4B3TO

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3tO00
4LF5O 4LF9O 4DV1O 1AILA 4LF7O 4OPAA 5A2QN 4DV0O 2LW7A 5LMNO 1KUQA 5H5NA 4LF8O 1XNRO 4LFCO 4DV6O 4AQYO 1HNZO 3F5TA 4DUYO 4DR6O 1A32A 4X62O 2DOSA 4LFBO 2ZM6O 1HNWO 4JI8O 2VQFO 4JI3O 5BY1A 4JI4O 4A5UB 3R66A 2UUAO 2AGAA 4JI7O 2DJVA 4LF4O 4DV7O 4DV4O 1FJGO 2F4VO 4DV2O 5IWAO 4KHPO 1XMOO 2JRIA 4DV5O 1R1BA 2UXCO 4X64O 4JI2O 4JYAO 4JI1O 1AB3A 4DR2O 1XNQO 5IT9N 2ZKOA 4YY3O 1N36O 3J81N 2UUBO 1IBMO 4B3MO 3SDLA 4DR3O 1IBKO 4DV3O 4X65O 4B3TO 4GKJO 4LFAO 3J7AU 1X59A 2UU9O 4LF6O 2VQEO 1J5EO 2UUCO 1I94O 5BR8O 1HR0O 4JV5O 1G1XB 2E5LO 4DR7O 3J80N 5FLXN 4DUZO 4OX9O 4NXNO 4GKKO 3OTOO 4YHHO 5LL6Y 4NXMO 1N33O 4DR1O 1HNXO 4JI5O 1XEQA 2UXBO 4JI6O 2HHHO 1YZBA 4DR5O 3JAMN 2FKXA 5BXZA 1DK1A 2N74A 1FKAO 4K0KO 2Z0AA 1R6TA 3O65A 1N34O 1D2DA 4OPHA 1FYJA 4JI0O 4DR4O 3RT3C 1N32O 3T1YO 1IBLO 1XMQO 2UXDO 4B3SO 3T1HO 1NS1A 4X66O 1F7YA 4B3RO 5LMUO 3M8AA
chains in the Genus database with same CATH superfamily
4JI4B 2X0LA 1PD3A 2UUAB 1YCIA 4H37A 2QM7A 5LGTA 5H5NA 3KG2A 4X20A 5B3SC 5IYCO 4FIPC 4DUYO 4FMTA 2NLJC 3BPZA 1SQGA 4X64B 5KLVH 1KQSU 1KP3A 4I9WA 4A5UB 1QBZA 4QGPA 2AHYA 1KECA 3JCZA 1NU1H 1JVMA 1URFA 3SPCA 4NR1A 2E74B 1WP8A 3ABMC 2DYSB 4TWKA 4X1IB 2CTRA 5IT9N 3LDDA 5IDJA 3TETA 4MTOA 2CTQA 3BHPA 4X88A 4WFEA 2ZQMA 4ZBMA 3ZRXA 1YTFD 5GONB 3SPJA 3ETGA 1VQNV 3TGUH 3OUFA 3OW2U 4O4LA 2P7TC 1PNLA 1ORQC 2XNDG 1S77D 4OX9O 4UCOA 3ABLC 3JAWB 2XTAA 3F5WC 4X8AA 4QPKA 2P4KA 4WFBV 4QNHB 1Z2GA 4NYKA 4N21A 2Q6AA 4PELA 5H6RA 3SJQC 1FJGB 4JV5B 3WG7C 2UXBO 3A8TA 4WFHA 4FZ1A 4IHJB 3R65A 2YEVB 5EYPB 3CXHF 1G8MA 3AG7A 4ZOLB 2ZE5A 4HNAA 2JGDA 1PNKA 1RPOA 1V54C 4YXWG 2ZDIC 3KKYA 2PF4E 4X66O 5CA1A 3M8AA 2OTJV 2X6BA 3AK3A 4PJ0Z 1WPBA 1I7FA 3K58A 2LFSA 3JD1A 2WLJA 4I5SA 4LFCO 2F66C 4DYLA 3I56V 3U0ZA 1PKXA 4LFBO 3CCRV 3H1IH 3E35A 3E83A 4ZI7B 3VQYA 2JGUA 2YS8A 1TGOA 2NN4A 1Q43A 2XAJA 1AP5A 2EJRA 3QO5A 4JYAO 3QNEA 1XOUA 4K0KB 2PI5A 3O9OA 1LNQA 4YY3O 3CYOA 3J81N 1I08A 4UXNA 2E5LB 3OEEG 2QDOA 4QPJA 1M90W 4KFMA 5BMVB 3E8BA 1AR1B 1IBKO 1SQBH 1HWYA 3JAKB 4J80A 4PA6A 2HP8A 3K3WA 2E75B 3FB5C 2ODMA 3SYAA 1QNMA 1IVSA 1BL8A 3OD4A 5KHIA 3TXQA 3CCMV 4DR7O 4DUZO 2Y0IA 2RJZA 5LHGA 3CCQV 1I0HA 4HAMA 2QEXV 2GSMB 5JH7A 2QWQB 2WWWA 1SA0B 2D3OW 3HPLC 2ZR3A 3N2KB 2DWEC 2IBZH 4UCVA 4B7KA 1P7BA 2FKXA 3ZHUA 2QA4V 2Y4UA 4ZHQB 4LF8B 1XNRB 2XOKG 3RVYA 1Y6XA 5LA6B 4AQYB 1VF6A 2HJDA 4AI8A 3T1YO 1XMQO 5J2TB 4B3SO 1SERA 4KL1A 4TV8A 1SETA 4LF9O 1XI1A 4DK1A 4E4EA 5BZBA 3VOUA 4X9QA 3OR6C 4X1IA 1NTKH 4DV5B 4DW1A 4DO2A 1IX9A 4JI1B 5KAIZ 1N36B 4G28B 2B5UA 4O2BB 4MTGA 3SYPA 1QVFU 3N27A 4D7SA 3CC7V 2IJJA 2PUSA 4QJFB 1QQCA 2QJ1A 4TQDA 2EILB 1K9MW 5GONA 1K7DA 1E1RG 4AHCA 2F1MA 3ZN1A 4MT8A 2EZOA 3ABMB 2F95B 1S5LZ 3JAWA 4DR3O 5LGNA 2MW2B 3ASNB 2ZXWB 3JASB 5EBWC 4YHHB 5FPRA 3CSXA 5B1AC 4PA7A 4IHJA 4J41A 2YEVA 5EYPA 1JQ0A 3CS5A 4JYBA 2Q7HA 3CRQA 4ZOLA 1GM8A 3HKDB 1PNMA 1GN4A 2QE7G 4K8ZA 1NKDA 5IJ9B 4JAUA 2ZCEA 3AG2B 4HZ3A 4I50B 5KA5A 1QR8A 2ARHA 1P49A 2ZINA 2IJKA 2QM8A 3FB8C 2F4VB 2HHHO 1YZBA 2DYRC 3B8NA 3ABLB 1FKAO 1E1QG 1MMMA 5LMNB 4PDVA 4UVBA 3FX7A 1FXVA 1B6QA 2DN9A 2IM9A 2GBOA 1NS1A 1NR7A 1MG1A 1ZSPA 2R9IA 4LF5O 2CK3G 2CAZC 1AILA 4DV1O 4ZI7A 3WB1A 1RFYA 3UCSC 2F93B 5J2UB 3CC2V 2Y4TA 5B66Z 1GMGA 1FFXB 1MA1A 2YIAA 5E1AC 1Q90D 2DQ0A 5CBHA 2QM4A 2JEUA 4H44B 5BY1A 1YXBA 4PA9A 3W7UA 4JI7O 4DV4O 5K1XA 4J9ZB 3CRCA 3BA8A 1Y67A 3JAKA 2HG5C 2OCHA 4NB5A 3K59A 3B4SA 4DR2O 1XUQA 1VQ5V 3CX5F 2WLKA 4MW3A 1GRJA 4YIOA 4H13B 4DV3O 3JD3A 1SA0A 2A7WA 1N33B 3N2KA 2HKOA 4DV0B 4GUNA 3H9VA 2DWDC 4GYCB 5CBGA 5DM6V 4ZHQA 4GT1A 2R9AA 3J80N 2G38A 2WPDG 1SF9A 5LA6A 2IU0A 4D7TA 3D3QA 4PHZA 3K79A 1FPOA 4FLYA 4GX2A 5J2TA 4EEQA 1THZA 5KA6A 5IYDO 4DR1O 1HNXO 4J11A 4LF7B 1DK1A 4G27B 1BHAA 3RYCB 3RWRD 5ITZB 2OWOA 2B9ZA 3K03A 4MSWC 4DR4O 4JASA 1NTZH 2PTMA 4MVQA 2UXDO 3K06A 1HNWB 3ZN0A 1M9NA 4O2BA 1YHQV 1ROPA 1KUQA 1S72V 1BMFG 5AG2A 2R9RB 1DLBA 4GKJB 4LFAB 4FLVA 4FLWA 4UVCA 3FYEB 5KUMA 4R8CA 1XNQB 1DTOA 1AI7A 1LUVA 3EVKA 1JX9A 2Q8VA 5EIBC 2UUBB 1LR1A 1J95A 1WB8A 2FL4A 5IWAO 3JASA 2Q5ZA 1Z5VA 1GH6A 1VEWA 3OAAG 3K0GA 3CB2A 4LR3A 2W6IG 4WCEV 4LF6B 1P84F 2VRZA 3ETEA 1R3JC 2P67A 3HKDA 4CH3A 4NKGB 2A9HA 5D5QA 2ZIMA 4IYHA 5IJ9A 1SQXH 1M1KW 4GX0A 3WB2A 2IH3C 4I50A 4B3TO 1Q86W 1BCCH 2DQ3A 1EFRG 2EINB 1I5YA 3BABA 4LP8A 3STZC 2A3QA 3UT5B 1CEZA 3E8HA 2W0FC 5CB4B 1U97A 5A9GA 4DW0A 3D36C 1NI8A 2ZR2A 4NXNO 3ZBHA 3G80A 5GW7A 2ZD9A 5B1AB 4I9QA 2O57A 4ZKIA 4NXMO 1VQMV 3H1LH 1H38A 2ZNIA 3FAVB 2KSDA 2JEXA 3JAMN 2ZDIA 3T4DA 5J2UA 3X2QB 3ZS8C 1TA8A 2H94A 1ZWIC 1FFXA 1QHTA 3WU2Z 1D5NA 3MD0A 4DR6B 1O9HA 4PDRA 4G2KA 4LC1A 5DN6G 3RT3C 1N32O 4CBCA 3F7YC 1D5AA 2WLMA 4LBEC 1ENVA 3MHSC 4LF4B 4DV7B 4BW9A 1JR9A 4J7JA 4DV6O 1M56B 2F43G 2DOSA 3IFXA 1VQOV 1WNSA 2YXYA 3SPIA 4OX9B 3R66A 3RN4A 2DJVA 1JJOA 2DW4A 2Z3YA 3TK1A 2WLLB 1VMGA 3VBBA 1JJ2U 4F6EA 3JATB 4E2LA 2UXCO 1YVWA 2NR5A 2FB5A 2RCVA 1Y66A 4J9YB 1I94B 4RO2A 1R6KA 1YI2V 2BOBC 2EILC 4B3MO 4FLUA 4PA4A 2JS5A 2QSAA 4K3AA 3ZHRA 3HKBB 3JCUZ 3IGAC 1NVPB 4X65O 5H2FZ 3OE7G 1S5JA 3L71H 4J7ZA 3FKSG 4O2AB 1GAXA 2VQEO 1J5EO 5KX5B 3E86A 3B8MA 4DR5B 3RYCA 3ASNC 2ZXWC 5HFLA 4LFCB 5ITZA 4C7UA 4KP4A 2QKSA 2CDYA 5DECA 4TT3G 4RAIA 3ZMSA 3HR0A 5HFMA 4KHPB 1AJNA 3RW0A 1W0JG 1MNGA 2N74A 1K4DC 3AG2C 4OPHA 1FXKC 1EN6A 1HP8A 4N23A 2AZ0A 2F23A 3FB6C 2R72A 1YF2A 1M93A 5LMUO 1M4UA 3DGEA 4JI3B 1BZKA 4TSFG 1S76D 1X4TA 4J10A 4U7NA 1BQ0A 1WA8B 5B1BB 4R50A 5JQGB 2K9PA 2OCCB 1R3IC 4JI4O 3E8GA 2KKWA 2UUAO 2AGAA 3QG5A 3CHXA 1H2KA 5JJEB 4W4KA 2W0XA 1Q3EA 4Z1MG 3OR7C 1XL4A 1R6NA 5JVDB 3RVZA 4P30A 4BIOA 3MAQA 4X1YB 3UT5A 1ZX3A 4X64O 2IJHA 2UU9B 4XDKA 3AG1B 4CH5A 5CB4A 2CGNA 1ZTEA 2UUCB 1Q82W 1DGSA 2WLNA 3E89A 1Y4MA 3CXCU 4GKKB 3A0RA 3NR7A 3T1YB 1XMQB 1GN2A 2V7QG 3OTOB 3IJ4A 2ZNJA 1XQ8A 3BY6A 4GX1A 3FAVA 3ML0A 1KP2A 3JD4A 4JI5B 2XAQA 3CE2A 5BR8O 1VP7A 3HKEB 1G1XB 1T5EA 2N04A 5FLXN 3OMIB 3L72H 2FTKA 2H3OA 4X89A 1XILA 2VWKA 3UO3A 1IBLB 2Y69B 4W4LA 4O4HB 3CJHB 4XDJA 4BW5A 3W7XA 2Z0AA 2YC0A 2XASA 3U11A 3L70H 3CCJV 1P7GA 4HYOA 3GWOA 3K08A 4IIJB 1OCZB 3RYHB 2KB1A 5CN0A 1AR4A 1QLEC 1Q8IA 4CC6A 5DEDA 3APQA 1R73A 2GUZB 4JV5O 1K5QA 1KMIZ 5JCOC 1UFIA 3JSNA 3ZMTA 5A2QN 1SESA 3P3PA 2WLLA 2AW9A 3JATA 4Z1VA 2QWOB 4PV1B 1Q6HA 4EKWA 3BA9A 2HLDG 2CTWA 1N8RW 3Q4HB 1Q6IA 1S3JA 3ICXA 1SZXA 3HKBA 2YICA 1BSMA 3ZMZA 5L3EA 2CH7B 4O2AA 5KX5A 4P2ZA 2GTAA 1IXMA 3AG3B 4AILC 1MZEA 2ZKOA 1F51A 1TVKB 3ZHSA 1B3QA 5C8YB 2Q67A 4U7OA 2QGNA 2LGQA 1PL4A 3W7SA 1BE3H 1JMKC 3CD6V 4MVSA 1GN6A 4RUFA 4TUYB 1B06A 3A0BZ 5JJNB 2EIKC 2E5LO 1E79G 2EINC 2HFEC 2BOCC 3IC7A 3QVNA 5LHIA 4B7EA 1RM1C 1NVPD 1VIBA 3T1HB 4B3RB 1XEQA 3H1KH 1JFFB 1H2NA 2BTOA 3P30A 2ILMA 3U10A 4RWUA 2WLHA 1OV9A 1KC8W 1N34O 5KAFZ 4JPRA 4JI0O 1WA8A 3A0HZ 4DR2B 2OT5A 5JQGA 1WP7A 1YSCA 3X2QC 4UB6Z 1VQ7V 4JF3A 3SJBC 2VQFB 1L8DA 1FXKB 2FMLA 3JD0A 4DV2B 4WFGA 4LF8O 1CXZB 1XNRO 5JVDA 1MZFA 4AQYO 2XAHA 4X1YA 4X62O 3LSUA 4Z2WA 2CGOA 2QWPB 4LWSB 3DTUB 2ZM6O 4HBNA 1SQQH 3ETDA 2CUGA 2EULA 1M56C 2CE4A 1S0VA 3CPWU 4DV5O 4OGQB 4O4IB 2V4DA 2OYQA 2LO1A 3LSSA 4JI1O 1AB3A 2ATKC 3HKEA 4DK0A 5K1PA 1N36O 4BIZA 4MW8A 1NJIW 2P90A 4X1KB 4Q6GA 3JYCA 3SDLA 4FVMA 2HJFC 2Q4PA 3KCXA 1SZTA 2IJIA 1CPYA 1US6A 5BMVA 3D36A 3ZHVA 1FD9A 4O4HA 3CJHA 2PI4A 2GV9A 3L73H 4JI6B 5EIBD 1W59A 4IL6Z 1IXBA 2WA3A 4WF9V 1K92A 4IIJA 3RYHA 5LYJB 4YHHO 1S5HC 2GUZA 1COWG 2L35A 3BRCA 4MS2A 4D6TH 3ZMVA 4FFBB 3GB7C 4CH6A 3JSLA 2WLIB 2Q0AA 3N2GB 2YUAA 1L0LH 1MSWD 3LDEA 3ZCCA 5IY5B 2RQ6A 4O4JB 3CWBH 1GM9A 3Q4HA 2Q7EA 5LXTB 2MK3A 4JI8B 2QR4A 3ZRVA 2DE0X 2Q7GA 1NT2B 3A2FA 5KHGA 2BCCH 5LMNO 5D5PA 1QLEB 3E8FA 5FNVB 2CH7A 1SS3A 3B09A 4I0XB 2Q0OC 2EZPA 1K33A 4FK5C 1TVKA 4F6RB 3VQXA 5C8YA 2N05A 3VQVA 1Y76B 5CA0B 5LP6B 4NXMB 2P4VA 5B1BC 2JJ1G 3T1CA 3ABTA 1XMOO 1XBLA 2OCCC 4FLXA 1IZ3A 1EN4A 3EHBB 5CBFA 3ZHTA 1AJQA 5IJ0B 4JI2O 4LH6A 4TUYA 5LBQA 4KUMA 1NTMH 3WFVA 2K1EA 2ZE8A 1KKCA 1IDSA 1IBMO 4MVMA 2JIZG 3K0DA 1N32B 2A0LA 4EB6B 1QCEA 5CA3A 3G67A 2LJ2A 3AG1C 3CCLV 5L3GA 2ITCC 1JFFA 1BT8A 1V9PA 3RFRA 3JARB 2X6AA 2YIBA 2QKAA 3I5DA 1VQLV 1AP6A 2HR3A 3OGCC 4ICGA 1HR0O 5J9PC 3B77A 4DV6B 3OUSA 2LGWA 4YIPA 5LL6Y 1N33O 4NTXA 4K35A 3AK1A 3M7MX 2EIKB 1FXKA 2P5OA 2Q68A 4MVUA 3ETQA 3FYIB 2XAFA 1R6TA 3O65A 3EFFK 1YJNV 2UXCB 1D2DA 1JCHA 1RM1B 4DUYB 2Y69C 4LWSA 4R7CA 3K04A 5CA1B 4UVAA 4WBNB 3G4SV 3FFQA 2VS0A 2YIDA 4LF7O 4CS2A 2LFRA 3HKCB 1OCZC 2LW7A 2B1IA 3TXSA 3CC4V 3L9DA 4X65B 2YIBD 3RBZA 2PZSA 4L8JA 4FZ0A 4O4IA 3LNNA 1YIJV 3F5TA 1BHBA 1A32A 2Y0PA 1AJPA 2ZIOA 4FM2A 1HNWO 3CCUV 5EBLC 4X1KA 3TJTA 3SYQA 1ZAUA 2EIJB 3S3WA 2YSUB 3E2EA 1CP9A 4MTFA 1YDXA 1R1BA 3CCEV 1GN3A 1NH2B 1N0NA 1WAZA 3BAAA 1XNQO 4BIUA 1F4MA 1XL6A 4JTCB 1AI4A 3PJSK 5L3BA 2UUBO 1YITV 5LYJA 1V55B 3AG3C 1K5SA 4TQFA 4FFBA 1B04A 3MHHC 4LF6O 2WAMA 2WLIA 2UXBB 2QTSA 3N2GA 4GX5A 2A79B 1NQTA 2ADPA 3SJCC 1OHHG 4CZZA 1K8AW 1VQKV 1EZVH 1AVMA 2D2CB 4O4JA 1QR9A 4B08A 2YDEA 5LXTA 1U96A 1H2LA 1W0KG 3SPGA 4X66B 4ASUG 1GTOA 1R3LC 2JK5C 3CEIA 1BGYH 3ZRWB 4IYIA 5FNVA 4UCUA 1EBOA 2YI8A 4TOIA 4I0XA 5JCOA 2XHBA 2LW1A 3QF7A 1ZLZA 4TV8B 3DC6A 1YEWA 2IU3A 4CS3A 4EFEA 4RUEA 4F6RA 4QE9A 4LFBB 1W2BU 3ZRSA 1JOYA 3I55V 1Y76A 5CA0A 5LP6A 3C3TA 2R70A 1HNZO 3LSQA 5IJ0A 4DR6O 1KYOF 5BR8B 2JVDA 2ITDC 4EFBA 4JYAB 1OCOC 3OMNB 1M57B 4YY3B 3MDSA 4OXSA 4LF4O 4DV7O 4EB6A 1WPXA 3EXAA 3K5LA 4Q20A 1TUBB 3ASOC 1IBKB 3LNMB 2KQXA 3JARA 2ZE7A 3TCUA 5B5EZ 1VQPV 3JALB 4UV8A 1SQPH 1UPGA 3SGIA 3OGIB 4DR7B 4DUZB 1SKVA 2AZ2A 1H8EG 1AI5A 5FPOA 1PM9A 4J42A 1XDCA 3AEIA 2DMXA 3OTFA 1Q7YW 1I94O 3P32A 1SRYA 1K3EA 4RQFA 5GTHZ 2QTOA 2XAGA 2IW5A 3UQ8A 4GZRB 3H1HH 4WBNA 2WA4A 1N4CA 4B3SB 4XBFA 1MABG 2YXHA 3HKCA 4DR5O 4LF9B 2EIMC 5IYZB 3LUTB 1NZ6A 3STLC 4PDMA 1BS3A 1FYJA 3VQWA 1JA8A 2BSKB 2FYUH 4XDLA 3K5OA 4KHPO 2NNUA 4TV9B 2JDIG 1H2MA 5IY5C 2Z5UA 1WJZA 2OIEA 4WFAV 3KCYA 4NTWA 1WB7A 1NR1A 2LP7A 2YXLA 3RYIB 1KD1W 1KB9F 4IGGA 3H1JH 3UO2A 4YJ2B 3UM7A 2EJ7A 4PA3A 4JI3O 2ETNA 3AG4C 1FJGO 4JTDB 4H0LB 4DR3B 1QU7A 4JTAB 5EZYB 1AROP 2HVJC 4MVZA 4BWAA 2C2AA 2M7WA 2V1DA 1GM7A 2BTQB 1OCRB 5LP6C 1G4YB 1N34B 3GVMA 1K73W 4JI0B 4UUJC 5L3FA 3DXRB 3CCVV 4I4TB 1FS0G 1VQ9V 5KHKA 1KU9A 3RYFB 1NBMG 5KHJA 3J7AU 2PYJA 2UU9O 1HDJA 2UUCO 1NH2D 5KUKA 2HHHB 3QO8A 3ZRWA 1GKFA 3ABUA 4ZIBA 4X62B 4U3FH 4GKKO 2E3CA 4F4LA 4UFZA 3OTOO 2ZM6B 5B1NA 4LH7A 2EBOA 2UXXA 4JYCA 1L1FA 3BEHA 4JI5O 1PV0A 1YJWV 1OCCB 4LF5B 4BAYA 1VQ4V 4DV1B 1Q5OA 4U3JB 4K0KO 2PGGA 4JAVA 3OMAB 1FXHA 1AR5A 1FAFA 2EX3A 5KMGB 3IC9A 3K5MA 3T2MA 1IBLO 5B3SB 3QO7A 2LQTA 5L3CA 1G6UA 3D8CA 3ZX6A 2PY5A 5H9CA 4JI7B 1EN5A 1H2SB 4DV4B 4CS4A 2QWNB 1QVGU 5C93A 1TUBA 3ABKC 5LHHA 3S3XA 3SYOA 3BFRA 3WB0A 2E76B 3JALA 4DRXB 1SQVH 2GDSA 3H01A 4UB8Z 1Q6UA 4I55B 1GO3F 1R3KC 3OEHG 5L3DA 3QTCA 2JRIA 1OCOB 4DV3B 5H6QA 2AXTZ 2Q9LA 4JGSA 3FD9A 2RN9A 3THOA 1RPRA 2BE3A 1RSOB 3HB3B 3NXSA 3L74H 2EIJC 2IH1C 3ASOB 2JS3A 5F2VO 3T4ZA 1L0NH 1N0JA 5LOVB 1FFTB 1QLNA 2P6JA 2ZT9B 2M6YA 5JWPA 3OM3B 4PI2A 4FM0A 1XHXA 4DR1B 1HNXB 5IYZA 3OT7A 3SJAC 4L87A 3JD2A 1V55C 1Y74B 3WG7B 4FPPA 1LUWA 5IE9A 3APOA 4YJ3B 4LNUB 1ZL8B 2BSKA 2KG7B 4DR4B 3B2EE 3GWKC 1OJHA 1SC5B 2UXNA 4TV9A 2UXDB 1V54B 2PYLA 1F4NA 3G6BA 4FLZA 4QE7A 3KZIZ 4MVOA 2ADQB 5LGUA 1O9GA 1XMOB 1DF5A 3G6EV 1EM1A 3RYIA 1Z5WA 3CMAV 4JI2B 1XREA 1OZ0A 3ZIAG 4QIWF 2EIMB 4YJ2A 3BCCH 3T1HO 4B3RO 4ABMA 1IBMB 3PN1A 1SQFA 1UJWB 5KHHA 1VF6C 1TAEA 3K5NA 5EZYA 3SR2C 4PDLA 2HEPA 4J7KA 5IWAB 2A06H 4FLTA 2HVKC 2QWRB 1YJ9V 2YI9A 2BTQA 4MTXA 2XUMA 1PP9H 1HR0B 2H8PC 2DYSC 2VQFO 2GHYA 4UCSA 3E22B 3DXRA 1IURA 2F4VO 4DV2O 4I4TA 1BQZA 3SPHA 4FM1A 2X7RB 3BVOA 1VF7A 4RQEA 2RMKB 1P4RA 4X20B 3RYFA 1YTFB 2Q73A 3F7VC 1M57C 4B3TB 3AG4B 3ZMUA 1WN7A 3B40A 1MSDA 3OFNG 4I7ZB 3W7TA 4NXNB 3FB7C 4DXWA 3DSQA 4PD4F 1X59A 4U3JA 2CTPA 4R6ZA 4UCTA 1WLEA 1ZUQA 5KMGA 3CRAA 5EC1C 3K57A 4JYYA 1H2GA 3CRMA 1MOFA 3C3SA 4MVRA 3DC5A 4JI6O 2VWJA 2P06A 3ZEDA 2P22C 4PI0A 5EBMC 5IYBO 3CMEV 1M5IA 5GTIZ 4O4LB 5B1OA 4FJCC 1VARA 4KXRA 4DRXA 3K9AA 1F7YA 4WFFA 5EK0A 2XT9A 1Q81W 4OPAA 4I55A 4JZGA 4DV0O 1F23A 2GTSA 4CC5A 3IAYA 2Q69A 3M99B 1JPXA 2RDCA 4HNAB 2JGDB 2RNBA 3CCSV 1RSOA 1GK9A 4CH4A 4NVPA 4JI8O 2L6LA 3ABKB 1KBHA 5CMUA 1AI6A 2ZE6A 4B3MB 3UKMA 5LOVA 4IT5A 1EZJA 3D3IA 3SYCA 3W7WA 1I5XA 2W6JG 1KKDA 1PL0A 3AK2A 3K9SA 5FL7G 2VQEB 4GLXA 1J5EB 1VQ6V 1Y74A 4P9PA 5E79Z 4YJ3A 4LNUA 1ZL8A 2KG7A 4LCUC 1OCRC 1K4CC 2AHZA 3ZHQA 4UV9A 2WSSG 1TUEB 5JJJB 3RGBA 3ZJZA 4GKJO 4LFAO 1VQ8V 4H33A 2X6CA 3CRRA 4NTYA 4UCRA 1VF5B 1PPJH 4FFKA 1HNZB 2DYRB 5EC2C 3P3NA 2OIGA 1HW7A 2QKCA 3L75H 2Y48A 4GCZA 5LMUB 3CP1A 3C90A 1K97A 2JJ2G 5BXZA 4K8XA 5TISZ 2OTLV 4JAAA 4BR6A 3LDCA 1XHZA 1K34A 1OCCC 1H8HG 2B1GA 3G71V 4P9OA 4JZ2A 1DF4A 1RP3B 5JH7B 3E22A
chains in the Genus database with same CATH topology
4LF5O 4LF9O 4DV1O 1AILA 4LF7O 4OPAA 5A2QN 4DV0O 2LW7A 5LMNO 1KUQA 5H5NA 4LF8O 1XNRO 4LFCO 4DV6O 4AQYO 1HNZO 3F5TA 4DUYO 4DR6O 1A32A 4X62O 2DOSA 4LFBO 2ZM6O 1HNWO 4JI8O 2VQFO 4JI3O 5BY1A 4JI4O 4A5UB 3R66A 2UUAO 2AGAA 4JI7O 2DJVA 4LF4O 4DV7O 4DV4O 1FJGO 2F4VO 4DV2O 5IWAO 4KHPO 1XMOO 2JRIA 4DV5O 1R1BA 2UXCO 4X64O 4JI2O 4JYAO 4JI1O 1AB3A 4DR2O 1XNQO 5IT9N 2ZKOA 4YY3O 1N36O 3J81N 2UUBO 1IBMO 4B3MO 3SDLA 4DR3O 1IBKO 4DV3O 4X65O 4B3TO 4GKJO 4LFAO 3J7AU 1X59A 2UU9O 4LF6O 2VQEO 1J5EO 2UUCO 1I94O 5BR8O 1HR0O 4JV5O 1G1XB 2E5LO 4DR7O 3J80N 5FLXN 4DUZO 4OX9O 4NXNO 4GKKO 3OTOO 4YHHO 5LL6Y 4NXMO 1N33O 4DR1O 1HNXO 4JI5O 1XEQA 2UXBO 4JI6O 2HHHO 1YZBA 4DR5O 3JAMN 2FKXA 5BXZA 1DK1A 2N74A 1FKAO 4K0KO 2Z0AA 1R6TA 3O65A 1N34O 1D2DA 4OPHA 1FYJA 4JI0O 4DR4O 3RT3C 1N32O 3T1YO 1IBLO 1XMQO 2UXDO 4B3SO 3T1HO 1NS1A 4X66O 1F7YA 4B3RO 5LMUO 3M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 O;  4LF9 O;  4DV1 O;  1AIL A;  4LF7 O;  4OPA A;  5A2Q N;  4DV0 O;  2LW7 A;  5LMN O;  1KUQ A;  5H5N A;  4LF8 O;  1XNR O;  4LFC O;  4DV6 O;  4AQY O;  1HNZ O;  3F5T A;  4DUY O;  4DR6 O;  1A32 A;  4X62 O;  2DOS A;  4LFB O;  2ZM6 O;  1HNW O;  4JI8 O;  2VQF O;  4JI3 O;  5BY1 A;  4JI4 O;  4A5U B;  3R66 A;  2UUA O;  2AGA A;  4JI7 O;  2DJV A;  4LF4 O;  4DV7 O;  4DV4 O;  1FJG O;  2F4V O;  4DV2 O;  5IWA O;  4KHP O;  1XMO O;  2JRI A;  4DV5 O;  1R1B A;  2UXC O;  4X64 O;  4JI2 O;  4JYA O;  4JI1 O;  1AB3 A;  4DR2 O;  1XNQ O;  5IT9 N;  2ZKO A;  4YY3 O;  1N36 O;  3J81 N;  2UUB O;  1IBM O;  4B3M O;  3SDL A;  4DR3 O;  1IBK O;  4DV3 O;  4X65 O;  4B3T O;  4GKJ O;  4LFA O;  3J7A U;  1X59 A;  2UU9 O;  4LF6 O;  2VQE O;  1J5E O;  2UUC O;  1I94 O;  5BR8 O;  1HR0 O;  4JV5 O;  1G1X B;  2E5L O;  4DR7 O;  3J80 N;  5FLX N;  4DUZ O;  4OX9 O;  4NXN O;  4GKK O;  3OTO O;  4YHH O;  5LL6 Y;  4NXM O;  1N33 O;  4DR1 O;  1HNX O;  4JI5 O;  1XEQ A;  2UXB O;  4JI6 O;  2HHH O;  1YZB A;  4DR5 O;  3JAM N;  2FKX A;  5BXZ A;  1DK1 A;  2N74 A;  1FKA O;  4K0K O;  2Z0A A;  1R6T A;  3O65 A;  1N34 O;  1D2D A;  4OPH A;  1FYJ A;  4JI0 O;  4DR4 O;  3RT3 C;  1N32 O;  3T1Y O;  1IBL O;  1XMQ O;  2UXD O;  4B3S O;  3T1H O;  1NS1 A;  4X66 O;  1F7Y A;  4B3R O;  5LMU O;  3M8A A; 
#chains in the Genus database with same CATH topology
 4JI4 B;  2X0L A;  1PD3 A;  2UUA B;  1YCI A;  4H37 A;  2QM7 A;  5LGT A;  5H5N A;  3KG2 A;  4X20 A;  5B3S C;  5IYC O;  4FIP C;  4DUY O;  4FMT A;  2NLJ C;  3BPZ A;  1SQG A;  4X64 B;  5KLV H;  1KQS U;  1KP3 A;  4I9W A;  4A5U B;  1QBZ A;  4QGP A;  2AHY A;  1KEC A;  3JCZ A;  1NU1 H;  1JVM A;  1URF A;  3SPC A;  4NR1 A;  2E74 B;  1WP8 A;  3ABM C;  2DYS B;  4TWK A;  4X1I B;  2CTR A;  5IT9 N;  3LDD A;  5IDJ A;  3TET A;  4MTO A;  2CTQ A;  3BHP A;  4X88 A;  4WFE A;  2ZQM A;  4ZBM A;  3ZRX A;  1YTF D;  5GON B;  3SPJ A;  3ETG A;  1VQN V;  3TGU H;  3OUF A;  3OW2 U;  4O4L A;  2P7T C;  1PNL A;  1ORQ C;  2XND G;  1S77 D;  4OX9 O;  4UCO A;  3ABL C;  3JAW B;  2XTA A;  3F5W C;  4X8A A;  4QPK A;  2P4K A;  4WFB V;  4QNH B;  1Z2G A;  4NYK A;  4N21 A;  2Q6A A;  4PEL A;  5H6R A;  3SJQ C;  1FJG B;  4JV5 B;  3WG7 C;  2UXB O;  3A8T A;  4WFH A;  4FZ1 A;  4IHJ B;  3R65 A;  2YEV B;  5EYP B;  3CXH F;  1G8M A;  3AG7 A;  4ZOL B;  2ZE5 A;  4HNA A;  2JGD A;  1PNK A;  1RPO A;  1V54 C;  4YXW G;  2ZDI C;  3KKY A;  2PF4 E;  4X66 O;  5CA1 A;  3M8A A;  2OTJ V;  2X6B A;  3AK3 A;  4PJ0 Z;  1WPB A;  1I7F A;  3K58 A;  2LFS A;  3JD1 A;  2WLJ A;  4I5S A;  4LFC O;  2F66 C;  4DYL A;  3I56 V;  3U0Z A;  1PKX A;  4LFB O;  3CCR V;  3H1I H;  3E35 A;  3E83 A;  4ZI7 B;  3VQY A;  2JGU A;  2YS8 A;  1TGO A;  2NN4 A;  1Q43 A;  2XAJ A;  1AP5 A;  2EJR A;  3QO5 A;  4JYA O;  3QNE A;  1XOU A;  4K0K B;  2PI5 A;  3O9O A;  1LNQ A;  4YY3 O;  3CYO A;  3J81 N;  1I08 A;  4UXN A;  2E5L B;  3OEE G;  2QDO A;  4QPJ A;  1M90 W;  4KFM A;  5BMV B;  3E8B A;  1AR1 B;  1IBK O;  1SQB H;  1HWY A;  3JAK B;  4J80 A;  4PA6 A;  2HP8 A;  3K3W A;  2E75 B;  3FB5 C;  2ODM A;  3SYA A;  1QNM A;  1IVS A;  1BL8 A;  3OD4 A;  5KHI A;  3TXQ A;  3CCM V;  4DR7 O;  4DUZ O;  2Y0I A;  2RJZ A;  5LHG A;  3CCQ V;  1I0H A;  4HAM A;  2QEX V;  2GSM B;  5JH7 A;  2QWQ B;  2WWW A;  1SA0 B;  2D3O W;  3HPL C;  2ZR3 A;  3N2K B;  2DWE C;  2IBZ H;  4UCV A;  4B7K A;  1P7B A;  2FKX A;  3ZHU A;  2QA4 V;  2Y4U A;  4ZHQ B;  4LF8 B;  1XNR B;  2XOK G;  3RVY A;  1Y6X A;  5LA6 B;  4AQY B;  1VF6 A;  2HJD A;  4AI8 A;  3T1Y O;  1XMQ O;  5J2T B;  4B3S O;  1SER A;  4KL1 A;  4TV8 A;  1SET A;  4LF9 O;  1XI1 A;  4DK1 A;  4E4E A;  5BZB A;  3VOU A;  4X9Q A;  3OR6 C;  4X1I A;  1NTK H;  4DV5 B;  4DW1 A;  4DO2 A;  1IX9 A;  4JI1 B;  5KAI Z;  1N36 B;  4G28 B;  2B5U A;  4O2B B;  4MTG A;  3SYP A;  1QVF U;  3N27 A;  4D7S A;  3CC7 V;  2IJJ A;  2PUS A;  4QJF B;  1QQC A;  2QJ1 A;  4TQD A;  2EIL B;  1K9M W;  5GON A;  1K7D A;  1E1R G;  4AHC A;  2F1M A;  3ZN1 A;  4MT8 A;  2EZO A;  3ABM B;  2F95 B;  1S5L Z;  3JAW A;  4DR3 O;  5LGN A;  2MW2 B;  3ASN B;  2ZXW B;  3JAS B;  5EBW C;  4YHH B;  5FPR A;  3CSX A;  5B1A C;  4PA7 A;  4IHJ A;  4J41 A;  2YEV A;  5EYP A;  1JQ0 A;  3CS5 A;  4JYB A;  2Q7H A;  3CRQ A;  4ZOL A;  1GM8 A;  3HKD B;  1PNM A;  1GN4 A;  2QE7 G;  4K8Z A;  1NKD A;  5IJ9 B;  4JAU A;  2ZCE A;  3AG2 B;  4HZ3 A;  4I50 B;  5KA5 A;  1QR8 A;  2ARH A;  1P49 A;  2ZIN A;  2IJK A;  2QM8 A;  3FB8 C;  2F4V B;  2HHH O;  1YZB A;  2DYR C;  3B8N A;  3ABL B;  1FKA O;  1E1Q G;  1MMM A;  5LMN B;  4PDV A;  4UVB A;  3FX7 A;  1FXV A;  1B6Q A;  2DN9 A;  2IM9 A;  2GBO A;  1NS1 A;  1NR7 A;  1MG1 A;  1ZSP A;  2R9I A;  4LF5 O;  2CK3 G;  2CAZ C;  1AIL A;  4DV1 O;  4ZI7 A;  3WB1 A;  1RFY A;  3UCS C;  2F93 B;  5J2U B;  3CC2 V;  2Y4T A;  5B66 Z;  1GMG A;  1FFX B;  1MA1 A;  2YIA A;  5E1A C;  1Q90 D;  2DQ0 A;  5CBH A;  2QM4 A;  2JEU A;  4H44 B;  5BY1 A;  1YXB A;  4PA9 A;  3W7U A;  4JI7 O;  4DV4 O;  5K1X A;  4J9Z B;  3CRC A;  3BA8 A;  1Y67 A;  3JAK A;  2HG5 C;  2OCH A;  4NB5 A;  3K59 A;  3B4S A;  4DR2 O;  1XUQ A;  1VQ5 V;  3CX5 F;  2WLK A;  4MW3 A;  1GRJ A;  4YIO A;  4H13 B;  4DV3 O;  3JD3 A;  1SA0 A;  2A7W A;  1N33 B;  3N2K A;  2HKO A;  4DV0 B;  4GUN A;  3H9V A;  2DWD C;  4GYC B;  5CBG A;  5DM6 V;  4ZHQ A;  4GT1 A;  2R9A A;  3J80 N;  2G38 A;  2WPD G;  1SF9 A;  5LA6 A;  2IU0 A;  4D7T A;  3D3Q A;  4PHZ A;  3K79 A;  1FPO A;  4FLY A;  4GX2 A;  5J2T A;  4EEQ A;  1THZ A;  5KA6 A;  5IYD O;  4DR1 O;  1HNX O;  4J11 A;  4LF7 B;  1DK1 A;  4G27 B;  1BHA A;  3RYC B;  3RWR D;  5ITZ B;  2OWO A;  2B9Z A;  3K03 A;  4MSW C;  4DR4 O;  4JAS A;  1NTZ H;  2PTM A;  4MVQ A;  2UXD O;  3K06 A;  1HNW B;  3ZN0 A;  1M9N A;  4O2B A;  1YHQ V;  1ROP A;  1KUQ A;  1S72 V;  1BMF G;  5AG2 A;  2R9R B;  1DLB A;  4GKJ B;  4LFA B;  4FLV A;  4FLW A;  4UVC A;  3FYE B;  5KUM A;  4R8C A;  1XNQ B;  1DTO A;  1AI7 A;  1LUV A;  3EVK A;  1JX9 A;  2Q8V A;  5EIB C;  2UUB B;  1LR1 A;  1J95 A;  1WB8 A;  2FL4 A;  5IWA O;  3JAS A;  2Q5Z A;  1Z5V A;  1GH6 A;  1VEW A;  3OAA G;  3K0G A;  3CB2 A;  4LR3 A;  2W6I G;  4WCE V;  4LF6 B;  1P84 F;  2VRZ A;  3ETE A;  1R3J C;  2P67 A;  3HKD A;  4CH3 A;  4NKG B;  2A9H A;  5D5Q A;  2ZIM A;  4IYH A;  5IJ9 A;  1SQX H;  1M1K W;  4GX0 A;  3WB2 A;  2IH3 C;  4I50 A;  4B3T O;  1Q86 W;  1BCC H;  2DQ3 A;  1EFR G;  2EIN B;  1I5Y A;  3BAB A;  4LP8 A;  3STZ C;  2A3Q A;  3UT5 B;  1CEZ A;  3E8H A;  2W0F C;  5CB4 B;  1U97 A;  5A9G A;  4DW0 A;  3D36 C;  1NI8 A;  2ZR2 A;  4NXN O;  3ZBH A;  3G80 A;  5GW7 A;  2ZD9 A;  5B1A B;  4I9Q A;  2O57 A;  4ZKI A;  4NXM O;  1VQM V;  3H1L H;  1H38 A;  2ZNI A;  3FAV B;  2KSD A;  2JEX A;  3JAM N;  2ZDI A;  3T4D A;  5J2U A;  3X2Q B;  3ZS8 C;  1TA8 A;  2H94 A;  1ZWI C;  1FFX A;  1QHT A;  3WU2 Z;  1D5N A;  3MD0 A;  4DR6 B;  1O9H A;  4PDR A;  4G2K A;  4LC1 A;  5DN6 G;  3RT3 C;  1N32 O;  4CBC A;  3F7Y C;  1D5A A;  2WLM A;  4LBE C;  1ENV A;  3MHS C;  4LF4 B;  4DV7 B;  4BW9 A;  1JR9 A;  4J7J A;  4DV6 O;  1M56 B;  2F43 G;  2DOS A;  3IFX A;  1VQO V;  1WNS A;  2YXY A;  3SPI A;  4OX9 B;  3R66 A;  3RN4 A;  2DJV A;  1JJO A;  2DW4 A;  2Z3Y A;  3TK1 A;  2WLL B;  1VMG A;  3VBB A;  1JJ2 U;  4F6E A;  3JAT B;  4E2L A;  2UXC O;  1YVW A;  2NR5 A;  2FB5 A;  2RCV A;  1Y66 A;  4J9Y B;  1I94 B;  4RO2 A;  1R6K A;  1YI2 V;  2BOB C;  2EIL C;  4B3M O;  4FLU A;  4PA4 A;  2JS5 A;  2QSA A;  4K3A A;  3ZHR A;  3HKB B;  3JCU Z;  3IGA C;  1NVP B;  4X65 O;  5H2F Z;  3OE7 G;  1S5J A;  3L71 H;  4J7Z A;  3FKS G;  4O2A B;  1GAX A;  2VQE O;  1J5E O;  5KX5 B;  3E86 A;  3B8M A;  4DR5 B;  3RYC A;  3ASN C;  2ZXW C;  5HFL A;  4LFC B;  5ITZ A;  4C7U A;  4KP4 A;  2QKS A;  2CDY A;  5DEC A;  4TT3 G;  4RAI A;  3ZMS A;  3HR0 A;  5HFM A;  4KHP B;  1AJN A;  3RW0 A;  1W0J G;  1MNG A;  2N74 A;  1K4D C;  3AG2 C;  4OPH A;  1FXK C;  1EN6 A;  1HP8 A;  4N23 A;  2AZ0 A;  2F23 A;  3FB6 C;  2R72 A;  1YF2 A;  1M93 A;  5LMU O;  1M4U A;  3DGE A;  4JI3 B;  1BZK A;  4TSF G;  1S76 D;  1X4T A;  4J10 A;  4U7N A;  1BQ0 A;  1WA8 B;  5B1B B;  4R50 A;  5JQG B;  2K9P A;  2OCC B;  1R3I C;  4JI4 O;  3E8G A;  2KKW A;  2UUA O;  2AGA A;  3QG5 A;  3CHX A;  1H2K A;  5JJE B;  4W4K A;  2W0X A;  1Q3E A;  4Z1M G;  3OR7 C;  1XL4 A;  1R6N A;  5JVD B;  3RVZ A;  4P30 A;  4BIO A;  3MAQ A;  4X1Y B;  3UT5 A;  1ZX3 A;  4X64 O;  2IJH A;  2UU9 B;  4XDK A;  3AG1 B;  4CH5 A;  5CB4 A;  2CGN A;  1ZTE A;  2UUC B;  1Q82 W;  1DGS A;  2WLN A;  3E89 A;  1Y4M A;  3CXC U;  4GKK B;  3A0R A;  3NR7 A;  3T1Y B;  1XMQ B;  1GN2 A;  2V7Q G;  3OTO B;  3IJ4 A;  2ZNJ A;  1XQ8 A;  3BY6 A;  4GX1 A;  3FAV A;  3ML0 A;  1KP2 A;  3JD4 A;  4JI5 B;  2XAQ A;  3CE2 A;  5BR8 O;  1VP7 A;  3HKE B;  1G1X B;  1T5E A;  2N04 A;  5FLX N;  3OMI B;  3L72 H;  2FTK A;  2H3O A;  4X89 A;  1XIL A;  2VWK A;  3UO3 A;  1IBL B;  2Y69 B;  4W4L A;  4O4H B;  3CJH B;  4XDJ A;  4BW5 A;  3W7X A;  2Z0A A;  2YC0 A;  2XAS A;  3U11 A;  3L70 H;  3CCJ V;  1P7G A;  4HYO A;  3GWO A;  3K08 A;  4IIJ B;  1OCZ B;  3RYH B;  2KB1 A;  5CN0 A;  1AR4 A;  1QLE C;  1Q8I A;  4CC6 A;  5DED A;  3APQ A;  1R73 A;  2GUZ B;  4JV5 O;  1K5Q A;  1KMI Z;  5JCO C;  1UFI A;  3JSN A;  3ZMT A;  5A2Q N;  1SES A;  3P3P A;  2WLL A;  2AW9 A;  3JAT A;  4Z1V A;  2QWO B;  4PV1 B;  1Q6H A;  4EKW A;  3BA9 A;  2HLD G;  2CTW A;  1N8R W;  3Q4H B;  1Q6I A;  1S3J A;  3ICX A;  1SZX A;  3HKB A;  2YIC A;  1BSM A;  3ZMZ A;  5L3E A;  2CH7 B;  4O2A A;  5KX5 A;  4P2Z A;  2GTA A;  1IXM A;  3AG3 B;  4AIL C;  1MZE A;  2ZKO A;  1F51 A;  1TVK B;  3ZHS A;  1B3Q A;  5C8Y B;  2Q67 A;  4U7O A;  2QGN A;  2LGQ A;  1PL4 A;  3W7S A;  1BE3 H;  1JMK C;  3CD6 V;  4MVS A;  1GN6 A;  4RUF A;  4TUY B;  1B06 A;  3A0B Z;  5JJN B;  2EIK C;  2E5L O;  1E79 G;  2EIN C;  2HFE C;  2BOC C;  3IC7 A;  3QVN A;  5LHI A;  4B7E A;  1RM1 C;  1NVP D;  1VIB A;  3T1H B;  4B3R B;  1XEQ A;  3H1K H;  1JFF B;  1H2N A;  2BTO A;  3P30 A;  2ILM A;  3U10 A;  4RWU A;  2WLH A;  1OV9 A;  1KC8 W;  1N34 O;  5KAF Z;  4JPR A;  4JI0 O;  1WA8 A;  3A0H Z;  4DR2 B;  2OT5 A;  5JQG A;  1WP7 A;  1YSC A;  3X2Q C;  4UB6 Z;  1VQ7 V;  4JF3 A;  3SJB C;  2VQF B;  1L8D A;  1FXK B;  2FML A;  3JD0 A;  4DV2 B;  4WFG A;  4LF8 O;  1CXZ B;  1XNR O;  5JVD A;  1MZF A;  4AQY O;  2XAH A;  4X1Y A;  4X62 O;  3LSU A;  4Z2W A;  2CGO A;  2QWP B;  4LWS B;  3DTU B;  2ZM6 O;  4HBN A;  1SQQ H;  3ETD A;  2CUG A;  2EUL A;  1M56 C;  2CE4 A;  1S0V A;  3CPW U;  4DV5 O;  4OGQ B;  4O4I B;  2V4D A;  2OYQ A;  2LO1 A;  3LSS A;  4JI1 O;  1AB3 A;  2ATK C;  3HKE A;  4DK0 A;  5K1P A;  1N36 O;  4BIZ A;  4MW8 A;  1NJI W;  2P90 A;  4X1K B;  4Q6G A;  3JYC A;  3SDL A;  4FVM A;  2HJF C;  2Q4P A;  3KCX A;  1SZT A;  2IJI A;  1CPY A;  1US6 A;  5BMV A;  3D36 A;  3ZHV A;  1FD9 A;  4O4H A;  3CJH A;  2PI4 A;  2GV9 A;  3L73 H;  4JI6 B;  5EIB D;  1W59 A;  4IL6 Z;  1IXB A;  2WA3 A;  4WF9 V;  1K92 A;  4IIJ A;  3RYH A;  5LYJ B;  4YHH O;  1S5H C;  2GUZ A;  1COW G;  2L35 A;  3BRC A;  4MS2 A;  4D6T H;  3ZMV A;  4FFB B;  3GB7 C;  4CH6 A;  3JSL A;  2WLI B;  2Q0A A;  3N2G B;  2YUA A;  1L0L H;  1MSW D;  3LDE A;  3ZCC A;  5IY5 B;  2RQ6 A;  4O4J B;  3CWB H;  1GM9 A;  3Q4H A;  2Q7E A;  5LXT B;  2MK3 A;  4JI8 B;  2QR4 A;  3ZRV A;  2DE0 X;  2Q7G A;  1NT2 B;  3A2F A;  5KHG A;  2BCC H;  5LMN O;  5D5P A;  1QLE B;  3E8F A;  5FNV B;  2CH7 A;  1SS3 A;  3B09 A;  4I0X B;  2Q0O C;  2EZP A;  1K33 A;  4FK5 C;  1TVK A;  4F6R B;  3VQX A;  5C8Y A;  2N05 A;  3VQV A;  1Y76 B;  5CA0 B;  5LP6 B;  4NXM B;  2P4V A;  5B1B C;  2JJ1 G;  3T1C A;  3ABT A;  1XMO O;  1XBL A;  2OCC C;  4FLX A;  1IZ3 A;  1EN4 A;  3EHB B;  5CBF A;  3ZHT A;  1AJQ A;  5IJ0 B;  4JI2 O;  4LH6 A;  4TUY A;  5LBQ A;  4KUM A;  1NTM H;  3WFV A;  2K1E A;  2ZE8 A;  1KKC A;  1IDS A;  1IBM O;  4MVM A;  2JIZ G;  3K0D A;  1N32 B;  2A0L A;  4EB6 B;  1QCE A;  5CA3 A;  3G67 A;  2LJ2 A;  3AG1 C;  3CCL V;  5L3G A;  2ITC C;  1JFF A;  1BT8 A;  1V9P A;  3RFR A;  3JAR B;  2X6A A;  2YIB A;  2QKA A;  3I5D A;  1VQL V;  1AP6 A;  2HR3 A;  3OGC C;  4ICG A;  1HR0 O;  5J9P C;  3B77 A;  4DV6 B;  3OUS A;  2LGW A;  4YIP A;  5LL6 Y;  1N33 O;  4NTX A;  4K35 A;  3AK1 A;  3M7M X;  2EIK B;  1FXK A;  2P5O A;  2Q68 A;  4MVU A;  3ETQ A;  3FYI B;  2XAF A;  1R6T A;  3O65 A;  3EFF K;  1YJN V;  2UXC B;  1D2D A;  1JCH A;  1RM1 B;  4DUY B;  2Y69 C;  4LWS A;  4R7C A;  3K04 A;  5CA1 B;  4UVA A;  4WBN B;  3G4S V;  3FFQ A;  2VS0 A;  2YID A;  4LF7 O;  4CS2 A;  2LFR A;  3HKC B;  1OCZ C;  2LW7 A;  2B1I A;  3TXS A;  3CC4 V;  3L9D A;  4X65 B;  2YIB D;  3RBZ A;  2PZS A;  4L8J A;  4FZ0 A;  4O4I A;  3LNN A;  1YIJ V;  3F5T A;  1BHB A;  1A32 A;  2Y0P A;  1AJP A;  2ZIO A;  4FM2 A;  1HNW O;  3CCU V;  5EBL C;  4X1K A;  3TJT A;  3SYQ A;  1ZAU A;  2EIJ B;  3S3W A;  2YSU B;  3E2E A;  1CP9 A;  4MTF A;  1YDX A;  1R1B A;  3CCE V;  1GN3 A;  1NH2 B;  1N0N A;  1WAZ A;  3BAA A;  1XNQ O;  4BIU A;  1F4M A;  1XL6 A;  4JTC B;  1AI4 A;  3PJS K;  5L3B A;  2UUB O;  1YIT V;  5LYJ A;  1V55 B;  3AG3 C;  1K5S A;  4TQF A;  4FFB A;  1B04 A;  3MHH C;  4LF6 O;  2WAM A;  2WLI A;  2UXB B;  2QTS A;  3N2G A;  4GX5 A;  2A79 B;  1NQT A;  2ADP A;  3SJC C;  1OHH G;  4CZZ A;  1K8A W;  1VQK V;  1EZV H;  1AVM A;  2D2C B;  4O4J A;  1QR9 A;  4B08 A;  2YDE A;  5LXT A;  1U96 A;  1H2L A;  1W0K G;  3SPG A;  4X66 B;  4ASU G;  1GTO A;  1R3L C;  2JK5 C;  3CEI A;  1BGY H;  3ZRW B;  4IYI A;  5FNV A;  4UCU A;  1EBO A;  2YI8 A;  4TOI A;  4I0X A;  5JCO A;  2XHB A;  2LW1 A;  3QF7 A;  1ZLZ A;  4TV8 B;  3DC6 A;  1YEW A;  2IU3 A;  4CS3 A;  4EFE A;  4RUE A;  4F6R A;  4QE9 A;  4LFB B;  1W2B U;  3ZRS A;  1JOY A;  3I55 V;  1Y76 A;  5CA0 A;  5LP6 A;  3C3T A;  2R70 A;  1HNZ O;  3LSQ A;  5IJ0 A;  4DR6 O;  1KYO F;  5BR8 B;  2JVD A;  2ITD C;  4EFB A;  4JYA B;  1OCO C;  3OMN B;  1M57 B;  4YY3 B;  3MDS A;  4OXS A;  4LF4 O;  4DV7 O;  4EB6 A;  1WPX A;  3EXA A;  3K5L A;  4Q20 A;  1TUB B;  3ASO C;  1IBK B;  3LNM B;  2KQX A;  3JAR A;  2ZE7 A;  3TCU A;  5B5E Z;  1VQP V;  3JAL B;  4UV8 A;  1SQP H;  1UPG A;  3SGI A;  3OGI B;  4DR7 B;  4DUZ B;  1SKV A;  2AZ2 A;  1H8E G;  1AI5 A;  5FPO A;  1PM9 A;  4J42 A;  1XDC A;  3AEI A;  2DMX A;  3OTF A;  1Q7Y W;  1I94 O;  3P32 A;  1SRY A;  1K3E A;  4RQF A;  5GTH Z;  2QTO A;  2XAG A;  2IW5 A;  3UQ8 A;  4GZR B;  3H1H H;  4WBN A;  2WA4 A;  1N4C A;  4B3S B;  4XBF A;  1MAB G;  2YXH A;  3HKC A;  4DR5 O;  4LF9 B;  2EIM C;  5IYZ B;  3LUT B;  1NZ6 A;  3STL C;  4PDM A;  1BS3 A;  1FYJ A;  3VQW A;  1JA8 A;  2BSK B;  2FYU H;  4XDL A;  3K5O A;  4KHP O;  2NNU A;  4TV9 B;  2JDI G;  1H2M A;  5IY5 C;  2Z5U A;  1WJZ A;  2OIE A;  4WFA V;  3KCY A;  4NTW A;  1WB7 A;  1NR1 A;  2LP7 A;  2YXL A;  3RYI B;  1KD1 W;  1KB9 F;  4IGG A;  3H1J H;  3UO2 A;  4YJ2 B;  3UM7 A;  2EJ7 A;  4PA3 A;  4JI3 O;  2ETN A;  3AG4 C;  1FJG O;  4JTD B;  4H0L B;  4DR3 B;  1QU7 A;  4JTA B;  5EZY B;  1ARO P;  2HVJ C;  4MVZ A;  4BWA A;  2C2A A;  2M7W A;  2V1D A;  1GM7 A;  2BTQ B;  1OCR B;  5LP6 C;  1G4Y B;  1N34 B;  3GVM A;  1K73 W;  4JI0 B;  4UUJ C;  5L3F A;  3DXR B;  3CCV V;  4I4T B;  1FS0 G;  1VQ9 V;  5KHK A;  1KU9 A;  3RYF B;  1NBM G;  5KHJ A;  3J7A U;  2PYJ A;  2UU9 O;  1HDJ A;  2UUC O;  1NH2 D;  5KUK A;  2HHH B;  3QO8 A;  3ZRW A;  1GKF A;  3ABU A;  4ZIB A;  4X62 B;  4U3F H;  4GKK O;  2E3C A;  4F4L A;  4UFZ A;  3OTO O;  2ZM6 B;  5B1N A;  4LH7 A;  2EBO A;  2UXX A;  4JYC A;  1L1F A;  3BEH A;  4JI5 O;  1PV0 A;  1YJW V;  1OCC B;  4LF5 B;  4BAY A;  1VQ4 V;  4DV1 B;  1Q5O A;  4U3J B;  4K0K O;  2PGG A;  4JAV A;  3OMA B;  1FXH A;  1AR5 A;  1FAF A;  2EX3 A;  5KMG B;  3IC9 A;  3K5M A;  3T2M A;  1IBL O;  5B3S B;  3QO7 A;  2LQT A;  5L3C A;  1G6U A;  3D8C A;  3ZX6 A;  2PY5 A;  5H9C A;  4JI7 B;  1EN5 A;  1H2S B;  4DV4 B;  4CS4 A;  2QWN B;  1QVG U;  5C93 A;  1TUB A;  3ABK C;  5LHH A;  3S3X A;  3SYO A;  3BFR A;  3WB0 A;  2E76 B;  3JAL A;  4DRX B;  1SQV H;  2GDS A;  3H01 A;  4UB8 Z;  1Q6U A;  4I55 B;  1GO3 F;  1R3K C;  3OEH G;  5L3D A;  3QTC A;  2JRI A;  1OCO B;  4DV3 B;  5H6Q A;  2AXT Z;  2Q9L A;  4JGS A;  3FD9 A;  2RN9 A;  3THO A;  1RPR A;  2BE3 A;  1RSO B;  3HB3 B;  3NXS A;  3L74 H;  2EIJ C;  2IH1 C;  3ASO B;  2JS3 A;  5F2V O;  3T4Z A;  1L0N H;  1N0J A;  5LOV B;  1FFT B;  1QLN A;  2P6J A;  2ZT9 B;  2M6Y A;  5JWP A;  3OM3 B;  4PI2 A;  4FM0 A;  1XHX A;  4DR1 B;  1HNX B;  5IYZ A;  3OT7 A;  3SJA C;  4L87 A;  3JD2 A;  1V55 C;  1Y74 B;  3WG7 B;  4FPP A;  1LUW A;  5IE9 A;  3APO A;  4YJ3 B;  4LNU B;  1ZL8 B;  2BSK A;  2KG7 B;  4DR4 B;  3B2E E;  3GWK C;  1OJH A;  1SC5 B;  2UXN A;  4TV9 A;  2UXD B;  1V54 B;  2PYL A;  1F4N A;  3G6B A;  4FLZ A;  4QE7 A;  3KZI Z;  4MVO A;  2ADQ B;  5LGU A;  1O9G A;  1XMO B;  1DF5 A;  3G6E V;  1EM1 A;  3RYI A;  1Z5W A;  3CMA V;  4JI2 B;  1XRE A;  1OZ0 A;  3ZIA G;  4QIW F;  2EIM B;  4YJ2 A;  3BCC H;  3T1H O;  4B3R O;  4ABM A;  1IBM B;  3PN1 A;  1SQF A;  1UJW B;  5KHH A;  1VF6 C;  1TAE A;  3K5N A;  5EZY A;  3SR2 C;  4PDL A;  2HEP A;  4J7K A;  5IWA B;  2A06 H;  4FLT A;  2HVK C;  2QWR B;  1YJ9 V;  2YI9 A;  2BTQ A;  4MTX A;  2XUM A;  1PP9 H;  1HR0 B;  2H8P C;  2DYS C;  2VQF O;  2GHY A;  4UCS A;  3E22 B;  3DXR A;  1IUR A;  2F4V O;  4DV2 O;  4I4T A;  1BQZ A;  3SPH A;  4FM1 A;  2X7R B;  3BVO A;  1VF7 A;  4RQE A;  2RMK B;  1P4R A;  4X20 B;  3RYF A;  1YTF B;  2Q73 A;  3F7V C;  1M57 C;  4B3T B;  3AG4 B;  3ZMU A;  1WN7 A;  3B40 A;  1MSD A;  3OFN G;  4I7Z B;  3W7T A;  4NXN B;  3FB7 C;  4DXW A;  3DSQ A;  4PD4 F;  1X59 A;  4U3J A;  2CTP A;  4R6Z A;  4UCT A;  1WLE A;  1ZUQ A;  5KMG A;  3CRA A;  5EC1 C;  3K57 A;  4JYY A;  1H2G A;  3CRM A;  1MOF A;  3C3S A;  4MVR A;  3DC5 A;  4JI6 O;  2VWJ A;  2P06 A;  3ZED A;  2P22 C;  4PI0 A;  5EBM C;  5IYB O;  3CME V;  1M5I A;  5GTI Z;  4O4L B;  5B1O A;  4FJC C;  1VAR A;  4KXR A;  4DRX A;  3K9A A;  1F7Y A;  4WFF A;  5EK0 A;  2XT9 A;  1Q81 W;  4OPA A;  4I55 A;  4JZG A;  4DV0 O;  1F23 A;  2GTS A;  4CC5 A;  3IAY A;  2Q69 A;  3M99 B;  1JPX A;  2RDC A;  4HNA B;  2JGD B;  2RNB A;  3CCS V;  1RSO A;  1GK9 A;  4CH4 A;  4NVP A;  4JI8 O;  2L6L A;  3ABK B;  1KBH A;  5CMU A;  1AI6 A;  2ZE6 A;  4B3M B;  3UKM A;  5LOV A;  4IT5 A;  1EZJ A;  3D3I A;  3SYC A;  3W7W A;  1I5X A;  2W6J G;  1KKD A;  1PL0 A;  3AK2 A;  3K9S A;  5FL7 G;  2VQE B;  4GLX A;  1J5E B;  1VQ6 V;  1Y74 A;  4P9P A;  5E79 Z;  4YJ3 A;  4LNU A;  1ZL8 A;  2KG7 A;  4LCU C;  1OCR C;  1K4C C;  2AHZ A;  3ZHQ A;  4UV9 A;  2WSS G;  1TUE B;  5JJJ B;  3RGB A;  3ZJZ A;  4GKJ O;  4LFA O;  1VQ8 V;  4H33 A;  2X6C A;  3CRR A;  4NTY A;  4UCR A;  1VF5 B;  1PPJ H;  4FFK A;  1HNZ B;  2DYR B;  5EC2 C;  3P3N A;  2OIG A;  1HW7 A;  2QKC A;  3L75 H;  2Y48 A;  4GCZ A;  5LMU B;  3CP1 A;  3C90 A;  1K97 A;  2JJ2 G;  5BXZ A;  4K8X A;  5TIS Z;  2OTL V;  4JAA A;  4BR6 A;  3LDC A;  1XHZ A;  1K34 A;  1OCC C;  1H8H G;  2B1G A;  3G71 V;  4P9O A;  4JZ2 A;  1DF4 A;  1RP3 B;  5JH7 B;  3E22 A; 
#chains in the Genus database with same CATH homology
 4LF5 O;  4LF9 O;  4DV1 O;  1AIL A;  4LF7 O;  4OPA A;  5A2Q N;  4DV0 O;  2LW7 A;  5LMN O;  1KUQ A;  5H5N A;  4LF8 O;  1XNR O;  4LFC O;  4DV6 O;  4AQY O;  1HNZ O;  3F5T A;  4DUY O;  4DR6 O;  1A32 A;  4X62 O;  2DOS A;  4LFB O;  2ZM6 O;  1HNW O;  4JI8 O;  2VQF O;  4JI3 O;  5BY1 A;  4JI4 O;  4A5U B;  3R66 A;  2UUA O;  2AGA A;  4JI7 O;  2DJV A;  4LF4 O;  4DV7 O;  4DV4 O;  1FJG O;  2F4V O;  4DV2 O;  5IWA O;  4KHP O;  1XMO O;  2JRI A;  4DV5 O;  1R1B A;  2UXC O;  4X64 O;  4JI2 O;  4JYA O;  4JI1 O;  1AB3 A;  4DR2 O;  1XNQ O;  5IT9 N;  2ZKO A;  4YY3 O;  1N36 O;  3J81 N;  2UUB O;  1IBM O;  4B3M O;  3SDL A;  4DR3 O;  1IBK O;  4DV3 O;  4X65 O;  4B3T O;  4GKJ O;  4LFA O;  3J7A U;  1X59 A;  2UU9 O;  4LF6 O;  2VQE O;  1J5E O;  2UUC O;  1I94 O;  5BR8 O;  1HR0 O;  4JV5 O;  1G1X B;  2E5L O;  4DR7 O;  3J80 N;  5FLX N;  4DUZ O;  4OX9 O;  4NXN O;  4GKK O;  3OTO O;  4YHH O;  5LL6 Y;  4NXM O;  1N33 O;  4DR1 O;  1HNX O;  4JI5 O;  1XEQ A;  2UXB O;  4JI6 O;  2HHH O;  1YZB A;  4DR5 O;  3JAM N;  2FKX A;  5BXZ A;  1DK1 A;  2N74 A;  1FKA O;  4K0K O;  2Z0A A;  1R6T A;  3O65 A;  1N34 O;  1D2D A;  4OPH A;  1FYJ A;  4JI0 O;  4DR4 O;  3RT3 C;  1N32 O;  3T1Y O;  1IBL O;  1XMQ O;  2UXD O;  4B3S O;  3T1H O;  1NS1 A;  4X66 O;  1F7Y A;  4B3R O;  5LMU O;  3M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...