1M9NA

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Structural Insights into the Avian AICAR Transformylase Mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 219
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m9nA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1m9nA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA02
1M6VA 1S8AA 4A1OA 1S89A 1CE8A 2XW6A 1KEEA 2B1GA 1EGHA 1M9NA 2YVQA 2IU3A 1T36A 1ZCZA 3ZZMA 2IU0A 1A9XA 2B1IA 1PL0A 1PKXA 1THZA 1G8MA 4EHIA 1BXRA 1VMDA 1C30A 1C3OA 1WO8A 5H3LA 1JDBB 1B93A 1IK4A 1P4RA 1CS0A 1OZ0A 2X8WA
chains in the Genus database with same CATH superfamily
1RT9A 2IQ5A 3RFVA 1D6NA 1UH5A 1H2WA 2GEBA 5A6VA 3I2IA 4HVTA 1H2RS 4PX5A 2WYWA 4DQVA 3AI2A 4KRYA 5HRCA 5JANA 2I2WA 3B51X 4L7VA 5IW8A 2JEOA 2HRDA 4YMWA 4BY9E 1Z73A 1QFZA 4UBLA 1K6EA 3AP1A 1XIVA 2KE5A 3V5NA 2F3TA 2A2ZA 4BFLA 1MC1A 2JFHA 4GSLA 3H5WA 3M7IA 5K3DA 3C4JA 4BX9A 3D6MA 1GN3A 1L0BA 2WD8A 1PFQA 2QENA 3R6WA 1TF2A 3KQYA 5K6AA 3DTVB 3HLTA 3EXIA 1VTKA 4C7UA 1PT6A 4N8SA 3K1JA 1HLDA 4AQYB 1OIVA 3FMVA 4GR5A 1INLA 1XQVA 1Y4DE 4TVKA 4OGKA 1JEAA 4WZAB 1Q1BA 1YZGA 4EEZA 1PW7A 3EAGA 3NOOA 3RABA 4TTIA 2YNMC 2XSZD 4JT2A 2X4LA 2IS1A 1ZHHA 2BCJQ 4PCUA 3GVMA 2FX2A 3OP1A 1LW6E 2BFDA 2FEKA 3HVIA 2QVLA 3DLBA 4PBSA 5JJEB 4UBJA 2EZ9A 2BFCB 1S3FA 3N53A 4MVJG 2WKQA 2Z98A 3EQ6A 4ME6A 2DX7A 1MGOA 5KNBH 4EBBA 2DH6A 3U16A 2F64A 4YLGA 4DDVA 1H42A 1O08A 5C8XA 1SC6A 4CGZA 5DGHA 2C8JA 1Z26A 2A7QA 4G8CA 1RC8A 4F4IA 2O8FB 3O90A 2F62A 1K86A 2HC9A 3BUSA 1JSRA 1QH8A 1VBKA 4P34A 1Z4JA 4JMLA 2BHSA 1J2JA 5KAPA 1AJPA 1C1XA 5FWDA 2MHCA 1GKFA 2O4UX 4BNNA 3BIJA 4OHCA 1AHNA 4X6LA 3ODPA 2PKRA 1RP3B 4D4KA 4D5EA 3IAS6 4XLLA 4IRXA 4P4TA 5BYAA 3SZGA 2YWFA 2Y6VA 2QLNA 1CQXA 2A94A 4AAYA 5P21A 5HM8A 2NV2B 1KU0A 4JWKA 1PL0A 3NV9A 3BWCA 1A9SA 1E7QA 4IXTA 5HQJA 3NAZA 1IG0A 4X84A 3TRHA 5ALTA 1UMBA 3F5MA 4N8EA 3V2IA 1TVMA 3EMKA 2P91A 5JW6A 1ZK2A 1SEVA 1IN5A 1G5QA 4FXOA 2JCVA 2Q6AA 5DYTA 3DHNA 4LYDA 1CQZA 1VMKA 3MOIA 4X85A 2H1FA 3S2SA 5FD8A 3B48A 1RRCA 3IIEA 4QIWF 3AI3A 4EI8A 4TWIA 1HNWB 5ADVA 4CLRB 1DCFA 3JPYA 2X15A 4MR7A 3VNAA 3WWOA 2IRWA 3WYAA 1WW2A 2IH2A 4HS4A 1G21E 2C5LA 1Z5ZA 2I33A 1A7AA 2XIQA 5FXMA 5D86A 4YIHA 4EG5A 1O2DA 2JIMA 4ZHSA 4H77A 1JA1A 3V1UA 5EINA 1BDJA 5CHYA 5CH8A 3LW8A 3WG9A 2RJ3A 4FIZA 1DB3A 1U0OC 3ML1A 1NJ8A 4XQGA 4KO4S 2IJIA 5IY5B 5TSDA 4ZALA 2XWSA 4NCHA 5I9BA 3ZIAD 2IW3A 1OB2A 1YRYE 1VCNA 1Z2DA 1YGYA 3UV7A 1ILEA 4EDHA 2OPHA 3TW8B 1FDSA 1PNLA 4KQ2A 2F1HA 4EP1A 4LF9B 2OBYA 1JECA 3GK3A 4K46A 4QUGA 2RKWA 2VPZA 3W06A 3PRKE 4J03A 4KAXA 4TS9A 5F7JA 2CXTA 3N6RA 4RC9A 4BNZA 2SCUA 4XD7D 2VP5A 3HRHA 4FVMA 2HDNB 1SB8A 3QPBA 2OAQ1 3G6BA 3F46A 2NW6A 4BB9A 4MYDA 1RJ9A 1G66A 2Z9DA 3TTYA 1P1IA 1XXHB 3DO5A 1P4AA 1JG7A 4H7HA 1NNUA 1QYCA 2PWAA 2H1SA 3NWOA 5CRIA 2ZRAA 3DCJA 2H5EA 4NOMA 2WMNB 4MUIA 2YDYA 3W7WA 5TEVA 4QU8A 1W4ZA 5FOWA 4PTZA 1EKXA 3WGUA 5CB8A 4LCNA 1UUFA 2AL7A 2VSYA 1JLMA 2J85A 3T1QA 1DEHA 4CU2A 3PQ6A 3AEQA 2WA3A 1ZR4A 4DUPA 3CZQA 4OJKA 5CCEA 5L45A 2IUYA 5DP1A 1UWCA 3A6DA 5EC8A 3QVJA 3ET4A 5DM4A 1KAEA 4W82A 3PJRA 3L9WA 3FAVB 3NVDA 4AZVA 1X59A 2VQFO 2O7VA 3ZCXA 5K3FA 1E3TA 4ZN6A 3AC0A 3TDMA 3P3NA 1VEWA 3LUAA 1FDWA 4HQ6A 1VQPV 2P22C 1U2TA 1V6AA 3RYFB 1AHHA 1UP7A 1BCSB 3K5WA 4KSYA 4F4LA 3H2JA 3J7TA 2GCPA 2O95A 1OTXA 1FMJA 1L3BA 4JLWA 3GRKA 2FWJA 4IDOA 3OQOA 3VKVA 3CMEV 3HP7A 4PY2A 1Z63A 3N2LA 1A04A 5DCAJ 5IC5A 2NT3A 5EHXA 1S76D 4K6HA 3GH1A 4E5MA 3ESRA 5FWNA 2NYTA 3NPAA 4TUYF 3MWLA 5HUHA 1F7UA 5CH5A 5A7HA 4XYGA 1USIA 3Q7EA 5BR4A 4IMIB 3KJZA 2JFUA 4PYIA 4PYNA 4G36A 2FLWA 1ORQC 1DRUA 5KWSA 1HZJA 4MW9A 4WFBV 4PGMA 5JRDS 5ISMA 1FLDA 1PZNA 3D3JA 1F2DA 1N6NA 3EARA 2RGCA 4IW3B 3ESAA 4JB3A 1GU7A 1JTVA 3VTAA 3LBNA 3UCXA 1R6NA 4XUCA 4DJFC 1IVYA 4DNFA 3MELA 4J9UE 4EPTA 5DWVA 2JJ2G 3R65A 3VU1A 2RAVA 4QASA 2HHLA 1T8WA 2QE6A 4MUAA 3GUUA 2ZJ6A 4AUKA 1TTQB 3OUTA 4KR0A 3V4SA 2DFKB 3LX5A 1JFSA 3PDCA 4EG3A 3O03A 3RYHA 1UEXC 3OY7A 5KYVA 2JIPA 1Q0PA 4ASUG 4QYSA 3BHIA 2GPAA 1ZWKA 4OBEA 1TUBA 1FK8A 3Q11A 1FSFA 1R0YA 3NHFA 1ATIA 2PTHA 3RHFA 4A5SA 1Q84A 1WABA 5KLVH 2C4VA 4DL9A 2NPIA 1UM8A 4IDQA 5K8IA 5TQ0A 1E3EA 1KDZA 2AN3A 4NOLA 3J81A 1SVSA 2OCCC 1L1EA 1C9MA 3GLFB 1IZ8A 1HEIA 2W6OA 2GHQA 1GRVA 1SBCA 4NWIA 3ZJYA 1PZEA 1SD5A 1P0QA 3KJNA 1UCFA 5B30A 1E79A 1J49A 4R5HA 3CE2A 4DBZA 4I99A 4M6WA 4TKVB 3KYCB 5LKRA 3ZMSA 3KB8A 2CV1A 3GT7A 2DQKA 4Y2VA 4PFSA 2IZ5A 1QC5B 2IEZA 3EFFK 4WASA 3BE8A 3DC5A 1NUUA 4MV9A 3EUEA 3NHJA 3NDBB 1DELA 3V4PB 5EGNA 1QMPA 5HRAA 4RTQA 5JCOA 3HUEA 4NSNA 3WZLA 3RFXA 1K34A 4A92A 1P60A 1RPNA 2I2FA 1E94E 3SMQA 4AQYO 2NO4A 4WECA 4MIOA 4HQNA 1U9IC 3F73A 5FTJA 2CHGA 6REQA 2EWMA 3UB2A 4FWTA 1DKRA 4J4BA 4HNRA 4V03A 3VKUA 2OQ2A 2CYBA 3KS9A 5AM0A 2NUTA 4MICA 1FRNA 3ZEDA 1P0MA 1O5IA 4L75A 3ZI0A 5IM4A 4ENUA 3AHHA 2ZRIA 4NTWA 4DR3O 2Z5LA 4ZEOA 2RC6A 2AYXA 3D2CA 5F7OA 4M8NE 1SXJC 4FQ7A 1T1GA 2OQVA 1BWQA 4YMSA 3H16A 1PWHA 2GN4A 5AI8A 3HY4A 7AT1A 3N27A 1QH1B 4GI3A 4LHZA 2EDCA 1UADA 5KOIA 4KMSA 4EUKA 1ZJ5A 1TJNA 4KG7A 1VYUA 5BN3A 2EW8A 3W0LB 2WU4A 3R23A 4COOA 4GX2A 4BVLA 5JAHA 1TD9A 1O77A 1QIFA 3LXMA 2ZR2A 2BUBA 3EEBA 5LMCA 4F5YA 3BWYA 5JSYA 4FJCC 3RCBA 3ZUGA 3T4PA 3ANYB 4L28A 3IFSA 4RPJA 4L8VA 1T8RA 4X41A 1EN6A 2IYVA 3ABLC 4EKNB 3UMBA 5TC4A 1AKRA 2A59A 2B83A 1V2GA 3A9SA 1LVHA 4P9PA 2QD1A 2MTBA 4K05A 4J91A 2Q6KA 2FKXA 4G2KA 3RSSA 3LCJA 1TAQA 2E21A 1E89A 3JWPA 3UWDA 2YBDA 2XWQA 3SFTA 4OX9O 5DW0A 5IYDO 2BISA 3TAHA 5MDHA 4K2HA 1SVUA 3L77A 3L07A 5FV4A 4X61A 3MB5A 1TJ5A 2P3OA 4PXSA 4BL5A 5IDVA 4NBLA 4QE3A 3MHTA 1KO4A 3EIFA 4JP8A 2GTPA 2Q7HA 3JD1A 3VO2A 5KNDD 1JKJA 1ZEMA 2IYUA 1Z6YA 2HMWA 4AMZA 1JLRA 3LFTA 4UCQA 5FBWB 3PGA1 2OD7A 3D0OA 4B2LA 3L3BA 1MG5A 4B84A 1ODLA 4JWTA 3D1JA 3KXPA 1A9YA 5BUZA 2I1QA 2QSJA 4ABYA 2WF5A 2W11A 4MNTA 5H6QA 3E9RA 2AIRA 3PKJA 1UMDB 1V37A 4PJ0Z 1OQAA 1XRQA 4CR6A 2R6HA 2EWWA 1EZ4A 2OCHA 4K86A 3EHBB 1KARA 2IU4A 4A2CA 4P3XA 3K6SA 3AJEA 3F4BA 5FDFA 1M2GA 2RSLA 1KO7A 1ROPA 2DKOA 3FAZA 5IG2A 2H2IA 1IXMA 2BZ1A 5AKIA 4C29A 4MYHA 3C3XA 5A5GA 4DPMA 3LVBA 1UF9A 3LQRA 1AF2A 4W63A 2ADOA 2VS0A 1P9WA 4JOQA 1FFXA 3LY9A 4XDKA 3B2QA 3FB8C 3AHGA 1R9JA 4XGNA 1LSOA 3U48A 3I6IA 2H59A 1Z2AA 3GXOA 4NF2A 4MV4A 2FPPA 3PQCA 4KNWA 2M6LA 3WZMA 4KQMA 1TYAE 4BKPA 4MVWA 2NZUG 2XGSA 2RE8A 2HBZA 4WCFB 3TUZC 3CXCU 5B37A 2W0XA 2F1JA 4HGQA 3EQ2A 2XW6A 3ZGXA 5D51S 1RRPA 2XOXA 5HWSA 3PUVA 1QP4A 3W79A 3DH1A 2H1LA 3SQMA 1NNEA 2XUDA 1XLWA 4NS4A 4NI5A 1G2PA 3GF4A 4HZ3A 2OHOA 5REQB 3HWRA 4RJTA 2ECQA 4YDHB 5L3QB 5AJYA 2Z2XA 3UC9A 3QWFA 1WMAA 1KAHA 1F2TA 3LUFA 1IE3A 1RABA 4C7KA 3SJBA 4JI1O 3JQBC 1XMQB 4L8JA 2CGOA 3DLHA 3L6OO 2YRWA 3TLCA 4CKBA 3MOSA 3E5HA 1RWBA 3IT1A 5A06A 1TMYA 3T7DA 3WGTA 1Q95A 1VL6A 3OFNA 1I24A 3BKWA 1DQRA 2GBPA 1LV8A 4FUTA 4EUNA 2RFLA 3D43A 3F7OA 4Y6OA 3I4CA 4C87A 4N7RA 2XAGA 1W93A 4AKSA 2JLYA 4G4IA 1O94C 4CS2A 2CLKB 3GL9A 4DV2B 2PBFA 3ANNA 1L8LA 4MVJF 1L3IA 4BNDA 3Q6IA 3TFQA 2HX1A 3TEJA 1RIFA 3I6ZA 1VF6C 4WD3A 4D74A 1E2PA 3OAAD 5ESDA 4G0WA 3JYPA 4I14A 3OO0A 1GGHA 1Q0QA 2K2QB 3CCLV 2ZI3A 4GHWA 4TLBA 4DLWA 2ZRQA 2ZDHA 3R3VA 1OUMA 4MGYR 4YRIA 3AG3C 3ZE8A 1JA8A 1R10A 3VNBA 1JQAA 1IOWA 1PVOA 4EG8A 3E9EA 1A7UA 2KB1A 1UC5B 2EKZA 1R0WA 4CNQA 4XGQA 2ICAA 2LO1A 2M6RA 2WK1A 2FWAA 2X0KA 4W9RA 4BQOA 3O4GA 1CP2A 4MMXB 4KHZA 4V02A 4UCVA 3VR6D 4GNKA 1OSNA 3TUJC 4CKEA 4U5XA 3WYNA 2NVUA 2C88A 3V1KA 4LCUC 1GSOA 3DE3X 2P06A 2B9ZA 5IBPA 3CXHF 2VAVA 3BCHA 1VIDA 2VHUA 4ZMBA 4TWJA 1BXGB 1CG6A 2J1LA 1E2MA 1AM4D 3ASYA 3N3BC 2CUKA 3JSLA 3IQIX 2GZMA 3KHKA 3ASVA 1B6GA 4O4JB 4IJKA 1X7DA 2R4UA 1S0UA 3TJTA 5GV8A 3ZZ0A 1TFRA 5ALPA 3MRVA 1XDSA 3FWNA 2PRSA 1NQVA 2CMKA 3K04A 3MQ2A 4Y67A 4XIYA 4BB0A 4Z4EA 2EIKC 4IY1A 1EQAA 2D0IA 3H1JH 3GBPA 4X71A 4LYYA 5J1TB 4TS1A 3OY2A 1JFFA 1MGPA 4Z1MD 3AVYA 1B1CA 4P9EA 2VDWA 4OYHA 5JJCA 4C3ZA 3GRZA 3L84A 1SZDA 1R5OA 1OZGA 3MS7A 3OX4A 4W4TA 1DV1A 3HR7A 4QXAA 5G1PA 1PYGA 2RK6A 1E2DA 2X8JB 1A2KC 3S5JA 2IU0A 1GVHA 3K2EA 4OJMX 5C1DA 3PGXA 1L5RA 1XJ0A 4H31A 2ZJ7A 4OHFA 3UANA 4Q82A 3W4KA 3OCXA 5EP1A 3K09C 4ZZ3A 1KAMA 4AP6A 4JJ6A 1H1DA 2LIPA 3IDZA 1G0OA 2WUFA 2HWXA 5CYPA 1SVIA 3DC2A 3KKQA 4YJHB 1K8YB 4AD8A 1NW6A 5BOSA 1Y1KE 3D6NB 4LYJA 4CTJA 3JQFA 3CZAA 1T0IA 1JEEA 5K3BA 1QVWA 1WXEA 2BMDA 1V7PC 3GP5A 4DIMA 1E2UA 2ZSIA 2QROA 3OT5A 3U6BA 1XMOB 4UTXA 5HK8A 4MEJA 4JVOA 1WETA 3TX6A 1QOZA 3H9VA 2CB0A 2NZ8A 3RBXA 3CH7A 1NRIA 1V3UA 4YMLA 2QJOA 3FCXA 2FFAA 1FYFA 1WCWA 1SOVA 3D59A 1YHNA 3UWMA 2EG9A 3E2IA 4X44A 3LC0A 3NONA 5I3ZA 3SOZA 3U4HA 2Z4TA 4RMHA 1YSCA 1YSBA 1FS4A 4M22A 1Z7EA 1LQUA 1VJ5A 1Y1SA 3MERA 3G82C 3IGAC 3R6LA 5PGMA 1TYDE 4GL4A 1DEKA 1WMFA 3AX6A 1ZA2A 1T9DA 4M9SA 4PHGA 3QW4B 1P62B 3HYNA 2O9JA 1QGUA 3CB4A 4GVPA 4C08A 1XI1A 5F4ZA 1Y1RA 4QYIA 1ZXBA 4Q19A 3C98A 2VO1A 4DKXA 2XY4A 2D00A 3PBKA 1H8ED 4GWKA 4WLEA 2GTHA 4LFAB 4AJOA 2KB0A 2QR5A 3AKYA 4JAVC 3FFQA 2NZXA 4HEHA 3KSAC 4HY3A 1GCUA 2B5VA 1D2NA 2VHZA 5BUSA 3BD8A 5FA8A 4JI2B 1C2YA 2OUKA 4OHRA 1IIBA 5AOAA 4C0BA 1E2BA 3CRCA 4BFYA 3NM5A 2H6EA 3HYSA 3IOMA 2JJ8A 2VOEA 2HVKC 3UY4A 1DWUA 4HDKB 4AG5A 2B98A 5HKOA 4LWZA 5B4TA 2Z3IA 2GZ3A 1C3OA 3M8AA 3O75A 5AKZA 4MVYA 4FOSA 3KFXA 1YBMA 2P9HA 2QUBA 3H8WA 1IUNA 3TLYA 3T3PB 2QYHA 3QX7A 2Q3CA 2RCYA 2HLDA 4BVBA 3QVGB 1N0IA 4XEHA 1WB7A 4NENB 3TLGB 8AT1A 1BE3H 1B0UA 1XNQB 2I3DA 3W1EA 1I01A 4LNAA 1Z13A 5JYEA 1M8JA 1NMQA 2W8BB 2P3SA 5JYCA 1PR1A 2O3TA 2Z5FA 1FD9A 4C7BA 4NCJA 1FCJA 3HGQA 3A58B 1B0PA 3ELWA 2V96A 2OOSA 2Q4OA 1NYRA 4NFSA 3M2TA 2AKYA 3TXQA 4RV4A 2IWHA 3EVFA 4KVFA 1QHGA 2QJRA 2NG1A 2WU0A 2WIGA 3N2GB 4DIEA 1DG3A 4FZ5A 1F4PA 4PYOA 3BTUA 2YWGA 4D0GA 4BMVA 4AICA 3EYAA 3RIXA 3NT4A 1M2NA 3CEJA 1FZTA 3K9BA 1N3BA 4MWBA 1VQ2A 1W2HA 2GCEA 2VPXA 5GZ1A 3AHFA 4JLNA 1XGKA 2Q0XA 3ZJVA 4I50A 5DWQA 2I99A 3KV3O 3ABMB 4ML3A 1NNLA 3CRAA 3HO8A 1YIDA 4J4HA 3A31A 5INTA 3H2YA 1DK1A 1VF7A 4MIKA 1Y3BE 2HI0A 5IAAA 3ICVA 4S2UA 4C6TA 3G5MA 1JEJA 2C5HA 2ZBUA 2D3OW 4R6WA 4HX2A 1IQUA 4XJVA 4HF7A 1U9ZA 2YBEA 3ODGA 3FPHA 1ACMA 5EFZA 4RM2A 4MW7A 1Y6FA 1QHHA 5IF9A 3MTEA 4DMHA 4KUGA 2QNBA 4YB8A 5U9CA 4II2A 3K8ZA 1DJPA 2W48A 4PHTA 4J3FA 4JV5B 2AOTB 3DCIA 2HIGA 2LRHA 5JAZA 3ZN2A 1GRRA 1RACA 3MIIA 1V43A 4PLCA 3DD1A 1NVPB 4X54A 2GVZC 3ICQB 2HF2A 2ONZA 5FWYA 4YCCA 1BX3A 4NU8X 4BXOB 1OB5A 1ZAKA 3T3EA 3K6JA 3X2FA 4O59O 1LPMA 1MV8A 5EHGA 3OCJA 4GYYA 1T5SA 4DV2O 4FFWA 3KCQA 2ZWMA 1KZGB 1C8KA 4YRAA 4XB6B 3SR4A 5CEEA 2R79A 4B6FA 1QIDA 4YYZA 5EZ6B 5GVRA 2W6ZA 3EXG2 2A5DA 5DI3A 5HE8A 4J1QA 3SZRA 2OHGA 2PK3A 1BQ0A 1QYDA 2YNMD 4N5LA 3SMVA 1TUEB 1VKRA 2G07A 2X6RA 1C7IA 3ETEA 2FPXA 2QSUA 3PQ3A 1IN8A 1ZLYA 3LKVA 2X5JO 4ZREA 1KOFA 1PJZA 4JI0B 2D7JA 3VM6A 1SXGA 4PSUA 1CT9A 1O8BA 4ALNA 4OXXA 1Z2NX 2IHYA 2OCIA 4D7AA 3V3TA 3UEOA 3RU9A 4G1VA 3CCSV 3GJQA 3IPCA 5GVSA 1UAAA 3GAFA 4ZU1X 5FLYA 3UMMA 3MAGA 2XTMA 1SCQA 5GM1A 2RH4A 1GPYA 4CS4A 2P1DA 1LQTA 4IVNA 2HGZA 1SKYB 2C7BA 2DQYA 4JC8A 3U9TA 3KLPX 4BV9A 5FJIA 5LMZA 4CFZA 2A0LA 3WLFA 4MTCA 2IEYA 4AU1A 5IT5A 1QVFU 3GRAA 1XLTA 2RMKA 4Q7KA 3ABRB 1ZX3A 2ZJ8A 2IX3A 2O7PA 1L5HA 4NY1A 4PXYA 2OLKA 4B81A 5BSHA 3OP4A 4UM9D 3P94A 5KHHA 3NYRA 4HO1X 4L2IB 2A14A 4Y8VA 3BQNB 1U8YA 3TOVA 5BUQA 2Q45A 3OQPA 2FA9A 3L05A 4F72A 2IYSA 2TMKA 2II6A 1IAVA 1PDWA 2C57A 4N18A 2GTAA 2FXIA 3WBBA 1LWNA 3NO4A 6ADHA 2XUOA 2FPGB 2VJLA 2G1JA 1ODJA 1CFJA 2DT8A 1QUEA 5CEJA 3NYQA 1CY0A 1OXTA 1ZJ4A 5EJ4A 5EKSA 2LGJA 3RVBA 1I1NA 3BFPA 5A9SB 2G88A 2G7MC 3DYVA 5D1HA 1GLVA 3L74H 4G81A 2DEUA 4U2EA 5LP6A 1F8XA 2ZTVA 2ID8A 3QNEA 2WLJA 1PK9A 2NMVA 1LD3A 2YICA 3BGVA 1PK7A 3ELBA 2G80A 2OMEA 2XVXA 3T1CA 2PZSA 1KDPA 4QUBA 5ALQA 4YH1A 4KRFA 3HO6A 4E46A 3K72B 4KXQA 4Z9YA 2WNHA 5D3MB 4O4JF 2G04A 3QX8A 3VR1A 2RHDA 1IEVA 3EEFA 1BN6A 1T5OA 4KUHA 3JCUZ 1J8VA 3ZD8A 1WAZA 3H0EA 1F9EA 2FYTA 5LFAA 4J2HA 2DBVO 4ITRC 1F51A 3E03A 1LX6A 4E7OA 4YAWA 1WUJS 1ZNQO 4U0JA 4WZBE 2OYCA 4AXXA 4CMEA 4LCBA 4BFXA 3ZU3A 4NFYA 4TGLA 5KTMA 4UE3S 2H16A 1JIJA 2ZYTX 5B66Z 4B6OA 3ZE6A 4MGHA 3UT0A 2Z04A 2ODMA 1Q1GA 3C3KA 2BWJA 4MCAA 2XDYA 4TV8A 2GRJA 3H1EA 4ZYTA 5BQXA 3SIRA 4LC1A 3H86A 4Q4JA 4RF5A 4AI8A 7REQA 1XZDA 4NNJA 4TZTA 2WHQA 4EY4A 3B9PA 2WTNA 3AUUA 1B74A 3H2HA 5K0ZA 4DCNA 4GI7A 1T4GA 4BQPA 1GL9B 2XUZA 1JNYA 1NM5A 4KAFA 2J5RA 1T4BA 1XG5A 4X1IA 1VHLA 1MAHA 1NP3A 1PSWA 1DIOB 2VHJA 4J76A 2EQ5A 4B3FX 4PF1A 1TQDA 1Q20A 2BONA 4ER0A 3BJZA 2YHSA 2GZHA 1QU3A 3DEJA 4FUQA 3VH4A 4OA5A 1NLFA 2I1LA 3V8VA 2JK1A 3TTUA 1IZ9A 4HNHA 5K0GA 4B9EA 3DR3A 2RHBA 2XPCA 2WB2A 3UK0A 1ZA1A 4XRRA 3CZRA 821PA 1VGQA 2QPOA 4HDRA 4MCHA 4GXRA 1M66A 1BH6A 1D9ZA 3T7RA 2BVNA 4QTZA 2GD6A 3RYIB 1G5FA 1TM2A 2Q1WA 3UNXA 3NYIA 4TQFA 3GN1A 1JDZA 2WSLA 3IVAA 4L0QA 2J9RA 1WF6A 3CWBH 1ORRA 5K8CA 1VE5A 1ZD3A 4ARAA 3GQBA 4PYLA 1OPXA 1MZVA 1W5EA 3QTTA 4X7BA 1DDOA 4FOTA 5DCUA 5EZSA 4ZJUA 4ZZ1A 1P2FA 5C32A 1PJBA 2FW1A 3FYUC 1AKEA 1YVUA 3MJEA 3BBLA 2J7PA 3U49A 4RV9A 1P9OA 3BF7A 4M1MA 5DSXA 1WY7A 3AM5A 2P5YA 2QTSA 2NTEA 2DHQA 2ZSFA 3GPBA 1XNQO 2OQIA 1TEXA 2F43B 2YWJA 5AHOA 4JOBA 2OKGA 5HTOA 4AJNA 3NRCA 3MQFA 3A3NA 2IOFA 4QTUB 4CM8A 1WOYA 3G2QA 1KKCA 3MWJA 4MKFA 4YJGA 2GBFA 1N9GA 2C4KA 2O3KA 1KNXA 4IR7A 2C1EA 3OEWA 1EX1A 4O4LA 2Z6QA 3KPUA 2OAEA 3FBGA 1T10A 3F3YA 2EFGA 3GLKA 4WKCA 3QENA 1CRQA 3HKDB 4OH1A 5H59A 1D07A 1QQTA 2V7TA 3OZFA 1I4OA 4OXRA 3R6GA 2C54A 2QK4A 1ONPA 5EOVA 4AYWA 3QFRA 2I4IA 1E8DA 5F33A 1E58A 2ZPTX 4YV1A 3O7MA 2JHAA 1GL3A 1ZYUA 1S5LZ 5E4JA 1T6ZA 3MC1A 4Y6QA 4NMHA 1GPUA 3HR0A 1U5BB 4QEZA 4KDEA 5A5VA 2IBZH 3ONWA 4KVZA 2VQFB 4UTNA 1NMXA 3DEYX 4QG7A 1FLVA 1D7AA 3EK2A 3NTQA 4R2HA 1LC0A 3TQQA 1GG5A 3TOCA 1LZKA 3W5UA 2K4MA 3KEGA 5FYDA 1W8IA 2CLOB 5FUBA 3HO1A 2F3PA 2R7LA 3O38A 5H1YA 3UHAA 4KNYA 1RPRA 4B7CA 5AW2A 4A8JA 3LSYA 3D8RA 3HYCA 3A8TA 3QQPA 4DG8A 4XPZA 3R77A 1LX7A 3ZS9A 3TS1A 1FXKC 3GFGA 3OEED 1UBHS 4X90A 5HQTA 2Y4OA 4LXHA 1V3QE 2CFTA 1JDUA 3EPHA 4AX4A 3RAGA 4NH0A 4AQDA 1G60A 4GP7A 1VG8A 4NYMR 3R0IA 3QF7A 3DSQA 3C48A 4MW1A 1OI7A 2N1MA 3D81A 2EINB 4MDHA 3DS8A 1E0JA 1OBHA 2ETVA 1G8MA 4FFBB 4P38A 4ZVUA 1YASA 3H05A 5KDDA 1XTBA 3SYOA 5ALFA 1YJNV 2FX3A 1RVV1 4ZAZA 3AHJA 1SXHA 4HB0A 2QAGC 4JI0O 3SYPA 1RPTA 1X9HA 2GQ0A 1SFRA 3CCMV 1SXJD 2FFBA 4AQ7A 4D4LA 3ZJTA 1CBUA 4KRXA 3OHSX 3KZIZ 2VK1A 5I7AA 5JIBA 2P1RA 5EJ6A 3HBAA 4JVSB 5DFAA 4MUNA 4NJOA 5CBKA 4A0GA 2Y4UA 1VJ0A 1I13A 5AW1A 3ZPXA 1GILA 2V6JA 2C2WA 4MJLA 4DYVA 4YBZA 2ZAIA 1NVTA 3UAVA 2G4LA 1Z9BA 3DOIA 3LBYA 5A5FA 5EPUA 4OHKA 2X9GA 2KJQA 1BE1A 2JJYA 2Y6UA 4KQGA 2LUOA 3QEKA 1XA4A 2IOHA 3I2KA 2GCNA 4RZ2A 4BP3A 2IH3C 5GQSA 4D99A 4JKOA 3UGTA 3ELYA 5EXTA 1OY1A 4RAQA 2J32A 5E0OA 1ZL8B 2O2HA 4RD2A 3HYLA 3T3HA 4XYMA 3FKSG 4RSHA 4INOA 3H9QA 2GLUA 3FNHA 1VYTA 1YQUA 1KECA 2JL1A 2IGTA 3BGOS 2QJ1A 1NT2B 3RLIA 2NO7A 2C83A 4CG2A 4BWYA 1DFIA 3DDWA 3AY6A 2XVMA 3ZHBA 1GSIA 3RG2A 2P9CA 3CNBA 3R09A 3U39A 5F1YA 3RGBA 1JUDA 4EB0A 1PNOA 1H66A 1ECJA 2P69A 3WSVA 2H92A 4LRSB 5EPEA 3L8HA 4YMVA 5IE9A 2REQB 2ZJ3A 2XCSB 1U8UA 2NUAB 2WY2D 3JSAA 1CV2A 2B92A 2DYRB 2O8CB 4WY5A 1O9HA 4MYSA 3RUFA 1DLIA 2A3NA 2JGMA 4TLEA 2ASEA 4IQ8A 4DR3B 4BCDA 2XMPA 5HZHA 1VE1A 4JVLA 3B2EE 5FJJA 3BD7A 5AR1A 4FFNA 7MHTA 4LH6A 3FTCA 5E4TA 1O6BA 4QUEA 5FPHA 1FFDA 1M56B 1QORA 3FOBA 1HL7A 4QDKA 2XD9A 1IHOA 1W46A 1E2KA 1SHLA 4M1YA 5LSAA 4Q20A 4RZXA 1E5TA 1SG0A 1MB9A 4G9EA 3BOSA 4TZKA 2D2EA 4I1UA 3HUTA 2AJBA 4I08A 3PRYA 1VJ1A 4MQLA 4RFVA 1U97A 4QIHA 5CDHA 4OP3A 1NVUQ 1KIFA 2BM0A 3QEMB 3W9SA 2J48A 1E20A 1N75A 3CRNA 3GFPA 4KLCA 4NQZA 4G07A 1UPUA 4BTLA 1F8UA 1U6JA 1DBQA 1U7TA 1GGFA 4MQ5A 1IZ7A 1FVXA 1I0ZA 3A9UA 4HX5A 5CCBA 1IPHA 1SHKA 1GZSA 4JT9A 4R83A 2PA3A 4OX9B 3TIFA 2WG2A 1XILA 4XB2A 3NR2A 1TOAA 4KX3A 1BDHA 4RFSA 1DRKA 4WK4B 4RF4A 4F46A 2VDJA 2BFAA 1MZPA 1KQSU 1LUWA 1KOLA 3FETA 2A6PA 3G88A 4A0SA 3HCFA 1YZNA 3AF6A 4MV6A 3GLTA 4XOUA 2MSEB 2JRCA 2Q2VA 4V1CI 2V65A 2XUJA 4MUFA 1YAHA 3NALA 4JR0A 5KYXA 1JR3E 2WA1A 3N0XA 4WLOA 2ZYRA 2JASA 3WMXA 5DX8A 1M67A 2VDMB 2CH7B 4FGUA 5K8UA 2VH1A 2WBLC 5KKNB 1NMZA 1E1CB 1PR4A 3B52X 3VZCA 2QD3A 4MP6A 3W7TA 4HN9A 5EIFA 4CE6A 4HTFA 1H2BA 5GZ6A 3BZWA 5KIAA 1OHHG 4XSGA 3W5BA 5DULA 2CL0X 1CDDA 3EF0A 4J8PA 1DX9A 5IEJA 2AF4C 2ZIFA 4OSPA 4LJ9A 5J4LA 4JYZA 1YI1A 1ZNWA 1O94D 3AG5A 3R8CA 3EEIA 5HF5A 1WVGA 3KB2A 1JQDA 4AECA 2Y1XA 2X6AA 5DXFA 3LFUA 1EGVB 5C7IO 1DDGA 2NTJA 4AMUA 2BE3A 4AJPA 3DAPA 4A2QA 4YASA 4D57A 3RAPR 1BGXT 5IK2A 2IDJA 2CVQA 4HAYA 4HQLA 3X1DA 3I2JA 1ZNZA 5FOVA 5TT0A 1GO2A 3M70A 4AILC 1PFWA 4U4AA 3O65A 1AUXA 4TSFD 1QRRA 4DNOA 4EHHA 4KFRA 5C8YB 3SQNA 3DC6A 2N75A 3UJPA 2HMVA 2V58A 3LPDA 4DGQA 1CJCA 1I51A 3GH3A 5JZMA 5LA6A 3WLIA 3CMMA 1ZESA 2E0IA 1E59A 1R0LA 5KNBD 4ZDJA 3SHFA 6NULA 3TN7A 1R74A 4JSRA 5EYPA 5AVYA 3VPSA 2AHRA 1RI2A 1O97C 3WQQA 1U3UA 3OEHG 2O8BB 1MBZA 5LL6P 5D3QA 2YFKA 2EJUA 4KK4A 3LAWA 2WSYB 1NZ6A 4P08A 3U11A 3ED1A 4G0OA 4OHZA 2NVOA 4R4JA 2HJRA 4JI1B 2J3EA 5KEIA 5EJ5A 1NMEA 4KO3S 2XNDD 2V1UA 4X0EA 2R9RB 1X77A 1EGAA 4DHWA 4N39A 3B77A 2YVQA 3VPAA 1HKHA 1W2WB 2JHGA 1OCOC 3TQIA 1ILWA 3PFKA 1S4MA 3BY6A 1Y5RA 2ZZMA 3RK4A 3GYBA 2Z3GA 1QLWA 4C9BA 5LZ7A 2X4DA 4Y1FA 3WL7A 5DHPA 2EJ7A 2OOKA 3WGHA 3IQFA 4AKGA 1UXOA 1WA8B 3BVPA 3ZHXA 1HEUA 5KTKA 1DFGA 2IPAB 1NVFA 4PA4A 1N4CA 4R1NA 3EH2A 3D02A 4UNIA 4Y2UA 3RT1A 4IDNA 3IQZA 3B70A 3CNOA 1ZGBA 4I5IA 2XCTB 3P9SA 1VQ7V 5E3JA 3KKKA 4KO8A 3Q0IA 3STWA 3AIKA 4DCOA 4LCEA 3FPGA 3CW9A 1RNLA 1LBIA 5JV5A 1ZONA 2PE5A 3NTLA 4RENA 4J0DA 2RHJA 1EUDB 1P3Y1 4R40A 1N1EA 2RQ6A 4TVOA 3FHTA 4JX9A 2HXYA 1JQ0A 4JN6B 2AYYA 3G9XA 1QX3A 2ZDQA 4GZ5A 1C9EA 2FG5A 2J41A 3EW7A 4EFDA 2CXUA 2G5TA 1P0CA 4DXWA 1RSOA 2VHTA 2YZ7A 3E15A 2PT6A 3OIWA 1EFUA 3RD5A 2P68A 3AQ4A 3KZKA 4P7BA 1S2LA 2KQUA 2XDQA 2GK6A 1JTEA 1DAIA 1VIAA 1ST2A 621PA 1F2VA 3GNTA 3A9CA 1AK2A 1T8SA 1JHAA 3ZGOA 1T26A 2IHKA 1VCHA 4FM2A 3KTOA 4MDFA 2YN2A 4Q9JA 4BW5A 4DUYB 1CUBA 4P92A 2XBUA 4YRZA 1Y82A 5B12A 121PA 2ZATA 1QV9A 4FLZA 1Z3AA 5JBIA 3EISA 2ILMA 2B9VA 4EQ6B 1BHSA 5F2VO 4RKRA 3DFIA 3MWFA 4IH1A 3LDGA 4K0KO 3QBJA 4NABA 1KBOA 2EZTA 4E1VA 2PGDA 1M0SA 4NZZA 5HQ3B 4J80A 1LY1A 4B3HA 5CVCA 4NNOA 1KTIA 1W44A 4B2PA 5FNVB 5B5SA 3RS2A 3WFVA 5F73A 1KP3A 4AZSA 4DC0A 1WN7A 1QDUA 1Z2OX 4YXFA 2XT0A 3JX9A 2JIRA 2XBLA 4MVCA 4TKMA 4E07A 3NH6A 1SVWA 5HK9A 3A0UA 3M5PA 1ZLXA 3H65A 4YECA 5JWHA 4WFFA 1E1QG 5A3SA 4L4XA 3AW8A 2CXRA 5K99A 4BO3A 2A7WA 1DT5A 4BLWA 2Q5ZA 3GEMA 1NDQA 5GP1A 3KJQA 2WHPB 4Y2QA 3UQZA 4DUGD 3SJCC 2MSNA 1N25A 3FB4A 3ZNOA 3R9XB 3ZCVA 1IY1A 1EP2B 1WDTA 4AURA 3K9SA 5EWJA 1Y9JA 4YRDA 1TYEB 3OJXA 2XUMA 1LW7A 3GFQA 2XQVA 3S40A 3H87A 5TMBA 1WD5A 4XXHA 3M82A 3UYLA 4EJSC 2QVZX 1V8DA 3UJDA 6YASA 2OZPA 2R6AA 2PJUA 4HKTA 2DLDA 4U2CA 1FW8A 4BS9A 1X8XA 1I7SB 1MO5A 9ATCA 4ZYWA 4IYJA 1WPQA 3RAEC 5IJ0A 5F2OA 2FYUH 3DHVA 1SBIA 3KZOA 4JGGA 4HNTA 3M7MX 4DQ0A 1NXWA 3E3LA 4J0FA 2B8EA 3NBKA 4BGEA 2P6JA 1Q7CA 1KWKA 3K4PA 1QO0A 3J7AC 2QVGA 3PN1A 3FY4A 5LHIA 4RLHA 4B5LA 3FYSA 4J0IA 1SCNE 3KR2A 3OE7A 4XQCA 5KYUA 1N4AA 1PLJA 1NVMB 4TTAA 2GCOA 5CYFA 5F23A 1PN3A 1VKHA 4HRVA 5MFZA 1U2DC 3N8DA 4KEAA 1FDVA 2BFEA 2ZNVA 3IBGA 4N21A 2L19A 5E1OA 4CCWA 4EO4A 4NYMQ 3G8DA 1L5VA 2JBHA 1P81A 3ZC3A 3CCFA 1S5JA 4OXNA 4H37A 2V6MA 4FC6A 1ZP6A 1IY2A 2OYRA 2JDIG 4Q7LA 4EGQA 4DKJA 4FMTA 2ZSHA 1C4WA 3OEEA 1EX6A 4UEOA 2Y1GA 5IAJA 2AMLA 2CEAA 5ERXA 3AG1C 2ZSEA 1R18A 4FZVA 5EZYB 2FHPA 3DM5A 3GAAA 3KKYA 4CIBA 1K73W 4QVIA 3G0BA 2JEXA 2QWPB 4ZVOA 2E7ZA 3DL7A 4HDSB 5EN4A 4AROA 1Q6IA 3DOCA 1N5DA 2YOHA 5JASA 3CEPB 1SBHA 4XFDA 4DZTA 2VT2A 2QI9F 3ZY4A 2P5SA 2Q5CA 5K20A 1AQNA 5IJ9B 4N47A 1KTVA 4R8RA 4CQLB 3CBGA 2WICA 4NAVA 4XUDA 4EB3A 2G5PA 1PGQA 3ONNA 4Q7EA 2ABWA 4CF5A 3NX4A 4PELA 1U0LA 3BORA 2BUAA 2C4MA 2ILVA 5LXTA 1B2RA 2YVAA 1QRSA 5ILGA 3F90A 3I30X 2C98A 4BW9A 2XCLA 3KJFA 5JARA 2ARHA 1ZUHA 4G1EB 1RAAA 4EFBA 2R6DA 3CNEA 1DAKA 3GQVA 5I7RA 5BWNA 2I2BA 2ZSJA 4LE0A 5EKDA 1B26A 3CZPA 1VQ9V 3TQTA 3K9LA 5COBA 4ARZB 5ALJA 2AR0A 2CDAA 1HDXA 2EQAA 1Q2XA 2DPLA 3SEFA 1VBMA 1P2TA 2UZAA 1RQ2A 4UVGA 2ZE8A 3K5OA 4YI3A 2ZKIA 2AA3A 3IE1A 2NP7A 5JU6A 2X8AA 2O14A 1NV9A 4KWCA 1FDTA 3SGIA 2JLVA 1V1RB 2I3AA 1NUTA 4RPHA 3PNOA 4Q47A 1VLZA 1MOFA 3OURA 1H2YA 4WXMA 3SICE 1RXSA 4W6ZA 2D06A 3MVEA 2AQKA 1SU4A 4S0ZA 4YAOA 3P7MA 1ZRSA 2IFTA 1RS0A 3LY8A 5EAIA 4IX9A 2BBWA 1SBQA 2GRAA 4O29A 2VL7A 2DW4A 2JKZA 3SXJA 5C8YF 4DW1A 2FEXA 4R41A 1C3XA 4CTMA 2WUDA 3SR3A 5BNIA 2W93A 3RYTC 1I10A 3G7NA 1FXSA 3OIVA 3PXEA 4D3SA 4WBXC 3FNGA 4HR7A 3C1AA 1E62A 4G5RA 2M6SA 2XSZA 1EHCA 4OX9Y 1C8LA 5JOQA 5FB3A 4KQEA 2GBGA 3FOEC 1D03A 1PL7A 2ZYHA 3ANXA 3H6HA 3OPYB 4CUKA 3VHXA 5FO1A 1YTFD 3L72H 1J5XA 3H1KH 1L8XA 4H3SA 4DMCA 1JIUA 4BVEA 2K7FA 3QFHA 1ZGGA 4BAUA 2CNBA 4RWZA 1NJFA 2YQ4A 3TE6A 1M8KA 1UEJA 4P84A 2I7DA 2G83A 4UU1A 4UDOA 1H9CA 4G0ZA 2QL5A 2O6LA 1QGED 3K3PA 5LQDA 2ODEA 1STOA 5BNFA 1Z6QA 2G8LA 4M21A 1GUFA 1VI2A 4W1SA 2O5VA 2R0QC 1VC2A 2AQ8A 2YZKA 5U4QA 3IVGA 4HZGA 1M2KA 3QVVA 1ZTEA 4ZOQI 4GL2A 3DNFA 4NR1A 2XNHA 3GX1A 3W5HA 2I6SA 2I7XA 1I33A 2BE7A 5M3BA 1FFHA 5AXDA 4FMPA 4K9RA 1TPZA 2FH5B 4BYMA 3M83A 2MYTA 4GM0A 5CPFA 5DB4A 2A0WA 4CBCA 3RHSA 2QUJA 4NMWA 4GR4A 2PTMA 2R5FA 2WJVA 1X0XA 4XH9B 4NECA 3BGSA 3ZIUA 2UUPA 4JUAA 4Q4LA 3U62A 4UUQA 2KKWA 1A50B 2NNLD 2Y05A 1Z6TA 4EPYA 3P9ZA 2W4QA 3QBVA 1U3VA 3OZEA 1ZW1A 4I8XA 4XIFA 2RPZA 3SFVA 4H0NA 4C01A 1OCCC 4I1VA 2RCVA 4LXUA 4OLJA 3DR5A 4DUYO 4H3HB 4EUEA 3LNNA 3BIOA 4GLFA 2W6CX 3HB0A 3S44A 4I5SA 3L7MA 1K75A 1TM5E 1YONA 4DSUA 1JQKA 3RUIA 3AXTA 1EFRD 4RKQA 5FV7A 1J21A 4RA9B 1LWOA 2EX3A 4DR6O 1YZHA 2A5YB 1C2TA 1B15A 3WGGA 4ZVTA 2FZCA 4MVZA 1TM7E 5C3MA 5A4DA 5AG2A 1GXSB 1RYYA 3PHLA 5C37A 1LA2A 1ZBDA 3ECAA 3WAKA 3FCYA 3LGAA 5A3VA 4YXWD 4CT0A 2C42A 2GUGA 1CRZA 2OBNA 1SQGA 3IAS1 4TTSA 3FZGA 3UOGA 4B6GA 3LL7A 2IE0A 2IHBA 2HM7A 3ZIAA 2CYCA 3VV2A 3LQ4A 3WNBA 2HA7A 4PIMA 3KOMA 3OD4A 1UK8A 1YDWA 2BMVA 4WPGA 1AGYA 1KA9H 1KEEB 1AGPA 1A7JA 3G7UA 3VH3A 1KHTA 1U90A 2HYIC 2PUBA 1CX9B 2IZZA 4XYEA 2R60A 4PZDA 2QL6A 3Q2OA 5C7OO 5BN4A 3T95A 5ITVA 3H1TA 2HT1A 5E4FA 2CVPA 4NEQA 4XD7A 3PLAE 1K63A 2KCQA 2OD2A 3WLJA 4IFIA 1MLDA 1U2RA 3KAJA 3TG8A 1YRQA 1H4SA 2X5OA 5FNVF 5F1OA 5AESA 3F67A 2DBZA 1I2MA 2V7WA 4LGVA 2BHTA 3FBTA 4NU5A 4G3MA 4OWPA 3E18A 3N2IA 3MMZA 2OVBA 2WLSA 1SBZA 1VHTA 2XZDA 1FYVA 1T9GR 4XAQA 3M4ZA 3DAFA 1FXWA 1QTNA 2GSDA 3TCNA 2P30A 2UZ3A 4BO6A 5DF1A 3NBQA 4R2WA 4U7OA 3COWA 3NDRA 2RNBA 2P0EA 4CM4A 3CLKA 3DEHA 5KNBA 4ZOLA 1XKLA 5A9RA 3V34A 1RZVA 4LRWA 2RD2A 2XTZA 1PEYA 5FPRA 3RJTA 1U9YA 3YASA 4FSXA 1EWQA 1FY2A 4JZKA 2ISQA 4EKGA 4M2LA 1XHZA 1UMCB 3FCEA 1OX5A 4GOXA 1IUKA 2VWHA 4WKPA 4XB1A 1IWBB 1Z22A 1KO8A 5DGCA 3GA7A 4U2FA 2N42A 2FDXA 3GJ3A 3FDIA 3IP3A 3LYLA 2XNDA 3DYBA 4I9HA 4CMIB 4EHAA 3GFBA 2YR0A 1XZQA 2PFSA 2VSOA 4WXRA 4OP1A 4I6GA 2C3MA 5LBUA 2MSLA 2PKWA 4O4IB 1CNFA 2XUHA 3JYLA 4Y1EA 5LDHA 3IC5A 4LG1A 4ILKA 3K70C 1E2HA 4F4FA 3LCVB 3ID6C 3NH9A 2QF7A 4HYOA 5JJKA 3RUPA 2R8PA 1UPCA 4Q1CA 4P0PB 4CG1A 5EKUA 3S7ZA 3S2GA 5H8WA 4JA0A 4P8RA 4CV2A 1P31A 1E3WA 3CSXA 4Y2YA 1E5LA 1R6KA 2UAGA 1ZUNA 3D6FA 2XXBA 3E9QA 2BR5A 1R3IC 3WGMA 3GDOA 3ORSA 2CEKA 1CRWG 2XB9A 4LOHA 2VDPB 4OB7A 1Z5OA 2BCCH 4B83A 3SSNA 1SBNE 5EI5A 2SNIE 5LQUA 4NZ9A 4WQMA 3SD7A 3O91A 1VIYA 2IYXA 2P79A 3ZTWA 5FFMA 1Q5OA 5K2OA 3EAFA 2YUIA 1UBNA 4LOKA 4NBRA 4GT1A 1V5IA 3JQPA 4U2BA 2C77A 1NUQA 4U6NA 2V6GA 4MQFB 4X1OA 3FLEA 5FI3A 3UCEA 2WLMA 5I45A 5EZYF 3RKRA 3ML0A 4AP9A 1GG2A 3NWJA 1XTQA 3O2SB 1WXWA 3PZBA 1LR1A 2AI2A 3ZK8A 4LBVA 1RYDA 3BPSA 4B6SA 2WJZB 4WACA 1Y34E 4CG0A 4DAEA 5CXUA 2PJZA 3COYA 4DJTA 2MSWA 1OBCA 1U3GA 2OV4A 1DFHA 4MOWA 1RJFA 5I7VA 1GZUA 2OO5A 3CVYA 2XT9A 3FOAA 1KY2A 2VTEA 4BNWA 5AW5A 3G1WA 1AO0A 3PUXA 3DBRA 5BNWA 4U2DA 4L5CA 1GPKA 3L04A 1QK3A 4CEHB 3E9DA 2VZ0A 4NDNE 9MHTA 3TGWA 2DTEA 2NTNA 5I47A 2V3CC 1G9XA 1P7GA 1UFKA 2VK4A 3NAGA 1ZFNA 4BO7A 3RC1A 3FVTA 1AN0A 3CCQV 3FYDA 1NJGA 3CVOA 1R4MB 2X86A 2KI5A 2YYSA 3TPFA 5CFPA 1CF4A 2OY0A 4F06A 4UFNA 2P2NA 4PDMA 4JAVA 1NC3A 1TIPA 5EQJB 2IQIA 3D7KA 1C1YA 2EDAA 4RORA 1E32A 4BNLA 3TLBA 5AVTA 5EJFA 1I0LA 3SZOA 4G23A 4ESOA 1RXIA 4B0OA 3LGXA 3Q0EA 4FT2A 3HP1A 1WF3A 2I6QA 4M4SA 4GQBA 2GJSA 1YK1A 3ETHA 8ABPA 4QPJC 4BFZA 1WSDA 5J2UB 2QSYA 1WS6A 1PGPA 1EAYA 3IDOA 1KBQA 4V0KA 3TIVA 2WAXA 4MMZB 4C21A 1GADO 3KWFA 4LHXA 3PQ5A 1Y6XA 1T1IA 1NLMA 4Q3DA 4YT5A 2G09A 3ZNQA 5EP4A 1VL0A 4YUXA 2RCNA 2R751 3WNDA 3KQPA 1OGJA 1PL6A 5GTIZ 3ROXA 3K9CA 4G8BA 3RYCA 1V39A 3OZUA 1BL8A 4G8DA 4EKIA 4Q9KA 1K33A 4X20B 1XNRO 1NN5A 2B9EA 3FPFA 4GKVA 3MPOA 3ZK9A 4QBIA 2XYHA 3UAXA 1FTQA 1C7QA 1IM8A 2ZETA 3T1TA 3FSGD 5CJPA 2H9YA 4HAUA 2RHHA 2G82A 1KAGA 4N5IX 4LE1A 1PNKA 4UHDA 4E0BA 3B2NA 1OI4A 3ZTYA 1FXUA 4EYKA 4ZO4A 4NPAA 2JG3A 1X7ZB 2GM5A 3OX2A 4NQLA 2VUTA 2VHXA 3DJFA 5FLXA 1HOTA 3NC0C 2MYNA 3J80N 1YS7A 3ABSB 2Q7XA 3GGDA 4ETIA 1NXSA 2XRYA 2DECA 2R1TA 5BN5B 2UXNA 2FEPA 1Z88A 1GP2A 2F43G 1FQWA 1JKIA 2CTRA 3H5NA 1ULUA 2ZW9A 3N6VA 5KNDA 4IVPA 1FRVA 2ZSKA 4TL9A 3TQCA 2WPDG 2H3EA 3X2QB 2WYHA 1C0KA 1QIMA 4OG2A 4P5DA 2WLTA 2O3SA 1RM1B 3BRSA 2O7NA 3OFVA 1SQVH 3PUYA 5JQGA 3ZKAA 4RS3A 4C4SA 2NYVA 2FQ1A 3IT0A 3ETNA 5H2FZ 1BE0A 3H4MA 3STZC 2ZJ5A 3L6EA 5AVZA 4KQJA 3HS3A 4M1TA 3RU2A 4RH3A 1L7DA 1SA0A 2VRBA 1CUZA 3P0EA 3SC2A 4Z54A 3TOXA 3VO8A 1TO6A 1J0BA 4YUWA 4W5OA 5C4MA 2PX3A 4HNAA 3CRZA 3VYRB 4D46A 1W5SA 4JXEA 2YZNA 4PIVA 1IEXA 1ZY2A 2VYVD 5C5DA 5LBTA 2FOLA 3O8BA 4ZO7A 1NR5A 2Y69B 4JD5A 3KLNA 3Q85A 3U44B 1BG6A 1W59A 3IOCA 1EWTA 3M9XA 1QHSA 3D0KA 1IWOA 2C3UA 5JXJA 4EJFA 3R5KA 2HQOA 1Y66A 2MINA 4A8HA 3ZLUA 3H2SA 5CVUA 2QQFA 2ISCA 3VOBA 5K6RA 1K89A 4OMUA 4CEIB 2PZBA 5A3RA 2PUAA 1BD4A 2NX8A 3IBSA 4NHEA 4KBFA 1JA0A 2WYVA 4YJ2A 3LU1A 1NF2A 4EQZA 3FFXA 1FP4B 1LTHR 4MKIA 4FS3A 4K40A 2J46A 2GA8A 1Z2CA 5DDIP 4BJ6A 3RC7A 2P2YA 2ZBGA 5FUQA 2FK7A 1N3YA 1U28A 4WNAB 1WWRA 1V7CA 5FI1B 2O2GA 3RUHA 3SEQA 4U9UA 3Q3JB 3JARB 4Q16A 2UZIR 3EHEA 1QB8A 3CKMA 2CJFA 3SYMA 3M3PA 4JBHA 5SY9A 3ANTA 1E0AA 2HCBA 2M7WA 5LIRA 1OFUA 3GPIA 2BKXA 1NBIA 3JAKB 4JI3O 3BFJA 3K0CA 4NBKA 3EOBI 1O97D 2H1WA 4CF3A 2Q4EA 4CM3A 4HWSA 4HJRA 4KL1A 3TJRA 1LI7A 1TTPB 3JATB 3EVKA 1AXEA 2GBLA 5K0EA 3T94A 1I1QB 1U8FO 4MH0R 4M83A 1JWBB 3ROPA 3FN4A 4PLVA 4RZQA 1JPJA 1JTKA 2VPYA 4ZAFA 2ZRHA 1QQCA 3FZQA 2INGX 4U5QA 3ENWA 3PL1A 2FMKA 3ANLA 5CLQA 3NYWA 1HW7A 1N6OA 5KYYB 1W85A 4MKZA 3HCDA 4LXIA 3COZA 2UVPA 3OAAA 1UKCA 2QZPA 2VVTA 4EZBA 4OCMB 3QUCA 4OSEA 3A0RB 4FFSA 3H2IA 1H1LB 5MHTA 2WZQA 4J7XA 3KLBA 4BMDA 3B6MA 4ND6A 3ONEA 5HBGA 1XFAA 5BP7A 1R0SA 1XB2A 2BGUA 4ZV9A 4L0CA 3ZOKA 4GZ3A 1XJ5A 5BY1A 3L8MA 4O4IF 3LDHA 1V55B 1YZKA 4GWLA 4AW9A 2NU7A 2HRBA 4NXMO 3PX3A 5EP3A 2B2XA 3ND6A 4F3CA 3DFMA 1JL3A 3VR6A 3V7WA 1PU2A 3CY6A 1FXVA 3WJ1A 4QYMA 5CAEB 3NCTA 5IBQA 5CGZA 3HA2A 4LV5B 3JALA 1P7BA 1XBTA 2XB2A 2WLKA 2Z8YA 2BGTA 5DBGA 2DUWA 5A2QN 4I55B 4DK0A 4OBWA 3UKDA 4AG3A 4RAOA 1JI3A 2I78A 1DAPA 3S70A 4BQSA 1JPNA 3E5NA 1QKKA 2BGLA 1I8TA 5K4AA 1PTJC 1J70A 1Z45A 3GPCA 2OXCA 1YE3A 2HV8A 3EQ8A 3ZHYA 4PZEA 2WF8A 4XJTA 1TEHA 1LDEA 4YAKA 5JY6A 1KI2A 4CWAA 2ZIXA 1G64A 5DO9A 5CYGA 2MDTA 1YU6A 4XIGS 5KKAA 3FTQA 1SAYA 3HE3A 1MX3A 4G9GA 4Z1MA 2Z4RA 1WHSB 1J06A 3MT8A 1KEVA 4H16A 4P30A 1WY5A 1JJAA 2B4YA 3KXLA 4IL5A 3L0SA 4H1TA 5K01A 4BYGA 5T8KC 3EXFA 1QXSA 3ETJA 4HRQA 1UK7A 4S0XA 5DNYB 3QV2A 1ZC4A 4DMMA 1U98A 2GD0A 1PEKE 4JTDB 3D54D 1BKYA 2A1UA 1C4OA 4EG2A 3SQXA 4UEJA 3SSOA 2XMCA 3C4QA 3NBMA 3AXSA 2RGNC 2DOKA 3HUUA 1U4NA 3U4MA 4JEMA 3SIPA 1QO7A 5TMPA 1JH9A 5IUJC 2AH5A 5JAOA 4OQDA 3FFTA 1Q7TA 3AF5A 4C2TA 3IB6A 4E15A 3N8GA 4WBNA 4Y6PA 2O06A 3LLCA 2YWHA 2Z8YM 5HJ7A 2BKVA 1G4AE 5D7BA 1K3UB 4FCCA 5FPKA 1X1SA 3QVKA 4JTAB 2QZZA 3G79A 3KQOA 5WRFA 4BO2A 4Y9RA 3R40A 1N5LA 2EP5A 2Q3JA 4YAEA 2J0SA 4V0OA 4EEXA 1HC7A 1GR1A 3OX3A 5DKFA 3GPLA 1BA3A 3T41A 1Y48E 1MABA 4UAVA 1REQB 3L6BA 4QZVA 4XGIA 4LVCA 1YL5A 5AHRA 2IS2A 3ENZA 3OZCA 4Z51A 1R8YA 3LP6A 1QNLA 4FP9A 4QJ4A 4D8WA 3FB7C 4A5UB 3EA4A 3WX0A 4P98A 3DXRA 2GN2A 4M60A 1IFXA 3F74A 3A6PC 5E6SB 1V11B 3N9IA 2OVFA 5JXWA 2A30A 1X92A 3RUEA 1DEXA 3VU0A 1HP8A 5ELLA 5J2UF 2Y9PB 3TZBA 1LDYA 2O48X 2W7TA 1X13A 1GPLA 1NSYA 2JH3A 4URXR 3I2FA 2W6MA 1DQZA 4RXMA 4DV0O 1ONNA 3EPJA 4N41A 4A2WA 5DGXA 3GOQA 4PZCA 5DSTA 4FDLA 1CS0A 3NUZA 2FZKA 1H8EA 4FD2A 2W83A 1OKKD 4Q3BA 1H0HA 2H29A 1KH2A 4TKZA 4K0KB 5DN9A 4M54A 4R9SA 4TSKA 4FNGA 1T4DA 3ZR4B 1ONOA 4KYTA 2G67A 2O5CA 4YHHO 1ODKA 4BMSA 3BAAA 1EX7A 3QMWA 2B6NA 5AT1A 1OC2A 2BDUA 2F23A 1IHDA 4MS1B 3EIQA 4KR9A 1GA6A 2ZWIA 2C2ZA 2UVQA 2FEAA 1HFEL 4TTVA 2PPVA 1EM8B 1F48A 2X0JA 2GTIA 4V3BA 1I3LA 1A88A 1PJ3A 1QVAA 4MYCA 3GGPA 1B3QA 1S89A 1KWGA 4FLWA 2OL4A 3G0CA 1Z5NA 3IB3A 4TKUA 3E86A 1M2OB 1KJJA 1Y6JA 2Z08A 2HJVA 1UDBA 3JVEA 4DJAA 4G6ZA 5A1TA 1TFUA 3JWJA 4KSBA 2YEVB 2PWZA 5EMMA 3EN0A 3JASA 1SVLA 3FUWA 2IF0A 1KYWA 4Q1DA 4X3PA 4BKOA 5DX1A 3EGDA 3O74A 1ORVA 1VZ3A 4MS3A 2D5LA 3IKVA 3WOHA 4NIMA 3MCUA 3SZMA 3CS3A 1NTRA 3OHMA 2JARA 5EC2C 2OC4A 1V54C 2FUG6 4Q4HB 5CBHA 5DBFA 2YY6A 2V0CA 4QG3A 3IR5A 2XLBA 1NBMD 5E8RA 4MAAA 3CPWU 4YLEA 4O1IA 2GJ4A 2FR8C 4PRLA 4N3AA 1W47A 2X23A 4ABTA 4UM8B 3N0RA 3MGKA 3C43A 1F4MA 1CJKC 3SPGA 1N92A 3WNQA 1VL2A 3BMNA 4BGDC 3COVA 2PVPA 1T8UA 4RKFA 1UWZA 4LJ6A 2HEIA 2VXOA 3MT9A 4S24A 1DINA 4W7SA 3UW3A 2ORYA 2EBUA 4BQRA 3TSCA 3MRTA 1JAZA 2QKYA 4PIPA 2KG7A 3W8RA 3LKZA 1ZG3A 4OD0A 3I5UA 3IVXA 1WE2A 1PZXA 4XVRA 4I5GA 2CKMA 2JHCA 3A3KA 1MFPA 4D9FA 4DS3A 3OJFA 1QU7A 3AG2B 3UA3A 4M1EA 4B3MO 3RRNA 4YRCA 2B2NA 5AKXA 4PHFA 2HTFA 1AK9A 4KAAA 3QBDA 4H2DA 3F1LA 1W0KD 3AEKB 4IWNA 1W36B 2RHTA 5JJ5A 3ACCA 3R6TA 1VMEA 3WQHA 2QYTA 4YCAA 4GPZA 4QFMA 4QGHA 1IDN1 1NJIW 3H13A 3QWAA 3CW8X 4MLZA 3ZWQA 3ZWNA 5IP5A 5C1OA 3THXA 2IDKA 1O58A 5LM3A 4QQFA 5T4FA 3ZMUA 1L9KA 2P9FA 4WVLA 2NACA 4PVDA 4UU7A 4RNCA 2YNMA 3AH8A 4EA9A 1R6AA 2HJSA 2NXEA 5KYWB 3Q5GA 3E2MA 1JYFA 4KKVA 1GTJ1 3K0FA 2Q0AA 4LKOA 4TWRA 3MW8A 1BJTA 3IV9A 3KJXA 1KI6B 4FFRA 3PI7A 2IM9A 3CRW1 3N2KA 2OFWA 2AGVA 5BMVB 1K27A 5AICA 1L5SA 1YBFA 2OP1A 3PDIA 1ZD2P 2CTWA 4B9AA 2EEZA 4P53A 4O8YA 3WGNA 3LDCA 2FP4A 3ICXA 3F0TA 1D8TA 3FSGA 5B6PA 3KEMA 4MW3A 2VCYA 4ZICA 3DV0A 3HU5A 5GIOE 2XKKA 3T54A 5G1OA 3B3JA 4GBGA 1J4AA 1SD1A 3B6KA 3WIDA 1M1UA 2D2IA 1JILA 1MPXA 3JSXA 4CC5A 1DJLA 1DUSA 4L95C 4R5MA 3RTGA 2PAFA 2DYSC 5AVKA 1UIRA 5AI6A 5HJ2A 2JGNA 5EJ7A 4WXEA 4A6EA 1PG2A 2PGLA 4FLUA 5AVWA 2F1OA 2FSHA 1CB0A 2Q41A 3AI1A 4DW8A 3VZSA 1XEQA 4PTLA 3GMIA 1XL4A 4U3JA 3I5DA 1YE5A 1FPQA 2C2BA 3ABTA 3GMTA 3NPMA 1U1FA 2E9SA 4UULA 3EYWA 3O8RA 1FJXA 3F4KA 2GFHA 3AG6A 3VQWA 4GWGA 1PGNA 3HWWA 1NJ2A 3KYBA 1AZSC 4KLRA 4CH6A 1PGJA 4G0PA 1YZBA 1Z28A 2QU8A 4HGYA 5CFZA 1I5EA 2FJ0A 1JG4A 1Z4LA 2QLTA 3LO5A 5J5AA 2ORED 4LBYA 4EHIA 2GXQA 3FPCA 3ZV7A 3I3OA 2PH3A 3QF4A 4D4MA 5AUQA 1UR5A 4I55F 5JSQA 1CDOA 3PWSA 1HO3A 4PSDA 3LUKA 1R4AA 3OMWA 4GM1A 1SHZA 1DCMA 2BI7A 2Q67A 5CVTA 2P78A 2XBMA 3GVXA 1K0UA 3DDSA 1I2CA 2PUWA 3CF6R 4GIBA 2XLCA 2QXUA 2QP3A 4HBZA 3OOEA 1LS1A 4KVGA 1MTOA 2J3DA 1PDVA 3UCSC 2WUEA 1TYCA 4X92A 3LVRE 6GPBA 5H83A 3ES9A 4BNMA 4C0HA 2M6KA 4I4LA 1F2UB 3D3WA 2FSVC 3LUBA 1OPRA 3I32A 2ZUEA 2RGWA 4ZTUB 1R0ZA 2RARA 1WZCA 1KBHA 2M1XA 5EERA 4ZVQA 4PO3X 2VNSA 4TT3G 3H6GA 1DG1G 2VR1A 3CCVV 5HPYB 4R01A 1X74A 3J7AU 1Z4KA 1JG3A 3WE7A 5BYKA 3VJRA 2WW8A 3E9MA 2QTBA 4EAQA 4POAA 1Q7GA 5JNRA 3I56V 2WLIA 1XD9A 2EX4A 3BN3A 4OK5A 1CLEA 2N74A 4EH1A 3HBNA 4CTNA 1M93A 2G6BA 2HA0A 3EY4A 1OIWA 2ZQYA 1MJFA 2DU8A 2VKTA 1KYVA 4EB6A 4RGBA 4MEAA 4NCAA 5AKHA 3AERB 4WDRA 4MXDA 5CXQA 3U0VA 5B58C 4AMBA 3CH4B 2IYOA 3V1YA 3RTCA 4ZT4A 3T7TA 1GKKA 3GLQA 3UA4A 1PM9A 1CR1A 2MSDB 1CTQA 3E8XA 3R20A 3CUEF 2AZMA 1GYRA 1NHGA 5F21A 1UC4B 2QY6A 4F60A 1GM7A 4HV4A 3LGSA 4DR6B 1XHEA 2KYRA 3MBOA 1Z37A 2VJKA 3WMFA 4UOZA 5JTTA 3TDKA 4ZC1A 1O0CA 2A1TS 1E9DA 3OQJA 5TE9A 4RY0A 3WIOA 1Y4SA 1M7BA 2KLHA 1PJRA 3CZ4A 4AJ2A 1WMEA 2HRCA 3AL3A 3VTKA 2DY0A 2YVKA 1QX4A 3ZMVA 2VRZA 1K5GA 2I7TA 3AB3A 4GRDA 3LT4A 2DETA 1G5HA 1Y3FE 2I3ZA 3PPIA 3IOBA 4YO7A 1LUAA 4GI2A 3LDFA 2QA4V 2RB5A 1HRKA 1ZCJA 3FTFA 1BW9A 5BRAA 3MTQA 3H9JA 1OV9A 1T2VA 3SPJA 1A9QA 2ZWPA 5C51B 1WDWB 1N32O 4QOGA 4CM1A 1GLGA 3K70D 2RH5A 4ACAA 2N46A 3U31A 4Z9AA 1Q86W 1W7AA 3Q4HA 1RCTE 1J23A 2ATCA 2X0DA 1XTVA 4DY6A 1FDOA 4KHPO 1FX0A 2FLKA 5K9ZA 3ZXUB 2Z3ZA 3WJ2A 1B0ZA 4TMTA 4FX5A 1EVIA 2HJWA 5TDHA 4CT4B 1IK4A 5BURA 3ER9A 2PI5A 1AJEA 2Q9BA 2RGXA 4IXMA 1HYBA 4RVSA 1YMQA 3M9LA 1T2EA 4OLFA 4J07A 2HA5A 4RYLA 4H7DA 4UNRA 4O3MA 1I5RA 2ERXA 2WIBA 3OKCA 3MSXA 2YY5A 3NTVA 5BSMA 2BP7B 1CW2B 2C5FA 2QN3A 1IBMO 1A8SA 1JZQA 3ZWVA 5B7PA 6PFKA 3AESB 3HR8A 1GFZA 4OOFA 1RHMA 5CVJA 2ZJYA 3PNPA 1G3MA 4D9EA 3T34A 3W9YA 2BFWA 2AN4A 1XZ8A 1KY3A 3GZNA 1SS3A 1F4NA 2XNKA 4UNPA 2N47A 3CLUC 2CL6X 2XJ9A 3N58A 3EZLA 2CVZA 1H8HD 2OHFA 2AVNA 3SLRA 3MGGA 3KBOA 3UG6A 3CRVA 1M34A 3NIFB 4PLZA 3KE9A 3MGCA 5DCYA 1RWNA 1GRCA 2VSQA 5EIAA 2XUQA 3RVMA 4OUDA 2QT9A 4X93A 2DR3A 3H6KA 4ODIA 3DZIA 2ZUUA 1EXNA 2BRUC 1OH8A 1RYEA 1M1YA 1UANA 2C7QA 5KVAA 5BSKA 3G2IA 2PV0A 4QHTA 4OFZA 2JEUA 2O0JA 4FJ0A 2J6IA 1XMIA 4IILA 2QTAA 1H38A 1SUPA 3GJYA 1NL3A 2HH9A 2CHQA 3HH8A 1JU9A 5L3CA 4YIPA 3TZEA 3PC4A 5FBKA 1RWOA 5E7JA 4ZI5A 1SUFA 1Z38A 2HSWA 3I72A 1O89A 1QH9A 3R7FA 1FSSA 1U9IA 2VEOA 1XWWA 1D1QA 4BX3A 5JH7A 2PFKA 3DL4A 1VBNA 2RBEA 2IIBA 2M98A 4IGAA 3AI7A 3KD2A 1ML3A 2YIDA 3A3YA 3ZV6A 1SXJA 1I7LA 4AY6A 5ITSA 4YROA 3ZHRA 1CZLA 1JJ7A 3R0ZA 5LWHA 3VX3A 1K4CC 4K35A 2WLLA 3L7BA 3D36C 3RU3A 1X2BA 3LWDA 2XEXA 1P84F 1HT1E 4W7IA 2YS8A 1D4OA 4FEGA 2QJTA 1MH1A 3VNSA 1BGYH 1SHUX 3DB1A 3BREA 1GNSA 2OM2A 2ZR7A 4KXVA 3IRUA 1OX6A 3MUFA 2JB9A 4F71A 3LQQA 2YIJA 4N7JA 3WDMA 3QGMA 4KH0A 4F3TA 1LH0A 2A9JA 2CUTA 3PITA 1EFLA 2BFBA 4EF4A 3TIXB 1BVUA 1WPBA 4X3CA 4DHEA 1KIMA 3H4TA 4HS9A 2Y0BA 1J42A 3ONFA 5JNSA 1DAOA 1P4GA 2REBA 2IHTA 1COZA 2JGDB 1YU9A 4RE5A 3HKBB 1AR1B 3G2MA 5F2KA 4DG9A 2FKAA 1ODCA 4G2TA 4IDDA 4M0PA 3IAFA 2B94A 4P4GA 5ICCA 3U4CA 2WAOA 1AQ6A 3V9PA 3TBFA 1E2FA 4TMYA 3OSZA 2R68A 5BMVF 5LD2B 2IYFA 1OBVA 1NG9A 1QCEA 5TMEA 4EARA 4CS3A 2HA3A 4TM7A 3AUKA 5IC6A 3SEZA 3DTYA 1GGEA 1U2DA 4FBLA 2J0UB 4NMXB 3FVVA 1U0FA 2Q6VA 2QG4A 3L93A 2WJPA 1EAMA 4Q9HA 2C0QA 3L4BC 1ULZA 1VE3A 4J7KA 3MHHC 5C5CA 5DOZA 1ZUD1 3QLUC 3EWNA 5KHKA 1EI9A 1BYUA 4NCXA 3A11A 2IKSA 4J4TA 5IC4A 1T2AA 5KO2A 1BDMA 3B1ZA 4LI3X 3Q98A 2XB6A 4PAWA 4RIEA 1VZ2A 1OXKB 2J9FA 4LWSB 4DCSA 3R41A 2ZUWA 3QO7A 1NMYA 1D2RA 4XX0B 2NTYC 2PNJA 4HNVA 4BE4A 5A4KA 4PG8A 5IAOA 1XKXA 2QORA 1XBLA 2ZIOA 4K1LA 3L02A 4R2KA 3PXBA 4MQMA 3HHEA 4GX0A 3NT2A 1NH2D 3KKLA 1B43A 4AY4A 3C3TA 3O0TA 3W05A 1Y8QA 3X2EA 3OBIA 1G8HA 4DLLA 4BQIA 1Y1LA 1ISFA 3GGCA 5KA6A 2XRFA 4CF4A 5JY1A 4EL0A 3WBFA 2BEKA 1XHLA 4NK5A 4XCQA 4XDLA 2D13A 5SY4A 2IP1A 3PXCX 2AD5A 3DVQX 3E53A 5T64A 1OW3B 3WNVA 3FHJA 1OC4A 1TGVA 4Q66C 1NHWA 3IBCA 3BRWD 1XN4A 3WLPA 4X7MA 3TMKA 1E1MA 1VB5A 4EF5A 4YIOA 3O2JA 1QHIA 1KPIA 4GXQA 1Z4NA 4TN5A 2ZD9A 2QIPA 1XNRB 3ZJ4A 1NBMA 3B36A 1MHTA 1TT5B 2PU5A 3L7AA 1D6SA 3VBEA 1RXUA 1I6KA 4RKYA 1ECGA 2C2XA 3ABQB 3Q8WA 5EP2A 1RADA 4IJUA 3NWPA 3L8YA 4M3NA 1GT91 4WFJA 4F5DA 1I5XA 3HFJA 3G49A 1C0LA 1P7YA 1W4RA 4BNYA 1G3IA 4TOIA 2W2OA 1TQHA 4Z3OA 4Y2JA 4QJIA 3TCUA 4YJ3F 3H2GA 3LQ1A 3NHRA 1D4FA 1GU0A 2WJIA 3TETA 1T35A 4B76A 1FYWA 3SFZA 1W0JD 5TGZA 5EBMC 4RHFA 4AXBA 2WDZA 1U8TA 4C03A 3EMDA 1YJ8A 3W2GA 4AS1A 4RUKA 4D45A 4Z9FA 1U7PA 2OFPA 1ES9A 2J3HA 5EJIA 4A6DA 1Z2PX 4E1BA 1NF3A 2IPOA 4BMNA 2RONA 1WQ1R 1TT7A 1OA1A 4ZU6X 3AVOA 4Z4HA 3G0IA 3IEPA 5AVQA 3SDBA 4Y9SA 1S7GA 1P0IA 1PIWA 4WY8A 3WY9A 3RROA 4MGEA 3IHTA 1Z8DA 3K4HA 1SUSA 4KC0A 1XU9A 3JQBA 4AIIA 2GPYA 3Q3VA 1RLIA 4RMIA 2W6JD 1BXRA 3G8CA 3TKAA 1T5EA 4N0QA 4NE9A 3VQTA 3OF2A 4UB6Z 4X66O 1I7PA 1M33A 3NEYA 4JLDA 2Q69A 5LQSA 1T9BA 3NIWA 1YR8A 4DARA 3QOXA 3DL0A 3TSZA 4WMLA 1X1AA 4MVJH 3P45A 4KL8S 4KI7A 2EKLA 5JBNA 1O94A 1UXJA 3LQFA 1CY4A 3O84A 5BPFA 2D0PB 2PPLA 1YA4A 1DX6A 1G59A 4RO2A 3IXMA 2WZDA 4B7UA 3IT2A 4NPCA 4J1TC 1VF6A 4Q0MA 1JVNA 4YV2A 4PFQA 4NPHA 3CE9A 5JNTA 1VHWA 1Y3AA 2QA5A 4GMHA 1JV2B 2DUJA 1G20A 1FFYA 2G17A 3HNRA 3KVVA 4DQUA 4F4UA 4I81A 3QG5A 4U00A 2NUBA 4TSFA 2VNIA 3GB9A 1D0IA 5IYCO 3CWZA 5TQVA 1ESEA 2P67A 3ND8A 1YJAA 3DOJA 4I9QA 3RS7A 5ALNA 4QGFA 3K1YA 1QCYA 4RTKA 1N2CA 5L53A 4I4IA 3BXGA 1K4YA 1USUA 3LUCA 5BVHB 3CVVA 1R0KA 3B82A 1DHRA 2QRZA 4MA0A 3EZNA 1WXGA 1BE8A 4N9WA 2LR0A 1A1VA 4DWVA 1AT1A 1T36A 2VKQA 4NZOA 4C3VA 1OLXA 4F6RA 2AD1A 3SP1A 2FXVA 2G72A 1RYFA 4WESB 4QUDA 3HSYA 1I30A 1FC0A 2V4MA 3U60B 2DKNA 1O6FA 1V1JA 3DF7A 2YYZA 3ZW9A 4D9HA 4BVAA 1MOPA 4NJEA 3VZQA 5DW3A 1ZPDA 3OZVA 4U8GA 5ER9A 3T3DA 1N2GA 4DV3B 1ZU5A 3IUEA 4TMZA 4JI3B 4WOBA 1TCCA 4F21A 2I22A 2PGXA 4CDNA 4DABA 4FHCA 3CX7A 1OWOA 4Y18A 2NOAA 4YPOA 3WU2Z 4R9UC 4F3NA 2GDSA 3KYDB 3ZY3A 5CN0A 2ZIWB 4I7ZB 2DFVA 1FRQA 2G76A 2V9CA 4UJ5A 1NP6A 4NS1A 4EG0A 2LE0A 3ZZ1A 2GJ9A 4M0MA 4MW2A 1BEEA 4PA9A 3K08A 1QLHA 3Q7TA 1MORA 3QTLA 4ALLA 1WMBA 2IS4A 1QP8A 3W2IA 2LCQA 1MB4A 3DBHB 2DBRA 5FI5A 1SWVA 4HAWA 2YMMA 2ZIMA 3EXHB 1OX4A 2ZUBA 1S9HA 2NO6A 5IULC 4WK2B 2GR9A 4BUCA 1Z0ZA 1SIWA 3OUFA 3D3QA 3PJFA 5A9GA 4QOSA 1D2EA 1YOVB 2YXEA 4G86A 3K09A 2XIJA 2IYTA 2C8VA 4ZGGA 4DSOA 1O4WA 2X40A 2FE1A 2JIDA 4IIJA 2J87A 4I2NA 4LRTB 1GM9A 3AJRA 5JR3A 1JAIA 3EJ6A 2WWVD 2D1RA 3T06B 4BX2A 2IPLA 1SOUA 5CMUA 2V7QD 4A0RA 2Z30A 2D1TA 1NLZA 4NXMB 1YCIA 4MDYA 5HHTA 3IH5A 3U3XA 2P6OA 4P82A 5AVUA 2CHEA 1MC5A 3C74A 2WV9A 3B40A 2Y0EA 4JBYA 4I1IA 4QVKA 1M5RA 3LK7A 5CNKA 1EFDN 3B1KA 5JSZA 5K8TA 3H3FA 1AR5A 3IAM6 1OYYA 3D4OA 5D84A 1X1EA 4X64O 2ZVDA 4A8PA 4C0SA 5ESRA 3G0HA 3ELDA 2A8NA 4KAJA 2PS3A 2WMYA 3NIDB 4IICA 3ZHTA 4W1RA 2DB3A 1EDBA 3KR1A 4JYPA 3USCS 1IL0A 2HWUA 1OF1A 4X60A 4Q3LA 1F8GA 3FH0A 2OB2A 3TI7A 2DUMA 2EC5A 3H5TA 2ZDGA 1OI3A 3K32A 2IY8A 1W29A 2R7AA 5HKKD 5JCPA 1ZUQA 4GBED 3GMDA 3AFIA 2GEKA 3JQGB 4LZNA 3V3KA 2WM2A 3RFTA 4JQOA 1FQJA 1GPWB 1Y3DE 4RTNA 1AVMA 1OFIA 3BIWA 4UAGA 2I03A 3REFA 1V6SA 3W04A 2WSBA 5I9TA 1L5MA 2RHCA 3IEXA 4TMWA 3JRNA 4PG5A 2WWYA 1AMNA 3ECCA 1JHMA 3AVPA 5M29A 3ZW7A 3AKCA 3WV4A 4MV7A 1DPFA 2YXPX 1RB7A 1Z8NA 4DJJA 2J5QA 2YOFA 4FE3A 3MIZA 4CXMA 1E2GA 4YFVA 1CU1A 3GDHA 1GCOA 1KVRA 3WK4A 3TR0A 1ENOA 2WZBA 4B3XA 3TZQA 2ZRDA 4WOKA 2H4FA 4QEDA 4DUGA 2IP4A 1OWPA 2DFLA 3X3HA 4N23A 2WWFA 4ZQHA 1Q21A 3E8SA 1V9PA 2OC9A 2P4UA 3VJLA 4WCVA 4B87A 2CHVA 3OU6A 1QFMA 4H0CA 3E81A 1AUOA 3KBBA 3B53X 1W88A 3FUTA 3IT3A 3LF2A 3D5TA 4BDSA 1KSFX 5H3HA 3RJZA 1GHTA 3JQCA 3CGWA 1JAXA 1K6JA 1MR3F 1YCFA 5I4CA 4P36A 4YS6A 3DZCA 3MJTA 4TQ9A 4ZZ2A 3RVSA 4UEQA 1JA9A 4OHOA 3ST7A 3UH1A 2EVWX 5IPFA 3W5SA 2W2PA 3TIGA 2CVFA 4LNUA 5AVVA 4KCGA 1PBTA 1A5ZA 4UOEA 3GRRA 4RHUA 3C1TA 4F3WA 5FQNA 5JDIC 1UFVA 3AZOA 5CFLA 3EA0A 1NVBA 3KCXA 2PCLA 5E7MA 1G21B 1P19A 1LRJA 2F4VO 2H5LA 1X4TA 3CU5A 3UUGA 2Y67A 2XH8A 3OT1A 1NW7A 4J2OA 4M1OA 4OCNB 1UPFA 1F6BA 3M4JA 2VWKA 1L8AA 1WKBA 1ADFA 1JI0A 4DV0B 1KB9F 1SUIA 1TIBA 4A7PA 1GN4A 5KQRA 4QBTA 2WI8A 3TQFA 2YDXA 3HXTA 1AI4A 1Z47A 3C8UA 1THTA 5EY5B 1VFPA 1X86B 2XVAA 4EG4A 2OLJA 4YHHB 1RYBA 3DSRA 1T91A 3CURA 5A71A 1E7SA 4MUMA 5IVDA 3KXKA 4JDPA 4MRNA 3BB4A 4PBTA 2O2XA 4Z9XA 3GWOA 2XMRA 3ZXSA 4PX9A 4B6QA 1G18A 2XYPA 5DLDA 4BO0A 5BZBA 5AIBA 4BRSA 3OA0A 4LECA 4B4OA 13PKA 1C9YA 1YQ9A 5BQ3A 3D0QA 2AX4A 1EJ6A 2W2VA 4UBMA 3IURA 2ZIAA 4V0NA 5KNCH 1BIFA 3NLLA 3STUA 3IRVA 1TCUA 3KZ1E 3F6YA 4Z2AA 4MAFA 4BC1A 4RACA 5CYOA 1NVGA 1PKEA 1G8GA 3NBYC 2CL5A 1FOEB 2Z3VA 3RS3A 2LJ2A 4GH5A 3UUFA 2YRXA 3IMKA 3BMQB 2XKBA 1G6KA 4X8MA 1TAHA 3JVDA 4N01A 3GCGA 2PLFA 3QO8A 2IJKA 5THKA 2WR8A 1PI3A 2JBWA 1JMKC 3KUUA 1O8CA 1PUJA 4QD3A 2ZI9A 3GWGA 3MT0A 3FB1A 4RZ3A 3I6BA 1A5AB 1Z3IX 2QYOA 2IZ6A 2DPHA 1F51E 3OH8A 5ED4A 3E22A 2IZ1A 2DXIA 3IEUA 4JXJA 5I7UA 2Q1UA 3LQYA 2CDRA 1MMFB 3FG9A 2UYCA 1MG0A 1BS9A 1XSEA 5IYZA 4G3XA 1W8DA 4HWGA 4MX8A 2HXVA 1VYVA 4BMXA 2J33A 1VPWA 4KIWA 3RIMA 2ZIUB 1EINA 2F66C 2VJBA 5FEMA 1NTOA 4U2KA 2FSIA 2JCXA 2JCYA 3PC2A 3L4JA 1JSCA 2IA5A 5DYYA 3NQ41 3MYYA 3Q3HA 1WB5A 2BFFB 2XOKG 1FP7A 2GSMB 4B48A 2HNBA 2NUPB 2XCQA 2H8KA 1EM6A 4AJKA 1H22A 1RQ7A 3B85A 3TX2A 3T1YO 2YIBD 1GTVA 2FSPA 1ZXXA 3WGZA 3WWDA 4DV3O 4MS2A 2QN9A 1DBRA 3FTPA 3KVRA 3CC2V 3WA6A 1N2JA 4XSVA 2JI8A 3H5OA 2Y76A 1GJRA 3CONA 2B35A 5D3KA 4AJLA 4MR9B 4B3MB 3V2UA 1NKDA 2PCJA 5IFLA 3E9YA 2WKRA 2YWXA 3VAAA 3KL2A 4J2TA 5TQ2A 5CD9A 2J9ZB 4MTLA 4G0QA 1ESDA 1P8JA 1P2GA 2PXHA 3MAQA 4B34A 1U8AA 3ZU6A 4ZDWA 4EOGA 1U0RA 3TXSA 1Q3EA 4WN9B 5JISA 5FBQB 1CUEA 1CE8A 4DILA 2HVVA 4HD8A 5DTRA 3RUDA 5AYVA 2W37A 4DDTA 4GOLD 1A3CA 5AW0A 4DC1A 1I08A 4K0RA 4MWSA 3UG7A 5SY6A 2GPWA 3PHGA 3JQDA 2F67A 3HDHA 3DUFA 3GFVA 4PGGA 5BSVA 4UUAA 2Q27A 5AD1A 3WTBA 3EGXA 3V4RA 2E87A 4Q3CA 4Q4CA 1UT5A 3CH5A 1XQ9A 3HN6A 1U0NA 3T5MA 3H1AA 1L5LA 1UX0A 1U04A 4L8LA 2OCBA 2CBXA 3HI4A 4LY6A 1ADCA 4CKCB 5DM2A 1X1BA 2REOA 1SNYA 2FMHA 2QSZA 3C3JA 1UM9B 2FUEA 3DUWA 1VQMV 4F3KA 3LBHA 3OKAA 4RDIA 1AK1A 3ZU4A 1M6VB 5EMKA 4B45A 1RRMA 5F5XA 2ORIA 1F20A 2L35A 4EPWA 2R6ZA 4UMVA 1S2OA 1M57C 3QQ5A 4XX1A 1F6DA 1EHYA 5G3ZA 4MRVA 3O4FA 3THOA 3IMCA 1B8UA 3AIOA 5K1XA 4H13B 3M6UA 2I3BA 3ICCA 1W0JA 3L40A 2FWIA 3QU5A 4NICA