1VF6A

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein transport
total genus 24
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6A00
1Y74A 1Y76A 1VF6A 1Y76B 3B40A 1ZL8B 1ZL8A 1VF6C 1RSOB 1Y74B
chains in the Genus database with same CATH superfamily
1M4UA 2LW1A 5LP6B 2N74A 2XOKG 3F7YC 4LFCO 2ZQMA 1N8RW 4J41A 4DR2B 2QTOA 4I0XB 1UJWB 3DTUB 4X62O 3ABMC 5HFMA 1D5AA 1SQFA 3H1HH 4JTAB 2QKSA 2ZCEA 1DGSA 2Q67A 3DC5A 4JASA 2DJVA 3IAYA 1NTKH 1IVSA 4EFBA 3ABTA 1U97A 1T5EA 3W7TA 1I94B 4LF5B 2PUSA 1BZKA 2UUAO 1HW7A 1ZSPA 3CP1A 1FFXA 1WAZA 3HKBA 5JQGB 4PA3A 1WJZA 4NB5A 1Q81W 4LCUC 3SDLA 3HKDA 2MW2B 1LUWA 2IBZH 3J80N 2IJHA 4KP4A 4LFBO 2EX3A 3BVOA 5IYZB 4JV5B 2JGDB 2B1IA 1VP7A 1VQ5V 5KA5A 3QG5A 1M5IA 1ZL8B 2OT5A 1FXKB 2R9IA 4GUNA 1KQSU 5BY1A 5B66Z 1W0JG 4TT3G 3FX7A 4LF6O 2ZIOA 4LBEC 4OGQB 4YIOA 3ZS8C 1GAXA 1AI7A 4FM2A 3JD4A 4ABMA 2CTQA 4DUZB 4LH6A 1KD1W 1R1BA 2EIMC 3HKCB 3ABMB 4TQFA 3K79A 1CEZA 3ICXA 5LMNO 1XHXA 2NNUA 3AG3B 4U3JA 2CUGA 3LUTB 4DW0A 2Y0PA 4H0LB 2RCVA 3JATA 5A9GA 4TV9B 1ZWIC 3OAAG 2HFEC 2ZINA 3SYCA 2F66C 1EZJA 2EIKB 2E76B 3C90A 2KQXA 5J2UB 3AG2C 3JYCA 1Q90D 3N2KB 4GLXA 4UUJC 3OMIB 4HNAB 3UT5A 1E1QG 2XTAA 3G80A 4WBNB 3SYPA 3JARA 1N32B 5B1AC 5KX5A 5FLXN 2Y69B 2PZSA 4DR2O 2ARHA 2DW4A 4MVQA 1XL4A 4MVMA 4LC1A 1P7BA 2IU3A 4MTOA 3F7VC 3JAKA 1VQ7V 2WA3A 4DV2B 1K8AW 1CPYA 2YXHA 1X59A 4LF5O 1H2GA 2D3OW 3SPJA 2ZDIC 1TUEB 4FFBB 5L3EA 4Z2WA 1A32A 2EIMB 4IHJA 3PJSK 4FLTA 1H8EG 3QO5A 1TUBB 1Q6HA 4TWKA 1FXVA 3OEHG 4PELA 3EHBB 4LR3A 4CC5A 4JV5O 3T1HB 2V7QG 3P30A 3A8TA 4QNHB 3RYFA 1N34B 3FB6C 3A0HZ 3ZN0A 2ZR2A 3P3PA 1BS3A 4BR6A 3L75H 2KB1A 3AG2B 2JS3A 1FXHA 2IU0A 4KL1A 2WLIB 3G4SV 3ZMZA 3ABKC 2H94A 4H33A 3SYAA 1BMFG 4JTDB 1N4CA 3P3NA 4DUZO 3J81N 1VF7A 1XILA 3QVNA 5FPRA 1QLNA 2CDYA 4D7SA 5BZBA 2GUZB 1PV0A 3SGIA 2EULA 2IJKA 3BHPA 5GTHZ 2M7WA 2QWNB 2YSUB 3LDDA 1F7YA 2L6LA 1TAEA 3E89A 2N04A 4MT8A 2ITCC 3D3QA 4PDRA 1UFIA 4CH3A 4YXWG 1RSOA 3THOA 2PTMA 2XAGA 2ZR3A 3LNMB 5JVDB 3AK2A 4D6TH 2WSSG 3CRMA 1NTMH 3SYOA 2WAMA 1O9HA 1FD9A 1JQ0A 4MW8A 4O4JB 1FJGB 2OCCC 4ZOLA 3A0RA 3F5TA 4IGGA 4FPPA 2QSAA 3CJHB 2QDOA 3OGCC 3JD1A 4I5SA 1HNWB 1GH6A 1Y74B 4NYKA 4DV2O 2P4KA 4JAAA 1VF5B 5JJNB 2ZIMA 3AG1B 1NKDA 1SC5B 2Q73A 3A2FA 4I50A 4UCSA 4JI4O 3Q4HA 1BSMA 2Z5UA 4UVBA 5KHKA 1AI5A 5EZYA 3N2GB 1XREA 1B3QA 4GCZA 2N05A 1L8DA 2R9RB 3WG7B 3SR2C 3MD0A 5KHIA 3W7XA 1S3JA 3OT7A 2LFSA 3T1HO 3ABUA 4J7KA 1PP9H 1Z5WA 4I4TA 1RM1C 1Z2GA 4NTWA 3RYCB 4PV1B 2BE3A 5IJ0B 3E2EA 5LYJA 2KG7B 3QF7A 1H2LA 4PA9A 5LA6B 3C3SA 1RFYA 1PNLA 2WLLB 3UO2A 3NR7A 4DV3O 4MW3A 4KHPB 3CRAA 4TUYB 3CCUV 2XAFA 3BABA 4OX9B 2X7RB 1DF4A 5KA6A 2VS0A 4LFAB 1Q3EA 5IYZA 2CGOA 1HP8A 1I5XA 2Q68A 1ZX3A 1ORQC 3WU2Z 1WA8A 5B1NA 4C7UA 1GN3A 1COWG 1Q8IA 3U10A 5B3SB 3CYOA 4LF4O 1BCCH 4X66B 4L87A 2LJ2A 4QE9A 1ZTEA 2HHHB 2ODMA 2VWJA 5EYPB 2VRZA 4XDJA 4ZHQA 2LP7A 2JJ2G 3UKMA 2PI5A 3O65A 3ZRSA 1XEQA 3FFQA 2BSKA 3WFVA 1H8HG 2WLMA 1VF6A 1Y66A 1KMIZ 1RM1B 3JSNA 3W7UA 4JGSA 3GVMA 3OTOB 4X1YB 1K97A 3APOA 4TV9A 4MSWC 3K59A 4DO2A 1YTFD 2QM8A 4LWSA 5J2UA 3UCSC 2CGNA 1MG1A 3K06A 3N2KA 4F4LA 1W59A 2V1DA 5EBMC 5B1BC 4WBNA 3D36A 4DV5O 4B7KA 3CCMV 5DEDA 4WFHA 4X89A 1WPBA 2ZE6A 4IL6Z 3ZRWB 3O9OA 3L71H 4JYAB 4GT1A 2JEXA 2DYSB 2Z0AA 2YDEA 4P9OA 4YIPA 3U0ZA 2JGUA 4X62B 4PHZA 4EKWA 3FYIB 4EB6A 3K5MA 3SPCA 3STLC 3OE7G 5ITZB 1R3IC 2EILB 1OCZC 3JD2A 3M99B 5J2TB 4KHPO 1DLBA 4ZI7A 4DR7O 1TUBA 5L3CA 3CXCU 2CH7B 5DECA 5L3FA 1XBLA 1YEWA 1SS3A 4YHHO 4OX9O 3IGAC 4IIJA 3CPWU 3CCJV 4LFAO 1KP2A 1PD3A 2V4DA 3CC4V 2EZPA 4UVCA 4OPHA 1J95A 4MVRA 3K0DA 3T2MA 1E1RG 4UCRA 2LO1A 2EZOA 3CE2A 4RUEA 5EC2C 1V54C 1FFTB 3RWRD 3CWBH 3JD0A 4FM1A 3HR0A 3HKEB 4G2KA 4LF8B 3KG2A 5JJJB 1JA8A 4DXWA 1QQCA 1JJOA 4YJ2B 4CH6A 4YJ3A 1M56B 2HHHO 3E8BA 5JCOA 3RYIB 1YI2V 1NS1A 1HWYA 1YSCA 2YICA 1MOFA 3BPZA 4LF6B 3ETEA 2ADQB 2GUZA 2Q6AA 1YF2A 3IC9A 4JI6B 4E2LA 1L0NH 1TVKB 5L3BA 4JI2B 3B4SA 3RT3C 2ZKOA 1B6QA 3OM3B 3RFRA 3F5WC 5LMNB 5B5EZ 4ASUG 2UXBB 2QA4V 2BTOA 4CS3A 4WFAV 2ZM6O 4X20B 2CK3G 2QWQB 1GK9A 5B1OA 3ASNB 3EFFK 5JVDA 1X4TA 3G6EV 4JI0B 3L74H 2VQFO 3APQA 4B3SO 1D5NA 5H5NA 3GWOA 2ATKC 2OIGA 2YIBA 1OCOC 4MVOA 3VOUA 3K03A 4JYAO 3K57A 5LXTB 1OCCB 3TJTA 3K04A 3ZRXA 3LDCA 3LNNA 1SKVA 2YIDA 4X65O 5KMGA 2F43G 2XAQA 5K1PA 2WWWA 2GTAA 4CH5A 4B3TO 2EJRA 4RQEA 1SQBH 3N2GA 4IYIA 1BQ0A 2P67A 3OEEG 5CMUA 3FYEB 1QNMA 1VF6C 4R7CA 2QWOB 1PM9A 3LSSA 5A2QN 1I08A 4H37A 4B7EA 4O4LB 5IJ9B 5C8YB 3WB1A 4JTCB 2A06H 3G6BA 2A3QA 2UXDO 3MDSA 3BY6A 4Z1VA 1EN4A 4UCTA 3K58A 2WLLA 1P49A 4RQFA 4LF8O 4HYOA 5JJEB 1GN4A 4K35A 5IE9A 3B2EE 3ZEDA 5E1AC 1BE3H 2W0XA 4PA7A 1WPXA 4N21A 2JIZG 2P22C 3I55V 3JAWA 1H2SB 1OCOB 4CC6A 1G4YB 3CCEV 1SA0B 4X1IB 3E83A 3UO3A 4JI6O 2XT9A 2Q4PA 3TCUA 4JI2O 1NVPD 2YIAA 1I0HA 1XL6A 2B9ZA 5LOVA 3RVYA 1WN7A 1S76D 4X1KB 3FAVA 4DYLA 2OTJV 3UQ8A 3KKYA 2UXBO 2KSDA 2RJZA 4JI3B 5E79Z 2UXNA 3H9VA 4K8ZA 4OXSA 5EYPA 1QLEC 4JI0O 1VQ4V 1FYJA 1MMMA 4YY3O 4FZ0A 4Q20A 4IYHA 4R6ZA 1KUQA 3ZIAG 3JCZA 3TXQA 5CB4B 4PA6A 3L70H 2B5UA 4J42A 5CA0B 1OHHG 4O2BB 4AI8A 4DR1O 1D2DA 3B09A 1YITV 3K9SA 2XAHA 3G67A 4XBFA 4PD4F 1M9NA 2FKXA 1AILA 1NJIW 4TV8B 3JALB 5LHGA 2AHYA 3ZHQA 3IC7A 3ZMTA 3K3WA 4FZ1A 4WCEV 2GDSA 1FS0G 5LHHA 3CCQV 4PI0A 1IX9A 1AR5A 4NR1A 2HJDA 2M6YA 4JI4B 5IWAB 1VIBA 3ZRWA 4R50A 4DV4O 2A9HA 5LHIA 2JVDA 4G27B 4O4HB 2IH1C 3LSUA 3H1LH 1AI4A 5D5QA 5KHGA 3H1IH 4W4LA 4BW5A 5ITZA 2X0LA 1K34A 2L35A 2WPDG 2HP8A 5BMVB 5IYCO 1VARA 4O2AA 1QLEB 3OUFA 4CZZA 5K1XA 2JK5C 1S5LZ 3H1JH 4TOIA 2F93B 2OIEA 2D2CB 1AP6A 5L3DA 4DV3B 4I7ZB 5DN6G 5B1AB 1V9PA 3CSXA 3CCVV 1S77D 3T4DA 4GZRB 1KKDA 3M7MX 5EIBC 3CMEV 2MK3A 5KUMA 1PKXA 1YHQV 4DR5B 1NR1A 3EVKA 2W0FC 3HKEA 4JI3O 1NI8A 5LGTA 1QVGU 2R72A 4YJ2A 3WB0A 3ML0A 1B04A 2EINC 1AJNA 1NBMG 4UXNA 2JS5A 2XUMA 4LF4B 3CMAV 1G1XB 3QO8A 3GB7C 3OW2U 1BHAA 1WB7A 1N0JA 3RBZA 4HBNA 1Q82W 2HG5C 3RGBA 5GONB 2CAZC 2LGWA 4RUFA 3IFXA 3DXRA 5CA1B 5LGNA 2E75B 5FNVB 3BAAA 1JFFA 4X20A 4QJFB 3W7SA 2LGQA 1V55C 4UVAA 2AZ0A 3TGUH 4JZGA 4KXRA 4J10A 1NZ6A 3S3WA 2Q8VA 3HPLC 1Q6UA 3ABKB 5KAIZ 4AHCA 5LP6A 5CBHA 4IT5A 5IWAO 2RQ6A 4UCVA 1NT2B 1M57C 3MAQA 4FLYA 3VQXA 1QR8A 4BAYA 4I9QA 4DV5B 3T1YO 3MHSC 4HAMA 4I0XA 1F51A 1Y76B 4NKGB 1LR1A 1H2KA 2H3OA 2Y4TA 2YS8A 4JZ2A 2EINB 1BL8A 1WLEA 2YIBD 1CXZB 4GKJB 2QR4A 3HKBB 1NH2D 5EIBD 2C2AA 4R8CA 4MVSA 4DR7B 5JQGA 1N33B 1THZA 2OCCB 4YHHB 1O9GA 3ABLC 3C3TA 2Q7EA 1GN2A 3ASOC 2YUAA 2A79B 2AGAA 4DR5O 2DE0X 3R66A 5IY5C 2JGDA 3ETQA 1M93A 1WP7A 5JH7B 3ZN1A 1XNRO 1SQVH 1ZL8A 5LGUA 2Z3YA 3GWKC 1FXKA 1M90W 1I7FA 1YTFB 1OCRC 3D8CA 1L1FA 1QU7A 1SA0A 4X1IA 1YZBA 4DR3B 2DWEC 3BFRA 1US6A 3HKCA 4P2ZA 1MABG 3K5OA 2RDCA 3DC6A 3CB2A 4OPAA 4MVZA 4U3JB 4MTGA 1J5EO 2HKOA 4X88A 1EZVH 3W7WA 5C93A 1KBHA 5IYBO 2R70A 3JATB 3L9DA 3S3XA 3B8MA 3CRRA 3L73H 4ICGA 2ILMA 1AP5A 5LMUO 2BCCH 2WLJA 3JASB 2ZM6B 4FMTA 3SJAC 4HNAA 3JARB 2PGGA 2QTSA 1DK1A 5KX5B 4ZBMA 1QBZA 1Q5OA 3DGEA 2ZE7A 2VQFB 1HNZB 1XNQB 1YDXA 4B3SB 4PJ0Z 1URFA 4LNUB 3ASOB 3L72H 2Q69A 3JAKB 1RPOA 2VWKA 3E8FA 1GM9A 2X6CA 3ETDA 2DYRC 4DV6O 4O4IB 4X8AA 4P9PA 1U96A 4FM0A 2E5LO 5KAFZ 4RO2A 4X65B 3ZJZA 1IBMB 5IT9N 1GKFA 3E86A 3BEHA 2YI9A 4GKJO 4B3RO 4ZIBA 1RP3B 1K3EA 4FFBA 4IHJB 4B3TB 1Q86W 3JAMN 4MS2A 1IBKB 2AW9A 5GTIZ 4AILC 1WP8A 1N33O 2UXCO 1BT8A 4O4HA 2WLHA 3A0BZ 4B3MB 1H2MA 1KKCA 1JVMA 3I5DA 3M8AA 3K5NA 4DV7B 2NN4A 3SJBC 4EEQA 1BHBA 4UCUA 3RYFB 1IZ3A 4K3AA 1PNKA 2K1EA 1VQOV 2UXDB 5AG2A 4AQYB 3FB5C 1YJNV 2PYJA 1IURA 1KU9A 5B1BB 2WLIA 5LP6C 5KUKA 4DR3O 4BWAA 4WFFA 3ZX6A 2F4VB 3FKSG 1VEWA 2HVJC 3CCLV 4FLUA 2ADPA 2YXYA 4J9ZB 2NR5A 4MTXA 2IJJA 1Q43A 1MSDA 1EFRG 3LSQA 1AJQA 1ROPA 3AK1A 4UFZA 2ZDIA 1VQ9V 1OCZB 4PA4A 4U7OA 2VQEB 4PDLA 2E3CA 1HNZO 1XNQO 1JJ2U 4O4JA 4YY3B 4CH4A 2ZD9A 4NXMO 1VQKV 4DRXB 1XDCA 4DR4B 1R73A 5BR8B 1YIJV 2FYUH 1VQ6V 5FNVA 3CJHA 1P4RA 4WFEA 1GTOA 4GX1A 1M1KW 4TSFG 4DR1B 4NTXA 1Y74A 1L0LH 1FXKC 1IBMO 1DF5A 1V54B 2RN9A 2HEPA 3ZMVA 1GM7A 1XOUA 4BW9A 3J7AU 4I50B 3Q4HB 5CN0A 2UUBB 4N23A 1SQGA 3IJ4A 5EZYB 3LDEA 2ZE8A 3RYHB 1ZAUA 1IBKO 1I5YA 4JI8B 4GKKB 3KCYA 1Y76A 4B3MO 1S72V 4LF7O 4DW1A 3AG3C 4DV4B 2Q7GA 4DV7O 4I4TB 5HFLA 4JF3A 2FTKA 2B1GA 1NVPB 1W0KG 1HDJA 4BIUA 4QIWF 3RYCA 2H8PC 5IJ0A 3DSQA 5LYJB 2PI4A 1QVFU 2KG7A 3FD9A 1YJWV 4LF9B 4AQYO 2UUCB 2EIKC 5LA6A 1ZUQA 3JCUZ 3ZRVA 2Q7HA 2F1MA 3I56V 3CD6V 3D36C 2PYLA 4JYYA 4F6RB 2F4VO 2CTWA 2Y69C 1CP9A 4TUYA 3ZMUA 4UB6Z 1K4DC 2IM9A 4HZ3A 1XMOO 2E74B 3VQWA 5JH7A 2HVKC 3QO7A 2IW5A 4JI5O 4X9QA 4BIOA 1WA8B 1K5QA 2Q0OC 2WLNA 3RVZA 1AROP 3KZIZ 1S5JA 5D5PA 2F95B 3PN1A 3CS5A 3E35A 4Q6GA 4DUYO 2VQEO 2A7WA 4ZHQB 1G6UA 4JPRA 2HLDG 3ZHSA 5EBWC 1KECA 1S5HC 3AEIA 3ZHTA 2BSKB 1K7DA 1N36B 1IXBA 4U3FH 3TXSA 2JRIA 1P84F 4DR4O 4CS4A 5BR8O 2DQ0A 1OV9A 4I9WA 4FLZA 4X1YA 2XASA 1OZ0A 2XNDG 5DM6V 2P4VA 1EN6A 2P06A 2RNBA 4LWSB 1VMGA 3JASA 1JMKC 3SPGA 1MA1A 2UUBO 4GX2A 2R9AA 3BA8A 3ZBHA 5JCOC 1R6NA 4X64B 3CC2V 1Q6IA 2GSMB 4UCOA 5IDJA 4Z1MG 1NQTA 1XMQB 4LNUA 2ZNIA 4QPJA 4JI8O 4GKKO 1GO3F 2Y0IA 4I55B 4U7NA 1P7GA 1GRJA 1IXMA 2AXTZ 3CEIA 4O4IA 3T1YB 4CBCA 2GTSA 5EC1C 3ZHRA 1HR0B 4LH7A 2YC0A 4EB6B 5EBLC 2QJ1A 1Y4MA 1I94O 2QM7A 5H6QA 1MZEA 4LF9O 5LL6Y 1AJPA 2UUCO 4F6EA 4J7JA 5KHJA 1PL4A 4PDMA 1LUVA 1QHTA 3TETA 1IBLB 4GYCB 4W4KA 4ZI7B 5J2TA 4D7TA 1KB9F 2CH7A 1TGOA 4IIJB 2QE7G 1VQMV 1SF9A 2GV9A 4A5UB 1PNMA 1RPRA 3E8HA 3FB7C 3KCXA 3R65A 3CRCA 1KYOF 3AK3A 2IH3C 1VQ8V 2OWOA 4JYBA 1Y6XA 2ZE5A 1PPJH 3AG1C 1SERA 2YEVB 3AG7A 4UV8A 4FLWA 1SZXA 4JAUA 3ZMSA 1JR9A 4YJ3B 1XNRB 4DV1B 2UU9B 3B77A 1VQLV 3RYIA 2QWRB 3E8GA 1AR4A 2HR3A 1K73W 1FPOA 2IJIA 5L3GA 5CA3A 1N36O 3WG7C 5CBFA 1F23A 4JI7B 3OFNG 2BOCC 4FVMA 1TVKA 2W6JG 1FKAO 1SZTA 4JAVA 1DTOA 3E22B 4KFMA 2CTPA 1EN5A 4BIZA 3OUSA 4GX0A 1J5EB 3OMNB 5KHHA 2P7TC 3CX5F 2BTQB 1N32O 2DQ3A 2ZNJA 4L8JA 1YCIA 3JD3A 4X64O 2P6JA 3H01A 5LMUB 5H2FZ 1K92A 1XMQO 2QM4A 4DRXA 3OR7C 3OMAB 4MTFA 1XI1A 1SESA 2OYQA 1XUQA 1UPGA 5LXTA 1K33A 1QR9A 2WA4A 4H44B 1Q7YW 1NH2B 4K8XA 3ZHUA 4TQDA 1HR0O 5KMGB 4JI1B 2EIJC 3JSLA 1SQQH 2FMLA 4DR6B 1JOYA 2FL4A 1ZLZA 5B3SC 4H13B 1Z5VA 4DV6B 3SJQC 5FPOA 4QGPA 2QGNA 1MSWD 1IDSA 2Q0AA 2E5LB 3ETGA 1IBLO 1R3KC 2DOSA 3RYHA 4G28B 3QNEA 3FB8C 3D3IA 3MHHC 4B3RB 1GM8A 3OTFA 2RMKB 2BOBC 2AZ2A 4QPKA 1FFXB 2ZXWC 1F4MA 2NLJC 4FIPC 4WFGA 4UV9A 4J11A 3VQYA 3AG4C 1N34O 1HNXB 2UXCB 1R6TA 4O4LA 5IJ9A 3HKDB 3B8NA 1VQNV 5C8YA 3UM7A 2A0LA 1MNGA 5KLVH 4P30A 5FL7G 1V55B 4DK0A 1R3LC 3VQVA 4DV0B 1YXBA 3CHXA 3NXSA 4DV1O 2ZT9B 4JYCA 2UU9O 4F6RA 1LNQA 1W2BU 2JDIG 4K0KB 3JAWB 2CTRA 1JX9A 1JCHA 1NTZH 4JI7O 1M57B 2GHYA 3P32A 1SQPH 4UB8Z 3G71V 3BRCA 1E79G 2P90A 2DYSC 5LOVB 2QWPB 5J9PC 1AB3A 3X2QC 3H1KH 2EIJB 5JWPA 4ZKIA 3FAVB 4X1KA 3CCRV 3K0GA 1EM1A 2Y4UA 5TISZ 2Q9LA 1WNSA 1YVWA 5CBGA 1ENVA 3SJCC 1XQ8A 2XAJA 4PDVA 5BXZA 2EILC 2PY5A 1FJGO 3HB3B 3K5LA 2GBOA 1Y67A 5H6RA 1B06A 3UT5B 3ZHVA 2ZXWB 3WB2A 4NXNB 1OJHA 3AG4B 2O57A 3CXHF 2WLKA 3RW0A 5CB4A 1HNWO 2Y48A 5CA0A 1AR1B 3ABLB 2LFRA 4FJCC 4O2BA 4B08A 4MVUA 1R6KA 4EFEA 4JI1O 4NXMB 3T1CA 4E4EA 2CE4A 1BQZA 5IY5B 4DR6O 3K08A 1F4NA 3SPHA 4TV8A 2ETNA 3JALA 3BA9A 1XHZA 2YI8A 4FK5C 4J7ZA 4RAIA 1M56C 4WF9V 2YXLA 1OCRB 3SYQA 5LBQA 2ITDC 2DMXA 4I55A 2OTLV 4NTYA 4LFCB 2AHZA 3X2QB 1YJ9V 2JJ1G 4RWUA 4LP8A 2W6IG 2X6AA 1HNXO 1AVMA 2QEXV 1JPXA 1VQPV 4GX5A 4LF7B 1KC8W 3QTCA 2LW7A 1WB8A 4J80A 4FFKA 2EBOA 3ASNC 4O2AB 3TK1A 5BMVA 4DV0O 4XDKA 3STZC 2PF4E 1K4CC 1FAFA 3CC7V 5IYDO 1TA8A 1SETA 4K0KO 4DK1A 2UUAB 1H2NA 2EJ7A 2X6BA 3BCCH 1G8MA 2OCHA 4J9YB 2LQTA 3RN4A 4XDLA 4KUMA 1PL0A 4NVPA 3B40A 1EBOA 2QKCA 1GMGA 1OCCC 1H38A 4LFBB 3OR6C 1SQXH 1BGYH 2DYRB 2DN9A 4X66O 1K5SA 5F2VO 1K9MW 1XMOB 1R3JC 2P5OA 2YEVA 3OD4A 5EK0A 2K9PA 4JI5B 1S0VA 2XHBA 1NU1H 2F23A 2FB5A 2DWDC 1RSOB 1KP3A 3SPIA 3N27A 3OGIB 2JEUA 2UXXA 3CRQA 2Q5ZA 1SRYA 2QKAA 4DUYB 4NXNO 3E22A 4CS2A 5GONA 1GN6A 3OTOO 3K9AA 5GW7A 3DXRB 1MZFA 4FLXA 4ZOLB 5CA1A 4FLVA 3ZCCA 3VBBA 3CCSV 4PI2A 4WFBV 1JFFB 2KKWA 2G38A 1N0NA 3U11A 3EXAA 1QCEA 1AI6A 1NR7A 2BTQA 2HJFC 3T4ZA 5H9CA 4QE7A
chains in the Genus database with same CATH topology
1Y74A 1Y76A 1VF6A 1Y76B 3B40A 1ZL8B 1ZL8A 1VF6C 1RSOB 1Y74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 A;  1Y76 A;  1VF6 A;  1Y76 B;  3B40 A;  1ZL8 B;  1ZL8 A;  1VF6 C;  1RSO B;  1Y74 B; 
#chains in the Genus database with same CATH topology
 1M4U A;  2LW1 A;  5LP6 B;  2N74 A;  2XOK G;  3F7Y C;  4LFC O;  2ZQM A;  1N8R W;  4J41 A;  4DR2 B;  2QTO A;  4I0X B;  1UJW B;  3DTU B;  4X62 O;  3ABM C;  5HFM A;  1D5A A;  1SQF A;  3H1H H;  4JTA B;  2QKS A;  2ZCE A;  1DGS A;  2Q67 A;  3DC5 A;  4JAS A;  2DJV A;  3IAY A;  1NTK H;  1IVS A;  4EFB A;  3ABT A;  1U97 A;  1T5E A;  3W7T A;  1I94 B;  4LF5 B;  2PUS A;  1BZK A;  2UUA O;  1HW7 A;  1ZSP A;  3CP1 A;  1FFX A;  1WAZ A;  3HKB A;  5JQG B;  4PA3 A;  1WJZ A;  4NB5 A;  1Q81 W;  4LCU C;  3SDL A;  3HKD A;  2MW2 B;  1LUW A;  2IBZ H;  3J80 N;  2IJH A;  4KP4 A;  4LFB O;  2EX3 A;  3BVO A;  5IYZ B;  4JV5 B;  2JGD B;  2B1I A;  1VP7 A;  1VQ5 V;  5KA5 A;  3QG5 A;  1M5I A;  1ZL8 B;  2OT5 A;  1FXK B;  2R9I A;  4GUN A;  1KQS U;  5BY1 A;  5B66 Z;  1W0J G;  4TT3 G;  3FX7 A;  4LF6 O;  2ZIO A;  4LBE C;  4OGQ B;  4YIO A;  3ZS8 C;  1GAX A;  1AI7 A;  4FM2 A;  3JD4 A;  4ABM A;  2CTQ A;  4DUZ B;  4LH6 A;  1KD1 W;  1R1B A;  2EIM C;  3HKC B;  3ABM B;  4TQF A;  3K79 A;  1CEZ A;  3ICX A;  5LMN O;  1XHX A;  2NNU A;  3AG3 B;  4U3J A;  2CUG A;  3LUT B;  4DW0 A;  2Y0P A;  4H0L B;  2RCV A;  3JAT A;  5A9G A;  4TV9 B;  1ZWI C;  3OAA G;  2HFE C;  2ZIN A;  3SYC A;  2F66 C;  1EZJ A;  2EIK B;  2E76 B;  3C90 A;  2KQX A;  5J2U B;  3AG2 C;  3JYC A;  1Q90 D;  3N2K B;  4GLX A;  4UUJ C;  3OMI B;  4HNA B;  3UT5 A;  1E1Q G;  2XTA A;  3G80 A;  4WBN B;  3SYP A;  3JAR A;  1N32 B;  5B1A C;  5KX5 A;  5FLX N;  2Y69 B;  2PZS A;  4DR2 O;  2ARH A;  2DW4 A;  4MVQ A;  1XL4 A;  4MVM A;  4LC1 A;  1P7B A;  2IU3 A;  4MTO A;  3F7V C;  3JAK A;  1VQ7 V;  2WA3 A;  4DV2 B;  1K8A W;  1CPY A;  2YXH A;  1X59 A;  4LF5 O;  1H2G A;  2D3O W;  3SPJ A;  2ZDI C;  1TUE B;  4FFB B;  5L3E A;  4Z2W A;  1A32 A;  2EIM B;  4IHJ A;  3PJS K;  4FLT A;  1H8E G;  3QO5 A;  1TUB B;  1Q6H A;  4TWK A;  1FXV A;  3OEH G;  4PEL A;  3EHB B;  4LR3 A;  4CC5 A;  4JV5 O;  3T1H B;  2V7Q G;  3P30 A;  3A8T A;  4QNH B;  3RYF A;  1N34 B;  3FB6 C;  3A0H Z;  3ZN0 A;  2ZR2 A;  3P3P A;  1BS3 A;  4BR6 A;  3L75 H;  2KB1 A;  3AG2 B;  2JS3 A;  1FXH A;  2IU0 A;  4KL1 A;  2WLI B;  3G4S V;  3ZMZ A;  3ABK C;  2H94 A;  4H33 A;  3SYA A;  1BMF G;  4JTD B;  1N4C A;  3P3N A;  4DUZ O;  3J81 N;  1VF7 A;  1XIL A;  3QVN A;  5FPR A;  1QLN A;  2CDY A;  4D7S A;  5BZB A;  2GUZ B;  1PV0 A;  3SGI A;  2EUL A;  2IJK A;  3BHP A;  5GTH Z;  2M7W A;  2QWN B;  2YSU B;  3LDD A;  1F7Y A;  2L6L A;  1TAE A;  3E89 A;  2N04 A;  4MT8 A;  2ITC C;  3D3Q A;  4PDR A;  1UFI A;  4CH3 A;  4YXW G;  1RSO A;  3THO A;  2PTM A;  2XAG A;  2ZR3 A;  3LNM B;  5JVD B;  3AK2 A;  4D6T H;  2WSS G;  3CRM A;  1NTM H;  3SYO A;  2WAM A;  1O9H A;  1FD9 A;  1JQ0 A;  4MW8 A;  4O4J B;  1FJG B;  2OCC C;  4ZOL A;  3A0R A;  3F5T A;  4IGG A;  4FPP A;  2QSA A;  3CJH B;  2QDO A;  3OGC C;  3JD1 A;  4I5S A;  1HNW B;  1GH6 A;  1Y74 B;  4NYK A;  4DV2 O;  2P4K A;  4JAA A;  1VF5 B;  5JJN B;  2ZIM A;  3AG1 B;  1NKD A;  1SC5 B;  2Q73 A;  3A2F A;  4I50 A;  4UCS A;  4JI4 O;  3Q4H A;  1BSM A;  2Z5U A;  4UVB A;  5KHK A;  1AI5 A;  5EZY A;  3N2G B;  1XRE A;  1B3Q A;  4GCZ A;  2N05 A;  1L8D A;  2R9R B;  3WG7 B;  3SR2 C;  3MD0 A;  5KHI A;  3W7X A;  1S3J A;  3OT7 A;  2LFS A;  3T1H O;  3ABU A;  4J7K A;  1PP9 H;  1Z5W A;  4I4T A;  1RM1 C;  1Z2G A;  4NTW A;  3RYC B;  4PV1 B;  2BE3 A;  5IJ0 B;  3E2E A;  5LYJ A;  2KG7 B;  3QF7 A;  1H2L A;  4PA9 A;  5LA6 B;  3C3S A;  1RFY A;  1PNL A;  2WLL B;  3UO2 A;  3NR7 A;  4DV3 O;  4MW3 A;  4KHP B;  3CRA A;  4TUY B;  3CCU V;  2XAF A;  3BAB A;  4OX9 B;  2X7R B;  1DF4 A;  5KA6 A;  2VS0 A;  4LFA B;  1Q3E A;  5IYZ A;  2CGO A;  1HP8 A;  1I5X A;  2Q68 A;  1ZX3 A;  1ORQ C;  3WU2 Z;  1WA8 A;  5B1N A;  4C7U A;  1GN3 A;  1COW G;  1Q8I A;  3U10 A;  5B3S B;  3CYO A;  4LF4 O;  1BCC H;  4X66 B;  4L87 A;  2LJ2 A;  4QE9 A;  1ZTE A;  2HHH B;  2ODM A;  2VWJ A;  5EYP B;  2VRZ A;  4XDJ A;  4ZHQ A;  2LP7 A;  2JJ2 G;  3UKM A;  2PI5 A;  3O65 A;  3ZRS A;  1XEQ A;  3FFQ A;  2BSK A;  3WFV A;  1H8H G;  2WLM A;  1VF6 A;  1Y66 A;  1KMI Z;  1RM1 B;  3JSN A;  3W7U A;  4JGS A;  3GVM A;  3OTO B;  4X1Y B;  1K97 A;  3APO A;  4TV9 A;  4MSW C;  3K59 A;  4DO2 A;  1YTF D;  2QM8 A;  4LWS A;  5J2U A;  3UCS C;  2CGN A;  1MG1 A;  3K06 A;  3N2K A;  4F4L A;  1W59 A;  2V1D A;  5EBM C;  5B1B C;  4WBN A;  3D36 A;  4DV5 O;  4B7K A;  3CCM V;  5DED A;  4WFH A;  4X89 A;  1WPB A;  2ZE6 A;  4IL6 Z;  3ZRW B;  3O9O A;  3L71 H;  4JYA B;  4GT1 A;  2JEX A;  2DYS B;  2Z0A A;  2YDE A;  4P9O A;  4YIP A;  3U0Z A;  2JGU A;  4X62 B;  4PHZ A;  4EKW A;  3FYI B;  4EB6 A;  3K5M A;  3SPC A;  3STL C;  3OE7 G;  5ITZ B;  1R3I C;  2EIL B;  1OCZ C;  3JD2 A;  3M99 B;  5J2T B;  4KHP O;  1DLB A;  4ZI7 A;  4DR7 O;  1TUB A;  5L3C A;  3CXC U;  2CH7 B;  5DEC A;  5L3F A;  1XBL A;  1YEW A;  1SS3 A;  4YHH O;  4OX9 O;  3IGA C;  4IIJ A;  3CPW U;  3CCJ V;  4LFA O;  1KP2 A;  1PD3 A;  2V4D A;  3CC4 V;  2EZP A;  4UVC A;  4OPH A;  1J95 A;  4MVR A;  3K0D A;  3T2M A;  1E1R G;  4UCR A;  2LO1 A;  2EZO A;  3CE2 A;  4RUE A;  5EC2 C;  1V54 C;  1FFT B;  3RWR D;  3CWB H;  3JD0 A;  4FM1 A;  3HR0 A;  3HKE B;  4G2K A;  4LF8 B;  3KG2 A;  5JJJ B;  1JA8 A;  4DXW A;  1QQC A;  1JJO A;  4YJ2 B;  4CH6 A;  4YJ3 A;  1M56 B;  2HHH O;  3E8B A;  5JCO A;  3RYI B;  1YI2 V;  1NS1 A;  1HWY A;  1YSC A;  2YIC A;  1MOF A;  3BPZ A;  4LF6 B;  3ETE A;  2ADQ B;  2GUZ A;  2Q6A A;  1YF2 A;  3IC9 A;  4JI6 B;  4E2L A;  1L0N H;  1TVK B;  5L3B A;  4JI2 B;  3B4S A;  3RT3 C;  2ZKO A;  1B6Q A;  3OM3 B;  3RFR A;  3F5W C;  5LMN B;  5B5E Z;  4ASU G;  2UXB B;  2QA4 V;  2BTO A;  4CS3 A;  4WFA V;  2ZM6 O;  4X20 B;  2CK3 G;  2QWQ B;  1GK9 A;  5B1O A;  3ASN B;  3EFF K;  5JVD A;  1X4T A;  3G6E V;  4JI0 B;  3L74 H;  2VQF O;  3APQ A;  4B3S O;  1D5N A;  5H5N A;  3GWO A;  2ATK C;  2OIG A;  2YIB A;  1OCO C;  4MVO A;  3VOU A;  3K03 A;  4JYA O;  3K57 A;  5LXT B;  1OCC B;  3TJT A;  3K04 A;  3ZRX A;  3LDC A;  3LNN A;  1SKV A;  2YID A;  4X65 O;  5KMG A;  2F43 G;  2XAQ A;  5K1P A;  2WWW A;  2GTA A;  4CH5 A;  4B3T O;  2EJR A;  4RQE A;  1SQB H;  3N2G A;  4IYI A;  1BQ0 A;  2P67 A;  3OEE G;  5CMU A;  3FYE B;  1QNM A;  1VF6 C;  4R7C A;  2QWO B;  1PM9 A;  3LSS A;  5A2Q N;  1I08 A;  4H37 A;  4B7E A;  4O4L B;  5IJ9 B;  5C8Y B;  3WB1 A;  4JTC B;  2A06 H;  3G6B A;  2A3Q A;  2UXD O;  3MDS A;  3BY6 A;  4Z1V A;  1EN4 A;  4UCT A;  3K58 A;  2WLL A;  1P49 A;  4RQF A;  4LF8 O;  4HYO A;  5JJE B;  1GN4 A;  4K35 A;  5IE9 A;  3B2E E;  3ZED A;  5E1A C;  1BE3 H;  2W0X A;  4PA7 A;  1WPX A;  4N21 A;  2JIZ G;  2P22 C;  3I55 V;  3JAW A;  1H2S B;  1OCO B;  4CC6 A;  1G4Y B;  3CCE V;  1SA0 B;  4X1I B;  3E83 A;  3UO3 A;  4JI6 O;  2XT9 A;  2Q4P A;  3TCU A;  4JI2 O;  1NVP D;  2YIA A;  1I0H A;  1XL6 A;  2B9Z A;  5LOV A;  3RVY A;  1WN7 A;  1S76 D;  4X1K B;  3FAV A;  4DYL A;  2OTJ V;  3UQ8 A;  3KKY A;  2UXB O;  2KSD A;  2RJZ A;  4JI3 B;  5E79 Z;  2UXN A;  3H9V A;  4K8Z A;  4OXS A;  5EYP A;  1QLE C;  4JI0 O;  1VQ4 V;  1FYJ A;  1MMM A;  4YY3 O;  4FZ0 A;  4Q20 A;  4IYH A;  4R6Z A;  1KUQ A;  3ZIA G;  3JCZ A;  3TXQ A;  5CB4 B;  4PA6 A;  3L70 H;  2B5U A;  4J42 A;  5CA0 B;  1OHH G;  4O2B B;  4AI8 A;  4DR1 O;  1D2D A;  3B09 A;  1YIT V;  3K9S A;  2XAH A;  3G67 A;  4XBF A;  4PD4 F;  1M9N A;  2FKX A;  1AIL A;  1NJI W;  4TV8 B;  3JAL B;  5LHG A;  2AHY A;  3ZHQ A;  3IC7 A;  3ZMT A;  3K3W A;  4FZ1 A;  4WCE V;  2GDS A;  1FS0 G;  5LHH A;  3CCQ V;  4PI0 A;  1IX9 A;  1AR5 A;  4NR1 A;  2HJD A;  2M6Y A;  4JI4 B;  5IWA B;  1VIB A;  3ZRW A;  4R50 A;  4DV4 O;  2A9H A;  5LHI A;  2JVD A;  4G27 B;  4O4H B;  2IH1 C;  3LSU A;  3H1L H;  1AI4 A;  5D5Q A;  5KHG A;  3H1I H;  4W4L A;  4BW5 A;  5ITZ A;  2X0L A;  1K34 A;  2L35 A;  2WPD G;  2HP8 A;  5BMV B;  5IYC O;  1VAR A;  4O2A A;  1QLE B;  3OUF A;  4CZZ A;  5K1X A;  2JK5 C;  1S5L Z;  3H1J H;  4TOI A;  2F93 B;  2OIE A;  2D2C B;  1AP6 A;  5L3D A;  4DV3 B;  4I7Z B;  5DN6 G;  5B1A B;  1V9P A;  3CSX A;  3CCV V;  1S77 D;  3T4D A;  4GZR B;  1KKD A;  3M7M X;  5EIB C;  3CME V;  2MK3 A;  5KUM A;  1PKX A;  1YHQ V;  4DR5 B;  1NR1 A;  3EVK A;  2W0F C;  3HKE A;  4JI3 O;  1NI8 A;  5LGT A;  1QVG U;  2R72 A;  4YJ2 A;  3WB0 A;  3ML0 A;  1B04 A;  2EIN C;  1AJN A;  1NBM G;  4UXN A;  2JS5 A;  2XUM A;  4LF4 B;  3CMA V;  1G1X B;  3QO8 A;  3GB7 C;  3OW2 U;  1BHA A;  1WB7 A;  1N0J A;  3RBZ A;  4HBN A;  1Q82 W;  2HG5 C;  3RGB A;  5GON B;  2CAZ C;  2LGW A;  4RUF A;  3IFX A;  3DXR A;  5CA1 B;  5LGN A;  2E75 B;  5FNV B;  3BAA A;  1JFF A;  4X20 A;  4QJF B;  3W7S A;  2LGQ A;  1V55 C;  4UVA A;  2AZ0 A;  3TGU H;  4JZG A;  4KXR A;  4J10 A;  1NZ6 A;  3S3W A;  2Q8V A;  3HPL C;  1Q6U A;  3ABK B;  5KAI Z;  4AHC A;  5LP6 A;  5CBH A;  4IT5 A;  5IWA O;  2RQ6 A;  4UCV A;  1NT2 B;  1M57 C;  3MAQ A;  4FLY A;  3VQX A;  1QR8 A;  4BAY A;  4I9Q A;  4DV5 B;  3T1Y O;  3MHS C;  4HAM A;  4I0X A;  1F51 A;  1Y76 B;  4NKG B;  1LR1 A;  1H2K A;  2H3O A;  2Y4T A;  2YS8 A;  4JZ2 A;  2EIN B;  1BL8 A;  1WLE A;  2YIB D;  1CXZ B;  4GKJ B;  2QR4 A;  3HKB B;  1NH2 D;  5EIB D;  2C2A A;  4R8C A;  4MVS A;  4DR7 B;  5JQG A;  1N33 B;  1THZ A;  2OCC B;  4YHH B;  1O9G A;  3ABL C;  3C3T A;  2Q7E A;  1GN2 A;  3ASO C;  2YUA A;  2A79 B;  2AGA A;  4DR5 O;  2DE0 X;  3R66 A;  5IY5 C;  2JGD A;  3ETQ A;  1M93 A;  1WP7 A;  5JH7 B;  3ZN1 A;  1XNR O;  1SQV H;  1ZL8 A;  5LGU A;  2Z3Y A;  3GWK C;  1FXK A;  1M90 W;  1I7F A;  1YTF B;  1OCR C;  3D8C A;  1L1F A;  1QU7 A;  1SA0 A;  4X1I A;  1YZB A;  4DR3 B;  2DWE C;  3BFR A;  1US6 A;  3HKC A;  4P2Z A;  1MAB G;  3K5O A;  2RDC A;  3DC6 A;  3CB2 A;  4OPA A;  4MVZ A;  4U3J B;  4MTG A;  1J5E O;  2HKO A;  4X88 A;  1EZV H;  3W7W A;  5C93 A;  1KBH A;  5IYB O;  2R70 A;  3JAT B;  3L9D A;  3S3X A;  3B8M A;  3CRR A;  3L73 H;  4ICG A;  2ILM A;  1AP5 A;  5LMU O;  2BCC H;  2WLJ A;  3JAS B;  2ZM6 B;  4FMT A;  3SJA C;  4HNA A;  3JAR B;  2PGG A;  2QTS A;  1DK1 A;  5KX5 B;  4ZBM A;  1QBZ A;  1Q5O A;  3DGE A;  2ZE7 A;  2VQF B;  1HNZ B;  1XNQ B;  1YDX A;  4B3S B;  4PJ0 Z;  1URF A;  4LNU B;  3ASO B;  3L72 H;  2Q69 A;  3JAK B;  1RPO A;  2VWK A;  3E8F A;  1GM9 A;  2X6C A;  3ETD A;  2DYR C;  4DV6 O;  4O4I B;  4X8A A;  4P9P A;  1U96 A;  4FM0 A;  2E5L O;  5KAF Z;  4RO2 A;  4X65 B;  3ZJZ A;  1IBM B;  5IT9 N;  1GKF A;  3E86 A;  3BEH A;  2YI9 A;  4GKJ O;  4B3R O;  4ZIB A;  1RP3 B;  1K3E A;  4FFB A;  4IHJ B;  4B3T B;  1Q86 W;  3JAM N;  4MS2 A;  1IBK B;  2AW9 A;  5GTI Z;  4AIL C;  1WP8 A;  1N33 O;  2UXC O;  1BT8 A;  4O4H A;  2WLH A;  3A0B Z;  4B3M B;  1H2M A;  1KKC A;  1JVM A;  3I5D A;  3M8A A;  3K5N A;  4DV7 B;  2NN4 A;  3SJB C;  4EEQ A;  1BHB A;  4UCU A;  3RYF B;  1IZ3 A;  4K3A A;  1PNK A;  2K1E A;  1VQO V;  2UXD B;  5AG2 A;  4AQY B;  3FB5 C;  1YJN V;  2PYJ A;  1IUR A;  1KU9 A;  5B1B B;  2WLI A;  5LP6 C;  5KUK A;  4DR3 O;  4BWA A;  4WFF A;  3ZX6 A;  2F4V B;  3FKS G;  1VEW A;  2HVJ C;  3CCL V;  4FLU A;  2ADP A;  2YXY A;  4J9Z B;  2NR5 A;  4MTX A;  2IJJ A;  1Q43 A;  1MSD A;  1EFR G;  3LSQ A;  1AJQ A;  1ROP A;  3AK1 A;  4UFZ A;  2ZDI A;  1VQ9 V;  1OCZ B;  4PA4 A;  4U7O A;  2VQE B;  4PDL A;  2E3C A;  1HNZ O;  1XNQ O;  1JJ2 U;  4O4J A;  4YY3 B;  4CH4 A;  2ZD9 A;  4NXM O;  1VQK V;  4DRX B;  1XDC A;  4DR4 B;  1R73 A;  5BR8 B;  1YIJ V;  2FYU H;  1VQ6 V;  5FNV A;  3CJH A;  1P4R A;  4WFE A;  1GTO A;  4GX1 A;  1M1K W;  4TSF G;  4DR1 B;  4NTX A;  1Y74 A;  1L0L H;  1FXK C;  1IBM O;  1DF5 A;  1V54 B;  2RN9 A;  2HEP A;  3ZMV A;  1GM7 A;  1XOU A;  4BW9 A;  3J7A U;  4I50 B;  3Q4H B;  5CN0 A;  2UUB B;  4N23 A;  1SQG A;  3IJ4 A;  5EZY B;  3LDE A;  2ZE8 A;  3RYH B;  1ZAU A;  1IBK O;  1I5Y A;  4JI8 B;  4GKK B;  3KCY A;  1Y76 A;  4B3M O;  1S72 V;  4LF7 O;  4DW1 A;  3AG3 C;  4DV4 B;  2Q7G A;  4DV7 O;  4I4T B;  5HFL A;  4JF3 A;  2FTK A;  2B1G A;  1NVP B;  1W0K G;  1HDJ A;  4BIU A;  4QIW F;  3RYC A;  2H8P C;  5IJ0 A;  3DSQ A;  5LYJ B;  2PI4 A;  1QVF U;  2KG7 A;  3FD9 A;  1YJW V;  4LF9 B;  4AQY O;  2UUC B;  2EIK C;  5LA6 A;  1ZUQ A;  3JCU Z;  3ZRV A;  2Q7H A;  2F1M A;  3I56 V;  3CD6 V;  3D36 C;  2PYL A;  4JYY A;  4F6R B;  2F4V O;  2CTW A;  2Y69 C;  1CP9 A;  4TUY A;  3ZMU A;  4UB6 Z;  1K4D C;  2IM9 A;  4HZ3 A;  1XMO O;  2E74 B;  3VQW A;  5JH7 A;  2HVK C;  3QO7 A;  2IW5 A;  4JI5 O;  4X9Q A;  4BIO A;  1WA8 B;  1K5Q A;  2Q0O C;  2WLN A;  3RVZ A;  1ARO P;  3KZI Z;  1S5J A;  5D5P A;  2F95 B;  3PN1 A;  3CS5 A;  3E35 A;  4Q6G A;  4DUY O;  2VQE O;  2A7W A;  4ZHQ B;  1G6U A;  4JPR A;  2HLD G;  3ZHS A;  5EBW C;  1KEC A;  1S5H C;  3AEI A;  3ZHT A;  2BSK B;  1K7D A;  1N36 B;  1IXB A;  4U3F H;  3TXS A;  2JRI A;  1P84 F;  4DR4 O;  4CS4 A;  5BR8 O;  2DQ0 A;  1OV9 A;  4I9W A;  4FLZ A;  4X1Y A;  2XAS A;  1OZ0 A;  2XND G;  5DM6 V;  2P4V A;  1EN6 A;  2P06 A;  2RNB A;  4LWS B;  1VMG A;  3JAS A;  1JMK C;  3SPG A;  1MA1 A;  2UUB O;  4GX2 A;  2R9A A;  3BA8 A;  3ZBH A;  5JCO C;  1R6N A;  4X64 B;  3CC2 V;  1Q6I A;  2GSM B;  4UCO A;  5IDJ A;  4Z1M G;  1NQT A;  1XMQ B;  4LNU A;  2ZNI A;  4QPJ A;  4JI8 O;  4GKK O;  1GO3 F;  2Y0I A;  4I55 B;  4U7N A;  1P7G A;  1GRJ A;  1IXM A;  2AXT Z;  3CEI A;  4O4I A;  3T1Y B;  4CBC A;  2GTS A;  5EC1 C;  3ZHR A;  1HR0 B;  4LH7 A;  2YC0 A;  4EB6 B;  5EBL C;  2QJ1 A;  1Y4M A;  1I94 O;  2QM7 A;  5H6Q A;  1MZE A;  4LF9 O;  5LL6 Y;  1AJP A;  2UUC O;  4F6E A;  4J7J A;  5KHJ A;  1PL4 A;  4PDM A;  1LUV A;  1QHT A;  3TET A;  1IBL B;  4GYC B;  4W4K A;  4ZI7 B;  5J2T A;  4D7T A;  1KB9 F;  2CH7 A;  1TGO A;  4IIJ B;  2QE7 G;  1VQM V;  1SF9 A;  2GV9 A;  4A5U B;  1PNM A;  1RPR A;  3E8H A;  3FB7 C;  3KCX A;  3R65 A;  3CRC A;  1KYO F;  3AK3 A;  2IH3 C;  1VQ8 V;  2OWO A;  4JYB A;  1Y6X A;  2ZE5 A;  1PPJ H;  3AG1 C;  1SER A;  2YEV B;  3AG7 A;  4UV8 A;  4FLW A;  1SZX A;  4JAU A;  3ZMS A;  1JR9 A;  4YJ3 B;  1XNR B;  4DV1 B;  2UU9 B;  3B77 A;  1VQL V;  3RYI A;  2QWR B;  3E8G A;  1AR4 A;  2HR3 A;  1K73 W;  1FPO A;  2IJI A;  5L3G A;  5CA3 A;  1N36 O;  3WG7 C;  5CBF A;  1F23 A;  4JI7 B;  3OFN G;  2BOC C;  4FVM A;  1TVK A;  2W6J G;  1FKA O;  1SZT A;  4JAV A;  1DTO A;  3E22 B;  4KFM A;  2CTP A;  1EN5 A;  4BIZ A;  3OUS A;  4GX0 A;  1J5E B;  3OMN B;  5KHH A;  2P7T C;  3CX5 F;  2BTQ B;  1N32 O;  2DQ3 A;  2ZNJ A;  4L8J A;  1YCI A;  3JD3 A;  4X64 O;  2P6J A;  3H01 A;  5LMU B;  5H2F Z;  1K92 A;  1XMQ O;  2QM4 A;  4DRX A;  3OR7 C;  3OMA B;  4MTF A;  1XI1 A;  1SES A;  2OYQ A;  1XUQ A;  1UPG A;  5LXT A;  1K33 A;  1QR9 A;  2WA4 A;  4H44 B;  1Q7Y W;  1NH2 B;  4K8X A;  3ZHU A;  4TQD A;  1HR0 O;  5KMG B;  4JI1 B;  2EIJ C;  3JSL A;  1SQQ H;  2FML A;  4DR6 B;  1JOY A;  2FL4 A;  1ZLZ A;  5B3S C;  4H13 B;  1Z5V A;  4DV6 B;  3SJQ C;  5FPO A;  4QGP A;  2QGN A;  1MSW D;  1IDS A;  2Q0A A;  2E5L B;  3ETG A;  1IBL O;  1R3K C;  2DOS A;  3RYH A;  4G28 B;  3QNE A;  3FB8 C;  3D3I A;  3MHH C;  4B3R B;  1GM8 A;  3OTF A;  2RMK B;  2BOB C;  2AZ2 A;  4QPK A;  1FFX B;  2ZXW C;  1F4M A;  2NLJ C;  4FIP C;  4WFG A;  4UV9 A;  4J11 A;  3VQY A;  3AG4 C;  1N34 O;  1HNX B;  2UXC B;  1R6T A;  4O4L A;  5IJ9 A;  3HKD B;  3B8N A;  1VQN V;  5C8Y A;  3UM7 A;  2A0L A;  1MNG A;  5KLV H;  4P30 A;  5FL7 G;  1V55 B;  4DK0 A;  1R3L C;  3VQV A;  4DV0 B;  1YXB A;  3CHX A;  3NXS A;  4DV1 O;  2ZT9 B;  4JYC A;  2UU9 O;  4F6R A;  1LNQ A;  1W2B U;  2JDI G;  4K0K B;  3JAW B;  2CTR A;  1JX9 A;  1JCH A;  1NTZ H;  4JI7 O;  1M57 B;  2GHY A;  3P32 A;  1SQP H;  4UB8 Z;  3G71 V;  3BRC A;  1E79 G;  2P90 A;  2DYS C;  5LOV B;  2QWP B;  5J9P C;  1AB3 A;  3X2Q C;  3H1K H;  2EIJ B;  5JWP A;  4ZKI A;  3FAV B;  4X1K A;  3CCR V;  3K0G A;  1EM1 A;  2Y4U A;  5TIS Z;  2Q9L A;  1WNS A;  1YVW A;  5CBG A;  1ENV A;  3SJC C;  1XQ8 A;  2XAJ A;  4PDV A;  5BXZ A;  2EIL C;  2PY5 A;  1FJG O;  3HB3 B;  3K5L A;  2GBO A;  1Y67 A;  5H6R A;  1B06 A;  3UT5 B;  3ZHV A;  2ZXW B;  3WB2 A;  4NXN B;  1OJH A;  3AG4 B;  2O57 A;  3CXH F;  2WLK A;  3RW0 A;  5CB4 A;  1HNW O;  2Y48 A;  5CA0 A;  1AR1 B;  3ABL B;  2LFR A;  4FJC C;  4O2B A;  4B08 A;  4MVU A;  1R6K A;  4EFE A;  4JI1 O;  4NXM B;  3T1C A;  4E4E A;  2CE4 A;  1BQZ A;  5IY5 B;  4DR6 O;  3K08 A;  1F4N A;  3SPH A;  4TV8 A;  2ETN A;  3JAL A;  3BA9 A;  1XHZ A;  2YI8 A;  4FK5 C;  4J7Z A;  4RAI A;  1M56 C;  4WF9 V;  2YXL A;  1OCR B;  3SYQ A;  5LBQ A;  2ITD C;  2DMX A;  4I55 A;  2OTL V;  4NTY A;  4LFC B;  2AHZ A;  3X2Q B;  1YJ9 V;  2JJ1 G;  4RWU A;  4LP8 A;  2W6I G;  2X6A A;  1HNX O;  1AVM A;  2QEX V;  1JPX A;  1VQP V;  4GX5 A;  4LF7 B;  1KC8 W;  3QTC A;  2LW7 A;  1WB8 A;  4J80 A;  4FFK A;  2EBO A;  3ASN C;  4O2A B;  3TK1 A;  5BMV A;  4DV0 O;  4XDK A;  3STZ C;  2PF4 E;  1K4C C;  1FAF A;  3CC7 V;  5IYD O;  1TA8 A;  1SET A;  4K0K O;  4DK1 A;  2UUA B;  1H2N A;  2EJ7 A;  2X6B A;  3BCC H;  1G8M A;  2OCH A;  4J9Y B;  2LQT A;  3RN4 A;  4XDL A;  4KUM A;  1PL0 A;  4NVP A;  3B40 A;  1EBO A;  2QKC A;  1GMG A;  1OCC C;  1H38 A;  4LFB B;  3OR6 C;  1SQX H;  1BGY H;  2DYR B;  2DN9 A;  4X66 O;  1K5S A;  5F2V O;  1K9M W;  1XMO B;  1R3J C;  2P5O A;  2YEV A;  3OD4 A;  5EK0 A;  2K9P A;  4JI5 B;  1S0V A;  2XHB A;  1NU1 H;  2F23 A;  2FB5 A;  2DWD C;  1RSO B;  1KP3 A;  3SPI A;  3N27 A;  3OGI B;  2JEU A;  2UXX A;  3CRQ A;  2Q5Z A;  1SRY A;  2QKA A;  4DUY B;  4NXN O;  3E22 A;  4CS2 A;  5GON A;  1GN6 A;  3OTO O;  3K9A A;  5GW7 A;  3DXR B;  1MZF A;  4FLX A;  4ZOL B;  5CA1 A;  4FLV A;  3ZCC A;  3VBB A;  3CCS V;  4PI2 A;  4WFB V;  1JFF B;  2KKW A;  2G38 A;  1N0N A;  3U11 A;  3EXA A;  1QCE A;  1AI6 A;  1NR7 A;  2BTQ A;  2HJF C;  3T4Z A;  5H9C A;  4QE7 A; 
#chains in the Genus database with same CATH homology
 1Y74 A;  1Y76 A;  1VF6 A;  1Y76 B;  3B40 A;  1ZL8 B;  1ZL8 A;  1VF6 C;  1RSO B;  1Y74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...