEB 4LFBB 3AG4C 4FLZA 1WN7A 3CXHF 3OD4A 1YCIA 4ZHQB 1WAZA 4P9PA 3SDLA 3CMEV 4K8ZA 3ZHTA 4X65B 4Z2WA 1EZJA 4GX5A 3OR7C 3EVKA 4UCSA 1RSOB 1PL0A 4UCOA 3WB0A 3U10A 4MVZA 2GDSA 1JMKC 1EZVH 1B3QA 1H2MA 2E5LO 1NTKH 3OT7A 4OXSA 3SYAA 2H8PC 4LF4B 4O4LB 4FFKA 3IJ4A 2RQ6A 4J11A 2Q7EA 3IFXA 4X62O 4FZ0A 2M6YA 1W0KG 1NBMG 4P9OA 1ENVA 1AR5A 1SA0B 1S3JA 2Q68A 2WLKA 3SPJA 2YXYA 4B3RB 5IYDO 4KP4A 1K7DA 4ZI7A 4HNAA 2ZR2A 4QIWF 4DR7O 3LNMB 4DR1O 5KMGA 3WB1A 3CCLV 4MVSA 1VQOV 2UXBB 1GK9A 3ASNB 4O4IA 4UFZA 4FJCC 1FJGB 4B7KA 1SQBH 2R9AA 4JI8O 5CA3A 2UUCO 1NTMH 2ZE5A 4DV0O 1OJHA 3D36A 1AP6A 4DV7B 2EZPA 2W6IG 3AG1B 2EZOA 4NTWA 5IDJA 2HHHO 3OUSA 2OCHA 2YS8A 2HEPA 1CEZA 4DR6O 1N32B 4IT5A 5DECA 4RUFA 3BA9A 1TA8A 3AG4B 3AG3C 2GTSA 4IYIA 3A0RA 3CRCA 2QDOA 1H2GA 3OR6C 2JDIG 1AVMA 4X1IA 1M56C 4WFHA 3B8NA 2Q7HA 4QGPA 4ZI7B 4Z1VA 1K9MW 4B3TB 4KHPO 1NQTA 5KMGB 3OUFA 4DV6O 4UVBA 3G6BA 5BZBA 1FYJA 1YJNV 3JARA 4DRXA 1HNZB 2Y69C 5BR8B 1VQ9V 2CTWA 4DV5O 2GHYA 5H6RA 5KUMA 3CMAV 4OX9B 1YXBA 4EKWA 2JK5C 1Q43A 1VF6A 1MSDA 1R73A 2HLDG 2XASA 5B5EZ 1BZKA 2E3CA 1SZTA 2Y0PA 3HKCA 1X59A 1NR1A 3P3NA 2NNUA 4MTOA 2PZSA 2DMXA 1N36B 4JI4B 1Q5OA 1FXHA 3I56V 4X88A 4GKKB 1QQCA 1DTOA 2W0FC 1I7FA 4X1IB 4EEQA 1EN6A 4QPJA 2VRZA 2ITCC 4JV5O 4LF7B 5JJNB 5IYBO 4JI0B 3AG3B 3FYIB 1Y4MA 5H5NA 3PJSK 3C3SA 4DV2O 2FYUH 3T1YO 3K3WA 1WB8A 3F5WC 3G71V 4R50A 3JARB 4DR2O 3T4DA 3NXSA 1EM1A 2F66C 3VQWA 1R3IC 4WFEA 3GB7C 1QLEC 4I55A 2QWRB 2JIZG 4ICGA 2ATKC 3SYCA 1SQQH 2ZIOA 5EBWC 3HKCB 1TVKA 4J41A 4GLXA 5IE9A 3KCXA 4H44B 2Y69B 4R8CA 4DUYB 2F1MA 4EB6A 2OT5A 3CCJV 2OCCC 3HPLC 2YIBA 1AI4A 1SQFA 1GN2A 1N8RW 4B3SO 5KUKA 2EIKC 2Z5UA 5LMUO 2CGOA 1FS0G 2HJDA 4CS4A 2HFEC 3D8CA 3ETGA 1MG1A 5LGTA 1YHQV 5LYJA 1L0NH 4PV1B 2QWNB 3HKBA 1BS3A 1WB7A 1FXVA 1YSCA 5CB4A 1SF9A 1HR0O 1K33A 2KG7A 1ZTEA 5EBMC 3E86A 4NXNO 1M5IA 4MVOA 2YXHA 2UXXA 4YJ2B 2R9RB 5IY5C 3CJHB 1L8DA 3VBBA 4EFEA 1TVKB 3JAKA 4MTGA 1Q3EA 4ZKIA 3CRMA 4PA4A 1AI7A 4JI6B 4EB6B 5FLXN 2UU9B 3DTUB 1FAFA 4DR4O 5LP6C 3W7TA 3OE7G 1I94O 3K04A 1XQ8A 1J5EO 3ZHQA 2NN4A 4LF9O 1VQNV 1RPOA 4ZBMA 3VQVA 1RP3B 1WPXA 3WG7C 1NZ6A 3CCMV 3A0BZ 1WA8A 2LJ2A 4I0XA 2OCCB 2WSSG 5BMVA 2PYLA 3K5MA 5KHKA 5BXZA 1H38A 2NR5A 3ZBHA 3UO3A 2CDYA 3QG5A 3LDCA 3RVZA 4LFBO 2EIKB 4FFBA 5JVDB 1VQ4V 1MABG 2LGQA 5IYZA 4NTYA 2Q69A 3ZN0A 1KMIZ 3CCQV 2N05A 1V54C 3B8MA 3CCVV 3OTFA 4X65O 3AEIA 4LF5B 4X1KA 1Z5VA 2ZXWC 4TUYA 1NR7A 3FB8C 4R6ZA 1EN4A 1XMOB 4MW3A 2QKSA 3CS5A 5IY5B 3EHBB 1KD1W 1GN6A 3I5DA 4TV9A 2P4VA 1QU7A 2OWOA 3K06A 5D5QA 2JJ1G 2CGNA 1V55C 3HKDB 1SQXH 5B1AB 4B3RO 4P30A 1HNXB 4KUMA 4NYKA 1ZL8A 4LF8B 1WA8B 2YEVB 4FM0A 4K8XA 1QNMA 3ML0A 3GWKC 3TXQA 3EFFK 5LP6B
chains in the Genus database with same CATH topology
2VRZA 3Q4HB 2DE0X 4ABMA 3OGIB 2KG7A 3O9OA 4LWSA 2AZ2A 2B9ZA 1WA8A 2VS0A 3FD9A 3G80A 3TXSA 4I0XA 3FAVA 4LWSB 4GZRB 2KG7B 3Q4HA 3GVMA 3ZBHA 1WA8B 3HR0A 2AZ0A 3GWKC 3TXQA 3FAVB 4I0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRZ A;  3Q4H B;  2DE0 X;  4ABM A;  3OGI B;  2KG7 A;  3O9O A;  4LWS A;  2AZ2 A;  2B9Z A;  1WA8 A;  2VS0 A;  3FD9 A;  3G80 A;  3TXS A;  4I0X A;  3FAV A;  4LWS B;  4GZR B;  2KG7 B;  3Q4H A;  3GVM A;  3ZBH A;  1WA8 B;  3HR0 A;  2AZ0 A;  3GWK C;  3TXQ A;  3FAV B;  4I0X B; 
#chains in the Genus database with same CATH topology
 1FD9 A;  1P49 A;  2GBO A;  2Y0I A;  2DW4 A;  4F6E A;  2QJ1 A;  4FFB B;  3ZHV A;  5IYZ B;  3B77 A;  1FJG O;  2P5O A;  2DN9 A;  4LH6 A;  2EIL C;  3WG7 B;  4EFB A;  4B3M B;  1WP8 A;  1ROP A;  1BE3 H;  1SRY A;  4RAI A;  4DV7 O;  1BT8 A;  2C2A A;  4TUY B;  5IT9 N;  1U97 A;  4X20 B;  3OTO O;  4GKJ B;  4U7O A;  3H9V A;  2BSK A;  1N32 O;  1IX9 A;  5CA1 A;  4PJ0 Z;  2CH7 A;  3T1H B;  4CZZ A;  4UV9 A;  5E1A C;  3KCY A;  1V54 B;  2P06 A;  4TV9 B;  3PN1 A;  2WA3 A;  1WP7 A;  3AG7 A;  2VQE B;  1RM1 C;  4X89 A;  4DYL A;  5FPR A;  3R66 A;  5EIB C;  4HAM A;  2ZXW B;  4FLX A;  1ZL8 B;  5KA6 A;  4ABM A;  2UUA B;  2Q8V A;  3W7W A;  3K5N A;  1SQP H;  1QR9 A;  4B3T O;  4JZG A;  5KX5 A;  2Q7G A;  1NS1 A;  5JH7 B;  2IU3 A;  2B1I A;  1E79 G;  1Q82 W;  1VQ8 V;  4GYC B;  2ZM6 B;  1SS3 A;  1WNS A;  2A0L A;  4MTX A;  5B1B B;  1HNZ O;  4J10 A;  4D6T H;  2EJR A;  3H1L H;  2UXD O;  1R6K A;  3DSQ A;  3RYH A;  1V55 B;  4GX2 A;  3CCE V;  1IBL B;  3F7V C;  4J80 A;  4OX9 O;  1LNQ A;  3CD6 V;  3K08 A;  3AG2 C;  1NH2 D;  2V1D A;  5L3D A;  1JVM A;  4UCV A;  2AW9 A;  1FFX A;  3TGU H;  5EZY A;  3J7A U;  3S3W A;  2HVK C;  2G38 A;  5L3B A;  4PA7 A;  2W0X A;  5J2T A;  4F6R A;  2W6J G;  4JI4 O;  4WFA V;  3Q4H B;  4Q20 A;  4GKK O;  1N0J A;  1XBL A;  4RWU A;  4UCR A;  4B7E A;  2P22 C;  2Z3Y A;  5J9P C;  3RWR D;  4AI8 A;  5KX5 B;  3LNN A;  1AI6 A;  2WLL B;  4BAY A;  1F23 A;  4PA9 A;  4GX1 A;  3CC2 V;  3G67 A;  3RGB A;  3JSN A;  5F2V O;  2F43 G;  1JCH A;  4LWS A;  1PD3 A;  2WLM A;  2RN9 A;  4PDR A;  1YVW A;  3RYI A;  2XTA A;  1FXK A;  1NVP D;  1NU1 H;  1THZ A;  3RYC A;  2IH3 C;  3SPI A;  4GZR B;  1K34 A;  2B1G A;  4JTA B;  4YIO A;  1XI1 A;  2PTM A;  3SPG A;  2BTO A;  4HYO A;  5EZY B;  4C7U A;  2ZDI A;  1B6Q A;  1S5J A;  4KFM A;  1W59 A;  1XMQ B;  4JYC A;  4X1Y A;  3S3X A;  3MDS A;  4DUY O;  4F6R B;  2ZKO A;  3ZN1 A;  2KB1 A;  3ZRW A;  3K0D A;  4Z1M G;  1AJQ A;  3CP1 A;  3HKE B;  3VQY A;  3MD0 A;  4FPP A;  3AG2 B;  5CA0 B;  5J2U A;  4LF6 B;  4QE9 A;  4GCZ A;  5K1X A;  3BPZ A;  1H8E G;  1XNR B;  5JJJ B;  2QM4 A;  4XBF A;  2UXN A;  3H01 A;  3CCU V;  1VF7 A;  3E8F A;  2VWJ A;  4JI2 B;  4LWS B;  1Y76 B;  3RYI B;  2FKX A;  1R1B A;  3HB3 B;  1VQL V;  4LFC O;  1JA8 A;  1K5S A;  1AR4 A;  2E74 B;  4K3A A;  4JYY A;  1YIJ V;  2ZIM A;  2P90 A;  3D36 C;  4MVM A;  3U11 A;  3OFN G;  2DYR C;  3RN4 A;  3FAV A;  4FLY A;  1K8A W;  5IWA B;  4YJ3 B;  4JI6 O;  4GT1 A;  3H1I H;  1HNW B;  5HFM A;  5LOV A;  4ASU G;  3IAY A;  1VF5 B;  2KQX A;  1GKF A;  2LQT A;  2A9H A;  3E8H A;  1VQP V;  3ABT A;  3AK2 A;  3OMN B;  3QNE A;  4JAU A;  3JAT A;  1MMM A;  2YDE A;  2A7W A;  1AP5 A;  1SC5 B;  1L1F A;  5B66 Z;  4H13 B;  1XDC A;  4I50 A;  4NR1 A;  2Y4T A;  4DW0 A;  3DGE A;  4O4H A;  1YJW V;  1GM9 A;  4DW1 A;  3TCU A;  3OAA G;  1QVG U;  4IL6 Z;  2VS0 A;  1DK1 A;  4F4L A;  1WLE A;  3SGI A;  1SET A;  4HNA B;  1KU9 A;  1D2D A;  1PL4 A;  2AHZ A;  1VF6 C;  2MW2 B;  3FAV B;  4G2K A;  4I9Q A;  4LF5 O;  3QO8 A;  3K9A A;  4XDK A;  3QO7 A;  1COW G;  4O4I B;  2LFS A;  1YI2 V;  4ZOL A;  5A9G A;  1XMO O;  4GUN A;  5LHG A;  5FPO A;  1NI8 A;  3H1H H;  4FM1 A;  1G4Y B;  1Q7Y W;  4RQF A;  1GAX A;  2DYR B;  2QM8 A;  5L3F A;  3H1K H;  1GMG A;  2YXL A;  4NKG B;  4LF8 O;  3UQ8 A;  2KKW A;  4JAV A;  4O4H B;  4TWK A;  2BE3 A;  3G80 A;  4CS2 A;  4LCU C;  1Z2G A;  5IYC O;  5ITZ A;  3RW0 A;  1Z5W A;  2AHY A;  3ABU A;  1JJ2 U;  2ZNJ A;  4J9Y B;  3G6E V;  4L8J A;  2WPD G;  3D3I A;  1SER A;  1GO3 F;  3K57 A;  2IW5 A;  2DWE C;  1PNK A;  2D2C B;  2IM9 A;  3T1C A;  4YHH O;  1BCC H;  3B4S A;  1XEQ A;  5JQG A;  1BQ0 A;  4MTF A;  3TXS A;  3IC7 A;  2JJ2 G;  2Q73 A;  2ZIN A;  1MA1 A;  1QR8 A;  4FMT A;  4DRX B;  1XOU A;  4BWA A;  4GKJ O;  4O2A A;  3WB2 A;  5D5P A;  2IBZ H;  3T1H O;  4KXR A;  2PY5 A;  1IUR A;  3RFR A;  2GSM B;  3TK1 A;  4X9Q A;  5HFL A;  3VQX A;  1SZX A;  3WU2 Z;  4U3J A;  3CRQ A;  2VQE O;  3E22 A;  1YJ9 V;  5EYP A;  5H9C A;  5EBL C;  1XL6 A;  2ZD9 A;  4DR5 O;  1XRE A;  1YZB A;  2WA4 A;  3BEH A;  2UUA O;  2XAH A;  1GRJ A;  1I08 A;  4G28 B;  5LGN A;  2ZM6 O;  4JAA A;  2B5U A;  5B1N A;  3ZS8 C;  4JI1 B;  2A06 H;  4OPH A;  2GTA A;  2JGD A;  4H33 A;  2YSU B;  2P7T C;  1IBL O;  4MS2 A;  2QTO A;  1CXZ B;  2F4V B;  3CC4 V;  4YY3 B;  3WFV A;  4YXW G;  5JQG B;  3ZMS A;  4MSW C;  4JAS A;  1HWY A;  1YTF D;  2HVJ C;  2UUB B;  3N2G A;  1KKC A;  2X6B A;  4PI2 A;  2YUA A;  4LFA B;  1OCZ B;  4NVP A;  1R3K C;  1VQK V;  2H3O A;  4X64 B;  4I55 B;  1F4N A;  3EXA A;  2Q4P A;  5IJ0 A;  1GN4 A;  2CAZ C;  1A32 A;  2RNB A;  3E22 B;  3B2E E;  4HZ3 A;  3LUT B;  4JYA B;  1PP9 H;  2KSD A;  3FX7 A;  1QLN A;  3UO2 A;  1H8H G;  3E89 A;  4DXW A;  4X62 B;  1XIL A;  2WLN A;  2N04 A;  5B1A C;  3U0Z A;  3FFQ A;  1M1K W;  3BA8 A;  3CEI A;  5C8Y A;  4BIO A;  5LMN B;  1I0H A;  3JD4 A;  3UM7 A;  3ABL C;  4DR7 B;  3ZHU A;  1Y6X A;  3JCU Z;  3RYF A;  1JQ0 A;  5E79 Z;  5CBF A;  1R3L C;  2WLH A;  1N33 O;  2Q67 A;  1RFY A;  5LYJ B;  1S0V A;  3NR7 A;  3HKB B;  1QHT A;  4QE7 A;  5CB4 B;  2UUC B;  1XMQ O;  1VQ6 V;  2KG7 B;  3W7S A;  2XT9 A;  1O9G A;  1KBH A;  4JYB A;  4TQF A;  1KUQ A;  3J80 N;  4WFG A;  3RBZ A;  1X4T A;  2LW7 A;  1BHB A;  3CRR A;  4UCU A;  5IJ0 B;  2AGA A;  5L3E A;  4DR6 B;  1FPO A;  1KB9 F;  4NB5 A;  1IZ3 A;  4BW5 A;  2MK3 A;  3CYO A;  3GWO A;  2RDC A;  4LF6 O;  4JF3 A;  2PUS A;  3JAK B;  4N21 A;  3K79 A;  1M93 A;  1B06 A;  1XNR O;  2OYQ A;  3KG2 A;  1W0J G;  2ADP A;  4CC5 A;  1YIT V;  1XNQ B;  4LF4 O;  1JR9 A;  2A3Q A;  4JI2 O;  1NH2 B;  4KHP B;  3L73 H;  4QPK A;  5B1B C;  4J7K A;  2E76 B;  2ZNI A;  4O2B A;  1IBM B;  4TT3 G;  3SR2 C;  2WAM A;  4MT8 A;  4DK1 A;  2L35 A;  4I0X B;  2Q6A A;  2P67 A;  1BSM A;  1TUB A;  2XUM A;  1S77 D;  2H94 A;  1EN5 A;  3UKM A;  5BMV B;  5IWA O;  2UXB O;  4CH4 A;  3ABL B;  2V4D A;  1HNW O;  4DR3 B;  4PDM A;  1D5A A;  3STL C;  1IVS A;  2ZCE A;  3ZED A;  1KEC A;  4IYH A;  1T5E A;  3ETE A;  3R65 A;  1KP3 A;  1DF4 A;  1RPR A;  4X1K B;  4PEL A;  1M57 C;  4TQD A;  2JEX A;  1BL8 A;  3RVY A;  5FNV A;  5GTH Z;  3L72 H;  4HBN A;  2X6A A;  3AK1 A;  2IJH A;  2ZR3 A;  4WFB V;  4JV5 B;  1BHA A;  1SKV A;  3F5T A;  4UUJ C;  1E1R G;  3CCR V;  3OEE G;  4O2B B;  3QTC A;  4DV2 B;  4PDL A;  4FZ1 A;  4TV8 A;  4J42 A;  1PNL A;  1J95 A;  2CUG A;  1OHH G;  4J7J A;  2EIJ C;  1Q81 W;  3LDD A;  1TAE A;  2P4K A;  2JGU A;  1O9H A;  1GM8 A;  5EK0 A;  1I5X A;  1PKX A;  5BR8 O;  2BCC H;  4P2Z A;  2R72 A;  5GON A;  2Y48 A;  1P4R A;  4D7T A;  3G4S V;  4BIZ A;  4DUZ B;  3ETD A;  5DN6 G;  2QM7 A;  4E2L A;  1S5L Z;  1JFF A;  2R70 A;  3QO5 A;  4FIP C;  3K59 A;  1SES A;  2DJV A;  3W7X A;  3ASO C;  2YIC A;  3OW2 U;  4B3S B;  2BSK B;  5CA1 B;  1KYO F;  2GUZ A;  2CH7 B;  1N36 O;  2IJK A;  1S76 D;  5LMU B;  2PF4 E;  1Y67 A;  1AJN A;  2ZE7 A;  1KC8 W;  2BTQ A;  4CBC A;  1GTO A;  4JGS A;  1FXK C;  1ORQ C;  4MVR A;  1M57 B;  3CE2 A;  3LDE A;  4TV8 B;  4J7Z A;  3L70 H;  4LF7 O;  2YI9 A;  3DXR A;  4NXN B;  5LL6 Y;  4K35 A;  3JAW A;  4JI0 O;  2ZDI C;  3SYO A;  1AIL A;  2EX3 A;  1VIB A;  1JPX A;  3ZCC A;  4ZHQ A;  3AK3 A;  3BY6 A;  2AZ2 A;  1HDJ A;  1EBO A;  4FLT A;  3F7Y C;  1ZLZ A;  1G1X B;  3RYH B;  3GVM A;  2EIJ B;  4FLU A;  1JFF B;  2AZ0 A;  2AXT Z;  3ABM C;  4YIP A;  1FFX B;  2LP7 A;  1YF2 A;  1CP9 A;  4KL1 A;  1MZF A;  4O4L A;  1PV0 A;  4FLW A;  5KHJ A;  1J5E B;  4FK5 C;  2JS3 A;  1K92 A;  3ZMV A;  1UPG A;  1P84 F;  2GUZ B;  3K5L A;  5J2T B;  4NXM B;  1S72 V;  1R6T A;  3ZMZ A;  1AR1 B;  3CHX A;  1UFI A;  3UT5 A;  3CWB H;  1H2L A;  2IJI A;  3A2F A;  4CC6 A;  4JI1 O;  4AQY B;  3MHS C;  2UXC B;  1S5H C;  3DXR B;  3ASO B;  4YY3 O;  3SJB C;  2PGG A;  4TSF G;  1ZWI C;  4H0L B;  4XDL A;  3JAW B;  3C90 A;  4JTD B;  3FB5 C;  2UUB O;  4LFA O;  3BAB A;  2OIE A;  1FXK B;  4DO2 A;  3RYC B;  1M9N A;  3L9D A;  4X64 O;  1GN3 A;  3SJQ C;  5EC2 C;  4CS3 A;  3KKY A;  3ZMU A;  1ZX3 A;  2R9I A;  3E8B A;  3LSU A;  1TGO A;  2YIA A;  3QVN A;  4JYA O;  2A79 B;  3DC5 A;  4PD4 F;  1QCE A;  1Q90 D;  4X1Y B;  2QGN A;  1MZE A;  1Q6I A;  4MVQ A;  1ZSP A;  5IJ9 A;  2EBO A;  3E35 A;  3P3P A;  4LBE C;  3ZHS A;  5B1O A;  3ZRW B;  2UU9 O;  1OCC B;  4DV1 B;  3UT5 B;  2HP8 A;  5LMN O;  1H2N A;  2QKA A;  2Q5Z A;  1OCO C;  3ABM B;  5J2U B;  4DV3 B;  3X2Q B;  2HKO A;  2IU0 A;  5CN0 A;  2ILM A;  4X8A A;  1EFR G;  3JAL A;  1LUV A;  5KAI Z;  2CTP A;  2DQ0 A;  2DYS B;  2CTR A;  2ZT9 B;  3SYQ A;  3IC9 A;  1M90 W;  4JI7 B;  3O9O A;  4JI3 B;  4R7C A;  2QR4 A;  4BW9 A;  1NKD A;  3JAS A;  1VQM V;  4J9Z B;  3ZRX A;  3JD3 A;  4WFF A;  1H2K A;  3CB2 A;  4PHZ A;  4BIU A;  3CPW U;  2DWD C;  3JD1 A;  3LSQ A;  1KKD A;  5EIB D;  3OTO B;  5FL7 G;  2BOC C;  1Y74 A;  3JAM N;  2N74 A;  2M7W A;  2ZE6 A;  3H1J H;  2EJ7 A;  5IJ9 B;  2V7Q G;  2X6C A;  4BR6 A;  4ZIB A;  4PA6 A;  1XHX A;  1N0N A;  1YEW A;  2F93 B;  5LOV B;  3QF7 A;  1G6U A;  1XNQ O;  4PI0 A;  4WCE V;  2XHB A;  4AIL C;  1YTF B;  4DK0 A;  1R6N A;  1DGS A;  5LA6 A;  4D7S A;  3JAT B;  5LGU A;  3E2E A;  1IBM O;  4I50 B;  4W4K A;  3T2M A;  5LXT A;  1FKA O;  3JAL B;  1AI5 A;  1HNX O;  3ZHR A;  1IDS A;  4W4L A;  2F23 A;  1QBZ A;  2UXD B;  3APO A;  3TJT A;  2IJJ A;  2QTS A;  2WWW A;  4X66 B;  3JAS B;  5GTI Z;  5K1P A;  1OCO B;  2ETN A;  3ZRV A;  4I4T A;  4DR3 O;  3N27 A;  1W2B U;  3BCC H;  2Q9L A;  1OCZ C;  2ARH A;  4AHC A;  5CBH A;  3JCZ A;  2PYJ A;  1Y74 B;  1N34 B;  4B3M O;  1K3E A;  2X7R B;  2K1E A;  4MW8 A;  1N4C A;  1VQ7 V;  4DV4 B;  5CMU A;  3OEH G;  2QA4 V;  5JCO C;  4JI5 B;  5LHH A;  4ZOL B;  4I9W A;  1NJI W;  4K0K B;  3CRA A;  2L6L A;  5EC1 C;  3ZX6 A;  1I5Y A;  1FFT B;  1PNM A;  2YID A;  3D3Q A;  3OMA B;  2VQF B;  5LA6 B;  1JOY A;  1XHZ A;  4WBN A;  3FB6 C;  3CX5 F;  2Y4U A;  3L75 H;  1MOF A;  3JSL A;  2ITD C;  4H37 A;  1P7B A;  5LXT B;  5JCO A;  4RO2 A;  2HJF C;  3BFR A;  5DM6 V;  5B3S C;  1XL4 A;  1M56 B;  4JZ2 A;  3BRC A;  1OV9 A;  3L71 H;  2OTJ V;  5ITZ B;  4YJ2 A;  3RT3 C;  2LFR A;  1B04 A;  3M8A A;  3OGC C;  4I4T B;  3O65 A;  3CJH A;  2XAJ A;  3SJC C;  3P30 A;  2YI8 A;  1IBK B;  4LH7 A;  3OM3 B;  2GV9 A;  3ZRS A;  5KAF Z;  3CXC U;  2Q0A A;  4DUZ O;  2FML A;  1IXM A;  3E8G A;  4N23 A;  3K58 A;  4OPA A;  2ZQM A;  4E4E A;  3MHH C;  1G8M A;  4FLV A;  5KHG A;  3OGI B;  2BOB C;  4G27 B;  4O2A B;  1DLB A;  3FD9 A;  3MAQ A;  3I55 V;  1GM7 A;  4FVM A;  4WBN B;  1OCR C;  2QWP B;  1L0L H;  4U3J B;  2E5L B;  2XAG A;  2Z0A A;  5EYP B;  5GW7 A;  4NTX A;  5JJE B;  1WJZ A;  3DC6 A;  3B09 A;  1K73 W;  3CC7 V;  1H2S B;  4LFC B;  2JEU A;  2PI5 A;  5JVD A;  4UXN A;  2JRI A;  1K97 A;  1LUW A;  3T4Z A;  2JGD B;  4DR1 B;  1ZUQ A;  1M4U A;  2ZE8 A;  4IIJ A;  1AB3 A;  3JYC A;  3UCS C;  2CTQ A;  3OMI B;  4U3F H;  3K5O A;  3STZ C;  5B3S B;  2DOS A;  2CE4 A;  3ZMT A;  1QLE B;  3N2G B;  4JI8 B;  3M99 B;  2VWK A;  2HR3 A;  1MNG A;  1BMF G;  4DV0 B;  4NXM O;  4LR3 A;  2HHH B;  5H2F Z;  1JX9 A;  3HKD A;  4LC1 A;  1LR1 A;  2YEV A;  4AQY O;  4TOI A;  5LP6 A;  4CH5 A;  2QEX V;  2UXC O;  4CH6 A;  1DF5 A;  4UV8 A;  1BGY H;  1SQV H;  5H6Q A;  1U96 A;  4JTC B;  3ABK C;  3N2K A;  5KHI A;  5C8Y B;  2QWQ B;  2D3O W;  2DQ3 A;  5KA5 A;  1NT2 B;  1OCR B;  1HP8 A;  1XUQ A;  4IIJ B;  3RYF B;  2CK3 G;  4DV6 B;  1SQG A;  4I7Z B;  1UJW B;  1ARO P;  4X20 A;  2RJZ A;  3HR0 A;  1VMG A;  2FL4 A;  4DV5 B;  4LNU A;  1K5Q A;  2K9P A;  4XDJ A;  3CCS V;  4FM2 A;  1HW7 A;  4DV1 O;  3A0H Z;  3JD2 A;  3APQ A;  2EIM C;  1P7G A;  1Q6U A;  2FB5 A;  1JJO A;  1ZAU A;  2XAF A;  2EIN C;  4DV3 O;  4Q6G A;  1D5N A;  2Q0O C;  5JH7 A;  1TUE B;  2DE0 X;  4IGG A;  1NVP B;  3N2K B;  3ICX A;  5L3G A;  2LO1 A;  2IH1 C;  2EUL A;  1E1Q G;  2PI4 A;  1URF A;  1Q86 W;  4JI7 O;  2YIB D;  4YHH B;  4JI3 O;  2RMK B;  3ETQ A;  2JS5 A;  2RCV A;  4I5S A;  3L74 H;  1MSW D;  1R3J C;  5KHH A;  5C93 A;  2F95 B;  5LBQ A;  3T1Y B;  3K9S A;  4DR2 B;  2XAQ A;  1F7Y A;  4RQE A;  2QSA A;  2NLJ C;  3ABK B;  2X0L A;  4LNU B;  1TUB B;  1YDX A;  5BY1 A;  1OZ0 A;  1VEW A;  1K4D C;  1QVF U;  3Q4H A;  1CPY A;  3ZJZ A;  5A2Q N;  2YC0 A;  3JD0 A;  3SPC A;  5TIS Z;  3CSX A;  5DED A;  5JWP A;  2LGW A;  4DR5 B;  1KP2 A;  3P32 A;  2P6J A;  3J81 N;  2WLJ A;  4JPR A;  1Y66 A;  2WLL A;  3SJA C;  4RUE A;  3BHP A;  5FNV B;  1AJP A;  2XOK G;  3BAA A;  3LSS A;  3M7M X;  2QE7 G;  4QJF B;  2XND G;  2WLI A;  4CH3 A;  1GH6 A;  3ZIA G;  2EIM B;  4B08 A;  4X66 O;  1KQS U;  2LW1 A;  2EIN B;  4O4J A;  1VQ5 V;  4GX0 A;  4OGQ B;  4IHJ A;  1NTZ H;  3VOU A;  3BVO A;  5KLV H;  2ADQ B;  4UB8 Z;  2O57 A;  1HR0 B;  1N34 O;  4LP8 A;  2OIG A;  4MVU A;  2E75 B;  4DV4 O;  2EIL B;  3SYP A;  1PPJ H;  5CBG A;  4JI5 O;  3HKE A;  4UVC A;  3SPH A;  3IGA C;  4WF9 V;  1Q8I A;  4L87 A;  1K4C C;  5CA0 A;  2JVD A;  4K0K O;  5GON B;  1BQZ A;  1OCC C;  3A8T A;  5L3C A;  3K03 A;  1RSO A;  2VQF O;  1IXB A;  2OTL V;  5LHI A;  3K0G A;  1VAR A;  2QKC A;  3B40 A;  3FKS G;  4DR4 B;  5AG2 A;  3X2Q C;  4PDV A;  4UVA A;  1V9P A;  3TET A;  1I94 B;  1Y76 A;  3THO A;  1WPB A;  4U7N A;  3ASN C;  3W7U A;  1RM1 B;  1US6 A;  2B9Z A;  4A5U B;  1Q6H A;  4LF9 B;  2HG5 C;  3E83 A;  4QNH B;  2ODM A;  2WLI B;  1VP7 A;  2DYS C;  2BTQ B;  2QWO B;  1SA0 A;  1N33 B;  4O4J B;  4PA3 A;  3FB7 C;  4IHJ B;  1IBK O;  4UCT A;  1PM9 A;  3AG1 C;  4UB6 Z;  1F4M A;  2FTK A;  3C3T A;  2F4V O;  1F51 A;  4YJ3 A;  3KZI Z;  3FYE B;  4LFB B;  3AG4 C;  4FLZ A;  1WN7 A;  3CXH F;  3OD4 A;  1YCI A;  4ZHQ B;  1WAZ A;  4P9P A;  3SDL A;  3CME V;  4K8Z A;  3ZHT A;  4X65 B;  4Z2W A;  1EZJ A;  4GX5 A;  3OR7 C;  3EVK A;  4UCS A;  1RSO B;  1PL0 A;  4UCO A;  3WB0 A;  3U10 A;  4MVZ A;  2GDS A;  1JMK C;  1EZV H;  1B3Q A;  1H2M A;  2E5L O;  1NTK H;  3OT7 A;  4OXS A;  3SYA A;  2H8P C;  4LF4 B;  4O4L B;  4FFK A;  3IJ4 A;  2RQ6 A;  4J11 A;  2Q7E A;  3IFX A;  4X62 O;  4FZ0 A;  2M6Y A;  1W0K G;  1NBM G;  4P9O A;  1ENV A;  1AR5 A;  1SA0 B;  1S3J A;  2Q68 A;  2WLK A;  3SPJ A;  2YXY A;  4B3R B;  5IYD O;  4KP4 A;  1K7D A;  4ZI7 A;  4HNA A;  2ZR2 A;  4QIW F;  4DR7 O;  3LNM B;  4DR1 O;  5KMG A;  3WB1 A;  3CCL V;  4MVS A;  1VQO V;  2UXB B;  1GK9 A;  3ASN B;  4O4I A;  4UFZ A;  4FJC C;  1FJG B;  4B7K A;  1SQB H;  2R9A A;  4JI8 O;  5CA3 A;  2UUC O;  1NTM H;  2ZE5 A;  4DV0 O;  1OJH A;  3D36 A;  1AP6 A;  4DV7 B;  2EZP A;  2W6I G;  3AG1 B;  2EZO A;  4NTW A;  5IDJ A;  2HHH O;  3OUS A;  2OCH A;  2YS8 A;  2HEP A;  1CEZ A;  4DR6 O;  1N32 B;  4IT5 A;  5DEC A;  4RUF A;  3BA9 A;  1TA8 A;  3AG4 B;  3AG3 C;  2GTS A;  4IYI A;  3A0R A;  3CRC A;  2QDO A;  1H2G A;  3OR6 C;  2JDI G;  1AVM A;  4X1I A;  1M56 C;  4WFH A;  3B8N A;  2Q7H A;  4QGP A;  4ZI7 B;  4Z1V A;  1K9M W;  4B3T B;  4KHP O;  1NQT A;  5KMG B;  3OUF A;  4DV6 O;  4UVB A;  3G6B A;  5BZB A;  1FYJ A;  1YJN V;  3JAR A;  4DRX A;  1HNZ B;  2Y69 C;  5BR8 B;  1VQ9 V;  2CTW A;  4DV5 O;  2GHY A;  5H6R A;  5KUM A;  3CMA V;  4OX9 B;  1YXB A;  4EKW A;  2JK5 C;  1Q43 A;  1VF6 A;  1MSD A;  1R73 A;  2HLD G;  2XAS A;  5B5E Z;  1BZK A;  2E3C A;  1SZT A;  2Y0P A;  3HKC A;  1X59 A;  1NR1 A;  3P3N A;  2NNU A;  4MTO A;  2PZS A;  2DMX A;  1N36 B;  4JI4 B;  1Q5O A;  1FXH A;  3I56 V;  4X88 A;  4GKK B;  1QQC A;  1DTO A;  2W0F C;  1I7F A;  4X1I B;  4EEQ A;  1EN6 A;  4QPJ A;  2VRZ A;  2ITC C;  4JV5 O;  4LF7 B;  5JJN B;  5IYB O;  4JI0 B;  3AG3 B;  3FYI B;  1Y4M A;  5H5N A;  3PJS K;  3C3S A;  4DV2 O;  2FYU H;  3T1Y O;  3K3W A;  1WB8 A;  3F5W C;  3G71 V;  4R50 A;  3JAR B;  4DR2 O;  3T4D A;  3NXS A;  1EM1 A;  2F66 C;  3VQW A;  1R3I C;  4WFE A;  3GB7 C;  1QLE C;  4I55 A;  2QWR B;  2JIZ G;  4ICG A;  2ATK C;  3SYC A;  1SQQ H;  2ZIO A;  5EBW C;  3HKC B;  1TVK A;  4J41 A;  4GLX A;  5IE9 A;  3KCX A;  4H44 B;  2Y69 B;  4R8C A;  4DUY B;  2F1M A;  4EB6 A;  2OT5 A;  3CCJ V;  2OCC C;  3HPL C;  2YIB A;  1AI4 A;  1SQF A;  1GN2 A;  1N8R W;  4B3S O;  5KUK A;  2EIK C;  2Z5U A;  5LMU O;  2CGO A;  1FS0 G;  2HJD A;  4CS4 A;  2HFE C;  3D8C A;  3ETG A;  1MG1 A;  5LGT A;  1YHQ V;  5LYJ A;  1L0N H;  4PV1 B;  2QWN B;  3HKB A;  1BS3 A;  1WB7 A;  1FXV A;  1YSC A;  5CB4 A;  1SF9 A;  1HR0 O;  1K33 A;  2KG7 A;  1ZTE A;  5EBM C;  3E86 A;  4NXN O;  1M5I A;  4MVO A;  2YXH A;  2UXX A;  4YJ2 B;  2R9R B;  5IY5 C;  3CJH B;  1L8D A;  3VBB A;  4EFE A;  1TVK B;  3JAK A;  4MTG A;  1Q3E A;  4ZKI A;  3CRM A;  4PA4 A;  1AI7 A;  4JI6 B;  4EB6 B;  5FLX N;  2UU9 B;  3DTU B;  1FAF A;  4DR4 O;  5LP6 C;  3W7T A;  3OE7 G;  1I94 O;  3K04 A;  1XQ8 A;  1J5E O;  3ZHQ A;  2NN4 A;  4LF9 O;  1VQN V;  1RPO A;  4ZBM A;  3VQV A;  1RP3 B;  1WPX A;  3WG7 C;  1NZ6 A;  3CCM V;  3A0B Z;  1WA8 A;  2LJ2 A;  4I0X A;  2OCC B;  2WSS G;  5BMV A;  2PYL A;  3K5M A;  5KHK A;  5BXZ A;  1H38 A;  2NR5 A;  3ZBH A;  3UO3 A;  2CDY A;  3QG5 A;  3LDC A;  3RVZ A;  4LFB O;  2EIK B;  4FFB A;  5JVD B;  1VQ4 V;  1MAB G;  2LGQ A;  5IYZ A;  4NTY A;  2Q69 A;  3ZN0 A;  1KMI Z;  3CCQ V;  2N05 A;  1V54 C;  3B8M A;  3CCV V;  3OTF A;  4X65 O;  3AEI A;  4LF5 B;  4X1K A;  1Z5V A;  2ZXW C;  4TUY A;  1NR7 A;  3FB8 C;  4R6Z A;  1EN4 A;  1XMO B;  4MW3 A;  2QKS A;  3CS5 A;  5IY5 B;  3EHB B;  1KD1 W;  1GN6 A;  3I5D A;  4TV9 A;  2P4V A;  1QU7 A;  2OWO A;  3K06 A;  5D5Q A;  2JJ1 G;  2CGN A;  1V55 C;  3HKD B;  1SQX H;  5B1A B;  4B3R O;  4P30 A;  1HNX B;  4KUM A;  4NYK A;  1ZL8 A;  4LF8 B;  1WA8 B;  2YEV B;  4FM0 A;  4K8X A;  1QNM A;  3ML0 A;  3GWK C;  3TXQ A;  3EFF K;  5LP6 B; 
#chains in the Genus database with same CATH homology
 2VRZ A;  3Q4H B;  2DE0 X;  4ABM A;  3OGI B;  2KG7 A;  3O9O A;  4LWS A;  2AZ2 A;  2B9Z A;  1WA8 A;  2VS0 A;  3FD9 A;  3G80 A;  3TXS A;  4I0X A;  3FAV A;  4LWS B;  4GZR B;  2KG7 B;  3Q4H A;  3GVM A;  3ZBH A;  1WA8 B;  3HR0 A;  2AZ0 A;  3GWK C;  3TXQ A;  3FAV B;  4I0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...