4B3TO

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3tO00
4GKJO 1J5EO 4DUYO 1F7YA 5BR8O 2UU9O 4DV5O 4DR4O 4DR6O 1IBKO 4DR3O 2UXDO 3J80N 1IBLO 1N33O 4X66O 3T1HO 2FKXA 4LF9O 3F5TA 4OPAA 1FKAO 4DR2O 5LMUO 4NXMO 2VQFO 4JI4O 4JI6O 1N34O 4LFCO 4B3MO 1HNWO 1N32O 5BY1A 4DV6O 1KUQA 1XMQO 1D2DA 4GKKO 4JYAO 3R66A 4X65O 2ZKOA 2UXCO 1FYJA 5BXZA 4DR7O 1XMOO 4JI7O 4A5UB 1IBMO 3J7AU 4LF4O 4LF6O 3T1YO 4LFBO 4B3TO 4JI2O 2AGAA 1NS1A 1XNQO 4AQYO 2DOSA 2N74A 2VQEO 4JI5O 4B3SO 2JRIA 5LMNO 2UXBO 3O65A 4JI8O 1R6TA 4K0KO 1N36O 1R1BA 4JI1O 1YZBA 2DJVA 1I94O 3RT3C 2E5LO 4DV4O 3JAMN 4DV2O 1X59A 1XEQA 1XNRO 4JI3O 1A32A 1DK1A 2UUBO 1HNZO 4LF5O 4DUZO 3SDLA 2UUCO 1AILA 4B3RO 4OX9O 4OPHA 4DV3O 4JV5O 4YHHO 3OTOO 2ZM6O 2F4VO 4JI0O 4DV7O 4KHPO 4X62O 5LL6Y 5FLXN 1AB3A 5H5NA 2Z0AA 1FJGO 4X64O 4NXNO 2UUAO 2HHHO 4LFAO 5A2QN 5IWAO 4DV1O 4DR1O 4LF8O 3M8AA 4DR5O 1HNXO 1HR0O 3J81N 2LW7A 4LF7O 4YY3O 1G1XB 5IT9N 4DV0O
chains in the Genus database with same CATH superfamily
2F95B 4FVMA 4TWKA 4JTDB 1BZKA 5LP6A 1IBLB 4LH7A 1OCZC 3SJAC 3L74H 3HKEA 3OR6C 2EIJC 3RW0A 5KUKA 2YDEA 1EN6A 1VQ8V 2PGGA 2GTAA 1EZJA 1GK9A 3VQVA 1YTFB 2WLIA 3H01A 2YC0A 1R3KC 4P30A 2E76B 2GUZB 4MTFA 1ENVA 4ABMA 2ZE8A 1D2DA 4WFHA 4BW5A 1DF5A 5B1OA 3CRMA 2QWOB 3DGEA 1JMKC 1H8EG 1F4MA 2WLJA 5LYJA 3RYHB 3HKDB 2CTWA 4AQYO 3CCLV 1EBOA 3UKMA 1M5IA 1O9HA 4JI1B 2L6LA 4MSWC 3DXRB 4X1KB 5IYBO 3CD6V 4FMTA 5J9PC 1X59A 3OUFA 1O9GA 3EVKA 4FIPC 2DYRC 1SESA 3JYCA 3OGIB 3HPLC 4OX9B 5JVDB 2WLHA 4DV3B 1KP2A 1E79G 4YHHB 4OPHA 4UCUA 3OR7C 1YDXA 1AI6A 2EINB 2WLLA 4JYCA 3SJCC 5EK0A 5FLXN 3EXAA 4Z1MG 3FB7C 2IW5A 2R70A 4I0XB 1M4UA 3X2QB 3M8AA 5KAIZ 4XDLA 1THZA 1VF6C 4MVZA 1WP7A 2GSMB 4GX5A 1SQGA 2UXDB 3ABLB 1H2KA 2GTSA 2F43G 3X2QC 1W0KG 4UCTA 4MVUA 4XDJA 2OWOA 1QR8A 3F5TA 1BHBA 2V7QG 3MHSC 4IGGA 4MW8A 3G6EV 1R3LC 4QE9A 3ABLC 2AHYA 5ITZA 5LA6A 4CS3A 1KUQA 3VQYA 3FB8C 3P3PA 5FPOA 4LF6B 2WPDG 4LWSA 4E2LA 1TUBB 5HFLA 3CMAV 1NVPD 4LF4O 1NKDA 1F4NA 2MK3A 5EBWC 4NKGB 3T1YO 4LFBO 4JV5B 1SQPH 1XNQO 2QM4A 1NI8A 2ARHA 1PV0A 4O4HB 1H2SB 2YIAA 1FPOA 3ZIAG 1NT2B 1H2LA 1K33A 3P32A 4JI3O 2YIDA 2WSSG 4J7KA 2AW9A 3EFFK 4TV8A 1FAFA 1S5HC 1XHXA 5DEDA 4AI8A 4HAMA 4O4LB 1Q6UA 1P7GA 1J95A 4X62B 2OIGA 4IIJA 1AI5A 3K5LA 2KKWA 3CYOA 1NU1H 3MHHC 1BHAA 1AP6A 5H5NA 3W7UA 3G6BA 1PKXA 1HR0B 1IURA 2XUMA 2HP8A 4DR5O 1SA0B 5JH7A 4YY3B 4Q6GA 5C8YB 1QQCA 3ZHQA 1Y4MA 3HB3B 3G4SV 1AR4A 3HKBB 4DV5O 5KUMA 3WB2A 3OUSA 1YJ9V 2PY5A 3T1HB 2ZXWB 3CP1A 4PA3A 5EIBD 3CB2A 2YS8A 1QLNA 2UXXA 4RAIA 3K5OA 3APOA 4IYHA 1XHZA 4DV6B 2JVDA 1SQFA 1U97A 1MABG 5JCOC 4QJFB 3BABA 4D7TA 4R50A 1PD3A 3OEEG 1VQPV 2WAMA 3ETQA 4UUJC 1DF4A 2UXCO 2QWQB 3TGUH 1Y76A 3UQ8A 5B1AB 1XDCA 3ABKB 2OCCB 3BPZA 4U3JA 2VQEB 4O4JA 3K58A 2UXBB 1GM9A 4I55A 3ZRWB 3ZMTA 3KZIZ 5KAFZ 4UCSA 4RO2A 2LFRA 1R6TA 4X89A 2BTQB 4DK1A 2DJVA 5B1AC 4DV2O 1R6NA 1AI4A 2OCCC 4QPKA 1HNZB 1PP9H 4X1YB 2OTJV 3CX5F 1XOUA 3TXQA 4WFBV 5LP6B 2EIKB 3SJBC 3A0BZ 3BA8A 3HKEB 4AHCA 1RFYA 2Q4PA 2F4VB 2LGQA 4GUNA 3A8TA 3BCCH 2Q69A 4EKWA 2E74B 3FB6C 3SYPA 4BWAA 3AK1A 3CRAA 5LP6C 2EIKC 1K9MW 4LFAB 1WB7A 5KLVH 1VQOV 4I9WA 5IYCO 4K8ZA 1I7FA 3B8MA 1PM9A 3DC5A 3IGAC 1HNWB 2PYJA 2QSAA 1Z5WA 4UVCA 4TT3G 1FS0G 1OHHG 4NVPA 5KHIA 1KB9F 4E4EA 5BR8O 1N33B 4O4IA 4DR6O 3SPJA 4JZGA 3A0HZ 4EB6B 1F23A 2N04A 3EHBB 4LF9B 4CH4A 2CUGA 1L0NH 1QU7A 3HKDA 4DR2B 4I9QA 4U7OA 1S72V 3JASB 1W0JG 3CCMV 1CP9A 1GKFA 3STLC 3RYFA 2B1IA 4X1KA 2QEXV 2R72A 3RGBA 5DN6G 1BE3H 1XBLA 1V54B 4JI7B 3D3IA 3RVZA 4FLYA 2WLLB 5JVDA 5EIBC 1GM8A 1HW7A 4ZI7B 1IBMO 5IYDO 2Q9LA 4NYKA 4X20A 1V54C 1VEWA 4ASUG 4I0XA 2AZ2A 3K57A 2GHYA 3ABMB 1FXKC 1I94O 2B9ZA 1KYOF 3Q4HA 1XNRO 3BY6A 1Q3EA 2W0XA 2ITCC 2OCHA 3BEHA 2ILMA 3IFXA 3ZS8C 4WBNA 3ABMC 1RPOA 4H13B 3SR2C 1GAXA 5GTHZ 5LOVB 1WN7A 2XAJA 5K1XA 4WF9V 2PYLA 4I5SA 4X64B 5LA6B 5ITZB 4WFAV 3ZN1A 5CBGA 1AR5A 4D7SA 2HHHO 4DV1O 1F51A 2Q73A 4YXWG 4F6EA 3OTFA 3JD1A 2P06A 2BE3A 3OFNG 3R65A 4JYYA 4DW1A 1YJWV 2HLDG 2ADQB 3AG4B 1MSDA 3ZCCA 2ZCEA 2WLKA 1IBKB 1F7YA 2UU9O 2QM8A 2RDCA 4Q20A 3BAAA 3CC7V 5IYZA 4FLVA 5LMUB 4NR1A 2X6AA 3LDDA 3AG4C 4NXMO 3B77A 4O4HA 4F4LA 4JI4O 3ASOB 2BCCH 5TISZ 1XMQB 1Y6XA 2FMLA 4TV8B 3JD0A 1M56B 4X65B 3K3WA 3R66A 4JTAB 1S3JA 4DR7B 4IIJB 4QIWF 4F6RA 2W6JG 4BR6A 5LHHA 3ASOC 4O4LA 1KD1W 1S0VA 1JR9A 4JI5B 4JI2O 1M90W 3QTCA 3OAAG 1M56C 5HFMA 3ZRXA 4K0KB 2HVKC 4RQEA 4DRXA 4MVMA 4JI8O 4P9OA 3W7TA 1SZXA 5BZBA 5C8YA 2R9IA 4J7JA 4PD4F 4TOIA 1VP7A 2Y0IA 2F1MA 4O2AB 1NH2D 3OTOB 5EBMC 4K35A 1Q6HA 2HFEC 4FFBB 5JCOA 3ZMVA 1VQMV 4QE7A 4XBFA 2IH3C 2Y4UA 1KMIZ 3H1LH 3SPCA 4LF8O 5KA5A 4DR1O 3BRCA 3LDEA 1SZTA 2WWWA 2F23A 1Y76B 2HEPA 4PDMA 4DK0A 2ODMA 4GKJB 4U3JB 4P2ZA 3CCVV 1MOFA 4O4JB 1XILA 3N27A 2XNDG 4IT5A 1I5YA 5E1AC 2D3OW 3NR7A 2A3QA 4X66O 1OJHA 3JSNA 4JI6B 1GRJA 3FD9A 2NR5A 1FD9A 4LFCO 3FFQA 4C7UA 4CH5A 2BTQA 2QTSA 1N32O 4GKKB 4JYAB 3MDSA 3NXSA 5AG2A 4X1YA 1BT8A 2DQ0A 1Q43A 4GX1A 2ZKOA 5BXZA 3H1JH 3D36C 4BW9A 1IX9A 3BHPA 2AHZA 3TJTA 3GB7C 1QR9A 1I5XA 1JFFA 3E2EA 5LMNB 1PNKA 4CH3A 4UV9A 1VF7A 2P6JA 1N36B 1RM1B 3JARA 1K4CC 3WB1A 3ML0A 2QWPB 3RT3C 1G4YB 4PV1B 3ZBHA 3H9VA 4KP4A 3PJSK 4U7NA 4O4IB 4MVQA 2UUCO 1RM1C 4FPPA 2O57A 1NQTA 2DYRB 3IAYA 5KHJA 3CE2A 2YIBD 1ZAUA 2A79B 3ABTA 3U11A 1NH2B 4EB6A 1ZUQA 3E35A 3CC2V 3RYFB 3CCQV 3VQWA 5CB4A 2LJ2A 2Z0AA 2UUAB 1P7BA 3JASA 1VQ7V 4PDVA 1PL0A 2DE0X 1GTOA 1CXZB 2Y48A 4LF7B 4JAVA 4CC5A 3SPHA 2MW2B 3CJHA 3QG5A 1UFIA 1J5EO 2RCVA 1FXKA 3ZN0A 4ZI7A 4X20B 5KHHA 1US6A 4WFGA 2Y69B 2ZT9B 1IBLO 1N0JA 3SYOA 2PI5A 4OPAA 4N21A 2GV9A 4UCRA 1JQ0A 1K97A 1V9PA 3OD4A 5B1BB 5KX5B 1KKDA 3Q4HB 3CSXA 1DLBA 1Q7YW 1WPXA 1FFXA 4PDRA 2EZPA 2Y69C 2N05A 4WBNB 3TXSA 1WAZA 1L0LH 3SJQC 5B1BC 1AI7A 2CTPA 2WA4A 4H37A 2QWNB 5IJ9B 4B3SB 1GN2A 3I56V 5LOVA 2LP7A 2M7WA 3RFRA 2E5LB 4JI1O 1M93A 5J2UB 1LR1A 5D5PA 4PI0A 5GTIZ 2UUBB 2Q0OC 4DW0A 1DK1A 3L71H 4DUZB 3GWOA 4O2BA 4Z2WA 2CK3G 1FFTB 4OX9O 5IYZB 2IJIA 4DV3O 2ZM6B 3G67A 4YHHO 1R73A 3JSLA 4FM1A 1BQ0A 4JPRA 1MNGA 1Q90D 1AB3A 1FJGB 1WJZA 1DGSA 2JIZG 1K8AW 1CEZA 3UCSC 4YIOA 3F5WC 1DTOA 1SQXH 4F6RB 1AJNA 2R9RB 4J9ZB 4IL6Z 3ZX6A 5L3CA 5FL7G 1HDJA 1BGYH 4DR4B 3BA9A 2UXDO 3LNNA 4DRXB 3ZMSA 3IC9A 2CH7A 2X6BA 2K1EA 1NTMH 3TCUA 4GX0A 3TK1A 2CTRA 2BOCC 4UB8Z 2ITDC 4H0LB 1P84F 1KECA 2WLNA 1VQ4V 5BY1A 1VARA 3FB5C 1VQKV 2ZE6A 2IJHA 1XMOB 5B3SB 2ZQMA 3B40A 2X7RB 1PL4A 3CCRV 3AG7A 2QJ1A 2E3CA 5B66Z 4B3TB 4O2AA 2D2CB 4LF6O 3QO8A 2EULA 1Z2GA 4UVBA 4FFBA 1LUVA 1YVWA 1NS1A 2CGOA 2A7WA 4K3AA 3B09A 3JD4A 2Q8VA 3UO2A 4NTYA 5B3SC 3F7YC 2ADPA 5E79Z 3B2EE 1H8HG 1G8MA 5CN0A 1SF9A 3JAWB 4QNHB 4ZOLB 3MD0A 1XEQA 1QCEA 1R3JC 3STZC 3E8FA 4LF5B 4I50B 5KHKA 1W59A 3CCSV 1NVPB 3ASNC 1QHTA 4DV7B 4X62O 4KL1A 5JJNB 5LHGA 3P30A 4J80A 1K5QA 2CAZC 4MTOA 4R7CA 1WA8B 3D36A 1K7DA 1Y66A 2X0LA 4EFBA 5C93A 3BFRA 4TSFG 3SYCA 1U96A 2ZINA 2JEXA 2ZR3A 1H2NA 1HR0O 2F66C 3CCUV 4DV0B 4YY3O 2XAQA 1L8DA 1KU9A 5IT9N 1JFFB 2EILB 1B3QA 4HZ3A 3RWRD 2R9AA 3JARB 1NTZH 4BIZA 3T1HO 2FKXA 3AG3B 4R8CA 3AK2A 3VOUA 4BIUA 2VQFB 5EC2C 4MW3A 4L87A 2V4DA 4B3MB 3SPIA 5BMVA 2EILC 1SQVH 2ZE7A 3U10A 1GO3F 4PA4A 3I5DA 4DV6O 3WFVA 2EIMB 3AG3C 1AVMA 1LUWA 1PNMA 2QA4V 1JVMA 2NLJC 3ZMUA 5CB4B 2H94A 1MA1A 2ZDIC 4JF3A 2VQEO 2JRIA 2UXBO 1COWG 2V1DA 3JCZA 1M9NA 3QF7A 1XI1A 2EIMC 3L70H 1R1BA 2B5UA 2ZNJA 4TQFA 4UFZA 3CJHB 4FZ1A 2HHHB 1QBZA 2WLMA 1FXKB 2WA3A 1HNZO 4B3RB 2YI9A 5GONA 2LO1A 2A0LA 2FB5A 4QPJA 1K3EA 3WU2Z 2IBZH 2CE4A 2DN9A 2F4VO 3ABUA 1EZVH 2C2AA 3CWBH 3FKSG 5LL6Y 2Q7GA 4DXWA 4NXNB 1FFXB 3I55V 2ZD9A 3E22A 2NN4A 3IC7A 5KX5A 4RQFA 1W2BU 5LHIA 2AZ0A 2RNBA 4LFAO 3ZHTA 3L73H 4LNUB 3AG1B 3J81N 3UO3A 4DYLA 1S5LZ 2CGNA 2JEUA 1UJWB 3ZRSA 2YEVA 4DUYB 3H1KH 1ZWIC 3M7MX 4DR3B 4FM2A 5EC1C 1SQBH 2KB1A 3K06A 4DO2A 1N33O 1IXBA 5IJ9A 1YHQV 1BQZA 4JI2B 3OMAB 4LF9O 3AG1C 3ICXA 3T4DA 1VQ5V 4NTWA 4DR2O 1ZL8A 1I08A 1MG1A 3BVOA 2PI4A 4O2BB 2Q7HA 1N0NA 1XL4A 5J2UA 1RSOA 2IU3A 3CXCU 3K9SA 2ATKC 4CH6A 2B1GA 3A0RA 1Y67A 1S77D 4JASA 1FYJA 5JQGB 4JI7O 4A5UB 2FYUH 1JX9A 2KQXA 2H8PC 4UCVA 4B7EA 1K5SA 4FLZA 1H38A 1K4DC 2YIBA 4FLUA 2L35A 3W7WA 4H44B 3ZMZA 4DV4B 4MTXA 3CRRA 4J10A 4RUEA 2PUSA 2ZR2A 2HR3A 2G38A 2IM9A 3H1IH 5FNVB 1VMGA 3K59A 2CH7B 4HNAA 2P22C 3FYEB 5CA3A 4JI0B 4MVOA 1WP8A 4KHPB 3RVYA 4J11A 4XDKA 1JPXA 3ETGA 3MAQA 1TA8A 3JAKA 1D5AA 2ZE5A 1ROPA 5IWAB 5IDJA 4X64O 4IYIA 1YTFD 5B5EZ 1URFA 1HNXB 1IZ3A 2OT5A 4CS2A 4MT8A 3OM3B 3CHXA 3N2KB 1YSCA 2ZNIA 3H1HH 2LFSA 2QGNA 3K0GA 1QVGU 1IBKO 3K08A 2QM7A 1YEWA 3KCXA 1OCOB 3G80A 3ETEA 4H33A 4YJ2B 1ZSPA 5LMUO 4K8XA 1MZFA 3C3SA 4RWUA 5LXTA 1N34O 3AEIA 1ZTEA 1Z5VA 4LP8A 3JAWA 4ZHQB 2VS0A 1XMQO 4ZOLA 3CEIA 1WPBA 4J9YB 1OCOC 4I50A 4X65O 4DR7O 4ZBMA 5EZYA 4CC6A 3LSUA 1Q6IA 1Y74B 4AQYB 3CS5A 3CXHF 3SPGA 4LC1A 1VQLV 4BIOA 2DWEC 4JI5O 4CZZA 5L3DA 5EYPB 1MZEA 4K0KO 3APQA 1WA8A 5L3GA 2JK5C 2GDSA 1B04A 1WLEA 1MSWD 3C3TA 3VQXA 1YI2V 1K73W 1VIBA 1IVSA 1PPJH 4JGSA 5H9CA 4BAYA 1TGOA 3OMIB 3LNMB 4FFKA 3RBZA 5CA0B 3O9OA 4GCZA 3OTOO 3KCYA 3S3WA 2FL4A 4CBCA 5BMVB 4MS2A 3T4ZA 4W4KA 3JD2A 3E89A 1Q81W 3C90A 1D5NA 5LGNA 2GBOA 3E8GA 4LCUC 2IU0A 4UXNA 2ZDIA 2P4VA 3L9DA 5K1PA 4LH6A 2BSKB 5CA1A 2FTKA 2XHBA 1GN3A 4GKJO 4P9PA 3JALA 3CPWU 4PA9A 3E86A 2VRZA 4MVSA 1FXHA 1KQSU 1MMMA 1ORQC 3FAVA 3JCUZ 1IXMA 4JAUA 3RYIA 3GVMA 1SQQH 1R6KA 4YIPA 2ZIOA 5JJJB 4JI6O 1N4CA 1SC5B 3E8HA 1SS3A 4KXRA 4ICGA 1YXBA 2HJDA 5GONB 3UT5B 5KMGA 4PELA 3RYCA 4GKKO 4JYAO 4TV9A 4D6TH 4LF4B 2VWKA 1ZX3A 2KG7A 3ZRVA 3T1YB 4LFBB 2OIEA 5LGTA 1GN6A 1XNQB 4ZKIA 4B7KA 1RPRA 3E22B 4MTGA 2DOSA 1M1KW 5LMNO 1AP5A 4LBEC 1N36O 3OE7G 1BL8A 2Q5ZA 3IJ4A 1YZBA 4AILC 2YEVB 2YXLA 4JI3B 1Q5OA 4LNUA 4HYOA 3ZJZA 2EINC 1AILA 1TVKB 2JJ1G 4YJ3A 1OCCB 2DQ3A 1ZL8B 1JA8A 3T1CA 1EFRG 1IDSA 2Z3YA 1V55B 1RSOB 3W7SA 1H2MA 1AJQA 2UUAO 4DR5B 5A2QN 1P4RA 1OCCC 1B6QA 2XTAA 1AROP 1BS3A 3CRQA 2Y4TA 4LF7O 4PA7A 3E83A 4G27B 2CDYA 1V55C 4DV5B 2H3OA 4FZ0A 5JQGA 5EBLC 1NR7A 1OCRB 3P3NA 1GM7A 5J2TA 1XL6A 1OZ0A 3E8BA 2OTLV 4FLWA 4MVRA 2K9PA 1EM1A 4KFMA 5LGUA 1OCRC 2RMKB 2YXYA 4IHJA 3AG2B 4HNAB 5CBFA 4J41A 2DYSB 4GX2A 4TUYB 2UXCB 2JDIG 4L8JA 2EJ7A 2IJJA 5FNVA 4I4TA 3D3QA 5D5QA 2JGDA 1JOYA 3J7AU 1SERA 3JAKB 3WB0A 2VWJA 1Q82W 2JS5A 2Q6AA 4PJ0Z 2KSDA 3N2GA 3ZHSA 1I0HA 2AGAA 2RQ6A 2OYQA 3B4SA 4B3SO 3AG2C 2DYSC 3O65A 4HBNA 4UB6Z 2E75B 2Q67A 5JJEB 3G71V 1VQ6V 4PDLA 1EN5A 3L75H 4DV2B 4X1IA 2E5LO 1H2GA 1SKVA 2XOKG 1N8RW 4FM0A 5L3EA 2UUBO 1QVFU 3N2KA 4DUZO 2PZSA 3K04A 3K5NA 4W4LA 3THOA 4JV5O 4FJCC 2ZM6O 5H6QA 3QO7A 1BSMA 3KKYA 3ASNB 5LXTB 2YUAA 4PHZA 3ZEDA 4YJ2A 1XQ8A 4J42A 5IJ0A 1FJGO 1T5EA 1SETA 2Z5UA 2M6YA 1S76D 2QR4A 2XAHA 1JCHA 4ZHQA 3QO5A 2LW7A 5EZYB 3HKCA 1G1XB 1WNSA 5BR8B 2XASA 1SRYA 2A06H 4DR6B 2YICA 4EEQA 2ZXWC 4DR4O 2X6CA 3OT7A 5CBHA 1Y74A 4QGPA 2QKSA 1YF2A 3K03A 2RN9A 1E1RG 1FKAO 2YSUB 3ETDA 1AR1B 3AK3A 5EYPA 3B8NA 1VQ9V 4FK5C 2HKOA 3JATA 4KUMA 1BMFG 2UXNA 4U3FH 3ABKC 1IBMB 1XMOO 2IH1C 5KHGA 1XUQA 5CMUA 1L1FA 2QKCA 3CCEV 4FLTA 1GMGA 5CA0A 4B3TO 3OMNB 2DW4A 2EZOA 4G2KA 3LUTB 4GT1A 2N74A 3CC4V 2P5OA 2WLIB 2QDOA 1I94B 4NB5A 4PI2A 4WCEV 4G28B 2Y0PA 1KKCA 4N23A 1XNRB 4X8AA 5CA1B 4TQDA 1M57B 2LGWA 3JALB 1QNMA 2HG5C 2GUZA 3VBBA 3QVNA 1UPGA 4LF5O 2BSKA 3SDLA 1NR1A 1NJIW 3FX7A 2CTQA 2BOBC 5F2VO 3FAVB 2LW1A 5LYJB 3RYIB 2PF4E 4DV7O 2DWDC 3A2FA 1M57C 3ZHUA 5KMGB 2AXTZ 4DV1B 3RYHA 1E1QG 1OV9A 1B06A 3RYCB 4JTCB 4TV9B 1K92A 2Q7EA 3LDCA 3JD3A 1K34A 3QNEA 3UT5A 2KG7B 3DXRA 1AJPA 4X9QA 1VF5B 1NBMG 4UV8A 4DV0O 2QKAA 5GW7A 3SGIA 2UU9B 1JJ2U 1YJNV 3U0ZA 1S5JA 4OXSA 4B08A 4R6ZA 2EX3A 4NXMB 1EN4A 4JI4B 1RP3B 3LSSA 2EJRA 4Z1VA 5JWPA 1LNQA 1VF6A 1FXVA 2VQFO 2YI8A 3DC6A 1GN4A 4B3MO 1HNWO 3CRCA 2ETNA 3D8CA 2RJZA 4GYCB 5DECA 2JS3A 4YJ3B 2P4KA 3DSQA 2XAGA 1TUEB 1HP8A 4LR3A 4X88A 1CPYA 5H2FZ 1TVKA 2W6IG 5IE9A 3RN4A 2HVJC 3K79A 1YIJV 2BTOA 3ZHVA 3GWKC 4JI8B 3KG2A 4RUFA 3UM7A 3K9AA 1NTKH 5FPRA 5KA6A 1ZLZA 1PNLA 3DTUB 4NTXA 1Q86W 1JJOA 2Q68A 3F7VC 1GH6A 2JJ2G 5DM6V 4J7ZA 4LWSB 5J2TB 4B3RO 1XREA 1TUBA 4EFEA 3T2MA 2EBOA 2QWRB 4LF8B 4IHJB 4DR1B 4NXNO 4GLXA 5H6RA 3WG7B 4CS4A 5LBQA 1N34B 2LQTA 4I4TB 3W7XA 2JGDB 1TAEA 5A9GA 4TUYA 3N2GB 2NNUA 5L3BA 4UCOA 4DUYO 3CCJV 2XAFA 4DR3O 3WG7C 4X66B 3J80N 4ZIBA 4FLXA 3TETA 3LSQA 2YXHA 4X1IB 3PN1A 4LFCB 2QTOA 2DMXA 1KP3A 3S3XA 2IJKA 1G6UA 2ZIMA 1N32B 5JH7B 1VQNV 3L72H 1QLEB 3CMEV 3OEHG 1P49A 3M99B 1SA0A 1YITV 3FYIB 4JYBA 1WB8A 4GZRB 2HJFC 1HWYA 1BCCH 5IJ0B 2Q0AA 1QLEC 3ZHRA 1KC8W 3K5MA 3HKBA 2XT9A 5IY5B 3K0DA 5B1NA 4WFFA 1KBHA 3HKCB 2A9HA 2W0FC 4DV4O 4JZ2A 3JAMN 1X4TA 2P67A 3SYAA 2P90A 4I7ZB 1A32A 2UUCB 5IY5C 3SYQA 1YCIA 4PA6A 1Q8IA 4JI0O 4KHPO 5L3FA 4I55B 4OGQB 3JATB 3OW2U 3HR0A 4JAAA 4UVAA 1NZ6A 3ZRWA 1OCZB 5IWAO 2JGUA 2EIJB 2F93B 1HNXO 3OGCC 1R3IC 2P7TC 2QE7G 2PTMA 1J5EB 4WFEA
chains in the Genus database with same CATH topology
4GKJO 1J5EO 4DUYO 1F7YA 5BR8O 2UU9O 4DV5O 4DR4O 4DR6O 1IBKO 4DR3O 2UXDO 3J80N 1IBLO 1N33O 4X66O 3T1HO 2FKXA 4LF9O 3F5TA 4OPAA 1FKAO 4DR2O 5LMUO 4NXMO 2VQFO 4JI4O 4JI6O 1N34O 4LFCO 4B3MO 1HNWO 1N32O 5BY1A 4DV6O 1KUQA 1XMQO 1D2DA 4GKKO 4JYAO 3R66A 4X65O 2ZKOA 2UXCO 1FYJA 5BXZA 4DR7O 1XMOO 4JI7O 4A5UB 1IBMO 3J7AU 4LF4O 4LF6O 3T1YO 4LFBO 4B3TO 4JI2O 2AGAA 1NS1A 1XNQO 4AQYO 2DOSA 2N74A 2VQEO 4JI5O 4B3SO 2JRIA 5LMNO 2UXBO 3O65A 4JI8O 1R6TA 4K0KO 1N36O 1R1BA 4JI1O 1YZBA 2DJVA 1I94O 3RT3C 2E5LO 4DV4O 3JAMN 4DV2O 1X59A 1XEQA 1XNRO 4JI3O 1A32A 1DK1A 2UUBO 1HNZO 4LF5O 4DUZO 3SDLA 2UUCO 1AILA 4B3RO 4OX9O 4OPHA 4DV3O 4JV5O 4YHHO 3OTOO 2ZM6O 2F4VO 4JI0O 4DV7O 4KHPO 4X62O 5LL6Y 5FLXN 1AB3A 5H5NA 2Z0AA 1FJGO 4X64O 4NXNO 2UUAO 2HHHO 4LFAO 5A2QN 5IWAO 4DV1O 4DR1O 4LF8O 3M8AA 4DR5O 1HNXO 1HR0O 3J81N 2LW7A 4LF7O 4YY3O 1G1XB 5IT9N 4DV0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  1J5E O;  4DUY O;  1F7Y A;  5BR8 O;  2UU9 O;  4DV5 O;  4DR4 O;  4DR6 O;  1IBK O;  4DR3 O;  2UXD O;  3J80 N;  1IBL O;  1N33 O;  4X66 O;  3T1H O;  2FKX A;  4LF9 O;  3F5T A;  4OPA A;  1FKA O;  4DR2 O;  5LMU O;  4NXM O;  2VQF O;  4JI4 O;  4JI6 O;  1N34 O;  4LFC O;  4B3M O;  1HNW O;  1N32 O;  5BY1 A;  4DV6 O;  1KUQ A;  1XMQ O;  1D2D A;  4GKK O;  4JYA O;  3R66 A;  4X65 O;  2ZKO A;  2UXC O;  1FYJ A;  5BXZ A;  4DR7 O;  1XMO O;  4JI7 O;  4A5U B;  1IBM O;  3J7A U;  4LF4 O;  4LF6 O;  3T1Y O;  4LFB O;  4B3T O;  4JI2 O;  2AGA A;  1NS1 A;  1XNQ O;  4AQY O;  2DOS A;  2N74 A;  2VQE O;  4JI5 O;  4B3S O;  2JRI A;  5LMN O;  2UXB O;  3O65 A;  4JI8 O;  1R6T A;  4K0K O;  1N36 O;  1R1B A;  4JI1 O;  1YZB A;  2DJV A;  1I94 O;  3RT3 C;  2E5L O;  4DV4 O;  3JAM N;  4DV2 O;  1X59 A;  1XEQ A;  1XNR O;  4JI3 O;  1A32 A;  1DK1 A;  2UUB O;  1HNZ O;  4LF5 O;  4DUZ O;  3SDL A;  2UUC O;  1AIL A;  4B3R O;  4OX9 O;  4OPH A;  4DV3 O;  4JV5 O;  4YHH O;  3OTO O;  2ZM6 O;  2F4V O;  4JI0 O;  4DV7 O;  4KHP O;  4X62 O;  5LL6 Y;  5FLX N;  1AB3 A;  5H5N A;  2Z0A A;  1FJG O;  4X64 O;  4NXN O;  2UUA O;  2HHH O;  4LFA O;  5A2Q N;  5IWA O;  4DV1 O;  4DR1 O;  4LF8 O;  3M8A A;  4DR5 O;  1HNX O;  1HR0 O;  3J81 N;  2LW7 A;  4LF7 O;  4YY3 O;  1G1X B;  5IT9 N;  4DV0 O; 
#chains in the Genus database with same CATH topology
 2F95 B;  4FVM A;  4TWK A;  4JTD B;  1BZK A;  5LP6 A;  1IBL B;  4LH7 A;  1OCZ C;  3SJA C;  3L74 H;  3HKE A;  3OR6 C;  2EIJ C;  3RW0 A;  5KUK A;  2YDE A;  1EN6 A;  1VQ8 V;  2PGG A;  2GTA A;  1EZJ A;  1GK9 A;  3VQV A;  1YTF B;  2WLI A;  3H01 A;  2YC0 A;  1R3K C;  4P30 A;  2E76 B;  2GUZ B;  4MTF A;  1ENV A;  4ABM A;  2ZE8 A;  1D2D A;  4WFH A;  4BW5 A;  1DF5 A;  5B1O A;  3CRM A;  2QWO B;  3DGE A;  1JMK C;  1H8E G;  1F4M A;  2WLJ A;  5LYJ A;  3RYH B;  3HKD B;  2CTW A;  4AQY O;  3CCL V;  1EBO A;  3UKM A;  1M5I A;  1O9H A;  4JI1 B;  2L6L A;  4MSW C;  3DXR B;  4X1K B;  5IYB O;  3CD6 V;  4FMT A;  5J9P C;  1X59 A;  3OUF A;  1O9G A;  3EVK A;  4FIP C;  2DYR C;  1SES A;  3JYC A;  3OGI B;  3HPL C;  4OX9 B;  5JVD B;  2WLH A;  4DV3 B;  1KP2 A;  1E79 G;  4YHH B;  4OPH A;  4UCU A;  3OR7 C;  1YDX A;  1AI6 A;  2EIN B;  2WLL A;  4JYC A;  3SJC C;  5EK0 A;  5FLX N;  3EXA A;  4Z1M G;  3FB7 C;  2IW5 A;  2R70 A;  4I0X B;  1M4U A;  3X2Q B;  3M8A A;  5KAI Z;  4XDL A;  1THZ A;  1VF6 C;  4MVZ A;  1WP7 A;  2GSM B;  4GX5 A;  1SQG A;  2UXD B;  3ABL B;  1H2K A;  2GTS A;  2F43 G;  3X2Q C;  1W0K G;  4UCT A;  4MVU A;  4XDJ A;  2OWO A;  1QR8 A;  3F5T A;  1BHB A;  2V7Q G;  3MHS C;  4IGG A;  4MW8 A;  3G6E V;  1R3L C;  4QE9 A;  3ABL C;  2AHY A;  5ITZ A;  5LA6 A;  4CS3 A;  1KUQ A;  3VQY A;  3FB8 C;  3P3P A;  5FPO A;  4LF6 B;  2WPD G;  4LWS A;  4E2L A;  1TUB B;  5HFL A;  3CMA V;  1NVP D;  4LF4 O;  1NKD A;  1F4N A;  2MK3 A;  5EBW C;  4NKG B;  3T1Y O;  4LFB O;  4JV5 B;  1SQP H;  1XNQ O;  2QM4 A;  1NI8 A;  2ARH A;  1PV0 A;  4O4H B;  1H2S B;  2YIA A;  1FPO A;  3ZIA G;  1NT2 B;  1H2L A;  1K33 A;  3P32 A;  4JI3 O;  2YID A;  2WSS G;  4J7K A;  2AW9 A;  3EFF K;  4TV8 A;  1FAF A;  1S5H C;  1XHX A;  5DED A;  4AI8 A;  4HAM A;  4O4L B;  1Q6U A;  1P7G A;  1J95 A;  4X62 B;  2OIG A;  4IIJ A;  1AI5 A;  3K5L A;  2KKW A;  3CYO A;  1NU1 H;  3MHH C;  1BHA A;  1AP6 A;  5H5N A;  3W7U A;  3G6B A;  1PKX A;  1HR0 B;  1IUR A;  2XUM A;  2HP8 A;  4DR5 O;  1SA0 B;  5JH7 A;  4YY3 B;  4Q6G A;  5C8Y B;  1QQC A;  3ZHQ A;  1Y4M A;  3HB3 B;  3G4S V;  1AR4 A;  3HKB B;  4DV5 O;  5KUM A;  3WB2 A;  3OUS A;  1YJ9 V;  2PY5 A;  3T1H B;  2ZXW B;  3CP1 A;  4PA3 A;  5EIB D;  3CB2 A;  2YS8 A;  1QLN A;  2UXX A;  4RAI A;  3K5O A;  3APO A;  4IYH A;  1XHZ A;  4DV6 B;  2JVD A;  1SQF A;  1U97 A;  1MAB G;  5JCO C;  4QJF B;  3BAB A;  4D7T A;  4R50 A;  1PD3 A;  3OEE G;  1VQP V;  2WAM A;  3ETQ A;  4UUJ C;  1DF4 A;  2UXC O;  2QWQ B;  3TGU H;  1Y76 A;  3UQ8 A;  5B1A B;  1XDC A;  3ABK B;  2OCC B;  3BPZ A;  4U3J A;  2VQE B;  4O4J A;  3K58 A;  2UXB B;  1GM9 A;  4I55 A;  3ZRW B;  3ZMT A;  3KZI Z;  5KAF Z;  4UCS A;  4RO2 A;  2LFR A;  1R6T A;  4X89 A;  2BTQ B;  4DK1 A;  2DJV A;  5B1A C;  4DV2 O;  1R6N A;  1AI4 A;  2OCC C;  4QPK A;  1HNZ B;  1PP9 H;  4X1Y B;  2OTJ V;  3CX5 F;  1XOU A;  3TXQ A;  4WFB V;  5LP6 B;  2EIK B;  3SJB C;  3A0B Z;  3BA8 A;  3HKE B;  4AHC A;  1RFY A;  2Q4P A;  2F4V B;  2LGQ A;  4GUN A;  3A8T A;  3BCC H;  2Q69 A;  4EKW A;  2E74 B;  3FB6 C;  3SYP A;  4BWA A;  3AK1 A;  3CRA A;  5LP6 C;  2EIK C;  1K9M W;  4LFA B;  1WB7 A;  5KLV H;  1VQO V;  4I9W A;  5IYC O;  4K8Z A;  1I7F A;  3B8M A;  1PM9 A;  3DC5 A;  3IGA C;  1HNW B;  2PYJ A;  2QSA A;  1Z5W A;  4UVC A;  4TT3 G;  1FS0 G;  1OHH G;  4NVP A;  5KHI A;  1KB9 F;  4E4E A;  5BR8 O;  1N33 B;  4O4I A;  4DR6 O;  3SPJ A;  4JZG A;  3A0H Z;  4EB6 B;  1F23 A;  2N04 A;  3EHB B;  4LF9 B;  4CH4 A;  2CUG A;  1L0N H;  1QU7 A;  3HKD A;  4DR2 B;  4I9Q A;  4U7O A;  1S72 V;  3JAS B;  1W0J G;  3CCM V;  1CP9 A;  1GKF A;  3STL C;  3RYF A;  2B1I A;  4X1K A;  2QEX V;  2R72 A;  3RGB A;  5DN6 G;  1BE3 H;  1XBL A;  1V54 B;  4JI7 B;  3D3I A;  3RVZ A;  4FLY A;  2WLL B;  5JVD A;  5EIB C;  1GM8 A;  1HW7 A;  4ZI7 B;  1IBM O;  5IYD O;  2Q9L A;  4NYK A;  4X20 A;  1V54 C;  1VEW A;  4ASU G;  4I0X A;  2AZ2 A;  3K57 A;  2GHY A;  3ABM B;  1FXK C;  1I94 O;  2B9Z A;  1KYO F;  3Q4H A;  1XNR O;  3BY6 A;  1Q3E A;  2W0X A;  2ITC C;  2OCH A;  3BEH A;  2ILM A;  3IFX A;  3ZS8 C;  4WBN A;  3ABM C;  1RPO A;  4H13 B;  3SR2 C;  1GAX A;  5GTH Z;  5LOV B;  1WN7 A;  2XAJ A;  5K1X A;  4WF9 V;  2PYL A;  4I5S A;  4X64 B;  5LA6 B;  5ITZ B;  4WFA V;  3ZN1 A;  5CBG A;  1AR5 A;  4D7S A;  2HHH O;  4DV1 O;  1F51 A;  2Q73 A;  4YXW G;  4F6E A;  3OTF A;  3JD1 A;  2P06 A;  2BE3 A;  3OFN G;  3R65 A;  4JYY A;  4DW1 A;  1YJW V;  2HLD G;  2ADQ B;  3AG4 B;  1MSD A;  3ZCC A;  2ZCE A;  2WLK A;  1IBK B;  1F7Y A;  2UU9 O;  2QM8 A;  2RDC A;  4Q20 A;  3BAA A;  3CC7 V;  5IYZ A;  4FLV A;  5LMU B;  4NR1 A;  2X6A A;  3LDD A;  3AG4 C;  4NXM O;  3B77 A;  4O4H A;  4F4L A;  4JI4 O;  3ASO B;  2BCC H;  5TIS Z;  1XMQ B;  1Y6X A;  2FML A;  4TV8 B;  3JD0 A;  1M56 B;  4X65 B;  3K3W A;  3R66 A;  4JTA B;  1S3J A;  4DR7 B;  4IIJ B;  4QIW F;  4F6R A;  2W6J G;  4BR6 A;  5LHH A;  3ASO C;  4O4L A;  1KD1 W;  1S0V A;  1JR9 A;  4JI5 B;  4JI2 O;  1M90 W;  3QTC A;  3OAA G;  1M56 C;  5HFM A;  3ZRX A;  4K0K B;  2HVK C;  4RQE A;  4DRX A;  4MVM A;  4JI8 O;  4P9O A;  3W7T A;  1SZX A;  5BZB A;  5C8Y A;  2R9I A;  4J7J A;  4PD4 F;  4TOI A;  1VP7 A;  2Y0I A;  2F1M A;  4O2A B;  1NH2 D;  3OTO B;  5EBM C;  4K35 A;  1Q6H A;  2HFE C;  4FFB B;  5JCO A;  3ZMV A;  1VQM V;  4QE7 A;  4XBF A;  2IH3 C;  2Y4U A;  1KMI Z;  3H1L H;  3SPC A;  4LF8 O;  5KA5 A;  4DR1 O;  3BRC A;  3LDE A;  1SZT A;  2WWW A;  2F23 A;  1Y76 B;  2HEP A;  4PDM A;  4DK0 A;  2ODM A;  4GKJ B;  4U3J B;  4P2Z A;  3CCV V;  1MOF A;  4O4J B;  1XIL A;  3N27 A;  2XND G;  4IT5 A;  1I5Y A;  5E1A C;  2D3O W;  3NR7 A;  2A3Q A;  4X66 O;  1OJH A;  3JSN A;  4JI6 B;  1GRJ A;  3FD9 A;  2NR5 A;  1FD9 A;  4LFC O;  3FFQ A;  4C7U A;  4CH5 A;  2BTQ A;  2QTS A;  1N32 O;  4GKK B;  4JYA B;  3MDS A;  3NXS A;  5AG2 A;  4X1Y A;  1BT8 A;  2DQ0 A;  1Q43 A;  4GX1 A;  2ZKO A;  5BXZ A;  3H1J H;  3D36 C;  4BW9 A;  1IX9 A;  3BHP A;  2AHZ A;  3TJT A;  3GB7 C;  1QR9 A;  1I5X A;  1JFF A;  3E2E A;  5LMN B;  1PNK A;  4CH3 A;  4UV9 A;  1VF7 A;  2P6J A;  1N36 B;  1RM1 B;  3JAR A;  1K4C C;  3WB1 A;  3ML0 A;  2QWP B;  3RT3 C;  1G4Y B;  4PV1 B;  3ZBH A;  3H9V A;  4KP4 A;  3PJS K;  4U7N A;  4O4I B;  4MVQ A;  2UUC O;  1RM1 C;  4FPP A;  2O57 A;  1NQT A;  2DYR B;  3IAY A;  5KHJ A;  3CE2 A;  2YIB D;  1ZAU A;  2A79 B;  3ABT A;  3U11 A;  1NH2 B;  4EB6 A;  1ZUQ A;  3E35 A;  3CC2 V;  3RYF B;  3CCQ V;  3VQW A;  5CB4 A;  2LJ2 A;  2Z0A A;  2UUA B;  1P7B A;  3JAS A;  1VQ7 V;  4PDV A;  1PL0 A;  2DE0 X;  1GTO A;  1CXZ B;  2Y48 A;  4LF7 B;  4JAV A;  4CC5 A;  3SPH A;  2MW2 B;  3CJH A;  3QG5 A;  1UFI A;  1J5E O;  2RCV A;  1FXK A;  3ZN0 A;  4ZI7 A;  4X20 B;  5KHH A;  1US6 A;  4WFG A;  2Y69 B;  2ZT9 B;  1IBL O;  1N0J A;  3SYO A;  2PI5 A;  4OPA A;  4N21 A;  2GV9 A;  4UCR A;  1JQ0 A;  1K97 A;  1V9P A;  3OD4 A;  5B1B B;  5KX5 B;  1KKD A;  3Q4H B;  3CSX A;  1DLB A;  1Q7Y W;  1WPX A;  1FFX A;  4PDR A;  2EZP A;  2Y69 C;  2N05 A;  4WBN B;  3TXS A;  1WAZ A;  1L0L H;  3SJQ C;  5B1B C;  1AI7 A;  2CTP A;  2WA4 A;  4H37 A;  2QWN B;  5IJ9 B;  4B3S B;  1GN2 A;  3I56 V;  5LOV A;  2LP7 A;  2M7W A;  3RFR A;  2E5L B;  4JI1 O;  1M93 A;  5J2U B;  1LR1 A;  5D5P A;  4PI0 A;  5GTI Z;  2UUB B;  2Q0O C;  4DW0 A;  1DK1 A;  3L71 H;  4DUZ B;  3GWO A;  4O2B A;  4Z2W A;  2CK3 G;  1FFT B;  4OX9 O;  5IYZ B;  2IJI A;  4DV3 O;  2ZM6 B;  3G67 A;  4YHH O;  1R73 A;  3JSL A;  4FM1 A;  1BQ0 A;  4JPR A;  1MNG A;  1Q90 D;  1AB3 A;  1FJG B;  1WJZ A;  1DGS A;  2JIZ G;  1K8A W;  1CEZ A;  3UCS C;  4YIO A;  3F5W C;  1DTO A;  1SQX H;  4F6R B;  1AJN A;  2R9R B;  4J9Z B;  4IL6 Z;  3ZX6 A;  5L3C A;  5FL7 G;  1HDJ A;  1BGY H;  4DR4 B;  3BA9 A;  2UXD O;  3LNN A;  4DRX B;  3ZMS A;  3IC9 A;  2CH7 A;  2X6B A;  2K1E A;  1NTM H;  3TCU A;  4GX0 A;  3TK1 A;  2CTR A;  2BOC C;  4UB8 Z;  2ITD C;  4H0L B;  1P84 F;  1KEC A;  2WLN A;  1VQ4 V;  5BY1 A;  1VAR A;  3FB5 C;  1VQK V;  2ZE6 A;  2IJH A;  1XMO B;  5B3S B;  2ZQM A;  3B40 A;  2X7R B;  1PL4 A;  3CCR V;  3AG7 A;  2QJ1 A;  2E3C A;  5B66 Z;  4B3T B;  4O2A A;  2D2C B;  4LF6 O;  3QO8 A;  2EUL A;  1Z2G A;  4UVB A;  4FFB A;  1LUV A;  1YVW A;  1NS1 A;  2CGO A;  2A7W A;  4K3A A;  3B09 A;  3JD4 A;  2Q8V A;  3UO2 A;  4NTY A;  5B3S C;  3F7Y C;  2ADP A;  5E79 Z;  3B2E E;  1H8H G;  1G8M A;  5CN0 A;  1SF9 A;  3JAW B;  4QNH B;  4ZOL B;  3MD0 A;  1XEQ A;  1QCE A;  1R3J C;  3STZ C;  3E8F A;  4LF5 B;  4I50 B;  5KHK A;  1W59 A;  3CCS V;  1NVP B;  3ASN C;  1QHT A;  4DV7 B;  4X62 O;  4KL1 A;  5JJN B;  5LHG A;  3P30 A;  4J80 A;  1K5Q A;  2CAZ C;  4MTO A;  4R7C A;  1WA8 B;  3D36 A;  1K7D A;  1Y66 A;  2X0L A;  4EFB A;  5C93 A;  3BFR A;  4TSF G;  3SYC A;  1U96 A;  2ZIN A;  2JEX A;  2ZR3 A;  1H2N A;  1HR0 O;  2F66 C;  3CCU V;  4DV0 B;  4YY3 O;  2XAQ A;  1L8D A;  1KU9 A;  5IT9 N;  1JFF B;  2EIL B;  1B3Q A;  4HZ3 A;  3RWR D;  2R9A A;  3JAR B;  1NTZ H;  4BIZ A;  3T1H O;  2FKX A;  3AG3 B;  4R8C A;  3AK2 A;  3VOU A;  4BIU A;  2VQF B;  5EC2 C;  4MW3 A;  4L87 A;  2V4D A;  4B3M B;  3SPI A;  5BMV A;  2EIL C;  1SQV H;  2ZE7 A;  3U10 A;  1GO3 F;  4PA4 A;  3I5D A;  4DV6 O;  3WFV A;  2EIM B;  3AG3 C;  1AVM A;  1LUW A;  1PNM A;  2QA4 V;  1JVM A;  2NLJ C;  3ZMU A;  5CB4 B;  2H94 A;  1MA1 A;  2ZDI C;  4JF3 A;  2VQE O;  2JRI A;  2UXB O;  1COW G;  2V1D A;  3JCZ A;  1M9N A;  3QF7 A;  1XI1 A;  2EIM C;  3L70 H;  1R1B A;  2B5U A;  2ZNJ A;  4TQF A;  4UFZ A;  3CJH B;  4FZ1 A;  2HHH B;  1QBZ A;  2WLM A;  1FXK B;  2WA3 A;  1HNZ O;  4B3R B;  2YI9 A;  5GON A;  2LO1 A;  2A0L A;  2FB5 A;  4QPJ A;  1K3E A;  3WU2 Z;  2IBZ H;  2CE4 A;  2DN9 A;  2F4V O;  3ABU A;  1EZV H;  2C2A A;  3CWB H;  3FKS G;  5LL6 Y;  2Q7G A;  4DXW A;  4NXN B;  1FFX B;  3I55 V;  2ZD9 A;  3E22 A;  2NN4 A;  3IC7 A;  5KX5 A;  4RQF A;  1W2B U;  5LHI A;  2AZ0 A;  2RNB A;  4LFA O;  3ZHT A;  3L73 H;  4LNU B;  3AG1 B;  3J81 N;  3UO3 A;  4DYL A;  1S5L Z;  2CGN A;  2JEU A;  1UJW B;  3ZRS A;  2YEV A;  4DUY B;  3H1K H;  1ZWI C;  3M7M X;  4DR3 B;  4FM2 A;  5EC1 C;  1SQB H;  2KB1 A;  3K06 A;  4DO2 A;  1N33 O;  1IXB A;  5IJ9 A;  1YHQ V;  1BQZ A;  4JI2 B;  3OMA B;  4LF9 O;  3AG1 C;  3ICX A;  3T4D A;  1VQ5 V;  4NTW A;  4DR2 O;  1ZL8 A;  1I08 A;  1MG1 A;  3BVO A;  2PI4 A;  4O2B B;  2Q7H A;  1N0N A;  1XL4 A;  5J2U A;  1RSO A;  2IU3 A;  3CXC U;  3K9S A;  2ATK C;  4CH6 A;  2B1G A;  3A0R A;  1Y67 A;  1S77 D;  4JAS A;  1FYJ A;  5JQG B;  4JI7 O;  4A5U B;  2FYU H;  1JX9 A;  2KQX A;  2H8P C;  4UCV A;  4B7E A;  1K5S A;  4FLZ A;  1H38 A;  1K4D C;  2YIB A;  4FLU A;  2L35 A;  3W7W A;  4H44 B;  3ZMZ A;  4DV4 B;  4MTX A;  3CRR A;  4J10 A;  4RUE A;  2PUS A;  2ZR2 A;  2HR3 A;  2G38 A;  2IM9 A;  3H1I H;  5FNV B;  1VMG A;  3K59 A;  2CH7 B;  4HNA A;  2P22 C;  3FYE B;  5CA3 A;  4JI0 B;  4MVO A;  1WP8 A;  4KHP B;  3RVY A;  4J11 A;  4XDK A;  1JPX A;  3ETG A;  3MAQ A;  1TA8 A;  3JAK A;  1D5A A;  2ZE5 A;  1ROP A;  5IWA B;  5IDJ A;  4X64 O;  4IYI A;  1YTF D;  5B5E Z;  1URF A;  1HNX B;  1IZ3 A;  2OT5 A;  4CS2 A;  4MT8 A;  3OM3 B;  3CHX A;  3N2K B;  1YSC A;  2ZNI A;  3H1H H;  2LFS A;  2QGN A;  3K0G A;  1QVG U;  1IBK O;  3K08 A;  2QM7 A;  1YEW A;  3KCX A;  1OCO B;  3G80 A;  3ETE A;  4H33 A;  4YJ2 B;  1ZSP A;  5LMU O;  4K8X A;  1MZF A;  3C3S A;  4RWU A;  5LXT A;  1N34 O;  3AEI A;  1ZTE A;  1Z5V A;  4LP8 A;  3JAW A;  4ZHQ B;  2VS0 A;  1XMQ O;  4ZOL A;  3CEI A;  1WPB A;  4J9Y B;  1OCO C;  4I50 A;  4X65 O;  4DR7 O;  4ZBM A;  5EZY A;  4CC6 A;  3LSU A;  1Q6I A;  1Y74 B;  4AQY B;  3CS5 A;  3CXH F;  3SPG A;  4LC1 A;  1VQL V;  4BIO A;  2DWE C;  4JI5 O;  4CZZ A;  5L3D A;  5EYP B;  1MZE A;  4K0K O;  3APQ A;  1WA8 A;  5L3G A;  2JK5 C;  2GDS A;  1B04 A;  1WLE A;  1MSW D;  3C3T A;  3VQX A;  1YI2 V;  1K73 W;  1VIB A;  1IVS A;  1PPJ H;  4JGS A;  5H9C A;  4BAY A;  1TGO A;  3OMI B;  3LNM B;  4FFK A;  3RBZ A;  5CA0 B;  3O9O A;  4GCZ A;  3OTO O;  3KCY A;  3S3W A;  2FL4 A;  4CBC A;  5BMV B;  4MS2 A;  3T4Z A;  4W4K A;  3JD2 A;  3E89 A;  1Q81 W;  3C90 A;  1D5N A;  5LGN A;  2GBO A;  3E8G A;  4LCU C;  2IU0 A;  4UXN A;  2ZDI A;  2P4V A;  3L9D A;  5K1P A;  4LH6 A;  2BSK B;  5CA1 A;  2FTK A;  2XHB A;  1GN3 A;  4GKJ O;  4P9P A;  3JAL A;  3CPW U;  4PA9 A;  3E86 A;  2VRZ A;  4MVS A;  1FXH A;  1KQS U;  1MMM A;  1ORQ C;  3FAV A;  3JCU Z;  1IXM A;  4JAU A;  3RYI A;  3GVM A;  1SQQ H;  1R6K A;  4YIP A;  2ZIO A;  5JJJ B;  4JI6 O;  1N4C A;  1SC5 B;  3E8H A;  1SS3 A;  4KXR A;  4ICG A;  1YXB A;  2HJD A;  5GON B;  3UT5 B;  5KMG A;  4PEL A;  3RYC A;  4GKK O;  4JYA O;  4TV9 A;  4D6T H;  4LF4 B;  2VWK A;  1ZX3 A;  2KG7 A;  3ZRV A;  3T1Y B;  4LFB B;  2OIE A;  5LGT A;  1GN6 A;  1XNQ B;  4ZKI A;  4B7K A;  1RPR A;  3E22 B;  4MTG A;  2DOS A;  1M1K W;  5LMN O;  1AP5 A;  4LBE C;  1N36 O;  3OE7 G;  1BL8 A;  2Q5Z A;  3IJ4 A;  1YZB A;  4AIL C;  2YEV B;  2YXL A;  4JI3 B;  1Q5O A;  4LNU A;  4HYO A;  3ZJZ A;  2EIN C;  1AIL A;  1TVK B;  2JJ1 G;  4YJ3 A;  1OCC B;  2DQ3 A;  1ZL8 B;  1JA8 A;  3T1C A;  1EFR G;  1IDS A;  2Z3Y A;  1V55 B;  1RSO B;  3W7S A;  1H2M A;  1AJQ A;  2UUA O;  4DR5 B;  5A2Q N;  1P4R A;  1OCC C;  1B6Q A;  2XTA A;  1ARO P;  1BS3 A;  3CRQ A;  2Y4T A;  4LF7 O;  4PA7 A;  3E83 A;  4G27 B;  2CDY A;  1V55 C;  4DV5 B;  2H3O A;  4FZ0 A;  5JQG A;  5EBL C;  1NR7 A;  1OCR B;  3P3N A;  1GM7 A;  5J2T A;  1XL6 A;  1OZ0 A;  3E8B A;  2OTL V;  4FLW A;  4MVR A;  2K9P A;  1EM1 A;  4KFM A;  5LGU A;  1OCR C;  2RMK B;  2YXY A;  4IHJ A;  3AG2 B;  4HNA B;  5CBF A;  4J41 A;  2DYS B;  4GX2 A;  4TUY B;  2UXC B;  2JDI G;  4L8J A;  2EJ7 A;  2IJJ A;  5FNV A;  4I4T A;  3D3Q A;  5D5Q A;  2JGD A;  1JOY A;  3J7A U;  1SER A;  3JAK B;  3WB0 A;  2VWJ A;  1Q82 W;  2JS5 A;  2Q6A A;  4PJ0 Z;  2KSD A;  3N2G A;  3ZHS A;  1I0H A;  2AGA A;  2RQ6 A;  2OYQ A;  3B4S A;  4B3S O;  3AG2 C;  2DYS C;  3O65 A;  4HBN A;  4UB6 Z;  2E75 B;  2Q67 A;  5JJE B;  3G71 V;  1VQ6 V;  4PDL A;  1EN5 A;  3L75 H;  4DV2 B;  4X1I A;  2E5L O;  1H2G A;  1SKV A;  2XOK G;  1N8R W;  4FM0 A;  5L3E A;  2UUB O;  1QVF U;  3N2K A;  4DUZ O;  2PZS A;  3K04 A;  3K5N A;  4W4L A;  3THO A;  4JV5 O;  4FJC C;  2ZM6 O;  5H6Q A;  3QO7 A;  1BSM A;  3KKY A;  3ASN B;  5LXT B;  2YUA A;  4PHZ A;  3ZED A;  4YJ2 A;  1XQ8 A;  4J42 A;  5IJ0 A;  1FJG O;  1T5E A;  1SET A;  2Z5U A;  2M6Y A;  1S76 D;  2QR4 A;  2XAH A;  1JCH A;  4ZHQ A;  3QO5 A;  2LW7 A;  5EZY B;  3HKC A;  1G1X B;  1WNS A;  5BR8 B;  2XAS A;  1SRY A;  2A06 H;  4DR6 B;  2YIC A;  4EEQ A;  2ZXW C;  4DR4 O;  2X6C A;  3OT7 A;  5CBH A;  1Y74 A;  4QGP A;  2QKS A;  1YF2 A;  3K03 A;  2RN9 A;  1E1R G;  1FKA O;  2YSU B;  3ETD A;  1AR1 B;  3AK3 A;  5EYP A;  3B8N A;  1VQ9 V;  4FK5 C;  2HKO A;  3JAT A;  4KUM A;  1BMF G;  2UXN A;  4U3F H;  3ABK C;  1IBM B;  1XMO O;  2IH1 C;  5KHG A;  1XUQ A;  5CMU A;  1L1F A;  2QKC A;  3CCE V;  4FLT A;  1GMG A;  5CA0 A;  4B3T O;  3OMN B;  2DW4 A;  2EZO A;  4G2K A;  3LUT B;  4GT1 A;  2N74 A;  3CC4 V;  2P5O A;  2WLI B;  2QDO A;  1I94 B;  4NB5 A;  4PI2 A;  4WCE V;  4G28 B;  2Y0P A;  1KKC A;  4N23 A;  1XNR B;  4X8A A;  5CA1 B;  4TQD A;  1M57 B;  2LGW A;  3JAL B;  1QNM A;  2HG5 C;  2GUZ A;  3VBB A;  3QVN A;  1UPG A;  4LF5 O;  2BSK A;  3SDL A;  1NR1 A;  1NJI W;  3FX7 A;  2CTQ A;  2BOB C;  5F2V O;  3FAV B;  2LW1 A;  5LYJ B;  3RYI B;  2PF4 E;  4DV7 O;  2DWD C;  3A2F A;  1M57 C;  3ZHU A;  5KMG B;  2AXT Z;  4DV1 B;  3RYH A;  1E1Q G;  1OV9 A;  1B06 A;  3RYC B;  4JTC B;  4TV9 B;  1K92 A;  2Q7E A;  3LDC A;  3JD3 A;  1K34 A;  3QNE A;  3UT5 A;  2KG7 B;  3DXR A;  1AJP A;  4X9Q A;  1VF5 B;  1NBM G;  4UV8 A;  4DV0 O;  2QKA A;  5GW7 A;  3SGI A;  2UU9 B;  1JJ2 U;  1YJN V;  3U0Z A;  1S5J A;  4OXS A;  4B08 A;  4R6Z A;  2EX3 A;  4NXM B;  1EN4 A;  4JI4 B;  1RP3 B;  3LSS A;  2EJR A;  4Z1V A;  5JWP A;  1LNQ A;  1VF6 A;  1FXV A;  2VQF O;  2YI8 A;  3DC6 A;  1GN4 A;  4B3M O;  1HNW O;  3CRC A;  2ETN A;  3D8C A;  2RJZ A;  4GYC B;  5DEC A;  2JS3 A;  4YJ3 B;  2P4K A;  3DSQ A;  2XAG A;  1TUE B;  1HP8 A;  4LR3 A;  4X88 A;  1CPY A;  5H2F Z;  1TVK A;  2W6I G;  5IE9 A;  3RN4 A;  2HVJ C;  3K79 A;  1YIJ V;  2BTO A;  3ZHV A;  3GWK C;  4JI8 B;  3KG2 A;  4RUF A;  3UM7 A;  3K9A A;  1NTK H;  5FPR A;  5KA6 A;  1ZLZ A;  1PNL A;  3DTU B;  4NTX A;  1Q86 W;  1JJO A;  2Q68 A;  3F7V C;  1GH6 A;  2JJ2 G;  5DM6 V;  4J7Z A;  4LWS B;  5J2T B;  4B3R O;  1XRE A;  1TUB A;  4EFE A;  3T2M A;  2EBO A;  2QWR B;  4LF8 B;  4IHJ B;  4DR1 B;  4NXN O;  4GLX A;  5H6R A;  3WG7 B;  4CS4 A;  5LBQ A;  1N34 B;  2LQT A;  4I4T B;  3W7X A;  2JGD B;  1TAE A;  5A9G A;  4TUY A;  3N2G B;  2NNU A;  5L3B A;  4UCO A;  4DUY O;  3CCJ V;  2XAF A;  4DR3 O;  3WG7 C;  4X66 B;  3J80 N;  4ZIB A;  4FLX A;  3TET A;  3LSQ A;  2YXH A;  4X1I B;  3PN1 A;  4LFC B;  2QTO A;  2DMX A;  1KP3 A;  3S3X A;  2IJK A;  1G6U A;  2ZIM A;  1N32 B;  5JH7 B;  1VQN V;  3L72 H;  1QLE B;  3CME V;  3OEH G;  1P49 A;  3M99 B;  1SA0 A;  1YIT V;  3FYI B;  4JYB A;  1WB8 A;  4GZR B;  2HJF C;  1HWY A;  1BCC H;  5IJ0 B;  2Q0A A;  1QLE C;  3ZHR A;  1KC8 W;  3K5M A;  3HKB A;  2XT9 A;  5IY5 B;  3K0D A;  5B1N A;  4WFF A;  1KBH A;  3HKC B;  2A9H A;  2W0F C;  4DV4 O;  4JZ2 A;  3JAM N;  1X4T A;  2P67 A;  3SYA A;  2P90 A;  4I7Z B;  1A32 A;  2UUC B;  5IY5 C;  3SYQ A;  1YCI A;  4PA6 A;  1Q8I A;  4JI0 O;  4KHP O;  5L3F A;  4I55 B;  4OGQ B;  3JAT B;  3OW2 U;  3HR0 A;  4JAA A;  4UVA A;  1NZ6 A;  3ZRW A;  1OCZ B;  5IWA O;  2JGU A;  2EIJ B;  2F93 B;  1HNX O;  3OGC C;  1R3I C;  2P7T C;  2QE7 G;  2PTM A;  1J5E B;  4WFE A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  1J5E O;  4DUY O;  1F7Y A;  5BR8 O;  2UU9 O;  4DV5 O;  4DR4 O;  4DR6 O;  1IBK O;  4DR3 O;  2UXD O;  3J80 N;  1IBL O;  1N33 O;  4X66 O;  3T1H O;  2FKX A;  4LF9 O;  3F5T A;  4OPA A;  1FKA O;  4DR2 O;  5LMU O;  4NXM O;  2VQF O;  4JI4 O;  4JI6 O;  1N34 O;  4LFC O;  4B3M O;  1HNW O;  1N32 O;  5BY1 A;  4DV6 O;  1KUQ A;  1XMQ O;  1D2D A;  4GKK O;  4JYA O;  3R66 A;  4X65 O;  2ZKO A;  2UXC O;  1FYJ A;  5BXZ A;  4DR7 O;  1XMO O;  4JI7 O;  4A5U B;  1IBM O;  3J7A U;  4LF4 O;  4LF6 O;  3T1Y O;  4LFB O;  4B3T O;  4JI2 O;  2AGA A;  1NS1 A;  1XNQ O;  4AQY O;  2DOS A;  2N74 A;  2VQE O;  4JI5 O;  4B3S O;  2JRI A;  5LMN O;  2UXB O;  3O65 A;  4JI8 O;  1R6T A;  4K0K O;  1N36 O;  1R1B A;  4JI1 O;  1YZB A;  2DJV A;  1I94 O;  3RT3 C;  2E5L O;  4DV4 O;  3JAM N;  4DV2 O;  1X59 A;  1XEQ A;  1XNR O;  4JI3 O;  1A32 A;  1DK1 A;  2UUB O;  1HNZ O;  4LF5 O;  4DUZ O;  3SDL A;  2UUC O;  1AIL A;  4B3R O;  4OX9 O;  4OPH A;  4DV3 O;  4JV5 O;  4YHH O;  3OTO O;  2ZM6 O;  2F4V O;  4JI0 O;  4DV7 O;  4KHP O;  4X62 O;  5LL6 Y;  5FLX N;  1AB3 A;  5H5N A;  2Z0A A;  1FJG O;  4X64 O;  4NXN O;  2UUA O;  2HHH O;  4LFA O;  5A2Q N;  5IWA O;  4DV1 O;  4DR1 O;  4LF8 O;  3M8A A;  4DR5 O;  1HNX O;  1HR0 O;  3J81 N;  2LW7 A;  4LF7 O;  4YY3 O;  1G1X B;  5IT9 N;  4DV0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...