4B3TO

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3tO00
1J5EO 1IBKO 1FJGO 1XNRO 4B3SO 4OPHA 4JI1O 4LF6O 1YZBA 1FYJA 4JI7O 3R66A 4DR7O 3O65A 2AGAA 4DV2O 4LF9O 4JI0O 2DOSA 3M8AA 2UXCO 4LFCO 2UUAO 1XMOO 4LF7O 2Z0AA 1XEQA 2UUCO 5BXZA 4YY3O 4DV1O 1N32O 1A32A 4DR1O 1KUQA 4LFAO 3J81N 2JRIA 4JI4O 3JAMN 1HNZO 2HHHO 4DV7O 3T1HO 2UUBO 4JI3O 4DR6O 5LMNO 1XNQO 4NXMO 4JV5O 4B3TO 4JI5O 4JYAO 5IT9N 1AB3A 2ZKOA 3J80N 5LMUO 2VQFO 4KHPO 4GKKO 2UXBO 4JI8O 1IBMO 1HR0O 1N33O 5BY1A 1G1XB 2LW7A 1HNXO 5FLXN 2F4VO 1X59A 4YHHO 4X64O 4JI2O 1R1BA 4JI6O 4A5UB 2N74A 1DK1A 1HNWO 4X66O 3RT3C 2VQEO 1IBLO 4LFBO 4B3RO 1N34O 5IWAO 2DJVA 4DR3O 4DR5O 2E5LO 1D2DA 4B3MO 4LF4O 4K0KO 4DUYO 4X62O 2UU9O 1AILA 3SDLA 5LL6Y 2ZM6O 1FKAO 3J7AU 4DV4O 1N36O 4DV3O 4DV5O 3OTOO 1I94O 1R6TA 2UXDO 2FKXA 1XMQO 3F5TA 3T1YO 4LF8O 5H5NA 4GKJO 5A2QN 1NS1A 4DV0O 4NXNO 4OX9O 4LF5O 4DR4O 4DV6O 4OPAA 4DUZO 4X65O 5BR8O 4AQYO 4DR2O 1F7YA
chains in the Genus database with same CATH superfamily
2BTQA 3HKCA 2F43G 1V55C 5F2VO 1FYJA 1KU9A 3CD6V 4G27B 1YVWA 1GN6A 1VQ4V 5CA0A 4BWAA 3N2KB 3ZHSA 1BE3H 4UCSA 2A3QA 4LWSA 4NTXA 4UB8Z 3CCLV 1XMOO 4I50A 1VQPV 2WA3A 2EZOA 3J81N 4LR3A 5JCOA 1MSWD 3T1HO 3D3QA 4LFBB 4KUMA 4XDKA 5IYCO 2CK3G 1YEWA 4UCOA 4EFEA 3L74H 1YXBA 4F6EA 1Z5VA 3ZHRA 4J7JA 3CX5F 5FPOA 2YC0A 1K5QA 2WLMA 5BY1A 4RQFA 4FLXA 3N27A 1COWG 3K59A 1KBHA 1Q8IA 4WBNA 1V9PA 2YXLA 4WFGA 4L8JA 4I9WA 2NLJC 4JZGA 4L87A 3AG1C 2PI5A 1G8MA 1IX9A 5KAFZ 3FAVB 3U11A 4DR3O 3B77A 1I94B 3M7MX 3CMEV 1G6UA 1VQKV 4I55B 2D2CB 2WA4A 5ITZB 4P9PA 2Y4UA 2Q6AA 2JVDA 2ZM6O 4PA4A 1FAFA 1HDJA 3OR7C 4NXNB 5FNVA 1BHBA 4LBEC 4GKJO 3CSXA 1BSMA 4RQEA 1US6A 3ZBHA 3ABLC 2P90A 3AEIA 2H94A 2IU0A 2A79B 4LF5O 1MG1A 1VP7A 4DV6O 1QVGU 4U3JB 3DGEA 2Q0OC 1JQ0A 2PUSA 3OUFA 5FL7G 4CC5A 2YUAA 5EBMC 3OFNG 5GTHZ 4LP8A 4GT1A 5EZYB 1EN6A 1Q5OA 2GSMB 3GWKC 4BAYA 2HHHB 1W0KG 1XNQB 1K9MW 1KP2A 4CH5A 3FB5C 4KL1A 4JI4O 3ABMB 5J2TB 3AG7A 3QO8A 2JEXA 4PA6A 1PL4A 2ZDIA 2YI8A 3VQYA 4LCUC 1RM1C 2F4VB 1F51A 3BA8A 2OTLV 4HYOA 5LHIA 2F1MA 3JSLA 3P3NA 3Q4HA 3IFXA 4ZBMA 4O4JA 3ZX6A 1IZ3A 3FYEB 4JI6O 3QG5A 4NTYA 1N34B 1Q3EA 5LOVA 3EFFK 1SERA 2GBOA 4FLVA 4FVMA 1QLEB 4X88A 4LFBO 4G28B 4O2BB 4J9ZB 1Q86W 4CH3A 3SPGA 4TQFA 4DXWA 4B3MO 4FLZA 1ROPA 1FXHA 4KXRA 2BOBC 3ASNB 4FM0A 2BCCH 1AI6A 3CP1A 4PDMA 1V54B 4HAMA 4HBNA 2DE0X 4X9QA 2B1GA 5C8YB 3CCRV 2ZE7A 5A2QN 1EZVH 2YDEA 4TT3G 4MVSA 3H1LH 5CBFA 4I5SA 3HKBB 1VQOV 4B3SB 4JI1B 1SRYA 4PI2A 3W7WA 2DW4A 4X1IB 5CA1B 1Y4MA 3PJSK 1NQTA 1OCOC 2GTAA 4MVUA 3FB6C 1BS3A 2UXCB 4LFCB 5IDJA 3ZJZA 1N0NA 1SQQH 3D36C 4GX5A 4MTOA 4JI0O 4DR1B 4UVCA 4FJCC 1XHZA 4DW0A 3K08A 4JI3B 5BXZA 1P7GA 3E8BA 1K8AW 1EN4A 4MVOA 1HNZO 2QGNA 1URFA 3N2GA 5B1BB 4JV5O 3W7XA 2YI9A 2A0LA 3FFQA 4MTGA 1H2GA 5LMUO 2LW1A 1WAZA 2PY5A 4DV3B 1JOYA 1G1XB 3AG4C 4H13B 1ZUQA 1TGOA 1Z2GA 4X66B 5GONA 4X64O 1YSCA 2WLKA 4FLTA 3OEEG 3ZHUA 1K5SA 3SYOA 3QO5A 3AG3C 2FTKA 4J7ZA 1L0LH 2LJ2A 1JJOA 3RVZA 3BA9A 3FAVA 5LHGA 4B3RO 4EEQA 4I55A 1FJGB 4N21A 5ITZA 3ZRVA 2EIJC 3RYIA 3RYFB 3AG2B 5DEDA 1H2KA 2YIBA 1ZAUA 3A8TA 4IHJB 2XASA 1Q6IA 2DYRC 1BZKA 3QO7A 3F5TA 4X1YB 1T5EA 2QWRB 3FD9A 3ASOC 2XAGA 2PYLA 2ZR2A 3MHHC 4NB5A 3T4ZA 3DC5A 1IBKB 1WB7A 4U3JA 4QPJA 1W0JG 1KKCA 5KA5A 4NXMB 4YIOA 3W7SA 3OR6C 4KP4A 1J5EO 2W6IG 2YSUB 2F23A 4OPHA 1YZBA 1SA0B 3HKEB 3R65A 4I9QA 4ICGA 4LFAB 2IJJA 3B2EE 4UCRA 4LF7O 2Q5ZA 2UUBB 3ZN0A 3IJ4A 1PNMA 4GX2A 2H8PC 2ARHA 5J2TA 3RVYA 1Q81W 5L3EA 2ZNJA 1K7DA 1IBMB 4EB6B 1N33B 1K97A 3O9OA 1OCCC 1ZX3A 3BHPA 1Q7YW 1I08A 4EFBA 2O57A 1NR7A 4K3AA 2ILMA 1PNLA 4ABMA 3CC4V 3CCUV 1TA8A 3SYAA 3JAWB 1IDSA 5B1AB 3VBBA 1D5AA 1VF6C 3LNMB 3RT3C 2VQEO 4DR5B 3VQXA 2XAQA 3MD0A 1BGYH 2P6JA 3CS5A 3BFRA 5IY5C 3BAAA 2PYJA 4J42A 3ZS8C 1VQ7V 1AR5A 4FM2A 3W7TA 2W0FC 4WBNB 4DV3O 1SS3A 1QU7A 1XDCA 1FFTB 5C8YA 5TISZ 2B1IA 2QWPB 1N32B 1CPYA 1CP9A 1GM9A 1NTKH 2ADPA 1FFXB 2BSKB 3ZIAG 2XAFA 3MAQA 4WF9V 4X1IA 4AQYO 5EC1C 2Z3YA 4DR2O 1DTOA 4WFBV 5IE9A 1FJGO 5FPRA 1P7BA 1XMOB 1Q43A 2OYQA 3LUTB 3ZMTA 5FNVB 3TCUA 1Q6UA 4E2LA 1M93A 5GTIZ 3T1HB 1JJ2U 1S77D 2EBOA 1WA8B 1F23A 3BY6A 3W7UA 1I5YA 2CTQA 4H33A 3JYCA 1MOFA 4FLYA 4I7ZB 4QJFB 4NXMO 4D7SA 1FXVA 2IJHA 4H37A 5K1PA 4TWKA 4JI8O 5LHHA 1HR0O 2LW7A 3ZRWB 1X59A 2R9IA 3JSNA 2WLNA 3SGIA 1HWYA 2Q69A 2XNDG 2BTOA 2EINC 2JS5A 1PPJH 2Q7HA 3G6BA 1IBLO 1XHXA 3C3TA 4UCVA 5DN6G 2ZE6A 2CAZC 5IWAO 2ZM6B 2DJVA 1XNRB 5IYDO 3C90A 3S3WA 2DWEC 3RYFA 1HP8A 3SPJA 4GKJB 3JD3A 4IHJA 4KFMA 1FPOA 1N36O 2WLHA 3OT7A 4X1YA 3BCCH 2M6YA 1SZTA 1GH6A 2P4KA 4DV6B 5JJNB 2CDYA 3OW2U 2P5OA 2JGUA 4BIUA 3IC9A 2Z5UA 2M7WA 4PDVA 3RYCB 1QHTA 4GYCB 3CRQA 2DYSC 1SA0A 1FD9A 3HKEA 4OGQB 2V4DA 4DV2O 1OCRC 4JAVA 2WAMA 3X2QB 1TVKB 2EILB 3CB2A 4JI4B 4PHZA 2LFRA 2KG7B 1N32O 5IJ0B 1U97A 4J9YB 1GRJA 2ETNA 1WJZA 1XL4A 4DV7O 1UJWB 4EB6A 1WNSA 1ZTEA 4B3TO 2RCVA 2E5LB 5JH7B 1AROP 1QR9A 3L72H 5KX5B 3EHBB 2ZINA 3FX7A 4MVZA 4WFFA 2YXYA 4JI6B 1H8EG 4JTAB 3SJQC 1WB8A 2CGNA 1M90W 4XDJA 5DECA 1JCHA 5EBWC 4JAUA 1YI2V 3JAWA 2Q0AA 4MVQA 3H1HH 2Y0IA 3NXSA 3N2GB 1AR1B 3K06A 1VQMV 1R3LC 4N23A 4X65B 4B3MB 2JDIG 1OHHG 3B09A 1UPGA 1ZLZA 1V55B 3OAAG 5J2UB 4CBCA 1R3IC 2ADQB 2R9RB 2WLJA 3C3SA 1LUWA 2IM9A 5GONB 4PA7A 3QTCA 3OTOO 4HZ3A 4ZHQA 4FFBA 4GCZA 4YY3B 1NS1A 1FFXA 4XBFA 4O4LA 1EFRG 4AILC 4CH6A 2KQXA 2BSKA 5H6QA 3E8FA 1FXKC 3LDEA 1AP6A 4DW1A 4ZI7A 1NVPB 4ZOLB 3CYOA 3RYHA 4D7TA 2EIMC 4UXNA 4MS2A 2CH7B 1XOUA 5H2FZ 3TJTA 4BR6A 2HVKC 4E4EA 4JI0B 1K92A 3RYIB 1XNRO 3JD0A 1SC5B 1JPXA 2LFSA 4MT8A 3CCJV 4DR7O 3O65A 1BHAA 3IC7A 2VRZA 2ZIMA 4QIWF 2EIKC 3K03A 1YITV 2AZ0A 3RFRA 1WA8A 4O4HB 3L71H 3K5LA 3L75H 1HNZB 4JV5B 1BL8A 3E35A 4QPKA 2LO1A 3AG1B 5IYZB 2HJFC 3DSQA 5LP6C 5L3GA 1QQCA 5LMUB 1YTFD 1CEZA 4X89A 1PM9A 1IURA 4P2ZA 2PTMA 1K34A 4D6TH 3ABMC 2ZD9A 3B40A 4GKKO 1I7FA 4X64B 1M4UA 3ZRWA 2B9ZA 2X7RB 3JCZA 1KC8W 2WSSG 2P67A 1KQSU 4H0LB 1SQGA 2FL4A 4YHHO 3K57A 4MVMA 2PF4E 5C93A 1THZA 2P22C 2XT9A 3ABLB 4YJ3B 4B3RB 2X6CA 2A06H 4DUZB 2NR5A 2ATKC 3SPIA 1B6QA 1OCZC 3GB7C 2UXXA 2QE7G 5KHGA 2E5LO 4MVRA 4GX1A 2Y48A 4LF4O 2GDSA 2YXHA 4RAIA 2N04A 5LL6Y 5L3BA 2IJKA 4CH4A 5KA6A 4P9OA 2F95B 4CC6A 3ASNC 2HFEC 5A9GA 4PDRA 5J9PC 1R73A 4OX9O 4W4KA 1JVMA 3TXQA 3RYCA 1J5EB 4X65O 1O9HA 2GUZA 3K9SA 1RM1B 3A2FA 3SPHA 2QSAA 1VARA 4MSWC 4LF7B 2Y69C 1TVKA 2DOSA 4FIPC 3QF7A 5KHKA 5BZBA 2KG7A 4GLXA 2UUCO 4YY3O 5IJ0A 4BIZA 3ZN1A 1F4NA 3CE2A 1R3JC 2OCHA 2QWQB 2RMKB 4UCUA 3HPLC 2JEUA 2QM8A 5JH7A 1MZEA 1MZFA 1YCIA 5KX5A 1XL6A 1AB3A 3B8NA 2X0LA 3HB3B 3J80N 2N05A 4X62B 2UXBO 1YJ9V 4DV5B 4GX0A 4PELA 3K5NA 2UXDB 5FLXN 2DWDC 5L3CA 3IGAC 3OGCC 1M56C 2VQEB 2OCCC 4DV0B 3WB0A 3JALB 3K3WA 5D5PA 3JAKB 3KKYA 3OMAB 1YIJV 3ABKC 1SETA 4LH7A 4NVPA 3JCUZ 4NTWA 1OCOB 4PA3A 2YICA 3ZHVA 5J2UA 2PZSA 1D2DA 4X20A 2CUGA 1E79G 1YDXA 3CJHB 1LUVA 1QCEA 4I0XB 5LYJA 4LH6A 1S76D 2R72A 2EZPA 3T1YO 5H5NA 4FZ1A 1SQVH 4YJ2B 4AQYB 2JIZG 1I5XA 4DR2B 4ZOLA 4WFHA 2CH7A 4IIJB 1G4YB 4DUZO 2WLIA 3K5MA 3G71V 3E8HA 1VQ9V 1DF5A 1QR8A 3I56V 3F7YC 2WLLA 3AG4B 4XDLA 2V7QG 2Q9LA 4LF9O 1YF2A 1ORQC 1Q82W 1Y6XA 5LGNA 4O4HA 2AZ2A 2UUAO 5H9CA 5EYPA 1JX9A 1JFFB 3AG3B 1A32A 1L1FA 2GV9A 5IYZA 1K3EA 1U96A 2JJ2G 4JI8B 3VQVA 1HR0B 3VOUA 5B66Z 4TV8B 4UV8A 2EIJB 3K9AA 1H2LA 5IT9N 3KCXA 3IAYA 4X1KA 2IBZH 4UFZA 3A0RA 2DYRB 2QM4A 3KCYA 1VQLV 4YIPA 3STZC 3ASOB 4LF8B 1YHQV 3ETGA 4YJ3A 1IBLB 2ITDC 2Y4TA 5IWAB 3APQA 4IGGA 4DR4B 3H1KH 4RUEA 5EIBC 4AI8A 5JCOC 4UVBA 5B1AC 1M57C 1N36B 4JAAA 3JD1A 5CBGA 5KMGB 3U0ZA 2UU9O 4X62O 1GAXA 3SDLA 4DV4O 4DV5O 1VEWA 2Q73A 2AHYA 2UXDO 2Q8VA 4QE7A 2OWOA 3H01A 4K8XA 3UO3A 4DV0O 4ASUG 3BVOA 1I0HA 1GTOA 3JD2A 1KYOF 1OCCB 2HP8A 2YIDA 1F7YA 2ZXWC 3K0GA 4DV2B 2OIGA 4Q20A 2HKOA 3T2MA 4ZHQB 4FFBB 3AK3A 4O4LB 4FLWA 2NNUA 4DV7B 4ZI7B 1S0VA 1Z5WA 3RYHB 4B3TB 4R7CA 1P49A 2IJIA 5JJJB 2CTPA 1X4TA 3U10A 1R6KA 1LR1A 4IYIA 5IY5B 4UVAA 1NI8A 3LSQA 1AJQA 1XQ8A 4HNAB 2VQFO 2XAJA 4DK1A 3H9VA 1RP3B 4JTDB 1ZSPA 4G2KA 5D5QA 3JALA 4TSFG 4RUFA 3JAKA 1DK1A 3FB8C 3K04A 1WP8A 3OMNB 2QEXV 4UB6Z 4Z1VA 1PKXA 3OTOB 3D36A 1KECA 4O4IB 2HJDA 2ZDIC 3CJHA 4I0XA 1WLEA 3J7AU 4F6RB 2DQ0A 1VQNV 4YJ2A 4LF8O 5HFLA 2IH3C 2LP7A 1GK9A 1KP3A 2Q4PA 1KD1W 2QJ1A 4IIJA 3BABA 3EXAA 4DR6B 1H2MA 3JASB 5L3DA 3E89A 4DR4O 2DMXA 3VQWA 4DR7B 2YIBD 2JJ1G 4OXSA 2QR4A 5KHJA 1XILA 1RFYA 1AI5A 4GZRB 4BIOA 3CEIA 1VF5B 2K1EA 3WG7C 1NKDA 2AGAA 5EK0A 1YJNV 2L35A 4DRXB 3G80A 1NTZH 5B3SC 5CMUA 1KMIZ 1JFFA 2Z0AA 2HVJC 2IU3A 2QKCA 4DV1O 3E2EA 4K35A 4JZ2A 2EINB 3QVNA 5CBHA 4DYLA 3P32A 3ABUA 4GKKB 1SESA 2GUZB 4CZZA 4TV8A 4TV9B 2IH1C 1B3QA 1EM1A 2RDCA 5K1XA 5BMVB 4YHHB 1ZWIC 1GN4A 4LNUB 3MDSA 1W59A 3G4SV 2OT5A 3CCSV 4TOIA 1R1BA 1SQBH 3OUSA 3DTUB 1FS0G 3G67A 3CCEV 3ETEA 4Z1MG 4JYCA 4TUYA 1HNWO 4P30A 1NTMH 5GW7A 1H2SB 4LF4B 2QA4V 1QBZA 1KKDA 1S5JA 3WB1A 2DYSB 3DXRB 1JR9A 3E8GA 2A9HA 4R8CA 5KMGA 2Q7GA 4O2AA 1ZL8B 2FMLA 2AXTZ 1K33A 3SR2C 2PI4A 1FKAO 1OCRB 3SJCC 3E22A 2QM7A 4FZ0A 2IW5A 1DLBA 3SJBC 3K58A 4OX9B 4C7UA 2QTOA 3ICXA 3OM3B 3LNNA 2JS3A 4NYKA 1KB9F 2RN9A 3FKSG 1H8HG 4OPAA 2XHBA 2QKAA 4X20B 4FPPA 1VQ8V 1Y76A 3SYPA 3FYIB 5B5EZ 2Q68A 4UCTA 2E74B 5LYJB 1NT2B 2UUCB 3THOA 3M8AA 1QLNA 1RSOB 1Y74B 1VF6A 3SYQA 2MK3A 3ML0A 1KUQA 3UKMA 3T4DA 2JRIA 2WLIB 3K0DA 4U7NA 1EBOA 5E1AC 4DR6O 2UXBB 3E83A 1EN5A 4JYAO 4HNAA 2WLLB 3UT5B 1L0NH 4JPRA 5CB4B 4Q6GA 3OD4A 1R6NA 1AVMA 3JD4A 4Z2WA 1IXBA 5EYPB 4PD4F 2JK5C 1E1RG 3CHXA 1WN7A 4IT5A 4YXWG 1FXKB 3L70H 1YJWV 2EIMB 3ZMUA 2KB1A 4X8AA 2AHZA 3M99B 3RN4A 2RQ6A 4O4IA 4X1KB 5LGTA 4K0KO 3T1YB 4DUYO 4F6RA 3P3PA 3CRAA 3CXCU 2EIKB 1K4CC 1VIBA 3HKDA 4JASA 2P4VA 3ETDA 3ZHTA 1RPRA 3AK1A 5LP6B 4J41A 3BEHA 3JASA 4QGPA 4I4TB 3GVMA 4DO2A 4JYYA 5BR8O 2F93B 5CN0A 1QLEC 2YIAA 1VQ6V 1ENVA 3CCMV 4LF9B 2L6LA 2R9AA 4LF6O 3I5DA 2UUAB 1M5IA 4DRXA 2V1DA 1JA8A 2Q67A 3B8MA 1WP7A 5JVDB 2EX3A 4NR1A 2WPDG 2ZT9B 3UM7A 1V54C 5B1OA 2ZIOA 3ABTA 1GN3A 1PNKA 5JWPA 4H44B 2YS8A 1XI1A 5LGUA 1SQPH 1BCCH 2CTWA 3PN1A 3JAMN 3CXHF 3OGIB 3GWOA 4TV9A 1OCZB 1J95A 2JGDB 5HFMA 2Q7EA 5E79Z 2HEPA 5KUMA 1DGSA 3I55V 5BMVA 1SQFA 4CS4A 3F5WC 2K9PA 4LNUA 5B1NA 2OTJV 1XMQB 2E76B 4QE9A 4RWUA 1AR4A 4FK5C 3ETQA 3L9DA 2H3OA 3JARA 2LGWA 2N74A 2KSDA 5CA3A 2VWKA 3S3XA 1PP9H 4CS2A 2A7WA 4JYBA 3MHSC 1Y67A 3DXRA 2VWJA 4U3FH 5EC2C 1BT8A 3A0BZ 3D3IA 2P06A 4PI0A 5B1BC 5IYBO 2UU9B 4DV4B 1ZL8A 5EIBD 5H6RA 2LQTA 1OV9A 2Y69B 1AILA 1I94O 3EVKA 1R6TA 2ODMA 1IVSA 4R50A 5LXTB 1MSDA 3LSUA 3OE7G 3K79A 3N2KA 3ZEDA 4QNHB 1BQ0A 4NXNO 3ZCCA 1Y66A 1GM8A 4MW3A 4FMTA 2E75B 1SKVA 3L73H 1RPOA 3OEHG 1M1KW 4KHPB 2XUMA 2W0XA 2R70A 4CS3A 1HNXB 3R66A 1JMKC 3TGUH 2BE3A 1YTFB 2ITCC 3AG2C 1M56B 2OCCB 4UUJC 1RSOA 1NH2D 1Y74A 1MNGA 2VS0A 2FB5A 1XEQA 5KHHA 4J11A 1AJNA 4J80A 3WFVA 3WB2A 3ZMZA 3CWBH 3ABKB 3CCVV 1S3JA 2HHHO 3B4SA 1H38A 2VQFB 5L3FA 1XNQO 4R6ZA 1PL0A 4W4LA 3UT5A 2ZE8A 4AHCA 2D3OW 1XUQA 1P4RA 5CB4A 4BW5A 2ZKOA 1QNMA 2PGGA 1B06A 5IJ9B 3TK1A 4FLUA 3G6EV 1NZ6A 3RBZA 2W6JG 2NN4A 1MMMA 1PV0A 2ZR3A 5JJEB 2F4VO 5JQGB 1MA1A 3OTFA 1FXKA 1TAEA 2UXNA 1GO3F 3LDDA 1W2BU 2G38A 1EZJA 4LC1A 2CGOA 2ZQMA 1N34O 3JATB 1NU1H 3CRRA 3CMAV 1DF4A 3SYCA 4JI7B 2E3CA 2XOKG 5LA6B 1TUBB 3TETA 1NBMG 4PDLA 2MW2B 4IYHA 1XMQO 2AW9A 1WPBA 5EZYA 4TUYB 3QNEA 5LP6A 5LBQA 4PV1B 2KKWA 4U7OA 4PA9A 4I4TA 3AK2A 5LMNB 4UV9A 4JI5B 4ZIBA 2F66C 2YEVB 4O2AB 1VF7A 4B3SO 2B5UA 4JI1O 1CXZB 2BTQB 5DM6V 3HKCB 3K5OA 2HG5C 4JF3A 3E22B 5JVDA 4WFAV 4DV1B 1WPXA 4JI2B 2UXCO 4LFCO 5CA0B 1XBLA 1S5LZ 1IXMA 2XAHA 2HLDG 4LWSB 3RGBA 3RW0A 1P84F 4DR1O 3ZMSA 4I50B 2CTRA 4B7KA 1VQ5V 3ZRSA 2JGDA 1S5HC 2BOCC 4JI3O 1H2NA 4BW9A 1AP5A 4EKWA 1Y76B 2EULA 3T1CA 1M57B 1MABG 2X6BA 1D5NA 1O9GA 2LGQA 3A0HZ 4O2BA 2GTSA 4PJ0Z 4KHPO 3BRCA 1NJIW 4MTXA 5KLVH 4MW8A 1GKFA 3CC7V 1HNXO 3RWRD 1UFIA 1GN2A 4NKGB 1HNWB 3H1JH 1BMFG 3DC6A 4A5UB 4J10A 3APOA 4WFEA 4X66O 1HW7A 1K73W 1AI7A 1N8RW 2ZNIA 3F7VC 1B04A 4WCEV 1OZ0A 1K4DC 1AJPA 2QWOB 3HKBA 2ZXWB 2DQ3A 1N4CA 3BPZA 5CA1A 1NH2B 2Y0PA 1L8DA 1XREA 2QDOA 2OIEA 5LXTA 3P30A 1Q6HA 3NR7A 2EJ7A 4IL6Z 3LSSA 3STLC 1N0JA 3KZIZ 1SQXH 3LDCA 1TUEB 4B7EA 1NR1A 3UQ8A 2QTSA 3WU2Z 4TQDA 5KHIA 1IBKO 4K8ZA 2CE4A 3UO2A 3SJAC 4JI7O 3CCQV 2X6AA 3HKDB 1NVPD 3E86A 3UCSC 1SZXA 2C2AA 4GUNA 4RO2A 3ZMVA 1GMGA 3KG2A 3CPWU 2QWNB 4LFAO 3CC2V 1M9NA 4JYAB 4JGSA 2RJZA 2UUBO 5LMNO 4DR3B 3SPCA 1AI4A 4JI5O 2ZE5A 4MTFA 3CRMA 4FM1A 1BQZA 2P7TC 5IJ9A 1F4MA 1IBMO 1LNQA 1N33O 1OJHA 1R3KC 5JQGA 3TXSA 5AG2A 2ZCEA 4JTCB 2HR3A 3Q4HB 4JI2O 3X2QC 4O4JB 2EILC 4DK0A 4LF5B 5KUKA 3HR0A 4F4LA 5LOVB 1GM7A 2GHYA 4K0KB 3JATA 4DUYB 2RNBA 4B08A 1SF9A 3ZHQA 4DR5O 2QKSA 3D8CA 5LA6A 1TUBA 3WG7B 3OMIB 5EBLC 3CRCA 1Q90D 4ZKIA 5B3SB 1QVFU 1PD3A 2FYUH 2FKXA 1E1QG 2XTAA 5KAIZ 3JARB 3FB7C 2EJRA 1S72V 5BR8B 4J7KA 4FFKA 1VMGA 2YEVA 4LF6B 3H1IH 2WWWA 2DN9A 3ZRXA
chains in the Genus database with same CATH topology
1J5EO 1IBKO 1FJGO 1XNRO 4B3SO 4OPHA 4JI1O 4LF6O 1YZBA 1FYJA 4JI7O 3R66A 4DR7O 3O65A 2AGAA 4DV2O 4LF9O 4JI0O 2DOSA 3M8AA 2UXCO 4LFCO 2UUAO 1XMOO 4LF7O 2Z0AA 1XEQA 2UUCO 5BXZA 4YY3O 4DV1O 1N32O 1A32A 4DR1O 1KUQA 4LFAO 3J81N 2JRIA 4JI4O 3JAMN 1HNZO 2HHHO 4DV7O 3T1HO 2UUBO 4JI3O 4DR6O 5LMNO 1XNQO 4NXMO 4JV5O 4B3TO 4JI5O 4JYAO 5IT9N 1AB3A 2ZKOA 3J80N 5LMUO 2VQFO 4KHPO 4GKKO 2UXBO 4JI8O 1IBMO 1HR0O 1N33O 5BY1A 1G1XB 2LW7A 1HNXO 5FLXN 2F4VO 1X59A 4YHHO 4X64O 4JI2O 1R1BA 4JI6O 4A5UB 2N74A 1DK1A 1HNWO 4X66O 3RT3C 2VQEO 1IBLO 4LFBO 4B3RO 1N34O 5IWAO 2DJVA 4DR3O 4DR5O 2E5LO 1D2DA 4B3MO 4LF4O 4K0KO 4DUYO 4X62O 2UU9O 1AILA 3SDLA 5LL6Y 2ZM6O 1FKAO 3J7AU 4DV4O 1N36O 4DV3O 4DV5O 3OTOO 1I94O 1R6TA 2UXDO 2FKXA 1XMQO 3F5TA 3T1YO 4LF8O 5H5NA 4GKJO 5A2QN 1NS1A 4DV0O 4NXNO 4OX9O 4LF5O 4DR4O 4DV6O 4OPAA 4DUZO 4X65O 5BR8O 4AQYO 4DR2O 1F7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E O;  1IBK O;  1FJG O;  1XNR O;  4B3S O;  4OPH A;  4JI1 O;  4LF6 O;  1YZB A;  1FYJ A;  4JI7 O;  3R66 A;  4DR7 O;  3O65 A;  2AGA A;  4DV2 O;  4LF9 O;  4JI0 O;  2DOS A;  3M8A A;  2UXC O;  4LFC O;  2UUA O;  1XMO O;  4LF7 O;  2Z0A A;  1XEQ A;  2UUC O;  5BXZ A;  4YY3 O;  4DV1 O;  1N32 O;  1A32 A;  4DR1 O;  1KUQ A;  4LFA O;  3J81 N;  2JRI A;  4JI4 O;  3JAM N;  1HNZ O;  2HHH O;  4DV7 O;  3T1H O;  2UUB O;  4JI3 O;  4DR6 O;  5LMN O;  1XNQ O;  4NXM O;  4JV5 O;  4B3T O;  4JI5 O;  4JYA O;  5IT9 N;  1AB3 A;  2ZKO A;  3J80 N;  5LMU O;  2VQF O;  4KHP O;  4GKK O;  2UXB O;  4JI8 O;  1IBM O;  1HR0 O;  1N33 O;  5BY1 A;  1G1X B;  2LW7 A;  1HNX O;  5FLX N;  2F4V O;  1X59 A;  4YHH O;  4X64 O;  4JI2 O;  1R1B A;  4JI6 O;  4A5U B;  2N74 A;  1DK1 A;  1HNW O;  4X66 O;  3RT3 C;  2VQE O;  1IBL O;  4LFB O;  4B3R O;  1N34 O;  5IWA O;  2DJV A;  4DR3 O;  4DR5 O;  2E5L O;  1D2D A;  4B3M O;  4LF4 O;  4K0K O;  4DUY O;  4X62 O;  2UU9 O;  1AIL A;  3SDL A;  5LL6 Y;  2ZM6 O;  1FKA O;  3J7A U;  4DV4 O;  1N36 O;  4DV3 O;  4DV5 O;  3OTO O;  1I94 O;  1R6T A;  2UXD O;  2FKX A;  1XMQ O;  3F5T A;  3T1Y O;  4LF8 O;  5H5N A;  4GKJ O;  5A2Q N;  1NS1 A;  4DV0 O;  4NXN O;  4OX9 O;  4LF5 O;  4DR4 O;  4DV6 O;  4OPA A;  4DUZ O;  4X65 O;  5BR8 O;  4AQY O;  4DR2 O;  1F7Y A; 
#chains in the Genus database with same CATH topology
 2BTQ A;  3HKC A;  2F43 G;  1V55 C;  5F2V O;  1FYJ A;  1KU9 A;  3CD6 V;  4G27 B;  1YVW A;  1GN6 A;  1VQ4 V;  5CA0 A;  4BWA A;  3N2K B;  3ZHS A;  1BE3 H;  4UCS A;  2A3Q A;  4LWS A;  4NTX A;  4UB8 Z;  3CCL V;  1XMO O;  4I50 A;  1VQP V;  2WA3 A;  2EZO A;  3J81 N;  4LR3 A;  5JCO A;  1MSW D;  3T1H O;  3D3Q A;  4LFB B;  4KUM A;  4XDK A;  5IYC O;  2CK3 G;  1YEW A;  4UCO A;  4EFE A;  3L74 H;  1YXB A;  4F6E A;  1Z5V A;  3ZHR A;  4J7J A;  3CX5 F;  5FPO A;  2YC0 A;  1K5Q A;  2WLM A;  5BY1 A;  4RQF A;  4FLX A;  3N27 A;  1COW G;  3K59 A;  1KBH A;  1Q8I A;  4WBN A;  1V9P A;  2YXL A;  4WFG A;  4L8J A;  4I9W A;  2NLJ C;  4JZG A;  4L87 A;  3AG1 C;  2PI5 A;  1G8M A;  1IX9 A;  5KAF Z;  3FAV B;  3U11 A;  4DR3 O;  3B77 A;  1I94 B;  3M7M X;  3CME V;  1G6U A;  1VQK V;  4I55 B;  2D2C B;  2WA4 A;  5ITZ B;  4P9P A;  2Y4U A;  2Q6A A;  2JVD A;  2ZM6 O;  4PA4 A;  1FAF A;  1HDJ A;  3OR7 C;  4NXN B;  5FNV A;  1BHB A;  4LBE C;  4GKJ O;  3CSX A;  1BSM A;  4RQE A;  1US6 A;  3ZBH A;  3ABL C;  2P90 A;  3AEI A;  2H94 A;  2IU0 A;  2A79 B;  4LF5 O;  1MG1 A;  1VP7 A;  4DV6 O;  1QVG U;  4U3J B;  3DGE A;  2Q0O C;  1JQ0 A;  2PUS A;  3OUF A;  5FL7 G;  4CC5 A;  2YUA A;  5EBM C;  3OFN G;  5GTH Z;  4LP8 A;  4GT1 A;  5EZY B;  1EN6 A;  1Q5O A;  2GSM B;  3GWK C;  4BAY A;  2HHH B;  1W0K G;  1XNQ B;  1K9M W;  1KP2 A;  4CH5 A;  3FB5 C;  4KL1 A;  4JI4 O;  3ABM B;  5J2T B;  3AG7 A;  3QO8 A;  2JEX A;  4PA6 A;  1PL4 A;  2ZDI A;  2YI8 A;  3VQY A;  4LCU C;  1RM1 C;  2F4V B;  1F51 A;  3BA8 A;  2OTL V;  4HYO A;  5LHI A;  2F1M A;  3JSL A;  3P3N A;  3Q4H A;  3IFX A;  4ZBM A;  4O4J A;  3ZX6 A;  1IZ3 A;  3FYE B;  4JI6 O;  3QG5 A;  4NTY A;  1N34 B;  1Q3E A;  5LOV A;  3EFF K;  1SER A;  2GBO A;  4FLV A;  4FVM A;  1QLE B;  4X88 A;  4LFB O;  4G28 B;  4O2B B;  4J9Z B;  1Q86 W;  4CH3 A;  3SPG A;  4TQF A;  4DXW A;  4B3M O;  4FLZ A;  1ROP A;  1FXH A;  4KXR A;  2BOB C;  3ASN B;  4FM0 A;  2BCC H;  1AI6 A;  3CP1 A;  4PDM A;  1V54 B;  4HAM A;  4HBN A;  2DE0 X;  4X9Q A;  2B1G A;  5C8Y B;  3CCR V;  2ZE7 A;  5A2Q N;  1EZV H;  2YDE A;  4TT3 G;  4MVS A;  3H1L H;  5CBF A;  4I5S A;  3HKB B;  1VQO V;  4B3S B;  4JI1 B;  1SRY A;  4PI2 A;  3W7W A;  2DW4 A;  4X1I B;  5CA1 B;  1Y4M A;  3PJS K;  1NQT A;  1OCO C;  2GTA A;  4MVU A;  3FB6 C;  1BS3 A;  2UXC B;  4LFC B;  5IDJ A;  3ZJZ A;  1N0N A;  1SQQ H;  3D36 C;  4GX5 A;  4MTO A;  4JI0 O;  4DR1 B;  4UVC A;  4FJC C;  1XHZ A;  4DW0 A;  3K08 A;  4JI3 B;  5BXZ A;  1P7G A;  3E8B A;  1K8A W;  1EN4 A;  4MVO A;  1HNZ O;  2QGN A;  1URF A;  3N2G A;  5B1B B;  4JV5 O;  3W7X A;  2YI9 A;  2A0L A;  3FFQ A;  4MTG A;  1H2G A;  5LMU O;  2LW1 A;  1WAZ A;  2PY5 A;  4DV3 B;  1JOY A;  1G1X B;  3AG4 C;  4H13 B;  1ZUQ A;  1TGO A;  1Z2G A;  4X66 B;  5GON A;  4X64 O;  1YSC A;  2WLK A;  4FLT A;  3OEE G;  3ZHU A;  1K5S A;  3SYO A;  3QO5 A;  3AG3 C;  2FTK A;  4J7Z A;  1L0L H;  2LJ2 A;  1JJO A;  3RVZ A;  3BA9 A;  3FAV A;  5LHG A;  4B3R O;  4EEQ A;  4I55 A;  1FJG B;  4N21 A;  5ITZ A;  3ZRV A;  2EIJ C;  3RYI A;  3RYF B;  3AG2 B;  5DED A;  1H2K A;  2YIB A;  1ZAU A;  3A8T A;  4IHJ B;  2XAS A;  1Q6I A;  2DYR C;  1BZK A;  3QO7 A;  3F5T A;  4X1Y B;  1T5E A;  2QWR B;  3FD9 A;  3ASO C;  2XAG A;  2PYL A;  2ZR2 A;  3MHH C;  4NB5 A;  3T4Z A;  3DC5 A;  1IBK B;  1WB7 A;  4U3J A;  4QPJ A;  1W0J G;  1KKC A;  5KA5 A;  4NXM B;  4YIO A;  3W7S A;  3OR6 C;  4KP4 A;  1J5E O;  2W6I G;  2YSU B;  2F23 A;  4OPH A;  1YZB A;  1SA0 B;  3HKE B;  3R65 A;  4I9Q A;  4ICG A;  4LFA B;  2IJJ A;  3B2E E;  4UCR A;  4LF7 O;  2Q5Z A;  2UUB B;  3ZN0 A;  3IJ4 A;  1PNM A;  4GX2 A;  2H8P C;  2ARH A;  5J2T A;  3RVY A;  1Q81 W;  5L3E A;  2ZNJ A;  1K7D A;  1IBM B;  4EB6 B;  1N33 B;  1K97 A;  3O9O A;  1OCC C;  1ZX3 A;  3BHP A;  1Q7Y W;  1I08 A;  4EFB A;  2O57 A;  1NR7 A;  4K3A A;  2ILM A;  1PNL A;  4ABM A;  3CC4 V;  3CCU V;  1TA8 A;  3SYA A;  3JAW B;  1IDS A;  5B1A B;  3VBB A;  1D5A A;  1VF6 C;  3LNM B;  3RT3 C;  2VQE O;  4DR5 B;  3VQX A;  2XAQ A;  3MD0 A;  1BGY H;  2P6J A;  3CS5 A;  3BFR A;  5IY5 C;  3BAA A;  2PYJ A;  4J42 A;  3ZS8 C;  1VQ7 V;  1AR5 A;  4FM2 A;  3W7T A;  2W0F C;  4WBN B;  4DV3 O;  1SS3 A;  1QU7 A;  1XDC A;  1FFT B;  5C8Y A;  5TIS Z;  2B1I A;  2QWP B;  1N32 B;  1CPY A;  1CP9 A;  1GM9 A;  1NTK H;  2ADP A;  1FFX B;  2BSK B;  3ZIA G;  2XAF A;  3MAQ A;  4WF9 V;  4X1I A;  4AQY O;  5EC1 C;  2Z3Y A;  4DR2 O;  1DTO A;  4WFB V;  5IE9 A;  1FJG O;  5FPR A;  1P7B A;  1XMO B;  1Q43 A;  2OYQ A;  3LUT B;  3ZMT A;  5FNV B;  3TCU A;  1Q6U A;  4E2L A;  1M93 A;  5GTI Z;  3T1H B;  1JJ2 U;  1S77 D;  2EBO A;  1WA8 B;  1F23 A;  3BY6 A;  3W7U A;  1I5Y A;  2CTQ A;  4H33 A;  3JYC A;  1MOF A;  4FLY A;  4I7Z B;  4QJF B;  4NXM O;  4D7S A;  1FXV A;  2IJH A;  4H37 A;  5K1P A;  4TWK A;  4JI8 O;  5LHH A;  1HR0 O;  2LW7 A;  3ZRW B;  1X59 A;  2R9I A;  3JSN A;  2WLN A;  3SGI A;  1HWY A;  2Q69 A;  2XND G;  2BTO A;  2EIN C;  2JS5 A;  1PPJ H;  2Q7H A;  3G6B A;  1IBL O;  1XHX A;  3C3T A;  4UCV A;  5DN6 G;  2ZE6 A;  2CAZ C;  5IWA O;  2ZM6 B;  2DJV A;  1XNR B;  5IYD O;  3C90 A;  3S3W A;  2DWE C;  3RYF A;  1HP8 A;  3SPJ A;  4GKJ B;  3JD3 A;  4IHJ A;  4KFM A;  1FPO A;  1N36 O;  2WLH A;  3OT7 A;  4X1Y A;  3BCC H;  2M6Y A;  1SZT A;  1GH6 A;  2P4K A;  4DV6 B;  5JJN B;  2CDY A;  3OW2 U;  2P5O A;  2JGU A;  4BIU A;  3IC9 A;  2Z5U A;  2M7W A;  4PDV A;  3RYC B;  1QHT A;  4GYC B;  3CRQ A;  2DYS C;  1SA0 A;  1FD9 A;  3HKE A;  4OGQ B;  2V4D A;  4DV2 O;  1OCR C;  4JAV A;  2WAM A;  3X2Q B;  1TVK B;  2EIL B;  3CB2 A;  4JI4 B;  4PHZ A;  2LFR A;  2KG7 B;  1N32 O;  5IJ0 B;  1U97 A;  4J9Y B;  1GRJ A;  2ETN A;  1WJZ A;  1XL4 A;  4DV7 O;  1UJW B;  4EB6 A;  1WNS A;  1ZTE A;  4B3T O;  2RCV A;  2E5L B;  5JH7 B;  1ARO P;  1QR9 A;  3L72 H;  5KX5 B;  3EHB B;  2ZIN A;  3FX7 A;  4MVZ A;  4WFF A;  2YXY A;  4JI6 B;  1H8E G;  4JTA B;  3SJQ C;  1WB8 A;  2CGN A;  1M90 W;  4XDJ A;  5DEC A;  1JCH A;  5EBW C;  4JAU A;  1YI2 V;  3JAW A;  2Q0A A;  4MVQ A;  3H1H H;  2Y0I A;  3NXS A;  3N2G B;  1AR1 B;  3K06 A;  1VQM V;  1R3L C;  4N23 A;  4X65 B;  4B3M B;  2JDI G;  1OHH G;  3B09 A;  1UPG A;  1ZLZ A;  1V55 B;  3OAA G;  5J2U B;  4CBC A;  1R3I C;  2ADQ B;  2R9R B;  2WLJ A;  3C3S A;  1LUW A;  2IM9 A;  5GON B;  4PA7 A;  3QTC A;  3OTO O;  4HZ3 A;  4ZHQ A;  4FFB A;  4GCZ A;  4YY3 B;  1NS1 A;  1FFX A;  4XBF A;  4O4L A;  1EFR G;  4AIL C;  4CH6 A;  2KQX A;  2BSK A;  5H6Q A;  3E8F A;  1FXK C;  3LDE A;  1AP6 A;  4DW1 A;  4ZI7 A;  1NVP B;  4ZOL B;  3CYO A;  3RYH A;  4D7T A;  2EIM C;  4UXN A;  4MS2 A;  2CH7 B;  1XOU A;  5H2F Z;  3TJT A;  4BR6 A;  2HVK C;  4E4E A;  4JI0 B;  1K92 A;  3RYI B;  1XNR O;  3JD0 A;  1SC5 B;  1JPX A;  2LFS A;  4MT8 A;  3CCJ V;  4DR7 O;  3O65 A;  1BHA A;  3IC7 A;  2VRZ A;  2ZIM A;  4QIW F;  2EIK C;  3K03 A;  1YIT V;  2AZ0 A;  3RFR A;  1WA8 A;  4O4H B;  3L71 H;  3K5L A;  3L75 H;  1HNZ B;  4JV5 B;  1BL8 A;  3E35 A;  4QPK A;  2LO1 A;  3AG1 B;  5IYZ B;  2HJF C;  3DSQ A;  5LP6 C;  5L3G A;  1QQC A;  5LMU B;  1YTF D;  1CEZ A;  4X89 A;  1PM9 A;  1IUR A;  4P2Z A;  2PTM A;  1K34 A;  4D6T H;  3ABM C;  2ZD9 A;  3B40 A;  4GKK O;  1I7F A;  4X64 B;  1M4U A;  3ZRW A;  2B9Z A;  2X7R B;  3JCZ A;  1KC8 W;  2WSS G;  2P67 A;  1KQS U;  4H0L B;  1SQG A;  2FL4 A;  4YHH O;  3K57 A;  4MVM A;  2PF4 E;  5C93 A;  1THZ A;  2P22 C;  2XT9 A;  3ABL B;  4YJ3 B;  4B3R B;  2X6C A;  2A06 H;  4DUZ B;  2NR5 A;  2ATK C;  3SPI A;  1B6Q A;  1OCZ C;  3GB7 C;  2UXX A;  2QE7 G;  5KHG A;  2E5L O;  4MVR A;  4GX1 A;  2Y48 A;  4LF4 O;  2GDS A;  2YXH A;  4RAI A;  2N04 A;  5LL6 Y;  5L3B A;  2IJK A;  4CH4 A;  5KA6 A;  4P9O A;  2F95 B;  4CC6 A;  3ASN C;  2HFE C;  5A9G A;  4PDR A;  5J9P C;  1R73 A;  4OX9 O;  4W4K A;  1JVM A;  3TXQ A;  3RYC A;  1J5E B;  4X65 O;  1O9H A;  2GUZ A;  3K9S A;  1RM1 B;  3A2F A;  3SPH A;  2QSA A;  1VAR A;  4MSW C;  4LF7 B;  2Y69 C;  1TVK A;  2DOS A;  4FIP C;  3QF7 A;  5KHK A;  5BZB A;  2KG7 A;  4GLX A;  2UUC O;  4YY3 O;  5IJ0 A;  4BIZ A;  3ZN1 A;  1F4N A;  3CE2 A;  1R3J C;  2OCH A;  2QWQ B;  2RMK B;  4UCU A;  3HPL C;  2JEU A;  2QM8 A;  5JH7 A;  1MZE A;  1MZF A;  1YCI A;  5KX5 A;  1XL6 A;  1AB3 A;  3B8N A;  2X0L A;  3HB3 B;  3J80 N;  2N05 A;  4X62 B;  2UXB O;  1YJ9 V;  4DV5 B;  4GX0 A;  4PEL A;  3K5N A;  2UXD B;  5FLX N;  2DWD C;  5L3C A;  3IGA C;  3OGC C;  1M56 C;  2VQE B;  2OCC C;  4DV0 B;  3WB0 A;  3JAL B;  3K3W A;  5D5P A;  3JAK B;  3KKY A;  3OMA B;  1YIJ V;  3ABK C;  1SET A;  4LH7 A;  4NVP A;  3JCU Z;  4NTW A;  1OCO B;  4PA3 A;  2YIC A;  3ZHV A;  5J2U A;  2PZS A;  1D2D A;  4X20 A;  2CUG A;  1E79 G;  1YDX A;  3CJH B;  1LUV A;  1QCE A;  4I0X B;  5LYJ A;  4LH6 A;  1S76 D;  2R72 A;  2EZP A;  3T1Y O;  5H5N A;  4FZ1 A;  1SQV H;  4YJ2 B;  4AQY B;  2JIZ G;  1I5X A;  4DR2 B;  4ZOL A;  4WFH A;  2CH7 A;  4IIJ B;  1G4Y B;  4DUZ O;  2WLI A;  3K5M A;  3G71 V;  3E8H A;  1VQ9 V;  1DF5 A;  1QR8 A;  3I56 V;  3F7Y C;  2WLL A;  3AG4 B;  4XDL A;  2V7Q G;  2Q9L A;  4LF9 O;  1YF2 A;  1ORQ C;  1Q82 W;  1Y6X A;  5LGN A;  4O4H A;  2AZ2 A;  2UUA O;  5H9C A;  5EYP A;  1JX9 A;  1JFF B;  3AG3 B;  1A32 A;  1L1F A;  2GV9 A;  5IYZ A;  1K3E A;  1U96 A;  2JJ2 G;  4JI8 B;  3VQV A;  1HR0 B;  3VOU A;  5B66 Z;  4TV8 B;  4UV8 A;  2EIJ B;  3K9A A;  1H2L A;  5IT9 N;  3KCX A;  3IAY A;  4X1K A;  2IBZ H;  4UFZ A;  3A0R A;  2DYR B;  2QM4 A;  3KCY A;  1VQL V;  4YIP A;  3STZ C;  3ASO B;  4LF8 B;  1YHQ V;  3ETG A;  4YJ3 A;  1IBL B;  2ITD C;  2Y4T A;  5IWA B;  3APQ A;  4IGG A;  4DR4 B;  3H1K H;  4RUE A;  5EIB C;  4AI8 A;  5JCO C;  4UVB A;  5B1A C;  1M57 C;  1N36 B;  4JAA A;  3JD1 A;  5CBG A;  5KMG B;  3U0Z A;  2UU9 O;  4X62 O;  1GAX A;  3SDL A;  4DV4 O;  4DV5 O;  1VEW A;  2Q73 A;  2AHY A;  2UXD O;  2Q8V A;  4QE7 A;  2OWO A;  3H01 A;  4K8X A;  3UO3 A;  4DV0 O;  4ASU G;  3BVO A;  1I0H A;  1GTO A;  3JD2 A;  1KYO F;  1OCC B;  2HP8 A;  2YID A;  1F7Y A;  2ZXW C;  3K0G A;  4DV2 B;  2OIG A;  4Q20 A;  2HKO A;  3T2M A;  4ZHQ B;  4FFB B;  3AK3 A;  4O4L B;  4FLW A;  2NNU A;  4DV7 B;  4ZI7 B;  1S0V A;  1Z5W A;  3RYH B;  4B3T B;  4R7C A;  1P49 A;  2IJI A;  5JJJ B;  2CTP A;  1X4T A;  3U10 A;  1R6K A;  1LR1 A;  4IYI A;  5IY5 B;  4UVA A;  1NI8 A;  3LSQ A;  1AJQ A;  1XQ8 A;  4HNA B;  2VQF O;  2XAJ A;  4DK1 A;  3H9V A;  1RP3 B;  4JTD B;  1ZSP A;  4G2K A;  5D5Q A;  3JAL A;  4TSF G;  4RUF A;  3JAK A;  1DK1 A;  3FB8 C;  3K04 A;  1WP8 A;  3OMN B;  2QEX V;  4UB6 Z;  4Z1V A;  1PKX A;  3OTO B;  3D36 A;  1KEC A;  4O4I B;  2HJD A;  2ZDI C;  3CJH A;  4I0X A;  1WLE A;  3J7A U;  4F6R B;  2DQ0 A;  1VQN V;  4YJ2 A;  4LF8 O;  5HFL A;  2IH3 C;  2LP7 A;  1GK9 A;  1KP3 A;  2Q4P A;  1KD1 W;  2QJ1 A;  4IIJ A;  3BAB A;  3EXA A;  4DR6 B;  1H2M A;  3JAS B;  5L3D A;  3E89 A;  4DR4 O;  2DMX A;  3VQW A;  4DR7 B;  2YIB D;  2JJ1 G;  4OXS A;  2QR4 A;  5KHJ A;  1XIL A;  1RFY A;  1AI5 A;  4GZR B;  4BIO A;  3CEI A;  1VF5 B;  2K1E A;  3WG7 C;  1NKD A;  2AGA A;  5EK0 A;  1YJN V;  2L35 A;  4DRX B;  3G80 A;  1NTZ H;  5B3S C;  5CMU A;  1KMI Z;  1JFF A;  2Z0A A;  2HVJ C;  2IU3 A;  2QKC A;  4DV1 O;  3E2E A;  4K35 A;  4JZ2 A;  2EIN B;  3QVN A;  5CBH A;  4DYL A;  3P32 A;  3ABU A;  4GKK B;  1SES A;  2GUZ B;  4CZZ A;  4TV8 A;  4TV9 B;  2IH1 C;  1B3Q A;  1EM1 A;  2RDC A;  5K1X A;  5BMV B;  4YHH B;  1ZWI C;  1GN4 A;  4LNU B;  3MDS A;  1W59 A;  3G4S V;  2OT5 A;  3CCS V;  4TOI A;  1R1B A;  1SQB H;  3OUS A;  3DTU B;  1FS0 G;  3G67 A;  3CCE V;  3ETE A;  4Z1M G;  4JYC A;  4TUY A;  1HNW O;  4P30 A;  1NTM H;  5GW7 A;  1H2S B;  4LF4 B;  2QA4 V;  1QBZ A;  1KKD A;  1S5J A;  3WB1 A;  2DYS B;  3DXR B;  1JR9 A;  3E8G A;  2A9H A;  4R8C A;  5KMG A;  2Q7G A;  4O2A A;  1ZL8 B;  2FML A;  2AXT Z;  1K33 A;  3SR2 C;  2PI4 A;  1FKA O;  1OCR B;  3SJC C;  3E22 A;  2QM7 A;  4FZ0 A;  2IW5 A;  1DLB A;  3SJB C;  3K58 A;  4OX9 B;  4C7U A;  2QTO A;  3ICX A;  3OM3 B;  3LNN A;  2JS3 A;  4NYK A;  1KB9 F;  2RN9 A;  3FKS G;  1H8H G;  4OPA A;  2XHB A;  2QKA A;  4X20 B;  4FPP A;  1VQ8 V;  1Y76 A;  3SYP A;  3FYI B;  5B5E Z;  2Q68 A;  4UCT A;  2E74 B;  5LYJ B;  1NT2 B;  2UUC B;  3THO A;  3M8A A;  1QLN A;  1RSO B;  1Y74 B;  1VF6 A;  3SYQ A;  2MK3 A;  3ML0 A;  1KUQ A;  3UKM A;  3T4D A;  2JRI A;  2WLI B;  3K0D A;  4U7N A;  1EBO A;  5E1A C;  4DR6 O;  2UXB B;  3E83 A;  1EN5 A;  4JYA O;  4HNA A;  2WLL B;  3UT5 B;  1L0N H;  4JPR A;  5CB4 B;  4Q6G A;  3OD4 A;  1R6N A;  1AVM A;  3JD4 A;  4Z2W A;  1IXB A;  5EYP B;  4PD4 F;  2JK5 C;  1E1R G;  3CHX A;  1WN7 A;  4IT5 A;  4YXW G;  1FXK B;  3L70 H;  1YJW V;  2EIM B;  3ZMU A;  2KB1 A;  4X8A A;  2AHZ A;  3M99 B;  3RN4 A;  2RQ6 A;  4O4I A;  4X1K B;  5LGT A;  4K0K O;  3T1Y B;  4DUY O;  4F6R A;  3P3P A;  3CRA A;  3CXC U;  2EIK B;  1K4C C;  1VIB A;  3HKD A;  4JAS A;  2P4V A;  3ETD A;  3ZHT A;  1RPR A;  3AK1 A;  5LP6 B;  4J41 A;  3BEH A;  3JAS A;  4QGP A;  4I4T B;  3GVM A;  4DO2 A;  4JYY A;  5BR8 O;  2F93 B;  5CN0 A;  1QLE C;  2YIA A;  1VQ6 V;  1ENV A;  3CCM V;  4LF9 B;  2L6L A;  2R9A A;  4LF6 O;  3I5D A;  2UUA B;  1M5I A;  4DRX A;  2V1D A;  1JA8 A;  2Q67 A;  3B8M A;  1WP7 A;  5JVD B;  2EX3 A;  4NR1 A;  2WPD G;  2ZT9 B;  3UM7 A;  1V54 C;  5B1O A;  2ZIO A;  3ABT A;  1GN3 A;  1PNK A;  5JWP A;  4H44 B;  2YS8 A;  1XI1 A;  5LGU A;  1SQP H;  1BCC H;  2CTW A;  3PN1 A;  3JAM N;  3CXH F;  3OGI B;  3GWO A;  4TV9 A;  1OCZ B;  1J95 A;  2JGD B;  5HFM A;  2Q7E A;  5E79 Z;  2HEP A;  5KUM A;  1DGS A;  3I55 V;  5BMV A;  1SQF A;  4CS4 A;  3F5W C;  2K9P A;  4LNU A;  5B1N A;  2OTJ V;  1XMQ B;  2E76 B;  4QE9 A;  4RWU A;  1AR4 A;  4FK5 C;  3ETQ A;  3L9D A;  2H3O A;  3JAR A;  2LGW A;  2N74 A;  2KSD A;  5CA3 A;  2VWK A;  3S3X A;  1PP9 H;  4CS2 A;  2A7W A;  4JYB A;  3MHS C;  1Y67 A;  3DXR A;  2VWJ A;  4U3F H;  5EC2 C;  1BT8 A;  3A0B Z;  3D3I A;  2P06 A;  4PI0 A;  5B1B C;  5IYB O;  2UU9 B;  4DV4 B;  1ZL8 A;  5EIB D;  5H6R A;  2LQT A;  1OV9 A;  2Y69 B;  1AIL A;  1I94 O;  3EVK A;  1R6T A;  2ODM A;  1IVS A;  4R50 A;  5LXT B;  1MSD A;  3LSU A;  3OE7 G;  3K79 A;  3N2K A;  3ZED A;  4QNH B;  1BQ0 A;  4NXN O;  3ZCC A;  1Y66 A;  1GM8 A;  4MW3 A;  4FMT A;  2E75 B;  1SKV A;  3L73 H;  1RPO A;  3OEH G;  1M1K W;  4KHP B;  2XUM A;  2W0X A;  2R70 A;  4CS3 A;  1HNX B;  3R66 A;  1JMK C;  3TGU H;  2BE3 A;  1YTF B;  2ITC C;  3AG2 C;  1M56 B;  2OCC B;  4UUJ C;  1RSO A;  1NH2 D;  1Y74 A;  1MNG A;  2VS0 A;  2FB5 A;  1XEQ A;  5KHH A;  4J11 A;  1AJN A;  4J80 A;  3WFV A;  3WB2 A;  3ZMZ A;  3CWB H;  3ABK B;  3CCV V;  1S3J A;  2HHH O;  3B4S A;  1H38 A;  2VQF B;  5L3F A;  1XNQ O;  4R6Z A;  1PL0 A;  4W4L A;  3UT5 A;  2ZE8 A;  4AHC A;  2D3O W;  1XUQ A;  1P4R A;  5CB4 A;  4BW5 A;  2ZKO A;  1QNM A;  2PGG A;  1B06 A;  5IJ9 B;  3TK1 A;  4FLU A;  3G6E V;  1NZ6 A;  3RBZ A;  2W6J G;  2NN4 A;  1MMM A;  1PV0 A;  2ZR3 A;  5JJE B;  2F4V O;  5JQG B;  1MA1 A;  3OTF A;  1FXK A;  1TAE A;  2UXN A;  1GO3 F;  3LDD A;  1W2B U;  2G38 A;  1EZJ A;  4LC1 A;  2CGO A;  2ZQM A;  1N34 O;  3JAT B;  1NU1 H;  3CRR A;  3CMA V;  1DF4 A;  3SYC A;  4JI7 B;  2E3C A;  2XOK G;  5LA6 B;  1TUB B;  3TET A;  1NBM G;  4PDL A;  2MW2 B;  4IYH A;  1XMQ O;  2AW9 A;  1WPB A;  5EZY A;  4TUY B;  3QNE A;  5LP6 A;  5LBQ A;  4PV1 B;  2KKW A;  4U7O A;  4PA9 A;  4I4T A;  3AK2 A;  5LMN B;  4UV9 A;  4JI5 B;  4ZIB A;  2F66 C;  2YEV B;  4O2A B;  1VF7 A;  4B3S O;  2B5U A;  4JI1 O;  1CXZ B;  2BTQ B;  5DM6 V;  3HKC B;  3K5O A;  2HG5 C;  4JF3 A;  3E22 B;  5JVD A;  4WFA V;  4DV1 B;  1WPX A;  4JI2 B;  2UXC O;  4LFC O;  5CA0 B;  1XBL A;  1S5L Z;  1IXM A;  2XAH A;  2HLD G;  4LWS B;  3RGB A;  3RW0 A;  1P84 F;  4DR1 O;  3ZMS A;  4I50 B;  2CTR A;  4B7K A;  1VQ5 V;  3ZRS A;  2JGD A;  1S5H C;  2BOC C;  4JI3 O;  1H2N A;  4BW9 A;  1AP5 A;  4EKW A;  1Y76 B;  2EUL A;  3T1C A;  1M57 B;  1MAB G;  2X6B A;  1D5N A;  1O9G A;  2LGQ A;  3A0H Z;  4O2B A;  2GTS A;  4PJ0 Z;  4KHP O;  3BRC A;  1NJI W;  4MTX A;  5KLV H;  4MW8 A;  1GKF A;  3CC7 V;  1HNX O;  3RWR D;  1UFI A;  1GN2 A;  4NKG B;  1HNW B;  3H1J H;  1BMF G;  3DC6 A;  4A5U B;  4J10 A;  3APO A;  4WFE A;  4X66 O;  1HW7 A;  1K73 W;  1AI7 A;  1N8R W;  2ZNI A;  3F7V C;  1B04 A;  4WCE V;  1OZ0 A;  1K4D C;  1AJP A;  2QWO B;  3HKB A;  2ZXW B;  2DQ3 A;  1N4C A;  3BPZ A;  5CA1 A;  1NH2 B;  2Y0P A;  1L8D A;  1XRE A;  2QDO A;  2OIE A;  5LXT A;  3P30 A;  1Q6H A;  3NR7 A;  2EJ7 A;  4IL6 Z;  3LSS A;  3STL C;  1N0J A;  3KZI Z;  1SQX H;  3LDC A;  1TUE B;  4B7E A;  1NR1 A;  3UQ8 A;  2QTS A;  3WU2 Z;  4TQD A;  5KHI A;  1IBK O;  4K8Z A;  2CE4 A;  3UO2 A;  3SJA C;  4JI7 O;  3CCQ V;  2X6A A;  3HKD B;  1NVP D;  3E86 A;  3UCS C;  1SZX A;  2C2A A;  4GUN A;  4RO2 A;  3ZMV A;  1GMG A;  3KG2 A;  3CPW U;  2QWN B;  4LFA O;  3CC2 V;  1M9N A;  4JYA B;  4JGS A;  2RJZ A;  2UUB O;  5LMN O;  4DR3 B;  3SPC A;  1AI4 A;  4JI5 O;  2ZE5 A;  4MTF A;  3CRM A;  4FM1 A;  1BQZ A;  2P7T C;  5IJ9 A;  1F4M A;  1IBM O;  1LNQ A;  1N33 O;  1OJH A;  1R3K C;  5JQG A;  3TXS A;  5AG2 A;  2ZCE A;  4JTC B;  2HR3 A;  3Q4H B;  4JI2 O;  3X2Q C;  4O4J B;  2EIL C;  4DK0 A;  4LF5 B;  5KUK A;  3HR0 A;  4F4L A;  5LOV B;  1GM7 A;  2GHY A;  4K0K B;  3JAT A;  4DUY B;  2RNB A;  4B08 A;  1SF9 A;  3ZHQ A;  4DR5 O;  2QKS A;  3D8C A;  5LA6 A;  1TUB A;  3WG7 B;  3OMI B;  5EBL C;  3CRC A;  1Q90 D;  4ZKI A;  5B3S B;  1QVF U;  1PD3 A;  2FYU H;  2FKX A;  1E1Q G;  2XTA A;  5KAI Z;  3JAR B;  3FB7 C;  2EJR A;  1S72 V;  5BR8 B;  4J7K A;  4FFK A;  1VMG A;  2YEV A;  4LF6 B;  3H1I H;  2WWW A;  2DN9 A;  3ZRX A; 
#chains in the Genus database with same CATH homology
 1J5E O;  1IBK O;  1FJG O;  1XNR O;  4B3S O;  4OPH A;  4JI1 O;  4LF6 O;  1YZB A;  1FYJ A;  4JI7 O;  3R66 A;  4DR7 O;  3O65 A;  2AGA A;  4DV2 O;  4LF9 O;  4JI0 O;  2DOS A;  3M8A A;  2UXC O;  4LFC O;  2UUA O;  1XMO O;  4LF7 O;  2Z0A A;  1XEQ A;  2UUC O;  5BXZ A;  4YY3 O;  4DV1 O;  1N32 O;  1A32 A;  4DR1 O;  1KUQ A;  4LFA O;  3J81 N;  2JRI A;  4JI4 O;  3JAM N;  1HNZ O;  2HHH O;  4DV7 O;  3T1H O;  2UUB O;  4JI3 O;  4DR6 O;  5LMN O;  1XNQ O;  4NXM O;  4JV5 O;  4B3T O;  4JI5 O;  4JYA O;  5IT9 N;  1AB3 A;  2ZKO A;  3J80 N;  5LMU O;  2VQF O;  4KHP O;  4GKK O;  2UXB O;  4JI8 O;  1IBM O;  1HR0 O;  1N33 O;  5BY1 A;  1G1X B;  2LW7 A;  1HNX O;  5FLX N;  2F4V O;  1X59 A;  4YHH O;  4X64 O;  4JI2 O;  1R1B A;  4JI6 O;  4A5U B;  2N74 A;  1DK1 A;  1HNW O;  4X66 O;  3RT3 C;  2VQE O;  1IBL O;  4LFB O;  4B3R O;  1N34 O;  5IWA O;  2DJV A;  4DR3 O;  4DR5 O;  2E5L O;  1D2D A;  4B3M O;  4LF4 O;  4K0K O;  4DUY O;  4X62 O;  2UU9 O;  1AIL A;  3SDL A;  5LL6 Y;  2ZM6 O;  1FKA O;  3J7A U;  4DV4 O;  1N36 O;  4DV3 O;  4DV5 O;  3OTO O;  1I94 O;  1R6T A;  2UXD O;  2FKX A;  1XMQ O;  3F5T A;  3T1Y O;  4LF8 O;  5H5N A;  4GKJ O;  5A2Q N;  1NS1 A;  4DV0 O;  4NXN O;  4OX9 O;  4LF5 O;  4DR4 O;  4DV6 O;  4OPA A;  4DUZ O;  4X65 O;  5BR8 O;  4AQY O;  4DR2 O;  1F7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...