1VF6A

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
b'VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein transport
total genus 24
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6A00
1Y76A 1VF6A 1Y74B 1ZL8B 1RSOB 1Y74A 3B40A 1ZL8A 1VF6C 1Y76B
chains in the Genus database with same CATH superfamily
3JD4A 3CB2A 2FYUH 1I5YA 2ZINA 1MABG 4I50B 1DF4A 4LF5B 3JCZA 1QNMA 4LH6A 1V9PA 4X1YB 1VQ6V 5DECA 2LGWA 1EZJA 3CHXA 4I9WA 2YUAA 1MA1A 1VEWA 4WFBV 1VF6A 1HNWO 4GKJB 1DLBA 4GX0A 3JAKA 1T5EA 3MAQA 4ZHQB 3K9SA 2ODMA 4B3TO 4DV7B 2EILC 2Q69A 1JX9A 1Q43A 4K0KB 2UXCO 2EJ7A 3A0HZ 4A5UB 2PF4E 3ZMUA 2G38A 1BQZA 5CA3A 1XMQB 3SPGA 2DJVA 1AB3A 3LUTB 2NNUA 3Q4HB 2EZPA 4QJFB 2QKSA 3CXHF 2XT9A 4LF6B 1OCOC 2P22C 1F23A 2Q67A 2CH7B 2UXXA 4DR5B 3K06A 3RGBA 3VQWA 3JD2A 5C8YA 2LFSA 4DUZB 4FLZA 3OMIB 2ZNIA 3RYHA 4P9PA 1SS3A 2ZR3A 3SYQA 4DR3O 2CAZC 4YJ2A 2OTLV 1NKDA 5JJEB 2GTSA 3CCSV 1Y66A 2UUAB 2DOSA 5L3DA 3UO2A 2UXDO 1R3JC 3BHPA 1SC5B 3BFRA 3CEIA 4QPJA 4GX5A 4G2KA 4LF5O 1IDSA 3TGUH 4YY3B 2QTOA 3OR6C 3K5NA 5IY5B 4R7CA 1I7FA 2XAGA 4UCSA 4PDMA 1JJOA 2YIDA 4LR3A 3U0ZA 4GCZA 1OV9A 2ETNA 2N74A 1IBKB 3E8GA 2F43G 3E8BA 3E89A 4R6ZA 3JCUZ 2DMXA 1FFTB 3LDEA 1BS3A 1JQ0A 1HNZB 2RN9A 1GM9A 4UFZA 4K0KO 2P90A 4JZGA 1OJHA 5BR8B 2ZXWC 5BXZA 2LFRA 2W0XA 3M7MX 4U3JB 1FFXB 4NTWA 3A0RA 5JCOA 2F4VB 4FMTA 1EM1A 3VQYA 1HNXB 1PL4A 1KC8W 4LF6O 2FB5A 2HFEC 2OTJV 2ZQMA 5GONA 4DR5O 1XMOB 1JMKC 4PD4F 1BHBA 3RYHB 3VQVA 1PL0A 2F23A 4WFFA 1MZEA 3IC9A 2DYRC 2IJIA 3BPZA 4YJ2B 1YCIA 1IBMO 4DR2B 3K0DA 4K3AA 5JVDA 4EFEA 4NXMO 3RT3C 4PA3A 2E5LB 1XHZA 2JJ1G 2UUAO 4X8AA 1FXHA 1Q90D 3FB7C 5IWAB 1ZL8B 1M1KW 5J2TA 1US6A 4GKKO 1FXKC 3IC7A 1VQPV 3HKDB 2JGDA 3JARA 4TUYA 3NXSA 3AEIA 5CA1A 2LO1A 4YY3O 2Z5UA 2ZM6B 3ZHRA 4UCOA 3ABLC 3A2FA 1BGYH 4FLUA 5BMVB 1JA8A 1OCOB 5JQGB 1IBKO 3BVOA 4DV0B 4X62O 4KUMA 1P7GA 4HAMA 2WLIA 3OUFA 3SPHA 1HNZO 4XDJA 1AILA 1K7DA 1SF9A 2KSDA 3CXCU 3SJCC 1KP2A 1P84F 3THOA 4I4TA 4DK0A 1RP3B 3HKEA 1WA8A 3MD0A 2R72A 3S3WA 3RYCA 4OGQB 1BE3H 4OPHA 1TA8A 2CGNA 3M8AA 1B6QA 2YI9A 4JI6B 1KYOF 4JTAB 1Y76A 1XMOO 1GO3F 1FPOA 1KB9F 4XDLA 2A79B 3E2EA 1N32B 3PJSK 4CZZA 4X65O 4DR2O 2R9AA 3RYIA 2FL4A 1TUEB 1S3JA 3W7SA 4X1KB 4CS2A 3LNMB 4JAUA 3JAWB 1KKCA 5CMUA 4PV1B 1UJWB 2RMKB 1A32A 3CC2V 2UUCO 5KHJA 3DTUB 3FAVB 1F4MA 4LFCB 2V4DA 4TV9B 2V7QG 4H33A 5EK0A 3CP1A 2ZM6O 1J95A 2OYQA 1K9MW 4UB6Z 5IYBO 5B1OA 1PNKA 3D3IA 3ZHSA 4P9OA 1VQKV 1GTOA 3P3PA 2UUBB 4P2ZA 1XQ8A 3SYOA 4KHPB 2XAFA 3L74H 3K59A 3ABTA 1COWG 3DXRA 3FKSG 3X2QB 3HKEB 1QHTA 5K1PA 4LFAO 4I9QA 3TJTA 2Y0PA 3AK3A 1XNRB 3SPIA 2DN9A 5LGTA 3CCJV 2L35A 1Y74A 2ITCC 5GW7A 2HHHB 5CBFA 4DR1O 3ZN1A 2YSUB 2YIAA 5LA6A 1HWYA 4JTDB 4DV6B 1PKXA 1K5QA 2B1GA 1JCHA 1WNSA 2A3QA 5EBWC 4JI6O 1Q5OA 3LDCA 1VMGA 1ZTEA 4B3SO 5LMNB 3T1CA 2JEUA 3B4SA 2WA4A 3H1KH 2P4KA 3OD4A 2QWPB 1QCEA 3ABLB 2YXHA 4LWSA 2JDIG 2H8PC 2XNDG 4LP8A 2B5UA 3I55V 5EBLC 3GB7C 3ETDA 2R9IA 1NT2B 4QGPA 2A06H 1H2MA 1K97A 4ZIBA 4I0XA 1CXZB 4DRXA 5EC1C 3WB1A 4B7EA 3SYPA 2XTAA 3L75H 5TISZ 1AVMA 4G27B 2HJDA 4JF3A 1EN4A 4JTCB 2UU9B 4BR6A 1S76D 4LCUC 3E83A 1TVKA 2WA3A 3E8HA 3UCSC 4E2LA 1AJPA 1Q6HA 4X9QA 3B40A 2WPDG 2QR4A 4MVMA 2ZE6A 3D8CA 1P7BA 2Q0OC 4JI0B 4Z2WA 3WU2Z 3SJQC 3ABMB 3ZBHA 4HNAB 5B1NA 4H0LB 1RPOA 4X20A 1XREA 1MMMA 2Y4UA 1XNRO 2M7WA 3R66A 4TOIA 4DUYB 2IU0A 2QJ1A 3U10A 4H37A 5GTIZ 4MTGA 1KQSU 2HHHO 5IYDO 5B1BB 1XOUA 1SA0B 5B5EZ 5JH7A 2XAQA 5L3FA 1OCZC 4DV6O 2LW1A 3SDLA 1R73A 1BQ0A 4J9YB 1SERA 3FX7A 1HP8A 4PI2A 4J7JA 4ZOLA 2HG5C 1Q7YW 1NH2B 4DV3B 4PI0A 3VBBA 1VQOV 4F6RA 1D5AA 4DRXB 2P7TC 3CMAV 2DQ0A 2NN4A 2ZT9B 1PD3A 1YTFD 2R9RB 3OE7G 3APOA 1RM1C 4IT5A 2UU9O 4JYAO 1GN3A 1TVKB 1H2SB 1S72V 5KUKA 4W4LA 2Y69C 3OFNG 5B66Z 2WLMA 1Z2GA 2YDEA 1MOFA 4JV5O 2F93B 1SZTA 3MHHC 4IHJB 1JOYA 1NI8A 1IXMA 3CPWU 2YEVA 1JVMA 4PELA 1MNGA 1IXBA 5KX5A 2VWJA 4UUJC 4JI1O 3ZHVA 4MT8A 1XL6A 3D36A 4DUYO 5DN6G 1W0JG 5L3GA 1D2DA 3FD9A 4CS4A 5D5QA 5JH7B 1VF6C 1AI5A 2H94A 3K5LA 1FAFA 3ML0A 4HZ3A 4O4HA 3H1JH 3ZN0A 3K03A 3JASB 1KD1W 2GHYA 3N2GA 1VP7A 3WFVA 2QGNA 3AG7A 3B09A 5H6QA 4JYBA 2KG7B 5EYPA 2KB1A 2PUSA 4AI8A 1MSWD 2UXDB 1YJ9V 4PDRA 2JIZG 1QVGU 4OXSA 3W7WA 2WLHA 3T4DA 4X1IA 3UT5B 2DQ3A 4O4JA 1QU7A 5LMUO 3F7VC 3ZMZA 3ABUA 3B2EE 2Z3YA 3LNNA 4LNUA 4JI4B 1NJIW 1GH6A 1W0KG 4QNHB 4BIZA 3RYFA 3ZRWA 2CTPA 3OUSA 3ZHUA 2WWWA 1OCZB 4E4EA 1ZSPA 3E8FA 4F4LA 1V54C 4NXNO 4B7KA 1H8HG 1PP9H 5KX5B 5KHKA 2AW9A 3AK2A 2IH1C 1WPBA 1XNQB 2XOKG 4I5SA 4MSWC 2EZOA 1NR1A 4CS3A 2IM9A 1YIJV 1H2KA 4EFBA 4FLXA 2ZE7A 1L0LH 1G4YB 4JI8O 3SYAA 2BSKA 3RN4A 4O4IA 1TUBA 2RCVA 3CCVV 1SQFA 3L71H 3E22A 1RM1B 2QWQB 2PTMA 2N04A 3ICXA 3P32A 3N2GB 4ZI7A 5LOVA 4J10A 2PYJA 1QBZA 1HR0O 4DW1A 4DV2B 1R3KC 1JPXA 2E3CA 2AGAA 2Y69B 1IBMB 1AP6A 3CRRA 2WLKA 4NXMB 5EYPB 5LP6A 1YVWA 4W4KA 1VIBA 3BAAA 2V1DA 3E35A 5JCOC 2QDOA 4MVZA 3IAYA 1AROP 4LF8O 3FYEB 1S0VA 2P6JA 4GKKB 4X1IB 5KLVH 3HKCA 4F6EA 4O4JB 4ASUG 3AG3C 4MTXA 3BA8A 3K58A 4AQYO 2D3OW 4FPPA 3J81N 1AR4A 4JI4O 1GAXA 4LF9B 1P4RA 2OCCC 3ZHQA 4Z1VA 4YJ3A 2EIMB 4TSFG 3GWOA 1GM7A 3JAKB 2HR3A 4X62B 1E79G 4I7ZB 3SYCA 4DW0A 1PNLA 3D3QA 3OTOO 1L0NH 3CSXA 1GM8A 3VOUA 3ZMVA 5FPOA 5CBGA 1IX9A 1XNQO 1F7YA 4EB6A 4JYYA 4TQFA 1SESA 1AJNA 1NVPB 4IIJA 4FM2A 2BSKB 5H5NA 4JGSA 4PDLA 5L3CA 5J2UA 4UCTA 1WP8A 2UXNA 3HB3B 3E22B 5C8YB 1VQ7V 2YXYA 2QKCA 5LOVB 4PA7A 4YXWG 2WAMA 4DV2O 3TCUA 5IDJA 4WFGA 2Q0AA 2P06A 5IYZA 3X2QC 3S3XA 4ZKIA 1Q6IA 5LP6B 4X65B 3CCLV 1Z5VA 1I0HA 1F51A 2JRIA 1UPGA 2OCHA 3TXQA 4I55A 1V54B 1WLEA 3UQ8A 2P5OA 2UUCB 1K3EA 2JS3A 4HBNA 2HVKC 1XBLA 4CH4A 4FFBA 4JAVA 2X6CA 2XAJA 2M6YA 4L8JA 3STZC 4LF9O 4FVMA 1QVFU 3EVKA 5F2VO 4LFBB 3T1HO 4JASA 2QM7A 3JALA 2PI5A 1GK9A 3OGCC 1NS1A 3FB6C 1N36O 2VQFB 3SR2C 1XEQA 2BE3A 3QO5A 1ZUQA 3JD1A 4EB6B 4LFAB 1BHAA 3I56V 2BTOA 3HKBA 3AK1A 3QTCA 4DO2A 4DR1B 2AZ0A 3IGAC 4BAYA 3PN1A 1OZ0A 3B77A 4J9ZB 5GONB 3AG3B 4DV1B 2Q4PA 1NH2D 4N21A 4B3SB 3ABMC 3BABA 2Q7GA 4BWAA 5IT9N 1AI4A 3N2KA 3TXSA 2OCCB 5IJ0A 5JVDB 4FJCC 4N23A 4P30A 2CK3G 3AG1C 3LDDA 2A0LA 3FB8C 4WFAV 1XI1A 4MVQA 5FLXN 4NTXA 2IJHA 1PPJH 1GN6A 1XDCA 5J2TB 3OGIB 3K3WA 2Q7EA 3RFRA 1KECA 5B1BC 5CB4A 5LHIA 2AXTZ 1WPXA 2JGDB 3JARB 4RO2A 4TUYB 1HDJA 2IJKA 5CA1B 4TV8A 1M93A 2GV9A 3F5TA 2EIKB 1VQ9V 2Q73A 2XASA 1M9NA 3OM3B 3QVNA 1SZXA 4O4LA 3JALB 3K5OA 3JAMN 4LFBO 1UFIA 2WSSG 1JFFA 2WLIB 2Q8VA 4QE9A 3BCCH 3K04A 1N33B 2Q68A 2OWOA 4JZ2A 4Q20A 2HJFC 3F5WC 1URFA 4I4TB 5J9PC 2VQFO 1WA8B 3A0BZ 1YF2A 3LSSA 2BOBC 4FM0A 2QE7G 4RQFA 3RYCB 2FMLA 4LC1A 5IJ9A 4MTFA 4ABMA 4EEQA 4DV5O 1O9HA 5ITZA 2CTWA 4UCVA 3RVYA 3LSUA 5BY1A 4DXWA 1S5JA 2W0FC 3KCYA 1Y76B 4DV1O 3JYCA 2YC0A 5JJNB 3BRCA 2BCCH 5L3EA 3UKMA 3DGEA 1Q8IA 4FIPC 2QWOB 4IL6Z 3U11A 3RYIB 2IBZH 2Q5ZA 4UXNA 5EZYA 2GTAA 1WN7A 3O65A 4CH5A 1VQMV 5CBHA 4UVAA 4XDKA 4DR6B 5CB4B 2JEXA 1S5HC 1WJZA 2W6JG 4TV8B 1XL4A 1N0JA 4X66B 4Q6GA 3OEEG 2YIBD 1ORQC 4RUFA 1YHQV 4PJ0Z 1E1RG 1V55B 5KMGA 4JYAB 2P67A 3CC4V 2EINC 4U3FH 5LL6Y 3P30A 5H9CA 2QA4V 4CC5A 3CS5A 1K73W 4CBCA 4JV5B 1AR5A 1FXVA 1AI6A 4GLXA 1G6UA 4UV9A 1VQ8V 1FD9A 1N33O 1U97A 2B1IA 3DXRB 4UVBA 2F1MA 4GUNA 3OMNB 1ROPA 1H38A 4OX9O 4JI1B 2CUGA 4KXRA 3AG1B 4WBNA 2ATKC 1M90W 4YIPA 1Y74B 5C93A 2ZDIA 2DE0X 4R8CA 5LA6B 5ITZB 2IW5A 3STLC 4PDVA 4K8XA 3IJ4A 5DM6V 1WB8A 2QKAA 3C3TA 4Z1MG 3OEHG 1NTKH 3CCUV 1N8RW 3JD0A 4C7UA 2BTQA 4G28B 5LHHA 3ABKB 5LGNA 4LWSB 1LUVA 1VQNV 3CJHA 3D36C 5H6RA 4X64O 3WB0A 4I0XB 4MW8A 5LYJA 2CGOA 4DR6O 4JI3B 4FLTA 1EN6A 2GBOA 3W7TA 2DYSB 2FKXA 1FJGB 1M56C 5EIBC 2QWRB 1X4TA 5BZBA 3ZS8C 3GWKC 4X66O 4UVCA 5LMUB 2Y0IA 5KMGB 1NTMH 5LXTA 1R3LC 1SETA 2KKWA 5KA6A 3L70H 4GZRB 3KKYA 4RQEA 1NZ6A 2VS0A 4UCRA 4I50A 3JSNA 4NXNB 4L87A 3H1LH 3WG7C 2LQTA 3CWBH 3N27A 1NVPD 2HLDG 4AILC 4JAAA 4X1YA 3K79A 3ZRVA 4X20B 1QLEC 3ZIAG 4GYCB 1YI2V 2Y48A 1H2LA 1L8DA 2VWKA 4PA6A 3G80A 4O2AA 4ZHQA 1GKFA 1VQ4V 1NU1H 3DSQA 1YXBA 4JI8B 2X6BA 1GN4A 2HEPA 4JI5O 2EIMC 2JVDA 3FB5C 1YDXA 4MVSA 2N05A 2CTRA 3BEHA 3QO7A 4YIOA 2ARHA 4IYHA 1HR0B 2W6IG 4ZBMA 3CJHB 2EINB 4X88A 4ZOLB 3CMEV 1JJ2U 3CCRV 3CRQA 3K57A 3ASOC 3Q4HA 5KAFZ 3FFQA 1CPYA 4F6RB 4RUEA 3RW0A 3AG4C 4TT3G 4LF8B 2CH7A 2H3OA 4JI3O 2ZCEA 1FJGO 4U7OA 3ZCCA 2QM8A 3R65A 4QPKA 2X7RB 3E86A 3ZHTA 5D5PA 2CTQA 1GMGA 1K34A 5E79Z 1KMIZ 4AQYB 1ZLZA 4NR1A 4NTYA 1WP7A 2RDCA 2MW2B 2EIJB 3CRAA 4FLWA 1KUQA 5GTHZ 4H13B 5LP6C 2GUZA 3CX5F 1M5IA 2DWDC 5B1AC 4LF4B 4PHZA 3CD6V 3OTOB 2YEVB 3G6BA 3H1HH 4K8ZA 2RQ6A 5B3SB 1J5EB 3ETEA 3CCMV 1YITV 1DF5A 1ZX3A 2CDYA 3OW2U 4DR7B 3ASNB 2VQEO 1KKDA 4MW3A 4O2AB 2VRZA 3QF7A 3M99B 2DW4A 3JSLA 1M56B 4B3RO 1N34O 2LW7A 4O4HB 4J7KA 2ZKOA 3SPJA 1LUWA 2IU3A 3ZJZA 4U3JA 1FFXA 2WLLA 1GN2A 1H2GA 4WFEA 2ZIOA 1OCCB 2QEXV 3FYIB 5KHGA 4DR4O 3T1YB 1L1FA 4JI7B 3GVMA 2QWNB 4GT1A 4IYIA 4NVPA 2Z0AA 3I5DA 3DC5A 1Y6XA 5FL7G 3VQXA 4OPAA 4LBEC 4RWUA 3WG7B 1B06A 1N0NA 2HKOA 3CE2A 1G8MA 3SPCA 1MSDA 1QLEB 2Q6AA 1TAEA 5FNVA 3W7UA 1BT8A 2PZSA 4BW9A 4LNUB 1X59A 4MVOA 3TETA 3W7XA 3RYFB 3ZRWB 1F4NA 1OCRC 2GUZB 4WCEV 3CRMA 1PNMA 3T1HB 4NYKA 1ZL8A 2WLNA 1K4CC 4PA4A 4LF4O 1QLNA 3HKDA 1WAZA 2R70A 4GX1A 1N36B 4JYCA 5E1AC 1Q6UA 1WB7A 5AG2A 1XILA 2IJJA 3ASOB 1J5EO 1M57C 1YTFB 3L72H 4DR7O 1ENVA 4RAIA 1QR9A 5BMVA 4GKJO 3AG2C 3AG4B 1LR1A 5JQGA 1R6KA 2EIKC 2AZ2A 2C2AA 4BW5A 3EXAA 4DV7O 3CC7V 1Y67A 4O4IB 3C90A 1TUBB 1SQQH 1CP9A 2JK5C 4UB8Z 2F66C 4ZI7B 2BOCC 2WLLB 2OT5A 1B3QA 1GRJA 1VQLV 4AHCA 1XMQO 4X89A 2QSAA 4MS2A 3ZRXA 3L73H 3T1YO 4JI7O 4J41A 3L9DA 2QTSA 2UXBB 5B1AB 5JJJB 2ITDC 3BA9A 1S77D 1K4DC 1QR8A 2LGQA 2ZE5A 1FS0G 4J80A 4BIOA 4DUZO 2XUMA 3HKCB 3KCXA 4UCUA 3RWRD 3G4SV 1P49A 5FNVB 1ZAUA 2D2CB 1BSMA 3K5MA 4FLVA 1DK1A 4MVUA 1Q3EA 1MZFA 2ADQB 3SJBC 3ZX6A 1NQTA 1XUQA 4X1KA 2OIEA 2EILB 2P4VA 3DC6A 3JAWA 3G71V 1K5SA 4YJ3B 4WFHA 2EX3A 5KHHA 3IFXA 2Q9LA 3JATA 1IZ3A 1KBHA 1I94B 5L3BA 5H2FZ 2WLJA 3MDSA 3H1IH 1BZKA 3FAVA 1K33A 1JR9A 1BCCH 4TV9A 2FTKA 1O9GA 4KL1A 3ZMSA 1Q82W 4DV4B 4IIJB 1S5LZ 1V55C 2YICA 4CC6A 2MK3A 5K1XA 4DV5B 1PM9A 2K1EA 5J2UB 2XAHA 2XHBA 3JD3A 2ZR2A 1K8AW 2EBOA 1NBMG 4J42A 5BR8O 4FZ1A 2A9HA 2Q7HA 4D7TA 1H8EG 4B3MB 4NB5A 5IYZB 4U7NA 1QQCA 3C3SA 2F4VO 1OCRB 1SQGA 1HNXO 1FXKA 4I55B 3J80N 2IH3C 2UXBO 2A7WA 1VF7A 1RFYA 3QO8A 3ETGA 1M57B 2F95B 1SQVH 5KHIA 4FFBB 4FLYA 3CCQV 3AG2B 1ZWIC 1YZBA 2E5LO 5EC2C 3ABKC 3QG5A 2CE4A 4FK5C 2QM4A 1NR7A 5IWAO 5IYCO 3JATB 4BIUA 1SKVA 1SRYA 2YI8A 1I94O 2ZXWB 1OHHG 1DGSA 1R1BA 2GSMB 1PV0A 3OTFA 3OMAB 2DYSC 3G67A 4FFKA 3H9VA 4OX9B 1THZA 3NR7A 3CYOA 1EN5A 3EFFK 3HKBB 2NLJC 5LGUA 4J11A 4DV4O 1VF5B 3H01A 5A2QN 4DV0O 2O57A 1HW7A 2NR5A 2PY5A 1VARA 2B9ZA 2ZNJA 1FYJA 1KP3A 5HFMA 3P3NA 2PGGA 4HNAA 2DYRB 1SQXH 5LHGA 4EKWA 2JS5A 4JPRA 3UO3A 4PA9A 1VQ5V 4B08A 5A9GA 3N2KB 4B3MO 5IJ0B 2AHZA 1FXKB 5KAIZ 2X6AA 1SA0A 5EBMC 3OR7C 1CEZA 3OT7A 4X64B 4KFMA 2ZDIC 1N4CA 1NTZH 1DTOA 1FKAO 1BMFG 3O9OA 4QE7A 4LF7B 4DYLA 4FM1A 5KUMA 1N32O 1YEWA 2ZE8A 4KP4A 3LSQA 1W59A 3K0GA 1AJQA 4K35A 4J7ZA 4R50A 4ICGA 4O4LB 2KQXA 4TQDA 2AHYA 1JFFB 1YJNV 1R6NA 1R3IC 3ETQA 3RBZA 1AI7A 3KG2A 1Q81W 2LP7A 5JWPA 2JGUA 4LFCO 3SJAC 4JI2B 1RPRA 1EFRG 4GX2A 5EIBD 1SQBH 1IVSA 3T2MA 5FPRA 3F7YC 3BY6A 2EJRA 5IJ9B 4MVRA 1B04A 5LBQA 1TGOA 2ZIMA 1LNQA 2EIJC 5CA0A 2UUBO 5HFLA 4QIWF 3K08A 1RSOA 2ADPA 4IHJA 4KHPO 4JI5B 2OIGA 1Z5WA 2DWEC 3ZMTA 1E1QG 4XBFA 4FZ0A 1U96A 5CN0A 1YJWV 1G1XB 1R6TA 5EZYB 2E74B 5B3SC 4H44B 1K92A 2PYLA 1IBLB 3KZIZ 1MG1A 3ASNC 2JJ2G 3OAAG 1Y4MA 2L6LA 3RVZA 2EULA 1H2NA 5LMNO 1W2BU 3SGIA 3JASA 4DK1A 4LF7O 5IE9A 3WB2A 4IGGA 1D5NA 1IURA 2E75B 4YHHB 2KG7A 4O2BA 1I08A 1KU9A 3QNEA 1SQPH 3ZEDA 1EBOA 2X0LA 1OCCC 5DEDA 3TK1A 2YS8A 1M4UA 3UT5A 5KA5A 3CRCA 2ILMA 1XHXA 4JI2O 1YSCA 3T4ZA 2RNBA 3J7AU 3K9AA 4WBNB 2K9PA 4LH7A 4CH6A 1HNWB 3HPLC 1Q86W 2VQEB 3MHSC 2YIBA 5CA0B 4B3TB 4HYOA 4JI0O 1AP5A 1RSOB 2Y4TA 2RJZA 4D7SA 4B3RB 3A8TA 1N34B 1AR1B 2UXCB 2PI4A 3CCEV 2HP8A 4WF9V 3B8NA 3B8MA 2E76B 2BTQB 3EHBB 5IY5C 4TWKA 4DR4B 3UM7A 4CH3A 4NKGB 2HVJC 3ZRSA 1IBLO 5LYJB 3HR0A 4MTOA 4D6TH 1BL8A 3G6EV 2GDSA 4UV8A 2YXLA 1EZVH 4DR3B 2ZD9A 1I5XA 5LXTB 4O2BB 4DV3O 4YHHO 3APQA 2LJ2A
chains in the Genus database with same CATH topology
1Y76A 1VF6A 1Y74B 1ZL8B 1RSOB 1Y74A 3B40A 1ZL8A 1VF6C 1Y76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 A;  1VF6 A;  1Y74 B;  1ZL8 B;  1RSO B;  1Y74 A;  3B40 A;  1ZL8 A;  1VF6 C;  1Y76 B; 
#chains in the Genus database with same CATH topology
 3JD4 A;  3CB2 A;  2FYU H;  1I5Y A;  2ZIN A;  1MAB G;  4I50 B;  1DF4 A;  4LF5 B;  3JCZ A;  1QNM A;  4LH6 A;  1V9P A;  4X1Y B;  1VQ6 V;  5DEC A;  2LGW A;  1EZJ A;  3CHX A;  4I9W A;  2YUA A;  1MA1 A;  1VEW A;  4WFB V;  1VF6 A;  1HNW O;  4GKJ B;  1DLB A;  4GX0 A;  3JAK A;  1T5E A;  3MAQ A;  4ZHQ B;  3K9S A;  2ODM A;  4B3T O;  4DV7 B;  2EIL C;  2Q69 A;  1JX9 A;  1Q43 A;  4K0K B;  2UXC O;  2EJ7 A;  3A0H Z;  4A5U B;  2PF4 E;  3ZMU A;  2G38 A;  1BQZ A;  5CA3 A;  1XMQ B;  3SPG A;  2DJV A;  1AB3 A;  3LUT B;  2NNU A;  3Q4H B;  2EZP A;  4QJF B;  2QKS A;  3CXH F;  2XT9 A;  4LF6 B;  1OCO C;  2P22 C;  1F23 A;  2Q67 A;  2CH7 B;  2UXX A;  4DR5 B;  3K06 A;  3RGB A;  3VQW A;  3JD2 A;  5C8Y A;  2LFS A;  4DUZ B;  4FLZ A;  3OMI B;  2ZNI A;  3RYH A;  4P9P A;  1SS3 A;  2ZR3 A;  3SYQ A;  4DR3 O;  2CAZ C;  4YJ2 A;  2OTL V;  1NKD A;  5JJE B;  2GTS A;  3CCS V;  1Y66 A;  2UUA B;  2DOS A;  5L3D A;  3UO2 A;  2UXD O;  1R3J C;  3BHP A;  1SC5 B;  3BFR A;  3CEI A;  4QPJ A;  4GX5 A;  4G2K A;  4LF5 O;  1IDS A;  3TGU H;  4YY3 B;  2QTO A;  3OR6 C;  3K5N A;  5IY5 B;  4R7C A;  1I7F A;  2XAG A;  4UCS A;  4PDM A;  1JJO A;  2YID A;  4LR3 A;  3U0Z A;  4GCZ A;  1OV9 A;  2ETN A;  2N74 A;  1IBK B;  3E8G A;  2F43 G;  3E8B A;  3E89 A;  4R6Z A;  3JCU Z;  2DMX A;  1FFT B;  3LDE A;  1BS3 A;  1JQ0 A;  1HNZ B;  2RN9 A;  1GM9 A;  4UFZ A;  4K0K O;  2P90 A;  4JZG A;  1OJH A;  5BR8 B;  2ZXW C;  5BXZ A;  2LFR A;  2W0X A;  3M7M X;  4U3J B;  1FFX B;  4NTW A;  3A0R A;  5JCO A;  2F4V B;  4FMT A;  1EM1 A;  3VQY A;  1HNX B;  1PL4 A;  1KC8 W;  4LF6 O;  2FB5 A;  2HFE C;  2OTJ V;  2ZQM A;  5GON A;  4DR5 O;  1XMO B;  1JMK C;  4PD4 F;  1BHB A;  3RYH B;  3VQV A;  1PL0 A;  2F23 A;  4WFF A;  1MZE A;  3IC9 A;  2DYR C;  2IJI A;  3BPZ A;  4YJ2 B;  1YCI A;  1IBM O;  4DR2 B;  3K0D A;  4K3A A;  5JVD A;  4EFE A;  4NXM O;  3RT3 C;  4PA3 A;  2E5L B;  1XHZ A;  2JJ1 G;  2UUA O;  4X8A A;  1FXH A;  1Q90 D;  3FB7 C;  5IWA B;  1ZL8 B;  1M1K W;  5J2T A;  1US6 A;  4GKK O;  1FXK C;  3IC7 A;  1VQP V;  3HKD B;  2JGD A;  3JAR A;  4TUY A;  3NXS A;  3AEI A;  5CA1 A;  2LO1 A;  4YY3 O;  2Z5U A;  2ZM6 B;  3ZHR A;  4UCO A;  3ABL C;  3A2F A;  1BGY H;  4FLU A;  5BMV B;  1JA8 A;  1OCO B;  5JQG B;  1IBK O;  3BVO A;  4DV0 B;  4X62 O;  4KUM A;  1P7G A;  4HAM A;  2WLI A;  3OUF A;  3SPH A;  1HNZ O;  4XDJ A;  1AIL A;  1K7D A;  1SF9 A;  2KSD A;  3CXC U;  3SJC C;  1KP2 A;  1P84 F;  3THO A;  4I4T A;  4DK0 A;  1RP3 B;  3HKE A;  1WA8 A;  3MD0 A;  2R72 A;  3S3W A;  3RYC A;  4OGQ B;  1BE3 H;  4OPH A;  1TA8 A;  2CGN A;  3M8A A;  1B6Q A;  2YI9 A;  4JI6 B;  1KYO F;  4JTA B;  1Y76 A;  1XMO O;  1GO3 F;  1FPO A;  1KB9 F;  4XDL A;  2A79 B;  3E2E A;  1N32 B;  3PJS K;  4CZZ A;  4X65 O;  4DR2 O;  2R9A A;  3RYI A;  2FL4 A;  1TUE B;  1S3J A;  3W7S A;  4X1K B;  4CS2 A;  3LNM B;  4JAU A;  3JAW B;  1KKC A;  5CMU A;  4PV1 B;  1UJW B;  2RMK B;  1A32 A;  3CC2 V;  2UUC O;  5KHJ A;  3DTU B;  3FAV B;  1F4M A;  4LFC B;  2V4D A;  4TV9 B;  2V7Q G;  4H33 A;  5EK0 A;  3CP1 A;  2ZM6 O;  1J95 A;  2OYQ A;  1K9M W;  4UB6 Z;  5IYB O;  5B1O A;  1PNK A;  3D3I A;  3ZHS A;  4P9O A;  1VQK V;  1GTO A;  3P3P A;  2UUB B;  4P2Z A;  1XQ8 A;  3SYO A;  4KHP B;  2XAF A;  3L74 H;  3K59 A;  3ABT A;  1COW G;  3DXR A;  3FKS G;  3X2Q B;  3HKE B;  1QHT A;  5K1P A;  4LFA O;  4I9Q A;  3TJT A;  2Y0P A;  3AK3 A;  1XNR B;  3SPI A;  2DN9 A;  5LGT A;  3CCJ V;  2L35 A;  1Y74 A;  2ITC C;  5GW7 A;  2HHH B;  5CBF A;  4DR1 O;  3ZN1 A;  2YSU B;  2YIA A;  5LA6 A;  1HWY A;  4JTD B;  4DV6 B;  1PKX A;  1K5Q A;  2B1G A;  1JCH A;  1WNS A;  2A3Q A;  5EBW C;  4JI6 O;  1Q5O A;  3LDC A;  1VMG A;  1ZTE A;  4B3S O;  5LMN B;  3T1C A;  2JEU A;  3B4S A;  2WA4 A;  3H1K H;  2P4K A;  3OD4 A;  2QWP B;  1QCE A;  3ABL B;  2YXH A;  4LWS A;  2JDI G;  2H8P C;  2XND G;  4LP8 A;  2B5U A;  3I55 V;  5EBL C;  3GB7 C;  3ETD A;  2R9I A;  1NT2 B;  4QGP A;  2A06 H;  1H2M A;  1K97 A;  4ZIB A;  4I0X A;  1CXZ B;  4DRX A;  5EC1 C;  3WB1 A;  4B7E A;  3SYP A;  2XTA A;  3L75 H;  5TIS Z;  1AVM A;  4G27 B;  2HJD A;  4JF3 A;  1EN4 A;  4JTC B;  2UU9 B;  4BR6 A;  1S76 D;  4LCU C;  3E83 A;  1TVK A;  2WA3 A;  3E8H A;  3UCS C;  4E2L A;  1AJP A;  1Q6H A;  4X9Q A;  3B40 A;  2WPD G;  2QR4 A;  4MVM A;  2ZE6 A;  3D8C A;  1P7B A;  2Q0O C;  4JI0 B;  4Z2W A;  3WU2 Z;  3SJQ C;  3ABM B;  3ZBH A;  4HNA B;  5B1N A;  4H0L B;  1RPO A;  4X20 A;  1XRE A;  1MMM A;  2Y4U A;  1XNR O;  2M7W A;  3R66 A;  4TOI A;  4DUY B;  2IU0 A;  2QJ1 A;  3U10 A;  4H37 A;  5GTI Z;  4MTG A;  1KQS U;  2HHH O;  5IYD O;  5B1B B;  1XOU A;  1SA0 B;  5B5E Z;  5JH7 A;  2XAQ A;  5L3F A;  1OCZ C;  4DV6 O;  2LW1 A;  3SDL A;  1R73 A;  1BQ0 A;  4J9Y B;  1SER A;  3FX7 A;  1HP8 A;  4PI2 A;  4J7J A;  4ZOL A;  2HG5 C;  1Q7Y W;  1NH2 B;  4DV3 B;  4PI0 A;  3VBB A;  1VQO V;  4F6R A;  1D5A A;  4DRX B;  2P7T C;  3CMA V;  2DQ0 A;  2NN4 A;  2ZT9 B;  1PD3 A;  1YTF D;  2R9R B;  3OE7 G;  3APO A;  1RM1 C;  4IT5 A;  2UU9 O;  4JYA O;  1GN3 A;  1TVK B;  1H2S B;  1S72 V;  5KUK A;  4W4L A;  2Y69 C;  3OFN G;  5B66 Z;  2WLM A;  1Z2G A;  2YDE A;  1MOF A;  4JV5 O;  2F93 B;  1SZT A;  3MHH C;  4IHJ B;  1JOY A;  1NI8 A;  1IXM A;  3CPW U;  2YEV A;  1JVM A;  4PEL A;  1MNG A;  1IXB A;  5KX5 A;  2VWJ A;  4UUJ C;  4JI1 O;  3ZHV A;  4MT8 A;  1XL6 A;  3D36 A;  4DUY O;  5DN6 G;  1W0J G;  5L3G A;  1D2D A;  3FD9 A;  4CS4 A;  5D5Q A;  5JH7 B;  1VF6 C;  1AI5 A;  2H94 A;  3K5L A;  1FAF A;  3ML0 A;  4HZ3 A;  4O4H A;  3H1J H;  3ZN0 A;  3K03 A;  3JAS B;  1KD1 W;  2GHY A;  3N2G A;  1VP7 A;  3WFV A;  2QGN A;  3AG7 A;  3B09 A;  5H6Q A;  4JYB A;  2KG7 B;  5EYP A;  2KB1 A;  2PUS A;  4AI8 A;  1MSW D;  2UXD B;  1YJ9 V;  4PDR A;  2JIZ G;  1QVG U;  4OXS A;  3W7W A;  2WLH A;  3T4D A;  4X1I A;  3UT5 B;  2DQ3 A;  4O4J A;  1QU7 A;  5LMU O;  3F7V C;  3ZMZ A;  3ABU A;  3B2E E;  2Z3Y A;  3LNN A;  4LNU A;  4JI4 B;  1NJI W;  1GH6 A;  1W0K G;  4QNH B;  4BIZ A;  3RYF A;  3ZRW A;  2CTP A;  3OUS A;  3ZHU A;  2WWW A;  1OCZ B;  4E4E A;  1ZSP A;  3E8F A;  4F4L A;  1V54 C;  4NXN O;  4B7K A;  1H8H G;  1PP9 H;  5KX5 B;  5KHK A;  2AW9 A;  3AK2 A;  2IH1 C;  1WPB A;  1XNQ B;  2XOK G;  4I5S A;  4MSW C;  2EZO A;  1NR1 A;  4CS3 A;  2IM9 A;  1YIJ V;  1H2K A;  4EFB A;  4FLX A;  2ZE7 A;  1L0L H;  1G4Y B;  4JI8 O;  3SYA A;  2BSK A;  3RN4 A;  4O4I A;  1TUB A;  2RCV A;  3CCV V;  1SQF A;  3L71 H;  3E22 A;  1RM1 B;  2QWQ B;  2PTM A;  2N04 A;  3ICX A;  3P32 A;  3N2G B;  4ZI7 A;  5LOV A;  4J10 A;  2PYJ A;  1QBZ A;  1HR0 O;  4DW1 A;  4DV2 B;  1R3K C;  1JPX A;  2E3C A;  2AGA A;  2Y69 B;  1IBM B;  1AP6 A;  3CRR A;  2WLK A;  4NXM B;  5EYP B;  5LP6 A;  1YVW A;  4W4K A;  1VIB A;  3BAA A;  2V1D A;  3E35 A;  5JCO C;  2QDO A;  4MVZ A;  3IAY A;  1ARO P;  4LF8 O;  3FYE B;  1S0V A;  2P6J A;  4GKK B;  4X1I B;  5KLV H;  3HKC A;  4F6E A;  4O4J B;  4ASU G;  3AG3 C;  4MTX A;  3BA8 A;  3K58 A;  4AQY O;  2D3O W;  4FPP A;  3J81 N;  1AR4 A;  4JI4 O;  1GAX A;  4LF9 B;  1P4R A;  2OCC C;  3ZHQ A;  4Z1V A;  4YJ3 A;  2EIM B;  4TSF G;  3GWO A;  1GM7 A;  3JAK B;  2HR3 A;  4X62 B;  1E79 G;  4I7Z B;  3SYC A;  4DW0 A;  1PNL A;  3D3Q A;  3OTO O;  1L0N H;  3CSX A;  1GM8 A;  3VOU A;  3ZMV A;  5FPO A;  5CBG A;  1IX9 A;  1XNQ O;  1F7Y A;  4EB6 A;  4JYY A;  4TQF A;  1SES A;  1AJN A;  1NVP B;  4IIJ A;  4FM2 A;  2BSK B;  5H5N A;  4JGS A;  4PDL A;  5L3C A;  5J2U A;  4UCT A;  1WP8 A;  2UXN A;  3HB3 B;  3E22 B;  5C8Y B;  1VQ7 V;  2YXY A;  2QKC A;  5LOV B;  4PA7 A;  4YXW G;  2WAM A;  4DV2 O;  3TCU A;  5IDJ A;  4WFG A;  2Q0A A;  2P06 A;  5IYZ A;  3X2Q C;  3S3X A;  4ZKI A;  1Q6I A;  5LP6 B;  4X65 B;  3CCL V;  1Z5V A;  1I0H A;  1F51 A;  2JRI A;  1UPG A;  2OCH A;  3TXQ A;  4I55 A;  1V54 B;  1WLE A;  3UQ8 A;  2P5O A;  2UUC B;  1K3E A;  2JS3 A;  4HBN A;  2HVK C;  1XBL A;  4CH4 A;  4FFB A;  4JAV A;  2X6C A;  2XAJ A;  2M6Y A;  4L8J A;  3STZ C;  4LF9 O;  4FVM A;  1QVF U;  3EVK A;  5F2V O;  4LFB B;  3T1H O;  4JAS A;  2QM7 A;  3JAL A;  2PI5 A;  1GK9 A;  3OGC C;  1NS1 A;  3FB6 C;  1N36 O;  2VQF B;  3SR2 C;  1XEQ A;  2BE3 A;  3QO5 A;  1ZUQ A;  3JD1 A;  4EB6 B;  4LFA B;  1BHA A;  3I56 V;  2BTO A;  3HKB A;  3AK1 A;  3QTC A;  4DO2 A;  4DR1 B;  2AZ0 A;  3IGA C;  4BAY A;  3PN1 A;  1OZ0 A;  3B77 A;  4J9Z B;  5GON B;  3AG3 B;  4DV1 B;  2Q4P A;  1NH2 D;  4N21 A;  4B3S B;  3ABM C;  3BAB A;  2Q7G A;  4BWA A;  5IT9 N;  1AI4 A;  3N2K A;  3TXS A;  2OCC B;  5IJ0 A;  5JVD B;  4FJC C;  4N23 A;  4P30 A;  2CK3 G;  3AG1 C;  3LDD A;  2A0L A;  3FB8 C;  4WFA V;  1XI1 A;  4MVQ A;  5FLX N;  4NTX A;  2IJH A;  1PPJ H;  1GN6 A;  1XDC A;  5J2T B;  3OGI B;  3K3W A;  2Q7E A;  3RFR A;  1KEC A;  5B1B C;  5CB4 A;  5LHI A;  2AXT Z;  1WPX A;  2JGD B;  3JAR B;  4RO2 A;  4TUY B;  1HDJ A;  2IJK A;  5CA1 B;  4TV8 A;  1M93 A;  2GV9 A;  3F5T A;  2EIK B;  1VQ9 V;  2Q73 A;  2XAS A;  1M9N A;  3OM3 B;  3QVN A;  1SZX A;  4O4L A;  3JAL B;  3K5O A;  3JAM N;  4LFB O;  1UFI A;  2WSS G;  1JFF A;  2WLI B;  2Q8V A;  4QE9 A;  3BCC H;  3K04 A;  1N33 B;  2Q68 A;  2OWO A;  4JZ2 A;  4Q20 A;  2HJF C;  3F5W C;  1URF A;  4I4T B;  5J9P C;  2VQF O;  1WA8 B;  3A0B Z;  1YF2 A;  3LSS A;  2BOB C;  4FM0 A;  2QE7 G;  4RQF A;  3RYC B;  2FML A;  4LC1 A;  5IJ9 A;  4MTF A;  4ABM A;  4EEQ A;  4DV5 O;  1O9H A;  5ITZ A;  2CTW A;  4UCV A;  3RVY A;  3LSU A;  5BY1 A;  4DXW A;  1S5J A;  2W0F C;  3KCY A;  1Y76 B;  4DV1 O;  3JYC A;  2YC0 A;  5JJN B;  3BRC A;  2BCC H;  5L3E A;  3UKM A;  3DGE A;  1Q8I A;  4FIP C;  2QWO B;  4IL6 Z;  3U11 A;  3RYI B;  2IBZ H;  2Q5Z A;  4UXN A;  5EZY A;  2GTA A;  1WN7 A;  3O65 A;  4CH5 A;  1VQM V;  5CBH A;  4UVA A;  4XDK A;  4DR6 B;  5CB4 B;  2JEX A;  1S5H C;  1WJZ A;  2W6J G;  4TV8 B;  1XL4 A;  1N0J A;  4X66 B;  4Q6G A;  3OEE G;  2YIB D;  1ORQ C;  4RUF A;  1YHQ V;  4PJ0 Z;  1E1R G;  1V55 B;  5KMG A;  4JYA B;  2P67 A;  3CC4 V;  2EIN C;  4U3F H;  5LL6 Y;  3P30 A;  5H9C A;  2QA4 V;  4CC5 A;  3CS5 A;  1K73 W;  4CBC A;  4JV5 B;  1AR5 A;  1FXV A;  1AI6 A;  4GLX A;  1G6U A;  4UV9 A;  1VQ8 V;  1FD9 A;  1N33 O;  1U97 A;  2B1I A;  3DXR B;  4UVB A;  2F1M A;  4GUN A;  3OMN B;  1ROP A;  1H38 A;  4OX9 O;  4JI1 B;  2CUG A;  4KXR A;  3AG1 B;  4WBN A;  2ATK C;  1M90 W;  4YIP A;  1Y74 B;  5C93 A;  2ZDI A;  2DE0 X;  4R8C A;  5LA6 B;  5ITZ B;  2IW5 A;  3STL C;  4PDV A;  4K8X A;  3IJ4 A;  5DM6 V;  1WB8 A;  2QKA A;  3C3T A;  4Z1M G;  3OEH G;  1NTK H;  3CCU V;  1N8R W;  3JD0 A;  4C7U A;  2BTQ A;  4G28 B;  5LHH A;  3ABK B;  5LGN A;  4LWS B;  1LUV A;  1VQN V;  3CJH A;  3D36 C;  5H6R A;  4X64 O;  3WB0 A;  4I0X B;  4MW8 A;  5LYJ A;  2CGO A;  4DR6 O;  4JI3 B;  4FLT A;  1EN6 A;  2GBO A;  3W7T A;  2DYS B;  2FKX A;  1FJG B;  1M56 C;  5EIB C;  2QWR B;  1X4T A;  5BZB A;  3ZS8 C;  3GWK C;  4X66 O;  4UVC A;  5LMU B;  2Y0I A;  5KMG B;  1NTM H;  5LXT A;  1R3L C;  1SET A;  2KKW A;  5KA6 A;  3L70 H;  4GZR B;  3KKY A;  4RQE A;  1NZ6 A;  2VS0 A;  4UCR A;  4I50 A;  3JSN A;  4NXN B;  4L87 A;  3H1L H;  3WG7 C;  2LQT A;  3CWB H;  3N27 A;  1NVP D;  2HLD G;  4AIL C;  4JAA A;  4X1Y A;  3K79 A;  3ZRV A;  4X20 B;  1QLE C;  3ZIA G;  4GYC B;  1YI2 V;  2Y48 A;  1H2L A;  1L8D A;  2VWK A;  4PA6 A;  3G80 A;  4O2A A;  4ZHQ A;  1GKF A;  1VQ4 V;  1NU1 H;  3DSQ A;  1YXB A;  4JI8 B;  2X6B A;  1GN4 A;  2HEP A;  4JI5 O;  2EIM C;  2JVD A;  3FB5 C;  1YDX A;  4MVS A;  2N05 A;  2CTR A;  3BEH A;  3QO7 A;  4YIO A;  2ARH A;  4IYH A;  1HR0 B;  2W6I G;  4ZBM A;  3CJH B;  2EIN B;  4X88 A;  4ZOL B;  3CME V;  1JJ2 U;  3CCR V;  3CRQ A;  3K57 A;  3ASO C;  3Q4H A;  5KAF Z;  3FFQ A;  1CPY A;  4F6R B;  4RUE A;  3RW0 A;  3AG4 C;  4TT3 G;  4LF8 B;  2CH7 A;  2H3O A;  4JI3 O;  2ZCE A;  1FJG O;  4U7O A;  3ZCC A;  2QM8 A;  3R65 A;  4QPK A;  2X7R B;  3E86 A;  3ZHT A;  5D5P A;  2CTQ A;  1GMG A;  1K34 A;  5E79 Z;  1KMI Z;  4AQY B;  1ZLZ A;  4NR1 A;  4NTY A;  1WP7 A;  2RDC A;  2MW2 B;  2EIJ B;  3CRA A;  4FLW A;  1KUQ A;  5GTH Z;  4H13 B;  5LP6 C;  2GUZ A;  3CX5 F;  1M5I A;  2DWD C;  5B1A C;  4LF4 B;  4PHZ A;  3CD6 V;  3OTO B;  2YEV B;  3G6B A;  3H1H H;  4K8Z A;  2RQ6 A;  5B3S B;  1J5E B;  3ETE A;  3CCM V;  1YIT V;  1DF5 A;  1ZX3 A;  2CDY A;  3OW2 U;  4DR7 B;  3ASN B;  2VQE O;  1KKD A;  4MW3 A;  4O2A B;  2VRZ A;  3QF7 A;  3M99 B;  2DW4 A;  3JSL A;  1M56 B;  4B3R O;  1N34 O;  2LW7 A;  4O4H B;  4J7K A;  2ZKO A;  3SPJ A;  1LUW A;  2IU3 A;  3ZJZ A;  4U3J A;  1FFX A;  2WLL A;  1GN2 A;  1H2G A;  4WFE A;  2ZIO A;  1OCC B;  2QEX V;  3FYI B;  5KHG A;  4DR4 O;  3T1Y B;  1L1F A;  4JI7 B;  3GVM A;  2QWN B;  4GT1 A;  4IYI A;  4NVP A;  2Z0A A;  3I5D A;  3DC5 A;  1Y6X A;  5FL7 G;  3VQX A;  4OPA A;  4LBE C;  4RWU A;  3WG7 B;  1B06 A;  1N0N A;  2HKO A;  3CE2 A;  1G8M A;  3SPC A;  1MSD A;  1QLE B;  2Q6A A;  1TAE A;  5FNV A;  3W7U A;  1BT8 A;  2PZS A;  4BW9 A;  4LNU B;  1X59 A;  4MVO A;  3TET A;  3W7X A;  3RYF B;  3ZRW B;  1F4N A;  1OCR C;  2GUZ B;  4WCE V;  3CRM A;  1PNM A;  3T1H B;  4NYK A;  1ZL8 A;  2WLN A;  1K4C C;  4PA4 A;  4LF4 O;  1QLN A;  3HKD A;  1WAZ A;  2R70 A;  4GX1 A;  1N36 B;  4JYC A;  5E1A C;  1Q6U A;  1WB7 A;  5AG2 A;  1XIL A;  2IJJ A;  3ASO B;  1J5E O;  1M57 C;  1YTF B;  3L72 H;  4DR7 O;  1ENV A;  4RAI A;  1QR9 A;  5BMV A;  4GKJ O;  3AG2 C;  3AG4 B;  1LR1 A;  5JQG A;  1R6K A;  2EIK C;  2AZ2 A;  2C2A A;  4BW5 A;  3EXA A;  4DV7 O;  3CC7 V;  1Y67 A;  4O4I B;  3C90 A;  1TUB B;  1SQQ H;  1CP9 A;  2JK5 C;  4UB8 Z;  2F66 C;  4ZI7 B;  2BOC C;  2WLL B;  2OT5 A;  1B3Q A;  1GRJ A;  1VQL V;  4AHC A;  1XMQ O;  4X89 A;  2QSA A;  4MS2 A;  3ZRX A;  3L73 H;  3T1Y O;  4JI7 O;  4J41 A;  3L9D A;  2QTS A;  2UXB B;  5B1A B;  5JJJ B;  2ITD C;  3BA9 A;  1S77 D;  1K4D C;  1QR8 A;  2LGQ A;  2ZE5 A;  1FS0 G;  4J80 A;  4BIO A;  4DUZ O;  2XUM A;  3HKC B;  3KCX A;  4UCU A;  3RWR D;  3G4S V;  1P49 A;  5FNV B;  1ZAU A;  2D2C B;  1BSM A;  3K5M A;  4FLV A;  1DK1 A;  4MVU A;  1Q3E A;  1MZF A;  2ADQ B;  3SJB C;  3ZX6 A;  1NQT A;  1XUQ A;  4X1K A;  2OIE A;  2EIL B;  2P4V A;  3DC6 A;  3JAW A;  3G71 V;  1K5S A;  4YJ3 B;  4WFH A;  2EX3 A;  5KHH A;  3IFX A;  2Q9L A;  3JAT A;  1IZ3 A;  1KBH A;  1I94 B;  5L3B A;  5H2F Z;  2WLJ A;  3MDS A;  3H1I H;  1BZK A;  3FAV A;  1K33 A;  1JR9 A;  1BCC H;  4TV9 A;  2FTK A;  1O9G A;  4KL1 A;  3ZMS A;  1Q82 W;  4DV4 B;  4IIJ B;  1S5L Z;  1V55 C;  2YIC A;  4CC6 A;  2MK3 A;  5K1X A;  4DV5 B;  1PM9 A;  2K1E A;  5J2U B;  2XAH A;  2XHB A;  3JD3 A;  2ZR2 A;  1K8A W;  2EBO A;  1NBM G;  4J42 A;  5BR8 O;  4FZ1 A;  2A9H A;  2Q7H A;  4D7T A;  1H8E G;  4B3M B;  4NB5 A;  5IYZ B;  4U7N A;  1QQC A;  3C3S A;  2F4V O;  1OCR B;  1SQG A;  1HNX O;  1FXK A;  4I55 B;  3J80 N;  2IH3 C;  2UXB O;  2A7W A;  1VF7 A;  1RFY A;  3QO8 A;  3ETG A;  1M57 B;  2F95 B;  1SQV H;  5KHI A;  4FFB B;  4FLY A;  3CCQ V;  3AG2 B;  1ZWI C;  1YZB A;  2E5L O;  5EC2 C;  3ABK C;  3QG5 A;  2CE4 A;  4FK5 C;  2QM4 A;  1NR7 A;  5IWA O;  5IYC O;  3JAT B;  4BIU A;  1SKV A;  1SRY A;  2YI8 A;  1I94 O;  2ZXW B;  1OHH G;  1DGS A;  1R1B A;  2GSM B;  1PV0 A;  3OTF A;  3OMA B;  2DYS C;  3G67 A;  4FFK A;  3H9V A;  4OX9 B;  1THZ A;  3NR7 A;  3CYO A;  1EN5 A;  3EFF K;  3HKB B;  2NLJ C;  5LGU A;  4J11 A;  4DV4 O;  1VF5 B;  3H01 A;  5A2Q N;  4DV0 O;  2O57 A;  1HW7 A;  2NR5 A;  2PY5 A;  1VAR A;  2B9Z A;  2ZNJ A;  1FYJ A;  1KP3 A;  5HFM A;  3P3N A;  2PGG A;  4HNA A;  2DYR B;  1SQX H;  5LHG A;  4EKW A;  2JS5 A;  4JPR A;  3UO3 A;  4PA9 A;  1VQ5 V;  4B08 A;  5A9G A;  3N2K B;  4B3M O;  5IJ0 B;  2AHZ A;  1FXK B;  5KAI Z;  2X6A A;  1SA0 A;  5EBM C;  3OR7 C;  1CEZ A;  3OT7 A;  4X64 B;  4KFM A;  2ZDI C;  1N4C A;  1NTZ H;  1DTO A;  1FKA O;  1BMF G;  3O9O A;  4QE7 A;  4LF7 B;  4DYL A;  4FM1 A;  5KUM A;  1N32 O;  1YEW A;  2ZE8 A;  4KP4 A;  3LSQ A;  1W59 A;  3K0G A;  1AJQ A;  4K35 A;  4J7Z A;  4R50 A;  4ICG A;  4O4L B;  2KQX A;  4TQD A;  2AHY A;  1JFF B;  1YJN V;  1R6N A;  1R3I C;  3ETQ A;  3RBZ A;  1AI7 A;  3KG2 A;  1Q81 W;  2LP7 A;  5JWP A;  2JGU A;  4LFC O;  3SJA C;  4JI2 B;  1RPR A;  1EFR G;  4GX2 A;  5EIB D;  1SQB H;  1IVS A;  3T2M A;  5FPR A;  3F7Y C;  3BY6 A;  2EJR A;  5IJ9 B;  4MVR A;  1B04 A;  5LBQ A;  1TGO A;  2ZIM A;  1LNQ A;  2EIJ C;  5CA0 A;  2UUB O;  5HFL A;  4QIW F;  3K08 A;  1RSO A;  2ADP A;  4IHJ A;  4KHP O;  4JI5 B;  2OIG A;  1Z5W A;  2DWE C;  3ZMT A;  1E1Q G;  4XBF A;  4FZ0 A;  1U96 A;  5CN0 A;  1YJW V;  1G1X B;  1R6T A;  5EZY B;  2E74 B;  5B3S C;  4H44 B;  1K92 A;  2PYL A;  1IBL B;  3KZI Z;  1MG1 A;  3ASN C;  2JJ2 G;  3OAA G;  1Y4M A;  2L6L A;  3RVZ A;  2EUL A;  1H2N A;  5LMN O;  1W2B U;  3SGI A;  3JAS A;  4DK1 A;  4LF7 O;  5IE9 A;  3WB2 A;  4IGG A;  1D5N A;  1IUR A;  2E75 B;  4YHH B;  2KG7 A;  4O2B A;  1I08 A;  1KU9 A;  3QNE A;  1SQP H;  3ZED A;  1EBO A;  2X0L A;  1OCC C;  5DED A;  3TK1 A;  2YS8 A;  1M4U A;  3UT5 A;  5KA5 A;  3CRC A;  2ILM A;  1XHX A;  4JI2 O;  1YSC A;  3T4Z A;  2RNB A;  3J7A U;  3K9A A;  4WBN B;  2K9P A;  4LH7 A;  4CH6 A;  1HNW B;  3HPL C;  1Q86 W;  2VQE B;  3MHS C;  2YIB A;  5CA0 B;  4B3T B;  4HYO A;  4JI0 O;  1AP5 A;  1RSO B;  2Y4T A;  2RJZ A;  4D7S A;  4B3R B;  3A8T A;  1N34 B;  1AR1 B;  2UXC B;  2PI4 A;  3CCE V;  2HP8 A;  4WF9 V;  3B8N A;  3B8M A;  2E76 B;  2BTQ B;  3EHB B;  5IY5 C;  4TWK A;  4DR4 B;  3UM7 A;  4CH3 A;  4NKG B;  2HVJ C;  3ZRS A;  1IBL O;  5LYJ B;  3HR0 A;  4MTO A;  4D6T H;  1BL8 A;  3G6E V;  2GDS A;  4UV8 A;  2YXL A;  1EZV H;  4DR3 B;  2ZD9 A;  1I5X A;  5LXT B;  4O2B B;  4DV3 O;  4YHH O;  3APQ A;  2LJ2 A; 
#chains in the Genus database with same CATH homology
 1Y76 A;  1VF6 A;  1Y74 B;  1ZL8 B;  1RSO B;  1Y74 A;  3B40 A;  1ZL8 A;  1VF6 C;  1Y76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...