4B3TO

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3tO00
4DR6O 1XMQO 4X66O 4JI1O 2FKXA 1XNRO 1R6TA 2VQEO 4DV0O 5LMUO 1N32O 2DOSA 5BR8O 4DV4O 1G1XB 1J5EO 4YY3O 2AGAA 4DUZO 5BY1A 5FLXN 4DR3O 4GKKO 1R1BA 4LF6O 1KUQA 1HNWO 1FKAO 3T1HO 4KHPO 1X59A 4OPHA 4JV5O 1A32A 4DV5O 4JI0O 2LW7A 4LF4O 4DR4O 4JI8O 1AILA 4NXMO 2UUAO 1XEQA 4GKJO 3J81N 3J80N 2DJVA 1HNXO 2JRIA 4DUYO 1F7YA 1IBMO 5H5NA 1IBLO 1YZBA 3O65A 4B3SO 4NXNO 1D2DA 4X64O 1N33O 5LL6Y 4DV7O 4DV1O 4JYAO 1N36O 5IWAO 3T1YO 1XMOO 2VQFO 3M8AA 4JI5O 3RT3C 4JI2O 1I94O 2E5LO 3JAMN 2ZKOA 2UXCO 4JI4O 5BXZA 3F5TA 1NS1A 4LF7O 2F4VO 1XNQO 4LF5O 1HR0O 1N34O 2N74A 2UUBO 2Z0AA 3OTOO 5A2QN 1FYJA 4DR5O 2ZM6O 1FJGO 2HHHO 4DV6O 4B3TO 4JI7O 4X65O 4K0KO 4LFBO 1DK1A 4LF8O 4LF9O 4DV2O 1HNZO 2UU9O 4DR1O 4B3MO 4JI6O 4OPAA 2UXDO 4A5UB 4X62O 5LMNO 4YHHO 4JI3O 4AQYO 3J7AU 1AB3A 4LFCO 2UXBO 4DV3O 3SDLA 1IBKO 4LFAO 4OX9O 4DR7O 4DR2O 3R66A 4B3RO 2UUCO 5IT9N
chains in the Genus database with same CATH superfamily
1S77D 3OUSA 4X62B 1I7FA 2CDYA 3ABMB 3U0ZA 3ZMUA 5CBHA 5BR8O 5CA1B 4R6ZA 5KHIA 3DXRA 3TCUA 2G38A 5LA6A 3ABTA 4MVMA 4DV5O 4UVCA 1N34B 4O2AA 3Q4HA 4DR4O 3CJHB 3KG2A 1QVFU 4HNAA 3G71V 3JSNA 2JJ1G 1L0LH 4B3SO 1XOUA 5EZYA 3D36C 4X64O 2HVJC 3STZC 2RCVA 3OGIB 2GDSA 4CC6A 3OUFA 5GONB 4IYIA 4NTYA 1V55C 2Y0IA 3JD3A 1NH2B 1PM9A 4DR2B 3K5OA 1CXZB 4JYYA 2PF4E 3QNEA 3JAMN 3CCRV 4ZOLB 5BXZA 1EZJA 3T4DA 3L70H 4LF4B 3LSUA 2CTWA 3K08A 3NR7A 2ZR3A 1FYJA 2WLIA 2UXXA 4K0KB 1JQ0A 4DR5B 1IXMA 5B5EZ 4IIJA 2ITCC 4JI6O 3LSSA 1SRYA 4WBNA 4YJ3A 2IH1C 2Q5ZA 1RFYA 2BCCH 3SYQA 2IH3C 2PUSA 3M7MX 2LGQA 3D3QA 3T2MA 3APOA 3JATB 1IXBA 1R3IC 1LR1A 4RO2A 2P06A 5JVDA 3SJQC 2OIEA 4MS2A 2OWOA 3JSLA 4GUNA 2KG7A 5JCOA 4DUZO 1E1RG 3H1HH 1R1BA 4QGPA 1AI6A 1U97A 3C3SA 4WCEV 4JI4B 1FS0G 4JV5B 2DJVA 2A79B 3SJAC 3E8BA 1HNWB 5IYBO 4LF6B 3CRMA 1KKCA 3ASOC 3DGEA 5CB4B 2OCCC 2YICA 2VQFB 3ML0A 5BMVB 1PNMA 4GZRB 3ZHSA 3ZHTA 3G4SV 3Q4HB 1ZWIC 4TV8B 5CBGA 3BHPA 1GN3A 4B3RB 4ZIBA 2WLLA 2KSDA 3FAVB 3CD6V 4X20A 2LJ2A 1AJPA 2KQXA 4FM2A 4EB6B 2B1GA 1QR9A 3HR0A 3RW0A 1KP2A 1IURA 4KHPB 4EFEA 1PP9H 1S5JA 4G27B 2DYRB 2IW5A 4LF8B 3FYEB 2LQTA 1FJGO 4CBCA 1NTZH 2CGNA 2ZIMA 4B3TO 5IE9A 5LYJA 4JI7O 2LW1A 5J9PC 1YTFB 1F4NA 4I55B 1K4CC 4UV8A 2Q67A 4LCUC 1HR0B 3VQWA 4QPKA 4IIJB 2Q73A 2XAJA 4GX1A 1NVPB 4X89A 3ICXA 4DR2O 3ABUA 3QVNA 3SYCA 4AQYB 4WFAV 5C93A 3N27A 4NYKA 4FLVA 4DR6O 1YEWA 4JGSA 1VMGA 4KP4A 2RDCA 4BAYA 3ZRVA 2LO1A 2DOSA 2JS3A 3JD4A 5IYCO 1Y74A 5FLXN 2DW4A 2PGGA 1KC8W 2BE3A 3ZMTA 5DN6G 3H9VA 3W7SA 1SQXH 1GN2A 3L71H 1A32A 4GKJB 4NR1A 3A0BZ 1GM8A 2ZE5A 2EIKB 2YEVB 2WA4A 3RBZA 3SPGA 2N04A 5A9GA 5CMUA 2E3CA 4I5SA 1RM1B 4YY3B 1K73W 4TUYA 1OCOC 2IJKA 5D5PA 2Q0OC 5JVDB 4NXNB 2XAFA 1EM1A 1SA0A 5BZBA 5IJ9B 1WB8A 2XAHA 3UQ8A 3BVOA 4OXSA 2A3QA 4X1KA 1N34O 3JAKB 2ZDIA 2X0LA 4ZHQB 5IJ0A 1N8RW 3ZHVA 1BS3A 5L3EA 4GYCB 2QWNB 1M5IA 3K9AA 1FJGB 4X8AA 4PELA 5ITZA 1NJIW 3K04A 1JA8A 4X62O 1WB7A 1B06A 1QHTA 4J7KA 4BW9A 1QU7A 3B8MA 3JALA 5IT9N 2JEUA 1BZKA 4K8ZA 3CCQV 5KAFZ 3CXCU 1YTFD 4ZI7A 1Z5WA 3FB8C 2NNUA 1QVGU 2VRZA 2Y4UA 1YVWA 4G28B 4PHZA 1NBMG 4J9ZB 4AI8A 2R9IA 1BSMA 2QWQB 3CCJV 5GTHZ 4LF4O 4KL1A 4GKJO 4LH6A 2XHBA 1F7YA 3W7WA 3P32A 3CCUV 1YJ9V 3O65A 5C8YB 3T1YB 4JF3A 3AEIA 3CP1A 1FXHA 3B4SA 1XL6A 2OYQA 2JK5C 1I08A 1NKDA 3ABLC 1XMQB 3T1YO 2P5OA 3LDDA 2IBZH 1VQ7V 5LOVA 4JI2O 4H0LB 1K4DC 3JATA 5K1PA 2WLIB 4JI3B 1XL4A 1KD1W 4TV9B 4XDKA 2Z5UA 2N74A 5JH7A 4TSFG 1NQTA 3N2KB 2GUZB 4J7ZA 4KXRA 4DRXA 1AR1B 4FZ1A 3JALB 1GTOA 2FMLA 1W0JG 3E8GA 1DK1A 4X1YB 3OM3B 5B66Z 1N0JA 3H1KH 4IT5A 4FMTA 2UXCB 4E4EA 2DE0X 4FJCC 2AZ2A 4LFCO 1OV9A 2WA3A 1SQGA 4I55A 3HB3B 2BOCC 5KX5A 1S72V 1K5QA 4B3RO 5JQGA 5L3DA 4IHJB 5LP6C 5IYDO 4DW0A 3OEHG 5LMUO 5B1NA 2P67A 2LFRA 4MVRA 3FFQA 1ZL8B 3ETQA 1F51A 1PV0A 3CCLV 4LF6O 4U3FH 1Q3EA 4JAVA 2BTQA 3HPLC 4EKWA 2QR4A 3AG4B 1VQ9V 2X6BA 3BA9A 2UUAO 3RYIB 1R6NA 1KB9F 1JFFA 1W59A 2GBOA 1ORQC 1K33A 4WF9V 4I4TA 3ZN0A 1VQ6V 5CB4A 2P90A 5JJJB 3WU2Z 5J2UA 1SERA 3L72H 2OT5A 2EZPA 1N32B 2FL4A 1NTKH 2R9RB 1OZ0A 1XREA 1I94O 5JWPA 3K06A 3WG7C 3H1JH 4DR7B 2JGDA 1VQPV 1HWYA 4BIZA 3ZHUA 3RVYA 1BGYH 4PA6A 5KLVH 1HW7A 4LWSB 1M1KW 1R3KC 4LF5O 1P4RA 3OTOO 2ZD9A 3ASNC 2R9AA 2GUZA 3UKMA 4AHCA 4X65O 2QM7A 1EN6A 4TV9A 2QE7G 4LF7B 1VF6A 1VQKV 4XDLA 3ZX6A 1TUEB 2QM4A 1XHXA 3HKEA 2N05A 1K3EA 3SYOA 1KECA 4Z2WA 2ADPA 5LYJB 5B1AC 2GTAA 3CE2A 1AI7A 4H44B 5IWAB 1WAZA 5GTIZ 1VQMV 2DWDC 1YITV 5FPOA 2DQ3A 1QLEB 4DR1B 5EBLC 1UJWB 1TUBA 5CA0A 5J2TB 2LP7A 1J5EO 3BABA 1MOFA 4I0XB 1SF9A 5BY1A 4GKKO 2AXTZ 1KUQA 5GONA 3AG2B 3VBBA 3OTOB 4CH5A 1X59A 5IDJA 3CX5F 2Q6AA 3ZMSA 2WLMA 3K5LA 2F1MA 3J80N 1VF6C 3M99B 1ZL8A 3QO8A 4DR3B 3QO5A 5EYPA 1YXBA 3BY6A 1XMOB 2EIMC 5JQGB 1I0HA 2CH7B 5EIBC 1N36B 1AJNA 2JS5A 1I5YA 1ZX3A 2QKCA 1NU1H 1CP9A 2VQFO 5KHGA 2YXYA 3P30A 3BRCA 3E22A 1ENVA 3FKSG 3MDSA 3TXQA 2PYJA 4R50A 1RM1C 2ZINA 2A9HA 4DUYB 3WFVA 4DK1A 1K97A 4JI4O 1P84F 3RWRD 1VQLV 2EIKC 1I5XA 1SQVH 2PTMA 2QEXV 1WNSA 4LWSA 5A2QN 1ZLZA 2ZM6O 3OR6C 3H1LH 3W7UA 2M7WA 3GVMA 4DV4B 3BPZA 4WFFA 4WBNB 4MSWC 4YHHO 4L87A 1EFRG 5B1BB 3QO7A 4U7OA 3X2QB 1SQPH 4UFZA 2ZE8A 4LFAB 4DV3B 5CBFA 1AVMA 2PYLA 2UUCO 3O9OA 4JYAB 2RJZA 3NXSA 2P7TC 5IYZA 1X4TA 2EULA 2ZCEA 4R7CA 4LFBB 1OCRC 1DF4A 3KCXA 4YY3O 4HZ3A 5BMVA 1HNWO 2X6CA 2DYRC 4OPHA 1PNKA 1GK9A 2W6IG 3HKDA 3J81N 3OGCC 2QA4V 1G4YB 1BL8A 4I50B 4CH3A 4TUYB 1JCHA 2RQ6A 4O4LA 2RN9A 2HJDA 2DMXA 1YIJV 3RYHB 2YXLA 3JASA 3GWKC 2V7QG 2ODMA 5HFLA 2ZE6A 3JCZA 5LL6Y 3LNNA 1OJHA 4X1IB 1IZ3A 2GHYA 1OCZB 3ZHRA 4PA4A 1OCCC 3PJSK 3M8AA 1UPGA 2ZXWC 3CCSV 2E75B 2PY5A 1PD3A 4NB5A 2ZKOA 1KMIZ 1BE3H 2H3OA 2KB1A 2R70A 5FNVB 1Y66A 2QWPB 4FFKA 1THZA 4OGQB 2K9PA 3SGIA 4I50A 2DN9A 4B3TB 1FXKC 3P3PA 1HNZO 1RPOA 2VQEB 1GH6A 1AROP 2NN4A 3QF7A 4YXWG 4WFEA 1H2GA 1XQ8A 1ZUQA 3G6BA 4CH4A 3L73H 3J7AU 1IDSA 1AB3A 2YC0A 5K1XA 2ZXWB 4F4LA 1R73A 5LGTA 4DR7O 1OCCB 3R66A 3ZHQA 1I94B 2QGNA 1TAEA 1COWG 4MVSA 5DM6V 1FXKA 4CS3A 2QWRB 3HKEB 4IYHA 4DV7B 2EIJC 2VQEO 4FLUA 4UVBA 1K8AW 5IY5C 4LF9B 4P9PA 1FXVA 4LBEC 2XAQA 2AGAA 4FVMA 1VQNV 4G2KA 4PDRA 4JYBA 5LGNA 1SZTA 4FFBA 3VQYA 3OR7C 1SETA 2LW7A 2V1DA 4JI8O 4E2LA 1R6KA 2L6LA 1K9MW 1MG1A 1SC5B 3K58A 2QTSA 5H5NA 2D3OW 2IJHA 4Z1MG 3HKCB 4TQDA 5H6QA 5EIBD 2O57A 1Q81W 1N33O 3DXRB 5LMUB 1WPXA 4KFMA 2BTQB 4K8XA 3CCVV 4H33A 3JARB 3DC6A 3ZRSA 2E5LO 3X2QC 1WPBA 2HJFC 3A2FA 4OX9B 5AG2A 3AG1C 1VQ4V 1NS1A 4CZZA 2OCHA 3SPJA 1V9PA 1MZEA 4UV9A 1GM7A 1B04A 1QBZA 1XI1A 3L75H 3K3WA 1WLEA 1RPRA 4JZ2A 3RGBA 3BEHA 2UU9O 3T1CA 2WAMA 3K0GA 2UXDO 2E74B 1US6A 3QG5A 4LNUB 4LR3A 5LXTB 2UXBO 4DV3O 1AP6A 1WA8A 3CRRA 2QSAA 3DSQA 3ZEDA 2YSUB 3L74H 5LHHA 5DEDA 4PDLA 4QE7A 3ZMVA 4J7JA 2XT9A 4GX2A 1KP3A 4CS2A 3T4ZA 2EIMB 1GN4A 3EXAA 4DV4O 1EN5A 3UM7A 1L0NH 3AG3C 1MSWD 4CS4A 2HHHB 1M56B 2H94A 4X20B 1VIBA 5L3CA 3ETGA 3T1HO 4BIUA 4U3JB 4P2ZA 4JI0O 5LP6A 3WB2A 4NXMO 3AG2C 1HNXO 4MTGA 4JASA 1VP7A 1PL0A 1IBLO 4RUFA 4UB6Z 1ZTEA 5KUKA 4WFGA 3E35A 4F6RA 3UO3A 1QLNA 1AP5A 4I0XA 4ZKIA 1N36O 2Q7EA 2HEPA 3G6EV 2QM8A 5B1AB 4J11A 2F66C 5D5QA 2W0FC 2IM9A 3DTUB 2DYSB 3DC5A 2AW9A 1IBLB 5TISZ 1IBKB 4P9OA 1ZSPA 3JCUZ 2H8PC 4XBFA 3OMAB 3E83A 4PA9A 3FB6C 1YSCA 4PA7A 2HLDG 3OFNG 1TGOA 3G80A 1RSOB 4I4TB 4I7ZB 3N2GA 1U96A 3IAYA 1MNGA 3ZN1A 4DUZB 3B2EE 1YJWV 3ASNB 3FAVA 3ZBHA 2CAZC 1G8MA 5IY5B 4ASUG 3U11A 1XNRB 4B7EA 3BAAA 4BW5A 2EIJB 2PI4A 1BMFG 1M57B 4JTAB 3K59A 3SDLA 3CRAA 3CHXA 4MVUA 1EZVH 2Q7GA 1EN4A 2YS8A 3E2EA 4MT8A 2Y4TA 5JCOC 3TETA 1LNQA 1VQOV 1QCEA 2VS0A 2ITDC 1W0KG 2Y0PA 4DW1A 1WA8B 3BCCH 4X65B 1FFXA 2ZNJA 4DV6B 3TK1A 2EILB 3ETDA 1WJZA 1VQ8V 4NTWA 1FKAO 4UCSA 1VF7A 2BOBC 3LNMB 5JJEB 1WN7A 1M90W 4NXMB 4X1YA 4WFBV 3A0HZ 3SPHA 5LHGA 4W4KA 2YXHA 1JR9A 5LBQA 1HDJA 2JRIA 1S5HC 1IBMO 1KYOF 1NR1A 4HYOA 4N23A 3OW2U 4UCOA 4FZ0A 3JAWA 3C90A 4NVPA 3MD0A 1Q6UA 1JVMA 4FK5C 2RNBA 4MTOA 2Y69C 5LP6B 2IU0A 1Y67A 4UXNA 4JTCB 2XTAA 1EBOA 4P30A 5IWAO 3IC9A 1WP7A 2CTRA 4ZBMA 2IU3A 1DF5A 2B1IA 4PD4F 4QNHB 1F4MA 2UXBB 2OTJV 1SQQH 3CWBH 1BCCH 2UUAB 4LF7O 2F4VO 1S5LZ 1HR0O 2JDIG 1BHBA 4H37A 1SZXA 1SKVA 1YF2A 3RYFA 4RQFA 2A0LA 4B08A 5EBMC 1VF5B 1RSOA 1SQFA 1H2MA 3UO2A 4LFBO 2XOKG 1NZ6A 3ZCCA 3ABKB 3K03A 3K5MA 1GO3F 2HFEC 4FLXA 1Q82W 5FPRA 3K9SA 1PL4A 2WLHA 4R8CA 3BFRA 4MTFA 1Q6HA 4YJ3B 2ARHA 4ZHQA 5IJ0B 2E5LB 2F43G 3APQA 3ABLB 1GMGA 2EX3A 5HFMA 5LMNB 2C2AA 1FAFA 2FKXA 4DV1B 3CRQA 2ZIOA 4B7KA 2CTPA 4J9YB 4CH6A 4LP8A 3S3XA 3EVKA 1DGSA 4TQFA 2ZQMA 2Q7HA 1TVKB 1URFA 2QWOB 2NR5A 1SA0B 1V54C 1QR8A 1BT8A 1DTOA 3SYPA 2F4VB 3EFFK 3ZRXA 1FD9A 4GX0A 3WB1A 3SJCC 1VARA 4JI5B 4X1IA 3CXHF 4J42A 2IJJA 2MW2B 2X7RB 2EINC 4HAMA 3STLC 4FLWA 3RYHA 2PI5A 3SYAA 4L8JA 4X66B 4X88A 4FM0A 4MW8A 3AK1A 1YJNV 1NT2B 1VEWA 3F7VC 4UVAA 5CA0B 3KKYA 3B77A 5FL7G 2VWJA 5LGUA 3FB7C 3W7XA 4RWUA 4DRXB 5F2VO 5DECA 3RFRA 4K3AA 2Q8VA 2XNDG 4DR5O 4LC1A 2HHHO 2R72A 4DV6O 3TJTA 3P3NA 3F5WC 3OAAG 5KHHA 3CJHA 1K7DA 4DV2O 4DR1O 1Q5OA 4DXWA 1QLEC 1H8EG 2UUCB 4GT1A 1BHAA 4JI3O 1Y74B 1P7GA 2WLLB 1XBLA 3MAQA 1W2BU 1Q7YW 1E79G 2QTOA 1ROPA 4X66O 5KUMA 4JI1O 1XNRO 2CUGA 4N21A 2GSMB 4CC5A 2UXNA 3CRCA 1H2NA 1Y4MA 4X9QA 3FX7A 1SS3A 3WB0A 4Z1VA 4PA3A 2YIAA 4QJFB 2HVKC 2UUBB 1NI8A 4LF5B 3KCYA 5ITZB 1AILA 4DR4B 1V54B 2Q68A 5H2FZ 3PN1A 4PDVA 2Q9LA 2Y48A 2NLJC 3W7TA 3WG7B 3LDCA 1AI5A 2HR3A 4PV1B 3CSXA 4MVZA 4UCUA 5CA3A 4O4LB 1GKFA 4GX5A 4O4JB 3CPWU 1XMOO 3CC2V 2EBOA 3D8CA 5H6RA 3ZS8C 1KU9A 2QJ1A 5B3SC 3CS5A 2CK3G 1PPJH 3B40A 4PI0A 5H9CA 4IHJA 1PNLA 3B09A 4ICGA 1XNQO 3AG4C 3ABKC 3D3IA 4K35A 4B3MB 3T1HB 3HKBB 4PJ0Z 1GAXA 1FFTB 1SQBH 1TUBB 2KKWA 3SPCA 1MABG 1Q86W 1XUQA 4HBNA 2FTKA 2YIBD 1H2LA 1Y76A 4JAAA 1B3QA 2B5UA 4O4IA 4YIOA 4MVOA 4DV0B 4IL6Z 4TT3G 2WSSG 3IJ4A 3JD0A 5KHJA 2JVDA 3RN4A 2F93B 4AQYO 1P49A 2W6JG 2ZT9B 3CMEV 4D6TH 3H1IH 5KHKA 1OHHG 5JH7B 4F6EA 3RVZA 1PKXA 3FYIB 4ABMA 3GWOA 2MK3A 2ZE7A 2GTSA 4UB8Z 1QQCA 4O2BA 4QE9A 1MMMA 3THOA 3OE7G 5KAIZ 3ZRWB 4C7UA 3HKBA 1M93A 4D7SA 4TWKA 3JAKA 3K79A 2F23A 1H2SB 2LGWA 5EYPB 3OTFA 1HNXB 4FFBB 3ZIAG 1UFIA 2JGDB 3LDEA 2V4DA 2EJRA 4EFBA 2EILC 4FLZA 3E8HA 2LFSA 3JAWB 1YZBA 3HKCA 5B3SB 4J41A 4O2BB 4MVQA 2F95B 3KZIZ 2L35A 1G6UA 3H01A 5GW7A 2K1EA 1L8DA 3OMIB 4EB6A 5KMGA 3RYCB 1LUVA 1M4UA 3GB7C 1NTMH 2YEVA 1MZFA 5B1OA 4YIPA 1R3LC 4ZI7B 3E8FA 2YI8A 4YHHB 3SJBC 1N4CA 3AK3A 5JJNB 1JJ2U 5EC2C 2Z0AA 2UU9B 2ILMA 4DV2B 3UT5A 4WFHA 4LF8O 4LF9O 2XUMA 2ADQB 4B3MO 3ETEA 4DO2A 3BA8A 3ZRWA 1XNQB 1Y76B 5LMNO 2ETNA 1NR7A 4J80A 2RMKB 2BSKA 3FD9A 1KQSU 1LUWA 1IBKO 5CA1A 4LFAO 4OX9O 1GRJA 3OT7A 1HP8A 2JJ2G 3TXSA 4GCZA 4ZOLA 1K34A 1H2KA 3CEIA 2JGUA 5EBWC 1N0NA 2AHYA 4QPJA 1CEZA 2P22C 1K92A 1HNZB 1Q8IA 4FLYA 1JOYA 1N33B 3F7YC 1G1XB 2QKAA 3I5DA 3OEEG 3CB2A 4DR3O 2WLKA 5EK0A 1M9NA 1TA8A 1NH2D 4JV5O 4H13B 4U3JA 1T5EA 2HG5C 1Z5VA 1XEQA 4JI0B 4QIWF 1KKDA 1M56C 3SPIA 2YDEA 5IYZB 4GKKB 1ZAUA 1D5AA 1MSDA 4NXNO 1VQ5V 5EZYB 4JZGA 2QKSA 4JI1B 1YCIA 2XAGA 3LUTB 5EC1C 1IVSA 4B3SB 2EINB 1OCOB 1AJQA 3OMNB 5J2TA 2CGOA 2XASA 2E76B 5KMGB 3RYCA 5J2UB 5KA6A 3OD4A 2AHZA 4LFCB 2UXCO 5E1AC 3F5TA 4XDJA 4FLTA 5C8YA 2UXDB 3CYOA 1GM9A 2BSKB 2GV9A 2WLJA 1GN6A 3R65A 1YDXA 4W4LA 1H8HG 4U7NA 1P7BA 3C3TA 4K0KO 4YJ2B 4J10A 5BR8B 2A06H 2OIGA 4UUJC 2AZ0A 2KG7B 2EJ7A 3N2GB 4JPRA 3AG1B 1H38A 2ZNIA 2FYUH 3K0DA 4FIPC 1FFXB 1D5NA 3JD2A 4JAUA 3CC7V 4TOIA 4BR6A 2P4KA 3JYCA 4JTDB 4D7TA 2P4VA 4BIOA 1NVPD 1R6TA 4RQEA 5E79Z 3K57A 4DV0O 1N32O 4X64B 3K5NA 1AI4A 1O9GA 4O2AB 1B6QA 1R3JC 1Z2GA 4UCTA 5LHIA 2EZOA 2IJIA 3VQXA 2CH7A 3UCSC 4MTXA 5KA5A 3I55V 1XHZA 2CTQA 2QDOA 4BWAA 3IFXA 3QTCA 4TV8A 2HKOA 4DV5B 2Q4PA 1Q43A 4DUYO 1YHQV 3U10A 1JMKC 2M6YA 4UCVA 1YI2V 2X6AA 1KBHA 2DQ0A 4RUEA 1JPXA 3D36A 4DV7O 1BQZA 4DV1O 1JJOA 4LH7A 2CE4A 4NTXA 2Y69B 1SESA 1TVKA 3JD1A 1RP3B 1Q6IA 2OCCB 3ASOB 5CN0A 2WPDG 2YIDA 4KUMA 1J95A 4I9WA 3E89A 3IC7A 1E1QG 1WP8A 4PI2A 1FPOA 2YI9A 2UUBO 1FXKB 2YUAA 3RYFB 1AR4A 3LSQA 3CC4V 3VQVA 1BQ0A 1QNMA 2ZM6B 4DYLA 1XILA 5LA6B 1K5SA 2JEXA 4OPAA 4FM1A 3E86A 3SR2C 4F6RB 2HP8A 4YJ2A 4JI2B 3N2KA 1OCZC 2WWWA 3AK2A 2P6JA 1F23A 5FNVA 1JX9A 4X1KB 2Z3YA 4I9QA 1XMQO 3A8TA 3E22B 1M57C 1L1FA 4GLXA 4JI6B 3MHHC 1O9HA 4Q6GA 4RAIA 4JI7B 4HNAB 4PDMA 5L3BA 1CPYA 4IGGA 3RYIA 1DLBA 2ATKC 1IBMB 3S3WA 3JARA 4KHPO 2VWKA 3I56V 2W0XA 2BTOA 3UT5B 5IJ9A 4EEQA 1JFFB 5L3FA 3CCEV 3A0RA 1OCRB 3B8NA 2DWEC 2DYSC 1XDCA 3VOUA 2YIBA 4DK0A 1J5EB 1V55B 1D2DA 4Q20A 3FB5C 1IX9A 3HKDB 4LNUA 5LXTA 4JYAO 4DR6B 3L9DA 4JI5O 3RT3C 4O4JA 3G67A 1Y6XA 4NKGB 3JASB 5B1BC 3CMAV 1S0VA 5KX5B 2Q0AA 3EHBB 2A7WA 4JI8B 4JYCA 2WLNA 3CCMV 4O4HB 2FB5A 1S76D 2OTLV 2B9ZA 3IGAC 4MW3A 2D2CB 3ZJZA 3MHSC 3AG3B 1Q90D 1AR5A 5L3GA 2PZSA 2ZDIC 2ZR2A 3ABMC 1MA1A 4O4IB 4A5UB 3AG7A 5LOVB 3ZMZA 4AILC 2JIZG 4FPPA 2Q69A 3TGUH 4UCRA 4O4HA 1S3JA
chains in the Genus database with same CATH topology
4DR6O 1XMQO 4X66O 4JI1O 2FKXA 1XNRO 1R6TA 2VQEO 4DV0O 5LMUO 1N32O 2DOSA 5BR8O 4DV4O 1G1XB 1J5EO 4YY3O 2AGAA 4DUZO 5BY1A 5FLXN 4DR3O 4GKKO 1R1BA 4LF6O 1KUQA 1HNWO 1FKAO 3T1HO 4KHPO 1X59A 4OPHA 4JV5O 1A32A 4DV5O 4JI0O 2LW7A 4LF4O 4DR4O 4JI8O 1AILA 4NXMO 2UUAO 1XEQA 4GKJO 3J81N 3J80N 2DJVA 1HNXO 2JRIA 4DUYO 1F7YA 1IBMO 5H5NA 1IBLO 1YZBA 3O65A 4B3SO 4NXNO 1D2DA 4X64O 1N33O 5LL6Y 4DV7O 4DV1O 4JYAO 1N36O 5IWAO 3T1YO 1XMOO 2VQFO 3M8AA 4JI5O 3RT3C 4JI2O 1I94O 2E5LO 3JAMN 2ZKOA 2UXCO 4JI4O 5BXZA 3F5TA 1NS1A 4LF7O 2F4VO 1XNQO 4LF5O 1HR0O 1N34O 2N74A 2UUBO 2Z0AA 3OTOO 5A2QN 1FYJA 4DR5O 2ZM6O 1FJGO 2HHHO 4DV6O 4B3TO 4JI7O 4X65O 4K0KO 4LFBO 1DK1A 4LF8O 4LF9O 4DV2O 1HNZO 2UU9O 4DR1O 4B3MO 4JI6O 4OPAA 2UXDO 4A5UB 4X62O 5LMNO 4YHHO 4JI3O 4AQYO 3J7AU 1AB3A 4LFCO 2UXBO 4DV3O 3SDLA 1IBKO 4LFAO 4OX9O 4DR7O 4DR2O 3R66A 4B3RO 2UUCO 5IT9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 O;  1XMQ O;  4X66 O;  4JI1 O;  2FKX A;  1XNR O;  1R6T A;  2VQE O;  4DV0 O;  5LMU O;  1N32 O;  2DOS A;  5BR8 O;  4DV4 O;  1G1X B;  1J5E O;  4YY3 O;  2AGA A;  4DUZ O;  5BY1 A;  5FLX N;  4DR3 O;  4GKK O;  1R1B A;  4LF6 O;  1KUQ A;  1HNW O;  1FKA O;  3T1H O;  4KHP O;  1X59 A;  4OPH A;  4JV5 O;  1A32 A;  4DV5 O;  4JI0 O;  2LW7 A;  4LF4 O;  4DR4 O;  4JI8 O;  1AIL A;  4NXM O;  2UUA O;  1XEQ A;  4GKJ O;  3J81 N;  3J80 N;  2DJV A;  1HNX O;  2JRI A;  4DUY O;  1F7Y A;  1IBM O;  5H5N A;  1IBL O;  1YZB A;  3O65 A;  4B3S O;  4NXN O;  1D2D A;  4X64 O;  1N33 O;  5LL6 Y;  4DV7 O;  4DV1 O;  4JYA O;  1N36 O;  5IWA O;  3T1Y O;  1XMO O;  2VQF O;  3M8A A;  4JI5 O;  3RT3 C;  4JI2 O;  1I94 O;  2E5L O;  3JAM N;  2ZKO A;  2UXC O;  4JI4 O;  5BXZ A;  3F5T A;  1NS1 A;  4LF7 O;  2F4V O;  1XNQ O;  4LF5 O;  1HR0 O;  1N34 O;  2N74 A;  2UUB O;  2Z0A A;  3OTO O;  5A2Q N;  1FYJ A;  4DR5 O;  2ZM6 O;  1FJG O;  2HHH O;  4DV6 O;  4B3T O;  4JI7 O;  4X65 O;  4K0K O;  4LFB O;  1DK1 A;  4LF8 O;  4LF9 O;  4DV2 O;  1HNZ O;  2UU9 O;  4DR1 O;  4B3M O;  4JI6 O;  4OPA A;  2UXD O;  4A5U B;  4X62 O;  5LMN O;  4YHH O;  4JI3 O;  4AQY O;  3J7A U;  1AB3 A;  4LFC O;  2UXB O;  4DV3 O;  3SDL A;  1IBK O;  4LFA O;  4OX9 O;  4DR7 O;  4DR2 O;  3R66 A;  4B3R O;  2UUC O;  5IT9 N; 
#chains in the Genus database with same CATH topology
 1S77 D;  3OUS A;  4X62 B;  1I7F A;  2CDY A;  3ABM B;  3U0Z A;  3ZMU A;  5CBH A;  5BR8 O;  5CA1 B;  4R6Z A;  5KHI A;  3DXR A;  3TCU A;  2G38 A;  5LA6 A;  3ABT A;  4MVM A;  4DV5 O;  4UVC A;  1N34 B;  4O2A A;  3Q4H A;  4DR4 O;  3CJH B;  3KG2 A;  1QVF U;  4HNA A;  3G71 V;  3JSN A;  2JJ1 G;  1L0L H;  4B3S O;  1XOU A;  5EZY A;  3D36 C;  4X64 O;  2HVJ C;  3STZ C;  2RCV A;  3OGI B;  2GDS A;  4CC6 A;  3OUF A;  5GON B;  4IYI A;  4NTY A;  1V55 C;  2Y0I A;  3JD3 A;  1NH2 B;  1PM9 A;  4DR2 B;  3K5O A;  1CXZ B;  4JYY A;  2PF4 E;  3QNE A;  3JAM N;  3CCR V;  4ZOL B;  5BXZ A;  1EZJ A;  3T4D A;  3L70 H;  4LF4 B;  3LSU A;  2CTW A;  3K08 A;  3NR7 A;  2ZR3 A;  1FYJ A;  2WLI A;  2UXX A;  4K0K B;  1JQ0 A;  4DR5 B;  1IXM A;  5B5E Z;  4IIJ A;  2ITC C;  4JI6 O;  3LSS A;  1SRY A;  4WBN A;  4YJ3 A;  2IH1 C;  2Q5Z A;  1RFY A;  2BCC H;  3SYQ A;  2IH3 C;  2PUS A;  3M7M X;  2LGQ A;  3D3Q A;  3T2M A;  3APO A;  3JAT B;  1IXB A;  1R3I C;  1LR1 A;  4RO2 A;  2P06 A;  5JVD A;  3SJQ C;  2OIE A;  4MS2 A;  2OWO A;  3JSL A;  4GUN A;  2KG7 A;  5JCO A;  4DUZ O;  1E1R G;  3H1H H;  1R1B A;  4QGP A;  1AI6 A;  1U97 A;  3C3S A;  4WCE V;  4JI4 B;  1FS0 G;  4JV5 B;  2DJV A;  2A79 B;  3SJA C;  3E8B A;  1HNW B;  5IYB O;  4LF6 B;  3CRM A;  1KKC A;  3ASO C;  3DGE A;  5CB4 B;  2OCC C;  2YIC A;  2VQF B;  3ML0 A;  5BMV B;  1PNM A;  4GZR B;  3ZHS A;  3ZHT A;  3G4S V;  3Q4H B;  1ZWI C;  4TV8 B;  5CBG A;  3BHP A;  1GN3 A;  4B3R B;  4ZIB A;  2WLL A;  2KSD A;  3FAV B;  3CD6 V;  4X20 A;  2LJ2 A;  1AJP A;  2KQX A;  4FM2 A;  4EB6 B;  2B1G A;  1QR9 A;  3HR0 A;  3RW0 A;  1KP2 A;  1IUR A;  4KHP B;  4EFE A;  1PP9 H;  1S5J A;  4G27 B;  2DYR B;  2IW5 A;  4LF8 B;  3FYE B;  2LQT A;  1FJG O;  4CBC A;  1NTZ H;  2CGN A;  2ZIM A;  4B3T O;  5IE9 A;  5LYJ A;  4JI7 O;  2LW1 A;  5J9P C;  1YTF B;  1F4N A;  4I55 B;  1K4C C;  4UV8 A;  2Q67 A;  4LCU C;  1HR0 B;  3VQW A;  4QPK A;  4IIJ B;  2Q73 A;  2XAJ A;  4GX1 A;  1NVP B;  4X89 A;  3ICX A;  4DR2 O;  3ABU A;  3QVN A;  3SYC A;  4AQY B;  4WFA V;  5C93 A;  3N27 A;  4NYK A;  4FLV A;  4DR6 O;  1YEW A;  4JGS A;  1VMG A;  4KP4 A;  2RDC A;  4BAY A;  3ZRV A;  2LO1 A;  2DOS A;  2JS3 A;  3JD4 A;  5IYC O;  1Y74 A;  5FLX N;  2DW4 A;  2PGG A;  1KC8 W;  2BE3 A;  3ZMT A;  5DN6 G;  3H9V A;  3W7S A;  1SQX H;  1GN2 A;  3L71 H;  1A32 A;  4GKJ B;  4NR1 A;  3A0B Z;  1GM8 A;  2ZE5 A;  2EIK B;  2YEV B;  2WA4 A;  3RBZ A;  3SPG A;  2N04 A;  5A9G A;  5CMU A;  2E3C A;  4I5S A;  1RM1 B;  4YY3 B;  1K73 W;  4TUY A;  1OCO C;  2IJK A;  5D5P A;  2Q0O C;  5JVD B;  4NXN B;  2XAF A;  1EM1 A;  1SA0 A;  5BZB A;  5IJ9 B;  1WB8 A;  2XAH A;  3UQ8 A;  3BVO A;  4OXS A;  2A3Q A;  4X1K A;  1N34 O;  3JAK B;  2ZDI A;  2X0L A;  4ZHQ B;  5IJ0 A;  1N8R W;  3ZHV A;  1BS3 A;  5L3E A;  4GYC B;  2QWN B;  1M5I A;  3K9A A;  1FJG B;  4X8A A;  4PEL A;  5ITZ A;  1NJI W;  3K04 A;  1JA8 A;  4X62 O;  1WB7 A;  1B06 A;  1QHT A;  4J7K A;  4BW9 A;  1QU7 A;  3B8M A;  3JAL A;  5IT9 N;  2JEU A;  1BZK A;  4K8Z A;  3CCQ V;  5KAF Z;  3CXC U;  1YTF D;  4ZI7 A;  1Z5W A;  3FB8 C;  2NNU A;  1QVG U;  2VRZ A;  2Y4U A;  1YVW A;  4G28 B;  4PHZ A;  1NBM G;  4J9Z B;  4AI8 A;  2R9I A;  1BSM A;  2QWQ B;  3CCJ V;  5GTH Z;  4LF4 O;  4KL1 A;  4GKJ O;  4LH6 A;  2XHB A;  1F7Y A;  3W7W A;  3P32 A;  3CCU V;  1YJ9 V;  3O65 A;  5C8Y B;  3T1Y B;  4JF3 A;  3AEI A;  3CP1 A;  1FXH A;  3B4S A;  1XL6 A;  2OYQ A;  2JK5 C;  1I08 A;  1NKD A;  3ABL C;  1XMQ B;  3T1Y O;  2P5O A;  3LDD A;  2IBZ H;  1VQ7 V;  5LOV A;  4JI2 O;  4H0L B;  1K4D C;  3JAT A;  5K1P A;  2WLI B;  4JI3 B;  1XL4 A;  1KD1 W;  4TV9 B;  4XDK A;  2Z5U A;  2N74 A;  5JH7 A;  4TSF G;  1NQT A;  3N2K B;  2GUZ B;  4J7Z A;  4KXR A;  4DRX A;  1AR1 B;  4FZ1 A;  3JAL B;  1GTO A;  2FML A;  1W0J G;  3E8G A;  1DK1 A;  4X1Y B;  3OM3 B;  5B66 Z;  1N0J A;  3H1K H;  4IT5 A;  4FMT A;  2UXC B;  4E4E A;  2DE0 X;  4FJC C;  2AZ2 A;  4LFC O;  1OV9 A;  2WA3 A;  1SQG A;  4I55 A;  3HB3 B;  2BOC C;  5KX5 A;  1S72 V;  1K5Q A;  4B3R O;  5JQG A;  5L3D A;  4IHJ B;  5LP6 C;  5IYD O;  4DW0 A;  3OEH G;  5LMU O;  5B1N A;  2P67 A;  2LFR A;  4MVR A;  3FFQ A;  1ZL8 B;  3ETQ A;  1F51 A;  1PV0 A;  3CCL V;  4LF6 O;  4U3F H;  1Q3E A;  4JAV A;  2BTQ A;  3HPL C;  4EKW A;  2QR4 A;  3AG4 B;  1VQ9 V;  2X6B A;  3BA9 A;  2UUA O;  3RYI B;  1R6N A;  1KB9 F;  1JFF A;  1W59 A;  2GBO A;  1ORQ C;  1K33 A;  4WF9 V;  4I4T A;  3ZN0 A;  1VQ6 V;  5CB4 A;  2P90 A;  5JJJ B;  3WU2 Z;  5J2U A;  1SER A;  3L72 H;  2OT5 A;  2EZP A;  1N32 B;  2FL4 A;  1NTK H;  2R9R B;  1OZ0 A;  1XRE A;  1I94 O;  5JWP A;  3K06 A;  3WG7 C;  3H1J H;  4DR7 B;  2JGD A;  1VQP V;  1HWY A;  4BIZ A;  3ZHU A;  3RVY A;  1BGY H;  4PA6 A;  5KLV H;  1HW7 A;  4LWS B;  1M1K W;  1R3K C;  4LF5 O;  1P4R A;  3OTO O;  2ZD9 A;  3ASN C;  2R9A A;  2GUZ A;  3UKM A;  4AHC A;  4X65 O;  2QM7 A;  1EN6 A;  4TV9 A;  2QE7 G;  4LF7 B;  1VF6 A;  1VQK V;  4XDL A;  3ZX6 A;  1TUE B;  2QM4 A;  1XHX A;  3HKE A;  2N05 A;  1K3E A;  3SYO A;  1KEC A;  4Z2W A;  2ADP A;  5LYJ B;  5B1A C;  2GTA A;  3CE2 A;  1AI7 A;  4H44 B;  5IWA B;  1WAZ A;  5GTI Z;  1VQM V;  2DWD C;  1YIT V;  5FPO A;  2DQ3 A;  1QLE B;  4DR1 B;  5EBL C;  1UJW B;  1TUB A;  5CA0 A;  5J2T B;  2LP7 A;  1J5E O;  3BAB A;  1MOF A;  4I0X B;  1SF9 A;  5BY1 A;  4GKK O;  2AXT Z;  1KUQ A;  5GON A;  3AG2 B;  3VBB A;  3OTO B;  4CH5 A;  1X59 A;  5IDJ A;  3CX5 F;  2Q6A A;  3ZMS A;  2WLM A;  3K5L A;  2F1M A;  3J80 N;  1VF6 C;  3M99 B;  1ZL8 A;  3QO8 A;  4DR3 B;  3QO5 A;  5EYP A;  1YXB A;  3BY6 A;  1XMO B;  2EIM C;  5JQG B;  1I0H A;  2CH7 B;  5EIB C;  1N36 B;  1AJN A;  2JS5 A;  1I5Y A;  1ZX3 A;  2QKC A;  1NU1 H;  1CP9 A;  2VQF O;  5KHG A;  2YXY A;  3P30 A;  3BRC A;  3E22 A;  1ENV A;  3FKS G;  3MDS A;  3TXQ A;  2PYJ A;  4R50 A;  1RM1 C;  2ZIN A;  2A9H A;  4DUY B;  3WFV A;  4DK1 A;  1K97 A;  4JI4 O;  1P84 F;  3RWR D;  1VQL V;  2EIK C;  1I5X A;  1SQV H;  2PTM A;  2QEX V;  1WNS A;  4LWS A;  5A2Q N;  1ZLZ A;  2ZM6 O;  3OR6 C;  3H1L H;  3W7U A;  2M7W A;  3GVM A;  4DV4 B;  3BPZ A;  4WFF A;  4WBN B;  4MSW C;  4YHH O;  4L87 A;  1EFR G;  5B1B B;  3QO7 A;  4U7O A;  3X2Q B;  1SQP H;  4UFZ A;  2ZE8 A;  4LFA B;  4DV3 B;  5CBF A;  1AVM A;  2PYL A;  2UUC O;  3O9O A;  4JYA B;  2RJZ A;  3NXS A;  2P7T C;  5IYZ A;  1X4T A;  2EUL A;  2ZCE A;  4R7C A;  4LFB B;  1OCR C;  1DF4 A;  3KCX A;  4YY3 O;  4HZ3 A;  5BMV A;  1HNW O;  2X6C A;  2DYR C;  4OPH A;  1PNK A;  1GK9 A;  2W6I G;  3HKD A;  3J81 N;  3OGC C;  2QA4 V;  1G4Y B;  1BL8 A;  4I50 B;  4CH3 A;  4TUY B;  1JCH A;  2RQ6 A;  4O4L A;  2RN9 A;  2HJD A;  2DMX A;  1YIJ V;  3RYH B;  2YXL A;  3JAS A;  3GWK C;  2V7Q G;  2ODM A;  5HFL A;  2ZE6 A;  3JCZ A;  5LL6 Y;  3LNN A;  1OJH A;  4X1I B;  1IZ3 A;  2GHY A;  1OCZ B;  3ZHR A;  4PA4 A;  1OCC C;  3PJS K;  3M8A A;  1UPG A;  2ZXW C;  3CCS V;  2E75 B;  2PY5 A;  1PD3 A;  4NB5 A;  2ZKO A;  1KMI Z;  1BE3 H;  2H3O A;  2KB1 A;  2R70 A;  5FNV B;  1Y66 A;  2QWP B;  4FFK A;  1THZ A;  4OGQ B;  2K9P A;  3SGI A;  4I50 A;  2DN9 A;  4B3T B;  1FXK C;  3P3P A;  1HNZ O;  1RPO A;  2VQE B;  1GH6 A;  1ARO P;  2NN4 A;  3QF7 A;  4YXW G;  4WFE A;  1H2G A;  1XQ8 A;  1ZUQ A;  3G6B A;  4CH4 A;  3L73 H;  3J7A U;  1IDS A;  1AB3 A;  2YC0 A;  5K1X A;  2ZXW B;  4F4L A;  1R73 A;  5LGT A;  4DR7 O;  1OCC B;  3R66 A;  3ZHQ A;  1I94 B;  2QGN A;  1TAE A;  1COW G;  4MVS A;  5DM6 V;  1FXK A;  4CS3 A;  2QWR B;  3HKE B;  4IYH A;  4DV7 B;  2EIJ C;  2VQE O;  4FLU A;  4UVB A;  1K8A W;  5IY5 C;  4LF9 B;  4P9P A;  1FXV A;  4LBE C;  2XAQ A;  2AGA A;  4FVM A;  1VQN V;  4G2K A;  4PDR A;  4JYB A;  5LGN A;  1SZT A;  4FFB A;  3VQY A;  3OR7 C;  1SET A;  2LW7 A;  2V1D A;  4JI8 O;  4E2L A;  1R6K A;  2L6L A;  1K9M W;  1MG1 A;  1SC5 B;  3K58 A;  2QTS A;  5H5N A;  2D3O W;  2IJH A;  4Z1M G;  3HKC B;  4TQD A;  5H6Q A;  5EIB D;  2O57 A;  1Q81 W;  1N33 O;  3DXR B;  5LMU B;  1WPX A;  4KFM A;  2BTQ B;  4K8X A;  3CCV V;  4H33 A;  3JAR B;  3DC6 A;  3ZRS A;  2E5L O;  3X2Q C;  1WPB A;  2HJF C;  3A2F A;  4OX9 B;  5AG2 A;  3AG1 C;  1VQ4 V;  1NS1 A;  4CZZ A;  2OCH A;  3SPJ A;  1V9P A;  1MZE A;  4UV9 A;  1GM7 A;  1B04 A;  1QBZ A;  1XI1 A;  3L75 H;  3K3W A;  1WLE A;  1RPR A;  4JZ2 A;  3RGB A;  3BEH A;  2UU9 O;  3T1C A;  2WAM A;  3K0G A;  2UXD O;  2E74 B;  1US6 A;  3QG5 A;  4LNU B;  4LR3 A;  5LXT B;  2UXB O;  4DV3 O;  1AP6 A;  1WA8 A;  3CRR A;  2QSA A;  3DSQ A;  3ZED A;  2YSU B;  3L74 H;  5LHH A;  5DED A;  4PDL A;  4QE7 A;  3ZMV A;  4J7J A;  2XT9 A;  4GX2 A;  1KP3 A;  4CS2 A;  3T4Z A;  2EIM B;  1GN4 A;  3EXA A;  4DV4 O;  1EN5 A;  3UM7 A;  1L0N H;  3AG3 C;  1MSW D;  4CS4 A;  2HHH B;  1M56 B;  2H94 A;  4X20 B;  1VIB A;  5L3C A;  3ETG A;  3T1H O;  4BIU A;  4U3J B;  4P2Z A;  4JI0 O;  5LP6 A;  3WB2 A;  4NXM O;  3AG2 C;  1HNX O;  4MTG A;  4JAS A;  1VP7 A;  1PL0 A;  1IBL O;  4RUF A;  4UB6 Z;  1ZTE A;  5KUK A;  4WFG A;  3E35 A;  4F6R A;  3UO3 A;  1QLN A;  1AP5 A;  4I0X A;  4ZKI A;  1N36 O;  2Q7E A;  2HEP A;  3G6E V;  2QM8 A;  5B1A B;  4J11 A;  2F66 C;  5D5Q A;  2W0F C;  2IM9 A;  3DTU B;  2DYS B;  3DC5 A;  2AW9 A;  1IBL B;  5TIS Z;  1IBK B;  4P9O A;  1ZSP A;  3JCU Z;  2H8P C;  4XBF A;  3OMA B;  3E83 A;  4PA9 A;  3FB6 C;  1YSC A;  4PA7 A;  2HLD G;  3OFN G;  1TGO A;  3G80 A;  1RSO B;  4I4T B;  4I7Z B;  3N2G A;  1U96 A;  3IAY A;  1MNG A;  3ZN1 A;  4DUZ B;  3B2E E;  1YJW V;  3ASN B;  3FAV A;  3ZBH A;  2CAZ C;  1G8M A;  5IY5 B;  4ASU G;  3U11 A;  1XNR B;  4B7E A;  3BAA A;  4BW5 A;  2EIJ B;  2PI4 A;  1BMF G;  1M57 B;  4JTA B;  3K59 A;  3SDL A;  3CRA A;  3CHX A;  4MVU A;  1EZV H;  2Q7G A;  1EN4 A;  2YS8 A;  3E2E A;  4MT8 A;  2Y4T A;  5JCO C;  3TET A;  1LNQ A;  1VQO V;  1QCE A;  2VS0 A;  2ITD C;  1W0K G;  2Y0P A;  4DW1 A;  1WA8 B;  3BCC H;  4X65 B;  1FFX A;  2ZNJ A;  4DV6 B;  3TK1 A;  2EIL B;  3ETD A;  1WJZ A;  1VQ8 V;  4NTW A;  1FKA O;  4UCS A;  1VF7 A;  2BOB C;  3LNM B;  5JJE B;  1WN7 A;  1M90 W;  4NXM B;  4X1Y A;  4WFB V;  3A0H Z;  3SPH A;  5LHG A;  4W4K A;  2YXH A;  1JR9 A;  5LBQ A;  1HDJ A;  2JRI A;  1S5H C;  1IBM O;  1KYO F;  1NR1 A;  4HYO A;  4N23 A;  3OW2 U;  4UCO A;  4FZ0 A;  3JAW A;  3C90 A;  4NVP A;  3MD0 A;  1Q6U A;  1JVM A;  4FK5 C;  2RNB A;  4MTO A;  2Y69 C;  5LP6 B;  2IU0 A;  1Y67 A;  4UXN A;  4JTC B;  2XTA A;  1EBO A;  4P30 A;  5IWA O;  3IC9 A;  1WP7 A;  2CTR A;  4ZBM A;  2IU3 A;  1DF5 A;  2B1I A;  4PD4 F;  4QNH B;  1F4M A;  2UXB B;  2OTJ V;  1SQQ H;  3CWB H;  1BCC H;  2UUA B;  4LF7 O;  2F4V O;  1S5L Z;  1HR0 O;  2JDI G;  1BHB A;  4H37 A;  1SZX A;  1SKV A;  1YF2 A;  3RYF A;  4RQF A;  2A0L A;  4B08 A;  5EBM C;  1VF5 B;  1RSO A;  1SQF A;  1H2M A;  3UO2 A;  4LFB O;  2XOK G;  1NZ6 A;  3ZCC A;  3ABK B;  3K03 A;  3K5M A;  1GO3 F;  2HFE C;  4FLX A;  1Q82 W;  5FPR A;  3K9S A;  1PL4 A;  2WLH A;  4R8C A;  3BFR A;  4MTF A;  1Q6H A;  4YJ3 B;  2ARH A;  4ZHQ A;  5IJ0 B;  2E5L B;  2F43 G;  3APQ A;  3ABL B;  1GMG A;  2EX3 A;  5HFM A;  5LMN B;  2C2A A;  1FAF A;  2FKX A;  4DV1 B;  3CRQ A;  2ZIO A;  4B7K A;  2CTP A;  4J9Y B;  4CH6 A;  4LP8 A;  3S3X A;  3EVK A;  1DGS A;  4TQF A;  2ZQM A;  2Q7H A;  1TVK B;  1URF A;  2QWO B;  2NR5 A;  1SA0 B;  1V54 C;  1QR8 A;  1BT8 A;  1DTO A;  3SYP A;  2F4V B;  3EFF K;  3ZRX A;  1FD9 A;  4GX0 A;  3WB1 A;  3SJC C;  1VAR A;  4JI5 B;  4X1I A;  3CXH F;  4J42 A;  2IJJ A;  2MW2 B;  2X7R B;  2EIN C;  4HAM A;  3STL C;  4FLW A;  3RYH A;  2PI5 A;  3SYA A;  4L8J A;  4X66 B;  4X88 A;  4FM0 A;  4MW8 A;  3AK1 A;  1YJN V;  1NT2 B;  1VEW A;  3F7V C;  4UVA A;  5CA0 B;  3KKY A;  3B77 A;  5FL7 G;  2VWJ A;  5LGU A;  3FB7 C;  3W7X A;  4RWU A;  4DRX B;  5F2V O;  5DEC A;  3RFR A;  4K3A A;  2Q8V A;  2XND G;  4DR5 O;  4LC1 A;  2HHH O;  2R72 A;  4DV6 O;  3TJT A;  3P3N A;  3F5W C;  3OAA G;  5KHH A;  3CJH A;  1K7D A;  4DV2 O;  4DR1 O;  1Q5O A;  4DXW A;  1QLE C;  1H8E G;  2UUC B;  4GT1 A;  1BHA A;  4JI3 O;  1Y74 B;  1P7G A;  2WLL B;  1XBL A;  3MAQ A;  1W2B U;  1Q7Y W;  1E79 G;  2QTO A;  1ROP A;  4X66 O;  5KUM A;  4JI1 O;  1XNR O;  2CUG A;  4N21 A;  2GSM B;  4CC5 A;  2UXN A;  3CRC A;  1H2N A;  1Y4M A;  4X9Q A;  3FX7 A;  1SS3 A;  3WB0 A;  4Z1V A;  4PA3 A;  2YIA A;  4QJF B;  2HVK C;  2UUB B;  1NI8 A;  4LF5 B;  3KCY A;  5ITZ B;  1AIL A;  4DR4 B;  1V54 B;  2Q68 A;  5H2F Z;  3PN1 A;  4PDV A;  2Q9L A;  2Y48 A;  2NLJ C;  3W7T A;  3WG7 B;  3LDC A;  1AI5 A;  2HR3 A;  4PV1 B;  3CSX A;  4MVZ A;  4UCU A;  5CA3 A;  4O4L B;  1GKF A;  4GX5 A;  4O4J B;  3CPW U;  1XMO O;  3CC2 V;  2EBO A;  3D8C A;  5H6R A;  3ZS8 C;  1KU9 A;  2QJ1 A;  5B3S C;  3CS5 A;  2CK3 G;  1PPJ H;  3B40 A;  4PI0 A;  5H9C A;  4IHJ A;  1PNL A;  3B09 A;  4ICG A;  1XNQ O;  3AG4 C;  3ABK C;  3D3I A;  4K35 A;  4B3M B;  3T1H B;  3HKB B;  4PJ0 Z;  1GAX A;  1FFT B;  1SQB H;  1TUB B;  2KKW A;  3SPC A;  1MAB G;  1Q86 W;  1XUQ A;  4HBN A;  2FTK A;  2YIB D;  1H2L A;  1Y76 A;  4JAA A;  1B3Q A;  2B5U A;  4O4I A;  4YIO A;  4MVO A;  4DV0 B;  4IL6 Z;  4TT3 G;  2WSS G;  3IJ4 A;  3JD0 A;  5KHJ A;  2JVD A;  3RN4 A;  2F93 B;  4AQY O;  1P49 A;  2W6J G;  2ZT9 B;  3CME V;  4D6T H;  3H1I H;  5KHK A;  1OHH G;  5JH7 B;  4F6E A;  3RVZ A;  1PKX A;  3FYI B;  4ABM A;  3GWO A;  2MK3 A;  2ZE7 A;  2GTS A;  4UB8 Z;  1QQC A;  4O2B A;  4QE9 A;  1MMM A;  3THO A;  3OE7 G;  5KAI Z;  3ZRW B;  4C7U A;  3HKB A;  1M93 A;  4D7S A;  4TWK A;  3JAK A;  3K79 A;  2F23 A;  1H2S B;  2LGW A;  5EYP B;  3OTF A;  1HNX B;  4FFB B;  3ZIA G;  1UFI A;  2JGD B;  3LDE A;  2V4D A;  2EJR A;  4EFB A;  2EIL C;  4FLZ A;  3E8H A;  2LFS A;  3JAW B;  1YZB A;  3HKC A;  5B3S B;  4J41 A;  4O2B B;  4MVQ A;  2F95 B;  3KZI Z;  2L35 A;  1G6U A;  3H01 A;  5GW7 A;  2K1E A;  1L8D A;  3OMI B;  4EB6 A;  5KMG A;  3RYC B;  1LUV A;  1M4U A;  3GB7 C;  1NTM H;  2YEV A;  1MZF A;  5B1O A;  4YIP A;  1R3L C;  4ZI7 B;  3E8F A;  2YI8 A;  4YHH B;  3SJB C;  1N4C A;  3AK3 A;  5JJN B;  1JJ2 U;  5EC2 C;  2Z0A A;  2UU9 B;  2ILM A;  4DV2 B;  3UT5 A;  4WFH A;  4LF8 O;  4LF9 O;  2XUM A;  2ADQ B;  4B3M O;  3ETE A;  4DO2 A;  3BA8 A;  3ZRW A;  1XNQ B;  1Y76 B;  5LMN O;  2ETN A;  1NR7 A;  4J80 A;  2RMK B;  2BSK A;  3FD9 A;  1KQS U;  1LUW A;  1IBK O;  5CA1 A;  4LFA O;  4OX9 O;  1GRJ A;  3OT7 A;  1HP8 A;  2JJ2 G;  3TXS A;  4GCZ A;  4ZOL A;  1K34 A;  1H2K A;  3CEI A;  2JGU A;  5EBW C;  1N0N A;  2AHY A;  4QPJ A;  1CEZ A;  2P22 C;  1K92 A;  1HNZ B;  1Q8I A;  4FLY A;  1JOY A;  1N33 B;  3F7Y C;  1G1X B;  2QKA A;  3I5D A;  3OEE G;  3CB2 A;  4DR3 O;  2WLK A;  5EK0 A;  1M9N A;  1TA8 A;  1NH2 D;  4JV5 O;  4H13 B;  4U3J A;  1T5E A;  2HG5 C;  1Z5V A;  1XEQ A;  4JI0 B;  4QIW F;  1KKD A;  1M56 C;  3SPI A;  2YDE A;  5IYZ B;  4GKK B;  1ZAU A;  1D5A A;  1MSD A;  4NXN O;  1VQ5 V;  5EZY B;  4JZG A;  2QKS A;  4JI1 B;  1YCI A;  2XAG A;  3LUT B;  5EC1 C;  1IVS A;  4B3S B;  2EIN B;  1OCO B;  1AJQ A;  3OMN B;  5J2T A;  2CGO A;  2XAS A;  2E76 B;  5KMG B;  3RYC A;  5J2U B;  5KA6 A;  3OD4 A;  2AHZ A;  4LFC B;  2UXC O;  5E1A C;  3F5T A;  4XDJ A;  4FLT A;  5C8Y A;  2UXD B;  3CYO A;  1GM9 A;  2BSK B;  2GV9 A;  2WLJ A;  1GN6 A;  3R65 A;  1YDX A;  4W4L A;  1H8H G;  4U7N A;  1P7B A;  3C3T A;  4K0K O;  4YJ2 B;  4J10 A;  5BR8 B;  2A06 H;  2OIG A;  4UUJ C;  2AZ0 A;  2KG7 B;  2EJ7 A;  3N2G B;  4JPR A;  3AG1 B;  1H38 A;  2ZNI A;  2FYU H;  3K0D A;  4FIP C;  1FFX B;  1D5N A;  3JD2 A;  4JAU A;  3CC7 V;  4TOI A;  4BR6 A;  2P4K A;  3JYC A;  4JTD B;  4D7T A;  2P4V A;  4BIO A;  1NVP D;  1R6T A;  4RQE A;  5E79 Z;  3K57 A;  4DV0 O;  1N32 O;  4X64 B;  3K5N A;  1AI4 A;  1O9G A;  4O2A B;  1B6Q A;  1R3J C;  1Z2G A;  4UCT A;  5LHI A;  2EZO A;  2IJI A;  3VQX A;  2CH7 A;  3UCS C;  4MTX A;  5KA5 A;  3I55 V;  1XHZ A;  2CTQ A;  2QDO A;  4BWA A;  3IFX A;  3QTC A;  4TV8 A;  2HKO A;  4DV5 B;  2Q4P A;  1Q43 A;  4DUY O;  1YHQ V;  3U10 A;  1JMK C;  2M6Y A;  4UCV A;  1YI2 V;  2X6A A;  1KBH A;  2DQ0 A;  4RUE A;  1JPX A;  3D36 A;  4DV7 O;  1BQZ A;  4DV1 O;  1JJO A;  4LH7 A;  2CE4 A;  4NTX A;  2Y69 B;  1SES A;  1TVK A;  3JD1 A;  1RP3 B;  1Q6I A;  2OCC B;  3ASO B;  5CN0 A;  2WPD G;  2YID A;  4KUM A;  1J95 A;  4I9W A;  3E89 A;  3IC7 A;  1E1Q G;  1WP8 A;  4PI2 A;  1FPO A;  2YI9 A;  2UUB O;  1FXK B;  2YUA A;  3RYF B;  1AR4 A;  3LSQ A;  3CC4 V;  3VQV A;  1BQ0 A;  1QNM A;  2ZM6 B;  4DYL A;  1XIL A;  5LA6 B;  1K5S A;  2JEX A;  4OPA A;  4FM1 A;  3E86 A;  3SR2 C;  4F6R B;  2HP8 A;  4YJ2 A;  4JI2 B;  3N2K A;  1OCZ C;  2WWW A;  3AK2 A;  2P6J A;  1F23 A;  5FNV A;  1JX9 A;  4X1K B;  2Z3Y A;  4I9Q A;  1XMQ O;  3A8T A;  3E22 B;  1M57 C;  1L1F A;  4GLX A;  4JI6 B;  3MHH C;  1O9H A;  4Q6G A;  4RAI A;  4JI7 B;  4HNA B;  4PDM A;  5L3B A;  1CPY A;  4IGG A;  3RYI A;  1DLB A;  2ATK C;  1IBM B;  3S3W A;  3JAR A;  4KHP O;  2VWK A;  3I56 V;  2W0X A;  2BTO A;  3UT5 B;  5IJ9 A;  4EEQ A;  1JFF B;  5L3F A;  3CCE V;  3A0R A;  1OCR B;  3B8N A;  2DWE C;  2DYS C;  1XDC A;  3VOU A;  2YIB A;  4DK0 A;  1J5E B;  1V55 B;  1D2D A;  4Q20 A;  3FB5 C;  1IX9 A;  3HKD B;  4LNU A;  5LXT A;  4JYA O;  4DR6 B;  3L9D A;  4JI5 O;  3RT3 C;  4O4J A;  3G67 A;  1Y6X A;  4NKG B;  3JAS B;  5B1B C;  3CMA V;  1S0V A;  5KX5 B;  2Q0A A;  3EHB B;  2A7W A;  4JI8 B;  4JYC A;  2WLN A;  3CCM V;  4O4H B;  2FB5 A;  1S76 D;  2OTL V;  2B9Z A;  3IGA C;  4MW3 A;  2D2C B;  3ZJZ A;  3MHS C;  3AG3 B;  1Q90 D;  1AR5 A;  5L3G A;  2PZS A;  2ZDI C;  2ZR2 A;  3ABM C;  1MA1 A;  4O4I B;  4A5U B;  3AG7 A;  5LOV B;  3ZMZ A;  4AIL C;  2JIZ G;  4FPP A;  2Q69 A;  3TGU H;  4UCR A;  4O4H A;  1S3J A; 
#chains in the Genus database with same CATH homology
 4DR6 O;  1XMQ O;  4X66 O;  4JI1 O;  2FKX A;  1XNR O;  1R6T A;  2VQE O;  4DV0 O;  5LMU O;  1N32 O;  2DOS A;  5BR8 O;  4DV4 O;  1G1X B;  1J5E O;  4YY3 O;  2AGA A;  4DUZ O;  5BY1 A;  5FLX N;  4DR3 O;  4GKK O;  1R1B A;  4LF6 O;  1KUQ A;  1HNW O;  1FKA O;  3T1H O;  4KHP O;  1X59 A;  4OPH A;  4JV5 O;  1A32 A;  4DV5 O;  4JI0 O;  2LW7 A;  4LF4 O;  4DR4 O;  4JI8 O;  1AIL A;  4NXM O;  2UUA O;  1XEQ A;  4GKJ O;  3J81 N;  3J80 N;  2DJV A;  1HNX O;  2JRI A;  4DUY O;  1F7Y A;  1IBM O;  5H5N A;  1IBL O;  1YZB A;  3O65 A;  4B3S O;  4NXN O;  1D2D A;  4X64 O;  1N33 O;  5LL6 Y;  4DV7 O;  4DV1 O;  4JYA O;  1N36 O;  5IWA O;  3T1Y O;  1XMO O;  2VQF O;  3M8A A;  4JI5 O;  3RT3 C;  4JI2 O;  1I94 O;  2E5L O;  3JAM N;  2ZKO A;  2UXC O;  4JI4 O;  5BXZ A;  3F5T A;  1NS1 A;  4LF7 O;  2F4V O;  1XNQ O;  4LF5 O;  1HR0 O;  1N34 O;  2N74 A;  2UUB O;  2Z0A A;  3OTO O;  5A2Q N;  1FYJ A;  4DR5 O;  2ZM6 O;  1FJG O;  2HHH O;  4DV6 O;  4B3T O;  4JI7 O;  4X65 O;  4K0K O;  4LFB O;  1DK1 A;  4LF8 O;  4LF9 O;  4DV2 O;  1HNZ O;  2UU9 O;  4DR1 O;  4B3M O;  4JI6 O;  4OPA A;  2UXD O;  4A5U B;  4X62 O;  5LMN O;  4YHH O;  4JI3 O;  4AQY O;  3J7A U;  1AB3 A;  4LFC O;  2UXB O;  4DV3 O;  3SDL A;  1IBK O;  4LFA O;  4OX9 O;  4DR7 O;  4DR2 O;  3R66 A;  4B3R O;  2UUC O;  5IT9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...