4B3TO

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3tO00
5BR8O 2FKXA 1IBKO 1D2DA 4JI0O 4JI4O 5BY1A 4DV4O 1I94O 4B3TO 1N34O 3J7AU 4B3SO 5BXZA 4DR1O 4OPHA 3OTOO 4LF9O 2ZM6O 1XNRO 3JAMN 4DV7O 2UUAO 4B3MO 1F7YA 1J5EO 4JI1O 1X59A 2JRIA 3T1HO 4JYAO 5LL6Y 4DR3O 4JI2O 3SDLA 4YY3O 1HNXO 1G1XB 1XEQA 5A2QN 5LMUO 4JI3O 4LF5O 5IWAO 4DR6O 5FLXN 1YZBA 2UXDO 5IT9N 4KHPO 2DJVA 3J81N 5LMNO 3M8AA 2Z0AA 4LFBO 1N32O 1XMQO 1R1BA 4OPAA 1HR0O 4DR7O 2HHHO 4YHHO 4LF6O 1FKAO 4DV1O 4A5UB 4GKJO 4DV3O 2DOSA 2UUCO 3RT3C 4NXMO 4GKKO 4JI6O 2AGAA 1DK1A 1HNWO 4JI7O 4DV6O 4DUYO 1NS1A 2UXCO 1FYJA 4B3RO 1XNQO 2F4VO 1IBLO 4LF7O 4X66O 1IBMO 2LW7A 2UUBO 2UU9O 4X65O 1AILA 2ZKOA 1R6TA 1KUQA 2VQFO 1N33O 3J80N 3T1YO 4AQYO 4DUZO 1XMOO 4DR2O 4DR5O 2UXBO 5H5NA 4LF4O 1HNZO 2N74A 4JV5O 4DV0O 4OX9O 2E5LO 3F5TA 4JI8O 4LFCO 4JI5O 4DV2O 3O65A 1A32A 3R66A 4X62O 1AB3A 4K0KO 1FJGO 4LFAO 4NXNO 4LF8O 4DV5O 2VQEO 1N36O 4X64O 4DR4O
chains in the Genus database with same CATH superfamily
1H2LA 3RYIA 4DK0A 1VQKV 5D5QA 1M1KW 2P7TC 1IZ3A 4EB6B 3CRMA 1R3LC 2ZNIA 1R3JC 4GKKB 4H37A 3CB2A 2Q7EA 4CBCA 1J5EO 3RVYA 2ZR2A 5LL6Y 4EKWA 3IAYA 3C90A 1AJQA 4UUJC 4J80A 3LDEA 3CYOA 3OM3B 3RW0A 2CH7A 2JJ2G 3ZRVA 3ZN0A 5L3GA 3ABMB 3PN1A 3BEHA 4DR2B 4NXMO 3OD4A 1BE3H 2QE7G 5GONB 2E5LB 3EVKA 2LGWA 3B4SA 2YICA 2UXCO 3JALA 2OIEA 5IJ0A 2HP8A 2F4VO 3AG1C 2QKAA 2M7WA 1VARA 1K5SA 3K5LA 5LXTA 1SQFA 2WLKA 3ZN1A 2BSKB 5KLVH 1EN4A 4G2KA 3UT5A 1XNRB 4ZOLB 1YCIA 1I7FA 2UUAB 3CX5F 3E89A 4O2AA 4JYAB 1W0JG 1Y4MA 2W0XA 4B7EA 4IYIA 3E8HA 1VQ4V 3AG3B 2A7WA 4LC1A 4P2ZA 5J2TA 2WLLA 5JJNB 2HVKC 5EZYA 4XDLA 2YC0A 4IHJB 4QE9A 2FKXA 1RSOB 1AI7A 1AVMA 3AG4B 3OUSA 1AROP 1LNQA 4X1KA 1WA8B 4K8XA 5HFMA 4DR1O 3OMAB 3SYQA 1JPXA 4UVAA 3WFVA 1UPGA 1S3JA 5LBQA 3DGEA 3WG7B 2E76B 4JTAB 5A2QN 2XAQA 4YJ3A 3SPIA 4I55B 4B3RB 3H1LH 2PY5A 2ZE7A 5LGUA 1Y6XA 2DJVA 4X66B 4RAIA 1R1BA 2WAMA 1Q6HA 3B77A 4DR7O 2KB1A 1XOUA 1UJWB 2N04A 1QLEC 1ENVA 1D5AA 2LFRA 4AI8A 4TV8A 3ABUA 3CMAV 4QGPA 4GKJO 4PV1B 2VS0A 3ZX6A 5J9PC 2WLNA 4NTYA 4LWSB 4GZRB 5DM6V 3OMNB 2WLIB 5KHHA 4X62B 5L3EA 1WB7A 4NXNB 5KHJA 3CCSV 1XUQA 5BR8B 1KQSU 3CPWU 4X65O 1FAFA 1SQBH 2EINC 3K9AA 4IL6Z 3RVZA 5DN6G 1I94B 4X88A 4J7ZA 1Z2GA 2BE3A 4CC5A 3OTOB 1BQ0A 4DUZO 1K34A 2JEUA 2OTJV 2ZXWC 3H9VA 3U10A 2ZQMA 3AK3A 1S0VA 4LFCO 2Y69C 3Q4HB 2Q7GA 3JYCA 1FJGO 1IXMA 4O4HA 3WU2Z 4MVSA 1LR1A 1FPOA 4I0XB 1GH6A 5L3DA 2P4VA 5A9GA 3OEEG 2B9ZA 1MSWD 1PV0A 2HLDG 2ZM6O 1MZEA 2JGUA 4TWKA 1OCCB 3ZHRA 5IYZA 4F4LA 2ODMA 3TCUA 3GWKC 2UXDB 1DF4A 1DGSA 4CS4A 4G27B 2M6YA 4FLVA 4X1YB 4KHPO 5CBHA 1AR4A 1XMQO 5B66Z 2XT9A 1R3KC 4JAUA 1AR5A 2A06H 2W6IG 2XAJA 4FM0A 2HHHO 3RYHB 1FKAO 5B1BB 3X2QC 5LYJB 4A5UB 1YTFD 4MSWC 4WFBV 2YIDA 1W2BU 3MD0A 3K5NA 1DK1A 2ATKC 3ZRSA 1HNWO 4PHZA 1Q3EA 2UXXA 1ZL8B 1NS1A 1RPRA 4BAYA 4K0KB 1ROPA 2GTAA 2PTMA 4YIOA 2ZE8A 1Z5VA 4X89A 3B40A 3BRCA 2EIKB 1FXHA 3K9SA 2ADPA 3T2MA 4B3TB 3AK1A 1GK9A 1GN6A 1YHQV 4B3SB 2XAGA 3A8TA 1Y66A 5DEDA 4DV7B 2EJRA 4B08A 2R9IA 5L3CA 4QPKA 3F5WC 4WFAV 4JGSA 1M9NA 3LDDA 3CC7V 1MG1A 2NLJC 2KG7B 2QWQB 1BSMA 1RFYA 1S77D 4JYYA 5TISZ 2ZDIC 2B1IA 2VQEO 4PI0A 3SGIA 4JI0O 2EIMC 5J2UA 3KCXA 4DV4O 1SA0A 4AHCA 1PPJH 2UUCB 4I4TB 4LF9O 1KP3A 4BIOA 2GTSA 2XHBA 1Y76A 1F7YA 4PDMA 1X59A 1JR9A 1RPOA 2YIAA 4QJFB 3NR7A 1S72V 3SR2C 4U7OA 4JI3O 2HKOA 4DR6O 5IT9N 1PNMA 1KECA 4BWAA 3BABA 2ZE5A 2ZDIA 1NH2D 5JVDA 4OPAA 3LUTB 5B3SC 3D36C 4KP4A 1N33B 3LSQA 1Q86W 1VP7A 1XL4A 5CMUA 3W7WA 3RT3C 2UXBB 4CZZA 3UKMA 3CCLV 2KKWA 1Q5OA 4XDKA 2P67A 2Y0PA 3F7YC 3FAVA 5B1NA 2JS5A 4DUYO 3RYFB 1WPBA 2HVJC 2HR3A 5JQGB 3K59A 1K4DC 4LNUB 2YEVA 1YJ9V 3W7XA 1JQ0A 5CB4A 3D36A 3QVNA 1EN6A 3CRQA 3OEHG 4LR3A 1U96A 3LSUA 3IGAC 4H13B 4K35A 1E79G 1GN4A 3JARA 2MW2B 2QTSA 2N74A 1Q81W 4ABMA 5LA6B 3D3QA 3BA8A 4YJ2B 1RM1B 4FLWA 3MDSA 4R8CA 3CC4V 4LF5B 1KKDA 4J41A 4WBNB 2ARHA 2R9AA 4LF8O 1Q6UA 1BMFG 3CXCU 4JI4O 1IXBA 3M7MX 1G8MA 3SYAA 3VBBA 3N2GB 1SESA 1HP8A 1AI6A 1GTOA 2H8PC 4QIWF 1P7BA 4UV9A 4DV6B 1GO3F 3T1HO 3CJHA 1QVFU 2XAFA 3ASOC 3W7SA 1AJNA 4F6EA 3FD9A 1J95A 4KFMA 1PM9A 2Q6AA 5LMNO 2X6CA 3CCMV 3U0ZA 1UFIA 3CMEV 3N27A 3H1IH 1R6NA 2Q9LA 1HR0O 1IBMB 2UUBB 1TGOA 3WB0A 4DK1A 2QEXV 1YF2A 4I9WA 5JJJB 4IIJB 5L3BA 2JGDA 3A0HZ 3T4ZA 3OMIB 1EBOA 1QR9A 2OIGA 2Q68A 4TQFA 4JI7O 4ZIBA 2FL4A 2WA4A 1QHTA 1GAXA 4JI5B 1IBLB 4O4LB 2IU3A 1N4CA 1P4RA 2NR5A 1EN5A 4LFAB 3STLC 3EFFK 2HEPA 4DW1A 4LH7A 1MNGA 4DR4B 3QG5A 4UFZA 1OCOC 3SPGA 3RYCA 2F43G 3C3TA 4TUYA 2G38A 1BGYH 1CP9A 1IDSA 2CTPA 3ABLC 1XMOO 4O2BB 4H44B 3A2FA 3AG2B 3K58A 4HNAB 4DV0O 2XUMA 3L72H 1B06A 4YY3B 3KCYA 1A32A 3HR0A 3ZEDA 3JD3A 2DWDC 4LCUC 1O9HA 4GX1A 4IGGA 3E83A 1WB8A 2JIZG 3A0RA 1YTFB 1S5JA 2YXLA 4DV1B 2BTQB 3CS5A 1YITV 2CH7B 3UM7A 3J7AU 3H1KH 5IJ9B 4UB8Z 5BXZA 5EYPB 2Q5ZA 1TUBA 5DECA 2R9RB 4TT3G 1P49A 3APQA 4MS2A 4DR3O 1XEQA 4UCVA 4BR6A 4LFBB 3ICXA 3ZRWA 4DYLA 2ZINA 3ETEA 1FXKB 4FLXA 2DN9A 3B2EE 4YHHB 3G67A 3T1CA 4MVMA 4Q6GA 3STZC 2RMKB 3BPZA 5BMVA 2UU9B 4F6RB 5LOVA 2QSAA 2R72A 1LUWA 2ITDC 3SPJA 2QM7A 5EIBC 4IT5A 4R7CA 1YI2V 4MVUA 2EBOA 4J7KA 4X1IB 1QNMA 3UT5B 2EIJC 2V1DA 4OX9B 5K1XA 1EZJA 1M56B 4FFBA 3JASA 1ZTEA 1MSDA 1OV9A 3LSSA 2QA4V 3OGCC 3RWRD 3MAQA 3VOUA 3HKCB 5IDJA 2MK3A 2Y48A 1VMGA 4JPRA 4W4KA 3ZRXA 3TXQA 3DSQA 3FYEB 1KMIZ 2BOBC 2EULA 3DTUB 3L71H 2R70A 1NVPD 4GUNA 1Q43A 4MTOA 1HNXB 3RFRA 1WLEA 1N36B 2Y4UA 4GYCB 4LP8A 2IJKA 5LHGA 2QTOA 3D3IA 4DW0A 4UCUA 3GWOA 3ZMVA 4X8AA 2LO1A 3ABMC 2DWEC 3K3WA 4EB6A 1KB9F 1K3EA 1N34O 2DYRB 2PGGA 2LW1A 1XDCA 2EJ7A 2YI8A 1MABG 2IJJA 4UXNA 1PNKA 4DRXA 5B1AB 1B3QA 5H6QA 3FB5C 3CD6V 4I50B 1PL0A 3E22B 3QO7A 2CTQA 5LMUO 1VQOV 5IWAO 4NR1A 2UXDO 3ZCCA 1N8RW 3J81N 1OJHA 4H0LB 4KUMA 1VQ9V 4UV8A 1SQGA 3JAWB 2ZE6A 1VQMV 2BOCC 4YXWG 1YVWA 4DV3O 3T1YB 2DOSA 4O4JB 3U11A 4U3FH 3UQ8A 1K9MW 5KHGA 5CA1B 2GUZB 2LP7A 4OXSA 5LGNA 2LJ2A 5GONA 3BY6A 3AG3C 1SZXA 1V9PA 4EFBA 1XNQO 5IY5B 5BZBA 4LF7O 5FNVB 3CE2A 4O4HB 5CBFA 3APOA 1GM9A 2BSKA 3AG4C 5E79Z 3KG2A 3CCRV 1NTKH 2EILC 2VWJA 4FMTA 4GLXA 4ZHQB 1J5EB 1WAZA 1GM8A 1MA1A 1JOYA 1NTZH 1CXZB 1KBHA 3WG7C 2RDCA 1SS3A 2AHYA 1FFXB 3CCEV 4DV2O 3R66A 3WB2A 1NQTA 3FB6C 1SZTA 2CE4A 4GX0A 3FKSG 4FM1A 3LDCA 1JJ2U 4MT8A 4IHJA 1RSOA 1VF6C 4JYBA 5IE9A 4J42A 3CCJV 4I9QA 3JATB 2X6BA 1ZLZA 1WA8A 4MVOA 3RGBA 4MVRA 1OCZB 1TVKB 4NXMB 5ITZB 4OPHA 1HWYA 3ASNB 3ZHVA 2DE0X 1ZSPA 1KU9A 1XBLA 3RN4A 1G1XB 3SDLA 1OHHG 1IX9A 1N0NA 3JSNA 1BCCH 2UXCB 3G80A 4I55A 4MW8A 5CA0B 2F4VB 5FLXN 1DF5A 1NU1H 2YDEA 3P3NA 1H2SB 1VF6A 2RNBA 1KYOF 4LF6O 3L75H 1NTMH 2PF4E 4Z1VA 4UVBA 4JI6O 2X6AA 1VIBA 5KX5B 2AGAA 4LWSA 4K8ZA 4WFGA 5K1PA 3D8CA 5LP6B 1FXVA 4FM2A 2WLIA 4UCRA 3TGUH 2HJDA 1FYJA 1TAEA 5HFLA 2XAHA 1ZUQA 4HBNA 2OCCB 2XNDG 3A0BZ 4P30A 4FLZA 2OYQA 3JD4A 4P9PA 2Q7HA 2QWOB 5GW7A 3BVOA 2VQFO 4DR1B 3B8NA 3KZIZ 3SYPA 3QNEA 5EK0A 4DR5O 5H5NA 1OCCC 5CBGA 3HKEB 1COWG 1P84F 2ZR3A 3E2EA 3F5TA 2BTOA 4JI8O 1GRJA 4DV5B 3O65A 4I7ZB 1M57C 1EZVH 2WLMA 5JCOC 4C7UA 4I0XA 1YIJV 4DR7B 1R6KA 3ZHQA 1PD3A 2GBOA 5BY1A 2QR4A 4KXRA 3N2KB 2E74B 4ZKIA 5KUKA 5KUMA 3HKDB 3PJSK 4B3MO 1SF9A 5JH7B 2JRIA 1L8DA 2QM4A 2PI4A 3HKBB 4MVZA 4NVPA 4TSFG 5KMGB 1Q7YW 3JD1A 5JCOA 2P4KA 3TETA 3O9OA 4X1YA 3M8AA 4D7TA 3TK1A 3JAKB 3CP1A 3ZMUA 1SQPH 1CEZA 2P5OA 1GMGA 1M4UA 2WA3A 4X65B 3BA9A 1QLNA 3RYHA 1M90W 1NVPB 3JD0A 4MTXA 4CC6A 4DUZB 3ZHTA 5LHHA 3CC2V 4D6TH 5E1AC 1DLBA 4LBEC 4O4IB 1ZL8A 4LFCB 2A9HA 5C93A 1FJGB 1M5IA 2Q8VA 4MVQA 1H2KA 4N21A 3WB1A 1IBLO 2QWPB 5EC2C 2O57A 1SQQH 1H38A 5C8YB 3K0DA 2LFSA 2YUAA 4GX5A 1I08A 3ABKB 3W7TA 3J80N 1PL4A 2ZM6B 4TV9B 2LGQA 2YXYA 2A0LA 3G4SV 1JFFB 1THZA 1IURA 1JX9A 2Q0OC 2KG7A 3JD2A 1Y74B 2DYSB 3CCUV 4X64O 4XDJA 2JS3A 1IBKO 4JF3A 2HHHB 1V54C 4BIUA 1L1FA 5D5PA 2IJIA 2FTKA 4I4TA 4PA4A 5FPOA 4RUFA 3K0GA 1I0HA 1VQ8V 1HNWB 5KA5A 4B7KA 4JI1O 3ETQA 1AP6A 1H2NA 2HFEC 4JI2O 3CRRA 4UVCA 1JJOA 3OR6C 3S3WA 3CCQV 1IVSA 4LFBO 2IH3C 2JK5C 3K5MA 1N32O 2L6LA 1CPYA 3EXAA 4RWUA 4YHHO 3LNMB 4OGQB 1K92A 4TOIA 4JYCA 3L70H 1H2MA 4GT1A 2PYJA 4GKKO 2ZCEA 1AR1B 4U3JB 4CH3A 3DXRA 4PA9A 1QR8A 1RM1C 3RYFA 3B09A 4WFHA 5JQGA 2V7QG 2NN4A 1ZX3A 3AK2A 5IYDO 2XASA 2P6JA 2VQEB 3CCVV 3OW2U 3JCUZ 1D5NA 1NJIW 4JI0B 4FFKA 1V55B 1HDJA 2VWKA 4DV4B 3RBZA 4ZI7B 3ZMZA 2GDSA 1PKXA 2CAZC 4PI2A 4DR2O 1ZWIC 3AG7A 2IH1C 4X20B 1JVMA 5LA6A 2JJ1G 2YSUB 3SJCC 2E5LO 1SKVA 3ZHSA 4YJ2A 2NNUA 4L87A 5GTIZ 1OCRB 4JZGA 4JI3B 2RQ6A 4DR6B 3OE7G 3P32A 4WBNA 1MZFA 5LGTA 1N36O 2V4DA 1NKDA 1T5EA 2W6JG 3RYIB 2KQXA 2FMLA 2B5UA 3P30A 4R6ZA 3IC7A 4PDRA 3N2GA 1F23A 2OTLV 1Q82W 5LOVB 1XNRO 2Q73A 4FK5C 2UUAO 1B6QA 1NT2B 3GB7C 2DQ0A 2PI5A 4FZ0A 4KL1A 4JYAO 4DUYB 3ZMSA 4CS3A 1BT8A 1WPXA 1XL6A 3R65A 4UB6Z 1WNSA 4TQDA 2IBZH 3EHBB 3OT7A 3P3PA 4E4EA 3OGIB 4IIJA 3I5DA 2D2CB 2X7RB 1NZ6A 4P9OA 3AG2C 3SYCA 3BAAA 3SPHA 3SJAC 4GCZA 2Q0AA 4G28B 1XHZA 1R73A 3TJTA 4O4LA 2F23A 4YIPA 3JALB 5IJ0B 4B3RO 3ZHUA 4LF8B 4X66O 2VRZA 5LXTB 5H9CA 4JI4B 3I55V 1SQVH 1OZ0A 2F1MA 1HNZB 2F95B 2B1GA 2AXTZ 2A79B 4O2BA 1H2GA 2HJFC 1MOFA 2FB5A 4O2AB 3T1HB 4HNAA 2CDYA 4DRXB 4X62O 3IC9A 5J2TB 2F93B 2WLLB 1S5HC 1FXKC 5L3FA 3AG1B 4J9YB 1VQ6V 5LMNB 5EZYB 4NXNO 2CGOA 1HR0B 1AI4A 1URFA 2WWWA 5BR8O 1D2DA 1G6UA 4PDVA 1JA8A 2Q67A 3K5OA 2BTQA 3HB3B 1QBZA 4JTDB 3K08A 1I94O 4X1KB 1JMKC 4MW3A 5IJ9A 2QGNA 3OTOO 5EYPA 1FD9A 4PD4F 5FL7G 4JI7B 1NH2B 4H33A 2RCVA 1M56C 5H6RA 3HPLC 4YJ3B 1VQLV 1SRYA 2F66C 2ZD9A 3C3SA 1FXKA 4J11A 2QM8A 2IU0A 1BHAA 1AI5A 1FFTB 3ZMTA 4RQEA 3E8FA 4F6RA 4L8JA 3G6EV 1GM7A 2GV9A 2AW9A 4TV8B 1GKFA 1YEWA 2CUGA 1XMOB 3VQVA 1NR1A 2ITCC 2RJZA 4X1IA 4DV0B 3BHPA 1BZKA 4K3AA 1Q90D 3VQWA 4JASA 2N05A 1E1QG 2YIBA 1DTOA 3OR7C 4JAAA 2AZ0A 1KP2A 2YI9A 3HKCA 2P06A 4AQYB 1AILA 1QLEB 2ETNA 1N0JA 5EBMC 4LF4B 3K03A 4JV5B 2ZIMA 2DYRC 3QF7A 3H1JH 2FYUH 5B5EZ 2IJHA 4UCOA 5EBWC 5B1AC 2EILB 4PA6A 4DR3B 1QVGU 2WPDG 4E2LA 5H2FZ 3KKYA 4K0KO 2IM9A 3ZJZA 4FZ1A 4FLTA 1Q6IA 4DV5O 2Z5UA 3VQXA 2EINB 4ZOLA 3FB7C 1WP7A 1QQCA 4B3TO 1AP5A 5FPRA 4B3SO 1F4NA 3K57A 1R3IC 4DV7O 2K1EA 1GN2A 2ZXWB 5IYZB 4FLUA 3L73H 2ZIOA 3OFNG 2ZNJA 2H3OA 2Y69B 1HW7A 2YXHA 4I50A 3E22A 2JDIG 1TA8A 1YZBA 3BCCH 3BFRA 3AEIA 1XILA 5IY5C 4J7JA 4NTXA 3JCZA 4Z1MG 4I5SA 4FLYA 3JAWA 3W7UA 4NB5A 4UCSA 4O4JA 2UUCO 4EEQA 1EM1A 5CA1A 2GUZA 3QO8A 3ZBHA 1ORQC 1BS3A 1W59A 5JJEB 4XBFA 3E8GA 3QO5A 1RP3B 4JZ2A 5FNVA 2PUSA 4UCTA 4FIPC 1BL8A 2Y4TA 1VF7A 2H94A 1Z5WA 1ZAUA 1XQ8A 2Q69A 2Z3YA 3X2QB 1N34B 1H8EG 1N33O 1OCZC 3ASNC 2UXBO 4ZHQA 4RQFA 3SJBC 4RUEA 4JTCB 1YXBA 1BHBA 3M99B 3CXHF 5LMUB 1FFXA 1I5XA 4D7SA 5IWAB 3SPCA 3E35A 1M57B 3JSLA 3VQYA 1GN3A 2E3CA 3JATA 5J2UB 1KKCA 1SA0B 2XTAA 4DV3B 4LH6A 2RN9A 1TVKA 3K06A 5ITZA 2WLHA 4DXWA 1KD1W 4DO2A 5CA3A 3DC6A 4WCEV 1Y76B 3Q4HA 4J9ZB 5LP6C 1PP9H 2X0LA 1U97A 5EIBD 1VQ7V 4QNHB 2QKSA 4NTWA 2QWNB 3T4DA 1XNQB 4LF5O 5CA0A 2WSSG 4MTFA 2Z0AA 4LF7B 2CTWA 1JCHA 5JVDB 3MHHC 5B1BC 4GKJB 2OCCC 2Y0IA 3ZS8C 2EIMB 2PZSA 3TXSA 5KX5A 1SERA 4JAVA 1K5QA 5LP6A 4QPJA 3H01A 4DV6O 3FAVB 1SETA 5KAIZ 1YDXA 4DV2B 1K97A 3OTFA 4ZBMA 1G4YB 3L74H 2GHYA 4AILC 3GVMA 1YJNV 1AJPA 2EIKC 2YEVB 4X9QA 4WF9V 5B3SB 5LYJA 5CB4B 1IBMO 2UUBO 1WJZA 1US6A 2ZKOA 1F4MA 1VEWA 2YIBD 1KUQA 1WN7A 3FB8C 1K33A 2DQ3A 5KA6A 1NR7A 1EFRG 1YSCA 1WP8A 4EFEA 3OAAG 2W0FC 1M93A 3JARB 3SJQC 3G6BA 3CRCA 3HKEA 1SQXH 4R50A 3UO3A 4JI5O 4FVMA 1NBMG 1VQPV 4BIZA 4LFAO 3LNNA 5EC1C 4DR4O 1BQZA 2Q4PA 4LF6B 3N2KA 2PYLA 4W4LA 4Q20A 2CGNA 2ADQB 2ILMA 3NXSA 4JI6B 3HKDA 1V54B 4BW5A 3JAMN 2JEXA 1E1RG 5JH7A 4FPPA 5B1OA 3CJHB 4YY3O 4KHPB 3HKBA 5KMGA 3DXRB 1XMQB 4HAMA 2QKCA 3H1HH 3CSXA 3FX7A 2JVDA 3CEIA 2IW5A 3K04A 2XOKG 3JAKA 2WLJA 3B8MA 1Q8IA 4NKGB 1XREA 3CHXA 2QWRB 4WFEA 3SYOA 2VQFB 4DV1O 3CRAA 4GX2A 3ABKC 3DC5A 4DR5B 4HZ3A 2JGDB 3ETGA 4O4IA 4JI8B 5JWPA 5AG2A 3ASOB 3G71V 1L0LH 4ICGA 1X4TA 3MHSC 2P22C 2DYSC 5GTHZ 3E86A 4CS2A 3RYCB 2UU9O 4TUYB 5C8YA 1R6TA 1S5LZ 1VF5B 2EZPA 1MMMA 4CH5A 1NI8A 1W0KG 4TV9A 5KAFZ 3K79A 4B3MB 1HNZO 1JFFA 4WFFA 4OX9O 3ETDA 4LNUA 3F7VC 4PELA 4U7NA 1YJWV 1K4CC 1Y74A 1P7GA 2YS8A 1H8HG 3IJ4A 1O9GA 4RO2A 1OCOB 4CH4A 5CN0A 4LF9B 2KSDA 5F2VO 1XI1A 3UCSC 2UXNA 2E75B 3ABLB 4PA3A 3QTCA 1TUBB 2AZ2A 2QJ1A 2A3QA 2EX3A 3I56V 1HNXO 1Y67A 3ZRWB 4BW9A 2OT5A 4HYOA 3FFQA 2OCHA 4FJCC 1B04A 5IYCO 2EZOA 2D3OW 2LQTA 1SC5B 5BMVB 1V55C 2OWOA 1QCEA 3ABTA 2CK3G 1XHXA 1L0NH 4PDLA 1LUVA 4U3JA 4PJ0Z 1VQ5V 1K7DA 1S76D 1KC8W 5IYBO 1K8AW 4FFBB 3JASB 1OCRC 3S3XA 1PNLA 2C2AA 3L9DA 3THOA 5LHIA 2DW4A 2GSMB 4X64B 1TUEB 4PA7A 1IBKB 1I5YA 4J10A 4ASUG 2LW7A 2L35A 1K73W 2BCCH 2P90A 4ZI7A 2QDOA 4NYKA 3CWBH 5KHKA 3ZIAG 3E8BA 5KHIA 3T1YO 5EBLC 4AQYO 3IFXA 2K9PA 4QE7A 4Z2WA 1F51A 4X20A 1VQNV 3OUFA 4JI1B 1FS0G 3ML0A 4LF4O 2EIJB 4JV5O 2ZT9B 3FYIB 4JI2B 4N23A 2CTRA 2HG5C 1AB3A 2DMXA 3UO2A 4MTGA 4IYHA 4CH6A 2AHZA 1N32B 1QU7A
chains in the Genus database with same CATH topology
5BR8O 2FKXA 1IBKO 1D2DA 4JI0O 4JI4O 5BY1A 4DV4O 1I94O 4B3TO 1N34O 3J7AU 4B3SO 5BXZA 4DR1O 4OPHA 3OTOO 4LF9O 2ZM6O 1XNRO 3JAMN 4DV7O 2UUAO 4B3MO 1F7YA 1J5EO 4JI1O 1X59A 2JRIA 3T1HO 4JYAO 5LL6Y 4DR3O 4JI2O 3SDLA 4YY3O 1HNXO 1G1XB 1XEQA 5A2QN 5LMUO 4JI3O 4LF5O 5IWAO 4DR6O 5FLXN 1YZBA 2UXDO 5IT9N 4KHPO 2DJVA 3J81N 5LMNO 3M8AA 2Z0AA 4LFBO 1N32O 1XMQO 1R1BA 4OPAA 1HR0O 4DR7O 2HHHO 4YHHO 4LF6O 1FKAO 4DV1O 4A5UB 4GKJO 4DV3O 2DOSA 2UUCO 3RT3C 4NXMO 4GKKO 4JI6O 2AGAA 1DK1A 1HNWO 4JI7O 4DV6O 4DUYO 1NS1A 2UXCO 1FYJA 4B3RO 1XNQO 2F4VO 1IBLO 4LF7O 4X66O 1IBMO 2LW7A 2UUBO 2UU9O 4X65O 1AILA 2ZKOA 1R6TA 1KUQA 2VQFO 1N33O 3J80N 3T1YO 4AQYO 4DUZO 1XMOO 4DR2O 4DR5O 2UXBO 5H5NA 4LF4O 1HNZO 2N74A 4JV5O 4DV0O 4OX9O 2E5LO 3F5TA 4JI8O 4LFCO 4JI5O 4DV2O 3O65A 1A32A 3R66A 4X62O 1AB3A 4K0KO 1FJGO 4LFAO 4NXNO 4LF8O 4DV5O 2VQEO 1N36O 4X64O 4DR4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 O;  2FKX A;  1IBK O;  1D2D A;  4JI0 O;  4JI4 O;  5BY1 A;  4DV4 O;  1I94 O;  4B3T O;  1N34 O;  3J7A U;  4B3S O;  5BXZ A;  4DR1 O;  4OPH A;  3OTO O;  4LF9 O;  2ZM6 O;  1XNR O;  3JAM N;  4DV7 O;  2UUA O;  4B3M O;  1F7Y A;  1J5E O;  4JI1 O;  1X59 A;  2JRI A;  3T1H O;  4JYA O;  5LL6 Y;  4DR3 O;  4JI2 O;  3SDL A;  4YY3 O;  1HNX O;  1G1X B;  1XEQ A;  5A2Q N;  5LMU O;  4JI3 O;  4LF5 O;  5IWA O;  4DR6 O;  5FLX N;  1YZB A;  2UXD O;  5IT9 N;  4KHP O;  2DJV A;  3J81 N;  5LMN O;  3M8A A;  2Z0A A;  4LFB O;  1N32 O;  1XMQ O;  1R1B A;  4OPA A;  1HR0 O;  4DR7 O;  2HHH O;  4YHH O;  4LF6 O;  1FKA O;  4DV1 O;  4A5U B;  4GKJ O;  4DV3 O;  2DOS A;  2UUC O;  3RT3 C;  4NXM O;  4GKK O;  4JI6 O;  2AGA A;  1DK1 A;  1HNW O;  4JI7 O;  4DV6 O;  4DUY O;  1NS1 A;  2UXC O;  1FYJ A;  4B3R O;  1XNQ O;  2F4V O;  1IBL O;  4LF7 O;  4X66 O;  1IBM O;  2LW7 A;  2UUB O;  2UU9 O;  4X65 O;  1AIL A;  2ZKO A;  1R6T A;  1KUQ A;  2VQF O;  1N33 O;  3J80 N;  3T1Y O;  4AQY O;  4DUZ O;  1XMO O;  4DR2 O;  4DR5 O;  2UXB O;  5H5N A;  4LF4 O;  1HNZ O;  2N74 A;  4JV5 O;  4DV0 O;  4OX9 O;  2E5L O;  3F5T A;  4JI8 O;  4LFC O;  4JI5 O;  4DV2 O;  3O65 A;  1A32 A;  3R66 A;  4X62 O;  1AB3 A;  4K0K O;  1FJG O;  4LFA O;  4NXN O;  4LF8 O;  4DV5 O;  2VQE O;  1N36 O;  4X64 O;  4DR4 O; 
#chains in the Genus database with same CATH topology
 1H2L A;  3RYI A;  4DK0 A;  1VQK V;  5D5Q A;  1M1K W;  2P7T C;  1IZ3 A;  4EB6 B;  3CRM A;  1R3L C;  2ZNI A;  1R3J C;  4GKK B;  4H37 A;  3CB2 A;  2Q7E A;  4CBC A;  1J5E O;  3RVY A;  2ZR2 A;  5LL6 Y;  4EKW A;  3IAY A;  3C90 A;  1AJQ A;  4UUJ C;  4J80 A;  3LDE A;  3CYO A;  3OM3 B;  3RW0 A;  2CH7 A;  2JJ2 G;  3ZRV A;  3ZN0 A;  5L3G A;  3ABM B;  3PN1 A;  3BEH A;  4DR2 B;  4NXM O;  3OD4 A;  1BE3 H;  2QE7 G;  5GON B;  2E5L B;  3EVK A;  2LGW A;  3B4S A;  2YIC A;  2UXC O;  3JAL A;  2OIE A;  5IJ0 A;  2HP8 A;  2F4V O;  3AG1 C;  2QKA A;  2M7W A;  1VAR A;  1K5S A;  3K5L A;  5LXT A;  1SQF A;  2WLK A;  3ZN1 A;  2BSK B;  5KLV H;  1EN4 A;  4G2K A;  3UT5 A;  1XNR B;  4ZOL B;  1YCI A;  1I7F A;  2UUA B;  3CX5 F;  3E89 A;  4O2A A;  4JYA B;  1W0J G;  1Y4M A;  2W0X A;  4B7E A;  4IYI A;  3E8H A;  1VQ4 V;  3AG3 B;  2A7W A;  4LC1 A;  4P2Z A;  5J2T A;  2WLL A;  5JJN B;  2HVK C;  5EZY A;  4XDL A;  2YC0 A;  4IHJ B;  4QE9 A;  2FKX A;  1RSO B;  1AI7 A;  1AVM A;  3AG4 B;  3OUS A;  1ARO P;  1LNQ A;  4X1K A;  1WA8 B;  4K8X A;  5HFM A;  4DR1 O;  3OMA B;  3SYQ A;  1JPX A;  4UVA A;  3WFV A;  1UPG A;  1S3J A;  5LBQ A;  3DGE A;  3WG7 B;  2E76 B;  4JTA B;  5A2Q N;  2XAQ A;  4YJ3 A;  3SPI A;  4I55 B;  4B3R B;  3H1L H;  2PY5 A;  2ZE7 A;  5LGU A;  1Y6X A;  2DJV A;  4X66 B;  4RAI A;  1R1B A;  2WAM A;  1Q6H A;  3B77 A;  4DR7 O;  2KB1 A;  1XOU A;  1UJW B;  2N04 A;  1QLE C;  1ENV A;  1D5A A;  2LFR A;  4AI8 A;  4TV8 A;  3ABU A;  3CMA V;  4QGP A;  4GKJ O;  4PV1 B;  2VS0 A;  3ZX6 A;  5J9P C;  2WLN A;  4NTY A;  4LWS B;  4GZR B;  5DM6 V;  3OMN B;  2WLI B;  5KHH A;  4X62 B;  5L3E A;  1WB7 A;  4NXN B;  5KHJ A;  3CCS V;  1XUQ A;  5BR8 B;  1KQS U;  3CPW U;  4X65 O;  1FAF A;  1SQB H;  2EIN C;  3K9A A;  4IL6 Z;  3RVZ A;  5DN6 G;  1I94 B;  4X88 A;  4J7Z A;  1Z2G A;  2BE3 A;  4CC5 A;  3OTO B;  1BQ0 A;  4DUZ O;  1K34 A;  2JEU A;  2OTJ V;  2ZXW C;  3H9V A;  3U10 A;  2ZQM A;  3AK3 A;  1S0V A;  4LFC O;  2Y69 C;  3Q4H B;  2Q7G A;  3JYC A;  1FJG O;  1IXM A;  4O4H A;  3WU2 Z;  4MVS A;  1LR1 A;  1FPO A;  4I0X B;  1GH6 A;  5L3D A;  2P4V A;  5A9G A;  3OEE G;  2B9Z A;  1MSW D;  1PV0 A;  2HLD G;  2ZM6 O;  1MZE A;  2JGU A;  4TWK A;  1OCC B;  3ZHR A;  5IYZ A;  4F4L A;  2ODM A;  3TCU A;  3GWK C;  2UXD B;  1DF4 A;  1DGS A;  4CS4 A;  4G27 B;  2M6Y A;  4FLV A;  4X1Y B;  4KHP O;  5CBH A;  1AR4 A;  1XMQ O;  5B66 Z;  2XT9 A;  1R3K C;  4JAU A;  1AR5 A;  2A06 H;  2W6I G;  2XAJ A;  4FM0 A;  2HHH O;  3RYH B;  1FKA O;  5B1B B;  3X2Q C;  5LYJ B;  4A5U B;  1YTF D;  4MSW C;  4WFB V;  2YID A;  1W2B U;  3MD0 A;  3K5N A;  1DK1 A;  2ATK C;  3ZRS A;  1HNW O;  4PHZ A;  1Q3E A;  2UXX A;  1ZL8 B;  1NS1 A;  1RPR A;  4BAY A;  4K0K B;  1ROP A;  2GTA A;  2PTM A;  4YIO A;  2ZE8 A;  1Z5V A;  4X89 A;  3B40 A;  3BRC A;  2EIK B;  1FXH A;  3K9S A;  2ADP A;  3T2M A;  4B3T B;  3AK1 A;  1GK9 A;  1GN6 A;  1YHQ V;  4B3S B;  2XAG A;  3A8T A;  1Y66 A;  5DED A;  4DV7 B;  2EJR A;  4B08 A;  2R9I A;  5L3C A;  4QPK A;  3F5W C;  4WFA V;  4JGS A;  1M9N A;  3LDD A;  3CC7 V;  1MG1 A;  2NLJ C;  2KG7 B;  2QWQ B;  1BSM A;  1RFY A;  1S77 D;  4JYY A;  5TIS Z;  2ZDI C;  2B1I A;  2VQE O;  4PI0 A;  3SGI A;  4JI0 O;  2EIM C;  5J2U A;  3KCX A;  4DV4 O;  1SA0 A;  4AHC A;  1PPJ H;  2UUC B;  4I4T B;  4LF9 O;  1KP3 A;  4BIO A;  2GTS A;  2XHB A;  1Y76 A;  1F7Y A;  4PDM A;  1X59 A;  1JR9 A;  1RPO A;  2YIA A;  4QJF B;  3NR7 A;  1S72 V;  3SR2 C;  4U7O A;  4JI3 O;  2HKO A;  4DR6 O;  5IT9 N;  1PNM A;  1KEC A;  4BWA A;  3BAB A;  2ZE5 A;  2ZDI A;  1NH2 D;  5JVD A;  4OPA A;  3LUT B;  5B3S C;  3D36 C;  4KP4 A;  1N33 B;  3LSQ A;  1Q86 W;  1VP7 A;  1XL4 A;  5CMU A;  3W7W A;  3RT3 C;  2UXB B;  4CZZ A;  3UKM A;  3CCL V;  2KKW A;  1Q5O A;  4XDK A;  2P67 A;  2Y0P A;  3F7Y C;  3FAV A;  5B1N A;  2JS5 A;  4DUY O;  3RYF B;  1WPB A;  2HVJ C;  2HR3 A;  5JQG B;  3K59 A;  1K4D C;  4LNU B;  2YEV A;  1YJ9 V;  3W7X A;  1JQ0 A;  5CB4 A;  3D36 A;  3QVN A;  1EN6 A;  3CRQ A;  3OEH G;  4LR3 A;  1U96 A;  3LSU A;  3IGA C;  4H13 B;  4K35 A;  1E79 G;  1GN4 A;  3JAR A;  2MW2 B;  2QTS A;  2N74 A;  1Q81 W;  4ABM A;  5LA6 B;  3D3Q A;  3BA8 A;  4YJ2 B;  1RM1 B;  4FLW A;  3MDS A;  4R8C A;  3CC4 V;  4LF5 B;  1KKD A;  4J41 A;  4WBN B;  2ARH A;  2R9A A;  4LF8 O;  1Q6U A;  1BMF G;  3CXC U;  4JI4 O;  1IXB A;  3M7M X;  1G8M A;  3SYA A;  3VBB A;  3N2G B;  1SES A;  1HP8 A;  1AI6 A;  1GTO A;  2H8P C;  4QIW F;  1P7B A;  4UV9 A;  4DV6 B;  1GO3 F;  3T1H O;  3CJH A;  1QVF U;  2XAF A;  3ASO C;  3W7S A;  1AJN A;  4F6E A;  3FD9 A;  1J95 A;  4KFM A;  1PM9 A;  2Q6A A;  5LMN O;  2X6C A;  3CCM V;  3U0Z A;  1UFI A;  3CME V;  3N27 A;  3H1I H;  1R6N A;  2Q9L A;  1HR0 O;  1IBM B;  2UUB B;  1TGO A;  3WB0 A;  4DK1 A;  2QEX V;  1YF2 A;  4I9W A;  5JJJ B;  4IIJ B;  5L3B A;  2JGD A;  3A0H Z;  3T4Z A;  3OMI B;  1EBO A;  1QR9 A;  2OIG A;  2Q68 A;  4TQF A;  4JI7 O;  4ZIB A;  2FL4 A;  2WA4 A;  1QHT A;  1GAX A;  4JI5 B;  1IBL B;  4O4L B;  2IU3 A;  1N4C A;  1P4R A;  2NR5 A;  1EN5 A;  4LFA B;  3STL C;  3EFF K;  2HEP A;  4DW1 A;  4LH7 A;  1MNG A;  4DR4 B;  3QG5 A;  4UFZ A;  1OCO C;  3SPG A;  3RYC A;  2F43 G;  3C3T A;  4TUY A;  2G38 A;  1BGY H;  1CP9 A;  1IDS A;  2CTP A;  3ABL C;  1XMO O;  4O2B B;  4H44 B;  3A2F A;  3AG2 B;  3K58 A;  4HNA B;  4DV0 O;  2XUM A;  3L72 H;  1B06 A;  4YY3 B;  3KCY A;  1A32 A;  3HR0 A;  3ZED A;  3JD3 A;  2DWD C;  4LCU C;  1O9H A;  4GX1 A;  4IGG A;  3E83 A;  1WB8 A;  2JIZ G;  3A0R A;  1YTF B;  1S5J A;  2YXL A;  4DV1 B;  2BTQ B;  3CS5 A;  1YIT V;  2CH7 B;  3UM7 A;  3J7A U;  3H1K H;  5IJ9 B;  4UB8 Z;  5BXZ A;  5EYP B;  2Q5Z A;  1TUB A;  5DEC A;  2R9R B;  4TT3 G;  1P49 A;  3APQ A;  4MS2 A;  4DR3 O;  1XEQ A;  4UCV A;  4BR6 A;  4LFB B;  3ICX A;  3ZRW A;  4DYL A;  2ZIN A;  3ETE A;  1FXK B;  4FLX A;  2DN9 A;  3B2E E;  4YHH B;  3G67 A;  3T1C A;  4MVM A;  4Q6G A;  3STZ C;  2RMK B;  3BPZ A;  5BMV A;  2UU9 B;  4F6R B;  5LOV A;  2QSA A;  2R72 A;  1LUW A;  2ITD C;  3SPJ A;  2QM7 A;  5EIB C;  4IT5 A;  4R7C A;  1YI2 V;  4MVU A;  2EBO A;  4J7K A;  4X1I B;  1QNM A;  3UT5 B;  2EIJ C;  2V1D A;  4OX9 B;  5K1X A;  1EZJ A;  1M56 B;  4FFB A;  3JAS A;  1ZTE A;  1MSD A;  1OV9 A;  3LSS A;  2QA4 V;  3OGC C;  3RWR D;  3MAQ A;  3VOU A;  3HKC B;  5IDJ A;  2MK3 A;  2Y48 A;  1VMG A;  4JPR A;  4W4K A;  3ZRX A;  3TXQ A;  3DSQ A;  3FYE B;  1KMI Z;  2BOB C;  2EUL A;  3DTU B;  3L71 H;  2R70 A;  1NVP D;  4GUN A;  1Q43 A;  4MTO A;  1HNX B;  3RFR A;  1WLE A;  1N36 B;  2Y4U A;  4GYC B;  4LP8 A;  2IJK A;  5LHG A;  2QTO A;  3D3I A;  4DW0 A;  4UCU A;  3GWO A;  3ZMV A;  4X8A A;  2LO1 A;  3ABM C;  2DWE C;  3K3W A;  4EB6 A;  1KB9 F;  1K3E A;  1N34 O;  2DYR B;  2PGG A;  2LW1 A;  1XDC A;  2EJ7 A;  2YI8 A;  1MAB G;  2IJJ A;  4UXN A;  1PNK A;  4DRX A;  5B1A B;  1B3Q A;  5H6Q A;  3FB5 C;  3CD6 V;  4I50 B;  1PL0 A;  3E22 B;  3QO7 A;  2CTQ A;  5LMU O;  1VQO V;  5IWA O;  4NR1 A;  2UXD O;  3ZCC A;  1N8R W;  3J81 N;  1OJH A;  4H0L B;  4KUM A;  1VQ9 V;  4UV8 A;  1SQG A;  3JAW B;  2ZE6 A;  1VQM V;  2BOC C;  4YXW G;  1YVW A;  4DV3 O;  3T1Y B;  2DOS A;  4O4J B;  3U11 A;  4U3F H;  3UQ8 A;  1K9M W;  5KHG A;  5CA1 B;  2GUZ B;  2LP7 A;  4OXS A;  5LGN A;  2LJ2 A;  5GON A;  3BY6 A;  3AG3 C;  1SZX A;  1V9P A;  4EFB A;  1XNQ O;  5IY5 B;  5BZB A;  4LF7 O;  5FNV B;  3CE2 A;  4O4H B;  5CBF A;  3APO A;  1GM9 A;  2BSK A;  3AG4 C;  5E79 Z;  3KG2 A;  3CCR V;  1NTK H;  2EIL C;  2VWJ A;  4FMT A;  4GLX A;  4ZHQ B;  1J5E B;  1WAZ A;  1GM8 A;  1MA1 A;  1JOY A;  1NTZ H;  1CXZ B;  1KBH A;  3WG7 C;  2RDC A;  1SS3 A;  2AHY A;  1FFX B;  3CCE V;  4DV2 O;  3R66 A;  3WB2 A;  1NQT A;  3FB6 C;  1SZT A;  2CE4 A;  4GX0 A;  3FKS G;  4FM1 A;  3LDC A;  1JJ2 U;  4MT8 A;  4IHJ A;  1RSO A;  1VF6 C;  4JYB A;  5IE9 A;  4J42 A;  3CCJ V;  4I9Q A;  3JAT B;  2X6B A;  1ZLZ A;  1WA8 A;  4MVO A;  3RGB A;  4MVR A;  1OCZ B;  1TVK B;  4NXM B;  5ITZ B;  4OPH A;  1HWY A;  3ASN B;  3ZHV A;  2DE0 X;  1ZSP A;  1KU9 A;  1XBL A;  3RN4 A;  1G1X B;  3SDL A;  1OHH G;  1IX9 A;  1N0N A;  3JSN A;  1BCC H;  2UXC B;  3G80 A;  4I55 A;  4MW8 A;  5CA0 B;  2F4V B;  5FLX N;  1DF5 A;  1NU1 H;  2YDE A;  3P3N A;  1H2S B;  1VF6 A;  2RNB A;  1KYO F;  4LF6 O;  3L75 H;  1NTM H;  2PF4 E;  4Z1V A;  4UVB A;  4JI6 O;  2X6A A;  1VIB A;  5KX5 B;  2AGA A;  4LWS A;  4K8Z A;  4WFG A;  5K1P A;  3D8C A;  5LP6 B;  1FXV A;  4FM2 A;  2WLI A;  4UCR A;  3TGU H;  2HJD A;  1FYJ A;  1TAE A;  5HFL A;  2XAH A;  1ZUQ A;  4HBN A;  2OCC B;  2XND G;  3A0B Z;  4P30 A;  4FLZ A;  2OYQ A;  3JD4 A;  4P9P A;  2Q7H A;  2QWO B;  5GW7 A;  3BVO A;  2VQF O;  4DR1 B;  3B8N A;  3KZI Z;  3SYP A;  3QNE A;  5EK0 A;  4DR5 O;  5H5N A;  1OCC C;  5CBG A;  3HKE B;  1COW G;  1P84 F;  2ZR3 A;  3E2E A;  3F5T A;  2BTO A;  4JI8 O;  1GRJ A;  4DV5 B;  3O65 A;  4I7Z B;  1M57 C;  1EZV H;  2WLM A;  5JCO C;  4C7U A;  4I0X A;  1YIJ V;  4DR7 B;  1R6K A;  3ZHQ A;  1PD3 A;  2GBO A;  5BY1 A;  2QR4 A;  4KXR A;  3N2K B;  2E74 B;  4ZKI A;  5KUK A;  5KUM A;  3HKD B;  3PJS K;  4B3M O;  1SF9 A;  5JH7 B;  2JRI A;  1L8D A;  2QM4 A;  2PI4 A;  3HKB B;  4MVZ A;  4NVP A;  4TSF G;  5KMG B;  1Q7Y W;  3JD1 A;  5JCO A;  2P4K A;  3TET A;  3O9O A;  4X1Y A;  3M8A A;  4D7T A;  3TK1 A;  3JAK B;  3CP1 A;  3ZMU A;  1SQP H;  1CEZ A;  2P5O A;  1GMG A;  1M4U A;  2WA3 A;  4X65 B;  3BA9 A;  1QLN A;  3RYH A;  1M90 W;  1NVP B;  3JD0 A;  4MTX A;  4CC6 A;  4DUZ B;  3ZHT A;  5LHH A;  3CC2 V;  4D6T H;  5E1A C;  1DLB A;  4LBE C;  4O4I B;  1ZL8 A;  4LFC B;  2A9H A;  5C93 A;  1FJG B;  1M5I A;  2Q8V A;  4MVQ A;  1H2K A;  4N21 A;  3WB1 A;  1IBL O;  2QWP B;  5EC2 C;  2O57 A;  1SQQ H;  1H38 A;  5C8Y B;  3K0D A;  2LFS A;  2YUA A;  4GX5 A;  1I08 A;  3ABK B;  3W7T A;  3J80 N;  1PL4 A;  2ZM6 B;  4TV9 B;  2LGQ A;  2YXY A;  2A0L A;  3G4S V;  1JFF B;  1THZ A;  1IUR A;  1JX9 A;  2Q0O C;  2KG7 A;  3JD2 A;  1Y74 B;  2DYS B;  3CCU V;  4X64 O;  4XDJ A;  2JS3 A;  1IBK O;  4JF3 A;  2HHH B;  1V54 C;  4BIU A;  1L1F A;  5D5P A;  2IJI A;  2FTK A;  4I4T A;  4PA4 A;  5FPO A;  4RUF A;  3K0G A;  1I0H A;  1VQ8 V;  1HNW B;  5KA5 A;  4B7K A;  4JI1 O;  3ETQ A;  1AP6 A;  1H2N A;  2HFE C;  4JI2 O;  3CRR A;  4UVC A;  1JJO A;  3OR6 C;  3S3W A;  3CCQ V;  1IVS A;  4LFB O;  2IH3 C;  2JK5 C;  3K5M A;  1N32 O;  2L6L A;  1CPY A;  3EXA A;  4RWU A;  4YHH O;  3LNM B;  4OGQ B;  1K92 A;  4TOI A;  4JYC A;  3L70 H;  1H2M A;  4GT1 A;  2PYJ A;  4GKK O;  2ZCE A;  1AR1 B;  4U3J B;  4CH3 A;  3DXR A;  4PA9 A;  1QR8 A;  1RM1 C;  3RYF A;  3B09 A;  4WFH A;  5JQG A;  2V7Q G;  2NN4 A;  1ZX3 A;  3AK2 A;  5IYD O;  2XAS A;  2P6J A;  2VQE B;  3CCV V;  3OW2 U;  3JCU Z;  1D5N A;  1NJI W;  4JI0 B;  4FFK A;  1V55 B;  1HDJ A;  2VWK A;  4DV4 B;  3RBZ A;  4ZI7 B;  3ZMZ A;  2GDS A;  1PKX A;  2CAZ C;  4PI2 A;  4DR2 O;  1ZWI C;  3AG7 A;  2IH1 C;  4X20 B;  1JVM A;  5LA6 A;  2JJ1 G;  2YSU B;  3SJC C;  2E5L O;  1SKV A;  3ZHS A;  4YJ2 A;  2NNU A;  4L87 A;  5GTI Z;  1OCR B;  4JZG A;  4JI3 B;  2RQ6 A;  4DR6 B;  3OE7 G;  3P32 A;  4WBN A;  1MZF A;  5LGT A;  1N36 O;  2V4D A;  1NKD A;  1T5E A;  2W6J G;  3RYI B;  2KQX A;  2FML A;  2B5U A;  3P30 A;  4R6Z A;  3IC7 A;  4PDR A;  3N2G A;  1F23 A;  2OTL V;  1Q82 W;  5LOV B;  1XNR O;  2Q73 A;  4FK5 C;  2UUA O;  1B6Q A;  1NT2 B;  3GB7 C;  2DQ0 A;  2PI5 A;  4FZ0 A;  4KL1 A;  4JYA O;  4DUY B;  3ZMS A;  4CS3 A;  1BT8 A;  1WPX A;  1XL6 A;  3R65 A;  4UB6 Z;  1WNS A;  4TQD A;  2IBZ H;  3EHB B;  3OT7 A;  3P3P A;  4E4E A;  3OGI B;  4IIJ A;  3I5D A;  2D2C B;  2X7R B;  1NZ6 A;  4P9O A;  3AG2 C;  3SYC A;  3BAA A;  3SPH A;  3SJA C;  4GCZ A;  2Q0A A;  4G28 B;  1XHZ A;  1R73 A;  3TJT A;  4O4L A;  2F23 A;  4YIP A;  3JAL B;  5IJ0 B;  4B3R O;  3ZHU A;  4LF8 B;  4X66 O;  2VRZ A;  5LXT B;  5H9C A;  4JI4 B;  3I55 V;  1SQV H;  1OZ0 A;  2F1M A;  1HNZ B;  2F95 B;  2B1G A;  2AXT Z;  2A79 B;  4O2B A;  1H2G A;  2HJF C;  1MOF A;  2FB5 A;  4O2A B;  3T1H B;  4HNA A;  2CDY A;  4DRX B;  4X62 O;  3IC9 A;  5J2T B;  2F93 B;  2WLL B;  1S5H C;  1FXK C;  5L3F A;  3AG1 B;  4J9Y B;  1VQ6 V;  5LMN B;  5EZY B;  4NXN O;  2CGO A;  1HR0 B;  1AI4 A;  1URF A;  2WWW A;  5BR8 O;  1D2D A;  1G6U A;  4PDV A;  1JA8 A;  2Q67 A;  3K5O A;  2BTQ A;  3HB3 B;  1QBZ A;  4JTD B;  3K08 A;  1I94 O;  4X1K B;  1JMK C;  4MW3 A;  5IJ9 A;  2QGN A;  3OTO O;  5EYP A;  1FD9 A;  4PD4 F;  5FL7 G;  4JI7 B;  1NH2 B;  4H33 A;  2RCV A;  1M56 C;  5H6R A;  3HPL C;  4YJ3 B;  1VQL V;  1SRY A;  2F66 C;  2ZD9 A;  3C3S A;  1FXK A;  4J11 A;  2QM8 A;  2IU0 A;  1BHA A;  1AI5 A;  1FFT B;  3ZMT A;  4RQE A;  3E8F A;  4F6R A;  4L8J A;  3G6E V;  1GM7 A;  2GV9 A;  2AW9 A;  4TV8 B;  1GKF A;  1YEW A;  2CUG A;  1XMO B;  3VQV A;  1NR1 A;  2ITC C;  2RJZ A;  4X1I A;  4DV0 B;  3BHP A;  1BZK A;  4K3A A;  1Q90 D;  3VQW A;  4JAS A;  2N05 A;  1E1Q G;  2YIB A;  1DTO A;  3OR7 C;  4JAA A;  2AZ0 A;  1KP2 A;  2YI9 A;  3HKC A;  2P06 A;  4AQY B;  1AIL A;  1QLE B;  2ETN A;  1N0J A;  5EBM C;  4LF4 B;  3K03 A;  4JV5 B;  2ZIM A;  2DYR C;  3QF7 A;  3H1J H;  2FYU H;  5B5E Z;  2IJH A;  4UCO A;  5EBW C;  5B1A C;  2EIL B;  4PA6 A;  4DR3 B;  1QVG U;  2WPD G;  4E2L A;  5H2F Z;  3KKY A;  4K0K O;  2IM9 A;  3ZJZ A;  4FZ1 A;  4FLT A;  1Q6I A;  4DV5 O;  2Z5U A;  3VQX A;  2EIN B;  4ZOL A;  3FB7 C;  1WP7 A;  1QQC A;  4B3T O;  1AP5 A;  5FPR A;  4B3S O;  1F4N A;  3K57 A;  1R3I C;  4DV7 O;  2K1E A;  1GN2 A;  2ZXW B;  5IYZ B;  4FLU A;  3L73 H;  2ZIO A;  3OFN G;  2ZNJ A;  2H3O A;  2Y69 B;  1HW7 A;  2YXH A;  4I50 A;  3E22 A;  2JDI G;  1TA8 A;  1YZB A;  3BCC H;  3BFR A;  3AEI A;  1XIL A;  5IY5 C;  4J7J A;  4NTX A;  3JCZ A;  4Z1M G;  4I5S A;  4FLY A;  3JAW A;  3W7U A;  4NB5 A;  4UCS A;  4O4J A;  2UUC O;  4EEQ A;  1EM1 A;  5CA1 A;  2GUZ A;  3QO8 A;  3ZBH A;  1ORQ C;  1BS3 A;  1W59 A;  5JJE B;  4XBF A;  3E8G A;  3QO5 A;  1RP3 B;  4JZ2 A;  5FNV A;  2PUS A;  4UCT A;  4FIP C;  1BL8 A;  2Y4T A;  1VF7 A;  2H94 A;  1Z5W A;  1ZAU A;  1XQ8 A;  2Q69 A;  2Z3Y A;  3X2Q B;  1N34 B;  1H8E G;  1N33 O;  1OCZ C;  3ASN C;  2UXB O;  4ZHQ A;  4RQF A;  3SJB C;  4RUE A;  4JTC B;  1YXB A;  1BHB A;  3M99 B;  3CXH F;  5LMU B;  1FFX A;  1I5X A;  4D7S A;  5IWA B;  3SPC A;  3E35 A;  1M57 B;  3JSL A;  3VQY A;  1GN3 A;  2E3C A;  3JAT A;  5J2U B;  1KKC A;  1SA0 B;  2XTA A;  4DV3 B;  4LH6 A;  2RN9 A;  1TVK A;  3K06 A;  5ITZ A;  2WLH A;  4DXW A;  1KD1 W;  4DO2 A;  5CA3 A;  3DC6 A;  4WCE V;  1Y76 B;  3Q4H A;  4J9Z B;  5LP6 C;  1PP9 H;  2X0L A;  1U97 A;  5EIB D;  1VQ7 V;  4QNH B;  2QKS A;  4NTW A;  2QWN B;  3T4D A;  1XNQ B;  4LF5 O;  5CA0 A;  2WSS G;  4MTF A;  2Z0A A;  4LF7 B;  2CTW A;  1JCH A;  5JVD B;  3MHH C;  5B1B C;  4GKJ B;  2OCC C;  2Y0I A;  3ZS8 C;  2EIM B;  2PZS A;  3TXS A;  5KX5 A;  1SER A;  4JAV A;  1K5Q A;  5LP6 A;  4QPJ A;  3H01 A;  4DV6 O;  3FAV B;  1SET A;  5KAI Z;  1YDX A;  4DV2 B;  1K97 A;  3OTF A;  4ZBM A;  1G4Y B;  3L74 H;  2GHY A;  4AIL C;  3GVM A;  1YJN V;  1AJP A;  2EIK C;  2YEV B;  4X9Q A;  4WF9 V;  5B3S B;  5LYJ A;  5CB4 B;  1IBM O;  2UUB O;  1WJZ A;  1US6 A;  2ZKO A;  1F4M A;  1VEW A;  2YIB D;  1KUQ A;  1WN7 A;  3FB8 C;  1K33 A;  2DQ3 A;  5KA6 A;  1NR7 A;  1EFR G;  1YSC A;  1WP8 A;  4EFE A;  3OAA G;  2W0F C;  1M93 A;  3JAR B;  3SJQ C;  3G6B A;  3CRC A;  3HKE A;  1SQX H;  4R50 A;  3UO3 A;  4JI5 O;  4FVM A;  1NBM G;  1VQP V;  4BIZ A;  4LFA O;  3LNN A;  5EC1 C;  4DR4 O;  1BQZ A;  2Q4P A;  4LF6 B;  3N2K A;  2PYL A;  4W4L A;  4Q20 A;  2CGN A;  2ADQ B;  2ILM A;  3NXS A;  4JI6 B;  3HKD A;  1V54 B;  4BW5 A;  3JAM N;  2JEX A;  1E1R G;  5JH7 A;  4FPP A;  5B1O A;  3CJH B;  4YY3 O;  4KHP B;  3HKB A;  5KMG A;  3DXR B;  1XMQ B;  4HAM A;  2QKC A;  3H1H H;  3CSX A;  3FX7 A;  2JVD A;  3CEI A;  2IW5 A;  3K04 A;  2XOK G;  3JAK A;  2WLJ A;  3B8M A;  1Q8I A;  4NKG B;  1XRE A;  3CHX A;  2QWR B;  4WFE A;  3SYO A;  2VQF B;  4DV1 O;  3CRA A;  4GX2 A;  3ABK C;  3DC5 A;  4DR5 B;  4HZ3 A;  2JGD B;  3ETG A;  4O4I A;  4JI8 B;  5JWP A;  5AG2 A;  3ASO B;  3G71 V;  1L0L H;  4ICG A;  1X4T A;  3MHS C;  2P22 C;  2DYS C;  5GTH Z;  3E86 A;  4CS2 A;  3RYC B;  2UU9 O;  4TUY B;  5C8Y A;  1R6T A;  1S5L Z;  1VF5 B;  2EZP A;  1MMM A;  4CH5 A;  1NI8 A;  1W0K G;  4TV9 A;  5KAF Z;  3K79 A;  4B3M B;  1HNZ O;  1JFF A;  4WFF A;  4OX9 O;  3ETD A;  4LNU A;  3F7V C;  4PEL A;  4U7N A;  1YJW V;  1K4C C;  1Y74 A;  1P7G A;  2YS8 A;  1H8H G;  3IJ4 A;  1O9G A;  4RO2 A;  1OCO B;  4CH4 A;  5CN0 A;  4LF9 B;  2KSD A;  5F2V O;  1XI1 A;  3UCS C;  2UXN A;  2E75 B;  3ABL B;  4PA3 A;  3QTC A;  1TUB B;  2AZ2 A;  2QJ1 A;  2A3Q A;  2EX3 A;  3I56 V;  1HNX O;  1Y67 A;  3ZRW B;  4BW9 A;  2OT5 A;  4HYO A;  3FFQ A;  2OCH A;  4FJC C;  1B04 A;  5IYC O;  2EZO A;  2D3O W;  2LQT A;  1SC5 B;  5BMV B;  1V55 C;  2OWO A;  1QCE A;  3ABT A;  2CK3 G;  1XHX A;  1L0N H;  4PDL A;  1LUV A;  4U3J A;  4PJ0 Z;  1VQ5 V;  1K7D A;  1S76 D;  1KC8 W;  5IYB O;  1K8A W;  4FFB B;  3JAS B;  1OCR C;  3S3X A;  1PNL A;  2C2A A;  3L9D A;  3THO A;  5LHI A;  2DW4 A;  2GSM B;  4X64 B;  1TUE B;  4PA7 A;  1IBK B;  1I5Y A;  4J10 A;  4ASU G;  2LW7 A;  2L35 A;  1K73 W;  2BCC H;  2P90 A;  4ZI7 A;  2QDO A;  4NYK A;  3CWB H;  5KHK A;  3ZIA G;  3E8B A;  5KHI A;  3T1Y O;  5EBL C;  4AQY O;  3IFX A;  2K9P A;  4QE7 A;  4Z2W A;  1F51 A;  4X20 A;  1VQN V;  3OUF A;  4JI1 B;  1FS0 G;  3ML0 A;  4LF4 O;  2EIJ B;  4JV5 O;  2ZT9 B;  3FYI B;  4JI2 B;  4N23 A;  2CTR A;  2HG5 C;  1AB3 A;  2DMX A;  3UO2 A;  4MTG A;  4IYH A;  4CH6 A;  2AHZ A;  1N32 B;  1QU7 A; 
#chains in the Genus database with same CATH homology
 5BR8 O;  2FKX A;  1IBK O;  1D2D A;  4JI0 O;  4JI4 O;  5BY1 A;  4DV4 O;  1I94 O;  4B3T O;  1N34 O;  3J7A U;  4B3S O;  5BXZ A;  4DR1 O;  4OPH A;  3OTO O;  4LF9 O;  2ZM6 O;  1XNR O;  3JAM N;  4DV7 O;  2UUA O;  4B3M O;  1F7Y A;  1J5E O;  4JI1 O;  1X59 A;  2JRI A;  3T1H O;  4JYA O;  5LL6 Y;  4DR3 O;  4JI2 O;  3SDL A;  4YY3 O;  1HNX O;  1G1X B;  1XEQ A;  5A2Q N;  5LMU O;  4JI3 O;  4LF5 O;  5IWA O;  4DR6 O;  5FLX N;  1YZB A;  2UXD O;  5IT9 N;  4KHP O;  2DJV A;  3J81 N;  5LMN O;  3M8A A;  2Z0A A;  4LFB O;  1N32 O;  1XMQ O;  1R1B A;  4OPA A;  1HR0 O;  4DR7 O;  2HHH O;  4YHH O;  4LF6 O;  1FKA O;  4DV1 O;  4A5U B;  4GKJ O;  4DV3 O;  2DOS A;  2UUC O;  3RT3 C;  4NXM O;  4GKK O;  4JI6 O;  2AGA A;  1DK1 A;  1HNW O;  4JI7 O;  4DV6 O;  4DUY O;  1NS1 A;  2UXC O;  1FYJ A;  4B3R O;  1XNQ O;  2F4V O;  1IBL O;  4LF7 O;  4X66 O;  1IBM O;  2LW7 A;  2UUB O;  2UU9 O;  4X65 O;  1AIL A;  2ZKO A;  1R6T A;  1KUQ A;  2VQF O;  1N33 O;  3J80 N;  3T1Y O;  4AQY O;  4DUZ O;  1XMO O;  4DR2 O;  4DR5 O;  2UXB O;  5H5N A;  4LF4 O;  1HNZ O;  2N74 A;  4JV5 O;  4DV0 O;  4OX9 O;  2E5L O;  3F5T A;  4JI8 O;  4LFC O;  4JI5 O;  4DV2 O;  3O65 A;  1A32 A;  3R66 A;  4X62 O;  1AB3 A;  4K0K O;  1FJG O;  4LFA O;  4NXN O;  4LF8 O;  4DV5 O;  2VQE O;  1N36 O;  4X64 O;  4DR4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...