1VF6A

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
58
structure length
58
Chain Sequence
VLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQLKGQLNHILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/protein transport
molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6A00
1Y76B 1ZL8B 1VF6C 1VF6A 1Y74A 1RSOB 3B40A 1Y76A 1Y74B 1ZL8A
chains in the Genus database with same CATH superfamily
1KB9F 3K04A 3OFNG 2YICA 1VF6C 4U7NA 1BHBA 2BTQA 4X66O 2HKOA 3PJSK 1ZL8A 3JSNA 2DQ3A 3T1YO 2EILB 3T4DA 4MVOA 4X1KB 3JALB 2ZQMA 4PI0A 2XT9A 1DK1A 5EBLC 1K4CC 4J11A 1GAXA 3G6EV 4NKGB 4PI2A 2P06A 5LYJA 1ROPA 3ASNB 2BE3A 2NR5A 3QNEA 1R73A 4Q6GA 3ASNC 1XMOO 3SYCA 2JIZG 1LNQA 4J42A 5KHGA 4X65B 4F6RA 1BQ0A 4PA6A 2UXDB 1L0LH 1R6NA 1WN7A 2P6JA 5FLXN 1AJPA 2Q69A 2Q6AA 3FB5C 5KUKA 2GBOA 3ETEA 4O2AA 4R8CA 4MW3A 2BSKB 1F51A 5IYCO 2IJHA 2Z5UA 2KB1A 5B1NA 3AG3B 4TWKA 1XI1A 5JJJB 2IW5A 4WFBV 4O4IA 4MVQA 1JMKC 4DV1O 3B2EE 1JFFA 2OWOA 5JQGB 4WFGA 1XUQA 4YHHB 3L72H 4DRXB 5KHKA 5CBFA 4JAAA 1K9MW 4CC6A 5EBWC 2R9RB 2JS5A 4MVUA 1H2KA 3RW0A 1AILA 5GONB 1QLNA 3EFFK 1KQSU 1JA8A 4J9YB 1FJGO 3SPIA 5J2TB 4LBEC 4FFBB 5FPRA 3FYEB 3ZRWB 4UFZA 3RYHA 1WP7A 2PI5A 1TUEB 4JI4O 3FYIB 1OCCC 3THOA 4LF7B 1JVMA 3L9DA 4H37A 2WA3A 2XAFA 4B3TB 4DR6O 4IL6Z 4JTAB 2ZINA 4ZI7B 3R65A 5FL7G 4NYKA 2YIBA 4NB5A 1JQ0A 2DW4A 2IBZH 5CN0A 2E75B 2BCCH 3OD4A 1N33B 1U97A 1QU7A 2LFSA 4BIOA 4RO2A 1WA8A 1I5YA 1BSMA 1YITV 4JI1B 2Q68A 3UT5A 3UO2A 2UU9B 1VIBA 4TUYB 4FLXA 3QVNA 5KA5A 1Y6XA 1ZSPA 4X65O 3H1LH 3L71H 4NTYA 2UXDO 1WNSA 1OCOB 2XUMA 2E74B 1PPJH 4R50A 1OCOC 3HKBA 1BCCH 1Y66A 1PKXA 2Y69B 3N2GA 1AI4A 3LDDA 1HR0B 1SQQH 2F43G 1MG1A 3LSQA 1J95A 1QCEA 1F4MA 5E79Z 1S3JA 2QGNA 3NR7A 3IC7A 4ZIBA 2H8PC 3E22A 1JCHA 4ZHQA 4YHHO 4PJ0Z 4A5UB 1LUWA 1P49A 2XAJA 1YDXA 2ZDIA 4D6TH 1AVMA 4UCRA 2RMKB 4IT5A 1IBKB 1KP2A 4ABMA 2RN9A 3JATB 4FLUA 1SERA 1AB3A 4I55B 3HB3B 2XAGA 4JTCB 5KAFZ 1P4RA 3SYQA 3CCSV 1IX9A 1Q90D 1YJNV 5IYZB 4C7UA 2ETNA 3CP1A 1UJWB 2ODMA 3KCYA 5B1AB 3VQVA 3RT3C 5KHHA 2QEXV 1VQ6V 3ZMZA 5B1AC 4LF7O 2WLHA 1US6A 5KMGA 3QO8A 3ZMTA 4DO2A 4B3TO 3KZIZ 2JJ1G 4UCSA 4O4LB 1FFXB 2B5UA 2ZE6A 4PA7A 4QIWF 4GZRB 4DV4B 1RPOA 3OUFA 3P3PA 3CCQV 4FMTA 5H6QA 1N33O 4L87A 3QO7A 2V1DA 2WLMA 2FTKA 1N0NA 4IYHA 3W7SA 4YJ2A 2QDOA 5L3CA 4UUJC 4JASA 4JI1O 1VQNV 2F4VB 1EBOA 3CRQA 3RFRA 2UU9O 1NTMH 3BFRA 1KECA 3NXSA 3C3SA 4Z1VA 1AI6A 1K92A 4P30A 2JGDA 2WAMA 2Q8VA 3ZHVA 1Q6UA 3SPGA 4IIJB 1KBHA 1FPOA 5BMVA 1XL6A 5EYPA 2HVKC 3HPLC 3UO3A 1N36B 3P3NA 1XHZA 1HR0O 5FPOA 1SQFA 1DLBA 3E8HA 3K9SA 4DW0A 1I7FA 1L0NH 2DYRB 1VQ5V 1S5JA 2DYRC 4I7ZB 5EBMC 3B77A 4UV8A 1YEWA 1SA0B 3SJAC 4DV0O 4QNHB 3K57A 3AK3A 1RPRA 4EEQA 4FLYA 5GTHZ 5E1AC 1IBKO 1WJZA 4HNAB 3AG1B 2CE4A 3ABMB 3C3TA 1TUBB 3AG1C 4RQEA 1K5SA 2RJZA 2VS0A 4FLZA 1G1XB 2R70A 3SYAA 3CRAA 1NQTA 5C8YA 1I08A 3CD6V 2IH1C 4RQFA 3ZJZA 3JASA 2ZM6B 3OE7G 2Z0AA 5IWAB 5CB4B 1V54B 1RM1B 2Y0PA 3WG7B 4X64B 4I50B 2YIAA 3WG7C 2WPDG 4DV4O 3G67A 5LGNA 3JARA 4CZZA 4X1YA 5J2UA 1OJHA 1OV9A 3RVZA 1VF7A 2ZE7A 2KG7B 2HG5C 2EIJB 1BZKA 3VOUA 2EIJC 4G28B 2F4VO 1OCRB 1G8MA 4TV9B 4GKKB 4R7CA 1RSOA 1Z5WA 5H6RA 2Q4PA 2QWOB 1N0JA 5JVDA 2E76B 4JI6B 1IDSA 2JVDA 3CWBH 1LUVA 3L73H 5LOVB 1VF6A 1BGYH 3KKYA 2QA4V 4MVRA 5KLVH 1N36O 2IU0A 5H9CA 3ZMSA 1DGSA 1Z2GA 4PELA 1K8AW 2Y0IA 5BR8B 2DWEC 3GWKC 1R6TA 4X1IA 3K06A 2CTQA 3FB8C 2Q7EA 1HWYA 2DYSB 2Y4TA 2R72A 2DYSC 2QWNB 4PDRA 3ABTA 1WAZA 4DYLA 1EN4A 4QE7A 4EB6A 5CBHA 3D3QA 3JAWB 1OHHG 5BXZA 3D3IA 1TAEA 2YXHA 3P32A 4GT1A 1M1KW 3BAAA 4EFBA 2CUGA 5EK0A 4U7OA 1JJ2U 4LWSB 3KG2A 1SC5B 2XAQA 4HYOA 1VMGA 2PF4E 2YDEA 1M90W 4YIOA 1F4NA 2AGAA 5LP6A 1XMOB 4N23A 3L70H 2ZM6O 5IWAO 5IYBO 2Y4UA 4LH6A 4IGGA 5BY1A 1K4DC 1NZ6A 1TVKB 2UXXA 1F23A 5H5NA 3AK1A 1K34A 2ARHA 1XMQB 1Y76B 5LMNB 3ZCCA 1R3LC 2LFRA 4YJ3A 3F7VC 3I5DA 5EZYA 4ZOLA 2WWWA 1FFTB 2IJKA 3CSXA 2PZSA 1CXZB 2ZT9B 3M99B 2EIMB 5DECA 1NH2B 4K3AA 1W2BU 2EIMC 4GKKO 1GO3F 4FLWA 1HNZB 1GN4A 2NNUA 4BAYA 1IZ3A 4UVBA 4J10A 3D36A 2YEVA 3S3XA 2JRIA 3E8GA 1QQCA 1H8EG 4O4HA 5B1BC 3MHHC 3Q4HA 1H2MA 4I4TB 2BOCC 1VQ9V 3K0GA 2HFEC 1H8HG 2EIKB 1Z5VA 1S72V 2EIKC 5BR8O 3WU2Z 3OAAG 2OTLV 4B3MO 1GKFA 2P67A 1NR1A 1WB8A 1PL0A 2EZOA 4KUMA 4ICGA 5L3DA 4NTXA 4PA4A 2ITCC 2BOBC 4D7SA 5H2FZ 2FKXA 4DR6B 3CEIA 4I9WA 2N74A 4DR5B 1GK9A 2EILC 1Q86W 5LHGA 2AHYA 3SPJA 4B3SB 5GTIZ 2R9AA 3B4SA 3H1HH 4TT3G 5B66Z 1B6QA 1FD9A 1Q6HA 1EZJA 2LW1A 1G6UA 3PN1A 2QWQB 1FKAO 2V7QG 3TK1A 3RYCB 3DXRA 2Q7GA 1H2LA 1W0JG 3RYFB 2Q0OC 1MZEA 4JI5O 4W4LA 3F7YC 2WLJA 5KAIZ 1YI2V 1YHQV 1WP8A 2O57A 1VQ8V 2PTMA 1XMQO 5LMNO 3E8FA 3AG3C 1FAFA 2XHBA 3I56V 3HKCA 2DOSA 2QM8A 5IJ9A 2GTSA 2P5OA 3CHXA 1PV0A 3IC9A 1HNZO 1EM1A 1R3KC 5HFMA 5KHJA 3ZBHA 2WLLA 1NH2D 3H1IH 2WLNA 2W0XA 4OXSA 3K08A 2CH7A 1O9GA 3N2KB 4Z2WA 3OR6C 1KKCA 5EIBC 5IYDO 2IU3A 3STZC 1S76D 2UXNA 1VQ7V 3O9OA 5F2VO 4K35A 2Q5ZA 4LF4B 3CS5A 2PYJA 1K3EA 2F23A 2W6JG 4UXNA 1ENVA 4X9QA 4WBNA 3HKDA 5JCOA 3K0DA 1H38A 2LP7A 3OM3B 1JX9A 4UCVA 5JH7B 2ZE5A 1SQPH 1VQPV 2AZ0A 5K1PA 5CBGA 2KKWA 1FXKB 1SQXH 1M5IA 4DR5O 3CJHB 1WPBA 3BRCA 5LHHA 4B3SO 5KHIA 4KP4A 3J7AU 1SZXA 1UPGA 3SYPA 3APOA 2F1MA 3G4SV 3BPZA 1QR9A 5FNVA 2F93B 5DEDA 3WB2A 1SESA 2P4KA 3T1CA 2OTJV 3OMAB 1KP3A 2XASA 4CS4A 5LA6A 4LNUA 1V9PA 4LR3A 3JD0A 1GH6A 4HAMA 1DF5A 3F5WC 3CC7V 2WLIA 3LNNA 2Y69C 4IHJA 3RYIB 2BTQB 4PDMA 4G27B 5LXTA 1ZL8B 2QKSA 5LL6Y 3WB1A 2JDIG 3FB6C 4YIPA 4CS2A 3HR0A 3W7UA 4U3JA 2OT5A 4N21A 4DV0B 4DK1A 3ETQA 5LYJB 3LSUA 2OYQA 3OEHG 1NTKH 3CC4V 4KXRA 3CRCA 2X6BA 2HHHB 2AW9A 4F6RB 3ABKB 1AJQA 1QNMA 2WLKA 4DK0A 1VP7A 5EIBD 4O2AB 2LJ2A 1K33A 1PD3A 3T2MA 3L75H 3OTOO 4LF4O 2K1EA 1U96A 2P4VA 1DF4A 1K73W 1YXBA 2G38A 4O2BA 2L35A 3KCXA 2N04A 4O4IB 3UM7A 1EFRG 2Q7HA 3JD1A 3FAVA 1JFFB 1YSCA 4CBCA 3BABA 2VQFB 2HJFC 2MW2B 2CK3G 1GM8A 4IYIA 4PV1B 3D8CA 1Q8IA 3RWRD 4WCEV 5IJ0A 1YF2A 2QJ1A 3IGAC 5ITZB 1PNLA 3LDCA 1RP3B 3CRRA 1IVSA 1OCZB 2QM4A 2PY5A 3E35A 4J41A 1OCZC 4JF3A 3ZN1A 4X88A 1XL4A 3BEHA 3DC5A 2NN4A 3SGIA 4O4JA 2VWJA 3CCUV 4H33A 2UXBB 5KX5A 2DE0X 1THZA 3RYHB 1I94B 2XTAA 1Q6IA 1D5NA 3ZMVA 4D7TA 2EINB 1SQBH 3ZHQA 3WFVA 3TETA 1Y74A 3OMNB 5IY5B 3UCSC 4UB6Z 2OIEA 5IY5C 1XOUA 1JPXA 1PP9H 3BA8A 4RAIA 4UCUA 4TQDA 2A06H 5L3EA 4GLXA 1MMMA 5CA0A 3IJ4A 4J80A 1ORQC 2ITDC 3SPHA 4JI2B 1WA8B 1YIJV 2GUZA 4FJCC 4MVSA 5JJNB 3U11A 3AG2B 3AG2C 3OUSA 1UFIA 1SQGA 2B1GA 1J5EB 3CCLV 2FYUH 4P9PA 1YZBA 1NKDA 1VEWA 3WB0A 2HHHO 1PNKA 4MW8A 3ABMC 3MAQA 3CX5F 3OR7C 5KA6A 4JI0B 4LC1A 1KUQA 3HKBB 4GUNA 5CA1A 3I55V 1NT2B 3N2GB 4R6ZA 3A0BZ 4CH3A 3SJQC 4XDJA 3SPCA 2HP8A 2X7RB 1ZAUA 1AR5A 1L8DA 1BQZA 2RQ6A 3MHSC 1V54C 5L3FA 1RM1C 1SETA 5IE9A 3E22B 4HBNA 2VQFO 3ZN0A 4ZHQB 1MOFA 2A7WA 1AJNA 1CP9A 4BIZA 1VQKV 1AR4A 3JAKA 3HKEA 3LUTB 3CB2A 1B06A 1YTFB 2YS8A 4NXNO 4JI7O 2CTWA 2XAHA 5DN6G 4TV8A 4J7ZA 3CXHF 4MVMA 4X20A 3QTCA 3OT7A 4GX1A 1GN6A 1OCRC 4UV9A 2CDYA 3ZRVA 3E86A 4FIPC 1XNQB 2UXBO 3DSQA 1QBZA 5HFLA 4LP8A 2RCVA 4QPKA 1I94O 3U0ZA 3K5LA 1KU9A 1AP5A 5B5EZ 2UUBO 4NVPA 4JZ2A 5EC2C 3B8MA 5B1OA 5KMGB 1HNXB 3JD3A 2AHZA 4MTXA 2Z3YA 3DTUB 4EKWA 4X1KA 3JALA 1CEZA 1AR1B 1Y4MA 4B3MB 1GRJA 4LH7A 1MSWD 2ADQB 2LGQA 4OGQB 3ZS8C 2VRZA 3RVYA 4JI2O 2QTSA 2YIBD 1CPYA 1VQLV 4J9ZB 4YJ2B 5KUMA 5LGTA 1N8RW 2D2CB 1EZVH 1J5EO 1A32A 4U3FH 1GM9A 1XREA 4DV5B 4JAVA 2Y48A 4DV6B 1NJIW 1YJWV 1XBLA 4GX5A 3BY6A 2JGDB 2ADPA 4JI0O 3CMAV 2BSKA 1KMIZ 5BMVB 5EYPB 2OCHA 1AROP 1JR9A 1GN2A 4UCTA 4DR3O 4ZKIA 5JQGA 1N34B 3JSLA 3K58A 4KL1A 2X6CA 3B40A 4JI5B 4GCZA 1XNRB 4DRXA 1JOYA 2P22C 3RN4A 1ZUQA 2RNBA 2KQXA 1M57B 4BW9A 3GVMA 5J9PC 1M57C 3RBZA 2MK3A 1Q81W 1WB7A 5GONA 4MTFA 1AI7A 4AQYB 4WF9V 4FLTA 4I0XB 4L8JA 3SDLA 2EULA 4UB8Z 5J2TA 2PYLA 1YTFD 5AG2A 1NBMG 2OCCB 1H2SB 3K03A 4FFBA 3FD9A 4FZ1A 4QGPA 3ZRWA 3MDSA 1XNQO 3K59A 2IJIA 3AEIA 4PDLA 5TISZ 3X2QB 3SJCC 5A2QN 3X2QC 5C8YB 2ZR2A 3JASB 3J81N 4LFCB 4WFAV 1D2DA 1HNXO 2UUCB 4ZI7A 4E2LA 3QF7A 2EJRA 3ZHRA 3CJHA 3UQ8A 3GWOA 3JARB 1KKDA 4BWAA 4X1YB 5J2UB 4P2ZA 1MSDA 3A2FA 3AG4B 5L3BA 2JEXA 3R66A 4CH4A 1NS1A 1ZWIC 3JCUZ 3U10A 2ZXWB 4TUYA 2IJJA 3W7TA 2ZXWC 3JCZA 1Q5OA 4FZ0A 4X62O 1RSOB 1VARA 4DV5O 1SF9A 2YIDA 4DV6O 1XDCA 4DR1B 1IXBA 2LGWA 2YUAA 5JVDB 3M8AA 4UVAA 1I5XA 5JJEB 3LNMB 3O65A 1L1FA 3W7XA 1YCIA 1E79G 4NTWA 4CC5A 4LF5B 4FM2A 3RYIA 5LMUB 2BTOA 3ABLB 1K97A 3ASOB 3ABLC 3TJTA 3ASOC 1H2GA 3FKSG 4GYCB 2GTAA 4DR4B 1N34O 1R3JC 4DV7B 4X1IB 4F4LA 1MZFA 4MT8A 1XNRO 2ZNJA 2DJVA 3JAMN 4KFMA 4I5SA 4KHPO 4JYCA 4PDVA 4MSWC 2YI8A 3JATA 4EB6B 1Q43A 2FMLA 5B3SB 1X59A 3G6BA 3E83A 4I55A 4LFBO 1RFYA 5B3SC 4AQYO 4W4KA 1ZLZA 3DC6A 5IYZA 1H2NA 2ATKC 1BL8A 1XHXA 1WPXA 2HJDA 2QSAA 4TQFA 3ZHTA 4BR6A 2EJ7A 3M7MX 2IM9A 4XBFA 5LP6B 4ASUG 5LP6C 1HDJA 4LFCO 1R3IC 2UUCO 4O4LA 4OPHA 1FFXA 2DWDC 2ZKOA 2PGGA 3FX7A 3CPWU 2FL4A 2B9ZA 1X4TA 4H0LB 5ITZA 3TGUH 4XDKA 3UKMA 3OTOB 2ZR3A 2XNDG 5LBQA 4LF9B 4YJ3B 1VQMV 1S5HC 2GV9A 2A9HA 1S77D 5EZYB 3CXCU 1B04A 3EHBB 4ZOLB 1FYJA 4QPJA 2E5LB 4DV3B 1QVFU 1GMGA 3QG5A 4LCUC 4PA3A 4FK5C 1OCCB 1FXKC 3CCEV 4DR1O 1IBMB 4JV5B 1N4CA 4IIJA 2YEVB 1R1BA 4Q20A 4FM1A 3D36C 3C90A 4O4HB 2P90A 2H3OA 2RDCA 2C2AA 4LF5O 3Q4HB 5LMUO 1PNMA 1GN3A 4FM0A 4AILC 3FFQA 4JI8B 5K1XA 1LR1A 4MTOA 2QWPB 2IH3C 2VQEB 1KC8W 4DR4O 4DV7O 4F6EA 1F7YA 1SA0A 5DM6V 3CMEV 4JI3B 4OPAA 3T1HB 3JD2A 4PD4F 2EX3A 4JYAB 1VF5B 2NLJC 1QVGU 1TA8A 2QTOA 1MABG 4HNAA 3P30A 4X8AA 5IT9N 1TUBA 2ZD9A 2QM7A 3B8NA 1P7BA 1IXMA 1B3QA 1W59A 4PA9A 3ZX6A 3TCUA 2E3CA 3G71V 4QJFB 1URFA 5CB4A 2JGUA 3K3WA 3DXRB 1HNWB 4J7JA 4I50A 1YVWA 3W7WA 3CC2V 2QE7G 4CS3A 1EN6A 3ABKC 4WFFA 1GM7A 3BVOA 2CGOA 1SKVA 4WFHA 4J7KA 3ZIAG 2GSMB 2KG7A 4B7KA 3BCCH 4LF9O 2R9IA 3SR2C 1NR7A 2L6LA 4LF6B 3CRMA 3HKCB 3A8TA 1N32B 2UXCB 1FS0G 4Z1MG 1IBLB 4TV9A 5IJ9B 2LO1A 2E5LO 4DV3O 2HEPA 1FXHA 3OGCC 2UUAB 1VQOV 1IURA 4LF8B 1IBMO 2WLLB 4JV5O 1SZTA 5LOVA 4MTGA 1M56B 2HLDG 1ZX3A 3CCJV 3OGIB 3RGBA 4NXNB 2CH7B 1M56C 4JI7B 1S5LZ 1AP6A 3K5OA 1COWG 4GX0A 1BE3H 4H44B 3E2EA 3ETDA 3E8BA 4JI8O 2OIGA 2CAZC 3H1KH 2HVJC 4NXMB 1SRYA 2VQEO 2YXLA 1O9HA 3CE2A 2HR3A 2PUSA 3ZRXA 2V4DA 2LQTA 4WFEA 4WBNB 3JD4A 4NR1A 2UUBB 4JI3O 3T1HO 1Q82W 3HKDB 1SQVH 2EINC 3MD0A 4JYAO 3ZRSA 3ZEDA 5JCOC 1V55B 3QO5A 3FB7C 4JAUA 1V55C 3JAWA 4H13B 1BHAA 4MVZA 4OX9B 2GDSA 3SYOA 3H9VA 3ZHSA 1Q7YW 4LWSA 4DV2B 2XOKG 3N27A 1SS3A 3VQWA 1DTOA 3H1JH 2DMXA 4DW1A 4LFAB 1OZ0A 3UT5B 2A0LA 4RUEA 4DR7B 5FNVB 3VBBA 3B09A 2YXYA 1HNWO 3AK2A 1M93A 3JYCA 1TVKA 3J80N 3AG7A 5LA6B 2Q0AA 4LNUB 4FVMA 2A79B 1Y76A 4YY3B 4ZBMA 2YI9A 3OTFA 4CH5A 2WLIB 4IHJB 3EXAA 5LGUA 5LXTB 4DR3B 4LF6O 1EN5A 4I0XA 2Q73A 2M6YA 3K5MA 4GKJB 1N32O 2UXCO 1NVPB 1XILA 1IBLO 2ZIOA 1JJOA 4DR2B 4DUZB 2UUAO 4U3JB 2CTRA 4LF8O 1M4UA 2LW7A 3A0HZ 4B3RB 1PM9A 1MNGA 2QWRB 2ZDIC 5JWPA 5CMUA 1W0KG 2W0FC 2ZIMA 4I4TA 3A0RA 4CH6A 2W6IG 4TSFG 1Q3EA 4RUFA 2ZE8A 3VQYA 4NXMO 5IDJA 4X89A 5L3GA 1AI5A 4G2KA 3K5NA 1TGOA 3OW2U 4O2BB 4DUYB 4JGSA 3FAVB 3CYOA 4K0KB 4AI8A 5C93A 4OX9O 4B7EA 3G80A 2B1IA 4HZ3A 4RWUA 4BIUA 4JYBA 4JZGA 5IJ0B 2ZCEA 4DV2O 1WLEA 2F66C 3LDEA 4FPPA 3EVKA 1HP8A 4I9QA 3TXQA 1MA1A 3GB7C 1E1RG 5LHIA 3OMIB 4LFAO 5GW7A 3RYCA 1P7GA 2QR4A 4DR7O 4UVCA 1R6KA 4O4JB 4X62B 5KX5B 2ILMA 3ETGA 2FB5A 3RYFA 2QKCA 3STLC 3S3WA 2QKAA 2AZ2A 4FLVA 1QHTA 1VQ4V 1Y74B 1QR8A 4YY3O 3LSSA 1K5QA 4YXWG 1BMFG 4X66B 4GX2A 3T1YB 1NI8A 2A3QA 2CTPA 3BA9A 2F95B 3T4ZA 1G4YB 1BS3A 1P84F 3ML0A 4GKJO 5CA0B 4B08A 2JK5C 2PI4A 4XDLA 1XEQA 2AXTZ 4DXWA 2GUZB 2M7WA 4DR2O 3IFXA 4DUZO 2JS3A 3ABUA 3L74H 4QE9A 1NVPD 4KHPB 1PL4A 4JTDB 4UCOA 4JYYA 4B3RO 4MS2A 1HW7A 3N2KA 1Y67A 3OEEG 3ZHUA 4LFBB 2N05A 3ICXA 1XQ8A 3E89A 4X64O 3K79A 2VWKA 3K9AA 1K7DA 2CGNA 5D5PA 4BW5A 2Q67A 2OCCC 1YJ9V 5CA1B 4E4EA 1KD1W 1KYOF 1BT8A 2Q9LA 1FXVA 3IAYA 1I0HA 1QLEB 5CA3A 1QLEC 5JH7A 2JEUA 4DV1B 3F5TA 2X0LA 2DN9A 2JJ2G 4JPRA 5EC1C 4DUYO 2ZNIA 3CCVV 2EBOA 1NU1H 2KSDA 4K0KO 2YSUB 4FFKA 1FXKA 4P9OA 2GHYA 3H01A 4PHZA 5D5QA 3TXSA 3APQA 1S0VA 4JI6O 1D5AA 5A9GA 2EZPA 5BZBA 2WSSG 3CCRV 2YC0A 5B1BB 3JAKB 3VQXA 3HKEB 2DQ0A 1NTZH 2H94A 3AG4C 4TV8B 4EFEA 3CCMV 1FJGB 2X6AA 4X20B 1E1QG 4AHCA 3ZMUA 1T5EA 1ZTEA 3DGEA 4K8XA 2D3OW 4K8ZA 3BHPA 1GTOA 2WA4A 1M9NA 4JI4B 2P7TC 4TOIA 3SJBC 2K9PA
chains in the Genus database with same CATH topology
1Y76B 1ZL8B 1VF6C 1VF6A 1Y74A 1RSOB 3B40A 1Y76A 1Y74B 1ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 B;  1ZL8 B;  1VF6 C;  1VF6 A;  1Y74 A;  1RSO B;  3B40 A;  1Y76 A;  1Y74 B;  1ZL8 A; 
#chains in the Genus database with same CATH topology
 1KB9 F;  3K04 A;  3OFN G;  2YIC A;  1VF6 C;  4U7N A;  1BHB A;  2BTQ A;  4X66 O;  2HKO A;  3PJS K;  1ZL8 A;  3JSN A;  2DQ3 A;  3T1Y O;  2EIL B;  3T4D A;  4MVO A;  4X1K B;  3JAL B;  2ZQM A;  4PI0 A;  2XT9 A;  1DK1 A;  5EBL C;  1K4C C;  4J11 A;  1GAX A;  3G6E V;  4NKG B;  4PI2 A;  2P06 A;  5LYJ A;  1ROP A;  3ASN B;  2BE3 A;  2NR5 A;  3QNE A;  1R73 A;  4Q6G A;  3ASN C;  1XMO O;  3SYC A;  2JIZ G;  1LNQ A;  4J42 A;  5KHG A;  4X65 B;  4F6R A;  1BQ0 A;  4PA6 A;  2UXD B;  1L0L H;  1R6N A;  1WN7 A;  2P6J A;  5FLX N;  1AJP A;  2Q69 A;  2Q6A A;  3FB5 C;  5KUK A;  2GBO A;  3ETE A;  4O2A A;  4R8C A;  4MW3 A;  2BSK B;  1F51 A;  5IYC O;  2IJH A;  2Z5U A;  2KB1 A;  5B1N A;  3AG3 B;  4TWK A;  1XI1 A;  5JJJ B;  2IW5 A;  4WFB V;  4O4I A;  4MVQ A;  1JMK C;  4DV1 O;  3B2E E;  1JFF A;  2OWO A;  5JQG B;  4WFG A;  1XUQ A;  4YHH B;  3L72 H;  4DRX B;  5KHK A;  5CBF A;  4JAA A;  1K9M W;  4CC6 A;  5EBW C;  2R9R B;  2JS5 A;  4MVU A;  1H2K A;  3RW0 A;  1AIL A;  5GON B;  1QLN A;  3EFF K;  1KQS U;  1JA8 A;  4J9Y B;  1FJG O;  3SPI A;  5J2T B;  4LBE C;  4FFB B;  5FPR A;  3FYE B;  3ZRW B;  4UFZ A;  3RYH A;  1WP7 A;  2PI5 A;  1TUE B;  4JI4 O;  3FYI B;  1OCC C;  3THO A;  4LF7 B;  1JVM A;  3L9D A;  4H37 A;  2WA3 A;  2XAF A;  4B3T B;  4DR6 O;  4IL6 Z;  4JTA B;  2ZIN A;  4ZI7 B;  3R65 A;  5FL7 G;  4NYK A;  2YIB A;  4NB5 A;  1JQ0 A;  2DW4 A;  2IBZ H;  5CN0 A;  2E75 B;  2BCC H;  3OD4 A;  1N33 B;  1U97 A;  1QU7 A;  2LFS A;  4BIO A;  4RO2 A;  1WA8 A;  1I5Y A;  1BSM A;  1YIT V;  4JI1 B;  2Q68 A;  3UT5 A;  3UO2 A;  2UU9 B;  1VIB A;  4TUY B;  4FLX A;  3QVN A;  5KA5 A;  1Y6X A;  1ZSP A;  4X65 O;  3H1L H;  3L71 H;  4NTY A;  2UXD O;  1WNS A;  1OCO B;  2XUM A;  2E74 B;  1PPJ H;  4R50 A;  1OCO C;  3HKB A;  1BCC H;  1Y66 A;  1PKX A;  2Y69 B;  3N2G A;  1AI4 A;  3LDD A;  1HR0 B;  1SQQ H;  2F43 G;  1MG1 A;  3LSQ A;  1J95 A;  1QCE A;  1F4M A;  5E79 Z;  1S3J A;  2QGN A;  3NR7 A;  3IC7 A;  4ZIB A;  2H8P C;  3E22 A;  1JCH A;  4ZHQ A;  4YHH O;  4PJ0 Z;  4A5U B;  1LUW A;  1P49 A;  2XAJ A;  1YDX A;  2ZDI A;  4D6T H;  1AVM A;  4UCR A;  2RMK B;  4IT5 A;  1IBK B;  1KP2 A;  4ABM A;  2RN9 A;  3JAT B;  4FLU A;  1SER A;  1AB3 A;  4I55 B;  3HB3 B;  2XAG A;  4JTC B;  5KAF Z;  1P4R A;  3SYQ A;  3CCS V;  1IX9 A;  1Q90 D;  1YJN V;  5IYZ B;  4C7U A;  2ETN A;  3CP1 A;  1UJW B;  2ODM A;  3KCY A;  5B1A B;  3VQV A;  3RT3 C;  5KHH A;  2QEX V;  1VQ6 V;  3ZMZ A;  5B1A C;  4LF7 O;  2WLH A;  1US6 A;  5KMG A;  3QO8 A;  3ZMT A;  4DO2 A;  4B3T O;  3KZI Z;  2JJ1 G;  4UCS A;  4O4L B;  1FFX B;  2B5U A;  2ZE6 A;  4PA7 A;  4QIW F;  4GZR B;  4DV4 B;  1RPO A;  3OUF A;  3P3P A;  3CCQ V;  4FMT A;  5H6Q A;  1N33 O;  4L87 A;  3QO7 A;  2V1D A;  2WLM A;  2FTK A;  1N0N A;  4IYH A;  3W7S A;  4YJ2 A;  2QDO A;  5L3C A;  4UUJ C;  4JAS A;  4JI1 O;  1VQN V;  2F4V B;  1EBO A;  3CRQ A;  3RFR A;  2UU9 O;  1NTM H;  3BFR A;  1KEC A;  3NXS A;  3C3S A;  4Z1V A;  1AI6 A;  1K92 A;  4P30 A;  2JGD A;  2WAM A;  2Q8V A;  3ZHV A;  1Q6U A;  3SPG A;  4IIJ B;  1KBH A;  1FPO A;  5BMV A;  1XL6 A;  5EYP A;  2HVK C;  3HPL C;  3UO3 A;  1N36 B;  3P3N A;  1XHZ A;  1HR0 O;  5FPO A;  1SQF A;  1DLB A;  3E8H A;  3K9S A;  4DW0 A;  1I7F A;  1L0N H;  2DYR B;  1VQ5 V;  1S5J A;  2DYR C;  4I7Z B;  5EBM C;  3B77 A;  4UV8 A;  1YEW A;  1SA0 B;  3SJA C;  4DV0 O;  4QNH B;  3K57 A;  3AK3 A;  1RPR A;  4EEQ A;  4FLY A;  5GTH Z;  5E1A C;  1IBK O;  1WJZ A;  4HNA B;  3AG1 B;  2CE4 A;  3ABM B;  3C3T A;  1TUB B;  3AG1 C;  4RQE A;  1K5S A;  2RJZ A;  2VS0 A;  4FLZ A;  1G1X B;  2R70 A;  3SYA A;  3CRA A;  1NQT A;  5C8Y A;  1I08 A;  3CD6 V;  2IH1 C;  4RQF A;  3ZJZ A;  3JAS A;  2ZM6 B;  3OE7 G;  2Z0A A;  5IWA B;  5CB4 B;  1V54 B;  1RM1 B;  2Y0P A;  3WG7 B;  4X64 B;  4I50 B;  2YIA A;  3WG7 C;  2WPD G;  4DV4 O;  3G67 A;  5LGN A;  3JAR A;  4CZZ A;  4X1Y A;  5J2U A;  1OJH A;  1OV9 A;  3RVZ A;  1VF7 A;  2ZE7 A;  2KG7 B;  2HG5 C;  2EIJ B;  1BZK A;  3VOU A;  2EIJ C;  4G28 B;  2F4V O;  1OCR B;  1G8M A;  4TV9 B;  4GKK B;  4R7C A;  1RSO A;  1Z5W A;  5H6R A;  2Q4P A;  2QWO B;  1N0J A;  5JVD A;  2E76 B;  4JI6 B;  1IDS A;  2JVD A;  3CWB H;  1LUV A;  3L73 H;  5LOV B;  1VF6 A;  1BGY H;  3KKY A;  2QA4 V;  4MVR A;  5KLV H;  1N36 O;  2IU0 A;  5H9C A;  3ZMS A;  1DGS A;  1Z2G A;  4PEL A;  1K8A W;  2Y0I A;  5BR8 B;  2DWE C;  3GWK C;  1R6T A;  4X1I A;  3K06 A;  2CTQ A;  3FB8 C;  2Q7E A;  1HWY A;  2DYS B;  2Y4T A;  2R72 A;  2DYS C;  2QWN B;  4PDR A;  3ABT A;  1WAZ A;  4DYL A;  1EN4 A;  4QE7 A;  4EB6 A;  5CBH A;  3D3Q A;  3JAW B;  1OHH G;  5BXZ A;  3D3I A;  1TAE A;  2YXH A;  3P32 A;  4GT1 A;  1M1K W;  3BAA A;  4EFB A;  2CUG A;  5EK0 A;  4U7O A;  1JJ2 U;  4LWS B;  3KG2 A;  1SC5 B;  2XAQ A;  4HYO A;  1VMG A;  2PF4 E;  2YDE A;  1M90 W;  4YIO A;  1F4N A;  2AGA A;  5LP6 A;  1XMO B;  4N23 A;  3L70 H;  2ZM6 O;  5IWA O;  5IYB O;  2Y4U A;  4LH6 A;  4IGG A;  5BY1 A;  1K4D C;  1NZ6 A;  1TVK B;  2UXX A;  1F23 A;  5H5N A;  3AK1 A;  1K34 A;  2ARH A;  1XMQ B;  1Y76 B;  5LMN B;  3ZCC A;  1R3L C;  2LFR A;  4YJ3 A;  3F7V C;  3I5D A;  5EZY A;  4ZOL A;  2WWW A;  1FFT B;  2IJK A;  3CSX A;  2PZS A;  1CXZ B;  2ZT9 B;  3M99 B;  2EIM B;  5DEC A;  1NH2 B;  4K3A A;  1W2B U;  2EIM C;  4GKK O;  1GO3 F;  4FLW A;  1HNZ B;  1GN4 A;  2NNU A;  4BAY A;  1IZ3 A;  4UVB A;  4J10 A;  3D36 A;  2YEV A;  3S3X A;  2JRI A;  3E8G A;  1QQC A;  1H8E G;  4O4H A;  5B1B C;  3MHH C;  3Q4H A;  1H2M A;  4I4T B;  2BOC C;  1VQ9 V;  3K0G A;  2HFE C;  1H8H G;  2EIK B;  1Z5V A;  1S72 V;  2EIK C;  5BR8 O;  3WU2 Z;  3OAA G;  2OTL V;  4B3M O;  1GKF A;  2P67 A;  1NR1 A;  1WB8 A;  1PL0 A;  2EZO A;  4KUM A;  4ICG A;  5L3D A;  4NTX A;  4PA4 A;  2ITC C;  2BOB C;  4D7S A;  5H2F Z;  2FKX A;  4DR6 B;  3CEI A;  4I9W A;  2N74 A;  4DR5 B;  1GK9 A;  2EIL C;  1Q86 W;  5LHG A;  2AHY A;  3SPJ A;  4B3S B;  5GTI Z;  2R9A A;  3B4S A;  3H1H H;  4TT3 G;  5B66 Z;  1B6Q A;  1FD9 A;  1Q6H A;  1EZJ A;  2LW1 A;  1G6U A;  3PN1 A;  2QWQ B;  1FKA O;  2V7Q G;  3TK1 A;  3RYC B;  3DXR A;  2Q7G A;  1H2L A;  1W0J G;  3RYF B;  2Q0O C;  1MZE A;  4JI5 O;  4W4L A;  3F7Y C;  2WLJ A;  5KAI Z;  1YI2 V;  1YHQ V;  1WP8 A;  2O57 A;  1VQ8 V;  2PTM A;  1XMQ O;  5LMN O;  3E8F A;  3AG3 C;  1FAF A;  2XHB A;  3I56 V;  3HKC A;  2DOS A;  2QM8 A;  5IJ9 A;  2GTS A;  2P5O A;  3CHX A;  1PV0 A;  3IC9 A;  1HNZ O;  1EM1 A;  1R3K C;  5HFM A;  5KHJ A;  3ZBH A;  2WLL A;  1NH2 D;  3H1I H;  2WLN A;  2W0X A;  4OXS A;  3K08 A;  2CH7 A;  1O9G A;  3N2K B;  4Z2W A;  3OR6 C;  1KKC A;  5EIB C;  5IYD O;  2IU3 A;  3STZ C;  1S76 D;  2UXN A;  1VQ7 V;  3O9O A;  5F2V O;  4K35 A;  2Q5Z A;  4LF4 B;  3CS5 A;  2PYJ A;  1K3E A;  2F23 A;  2W6J G;  4UXN A;  1ENV A;  4X9Q A;  4WBN A;  3HKD A;  5JCO A;  3K0D A;  1H38 A;  2LP7 A;  3OM3 B;  1JX9 A;  4UCV A;  5JH7 B;  2ZE5 A;  1SQP H;  1VQP V;  2AZ0 A;  5K1P A;  5CBG A;  2KKW A;  1FXK B;  1SQX H;  1M5I A;  4DR5 O;  3CJH B;  1WPB A;  3BRC A;  5LHH A;  4B3S O;  5KHI A;  4KP4 A;  3J7A U;  1SZX A;  1UPG A;  3SYP A;  3APO A;  2F1M A;  3G4S V;  3BPZ A;  1QR9 A;  5FNV A;  2F93 B;  5DED A;  3WB2 A;  1SES A;  2P4K A;  3T1C A;  2OTJ V;  3OMA B;  1KP3 A;  2XAS A;  4CS4 A;  5LA6 A;  4LNU A;  1V9P A;  4LR3 A;  3JD0 A;  1GH6 A;  4HAM A;  1DF5 A;  3F5W C;  3CC7 V;  2WLI A;  3LNN A;  2Y69 C;  4IHJ A;  3RYI B;  2BTQ B;  4PDM A;  4G27 B;  5LXT A;  1ZL8 B;  2QKS A;  5LL6 Y;  3WB1 A;  2JDI G;  3FB6 C;  4YIP A;  4CS2 A;  3HR0 A;  3W7U A;  4U3J A;  2OT5 A;  4N21 A;  4DV0 B;  4DK1 A;  3ETQ A;  5LYJ B;  3LSU A;  2OYQ A;  3OEH G;  1NTK H;  3CC4 V;  4KXR A;  3CRC A;  2X6B A;  2HHH B;  2AW9 A;  4F6R B;  3ABK B;  1AJQ A;  1QNM A;  2WLK A;  4DK0 A;  1VP7 A;  5EIB D;  4O2A B;  2LJ2 A;  1K33 A;  1PD3 A;  3T2M A;  3L75 H;  3OTO O;  4LF4 O;  2K1E A;  1U96 A;  2P4V A;  1DF4 A;  1K73 W;  1YXB A;  2G38 A;  4O2B A;  2L35 A;  3KCX A;  2N04 A;  4O4I B;  3UM7 A;  1EFR G;  2Q7H A;  3JD1 A;  3FAV A;  1JFF B;  1YSC A;  4CBC A;  3BAB A;  2VQF B;  2HJF C;  2MW2 B;  2CK3 G;  1GM8 A;  4IYI A;  4PV1 B;  3D8C A;  1Q8I A;  3RWR D;  4WCE V;  5IJ0 A;  1YF2 A;  2QJ1 A;  3IGA C;  5ITZ B;  1PNL A;  3LDC A;  1RP3 B;  3CRR A;  1IVS A;  1OCZ B;  2QM4 A;  2PY5 A;  3E35 A;  4J41 A;  1OCZ C;  4JF3 A;  3ZN1 A;  4X88 A;  1XL4 A;  3BEH A;  3DC5 A;  2NN4 A;  3SGI A;  4O4J A;  2VWJ A;  3CCU V;  4H33 A;  2UXB B;  5KX5 A;  2DE0 X;  1THZ A;  3RYH B;  1I94 B;  2XTA A;  1Q6I A;  1D5N A;  3ZMV A;  4D7T A;  2EIN B;  1SQB H;  3ZHQ A;  3WFV A;  3TET A;  1Y74 A;  3OMN B;  5IY5 B;  3UCS C;  4UB6 Z;  2OIE A;  5IY5 C;  1XOU A;  1JPX A;  1PP9 H;  3BA8 A;  4RAI A;  4UCU A;  4TQD A;  2A06 H;  5L3E A;  4GLX A;  1MMM A;  5CA0 A;  3IJ4 A;  4J80 A;  1ORQ C;  2ITD C;  3SPH A;  4JI2 B;  1WA8 B;  1YIJ V;  2GUZ A;  4FJC C;  4MVS A;  5JJN B;  3U11 A;  3AG2 B;  3AG2 C;  3OUS A;  1UFI A;  1SQG A;  2B1G A;  1J5E B;  3CCL V;  2FYU H;  4P9P A;  1YZB A;  1NKD A;  1VEW A;  3WB0 A;  2HHH O;  1PNK A;  4MW8 A;  3ABM C;  3MAQ A;  3CX5 F;  3OR7 C;  5KA6 A;  4JI0 B;  4LC1 A;  1KUQ A;  3HKB B;  4GUN A;  5CA1 A;  3I55 V;  1NT2 B;  3N2G B;  4R6Z A;  3A0B Z;  4CH3 A;  3SJQ C;  4XDJ A;  3SPC A;  2HP8 A;  2X7R B;  1ZAU A;  1AR5 A;  1L8D A;  1BQZ A;  2RQ6 A;  3MHS C;  1V54 C;  5L3F A;  1RM1 C;  1SET A;  5IE9 A;  3E22 B;  4HBN A;  2VQF O;  3ZN0 A;  4ZHQ B;  1MOF A;  2A7W A;  1AJN A;  1CP9 A;  4BIZ A;  1VQK V;  1AR4 A;  3JAK A;  3HKE A;  3LUT B;  3CB2 A;  1B06 A;  1YTF B;  2YS8 A;  4NXN O;  4JI7 O;  2CTW A;  2XAH A;  5DN6 G;  4TV8 A;  4J7Z A;  3CXH F;  4MVM A;  4X20 A;  3QTC A;  3OT7 A;  4GX1 A;  1GN6 A;  1OCR C;  4UV9 A;  2CDY A;  3ZRV A;  3E86 A;  4FIP C;  1XNQ B;  2UXB O;  3DSQ A;  1QBZ A;  5HFL A;  4LP8 A;  2RCV A;  4QPK A;  1I94 O;  3U0Z A;  3K5L A;  1KU9 A;  1AP5 A;  5B5E Z;  2UUB O;  4NVP A;  4JZ2 A;  5EC2 C;  3B8M A;  5B1O A;  5KMG B;  1HNX B;  3JD3 A;  2AHZ A;  4MTX A;  2Z3Y A;  3DTU B;  4EKW A;  4X1K A;  3JAL A;  1CEZ A;  1AR1 B;  1Y4M A;  4B3M B;  1GRJ A;  4LH7 A;  1MSW D;  2ADQ B;  2LGQ A;  4OGQ B;  3ZS8 C;  2VRZ A;  3RVY A;  4JI2 O;  2QTS A;  2YIB D;  1CPY A;  1VQL V;  4J9Z B;  4YJ2 B;  5KUM A;  5LGT A;  1N8R W;  2D2C B;  1EZV H;  1J5E O;  1A32 A;  4U3F H;  1GM9 A;  1XRE A;  4DV5 B;  4JAV A;  2Y48 A;  4DV6 B;  1NJI W;  1YJW V;  1XBL A;  4GX5 A;  3BY6 A;  2JGD B;  2ADP A;  4JI0 O;  3CMA V;  2BSK A;  1KMI Z;  5BMV B;  5EYP B;  2OCH A;  1ARO P;  1JR9 A;  1GN2 A;  4UCT A;  4DR3 O;  4ZKI A;  5JQG A;  1N34 B;  3JSL A;  3K58 A;  4KL1 A;  2X6C A;  3B40 A;  4JI5 B;  4GCZ A;  1XNR B;  4DRX A;  1JOY A;  2P22 C;  3RN4 A;  1ZUQ A;  2RNB A;  2KQX A;  1M57 B;  4BW9 A;  3GVM A;  5J9P C;  1M57 C;  3RBZ A;  2MK3 A;  1Q81 W;  1WB7 A;  5GON A;  4MTF A;  1AI7 A;  4AQY B;  4WF9 V;  4FLT A;  4I0X B;  4L8J A;  3SDL A;  2EUL A;  4UB8 Z;  5J2T A;  2PYL A;  1YTF D;  5AG2 A;  1NBM G;  2OCC B;  1H2S B;  3K03 A;  4FFB A;  3FD9 A;  4FZ1 A;  4QGP A;  3ZRW A;  3MDS A;  1XNQ O;  3K59 A;  2IJI A;  3AEI A;  4PDL A;  5TIS Z;  3X2Q B;  3SJC C;  5A2Q N;  3X2Q C;  5C8Y B;  2ZR2 A;  3JAS B;  3J81 N;  4LFC B;  4WFA V;  1D2D A;  1HNX O;  2UUC B;  4ZI7 A;  4E2L A;  3QF7 A;  2EJR A;  3ZHR A;  3CJH A;  3UQ8 A;  3GWO A;  3JAR B;  1KKD A;  4BWA A;  4X1Y B;  5J2U B;  4P2Z A;  1MSD A;  3A2F A;  3AG4 B;  5L3B A;  2JEX A;  3R66 A;  4CH4 A;  1NS1 A;  1ZWI C;  3JCU Z;  3U10 A;  2ZXW B;  4TUY A;  2IJJ A;  3W7T A;  2ZXW C;  3JCZ A;  1Q5O A;  4FZ0 A;  4X62 O;  1RSO B;  1VAR A;  4DV5 O;  1SF9 A;  2YID A;  4DV6 O;  1XDC A;  4DR1 B;  1IXB A;  2LGW A;  2YUA A;  5JVD B;  3M8A A;  4UVA A;  1I5X A;  5JJE B;  3LNM B;  3O65 A;  1L1F A;  3W7X A;  1YCI A;  1E79 G;  4NTW A;  4CC5 A;  4LF5 B;  4FM2 A;  3RYI A;  5LMU B;  2BTO A;  3ABL B;  1K97 A;  3ASO B;  3ABL C;  3TJT A;  3ASO C;  1H2G A;  3FKS G;  4GYC B;  2GTA A;  4DR4 B;  1N34 O;  1R3J C;  4DV7 B;  4X1I B;  4F4L A;  1MZF A;  4MT8 A;  1XNR O;  2ZNJ A;  2DJV A;  3JAM N;  4KFM A;  4I5S A;  4KHP O;  4JYC A;  4PDV A;  4MSW C;  2YI8 A;  3JAT A;  4EB6 B;  1Q43 A;  2FML A;  5B3S B;  1X59 A;  3G6B A;  3E83 A;  4I55 A;  4LFB O;  1RFY A;  5B3S C;  4AQY O;  4W4K A;  1ZLZ A;  3DC6 A;  5IYZ A;  1H2N A;  2ATK C;  1BL8 A;  1XHX A;  1WPX A;  2HJD A;  2QSA A;  4TQF A;  3ZHT A;  4BR6 A;  2EJ7 A;  3M7M X;  2IM9 A;  4XBF A;  5LP6 B;  4ASU G;  5LP6 C;  1HDJ A;  4LFC O;  1R3I C;  2UUC O;  4O4L A;  4OPH A;  1FFX A;  2DWD C;  2ZKO A;  2PGG A;  3FX7 A;  3CPW U;  2FL4 A;  2B9Z A;  1X4T A;  4H0L B;  5ITZ A;  3TGU H;  4XDK A;  3UKM A;  3OTO B;  2ZR3 A;  2XND G;  5LBQ A;  4LF9 B;  4YJ3 B;  1VQM V;  1S5H C;  2GV9 A;  2A9H A;  1S77 D;  5EZY B;  3CXC U;  1B04 A;  3EHB B;  4ZOL B;  1FYJ A;  4QPJ A;  2E5L B;  4DV3 B;  1QVF U;  1GMG A;  3QG5 A;  4LCU C;  4PA3 A;  4FK5 C;  1OCC B;  1FXK C;  3CCE V;  4DR1 O;  1IBM B;  4JV5 B;  1N4C A;  4IIJ A;  2YEV B;  1R1B A;  4Q20 A;  4FM1 A;  3D36 C;  3C90 A;  4O4H B;  2P90 A;  2H3O A;  2RDC A;  2C2A A;  4LF5 O;  3Q4H B;  5LMU O;  1PNM A;  1GN3 A;  4FM0 A;  4AIL C;  3FFQ A;  4JI8 B;  5K1X A;  1LR1 A;  4MTO A;  2QWP B;  2IH3 C;  2VQE B;  1KC8 W;  4DR4 O;  4DV7 O;  4F6E A;  1F7Y A;  1SA0 A;  5DM6 V;  3CME V;  4JI3 B;  4OPA A;  3T1H B;  3JD2 A;  4PD4 F;  2EX3 A;  4JYA B;  1VF5 B;  2NLJ C;  1QVG U;  1TA8 A;  2QTO A;  1MAB G;  4HNA A;  3P30 A;  4X8A A;  5IT9 N;  1TUB A;  2ZD9 A;  2QM7 A;  3B8N A;  1P7B A;  1IXM A;  1B3Q A;  1W59 A;  4PA9 A;  3ZX6 A;  3TCU A;  2E3C A;  3G71 V;  4QJF B;  1URF A;  5CB4 A;  2JGU A;  3K3W A;  3DXR B;  1HNW B;  4J7J A;  4I50 A;  1YVW A;  3W7W A;  3CC2 V;  2QE7 G;  4CS3 A;  1EN6 A;  3ABK C;  4WFF A;  1GM7 A;  3BVO A;  2CGO A;  1SKV A;  4WFH A;  4J7K A;  3ZIA G;  2GSM B;  2KG7 A;  4B7K A;  3BCC H;  4LF9 O;  2R9I A;  3SR2 C;  1NR7 A;  2L6L A;  4LF6 B;  3CRM A;  3HKC B;  3A8T A;  1N32 B;  2UXC B;  1FS0 G;  4Z1M G;  1IBL B;  4TV9 A;  5IJ9 B;  2LO1 A;  2E5L O;  4DV3 O;  2HEP A;  1FXH A;  3OGC C;  2UUA B;  1VQO V;  1IUR A;  4LF8 B;  1IBM O;  2WLL B;  4JV5 O;  1SZT A;  5LOV A;  4MTG A;  1M56 B;  2HLD G;  1ZX3 A;  3CCJ V;  3OGI B;  3RGB A;  4NXN B;  2CH7 B;  1M56 C;  4JI7 B;  1S5L Z;  1AP6 A;  3K5O A;  1COW G;  4GX0 A;  1BE3 H;  4H44 B;  3E2E A;  3ETD A;  3E8B A;  4JI8 O;  2OIG A;  2CAZ C;  3H1K H;  2HVJ C;  4NXM B;  1SRY A;  2VQE O;  2YXL A;  1O9H A;  3CE2 A;  2HR3 A;  2PUS A;  3ZRX A;  2V4D A;  2LQT A;  4WFE A;  4WBN B;  3JD4 A;  4NR1 A;  2UUB B;  4JI3 O;  3T1H O;  1Q82 W;  3HKD B;  1SQV H;  2EIN C;  3MD0 A;  4JYA O;  3ZRS A;  3ZED A;  5JCO C;  1V55 B;  3QO5 A;  3FB7 C;  4JAU A;  1V55 C;  3JAW A;  4H13 B;  1BHA A;  4MVZ A;  4OX9 B;  2GDS A;  3SYO A;  3H9V A;  3ZHS A;  1Q7Y W;  4LWS A;  4DV2 B;  2XOK G;  3N27 A;  1SS3 A;  3VQW A;  1DTO A;  3H1J H;  2DMX A;  4DW1 A;  4LFA B;  1OZ0 A;  3UT5 B;  2A0L A;  4RUE A;  4DR7 B;  5FNV B;  3VBB A;  3B09 A;  2YXY A;  1HNW O;  3AK2 A;  1M93 A;  3JYC A;  1TVK A;  3J80 N;  3AG7 A;  5LA6 B;  2Q0A A;  4LNU B;  4FVM A;  2A79 B;  1Y76 A;  4YY3 B;  4ZBM A;  2YI9 A;  3OTF A;  4CH5 A;  2WLI B;  4IHJ B;  3EXA A;  5LGU A;  5LXT B;  4DR3 B;  4LF6 O;  1EN5 A;  4I0X A;  2Q73 A;  2M6Y A;  3K5M A;  4GKJ B;  1N32 O;  2UXC O;  1NVP B;  1XIL A;  1IBL O;  2ZIO A;  1JJO A;  4DR2 B;  4DUZ B;  2UUA O;  4U3J B;  2CTR A;  4LF8 O;  1M4U A;  2LW7 A;  3A0H Z;  4B3R B;  1PM9 A;  1MNG A;  2QWR B;  2ZDI C;  5JWP A;  5CMU A;  1W0K G;  2W0F C;  2ZIM A;  4I4T A;  3A0R A;  4CH6 A;  2W6I G;  4TSF G;  1Q3E A;  4RUF A;  2ZE8 A;  3VQY A;  4NXM O;  5IDJ A;  4X89 A;  5L3G A;  1AI5 A;  4G2K A;  3K5N A;  1TGO A;  3OW2 U;  4O2B B;  4DUY B;  4JGS A;  3FAV B;  3CYO A;  4K0K B;  4AI8 A;  5C93 A;  4OX9 O;  4B7E A;  3G80 A;  2B1I A;  4HZ3 A;  4RWU A;  4BIU A;  4JYB A;  4JZG A;  5IJ0 B;  2ZCE A;  4DV2 O;  1WLE A;  2F66 C;  3LDE A;  4FPP A;  3EVK A;  1HP8 A;  4I9Q A;  3TXQ A;  1MA1 A;  3GB7 C;  1E1R G;  5LHI A;  3OMI B;  4LFA O;  5GW7 A;  3RYC A;  1P7G A;  2QR4 A;  4DR7 O;  4UVC A;  1R6K A;  4O4J B;  4X62 B;  5KX5 B;  2ILM A;  3ETG A;  2FB5 A;  3RYF A;  2QKC A;  3STL C;  3S3W A;  2QKA A;  2AZ2 A;  4FLV A;  1QHT A;  1VQ4 V;  1Y74 B;  1QR8 A;  4YY3 O;  3LSS A;  1K5Q A;  4YXW G;  1BMF G;  4X66 B;  4GX2 A;  3T1Y B;  1NI8 A;  2A3Q A;  2CTP A;  3BA9 A;  2F95 B;  3T4Z A;  1G4Y B;  1BS3 A;  1P84 F;  3ML0 A;  4GKJ O;  5CA0 B;  4B08 A;  2JK5 C;  2PI4 A;  4XDL A;  1XEQ A;  2AXT Z;  4DXW A;  2GUZ B;  2M7W A;  4DR2 O;  3IFX A;  4DUZ O;  2JS3 A;  3ABU A;  3L74 H;  4QE9 A;  1NVP D;  4KHP B;  1PL4 A;  4JTD B;  4UCO A;  4JYY A;  4B3R O;  4MS2 A;  1HW7 A;  3N2K A;  1Y67 A;  3OEE G;  3ZHU A;  4LFB B;  2N05 A;  3ICX A;  1XQ8 A;  3E89 A;  4X64 O;  3K79 A;  2VWK A;  3K9A A;  1K7D A;  2CGN A;  5D5P A;  4BW5 A;  2Q67 A;  2OCC C;  1YJ9 V;  5CA1 B;  4E4E A;  1KD1 W;  1KYO F;  1BT8 A;  2Q9L A;  1FXV A;  3IAY A;  1I0H A;  1QLE B;  5CA3 A;  1QLE C;  5JH7 A;  2JEU A;  4DV1 B;  3F5T A;  2X0L A;  2DN9 A;  2JJ2 G;  4JPR A;  5EC1 C;  4DUY O;  2ZNI A;  3CCV V;  2EBO A;  1NU1 H;  2KSD A;  4K0K O;  2YSU B;  4FFK A;  1FXK A;  4P9O A;  2GHY A;  3H01 A;  4PHZ A;  5D5Q A;  3TXS A;  3APQ A;  1S0V A;  4JI6 O;  1D5A A;  5A9G A;  2EZP A;  5BZB A;  2WSS G;  3CCR V;  2YC0 A;  5B1B B;  3JAK B;  3VQX A;  3HKE B;  2DQ0 A;  1NTZ H;  2H94 A;  3AG4 C;  4TV8 B;  4EFE A;  3CCM V;  1FJG B;  2X6A A;  4X20 B;  1E1Q G;  4AHC A;  3ZMU A;  1T5E A;  1ZTE A;  3DGE A;  4K8X A;  2D3O W;  4K8Z A;  3BHP A;  1GTO A;  2WA4 A;  1M9N A;  4JI4 B;  2P7T C;  4TOI A;  3SJB C;  2K9P A; 
#chains in the Genus database with same CATH homology
 1Y76 B;  1ZL8 B;  1VF6 C;  1VF6 A;  1Y74 A;  1RSO B;  3B40 A;  1Y76 A;  1Y74 B;  1ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...