1M9NA

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Structural Insights into the Avian AICAR Transformylase Mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 219
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m9nA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1m9nA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA02
3ZZMA 1CE8A 1VMDA 1THZA 2IU3A 1WO8A 1JDBB 2YVQA 2B1IA 1T36A 4A1OA 1KEEA 1S89A 1PL0A 1C3OA 5H3LA 1EGHA 1CS0A 1PKXA 2B1GA 2X8WA 1BXRA 1P4RA 1OZ0A 1G8MA 1M9NA 1B93A 1ZCZA 4EHIA 1IK4A 1M6VA 1A9XA 2IU0A 1C30A 2XW6A 1S8AA
chains in the Genus database with same CATH superfamily
3DQPA 2XOXA 1WZUA 1HUQA 1PNLA 3RFVA 1UFIA 4PLPA 5KSPA 3U1TA 3TB4A 4WZZA 5BSMA 1LF0A 3UHFA 3T12A 1WCWA 3DHVA 3R0IA 1FE8A 1VCOA 3CLRD 2X8AA 1ZJ4A 1KC3A 1L5LA 1EN5A 1ZHFA 2G1JA 3CVWA 4GBGA 3LPNA 1U63A 4ZEXA 5ES4B 3I5XA 2Z5LA 3HSKA 5DT9A 1OCCB 1C3OA 4IQ8A 1V26A 1V55B 4AJOA 1O4VA 2FUG6 4KO2S 1KTIA 1UX1A 3SD7A 3OEHD 4UHKA 5JYEA 1IAQA 5JQWA 3ET5A 4A8PA 4RFSB 2FEPA 1CJMA 1NKSA 4LNHA 3NBMA 3JD0A 3MAJA 3H16A 5KVSA 4R40A 1WKBA 1YZQA 3IDFA 1ZBQA 2J5BA 3LUJA 3IKLA 2I4LA 4LEIA 3G0CA 4JAUA 3MYRA 2W4LA 3FR7A 3K92A 3LNNA 2NZ2A 1SULA 3S2IA 5B7NA 2A4KA 1LSOA 1JLRA 5EMHA 2XEXA 1R2QA 1CUHA 2YFKA 4MS1A 4IFTA 5DBFA 3CT4A 4YRZA 1YQTA 3V4LA 3FGZA 1EXNA 1TD1A 3L74H 1F6BA 4KR0A 2HI0A 3E7PA 4I14A 1ZABA 2F4VO 2IOYA 1RXIA 1ZIXA 2R8RA 1XPUA 2P9JA 3D5QA 1BSMA 3CNOA 2FPKA 3I9KA 3BWXA 4BNLA 4ZAFA 1ECJA 4KQ1A 5EYPB 4R7TA 4L0MA 3E6AA 4DIEA 3HGTA 2MYPA 4JVNA 2CHGA 3S1AA 4BZPA 3OZUA 3E61A 1Q0UA 2NVBA 3ZDBA 3FPCA 1WD7A 2NTYC 3I9NA 1KJNA 5EMLA 1T1RA 4QBGB 4NBKA 1EM6A 1IYZA 2HU2A 3L49A 4AZVA 3B53X 3GVCA 4Z7QB 3SP1A 1OBHA 4OQMA 1F8GA 5DE3A 5BRNA 3C4QA 1ST2A 2EKLA 1O58A 2GEJA 4LOKA 4CMKA 4BFSA 1KMIY 4BFUA 2AYZA 4D3SA 4KCGA 1A04A 2YUTA 3VNVA 2X0NA 3G7NA 2IHJA 5KCZA 4OJQA 4M8NE 3L7JA 1E3LA 2CC2A 2NR5A 4DCJA 3CW2A 1RAIA 2P2YA 3SYRA 5LNK6 1CD5A 3ICXA 2VTBB 1NXWA 2Z2XA 3OOYA 4LZZA 3E4CA 1YS9A 4O63O 1J8YF 2JEXA 3OLXA 2PUVA 1NXXA 4O2LA 3ED1A 2Z83A 3OC0A 4M1QA 3SC6A 1ACMA 3WHPA 1SCNE 2YDYA 4DWOA 1KI7A 4WKCA 4U7HA 3I9V6 4J3JA 2KKWA 2V7BA 4KKXB 2IU6A 4W7IA 1SZPA 3Q7IA 3R41A 3PHCA 3PQ3A 4JY7A 4MTOA 2FHPA 2O95A 3QWAA 1RLTA 2HCRA 4M1MA 1G9TA 5EZYA 3ZN1A 2D2CB 4L78A 4IGKA 4GL4A 4A5SA 2O1SA 5A06A 1D8TA 2KG7A 1RAFA 1T43A 3DOFA 3OIYA 5F52A 6ADHA 3KUXA 3RI3A 3QK7A 3NDJA 4CIVA 4Q9JA 3IB6A 4XLLA 5EBWC 4CM5A 3S2SA 1JG4A 3WA6A 4BNVA 3B2EA 3W7UA 3PQDA 1RJEA 4JKYA 1IBSA 4MAAA 2B1IA 5HEKA 2CE7A 4MS4A 3NHKA 5LMUO 4OSPA 1GN6A 3RYFA 3JYCA 5BY2A 4DNPA 2XGOA 1XQ6A 1U4OA 4N3NA 1XKLA 1QQ6A 1QU7A 5TMEA 4DLWA 2HDNB 3C3DA 4TL8A 4ESHA 1UMCA 1FEZA 4WXPA 1DC3A 3GJZA 3NALA 2DPHA 3BM5A 5EIOA 1YRBA 1CNEA 4LVUA 2W2OA 5KNCH 4C04A 4EHBA 3NBQA 4M8SA 4BX2A 4K40A 1AG9A 3WGHA 2DBQA 4ND5A 1ZA2A 2AEJA 1V7QA 2BFBB 1C3EA 2GCOB 2FPLA 4M46A 3ZV6A 4HXGA 3OX4A 4ASUA 1TUIA 3LMKA 4IQ4A 2J7PD 3I5DA 2XKBA 1PFUA 4L3WA 2H1RA 1FMTA 3BJMA 4CNQA 4I1SA 2HF2A 3Q3EA 1LPSA 5ALDA 4RLFA 1K8XB 2Q3MA 3Q4HA 4DCUA 3DTUB 2EQAA 4JQOA 5B2ZA 3HYTA 4G0UA 5EKDA 1NP7A 3MF4A 3GQBB 3C6YA 2FUNB 1ZX3A 1YOVA 2BH9A 5EJGA 4TTPA 3P96A 5DDIP 4KO4S 1CXZA 2NSHA 3QMMA 5CLHA 3KU1A 4RKFA 1HT2E 4EKWA 1Q6IA 3A11A 3K9WA 5J1TB 2MSWA 3Q3IA 1N34B 3CLTC 4EO9A 4QBIA 5AP9A 3P20A 4MV3A 3NYRA 4G97A 3I5AA 3F6RA 3VA7A 3BFRA 4NQZA 3EAGA 3RLFA 2PSSA 1OCRB 1L4YA 5A2QA 5B57C 4XI9A 4RZHA 3K9SA 4IICA 1Y3AA 1MVLA 2APJA 2OMEA 4C7VA 1WS6A 4EFDA 4RK1A 3O2QB 1E58A 3LV8A 3L6CA 3LYLA 5L3VA 3AVOA 2LKCA 3U4QB 4TMVA 1AK1A 4CEJB 3B6MA 1RPRA 3CLSC 3HYRA 3W34A 2QG4A 2IP1A 4Z9AA 4MVJI 3AK4A 2ZTMA 4NAVA 2DX7A 1UQTA 2XDQA 2QLLA 3L6EA 3FYHA 2AR7A 2ZR9A 3VVMA 3OJWA 1VL2A 1G1AA 1NI3A 3L7YA 5JE8A 3A6EA 1Z0ZA 1CDDA 3TTTA 3MNFA 3ZBQA 1EE9A 4EHHA 2EFJA 1EDBA 2FTKE 4MGKR 5LP6C 1M1YB 1JDUA 1NG9A 5H16A 2H2HA 3K0GA 1EFRA 4OGFA 1JMYA 1YZKA 5CG2A 1Z5PA 4N41A 1GTJ1 3NVAA 4YAIA 2GK4A 2V6BA 4LC5A 3W7XA 1GKIA 5BWBA 3JVEA 1GT6A 4DRXA 1TW3A 1OWPA 2R9VA 1BMTA 2OXRA 2X0RA 2YQ5A 1Y3IA 4IMPA 3S5UA 4K9OA 5CJPA 2FCAA 1DAFA 3CKKA 4ZZIA 2BI8A 4OQDA 3VJRA 5FBLB 2HJRA 5CB0A 1QVFU 5HUHA 2M6KA 1BDMA 2UUCO 1DQZA 2QLBA 4Q7LA 3NXKA 3AQ4A 4PO3X 3LIPA 3CRZA 3E9YA 3K5LA 3KOWA 4BLOA 4F6RA 4DCMA 3B8EA 3V7WA 4UCWA 1KP3A 4D8UA 2E74B 1J24A 1UPTA 1WJZA 1FQKA 2FZLA 1K8QA 1H05A 5LYJB 2X86A 1P29A 3R6DA 1UL1X 3KLNA 4IYRA 5ARDA 4WLFA 5JD6A 3ORSA 1BWQA 1Q16A 4EKDA 4YJ2A 4OXIA 3VR6D 3QFSA 1NBEA 2QJ1A 5IDQA 3E9ZA 3G88A 1QP7A 3W4JA 3WFIA 5EJMA 4CBVA 2Q3LA 4J6FA 2Z95A 5CT6A 3OT4A 4YRSA 3ONDA 2WEKA 4G56A 2GHQA 5MGNA 1N5DA 5BV1A 1GPYA 3BVPA 2YIAA 3BDAA 3TI9A 4UEOA 2EATA 1G6UA 3GEDA 4K81B 5ALXA 4ZRNA 4CVNA 2DWOA 2GASA 3T1YB 3MJRA 3A32A 1J20A 4H1TA 2W42A 4EHLA 1QQ7A 2AI3A 1HRDA 2HRRA 1ZGJA 2OC4A 2ADQB 2W71A 5CAEB 1X87A 2E75B 3A14A 5FTLA 1X9IA 3ER9A 4KN6A 4FR2A 1P7VA 2JIZA 5LZ5A 4LKOA 2G8NA 3QHAA 1X86B 3G2LA 1BVHA 4QQKA 3CX3A 1Z0IA 2C61A 1CCWA 1R50A 2I2CA 1XVLA 1DO0A 4RTMA 1AP5A 4HDKA 1OH7A 3LVFO 1C7QA 5JSZB 2IJGX 4FHCA 3O03A 5CA1B 3I0ZA 3PHIA 3QA9A 3GZNA 3WR5A 1VHQA 3GRZA 4CEIA 1COWA 3B6EA 4D8YA 1Y76A 2SNIE 3WFJA 1UPBA 1KC8W 1MIOB 3EVZA 4NG4A 3AFMA 4PNPA 2WAOA 4RY0A 5BOSB 2VTKA 2PS0A 3M6IA 3TLGA 4NCJA 2QUBA 3UZUA 4JP5A 4YDRA 4DRYA 3OVMA 1CY7A 2Q3EA 5K51A 1UXGA 3OTHA 1UF9A 1SQ0A 5ALRA 5LBIA 4JD5A 1Q91A 2XGMA 3NEJA 2YY7A 1WB9A 1C30A 1EFAA 4L4UA 2RGAA 4RH1A 1ZHHA 2XWPA 2C7VA 3ZJYA 5K09A 4FXOA 3VH4A 3EG5A 1M1XB 3GZ4A 4HLUC 2WUFA 3FAVB 5EOVA 6ABPA 1PJRA 3M3PA 4H4CA 5TE9A 4QDOA 3ZCRA 1YR7A 1QE5A 4LJLA 1APBA 5REQB 1CVRA 5AKYA 4DHWA 2O1XA 3QVTA 3W9SA 4ZYXA 1KC1A 3LRXA 3LBHA 1YZVA 4J4HA 4OJYA 1FS6A 3C39A 1JR3E 4ZANA 1FZTA 4WFJA 2G76A 1IBKO 1NRXA 1RXCA 2E5WA 2JGFA 5JRJA 4B4OA 1MG1A 5FOTA 5FCDA 3CCFA 3TQCA 1PWZA 3GXBA 3N58A 5LQCA 2G67A 4S1TA 4AECA 2J4FA 2FW6A 2AJLI 3M9WA 1ZKMA 4QUJA 3K70D 9GPBA 4R5HA 1A7AA 2BCEA 3NTXA 5JI2E 5K1ZA 2A2ZA 2HPAA 4OG2A 5C1BA 1R6UA 5JAQA 2FN9A 2FX3A 3DZGA 3VC3A 4J80A 5EZ6B 1MCZA 2CVQA 3IKTA 4WASA 3TPFA 1AXRA 2V8OA 4LXIA 1M2WA 2VNIA 1G8JA 2PW9A 4IL6Z 4J1SA 4FFNA 4K88A 2G9UA 3BMNB 4BWGA 3BK1A 2CXHA 4W8HA 5DB4A 3APOA 2EZTA 1ZOLA 2HK8A 5TT0A 3WWZA 1UT5A 4EFMA 1F4LA 5JMTA 3S7TA 1EP2B 2VYQA 1WQ4A 4WADA 2KCQA 1NTOA 1GD1O 4YMTA 3GLUA 3GX1A 1Q12A 3N8IA 1YIAA 5CIYA 4YRKA 5KOHA 4KRXA 4Y1RB 5FX2A 2EZ9A 4QFTA 4MSJA 4IKOA 5KSWB 4V3BA 2YOFA 1M2VA 1XROA 1M9NA 2C8JA 3A4YA 4R9VA 1E4EB 2GXSA 4KHZA 4V03A 1QK3A 2PT7A 4KB5A 1CY0A 3SQNA 5C8YA 2NZUG 2P9ZA 1CETA 5KC8A 5K3FA 1U8FO 1NI5A 4ID3A 3ZWAA 3I83A 3LC1O 3QP9A 5F3WB 4BUZA 4A8JC 1J8DA 5AI6A 2AQIA 3AIMA 1T0HB 2XKJE 4V2IA 1QH8A 3AYXB 3W90A 2LJ2A 5AKJA 3KJIA 2QTHA 4MUIA 1MB0A 3ZYCA 2W58A 2QW1A 3QE3A 1RMYA 3G9QA 4QDXA 3PE6A 4G89A 4WZBA 1QP0A 4TVKA 1DEOA 1UJCA 1VSQA 1VCNA 1I7FA 4NTZA 4TTJA 2HG5C 2OUKA 3W78A 3GLHE 3DBVO 3IVCA 4F5EA 3BXGA 1T29A 1GVHA 4QVKA 1K73W 3OU2A 3M82A 4U7TB 4YMLA 1WMDA 4CG1A 3DEHA 3GCZA 2RBGA 4CKBA 4OI1A 1T5TA 2J0QA 1AQUA 2AMVA 3V34A 3R8FA 3RGWS 3KUCA 1GIAA 2WIDA 2CT8A 1KKLA 2B20A 4QHYA 1L5NA 2GZDA 3DMNA 3B9PA 2QL9A 5TIIA 4H60A 3AVXA 2QTWB 4UFPA 1O08A 2R9RB 1GQFA 2IX3A 4FSHA 2VF8A 2P91A 2UUAO 1ZCFA 1N6IA 5JR3A 2CJYA 2VZEA 5JUWA 5D86A 1RYZA 4MHOA 2UXDB 3IR5A 5IK2A 5FQOA 3ETGA 3QUSA 4OYRA 4RLHA 4IIJB 1IHUA 2FMIA 1ZRSA 2OSVA 4NV0A 4IBOA 2JJ8A 3H1IH 2IX9A 1EWTA 4HDCA 4MB2A 3BBPA 1JFSA 4OHFA 1PR9A 2CWDA 2GN2A 2G08A 2ZIFA 2P9BA 4NR1A 4FLVA 1BX1A 1C2YA 1DO2A 1VLQA 3SZGA 2DC1A 3RC2A 1HQKA 5ALOA 2OEPA 2PU5A 8MHTA 3I8SA 1SBIA 5E4FA 4IAOA 2WD7B 4QYSA 1VL0A 3R0QA 1ZI9A 4L87A 5DIFA 3WHLA 3EPJA 3RAEC 5YASA 1WR8A 4BYMA 4C30A 5FWAA 1LSSA 4ITRC 2VWQA 3QUQA 4Q12A 2ZJ4A 3EZYA 4RUEA 3NJ8A 2R70A 5H82A 4RANA 3PFCA 1ZM9A 5H4GA 5H81A 1W29A 1K6XA 1NHGA 3E5RA 1NKDA 4EB0A 3L43A 2Z3GA 2RHWA 1JLLB 4J1NA 5GTIZ 3RQSA 2PR7A 1D1QA 1KI3A 1H85A 4F9FA 1M5IA 3KCNA 3TNYA 5CYOA 3SAJA 2OMKA 1EBFA 5B5EZ 4MAFA 1CR0A 1I4EB 1JWLA 4LZWA 3VKHA 1RLUA 3RKSA 1O2DA 4D02A 1GH6A 4DEXA 1LEHA 4DARA 4ED9A 3P0JA 2RN9A 5J4KA 2A35A 3C6MA 1R8JA 3FTQA 1H65A 2J3KA 1P9WA 3D0KA 2FW7A 3BWDD 3TVDA 1P6XA 4EW2A 3N7AA 3LPDA 2JFHA 2JL1A 3P0HA 2V4DA 4JJZA 1G9SA 2PL1A 2W2PA 3Q8KA 3L73H 4PV7A 1I3MA 2PMDA 2IEDA 3B6JA 2L18A 4DR5O 2JHPA 3EIHA 4U0KA 4G5OA 1FXUA 1YHZA 1W6UA 5CNJA 1BGWA 1D1TA 2HN9A 4PQFA 2DHRA 3OF3A 2R6JA 4P54A 3K53A 5AMXA 1DCKA 1Z4KA 4UARA 4IJQA 1M2JA 1OX5A 3GGJA 2JGAA 3K94A 4HC4A 4M8LA 2FN3A 2GBFA 2JAHA 1J70A 3BHMA 4O4JA 2FFRA 5FLYA 3ZKWA 3KQOA 1YVPA 1QVZA 4MCAA 2ZVPX 4N9WA 3FPHA 4UJ5A 3GLFE 2DUNA 1ZD5A 3VOTA 4R8SA 4MWGA 4C4TA 4Q3NA 4J7AA 1NQXA 1CF9A 3K0EA 4JUCA 2VF5X 3HCWA 2WJVA 4PRYA 4FWIB 3BAAA 1YJ8A 4KOAA 1L4UA 4UNQA 1KYZA 2V7WA 2BR4A 1IVNA 3A10A 5IT9N 5AK4A 3ZI4A 4QTZA 4D26A 5KYTA 3HXKA 4MPRA 3MWJA 3Q6MA 3M6WA 3J7AC 3TR6A 1QQCA 1SF9A 4XE5A 3TD6A 3NIGB 3ZD9A 1MR3F 5K3BA 5FTJA 5EESA 4LXYA 3F47A 1THMA 5HKLA 5BURA 1S89A 5EE9A 2PMWB 1AILA 4YR7A 4FJCC 5CB8A 1EBUA 1NVVR 2CBXA 2C5SA 3DE2X 2REXB 3A1SA 5CDYA 2JJQA 1EBBA 1GAEO 4IZ6A 5DMXA 3CF0A 4KXWA 2Q45A 5H02A 1DC7A 3V1KA 2ZYIA 3P9XA 1RXEA 4X44A 4DMGA 1B0UA 1LI7A 4L2IB 3TNDA 3UW1A 3HCAA 5CM8B 3GVHA 4EHFA 1QCCA 1JHQA 3EGIA 1IJBA 3A9RA 4B44A 4MQFB 5EWMB 2IC5A 1V7ZA 3CUTA 1NIJA 1KYTA 2I2AA 4LAFA 3EGVA 3AEZA 5GOZA 3PE4A 3LG2A 2DLCX 3A05A 1R4NB 1PV1A 3ANYB 2CHEA 3ZJUA 5KJFA 4YEDA 1LLQA 4MJ7A 2Q50A 1H3FA 1YJ9V 5MFPA 3HXMA 2R7KA 1U0FA 4DYLA 1GKFA 4BMNA 3UM9A 1MRNA 1UPGA 4Q3CA 4WIGA 2KKSA 4B75A 4DIBA 1ZK0A 2ZZKA 2ZIAA 3UXHA 1YIJV 4HYOA 2VPWA 1LVUA 5L9AA 3OJXA 1VYTA 1EHIA 5FPSA 5LYJF 3WNCA 5I01A 4TQFA 2X7JA 4G0MA 3LOPA 3OM9A 3NHYA 3MG9A 3CC2V 1OREA 3WRXC 3SPXA 2GDZA 1N8TA 1L4NA 4M9QA 2P3OA 3FWKA 3CVOA 4KSCA 1Q1BA 4HAZA 2P40A 3KAKA 2QTFA 2MYTA 1U1GA 4JLPA 2EAUA 3WTCA 5DCUA 4WL0A 5T6BA 3BGSA 1FC0A 3K30A 3RS0A 4DA0A 4MRNA 4AJPA 1ECGA 1RS0A 2W6ID 4KIWA 3RAJA 1ZIPA 1HE5A 3DBRB 1RBMA 2PLWA 4FZRA 3FUUA 2VG8A 1JEAA 3WKEA 1PNKA 1EWQA 2CVHA 3ENVA 1RLJA 3ETLA 4KUHA 1A76A 3KSAC 4E5SA 4JC4A 4B84A 1H6CA 2EFYA 3U80A 4PIMA 4HGOA 1C4XA 2PWZA 2WHRA 2K7FA 2ISSD 4H7DA 3RC1A 4L16A 5FH9A 1N6HA 4MVJP 4XDGA 2RHTA 4P86A 1SBYA 1GKUB 3V42A 2NYTA 3GPCA 1R5BA 4KH1A 3PRHA 1RPJA 1NMSA 2ECOA 1QFZA 3OPYA 2OAGA 4F97A 3W5BA 3QJYA 2C3YA 1EFVB 3K5MA 1X39A 5LUBA 1GN4A 4MI1A 3P32A 5K3SA 1OIXA 4B6FA 3RUIA 1DADA 2CK3A 4LF9O 1ISMA 1N36B 2FX5A 1ZCBA 3GEIA 5CA1F 4E7OA 3JALB 2E4AA 3ABTA 4ZVVA 3M9LA 4MRAA 1A1SA 4YMGA 5AKGA 2AUMA 1G3IA 1RZRA 5EIBD 2RNBA 1LRJA 3MXTA 3HXPA 4BLSA 5JTUA 3ZLUA 5SZJA 3GWKC 1D0VA 2ZSJA 3KIPA 3O3CA 4LD2A 5BQPA 3GN2A 4EUSA 1MX1A 4GKJO 2LV8A 3COSA 4JSRA 1MOFA 2H1LA 1E1CA 1B04A 3PRJA 2ZIZA 3I12A 3NUQA 2D59A 1IUOA 2CMKA 2VH1A 2WAXA 3MC1A 3HUFA 3V6MA 2BFFA 1UBFA 1P1BA 1R3IC 5KWVA 3MWEA 3TLCA 4Y6LA 2KM1A 1W5TA 1EFPA 3AETB 3PA8A 4BN5A 1Z3IX 5M2QA 3VISA 1DC6A 1C4OA 2YV2A 2G9VA 3A6LA 3GP8A 2CB9A 1KB9F 4BZWA 5BT9A 5AJZA 3W9UA 3A1WA 2JJ1G 4BFTA 5EHZA 1UWKA 4C78A 1L4BA 3FCEA 3W8NA 4CU5A 1V8DA 1H0HA 1S77D 2FX2A 2PUDA 3A26A 4Q19A 2WILA 4KQIA 5C4GB 1I0HA 4XDYA 1NPTO 2NO9A 5TJ9A 1H8ED 5IRCD 3Q4GA 3VPBA 4GWGA 3DO5A 3FYDA 4PYKA 5HYVA 4Q3LA 2AF4C 2EFHB 1QHIA 3MHPA 3RKRA 5ITZA 3PLRA 2QGFA 4GVPA 3JARB 4J0KA 2FFQA 1LQUA 4I55A 2WLIB 1QIIA 4Y2GA 5HK8A 5IYDO 2Q5EA 2EINC 3D5EA 4XB2A 5CN0A 1OX4B 4B3TO 5HIKA 1AJEA 4L08A 3GUVA 3HTXA 4HB3A 1Y8AA 3SPGA 2C9ZA 4UFOA 3CZAA 1FXKB 1JHXA 4GI1A 3IDZA 2RI6A 4CMJA 3G0GA 3Q7PA 1G59A 4AMUA 5B1EA 2BKLA 4OQFA 4KNWA 2VEOA 4YGXB 2FN8A 3TAUA 5KX5B 4M0MA 1YS1X 4DCVA 1EH5A 1RC1A 2HA2A 4QELA 3T0FA 4TKVA 1BXZA 3EK2A 4NBTA 2VDPB 2J0UB 1YMUA 1KFEB 5KDLA 3UHPA 4PG8A 4LK2A 3OAAA 4DLKA 3ENQA 2BMFA 3N2IA 3U9SA 4ZQEA 1NBWB 3IP6A 5TEVA 3L77A 1KJZA 2NTJA 2PUHA 3WLTA 3H18A 1HDXA 2VPPA 1GG8A 2Q2WA 3EPPA 2O2DA 1SU6A 4JBYA 1Q5PA 3MEQA 3MMXA 3GNQA 2P9CA 1K5QA 2B5OA 5KI6A 1ZI8A 4MGEA 4G24A 3OE7G 2WHPA 1HYQA 1AQIA 4P8RA 2OV2A 5CFZA 3GAFA 5AJVB 2JEOA 4EPXA 1G6HA 3MQ2A 3DE7X 3G0IA 4AF7A 4CQJA 4MRRA 5LMCA 1BA3A 1R8XA 1R4MB 4XIIA 2C9OA 1BHJA 2YUAA 2KMLA 3OY7A 4R2JA 2O06A 3MQFA 3H75A 1KP2A 3WQQA 4ZGGA 4TTVA 1DDGA 2GM9A 1VI2A 3CWQA 4BFCA 1X92A 4QXOA 4LWSB 1DJLA 4N7JA 1UBTS 3D0OA 3DTNA 1BXGB 1XI2A 2O07A 4IVPA 1TQHA 1GVNB 2R60A 3HLTA 4B40A 1NOKA 4FCCA 3I1FA 4ZO8A 2R7MA 3G1WA 1PFYA 3GLIE 3LDHA 5DM1A 3IPLA 4C20A 2R1VB 4CV1A 4GE0A 1WF3A 4X6UA 2QT1A 1DRWA 4EG0A 2VYFA 3ABIA 4BFYA 4GSKA 4IGFA 1JLKA 3U4IA 1W581 4OAPA 1QVAA 2GJ9A 2W6JA 2ZG6A 3EQZA 2XHEA 3ASZA 4OF4A 2I1QA 4URXR 1N9ZA 3EXHB 1I0LA 5AM5A 3GLTA 3T5PA 3T9EA 1H42A 1I6WA 4IIJF 2P3LA 3VUEA 4BOYA 2C97A 4DR4O 2GBGA 1SC1A 2O4CA 3WLQA 4Z0NA 4P83A 1GGVA 3DXRA 1V2GA 2Z09A 3TX2A 3KE9A 1HKUA 4RNCA 1GPWB 5A4JA 3NBYC 4P6VF 5EEHA 1J8MF 1VL6A 3SDLA 3LTNC 1GNLA 3Q40A 5C7IO 4ER7A 4WKPA 2ZRGA 3QLTA 1KJYA 2XVZA 2PSDA 3TGLA 3EDOA 2DW4A 4A15A 1WU8A 1K9MW 3BAFA 3ZVNA 3H6HA 3TQSA 2BE9A 4YT5A 3SQXA 3MS4A 3OQPA 4Z4HA 3NMUF 1VZ3A 3G13A 4LYFA 3K0DA 3C3KA 4Z0TA 3AVUA 1Q2XA 3OR7C 4CM9D 4C6TB 3PHJA 1SA0B 5KYXA 2VBIA 2EIXA 4WKGA 4G5FA 1YRAA 4NFLA 3SC2B 2R4TA 3QIVA 3VPFA 4N39A 3QO7A 1I13A 5EFZA 3L06A 4ZWNA 4HYEA 3LQRA 2WWWA 1KOJA 1ZNZA 4JKOA 2FRXA 3GNSA 3W6UA 2FQXA 1IZ3A 1W2BU 2B2XA 5DF1A 1L8XA 4CQLB 4DR3B 1AJQA 3CVUA 3LQYA 4XWWA 3BF7A 2FSUA 2VSQA 3FSGA 3G0HA 2OV4A 4D3YA 3COWA 2RKWA 4Y2YA 4MWZA 3AU8A 2VT2A 3AERB 2XT0A 3TDMA 3PPYA 1U0TA 1Y8CA 2YHSA 4D4GA 3CNBA 4KXNA 4OHWA 3H5AA 4U7WA 4L72A 3E5NA 1S3JA 3NYQA 3MRTA 2ZR7A 1ENOA 1PZGA 1Q7BA 3EC1A 3CZ4A 3RFFA 3WGIA 2NT4A 4D9MA 3P26A 4YR9A 3O9MA 4NFHA 4X1YA 3ZD6A 3A9UA 4CZ2A 5L3SA 2FE4A 4JB3A 1E5QA 2YIBA 2IH5A 2UZ1A 3R7AA 3UCSC 3ZIAD 1SCQA 1W19A 3OD5A 1SR8A 2EQ5A 2VTDA 2WR8A 1MSWD 2O2HA 3HV2A 3QPDA 4OGKA 1NKTA 4KDFA 1F48A 4RF5A 3C7AA 4R01A 2ZDIA 4BVFA 2JLZA 3MHSC 1R0YA 4IHAA 1MB3A 4AMZA 2RONA 4QPZA 1ZP6A 4DIKA 2Z0AA 1HDOA 3KEFA 4MUEA 2FOLA 2UU9B 1PVDA 2OTJV 5AI0A 4RX1A 1AGPA 4HV4A 1VE6A 4RETA 1QNLA 4BECA 4MUHA 3ASOB 2FR8C 5ALSA 2UXNA 1KK3A 4GKAA 1A98A 1NMEA 4CTOA 1KZHA 4XUDA 1VFPA 2QYHA 2GN4A 1KZ1A 2ZB7A 3WZ2A 4F1KA 2BELA 2VS0A 5BYAA 2DUMA 3BL5A 3IUJA 2X0FA 3WADA 2B3DA 4DWWA 2FDCA 1A9OA 3EODA 3WJ7A 4GC9A 3PXBA 1IH8A 4UEKA 3ILYA 4DLXA 4TKZA 4A73A 3O8QA 2O8FA 1NBMG 5CEFA 2QJFA 4FP9A 3FN4A 2WZCA 3ONEA 2G82A 3AR3A 1OU4A 3QV2A 2OBFA 2O7QA 3R0VA 3T9CA 5EXEA 2FI1A 4K86A 1WN6A 4HGQA 4E46A 1HQDA 4F92B 3KB1A 3E83A 1NTRA 5I7OA 1PFQA 3BFXA 2HEIA 3HZHA 1RJGA 2AN9A 3F67A 4QQFA 3TETA 4LI0A 3F6CA 4YP6A 3JYNA 3MW8A 2F1RA 3HU2A 3V4SA 4JQCA 1A50B 1HLDA 1JQKA 4U39A 2PT5A 4JI8O 1QX4A 5ELXA 2W0XA 3LS2A 3IVGA 4KE6A 1AHNA 2QUAA 3LUBA 3BWVA 4UULA 5K3EA 1A9SA 5D8DA 5DBHX 1PNTA 4LDNA 2A5LA 4QLBA 2CXPA 5CGQB 2WIBA 2QTOA 2BDUA 1ZSPA 4F5YA 3HP1A 4EHDA 1HNXO 2WQ6A 4ZCIA 3V2UA 2QRVB 3NTUA 5CFQA 2ABWA 2RIPA 3VOUA 5HPYB 2E1RA 3QX9A 4INJA 4MR8A 2BH2A 4OI2A 3K1ZA 2ASEA 1USUA 3TL2A 4S1OA 3M33A 1KO1A 4EDHA 4ZT2A 1A0OA 1E8MA 3UJ9A 1VCMA 4NAUA 3T0IA 2AHRA 4EW3A 8GPBA 2QJTA 1Q0ZA 2ANBA 4ZCRA 3K7EA 3G2NA 2XWBF 5COQA 3ABKB 5EE1A 1IMOA 4EZEA 4UUOA 2J45A 4JGGA 1T4GA 2X77A 3QE0A 1N5MA 2RJZA 1T8RA 1N32B 1SH7A 4TXNA 2WAYA 3KWMA 4HMPA 3D7MA 5AI9A 4X9QA 5AW1A 1PO7A 3U49A 1XQ8A 3A0HZ 5AXCA 1RR6A 3CE9A 5HZGA 2NXCA 1FXSA 2ZQMA 1KQPA 1UT8A 4GRDA 1VQ4V 1BFUA 3ROTA 1SUEA 1VQOV 4IHQA 1T8SA 3LF1A 3WP1B 2DKOA 1EN6A 5CURA 2GKOA 4JUIA 5KYYA 1FA9A 1YRYE 3QUBA 4YAGA 5HJ2A 4WA7A 3OHSX 4LV8B 4XR4A 4JWKA 1A7UA 3DLAA 1J5EO 1BZKA 1XU9A 1OI7A 3KQSA 2R6HA 4RPIA 3G49A 4OK6A 4HWKA 4EITA 2JI8A 3A1VA 3SZRA 4C0AC 3UWSA 5CYGA 1X6VA 1OHHD 3GFBA 2GCEA 1JJIA 1GPDG 4ZA2A 4HUJA 2COUA 1Z88A 1YDXA 4UZFA 4N21A 1P1CA 1I7PA 3HFRA 4YCMA 4LHWA 2Y8EA 3QWHA 5K3CA 1NQTA 4P7KA 3MVEA 1OFHA 4L28A 2HGZA 5IXYA 3OM3B 4U6SA 2A1TS 4UE2A 2QD5A 2FU5C 3ISVA 1E79D 5FR2A 4C21A 4EQ6A 1QLEC 4UU7A 2P0EA 4H7HA 4AILC 3B8NA 2AJTA 3PDIA 4NBWA 3TZKA 3U7HB 2X58A 3V4PB 3RU7A 1XL6A 1LS6A 3FB4A 1SXIA 3VYUB 2DCMA 3QEAZ 4LWOA 2RHRA 1OCOB 4PYQA 3D0RA 1YSCA 4YP0A 4ACAA 1VJCA 3IP5A 3ZHOA 4GMFA 2QL6A 4AROA 3G6BA 1JSLA 1Q3KA 5L8VA 4J07A 1HNWB 2Y1GA 1BQZA 4UBLA 3E1GA 3FPSA 5DLEA 3A31A 1D4FA 2RGRA 3GQVA 3MINA 1CG6A 2F2TA 3HE3A 1BVUA 3IHLA 3MUNA 4NI5A 3RBZA 1R18A 3THYB 2WV7A 3AKZA 1YULA 3B1JA 4NU8X 3DFKA 2FN7A 2ICAA 2NXWA 3D3WB 1OXUA 1QH1B 1D7AA 1ADJA 4AWBA 1EKXA 1I7LA 2NZYA 3OCXA 5AW7A 1JSCA 3WYGA 4DJDC 5EERA 4C7BA 3FX7A 1XZCA 4IO0A 2ODBA 3BS4A 4YMHA 3EIUA 2ZYWX 4LJ4A 5T41A 2DMRA 1QG0A 2CDBA 1XFAA 2JFOA 3M70A 4DSUA 3KZKA 1Z2GA 2RGGA 2XKKA 4PIVA 2LP4Y 1NVPD 4ZBMA 3D7SA 4X7RA 3VKVA 4NZ9A 2PK3A 1EA7A 1FNSA 4IRMA 4K3VA 3FBTA 3WWYA 2HTFA 5T4HA 2PMBA 1YJ5A 2XA1A 1CE8A 5KX5F 2P8SA 1KEKA 4BATA 2O3QA 2GPWA 2WUWE 3JRNA 4UU0A 2JGEA 5HKBA 4JVSB 4YUYA 5IZCA 2JK0A 3E2MA 4V0KA 5FL7A 1VMIA 1R0LA 1IWBB 4MW1A 3DGEC 3KV1A 5ILGA 4B85A 2QM0A 4QXRA 4D6PA 1X0VA 1YQDA 1IRIA 5LM3A 2HA5A 1K8YB 4QPJC 1WEKA 3AUTA 3AR7A 1KH1A 1UWZA 5BR8B 1EWKA 3AG6A 3UH1A 2YWCA 1YA4A 4ND8A 4JI0B 3M5DA 1TM3E 1S02A 4RACA 1W44A 1EFHA 4AWXA 2XJ9A 3R3HA 3D54D 1ZAUA 1R66A 2VJNA 3PUWA 3PXEA 3GFTA 1ZQ1A 4E6PA 2PGDA 2ZBDA 2VXCA 2C00A 2EU8A 2OV6A 3EFBA 5D3QA 4NZNA 5DI9A 2F93B 5CDGA 3LW7A 3R2JA 3IAAA 1IXYA 2JD2A 1QHNA 1RYHA 4YMIA 4AZ3B 2VBFA 1KEVA 1TK3A 1UBCA 2GZ2A 5JNRA 4FHEA 4RQAA 1BWSA 4QQRA 4PZYA 5ALPA 5FPPA 3QIAA 1MZEA 2ZSHA 5JY6A 2XE4A 1H69A 3ITDA 4ZKDA 2AD5A 1P9LA 3A9VA 2QDXA 1K2WA 2L35A 1SURA 3D3EA 4MQUA 4LCEA 4H6XA 5ALFA 3DZKA 3QU4A 4I1YA 4BVGA 2YHBA 4FLTA 2I1VB 4BU1A 3PEFA 2R87A 4FE4A 5EC8A 5JQGB 2FW1A 2OHVA 4WXRA 4MI3A 1I32A 3HPQA 4KE9A 3EH1A 4OA5A 1EVIA 2ZWPA 2DWDC 4X85A 2B9ZA 4XYGA 1HSOA 1T2NA 1A2BA 3W6NA 3VU9A 4KNVA 2PZAA 4C0BA 3M49A 5FPQA 2BDTA 3FYUB 5ILOA 4DV3O 3VO2A 2BR3A 5E6UB 4C9BA 2ZS7A 3LECA 1QDLB 4QTTB 3RN4A 2CL5A 5KA6A 1GTL1 1IHYA 1X38A 3W5AA 3EXEA 3QVJA 4X1IB 2BSQA 4O2AB 5KZMB 3HBMA 3OG9A 1XXHA 1KS9A 4ZO4A 2Z5GA 1DJPA 3SR4A 1XQWA 3NZEA 4OA8A 3MT7A 3MPUA 4I5FA 3QEMA 3TIXB 5A4AA 1TIPA 1IPHA 3ZYZA 5L40A 2QN2A 1GAXA 4NENA 4S1WA 1JEDA 3LDFA 4LFCB 1QAOA 4JQYA 2H85A 2G17A 4KJXA 3TSWA 1QP8A 1CJTC 4QG3A 2OIEA 2W0MA 4M0CA 5HFJA 2IYEA 1AX9A 4IVNA 1Y3DE 3E3NA 3OBBA 2JFZA 4YK7A 1W96A 3JTMA 3OIDA 1FUEA 1W35A 3G23A 5KNDA 1U2ZA 4WOBA 3CNHA 2PGAA 2H57A 4I19A 2W5UA 5DRYA 3UKOA 4IIUA 1E0KA 3Q72A 3VHXB 16PKA 5AW6A 4NU0A 2LQTA 1QM5A 3EMVA 2QSUA 1U2DA 2YWRA 1DV1A 1GDTA 4EUKA 4UPVA 4OQNA 1JFFB 2ZNVA 1OFTA 2XQKA 3ITNA 3VI3B 3TEFA 3U3DA 5FOWA 2X7RB 3DD5A 2G7ZA 2EJVA 3P9NA 3OA2A 3SDSA 3WU2Z 2CFCA 3H4VA 5KYWB 1A7JA 1K7SN 1W0KG 3FTNA 3D3KA 4FHZA 2ZPAA 3CWCA 4F4FA 1SKMA 1E5VA 1NM5A 3OP1A 2C82A 4RE6A 4JBWA 3UOGA 3WQBA 3R0XA 2IXBA 2WKQA 1XCMA 4ILEA 1OXSC 1R00A 2RHDA 2W6MA 2DB3A 2RSLA 3FROA 1V9LA 1MO2A 3UK6A 1M7HA 2PS3A 3L0OA 1U5AA 1O96B 4HRWA 1SZJG 2PO5A 3ZWCA 2J59A 1KY5A 3CZMA 1OIWA 3ZK9A 2J31A 4RPCA 3TXSA 5A6VA 1TA4A 2AMLA 3FZGA 2HHJA 3QHPA 3OC6A 5EYPA 3QFRA 4Y1EA 4NKRA 1OYVA 2PTHA 2QG6A 2ZJ6A 4E15A 2Y0CA 3H5WA 2FETA 4COKA 2EP8A 5I4BA 4GDMA 3OLWA 4MPPA 3FNIA 1O8BA 1NBAA 3PJSK 2Z0MA 4LS3A 1NMXA 2H1HA 2QE7D 3B09A 1ODCA 2AHZA 4OU4A 2QN3A 1MTZA 4P32A 2D8MA 3RUHA 3TPZA 2BMAA 1QQ5A 2QMZA 2ZI3A 1HRKA 5HIIA 4PBTA 2FXVA 4WOCA 4WRRA 3AK3A 4J7UA 2Q6IA 3U7QA 1KI2A 4M0DA 4BFZA 2EULA 4HAMA 5C81A 1QRDA 1UP7A 3B52X 2VNKA 3IQZA 1P31A 1UUFA 2VAMA 3BRWA 1I24A 2XAUA 3LNMB 4KPEC 1OAOC 1X15A 3ST7A 4G5HA 3EGWA 1C9YA 4WCDA 1ULSA 2OCHA 3QRWA 3DXXA 5M29A 1SCAA 4OX9B 5FI5A 5EBMC 3IS3A 5CB4B 1FYDA 2YV1A 2O7NA 4LJSA 3UG6A 4CV2A 1ZKDA 1SXGA 1JWAB 2Y71A 3TLBA 1GKLA 5CLQA 2C4TA 4A5UB 5BXYA 2Q6TA 1KIFA 5KYVA 3PWZA 1Z16A 2A5YB 3C3BA 4XAQA 4M37A 4BKPA 4GOJA 1OZ0A 4ETWA 5HTOA 5T3YA 1V6CA 2NM0A 3QNWA 4L9SA 1V9CA 1XT6A 4G1VA 2CH7B 4JJFA 4BN0A 5AKXA 1YITV 1II8B 3DLTA 3F1LA 4EGCB 2QW0X 4CZZA 1E2KA 2OBMA 1WJGA 3T3GA 4QATA 3KJXA 2H1FA 5TVKA 3M5CA 3UYKA 4YUVA 4NCAA 1JHPA 1NZJA 2OILA 1EVQA 1PR4A 2V55B 2C88A 3IT0A 1N2HA 2P2DA 1UFOA 3QELA 1RMQA 5EUQB 1N78A 3PHHA 1RYEA 5GADl 1P39A 1GY8A 4V1CB 1EI9A 1R0BA 4FSXA 4EL0A 1AC5A 1FJ2A 4N65A 2P7TC 1KI9A 2HHHO 4IM7A 4QRHA 3L6OO 5GJCA 3PWSA 2PIAA 2RGYA 1OU0A 1JKFA 4BNTA 1F0PA 1P4GA 2J9RA 4GI7A 1IXMA 3KUDA 3LCUA 4E08A 2NAFA 4ABMA 1RRFA 2MR5A 1GXSA 3GVPA 2Y92A 1QV6A 4E4YA 4S1PA 3NVDA 1PUIA 3HVKA 1W4BA 1DQRA 3UJAA 4LNUB 5H6QA 5DLQC 5E1OA 1FLVA 2LTAA 1UMKA 2WJPA 3TL6A 2BFBA 1Z8HA 4BIIA 2GCOA 3R7WB 1P2FA 3IHWA 2AA3A 3B3AA 3ZCQA 1YFZA 1Q0PA 3KCQA 3R24A 5HR5A 2ZVJA 1ECLA 2HVWA 4JAAA 4LOIA 3F74A 1IBLO 2BGWA 3ET4A 1ZHOA 3BMOB 3ZJVA 1ZXXA 1VE5A 2Y6VA 3IBSA 4YN3A 1PR6A 2D2FA 2V5AA 4Q47A 4KUGA 2I4RA 4PDMA 3QXGA 3K79A 2Y0BA 3ZIUA 4F6LA 9ATCA 1V1RA 3KB8A 2VWJA 2F8MA 4J94A 2B1RA 3D02A 3HB3B 1S3IA 2Q8VA 5JCOA 4MPJA 2Q0AA 3L7AA 2VBGA 5JAHA 1TVKB 4RHEA 2I1WA 2XODA 1K86A 2CMDA 4XVUA 2ZYVX 2ZIEA 1P0PA 5FOUA 3TW4A 1NYQA 3I01A 1QUEA 4YT8A 821PA 5JLJA 1LBSA 1QIKA 5LQAA 5B7PA 1UH5A 4MUFA 3V3KA 2Y66A 1FPOA 3NUZA 4PSAA 4UE6A 1ZUD1 4IHJF 4JBXA 2ZB3A 4AXBA 3U4QA 5C46F 1II9A 2R96A 2G0NA 4G5SA 3K5WA 1DRKA 2QTBA 2NU9B 3G8YA 4ARUA 3S7ZA 3COZA 4BKRA 1CP2A 4BX0A 1SBHA 1DBQA 4REMA 3RRFA 4PY2A 1FVXA 3QFTA 5HS4A 5IULC 4QAJA 3KTFA 2G6TA 3ZU3A 4Q7KA 3OM1A 3WNZA 3OWOA 5IT9A 1PZMA 2HXYA 2P2NA 5BVHB 1M1YA 3OLYA 3PDHA 5TMBA 2RHOA 3I2IA 1NVPB 1XLTC 3FKSA 1VFNA 5KJ6A 2Y93A 2ZJ2A 4WY2A 1D4AA 4IS2A 2OO5A 3STTA 1QKJA 1DUVG 4RCZA 4LISA 3A1NA 4PYRA 3KWFA 1RWWA 4X9XA 4KYVA 3PA6A 2X14A 1NKVA 3H9EO 5HKOA 1DBWA 3GLIB 5ICMA 3SJ7A 1LV8A 1UPAA 2YEVA 2I9KA 1Y0BA 2X40A 4EG3A 3WIVA 4V0RA 5I9BA 1MB4A 4UMVA 4GLOA 4IMRA 4GGMX 1M2KA 4JQZA 1VQ9V 2OKCA 2GTPA 4HYQA 3J81k 4XPZA 1IVYA 2Y9MB 3TL3A 3JQCA 3GHYA 4C7MA 2JHGA 4EJFA 2HDOA 2A0UA 4UXHA 4BKQA 4PE5B 3HXTA 1Z6GA 2QN7A 4BIMA 3E1KA 3L2OB 1X7HA 2XGJA 3A7EA 1ZO8A 4A0RA 4EF5A 1QIGA 3BWBA 3SSOA 3SZOA 4BTVA 1U97A 3NRJA 2O54A 1T5BA 5BWCA 2LGQA 1F51E 2QENA 2GTIA 3H11A 4RVFA 3HR4A 2ZANA 2R44A 5CYPA 2AZ2A 1NC1A 4AO6A 5IJ9B 3OX1A 4HP8A 1D2MA 4P2BA 3KZMA 2NLOA 3QVMA 3SMVA 3PJDA 2XXAB 2YX1A 4X45A 1WXWA 4Q24A 4GOXA 1FYXA 4MYHA 2W4IA 2C2ZA 2PJUA 4PQRA 1GTG1 1GFZA 3V9AA 4YP9A 4G1CA 4XFKA 3RBAA 4JP8A 1IVSA 3F7NA 3D81A 1NJ5A 1L7OA 1FFHA 7AT1A 5DNVA 4RH0A 2Q3DA 3K8OE 4E21A 2LZ0A 3REOA 2FSVC 3SY8A 4BVJA 4NCHA 4F21A 1L5YA 1WU7A 3IE0A 3TW8B 2WIFA 2PUFA 3KR9A 2A92A 1QQAA 2WTEA 1W87A 4CU2A 1TA0A 1VL1A 4BXOB 3MQ4A 1IXKA 5FPRA 3N0XA 4KHPB 3IAS1 4GNRA 2J3EA 5CDUA 4Z2WA 1VKNA 3QU7A 3COJA 1PFVA 5JSZA 1V9PA 3IO5A 4EFNA 4OVKA 5I7RA 4G5XA 3SYQA 3LUFA 3GPBA 1FNNA 1NXOA 5D3ZA 4BIZA 3I6MA 3C5EA 5JQGF 3HM9A 4LHXA 4UTPA 2D8AA 2Q6OA 1XG5A 3DWIA 2NN4A 4LMPA 5BOSA 1SQVH 1MN6A 3NYWA 4UASA 4UVCA 2IFTA 3UAVA 1IWPB 3S1LA 2BMEA 4MV0A 4Q4JB 3KYCA 1HEYA 4X20B 1XL4A 4EFEA 1RDFA 2WOOA 3T3EA 3I04M 3ROPA 3W4KA 3NJRA 2FPUA 1XRMA 4DLNA 1YMQA 3W9YA 4CLDA 5SZKB 2CVZA 3RH0A 3QVNA 3KSRA 2K4MA 5K0CA 3KYJB 4OMUA 1I1NA 3JQ8A 1AKNA 3FAVA 3LZDA 4KQJA 3DQZA 3D7KA 3JYLA 4FIZA 4I9GA 3DYBA 4OQYA 5A7FA 3BD8A 3CMAV 4JI7O 4LHZA 3FPAA 5L7YA 2HJHA 4Q6GA 2XYQA 2DJVA 3RVQA 4O2AF 1T6ZA 3PPVA 5REQA 3HVHA 1AQLA 3PD1A 4R8VA 5B7GA 2B1GA 1VE9A 3ORYA 4QULA 2CE4A 4XDJA 3MUEA 2QMEA 3EE6A 4QQ8A 2DQKA 5G1PA 5ERGB 4R6XA 3DTTA 1NF8A 2X5OA 4OPMA 4YMSA 3VJLA 5EY5B 4PXAA 1GILA 1IZ0A 3HYLA 1W25A 2P77A 1NTZH 4Q4CA 2GM4A 1YQ9A 1XC7A 4YBZA 1V11A 2LP7A 3E05A 3OU7A 2ZUVA 3QI2A 4OD0A 1NXTA 5B1AC 4Y9RA 5BY1A 2OZPA 4F8JA 1PNOA 2C4HA 4G1BA 4Q02A 4ZVOA 4J9UE 3F9RA 3VQYA 2AIRA 4DR1O 2JCYA 1GSOA 1WXFA 1MG0A 1WTAA 4I8DA 4B71A 2NPFA 2ZYSA 1ABFA 3RSSA 3F98A 3MMNA 2ACKA 3S6JA 4DIUA 3MLEA 2VZ0A 3RFTA 1RZVA 4V3CA 3H3FA 3QVGB 4Z0HO 3ASNB 1UM8A 5T4EA 4QYWA 2Q2NA 2ZE5A 1BWRA 2O4UX 3QJ5A 3BZWA 2XOKD 1NR1A 4KUEA 2W4QA 3V97A 4R7GA 5LD2B 2X8WA 3ROEA 3LHIA 5B6JA 3BMNA 1RB7A 3L84A 2FB5A 3HDQA 4BRSA 1QRAA 3JSAA 3P0RA 5AHRA 1LA2A 3NLLA 5J59A 4F3RA 1E2LA 3O31A 5ED4A 3WBKA 2A3RA 2P67A 1DX6A 4DA9A 2VQEB 5AW3A 1OYWA 1QIFA 4BX3A 3I58A 4MUNA 4K3AA 4Y1RA 3ZHRA 2EARA 3I9FA 1XO1A 2C99A 3TQHA 5JANA 5B3LA 4Y6SA 2YWJA 1V5IA 4E5DA 4BJ3A 3D4BA 2OL4A 3K9QO 5DNDA 4YRTA 3SIPA 4YRRA 1IN5A 3WYCA 1FLNA 5CVTA 2IODA 4LX8A 3VDMA 2QR5A 3DL7A 1PGJA 3RODA 3IUMA 4Z1MA 1TMOA 4G6ZA 3IUBA 2IPOA 4NR0A 4F04A 2Y0PA 1EQUA 2B30A 3CTPA 1SKVA 4C5CA 3TZLA 5ES3A 3NNDA 4CM7A 1TUBB 4AQYO 3UUWA 5J4HA 2CLKB 3PI6A 4BMOB 1CDOA 3WV4A 3I92A 2C1XA 1JR3D 5TF0A 2ZSDA 2YICA 3QE2A 2NN3C 2SICE 1X7ZB 2IGBA 3HDTA 5DBOA 1KZ4A 3DG9A 4WINA 2J46A 3KQHA 2ZT8A 3F5DA 2XQGA 1O8CA 4FGWA 2BI7A 2WI8A 3CG4A 3LBYA 3CVXA 3A6DA 4K0RA 4ALJA 3CXUA 2PFKA 4ETNA 3OEED 4GU5A 3CX4A 3M5WA 3BD9A 4EKEA 2Z3YA 3ZH2A 2BUCA 3H42B 2MCFA 2WUEA 3OUTA 1UIMA 4OXQA 3RB8A 2ADOA 3WB1A 3AO0B 1RKBA 1GYRA 3EX7C 3RK4A 2P9HA 3DVLA 1NQAO 4LQDA 3I6QA 4MWEA 1NLZA 2QUIA 4YCCA 4GXNA 3GVIA 4TUYF 5K9ZA 1RACA 1CLUA 5CB4F 5I5GA 4NTXA 3JV7A 4NE9A 4GOND 5JZ9A 2CXQA 4EWLA 3TCUA 4OTZA 3CZQA 1AR5A 1QQBA 3IA7A 1P7PA 1FJGO 4EW1A 3HB9A 4DPMA 1FZQA 4HOYA 1QMGA 3H2SA 4BNFA 3VPDA 1TOAA 4KQEA 1TX4B 3QG1A 5K01A 5A5FA 1M6VA 5TY0A 3PQ8A 4NY1A 4MVMA 1YCGA 1OPXA 1M6NA 5E7IA 3SXUB 1ISJA 2FLWA 4EZBA 2XIJA 2VDQB 4WFIA 4LSZA 1E2BA 4RZQA 1MHTA 1EVZA 1Q77A 3FIUA 1Q22A 2ECFA 1DMRA 2FH5B 5KQMA 4QD3A 2N74A 3CR3C 2G83A 1JFVA 5L3EA 5A2GA 1D4ZA 5AVSA 2PE5A 1LDNA 3U61B 1XREA 2RK3A 4GPEA 5K1XA 5LC1A 1T6XA 2DR0A 5PNTA 1N2SA 4HFJA 2WWHA 3TTYA 2ORWA 1N2JA 4G2TA 3AF2A 3AWDA 5JMPA 4GLFA 4FE7A 4Y7DA 1OV6A 5HZHA 3LK6A 2ZAMA 5AW4A 4RZXA 3CJTA 2H6EA 3ND7A 2O0KA 3W2GA 4HUQB 3T7EA 4BVEA 4HWPA 4RPJA 2J7PA 3E58A 4FHGA 1IBRA 4LCBA 4BDSA 3AESA 4W9RA 3UQYS 3CZ5A 1TB4A 3MA0A 3UAOA 1RJ9B 1LBQA 4NEQA 2GEVA 3SQWA 9ABPA 1NVKA 3CCMV 4BIUA 2CDRA 1EK2A 3QVSA 1MEOA 1NJSA 5ECGC 2QTGA 2NO4A 1JTEA 3OJFA 2JLCA 4FMBB 4HEHA 4G0VA 1YK0A 1DARA 4WWHA 4EJSB 3D8SA 3JQ9A 1T9KA 1PTKA 1Y1QA 3BE8A 5DHRA 3GPLA 2WFLB 5EQFA 4ZN6A 3V7UA 1S2IA 2BLLA 2VCEA 2DMXA 1QLJA 1ZJ6A 3O38A 2O50A 5IKOA 3UMRA 3A4MA 3CWZA 2EIJB 3EZGA 2WTAA 4URHA 4ZT5A 3MAQA 2PQ6A 4IXDA 3G9XA 2HXGA 4OQLA 2O8DB 2DM6A 2QYOA 3FB5C 1HOTA 1O89A 1LLDA 3F46A 4P33A 3QY9A 1Q3HA 1FUKA 2VQ3A 1R12A 1FFWA 5B53A 4BLRA 1P3DA 3CH6A 4K6CA 4AIRA 2YXBA 3T7IA 2PUGA 1FRZA 4JT4A 4YP7A 4GF5A 4GECA 4KN8A 3VU8A 1HL7A 2B2NA 4QBTA 4Y7CA 3WGMA 3CPSA 1V4VA 3ZCTA 4JZKA 1M0EA 4CEHB 2PIDA 3ZWMA 5JYDA 4UUPA 1P44A 4P7BA 1U8XX 1KYXA 3HKCB 2V97A 5CA0F 2H5JA 3DAGA 5GTHZ 1L4GA 3GJYA 4YRNA 1WB6A 1DGQA 3G4SV 5D5PA 1XELA 1MB9A 4TMWA 3GROA 1VHTA 3NCTA 1E1RA 3IOBA 4K8ZA 1FQOA 2XGGA 4JJ7A 3ZCCA 3PQEA 3KKYA 3GCXA 5GTDA 3Q0EA 1AF4A 1GNQA 1G2QA 1IEVA 4L2IA 4MYUA 3T5BA 4X90A 2AJDA 2N3ZA 2DFPA 4EEZA 5BSVA 2CDYA 4L74A 2VRBA 2JFXA 1VJTA 4N54A 4IDCA 4MQFA 4UW9A 2CJWB 2C5FA 5IG2A 3HU5A 4AO7A 1ZSVA 5BYBA 2GZHA 1QO7A 5DASA 1J9EA 3BE4A 3I0NA 2GAIA 1F06A 3ICWA 1QK4A 1R4NA 3WL5A 5D5HA 4JV5O 2BTEA 4FCVA 4DMHA 1PGOA 1WA8B 2ERCA 3MGKA 4XD2A 1DG9A 3KAJA 2OBLA 5CCDA 5DM70 1YJQA 4KWIA 2POCA 2HLDD 3CP1A 2IY9A 3WGKA 3PR3A 3ZMSA 4QM6A 1H2ZA 4TQUS 3VR6A 4PYLA 2EFGA 2X42A 4I0XB 3U40A 2CXSA 2AN5A 3K9FC 1DTSA 3WKAA 4TLBA 3EQ2A 5IDWA 1A2OA 1JW9B 3O21A 2OENG 2HJSA 1Z7BA 2HF7A 5G4KA 5SY4A 1E2EA 5B66Z 3N0TA 4II7A 4C0KA 1VJGA 3DZCA 3LPCA 1A9XB 1XMVA 1BCSB 2X2OA 4ABYA 1GSAA 3FLAA 1T9CA 4INAA 1NHWA 5LB4A 1J0EA 3GJRA 2GH1A 4I0WB 2BGNA 1ETHA 1UEXC 4RTLA 3RC7A 5L7TA 1UJMA 5BT8A 4URYR 5I51A 3SEQA 1JECA 5H2FZ 2F90A 3HN7A 1FUYB 3BJZA 2X7XA 3DZBA 3I9MA 3QJGA 4LI3X 1F0NA 1HTBA 2LPMA 3FHJA 1VLVA 4B6EA 2EGHA 3U7IA 2B3JA 4RY2A 4EYGA 1C50A 2XRYA 4R9SA 2XX3A 4TWAA 1IM8A 2X8LA 4KTTE 2I0FA 1XAIA 2YN0A 4B2YA 3ZHTA 1G20E 4HDQB 1GUBA 5BR7A 4B7ZA 3UC9A 4RK4A 1WP4A 3OU6A 3SYCA 5FOVA 2Y99A 5IANA 2YZNA 5JSYA 5K6AC 1B2RA 2C3MA 5J9FA 5CXXA 2CUKA 2GCPA 4K05A 2O2IA 5IUNC 4MINA 4WNIA 3EDQA 1BROA 1CZLA 3NDBB 3JALA 3I9LA 2BUAA 2AMYA 3D6AA 2E6UX 2H4ZA 3WYEA 3ELYA 4EHNA 3ABSB 4MVWA 1KZYC 1EMDA 2A9PA 2RD2A 3GMSA 1HE2A 5JJCA 1M56C 3R7LA 1XA4A 2ZEJA 4Y3UA 4FFRA 1KI1A 3PLAE 1QUFA 4RHCA 3CUKA 4LRXA 2CXOA 4WD3A 2PPLA 1TL7C 1IB0A 4LHEA 5DW3A 3NP9A 3KNZA 2CZQA 1JKJA 5AOBA 2OQVA 5BVGB 3I09A 2QN8A 2C7GA 1OH6A 3R0ZA 2Q6VA 2EYUA 3FDZB 3MJ4A 1C8BA 1QANA 1OAAA 2ILTA 4ZCSA 2ZE7A 2V1DA 4P3NA 1Z5OA 1QLHA 2VF2A 3DVQX 5KTTA 4B2PA 3IAYA 1A4XA 2JLUA 4X97A 3AR4A 2VR1A 3AETA 5EPOA 4FYIA 2RGNA 2A9JA 5FWYB 4F3YA 2Q99A 1TO1E 2PLRA 4BO9A 2R7LA 3JWIA 2CEAA 3M5PA 1Z2DA 3TZCA 2NU8B 1G16A 3IUSA 4MW7A 3EBPA 2WIKA 2AFVA 3VR3D 4YHHB 3KP1A 2GBLA 3KYBA 1PHRA 3DAOA 4XWAA 3DLHA 2E82A 5KOIA 3AM1A 4LWQA 4WBXC 5LUAA 3EVTA 3OP4A 2GJSA 2BOCC 3CGWA 2YC0A 4GMDA 4DXHA 5CT9A 4E4RA 4D9JA 3E15A 3CCBA 4GYCB 2GV9A 4PF1A 4UAUA 1JUDA 2VT3A 7MDHA 3JARA 4WCEV 3UT5B 3OFND 2WLIA 3NHAA 5IBQA 1WOYA 1AN0A 1I51A 3U37A 4WDRA 4X6YA 4Y6RA 1U4NA 4FZ1A 3LT4A 5H6RA 3AR2A 3SE7A 1U0SY 3ENKA 4AUKA 1ZM4A 1OLSA 5AW8A 1W5BA 1J2TA 5DSXA 3BH6A 3W05A 4B3XA 1OLXA 4WDQA 1N9GA 2DZDA 4Q9NA 5AM1A 5JD3A 4RHUA 2D5AA 3R40A 4K9RA 1R8SA 4MVRA 4JEIA 4X41A 1XKQA 1WMSA 5HKKA 1ZNQO 4NK5A 3UFXA 3PVSA 5CJ2A 5GINE 3AEXA 1XNQB 3I76A 2YXHA 2J0UA 1HNZO 2E21A 5LJLA 5KVVA 5I3ZA 1EVKA 4S05A 4X3CA 3MB5A 2IWRA 2CUNA 4D97A 5KHJA 2QROA 1Y3FE 4P7FA 4CQMD 4RABA 5CVDA 3DV2A 3PVZA 2XBMA 1NRIA 4BQNA 4GEKA 3KKPA 2PDAA 3KEGA 4CT0A 3L72H 1ZWKA 2ZQYA 4ZREA 4Y2HA 3O8DA 4DV2O 4TWRA 3FG9A 2QRQA 4BO3A 4E5VA 2GF9A 4NZZA 5EAIA 3NEYA 2Q28A 1PDWA 2QTLA 4WLVA 2MINA 5B37A 1ZGZA 3BWEA 3HYSA 3AJAA 4NQLA 2IHZA 5GM2A 3S68A 3ZDXB 4PXYA 2ZWIA 4Q9AA 4OBBA 1B14A 4LWSA 1E5LA 1VB5A 3WMFA 1MO5A 4BMYA 4DMKA 4QUDA 3DW3X 4D4JA 3TEJA 4HVTA 4D44A 4X88A 2IYWA 1SN7A 4IP0A 1PBTA 4BLTA 1SS3A 1ZFNA 2QVBA 2GNAA 2I3GA 3ZI7A 3BKWA 3PS9A 2CLIB 3E3MA 2EG5A 1P2DA 4A10A 3ESCA 3E89A 1DCMA 2NU6B 1ZGHA 4DJJA 2XCQA 1AQNA 3NEPX 2CV2A 4EI2A 2Z2IA 1U2GC 4JBHA 5H5NA 3AFIA 1REQA 3EN0A 3PFKA 4Z1OA 3G8QA 3RUDA 1KVRA 5I45A 3AG1C 3M4JA 3RRXA 3SPCA 1TCCA 2IA5A 1WW3A 2G6VA 1LQTA 1NVUQ 1NGSA 5EJEA 3I61A 4IHJB 4YFYA 4DLAA 4JASB 1ZRNA 3FTFA 4FBGA 3GO4A 1S4MA 4I4CA 4ZEOA 3CR8A 2HU8A 1JDPA 4QLAA 2KWIA 3WKCA 2C95A 4YRCA 3OQVA 3KX2A 4E88A 3RVBA 4ZXPA 1UP6A 4NVPA 4C22A 1JZSA 1MPXA 1PYDA 3HVUA 3IQFA 3ZQUA 3KYDB 2EXXA 4TT3G 3PNYA 2GJ4A 4P5DA 3P7MA 5L3FA 1YVEI 3CUSA 3GLHB 4F06A 1OI2A 4WLNA 2QEXV 1WO8A 5HBRA 3VPAA 2C2WA 1SA0A 1QCZA 1RI4A 4M49A 2VXYA 4YRIA 1PS0A 1NUHA 2QNIA 4EY8A 4CODB 2J6BA 1F5SA 1RM1B 1B93A 3WSWA 1FU8A 5CGZA 4S0XA 2DULA 2IY8A 5JD5A 2JH9A 1C3XA 1EEXB 1PJAA 2PXAA 3X2EA 2P5OA 2JJ2D 3GFQA 4CQLA 3Q0IA 3SFZA 4L22A 1E8NA 2CVFA 4IIVA 4P0PB 1FKAO 3IR6A 2IV7A 3AERA 2FNAA 2WTMA 3B7WA 4PC1A 3M6UA 1U5BA 4JITA 3ZS9A 2HLHA 3WB9A 1OBFO 4LHVA 4MS3B 2Q8QA 1PK7A 3H8WA 1OGJA 4MQMA 4EEQA 5JNSA 4EEXA 1H5NA 1IBCA 3CNNA 2A14A 4ITVA 3ABUA 4KXRA 4E51A 2G8LA 5DHFA 3TJRA 3G2JA 5KCMA 1H1DA 4IYHA 3EVNA 3SKXA 4ZTUB 2OB1A 3CRAA 4PLYA 1BAPA 1CB0A 2R8ZA 2I5PO 1HE3A 5BQXA 4JENA 4AX4A 3QPUA 2BKEA 5LDDC 3WWEA 4IW3B 1VLHA 1UKVY 4U6QA 4LY3A 5EIAA 2NWQA 3DYIA 1ORQC 1A9PA 2VHYA 3SEAA 2Q6KA 1GN3A 1PWXA 2Q9UA 3MAAC 4O2RA 4IF4A 3H7AA 3MJCA 3ZHCA 3NR7A 5LKAA 1CRWG 3G6EV 4TMKA 4WUTA 4HL6A 2Q5FA 1N2IA 5E8JA 1UZLA 1VDMA 5DCYA 3W8EA 2DAPA 3GJ3A 3E86A 5IDXA 5A9SB 2WPDG 3IR7A 4MGYR 5FP0A 3TPCA 3NPAA 2GM3A 5SICE 3MFQA 5ANRB 2EDAA 1J6UA 5I7FA 4C01A 1KY2A 1WNFA 1VEWA 5BNZA 1O0CA 1C9DB 3WSVA 5F2KA 1OD6A 4GRAA 2CNNA 3AUSA 3FNRA 5FPKA 2WIAA 1T8WA 1CR2A 5TXGA 2Z98A 5ALLA 3J81N 1CJBA 5TPZD 4PS0A 2HVVA 5KYUB 3B2NA 5JNLA 5F1OA 1N4DA 2X4IA 2C4VA 4PQGA 4IJUA 2YJTD 2WMYA 2H2DA 2G5GX 3GNTA 4F3WA 2W70A 1YKGA 3LL7A 3FOWA 3L8EA 1WOMA 1FY2A 4EOGA 3A4NA 3IVMA 4KYTA 4MYDA 3AJ9A 4UHDA 4KNYA 4K26A 3O73A 1GPLA 5FUWA 1XSEA 3E2PA 2AE2A 4FYHA 3E22A 2GCIA 1UKCA 3QU5A 2OK7A 1N8KA 1P2UA 3O8CA 5FWXA 1MVNA 2FRDA 2XMGA 2EL7A 3GLFB 1CUGA 5IXJA 5JDIC 1SBCA 1X42A 1MOSA 1KMHA 1MABA 1PSWA 4YRQA 4LXTA 5FLEX 4IX9A 1Y7PA 5DCWA 3F73A 1THZA 1UZNA 3NBKA 2RB4A 1YQQA 1E7WA 2NZVG 4P0QB 4QGBA 1V5GA 3KKOA 4FDTA 2QB5A 2DFNA 3NRCA 4H6VA 3ZTWA 4B33A 3LYHA 3DDNA 3ZD7A 3AUUA 1HETA 5AOCA 4DQLA 2FPOA 5DI3A 4JLMA 4AI6A 3SXPA 3DL0A 4URFA 4W5OA 3HR7A 2WU8A 2V0NA 2DYKA 5JCJD 5LDHA 3PZRA 1RQXA 3IMEA 4HPWA 2A7QA 5K0NA 4PO8A 4CF4A 3MUFA 3AIKA 4RZ3A 3G5AA 3C3AA 3RS2A 1Y80A 3QMVA 4DV7B 1GN9A 3VR4D 5HVNA 4FJ0A 4POAA 1INLA 4CFYA 1YR3A 1JS1X 1K4KA 3N6VA 4C6HA 3DOUA 3GEGA 1O3YA 3KWLA 1UC8A 5DM2A 2ACWA 2IU4A 1IULA 3C16C 1EUZA 4G1FA 3AB7A 3G17A 5C1DA 2AK2A 4Y6QA 2X8BA 4BNNA 4BNKA 3L4SO 2M98A 1UM9B 4ESEA 3OFKA 4HH4A 3GWOA 3T3MB 2H4YA 3SJAC 1RC0A 2P5YA 4RFSA 2B7BA 1US8B 5M52C 2OESA 3FMGA 2GPNA 5TQ2B 2RJOA 4JI2B 2ZJBA 1UC9A 3AGPA 1VLMA 3DMYA 3SQMA 3V8MA 1S9DA 4WBSA 3KELA 3KPJA 1PNRA 2V7TA 4JNCA 5EIXA 4MMZB 1U3UA 3DDCA 1ZIYA 1R74A 5AJWA 1ORTA 4JELA 1OF1A 1OI0A 1FTQA 2EERA 3ZDEA 3RF7A 1ISHA 3GUCA 4HBNA 5FHRA 2VRCA 4OI0A 2ZULA 3F8TA 1MQSA 1KJIA 2H92A 4MGZR 5FO1A 5GV7A 5FR1A 2I2XB 2Q41A 3H7IA 1YDHA 1K2VN 3AF5A 2I6XA 4BCCA 2O14A 1EXWA 5JFGA 1N1DA 1IEWA 1YB5A 5JBIA 5G1OA 1XHXA 4NBNA 3LPAA 4PDLA 1W7AA 2ADFA 4LXGA 4MKHA 3ZRWB 1LQ2A 4MZXA 5IU6A 2IDMA 5CNIA 1DIRA 3FNHA 2XUJA 3LWZA 6PFKA 2O8NA 1GTZA 4A5OA 4ZU1X 3QXXA 4DSAA 5GMOA 3VXKA 1OTXA 4XYBA 1R0ZA 4ZIBA 4F91B 4FK5C 1AQJA 3IP7A 4MB0A 1NSYA 1S1CA 1GOTA 1YVUA 1VQLV 5FLXA 1HFJA 2B5WA 5C18A 1LSUA 4I5DA 5DEOA 1A5SB 4Z8XA 3RCBA 1H8EA 2B8EA 2WT4A 3QE9Y 3KCXA 3FTDA 3LDGA 3QPWA 4AS3A 2D5CA 1TKCA 2EIKB 4AMYA 2BRUA 4W9NA 2ZM6B 4HTAA 2VTBA 2YHIB 2OM6A 3JWJA 3AKYA 1QCYA 5ECYA 4JXEA 4EPVA 2GPSA 3ETQA 1U8EA 2HMYB 4TUYB 2Q9LA 1PQWA 1R6VA 3ZRXA 3OQIB 1Y8ZA 2O7RA 1VTKA 3VR5D 3OIFA 1P5ZB 2VHWA 1QZTA 2V03A 5HS6A 2OCPA 3I64A 2JIZG 2IZ5A 3K9AA 2CNWD 2OKGA 2ZT7A 5C7OO 3V55A 3FX2A 4HCJA 1OSNA 3A9TA 5DWVA 2I80A 1J90A 5IKPA 4C4PA 3FI9A 1NZFA 1IHOA 4FLEA 2YYYA 3E7DA 5KS2A 4BNYA 4MVJE 1XU4A 1X4TA 4RVSA 4DLZA 5KTNA 5JCPA 2O8CB 4Y9DA 4BNDB 4B7AA 1XMJA 3IODA 3C8DA 3FBWA 2C96A 2JJYA 4I66A 5K05A 3W2HA 1S8NA 2F8TA 4X8HA 4B6JA 3GT7A 4J0GA 1E3WB 3L79A 2QMUA 2XTMA 3L7CA 5AYVA 3IUQA 4G84A 2R2GA 4CIYA 3SJUA 3VMMA 4FQ5A 1KY4A 1XIVA 4CQMB 8OHMA 4I8IA 3UGKA 3KR2A 5DHQA 1LPOA 3IT2A 3VX4A 3IILA 2WA3A 3GY0A 1AT1A 3HA7A 2CJPA 4P9DA 4RY8A 1OW3B 1XZNA 4AY6A 4UHEA 5JSQA 1T0IA 1IUKA 5EBLC 2BKUA 3K2QA 2XIQA 1L1RA 3HRKA 2YASA 2YZ2A 3DAPA 3HZRA 4PCAA 1SVWA 1XDCA 3U0ZA 1F3LA 1IATA 1HG1A 5LR6A 3Q7EA 3AR5A 2QP4A 1TVMA 1C1XB 4BB9A 1OFGA 3W79A 5DYWA 2DG2A 3RF6A 4JBIA 3LNTA 4F2DA 4HJXA 1E4VA 2FSGA 2ZBGA 3VHLB 1P4HA 5TLSA 2IS2A 3IAXA 3F7OA 3FUTA 4F56A 3KK0A 4CH3A 5ALNA 5EZ5A 3AG3B 1ZICA 3JZDA 3ANMA 5IM4F 4MIKA 4JYCA 1U9YA 3MCTA 2ZU6A 4U9HS 2NX8A 1WE2A 2PD4A 2GJ8A 5CNMA 3ZE9A 4F6CA 3A2NA 3QI7A 4TWIA 3ANXA 5DV9A 3JQQA 3NTLA 3VDQA 2CZGA 3L4BC 3B3FA 4KMMA 3WI7A 3OA0A 3LKZA 3Q6IA 3EX8A 3QKTA 5ARBA 3GQBA 3DBHB 2QWNB 5FLXN 2I66A 1S1MA 3S27A 2QDKA 5FJJA 3L1HA 2DPLA 1JG1A 2ARKA 1Z4IA 3KAQA 1BMFD 4IXMA 1HXHA 4P34A 1DEAA 2DYSC 1U0NA 4CDGA 5ICFA 2KB0A 3UMCA 1ZVJA 4GI3A 1VJDA 2RE8A 1J97A 1T5EA 1FLDA 1P75A 3L7NA 1M34E 4QJ3A 3LBFA 5CA0B 3C5CA 4C2UA 1UBOS 2FPGB 4HTFB 1HQYE 4CEJA 4YB8A 2RJNA 2E3CA 2AB0A 5E6UA 4WY5A 2FOXA 3VSBA 4MHTA 1NX9A 5CW6A 4IDDA 3M1LA 3QX3A 2CBGA 4PPNA 2V4UA 5I7SA 1JCHA 4DUZO 4EPWA 3W3ZB 2K87A 4IQGA 5EEGA 3ZNPA 4Y2TA 1F4MA 2UZ3A 3AV3A 3GH1A 1Z4MA 2P9TA 2Y0EA 5SY9A 1XMIA 4KL8S 5FYDA 1H2NA 5HIAA 3IC9A 4MUXA 4CF6A 1MT0A 4JEHA 4KX3A 2G38A 2FZVA 4NESA 2NO0A 2YMPA 5JY1A 1UOOA 3SZMA 3KXIA 4C6RA 1NRWA 1DJQA 4LH6A 3LH5A 3QTTA 4C0XA 4LC0A 1DEXA 1CQJB 3L6BA 1T0UA 4XIFA 1J42A 3OMNB 2FB9A 2NSJA 3IYLW 4RHFA 4IYIA 1VBMA 3QBVA 1EJ0A 5HF5A 1D09A 1BN7A 4CHTA 2IDJA 1LK7A 4K0KB 3KQNA 3TIGA 5K03A 3KSMA 2J5KA 4MUGA 3ZZMA 3MCUA 4E09A 1XHLA 2W6ZA 4H0NA 4X94A 5I7AA 4JLOA 5B3JA 1ZAKA 5LYJA 1DLBA 3ZDRA 4DJ5X 3IELA 4NVRA 3GVXA 4N5DA 1NPDA 5G3YA 4US1R 2I4MA 4DG9A 1NF2A 4KR3A 1Q20A 1VF6C 5IZ4A 9MHTA 3IQDB 1NVBA 2WTUA 5HOQA 2FKXA 3HA5A 2PX6A 2P27A 1H2LA 1XMQB 4HWRA 4IQ0A 2A67A 2EJTA 3R5XA 1WMEA 4KVGA 5KYWA 4L3OA 2O0MA 2QPTA 2R6DA 3LZ6A 5LZ4A 1FD9A 4JJ6A 2RIRA 5DGTA 1Z8FA 1VB3A 1VI6A 1GTRA 4CGZA 1YTUA 1LWNA 4FFMA 3RZVA 1OWMA 1QOZA 3CF6R 3I55V 2XTNA 2PH1A 4QBKA 4BGDC 2H65A 1XZIA 3U19A 4AY5A 1BDIA 4ZVRA 3U5TA 2W0FC 3GLKA 2AZXA 2Q4TA 3U9LA 4WHMA 1MC4A 1O96A 5JVDF 1BE8A 4N03A 1X1CA 1XVUA 3DSRA 3HEAA 2UZ4A 4F7WA 4P3KA 3CN9A 2H9AA 3OD4A 1G291 5CAEA 4E5YA 4HB2A 1L5ZA 1D9XA 4K8XA 4DB2A 1ZL0A 4IIYA 1QOQB 2WWTA 3H9UA 4GBED 5AVYA 3PUXA 4YJ3B 4R51A 3V2GA 1FDSA 5CA1A 2R72A 4D98A 2G06A 3GOHA 1AU9A 4QDKA 4OB7A 3EWNA 3GRKA 1Y3HA 4P5EA 3DPIA 5DU2A 3TIVA 2JDID 4WIFA 2WSSD 1W48A 1RYDA 5DNEA 1ZVKA 2NSDA 5JASA 5AQ1A 5TV2A 1G3UA 2YCBA 4YRDA 1SCKA 2BGLA 2E5LB 1MIOA 5G0SA 2O2XA 5J58A 3HACA 3AB8A 3CN7A 4ILGC 3R3ZA 1FQWA 3NORA 3UHJA 1XEWY 5EGNA 4TSFG 4Z4CA 2E4VA 4M54A 1QG6A 2NTVA 1CQPA 4LF8O 3LRTA 4LY6A 2ONYA 1BYUA 2J5RA 3JQGB 2OFFA 1N6PA 1U7DA 1ZY2A 1CY8A 2L69A 3AVWA 2PZ8A 1RM5A 4G01B 2MU1A 4HN9A 2R2AA 1F8YA 1XI1A 5BNFA 3EF1A 1PW7A 5CEJA 3URMA 4LF4O 2RARA 1VM6A 1XLVA 1CZOA 3PRYA 2CCGA 1JBKA 4DM7A 1G1MA 4EJ6A 4B08A 5EE0A 4PI2A 4K6KA 4X64O 4KTVE 5IABA 2XWSA 3IRUA 2Q0SA 1RRMA 3RS9A 3T5AA 1EP1B 1SXQA 4EEKA 3ID6C 2CH7A 3EPHA 1PNMA 5LXTB 4XTRA 4HAWA 4R7CA 1K4CC 2H7CA 1NS1A 1R37A 4LJ8A 3SJBC 1Z83A 3UGQA 4NYIQ 1EUDB 2VQDA 5AOAA 5EKTA 2HCBA 2CYBA 2QZJA 1B0AA 4ZD6A 2AEEA 3QVXA 2WTXA 1E0SA 4BNIA 4G8DA 1WPRA 4HRXA 3OEHA 3H9JA 1P6OA 2R84A 3RRYA 3IMFA 4I4IA 3ZKAA 4LF6B 3IESA 4X1KB 1TAQA 1POWA 2V65A 2CE2X 4DC1A 1MQ9A 2F9FA 1FTWA 2ZB4A 2BM8A 2KHZA 1KKUA 3SGLA 2LUOA 1L5HB 3AONB 2NW6A 1HFWA 1YDFA 2JKYA 1KK0A 4PA7A 1ORIA 1OZFA 5K6RA 2AOVA 4TZ6A 4UVGA 3ML0A 2O2EA 3CRMA 1CQZA 1QHXA 3TKAA 1GGMA 2IGTA 3UK2A 2JGIA 4IILA 4X60A 1Z12A 1KI8A 3PJGA 1T36B 4HQFA 4UUJC 4HAUA 3UOAB 4UXIA 2JLVA 5IF3A 1Z2AA 3GIDA 3RC9A 3X44A 4JBNA 4PHTA 1OHHA 1L7AA 4NOKA 2W6CX 4YRLA 1YEWA 3U60B 1IN8A 3SYAA 2R1TB 3G2KA 1U2QA 3AEIA 3R7WA 1LZLA 3IKJA 1Z13A 3CHXA 1MAVA 4PO1A 2YIJA 1E4EA 3E70C 4IOMA 4MO9A 1JTVA 1G6Q1 3GYGA 3R7FA 1QZUA 3SBGA 1E79A 1KSHA 5FBWB 1R1DA 1FBTA 3QUAA 1NW6A 1QF6A 3R5TA 1KQGA 4PBRA 5TT1A 3LFHA 4JI4B 1OUMA 2Z5VA 2HRQA 4ARIA 4PGHA 1VIVA 4UOZA 1A96A 2JFFA 5TF4A 3IFXA 2V5VA 2GSMB 2MYNA 2VN8A 1SKUA 4DMFA 3E7WA 4R1QA 3VI4B 1ATZA 1OI4A 4E4EA 4FX2A 2Q6LA 4S2UA 3I42A 1IZYA 3QITA 2ORYA 3WLMA 4RESA 4RM2A 4R1SA 3G5TA 1U0BB 1I5EA 2D3WA 1FRNA 1V5FA 4QARA 4ZOQI 3UHAA 4CUJA 3O74A 1U0OC 1D2EA 2EP5A 2NYAA 1PIWA 2I6FA 4JFRA 4BMXA 3SYPA 4LFAO 4HNUA 2QXUA 5JSUA 1MUUA 1PNVA 1NBHA 2JGDB 2X4GA 4UVBA 2YIVX 4FB4A 4I2VA 2UV8A 1QMPA 3A25A 3QXJA 4UMFA 4FYKA 5HIMA 1L1FA 1TYCA 4GHWA 4L8YA 5M3BA 1YRLA 3T1NA 1CULC 4IIJA 5EGSA 5BVHA 1CUYA 1EX6A 3TINA 5GGXA 4XA8A 4BGEA 1N0UA 2OUIA 3ANTA 4ID9A 3C15C 1RI2A 2ODPA 3SZLA 2XE8A 1QPBA 5T8KC 1KKDA 1D2RA 3EWAA 4F4JA 4ZC8A 3M4NA 2UXCB 1VECA 4L07A 1I7SB 3PIIA 2PKQO 1TUGA 2ITCC 3ZV4A 3IUYA 2WD7A 4KXLA 2YI8A 3L8CA 1H93A 3R8XA 1JPJA 2C7RA 2PPVA 4BMZA 3FCSB 5CD9A 5E2IA 1BKYA 4M9XA 2Q62A 4P82A 4OGGA 4XRRA 3H04A 3AZOA 3VVCA 4M88A 4N6NA 5T5QA 1N2GA 3KYIB 4C08A 3RSOA 4KPYA 1M5RA 4G37A 4PRZA 2WKWA 1DNPA 1UK7A 3BCRA 5JIBA 3KTDA 1JLLA 4TN5A 2Q68A 4OK5A 1P17A 1O87A 4F38A 3P2IA 3LNCA 1G4HA 1ZRMA 3LP8A 3HBAA 3KUUA 3FPKA 3PXGA 2HNBA 3EZ2A 1PE0A 2YFQA 5KTSA 3B1FA 1SQGA 1NRJB 4PNHA 3B13B 2VK8A 4GXQA 4XB6B 1HG0A 2R7NA 4D46A 4N82A 2XXAA 3TNLA 1SC5B 4QPNA 4ZTBA 2N0SA 4MROA 4AMBA 2R3SA 2GDJA 2VDWB 4TQAA 4QL3A 3K4HA 1A4IA 4P5PA 2KQUA 1GNRA 5E4JA 1G98A 4UCFA 5KNBD 2EVWX 3SOZA 5D6NA 2VOEA 2AXPA 2J6IA 1Z63A 1GZ3A 4IO1A 5F78A 2J3LA 3CGGA 4TWZA 4XQEA 2VZ9A 2C9DA 1J2YA 4LF7O 4UATA 3M2PA 1J4AA 4OYYA 2EKBA 3FOZA 3GGGA 3R23A 2B3ZA 1WMFA 3DE3X 2HCTA 4M7OA 5K1PA 1SCBA 4EYQA 4B8YA 5DEIA 2FMXA 4MLPA 3GJ0A 4ER3A 4XKJA 1PL0A 2WF7A 1L0BA 4NBSA 5TPWB 3BMQB 2GEKA 4GGPA 3IXLA 4WKNA 2H3EA 3DKVA 1V8FA 4GMHA 3FYIB 2PNJA 3LQ2A 2IYNA 3DF7A 4IG4A 1MDBA 2QKSA 3O3MB 2IYFA 3KKQA 3T7TA 2HSZA 2IRWA 5CDFE 2GN0A 5AVQA 4L7VA 4BEWA 1MJNA 4BRWA 1W4CA 4LTNA 4AUEA 3VKFA 2O8BB 3GG2A 3PQCA 4MYCA 3KQPA 3S4YA 2O20A 1DT5A 4G41A 2ZIMA 4KFTA 4X20A 2QLNA 3ZW7A 1Q3TA 3EMDA 4MVQA 3T9BA 4IG9A 3VGJA 2SKCA 2QXTA 2DUJA 1QBZA 3UJHA 1YI0A 3AWIA 1IBMB 2IBSA 4EKNB 4RL4A 1ZZEA 1Q17A 2O6LA 3ILHA 4Q6BA 1G8GA 4RZ2A 1DRJA 1UK6A 5HUQA 1VKRA 5F73A 1EAMA 1LR1A 2WSLA 2Y2VA 1R5OA 4NEHB 3ZHVA 1D0SA 2PZKA 1U28C 2FKNA 1JAZA 1XZBA 1DPFA 3VZSA 4R83A 1P3Y1 3C7TA 3QA3E 4EY5A 3W7VA 3AFOA 3BIWA 4MSQA 5AXBA 4MLDA 1T4MA 5EWMA 1LNZA 3IEXA 3PIRA 3ZR4B 2B94A 5L3CA 4FGLA 3RM3A 4R3UC 4UBIA 2A57A 1CUWA 3UB4A 3BA6A 4ROSA 1V96A 4EFBA 1NSFA 1JKMA 3QBTA 4ZXFA 2XPCA 1NW3A 1UIRA 1TC1A 1CF4A 3WNQA 4YRMA 1WBJB 2HA3A 3FVWA 4MWTA 4WV3A 1W1UA 3P2OA 4JVOA 4MXDA 5DM4A 3ZVMA 3PUZA 1BD4A 4NG5A 4ECAA 3BMCB 4AY2A 4M76B 3R2NA 1PFGA 3VDXA 1UMBB 3A2KA 1AA9A 4H35A 2Z58A 2WYOA 1PZEA 3A1UA 3DCJA 2I29A 4X54A 2ZCUA 2CLSA 3F9IA 1QGUB 1UKBA 4LZNA 3HA3A 3RUEA 2W6JG 1XA3A 4R3WA 1BRTA 3STHA 4G4SO 3WLNA 4PNZA 5GWXA 2WWFA 5DMHA 1KQOA 3PYXA 2Q1UA 2PUWA 1E1QG 4GZMA 4TKUB 4I6JA 1PQ4A 1RW4A 1VIDA 3G5UA 1SXJC 3RVDA 2IEZA 5HA5A 2WSMA 1D8AA 1QLNA 5HQTA 1LF5A 2GILA 1KGDA 4DC9A 2JFVA 5F9HA 4GM1A 2BM1A 2GJKA 5T7BA 3ESQA 4E5NA 2BTQB 3L75H 3GCWA 1U7WA 3JQFC 2IXTA 3DBRA 2OCDA 3CCCA 1MAWA 1E66A 4YXWG 4RTNA 4QODA 2BP7B 1RE0A 4BQIA 5LLTA 4ZI2A 1NZDA 5KLVH 4UVIA 2JFYA 1Z0AA 3CY6A 4JR0A 3ZE8A 3QU9A 3LXMA 3R65A 3LCJA 4R3NA 5EIHA 3RVSA 2HBZA 1XAHA 2FLKA 3CC4V 3MOSA 3ZQ4A 4NOLA 1HK7A 3A0RB 3KVYA 5H70A 2GETA 2IUUA 4K6FA 3W2EA 2QK4A 3D2BA 2FMHA 1BHBA 1XFDA 2WJYA 3ZCPA 5EIFA 5F5XA 2QM8A 3R20A 2JAWA 4DDUA