1M9NA

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Structural Insights into the Avian AICAR Transformylase Mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 219
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m9nA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1m9nA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA02
1PKXA 1G8MA 2IU3A 1WO8A 1S89A 1M6VA 1BXRA 2X8WA 1S8AA 2YVQA 1M9NA 1EGHA 2XW6A 2B1GA 1A9XA 1OZ0A 4A1OA 4EHIA 1CE8A 1B93A 1PL0A 1ZCZA 1JDBB 1P4RA 1T36A 1KEEA 2B1IA 5H3LA 1C3OA 1C30A 1THZA 1IK4A 2IU0A 3ZZMA 1VMDA 1CS0A
chains in the Genus database with same CATH superfamily
3D3EA 2CV2A 1LSOA 4J7ZA 2X8WA 1T8WA 4GWLA 2CNLA 2C9YA 5HS6A 4B44A 1GT6A 5JSKA 1ATZA 2XB6A 3K09C 4WOPA 4QFTA 3W05A 4PD4F 2I3BA 2FXIA 1M34B 1XTUA 1B6SA 4BGUA 3GBVA 3CC4V 1U0JA 1YHQV 1K5QA 5IX8A 4N49A 2OO7A 4WCVA 2HWUA 5EKSA 5I7HA 3KK0A 2I2CA 3OHSX 5DMXA 2VQ6A 2BEUA 2G6VA 4LC5A 1Y6ZA 4WPGA 4YXWG 1Q1AA 2VDWA 1HQCA 1ZM3A 1TVKA 3KCXA 3W79A 3OJ6A 4E5UA 3ZBUA 1S02A 3SC6A 2BFWA 1RJGA 3HWSA 5IC4A 4CT0A 5K01A 2A33A 2MIIA 2W6NA 4ARZB 3F7VC 4J7UA 4IV5A 2OLEA 4I5FA 4KBGA 1X1TA 3RV3A 4CLOB 3DEAA 1B8PA 3DNFA 1OXVA 2DFNA 4FW8A 4LF4B 2AT1A 3CNEA 1U0EA 3AETA 3DLHA 3HEMA 3CSUA 4FN4A 3OT5A 3UWOA 5NLLA 4L72A 3Q9SA 4B85A 2Y77A 1N5JA 4JAVA 3H13A 3PVZA 2XOKG 2H3HA 5GOTA 5TPWB 2KE5A 1G9XA 1XPOA 4LQLA 2BUAA 1I3OA 3IT3A 2ADFA 3I9OA 2VK8A 4N0PA 1I5YA 2HLDG 3GNLA 4A2PA 4J1SA 2OXFA 1L6RA 3Q4HA 3TLEA 5E8JA 3AX6A 3D3IA 4JB2A 2C9BA 5FOUA 2OZPA 1V9SA 1KFEB 4HAXA 3PC2A 4NFLA 1QS0B 2VLIA 2IITA 3RJ9A 2JI9A 4D7SA 4PX2A 2PZMA 4TWAA 1NI4B 1S3JA 3JYHA 2ITDC 2HAEA 3H97A 3AHFA 1KC1A 2CNKA 3G5LA 5FI5A 1Z25A 2QW1A 3WDLA 2J7KA 1YFLA 2XQFA 4DWWA 3G9XA 3FNQA 4RPLA 1N5LA 1WCV1 2OFPA 2PTMA 1F1BA 4IDBA 4I4CA 4YP6A 3G9UA 1YTFB 1MMMA 2IYSA 3JR3A 2IW1A 5C7OO 3WGUA 1X1EA 2GILA 4DREA 2CXNA 1GPNA 2V7VA 4YV7A 1FFEA 1RCUA 1FNSA 3IVGA 2B37A 2A92A 3PXEA 4LXQA 2NTYC 3G71V 3F71A 2Q0SA 1GZVA 2C4UA 2ZUWA 1KK0A 4C0KA 3NFRA 4J0QA 3NI2A 4JB0A 4X94A 1H2XA 4ESHA 4XDZA 3RYHB 3VQVA 4KXYA 2XCLA 2QL6A 2O19A 1URPA 4L3VA 1AF7A 2PBLA 2GEUA 3EBOA 2AOUB 1G9SA 2B35A 1HLPA 3R3HA 1WWKA 3TR6A 3UT5B 2PKQO 4A15A 4F3RA 3KAPA 3ZQJA 3C3XA 1Y1RA 3ZDQA 2NLJC 3FWKA 5CBPB 4YR7A 1OCCB 4YJGA 5JTTA 1LVUA 4AJKA 4BXOA 1BQEA 5IJWA 3B85A 1OH8A 1MRSA 3VU8A 3SGIA 4DRXA 2WMNB 1ZGAA 5ALOA 4LDPA 3IUSA 3GLSA 3CLVA 1XREA 4EA8A 3UK1A 1XF1A 3GCWA 3SX0A 1Q1ZA 4YCBA 4EB8A 3W7SA 1K8QA 1M8JA 1UXKA 4Y6PA 3JAKA 3RT1A 3F7MA 4UUJC 3QA3E 3KB8A 2D1SA 4IH4A 3ZNNA 1P1CA 1Y6RA 2C5EA 1VFNA 1RXWA 3KYCA 3HV2A 4QGBA 3VZQA 1K6XA 3CVXA 6AT1A 4KX5A 4DY4A 3P0EA 2L19A 3DQQA 2WSYB 3OFND 3DLCA 4GXNA 2OP1A 4OXRA 5ICMA 4ZD4A 4TMTA 4AY4A 3K71B 1W2HA 1CTTA 4HTAA 4OLJA 1FU7A 4CL8A 3NC0C 4BNLA 3RTBA 3MSCA 4N6NA 3UTDA 2Z0MA 1UJMA 1M75A 1Q3HA 1ZTEA 1BS1A 4KQCA 5EUCA 4W7IA 4EB0A 4BU1A 2DOSA 3UAWA 1F2TB 1Q0UA 4GKAA 3LTEA 1MV5A 1Y7HA 3QYFA 4H18A 2B3JA 3AY0A 4UNNA 5GTHZ 1KHTA 4LDQA 5KWSA 5TS2A 4CGYA 3NBFA 3FY4A 3CIOA 4UXJA 2V1XA 4OMDA 4BLTA 4DR2B 3KKNA 2PX2A 4YXWA 4YY3B 1B6GA 3AL2A 3R6WA 1LFDB 1E2UA 4I4TF 5KCZA 3JSNA 4S2UA 4EB6A 4RKQA 4JOCA 1TEVA 2X1VA 1JDPA 5JO0A 1PS0A 5IJ9B 1FUKA 4IL6Z 4C76A 4RAQA 3H01A 1F17A 1QF7A 3WAGA 4GVXA 1GCIA 2WJGA 4CJXA 4AYXA 4BIZA 1YWGO 4D9KA 4RF4A 4D5GA 1O5IA 1U7OA 4J0EA 3M9WA 5K0EA 4TWJA 2BMFA 4PSDA 4TKMA 1ULTA 3N0TA 1ODLA 1ZK2A 2GA8A 1PNKA 3IE2A 1KYZA 2ACVA 4N7RA 3ASNB 1SUPA 2H2HA 1NUSA 2XOKA 1B6TA 5JHHB 4B8ZA 2Z3VA 1KOFA 1W9MA 3DLTA 4EUSA 2KMLA 2LP7A 2VFAA 1G8FA 3LP8A 3GUVA 2HLDA 3LC1O 4RCYA 1EXMA 2BEVA 2DPLA 2RN9A 3FWYA 4YYEA 2R11A 4RSRA 3SEQA 4G1MB 1YZFA 4NBVA 4IMPA 4ZI2A 3KR9A 2H48A 4ZVTA 2UU9O 3P3PA 4OU4A 4FCCA 4LE1A 4BVJA 3I45A 4X95A 2VBGA 4BWVA 4NVRA 2GTSA 1XJ0A 1HOXA 4G63A 5FBWB 4M88A 2J30A 3R76A 5ADUS 3J7AU 3OA2A 5D84A 4GZRB 4LE2A 1AN0A 4BCDA 1TAHA 1GPKA 3EPRA 4M0UA 5BV2P 1VLZA 2Z3GA 4KBFA 4G4JA 1SQXH 4EPVA 4C7OB 4TWBA 4RAIA 1PV1A 2HK6A 2NACA 1YNSA 4BVHA 2H6EA 2JFZA 1XEQA 4QFBA 2BFAA 3OD4A 1Z2OX 1M2HA 1BE1A 1X7GA 3L6EA 1JKJB 4QA9A 4ITUA 3AJDA 1R50A 4G81A 5TGDA 3WL3A 2H2WA 3WV4A 1ZH8A 3GLKA 3WQSB 2YJ3A 1ZD3A 4XOUA 1ZJJA 1U7WA 4M83A 3RODA 1LVHA 1V41E 1EDOA 4OJNA 3P8ZA 2MTBA 3J80N 1HBJA 1MNGA 2OSVA 5KSOA 2JFUA 4CM4B 4TTSA 2NR5A 2ILMA 3CH6A 2AE1A 1AKTA 2I80A 3SR3A 1VGRA 4EGSA 2GXSA 3C3AA 2Q6IA 1MAVA 3FDZA 3UK0A 3DG9A 1T9BA 4IQ4A 5IY5B 4MRMA 1AGXA 2EC5A 2ZIAA 1E7YA 2R6DA 4GO1A 2LRHA 4C6SA 5FTJA 3EIXA 4M46A 4HWSA 4JGSA 3INGA 3SZMA 3TB4A 2W6PA 1DRKA 5JASA 1U8AA 3NTXA 3TRKA 2PZAA 4TQDA 3JQGA 3OZFA 2GPTA 4HD8A 2QPOA 5CIQA 3BJEA 2CHFA 4NTXA 1T0UA 2FF5A 3O4VA 3AI2A 2IPOA 1U0OC 1CY7A 4KITC 4FCTA 4D0NA 4JEHA 4DK0A 1VMGA 4P5PA 4TQGA 3SJZA 4LY0A 4YUYA 3A0HZ 5JCPA 1RWWA 1OI3A 3VSEA 3A9SA 4FGWA 4N6GA 3HXPA 3RRZA 2OCXA 5BMVF 5K0TA 2F67A 1GG5A 2WLIB 4IHAA 2Q7OE 3NKVA 4Y9DA 3RWRD 3LI2A 4R2HA 4YFVA 3HN7A 5L7YA 2IGBA 2JK5C 4K3UA 5HHTA 3KBOA 3U7EB 3QELB 5C31A 1NZDA 3FYHA 4UHDA 1E3QA 1Q19A 4KSCA 4OBWA 1LBSA 2D1TA 3QPAA 1K4MA 3N7UA 3WBKA 3OOSA 1XE3A 4AO8A 3UC9A 4M1YA 2VF5X 3U7JA 1VHDA 1A98A 1W94A 1H0KA 3ECSA 3U3JA 2AJLI 1US6A 4PTLA 3E82A 4MUXA 4P53A 4BB6A 4PQYA 5LOVF 3S2YA 1WJGA 3WIDA 4GM1A 1OIWA 3A3OA 3H2GA 3WB1A 1MJGA 3REOA 3DV0A 1PLLA 1KYXA 3VR6D 1PHRA 3OHMA 4TKVB 2BUBA 1OX4A 2UU9B 4HRAA 1X7HA 1WW8A 4NF2A 1HUQA 4DLUA 5TMBA 4B33A 3O8NA 3JRWA 1QHXA 3S1LA 5F7XA 2Y1EA 4OB8A 3ONDA 3OPYB 4DN6A 1EZJA 5E2AA 2YOHA 2RI1A 3GDFA 1X87A 4JYCA 1TIPA 2NMVA 4C3ZA 3CXUA 5DXFA 4B4OA 3MJCA 1KAEA 4JAVC 3FNFA 3CNQS 3BCCH 1NV8A 1RMYA 2CYAA 1AI4A 5HF9A 3GJ6A 3MTGA 2Z6VA 4O2BA 4UVAA 4Z7NB 4X9XA 4UC0A 1JR2A 4XGKA 5J43A 4UVCA 3NHUA 1SELA 3DMTC 5D7BA 1PEDA 1DC6A 3DR5A 3LNNA 5ALLA 3DXRA 2Y66A 2BSQA 1XPJA 5ICSA 4Y1FA 1SHKA 5LGUA 2W6JG 5FPSA 3DB1A 2R7MA 1EAMA 3IPLA 3WWYA 3Q8MA 4O02B 4H4CA 4NYMQ 4JVOA 4E0QA 1DT5A 3DA8A 3SYPA 2OZVA 4Z2WA 1D2EA 3IO3A 1X70A 2PRSA 3RLIA 5J4KA 4PSAA 2NTVA 3FB8C 1UKBA 4MUHA 3F9RA 4ETNA 1NDHA 1IHPA 4LXYA 2PK3A 4BMYA 1VE9A 3SOPA 1MX3A 1JJBA 1DEHA 1T8YA 2CXQA 4XX0A 3CR7A 1IX9A 4N3NA 2G07A 3UJ7A 5J3JA 4L02A 4OVKA 3BRWD 3ZWAA 2WFAA 1OC4A 1YZNA 3GVXA 3LXUX 5HZGA 3FYTA 1ID1A 4QDOA 4RZIA 1IURA 4IRUB 3BWCA 1CUDA 2EKQA 1ZIPA 5H4GA 2DQ4A 2EKBA 2XVAA 3E58A 4UJ5A 4XIYA 3X2QC 3TUZC 3KSRA 1RZRA 1ZZEA 2ZS8A 2H4WA 1EXWA 1YGPA 1LV8A 2NU9A 1GU1A 2JHAA 2BONA 4NK4A 4IHJA 5G3YA 4I55A 3OZRA 1AD2A 3VOTA 2NLOA 4D9HA 4EKDA 3ILVA 1Z28A 4AP9A 2I8LA 5F7JA 4DW8A 3VGJA 3AUAA 3DBLA 1I4EB 2R25B 5K8TA 1VIBA 2NPOA 3IMKA 1H2EA 4U00A 4N8SA 1T5OA 3TLKA 3E86A 2VAVA 2ZQZA 4RX1A 3QOXA 2RHWA 2WVHA 5EN4A 4XM1A 1XZBA 1MEJA 1GP2A 1M8GA 2A5GA 1H5QA 2NX2A 2UZ1A 4KO1S 3L6CA 3EFOA 4HN9A 3MT0A 2Z9BA 4B6JA 3FPSA 4MULA 1QYWA 1C4XA 2SKDA 4FLMA 2WF7A 3DDCA 1QK5A 4ND1A 3JAMN 1L7PA 4IL5A 5C8YF 4H6XA 1OH6A 2V97A 4CMEC 1Y1QA 3THWA 4QM6A 5KHJA 4UMVA 1G7TA 1TKAA 1PQYA 5C93A 1VMAA 4DR4O 4E31A 2PQ6A 4PZYA 4QDTA 4GGPA 2Y4OA 2Y0CA 1MH1A 2DT8A 1GL9B 4BWGA 1PD3A 3KLNA 4TL6A 3OICA 4GBMA 5K0CA 2QMHA 4HLUA 1WIWA 2OVFA 5JCJA 4D97A 4LY3A 1AMOA 2BEWA 3AVPA 1QP0A 2YJGA 4B3MB 5H4HA 4GI5A 5TT0A 3C48A 2HJVA 1IB0A 4ZMSA 4JLUA 2NO4A 2REQB 3ABOB 4B7ZA 2WAMA 5JZBA 5ARBA 3OX1A 4F8JA 3L1UA 3WISA 1QHNA 3M1YA 4E2YA 6REQA 4J16C 2NNUA 1XVLA 2J08A 5CTJA 2IIPA 1VIDA 2CVHA 4FKZA 4MWTA 3RFXA 3KQKA 1Y8QB 2IT1A 2G4LA 2J3IA 1YIOA 2ZGVA 5DN6D 4Q05A 1QHFA 3WBJA 1L7EA 1ACJA 4BIUA 3I6QA 4BMZA 4R41A 2DWPA 3E9CA 4PLYA 3K2QA 4J0HA 5LR6A 4NU0A 3AL0C 1EP2B 3N2GA 4WLFA 1FP6A 4YRPA 4PS0A 1L0BA 4P0TA 3NWEA 4NESA 3BXHA 1VRWA 5AXDA 4CTJA 1NNLA 2VUHB 3KYIB 3VR5A 2VS0A 4H1UA 1K6MA 4AKTA 4F12A 4CDGA 2WU0A 1G55A 3PPYA 3HU1A 3IR6A 4ZXPA 1T4BA 4YJFA 3C4VA 4MCHA 2WTMA 3KKPA 4CC6A 2DGDA 4B3TB 3WG9A 5JJIA 4IWXA 1ULBA 4H77A 5HZHA 3DHEA 2FN9A 3ANMA 1T4DA 3H8SA 2W6JA 1SVSA 3J80A 3X1DA 3WMWA 3O8LA 4N0MA 3OLQA 2ZUCA 1EWYA 2PF4E 4DMMA 1GOTA 1BH2A 3KDSE 3PXBA 2ZDIC 3WLLA 1FQKA 3OJOA 4BMOB 1GN8A 4BP9A 3WGLA 3B3AA 4Q1EA 4WD3A 1DO0A 4E2LA 3UA3A 4EF5A 4O1IA 1VSTA 4CMIB 2P78A 2BBSA 1ZSVA 4GZ3A 1JA8A 4I1OA 3OTHA 4UV8A 1FJGO 3K9LA 2OAGA 5JJNB 4KR6A 5DTIA 2EFGA 2QWQB 2BBOA 3KRTA 4QJ5A 1YTLA 1M93A 3GJZA 5K3AA 6YASA 5MGNA 4ZAXA 4KC0A 4DABA 4IM7A 4MHSA 1GAJA 1D5AA 2G36A 3NBXX 2WA4A 2P2NA 4NTZA 3N8DA 2YV4A 2RGBA 1IM8A 3HDQA 4R7CA 4UM9B 4JJFA 1OVGA 4LPKA 1SQQH 1G5IA 3PGKA 1YE8A 4ZOCA 1PR2A 1CKEA 4HGRA 2VHVA 3HKEB 3S1AB 1RM4A 5CX4A 4EPXA 3ADPA 2X0EA 5B64A 1KYYA 1YZLA 4C29A 2QGZA 5BW4A 3FFXA 2XWJI 3LFUA 3KJNA 1V8OA 2AZTA 2V6MA 4XLLA 4JX9A 2A7XA 2HFKA 4CEJB 4J9UE 4WOBA 1N9GB 1VB5A 5I7OA 4URYR 2M7WA 5AJWA 2OCYC 2H65A 4H4DA 2HG5C 4DWOA 1QCCA 3REQB 5CLGA 4EA6A 3JQ9A 6ABPA 1JIJA 1GQRA 1HQDA 2Q27A 4KOAA 1RCTE 3HLKA 4AUMA 5I48A 4LXHA 3JQ8B 3GJ5A 4ZKDA 1JX9A 1AR5A 1GKYA 5J2TF 3PVSA 2ZJYA 3T9BA 3I5DA 2PR7A 1UC9A 4KP4A 4IIEA 1NOIA 3QO5A 2XGGA 1SVMA 2JAUA 3M6XA 3QJYA 1IPFA 5DT2A 1TE2A 2ECKA 2EILB 3L9DA 1ZPDA 4X3CA 1BVYF 2OT5A 1C8KA 5LLTA 5E79Z 3TCNA 2J3KA 1JILA 4WRRA 3T4ZA 3BTSA 3JQ6A 3G5MA 5EXXA 4R3NA 3A04A 2QRUA 5BXQC 3R3WA 1VKRA 3NHJA 3AVUA 4DDTA 4MPJA 4RC9A 2QIPA 3KL2A 1CYEA 4US2R 5D5PA 4OWPA 3LS2A 5HEKA 5IWCA 4RQAA 1YJ8A 4IIXA 3T4XA 3HJFA 3ZC3A 2CFTA 2CL5A 4XRGA 3ZN1A 3V97A 2Z57A 3EXEB 3A2NA 2LFRA 2HZBA 2FYTA 4EQZA 2EZTA 3A11A 1YGYA 4DCGA 2C7RA 1DLBA 2ZJ0A 1YB4A 3LY7A 3DH0A 4K6CA 3K59A 2NUAB 1MJFA 1M9NA 3R23A 5IDYA 4BQSA 3COVA 4EKGA 2Q29A 4HNHA 5EXDA 2LTAA 1Z06A 1O58A 3K5LA 2JGLA 5BR4A 1BDBA 1NLUA 2QWXA 4DXAA 2NZUG 5E6SB 4GUDA 3ZU4A 1O6BA 2OG2A 4ZCTA 2JHCA 1ZCFA 2WPDD 2OTLV 1P9LA 3C3EA 2PT9A 4YIKA 4A5UB 1RRGA 1VSVA 5KAMA 4RTOA 3Q1LA 3L0ZA 1XZGA 5A03A 2QTNA 3QVMA 4PVCA 5LYJB 5FBQB 1QNFA 2FEAA 3JWHA 4D9NA 4LYDA 1GFWA 2BCGY 1GPBA 3OG9A 3GD7A 1E5QA 1DLIA 3H5AA 3KQOA 2O5VA 3ZHZA 4XDKA 2VCEA 1CRQA 3AK4A 4A73A 4Y9UA 1FJGB 1FXKC 5LA6B 1PGOA 4G07A 3GA7A 2J7PA 4PYMA 1TVMA 2YXEA 4O4LF 4MVYA 4AJ2A 2X1MA 4IDFA 4YA6A 3BDAA 5EEGA 4YALA 4FMBB 1UFQA 2VP6A 3U62A 1NDUA 1WAZA 1WTAA 1JLRA 5L7WA 2CJFA 1T5LA 1KI2A 1U0BB 4L8FA 4TLMB 4J7CA 3WYFA 3FROA 3RI3A 1NJGA 1J95A 1TK2A 4KIWA 1WDMA 1SIWA 1Y98A 4D0LB 3UFBA 2FP3A 1RHJA 1LTQA 2BFEA 1Q5OA 2EFDB 2I9PA 1E66A 2GB4A 2YUIA 4JN6B 3IAFA 2NSLA 4MK4A 3VZSA 3BIXA 4NS1A 4J76A 4C43A 5JD4A 3FI0A 2YJ6A 3IXMA 3K1ZA 1V55C 3SI7A 3TLGB 4NH4A 3CB2A 1UQTA 1R8YA 1TUEB 1NN5A 4V1CI 2VHWA 5G0SA 3VRHA 4WA8A 1C3EA 4G56A 3M89A 4OB7A 3PHGA 4ZKIA 1D03A 2FJ0A 3NHZA 4OK5A 3BTUA 1NYQA 2ZT7A 5CURA 1Y9JA 4P4UA 3JAMA 3KOMA 2YNMD 1HRKA 5I9LA 2HV9A 4JT8A 3AR3A 2VUSA 4J0CA 4L0DA 2VHUA 3KPYA 2QX4A 2H9IA 3KKYA 3DE5X 3MS4A 3BD6A 5CCEA 3LLVA 5DWQA 4Y18A 1W36D 1WA8A 1VQ9V 5J58A 4Q4JB 2ZYSA 1GGJA 3EDOA 1SB9A 5JCXA 2FPWA 2NZXA 3COWA 4LCOA 3UHFA 4EW3A 2CGOA 4A8JC 2FPXA 2MSNA 4HBNA 1DL5A 1ZBDA 4QDUA 1PV2A 1RM0A 3P2KA 1XDDA 3SJAC 2YXYA 3N3AC 1KHHA 5DM2A 5K45A 2GCGA 1NV9A 2XRZA 3GRUA 1QHYA 3GWGA 4OUDA 2Q3BA 4JNCA 3T34A 2BTEA 1U7DA 2I3GA 3MINB 2WAXA 4TMVA 4AJLA 5ESXA 3A6JA 1ROPA 1WG8A 3VKFA 2XUMA 3G2OA 4QOIA 2UYOA 4GLXA 2ZBEA 4CIXA 2PL5A 3NNNA 3O8OB 3MJVA 1T3ZA 2GBFA 4L4ZA 9ATCA 2V8OA 1Q6UA 4DBVO 2FSVC 1OKKA 4V3CA 1P7CA 4H0NA 5ALKA 4LFBB 4A03A 4AS1A 1OV6A 1CZUA 3H5OA 4WXMA 5ALWA 4BUZA 2HYIC 3Q40A 5I01A 2FUCA 2BMWA 4FLFA 3TTUA 2BGUA 1JBEA 5FWXA 1MO2A 1MJ5A 1FY2A 4K86A 3I2FA 3K79A 3T5AA 1FRNA 1OZGA 3JQDA 4EJSA 1FDSA 4MR7A 2D06A 4JYMA 2PTGA 1KTIA 4II3A 2IOHA 2FWJA 3LCUA 3I01A 2C4WA 3HUEA 3CLRC 4YP9A 4ZCMA 2BDTA 1UWLA 1AB6A 1CUSA 4HVTA 1J23A 4KQEA 5JS2A 5IF3A 1CHDA 3JWJA 4OBEA 5ALIA 2FSIA 4H4EA 2C8LA 3LBAA 1QDLB 2P79A 4LVNA 1Y63A 3Q9NA 1D0SA 3JVUA 1YF2A 1E20A 5JO9A 1KMHB 1Y8ZA 1H2RS 4TQUS 3OZSA 2OXEA 1GCAA 2GCPA 2AOVA 3DS8A 2H00A 2PS9A 1TIBA 4Q4HB 5CX1A 2PCLA 1CIVA 2BFMA 4IFEA 3SYRA 3WWOA 3AESA 1JH9A 4CLRB 2V7PA 5IAJA 1S4QA 1HEIA 2F1OA 4FZVA 1QP8A 3L7DA 4Z49A 4IWNA 4FEEA 4QDXA 1OXSC 1U65A 4C0QC 1NJ8A 1ACLA 3B12A 4FMPA 3VAAA 3ZJ4A 1W25A 4DLRA 1QSGA 1DDOA 3S70A 1MNQA 2NTJA 1RYZA 5K0NA 2Q4PA 1FSFA 1MX5A 4UEJA 4QC2A 4I1SA 3TUIC 2MYUA 5L3ZA 4BE9A 4UUNA 3I30X 3DD1A 1NXXA 2ZULA 5B6PA 3IUQA 3THXA 1QG4A 4KO4S 3UJCA 1OX7A 1ZU5A 4IHKA 1OJ7A 1Y7LA 4N1AA 4Q6GA 1B8VA 3JPWA 1W2GA 1V8DA 5JVDF 1ZO8A 3U10A 3ND8A 5AD1A 5JYEA 1FPQA 3SIXA 2DUMA 1O89A 1KYQA 5DM60 3W5IA 5EZYA 1M90W 2ZT6A 4EGFA 4V0ME 4L9SA 2P5UA 1G6OA 4Y7DA 3A4VA 4P1ZA 3H5IA 3W5DA 3EGCA 5FFMA 3OKAA 3MMXA 4HDRA 1V5IA 4JC0A 4RHFA 1DS6A 3BIOA 1GUZA 5DHAA 2ZWMA 4LWSA 4O29A 3BXXA 4KVGA 1S2GA 4P3KA 1C0EA 4JBNA 4WK4B 3B3GA 2CFRA 3E1UA 2K7ZA 3OEWA 5A0FA 1NLFA 4DSUA 1PQUA 3E3OA 1YRHA 1Z7GA 2XR1A 1BYUA 3ZJVA 3LX8A 1GLVA 3WLPA 1Q1QA 3FTFA 2B20A 5K3SA 1AZLA 3AIOA 4E46A 1I2MA 1UEIA 2XY4A 3EEOA 3N2NA 5ITZB 2LW1A 5IKEA 1NSFA 3TPCA 4S04A 1W34A 2W2KA 3F49S 3QV1A 4GOND 3USCS 1U1IA 1K0UA 2FPUA 3VQXA 4R83A 2EDCA 4ZDWA 5K1PA 5DGIA 3UCSC 4IYHA 2AEEA 2PQ2A 5FL3A 3RRNA 1HE4A 4CKZA 2WHQA 1K8ZB 1E5LA 4XYLA 4BV3A 4OHBA 4OOEA 5JQGB 3AXTA 1AF4A 1QKKA 3RHZA 5FHQA 3IKJA 2IXAA 2WKQA 2NU8A 1TAQA 2D6FA 2YI9A 1IZ8A 1SCNE 3VPSA 1YUNA 1RXUA 1JB9A 3S27A 1VECA 3ONVA 3VR2A 3TCUA 1VKZA 2QNIA 4AZSA 1RXCA 4P4LA 3ZDDA 4MV7A 1FQJA 1HY3A 1K08A 1BCSA 2KG7B 1XG5A 3H8VA 1Q82W 1N5OX 4X0EA 4F8EA 4LA4A 4ROSA 3FLAA 2CXRA 1V9CA 3W9YA 1SESA 1QR8A 4X41A 1XRPA 4RVGA 1GR1A 2ATVA 3S7TA 1YZUA 4FGZA 4GDFA 5L8VA 2A5YB 2QN6A 5DHTA 4FFRA 4NLLA 5CYFA 2NVUA 4MX8A 4PRLA 4TUYF 2CFOA 1BOOA 3D1LA 3SVZA 2O0JA 1TI7A 4P92A 1F8YA 5A4JA 3ADBA 3ETQA 1VBMA 4E09A 2ZRHA 2I4IA 3TNFA 2C07A 3KT3A 2BBWA 3ROTA 4WNAB 1E6UA 3HABA 3JASB 5BRAA 3PUZA 5EHGA 3TEFA 4UHCA 1EDZA 2YN2A 2L6LA 4IILA 4NYJQ 5A1JA 5AKXA 3A9WA 4JLBA 1XYGA 5K2OA 3WTBA 1G8HA 4DG8A 5ER6A 1XLTA 4BC1A 5ALDA 2CV1A 2IODA 1AMNA 4HWOA 3W6PA 1JEJA 1VZ2A 2BCEA 3N2ZB 2HJHA 2GN6A 4B8WA 1LQUA 3HV0A 3RYTC 2X0FA 1KNXA 2W2PA 4AJEA 1Z0SA 2XWPA 1SUFA 2PPVA 4FPXA 4CCAA 3NYQA 3RK4A 2HX1A 5LZ8A 1NZFA 1B14A 3EF1A 3NIFB 5FV4A 1DELA 3K2IA 3AKCA 1FRQA 4QARA 2I2AA 2IUYA 4Q4AB 2FX5A 2CXUA 2NUTB 3IUEA 1UPUA 4OHPA 4IKEA 4D02A 3FMVA 5DNYB 4W7HA 3E3LA 3FPEA 5TSDA 1T25A 5FBZA 4URXR 1QGZA 4WMLA 1M2NA 2IW3A 3C5HA 5KJ1A 2J0VA 1VYHA 1SVUA 3F2IA 2FSHA 2TMYA 3CUVA 3ZK8A 4ZI7B 1KJIA 1AGRA 4I8XA 3PUKA 1GN6A 3V9PA 4NAHA 5HKBA 4BMXA 1KP9A 4NL4H 1VQMV 3T41A 1F20A 4HX9A 4E7PA 3IEIA 1EXDA 4G6ZA 4QXAA 5DHUA 4H27A 4YWJA 1JPJA 1WM1A 2F1JA 3K9NA 4E5KA 3ENQA 3PUVA 2Z3HA 4KGXA 3VR4D 4FYYA 2HW8A 4PO9A 4HDMA 1R5NA 1N4AA 4MQFA 2A57A 1DJMA 4CQLB 2W90A 3CF6R 2GAFA 3QV2A 1LS1A 1QFMA 5DBEX 4LBZA 4B4UA 3QSGA 1R0WA 4OQFA 1D8AA 4W82A 3QLTA 1JKXA 2JBWA 2LE0A 5FOQA 5JFTA 3KQLA 1SETA 1CUJA 2PW9A 2GK6A 2DFLA 3RAEC 1Q74A 1PX2A 2HWYA 1NG1A 3OCVA 3PU6A 3E8FA 2VQFO 4I9WA 4OCMA 5A0TA 4HRYA 4QGGA 2JHPA 1S89A 2YCLA 1UJWB 4CHGA 1ZC3A 4NENB 3IUJA 4YPFA 4HEHA 3H1TA 1ZK3A 1G3UA 2DECA 3FWPA 4IQ8A 4FB5A 1URFA 5BV0A 2QUHA 1EUCA 2RONA 4HQLA 2WVAA 5DM6V 1QUFA 1HC7A 3WB2A 4XQGA 3W7VA 2XRFA 1XL6A 4MVJP 4Q3OA 4R5HA 4Z0HO 2CK3G 2FEMA 2X13A 4D9GA 1U80A 3KU4A 3PR1A 2Z4RA 3MN1A 2Z2JA 3MTAA 1M2JA 5F2OA 5IZCC 3HSKA 3CF0A 4M8LA 1C1DA 5KDLA 5CNMA 4QBHA 5ALXA 4NPHA 3OX4A 3T1YO 3ABRB 2SKCA 3QKRA 3WBBA 2QXTA 3JQAA 5JRDS 5AK0A 2P11A 1FC0A 1EGQA 2EQAA 1IMOA 1YB5A 4DR7O 3GCXA 1TTHA 4KMMA 3QF4B 3PC8C 1Z39A 4C5AA 3CE9A 5HIAA 4ZZ1A 5AKEA 4HAYA 3AL3A 3QE9Y 1Z74A 1JOYA 1D2AA 2ZUTA 1M6NA 4MTOA 3E22B 3F4LA 3PD0A 3IQXA 2ZBQA 4NZOA 1CY8A 4DY6A 4FDTA 3R5JA 4BOYA 4C78A 3AEIA 1HXHA 3RN4A 3GMSA 4G97A 3JD3A 4OXIA 1HDZA 4JSYA 5AM1A 3ZHVA 3TOSA 3KPWA 2RC5A 3PITA 1IWOA 3MTQA 5BN5A 5HNKA 4HVLA 2VDLB 4EJSC 1NVPD 1O03A 1DG1G 4P3YA 3LBFA 4BL5A 2J32A 4EG5A 3GCGA 1GNSA 2XUFA 4F60A 4OHCA 3HACA 3AFIA 1L4FA 2C57A 4FOLA 5BN3A 1RPZA 3RD5A 5M04A 1Q7BA 2PT5A 5JCZA 2O0MA 2AUNA 4UM5A 4JPRA 1KPHA 4JENA 5B7PA 1U81A 2RC6A 1QYCA 3DMPA 3OECA 2R2AA 1G4UR 4MZXA 4ILEA 2NU6B 2VJYA 3TZHA 1MTOA 2FCRA 2G08A 4MP3A 3SGLA 3UJ6A 3G5AA 1ZVQA 4CQMD 1C81A 4K9MA 1ENZA 1V39A 3QVUA 3T0FA 1XZHA 3ED5A 1NI8A 1PNQA 1Z5VA 1FFWA 1QR2A 3O26A 2V7TA 1K3UB 3PJDA 4WZ6A 1VKHA 4GE3A 1AURA 4NCAA 3AR7A 2VQFB 1EGAA 2WILA 1DAEA 5SZIA 4UBNA 4L0MA 1MU0A 3STYA 3ZVRA 3ADCA 3NC1C 4QJBA 2OLKA 2Y4NA 2FTKA 1H38A 1TLFA 2XUZA 2GD6A 1LA2A 3EZXA 1I5OA 1S6YA 1WUHS 3ABTA 1OX5A 1NW9B 5LQMA 3INNA 1VK9A 5KNBH 2P6UA 1C7ZA 3DL7A 2Y0EA 3S68A 5A4IS 4WIFA 4KQ1A 3UKDA 4TQFA 4JJ7A 2OIEA 3KS9A 2GDSA 3LHFA 3NS7A 1TM1E 4M1TA 2PZ8A 1ZXXA 4ZV9A 5KVVA 2RHTA 3T1YB 4V0SA 4LHXA 5J5CA 3CMAV 3VI4B 2OFFA 1B7GO 1ABFA 5K8VA 4CG2A 3KVYA 3AVQA 2A0XA 4LOLA 4RVCA 1E9RA 3ZU5A 4GM4A 3OKCA 4UU8A 3G8YA 5LZ7A 4H1VA 3DEJA 4N03A 5BMVA 1EB8A 3DAHA 3TX6A 4DR7B 5IK2D 2EBUA 5KKCA 3K5HA 5JS1A 4LMRA 1MPTA 5DLQC 5EJFA 2BGNA 1ZZGA 3MMNA 3HKCB 5LMZA 1J1UA 5K3EA 4OA5A 1I9GA 3GQBB 4OH1A 3FPLA 3D3NA 4NFHA 4R05A 2Y0IA 2GETA 1HT2E 3ZHRA 4H3VA 4HAMA 2CHEA 2AZMA 3GWOA 3CCEV 1ZISA 1U6KA 3T94A 4RVDA 4IIJA 2X42A 3VU9B 1I1QB 1TRHA 2C0CA 4D8TA 3VJLA 1GN9A 4Q6BA 4H2DA 4NOJA 5KNDA 4CMAA 4B17A 2CK3A 2WTAA 5E1DA 2JFYA 2ZPUA 4BBPA 1SD1A 1OZAA 4UUAA 4RHYA 2XDYA 2Z8YA 4M8KA 1EDEA 1U0LA 4BRZA 3FR7A 5CLLA 3D8NA 2D13A 4O2AF 2ZE6A 2PSDA 1PK9A 1P2TA 1YSDA 5AI8A 3T5DA 3AXSA 1D7OA 1XAHA 2HWWA 1F3LA 4YRJA 3HADA 4U63A 3UGQA 3G0BA 5LZ2A 3AONB 3QUQA 3OJWA 5ALEA 1CWUA 2XOXA 2YN4A 1Y1LA 1DC4A 3ZJUA 1YHNA 2FUG1 2BGTA 1HWYA 3LT1A 5K6RA 3CZ9A 2DYRC 5FPTA 3THYB 3QGMA 2M6SA 1QLJA 5C51B 2HHCA 4UCWA 3EGXA 3ZCSA 2CXHA 2AX4A 4EEXA 1TM2A 2NW6A 2X2FA 4F1KA 2PLWA 1E3DA 2PRYA 4BAGA 5I8WA 3DFUA 2C5SA 4ZYXA 1A2BA 5AXBA 3R8FA 5P21A 2VAWA 2A5JA 2XECA 4KR3A 3U3MA 1TYCA 4FSXA 1TCBA 3I61A 3NM6B 3ZZ0A 5AW1A 1YRBA 4JVSB 3UCXA 1JFVA 3AG4B 2XHEA 4UV9A 4PC1A 5M5BA 4QU8A 3O3NB 1BVUA 3L4BA 3NTRA 3RKUA 1XDUA 3V2GA 4NZPA 5EJGA 4FLVA 2AG0A 4NBKA 4JC5A 1E7MA 1AXEA 1VJRA 4FIPC 4J9YB 4QVIA 4DXDA 1T35A 1X7ZA 5CIWA 1VP7A 1V47A 3SSMA 2AG8A 1JLHA 3AF0A 4LOKA 5ALRA 3PEEA 4EUHA 4FDMA 1W85B 1DQZA 3DMNA 4F72A 1PYOA 1SXJB 4YWHA 4BNIA 2P8SA 2W37A 4G67A 1JFFA 4YRGA 3E8XA 2GM5A 4R6ZA 1E6MA 4CMBA 1W4AA 4QWWA 2WSSD 2D2EA 4Z4EA 1LRJA 2H59A 1COWD 2AX3A 3A4YA 3SLGA 3KEGA 3A1VA 4DJ5X 5JG7A 3EIOA 2X6RA 4UQPA 5F64A 4DSTA 4YV2A 3VR1A 4XIFA 2VHQA 3I5XA 4MPDA 2FX3A 1KPIA 2DLCX 4QUJA 1T0IA 2B94A 4PRZA 3UJ3X 2QMOA 4PLZA 3WFZA 4C6RA 4LZLA 4F96A 4PF1A 3BERA 1VTKA 3D5EA 1GU0A 5IVKA 3G02A 3O03A 3QUBA 4GL4A 1E32A 2QRHA 5DULA 4IVNA 5I4CA 4JL5A 2JVJA 3ZE1B 3ITKA 1KQFA 3T1NA 4I50A 1T2EA 3KR0A 3CCLV 4R71A 2FEKA 4RL4A 1TX4B 3W5UA 2B0CA 2EHDA 3GFOA 1FB5A 4LX8A 5E1MA 2JHGA 5HG0A 2AV6A 5LWHA 1II8A 4X1YA 3ZHOA 4BC0A 5TLSA 4BX2A 1IOVA 3Q5EA 4JGIA 5GV7A 4GMGA 1EGMB 4PA3A 3NH6A 1HNWO 4YFYA 3WDKA 2JVIA 1H42A 3VZPA 1Q86W 2I3AA 3EB9A 2IPAB 2LIVA 2XGOA 4LJ4A 3GLGA 2PMBA 4OD0A 4RTNA 4M7WA 4DT1B 4MNTA 3CEAA 4R84A 3S2SA 1SBNE 5CDFE 4H3KB 3EVCA 1MAAA 1FW6A 3QU4A 2IDZA 4P2BA 4NY1A 5LQSA 4RUKA 3L4EA 4WECA 4MSDA 2EGHA 3TCKA 3K16A 4OYYA 4ENUA 4TQ9A 1TUBB 3EXFB 4JUFA 3EWNA 1R66A 2FPKA 2NXEA 4GQAA 1J70A 4HDAA 3HNRA 1OLUA 4N48A 2GVZC 2QVCA 4LISA 2H1WA 2B1QA 2FWNA 1J56A 1BJKA 1EINA 2L82A 3HGTA 3I0NA 2DQSA 4D0SA 1PFYA 1FTQA 5JAHA 3G13A 2IH1C 4EH1A 1T9KA 3TSOA 4PLHA 1E5VA 4DGSA 5H82A 1LF0A 3GEMA 1K8XB 1C5KA 1THTA 1D2CA 1PSZA 2KI5A 1O4VA 2FZKA 2B92A 3AVWA 5TXGA 2JHFA 1Y9EA 4NJMB 2HQSA 3EPJA 2Q28A 4XJTA 1QC5A 3E8HA 3GL9A 3HKDA 4GI7A 3WB0A 5DMHA 5EZ6B 4MVJI 2BGRA 2RSLA 2A9JA 3LM8A 1JDNA 3V48A 1GZ3A 4BAUA 3NO4A 1QLEC 2HDOA 2W8BB 3I9NA 3MMZA 2I6FA 3DFKA 1I3MA 3L74H 4BIIA 1H2KA 3IIKA 3I0ZA 3ZWPA 5GGXA 1F8XA 3IDAA 2NU7A 5A62A 5D6NA 2QJTA 1DC5A 5G2OA 1I4OA 2FU5C 1OW3B 1YCHA 3FVWA 1R5JA 4C2TA 3U31A 2A7QA 1PPJH 2PZFA 4R1MA 3U6KA 3FYIB 1XTBA 1O4WA 5TY0A 2XZDA 4OPAA 4F84A 3R9WA 1BXGA 3L4SO 1NT4A 1TQ6A 3VVCA 3LKBA 3UJNA 4WCEV 2OZLA 2YJTD 3AJAA 2HRCA 4L2IB 3ZZMA 1WXHA 3T7JA 4HJRA 3W1EA 4UM7A 2VDVE 4WCFA 1D1TA 3K31A 3RSFA 1LLDA 5LDGA 1MSWD 3SFTA 1X7XA 4PCVA 3L6OO 1TMYA 4FYKA 1A8IA 2Q6VA 3BTOA 2J8ZA 1JR4A 1XV5A 3GPCA 5HGJA 3SR4A 2OCGA 1UP4A 4EG0A 4WKPA 4GE0A 3TDMA 3OCCA 1TRKA 2GXQA 1NHWA 3LHKA 1E94E 1MHTA 3DONA 1QDEA 2WWIA 4QEDA 5HILA 2LPMA 2PKEA 3ERCA 1BCRB 1FFHA 4XYEA 5CN0A 3IBYA 1WXWA 1EXNA 2FPLA 2QYSA 1C14A 1AKRA 2FFHA 1P62B 3IA7A 4JYAO 4ZRMA 3IDOA 4PGFA 2DSTA 1HNWB 2Y3IA 5I5GA 5C3MA 4A2QA 5G0VA 4JCCA 4YQYA 4O63O 1IRIA 1PR9A 3Q3JB 4PLGA 5BNZA 4HT3B 1P84F 3STZC 4C0XA 1Y89A 1DTWB 1N2OA 1ZXLA 4OAQA 3MCWA 2FB9A 2MHCA 4BNGA 3V1UA 2H3OA 3KEFA 5H59A 2OIGA 3IBTA 4P33A 1C50A 1MB4A 3E9YA 4ZICA 5JZVA 4G89A 4MAMA 1PS8A 1C3LA 1ZSPA 3GWKC 4A8PA 3FE2A 4Q01A 1SXIA 1KRWA 1K7DA 1FFXA 3A6KA 4JAAA 5I4BA 1NF9A 4V39A 4LMAA 5J2TA 1JYEA 4EHJA 1PGQA 4I1RA 4OQZA 4IX1A 3LDCA 4DMUB 4KL8S 4BCBA 2WUEA 3O3CA 2C54A 3KV3O 5HIJA 3GBPA 4LHZA 3AILA 1VF7A 2D0DA 1J22A 1LZKA 2FNAA 3F5FA 4WNIA 4P6VF 4QBTA 4RHUA 1XNHA 1YR8A 3EHEA 3B1ZA 1RHMA 3IMFA 2EZ8A 2OOKA 4E4YA 3MRXA 3FNBA 5EJMA 2QVZX 1YZHA 2I7DA 3WAJA 5JAOA 1OV4A 5IKMA 4J10A 3QXXA 3LGXA 4U8HA 1NJ2A 4DIBA 4ZOQI 1XCGB 3ASOC 2HR3A 2ZSHA 4K2HA 1SIOA 2BGMA 2NUPB 1BVHA 3GO4A 4R50A 1DKOA 1IN8A 2BAGA 1CQXA 3TEMA 1GQQA 3EODA 4BQRA 1V1RA 3NQ41 4E32A 2F48A 4YMWA 1HDYA 2Q0HA 1UOQA 2IEYA 3I04A 1MG5A 1EFKA 1DXHA 2X0RA 1ISSA 1CV2A 3PENA 4AS2A 5A9GA 4UVIA 1RFGE 5E0OA 1QQ7A 4Q48A 2Y4TA 1V1JA 3T1HO 3FFQA 4LCJA 3PF9A 3GZ4A 4GLJA 4BFWA 3BE6A 2HMTA 4ZEVA 4C4RA 4KLCA 2C77A 1P75A 1KZGB 6PFKA 4FFLA 4I3HA 5L3GA 5ECWA 3RYCA 3C6ZA 2IY8A 1N2XA 4TXNA 4WKOA 1RT9A 6GPBA 4AMYA 3RSLA 5KX5A 5J2UB 1K34A 2QNBA 2C5BA 2QR5A 3HFSA 2G80A 4DDHA 2AJDA 1YCDA 3BGDA 2REBA 3PFNA 1AV6A 3WYGA 1VSBA 1RRMA 2UKDA 3DO6A 3UJBA 2RE8A 3ZPCA 4AICA 4H35A 3MLAA 1A7KA 3JQCA 4YMTA 3T15A 2ECPA 1US8A 3G2HA 4JJZA 5AW6A 1CZLA 2PSJA 4NCIA 3IE1A 4Y6OA 4GGOA 3ZDFA 1CULC 3LT2A 4LYEA 2PH1A 4YONB 2VYVA 1VYUA 1C9YA 2Q9BA 3SXUB 5K1ZA 1PTJA 4DNXA 2XB9A 4HAOA 1IWBB 1ODCA 3NPMA 3ESRA 3X2SA 4EG2A 4J41A 1RFLA 4FMDB 1Q0ZA 1HL7A 5DV9A 2ZVJA 1YFZA 4JJAA 2HK8A 4QAQA 5KVCA 4JYAB 4FC6A 1N6OA 2M6KA 4DAOA 4GOJA 1Q92A 2VSFA 2O8EA 4C4TA 4WASA 1KI6B 3GAZA 3K7EA 5GINE 3UAYA 1UAYA 1QHTA 1N4DA 5KWIA 2AFIA 2HSJA 2JD1A 5HBGA 3OU6A 4M1WA 3C97A 1QH8B 1DTEA 4YRKA 1HEUA 4M3NA 2OBLA 3JQ7B 4HDSB 1VQPV 3GPBA 3CLUD 13PKA 4CDMA 1ZN2A 3CUYA 4EY5A 3F78A 1E6WA 1C0IA 1J8YF 3T7KA 2WDPA 1ULZA 5E4TA 3MJHA 1ATIA 3V46A 3ZWNA 4D4HA 3TINA 1NU1H 1TTQB 3I76A 1ZD9A 5L4SA 1FDRA 5K8UA 3T0IA 3RJMA 3W7UA 2GZAA 5BT9A 2ADPA 4Q16A 2QM8A 4ARAA 1WABA 5KI6A 3CRMA 3JALA 4P5DA 1D1PA 4WZBA 4V0LA 1P0PA 4IBOA 2CFSA 3DVAB 1EH5A 2DBVO 4WFJA 5GJVC 5A9SB 2ZXEA 3OZIA 1NUHA 4A2CA 1QP4A 3SCZA 1DX9A 2Z5LA 3VTFA 3V4VB 1KEPA 5K0GA 1L5MA 1XZPA 3ZK7A 4DR4B 4CS3A 4HRWA 4ARIA 3AI3A 1SY7A 4B32A 2DAPA 1OY1A 1QBZA 2AJCA 1E2PA 2JANA 2EBOA 5EZSA 5BSEA 3TG2A 2LW7A 2YSUB 2VQDA 4DV5O 2J5QA 1S5JA 3CUTA 1EFRD 1XOIA 1KDPA 3ABUA 1SPBS 2ZJ8A 3HDGA 3GGSA 4QLBA 4HFRA 1EJ6A 1IXBA 4H08A 3IYLW 5CU7A 1I6WA 1XHZA 3BMOB 4EFKA 4KIGA 3T1HB 1JXQA 3S5UA 4EO9A 4QTZA 5GZ6A 2JIRA 4WDRA 5KYUB 2YXBA 2KWIA 1SURA 4NHOA 4YMVA 5DSTA 1HA3A 2V8BA 2LNDA 4YQZA 2BMEA 1K7EB 3RU9A 4V2IA 1PFWA 5AJUA 2C4TA 3VM6A 2M2IA 1WHSB 1JN0A 3JY6A 5CUQA 1Y6QA 3HN2A 1X19A 4D6PA 3HYNA 5ALYA 1LX7A 2O1WA 4R9RA 4M9ZA 1NW4A 3ND9A 4B74A 5JPCA 3RTCA 1G1XB 1QCYA 5IYBO 4M99A 4YCDA 1XZLA 4F4LA 1H4VB 4LC0A 2UXXA 5KWEA 4QGAA 4MUKA 2EZ9A 1HGXA 3X2QB 1TT7A 3FM9A 4Y6QA 3GI1A 3M5DA 1GADO 2QEQA 3VOUA 3LCJA 2R84A 4Q47A 1JSCA 3IUNA 2DR3A 1CY0A 4IFIA 2XAUA 1SULA 3VMMA 1EVKA 5I47A 2KQUA 5JALA 3V34A 1XFDA 3OX2A 1PO7A 5GZ1A 1DEXA 3RVNA 2I4LA 3WYAA 2RHHA 3KIPA 5LBUA 3RVSA 1UXGA 1EFPA 3A6ZA 1V43A 2RHJA 4JGBA 3PI6A 2OV4A 3M4NA 4MV1A 5H70A 2OK8A 1YQXA 4RA6B 4JJKA 2G1KA 3ETGA 1WVMA 3RZVA 2GO1A 3UANA 1F60A 4WZAA 1ZUIA 3OQ6A 1DZIA 3B5EA 1YC2A 1ISGA 2X6BA 1PDVA 3KHTA 1ECLA 4WBNF 1ZBQA 3NOQA 2A3NA 4UVHA 4IPTA 1V45E 5EXTA 4Q9HA 4PZEA 4YP7A 2K2QB 1A9XB 3LGAA 4TTQA 4F71A 5FFNA 1U31A 2ZTUA 2Q6LA 2DPGA 3GEPA 2PKWA 4D44A 5JBNA 3QKUA 4OP1A 5JCOA 5JATA 4FJ0A 2FK7A 3R3UA 5K0LA 4ND3A 2BM9A 1G8MA 1FUIA 2NSYA 3LRPA 2E5LO 4HWRA 1KS2A 1Z82A 2W4MA 4D8YA 4PICA 2JB9A 3KXLA 1B43A 4R8CA 4DL9A 5JVDA 3MZ0A 4WFFA 3QEOA 2WINI 4NU6A 4JLSA 3S3TA 5BYAA 4JP1A 2QRVA 1CDEA 2CTWA 5JNUA 1R74A 2ZREA 3S6JA 1L5NA 4D9EA 4DV5B 4TKUB 2Q2OA 2G40A 3T9DA 1AKMA 2HTFA 1WA5A 4DA8A 1VG9B 1ZCBA 3PEFA 2BHNA 5DW3A 2NTNA 4DQ0A 1MX1A 1QIGA 2PIDA 3TIVA 5HTOA 1XOUA 3LK7A 5EWJA 3N07A 4ANFA 5JWPA 3VHXA 4YAUA 3AQIA 1Q7GA 4N8DA 3Q8XB 3PE6A 1SRQA 3ZX5A 4BR6A 2DPXA 5SYMA 4LK2A 2D2IA 3G4SV 1MOQA 5IFLA 1CS4C 5JHGB 3VGPA 3HN6A 2NP6A 4I5IA 3SMQA 2DP4E 2Y76A 3F5DA 4OHFA 4Y8VA 3ROZA 1XELA 4B83A 4Z7QB 3WGTA 4L73A 3I9V1 4F9EA 4KMOA 3WL6A 4XAQA 3LQFA 1FVHA 1M1NB 3TL2A 1RLIA 1FYXA 4YRNA 2ZR9A 2QJ1A 3AVVA 2BE7A 1DRUA 1NVDA 1M0EA 2GNPA 4BVGA 3K0AB 2UZ3A 3G8AA 4LF6O 3WLRA 3A6GA 1EFDN 2ZJAA 5HOQA 2QVYX 3CJRA 2X76A 3L82B 2BGIA 1L4GA 3ZTWA 2C99A 1O3YA 5ETJA 1SIUA 4F0JA 5LYYA 3RSCA 2YI8A 2H51A 4LW8A 1DB3A 2H18A 4ZOLA 3WGKA 1P91A 4ARVA 2QN1A 3F73A 2GKSA 2JIMA 2P75A 3LCCA 4UVBA 3SN6A 3CYOA 4HQRA 1SQSA 5FRDA 2ZETA 2JCVA 1YZTA 3IRVA 3QPVA 4WUTA 5LP1A 3M0EA 3O2SB 4A0FA 5C8VA 4UDNA 2Z1NA 1O95D 3NHAA 1E0AA 1DOHA 5JS6A 3ZZTA 3O1HB 3ZXUB 1PP4A 1DAHA 4DLXA 4CZZA 4M36A 2R8YA 4DMRA 1ZN8A 2Z30A 5ED0A 1QHHB 3WWZA 2NZWA 1SWWA 3SM3A 3KLPX 3EZGA 3KDAA 2LV8A 1TQ8A 4HLUC 2B8NA 2FR5A 3EWSA 1ORTA 2YC4C 1BL8A 1G5PA 3GELA 4NMWA 2OILA 5KQMA 3H5LA 4FMCF 2IBTA 4HEA6 1XPRA 3IV9A 4PO3X 4MR9A 4MIKA 1H2GA 1U0GA 5BSTA 2PGLA 3CSXA 3F5QA 4NFSA 1SOAA 2E5LB 1Y37A 4OQDA 3AUJB 4P9PA 2IOQA 3DYIA 1Z6ZA 1N8RW 2EBWA 3AHCA 3KZCA 1F2UA 4GX1A 1V4VA 4ED9A 2YDYA 1HYBA 2ZCUA 2GPYA 1XBTA 4LMPA 4B6GA 3C8MA 3UMYA 1LEHA 1OH7A 2QW8A 3NGXA 1GKKA 3S2IA 3L5OA 4EUKA 1NH2B 4YMHA 2Q8NA 4LK3A 2W2NA 1QOZA 2EFYA 2PRKA 3MSXA 2A6PA 4HVCA 1MAHA 1AKQA 4JSTA 3TD2A 5I3ZA 1PVDA 3ETJA 2B9EA 1RACA 2F00A 4R3UC 1WXGA 4CUZA 1NATA 3T1TA 4MOWA 2O8NA 1FP7A 3ACCA 4D4LA 3AFGA 2JLYA 4BJ3A 1EVQA 3CRQA 3N8IA 4B80A 4LYGA 3L7YA 1KJ8A 4YCJA 2YTZA 1LDGA 2W5UA 3PNQA 2W6MA 2VJKA 5DEDA 5B55A 4P9DA 5GM1A 4Q24A 4Y2GA 3PL5A 1W5FA 2JFOA 1IZ3A 3DAGA 1SPXA 4ZVQA 2CUTA 4B3SO 4BN0A 2ZAOA 5BRJA 1VQ8V 4LF6B 3E89A 5HK8A 5DXJA 1QMPA 3DEKA 3GLTA 5TMEA 3HB9A 3EOBI 3ZWYA 5TE9A 3LIIA 4P4SB 3ZWBA 4ASUG 3PE4A 1NKTA 4JLMA 1LSJA 1BJRE 2A9KA 1H2FA 2EJRA 3IEPA 1UBMS 2BGGA 3JYOA 3R6TA 3RT7A 3L7MA 1JJ2U 3SU8A 1M56C 3OQ1A 1U11A 4JKOA 4P3OA 4FDVA 3K8OE 2WLNA 2AR7A 4LGMA 2IF2A 4XWKA 2QZZA 3NEYA 1RPNA 3Q7SA 4AKEA 2AKEA 3PFWO 3E8SA 4RHXA 3GJ7A 2BE3A 1M2VB 3QBJA 2ZLBA 2ONZA 1HYEA 2N04A 2BFDA 1JECA 2DC1A 1ZD5A 4NX2A 4HC4A 4PDMA 3FUCA 5G40A 4B4WA 4B3FX 4TTPA 2XQVA 5AVOA 3IO5A 4E30A 1TOAA 4WOCA 1E1LA 3R1IA 5DU2A 4G4IA 3D7SA 2PUBA 1FXKB 5IAGA 3J7AC 4KRXA 4CN9A 2I2XB 2CB9A 4QSHA 5JXJA 3ELYA 4P98A 4MP8A 1O1YA 5EJEA 4CT5A 3GT7A 3NVMB 5F1PA 2Y68A 1Y82A 4QRIA 2N05A 3FDJA 3SDZA 2WNIA 3T7EA 3DTVB 2VSXA 1ZGHA 3JQ9C 3OPYI 1J33A 5AI5A 1E1MA 1ZLZA 1PL4A 3CR3C 2BY4A 4RK6A 4GZ5A 3RVDA 4GEGA 2EDAA 2IZOA 4AZ0A 4G25A 3ZQ4A 3UYLA 3II6X 3QI2A 2PJRA 3GJTA 3FKSD 4HNRA 1BDMA 3UT6A 3W90A 4EKWA 3DT9A 1DBPA 1ORHA 4HOYA 2X3FA 3ZHTA 3IDZA 4EY3A 3TAHA 1AQUA 1Z5WA 1LTKA 2BP7A 4Z53A 2ZU0C 3ZGLA 4XSGA 4WBSA 4RFSA 3H05A 4CKEB 4MHTA 5AKKA 5SY9A 3GEBA 4LRXA 1JQJC 3QRWA 3WHIA 4R0NA 1RQ7A 4ZAYA 4MB0A 3CJQA 5LMNO 2UZIR 2INGX 3LPAA 2V9PA 2RH4A 3JU3A 5BN1A 2G5TA 5FKJA 3VVBA 2FEOA 2XGMA 2PL1A 3HKBA 5E3IA 4F3TA 2B8TA 4ZQHA 3RWOA 4U7FA 1F51E 4NRDA 1W5EA 2R86A 3M6VA 1JTFA 1EJ0A 4YCMA 2GEFA 3BRWA 1L2TA 3HYTA 5KSPA 4KACA 5JMPA 5C4IA 3VBEA 5TVGA 1V6SA 3SWWA 2QKYA 3DMGA 3PEWA 1LDYA 1S1MA 3H11B 4QATA 1R0RE 3VPDA 3TW8B 5E6UA 4N6OA 4E1BA 3GG2A 1T2AA 1XD2A 1D0IA 2H8PC 4O5OA 1I6LA 3T3PB 2N75A 4IDOA 4A8JB 2CYCA 1FCJA 2C2HA 4CM5A 3CKYA 4DA7A 4RK4A 1R6NA 2GD2A 1BWPA 4EYQA 3LUKA 2FDCA 1T10A 3D59A 3SQDA 3G7NA 2AN1A 5C1DA 5K1XA 3H1EA 1CJMA 5FUWA 3ST7A 3P5BA 4RDXA 1HDXA 2QA5A 4LE0A 4E13A 4AXXA 4PG6A 2ZRLA 4FLWA 4XGNA 3RG2A 3TO5A 1NQXA 1O87A 2QMQA 4K81B 4BJ1A 3AG2B 2G83A 5JCOC 2A88A 4K9SA 4XCVA 3OETA 2O59A 2JH8A 2IJHA 4DVJA 3K9QO 1IBMO 3KKQA 2ISSD 3MJEA 4FKMA 1YVUA 2ZBGA 4I3FA 4QDJA 2PMWB 5CD9A 4I81A 2PHZA 2Z3WA 4KXMA 4JZKA 2B5VA 2G67A 2WM2A 4Z1MD 1UAQA 1VPTA 3IRUA 2GZRA 2WFLB 4HTFB 3V8QA 1UOOA 1I5EA 1LPMA 1TA4A 1Z4NA 5WRFA 3UG6A 3M70A 1DAIA 4KVFA 5CXSA 2VH1A 1FYDA 3L0DA 1FF9A 1X77A 1N9ZA 1XU7A 4ASUA 4EHNA 1YS9A 4UTXA 3V33A 1KETA 4PZ0A 3CS3A 4X62O 1L7AA 1AZWA 4EARA 1JL3A 3PDHA 5B4UA 1NNEA 4LQCA 1QVVA 2XKBA 3UV6A 4MJLA 1UKYA 2GTHA 1UMKA 3CPSA 2BYTA 1NF2A 3G17A 1ZNQO 1TIYA 5DK6A 3EDRA 1SKMA 3I52A 1WPBA 3B6IA 4M9CA 4AMBA 5DYWA 3ZBQA 4QUDA 2BCJQ 3MEQA 1NVWQ 4O59O 121PA 4XPZA 1CQJA 1I10A 4UDXX 2QE6A 4BQPA 2IOYA 2Y93A 1VKOA 1UBKS 3QTTA 4GMHA 4EPRA 1FKAO 5FLEX 4MSJA 3FSRA 3T7IA 1R4NA 3KQYA 5LMNB 1AGYA 1MA1A 1M5TA 1DSSG 1NKSA 3ROGA 2VRCD 1B42A 1CRLA 1XFAA 1IXRC 4KDEA 1NVAA 3KVNA 2IH4A 3FTDA 4RHEA 1PZNA 2GZ1A 3HE3A 2GTPA 5G0TA 1BC5A 1MVOA 2W2LA 4I4TA 3E0QA 2WQ7A 3CRAA 1AKNA 1RP7A 1TQ2A 3RRXA 1YU6A 2P0EA 1Q0SA 2R1UA 2QQ5A 1IXMA 1JTKA 1KFBB 5JU6A 3OUZA 3ORQA 4TX1A 3V6LA 3DXXA 4LOHA 3IUYA 3INYA 4B81A 2IS1A 2EL9A 4KV7A 1H66A 1QE0A 2A0FA 4RK1A 2E4WA 1WMDA 4P08A 1E2MA 2DMXA 1C9KA 1B6QA 4BNTA 1D5CA 1Y3AA 5HKLA 3QK7A 4MGZR 2NZYA 1LGYA 1ZAKA 4XBFA 4IYJA 3M6WA 3ZY4A 3EVBA 1PFQA 5K4HA 2AA3A 3UOAB 2ZJ6A 1ZJZA 2FQYA 5H3HA 1ZM9A 4TM7A 2BFBA 3SQXA 1ZH4A 1BQ0A 4OK6A 4U0JA 3WDSA 1GQFA 4S35A 3E7PA 3H2BA 3QFHA 1NBMG 5CRIA 2RKWA 1YCFA 2JVDA 4RVNA 2EFHB 1XRSB 1VMKA 4ZKEA 4GBJA 4UU7A 3QVGB 3NVKI 2XNDD 1DIGA 3GUZA 2V7QD 4LZNA 4BZPA 3GNQA 2LBPA 4OYHA 1TJ4A 1IBMB 3WA6A 5JC1A 3G0CA 1LK0A 4PBRA 4BATA 4IJKA 1LY1A 3WZ2A 3D8RA 3EMDA 5A1TA 3NT2A 3AG7A 2PT6A 2R8EA 4BGEA 2SECE 2VK4A 2DCMA 4X3PA 1OXKB 3I32A 3QP9A 1SXGA 1CY1A 2WWFA 1JT2A 3RWBA 4J6EA 5L3EA 4NTYA 3ZNOA 4IMRA 2X3UA 3QHPA 3NBMA 2PXXA 5JMTA 5DRYA 1FNMA 1R6UA 1QIIA 3Q7QA 4KQIA 2QL9A 4WEQA 1NTZH 3L79A 5CW6A 3BHPA 1IJEA 1KEWA 2DHQA 2COEA 1XWIA 2I6SA 1V1MB 3CGWA 2Q6OA 4X62B 4FYXA 3KFXA 4QNNA 1DKLA 1Z5GA 2WM8A 1L4NA 1ONPA 3E81A 1RLOA 2I2BA 3IAS6 4J2TA 3OY7A 2P6PA 4GLBA 1R8JA 1X4TA 4XGIA 2GCEA 2PANA 1KMNA 1MZFA 1DMSA 2C3UA 1Q1BA 4CI9A 1LC0A 3MLEA 5IHXA 1BHO1 2ZWPA 1X59A 2QWPB 2ZIUB 4U7JA 3MAQA 5FO1A 1K68A 1UMCA 2OCLA 5KA6A 3NDJA 4WN3A 1PJQA 3BSYA 5HW0A 1ID8A 4R1PA 3PQDA 3ZE2B 4O4IF 2EP8A 1SQFA 3K20A 3DV2A 4B2YA 3NBUA 1GTG1 1TO6A 3EH1A 3VU0A 5FR2A 5DE3A 3OZGA 1VMDA 2ARHA 3K9SA 5DN9A 4FR2A 1DJLA 1N6HA 2V74B 2C31A 3LNMB 3EX7C 3N05A 5DTRA 3AUYA 1DJPA 2EBFX 4IKPA 1G64A 2HRRA 1D2GA 2BLLA 2WR8A 4M1ZA 3U40A 2JDID 4N9QA 2VJDA 3BJIC 3IHTA 1XDSA 2WYWA 3RVQA 3T5TA 1YRAA 3KE8A 6CHYA 5JSZB 1RYBA 5BSMA 2ZI9A 1CUHA 2YWRA 1SU7A 4ER0A 1Z73A 2H2IA 2IIVA 1JEQA 1QTRA 5CA1B 1K9VF 2HKIA 4E5YA 3ED1A 4UCUA 4TZ6A 1OWMA 5LOVA 1JDZA 4XTRA 2ZCJA 1WDKA 5ALVA 2YKGA 4UCXA 4PIMA 2EIKC 2ZJOA 5FI1B 3HDYA 3NH9A 4E5VA 3R7FA 2QKSA 5IANA 2WU1A 3O90A 4EGQA 2ECOA 4XWTA 5LKAA 3TKYA 5BUQA 4WFGA 2IQIA 3ZN2A 3QVSA 2TYSB 3B8HA 1LRLA 3O8RA 2EX1A 3T6KA 3LW8A 2YVKA 3M7IA 2VXBA 3VPCA 2C8VA 3HTXA 4FXOA 5AM4A 5KNBD 5M29A 5HKKD 4K8ZA 3FNHA 4JZ2A 5IMBA 4PA4A 2PH7A 2VOEA 1PLJA 2H1CA 3DBRB 1SKUA 3GLFE 4B84A 4AJ1A 2XB2A 3EYWA 4DV7O 3PXAA 1FLVA 4BZQA 1VBFA 5E38A 3HXMA 1Z6YA 3U9TA 3CS5A 2UYCA 2HJRA 3SPHA 4OJKA 2BF4A 1RE1A 5U1PA 2OD2A 2A8YA 4MS1A 5FOSA 4FI3C 1GGNA 4HK4A 1EP1B 4ALJA 3KYJB 2PU5A 4N01A 4EG4A 4ZDJA 3H3JA 2FHPA 2XQGA 4HNGA 3TSYA 1GM9A 2CLMB 1C7RA 4EPYA 1PNLA 2ANCA 1GRVA 5D3MB 2H16A 3OFJA 3OPQA 3R0ZA 2P35A 3ORFA 1YR1A 1AI6A 1NQVA 1Q6IA 1NBMA 4NDZA 1IJFA 2DTDA 2WHYA 4RM2A 4NBTA 4KLAA 2E76B 1XLTC 2QBYA 2O8FA 3SC4A 3F1LA 5JAMA 4M6WB 2BFFB 2GYWA 4QUHA 5FBLB 1H5NA 1OCOC 2AYYA 5DM0A 4F5YA 2BMDA 2Y1XA 4URWR 2ARKA 1NZ6A 2I66A 4FHDA 1AR1B 3JSLA 1CT9A 2XIJA 1NUTA 4G1UC 1J8VA 3EEBA 3OJEA 1QTQA 3MUNA 2MW2B 2C1EA 2OMEA 2P7TC 2VWQA 4NIMA 5AI6A 5IYZF 1IHXA 1NPDA 3FCEA 4UFPA 1ULUA 3L6RA 1T6ZA 5SY4A 4BDTA 1UT8A 2B4TO 1KDZA 1EHCA 4MS4A 3R5XA 1SZDA 4CGZA 3LBNA 3TZLA 4JQCA 4KIUA 1DIAA 4NHEA 3EAGA 4KUHA 3FTCA 4LCUC 2VZ8A 3IPXA 3UUWA 1BW9B 1AHPA 3VYTB 2FP4A 1TT5B 5HDQA 1VHLA 1N1DA 1V26A 2OMKA 5F52A 1JJFA 2VP2A 3EGWA 4P35A 4HGNA 2XW6A 1YRYE 1P1RA 1ZVKA 3QPDA 2UXCO 8GPBA 3HCOA 5IE9A 2H7VA 2P65A 3SLKA 1IRXA 4RTQA 3K0KA 1Z6AA 2W6ID 2WUDA 4DXHA 2ID8A 5KQPA 1LJUA 4L8VA 1AI5A 1ZA2A 1GG8A 4B6RA 4OHRA 5C8YA 1ZOPA 4DV4O 3ZDXB 2IBZH 3AG3C 4YJHA 1EX1A 5TARA 4FE4A 3CSDA 1OBOA 1K6JA 4LNUA 5L3QA 1LDMA 2HU7A 1STOA 1AV7A 4Y0AA 4L5BA 1ZK4A 3BMQB 3QPUA 3LFHA 4PTYA 1OZ0A 4UMDA 3O8BA 1P6XA 5CDSA 5IULC 5JSQA 3FCAA 3I73A 4X91A 4MSUA 1UX0A 4FDLA 2GX6A 5BQXA 5DEOA 3ESAA 3FF1A 4NCBA 2Q2QA 3SZUA 5FEMA 1XAIA 3O4GA 4HGZA 5KKAA 3BFJA 4DYDA 2QP4A 2DTEA 4Q0MA 5BYJA 4DV7B 3RT3C 2DQYA 2A5FA 1IVYA 2DRIA 8AT1A 3LX6A 3DUFB 2UZ4A 1CXZB 4BEBA 4NE2A 2EQBA 5GZ3A 1WWRA 4PPQA 4MTFA 2J4CA 4KQFA 1VM6A 4MW4A 5B3LA 2AFHA 2YMQA 1FFDA 3F7YC 2WSBA 3Q7TA 3F3KA 5JMOA 1RWXA 3ER8A 3ZLTA 3E03A 2V4DA 3CISA 5L3CA 3OEYA 4CG1A 5AQ1A 3CTMA 1KRXA 2ASVA 4OGFA 5T4EA 3SBDA 4PA7A 1WV0A 4FYVA 4U2KA 2Z9CA 2VVTA 4KWEA 3OUFA 1T34A 4K7JA 3MFQA 5ADHA 2CYBA 4G1EB 4M8SA 1EWTA 5B30A 4MW2A 3QKIA 2CZCA 2X6CA 3BPZA 2BKVA 3IAEA 4LDJA 1E8MA 3RAFC 5EP2A 1YK1A 4GRAA 1XKXA 1CB7A 2X7HA 2O8CB 1LVGA 3L9WA 4DG9A 4NCXA 3FSEA 4AURA 4K5QA 2WLLB 4M1OA 4NCKA 3BHIA 4AKSA 1A97A 5KOHB 3C24A 3UMGA 3IA2A 3TLMA 3WYDA 2JJ1D 1QIJA 3P2YA 5L6MB 1OJLA 3T0GA 1WMFA 1DI0A 3ZHUA 3BOSA 4FD2A 2YEVB 1F38A 2VDOB 1EI9A 1BZYA 4UPEA 3UUGA 1D4FA 2IVZA 4ITRC 3WSVA 1GT91 1U3WA 3D5TA 3IQHX 3EHBB 1KFKB 2HWKA 4RU1A 3K70D 1Z4PX 3GGPA 3R9XA 3WKAA 1Y76A 2VTEA 2G6TA 3BWBA 3F6EX 2AN4A 3FCXA 2NXWA 4BNDB 2EJ7A 2UXCB 4DE5A 1EN5A 4P32A 4XQ9A 3CJTA 4BNYA 4QRHA 2IU3A 3B9QA 1DXQA 3AB3A 4MWGA 1DGQA 4AHCA 3G82C 5DLPA 5CM9C 1M7BA 1P1KA 2QUAA 1K7YA 2XVYA 4D9CA 2B2XA 4DV4B 4Q03A 1W5SA 1MR3F 5ICFA 4MW8A 5LGNA 1SC1A 1RPAA 3ZCXA 1YS1X 1HEYA 3H9QA 2WJYA 1YIAA 1DWQA 1KC8W 1PVOA 2HBQA 2B61A 1UMBB 5CA3A 2OCBA 4MUJA 2VXYA 4G0VA 2WZBA 1JGTA 3AEUB 1AS0A 1R3UA 2PQ0A 1NAIA 2QSJA 2YZNA 3CC8A 2IGTA 5F3RA 2FQQA 2DYRB 4DLVA 4FIDA 2ZSEA 2FLWA 1EUDA 4B08A 3L0CA 2C2MA 3UXMA 1FL9A 1SCAA 1A8QA 3ZMTA 3RRYA 2HA6A 4K3VA 4PCAA 4KREA 2EF0A 1V5WA 1QRRA 5IJ0A 5E9JA 4EMUA 4F4JA 4C6TA 5IVPA 3CVJA 3F3YA 3D1VA 1ZL2A 5LL6P 2CD9A 4CE6A 2H4JA 4KW7A 4TV9F 5KNCH 4B2PA 3KZXA 1TJYA 3QITA 1N2CE 3V2HA 4K9PA 2ZI3A 3PUIA 4AMGA 3D6HA 2PKQP 3E1GA 1PUIA 4YJ2B 2P2YA 2XVMA 3ZN0A 1QG2A 3TNLA 1R00A 1YBFA 4KE8A 2A0YA 3WIOA 1S2NA 4CH4A 3ABMC 3AM5A 3PXGA 3PCXA 3QVKA 4LDNA 3LC7O 3QWIA 4UUOA 3T4PA 3ANYB 1RFYA 1CE8A 3FAZA 5LCXA 5HUHA 1L1RA 1FRFS 1L3CA 4XARA 4YRBA 3R66A 1JKMA 4MSMA 3HRIA 2XD4A 4E5PA 3ZGZA 4G8DA 2J3LA 3LT0A 4PDVA 2V5AA 3KLBA 4KN8A 3BH1A 2NSJA 3BDVA 3U81A 5FUBA 2WG1A 1P5JA 4EBBA 2YV1A 3Q0IA 2ZD9A 1A2OA 1GO2A 4Z4IA 4KPYA 1GZSA 1NW6A 2OUKA 1CNMA 2VUUA 4GUNA 2YINC 4KQ6A 2O4CA 1G5RA 4C4ZA 1NPTO 4YRCA 3DF9A 3KVOA 1OXBB 4U6SA 3TVYA 1V6AA 3S1SA 3TIFA 4B3DA 1XO1A 3K94A 3QA9A 3FCYA 3RNOA 5JYBA 1CIPA 1NASA 1NVEA 1QOQB 2OHHA 5C3UA 4S1PA 1KP3A 3BKXA 4OCLB 2XT0A 2W6ZA 2R79A 1OAAA 2WF9A 5IJZA 2OBMA 4WFHA 1CZHA 5KTRA 1P1IA 2JGEA 1JMKC 2CBXA 2QI9F 4S1TA 2PMEA 1EWKA 1SRRA 5AIAA 3OM8A 2D4HA 3FUWA 1O6FA 2MYTA 3ZUPA 4CDRA 3OT4A 1T13A 3ZBPA 3LYLA 2POCA 4NEHB 2PRIA 1NP3A 4IT5A 1G3IA 2HJSA 2Z83A 1JHYA 5HQ3B 1IE3A 1MB2A 1T9CA 4NABA 4O4LA 3KTDA 4PU0A 1UODA 4Z8YA 5HRCA 4IO0A 3VR4A 1L4EA 4DRZA 1JFLA 2BFPA 2G38A 3I3SR 5FI0B 4CRWB 1AY0A 1MA3A 4KITB 4M7RA 3FPJA 2ZYUX 2ORVA 1OBCA 5JSYA 3U7RA 4JWKA 1KK1A 1SOWA 1ODFA 3ZGXA 4LRWA 5BVGA 3T38A 4KE9A 2QN9A 3DW1X 2IYOA 1GAQA 2DW4A 4GNKA 3BWDD 5FTMA 1EMDA 1H2WA 1TKCA 4GQIA 2RJZA 3L4BC 2QKCA 2FJPA 2OCIA 1YUBA 1PP9H 1B8OA 2YHIA 3GCDA 2BI7A 2DHRA 4NBLA 3KHSA 5EKTA 4M0FA 2CEAA 2UV8A 4D74A 2X8JA 2LUOA 4W5WA 3KQPA 1K3EA 3C7CB 2XODA 3WK6A 4TLLB 4GX0A 3C98A 3OT1A 2ZPAA 3CZAA 5H9WA 1PEAA 1AQYA 3DKRA 3HXKA 3U16A 4TVSA 2CNWD 2ZYHA 4AX8A 3DDZX 2X9VA 4GAEA 1HMPA 1S72V 4UATA 2BOCC 3QWFA 3CEMA 3NR7A 2J45A 3OFNG 3TW0A 2OC9A 2ODAA 1K1EA 4AQYO 2BEUB 3I2HA 5DGCA 4CTKA 5BYKA 2CJPA 1FNNA 3FGNA 3L1HA 1VJTA 1JE0A 3T1QA 2VDWB 3O4JA 4R4JA 1TVKB 3BIWA 1H8HD 3GOQA 2XYGA 1IVSA 1QHSA 1H0SA 3N0WA 5T4BA 5FUVA 5UKDA 5BQFA 1HKHA 1ITZA 3DSRA 4RWZA 1F2DA 1EZVH 2VDPB 5AI0A 1Q43A 5TQ0A 4TMYA 1RAAA 5MN5A 2CAZC 3DJFA 2PYZA 2QRZA 2I03A 1QJCA 5MN6A 4WUVA 1QLEB 2ZI6A 3WGHA 4CR8A 1RM3A 4BQEA 3AETB 2AOWA 3O9OA 3R77A 1L7BA 4PZDA 2JH3A 3TDNA 2EKPA 2E87A 3CLSC 1SZPA 4OGGA 5E2BA 5EIBC 3I5UA 1W4CA 1L8OA 2IPLA 1UKEA 4DB2A 2QJOA 2VWGA 2FR6A 4DW0A 3CLKA 3MWEA 3MCTA 2QQEA 2Y6VA 3QO7A 1WKVA 1H9CA 2D2CB 3ACDA 3ZY6A 4ZCQA 3U4IA 3Q4HB 1MMFB 3AF1A 4LQDA 4HH4A 2JCBA 1JIQA 2H5LA 5FA5A 2IHUA 1T2UA 1JLKA 1FNBA 2Q45A 1LWNA 2I8CA 4D5EA 4U7PB 4BYMA 3ON5A 4EUNA 5DI3A 5D86A 2JC3A 2DSNA 4EHKA 4QWMA 3E27A 1UKVY 4YEDA 2ZSAA 5HA5A 3G2LA 3BXOA 1SBTA 3EEQA 4P3XA 2SICE 2ZAGA 1FU8A 3SSNA 1HYQA 4MTGA 1RWNA 3RANA 4L9RA 1BIFA 2IDJA 3IJEB 3HFRA 1FSGA 4LY9A 1KL7A 5ILQA 3ITDA 3MW8A 4RENA 3IEXA 3PRHA 4B6OA 1C0LA 2NV6A 4M0LA 1V4BA 2ZR0A 4P34A 3ZQUA 2WLHA 1Q8IA 1COWG 3LPNA 4PC3A 3IULA 1WDLA 2BEKA 2ZB2A 5T3UA 1XZEA 3C3DA 4HB0A 3K05A 3OOWA 3EGDA 4MW0A 5LGTA 4JI3O 5ENVA 1ZRHA 2NNWB 2ZW9A 2PS1A 2WUWE 5TGZA 4PDRA 1ZUNA 1EJBA 4NZMA 5DBOA 3K9HA 3BB1A 2FSSA 1M1YA 4EJ2A 1ABEA 2GERA 1NFFA 2AN9A 3KLMX 1UJ6A 3ZI7A 2NPIA 3E9DA 4MQMA 4F92B 3W34A 2V96A 2II6A 1T5IA 4IJQA 3ZX4A 4QO7A 1KQGA 1QO9A 4YJGB 4GU5A 1IIBA 4BXOB 4BNWA 4I4LA 3GMIA 3RCBA 2A1TS 4AQYB 3DCYA 1OWPA 4DRXB 4FHGA 1B1AA 1F9EA 3M49A 3AGPA 2JFHA 2H4XA 3APOA 2FZ4A 1YQ9A 4I5SA 1NTKH 3P2OA 3CMMA 4F93B 1N2SA 3DMYA 2QTCA 4TVKA 1WVIA 1GCUA 3JAKB 5L4LA 1GILA 1D4OA 1DPGA 1CEZA 3GN2A 3ZV4A 3PWTA 4OO3A 2V65A 2D7DA 1Q3EA 1CP2A 1P0FA 2DJ5A 3KYCB 1XROA 3ASOB 1XXHA 5F98A 1MVLA 3N39C 5B3AA 1ZHFA 4WCFC 1BGXT 1OXTA 1CW2B 1LFAA 3WGZA 2EEPA 2HIAA 3MJ4A 3I2YX 1Q0PA 3ZVNA 2EBHX 1IM2A 2WZDA 1XNGA 1N8NA 3ZMSA 2L17A 3NHLA 1CJUC 1P73A 3S40A 3WLIA 3T3MB 1X8KA 1NJ5A 3PWSA 1YI8A 2F23A 1Z18A 2YIJA 4MUYA 1WMAA 2JLZA 4RV5A 2GOYA 1YMUA 2AVDA 4CEIA 3DGEA 5FPPA 1WKCA 1B3RA 1JIVA 2H5EA 4LYHA 1SXPA 3ZCTA 2O2DA 5EHXA 3OFNA 4ZIBA 5AHXA 1UK6A 5DSZA 2QT9A 2AXTZ 1EBOA 2MSWA 3EFFK 1USKA 3PXDA 3VBBA 3LUGA 4CIBA 3EIWA 1OAOA 3CB4A 1Z37A 2DQZA 2Q8VA 2R4UA 4R8KA 3LY8A 4EB6B 1FNCA 1WVGA 4BVAA 3P94A 4HP8A 3M8AA 3HM2A 2WHXA 3N76A 3OLWA 4CH6A 2G5PA 3ZHCA 1S8AA 4U39A 4MITA 5JT1A 1QUEA 3ZS8A 1T3SA 3O7WA 1NP6A 3ZVMA 2G88A 5AQEA 4ZEWA 4DLPA 1Z6XA 3D3QA 1CEYA 2GVNA 2KKSA 3LKDA 1RBYA 5FF9A 4QUBA 1R0CA 4YQFA 1ADFA 2YDEA 3IILA 1I33A 2PGGA 1N75A 1VL6A 3MLBA 3C39A 4QPPA 3TWOA 4HN2A 1PFGA 5IW8A 2N42A 2FG7C 7GPBA 4CL3A 2BEVB 2Y05A 1SH7A 3C6YA 4JJ4A 2FW6A 1Y7TA 4OPHA 4C1BA 3D54D 4NNJA 2YQZA 4N47A 3EEIA 2F8LA 1S4MA 3H1AA 4TXHA 3IDQA 2Q6KA 3EZFA 3RIGA 4D99A 4E6EA 3C14C 2NXJA 1LUAA 1M6YA 4R1LA 3NU1A 4CKBA 5A4FS 5H0IA 3F9CA 3BHMA 5FI3A 5KUMA 3TXYA 5EQDA 1TCAA 4L4XA 2L35A 4KN6A 1I9CA 4MUNA 2ODNA 4TUYA 2Y99A 5A2QA 3TVTA 3WB9A 1BA2A 2RH8A 1I8TA 1J42A 4WX2B 4UZSA 2OQ2A 2CT8A 3E7DA 5HOEA 4ECAA 3U13A 1W88A 4M86A 2I6XA 4L74A 2ODEA 3RUEA 4E88A 1NVKA 2ZR2A 1IZ9A 2YVUA 4PJ0Z 1JQ5A 4RQEA 1JFRA 2HFJA 4NXMO 3DE7X 1IJBA 2PMCA 4MUGA 2Y69C 4XGQA 3EBLA 2XYHA 3UXHA 4AMVA 2YXLA 1Z2GA 4YT8A 1NR7A 3G9QA 2Y2UA 4NYIR 5I4IA 1LF5A 1BSMA 1XP5A 4KO3S 4MDHA 2JA2A 4FNGA 4HWGA 3PHIA 2N1MA 3PHLA 4AG6A 3MBIA 2HEPA 2NSDA 1COWA 3RHSA 1V5EA 2OFOA 2VRBA 3HCPA 2E21A 3A4NA 1DQRA 3GFBA 2QTRA 2I2DA 2ZRDA 3FDZB 5EKUA 1JHQA 4MIOA 2CMKA 4FHFA 4JQZA 4DHWA 1WLYA 5ALGA 4FX5A 4MRMB 4ZA2A 1KYIA 2GPNA 1S2DA 2BL4A 1UBCA 2WHRA 1XHXA 5AJVB 1K8YB 1BGYH 1GTVA 2IE0A 2AC7A 5J40A 1VG0B 4J07A 1ZJYA 3JQGB 4MUBA 1L1FA 4WTOA 1PTJC 4KXLA 4L8YA 4PQTA 2C7QA 3TE7A 5L7TA 1W96A 3P9PA 1G42A 4QJFB 3JVVA 2QD2A 3V4ZA 2P2DA 3G6KA 3LF1A 4R1SA 4Q3LA 3ISVA 2AQIA 2W43A 2UYYA 1R2QA 2CXTA 3H42B 3LBIA 3A70A 2HSZA 3EA0A 2OVBA 3WP0A 5BUCA 4GSKA 4OQMA 4V3BA 5T4FA 2PE5A 1CNEA 1T91A 3FJOA 4QBKA 2DKOA 2WFZA 3HYLA 3CWCA 1XU9A 1CU1A 5KEIA 4JNKA 4N7MA 3U7FB 2PMFA 1DG3A 5E9AA 5CEJA 3MB8A 2GSWA 3DMHA 1WE2A 3EVGA 2HA7A 4RD6A 5KCMA 4IQ0A 4LCEA 5DNEA 5FH9A 1YMVA 4E6PA 3TQHA 3DMFA 1A7JA 3MB5A 1A8SA 4B82A 3JQQA 4DJFC 5ALHA 4JBXA 3K0DA 1QXSA 3P2EA 2GHRA 5AJYA 1J2YA 4CS2A 1IOLA 4CNQA 2Q1YA 1RJDA 1SVNA 2X3YA 5TQJA 1FE8A 2P6RA 3UMCA 3EFEA 4MMYB 3PV0A 4ND8A 1FQWA 4MVJE 4KVAA 4KRFA 3RIMA 2ZSUA 1JP7A 1Z2EA 3DV0B 3SYAA 4JZGA 3H4TA 1FVOA 4KFCA 5B2FA 1OX4B 2C94A 2W2VA 4NS4A 4H0LB 2YWGA 1G4YB 2X8LA 4BO1A 2CZGA 2Q0XA 1C8LA 1SZCA 1QANA 4ZU1X 1M6WA 4RK0A 2J48A 2G17A 5IDXA 5CB0A 3FZYA 3PE3A 2E48A 2JLQA 4M7OA 2BRUA 2YS6A 4Z9YA 5F23A 3DEZA 4BZZA 1JUDA 5DN6G 4AAYA 1I13A 3LA8A 2FEXA 3PQFA 1LX6A 3VR6A 2NXCA 1G5HA 4O2BB 4HB3A 2Y4UA 1V35A 3QVVA 2DLDA 2EZUA 5C18A 4BLRA 4MWEA 2HHJA 1I3NA 4NXMB 2H1IA 4EFBA 1Z47A 3QOWA 1UOPA 3DXRB 4X8HA 1FJ2A 2B21A 4UTOA 5I5EA 2B36A 3H84A 4CT4B 3H1IH 4INAA 2H2FA 4BMVA 3VKUA 2IEAA 4NC9A 1Q7RA 3B52X 3D4IA 1PK8A 3SFVA 4MP6A 5BR1A 3PSHA 4F9GA 3VYUB 2BZGA 4JQOA 3D8TA 2VUTA 2X4DA 2ZINA 4XYGA 1PVVA 4XX0B 2WABA 3WLKX 4MQEA 1IQRA 3HXOA 2HK9A 2P27A 1Y9AA 4WSOA 3AIIA 1V55B 5CFMA 5F78A 4AYTA 4HGQA 3R0VA 4AC9A 1T0JB 4ENSA 3PPVA 1K8RA 1SCJA 3NHRA 3PB3A 2C5GA 3KOYA 4CLEA 3GLHE 2C3MA 4OGLA 2D74A 3IQDB 2EZOA 2YRWA 5H7XA 2HVVA 1NNI1 1PWYE 5GAOA 2BM1A 1P2VA 2GNOA 4L50A 2BDEA 5LQDA 2O23A 2BGLA