1M9NA

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Avian AICAR Transformylase Mechanism.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
total genus 219
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2002-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1m9nA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1m9nA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1m9nA02
1PL0A 1ZCZA 1IK4A 1G8MA 1BXRA 1CS0A 1P4RA 1C3OA 1OZ0A 1M6VA 1PKXA 2IU0A 1A9XA 1WO8A 1S89A 1B93A 2B1IA 1S8AA 1CE8A 1JDBB 2B1GA 2YVQA 1VMDA 2X8WA 1C30A 1THZA 5H3LA 2IU3A 2XW6A 1KEEA 1T36A 1M9NA 4A1OA 3ZZMA 1EGHA 4EHIA
chains in the Genus database with same CATH superfamily
3NCTA 3U7EB 5EIOA 1OH5A 3W05A 3BILA 3T4EA 5AHOA 5A5VA 2D6FA 1YB2A 3OUSA 2XUHA 5IW8A 1W581 4C43A 4Q15A 3G13A 5JXHA 5AJXA 2QMQA 3P9KA 1WXHA 2WKWA 5AXAA 4JUDX 3TE6A 2VJDA 4K3AA 4PA3A 1SHZA 4OB7A 1ESZA 2K2QB 4F3NA 2IDKA 3ZN0A 3B82A 3BZWA 3ILVA 4L28A 1SC4A 3IT1A 4XJXA 5AI6A 3IEKA 5B2ZA 2ZM6B 3DPUA 2E4YA 1ORRA 3PLNA 1U8ZA 3JASA 1DBQA 1TKCA 4JSYA 1IAQA 3BAFA 3LHIA 4D9BA 5BORA 3Q85A 4F84A 5LJLA 3VHXB 4LZLA 2RNBA 1RWWA 1QVWA 1FDOA 4TXHA 2ZNJA 4LBEC 1NW9B 1PR2A 3EPPA 4QUGA 1J23A 5EFOA 1OHHG 4DLPA 1DFIA 1O6BA 1AKWA 2PNJA 1ZUNB 1XTIA 2Q3EA 4CM5A 1M57B 3MJDA 1MC1A 4ZQIA 3TLYA 4B6EA 1Q17A 2P62A 1P5HA 4NZYA 2R4QA 1GPJA 1X7YA 5JDCC 2H18A 2QBYA 3RRNA 3ABKC 1RJ9B 5GQSA 4C0JA 1KZGB 1B8PA 1CWUA 4WUTA 1RLOA 2DW4A 3CCJV 3BVPA 1JX9A 3TLXA 4REQB 1MR3F 3EFOA 5AJHA 2WTUA 1ZGJA 3CC4V 1FLAA 1C1DA 5JLAA 3E5RA 4JBNA 1ZLXA 1UJ5A 4HDKB 2H0AA 2YJ5A 3KR1A 2B3TA 3MB8A 2GN2A 2R2AA 3KSZO 3RQIA 4LWOA 5L4LA 4UJ3A 1YEWA 2HCRA 1TPYA 1CPYA 1PR3A 2EYUA 3E70C 3PJGA 3TNDA 2C2WA 1BQ4A 2D5BA 3KCNA 3IX7A 4R1PA 5DNCA 1W19A 2V1UA 2DWEC 2WT8A 4PA6A 3EMBA 4GWLA 2WWRA 2IEGA 4M0EA 1L7BA 3ZRXA 1SCDA 1E7YA 2WIBA 1Y1LA 1A7JA 2C5SA 2G36A 2SHKA 1GR0A 2GZ3A 3NNDA 1SRQA 3M2TA 2NV0A 4R2HA 5EKUA 1J90A 4YJHB 4CDNA 2XRZA 4MROA 4R6XA 3VPCA 4XIGS 5H1YA 2FZVA 2P3OA 4GZLA 2YXNA 5J5VA 3ZLUA 3G6EV 4HVCA 4MV3A 4XVUA 2ENWA 4LI0A 1D9ZA 1WCYA 3A6DA 3KPJA 3DBVO 4AJNA 4B0PA 2Z3GA 3EF0A 1QLWA 4D2IA 1EM6A 1HDXA 2GAFA 2ZPAA 4HX5A 3CC7V 1X8JA 2F1MA 2AC7A 2X9NA 3AXSA 4S2EA 4DSAA 1TTQB 1UWKA 5ECDA 2AFIB 3JPWA 4R7ZA 5GTHZ 2Z3IA 2YJ4A 4WA7A 5FHQA 4N39A 2YXYA 1F12A 3DEAA 1WD7A 4RSHA 4X3CA 4H1HA 1LPMA 2Z30A 3FYUA 1QH8A 3WJ7A 1UBOS 3GG9A 4JROA 2Y6VA 4TM8A 3RFUA 2YZGA 3HPRA 4RKFA 5LB2A 2AHOA 2YHBA 2W8BA 5M5BA 4JI8B 3HVRA 5ALSA 3OZUA 2DEUA 3OJXA 5FOSA 4OQDA 5IDWA 4JI7O 1NMEA 4G1MB 6CHYA 3IFXA 3G2MA 4S1VA 3DLHA 3OEYA 5JFOA 2NOAA 1ZM3A 4OO3A 3A1FA 4Y2GA 3OUUA 1KH1A 4M0LA 2XMQA 4MPJA 2GRUA 1D4FA 2GJ8A 4M1KA 3H84A 1TZKA 1NRIA 3RAGA 3BWCA 4QQRA 3TEFA 3VR2D 3R66A 4IKEA 4P3KA 2VDWA 1JR6A 2ACWA 2NU7B 1X59A 4MYRA 1SS3A 1YIJV 4QWWA 4C0SA 4WZAE 3VNQA 2RB4A 5DNVA 5C8ZA 3QA9A 4NQLA 4NOMA 1SZXA 3OQOA 1MPXA 1F60A 1LW7A 1PEDA 1K6EA 3QPUA 2NX8A 2GF9A 1I6KA 1QFMA 2CMKA 3KFVA 3U0BA 5L3RA 4DHEA 1PS0A 3IQEA 3AHEA 1BSMA 4G5QA 3JQ9A 3VPDA 4CT0A 3W7XA 5ITWA 4B3CA 1R3UA 1XNHA 1MO6A 1FXUA 2QRLA 1E9SA 3NU1A 4Q3NA 1DIGA 2XUGA 5BR7A 2XAQA 1FUUA 1X8LA 3TXQA 1CE8B 1QTIA 4LH6A 2NZ2A 1N6OA 1EE9A 2VHXA 2RN9A 1KIAA 2EG9A 5IDQA 2O8DB 3HP1A 4Z51A 4LYHA 1XMOB 1SVOA 2J7PD 3K4QA 4I66A 1PKXA 3B77A 4PELA 2JCSA 3EGVA 3KALA 4FIDA 3IBGA 4JI2B 1S0VA 1IU9A 2F1HA 1SXJC 2J6HA 3H9UA 4NQZA 4V39A 5FAKA 1C4WA 2HRZA 2YRXA 3DW3X 3H4MA 2XUAA 2BRUA 2Q5JA 4M7RA 4A8HA 1M1ZA 1SG6A 1T36B 2WZCA 4FLTA 1PN3A 3K05A 4XDZA 3FXAA 2OZKA 3KKLA 3ZGXA 3BMQB 1V1RA 5J4KA 2I2BA 3HBJA 5A6SA 4CG3A 3AKYA 1OCEA 1SCQA 3ET4A 3RV4A 3L05A 5IULC 4KK4A 3FX7A 3L84A 1JCHA 3GJTA 1CY1A 1VLQA 2IEZA 3C3SA 2QI9C 3ND8A 4IDBA 3BAAA 1E69A 1A5BB 1JIQA 2AUNA 2EJBA 2XQGA 1Y1SA 2MOKA 2QG4A 3WAGA 2V45A 5TQ2A 1QGAA 4OM8A 1G8AA 3P20A 4YRBA 2QRGA 3O9ZA 3B9BA 1DCFA 2E82A 3BMCA 1N92A 3QTLA 4MTCA 3IXMA 1IUOA 3OFVA 1UBKS 4JP1A 1TX4B 4FSXA 4DDMA 2FNAA 4EVIA 5B1BB 1IDN1 3SYCA 4V24A 4NU6A 3N2EA 5B3JC 2LIVA 1ZSVA 1NUQA 2WF9A 3OTHA 4O5OA 4YQEA 1UK9A 4AO7A 5U1PA 2ZBDA 4B4DA 4EKGA 2OBCA 1XOIA 3U4CA 4DR5O 2KG7A 1GPDG 3R8CA 5EKXA 1OF1A 4INZA 5EVJA 4OB8A 4PS0A 5IXYA 3MWFA 2GXAA 1QHIA 1KYOF 3PKIA 4R3WA 3CLTC 4EYSA 3ZI7A 5E4JA 1UWLA 1UEJA 1RPJA 2CJFA 3RBXA 3RARA 3NUQA 3KWLA 1C9YA 1NG1A 3NTQA 3IJ4A 1IM2A 1WMEA 2OOSA 2X5KO 5HMMA 3IXLA 4JT2A 1KE2A 4E5PA 3QGMA 1RYNA 3VJRA 3ICEA 2ZXFA 2Z57A 5JNVA 5KSWB 4EBFA 3GLTA 3SICE 1F8YA 1KFCB 1DOZA 3EVAA 4YAFA 1J8YF 3L7IA 4FIZA 2VK2A 1BH6A 3W6ZA 1IURA 4KQEA 3VZCA 2G9ZA 2C78A 3WTCA 4X66O 2Y77A 4M1WA 1ORQC 3WE7A 3K9CA 1SUPA 3NX4A 1AA6A 4EJ6A 3HDVA 4JYBA 1Y1TA 1PEKE 2NYUA 1MQ8B 4W5HA 2IBTA 1MV5A 1YACA 4XW2A 5IXSA 4KV7A 4LRWA 1WPXA 3KZCA 1NX6A 2PV0A 2VYFA 3RYCB 1T15A 2WV7A 3MERA 5BR4A 1W34A 4MDEA 1BX1A 3VSDA 2WJHA 2XITA 5GTDA 4MH0R 1B26A 2WWIA 2WWHA 2CH7B 4X65O 2IEDA 3A4MA 3FVWA 2PAAA 2PO5A 5TLSA 2HIMA 3ZG6A 2I3GA 2ZR7A 1ATZA 2A4MA 3ABSB 2X2EA 3PJSK 1K3TA 5JC8A 4Q6WA 2C0CA 1CK4A 5BXQC 1ODCA 4EYQA 3QYJA 3CHYA 2XSZA 2Z3ZA 3IAFA 4H77A 1J7KA 1PWEA 1M8PA 4FU0A 4KE8A 3OCXA 1XNRO 4LXTA 1GRRA 4YRKA 2X23A 4W7IA 3UGKA 2A9FA 1TQ8A 1UBHS 4ZTBA 5DN6G 1YL6A 2CB9A 3L92A 4LCPA 3L8YA 1PFWA 1WB6A 3LBNA 4LGCA 5BZBA 3D54D 1OU0A 1SKUA 3BZUA 1NVPD 1EA7A 4QBGB 3UAYA 1MAWA 3LD9A 4J11A 4BO0A 1UCFA 2AFRA 1RAHA 1KI3A 1GM9A 1QG6A 4X44A 2UYOA 5KOHB 4C07A 1P3Y1 4MKGA 4B85A 4CM9D 1SKMA 2V3CC 3MIZA 2QRMA 5A1JA 4KR3A 1WZCA 3T7SA 1V1RB 4ZV4A 2G6BA 5LMNB 3GAMA 2ZBEA 3KSMA 4FE4A 1DGQA 1C81A 2QF7A 1G8PA 4TKVB 4ND6A 1ZTEA 2JS3A 1DB3A 1R8XA 2DPHA 2GDJA 3IMGA 1T36A 3JQAB 4HVAA 3WK8A 1Z35A 2FE1A 3M82A 4G1BA 3FWHA 2P68A 1WHTA 3B9PA 4YEDA 1N4CA 3PPXA 2QXTA 2VDLB 4Z53A 2E4WA 5E6RA 4POAA 3KPVA 3L9DA 3ZBPA 1EFDN 1ICEA 5FX2A 3JAMN 4NTWA 2OYRA 4WK2B 4ARZA 2RBGA 1XQ8A 2O8CB 4UNSA 3CSXA 3D64A 3K1ZA 3ZLJA 5ERGB 1V47A 4D9FA 1EBOA 2ST1A 3KNZA 4ENVA 4ADSG 1GAWA 3EAQA 1J5EB 3OX4A 4LTMA 3KHKA 2C1XA 2NO4A 4WJLA 1I2AA 1E5QA 2PFKA 1A2KC 4CIXA 1R7RA 2W6NA 3KUUA 4KL8S 4M9RA 5TGTA 3RW9A 2JRIA 2BIFA 1CJBA 4M46A 2R44A 5CFRA 3PNKA 3EA4A 3LNNA 2QMOA 4YRTA 1KEEA 1PKEA 3TLGB 4LNUB 2JGRA 2ZRKA 4HL6A 5GM2A 3O92A 3ZUGA 1OXVA 1ZBDA 2PTHA 3KU1A 3MEQA 5DTJA 3VNRA 2VAWA 3E81A 4FM1A 1FX0B 3KXLA 1G8HA 2CD7A 2HJHA 4RJLA 5LOVF 4DSZA 1HQDA 1UKEA 3E22A 3O74A 5KDOA 2J6BA 2Z8YA 5DHSA 3GB7C 2NQ2C 3V1TC 2ARKA 2PZLA 3B13B 4V0SA 1DBPA 5H59A 5I9TA 4NVPA 1S3IA 1XHXA 1JW9B 2OBLA 2F43G 2Q21A 1HDJA 3IE2A 1J5PA 4BNXA 2O3JA 3WQSB 1A69A 3CUKA 3FTEA 1JEQB 1V2HE 1Y3IA 1T8YA 3NHLA 3P19A 3N0XA 4P3OA 3DEJA 4PPGA 5DECA 1OTHA 4TRRA 4ZOLF 4LV8B 1O95C 5EHGA 4F60A 4OBXA 3R5KA 4RK6A 3IUYA 3GDOA 5C2JB 1CY7A 3S7ZA 3GBVA 4HEJA 1FYXA 3U61B 1F0YA 4EFKA 2Z9DA 4LMRA 3G1TA 1JLLA 1S5PA 1NP7A 3RSLA 3EGDA 3BSSA 4US1R 3KLPX 5IDXA 3HI4A 3A7EA 3ZV5A 4GQIA 3O8RA 1XTJA 1BSVA 4EYEA 3ZU2A 1I5RA 3BS4A 3NHYA 2JFHA 3WA7A 1G63A 3JVIA 1BT8A 1KC3A 1QIDA 1UZUA 3Q6NA 4JLJA 3SYTA 4PDRA 4AUMA 4UM9B 2QYHA 4JOCA 3WK6A 1SUCA 1TQ6A 2H1SA 5JJNB 1NMYA 4OI4A 3L0ZA 2FWAA 4FP9A 1DKPA 4DXWA 5KKAA 1H8EG 1AF7A 2G0AA 3H5NA 3LRXA 3FFQA 3H1HH 1F5SA 1YOBA 2RHCA 2ID9A 2YRWA 3EOZA 4Y2JA 3PR1A 5F21A 3BCUA 1AQIA 3QVLA 4UCVA 1GCAA 2F00A 3I73A 3KXIA 5AW0A 1UXGA 3GIDA 2VRZA 1KYVA 3KZ1E 2ZTVA 1Q7BA 3PI6A 1XGKA 2ZJOA 1CUYA 3A2NA 4ZVOA 3ONVA 3TZEA 1N6HA 2HTFA 2QNRA 5HM8A 4LNHA 4DPKA 4YXWD 5C9ZA 3KJXA 1I7LA 2CXHA 2PKCA 2VPYA 3FX2A 3PDHA 1PK9A 1ZMRA 1SC5B 1CKEA 1ECFA 2JGAA 4WAUA 3ZWNA 4CTMA 4WN3A 2YFYA 4H27A 4BQFA 3ZGOA 4XI9A 2BL4A 2R6HA 4AMGA 3FCUB 1ECGA 2WA1A 3LO5A 3GFTA 3PNOA 3EMDA 4XGRA 4PIMA 2G6TA 1JQ0A 2HDHA 2V6BA 5KJ6A 4RJ2A 5FUWA 4IHJA 1CYDA 1XYYA 1I08A 1H38A 4NS1A 4Q9KA 5L4NA 3B3FA 4XWWA 3LZDA 2FF7A 4JV5O 3IBTA 2I6FA 1WOYA 2J3LA 1GUBA 3NT4A 4YP1A 3W2TA 1L0NH 1CZUA 4H15A 5DTEA 1QH1B 4NABA 1VIVA 3ZJ5A 2ID7A 1VQ2A 3VZRA 1WB8A 2WHEA 2IYFA 4W82A 3ZIAD 4BEJA 1OCZB 5DTQA 1PZFA 1LPOA 1JDNA 1NSTA 1EWQA 2Y1OA 3GGOA 1B8NA 4FUQA 4QG3A 2RE8A 4BXOB 3P9ZA 3UMSA 4OG2A 1U63A 1HKHA 3JQGB 4G07A 4CQMA 4IYJA 3UJAA 4GE3A 1G17A 4YCCA 5A5EA 3ZLVA 2PRIA 2DU8A 2MJLA 2ZUFA 1UFQA 3C3WA 1S4MA 1HTTA 1JTEA 2C2ZA 5JI2E 1E3LA 4HAZA 4IHKA 3WLIA 5CA0F 1BDIA 1KPIA 3U49A 3VR2A 4E11A 3REQA 3IP8A 3QYFA 1BA2A 1ZWIC 2IJGX 3GJXC 4C21A 4ER0A 4GLOA 2J1LA 4IIHA 3X1ZA 5CDHA 4J0EA 5JD4A 5J9PC 1P6XA 3JCUZ 3JD4A 2NUPA 2W71A 1K7EB 1YAHA 2LE0A 1T9CA 3FUXA 3LG2A 4NJEA 4UDOA 4K2HA 3TQFA 5FPKA 5CDGA 4GRAA 1SXJE 1Y8RA 1E9EA 5JWRA 1F6DA 1PD0A 2HK6A 3GUVA 1OT5A 3E8MA 3GCZA 3RG2A 3AEXA 1RPNA 4DCNA 2JJ1G 1FPQA 3IDZA 4PHFA 5FORA 3JS5A 4AMBA 4DIKA 1JDUA 5CH3A 3VI3B 3O38A 1I94O 4N3BA 1W59A 5CXXA 3DAOA 1N7IA 1HYBA 1T4GA 5KOYA 1YZUA 1U0NA 5L3GA 1KIMA 4XCVA 4FEAA 1UZNA 2OY0A 4YJ3B 4ES6A 1D8TA 3JYNA 4GBGA 4ZK2A 4RAQA 1M0SA 1ZUHA 2O5CA 3U6KA 4LCEA 3H9GA 3EZYA 3STLC 4DKJA 1QPZA 1UWVA 4KXFB 2I1WA 3NRCA 1BJRE 2KWIA 3CJQA 5JWPA 3EC1A 3LL4A 4PNZA 5D7BA 3RHFA 4B44A 1LQ2A 4HWGA 4MW2A 3HO8A 3E22B 4DV2B 1UFVA 1E3JA 2ZUCA 2JGEA 4MYDA 2R1VB 5H3HA 4UHJA 4UU8A 4QSHA 4YV1A 4FFRA 1VI5A 4KQ2A 4EVSA 3S8YA 2Z6UA 3DMRA 5LHGA 4ZYXA 4PRYA 5JXGA 1SBQA 4Q9LA 1I3LA 2IXDA 3CXRA 3K30A 3STTA 1U98A 5LWQA 1IY2A 3PF9A 1GCUA 2WT4A 5ALNA 1ZU5A 2O2GA 3QUAA 3QLUA 1B8OA 3IYLW 4EGSA 4M1QA 4PWYA 1ZD9A 1PSDA 5IAGA 1XHFA 5J47A 3I92A 1KKUA 1K8ZB 3NDPA 3ZK7A 1YR6A 3VTKA 3A3KA 5DM0A 2CC2A 1ISFA 3WRXA 2R6R1 1K98A 3Q2OA 1K8QA 2H4YA 4E3WA 5DU2A 3JAWB 2ZKOA 2B4QA 4BAZA 1PJLA 3WGMA 5DNEA 4JR1A 4HUJA 1XTQA 4KLRA 1EXWA 1RAFA 2I0FA 1X8KA 2WAMA 2PBZA 1NLYA 3ESBA 1V54C 5KU7A 1ZLYA 3DL2A 1EQUA 4LHVA 3ZDDA 2FSGA 4G86A 4QNNA 4JZKA 2FEOA 2PH3A 5DTIA 4BNDA 1R27A 2CLEB 3JPYA 3M33A 3WLRA 2M6LA 3ZE1B 3PHHA 4KGDA 1HFJA 5EZYB 2NZ8A 2PF4E 2K7ZA 3DEYX 1JWLA 3N28A 2ZRGA 2NLJC 1PEYA 2CLCX 3L6DA 4V0RA 1MZFA 3CEIA 1KKLA 3CRVA 3PQ3A 3UXYA 4TKUB 2R8PA 1SBIA 1WZ2A 2YDXA 1JYFA 5GM1A 2OB2A 3D6UA 2GPAA 3DO5A 2R62A 3LCUA 4RUFA 1L7QA 4MI1A 2PNFA 4N12A 4NYMQ 4RO0A 4X84A 2E37A 5BSGA 1P3DA 6REQA 1XNRB 5F2OA 4HS4A 2DBZA 3EIOA 1DX9A 3G2OA 1H23A 3ZDRA 4DG8A 4PAGA 4ESVA 1WUJS 3IP5A 1FMTA 5CFNA 1W0JG 2W0MA 1C3VA 1DUIA 4CIBA 1SQVH 3GQBB 3LQFA 1NR5A 5LP6F 4HQ0A 4D46A 1SEVA 4YCAA 4D8VA 5JQWA 1FTGA 1IONA 1XNQB 1IAVA 4GGPA 2IXEA 3CWBH 2JFQA 1NMXA 2RHJA 2VRBA 3TSAA 1RWBA 3RAJA 4KXUA 3CX6A 4IG9A 4LISA 4WINA 4Y2VA 3SC2B 3ZDEA 2D74A 1B0ZA 2HZ7A 4JA2A 2LFSA 3ONWA 3JD3A 2GN8A 2IT1A 1FYFA 4H7FA 1NT4A 3VBBA 2VDNB 3ZVKA 5DLQC 2P3SA 4M0UA 5EOVA 3Q3JB 2GF0A 2QE7A 4D25A 4P38A 3PEUA 5EUMA 1TPZA 2AK2A 1P6QA 4H7DA 2QX8A 4FFLA 3VU9A 1M3SA 3FDXA 3FTDA 2J9GA 3LH5A 4AECA 1GNRA 1J97A 1QRUA 3FLEA 1L8DA 4N0PA 2CMFA 3A3YA 3RUCA 2G07A 2VSOA 4YJKA 4XGKA 1IY8A 4HNQA 4O63O 3NMUF 4TQFA 3A6JA 5DYWA 2ZOSA 1SG0A 1GL7A 4K2AA 4G28B 3U11A 1HDOA 2IIPA 3LMKA 1GTRA 1JJ7A 1M1NB 1PBNA 4NOJA 4QGHA 1OKKD 3C4JA 1ISGA 1YQEA 4KQCA 2ZVQX 1Y5RA 5THKA 1Q95A 2O05A 1SUAA 1W2BU 2JIZD 4IZ6A 2A0FA 2YIBA 1YJXA 3ZEDA 2LV8A 2PX4A 5DCUA 3TSWA 3NM6B 3AF6A 2DQYA 2HFKA 4IXMA 4DMFA 1JIVA 3V4ZA 5BV0A 4YO8A 4H1UA 5TNXA 3FSGD 1EVJA 3G2PA 4JQYA 1USWA 3QKUA 4TXNA 4YLEA 1T6YA 2FKNA 3D8SA 1R10A 4RL4A 3T7KA 5CT5A 4I9UA 4KQHA 5D5PA 5D3MA 5F7ZA 3RFXA 6ADHA 1NPTO 3UGTA 3QW2A 4UEKA 1JZTA 4YPVA 1RP3B 2C95A 1S4QA 2BI4A 2IDZA 3FAKA 4PPYA 3V8QA 4KPEC 4AURA 2AN4A 3KT3A 3LUBA 1T6XA 1UIMA 2ZR3A 1Y33E 1P7BA 2QAIA 1IN6A 3I42A 4WVFA 2QRJA 2ODMA 4F4FA 2CXOA 4GZRB 1SPXA 3AB3A 1TAQA 2PCJA 3AP2A 1LZLA 2FCAA 1XZAA 3CNOA 3ZDYB 4DLVA 1B1AA 1Y6XA 3QWAA 2BDTA 5FL7G 3PIIA 1XLTC 4XX1A 4C4AA 4EG4A 4O2AF 2FMKA 1OPXA 4TGLA 5L3CA 1L7RA 2GAIA 4G5HA 1KMNA 2VHUA 3OEHA 3OT1B 2AJCA 2QVZX 4DWOA 1NPDA 3EXFA 4PSAA 5JT1A 3V8MA 3UJ9A 3H9VA 2NO5A 1J9ZA 2RAVA 4EGAA 2XYVA 3EN0A 3MMSA 1OFHA 1VHWA 4D98A 5BOSB 1CB0A 1RHUA 2BCCH 2WPNA 2BCEA 2ZRBA 4TMYA 4EMBA 3A3NA 3JWIA 2JEXA 4INAA 4I08A 5KTPA 3CO5A 4FFPA 3SHTA 6PFKA 4X5OA 3QO8A 1DL5A 1LS6A 1XZBA 4QXOA 1I4EB 1TGVA 5AI4A 5HKBA 3CCCA 5DX0A 1KMHB 3P32A 3F6CA 2FSPA 2C2KA 4H13B 1U3DA 3DULA 1X9HA 3HQ4O 4LJ7A 5HIKA 2XWQA 4LTDA 2R60A 3AG1B 3HBFA 4OU4A 4Y9TA 3SVZA 3CURA 2R9VA 4IDHA 1RWXA 3HB9A 1DNPA 4RACA 3TRFA 4CLEA 1Z45A 4DIEA 3CONA 1F8GA 1WAMA 4BNMA 1MN6A 2I66A 4RQBA 4OA5A 5GOZA 3VI4B 2AYYA 1JVMA 1QYCA 2OBYA 3TG8A 5CM8B 7MHTA 2QAGB 5ADHA 4BP1A 2AGVA 1GM5A 5B2EA 5T4BA 5ER9A 5M7EA 3BVOA 1PX0A 3DVLA 4RH1A 5CUQA 1LRLA 4MLZA 2IH5A 3FKJA 1WMBA 4HNAB 1BXRB 1VPVA 4KUHA 4U2DA 2FEMA 5IFLA 1ICIA 1YR9A 2BHSA 2GBGA 2MCFA 1CZHA 2IHKA 3UCEA 2D54A 4DDUA 1FDSA 1TO2E 2IGTA 2O6HA 4ZOEA 3UATA 1AMUA 1S8FA 3UO8B 4E2WA 2ZUEA 1Y9JA 2AFHB 2E2WA 3HTXA 4WQMA 3AIKA 3UEOA 4RD2A 3U2QA 3ZIAG 4BY9E 1OX5A 3BH6A 3D81A 3Q72A 1F2UB 4L57A 1PUXA 4UHEA 1P49A 5E9WA 5EZQA 1JSZA 3ROTA 2H59A 3GH1A 2HP8A 2ZNIA 1OQAA 2BWJA 2ZSUA 2IP1A 3H86A 3IVCA 3SPJA 1WKBA 3MA0A 2WIDA 2ZSFA 4GG1A 2AG1A 5FAXA 4A5OA 1BTOA 1HNZO 4MCIA 3VZSA 2XOKA 3PD1A 4TWAA 5A5GA 3PDUA 4UCFA 2GYVA 3NIGB 2QTZA 3PQDA 3PXUA 4Q4HB 3U3RA 4B0OA 2AZXA 3G0IA 4PX3A 2CFCA 2Y1KA 4JJAA 3P3PA 3HBNA 4ISCA 4ZCQA 3A6PC 4FM2A 3OM9A 4HDAA 1YSCA 4FDUA 4KRXA 3M81A 4LXGA 4IUCS 4WBXC 5T3YA 4BV8A 4C05A 2I80A 5HPYB 2W6JD 4WZAA 3TUIC 2JAQA 4FVTA 5CX1A 3O7MA 3KPWA 1BJTA 4CT5A 5FWXA 5BSWA 3PENA 1DFHA 3SJBA 1A77A 3Q4HB 1GVNB 1XJ5A 2XMZA 2QE7D 4YDQA 3JALB 3BRWA 3B6IA 4DW1A 4QFCA 3P97A 3VGJA 4TSKA 4TZ0A 2WJ3A 1D2EA 1Q7RA 2LO1A 1MOQA 1JG3A 2GI4A 1V41E 3DHNA 3LLMA 4C9BA 5JVDF 1LCIA 3DGEC 3ML1A 4ILKA 1LRJA 2HVJC 3A6LA 5DASA 1YDXA 4BJ6A 2E4AA 3BD7A 1EN6A 5HMLA 1MSWD 3WNBA 5B58T 5J2UF 5KQMA 1DDIA 2AZ0A 2CBXA 3C7DB 3IESA 3UKDA 4CL8A 1P44A 2R00C 1EWKA 1J0CA 1C7JA 2FF5A 4WLUA 4ZQCB 4ZGGA 4PVCA 3CZMA 3LOQA 4PG6A 5K05A 3ST7A 1XYGA 3C39A 2GTSA 4DV3O 1RCFA 1YZQA 3WKEA 4CMGA 4G84A 3TI9A 1DCTA 2ZUVA 4MS1B 1OI2A 1Z47A 2XDWA 5EMJA 5FI1B 1SQGA 1TEHA 2JCBA 1Z12A 4QFBA 3FMIA 2JFXA 2CHFA 1W2GA 3DE4X 4MR9B 5DI3A 1K7CA 3ZNPA 4LBVA 5HRAA 2P1RA 2YN0A 2PJUA 3OEEA 3M3DA 1UDCA 3UIEA 5FJIA 5K8LA 2DJVA 2O3TA 3FYEB 5ISMA 5B37A 4NBNA 1NSFA 1EFAA 3F9IA 4Q1EA 4FOTA 2XAFA 1MB2A 4M9UA 4RU1A 1XTKA 1U2GC 2FOXA 4NTXA 1N32O 2VSFA 4JWTA 2OSBA 2XQJA 5DP1A 3RQSA 1N2GA 1ES9A 2JA2A 3L70H 3NKFA 3IAUA 4H60A 1UXIA 1GFZA 1SC6A 1Y80A 1ZUNA 2FSVC 1PGOA 2Q1TA 5EMKA 3ROFA 2H2FA 5GJWC 3V8NA 5AUNB 1R64A 5EJEA 3EX7C 1C1YA 4FZVA 1TM5E 5CA1B 2B78A 1Z3IX 3QPBA 1C30A 4MUIA 5H5NA 1LX7A 2GCPA 3CEAA 5FOUA 3WLLA 1GPKA 4D57A 2HSWA 1XVLA 1KQOA 2HK8A 3I55V 1W0KD 2HHCA 3D6JA 3KOOA 3USES 2GYYA 4HAMA 1RXVA 4NE9A 2PKYX 1B43A 3MGCA 5E7MA 5H70A 1WUIS 3CB4A 3HKDA 1SVMA 4P84A 5DW0A 4IDEA 5JQGB 3TJRA 1FA9A 4RAIA 3ZRSA 3DKKA 4U7FA 4NBLA 1M6VB 1T2VA 1ADCA 2JGIA 3PCTA 2F9FA 1FVHA 4LE0A 5FT9A 3VISA 5C80A 3PI7A 5KYXB 2H3OA 2C88A 3T5MA 2J6CA 4OSEA 3OZ7A 1SH7A 1QDEA 2GCIA 4M60A 1CR4A 1OZHA 1X4TA 3AK2A 4I50A 3NVAA 1N2CA 1AGRA 3G8BA 1GG9A 3CF4A 4TMXA 2O8EB 4WY8A 2JLYA 2XKKA 4A8JB 2AX3A 1PZHA 3T3PB 5C7OO 4BJHB 4K86A 5ESRA 3ZQKA 2OHIA 2I7TA 3EF3A 4KACA 4Z4GA 4QXMA 4IYRA 2YJTD 1T1IA 4IOKA 1P9RA 1COWG 3Q7PA 5TISZ 4G9GA 3KQOA 1TL7C 2AC2A 4GI7A 1ODKA 3GXBA 3HI6A 4K26A 1DQSA 1ID8A 3NLLA 2IJJA 3GDGA 1TJNA 2NU8A 5JPDA 1EX9A 4EZBA 2GLTA 4UZSA 4RKEA 5H16A 5TPWA 3ZNQA 2B3JA 1Z2EA 1N36B 4F11A 2QWOB 2HL6A 5AG2A 1WUYA 3QVKA 4QJFB 2Z1DA 3FYDA 1SMKA 2WTBA 2O59A 2BHRA 2IIQA 4BWVA 4WSOA 5IU6A 4XYLA 5L51A 4F6CA 4AZSA 4R69A 1SVWA 5ER6A 4IW3B 3LNCA 3TJMA 4ZT2A 10MHA 3FB6C 1JYEA 2HLHA 3LYHA 3PXGA 3TUJC 5A9SA 5TIIA 3L73H 1DWUA 1ZIPA 3WK5A 2DFVA 5EWLA 4DV5O 5F2KA 2GN9A 2PZJA 3DVQX 3UKOA 5DISB 2NPOA 3FB4A 2GK7A 1ORIA 3FUTA 1SHJA 2GNPA 3LO8A 4C2UA 4H1TA 4D8WA 2WHYA 4WDRA 1M2GA 1E6MA 1C9EA 2IEBA 4RPJA 1AZLA 1IZ0A 1R0CA 3EVCA 3M89A 3KJGA 4URVR 3U4MA 3ANSA 3LKDA 2UVPA 4ND1A 1JXQA 2WUVA 3GD7A 3C1TA 1EZVH 1JIKA 2AFIE 2QTHA 5IARA 3V97A 2HZBA 1K7DA 1R00A 3FYHA 4TYPA 1FJGO 5HBRA 4ASUA 3R9WA 1X2BA 2O96A 5JYBA 2PLWA 3NBAA 4K9MA 1R1BA 4AUNA 3FZEA 5JFGA 1YB6A 3SXUA 4LY0A 1PGQA 1J2YA 1KEZA 4RMIA 5CLLA 1SVKA 2X2PA 3L79A 3PT5A 4YDRA 2X9QA 3WKBA 5LU8A 1JEYA 5SY4A 1O95D 3ZKWB 2WLNA 4RW0A 3QVGB 1LV8A 2AX4A 2O4UX 4IQ8A 3MIIA 3PUXA 4OF4A 4P5EA 3G7SA 2A6PA 2CXNA 2PZGA 2QM0A 4TKZA 3OESA 1G20B 2AMFA 2WHPB 4LJAA 3FPFA 4CL0A 3I8XA 4Y18A 1QFZA 3CLVA 5I48A 1S5LZ 1QUEA 1HEUA 3TPZA 3W5CA 1RQ7A 3KM0A 1TD9A 2C57A 2C3MA 3AJRA 3PDIB 4LEIA 3N53A 1N7HA 4U2CA 4OHXA 1L5YA 2Q7OE 1XDGA 3E35A 3NEJA 4WESA 3SBOA 1UK8A 3KE9A 4PN3A 2ZNRA 5LYJA 2B82A 4IFEA 1P8JA 3GRFA 4U2FA 1DKOA 5FR2A 4E21A 2C2OA 4R9VA 4MPRA 4QNMA 4ID9A 5A06A 5FH9A 1N5KA 3E05A 1GGKA 2NU6A 3L5OA 3G9ZA 5K0JA 2JI9A 4Q4HA 4XDLA 1BFUA 3LDFA 4WW0A 2BSKB 3IH5A 2HG5C 5CAEB 2E49A 2LXNA 4X64O 1J5EO 3RBZA 1BNCA 3QPCA 4GPTA 3UQYS 1EP3B 2Y76A 1L5SA 1XTRA 2A78A 1WCXA 3DE6X 3ZLBA 2IUFA 1SAYA 2Z83A 4UEWA 1RKQA 2XA2A 1HORA 3AJEA 5AI5A 3A4NA 3R7WB 3P2JA 4GYYA 3ZMVA 2VA8A 1U3TA 4B6GA 4DILA 2JEUA 1IXBA 3QJYA 2BFDA 1IB6A 3FKSA 3H19A 4NY1A 5ELMA 1V11A 2EZTA 5IT9N 5G3ZA 3JX9A 2FPGA 2VQFB 2GZMA 2NADA 3HU2A 3H05A 3HRIA 2C2XA 2IQIA 1KXZA 1C2YA 1RWQA 3D0RA 4P3XA 3CX4A 5JAQA 1ODFA 4N0MA 3S7TA 4MQEA 3BTOA 4I9HA 1E1RD 3DBRA 3HDJA 5K0EA 5TSDA 3EZNA 1Q6UA 4Q39A 2N05A 1Y4AE 4YJFA 4JJ7A 1E1KA 1KAHA 4ICIA 3FPSA 3TO5A 3X44A 4D6YA 1SGWA 1KBOA 2GN0A 4JLBA 1U94A 4GX1A 3K2QA 3QBVA 1VCNA 1IVSA 1PLKA 3F0TA 3INGA 3M9XA 4LBWA 4BBAA 1NNI1 2QM3A 4KH1A 2QEXV 3G2KA 2EGGA 4MVOA 3TKAA 3KQHA 2CN1A 3RK4A 2FFJA 2OGWA 4H18A 3ODGA 5H4HA 1L5GB 3COPA 3TW6A 1MIOB 4E1BA 4BN5A 1NVTA 4MUNA 2HB6A 4KIGA 1WXWA 4QU9A 3SVLA 3OKAA 5KVQA 1R12A 3C8DA 1HFWA 1LVUA 4J0IA 2UZ4A 1J2RA 2HI0A 3B51X 2B36A 2VP9A 2YHAA 2YUIA 2HUPA 4XARA 2GS9A 4LFAB 1Z8HA 3H4TA 2HT6A 1J09A 1UM9A 3NBMA 5LZ4A 4MRNA 1V3UA 4LY6A 5JU6A 4GQAA 3VO1A 1OZFA 1VJ5A 4DBLE 1ZG3A 5C8YB 5LP6A 4LOAA 2GZAA 1R5BA 2ORWA 1UP7A 2NUBA 1D2GA 5EXDA 2OYCA 1NJ1A 4A8JC 5JI3E 1SA0B 3WKCA 2PE5A 1D1SA 1EQAA 4RZSA 1CUUA 1DUVG 1GPMA 2IXAA 5TMEA 3SM3A 1DSSG 1KSGA 1DJOA 4KG7A 4DLTA 5HJEA 4YBZA 2PD6A 3RWBA 3KZNA 5BNWA 4L3OA 9GPBA 3A1VA 3G5TA 2ODNA 2DBQA 2Z5VA 4JLMA 5U4XA 3E58A 2HU8A 3GRVA 1WS6A 3E3MA 3FOAA 4RZHA 3T3DA 3OSZA 4DR1O 4IRUB 1Z2GA 1YFLA 5IBPA 2WB4A 1EX1A 1TRKA 5DIZA 1PJZA 3KOYA 3T7CA 3F46A 2QIPA 4F0JA 4N8DA 1M83A 3GROA 4K9NA 2I99A 4TYWA 1Z6TA 3RODA 4NESA 2OXCA 3JRWA 5AKHA 4CKCA 1PP9H 1JR3E 4QPZA 5B3LA 1WL8A 2WG0A 1HNWO 1YITV 3OJEA 4AZTA 1BMTA 1BVUA 5T7BA 1D0SA 2SBTA 3DV9A 5CPFA 3UVEA 3LYUA 5ADVA 3C90A 4QRDA 3OQ6A 1Y6GA 1ADYA 4LVOA 2A88A 5DLDA 1DAOA 1LGYA 3UHOA 4EJSC 3MB5A 4L3VA 2P9JA 2GCEA 2JLRA 2IBSA 4FPPA 2YHIA 1BS2A 3KQKA 1K33A 1GPUA 4RKWA 1S0UA 7AT1A 4OXSA 1BS1A 1SBTA 2W2PA 3MAJA 3IV6A 4RD1A 4A10A 1HTBA 4PC2A 5E2BA 4BNGA 3VKWA 3NAQA 3M4NA 5CFPA 3BFRA 3QLVA 4HDMB 5GJCA 4JPRA 1YZNA 3WGTA 1QIMA 4ACBA 3N8IA 3VBCA 5E4FA 1NZ6A 1ZHOA 2VEDA 5C0OE 1EGVB 2G71A 3B9RA 3H83A 2X0JA 3KS9A 3LLSA 1KO5A 3R7WA 1OXMA 1UWZA 4F3WA 2GDSA 3TR0A 1QHXA 2NVUA 4OLHA 2PRKA 2VBIA 4JLAA 4ZC1A 2FMTA 1NBHA 1X7XB 5BWMA 1PR0A 2WU8A 3BWXA 2IYAA 3S27A 4AS2A 4C1BA 3WZLA 4U7DA 3SC2A 3L40A 3BA6A 1Z6XA 3CJTA 4FWTA 4IRXA 1DQZA 1ZPDA 2PY6A 3KQSA 2GKSA 4BE4A 3OE5A 3R40A 1Z13A 3VKHA 1NSYA 1TO6A 3G2HA 4GUDA 5F2VO 3VUFA 3ZI4A 2JHFA 4DM4A 1QC5B 3FFAA 4NMXB 3D5TA 2ABWA 4B4UA 2WUWE 2C94A 2NTYC 4EUKA 3QUQA 2DWUA 2O0KA 5B1DA 4P58A 5I4BA 2ONKA 1CUXA 2RARA 2Y69C 4FWBA 4IIGA 4N3GA 2C2GA 4KZPA 2RHOA 4UQOA 5IC6A 2O1EA 3BSWA 1LDBA 1Z74A 2P9QA 2CLKB 4MWOA 4ZV9A 5L53A 5IM5A 5L9AA 3OTFA 4CF3A 5GJBA 2PIAA 4HZ3A 1WPQA 1BHO1 4P3YA 5L4SA 3HXQA 2B1GA 1BQZA 2NN3C 5KNCA 1GTMA 3QXHA 3OBBA 2XD4A 3W0LB 1Z3AA 3WA6A 1Z16A 4BQNA 2CUNA 1PZEA 2GKOA 2OC4A 5C5IA 4XD2A 4ZQBA 1GUAA 3H87A 2DFPA 3HGQA 1M6YA 2BDUA 1Y7HA 1CQIA 4WL0A 3SY8A 4WASA 4KHPO 5JNLA 1LPSA 3BTSA 3GP5A 4OJMX 5H82A 3BT7A 4GSYA 2JK5C 4HRAA 1C3EA 2MMGA 4I0XA 1XHZA 2ZTSA 3PYXA 3MTGA 3KYDB 4O02B 4OHPA 4RFLA 5AKYA 3AEUB 3IRVA 3COSA 5EY5B 3WBKA 2VK1A 4HTAA 2VWPA 3C1UA 4RMHA 1TTPB 1M0TA 4X20A 3DR5A 3ANTA 3IULA 4CTKA 4FFDA 1PW5A 4DMMA 4URXR 3PVSA 2HO5A 3T95A 3JAWA 2NSYA 1G6KA 3B7GA 3CNEA 3A1WA 3CF4G 4QU5A 3R0XA 1PWXA 4Y9DA 3UOWA 2ZIUB 1ENYA 5M3BA 4PV1B 3CISA 4C7BA 3DLPX 3MMZA 2EJCA 1Y74A 3ERCA 3KPYA 4NYJR 4PDVA 3IUEA 1QGZA 2EHDA 2QX9A 1NVMB 4AJLA 2DFTA 1F8XA 3MCZA 5AVQA 3AG2B 2ECFA 2EQ5A 1U11A 3NR2A 2DHEA 1ZSPA 4QHTA 2ACEA 5D5HA 3WRYC 3WX0A 4C6TB 4URYR 1EIZA 4MYHA 3WLHA 1IWPB 1Z18A 1PEAA 3KXPA 2AKEA 2CXSA 2M9MA 4D0LB 2A84A 4KPGA 2P65A 4ZEVA 4TWKA 2R8XA 2PZFA 5JAOA 3Q6IA 5C2OA 1T2CA 3T4DA 1G6UA 1I0LA 1O96B 1E9VA 2XQVA 3E7XA 3GUZA 4CODB 3HVHA 4GPIB 3TKYA 3PXBA 2QT0A 1Q6YA 4RTPA 2VG8A 1W29A 1EK6A 2BE3A 3HWX1 2SKEA 3JWJA 4TRNA 2YZMA 5DYYA 2BTOA 5FWAA 1JFSA 2BMWA 1GKFA 2ZAIA 2C9OA 1DTOA 1ZSYA 2BM1A 2QVXX 2HF8A 2YQ4A 3EEQA 2CKDA 2UUAO 1Q84A 2AN5A 1JKJA 4IIYA 1NQWA 1CQZA 3HE3A 2P6NA 4JT4A 5CFOA 2N1BA 3LWZA 2R8EA 4ND8B 5K4AA 2X86A 1E5DA 2CTPA 3A2LA 3C98A 2PT9A 1JH8A 2GO7A 2A3QA 1WULS 1L5ZA 3KVVA 3BCCH 3LPCA 5E4TA 1BWRA 2Z5FA 1CDZA 5CLIA 4KHZA 4MA0A 5D84A 5DLYA 5K8IA 4ABTA 5EP3A 4XCXA 3VU9B 3CF6R 2ZM5A 4EG8A 4AWAA 5EMHA 1TADA 1FXKA 5CBHA 3T94A 3K32A 3LXRA 3K92A 4AO8A 4D3FA 4TVOA 4D9MA 2GWHA 3YASA 4HMPA 3FSJX 4WKCA 5JV5A 4B34A 3ETDA 1CY2A 4KBYA 4I81A 4D6XA 1L2TA 2P35A 4CEHA 4FMDF 3OVMA 1P62B 4PYRA 4NU8X 2PZBA 3D1JA 3MZ0A 4U2EA 5EE1A 4JYAO 3NBUA 4XE5A 1U3GA 2GERA 2UXDB 1KYYA 1YBVA 3N0TA 5J1TB 2Y05A 2HEPA 1BQ3A 1VG8A 2PR2A 3K35A 1RM1C 3K4PA 5TGZA 3H18A 1ORHA 3BX1A 3KJFA 4OXIA 4YRLA 4QOIA 2F95B 4KYIB 1BFKA 2EEPA 5LQMA 2I1VB 1OB2A 1YB5A 1XPOA 2B5VA 3HXLA 2X14A 1A8PA 3CUYA 4DCPA 1K88A 1H8EA 5CM2Z 5E1BA 5IABA 1X8XA 1KAQA 4IX9A 2BMFA 3IP6A 4INOA 1IBMO 2V7VA 2E76B 2WLIA 1B6SA 3M6VA 4R2MA 1ZRSA 2HNKA 3QXJA 4X1KB 4BO7A 2XSZD 2WD8A 1ZMBA 4RF4A 4X7BA 3S29A 3ZEIA 1U5CA 5AVJA 3MN1A 1ZH4A 3S55A 3W3AD 4MJLA 3OJLA 2ZT5A 3T3OA 1LLDA 3DAPA 4C6RA 1IBCA 4MRRA 3W9BA 2PUHA 3N7UA 4M76B 2WM3A 3A9SA 5IP5A 4B4KA 1PQUA 1OA1A 3U7RA 1TFUA 1G4AE 3G0GA 3QIAA 1JG6A 1K6JA 5EBWC 1NM5C 1RLMA 1REQA 4FM0A 3F6SA 3JZAA 4JGIA 4N9QA 3ILSA 4B3BA 9LDBA 3GLGE 1JEYB 5HA5A 2F9MA 2I6UA 4EBBA 5L7TA 4GH5A 1NBEA 2Q6OA 3VR4A 5TQ0B 3SYMA 2JLWA 5EIXA 4XVRA 2G8LA 1N34B 4MVYA 4D3SA 4KR2A 1JDSA 3BB3A 5A4FS 4NCNA 4LNAA 1VSVA 2WYVA 3H3JA 4W9NC 3IAM6 3LHDA 4N7BA 5F5NA 3OFNA 3UG6A 1T8RA 2XR1A 2JDIG 4BFZA 2Q2WA 4ARUA 4JKOA 1PYGA 4B4OA 3AVTA 1OCOB 4UV8A 4JOQA 4OBBA 3SEAA 1LK0A 4Y6QA 4UUOA 3IMKA 5D7NA 3SIPA 4QT4A 3VR3D 1A9OA 3WWYA 1N1EA 4RCYA 4YFVA 4EMSA 1NJ5A 2OHOA 2EC5A 2RHDA 4NMMA 4XGNA 3RSOA 3WSWA 2A8YA 4Q1VA 3TTYA 3PUHA 2C7OA 3GRCA 1FQWA 2D2IA 1HNXO 4ZZ2A 5AM4A 5DHTA 1Z75A 2PA3A 4TQUS 4JI6O 1Y6JA 1JLSA 2NPIA 2B7CA 1H6DA 4D6PA 4NEGA 4YP9A 1A7UA 1SZCA 4OHUA 3LNTA 4IX1A 4UE2A 4NK5A 1UP6A 3H11B 4UE3S 4F96A 3RGWS 4ZIRB 5AVXA 1U0BB 2NP6A 5TMDA 2O1SA 4MICA 3B12A 3VUEA 1F4MA 4G3MA 4PXYA 4LF4B 1N0IA 3CZRA 4J6EA 1JHYA 2R68A 3QHAA 4Y9UA 3JQFA 3MJFA 1EWTA 2VYCA 2QW0X 4JMPA 2PS3A 3SSOA 3TTWA 2ZRHA 2J3EA 5TT0A 4NB5A 1E6KA 2BFEB 2V0CA 3TOCA 4WFBV 4UPDA 1VF6C 2G0NA 1OCCB 1UBNA 2JLQA 4EY5A 1PUIA 3U10A 2DH6A 5KMGB 4WZBE 1MQAA 4EO4A 2O7SA 5BQOA 3KKYA 4RTLA 2IOFK 1FPMA 3KAJA 4N9WA 1ECPA 1ZKMA 3HJGA 4JOSA 2Y69B 1X77A 4MWBA 2V6MA 3H75A 3E7WA 4UD6A 4E15A 2ZJYA 4B6JA 3MG9A 4ZALA 4DMGA 2ADOA 1VKOA 1X1SA 3IHWA 4FFNA 5KHGA 3D8CA 2P9HA 2WVAA 4KQGA 4L8FA 4TTTS 3SGLA 4AJIA 4DFDA 3PYLA 2IVZA 1AUPA 1SVNA 1WTCA 3TMAA 3VAYA 2ZYVX 4BMOB 5KYXA 2LKDA 4FGZA 3WB1A 5FYDA 1PG0A 4ZZ1A 2ASEA 1NDUA 2IPLA 2RGNC 5T8KC 2A7WA 2YN2A 3T7RA 5C7YA 2IV3A 1D6MA 1UC5B 3K72B 1WCWA 1MH9A 1NQVA 1U7OA 2GUZA 1PL6A 2Q4EA 3I32A 3AEQA 4R1LA 4DV0B 3L7AA 5JANA 5DK4A 5B7PA 1FTQA 2EIXA 2NU9A 3QVGA 2CVPA 2WQZA 2WTNA 3IJ5A 3KOZA 3PUWA 5ALMA 4F7DA 1FU7A 2AZ4A 1EJ2A 3MSCA 1XTBA 4Q1FA 3ZQ6A 2H1LA 1TOAA 3VO8A 3J80A 1ZZEA 1SRYA 1EGHA 1FJ2A 4CLOB 1J5XA 2DLCX 4Q7EA 1K9MW 3M83A 3GCWA 1YB7A 3NNNA 3T4PA 1WP7A 4MUKA 4EPYA 3PEWA 4LFBO 3BFVA 2FUNB 1RZRA 1J6UA 2OAGA 5EJGA 4X92A 3VKVA 4ZFTA 2E0IA 2JCYA 2PL1A 4ZTUB 1DZIA 1UXHA 3GR6A 2BFAA 1FNSA 4KDFA 4ARZB 3ZK8A 3LXUX 2O8CA 4HK4A 4QTXA 3UT5B 2AYZA 2OP1A 3TB4A 4EX6A 3LPNA 5FDFA 1GVHA 4OHZA 1W25A 2UUPA 4BIOA 3GLIA 1E1CB 3L7BA 4LQCA 3T15A 3ZRVA 2TMGA 5J59A 5L3BA 2K5UA 1RMTA 4OFXA 1V3TA 3AVOA 3RNLA 1B06A 1QRRA 3KTDA 1LJUA 3KB8A 1H2GA 1ESCA 4WECA 1MSDA 3L1UA 4ARSA 1GGVA 1O5IA 1GPLA 4J0KA 3ZHCA 3BH0A 2WKRA 5I9IA 1W48A 3N6XA 2QWRB 3DHYA 5JS2A 3CRW1 4BQIA 2IZ5A 5I6DA 2OV6A 2ZI7A 5EXSA 4ZVMA 5AM0A 4F91B 2FKAA 3E61A 3QEMB 4MUEA 2Q69A 4BFSA 3ADDA 1NA5A 5E79Z 1U7ZA 2JIDA 1ZW6A 1RXSA 2JKZA 3DBOB 4GSLA 3CCLV 3L3BA 3ELDA 2BOVA 1L8OA 1XDSA 2ZULA 3DEIA 4KKVA 2HXGA 2RH8A 2JJYA 4BWAA 3PGXA 5JLJA 4CW7A 1HRKA 2Q41A 1KEWA 2J9FA 3JYOA 5D1NA 5AD1A 2L0XA 3DFIA 3G23A 3K9HA 3KEFA 4LYGA 4YRCA 1DIBA 3U3DA 2J8ZA 2QX7A 3UFXB 3K79A 2P2YA 2C5AA 4FKBA 1ENZA 1M6WA 1VE9A 2I9PA 3DZ8A 1FFGA 4PR3A 4AWXA 4W8GA 2HLPA 2NAFA 4Q7KA 2O7QA 4OLAA 1VQ6V 1LI4A 1T1GA 2NT4A 4Y7DA 5G2OA 1PDOA 4KSBA 1P2GA 2Q5LA 5I45A 3OETA 1JLLB 2Z2YA 2RGWA 1QHTA 3IAEA 4TTAA 3ASNC 4FDAA 2FRDC 3CFYA 2JGMA 1RCTE 2D8AA 4R7GA 2Z6AA 4UM9D 1TM1E 1RWMA 4QTZA 3QE3A 3WYEA 1H3EA 4CV3A 4CCWA 2WM9B 1C3XA 2CLIB 1AP5A 3QE0A 1U8FO 1UAGA 4MI6A 8ADHA 3QITA 4TL9A 2WLLB 1ZXXA 3UV7A 3WQRA 4LHWA 2W6OA 5L6LB 3K6SB 3U9TA 2QMHA 1KBQA 1SESA 2Q3MA 4PHCA 4CIYA 1QRAA 1MABG 1WQ1R 1NVBA 4DA9A 3K5IA 2II6A 2Y0PA 1CJMA 4WLNA 3U4IA 4Z2YA 4MGIR 3VVCA 1ST3A 4NR0A 5B1OA 2QM7A 1VIBA 3O2SB 1E58A 1KMQA 2DH5A 4L16A 5ALDA 4BIIA 3V1KA 5LQNA 3GC6A 5A2QA 2NYAA 1TU0A 1JPJA 1WB4A 1Z7YA 3P9QA 4Q9AA 3WWOA 2OV4A 3HCDA 5E3HA 1GA1A 2F7SA 3OO1A 3K0DA 2OO7A 3JATB 3TFQA 4ZDKA 3VDMA 1GQOA 2WTEA 1WN5A 3RN4A 1T0UA 3K1AB 3LKBA 1HLPA 2ID4A 1I2BA 2C2MA 4ROSA 3V8PA 4EW3A 4POOA 4YX9A 4PCAA 1JSCA 2VYVA 3E7FA 4QRIA 5D85A 4B43A 4UQLA 2O07A 5HFLA 3FZQA 3H6HA 3QH4A 5IM4A 3Q8LA 4DQUA 4JJZA 4ZOLA 2MK3A 2R7NA 3B60A 4LV5B 2N46A 3QEOA 3CW8X 3FPHA 3NC4A 4NATA 1YASA 4G1FA 1R3IC 2OKCA 3MGAA 3PPIA 5F1OA 5JAUA 4K9OA 3GPCA 3FKSG 1SKYE 4L5IA 3HSYA 1EFUA 2IYZA 4JI5B 2ZVPX 2C4UA 5KHIA 4IINA 2J3MA 5HG0A 4QTYA 5CVJA 3B1ZA 2Y1EA 1W6UA 3OMLA 1G5PA 2VDRB 4IV5A 2C31A 1XDWA 2JKYA 2C92A 5KWVA 1JAZA 2AXEA 3HJBA 3NC1C 1EP9A 1GTL1 5A7GA 4TV8F 1KDOA 5TXGA 1HM5A 2LPMA 3HDGA 4AM8A 2NQ8A 3Q7SA 3ZW9A 4UDXX 3GUUA 1V8PA 3RSQA 1I3NA 5G40A 4U39A 4FYIA 1FOEB 4UPVA 3BMQA 4W4LA 1JEDA 3EXG2 1WJGA 4MP6A 3ZIDA 4Q02A 4Z7QB 5CGQB 5JSYA 4TS4A 4OK3A 2P9YA 5ICGA 1M2OB 5K0CA 1DLJA 3AR7A 3PRHA 2DULA 3PRJA 3TQTA 3OMNB 4PD4F 3HO1A 2AW3A 2GVNA 5JEDA 1EXMA 1QYIA 4GLFA 4M0PA 3K8YA 1U7WA 1M8KA 3IBCA 5AFSA 1GV1A 2B5WA 5B5EZ 3SSAA 3SF0A 1U7PA 2P4EA 2IS6A 4I55F 1BYIA 2CDBA 2CLHB 3A28A 1MA3A 1A82A 1LVHA 1WTAA 3ZE7A 4CMIA 3K7EA 3ESQA 4DUGA 2E5FA 5JBIA 3VAZA 5IWAO 2ZYHA 4RELA 4RO2A 3EARA 5IWAB 1I1OA 4LZJA 4FC6A 1FX1A 4OP2A 1YZFA 2FR1A 5L3FA 3LCVB 3K5LA 5LMUO 1NDHA 4ZC8A 3SS7X 3UW1A 2EYQA 4D41A 1Z63A 2BEWB 1X7XA 2HMVA 2UZIR 3VH4A 2NXWA 1X7ZB 3R0VA 2FEAA 1S3FA 4R2IA 1R8QA 1XQ6A 1UK7A 1UDRA 3F67A 1KJ9A 3R77A 4GXRA 4W5WA 1MB0A 3VRHA 5KOJB 3ZRWA 2W6JG 4JN6B 4JZYA 2LKCA 1YZVA 4GMXA 3PJRA 4MUGA 1FNCA 5ALPA 3HJFA 1GPNA 1DLBA 3U4HA 2V4ZA 2P0YA 3P4UA 3R24A 1FE8A 2IYLD 2QVYX 3CNHA 2PJDA 4PZUA 2Q9AA 3MWEB 4MNTA 5ILGA 1I9CA 3QNUA 1ZDMA 1UX1A 5EE3A 4K5QA 1V96A 1XRSB 2AZTA 3SR2C 3B6JA 5A05A 1R3LC 1E0KA 1R6AA 3T2MA 1EGAA 2H85A 2YY6A 3CMAV 3H6GA 4FI3C 5GTIZ 3THWA 5BR8O 1KVUA 2R87A 4J4HA 2EW2A 1V8BA 1NYQA 1FVOA 1MJFA 2DWQA 2ESRA 1B7GO 1EKXA 5CH5A 4BVLA 5LP1A 2WIGA 2OZVA 3A37A 2G7MC 3OKPA 2XUQA 1Q0LA 3H9JA 3SHFA 5LNK6 2QX4A 4FGSA 2FZEA 5U4QA 4MDHA 1IOWA 2BCJQ 2EILB 2Z8XA 1N1GA 1QJ4A 2QUZA 1OU4A 4RENA 4Q9IA 1XYVA 3HEMA 1MT0A 1KQFA 4QM7A 4DA4A 3QPWA 4NIMA 3GT3A 2ZJ0A 2C8VA 3FYSA 3HG7A 4YAUA 1WNFA 1IRXA 4MZDA 4FMTA 2D5AA 4HYTA 5BMVF 4B33A 3GRYA 1L5RA 1PZGA 4I36A 3AV3A 5CRIA 3TFOA 3ADBA 1XQWA 1LBTA 3L6BA 3GP8A 3U9SA 2B61A 4K88A 3ICCA 4J3NA 4GI1A 3TNFA 4CLHA 1JLMA 2YYZA 4Z1VA 1CB7A 1XRMA 3TBHA 3UTDA 1GUFA 3CVUA 3ZXYA 1I01A 4F3CA 3H42B 1JAYA 2P5SA 3V2HA 1G21B 3HCPA 2OV2A 1RJEA 3PTLA 1X13A 3L75H 1SA0A 2OAP1 3FUUA 4OCNB 1VB3A 2O57A 1CIJA 3G7UA 1SWWA 1WW3A 4HAOA 4MQ6A 2HM7A 1KDVA 3C24A 3VPGA 1GA6A 1FS5A 2QTMA 2M32A 3KK0A 1TZ2A 3NNSA 4UB8Z 1M10A 2ORYA 4N21A 5EVCA 3WYAA 4BRWA 2KB0A 2K9PA 1V0JA 2BGMA 4YRQA 1QF6A 2GPNA 3UJ8A 2AJLI 3C6ZA 4AULA 4YRZA 3NWBA 3M9WA 4E6EA 1VE6A 3O5AA 1U3VA 2Q6AA 1Z3CA 3ADKA 4MGZR 3EVTA 2GJ9A 5D87A 2AUMA 2JD1A 5E6UB 1VE3A 3MINA 2OM6A 3DZJA 4X94A 5D3QA 3M4XA 2C4HA 4I8XA 4KITB 4ARBA 4LJYA 1ZD4A 2VF2A 3SQMA 1K6IA 2WWWA 1QX3A 2WD7A 5T64A 5I7UA 1Y7TA 4CETA 1GL6A 1N6PA 3WTBA 1K4CC 1NI8A 3T1CA 1G21E 3HUDA 4HAUA 5A4KA 4IYIA 2QA5A 1OWNA 1CUBA 3C14C 3H2YA 5FP0A 3TIVA 3TBFA 1I7DA 4BQOA 1WLSA 4W5RA 4IF6A 1CS0A 1NVFA 1NWHA 3SYKA 3THYB 1YF2A 1QM5A 3DVAA 2JGKA 2HXVA 3B36A 3V4SA 1WN7A 1ZNWA 4JB3A 3AU9A 5IJ9B 3GAFA 3LUFA 4EEQA 2HHAA 2ZIEA 4WRRA 3EIWA 4AJHA 5BN5A 1NM5A 3GLKA 4U9HS 2YI9A 3OLXA 5K1ZA 1NQOA 3RH0A 4E2LA 2QU7A 3MOSA 5FO1A 2QTCA 2H07A 2CE2X 2GARA 4RHXA 4ETIA 4LZOA 2LCQA 1AMOA 4RQFA 3V32A 4TT8A 3EPLA 3QWFA 2A9OA 1KI1A 1CEXA 2QB5A 1K34A 4DDVA 1S02A 2HCTA 4MX8A 1A9ZA 3GJZA 4OVKA 2OCBA 1K7SN 5HX7A 3JQQA 4H4CA 1E3WA 4X89A 5AOCA 3EHDA 3KUCA 4NV1A 1A7KA 5B1BC 2XE8A 3ZDBA 4TLBA 4QM6A 4WXPA 1IZ3A 4C06A 3R6TA 3HB0A 1HG1A 4LDNA 5A7HA 4BEVA 2MT9A 1GARA 3LLUA 4ONEA 2A33A 4ZYTA 1G5FA 1YE8A 5T67A 5THQA 3UM9A 3WI7A 1GG5A 1PJRA 3CZAA 1TVKA 4HBNA 1ZVVA 4OTZA 2VF5X 4JJ4A 1ZY2A 1KQPA 2O8VA 2OBNA 4LVNA 4J0HA 4BIUA 2F1KA 4P54A 4RGVA 4YAIA 4UVIA 4W1QA 3RADC 1C3JA 5JHHB 3COZA 3F6BX 4QJBA 1T3SA 1KO7A 3N0WA 5CG2A 2CK3D 3BJZA 3EXG1 3I39X 1F2VA 5FTMA 4PTLA 4OYLA 1Q14A 1D2RA 3U44A 4ZHQB 3W1WA 1WU8A 2WZBA 3F96A 3R5HA 1ZK3A 1URFA 2EKLA 4MO9A 4RMJA 1JG2A 4OFZA 3SJCA 2BKVA 3DZDA 3A4LA 1MQ0A 4LZNA 4R1SA 4AXXA 1QGED 5E6SA 4FOSA 1UAYA 2AW9A 1UPTA 3V46A 4EOGA 3SQLA 4YT2A 3I9V6 5A4JA 5EJ5A 3ZCPA 1WLEA 2R8RA 2XGSA 2X13A 3HFGA 4MVUA 4GVXA 4GZMA 1SULA 3QKIA 4QICA 1U2DA 2GN1A 1JKFA 3WFZA 4YCSA 1KGSA 1ZGBA 1INLA 2FJUA 2WLSA 3HKBA 4J9YB 3I1JA 3C16C 4OGGA 1VI2A 2DUJA 2KE5A 2Q2QA 3IMCA 4KPFC 2P27A 3RS7A 4W5OA 1IHYA 1V4VA 2BBSA 3N7AA 2PX2A 1XRJA 3UF0A 4MRSA 3ZC3A 2KLHA 4KE6A 3ZKWA 1MT3A 4OQFA 4R1TA 3EOAI 4PQYA 5KQPA 3U44B 2VDVE 5KS2A 1JBQA 4BAUA 4DANA 3EQ7A 3WOVA 3I9MA 3ETEA 3NV7A 1UXOA 3H8SA 1R16A 3EXEA 3PL1A 4NJMB 4WZBB 2IPAB 1FFSA 4BMDA 2DP4E 2HK7A 4ZJYA 2H31A 1H4VB 2XEDA 3FJYA 4IJMA 4DMRA 2N47A 3G6WA 1DE0A 4JJFA 1ND5A 3PQ5A 3RLFA 3K15A 4IUYA 2EIKC 1JQAA 1PS9A 3D6VA 3HMQA 3ILXA 5FBWB 3O8QA 1QYXA 1M90W 2GH1A 5AW1A 5AUQA 5F51A 4JBXA 5JS8A 3LCCA 3I9LA 5AYVA 2QUBA 1JRLA 1ZZGA 4JI0O 1EFPB 1WHTB 4GSKA 4LZAA 2CDAA 5K7SA 1CV2A 4LZWA 3EMKA 2XEXA 3EFOB 2UYQA 3NWJA 5LD2B 2GJSA 3AG1C 2AFHE 2IP4A 2XE6A 5CCDA 4TKVA 3K8ZA 5HNKA 4WJZA 4HJRA 4M8SA 3AR5A 3CX5F 3JYCA 2ZI4A 5BNIA 3AM1A 1ABFA 5JZ9A 3JYPA 5JXWA 3N75A 1H2ZA 2C2YA 3AUFA 3G67A 1JPUA 1BFDA 1RWNA 3DDCA 1MQ9A 4W7SA 3RIMA 3OMAB 1MMFB 1GTJ1 3A3OA 5KTTA 1RI3A 2HJFC 1XZPA 3DBRB 1SB8A 2AG0A 4HH3C 1MX1A 1XFDA 7ABPA 4NOLA 3VZPA 3F78A 3L4SO 1HR0B 2QN6A 3VHXA 4ZEMA 4NXNB 2FR0A 4TMKA 4EEXA 5EJ8A 4HLCA 2ZAYA 4A36A 2PUBA 3OKFA 1A2BA 1H6AA 2GQ0A 1SZDA 1U7TA 3O6VA 4PV7A 2UXCO 5BP7A 2FPMA 1Q1GA 4CM3A 1IBLO 2PIDA 4Q47A 4RLQA 2ZDIC 1E6WA 2X5XA 4X00A 2NMVA 5KJ1A 2H06A 2YC0A 3BD6A 3N5KA 3SYRA 1KAOA 1WHSA 4FQ8A 4EM6A 1ODJA 1DRJA 3E48A 4TV9B 1DTSA 3VYTB 4LOLA 1P6OA 2O8FB 4LK3A 4FYXA 2XJ9A 4EFDA 5LQAA 5ULLA 1KJZA 3F5FA 5B1SA 3ESZA 3TR5A 1M6VA 4NOKA 1FFCA 4I8DA 2FW6A 1Q81W 4L0DA 2WKPA 2FHSA 4N23A 2K6GA 4U7JA 5HF9A 1TKAA 4CGYA 3RYCA 4IXWA 4XRGA 5J1SB 4GKBA 2QTGA 3UM7A 5F3WB 3KSRA 4N0QA 3H7AA 1Z22A 2I33A 1SC9A 1C9KA 4PZCA 5HJ5A 3CZPA 3E9NA 1V55B 5BXYA 4BFWA 4EDFA 1C30B 3AUXA 2CGNA 3NXSA 4NZ9A 4XPIA 4COKA 1COZA 4CV2A 1I7NA 3R9XA 3I04A 1Z37A 1GRVA 3WNCA 3ZWVA 4UVBA 1O77A 1Z6ZA 4LXHA 2VAMA 3PX3A 5AT1A 4DLLA 4KPYA 1S3GA 4BBPA 5DO9A 5DHQA 1N0HA 4AW9A 3LDCA 4D4JA 1B04A 3A14A 2I3BA 1I0ZA 1MOFA 4MT8A 2W6CX 3AEIA 1KYQA 2PQ0A 4MXDA 3CKYA 2AE1A 3FWPA 4QPCA 3K5MA 3ZGVA 1XCMA 1SC3A 1D8AA 3BA8A 1FMJA 1FXWA 4JTDB 1L8AA 1NN5A 2OT3B 2XMPA 4OBWA 2VQEO 1F0KA 4NK4A 3WK4A 5CH8A 3HM9A 1K5QA 4TVKA 3U3OA 3AI2A 3BM5A 2RK3A 4A92A 1N7JA 1FZQA 3NRBA 3P0JA 2PO7A 5FLKA 3VX4A 2ZWAA 2JIZA 2HBRA 5KYWB 4N48A 4EI8A 1D2HA 4JL5A 2EULA 1Z2AA 2WWXA 4WA8A 4WN9A 1M1KW 1XU7A 1RWVA 3GEIA 2G3YA 2G40A 5G4KB 4QQKA 4KR9A 1S7GA 3HB1A 1OI3A 3QF4B 4P5PA 1K5HA 2L42A 3TRIA 1QZUA 2Q5QA 3OX3A 4UTXA 2XZOA 1ZOPA 1QR8A 3DSQA 2VI5A 1G7SA 3AIIA 3L7MA 4R2JA 5CNMA 2AW5A 2ZUDA 1Y8ZA 2XVXA 5ALHA 3MYRA 2XAHA 1WF6A 3GFGA 1FSSA 1EM1A 3SHQA 2GR9A 3LI2A 3AUJB 1XD8A 2HIGA 4W4KA 1BMQA 1QSGA 2X6RA 4MA5A 4PIPA 2FW7A 3R3VA 3WSVA 3W9YA 1HDEA 2GBOA 3OCCA 2IODA 4NMLA 1BS9A 1US8A 4P5DA 2OKGA 2VZ8A 5DNYB 3LBFA 3RFVA 1LF0A 2CFRA 1FYJA 4WOJA 2Z6QA 4I9QA 3DOHA 4S1WA 1M6NA 1RJFA 1VSQA 3OMIB 1JHQA 2RGCA 4HUQB 3PC4A 4KR0A 4HNTA 4Q34A 3I61A 1JFLA 2QLJA 3E27A 5FBVB 3MW8A 4C87A 2E6UX 3BRCA 1XRRA 3ZWXA 2VTKA 4TL6A 3OEEG 5AWFC 1RI4A 1KZ1A 3QWBA 2X7RB 2IH2A 1YE5A 1IG0A 1LBQA 1U2DC 4UDYX 3C6MA 5FL3A 3CE6A 4HQOA 3EGXB 4DBLC 1EZZA 4EF6A 4FMPA 2C97A 3AP3A 4CF4A 2XVYA 1J39A 3TLKA 5ELXA 3F74A 2R9IA 1E0SA 4XJVA 5JO9A 2FLKA 1NXPA 1V54B 1U8EA 3CN9A 3MILA 3R44A 3TX2A 4RQAA 4ESHA 3MJHA 1RC8A 2HV9A 2VZLA 1H9AA 4D79A 3CZ5A 1LX6A 1FXKB 3DG9A 2OZEA 2NVWA 3N86A 4FBMA 2FPKA 4QYTA 2C84A 3HCWA 2WP0A 4M37A 1IYZA 2QN2A 4LF8O 1TT5B 2GAAA 3QLUC 3SU8A 1VSBA 4CMEC 3EGWA 3INRA 3O8BA 3PQ7A 2QYTA 2V8OA 3FNGA 4CR7A 2YIBD 1B2RA 1G2IA 2VNAA 2IUSA 3K9AA 1GZ5A 5E1OA 1ULSA 1P4RA 1FEZA 1Q92A 2FZCA 2WV9A 3BIJA 4L7QA 5DYTA 4I4TB 3GFSA 4J7UA 1J07A 3TXSA 2XUIA 3SEQA 4ZI7B 3KB2A 3L8EA 4BWFB 3EIQA 4ZVUA 3AVQA 2ZYSA 1JAIA 3VTAA 3PQFA 3QG5A 3FMOB 3AF0A 2I3DA 4MUYA 3MMPA 5EZ6B 2H2WA 1YI8A 3T7JA 5ITZB 4WFKA 1RYZA 5TEWA 1RRFA 1AI7A 4UUBA 2IOFA 1S5HC 2VP4A 4TQDA 3GLVA 2JVDA 4E03A 2FZWA 1L5WA 1E6UA 1RKXA 4CCAA 4LWZA 3M1AA 3GVPA 1VJ0A 5H2FZ 2PD4A 3FFBA 1MVOA 1GU7A 4L75A 4GT1A 2CVFA 1I1NA 4QX6A 1E92A 4XSHA 1EN5A 1NTRA 4LSWA 3P3NA 4QXQA 1CC1S 5KLVH 1KB9F 3DBLA 3HZZA 4W1PA 4D3YA 5KPJA 4XUDA 3U5ZB 3L4BC 4WCFC 4ZMRA 3GRZA 1CY8A 4YVFA 4MR9A 5KREA 2WHQA 2P6OA 3B7PA 4UXIA 2XYGA 1ATIA 1DKNA 2G25A 2KG7B 4UV9A 2YC4C 3H2SA 1UPCA 1IVNA 3T7IA 3PNMA 4DLNA 3SBXA 1RBQA 4Y6LA 4MVWA 3VDQA 2X15A 3GLSA 2H2GA 3TXXA 2Y4NA 4MSUA 5KAPA 5CK5A 3P8ZA 4G27B 1YJ9V 4NXMO 3A9CA 4UOEA 2L18A 1OX7A 1JNYA 5LMCA 5LQKA 3LSYA 1A1VA 5EE0A 2VTBB 4JAAA 5DM6V 2A9VA 3L72H 2C20A 1D9XA 2OLKA 5BSEA 1QU3A 2Z4RA 1SVLA 3ZEFB 4GECA 2PSFA 3DDOA 4TRJA 4E32A 5JJLA 3AONB 3OPXA 4KFRA 2Q5FA 3BIOA 1C0EA 3CXCU 4QXRA 5JSQA 3KSBC 1XAGA 4N6NA 2I03A 3QI2A 1RLUA 4Q1BA 4PEVA 1XP8A 2PZ8A 4IGEA 4QECA 5EJMA 5CDFE 3RVLA 1BHAA 4U2KA 4DWVA 2Q99A 4YRJA 5FUBA 3T9CA 2QRPA 3OFKA 4FI3F 1SNYA 2HSEA 2WI8A 2XRMA 1C1DB 3FRHA 4KWEA 5I9BA 3V7WA 4QXAA 2Y71A 4S0XA 2VHCA 3H04A 4OGQB 2OESA 1DAPA 1OCZC 1OXXK 3GFOA 5CB6A 4JVSB 2ZSHA 5JS7A 1X19A 4LXQA 4Y2YA 1B76A 3HVIA 1PSWA 3QVXA 2A7QA 3ZKAA 5IKMA 1IJEA 5KYTA 1CE8A 2LGJA 2PA0A 4BCDA 4OX9O 2RHRA 2VYND 2WMNB 2YMPA 3AG3B 4CHGA 2ONYA 1PJQA 4QOEA 5M29A 3UOAB 1KP3A 4PS1A 1TEZA 2OXTA 1U80A 4YUYA 1L9KA 4OCMA 2DR2A 2G1AA 1A9QA 2CJXA 2VQ6A 1XRNA 2YXPX 4FGWA 4HDSB 3CNNA 2P41A 3OPVA 3FN4A 4F1KA 2R6GA 2RGYA 1TAEA 2UYGA 1TYCA 3C2QA 3NALA 3A0HZ 3OCQA 3WWZA 4JZGA 3C4VA 3UUWA 3AOEA 4PTYA 1VPLA 1QQ5A 4DCUA 3T9DA 3KQVA 5F4ZA 1DHTA 1Z28A 2C07A 2ZB3A 1YJAA 3KYBA 4L74A 1FNMA 3I37X 1C29B 3DDWA 3A06A 4DBVO 4D0SA 3W8DA 3K0CA 1VA4A 1W96A 2AYXA 2HK9A 1BDMA 3L0YA 4E7OA 2PL3A 1B16A 1NBIA 1W2WB 5K0FA 3UHPA 1IJBA 1UQRA 4J1QA 2OBFA 3AYXB 1V16A 3VPFA 1DWQA 3II6X 1LBIA 2AK3A 3D2LA 2X0LA 3DXXA 4X3OA 4F3RA 3DUWA 1SQFA 1SC1A 2ATXA 2EVWX 1JSLA 1HLFA 3IAAA 5B1HA 5LUAA 2ET6A 2HF2A 1ZIOA 4I0WB 3LQYA 5ECGC 5DMHA 3NHWA 1L4LA 1SHKA 4GUAA 3RIXA 3I56V 5C4IA 4D4HA 1ZUIA 4AJ9A 2R4TA 3PDCA 1CIPA 2HQ1A 3EEOA 2YYAA 4DW0A 6REQB 3L6CA 1XZMA 3RB8A 4BGEA 4F93B 1T29A 4ON9A 1OAAA 1Z6GA 1JKIA 4YT8A 3DE7X 2YUTA 5AW9A 4DB4A 3EIFA 2QXYA 3WGGA 2WIAA 3AT1A 5CW2A 4HGPA 3S3TA 3VH2A 1TZJA 1FUKA 1ZKDA 2WYHA 3E8HA 4JUBA 2IXBA 4EECA 4ALKA 1JR9A 4E5DA 2EBFX 2CT8A 2QRNA 1CR0A 2IELA 2CXPA 3SN6A 3HXOA 2LRHA 4IQFA 4RVNA 4I5IA 3R7FA 5EJ9A 1JEOA 5EUBA 2JBWA 4HAYA 3VU8A 3T9FA 3E0QA 3A6KA 2A1TS 1QS0A 2QR3A 4P7BA 1N5LA 1FLDA 4YQZA 1P18A 5GMOA 4U9IS 5FYQA 5HQ3B 4EJSA 5B5SA 3IRUA 4G8CA 1Z4LA 4FZ0A 3H1AA 4WEOA 1ZN2A 3NTOA 2I8LA 3M6UA 3R2JA 4U7HA 1J1UA 4N5MA 3IVMA 4G56A 3H4IA 2WPDG 2WJZB 1Q0QA 1Q0ZA 4K81B 3RFTA 4FDVA 4B3TO 4MAAA 1AZSC 4GOOD 4Q82A 1NOIA 4A73A 4GKKO 1VE7A 1O03A 2AQHA 4MW9A 2I1LA 4ZP1A 4GOND 4R2XA 4GXTA 5HDQA 3VBEA 5JTTA 4PGFA 2X4LA 2PWBA 4HDKA 4MVJE 1XAIA 5KTMA 1Y6FA 2VJLA 2FSSA 2E75B 3WBFA 3WBJA 2R7LA 3PUZA 4DIMA 3ZU4A 4HFMA 3CU5A 3PC6A 4R9SA 2M2IA 5IYCO 3ABMC 2EL7A 4WUVA 3S99A 1ZGZA 4Y6SA 2P6PA 3T1YO 1ZOIA 2VDWB 4RK5A 5A0TA 3AG3C 4Q4CA 3K94A 3KB1A 1U9YA 1E1MA 1M56B 1TRHA 2WWFA 5J23A 4U2GA 1ST2A 1WX1A 3HFRA 3V8EA 5BQPA 2WF8A 2NNWB 1F7VA 4C0LA 4HB2A 3VZQA 5LMZA 1NASA 5CXQA 1YZHA 1BE8A 3UENA 2GRJA 4UM5A 3NP7A 3DMGA 2FK7A 5A3JA 4L87A 4ZRDA 1JTVA 3W3AH 5MF6A 4OXXA 3SEFA 3I09A 1L7VC 3TECE 3Q9SA 4N49A 3FNIA 5TS2A 1Y48E 2W22A 1MHTA 1NJFA 3CLRC 3J7AU 2JIPA 5ES4B 3IQGX 1EVQA 3KVRA 3M2PA 5KINB 1GXSA 2QEQA 4BLTA 2AQIA 4A6XA 1USIA 2EWVA 4HJXA 3IIJA 4PC7A 2MSNA 2ASVA 4R98A 4M0FA 2W2XA 1SQ6A 2A0KA 3N2GB 1U0RA 3FROA 5I4IA 1BAPA 1U0TA 4ND5A 2W2NA 4B7UA 3MDSA 2IYRA 3N05A 1PNRA 3MHSC 3D6FA 3ZQJA 4TWRA 4RCVA 5M52C 1DELA 1SERA 3SYQA 1W9HA 1N2SA 2WW8A 3FDZA 2I2WA 2PFSA 4ZIRA 2JCGA 1Z06A 2RJNA 1E6CA 3AVWA 2ZDIA 2DWOA 3LRPA 1RZRD 3KEQA 4FMBB 5FBLB 1Q82W 3F4LA 3ESRA 1U9ZA 2WMOB 3ECCA 3OPYA 2R48A 3QU4A 2VT6A 4I19A 1EIWA 4S12A 3EXAA 3IPYA 1QHEA 3CCBA 2LBPA 1MB4A 1TEXA 5K2MA 1SF9A 3HCRA 5DM2A 2H8GA 2VBCA 1D2AA 3V00A 1NJ8A 4HQNA 3KJEA 5AKXA 4H37A 2YOFA 2IOQA 4GYJA 2NW6A 5AO9A 1H5UA 3U31A 5JPCA 3WU2Z 3USCS 3ZCRA 4DEVA 2CL7X 3WDSA 1QF9A 4MQ5A 4FCCA 2O9JA 3AB8A 4IQ4A 1K3EA 2CTWA 3B53X 3ACBA 4J07A 5DN6D 4QTUB 1ULZA 1QHGA 2C77A 2X9VA 2ZBGA 3L7KA 5EYPA 2MSDB 3WRYA 1I5EA 1XE3A 4JDUA 5L7YA 2NO9A 3AY6A 3B1JA 3EFBA 3H5VA 4XRRA 2XB9A 3FAVB 4J80A 2XODA 1XVTA 2X1LA 5A3VA 3BQNB 3W9SA 1KFEB 1F14A 4OI1A 1G3IA 1PQ4A 3AW8A 4NFHA 4WD3A 2WD7B 4YHHO 3PHBE 5KEIA 3ZWKA 2JJ1A 3ED5A 3V4FA 5E6UA 5IRCD 1TUIA 4RHTA 4CKXA 3HB5X 4EABA 3IEMA 2HMYB 1V1MA 1XSEA 4LA4A 4G01B 2FPRA 5B3SC 1CBUA 3CA8A 1T1SA 3HPLC 1IY9A 4IILA 1KYIA 4AQDA 3K6RA 1G8MA 2WLIB 5IE9A 3LW8A 2HIHA 5DNAA 2YICA 4BWYA 1S76D 3GFPA 4D92A 1EUYA 2IHNA 1BWPA 1DRUA 4ARCA 3X1KA 3D7SA 3W9UA 3LY7A 1FFWA 4B8YA 2JH3A 4HWSA 5GY7A 2IX9A 5B7GA 4MV5A 3L0BA 1AGYA 1E4VA 2ZWVA 2JI7A 3C8UA 2DKFA 3NATA 3U81A 2CDNA 3W5UA 4E1VA 4BLPA 4BRSA 2VP3A 1NE2A 2QENA 2C9BA 1Z4JA 4L15A 4MVJI 3ROZA 4F04A 5HP4A 1G8SA 4IHAA 3V4RA 1VBMA 4OQMA 2ZIXB 2D7DA 3PEFA 3G8QA 3X3HA 4W5JA 1YR2A 1TJYA 2BKLA 2FVYA 3EGOA 1EGMB 1ZRHA 5AXDA 1EAYA 3IXQA 3VPAA 4O2RA 1XNGA 4YRDA 4JC5A 3WP1B 4NONA 1SOVA 3AWDA 1ETUA 4AP6A 4AYXA 4U7GA 1N77A 3EG5A 4K8XA 1CUFA 1EN4A 3V4LA 4A0SA 1Z4OA 3ADPA 4LCNA 1QQ7A 5JCXA 4X1IA 4BVGA 2PLFA 3H0CA 1M6HA 1RDFA 4LF6B 1V4NA 1UJNA 6YASA 2RK6A 3SYLA 4F5WA 1T3TA 4FW9A 5EPUA 5G41A 1UKVY 2Y9PB 3Q7RA 5K3BA 2RH5A 2GAJA 1FRVA 1GD1O 1FS4A 4DZRA 2GRAA 4UJ5A 3U1VA 4A91A 4LQLA 3CPWU 3HV2A 3ZD6A 4LJSA 1E3MA 1NUUA 3RW0A 5EKSA 1JG1A 2JFVA 4RM2A 1UBLS 1EHIA 3KB6A 1MAAA 1R5OA 1KI4A 2M1ZA 2Q0HA 1U2SA 4WK6A 2BONA 2GD2A 5DP2A 4AKHA 2MU1A 3IBFA 5JQGA 3FNQA 5M2QA 2FZKA 1I2CA 3EZ9A 4KN9S 2QV0A 2ZIXA 2OB1A 3HDQA 4UUNA 2VSNA 1IZZA 2G1UA 2X42A 4DR7B 1V5FA 1SCJA 1ZHFA 2PG3A 2Q3BA 3A6HA 3ZY2A 1X94A 4D3DA 1TK9A 1L5HB 2QXUA 1DXOA 1WD5A 1J20A 2X6QA 2CUTA 3C6BA 2R8ZA 3OPYI 2P30A 4CHTA 3PFWO 3GYGA 3TTSA 1GAEO 1UBSB 4CMEA 2XNJA 3JR3A 3KR0A 1VLVA 1MGOA 3LJKA 2I4RA 1YGYA 2JGFA 3KDSE 1GGMA 5AMXA 5JC1A 2VDJA 1MPTA 4QOHA 5KNCH 2A3NA 2ZXEA 1RPTA 1LS1A 2AKYA 3I9V1 2XIJA 4TLEA 3SD7A 1M66A 1TIYA 4WNAA 1LI5A 2F90A 4IIDA 1J21A 3SF8B 2ZSKA 4IKOA 3ANYB 1CXZA 1FFBA 1I14A 2LQTA 3QPDA 4IAOA 5FTWA 1QH1A 2W0SA 2AJDA 3CH5A 3EVGA 1KVRA 1SUEA 3ZOKA 3ZX5A 4BQEA 3IP1A 3L8GA 2D1YA 3D0OA 3KKQA 5LQDA 1BZYA 2A5FA 2FPIA 3P9CA 4S0ZA 3LDGA 4U7OA 2PS9A 3HFSA 4E22A 1XD2B 2RI0A 1C8LA 3DT6A 4RHFA 1EZJA 1PE0A 3SLGA 4AZVA 4W5NA 2A9PA 2I5PO 3E1UA 2VNIA 1YZLA 4X41A 4DC9A 4F2DA 3DFFA 1P1KA 4O4HF 2VFAA 3RTEA 1JR3A 2R7AA 2SNIE 3RVQA 5I7AA 1PL4A 1NJSA 1GZVA 1U7DA 4EB0A 4R1QA 2ZS8A 2LGQA 2MSCB 3TZBA 2F1JA 5KDLA 3IT2A 4G0ZA 3SKYA 5JECA 2IZ6A 1RPZA 1E7SA 1CUHA 4PG7A 3K03A 2WLMA 2X7JA 2OA0A 4O4HA 1WY7A 1KOGA 4U9UA 3M5DA 1U9JA 1T2FA 2V97A 3DWFA 1DC6A 4PAMA 1V1JA 2AVNA 3A9RA 3HUUA 5JJBA 3QE4A 4LHYA 2DB3A 3FKQA 3CG4A 4JI3O 1DQRA 2VRCD 3TVTA 2I65A 3G0DA 1P17A 1PFQA 3LT5A 4JQZA 3AKEA 4WK4B 5BV8A 5CBPA 1WLYA 4JUCA 2XW6A 4UHFA 4EI2A 2HJWA 2BF7A 2L17A 3KQWA 3WO1A 1RD4A 4NZOA 3Q41A 4FFSA 4R7TA 2C9DA 5JADA 3G71V 1N6KA 3ZW7A 4DPMA 2XCTB 2C2HA 3HLYA 3HV0A 3CP1A 3QU2A 4OLJA 3B6EA 3FJOA 3I6ZA 1JAXA 3LU1A 2NYVA 4PPFA 3RYHA 2A5YB 1I9GA 1PZMA 3Q2IA 5CA0B 4B3RO 1E4OA 3WIEA 5F7XA 3STZC 1LW6E 2OVFA 4C2BA 2G88A 4JB0A 4ER3A 3BJEA 2FCRA 4R50A 2HWUA 2CNOA 2W6ZA 2QZZA 3MWJA 3BH1A 3KOWA 4C22A 5BNTA 3O91A 4JS0A 3O4FA 5A3SA 1ESDA 3RYIA 3N59A 3B1FA 4N1AA 4NV0A 2KLBA 2VHVA 4F3TA 1T3ZA 5DBFA 2VRNA 3ESCA 4DCSA 1NRWA 2ZAGA 1WV1A 1VK9A 1KOFA 5JJEB 2QP4A