1M9NA

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Structural Insights into the Avian AICAR Transformylase Mechanism.
pubmed doi rcsb
source organism Gallus gallus
total genus 219
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m9nA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1m9nA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA02
1P4RA 3ZZMA 1A9XA 5H3LA 1S8AA 4A1OA 1C30A 1PL0A 1VMDA 1M9NA 1CE8A 1JDBB 1M6VA 1KEEA 1IK4A 1EGHA 2X8WA 1BXRA 1THZA 2YVQA 1C3OA 1PKXA 1WO8A 1B93A 1CS0A 2XW6A 2IU0A 4EHIA 1T36A 2IU3A 2B1GA 1OZ0A 1S89A 1G8MA 2B1IA 1ZCZA
chains in the Genus database with same CATH superfamily
4QELA 2J3EA 4C4PA 3OIYA 1AKWA 1GNRA 1YR9A 3MPUA 1LPAB 1UKZA 1KYVA 2M1XA 3TSCA 4YDHB 2XUPA 5JSZB 3B6IA 5ADHA 2IYFA 3KS9A 4F84A 3WDSA 3LPDA 3KXKA 5JJBA 1R5TA 5BWOA 1T2AA 2FQWA 1KQGA 5EJ6A 4OCMB 4NU8X 1TCAA 3JZIA 1HMPA 3IP1A 3ZJZA 4L0QA 4D3YA 2WWYA 4PA4A 4WVFA 5A9TA 3C8UA 1IRXA 3K5OA 5CCBA 1PJZA 2CB0A 3IAYA 4JC4A 3O7WA 1Q1EA 3TWOA 3WLJA 1KEWA 2A0LA 2W2PA 1J9ZA 3BJRA 3IMKA 2A7XA 1KZ7B 2RI1A 1H5NA 2V7VA 4Q9NA 1EVEA 1T35A 2XGMA 5C5CA 3VR5D 3TFOA 2HIGA 2A92A 4KN9S 2XNJA 2CHEA 3BSSA 4FE7A 3LSSA 3GLHE 4A6PA 1F9EA 3I12A 2X4DA 1UBEA 5K3CA 1ND5A 2H4WA 1U8YA 2WA4A 3FAKA 4G9GA 2C1ZA 4J16C 4G5QA 3NWJA 2BC9A 2JFVA 1UM8A 2WPNA 1QE5A 4MUHA 3ANMA 3W6NA 4FS8A 5EP4A 3LK7A 3EVCA 1J1ZA 5FOSA 3ROMA 3R24A 1RYZA 3C98A 3D54D 4R2WA 3V4FA 3NVMB 4J1TC 2WLSA 5JBQA 4FVMA 3P9NA 3R5KA 2XZTA 4RORA 1FP7A 1E6CA 2WSSA 1NWCA 2PN1A 5CB8A 1KYQA 1OT5A 1KAGA 4EGJA 4D4HA 2ZGVA 4ROSA 2O0LA 3BQ9A 3I62A 1IUNA 3PEFA 4KXVA 3IEKA 1J1IA 2PSDA 1WA8A 1OXBB 1I7FA 1TF7A 2YS7A 3T3NA 2F48A 1CB0A 1ONOA 3W4KA 3PGKA 1G2OA 1OUMA 2RK3A 5DTRA 2IKSA 1U11A 3AY6A 2WYWA 3DFZA 3TAHA 3H1LH 1Z47A 3ASNB 2ACKA 1YQTA 4D46A 3ZHQA 1BH6A 2XJ9A 4DUGA 4LF7B 1L5MA 1AKNA 1G8GA 3G5AA 5HTKA 4Q4AB 1VSBA 4EEKA 3LD9A 1NPDA 1W4AA 2Q46A 1W85A 3HN7A 1YOBA 1JIVA 4E30A 4FFVA 1RKXA 3P97A 2IOFK 1K89A 5CA0A 1R0SA 4CQJA 1XWWA 4UM8B 5KAIZ 2BMJA 5EHXA 3CLUD 3A6HA 2QW8A 3DE6X 5H80A 1UBSB 4AMYA 3H1IH 1E4VA 3SLKA 1VOTA 1FJGO 2Q07A 4MI1A 4QBIA 2P65A 2CL0X 3OJOA 3ZCUA 4H60A 1NU1H 4JMPA 2PL5A 4H1UA 3MCVA 2NUPB 4UZFA 2A0XA 4MVJP 3DWFA 3WO1A 4PYRA 1T6YA 5K0FA 2YICA 4Z4HA 2P8SA 2IYNA 3GPBA 4FSXA 1PEDA 3DO5A 3G71V 4RV4A 4RSRA 2VNKA 3UMBA 2C31A 5CEEA 2ZNVA 1BGXT 4HX5A 3AR8A 4P0TA 4X65B 3TLCA 4FNOA 4KGVA 1F6DA 1S89A 5FWYB 4PLCA 4UDOA 4MIKA 4QZVA 3RYTC 4O4JF 3G1WA 2CVFA 1SCKA 3RUPA 4WCFB 1TRHA 2GZAA 1BDJA 1V1RB 5CLHA 2PX5A 2NT4A 4DNPA 2JLCA 2YWXA 3GCDA 1Y0BA 2HP8A 2O59A 4K86A 3QF4B 4LRYA 2VUTA 4AI6A 5HCIA 3U0BA 1D2HA 3MD0A 3RJ9A 3Q4HB 1C2YA 4XGNA 1QLJA 4JI8B 3BGIA 1FDVA 3VR2A 5FPRA 1I3LA 4HN2A 4O5AA 1W6UA 4J0JA 1ZOPA 2WDZA 4BIIA 4I66A 3I5XA 4YUXA 2B1IA 5J58A 3V7FA 3L72H 2W2QA 2AGVA 4J0QA 3ZWDA 2X4IA 5DLYA 3A4TA 3L77A 4W8OA 3ZNNA 2C8JA 4RPIA 2ZXWB 4FP9A 3RR2A 2GARA 3JCUZ 3Q7QA 1Q22A 4KVZA 4XQEA 4DGSA 2QSYA 4YMTA 3CMMA 4K9SA 1F8FA 3M2TA 4Q37A 4OGLA 4BWYA 2QW0X 1I7DA 2YMPA 4CEHA 3T3PB 5GIPE 2DOKA 2LZ0A 5EHGA 1DWOA 1LDMA 2LW1A 1VC2A 2HCFA 1NURA 2I76A 1XKQA 3GNLA 4ECEA 1Z2EA 2HKIA 1MEOA 4M8NE 4NZNA 4TVBA 4A0FA 4FEYA 5CH8A 5LKRA 3EXHB 5CJJA 3CBQA 1RAHA 3PRJA 4LJLA 3ZHYA 3ZEFB 3RU3A 4EX7A 5EJIA 4B17A 4IUDS 1ULBA 1JV2B 4ND6A 3NV9A 4UHJA 2BHTA 3CCCA 3AEZA 2Y76A 3TQFA 4ARZA 1F38A 2HT6A 3DGEA 3K30A 2WUVA 3R6DA 4K6MA 2DLDA 1DUIA 4JT4A 4CV2A 4Q0MA 1KYOF 1NI5A 5ICGA 1KSGA 1NBMD 3STHA 2ZTSA 4BO2A 3R6GA 3G0DA 3DT8A 3OEHG 4JBLA 4M0KA 3PLAE 1FK8A 3TYXA 2C8VA 3BD9A 2BRUA 4UBMA 4BNGA 3TUJC 1VZ3A 4M36A 2CZGA 1P1RA 3K08A 2P06A 3PUHA 3I72A 1PQWA 5JALA 4G4GA 2FWRA 4IEFB 2CFOA 4EQ6B 2NNWB 5HIMA 3TIIA 1FXSA 3DUFB 3WMEA 1M54A 1EFRG 5IH3A 4C89A 1NC3A 4PZYA 5G0WA 1Z34A 5G40A 3U26A 3S5UA 4JP1A 5BSWA 4WF9V 5MHTA 4HB3A 3FYTA 1SQQH 3O0DA 5KAFZ 1NI3A 3COZA 1Q7TA 2BEUB 2P6OA 2BEJA 3THRA 2P0EA 1C1DA 1U5CA 3GVXA 4P31A 5LGTA 4H6PA 1Q7EA 3LSQA 3HMQA 3DP9A 3B40A 1ZUIA 1ML4A 4TRNA 4X20A 4Z2AA 1W88A 4KVGA 1HNWB 3HP7A 1W19A 1QIHA 3RABA 1T3SA 1P7VA 3QPWA 3FDIA 5F5LA 3C1UA 4GGMX 5CLGA 3TDMA 1X2EA 2PKQP 4JI5B 4DJDC 3JYCA 4M9CA 3IOEA 4ZYVA 4TSFG 2BGWA 2HXSA 3U40A 4O3MA 3LL4A 1XDUA 4EA7A 1R74A 1QHFA 3UM9A 2VG8A 3MGCA 4LYGA 1OU0A 3PTAA 4AS2A 2AEMA 2C1XA 5MN4A 3EMKA 3VZSA 1M75A 2FLVA 2PKQO 3EHDA 3HCWA 3QKIA 1NA5A 1Y67A 1SCQA 1UCFA 2Z2IA 2JS5A 1I5EA 1XTTA 2PHZA 1M1NA 1Z2CA 1BHAA 3P52A 3TQSA 2BE3A 4XDYA 2C7VA 1M1KW 1N6HA 1ONSA 3ZIAD 3JYHA 2FWNA 3F1KA 3ZDDA 2FOIA 4N65A 4Z49A 5IF3A 1Z5UA 3DDZX 4Q7MB 2JJ1A 1ZD8A 2WU8A 3UGKA 1A3CA 4ZYXA 2AEFA 1PGJA 2Z1MA 3TOSA 3ZS8C 4OYHA 4KXUA 2I4OA 4CF7A 5L45A 1CR4A 3CBGA 2WZBA 5CDHA 4B74A 1K92A 5KSOA 3K58A 1GVNB 5AM2A 1YB7A 5GV7A 4D0RA 2O4UX 2V0NA 7GPBA 5BNWA 1JH9A 2ZINA 3SHFA 2ZUUA 1EBBA 2OQIA 2AI3A 5KOYA 3BXPA 4Z5XA 3CX4A 1E0AA 5C31A 1XAGA 4ALMA 4FLWA 4Z9FA 4LQ4A 1KS9A 1PNQA 4C3UA 1LZLA 2AVNA 4LOAA 4LSMA 4DCPA 5E7IA 4NCBA 3K2EA 1SJ9A 2SKDA 2XUGA 4QDJA 1YQEA 1QVVA 4OFWA 1PWYE 5EG5A 3ZZTA 1WPBA 4AY6A 3NRJA 3ZIDA 3AINA 4M9QA 5BMVB 2ZULA 4FWTA 2H54A 1LTHR 3DS8A 5LA6B 5PNTA 3RRMA 4BP3A 3R74A 3ESQA 2FRVA 3D2LA 3MS4A 1HEUA 4NMMA 2JGFA 4BAZA 3FLAA 4I5GA 4WWHA 3I9LA 3KZMA 4HYOA 2CUKA 2GV9A 4HNAB 1XPJA 4K88A 3KDPA 4XIFA 2VWPA 3GN1A 3CJTA 4PO1A 4KW7A 2LP7A 2G04A 1XGKA 4PZPA 5CA1A 1EVZA 3FVQA 3ASOB 4MEJA 4MVJA 4OHOA 3S2FA 1W94A 4KN5A 1OBOA 1TGVA 1IXBA 3PE4A 2B25A 1RM0A 4RQUA 2PRJA 1WVMA 1V54C 3BEDA 2BZGA 4QOHA 1WHSB 3O95A 4P84A 3LT0A 3GNQA 4HNGA 2AOUB 5DBIA 3LPLA 3IALA 1TTQB 4HI0E 3ABQB 5COQA 1T0IA 3I2KA 3DE7X 1P5RA 4QBTA 3HR0A 1H2FA 5CB0A 4DLSA 2Q4PA 4RZUA 2W9XA 2ZWMA 1TTHA 2L17A 5BN3B 1M2EA 1U1IA 5BVHA 3TPZA 5I48A 1KDZA 1E4EA 1N5RA 3V8QA 4YJHB 1YFKA 1PR6A 2ZBEA 2J41A 4D45A 2D5BA 3LLUA 2V5UA 1Q2XA 3JQBC 2QR2A 3KFXA 3FYDA 3HCDA 2YW9A 3Q9UA 4JASB 1SBNE 5IF9A 5IYCO 1ZR2A 2NZWA 1J8VA 1E3WA 3GLTA 4RD4A 3B9PA 3KLBA 1UPBA 2B37A 3EGIA 1A8UA 1VL2A 2XTMA 3EUAA 2ZI3A 4LYAA 2FWAA 4B31A 2Q5OA 3T9AA 2C8LA 1ENOA 3AU8A 3L6DA 5FOTA 3G5MA 1MC5A 2P5SA 1A0OA 4I08A 1US8A 5JAZA 1J23A 2OGUA 1S8FA 3LYLA 4Q7EA 3V1LA 3M4NA 5IJ0A 3UWDA 3AIMA 1TUBA 3SWWA 2FPMA 1EP2B 5LBIA 3BEHA 1BVYF 1PO7A 2POCA 4MQUA 4O8YA 4YCJA 3W2IA 1GDHA 4ILGC 4JX8A 1DT3A 4G84A 1B43A 1BE6A 4WBSA 4CT0A 3T0GA 4MVQA 4KSYA 1N9ZA 3G2IA 1WWRA 4XGIA 4Z53A 3EIUA 4F85A 1JYEA 4DVGA 5TF4A 4LE0A 3FKSD 3JQFA 5CPBA 1ZNYA 3EWSA 4MWGA 4X54A 3ASZA 1QJCA 3EVZA 3NOQA 2UYYA 3CQ9A 5A2QN 2X86A 5CGQB 4GM1A 4PIPA 3RC7A 3RF6A 3SVZA 1LNZA 2D3OW 2JHFA 2O1SA 4A5SA 5I8PA 2XR1A 2WV7A 4OWPA 4EO9A 3PDHA 4HYTA 4OM7A 4K3UA 3IB6A 1Z3CA 2O2YA 2VHZA 3WGJA 1B14A 4LWSA 3T94A 1JEYB 5AQ1A 4OIFA 1THGA 4B34A 1UMCA 1FPMA 5A03A 3MMSA 3JWIA 1XPRA 2YY6A 2VXOA 3OY2A 1BQ4A 3IJRA 3ETGA 2IOFA 3ZDCA 4BAUA 5SY4A 1T8UA 2NO0A 3D4NA 1PI3A 3PB3A 2V98A 1L4MA 3PRKE 1HORA 2DFDA 4DARA 4P6VF 4IIJA 1ICEA 2X6TA 1MAWA 2AOXA 5TJ9A 1KP9A 2VJYA 3ENKA 4M89A 3P0HA 2CHVA 3DFKA 1RPTA 4ZOCA 4PDVA 3N2LA 4Q9DA 2PS3A 4OVKA 5LBQA 4KSBA 1NBHA 4XTRA 4HPWA 5A5DA 1U04A 4WXPA 2Q3BA 1GT91 4Q39A 2OXCA 4RACA 3ZDFA 1HT1E 3M34A 4QNRA 1VQMV 1CY1A 2YEVB 4I50F 2I99A 2JFOA 5HF5A 3L46A 1P7ZA 3TVDA 3MCZA 3C7KA 4EOGA 2FXVA 1NSYA 1COZA 1FFGA 3Q98A 3T1CA 3SKXA 1OVGA 5WRFA 4LX8A 2G4LA 4UUOA 5EE3A 3OLCX 2QD5A 4DR1O 2WTEA 4TMWA 2ZE5A 3OQIA 3RUCA 3W8DA 4Q4CA 1DFIA 1TE2A 2A3RA 5LMNO 4BRWA 1KQSU 2QA5A 4MUKA 1USUA 4D4GA 1NFRA 1KH2A 2GHIA 1ZU4A 3R2JA 5IDXA 4OD0A 2Z3JA 3RUAA 1B3QA 5JW6A 5KTSA 4J03A 5JSQA 4JSRA 2B8JA 5ALRA 4HXGA 3CPJB 3NIDB 2AWNA 3ZDQA 1NATA 4ZMSA 2VP9A 3EA5A 4FBMA 3DV0B 2P2DA 2AHZA 3VKWA 2XE4A 5FOXA 1VE3A 1JDNA 1AN9A 2CK3A 1K86A 1QH8B 3HTXA 1ZIDA 3W5DA 1HLGA 2OT5A 2JEYA 3G2LA 1XA4A 4QECA 3KUUA 2YQ4A 3SDZA 2WYOA 3TJZA 4UJ3A 2E37A 3O75A 3NDBB 1QIMA 1ZOIA 1FIUA 2UXXA 2Q4RA 1AVMA 4B6OA 4UBIA 4UVHA 1O9BA 4ZRNA 4A82A 5LL6Y 3G2OA 4W1SA 3R0VA 1XEWX 2W22A 4YXWA 4TYMA 1P1BA 4DV1O 1VMGA 5BY2A 1QG2A 4FFRA 2JGDA 3T6KA 4F11A 1T2VA 2A1IA 1V8BA 4MDEA 1FFEA 3PSAA 2HRCA 1KK1A 1UX0A 5BN4B 2GLXA 3R5FA 2Z09A 4PLZA 4K81B 1TVKA 3CWZA 3RH0A 1JPVA 2HDWA 1N1GA 4MWTA 4OB6A 4R1QA 3KO8A 1JXMA 3F3SA 2CMHA 1O0BA 5AW2A 4WASA 3GMIA 5H83A 3EODA 4PNHA 3V8BA 3FN4A 1XYGA 3REQB 3FNRA 3QLUA 4ABMA 1SZDA 2XYGA 3JZAA 3M5DA 1DJNA 2R4UA 1KFCB 4UXNA 4MKZA 4KITB 3WGLA 3K04A 2WSLA 4XVRA 3PWZA 2FUG1 1OCEA 1REQA 2G6BA 3P94A 1EDBA 3EAQA 1MTZA 4AUKA 2XMSA 3GVPA 1IFXA 2Y0BA 4KBGA 4EUHA 3KJNA 3LP8A 3BB4A 5ALGA 1FXKA 1PZXA 5K09A 3C3YA 3IHKA 4XDHA 4Z4QA 5C2JB 1QJ4A 3B48A 1YI1A 5CDTA 2D1TA 5IUNC 1X1EA 3HM2A 3DL4A 4LVNA 3EA0A 2RKBA 1P4JA 4TMVA 3LT2A 3CH4B 4HEJA 1NI4A 2DUUA 2CLEB 4X8AA 3VISA 2RHOA 3AKYA 1WAMA 2FLKA 4XWWA 1MXFA 2NTJA 2C7BA 2PRKA 3KQTA 1PR9A 4HTFA 2FVYA 3PK0A 3C3DA 4FQ7A 3H9VA 4BP8A 1SCIA 2AR7A 3D5TA 5DGCA 4X6XA 2ROQA 3B6EA 2GF2A 1RTTA 4G23A 2HPHA 2XB6A 4L7QA 1S2NA 2RGWA 4FLXA 1GITA 2X8LA 3HRIA 5CYPA 3WLNA 4MVJG 3AP1A 2PT7A 4NDNE 4XCQA 3NZEA 3GRAA 3K0AA 2O57A 3TQHA 4P3KA 2O52A 3ITEA 1U2DA 4TWBA 2C8KA 2UUCB 2IHVA 1VSQA 5JS2A 4LV8B 1AKQA 1Y81A 2C94A 4MVSA 2B4TO 4GMKA 1RE1A 2WLIB 1PN3A 2AS0A 3H9UA 3H0KA 3NAQA 3WY9A 1XRJA 4YIPA 2R8OA 3MJ4A 1KS2A 1R0WA 2H7YA 2SHKA 4R7GA 2XDQA 4QO8A 5EJFA 3OPYB 2ZIXB 3QJ5A 4DMHA 4QIWF 2VR1A 4MR7B 1U9CA 4INPA 4TL6A 2O5EA 5B1OA 2YVUA 3HGQA 1ISPA 2EWVA 2GCEA 1JU4A 1F2UB 3REGA 1C8KA 3K9NA 3HY6A 4AIRA 3D3EA 1Y76A 3O2QB 2HU7A 2PMFA 2X0LA 5HEKA 5U4XA 3C6BA 3ZHVA 1RXEA 4N3NA 4MA4A 3ICCA 2WAXA 1U98A 3VO8A 3VKUA 3KM0A 3ZJ4A 4S12A 3WAJA 3NORA 2WPDD 1GGHA 1P5FA 3RF7A 1FZTA 3PTZA 3VR3A 1PV2A 3AETA 1IRIA 3M4JA 1HQDA 3KT3A 1NT2B 2VK4A 3DC7A 1QO7A 4Q3AA 1N9GB 1U3FA 3KETA 1L5KA 3SEFA 4MKIA 1DBWA 3AB8A 4OMCA 4MVWA 5IBRA 3MG9A 2QNBA 1C7FA 3RAJA 3JQGA 3DTUB 4DUYB 3HJNA 3ZH9B 1RM4A 3H5TA 3BA9A 5L3VA 3MXTA 2W2NA 5CNJA 1DKNA 3QENA 1QVAA 3WKAA 5CB4F 2FK7A 3GCZA 4XUGB 3TGPA 1F06A 4HV4A 4TQDA 2ID7A 1OI2A 2R72A 3F4LA 4NBUA 5LMUB 1AB6A 1H2YA 4KSCA 3ROKA 1CJUC 1B8VA 4BGDA 2PQMA 3URKA 2RGNC 3TRFA 4JS0A 3CX6A 3DP7A 4ZKDA 3X1XA 2P8RA 1RWQA 4Y30A 4KQMA 1FU8A 3SEZA 5BUQA 2ADFA 5BN1A 2VPZA 1TZJA 4L16A 3VSCA 1OFVA 2B1JA 2ITCC 4YREA 4P7KA 3TI9A 4BIMA 4KC0A 1Y4SA 3F2IA 1NMYA 4KWHA 4QOEA 2D8AA 4EF4A 5IDJA 3WICA 1EVQA 4P98A 2XMRA 3R7AA 1NTRA 4K40A 2VC2B 3AJ8A 1X9HA 1BWQA 4HBGA 2WJJA 4OREX 4RCZA 4R7CA 5CNIA 1XEAA 1O6GA 1Z29A 1BQ0A 5TMPA 4WZBB 2VPIA 1SUWA 6NULA 1VPWA 1PFGA 4EECA 2CMKA 3RGBA 1XDZA 1ZJYA 5E6SA 3S1AB 4XYLA 5JAUA 1AKYA 1Z3AA 4EGFA 2E5LO 4C0QC 3NUZA 1B6TA 1DUVG 3X1YA 2AW9A 1SMKA 4NV1A 4AU1A 2X5NA 3K03A 3KOYA 5CX1A 1RI3A 4EUEA 2NPIA 4EGQA 2YVAA 1TYZA 1EHYA 2YJ6A 1TNDA 3PHLA 4PAWA 1I6WA 4DDHA 1G4YB 4Z1OA 2V6IA 1GNPA 2MSLA 3NIWA 2IUSA 1WB6A 4OG2A 1EX7A 2BCEA 3PS9A 3V4LA 1ZRSA 1HQYE 4QKQA 3K0GA 2PXCA 4RKQA 2J9RA 1U0OC 1U4NA 2Q29A 4YRRA 5IEJA 2ZRIA 3THSA 2HU5A 1JLKA 5JTUA 2F3TA 2X22A 1CEXA 4P3OA 3PR3A 4Z1MA 2NXCA 4HSEA 1MO3A 4BUCA 1VKOA 1ZVMA 5K4AA 4DXAA 1VI5A 1YXMA 3KCYA 1ZC3A 3EMDA 2DSNA 4FM0A 2B5WA 4ADSG 5FRDA 4EFLA 3OPNA 4JUFA 1NXOA 2CSXA 5KKNB 4OL0A 1YI0A 2W90A 4CIWA 2O14A 2CK3G 3PX7A 2IQIA 1BOFA 4B6RA 1T4GA 1Y1PA 4U2EA 5KWJA 2WYIA 2QGNA 2JD2A 2AR9A 1I3NA 4YRIA 4QEKA 2N74A 3QFHA 4UPEA 1CUZA 3L74H 3NT2A 4ZN6A 4ER0A 1Z7GA 5FOWA 3GIWA 3BCUA 4C20A 1QYRA 3TBKA 3MTQA 3KELA 4EITA 4PSKA 4UTXA 3VR0A 2LDXA 4QLAA 4LBEC 4ZV7A 4PSDA 1Q6YA 2GFIA 4YXWG 1WWKA 4Q6BA 1PJ3A 3GZNA 3HB3B 1Q7CA 1TX4B 3FUCA 3G59A 4ER3A 3QIAA 2H3EA 2BFBB 1O5IA 3CVJA 3UW3A 2B8WA 3VOTA 4OAOA 1O03A 3THXA 1W6RA 2ZJ8A 2C3PA 4KXWA 1J0DA 4IWYA 5IW8A 5GJCA 4Z8XA 3A1NA 3H4IA 3F3YA 1P5HA 5FQOA 3BSYA 3FPSA 4N3CA 1YCDA 1NR7A 2Z1DA 3ZTWA 5EINA 1M4UA 1MW8X 2IS2A 1H2MA 1H6AA 2PJZA 5EZ6B 4H7HA 2IF0A 4JBYA 1HDXA 1D07A 2CLMB 4JI0B 5B1SA 1K4MA 4TXJA 3D6FA 3N1UA 4MULA 4GDMA 3WISA 2HT1A 4XEHA 3RB8A 2QN1A 1XCGB 3UT5A 4CL3A 2DFNA 4L5BA 4FLEA 4KPYA 4CM7A 4MP6A 2B1GA 3KR0A 4YO8A 1RHRA 1S72V 1B6QA 5K51A 5EFZA 4LCPA 4YV2A 4P3PA 1YL5A 3RTBA 2GEDA 3TVYA 5B36A 2DYRC 4EHBA 3RGWS 5ELXA 1WKCA 3CWQA 3FSJX 1XOIA 3AVPA 5F3DA 4NONA 3KYBA 1W46A 1LI5A 2JCVA 1T9HA 4WXMA 3ZBTA 4J11A 3S40A 3KQQA 1NLYA 2HA2A 4WJLA 1OHHA 1NH2B 2J5RA 2EX1A 1T0PA 4LXUA 3FPBA 1JXAA 3EWNA 4ZT6A 5JVDB 2I03A 1W73A 4II3A 1N32B 5LYYA 4H1VA 1V55B 3OCYA 2I4IA 4DOMA 3K09C 4QLBA 4ZRDA 3T4UA 1VQ6V 4MCIA 3F4BA 5AW8A 4JI4O 3WKDA 2MCFA 4IQGA 4D92A 4M9UA 5JMTA 3UJBA 2JGUA 2QU8A 5B7QA 2X6QA 4JJGA 3ELYA 3U56A 3ESYA 3A70A 2PA0A 4YLYA 2PUSA 3LT1A 3TSOA 1UQRA 3DHVA 3FF1A 4ODIA 1JJVA 2AKEA 3ZD6A 1QLWA 4B2YA 4E5YA 3QJGA 4Q16A 2I91A 3PWKA 1OXUA 5EC1C 4QBHA 4UD6A 3E1GA 4JT2A 4LBVA 1T5LA 3FTEA 1F2TA 2DWDC 2R6JA 3OJLA 3JASA 3QYJA 1JDZA 3Q12A 4F6RB 2RI6A 2Q5EA 3CT6A 3GLQA 3HUUA 4HXEB 4NAHA 3ZWOA 4JJ8A 1YDHA 3QVXA 3FCUB 1PTJA 1VMDA 3LLVA 3B78A 1PJSA 4LOJA 2NU9A 2IYYA 3AESB 3QSYA 2IX9A 3NTLA 1R64A 2NAPA 1FXHA 3KWLA 1TJ3A 4ABYA 3GRCA 3F0TA 1HC7A 4NE9A 1H9AA 5KX5A 3TINA 2AXPA 4CGZA 1AY0A 1XU9A 4HDQB 5IKMA 5GZ6A 5FLXA 3PIRA 2GAFA 3PSHA 1ATZA 4J0GA 3K9QO 3KSAC 5EZYF 5E6UB 3AF3A 1NF2A 3A3PA 1ZZGA 2EQBA 1L8DA 4NWIA 3O4VA 2O2CA 3W1VA 1Q3TA 3KWFA 4CWAA 5HTOA 1EFTA 4O59O 2Q62A 2ZCEA 2POQX 4DUPA 4U00A 3GFFA 3LP5A 4M55A 3N58A 2QBYB 4YI5A 1XCBA 3ZWWA 1AF2A 5JCJD 1D1SA 4FYPA 3VGPA 5HBRA 2WIGA 1A72A 4ER7A 4L5YA 1RJ9B 3MRXA 4I55B 2C4KA 2FLWA 2ONKA 4ND4A 1KK3A 1Z5OA 1HR0O 2YZKA 3BB1A 1A9YA 1A7UA 1SXIA 3O4IA 3GIDA 3KKEA 3I5UA 3OKCA 2AE2A 1ZH8A 3ASNC 1KOGA 3GFTA 1RABA 5AXCA 5JPDA 2ATIA 1HGXA 5IYBO 4O6VA 4L51A 4JL6A 3H1JH 1XD2A 4FN5A 4LF9B 5HRAA 5AVJA 4P5DA 1U7UA 1QE0A 5IE9A 4EI2A 4GYYA 3ILHA 2O8NA 4FGWA 3A2LA 4F7OA 1JG3A 4RO2A 5G3ZA 1HWYA 1QYVA 5LYJB 4QJIA 5CFRA 4IS3A 4RXTA 2P4VA 5DT2A 4LMPA 4I36A 3HBLA 4MHSA 2XYQA 1KSFX 2Z2XA 3X1MA 2DQYA 3FSGA 3IMCA 2GBGA 4MUIA 1XPOA 1DKUA 4V0RA 4CMAA 5TT0A 4CQMA 1TO1E 2ZRBA 2XD9A 4FTWA 4F2HA 1YULA 4P54A 3JQPA 4J2HA 1GTSA 2XRZA 3FY4A 4TYYA 4ZI7A 1V39A 2FEMA 1YJ5A 4RY2A 2ODAA 3MSXA 5F5NA 4KH0A 4D4IA 3PEUA 3AR6A 3FPGA 1I7NA 2J9FA 3I01M 4FOLA 1FNNA 1XCMA 2QYSA 1JDSA 4RGBA 2A1UB 1CDOA 2ZDIA 1P2GA 4EP1A 5JNSA 4D4JA 2HNKA 5E4YA 2DVMA 1QUFA 3Q9LA 2FN8A 4DR5B 3SZMA 4Z1MG 4BVEA 3OM9A 2OHOA 4WCFC 4F91B 2QIOA 4K9QA 2YBEA 3BB3A 3WP0A 1E1NA 3AFMA 2VK2A 1DG9A 4DJJA 3MGAA 1ORQC 4M46A 3HUFA 5JSKA 4G1MB 4HZUA 2QWRB 4MVOA 4RNDB 2XCOA 2GK4A 2OGSA 2GHTA 1ECBA 3OEHA 4DV6O 1X8LA 2ZVJA 2FXIA 3VUFA 3RZVA 1S5LZ 3UMFA 3W77A 3R20A 4URVR 3O8QA 3AHHA 4LJ7A 2O8FB 2ZXWC 4TRMA 4IUCS 2P9BA 1MABA 1KIMA 4RMHA 4MYSA 1T8SA 1A5TA 1NYQA 3QY9A 1M7BA 2ZB3A 3WWEA 4TKUA 3R7WB 4PA6A 3BTSA 2AKYA 3S7TA 2CF5A 5ALNA 1I14A 5BWBA 2PBLA 2DYRB 3DKRA 4OPMA 1WSWA 1M34E 4GI3A 1M6VB 7AT1A 1Q20A 3RWMB 4ZHSA 3OKFA 4OFXA 3EUFA 1DS6A 1ZI6A 3ZYZA 2KLHA 1X1CA 3EXHC 2DG2A 2I1QA 3OQHA 4JF3A 2ZYVX 4EI8A 3K06A 1LWNA 3CVOA 1KC1A 3KE8A 1PL0A 1K5QA 4BO9A 2NG1A 1VYHA 2HJRA 2VK8A 3WQHA 4M7OA 4Q03A 3U4AA 3A4YA 3ZU5A 2VYND 3F6SA 3V5NA 1M1ZA 3ZWXA 1MAVA 2UDPA 5ED4A 1JYSA 3O93A 3EH2A 3UJPA 4FHZA 1K7XB 4US1R 5HFNA 3ZGNA 3UXHA 4I4TF 1NLUA 3LFUA 4ENPA 3EFOA 1RCUA 1PWHA 3H04A 1BDHA 1RD4A 3MWFA 1SQ5A 5AT1A 4QPJC 3KP1A 5MFPA 4CZ2A 3K9LA 4K8OA 1EGMB 3OMWA 2WKRA 1HTTA 3TB4A 1IZYA 4O2AF 4NQZA 2OG1A 2CKMA 2OORA 5DM1A 1CUIA 2HRQA 3RYFB 4P4TA 3WGZA 2GPYA 3KVYA 4YCLA 1BX1A 4R81A 4TLMB 3A6ZA 3LU1A 5AICA 5HK9A 1PW7A 1ZN8A 3PIDA 2RHLA 2QM4A 4MV0A 4KR7A 3VNQA 5HPYB 2CDCA 2I6SA 5LBTA 4QYIA 2YW2A 2IS6A 1YJXA 3S29A 5C7LO 2NVOA 3NJ4A 4DG8A 5FPKA 1OHHG 4MS1A 2AQKA 3N2GA 4BQNA 2PUDA 3JATA 3PC2A 3ZQKA 3K71B 5F5XA 2VXBA 2CNWA 4WCDA 4MRMA 1WUJS 4R1PA 1G60A 1R8YA 5K1ZA 2GEKA 1G8AA 1O96B 1XVAA 2QT0A 2WUWE 1B4DA 4N0PA 4REOA 3UXEA 1RACA 3HN6A 4XM0A 3GL9A 5KUMA 3OIGA 1OCRB 4HJRA 2WDPA 1AJNA 3TX6A 4KPFC 3AG4B 5FTMA 1G8MA 4GICA 3SYNA 3T06B 1T91A 5C5EA 4LRWA 1W4CA 5F77A 2VTBB 3PNSA 1JXQA 2ZJYA 3ENWA 1MUUA 1XNQB 2CZQA 1VK9A 3PC6A 3RS8A 5LXTA 2XBUA 2CLSA 5J43A 2OTCA 1IK4A 1G6UA 1XZCA 3HZOA 2PSFA 1OV9A 1LRLA 3T5AA 3ZBUA 3ZWMA 4Z4CA 5CM2Z 3EYWA 1VP3A 3AIIA 1HE3A 1VZ2A 3E86A 4B7UA 1K34A 1JAYA 1G63A 3TZKA 1VE6A 2E87A 1O9HA 1ZM4A 2QX4A 2YTZA 1TADA 1VBFA 4A8TA 2GN6A 3G88A 3HWWA 5K0ZA 4JN6B 3T4PA 2RJ3A 4Y6QA 1U9ZA 1A8HA 3CUEF 4UAGA 4DWWA 1X1TA 3QGMA 2GYWA 3UT0A 4DILA 4RJLA 2RPZA 3R0ZA 3E84A 2WMNB 3C3XA 1EX9A 3UM7A 2RGYA 2N9UA 3K53A 2IEDA 3HDHA 5EMLA 4P35A 3KB1A 2Q7GA 3SC4A 5HZMA 2XD4A 3WL4A 2P67A 1WLYA 2VH5R 5D5QA 1E6EA 4CL0A 5KVCA 1I94O 4MVXA 4X1KB 1CY7A 3P30A 5DSZA 1R0XA 3QKSA 3I32A 4M37A 5C8YB 1IY9A 3R7LA 1R6VA 1G9TA 3OF2A 1EX1A 4M76B 3WNBA 2ADMA 1SPXA 1JKMA 4MTFA 4EKYA 4PCVA 3UN1A 1W4LA 3RS4A 2C3MA 2LCFA 4EENA 1WSDA 2A86A 1AUOA 3FA2A 3UAWA 4ZKEA 3BM5A 2XUKA 3GOHA 2VOJA 4G6ZA 3MUFA 2CNBA 4PC1A 4RZ2A 1PJ8A 1F0KA 1S5HC 1YS7A 2ZSBA 1O6FA 3CNOA 1YTUA 1PM9A 4RHCA 2O19A 4XIJA 3EH1A 2PVSA 3LDDA 3ASOC 5DKFA 3VV3A 1YS9A 3FNFA 1P0PA 1N7JA 1QTRA 3RRJA 4QU0A 1R6DA 4H18A 1ABFA 1N77A 2D0OB 3HBAA 4MV5A 1S8OA 1SIOA 5JXHA 1WQ4A 4M86A 4OCNA 1VRWA 5CD9A 4J9ZB 2HGSA 4H1HA 2B3TA 3UMCA 2N42A 1LQTA 3N39C 2EDAA 2ZWVA 4A0GA 3DZBA 1CUFA 3DC2A 3KU4A 4FX2A 4WKPA 4TTTS 3B5EA 3K9WA 4F5ZA 3I9MA 4QBFA 4RLSA 2IYOA 1G98A 2P2LA 3ZZ0A 3ZWQA 2ZI7A 5FLYA 1UDWA 4X3CA 1Y8QB 3I8SA 2AG5A 3IVRA 4UTVA 5F1YA 2CMDA 3UPDA 2QN6A 2CMFA 1SF9A 3IDOA 3PT5A 4KFRA 1QQ7A 1FTQA 3L49A 1KR5A 2DPYA 1NTMH 3VGJA 1AP6A 3B3GA 4PWYA 4ZO8A 3RJZA 3GJ3A 3D6UA 4ZGBA 1YDGA 1VQ9V 1Q7GA 3NLLA 3L1UA 2C92A 1NN3A 4Q3LA 4MINA 7REQA 3AKCA 3A10A 4MUAA 4OF4A 3AJ9A 6ABPA 4M22A 2PU5A 4UU8A 2V3CC 4RHFA 1U0BB 4F5WA 3EXEA 2UXCB 3UXMA 3CJHA 3AUKA 3N2ZB 2NYUA 4ARUA 4PXYA 4DADA 3ZHZA 2RGRA 1M10A 4CVNA 3N76A 4R9VA 3AUJB 2EDCA 3NH6A 1ETUA 2ODBA 3VHXB 1G1XB 3KXIA 2HPVA 4FM9A 5LWHA 1GGMA 3USCS 4BXOA 3AEIA 2R1VA 3GGPA 1KRWA 1FVFA 3O1HB 1G1AA 2VNIA 1MABG 1SXQA 1BWSA 5E8JA 1G41A 2J31A 5TQ0B 3FWPA 1Y34E 2C0CA 1VE9A 4KV7A 2XRFA 4G1EB 2Y8EA 3NVKI 1P8AA 4GPD1 1GARA 4FINA 4TL7A 3D0RA 5DO9A 2Z2YA 3WGTA 3IPAA 1YS2X 3T4DA 2O5VA 1C4OA 1UWVA 1TM2A 3L4SO 1FFYA 4FKBA 3HB4X 4BNYA 2CDNA 2EP5A 3L4BC 1EIWA 4F4JA 4POOA 5FOUA 4DR6O 1GRJA 2Q2VA 2VDWB 5H0IA 5F4BA 1OX4A 4R9RA 2PS9A 3ZCTA 2RHRA 2RK4A 1R15A 1VFNA 3U4QB 1A8SA 4JLAA 4U8HA 3WYEA 4KPEC 4JI2O 4AM8A 4U7GA 1LB1B 3A58B 2O8DB 1SM4A 4OHVA 3SX2A 2DFLA 4RYLA 4AWAA 3PFCA 1ZCJA 4RHXA 5HP4A 2ODTX 1L7RA 2OXIA 4RE5A 1YL6A 2O0JA 2OIEA 3JYNA 3DEFA 3UOGA 2UUBB 3ABOB 4DREA 1R3DA 2GEVA 1YAHA 4B85A 4CXMA 2H2HA 1T26A 3QE0A 1P6QA 3MPZA 2RDMA 2C00A 1XZAA 2WOOA 1ID8A 5JPIA 4F60A 4DR7B 1HYEA 5ECWA 3U31A 1CNMA 4IHKA 2XAFA 2AZTA 3HJUA 4EKGA 4B4DA 4L75A 4HRAA 3EXFA 5H4GA 1XRPA 3RJ5A 5JXJA 3K16A 1GAWA 1WLSA 3U13A 2FK8A 4HSGA 2HEPA 3DDHA 1TMOA 3BJMA 5G2OA 1R6BX 5LNK6 4DA8A 1G3QA 1Q14A 2YJ4A 1N34O 5FFNA 1L8OA 2IDZA 4H13B 2CFTA 1FS4A 2FMHA 3CMAV 1X1BA 4OA8A 2JGAA 3TEFA 4PN7A 3I4FA 4EL0A 1EP3B 4BJ1A 1ZZEA 5MN5A 1JQAA 3X43A 3L79A 5L7TA 2MOKA 1NVMB 4GYKA 2WG1A 5IJZA 5HVNA 4OQFA 3RVDA 3E9QA 3AHJA 4ND8A 5KNBD 4GVLA 3RGGA 4NOMA 2GTPA 1TM4E 1V6CA 4S2EA 4FFBB 5JMPA 1H8HA 1UKCA 4NR1A 1HRDA 2F1JA 4HLUC 3D8RA 4QWWA 1AT1A 5EIBC 5BV0A 4DCJA 3RK4A 4TX1A 2X7RB 4HDSB 1YRLA 3HACA 5AYVA 1FP6A 2V4UA 5B6PA 1G8HA 3W1WA 3UATA 3KZXA 4H4CA 1VKZA 3GLGB 3GG2A 2OAEA 3E9YA 4CS4A 1AUQA 3IEUA 5G4KB 3MJFA 3S70A 3U1TA 3DWIA 2BKAA 1UWCA 1T34A 2ZUTA 4E3ZA 4PGMA 4EVQA 4GZ3A 3O38A 4KR9A 3B4SA 3CTPA 5ALXA 2GXQA 2BMDA 5LHHA 4B3RO 3PFBA 5FFMA 4TT3D 2ZJFA 3ZQ6A 3EPPA 1TQ8A 4HBNA 3LPAA 1PV0A 1T9DA 2P5YA 2K87A 5L3GA 2IYLD 4L3OA 4KITC 4TTSA 2XXAB 3QOXA 1HURA 3HXLA 1J6UA 1JTEA 3R7FA 5JFOA 2AJBA 3A06A 2BM0A 2AXNA 1L6RA 2I34A 4EFMA 4OXYA 3KXDA 4ZZ2A 4RTLA 3QU7A 2NTYC 4G41A 2FEKA 5CG2A 4OFZA 2WF7A 2QKCA 1I5OA 3HM9A 4LOLA 1HG0A 1L5ZA 2MINA 3ZX6A 4FDLA 1Z6YA 1LPPA 4G4SP 3BABA 1C3JA 3MTAA 3NGLA 1LDYA 5EHQA 2P3OA 1X9IA 2H29A 3TM4A 1GKLA 1E61A 3IUQA 3R3YA 3K57A 4U5QA 2QE7A 3C5HA 3GJQA 3MGBA 4UCWA 1WB8A 4G4SO 3SOZA 5LZ5A 3BAZA 3SF8B 1LDGA 3SZUA 3L40A 4DRYA 3IQHX 2PI5A 3UHPA 3NM6B 1IOWA 2PY5A 2NW6A 5JZOA 4GG1A 3LDEA 3ACCA 1K7FB 3LA8A 5ALYA 3RW9A 4W5JA 1GMGA 4QDKA 4ME6A 1ZVQA 4U7OA 2AI1A 3C6YA 4LE2A 2D2CB 3KKYA 1RQNA 3WGYA 4O4JB 3WKBA 1RPZA 4M4SA 4FM1A 3U5TA 2GAOA 5K1XA 1ORRA 3MT8A 4XTCS 1V2HE 2W0FC 3ABKB 1WCWA 4M0MA 4MSDA 5HFJA 2RSLA 1RYBA 1TCCA 5D00A 3BMNA 3DOEA 1M56B 4XAQA 3GRVA 4YQFA 2ZIFA 2QQ5A 2A78A 3FGPA 4DSZA 4ZYTA 1VEWA 4X89A 4CM4B 2Q4EA 4K0KO 2H65A 2CYBA 3T1YB 1MRZA 1R10A 3DCNA 3L1IA 4U7TB 5BURA 1JR3A 4XJTA 2FW1A 1RMYA 4KYUA 1P19A 3NM5A 5BQPA 2RHJA 5AW5A 1QRSA 4KLAA 1IH8A 3BAFA 5ENZA 5FR1A 1AXRA 4CEJB 4AG6A 2R6GA 3RK0A 1C3OB 5K8VA 3DMTC 4RD3A 3OHPA 3ROQA 3E0XA 4OU5A 3ZWKA 1Z5VA 2EP8A 1Z63A 2JIPA 3GXBA 1Q43A 2OBFA 4HLQB 2R85A 3UV7A 1T6XA 5CBFA 4HB4A 5D01A 1VKJA 2GZDA 4R5HA 3NXKA 1IB0A 2B8NA 2D2IA 2CTQA 5LP1A 2ZM6O 5I7EA 1SXPA 2P0YA 3UB4A 1X1DA 1JSLA 1XWFA 1YACA 2F59A 2BMEA 4ID3A 4FR2A 3ROZA 2IJHA 2YOFA 1J99A 4AY2A 1L7BA 4P4SB 1KEKA 4PRZA 4YP1A 1TK2A 3GDGA 4C7UA 1KKDA 1ZAKA 1FF9A 5C9ZA 4JCOA 1KI1A 4V0NA 4A27A 4LXYA 2JKZA 3BZWA 5HKAA 4EDHA 4WV3A 2DWEC 4HGYA 3HKEB 2VDQB 3EZ2A 4HMQA 4Z3KA 2WSSD 3ICXA 1ZVKA 2EF1A 3FVRA 1GO2A 4G0PA 2OD9A 4WACA 4XKJA 4B6JA 3GFOA 1JX9A 4NOJA 3VDQA 1KECA 4GLOA 5BO5A 3IE0A 4GUAA 4QUKA 1EHIA 2AG0A 2XMZA 1EZJA 4H3KB 2XCIA 4KPUB 3HXKA 4N6OA 4MUJA 3ZJVA 4WAUA 4UUJC 1L5HB 1HDGO 5T64A 1G5HA 1NOIA 3X1ZA 1TJNA 1FDRA 3SIPA 2AI2A 5TNXA 2PQ6A 2CGOA 1JSCA 3TX2A 1BEZA 1L4UA 1TO2E 3VPHA 5T8KA 5IDYA 1UMDA 3N8DA 1MJFA 5DN6D 5CYOA 4IDOA 3VOAA 3NH9A 5I9SA 5F1OA 1CQXA 1ADJA 5B3JC 2HA3A 3SSOA 4RKRA 4IHAA 3TMAA 1BHO1 2DUWA 2C58A 4IIGA 4YUVA 3JSLA 1TF5A 2JGJA 5JISA 4PGGA 2F43B 2FN9A 2BFNA 4PZDA 3NO4A 2JFNA 2V97A 2AOWA 1UEXC 1U9IC 1JR3E 2ONCA 3QBJA 4RCVA 2P2SA 1NMSA 1T5SA 4EGSA 1QB8A 3CF0A 1H2KA 5CNKA 4DQUA 1FEZA 5FTWA 4ZVQA 2NU6B 3WO0A 4Q1BA 4GI2A 4GP7A 4JR2A 2WU3A 1ADCA 4LF5B 3ZN0A 1CBUA 2P11A 4ZEVA 2DKFA 4WCEV 1VL6A 1QXSA 1H2GA 2ZT9B 3E8GA 2W8BA 1P31A 3I3OA 2VHJA 1J22A 4REMA 3KZKA 1K3UB 1AK2A 1R5OA 3GJ5A 1IULA 1NOJA 1M2KA 5TPWB 3I6MA 4L4XA 3LXUX 4KR2A 1R9JA 2GHYA 1D1PA 3P5BA 2ZKLA 3LG2A 1VIDA 4LH7A 1PZMA 3OFSA 2HDOA 1VE7A 4KWEA 1F0YA 1HQCA 3IC5A 1SC3A 5JV5A 3RC2A 4NNPA 1F2VA 3WLFA 1NHGA 2O1XA 2V4MA 1AI6A 3AG6A 2ITDC 4RVFA 1GPH1 1LS1A 3WLQA 3NGMA 5FTJA 4G1UC 4LWPA 4TV8F 3S2YA 3UAXA 3I28A 1VPVA 1JQJC 2JLWA 2AMJA 3NS7A 3HR4A 2PYDA 1A9QA 3FMFA 1FVOA 2ZNJA 3JTMA 4NABA 1G7CA 1C4XA 2X6CA 2H8PC 1QFZA 3DDUA 1QFYA 1KBZA 3UFXB 1P44A 2P2YA 4LCNA 2NAFA 2IW3A 1XCJA 3OOEA 3GT4A 1E2HA 5I51A 1H8HG 5F9HA 4N18A 3LGSA 2UZ1A 2HEIA 1NIPA 4DSNA 3KUKA 5JH7F 2PI4A 2PY6A 3AG5A 3W7BA 1QIJA 3AZQA 3EX8A 2IXTA 3PCRB 3P3PA 3RS9A 2NWQA 4E5KA 1UBRS 5M59B 1PT8A 4ZHQB 3NASA 2QVLA 3RS7A 2IY7A 4QDZA 4RMJA 1A9OA 3HADA 1POXA 3F7VC 2EWWA 1WPXA 3LZDA 4EPYA 4LOKA 2H48A 4TUYF 4X60A 4PO8A 4IILA 2C54A 1J5EO 4I8IA 4QU5A 2YNMC 5JD3A 2JIZA 5FV4A 5KWVA 2LRHA 5AIAA 3SS7X 2JFXA 4IIEA 5FHQA 5L3CA 3TGUH 5E9JA 1KR2A 521PA 5GV8A 3QY0A 3FFTA 4BAGA 3DYVA 3JALB 4NMLA 4JTAB 5BPHA 2OCDA 3OP4A 4ARBA 5BMOA 2I8CA 1WDKA 1K6EA 3G0CA 3N53A 4KAAA 1SOVA 3ADOA 4XWKA 1BXRA 4W7IA 4DIMA 4ESEA 4ED9A 4HVCA 3DA8A 3O91A 2QE7G 5CP8A 3UBTA 2EZOA 1V9CA 4Y98A 1L0BA 3IO5A 1ZXBA 4IJVA 2PTHA 4CL2A 5BORA 2VT3A 5KLVH 4H16A 2H07A 3H2SA 2RHDA 2B82A 1DBQA 1N8RW 4AG3A 1VG9B 2C5EA 5B5EZ 1RWXA 4Y67A 1TVMA 3AHEA 4Z3DA 3P2YA 1T36B 2PKXA 5CVVA 4YA6A 3H4MA 1EFKA 1ACMA 3ZW9A 5CXUA 1SZPA 3G9QA 2C7PA 2ZR2A 5AM5A 4K7JA 5CYGA 5J5CA 1U8UA 5EJ7A 4L8GA 3TLEA 1J90A 5JCOC 4HX2A 1Y6XA 1SQVH 3QVNA 1SCNE 2RB5A 1V55C 3ZRXA 4QTXA 1XDSA 2D4AA 4OGGA 4BNDB 4Q4HA 4XR4A 5EZ5A 4P0QB 2RAFA 3VYWA 3DT6A 3Q0IA 4D9JA 5DBGA 3SXUA 5KUTA 2GUGA 1NVFA 3PUWA 4RNCA 1WMEA 3QFFA 1SHTX 1BGYH 5ALSA 5IG2A 1G0OA 4RU1A 1X8XA 2UVDA 1ZUNB 2V7QD 3QQ5A 2NYTA 2GUZA 2QT9A 3STYA 1NPYA 2UYOA 2BHRA 1T1RA 3P9RA 4JNCA 1M83A 4LCJA 1DQRA 1A9TA 2WKQA 3FAZA 4TVSA 4QM7A 1DLIA 1YE3A 3T54A 1COWA 2OHXA 2YXNA 2HK8A 2JJ1D 3RYHB 4GEKA 1WVIA 2JGLA 2QM3A 2YZNA 3DAOA 1TUIA 3GGJA 2FFRA 2IXBA 3WFIA 1GFIA 2R8PA 3GRZA 3CZCA 5ECGC 5ARCA 4YS6A 4EGAA 2ZIWB 3EK2A 3Q3CA 1Z33A 3FUUA 3PPXA 1OZHA 1A7KA 2WW8A 5E2AA 3B1WA 3CSXA 4IJWA 2GCNA 1ORTA 3N8GA 3IBSA 4FIZA 5ULLA 1PNLA 1GD1O 4PLYA 3ANLA 2C07A 2PLWA 5L4NA 3RAFC 2JA2A 4WLFA 5KEIA 1DX4A 1MLDA 4MI6A 1OPXA 1NUAA 2IEGA 1NVAA 3DL2A 3UMGA 1XRQA 4JUDX 4V1CA 2BL4A 4OXNA 2O8CA 1RCTE 1QLNA 1RI2A 2EFGA 1RI5A 2J4CA 3GD7A 4JOBA 5JBIA 3F5QA 2C84A 1E9SA 3TLXA 1MA1A 1TPYA 3K96A 1WV1A 1JSRA 1F4PA 2XUIA 5IYZF 3T8YA 1M7GA 2ZAOA 5KNCH 5J63A 1RRGA 1QIGA 4QT0A 5AW0A 4I50B 1YMVA 4AP5A 4DGQA 1ORIA 2WVHA 4H27A 3MJVA 1TECE 4FYJA 1WN6A 1JZQA 2I6QA 3ZKWB 2XHBA 1L4HA 5SY9A 1W0CA 3THWB 2JCBA 3WWOA 4RXUA 1WUIS 3GP3A 3VDXA 4KQWA 1QG6A 3TLGA 4NQLA 2FKNA 3SYTA 3KG2A 1KQ3A 5EIOA 1OBHA 2QAJA 2IKQA 4MVJD 1NPTO 3S5JA 4PSVA 1PDWA 4BKQA 1CQIB 3WR5A 4GNKA 4KOAA 5I5EA 2D2EA 3QITA 1M73E 1GM5A 3DAHA 1PLJA 1ESCA 3NHBA 2QLBA 1OWLA 2EJTA 2YFYA 1C1YA 2GZ2A 4YRFA 3VR6A 5TIIA 4H17A 4J29A 4QQRA 4FZ3A 4F3RA 4IVPA 2YJ3A 4PPNA 2PTMA 1F9AA 4AMBA 2EW1A 4IXMA 4ETIA 4EWLA 4CG1A 4DR4O 4X85A 4CKZA 2BDUA 4DEVA 1OXXK 5C4MA 4OHFA 4GXTA 1PJCA 1BKDR 2JLAA 1LDNA 1RZ3A 2LCIA 3W3AA 2H0RA 4L3VA 3M1YA 3KQPA 3HLTA 3KSUA 1U1EA 1KZHA 3SZGA 3DLAA 1TYCA 4H7EA 4PYKA 3QWBA 3QXGA 4P86A 1C30B 3ZE7A 4LKOA 2VRCA 1X7WB 2BJVA 4MP8A 4Y6RA 3UMVA 5F23A 3VU0A 4HWRA 3P9ZA 4J94A 2PAFA 1Z6QA 4L87A 1HFEL 4OLAA 1VLQA 1PYDA 1DKQA 3P0JA 3RWOA 1RAEA 2PEZA 3TZLA 5ITWA 3TETA 1Y8RB 1U3DA 3PUKA 4W99A 5AW4A 3OU2A 1NJIW 2GB4A 3FPJA 5BSFA 2Q6LA 3H13A 5LD2B 2N75A 2JHAA 4MJ3A 2YYSA 2R9RB 2UZ3A 3MAAC 1QH1B 1SXJD 5GONF 1E59A 4CQLA 1FCJA 2AYZA 5T67A 1BW9B 1CR1A 3DT9A 2HQOA 2EJ7A 5KQGA 4TQFA 1UKEA 2J3JA 4UUNA 1NN1A 3KYCA 4IH4A 1XX6A 5LPNA 2JA1A 1ZL8B 3SHWA 3M0EA 3HJTA 1G16A 1UBLS 5TY0A 2AR0A 5E4FA 3N0TA 5IVDA 5DSXA 3WLRA 4PPYA 1N3BA 1CVIA 2RGUA 5NULA 3W7SA 5GZ1A 3HDGA 3CLSC 2VWGA 2HX1A 4XZ3A 4Y2GA 2P7TC 1T3LA 1CF2O 4XM1A 1XNRO 1E2JA 1A82A 4G9BA 2OO3A 5L6LB 3VQVA 3AWIA 1IY0A 1KYYA 2UXBO 4RK4A 2PX8A 3CUYA 4NAUA 4YAIA 4DE5A 1O97C 4JEHA 3LIIA 5ICCA 2ZBFA 3G5TA 4UVBA 2QENA 1NTOA 1OIWA 4UDXX 3L0SA 4EPTA 2PKEA 4WIAA 4P7FA 4BVHA 2J87A 2HNAA 2VNAA 1OYWA 3SF0A 1XZHA 3BVPA 3IEIA 1WY7A 4WFQA 4EARA 3WIBA 5B2ZA 4NYMQ 2J85A 2JIZG 5K8IA 5JJEB 1UM9B 1RZRD 5HUHA 4ZU6X 3BKWA 1SK9A 1ODFA 3ZGZA 2XGOA 3OTOO 2WSIA 4KRXA 3GH1A 4EZBA 2KG7B 3WYGA 1F4LA 3HB7A 4JAVA 3ZRVA 2VZ8A 3JRXA 3CLKA 2ZIUB 2BMAA 1G8YA 3ZOKA 2QIPA 2RC5A 2QZZA 5KAPA 5KNDA 1MB2A 2VBCA 4ANFA 4ZCIA 3FLEA 5AW1A 3KFLA 5KO2A 4FPXA 4CR8A 5A5EA 1JQ3A 4K6OA 2HPZA 4H37A 3EDCA 4CKYA 4G63A 1XDWA 2C2MA 2NYVA 4D9MA 3V8VA 4EHFA 4LCBA 1Z22A 4BO7A 3QTLA 1OI0A 3U39A 4RD2A 3OT1A 4LRSB 3TTVA 4ZI2A 2N46A 4HKTA 2GPNA 4JLDA 4UEQA 4DY6A 3N6RA 2Y1CA 3N3BC 4RVHA 1NSTA 4PG5A 1GYRA 2OBNA 3IESA 2AXTZ 5CBGA 3M3HA 2WF8A 2V96A 1VF6C 1WXIA 3PXXA 1NMQA 3II6X 4CR7A 2NVBA 5IVPA 4O25A 1XN4A 4J0DA 1EVJA 3QW2A 5BXZA 3Q15C 1QHEA 5EESA 4PRYA 3QTCA 3DYBA 4M0EA 3JY6A 1Y9ZA 1A8QA 1L5GB 2JFBA 3ND6A 2PCJA 1OCRC 4DLUA 4YXWD 2C3UA 2W37A 3F3MA 2QLMA 1BN7A 3AG4C 4YMHA 3SQWA 2EEPA 4F21A 4PCAA 1C9EA 4JLWA 3UJDA 3ZXXA 4RQFA 1JW9B 3LE8A 1T4CB 4KQ2A 4W4KA 3FCXA 2NUAA 4KFUA 4IGFA 5KWIA 2XQJA 3H1EA 3BRQA 3ZY5A 2F6RA 3W5BA 1T15A 2F55A 1COWG 1K2VN 3BIFA 2Q6TA 1EUDB 4M60A 1QGZA 1UBFA 2B0CA 5IKXA 3TKLA 1WP7A 1Z0JA 2BFDB 2ZTVA 1NP6A 4KK3A 4RADA 1IJBA 4J49A 1BE8A 2FPIA 5EUBA 1Y42X 3G2MA 1PS8A 3TD9A 3WNDA 1KYTA 2D2XA 1NXWA 5KOJB 3KBOA 1ZX1A 5TPZA 5CEFA 1VQPV 3KXLA 1M34A 1UOOA 4D82A 3ZV4A 1ECLA 2VS1A 3ML0A 1RWNA 4JB8A 2ACWA 5C51B 4HGZA 3ANYB 1Z25A 1QX4A 2Y4NA 5B4UA 1JJ7A 1X1AA 2H8KA 2NGRA 3Q3JB 3BULA 4Q20A 2BEKA 3O4GA 4OX9B 3BRSA 4YONB 2XTZA 2ZCJA 3IMEA 4RE6A 1N75A 3AJDA 1YB1A 2GR9A 4AJJA 3W4JA 3JQCA 1Q0TA 2DFTA 4J8PA 4WECA 2D7JA 3MQFA 1AKRA 4IDPA 1L7OA 2ZBUA 3KJXA 2O2IA 4TLEA 3BMQA 1SG0A 2BZ0A 4ZO9A 3O9OA 1W4RA 1IVYA 2IEYA 1KJZA 3LWBA 3BXHA 2H5JA 4HMPA 1JQLB 5KAMA 3GJXC 2HVKC 1H2ZA 4O4LB 2IQ5A 3N2KA 2ZJ0A 1KJJA 5KQLA 3TR0A 4WN9A 3S2UA 4E11A 3H2JA 3HA3A 3PJFA 3VNAA 1N6KA 2HIMA 5DOVA 1PGQA 4CE6A 3ONEA 1XF1A 1CUAA 1YVDA 4Q1FA 3GFPA 1JTFA 4ZXPA 1FFBA 3MWJA 4HGPA 1NF8A 3ESRA 2SNIE 5ALHA 4UW9A 4MQ5A 3AILA 3CZ9A 2R1TB 4N47A 4JVLA 1AS3A 5IAGA 4ZICA 1WN7A 2C29D 2PGJA 4NMWA 5E1MA 3K6SB 5JAHA 4F96A 2FE4A 3MMNA 1X14A 3KYJB 2Q1YA 5JZVA 3IPCA 3LBAA 1QHHB 2QRJA 4NIMA 1E9EA 3RG8A 5JD6A 3VKVA 2OGTA 3QMVA 4M2LA 4YMLA 3BRWA 2ERCA 2NU8B 5CVCA 3OCWA 1XROA 5JZSA 1O87A 5P21A 3X3HA 3ACBA 2O1WA 5ILOA 1KI6A 4E2ZA 3H3JA 1VBMA 2FSGA 3O4JA 2O2DA 4IZHA 1LNSA 1WNTA 2DQ4A 4WFEA 3ZY3A 1PUJA 4OYLA 1IG0A 2AKAB 1A9XB 4ESHA 1II9A 3AX6A 1XZIA 1KI7A 1RHMA 1QQTA 4A6XA 3MJEA 1FU7A 2ZB4A 5JR3A 4U6NA 2R7NA 2VBIA 3MCWA 3NJ8A 3SC3A 1QZTA 5ILQA 4IFBA 1RHQA 4XIIA 4DNOA 1RCFA 4DNXA 3TXQA 3VR3D 4J1NA 3E6AA 1KI4A 1KRHA 3GQBB 4M1QA 5KB3A 1ZA1A 1P7CA 1P5JA 2OFPA 7MDHA 3R5SA 3GLSA 1GPUA 1X92A 5DOZA 4UMFA 1GK9A 2DAPA 1NDHA 5YASA 3BERA 2M6KA 1U3CA 4UU0A 4DQXA 1B8PA 1PKEA 5JAQA 2ID9A 3M9WA 1Y6ZA 1I51A 1PD0A 1N6RA 4I19A 3AEXA 3SDBA 4OMUA 1XDDA 3GB7C 3VQYA 3T1OA 3FR7A 1P2TA 3HBJA 1HE8B 1M8GA 1SD2A 2BTQA 5EXTA 1ZHFA 2WJWA 2ZD9A 3A6DA 4FGLA 1JMKC 1J70A 3FNIA 3DBLA 2H52A 5E1BA 1G7SA 5JJNB 3WMGA 1O8BA 3C3AA 3VA7A 5L3SB 3HU1A 3IAS6 3K1ZA 2G1AA 4MV1A 1HNNA 3C87A 3M6XA 3VAAA 4LDZA 3RSSA 1Z6AA 5DFAA 4E3WA 2PW9A 1EFHA 4OHKA 4PQFA 2PPLA 2ET6A 5F2VO 4ID9A 4YECA 1GFWA 1Y5LA 4V0MA 4YJFA 1EDZA 4UMDA 2ATKC 4G0ZA 2AN3A 1P3Y1 3GX1A 2WJGA 2EHDA 4DKJA 2FDXA 3F6PA 2QD3A 2JBHA 4EPXA 4X7RA 1IU9A 1JNXX 3RK1A 1S2MA 1U1GA 3EQ6A 4HQRA 2R9IA 3L8YA 1HL3A 1IXMA 4G5FA 4G5YA 3CZAA 1N3YA 1MB4A 1WOMA 4X66O 4TS1A 2O7RA 3DB2A 1YO6A 3K0HA 1CNEA 3O21A 1BKSB 1SEVA 2P77A 1MNGA 1U81A 2PEYA 5GOTA 2VUIB 3GFBA 3GQVA 3V4ZA 4YT5A 1UPUA 1UOEA 3F9CA 4JIMA 4YWJA 5LVAA 1YU6A 3GZJA 2IXGA 5ALFA 2O8VA 1M3SA 3FI9A 2C2XA 4G8CA 3UJ9A 3RS5A 4W82A 4MB2A 1WUKS 2WP8J 4F72A 4KQGA 4UARA 4QFDA 4ML3A 2JBWA 2AN1A 4NZPA 1DMRA 4M8KA 4HGOA 3PC8A 4W9NA 4Y2XA 2P4QA 2R65A 1BFKA 2JH8A 2A94A 3GJZA 4DMRA 5ICMA 2R68A 4Z1MD 2ZE6A 3CEHA 3TFWA 4YT8A 3RVSA 3FDZB 5D8DA 1Y80A 3L4JA 4LZAA 4UQLA 4AZ0A 4FBGA 3WBKA 1G6Q1 3C6XA 3BY6A 4PXSA 2J7PD 1UXJA 4B6QA 2G76A 5CDYA 1YJAA 2OCYC 5HF9A 4EA8A 4MMXB 2ZUBA 3RVOA 1NVVR 1SIWA 3G80A 5L3DA 2OO7A 2UXNA 3RT3C 2LD4A 4BDTA 1D9XA 1SHUX 2VPYA 2IP4A 2G80A 1U28A 2HDHA 3DBRB 4QUAA 1WL8A 3IUEA 4BBJA 2I33A 2H0QA 5F1PA 2CVQA 3BMXA 3KC2A 4X0EA 3PCTA 5REQA 2ZIOA 1XJCA 2IYZA 1K6MA 3V1YA 1U7PA 1U1DA 2ZTMA 4RDCA 3EVBA 3JAKB 1YTFB 3DKKA 2B20A 2DUNA 1Z7YA 4P3YA 1CERA 2CXRA 3W6PA 1KO8A 1G4AE 1U99A 2IK8A 3RTEA 4PS0A 2KCQA 2FZ4A 4DXHA 1BRTA 1DAEA 1NZ6A 3KJQA 4V0ME 4AF7A 3L05A 1ZP6A 4BFCA 1BXZA 5J4LA 2ZWAA 1X4TA 1XZJA 2FSHA 5DK4A 5A62A 2H7CA 3EGEA 3GP5A 1L8AA 2QZ9A 2QWPB 1LY1A 4RLHA 4X1OA 2PQ2A 4GPAA 3UHOA 3IVGA 3B6KA 3AJRA 4D9KA 3P9YA 4K9MA 4Q3OA 3RG2A 4LHZA 3NFYA 3OEEA 2Y48A 2QU7A 1M2GA 2WYVA 1S2LA 4BIZA 1Z83A 1A2OA 3ROGA 1MT3A 1WCV1 4C4YA 1ZNXA 1Y9DA 3ZRSA 2DR3A 4HS4A 1RQ2A 2QRVA 3QVOA 5EMMA 3HVRA 4KWTA 1Z2AA 2L82A 2OVBA 1QCZA 1W35A 4QRHA 3PYMA 2W2KA 2ODEA 3AKDA 3WRYA 4P9EA 3FGZA 4PELA 4PU0A 2HJHA 2A9OA 2MR5A 5CDGA 3EIOA 1LUAA 2DZDA 3LVFO 2O2GA 1W44A 4OXRA 1GT6A 4LVUA 3SSMA 2X41A 3MN1A 3T0IA 1I9CA 4HZGA 2ZRJA 5F1KA 1DOAA 2V0CA 1LGYA 1I32A 3IA2A 1DCFA 5ALEA 1Q6ZA 1FE8A 3X1DA 4GO1A 3P20A 1D5AA 2G1PA 2D5AA 3PQCA 2XYVA 4B7XA 1Z2NX 1JQ0A 4O1MA 5IEBA 3ELDA 1JHUA 5C32A 1XVLA 5LZ7A 2QQ0A 3QU2A 3TTUA 4Y6SA 3V8MA 1QCCA 1AV6A 2GD1O 1I1NA 2FW7A 3VU9B 2ZRAA 5TC4A 1XEXB 4S1NA 2HLPA 5AWFC 3HYRA 2DKNA 2MHCA 3HL0A 4REQA 4MX8A 4LMRA 1SBCA 3DHEA 1FYXA 1C7ZA 2H9IA 5CBHA 1T6NA 1R8XA 4HPXB 1C3LA 2G63A 2C59A 4NMXB 4B3JA 3B8NA 1Z0AA 2ZBGA 3ABKC 3ONWA 1SBYA 1T5OA 1LSJA 2CY0A 4Q6WA 5B66Z 2ZITA 4CMIB 4KE7A 1WE2A 2QDXA 4L0DA 4JUCA 2GM4A 3TDNA 1M56C 2PGXA 3C7TA 3P71T 2IHBA 1JAIA 1RJGA 2FW6A 5IKPA 1FP4B 4DMKA 1N8TA 2AFHE 2N3ZA 5LUBA 4MUFA 5DGIA 5BNZA 1U9JA 2HV8A 3OFJA 3BFKA 1DXHA 1DQPA 3BN3A 4EEXA 5FCDA 5JI2E 1XMQO 4D3FA 2P2NA 4CLEA 1VGVA 5CXXA 1V4BA 1ZABA 2HSWA 2D2FA 2ZQ5A 3RBXA 4BZWA 1AZTA 4CR6A 1FPOA 1ZYUA 1KFEB 4HPJB 4HVLA 3EBLA 4KQHA 4ZEOA 1SBTA 4NJOA 4DMFA 1L7NA 4YJ3F 1QYXA 3NKFA 3MBIA 4EJFA 1LCIA 4G36A 2IYQA 3H11A 3PD0A 3EOBI 4NATA 3PHHA 2JBAA 3G82C 1J33A 4IV8A 1QE3A 5L9AA 2ZT8A 5JSHA 5EKXA 2ZI4A 4YDRA 1P0MA 4IHJF 1QU2A 1XF9A 3MDSA 2HMWA 2YVKA 4ZOAA 1E2NA 3ME5A 2W6MA 1I6KA 1NXPA 3DR3A 3G8CA 3QO5A 4BRSA 2H2GA 5EOVA 2XUHA 1E79A 2O3SA 2QZPA 2HV9A 3GOQA 3PFIA 4W1RA 4JP2A 5IC4A 5C35A 4IDHA 1N5LA 5IHPA 3EHBB 4AMUA 2OTLV 2IUTA 2R8RA 4P34A 4XDLA 4X93A 3FTFA 2JAQA 1TXGA 4L3WA 2AMFA 4A2WA 2E4WA 1ESNA 1T4DA 3OZGA 3TK1A 3WAGA 1GQSA 1NVKA 1R1BA 3KLPX 1LF0A 3L7BA 2MSCB 3I61A 1Q21A 4WXEA 2GVZC 2ZUFA 4D0LB 4DIBA 3GV0A 1N36O 1G9XA 2A67A 4DTCA 2VT2A 1CRZA 1ZJJA 3VZPA 4HNQA 3SKYA 1O95C 4TKVB 1QG0A 1JLLA 2Q5LA 4BNFA 4Q1CA 3DTVD 2XTJA 1YIAA 3KKLA 1VP9A 5IC5A 3ZHBA 3O6VA 1TF2A 3A05A 1MHTA 1OYYA 1KMMA 3CB2A 3IELA 4YY3B 4EY3A 1V5IA 3IP5A 1T0BA 4MSWC 4KYIB 3AKZA 3N2NA 1JFFA 3FSGD 1Z4IA 5AHOA 2VSXA 5DI3B 5EMKA 3KVNA 4QASA 4YAFA 1VSVA 3FMOB 1ZONA 4NYJQ 4P4UA 4PY2A 2Q8PA 4QATA 2NX8A 1KKLA 4L8LA 3I23A 4OP3A 2YIAA 2IU3A 1UXIA 2WAAA 2R47A 4C14A 2J59A 4HADA 1HUQA 4RKFA 1GV0A 3L73H 4DM4A 3GUVA 3QWFA 4OIMA 5AI8A 2CL5A 3OAAG 2FX3A 4D5GA 5M04A 3TEJA 1VL8A 1DXOA 1SB8A 1WKBA 1D0SA 2AOTA 4LV5B 4BX3A 1K7DA 4WT7A 2EQ5A 2Y4OA 3D3NA 2FB5A 1NDUA 3LO8A 1NUHA 3LWDA 3S99A 1XVVA 4N5HX 5BRAA 4FLUA 4FMPA 3UJ7A 4R05A 2WY2D 5GVSA 4Z0NA 3GLIA 1Y7PA 1Q12A 4AX4A 4Q1DA 4Q01A 2P9FA 4R2LA 3BHIA 5A3RA 2V7XA 5CT9A 3D3IA 4DIFA 4PV7A 4NQRA 1V8ZA 1QYDA 4J6EA 1NV9A 1RLUA 3CKYA 3OEHD 1C50A 1M0TA 3AHDA 4M9ZA 1V35A 1P9WA 5EXPA 3M99B 3RRZA 4NK4A 4KJXA 4B35A 1GUBA 4U6QA 1TAEA 1OJLA 3S3WA 3K5HA 2WUGA 1ISHA 4LI0A 3OGCC 5L3QA 2BEWB 1FXWA 5IXSA 3ZHRA 2WLMA 1AHIA 4IOJA 2G77B 2HF8A 4KDCA 2Q4TA 3IGAC 1EFRD 2ZRKA 1JSXA 2CEAA 2DQ3A 1JEOA 4U9UA 1ZJ4A 1AI4A 5KTNA 2KPOA 5KYUB 4M9SA 2WHPB 3A6KA 5M29A 1QLEB 5DMXA 3DZCA 3MWEB 2HK6A 1WY5A 3VMFA 6YASA 3HBNA 2GEBA 1FP2A 3OJFA 3CF4A 1ZISA 3OCUA 3LC0A 2H6EA 1UK8A 4YHHO 1P39A 4JDUA 1EN5A 3J80A 1E1CA 4CCYB 1M0SA 4FFMA 3PJRA 4L78A 2WYUA 2W6ZA 2NXNA 4AJOA 2EBHX 4RPGA 5AJXA 3RS0A 1E63A 2Q3MA 5FTKA 1YC5A 4A9AA 2EKZA 2X8WA 2IYUA 3OG9A 4C06A 5CW6A 4RQBA 2D1RA 1FLDA 5LQJA 4YAOA 4HAXA 2FPLA 3HJCA 4U1RA 1ZM2A 2FEXA 4TSFD 3OH8A 3OEEG 1P33A 3OU6A 1B42A 2B99A 5KINB 2JGEA 2ZB7A 1HNXB 1GUZA 2XUZA 5CNMA 3QI7A 3U09A 2RGEA 4GXRA 3E22A 4U3JA 3R75A 1SURA 2ZS7A 3L8HA 4YJGB 2X9GA 1HDEA 5C18A 2Q3JA 4FT4A 1NFQA 1Y3IA 5DIFA 4BJ6A 3HEBA 3I30X 4NTYA 2YDYA 1OLXA 1RLOA 3NC1C 3CNHA 3U0VA 3VPAA 2G9VA 3W06A 2RGDA 2XWSA 4DCVA 2HHHB 1CUXA 4TS9A 1E6MA 3HMKA 1P0QA 1CUHA 2YZGA 1JEQA 1W36B 5E7JA 9LDTA 3HPLC 3KQSA 4MJLA 2ZJAA 4V3CA 1S4MA 4LJKA 1OGJA 4HDCA 2EZTA 2AZMA 2QL9A 3OR6C 4O0MA 2GN2A 2CJWB 3ZLUA 1PJLA 3GLIE 2ODNA 3CR7A 1EEXB 3FXAA 2JDIA 1IIBA 5DWVA 3EIQA 3V46A 3VYTB 4QOFA 4PVDA 5JXWA 2JZOA 4FDUA 3GFQA 1H93A 1KARA 5AI0A 5EWJA 2VJCA 5FBLB 2CNWD 4IFEA 3SX0A 2PQ0A 2GJKA 1QFXA 1IZZA 3B77A 2RC6A 1O6BA 1FJXA 4U0JA 1O08A 4B3XA 1ECPA 2VK1A 2QZ4A 4FEEA 2W6OA 3T35A 1AQNA 3G49A 2AN5A 4L4UA 1VDZA 4X64O 2GPTA 1XL6A 3FAVA 3GU3A 4UHDA 4QJ3A 1HKHA 3LCRA 3LP6A 3UCXA 1E7MA 4V2UA 4C4AA 2KLBA 5ALWA 4M6WA 4QUHA 2QN3A 2YMMA 2ZSDA 3CV3A 1I2MA 2VJMB 3F6RA 4PN3A 1CQJA 3RIYA 2XZOA 5AKKA 2X77A 2XA9A 3R3XA 4UBNA 3PXAA 3TCUA 5E95A 2Y2UA 2YIJA 2HADA 1PR5A 2Q73A 1F5SA 2O0MA 1XIVA 1XUOA 5IT9A 4NECA 4MVUA 1QQAA 2GFHA 1UK9A 3SQNA 1VYVA 1XHFA 3LKVA 4FMCF 3QLVA 3PHGA 4FHDA 2C1EA 3WL8A 4I1YA 4DBLC 3KDSE 4FZ1A 4DUGD 3CUTA 4ECAA 4EYEA 2CJPA 2BONA 2D54A 5IX8A 2Z5UA 3CPWU 4TXLA 3CCQV 3C4JA 4IWNA 4M0FA 3E83A 4FDAA 4BQFA 3KPVA 1FYJA 1KUQA 1YR3A 3FZGA 5HDBB 2AOVA 2DY1A 4L4YA 5F52A 4FQ8A 5HKKA 1ZHHA 2D5NA 3OBIA 1L5QA 1TO6A 3NHLA 4Q12A 3IYLW 3C3CA 5AK5A 4ZCTA 3UG6A 1SHJA 3HCFA 4E33A 1QO0A 1XDCA 3A1SA 3L7YA 1E79G 1VCMA 1AQ6A 4R8SA 4KQ9A 3O74A 4FFDA 3BDVA 4LAFA 2CLHB 4O4HA 4GWLA 2QUBA 4CM1A 4RJKA 1MV8A 5GM1A 3FNHA 4W1QA 1VPLA 3IAAA 1Y6FA 2FV8A 1W93A 2DJVA 1K3FA 2VP0A 2RKOA 3M3DA 3ZCVA 5CJ2A 1P4HA 3UC9A 1IHYA 1ELOA 5AVTA 3QNMA 5LQDA 3MWDA 3R8CA 3OGIB 1HYBA 3B3FA 2ID8A 3Q9NA 4RA9B 3SJQC 3TOZA 3RYIB 3IDQA 3IIJA 4IEEA 5KJCA 2LCQA 1CD5A 2Z3YA 1DJLA 1MFPA 3HCNA 3OCZA 2PWAA 4ENRA 4XYGA 4K6HA 5FEUA 1RRCA 5F3WB 4PFJA 3VR4H 3PRYA 3T5GA 4HUQA 3WYCA 4GOKA 4NXNO 4GQBA 2PT9A 4BUJA 2CW5A 3IDZA 3VR2D 5G1OA 2OBYA 2VDLB 2WYHA 3L7OA 2PGIA 1UAYA 4MDHA 4AQDA 4I4NA 4RTPA 4N6NA 4R40A 1S2GA 3SBDA 1DAOA 2P6UA 1LK5A 1VLVA 4AJKA 1SG6A 3HV0A 4W5WA 2JAWA 3K9AA 2Z1NA 1I7LA 5CTJA 1YD7A 3ZHUA 1QRAA 5D3MB 2E74B 1MTOA 2IY8A 5FPOA 1DU4A 3SXPA 3OIUA 3G2PA 4GH5A 2O2JA 2ZDHA 1IOZA 3EZ6A 1WMDA 2C9BA 2I66A 5E6RA 2ENWA 2FX2A 5DP2A 2F1IA 1KJIA 5BOVA 5EJGA 5J2UA 1AO0A 4I1RA 2R00A 4R1OA 1RBZA 1I8TA 2XV1A 3H4TA 2DFKB 2YXDA 2YZ7A 3LWNA 3SJBA 1L1QA 1GPBA 4WLUA 2I54A 1DX6A 3GYBA 4AJEA 5CDUA 3JD2A 5LD2C 2WTNA 4PAGA 4BU1A 1SAYA 5EL0A 1DPFA 2OECA 4GI7A 3HJBA 1X1SA 3U3XA 4RH1A 4JR1A 3MXOA 1AR1B 1RAFA 4NJMB 2Y0CA 2IW1A 2QORA 1W1IA 4DSOA 2M7WA 4MW3A 1D6JA 2EKPA 5CCXA 1H5UA 4J6FA 5J23A 4LNAA 4DQLA 3WJ2A 3PQ5A 5KDLA 4EJSB 4K03A 5IFKA 3I9NA 4ZU3A 3HVIA 2ZP1A 2BFFA 2IU6A 1W8DA 1B1AA 4JEUA 3ZHXA 1IZ8A 2ONJA 4EATA 3SPIA 5A4JA 2ZRMA 3ODGA 3B7PA 4Y2UA 4ZIBA 1WJGA 3IJPA 5GQSA 1EFPA 1P29A 4MEAA 1FQOA 4L15A 1V1MB 1ZM7A 3AUFA 5K3OA 4G01B 4LFBO 3R4VA 3EF1A 4X7BA 1KO4A 2Q3LA 3WV4A 3R3VA 3ZDZB 3I04M 4MRAA 4IJKA 4WQMA 1T25A 1OXKB 3MAJA 2J6CA 4I9HA 3IA7A 3NM4A 1I6MA 2NU7A 3RC8A 2PCLA 1Y1LA 3CF4G 2W7TA 4JCCA 5LL6P 2V03A 4IJQA 2H2AA 5CTAA 5LHIA 4UD2A 3NTUA 4YGXB 5JHHB 1OW3B 4RSMA 2IYRA 3U4DA 3L7CA 3SXJA 4DA4A 3O2JA 1JALA 2NNUA 2JCSA 2IYEA 1BSVA 4BNMA 5AM0A 3FOFC 1YVWA 5TQJA 2X7JA 5A0VA 5IBQA 2I6XA 3EY4A 2UZAA 3AZOA 3I09A 2XMQA 3RQIA 1L8QA 1N2HA 3PG5A 5B7PA 1SHKA 3RSFA 3O4RA 1EM6A 5EMNA 4JXKA 3TPCA 2EKBA 1LBHA 3DTTA 2WTXA 3GNSA 2BHLA 1WSBA 2W2MA 5C4GB 1DKOA 1PG5A 4YYZA 3H01A 1QP7A 3GLVA 1T2CA 5E4TA 1G5TA 4G9EA 3Q7RA 4I99A 5ALJA 1KZGB 1I08A 4UUBA 1XMPA 1I4OA 4FDTA 4PTLA 3MJHA 1LI4A 2G40A 5B1YA 4J07A 5A6VA 5JEDA 4N0QA 2E6UX 4EYGA 1VCOA 4M0LA 3D8BA 1UAQA 3G0GA 3E7FA 1VI2A 3RVLA 2ADQB 4PLWA 2MR6A 3A37A 3IO3A 4BQOA 2F4VO 3LLSA 1W1UA 3RI3A 3VC2A 2OHIA 3UKOA 2JDIG 2X7XA 1MH9A 2AK3A 1WB7A 1EHCA 3QPBA 4AKGA 3J7AU 3TL3A 5KTRA 1L5FA 2P8JA 4NFHA 3L84A 5C8XA 2WWRA 4LXXA 2CJYA 3FNEA 2QPLA 2QAGB 2JJYA 4ND7A 3NX4A 3UHAA 3R41A 4ZDJA 2VQFB 3GAZA 3TOCA 3VC7A 3SE0A 1IBKB 3PGVA 3L1VA 4BYMA 3Q8LA 4OV6B 1D0VA 3VZCA 4IFTA 3HVJA 4R2HA 2NSLA 4W63A 3TMKA 4CC5A 3T1HB 5E79Z 2KSQA 1P2FA 3UPUA 3S2ZA 4RSHA 2BHSA 4U9IS 2NP7A 2Q28A 5CT4A 3COSA 5DBEX 4XR9A 3QWHA 3LRTA 3JQEA 2CNNA 1ZNWA 2CAZC 2C0PA 4A26A 4IGGA 2CNKA 4Q5IA 1Z08A 2YUIA 2UUAB 2AYXA 4BWAA 4IZIA 1A4XA 1O4VA 2Y71A 4TTIA 5D3ZA 4LTDA 2ZSUA 2H1FA 2W83A 4M7RA 4PDRA 4PIMA 5IKOA 2XVAA 4J1SA 2GYUA 5ICSA 3RFXA 3S8EA 4CCSA 2VYVA 2SKCA 2ORYA 1HNZO 1M57C 3I76A 1YJNV 1H0RA 3BA6A 2UYHA 1GTOA 4Y2HA 4C21A 1RHKA 5FLKA 4U4AA 3IV7A 2ZYRA 5EYPB 3GO4A 3MS7A 2O2SA 1DFGA 4D9CA 1J09A 4FZ0A 4RZ3A 5AKEA 5BSTA 3O84A 1M5RA 3LDGA 1H05A 3L3BA 2Z43A 5DYWA 1UFRA 3L0CA 3QWIA 4P08A 2HWUA 4Z9BA 1PWEA 4CN8A 4G1VA 4BMNA 1PSWA 3FUTA 4PFSA 4IUBS 2VSQA 4J75A 4NCAA 1FFHA 1JVSA 2F17A 3SHOA 2MSWA 1P1HA 3UGTA 3TCKA 5DEIA 3WA7A 4KREA 4GKKO 4N39A 1KMIZ 2Z5FA 4CNBA 5T4HA 4H1WA 4CKEB 1P91A 3OM3B 3VAZA 4KGDA 2W6IA 4KVAA 2C83A 2V7UA 4N12A 3WRVA 3CH7A 2DGDA 3HGTA 4XPZA 4RFVA 3CW9A 1PP9H 2ZZNA 2A9PA 3ZN1A 2H4FA 3CXUA 3BXEA 4XSHA 2V74B 1KKUA 1JDPA 1JYFA 3ZWAA 3T7DA 4RK7A 1PE0A 1LKZA 2YN2A 4E2YA 3FCOA 4KQXA 4JNKA 3R3JA 3I37X 3DQPA 2AH5A 2W6JA 4OXIA 2AHOA 1DAHA 2VQEB 3EQ8A 3MINA 3FLMA 1KJNA 3HYTA 2OHGA 4GOOD 1FMTA 4FB4A 1MT0A 4RV5A 1JJFA 3AF6A 1MOFA 3R76A 3GGGA 1X74A 4JZ2A 4TWKA 2OO5A 2YHIA 2MYUA 5AOCA 1KVRA 2I6TA 4V0KA 4O4IF 1DKRA 4BYGA 3T9BA 1JFSA 5JJKA 4ALLA 4ZOQI 4Y6LA 2Z3GA 1IUKA 5A4KA 4AWBA 5ES4B 5EBLC 3WNCA 4LBZA 421PA 1SOMA 4TTJA 3IAM1 2QEXV 2XVZA 4W6ZA 2Y9MB 2AZ4A 1LR1A 1YBAA 2Y67A 1YOVA 3TW8B 2R1UA 2VP6A 4R0NA 2Q5FA 1KP3A 3DZIA 3LOPA 1M2VA 5JI3E 1MF7A 2VQ3A 3BWBA 5CFNA 1M90W 4BVAA 3GA7A 4BE9A 1ZJZA 2XCRB 2GJAA 4Y9DA 1A7AA 2ZSAA 3SS9X 2ZJOA 2QTWB 1CTTA 1NJGA 4UUMA 4MT8A 1CIJA 4QREA 4HNUA 1TEHA 5TGZA 5IDWA 1RJWA 1XQVA 3I2FA 4DG9A 5CMUA 4UE3S 3MJSA 4B3CA 5I4KA 3AF2A 1F5NA 1E64A 2E18A 4JYCA 2XI4A 4YAKA 4C43A 1XHXA 1XL1A 4TUYB 1CF9A 1EIZA 1L4GA 1X38A 3LLCA 1TI7A 3K1AA 1HSZA 2J3MA 1FMLA 4RK0A 4BMXA 1O8CA 2CXUA 2PMDA 3RFFA 3ENZA 4BO1A 3PNYA 1MB9A 4O2RA 4A0RA 2IH1C 1YAJA 1CC1S 4N40A 1PZNA 1X7HA 2MSKA 1NKDA 3QOWA 5LDHA 4MYCA 1L1RA 3WP1B 2O8EB 3HNOA 2A9FA 4LEIA 4D6PA 3QVUA 1H66A 3ZE0B 3S81A 2GO7A 4HRWA 3KE9A 3O03A 1ZHOA 6ADHA 1WRBA 1IM5A 4IXNA 4DA0A 4MW1A 2G5CA 2A7WA 4DAEA 3W5CA 5TRTA 1FDSA 1JSZA 5EIFA 2H1VA 3M6MD 1ROPA 3ABZA 4RVCA 3JARB 3KPWA 2QSAA 1XELA 3BHMA 5JY6A 2BLNA 1U90A 4IFIA 4J7AA 4DCGA 2PSSA 3A9VA 3CZ4A 1U0EA 5H6RA 4UQPA 3IKLA 4BLRA 1L5RA 3CD6V 3NBKA 1FFCA 1Y1RA 4URUR 5KJFA 4IIBA 1B3BA 3TKAA 4ZARA 2CK3D 5IKEA 4Y9SA 2VI5A 5LOVF 2WM2A 3Q5DA 2ZREA 3K4QA 3KU1A 1NBEA 1T8PA 4GEGA 3KT6A 1ZRNA 4DCCA 4CIYA 2I1VB 1EFUA 1Q3EA 4HRVA 4JWKA 3LSYA 1F8YA 4YJ2F 2IW5A 4LF7O 3D4OA 4MYRA 2FG6C 5ENDA 4QJBA 5EPOA 4B1FA 5KSZA 1YT5A 5KYTA 1ZKDA 1XAIA 1KSJA