1OCCB

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
total genus 61
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1occB02
2E86A 3GXUB 1OCZB 1N70A 1RZQA 2HXAA 3T71A 1BYPA 2FQFA 4HHGA 3T6ZA 2BP8A 3UGEA 2YEVB 4DP5X 5A7EA 3KW7A 1NIAA 2YQBA 3OMNB 1AANA 4A68A 2GBAA 2YAMA 2B08A 4HALA 1FFTB 4A2HA 3NP3A 2TSAA 3X1EA 2IDUA 1JZEA 2EILB 1XB8A 3ZBMA 3NT0A 4W9ZA 4YSTA 3EH3B 4DPAX 2FJSA 5AFAA 4ZK8A 5I5IA 2BO0A 2BP0A 3NJMA 2VW6A 3UABA 1GS8A 1A8ZA 2ZXWB 2HX8A 1ILUA 4QLWA 4KNSA 1M9WA 1JZFA 3FSAA 1A4AA 2XV3A 5EHFA 1GS6X 1UATA 3GYRA 1JVOA 3NSCA 3WI9A 4AKOA 3S8GB 4E9XA 1A3ZA 1V10A 5B7FA 2DWTA 3NYKA 4BXSV 5B7EA 1ID2A 5I6NA 2UX6A 2HRGA 2VSMB 1B3IA 2XXFA 3QJTB 2CAKA 1JZIA 2XV0A 4NERA 1KBWA 1SHXA 4YSSA 2FTAA 1HAWA 2IWEA 4EF3A 2PP7A 3PAZA 4DP2X 2H5UA 1IBZA 1CYWA 1QNIA 4WKXA 3WNJA 4NB7A 1URIA 2PCYA 4FAAB 3SBPA 1SDDB 2RACA 1DYZA 2ZOOA 1J9TA 2OJ1A 1N68A 1ET8A 1KDIA 3BVDB 4KO9A 2XXGA 2CCWA 4RH4A 4E9VA 5B1BB 3CG8A 3SQRA 3UADA 1AZBA 1E5ZA 2PP9A 2GSMB 1XB6A 3NJGA 3CZUB 2FQGA 3FS9A 3ASNB 1L9QA 2VN3A 1ZPUA 1IKOP 4GP5B 2IWFA 1BQKA 1IC0A 4JHUA 1WS8A 4AKQA 3U25A 3FT0A 1R1CA 2FQDA 3QJUB 3X1BA 3SBQA 4DP8X 4A2FA 1SF3A 1J9QA 1PY0A 2GB2A 4DP0X 3TBBA 2Q5BA 3QJVB 1OCCB 1JVLA 3UACA 4CSPA 1A4CA 4E9SA 1ASPA 1FA4A 1NICA 1DZ0A 4E9RA 2AZUA 1L9TA 4KOBA 1J5DA 2A3TA 4YSOA 3FU8A 3L45A 3WNIA 3C75A 2PPFA 2QDWA 1NZRA 3AZUA 2IDSA 1W6WA 4YL4A 1AZUA 1OF0A 4CSZA 2IWKA 2N0MA 3EH5B 1JXDA 4E9TA 2J55A 1JZHA 3JT2A 2I85A 2VW7A 1ZIBA 3ZX1A 1J5CA 3CVBA 4QKTA 3FU9A 4PCYA 3FU7B 4HZ1A 3IBOA 2IH8A 5D4HA 4JKNA 3DIVA 3IN0A 1NWPA 2ZWNA 1AS6A 1E67A 4P5SA 3OMIB 1CYXA 4DP9X 4P5RA 1PZAA 5AKRA 3FPYA 3TASA 2YAFA 5I6PA 1SDDA 1HAUA 2YARA 3OM3B 1OE1A 3OD3A 5B3SB 4GP4B 1L9SA 1BAWA 2J56A 2PLTA 4YVNA 1E5YA 2XU9A 4G7QB 1AG6A 4FA7B 6PCYA 2HX7A 3MBWB 1AR1B 2HX9A 4DPBX 2FNWA 3FSWA 3FSZA 3N55A 2DY2A 1V55B 3HEIB 3PLYA 2CBPA 1NIBA 4HIPA 2IAAC 2XLLA 2EIMB 2PPDA 2PPCA 2IDQA 2ZONA 3ZDWA 1W6LA 3DKHA 3UAEA 5I6OA 3IN2A 2CJ3A 4DP4X 3IEAA 4NAJA 1PLCA 2DWSA 4K9JA 3IE9A 1AQ8A 2CUAA 2I7OA 1ILSA 4G70B 1NDTA 1GS7A 5B1JC 1I53A 1AS7A 1WA1X 2H3XC 4A2EA 3MX0B 5AZUA 3WKQA 4GYBA 1RKRA 1ET5A 1NIDA 1NINA 2R7EB 2BZCA 4N4YB 4BWTA 1RZPA 3TA4D 2UXGA 3WIAA 3NJFA 2NRDA 2YXWA 1NPJA 3FYEB 1OOWA 3UAAA 3CDZB 5F7AA 2HRHA 1CC3A 1TEGA 2UXTA 1YLBB 4GXFA 1PNDA 3S3DB 3G5WA 1AG0A 1GW0A 1PLBA 3FU7A 3X1FA 4G71B 1OE2A 2FT8A 4AZUA 2VSKB 2PPAA 1GR7A 2H47C 4PAZA 1AZRA 2PCFA 3T6XA 2BWIA 3PXLA 3ABLB 2MTAA 4A2GA 3TU6A 1AZNA 1WAEA 8PAZA 1V54B 4BWUA 4F2FA 1F56A 4YSCA 1MG3C 3AY2A 5I6KA 2IH9A 3JTBA 4Q89A 1EZLA 3QQXA 4BDVB 3X1NA 2GC7C 4AI7A 2OCCB 3AG4B 1SNRA 2LLNA 1PZBA 1AZCA 3ASOB 1OCOB 1ZDQA 1MDAA 2QPEB 2P80A 5I26A 3T6WA 5B7MA 1X9UA 2XV2A 2YAHA 4MFHA 3V9EA 4A66A 5IY5B 4E9WA 4DP7X 4DPCX 2HZHA 7PCYA 1MG2C 4UANA 2J57A 2Q9OA 2OV0A 1KGYE 3ABMB 2QPDB 4DP6X 4TXVB 5TK2A 3S8FB 4KNTA 3WG7B 1ET7A 1E65A 2UXFA 1KYAA 3NSDA 2JKWA 1XMEB 3KW8A 3EHBB 1T5KA 1HFUA 1MZZA 2EIJB 2DYRB 2TSBA 3D12B 4A2DA 2QT6A 2R7EA 2WO3B 2XVBA 4KO6A 3ABKB 3BQVA 3FYIB 1JXGA 3ERXA 5FC9A 1NIEA 4KOCA 3FPXA 5PCYA 1AOZA 3NJKA 4YSDA 5I5MA 1J9RA 1QLEB 3CDZA 4HCIA 2HLEB 2CALA 3ZIYA 4F2EA 2VMJA 3V9CA 4Q8BA 2XWZA 2GIMA 3NJJA 5TK4A 3RYMA 1IUZA 1TU2A 1SFHA 2VM3A 4YSRA 3NJLA 1TEFA 5I5JA 1SF5A 4HCFA 2FWLB 1ZIAA 4HCGA 1KCBA 3S3CB 1TKWA 3FQ1A 4AKPA 2AVFA 1L9RA 4M4RB 1KBVA 3OQRA 1BYOA 1GY1A 5I6LA 3H56A 4WTQA 4KNUA 1M56B 2PPEA 4BDVA 1X9RA 4JHVA 2BW4A 3S3BB 2AZAA 3QJQB 4YSQA 1AACA 2P80D 1SFDA 1JERA 1FWXA 4BXVA 2FT6A 1JZJA 3PCYA 3CVDA 2J5WA 3NSYA 5B1KA 3SBRA 1GSKA 1A65A 2AFNA 5F7BA 1ZDSA 2XX1A 3QPKA 2EIKB 1SHWA 4M3HA 3EF4A 1SJMA 1NPNA 2X87A 2X88A 1IBYA 4A67A 2DV6A 4YVUA 1AAJA 2UXVA 5D4IA 3NJHA 4GY4A 5I28A 2JXMA 7PAZA 2XX0A 1BQ5A 3WKPA 2GI0A 4HAKA 4YSEA 2XYBA 1JZGA 1ZV2A 4W1TA 2BWDA 3NP4A 1OCRB 3FQ2A 3HB3B 3T6VA 2IDFA 2YAPA 4X4KA 1ASOA 1GYCA 2WSDA 3EH4B 4BWWA 4KO5A 1BXUA 1BXVA 2PP8A 3FQYA 2IDTA 1M57B 4E9YA 3NSFA 5PAZA 1PZCA 1PLAA 2XUWA 2YXVA 2FQEA 1PAZA 1BXAA 1J9SA 3H4HA 1WS7A 1QHQA 1E30A 1KCWA 2BP8B 1VLXA 4YSAA 4N8UA 3X2QB 2WO2B 4G7SB 2Y69B 2W88A 3FSVA 4ENZA 1GY2A 3N2JA 4AX3A 1ETJA 1L9PA 1BEXA 2VM4A 1PMYA 3AG2B 3T9WA 5LDUA 3ABGA 3PAUA 4YSPA 1PNCA 1NWOA 1A4BA 1OV8A 4UF7C 1PCSA 1KDJA 3X1GA 1EHKB 2DYSB 1WA2X 5ANHA 3TBCA 1JXFA 3AG1B 5B1AB 1JOIA 3AG3B 2B3IA 2YAQA 2BP0B 5D4JA 2BW5A 2I7SA 2QDVA 4G72B 1CUOA 4HHWA 1ASQA 3QJRB 2GHZA 1NIFA 2GC4C 1AIZA 2BHFA 2UX7A 5I6MA 3NJNA 4DP1X 1PF3A 1KV7A 6PAZA 2BZ7A 3AW5A 4L0PB 4E9QA 4BK5C 2YAOA 2W8CA 2YAEA 2FT7A 4YSUA 3PPSA 3CVCA 2MRYA 1BQRA 4GP8B 1CURA 1MZYA 3DTUB 2EINB 1W8EA 1AS8A 2Y1AA 1NTDA 5E9NA 9PCYA 3PAVA 1XB3A 3QJSB 1L9OA 4F7KA 3NJIA 5B1JA 1OE3A 2JFCA 2VW4A 3H4FA 4UAHA 1WA0X 1ADWA 1RCYA 4KO7A 3OMAB 2AANA 4G7RB 3GDCA
chains in the Genus database with same CATH superfamily
3ETGA 1DLHA 1V7NL 3RI5K 3WTTA 4MCNA 5F1KC 1E4KC 5E2VL 4YHYC 4UOZA 4BHUI 4X1KB 3HHMA 3B5HA 1I94O 4M8VA 4NR1A 4CS3A 1YCSA 2GBTA 2YUZA 3FU3A 3MACL 4FZ8H 4IIJA 4BR6A 4JO2L 3S2CA 3CMOL 3SKOA 3U1QA 5KLVH 3ZRFC 4FZEL 4JAMA 4M43H 2ZOUA 2D3OW 2B2XL 4JPKL 4PBDA 3HI5L 4F7PA 2AV1B 4HV8A 4TUOB 3T8VA 1U3JA 3V52H 5B39B 4P48A 4P2RB 4OZIE 1FHGA 4JHAH 2XG4A 2P8LA 5I1AB 4KH9A 3RWEB 1JVKA 3TWCH 3K2UL 5F3FA 1CGWA 2EEXA 2WD0A 2HP8A 1UWXH 5L7XL 3B2MA 3FQWA 4JM2A 4XMVA 4X4ME 1QATA 1Y7VA 2V9QA 1QLNA 2PYFA 3MRMB 4HUVB 3BVWA 3DUSB 3UABA 3T3PB 5IJ9B 4JDTH 4YH6A 3H9SA 3ETTA 1U3HD 4FFZA 3S96B 3FU0A 1FJ1B 3GYRA 4UNTA 2C1PA 2PWGA 3WI9A 1N3NB 4WHCA 2F8IA 1O5DT 1V10A 3QEUA 3OKYA 3K7UA 4O02A 4P9OA 1A2YB 3BCDA 3QUZA 4NN6C 3VCLA 3HKDB 1XGQA 5DI8A 5T3XE 4DV4O 4YN3A 5DJ2B 2YPVH 4HDIA 1M6OB 5ANME 1UM5L 4L05A 1KB5L 4P2OA 3GSUB 3AG2C 3GM0A 1JPST 4NCDA 4PRPE 4DTGH 4ZBMA 2H1XA 2NT0A 1N0NA 3N2GA 5JJJB 4UNUA 3NCJH 5CJXC 1CYWA 1QNIA 2ODMA 5BQDA 4XXDA 2ISDA 2ZG3A 5JXEC 4XMKH 3LKRB 3ZT6A 1EBOA 1UD3A 3T0BA 5EIIA 1NMAH 1G6UA 3MUZ1 4MMZB 4M1DL 5DA4A 4YJ2A 3IJHA 4EEEA 4PLNC 1ET8A 4OZFH 4L18A 2CCWA 2VRAA 3ZHRA 4E9VA 3MRPA 2D0FA 2MNUA 3HZMB 1QYGL 4ZDHB 1CDYA 5KBPA 4NQEB 5FA4A 3CSXA 2JKJA 4Z18A 1VGKA 4LEXL 1QLEC 5IIEA 3GUTB 1ACZA 4JHZA 4X66O 1EANA 1OM3L 4UI2A 4FLWA 4YX2H 2GK0A 5T1LD 3OZKA 4JI0B 3RWRD 1KF9B 1BFVL 2R2EA 4KI1A 3TO4D 4YXWG 3TYGH 5KVEH 3L54A 3T65A 3VQLA 2B5IB 1CU4L 2W0FA 2JK5B 2YMOA 5MEOB 3BISA 2B59A 2B39A 3KCWA 3PGFL 2JIXB 4HUUB 3ARWA 1F1GA 3LH2H 4RLDA 1R75A 1L0NH 2X53A 4TVPD 4JFYA 3MGAA 4QNPF 3FU8A 5JUEH 3H7BA 3KCPB 2HJFA 2LOEA 3DJZA 2X4QB 3EGXA 1FZOA 2VZOA 4WFAV 4YGAB 7FABH 3S35X 1IBKB 3EH5B 2ORBH 1CGVA 1NDMB 5D1XA 4ENED 3ZE1B 3N1MC 5E6UB 3JV0A 5DEGA 3ECQA 2GSGB 1SM3H 4UU9B 4K94C 4OGQC 1W15A 1BJ8A 2B16A 3E0GA 3KPQB 4Y19E 2XTSA 1OSPH 3F84A 1EHLH 4FMTA 4LPYA 2PI5A 4PJDF 4XPTL 1Q43A 4MDJA 2QTSA 2J71A 2XA3A 5FO8A 2V9TA 2WIIB 1I1YB 2G9HB 4OM0L 3JCZA 4U7MA 1AS6A 4N2BA 1OAQL 1YY8A 1IBHA 5IMKB 5IQ7H 2XTLA 2OULB 2ZUSA 4P5RA 4ONFH 5GHWH 2IWGA 3TASA 4FDWA 5KZCD 3IJYB 3L4VA 4B0MB 1MZEA 2F1EA 1SXZA 1G1YA 1LO5A 3ZE2F 3RDTC 4GP4B 1MCLA 4R2GC 5E79Z 2F54D 4F7EA 3PWPE 1UT9A 4H8WC 5EV7A 5CA0A 4R7DA 5EU4B 2XY1A 4GI9A 4R4BA 5CCKH 2VJ8A 2VLKB 2HX7A 4KNQA 2MMXA 3G5YA 3B9EA 4OJEH 3CFCL 4YY3O 1G0YR 1R5VB 4MAYC 2D03L 2N1KA 1NMBH 1XL4A 3UIZA 3CFBB 1A64A 2VDMB 2IDQA 1KGCE 5KJRH 1GKOA 4L23A 4UILL 5T3ZE 3D3QA 2DH2A 1WZ1H 3MODL 5CHNA 1V7MH 2R4SH 3BPOC 2ITDB 4OZ4B 1PP9H 1ZA3A 2HFGH 1B9ZA 3G5ZB 3ALXA 1LEIB 2VDOB 4GQZA 2A1WL 2EICA 4JZOA 1YUHA 2P44B 1JR9A 5TDNB 4JYAB 2Q87A 5I1HL 3TF4A 4NRYB 3TA4D 3MXWH 4QYOA 2W60B 3VO0A 4Z8FH 1FPTH 3MV01 2GK2A 2X10A 4NC1E 1P84K 3CDZB 5D7IA 2A74B 3RN4A 4Q58C 1AJ7H 4FMVA 4HP5A 4DR5O 3UTZB 3U2JA 4DO4A 5L6YL 1NC4D 1NKGA 1QBAA 4YHLL 3R1GL 3DURA 2CIIA 4MVZA 5IE9A 1AO7E 2XT1B 5MI0B 1VMGA 4PJ8B 2JS3A 2HP4A 3QIBB 5JIMA 2YGNA 4BW5A 1GPOL 1OB1B 4FP8H 2N0KA 1WN7A 1AZRA 4HJJL 4A2GA 3OW2U 1I8IB 2WXMA 1JPTH 2DW4A 4HLJA 4FABH 1H8HG 2L8AA 4PBVC 4DUXA 4JM2C 3HHRB 4RA0C 4J39A 3GSNH 2BVQA 2GJ6D 2JGDB 3M7OA 4LIQH 4P2RE 1JNHB 4YE4H 5KYUB 2AAAA 3FO2A 3P9LA 1BQHG 3ZDYF 1SNRA 4TV8B 3I2CH 4TVPL 4CL7A 2FIKA 2JDIG 4ZG1A 3OHXB 1IX9A 5IHZB 4MNQD 4E41A 3HNVL 2BVTA 5HI3D 4LF7B 4HWEL 5I26A 3FFDB 3DJ9A 4XOAA 1XXDC 2H3NA 2VLME 1FFOA 2APSA 1VZIA 3EDEA 4AQAB 3L4YA 4OI8A 3QUZC 3T3PE 1O5PA 4GBXA 4OD1H 1NLDL 2X0LA 4PR5A 3T2OA 4YXLH 1NCIA 1U8HA 4P2OC 4AW4A 3RYHA 2B7DT 4GI6A 2XWJA 3UC0H 3Q9PA 3OL2A 3OXSB 5IUSA 3DO7A 3CCUV 1RULL 3GSVA 1QSEB 1UXSB 1XDCA 3G5VB 3TEXA 4YAQB 1N18A 3WG7B 4KNTA 3S8FB 4LOVA 2YLHA 5E56A 3K9SA 5FUZH 1E65A 5IHHA 3ALPA 4LLDB 4OZHE 3SGDH 3TTYA 1HFUA 4S1SL 1JTPA 2TSBA 2JF1A 2QT6A 4YQXH 4R96B 2F7QA 5KSBA 3PHSA 4J3OH 3SO3B 1ZCRA 1Q5OA 4XAWH 2WYZA 2B1IA 2C4XA 2KDGA 5MHSD 1B0IA 1OAUL 4YSDA 3EXJA 2XFXA 4A1RA 1G7IB 5E0QA 5A2BA 5D1ZA 1BVKA 3VU1A 2R83A 3VXSA 1J12A 1S7TA 3E8FA 4BFBD 1X4ZA 4TNEA 1JWUB 2NNAB 1YY9D 3WFVA 3B9KB 3EUDA 1YJ9V 4G6AD 2G5BA 4PA7A 2X7LB 1KIUB 1G6RA 2BNQA 4JLRA 1BD2D 4YXKH 2W0FC 2W5PA 3FF7A 4W9GC 5BV7H 1KBHA 5GZOD 2HVJB 1K92A 4HCGA 5AD0A 2QQNL 2Z92A 1TKWA 3VM5A 4WU5B 4G59C 2CCLA 1WVZA 2P4KA 4OLVL 4TN9A 2YXLA 4FKKA 4YDLC 1HH9B 3ARGA 3H56A 4DW0A 1AQDB 3HBQA 4H25B 3L4ZA 4CSSA 5EOQL 4Z95H 2HJFC 3ML9A 3RYCB 3V5KA 2CMRL 3NJXA 3FT4A 2DIAA 4MZ3A 4YHKL 2OTJV 2IIJA 4UBDD 4XN1A 1TGOA 5EBWA 3PF2A 2UUAB 4BQ8A 1Z2KA 3MYJA 4FQIL 5KX5A 3F62A 4LMQI 5DJCB 5C93A 1TG8A 3QUXB 1GGUA 4R7LA 4ZX5A 5D1XC 4FKHA 4DK6A 3W7WA 4NKDB 5FHBL 3WEXB 5J2UA 3VW3L 5ISZD 3BVVA 4LF3B 1E6JL 1JZJA 2DKMA 1HXMA 4U1LA 4EJ1C 2W59A 1OW0A 5IHUL 1K6QL 2NW2B 1YSCA 2Y1ZA 2HJLA 1TTGA 2BCKB 3UKMA 3GLAA 5B1KA 3W9DA 4BZYA 2V2TA 3IFOA 1JHLL 1QBBA 1U8QA 1INEL 3QFJA 1I1AB 4KAQL 5D7JD 5G4MA 3ZE1E 4ZXBA 4LLMB 3NQKA 1J0YA 1AHMA 4U2YA 3IDNB 2VR8A 4D9LL 1PS3A 4CC5A 2BHUA 1FGNH 5EOTA 3ZHDA 3OVUB 3QNXA 4BBWA 1C12A 4XGZB 4Z78A 2CRYA 4KTYA 3BAEH 4R50A 4UWQB 3NGBB 1V54C 3U9PL 3VJ6B 2BTQB 2QKAA 4MD5A 4ZFGL 3NSXA 3SJBC 1SEQL 4GY4A 4AE0A 2G5UA 4CNIB 3SE8H 2PABA 1CR9L 3SCMB 1BMWA 3GB7B 4NKIH 2V3DA 1OTTD 1UWXK 3QXVA 4EDWH 1BQLL 2RALA 3DRTA 4ZD3H 4HSCX 3OXRB 1NUFA 1JGVH 3U7WH 4KI5E 1RIHL 3LKNB 5FLVA 2BHZA 4WI0A 4FNSA 3H9ZA 1KJVB 2AK4A 1SQFA 3IU4H 4C57C 4L3EB 1GGBH 4E9YA 2WAQA 1AXTH 1D5XA 4HK0B 1FNEA 2GTZB 1MJJA 3KCXA 4TV9B 1CVRA 1EJ8A 1BS3A 4PJXB 5EC1A 5A16B 1GGCH 4Z3IA 1DE4B 2VH5L 4QPEA 3AK2A 1K5NB 5EU5A 1I3VA 4EI5A 4U0RB 1HWHB 3T1FA 4HQQL 3EHBC 1DQLL 3B2VL 3BRCA 1H3UA 1Q9LA 1J5EB 3CXDH 3L5WB 4X9IA 5E5MB 2R56L 4ELMF 1R4XA 3UFIA 4I7ZB 1D9KD 2YEVA 1BEXA 2WUBH 3QIUD 1MFUA 3LIZH 2ODIA 1F6FB 5CD5C 5F89B 2X4NA 1OV8A 4F6EA 3ZTNH 3WEBA 1I9IH 1GGYA 3G67A 3KYMB 3ZVVA 2C1OA 4P9HC 4PDMA 4H8HA 4OGZA 3T1CA 5I2IA 5I1IL 4HOWA 3RG1C 1N6VA 5KJ7E 4HYOA 4TUYA 1E4JA 2IAMD 2YMTA 1WA2X 1RK0B 3CH8A 3J07A 2PNDA 3KPSA 2OR8A 1AR5A 3AG1B 2RQ6A 2DL9A 4HU8A 3WN5A 1TZIB 4JI1O 1DN0A 1KBGH 3ZIAG 1QQDA 1T20B 2BP0B 3K4ZA 3NCMA 4NQSA 5F7KC 4TUUA 4HKBA 2PR4H 4HX1B 4KKNA 4Z7OF 1CUOA 1G87A 2BMKB 3C90A 1UH4A 5B3SC 3B56A 3ZE0F 1KB9F 2HHHB 5D7EA 5TE4H 3TC9A 1PF3A 4PJHA 2H8PB 1ONQA 4PWFA 1IL1B 2XAQA 1LXMA 2YAEA 3CHPA 1SY6L 4FLOA 3BP5A 4KVNH 5BUPA 5C0NC 1VZGA 4HJSA 5KBMA 5DZLA 1T4KA 3HN3A 1UHVA 4FQQB 5E2TH 3HMXA 4GBXC 1KJ2A 3P0YL 5EEYA 1UB6B 4FXLA 3V6OE 4DZ8B 3MFGB 3QNYA 4LFCB 3DK2A 4K3DH 1TVBB 4XPAL 4X2UA 2XKUA 2CDGB 4Y1AD 1C7TA 1ZVHA 2VIRA 3VXMB 5IJKA 4WUUD 5TF1L 4RRPG 2AI0L 4NJAH 5HHMD 5CSZA 1BVZA 4G6ML 4JJ5A 2EIKC 3CH1A 4WU7B 4IKNA 1H9DA 1AI1L 2NX5B 3EYVB 4HHGA 3QR2A 1LQSR 3LNMB 3K8MA 2HFEA 3DC5A 4KKAD 4UM9B 3VFSA 3HR5A 4ZPVB 2CO7B 2JKIS 5D1ZC 1UJ3A 1NGXB 2VLJD 1KTRL 1Q9KA 3TYFA 3B2EE 1ZT4A 5CNHA 4A2HA 2EEAA 5KVDE 1PCXA 3OBAA 5MERB 4FJCC 1MFNA 3QWRD 2YPKB 1AD9B 3IMRA 1HQRB 2J20A 1MHHA 4ABMA 4NZ8A 5I0DA 1U8IB 4UV8A 1F3DJ 1KC5L 1LO3H 2FGWH 3EFDL 2XNAB 3VA2C 2YZ8A 4EOWH 2WXRA 3KG2A 5ICYA 4EVNA 1BMZA 2BC4B 3ARGC 4QJ4B 2QM7A 5I1JH 4WSKA 4NXMO 4L4VD 5L3CA 4HUWA 1KYFA 4GAJL 3FJTA 2FR4A 1XBLA 1E3FA 5EBWC 3QUGA 3SGEI 1UATA 3KPTA 1L6PA 4AEHH 2YBRB 1HR0O 3LQAL 1RPQA 4PRHD 4PJBA 1ZLSL 4E9XA 4JRXD 2DWTA 3SYOA 2CLZB 2X9XA 3L08A 4X4XB 1A1MB 3OUFA 3KWTA 3L2MA 4ZJ9A 1SYSA 4NERA 3MOAH 3K6OA 1XTMA 4QE9A 3DRQA 1OW0C 1JF1B 3NK3A 4HPOH 4XHJD 3ZKQD 4CC4A 4ZMQA 3EJPA 4PG9B 4GRLB 4FNLH 4G7VL 1B0GA 1U8LA 2JB6A 4Y2DD 2EEFA 4ZXBC 1NC2B 4U6XB 1DF4A 4CVWA 1F90L 3HZKA 1FL3A 3HKEB 1V3JA 4NDMB 5IGXL 1M05B 1C5DA 1QSFB 1KN2L 4KHTH 2Z35A 4HIEB 5FYJD 3WKMH 3W7XA 1YEFH 4MJIE 5C07A 4ETYA 2WA3A 5GS2D 4JKPL 3RURA 1H8OA 3RL1A 2K1MA 3DROA 4W4KA 1PGRB 2WQWA 2GSMB 5L2KA 3U11A 2EE0A 2IV9A 1D2DA 5C0EA 3GK8H 4QWWD 2CDEA 3EZJB 1YECH 4R90H 2MCPL 5FWRA 1XI1A 5I0XA 3REWA 1KP2A 4MT8A 3K6FA 1QCEA 4FG2A 4JPIA 5HHPB 3UL4A 3EG9B 4YEFA 3G6JA 5D93B 1JNNL 4GRWB 3CYOA 2AQPA 4DP8X 4F1SA 3BUYA 3D85D 3GRGA 5BQ7B 1Z1WA 3EFFK 4JFOA 3BPNB 1MA1A 4U7NA 4PJCF 2FKXA 2XIDA 4NBXB 2F74B 4J3BA 4B60A 3CNKA 3EO1B 3HLKA 3EYOB 3LEVL 3V8OA 1L9TA 3TFKC 2EDHA 3JUZA 1OQOA 1Q72H 2A3TA 4D9RE 5L0QC 1O7VA 1T5XA 5B3JE 4LVNB 5D7KD 5EC1C 2BVEA 3Q6FA 4EKJA 3C75A 2FDBP 4DKAA 3P69A 1IQWH 5E9AA 5F88A 4EI5C 3DVIA 3KPOA 1AE6H 4KXDA 3MRGA 4L3EE 3VE0B 4IBTA 4KTDL 5E2WH 1TIUA 2X1PA 3MRDA 4KXAA 2HUEA 2J55A 1TJHL 4RX4A 4Y5XA 5FA3A 5FV1L 2EKJA 4TYUA 1VF7A 3UYPA 2ICWI 2OXHB 5TDOB 4O4JA 3FUJA 3LQZA 2YK1L 5CZXD 3VYNA 5J8OA 5F9WC 3FXIC 4GLXA 1MMMA 1QPXA 3LH9A 5EBLB 4MA8H 3FUHA 3X3FH 5E08L 3BQUA 4JFWA 2OJEA 1QLRB 3ZBHA 1Y18A 3FFCD 2UZIL 2WXKA 5FKAA 3S0PA 3WN5C 2PGGA 4ZUSA 2HJDA 1DVTA 3O3EB 5LLIC 5CU9A 2B1AL 1GN6A 4BQCA 1BWMA 2ROYA 1TVDA 1NGQH 2XVGA 2XZAL 1J8KA 4B3TB 2UZPA 3Q8CA 3OC8A 3QWOA 1KFAL 3DX3A 4UTBH 1EZVH 2ATPA 4G7QB 1OP9A 6PCYA 1AG6A 2Z8WC 2P7TA 3F2LA 4P4RB 2V8LA 4R5XA 1R47A 1FV1B 3MCYA 2R51A 3LMJL 3VFWB 4AWJC 1U4FA 1BQUA 1YC8A 1RUMH 2Y06H 3VH8B 4DEPB 1ZD6A 4B3MO 2BNUB 4MB5A 3US9A 4U7KA 1K3IA 2HN7B 2ADGB 5E00B 1XBDA 2K0RA 5H35A 3DKHA 5KBLA 3VRLE 4NXNB 4P3CH 4ASUG 1D6VL 3BGFB 1P1ZA 1Z9SA 3HMWH 3MJGX 4GW1B 1ADQA 4PYGA 3K5LA 2VNCA 4ODHL 3SN6N 3UZVA 3KHQA 1H8EG 5DK3A 4RDQG 1CF8L 2FD6L 2QR4A 3HKFA 4MQ7B 3FFQA 1ZTXE 1KLFA 1OO2A 5IJKC 1ND0A 4H8UA 3BWUF 5CLXA 5DLMH 2R9IA 3ESOA 4Q9CA 3B9DA 2FSEA 2GUZA 3H1KH 3IJ8A 5FYJL 5LG1A 3HI1B 1HC1A 2BLFA 1RPRA 3EO9H 1DLFH 2HFEC 3V6FA 1FXKB 2O5XL 4JI7B 1R3IL 5EU7E 1UJ3C 1MQKL 3G5WA 5CFAA 2OL3B 3BSZH 4N86A 4NAQA 2NX5E 5I66B 3C09C 2ZOLA 4LHUD 2ZUTA 4X6DB 4NI6A 1U92B 3U79A 4M1CC 4R0LB 2ZX9A 3LNIA 3RVZA 1ZT7A 4LL1A 5JIQA 2H0PA 1INQB 4O00A 3T4YB 4UCTA 3WIHA 1QHTA 3L1OL 1CXKA 1DEEB 5IESH 3U0PA 1NLBL 1A8JH 1XF4B 3LIUA 3FT3B 3DK0A 5IJ0A 4WFEE 3POCA 4HJUA 5C0GB 2R2BA 2GJZB 4Y2OA 4ABUA 1KLGB 4DNLA 4MA1C 4WF9V 3QFDA 5MEPB 2LLNA 1UOVA 3D5OF 1U8OA 1IO4C 1COBA 5H37G 5SX5H 1KIQB 5F9JA 3MXVH 1ZEAL 5BR8B 3PWNA 5GSVB 4A66A 2BOBB 1WWWX 3KPPA 4PV1B 3DV6B 4C8XA 1XCQA 3NOIA 4PDVA 4JFDB 1EHAA 4TT3G 3FH8A 5LN4A 5IEKB 3K5SA 2OBGA 4IIQB 4CC4C 1UB5A 1X5KA 2ZP9A 1PJWA 3U1SH 4PUBL 4XPHH 3GMOB 4FK5C 1G7QA 1BWWA 3GXFA 2DJUA 1CL7L 4L5FH 4LEEA 4PBXA 4F20A 4YNYB 5LO7A 5T1MA 2EIJB 3SJAC 4NEHB 5B22A 4IS6A 2IGTA 5F3BA 1M2VB 4N0UB 1SJVA 1JPXA 3FTZA 4POZC 2BRQA 3NJKA 4UCOA 5F21B 4IIZA 1QSFE 4HJTA 3BMWA 1FVCA 5DK0A 3TA3A 4GO8A 1FDLL 3LH8A 4RWHA 3JASB 1KELH 4XZ4A 2CSPA 5ALCL 2CR3A 3NZ8B 2NY3B 2BOCA 3NCXA 4LQFH 4H0LC 1E6OH 3PHQB 4YSRA 5E4EC 8CGTA 1FL5B 4JUSA 5SWZB 4WHTA 5K1PA 1J5EO 1OLLA 4BKTC 5IJBC 5KAQF 4WO4D 3CAFA 3WS3B 5I8EA 4XZUA 2NY5L 2XKNA 4KNUA 4BDVA 3MJ9A 1MHCB 1X5ZA 2BW4A 2HMIC 3A23A 3O2WL 2F5BL 3DETD 5ESQA 1SLWA 2Q6WA 4AVKA 4N2LA 5CR1A 3M1OA 5F72S 1V27A 4YHHB 1JFQL 3SD5A 2C9UA 3BPZA 4X0NA 1AACA 1MH5A 5HFLA 4Y5XC 1O9VA 1A3QA 1KLUA 1EMTH 2Q86B 1JERA 3QZNA 1HEHC 4PRPD 5H9CA 4QHLA 4EDXA 1QR8A 2UXNA 5DHVA 5HDLA 2HG0A 5ABZA 1DFBH 25C8L 4WW2A 1YEGH 2WQ8A 2WBJD 2HHHO 2E5LB 1MAML 3WY4A 3BQUC 2AZ0A 3H3PL 3SODB 2WBWB 2PWDA 3QPKA 2V7QG 4DGYH 3GBNL 4KUZL 3VXUD 4H44C 4L8CB 3QO5A 5IT9N 5FGSA 3C8HA 3FRUB 1J8HB 3O4OB 4HMEA 4WFFE 1W0WB 4MVBD 1HHKA 4AYFA 2Q2LA 1KCSL 4GG8A 2R0KL 1UWEH 2CBMA 2AQ1A 5I1GL 2VMCA 3O0RH 1B6DA 4OLUL 2QSCL 4GEJA 2P7TC 4CH6A 4U3JA 3VSQA 2OCCC 4HZAA 3DPBB 4HA1A 4MD4A 5IKCB 3FULA 4ZPTB 4BYHA 4DQOL 1QFUH 5E8OA 2MHAA 3RWFB 2XDHA 3TEYA 1IM3B 3UAJA 1QKZL 2B1HH 4P4KB 1YEEH 3TEUA 1Q81W 1WBZA 4FQHB 4KWUA 3SJVA 2R1WB 3UH8A 1HL8A 4XN9A 1P7QA 3HB3D 1BM3L 3GSNA 4Z0XB 4ZXBD 3VI3F 4QJFB 3FHEA 3GKWL 1M93A 2Z1KA 1LEKB 2EEDA 1EO7A 4LKXB 1J1XH 4TSCH 4ZTOH 4LF9O 3EFFA 4OF6A 3C12A 2UXBO 4M93B 3FAWA 5HYSB 2ZIMA 4DK5A 3NIGB 5DHMC 1P0SE 1ZANH 2BIOA 1KJ3H 1PYWB 2BP8B 5JIDA 1M7DA 1RXLA 5HHOD 1B0RA 4IBWA 3CHXA 4Y19D 5EC2B 3RHWF 1AHWA 3W2DH 1IGJA 3Q01A 4FQCH 1R3JA 1WNSA 2NQ3A 3RPKA 3S4SB 2CTPA 4LT7A 1MRCL 2F7PA 2XTJD 1FLRH 1WUZA 4TUKL 5TE7H 1P4LB 4G27B 5C0BA 1J10A 1T89A 4LFHD 2WSSG 1N8ZB 4NT6B 2EVJA 3TBCA 3N06B 1UKQA 1ULVA 1JXFA 1XO8A 4NQTA 4KKLD 5J6GA 4E5XG 3MD0A 1S7QA 3PJLA 3PWPD 1S3KL 1JHKH 4MJ4A 4WEBH 5GS1A 2EXYC 1MCOL 2Y4TA 3E7JA 4J1UB 5LN8A 1EV2E 4X6DE 4YIPA 1ASQA 5DF0A 2X4PB 3I74A 3OB0H 2GC4C 5EN3A 3OGCA 2VRKA 4JANA 1CD1A 5EZOH 5FB8B 1AR1C 2Y7OA 4NP4L 5FDWA 3L75H 1KGCD 4DSYA 3VDBA 2F19H 1MSPA 1OPGH 1T21A 3CRRA 3MLYL 5HI5D 3EH1A 5T3ZD 5DJ0B 2NY4C 3OSKA 3NQIA 1FSKB 2QTEA 1NGPL 4K3JL 4H20L 4MYPA 9PCYA 1UUNA 2YIDA 5AW3B 3MRFB 4Z1MG 1NCAH 2YFOA 3W5MA 5DHXB 4AIZB 4B50A 3QEQB 1RIVL 4XP6L 3KLDA 4JG1L 3L4UA 5A6IA 4JI5B 4K7PH 2H6OA 5CXPA 3EF7A 4GG6E 5DRWB 5GISL 3E2EA 1R6NA 1FS0G 5ID1B 1VRSA 4GUPA 4DKEL 1I7UA 1C5CH 1TQBC 3T71A 5IEHB 4LCYB 2FQFA 2P5WA 2JCCB 4L8BB 2YKLL 3PUCA 1UD6A 4A7VA 3H2PA 3RVWD 3BC9A 3IU3A 4X7CC 2R29A 1KQSU 1IKFH 1TJMA 2MOGA 3WUWA 4A68A 3WXWL 6FABL 3AQZA 3ZYIA 3SDCB 3MGOB 3OAYK 4LLQA 5AYTA 3TA3C 2ZUWA 1LP9E 1E9QA 1WFTA 4KQ4H 1G5AA 2K9PA 2I5YL 1FPOA 1JZEA 4YJ3A 3VQVA 2UWEF 5CLTA 2BOCC 3VFNB 2YXMA 3IDXH 3TCXA 3RWJA 3ICXA 4ODBD 4Z7VA 5GS0C 3KMDA 2EQDA 4UDUA 1CT8B 1WF5A 5D2LB 1CWVA 2DWEB 2A77H 3ABLC 3S88H 4P2RD 3IFLL 3V0IA 5B4MC 1OGPA 4KXBA 3MUY1 2VW6A 4WO0A 3CLFH 5CEXA 1LMIA 1PY9A 1R0AH 5TD4A 3BJ91 2N7AA 1I7ZB 3CX2A 1GS8A 4JAAA 4BKSC 5T1KB 1TQWA 4LPXA 3VVVA 5IROD 5CUSL 2J43A 1VEOA 4JI6B 3E3QE 3BHBB 4KK6C 3K6IA 1A6VL 3WV0A 4JQXA 4XWOD 1R3HA 5B38A 4N8CH 3KS0J 3LN4B 5A2AA 3KL5A 4FZ0A 1TFPA 2ESVA 1KGJA 1URFA 3HZYA 4TNVF 3CZEA 3W9EB 4Y8DC 3QJTB 2WQRA 5DUBA 3TV3H 2WVUA 1RJLA 3DWTA 3KPNA 4U1KB 4XP4H 4WW2C 4XPFH 1F4HA 3L4TA 4F9LA 2W6IG 4H26B 4HOMA 1FCCA 1MNUL 3ABMC 1IBZA 4NUQA 5KSAB 3PJSK 1H3PL 4K15A 1U8KA 2DYPA 4RAHA 3VXOB 1X6NA 1X5MA 4HLZH 1AMYA 2DYSC 4LP5A 2ZP8A 2G75B 1IZ3A 2DE0X 1A4KB 5DD1L 1F3DH 4Q7DA 4YO0A 4OVVA 5KANG 3RBSA 2NCEA 3QDGA 1NA8A 1P6AB 2P67A 1TTUA 5ID0B 3LPFA 3JTTB 4EQ2A 5J12C 4GX2A 5D9SA 2VYRE 2YEZA 2EKSA 3C60B 3IPFA 3M99B 1IGFH 2VN3A 2Z0BA 3MKKA 2OIEA 1W0YT 2WVVA 5EFIB 3RWCB 5B21A 2WXFA 4NQED 4A7TA 4LLWB 3T6QC 4GSXA 1CXHA 2VR4A 3RYFB 3FB8A 1BVNP 3CSPA 5E1AB 3UAJC 4G6KL 1O7SA 1XGUA 3KH4A 3O4LB 3CVIL 5DQ9A 2JE8A 1IQDA 4A7UA 3TBBA 1ZSPA 2IPUG 1FAIL 1OCWH 4G9DB 5MP6H 3QR1A 12E8H 3QBTB 5E6YA 5IVZA 3S35L 5JNYA 4HEPA 2YOCA 4E9RA 1O6SB 1RQ5A 2BCCH 4NRXB 3AXLB 4HNAA 2Y5QA 2AQSA 4EE2A 1S77D 4AC4A 2JIXD 3FMGH 3GZQA 5CGBA 3HPJB 1D5RA 3MV7B 2FWOB 4S2SB 1L7IL 4HHAA 3SDAB 4JI8O 3EYQD 4FYSA 3WFCH 2FEEI 2NY7H 4JW3A 3PABB 2ZCHH 1OF0A 1N0LA 4KGJA 4HCRA 4M1GH 2F5AL 2XZQL 4M8RA 2ZG2A 4XNDA 1AHWC 1IC7L 4E9TA 1AYOA 4HLEA 2Q6AA 1QR1B 5EIIG 3QHZL 5FFLA 1R3JC 1T22B 3ZX1A 4CC0A 4GKSB 4M48L 1XZ0A 4X1IA 2GPZA 4ZUVB 1W0VA 2BFGA 3NIGE 4RGOH 4GAGL 2HH0H 4WJ5A 3P2BA 4ZOEA 3WIFA 1Y76B 2Q76B 3LB6D 3RNQB 1T89C 1DQJB 3CZNA 1T1WA 2UUBO 4J7RA 3RB5A 5BRZE 1JPGA 3D9AL 1WPXA 3JWDH 4UV7H 1GIGH 3FHQA 1YJDH 3JVFC 2KZ1B 3CQFA 5HGHB 5GS1C 1M71B 2XNDG 3VG9B 4X6CF 2HVKB 1LM8V 1BZDA 8FABB 1U97A 3GTNA 3IJSB 1L9SA 2OZNA 2DEYX 3IKCB 4HPYH 2E74B 3OGCC 2ZYSA 3QZOA 4LSSH 1X5LA 1RK1A 1S7WB 1V05A 3FTWA 2OM5A 1PLGH 2A7WA 1NBYA 3CMGA 1PNKA 4EIUA 1NBVH 2NUTB 2Q7GA 2VLKD 4JFZH 5A2CA 1A3RH 4N26A 4AYSA 4Z7QF 4HS3B 1CPYA 2YC1A 3FU6A 1BEYL 4Q6GA 2X6MA 5DVLA 1CI3M 5I15H 3CWBH 2G2PA 4R8WL 2LW1A 1OGAB 3B3IB 3DUUA 1TO4A 5F96L 1MOEA 4YDNA 2AMUA 1H3TA 1RIUL 2DI9A 4QCIA 1SDAB 4TVSa 3V4UL 5IFHL 3D4YA 2ICEA 4K5MA 5M94B 5C0RL 1TSRA 4NGHH 3TIDA 1CXLA 3C6SB 5GGTL 1DUZA 2Q9LA 1RJCA 1XL6A 1NEZA 4BHUA 1B04A 2QPFA 5FW7A 5C0AA 2GAZA 3PDGA 5F71A 2XN9B 4I3SL 4UZGA 4KJQC 3CFMA 3QEQE 1R34A 3CV5A 3UJJL 1NPJA 3BO8A 4RMVA 4TLTA 2AITA 4Y5VB 5F7AA 3QEHA 3A4FA 3P77A 4O2EA 4HT1H 2FJGB 1QAWA 1RLBA 5A2IH 3ASNC 1LK2B 3UO1L 1YAZA 2ZINA 2QQLH 4ANKA 5IB4B 3JSLA 2AF2A 2VN4A 3IGLA 4H13B 3H2WA 3B7TA 3CPLB 1AOHA 1RUPL 4NQCB 2WZPA 5BV7B 2VUOA 1KCLA 3F04A 4S11A 3LVEA 1NL0H 1JYVA 3Q4HA 4PJ8D 1OF2A 1PZ5B 3FB5B 4I4WB 4YC2C 3PGCA 3QIBD 5DA0B 2OJZL 1XZWA 2APWA 2J88H 4C58B 5L2JA 5CEZE 5J4MA 4AI7A 4K71B 2XWBA 1NBZB 3QUKA 5AW6B 5I82A 4IHJB 2FECI 4QRRA 4N1EA 5IVXF 3VFVB 4I1PA 4I89A 4LDCA 3H0TB 5CA3A 3PDOA 4LSVL 1BGXL 4JQXC 4R5TA 3UBXA 2YD1A 3RDJA 3OSVA 2VXQA 1OHQA 4G8GB 1SJXA 3EAKA 4AL8L 4JRYE 4QGYA 5IY5B 1MJ8L 4JFXB 5IB1A 3BCCH 5H4ZA 1BFOB 1FG9C 2HSIA 3RAJH 2WLIA 2OV0A 4LOUC 4F9LC 3MUGB 3UIYA 4WNJA 3FW6A 5CMUA 2L7QA 5L4FA 2FATL 4QOKA 1SJEB 3GWJA 5AVRB 1BF2A 3MU3A 2NR6A 3AGVA 43C9A 2P5EB 2DN7A 1QSED 4AQ1A 1MZZA 1KKDA 2GJRA 3M17B 5TFSH 3P4NB 4A2DA 2VAAB 2QVFB 4G1MB 1F6AB 3VQ2C 3ZCCA 3MRLA 1KPRB 2HCZX 1LNQA 3DXAB 3QXAA 3GMPA 4FHJA 4HCIA 4IRZL 3UZQA 3CCEV 1QO3A 1MFAL 4NM8L 3CSBA 1NAKL 4CDHA 2Z3YA 2J1ZA 4CJ1A 3FB8C 3NJJA 3KEHA 5I75C 1OZ0A 2W81C 2P28B 5LAXB 2NR5A 1CLZL 3NPSB 5C0IA 4H5SA 1M90W 3IDJA 1J11A 1AC0A 3U4EA 5EZJB 2BP3A 3B9KD 1RM1C 1UCBL 3V4PA 5CB4A 3K2IA 1WHOA 5EMYA 1VACA 1AP2A 1URZA 1HH6B 1IVTA 2DKUA 1SQGA 5TDPA 2W9DL 4HKZB 5GIRA 1PM9A 3BX7C 1VADA 1FHNA 4K94L 4K8XA 4AQYB 1TVHA 4YLQT 1UYWH 4U31A 4AMXA 3OV6A 4I4TB 5F8RC 3WJMB 4QRSB 2QFPA 5BXFA 1XV8A 1G7LA 1F42A 3WU2Z 3JZ7A 3JCUZ 4IOFC 4S1DC 5IDJA 3NIDF 3ECWA 5LGJB 5EOCJ 3T0VA 2P80D 3BP6B 5HYQA 2PCPA 3CIAA 5F1IA 2VDOL 1MKFA 4IHOB 5H8DA 1BXXA 2HFFA 3V55A 3KWUA 3MV7E 1EEZB 3QUXD 4GSUA 1NMCB 3GSRB 5DJYA 2GY5A 3H3BC 3CLEL 1X4TA 3BVTA 2BFVL 2YMXL 1LNUB 2VERN 3MLWH 3N9GL 3U6RA 3MUUA 4JFFB 3X11A 3LTVA 4LSTL 3V6ZA 4P07A 4CMHB 2XVKA 4A7SA 1ECYA 4Z7UB 4ELKA 5IMLA 2QWNB 4TTDC 5IB5A 4YHYB 4OFKA 2VERA 1C08A 4M3HA 4OJAA 1I1AD 4PLKC 1HNFA 5K1XA 3OZ9H 2OTWA 4F7MB 2RNBA 3PJSA 4DKTA 2UXVA 5GRUH 2OFQA 1EBAA 3WKNA 2NTFB 1HSBA 3VXPB 4X62B 2IF7A 3KNBA 1A6ZA 3D08A 5I8CA 6CGTA 3WKPA 1BFVH 2YFNA 3ML0A 3BH9A 3O45A 1N33O 1TQCC 2BWDA 3RVVD 2W07B 5GSRA 1IAIL 3VI4B 4C55A 2V7HA 5J7CC 3SCMD 2ENYA 3BRGC 3KM2A 1FYTB 1GW6A 3OWEA 5JHDB 1SRDA 4N0YH 1VESA 4JTDB 1BV8A 3B2XA 3D2UA 2MQ3A 1TCMA 4HKJA 3CK0L 3KYKL 1N7MH 3QI9A 4D9RD 1VGEH 2Y72A 3UJTL 1TA8A 3W0WA 5AW0B 4IDJL 4P9MH 5BZZA 4BELD 2ICEC 3V0WL 2YXVA 1RFDH 2FQEA 4PJ7F 4E0RA 2XUMA 1ACCA 3IDMA 4OBRA 4LLUB 4F57H 4L3ED 3OB8A 3HNTL 3FOMA 5C70A 3GMLB 2BIPA 2YD5A 1VQMV 1OGAE 4GOSA 5CIPA 1VLXA 1N32B 5CZVL 3CXFA 3RFRA 3JWNH 3L3IA 4ENZA 2DQTH 2AJZB 3QHFH 4BRVA 4L0YA 3AG2B 2Y1VA 5BZWB 1NZ6A 5EO0A 1I8UA 3ILEA 3J80N 1KG0B 3KGRA 1T7YA 4AEFA 3CZFA 2BIHA 3FB6A 3GC3A 2RJZA 1XNRB 4YFLF 1PCSA 3HUJE 3J8F7 2R4RL 2ZAGA 5C2UB 2W65B 1VPOH 3HFML 5DWUL 1ICTA 1XD1A 1JOIA 4GMTL 3AG3B 3K2KA 5LCVL 2B3IA 1A9BB 4DQAA 1WV7T 1G4RA 3LKQB 4IBLT 2NTSP 1XOUA 2CLVB 1FH5H 1GZPB 2R69A 4N0CC 4NQCE 1EAQA 5DD6A 4PTTB 4B96A 3W38A 4Y16A 1PQZB 1U2CA 4D0CB 2DI8A 1IBDA 5C0FA 4L1DA 2F95B 3ARDA 1TCRB 1T2QL 2EDXA 5F1SA 4Q6YA 1E90A 2CXGA 5LBGA 4PV9B 3JV6A 4EZMA 5FO9A 2FX9H 4O58H 2O5YL 2E9IA 5K9JH 2ZE5A 3F7KA 3L3HB 2QMKA 2AJ3A 3ARXA 4B7EA 3B6SB 2WHVA 3I6GA 2JEXA 2CQVA 2VLLA 3NFSH 1S7RA 4HFWA 4KRNA 3T4AB 2DD8L 2JIZG 4PRAA 3MRKA 4M62H 4G8GE 5CKAA 5DR5L 3II1A 2V5SA 3SPCA 2O26U 3HC3L 3H4FA 1BVLA 2AEQL 2IH3B 2J8UF 1Y67A 1E4HA 2P90A 3MR9A 4NZUL 4XMLH 2NR6C 1EDHA 1UC6A 1Q4NX 3HE6A 4AQ1C 1C1EL 1I1CA 1OCZB 4L29B 4C54A 4GAYB 3KLHC 3UXFA 4KK5D 5EWIL 1BZEA 3VXMD 1ZLDA 1EGJL 43CAB 4OGQB 1JGUL 2B4CH 1JWMA 3O3AB 3M88A 3AREA 2AEPL 4KZEH 2GITA 3CVHL 1Q9OA 4WHDA 4PY8J 2NX5D 4J3VA 5FYLE 1HXYB 4PQXA 4YHNB 3HNSL 3RNKA 4M7LL 1A7PH 1NJ9B 4UM9D 1ZVNA 3GI9L 4GKKB 5IG7A 4PJDA 2VOTA 5KAIZ 2XV6B 2ZOKA 1ROWA 3KWVA 1IGYB 2LAAA 1J1PL 2FEDD 4RNRB 2Q8AL 5IREA 4KTEL 2X12A 2O61A 3MRIB 2D7OA 4C59B 2OR7A 3L3DB 4HPHA 3IC7A 1JPFA 4GKZA 5F44A 4NFBA 4TPRL 4ORGA 5JLZB 3E6FB 3ME0B 5ACZB 3ETQA 5I18L 1RZIB 5ITFA 2AJXH 4XNXL 5I17B 2HX8A 1G9EA 2XJLA 3OKDA 2JQAA 2WYHA 5M7QA 2DMCA 1H15A 3VFMA 1ODAA 4MAYB 3ETBF 4CS4A 1G6VK 1WZKA 3ASOC 3ZN0A 2NUPB 4JI3O 4RAUB 1OP5H 5D6CA 4KZDH 3QJOA 5A1AA 3L73H 2DQHH 3QUYB 2VE6A 4NYLB 5AWNL 2OYLA 5GGUB 4KTGA 1YA5A 1T03L 3A67H 1OK0A 4MJHA 1JZIA 5EUOB 2C34A 4M29A 2Y3NA 5BOJA 3RGHA 4MASA 4XMUA 3ZRSA 2OMVA 1FYHB 4N2KA 3WCYA 1I3GH 2H5UA 1RHHB 4A6YL 5T5FL 1E4WH 2V7NB 4WNQA 1GK9A 2PCYA 4OXSA 3RWDA 3PJNA 4OW6A 4FC3E 3MLVH 4GRLD 1M9NA 4IU3A 1MCWM 2EIEA 4QRUA 1BZ9B 2EDEA 1NC2D 2A6JA 1Q6UA 4JAMB 1QSFD 1Q0XL 1Q9WB 1R24B 1SESA 2B0SL 2FHCA 4Z7UE 5AL0A 5DJDB 3CZUB 3SDDB 4F7PB 1OM9A 4HV8B 4XO5A 3L3OA 4HJGA 2ED7A 3LZRA 1OD7A 4XN5A 4FFVD 4J3WA 4LRNL 3ZZSA 5LBSL 3JALA 3M1BA 3FQRA 3KS0H 2P8LB 2Y6TE 4BQ9A 4EKXA 2F8VA 3JWOL 3RE0A 2BY3A 4YFLI 2K1EA 4QXTB 3DGGB 4Z3HA 2WB7A 4HF5H 4H0HB 1S7UA 3D39A 4AVIA 3QI9C 2VQ1A 4PJEF 4PWIA 2WO4A 5JPNA 1Q1JH 5SWSA 1NOFA 1U8PB 4F7TA 1RUKH 4DR4B 2J4WL 1E8YA 3BEWA 1FYTE 4HIIA 1S7VB 4ZQKA 4C4KT 2C1PB 1WFMA 4JG0L 2EZPA 5D8JL 3ZU8A 1RZJL 2NY2C 2FL5A 3BD3A 3MRQA 3ULUD 1OZUA 3OEHG 2D3VA 3EBIA 2DIBA 1ITBB 1UPGA 2FUTA 3HVNA 3CFTA 4R26H 3QUZB 3BAJA 4CSZA 3P3RA 5DI8B 3PNWA 1E6JH 5G5DA 1KJMB 1M7IA 3SHSA 3MRCB 5I16A 5DUJA 2A4EA 5L9DL 4GAFB 4JPWL 2YA1A 4P2QE 5AVYB 5A9GA 1NCBL 3FU7B 4ZNEE 3NZHL 2IH8A 3FB6C 4N2EA 3DIVA 3V0DA 3U6XS 3VWKB 4QHMA 3HS0A 4IGGA 1EM1A 4NHCH 1A1OA 1BIIB 2VMFA 5HPMA 1YN7B 4G43A 4WFFD 5EU3A 4Y4FB 3W39A 5AOZA 4UAOB 2NPLX 1MIML 3U9PH 3ARQA 4KMTL 5E4AA 4XNYH 4I3RL 4CBZA 1N6UA 5AOIA 4KKRA 5FA4B 2AEOA 1CR9H 3OD3A 3MLPA 3PWVA 4G28B 3LZLA 3DMMB 1YHPA 5DD3H 5IIEB 5JW4M 4N3TA 2PLTA 5D5MF 1E5YA 2PTVA 4Y16C 1GTOA 3K5RA 4MXQC 3MOBH 3HRZB 2I26N 4RQQA 3FSWA 3NDYE 3WB2A 1OIOA 4I0XA 3ARDC 1N36B 2R2EB 2IJHA 3DSFH 5F8QC 3EOBB 3S5ZA 4MVUA 4BZ1L 3BUDA 1DBJL 5JHLH 5LMUO 4O4LB 4HUXA 3IK2A 1Q8MA 5C0CA 4KKBD 4HXBH 3BKMH 2K9UA 4N21A 1A14L 3WMSA 3NZUA 2OP4L 3K91A 3SKNB 4K9JA 4ZFZB 3WD5H 5JOFB 4NM4L 1AMXA 1TNMA 1SVZA 5KMGA 3O81A 2I7OA 3KAAA 4P30A 3ELAT 2ZM6B 5CMAB 1GS7A 1H5BA 2P42B 1X7TA 2Q7HA 4YDKH 4W4NA 5CBGA 4BIUA 1FZOB 3WKQA 4NBZB 5AVQB 2RR3A 2QTVA 4N22A 1NINA 3HE6C 4F3FA 3M7FB 1MCJA 2ZZUT 4HMCA 3CJJA 3SQBA 4OGXL 2HTLD 6TAAA 5DZNA 4S0SD 4X88A 1JPEA 3P4LA 3AREC 4XRCA 1NFIB 3EKCA 3ETBJ 4L4TA 4XMPL 1CC3A 4MDJB 2AABL 3JYCA 3WTXA 4HAFA 4XCYA 3MNMA 2JTYA 4FQ2H 4LOEA 1MEXL 1S9VA 5GGQL 3TBYA 3A0RA 4OKDA 1F45A 4TRPH 5FF6B 1NANI 4MB1A 2ARJA 4HSAC 1IIIA 2H3OA 2AZ2A 1UA6L 3OKMB 2Y25A 4AQYO 2DQJL 5D96B 1GR7A 3GPEA 3WFHB 4YHML 3TGXA 4PAZA 4XCNA 2PCFA 3GNMH 3OZLA 1FI8C 3P11L 2UVEA 5B1AC 2AXFA 3I50H 3JUYA 1LO5B 5IFAL 1V54B 2AJVH 1PL3A 3LD8C 2IFFL 2PETA 2UZYB 2PI4A 1AKJB 5DO2C 2P24A 5KSVB 5CA0B 4R7DB 4DV1O 1P4BH 3A6CL 1BBJA 2GKIA 1RPOA 5BXZA 3G5YB 3IGAA 3PL6B 1TTCA 3BABA 1IDSA 1PZ3A 1Z6JT 1AZCA 2ZXEB 2VQFO 1OCOB 1YMHA 3ZHLA 1ZDQA 5FYKE 1IGCL 4AQOA 3ULUL 3KYOA 2XV2A 4MFHA 1JGDB 1EJOL 2JKLA 4HZ3A 4G9FA 1UEMA 4ALAC 4JZJB 2W6JG 1MF2L 3VGEA 1NCDH 4R4FL 2EDJA 1JFFB 5CHNB 4FNPA 1JI2A 2DQDH 1KPVB 5LGTA 3F05A 3CCHA 3HI6L 3KBEA 4FG6D 5J57B 4ZUWA 1DL7H 1W72H 2XAFA 1SBSH 4N8VG 1IU1A 4N2FA 1YUHB 2WSKA 4JFDD 3U7YH 5BZBA 1ET7A 2UXFA 4I5SA 4QTIL 2HWZH 4RISL 5EUOE 3CDFA 4LGRB 5AUMB 3EHBB 3WHXB 2C7FA 1XAUA 2L7EA 2YD4A 4QYOB 3DOHA 3EGDB 5I1LB 5E24E 2V9RA 1Q90D 2Z9TA 3MLRL 4B41A 3CN4A 2AGAA 4FFYH 5DJ8B 4D3CH 4Z6AT 4PJIB 1K85A 1ROPA 1TVKB 4I5BA 3UAFA 3FPXA 4FLQA 4OZFG 3L3OC 3Q1SL 3HC0B 4ELMA 5B66Z 3X3GH 1G9HA 2VMJA 2JKXA 2ZX6A 2ZUYA 1KTDB 1WD9A 3WOVA 1G84A 3DVNB 1JJOA 4YXHL 3HZ3A 2EH7H 1XCWA 1D7FA 5DFVD 3LV3B 3FTGA 4D7TA 5FEBA 4LF5B 4AQ8A 1TEFA 4HISA 4XB8A 1QHOA 5CS7A 1F8TL 1RP9A 2NY3D 4XP1H 1TTBA 2BVQB 1KULA 3QZPA 4ZNCD 3UO8B 5JPNC 3P9LB 5AOMA 15C8L 1WGOA 4KKQA 5SWZD 4JPQA 1M56B 4PS3A 2ZXWC 1LILA 4E41B 2ZYRA 1MSWD 3FN3A 2Q4PA 2AZAA 4PP2A 2H3NB 4AK2A 3L9YA 4FPPA 1FFOB 2G4GA 2HLFC 4YDJA 4FLYA 5CN3A 3CBRA 1J5OH 1HDJA 3OJDB 4GBXB 3H9SE 4OPHA 5IK3B 3VG0H 4YSQA 2PY5A 2Y4UA 3NABH 3Q5OA 4QRBA 5TGBA 2CKNA 3MLZL 2PF4E 3RYHB 1GYUA 1PDKA 1RL1A 2ICWA 2Y5TA 2FNBA 2H32H 3LEXA 5I1CH 3QRFM 1U3ZA 4JHWH 3DO7B 1HI6B 2KZWA 2WWKO 1WITA 3GSVB 3QZMA 3FUNA 3V0JA 4UQCA 1TTFA 1F90H 4RBPK 3HS0C 1EO8L 5D7LD 4ZAKA 3AG7A 3PP3H 2WJ5A 3B7YA 1ZUQA 2X7RB 1PL4A 3Q6GH 1ZL8A 2YPLB 3MNWA 1XSJA 3N1PC 4ETQA 4MQXC 2EIKB 1SHWA 2OW7A 5EYPA 3GIZL 1NGYA 4ZMTA 4EN3A 4ZW5A 1U6AL 3KVQA 1MCIA 2DMGA 3ARUA 1E5CA 4JDVA 1RSYA 3BA8A 4AYID 1Z66A 2XPGA 3ZL1A 3T0DA 2ILMA 2KKWA 2E6QA 2XFXB 1J8HD 1MFEH 1BVKB 5D1ZB 3FAVA 4OV5A 4BH7A 2PR9A 4F37F 5I30L 1II4E 2YEQA 2ZCLL 2CJUL 1JNNH 4JFUA 3DYMA 4HAKA 4V1DA 4YSEA 3ZMRA 1SZTA 1ZV2A 5KHKA 1IBMB 1G6RB 3P30H 3Q2VA 5EOCH 2J6EA 3HZVA 4H88H 1YIJV 3C8KA 2HG5A 2E0PA 2DTML 2YAPA 3QJHA 2WSDA 1BGYH 3NG5A 1JE6A 4J3SA 2YIBA 5L3FA 2EVFA 4DRXA 4XMXA 1IM3D 3LSQA 4EB6B 1BFSA 3ARGB 4H4NA 2MQ0A 4NZDA 1A47A 2VZTA 1H8LA 3CSYB 4I0PB 1H5BC 4P4KD 2V3EA 4DR2O 3B9VA 1PLAA 1E9OB 4DVRH 1E9PB 4PD4F 1YEJL 4GQ9H 3VTMA 1ETB1 2HRPL 5EBWB 3Q8BA 5KX5B 1BXAA 3DX7A 5LHHA 2X0VA 2K70A 3N50A 4BUQA 4NZTH 4NKGB 5JXAH 5HYJA 1YJWV 3W3BA 5DJXB 2YK1H 1GHFL 1PMYA 3PAUA 3N04A 4XCEB 4YL9A 2HJLB 5MENA 4X9HA 3UC2A 3QFJB 1VEMA 5D1XE 3X12B 1WQVT 5J2TB 1I08A 1RU9H 1A02N 1JN6A 1U8NA 4LVHC 1QI5A 4YFDB 2HT3D 4IOSA 5KVMC 2A6KB 4JI2O 3W56A 4WY7H 4Z78B 1Q0YL 3EYSH 4PS8A 1MRDL 1MCKA 3LN9A 3OJMB 3EXLA 3LRSA 4P5KB 3HC4H 4TQHA 1YMMB 2QDVA 3FQUA 2X44D 1VIWA 3UP1A 3SY6A 1DQQA 1LE9A 5CR8A 3QUMH 3IGAC 3HE7A 3LMJH 4QTHB 5I1KH 5I6MA 1MCNA 1Z0NA 4V11A 3DRTB 5HDQH 1XMQO 4RFNC 1T0OA 4ZBJA 4DR7O 4JKMA 4WFEA 2GBUA 4JFHE 1U2YA 3CRMA 4WI0B 2DLFH 2NXYC 3CXHF 2MRYA 2ADIA 4YLBA 2ZE7A 3SE9L 1N0JA 1JCKA 2X6AA 2BSBA 3D25A 4PDLA 4J4PD 3N1GC 4M8QA 4PJGF 1G9MH 4KJPC 1FNEB 2BVPA 1MW0A 5L0QB 4UCSA 2F7IA 4UTAH 5EC1B 3CSFA 4I18A 4PJCA 2YSUB 4DV6O 1SN2A 5EU5B 1CLCA 4UT7H 3BFQG 4EI5B 5FYJH 4LL4A 4PGBA 1J05A 1N2RB 3BP7A 1SUJA 1ZA6A 3DVGA 3WFDL 3RHWK 3MVSA 3QEQD 3E89A 1NSNH 2XA8H 3OF6D 5F7NC 4HU2A 5FHAL 2E75C 1O9ZA 1KB5A 1BYPA 3ECVA 4GSQA 5C1MB 3OX8A 3H9HA 1YEKH 2YEVB 3TCTA 4FULA 4XWGL 4PV8B 1MAKA 3L4XA 2DQEL 5EF1A 3ARBB 5K9KA 3ZQXA 3VGAC 3CTTA 4KKCC 4KV5E 1HNZO 2AJUL 2C1OB 2B77A 4NWTL 3CZGA 3D36A 2QV4A 1E3XA 5I2IB 4TUYB 1XR8B 4OUUA 5D7IE 4EXPX 2H1LM 2IDUA 2WXPA 2G2RA 5IF0A 3GSXA 3SDCD 1FZMB 1VEWA 2LAGB 2Q7NA 4K3EH 1DN0B 5T1DH 5A40E 1PKQA 1CE1L 4NQSB 4AQ8C 2YUVA 2F61A 4LAJH 4NKMB 4QHNA 4WVRA 3RB7A 1D5AA 4LL9A 2OMYA 5CEZD 4G42B 2GCYB 4NFDA 3TESA 1GZHA 5LXVA 3P4MB 4PJHB 1XGYH 3L5XL 1ONQB 1HESA 3V4VH 1WICA 3TJHD 1P5VA 2CUHA 3BP5B 2R9RB 2RDCA 1QZNA 4WZ9A 1KEML 1A4AA 2XETA 3F7RA 3LOWA 3NSCA 4U1IB 3V5DB 3KYNA 1P7HL 1HCZA 2CHNA 1UKTA 1J95A 1KJ2B 5T1KD 3O11A 4QIWF 1GMIA 2QPSA 2UX6A 3BH8A 3IDGB 1DVFA 3QNYB 1B3IA 4E41E 3QQ9D 1O9GA 3A8TA 1XF1A 2BY2A 4M61B 5ICXB 4FZ8L 3FO1A 5GGRA 3TBWA 2KBGA 3WHE0 4BK4A 2PP7A 1GOFA 4M6NH 1U36A 4LSRH 3S7GA 3N43B 4B5ZA 4ZAKC 4M43L 4K7PX 1YDPA 5T5NG 5ICZA 3MO1B 4JFQA 4BFNA 2WLYA 1TQTA 1RZGA 4KKZA 2IMNA 2YD3A 1N36O 4JJ5B 3SGKA 3PQYB 4MYWB 3V52L 4EN3C 2QELA 5KSAD 3QULA 4JHAL 5CP3A 2J12B 2L7UA 3CX5F 1FYJA 3IKKA 5C6PB 3TWCL 1E5ZA 1G7MA 1XB6A 5AVTB 1Q9KB 1ZT4B 2XG5B 4FM2A 1D7CA 2BVOA 4M8UA 3R66A 5KSBE 1VAHA 4PGEB 5CLZA 2DQ0A 1TDQA 2XHNA 3C60D 2LT9A 3OR6B 2Q7YB 4JDTL 5E23A 4RZCA 2HG5C 1ACYH 5GRWA 4QF1B 3TONA 2KLRA 3QO1A 2AS5M 5F0MB 1MWAB 3B2PA 4EVNB 3O4LD 3LRMA 5B38G 2Q0OC 2BNQE 1B06A 1U3HA 4X80H 4KHPB 2AHYA 3CFKA 2YPVL 1AGDB 3FU5A 3P9MA 4GKOA 3BIKB 4MA1B 3MBEA 2WQVA 3OTFA 5KHJA 3MREA 2ADYA 1K72A 1X3DA 4B7LA 4O51A 2E4TA 3L45A 3WNIA 1IAII 1MI5D 4DTGL 3GMMA 2ZDIA 2QDWA 3AZUA 4PJBB 1LL1A 4RIRA 5F7EH 4UQ3A 3VFOA 3RY4A 4QRAA 3NCJL 1WPBA 4TNVK 4BGDA 4XMKL 1EXHA 1SYSB 3MV7D 1I4FA 2D3LA 4N2GA 3FKUS 4YGVB 3SDAD 3P02A 2I85A 4RGNC 4QMEA 3VFUA 3DRQB 3HG0A 3ATDA 1RP3B 3BUTA 3TOPA 4LF6O 1B0GB 1U8LB 2JB6B 3CMEV 1MCDA 3KPRA 3D87B 4BZ2H 1FCGA 3HZKB 5FLUA 5B8CA 4HH9A 1FL3B 4XVOA 2X0UA 3SPIA 1NFDF 3B43A 3FQXB 4NNYA 5D71H 1E67A 4UT9L 3MJ8B 5F7LB 4O4IA 1CYXA 5C07B 3IFNH 3K4AA 1PZAA 1JZ7A 4YX2L 1XEUA 3QFJE 1KIPB 2YXHA 3TYGL 5KVEL 2N04A 3JV5A 3PWUA 4N20A 2YARA 1OE1A 3IMUA 4MB3A 1VHPA 2QL1A 5C0EB 2CDEB 1IGMH 1JWSA 3HE7C 4WIQA 2L04A 3N2KA 2IU3A 3GEWB 1URLA 5T1LA 2RA1A 1FN4A 4Z5RB 4HYTB 1DBAH 3ESPA 1VFMA 1XF5A 4GXVH 4XNZC 3G6JB 3D4GA 4HEPG 2CBPA 5EBGA 3ZGHA 2M6YA 4H0LB 3BUYB 3RTQA 5JUEL 4LWSB 2ZQKA 4WJKB 2ZONA 4H1LB 3C9NB 4P06A 2FO4A 3U48A 3QCTH 4Y1TA 7FABL 1UA7A 2JS5A 2ITCA 1DQDL 1XF3A 4X42A 2ORBL 5DUML 4P2YA 3LRLA 5FKPA 4I2XA 2A3QA 1FO0B 1L0PA 1SM3L 4NO2A 1CE6B 1K3ZA 2OMXA 1IEAA 3ARFA 3INOA 3KLAA 3Q6FB 1OSPL 3FCTA 4FQXA 4I18C 1EHLL 2VDQH 4A2EA 5F88B 3QNEA 4AILC 1OGAD 3EJCA 1FH2A 2AK4E 3T4DA 3MRGB 3H1HH 3L1GA 3MRDB 3CBJB 5IQ7L 4MMYA 1CXZB 1ZV5A 2GVYA 5FA3B 1FZKB 2CDYA 3WIAA 3NJFA 4AXWA 4ONFL 5GHWL 3V2AR 1IJNA 1A7BA 1CQKA 3U30B 5CJ8A 4W93A 4O4JB 3LQZB 3T09A 3QPQD 3GBMH 2XN9D 1SOSA 5KUKA 2BH0A 3DXRA 1AH1A 3JAKA 1HSAA 1MRFH 2R2CA 2CXKA 1PNDA 1XGTB 2P8PB 4N1HB 2XWTA 3D36C 1PLBA 3WFBH 5LYJB 1CZ8H 2RFXA 2FT8A 2OJEB 2C5DC 1Y18B 5IBLD 5FKAB 4H44B 1OWRM 2H6PB 4ZUSB 5AVXB 1WPCA 5JW3H 4MX7A 1FXHA 2D9CA 4YDVB 3QDJA 2F54A 4GKJO 2DJSA 2EDOA 1NMBL 3E38A 5F7YC 4NQCD 3LKPA 3VMNA 1VF5C 1O75A 3AMKA 4ZOCA 5I6KA 3UCSC 1GZHC 1AFVH 3VQWA 2ATPB 2VN6A 3BFOA 3KPSE 4Q89A 5CBFA 4U3SA 1EA9C 2ZT9B 2Y2YA 3HG5A 1H0DB 4GQQA 5JW4N 4NP4H 5L8JB 2OCCB 3AG4B 1WZ1L 2N74A 1V7ML 2R4SL 3RU8H 3DX9A 1BCIA 3LDBC 1GH6A 2Y1YA 5AVVB 1KY6A 1ZGLB 5DC0A 2YQ2A 5T3XH 4OQTH 4LFBO 5FPIA 4TTGA 3T6WA 4JGSA 1P6FA 2YAHA 5FK9A 3RWHB 1N4XL 4PJHE 2JRIA 1DDTA 1TNNA 4YHOH 1DVFC 2D3JA 4UZUA 5C08B 1NEZG 3S37H 3MXWL 2JEUA 4G8GD 1WH0A 2MW2B 3V95A 4Z8FL 1KGYE 1FPTL 1ZRUA 5KSUA 2OWOA 1KLFB 1AJ7L 1ZPLA 3VI3A 1DUYA 2GYSA 4I48B 3BZFA 5KN5B 4P5MB 3B09A 4K5OA 2GUZB 4DESA 3SGKC 5CBHA 1IBMO 4TLKA 2ZX7A 5GTHZ 1HQ4A 1H2GA 1FJGO 4EO5A 3BWUC 5H94B 2D3NA 3RJQB 4FP8L 5DCCA 1IRAY 2H1PL 5F7UA 1NC4A 2P5ED 2WB1A 5MEQA 3QEGH 2F08A 4FABL 1JPTL 5I5MA 2I5YH 3EFOA 3FTYA 4OZGF 2ZOLB 4LIQL 4FHBD 5J1TC 4DCQA 2HTKC 1VJSA 4GRWF 5CU5A 3DXAD 4P23B 5KA5A 5ECGA 3I2CL 4X6FB 1HNWB 1U8MA 2H2SD 2QR0B 2ZE6A 4P99A 4U6YA 1M1XA 3G6DH 4KQ0A 3EJRA 4LBEA 4NWUH 2UV3A 4PSRA 5E99H 3CHRA 3TO2A 2YRLA 4AQEA 3DPDA 1ZIAA 2TRYA 2X4SA 2X09A 3JV4B 3ZJAA 3NIFB 5DD0H 3ULUF 2R2BB 2ZAHA 1U3HC 2OSLA 4OD1L 5JQHC 5CSBA 1GY1A 4NO3A 5CUSH 4YXLL 4RQEA 2KQXA 1WA8B 3MBEC 4MNQA 1B2WL 5IYCO 5DC4B 3UC0L 3AB0C 5J6HA 2ZDIC 3ZEDA 4WO4B 4KY2A 1F11A 1RMFH 2DQCH 3NEEA 3OKEB 4YK4C 4UQAA 4XBPA 5GS3A 1JYXA 5FUZL 3RVXD 2AXGA 2NY4B 3GBLA 5CEYB 3L7FA 1XCQB 5TTRA 5E8NA 1HNGA 1M1SA 3N42F 4YQXL 2ZJSH 4ODWB 2GDSA 1E28B 1UB5B 4OTXL 4PJBE 4YEEA 5IQLA 4UINH 1XEDA 2EZ0D 1QTPA 4XAWL 5B8CC 2QKCA 3QA3B 2ROXA 4ZMYA 1KTLA 5T1MB 1DP0A 4IS6B 4ZSOA 5F3BB 4JFFD 2X87A 4DR3O 3ZMUA 1E42A 3OKNB 1DJYA 5CWSA 4DZBA 3BVOA 4YXKL 5BV7L 3ULVE 2A99A 3K72B 3TVMA 2CK0H 5AZ2H 4L8JA 4CADA 5DMIH 1FVCB 5C07E 1I82A 3T2LA 1MFVA 5DK0B 4F58H 3TA3B 1PEWA 1BQ5A 1NUNB 4OCYH 4HK3J 5IYBO 3TXAA 3TO4C 4DV5B 2I9TA 1QD0A 2XQBH 2XYBA 2BIMA 5FCSH 3TJEH 5L2KE 5GZOA 3RTQC 5T3ZH 2BSSB 4Z95L 4BA8A 4UVBA 3WL9B 3T0EA 2A7BA 1G1CA 2UWEA 4MXWH 2XTAA 2QGNA 3ASWA 4Z1VA 2ITCC 1O6VA 5I8EB 3G6JE 4XZUB 1FYTD 1WCBA 2VQUA 2XKNB 4L3FA 5JHDD 3OJVC 3V6BR 1SY6A 2ZOWA 3ARFC 4MA7H 4MD0B 3I6KB 2Z5UA 1AB3A 4FQXC 2Y24A 3S6CA 2Q6WB 4XPGH 4X7TA 1CB4A 4J10A 2UUDK 4PRNA 4ENEC 3MKGA 4X4ZA 4ZMPA 4DR6O 1L0XA 2W9EH 3X2QB 2LLLA 2F4VB 3NFNA 4PJXF 1FGNL 2WMPA 4EDXB 1TZHB 5DGRA 4XBFA 5DVOA 1N0XH 5DHVB 2UXCB 1T83A 5K59F 1DQVA 4L1HA 4XI5D 3TNNB 1I8AA 1U91A 1M7XA 2RJMA 4JN2A 2I9LA 3PWJA 1L1FA 3SE8L 3F7VB 4AGPA 2I07A 4HOZA 4NKIL 2DYSB 3AY4A 2OYMA 2VZ3A 4EDWL 1I8KB 3EXAA 1J48A 2PMZA 4ZD3L 5DQJA 4AYFB 3PV6B 2DQGH 3MHZA 2ZQMA 2DBLH 2ZX8A 5J12B 4IBVA 3MV9A 1JGVL 3U7WL 3ETEA 4FA8A 3E8GA 3I9AA 5G5DB 3QJRB 2PWFA 4LHJB 1BSIA 5BNXD 1IC4H 4KJYB 5IQ9B 4PGZA 2OZ4L 6PAZA 5I23A 3IU4L 1GGBL 5E8OB 4E9QA 3MRBB 4KP4A 1AXTL 1HWGB 2YSSA 2OT5A 1RUQL 4XO9A 5DDHA 4BCZA 4XPBL 3CFDA 3LPGA 4RA3A 4ANWA 1BEYH 1WBZB 1GGCL 1QMUA 2CO4A 2EO9A 1HYSD 1RFYA 1G1OA 4CVZA 2A4ZA 5DEZA 1P2CB 3IYLW 4ABVA 4RAIA 1WYJA 3DX6A 1XH0A 3CXDL 1EK3A 3S34H 4LSQH 5DYFA 2IO5A 4HD9A 1MNGA 2UU9O 1S9XB 2WUBL 4O2CA 4KDTA 4RMBA 5B1JA 3LIZL 1UZ6F 4JPVL 1OE3A 4PVNA 3H8NA 3VFRA 1G94A 5DJAA 1EN6A 3ZTNL 1I9IL 1EFRG 4LDEB 1GC1H 3O2DL 3GXUB 1I1FA 2ADPA 1D9KA 2HXAA 1IGJB 3QIUA 4LKCA 5HI4D 3ZJZA 4FYTA 1GH7A 1PW3A 2VKXA 4QD2E 1KBGL 4UOW0 2F7RA 5JORA 4X1YA 2PR4L 3LN5A 1UH3A 3ATBA 4QE7A 3GEFA 2IAMA 4NC2B 1P4IH 3RGVB 4MA3A 1T7XA 5TE4L 5IHLB 2V5MA 5I1DA 1O7DC 2ARWA 3GMRA 4KVNL 1SEBB 4LBEC 2QQKL 2OJZH 5DRZB 5GS1B 1ZLUK 1XCTB 5ECJE 1MSDA 3BZ4B 3P73A 4YDZA 3ZK0A 1X5XA 5LGHH 1ZK9A 1E4XI 2K8QA 5E2TL 4IBUA 4QHKI 1H6EA 3ARRA 3OGCB 4Q20A 4GZRB 4QHKJ 4HS6A 3HW7A 3L3GB 5E8PA 5HI3C 2R2HB 4X6CA 2OTUB 4K3DL 5FYKD 3K9AA 4ONHB 2AHZA 1BBDH 3VSTA 4AZ8B 2EXWD 1XCXA 3NIFE 4AL8H 1T21B 1TZOA 2ZICA 3RWIA 3LKOB 4PJ9B 1RZKH 4HXAH 4AKOA 1IFGA 2WIMA 4AUUA 4X9GA 5ALBH 5KJRL 1GN3A 4MAYD 4AV0A 4NJAL 3VGGA 1M7UA 2VISA 4TQEH 5L8KB 2XV0A 2X2JA 2W1NA 1CDCA 2Q8BH 3QUYD 3LX9A 1YN6A 5CCHE 1X7SA 4LBAA 3I6SA 3Q5YA 4AJWA 5L3DA 4O4YH 2IPKA 3LJ3A 4ZFFA 2CTWA 4CMMA 2A6DA 5EU6A 1I7UB 1QFOA 2WZ0A 1JV2A 4TUJA 3ISRA 4RH4A 2DOCA 2KDYA 2EVHA 4PWJA 2N56A 3IU3B 3WUWB 2Z31B 4UNIA 3FRPA 5GXBB 4HBNA 3TVMC 3FB7A 3K08A 4PA9A 2W92A 1NAKH 1YY9C 2FGWL 3ASNB 2DQMA 3LZOA 3QWRA 4AJVA 4EOWL 5CCJA 1VARA 3BSGA 3T1HO 4KXCA 1CTMA 1IC0A 1SZNA 2HT2C 3SDDD 4JHUA 3RWJB 5GZOC 5I1JL 2FQDA 3HAEH 4NHUA 4Z7VB 3X1BA 3MNVA 4UDUB 4MS8D 3ZRCC 2V5YA 1E1QG 3KDMA 1UCBH 1J88A 4JFEA 3T0EC 4AEHL 4PS4H 4Y4HA 2YICA 4E68A 4CSPA 5DRXA 2VDLH 2WA4A 2VDMH 3R06A 1A22B 2E4FA 4L4VA 5I5RA 1LD9B 4ODUB 4Z23A 1W8NA 3D8CA 3MOAL 3QIWB 1SERA 4PS7A 4HPOL 1MCCA 4JRXA 1G7HB 4OV6F 3TH3T 4JKLA 4AV4A 4FNLL 4EIZC 2ITEA 1IAKB 2OI9B 1CYGA 1XF2A 3ZDZB 3HZYB 4MJ6B 1LUWA 3RX7A 5IVXA 2BE3A 4FLUA 1N26A 5DUBB 2MTPA 5EZIH 5HJ3A 4KHTL 4HKXA 3WKML 4HJ0C 1RJLB 2E76B 1YEFL 2EECA 3APMA 3E80A 1T83C 3QUZD 5ITZB 2GUOA 2CAZC 1T7WA 4Y2DA 4LSTH 4XMTA 4PJ6A 5D4HA 1CXIA 4Q6IA 3I6LE 5HDBB 5L3EA 1FORH 4R90L 1YECL 3AY4C 1DHKA 1S5JA 4YO0B 1UGNA 3LPWA 4FIPC 3TPKA 3VWKD 2EILC 3MJ7B 1UTDA 3BPCB 1CFTB 3CHOA 4XP9H 5D9SB 2QA4V 3NDZE 2JVDA 2CZNA 1LYQA 2YEZB 4Y4FD 4B6ZA 5LGUA 3ZQ9A 1OTTC 2ZXGA 3LSOA 1LUVA 2BSKA 2WVVB 5IMMA 1DJHA 4XNMA 4E9LA 1CDHA 3PLYA 1XH1A 3ESNA 3FB8B 5I75B 2DQUH 2Z8RA 3DMMD 1QUPA 4M3JA 1XGUB 2ZAIA 3D85A 2KG7A 5DQ9B 1IQDB 4LB8A 5TE6H 1U8JA 2R0ZH 4JI4B 1IQWL 1RM1B 5IVZB 1AE6L 3IEAA 4LF8B 4LFAB 1MXDA 4O2FA 4AM0Q 5DFAA 1N5AB 4IDJH 5E2WL 2Q0ZX 1TEYA 2VABB 4HNAB 5L4MA 3V4VA 5JTWA 1NDTA 3ALWA 3O41A 3SKJH 3LQAC 4KDTC 5B1JC 3SJVE 4FL4B 1RVFH 1NBCA 2EJ7A 5LHDA 2C9VA 4UVCA 3UROR 2E27H 2EVGA 3RPIB 5JYMA 1N0LB 1JF6A 3G04A 4FQPA 3X3FL 4MA8L 2JCCF 1D9KC 4BWTA 2FAUA 3QIUC 2DRUA 1XT5A 3CGTA 4B27A 4IRJA 3BA9A 1F4XH 1QVOA 5IQNA 5JA9A 4J3TA 3MFFB 1XZ0B 4FTVB 5ESVA 1W0VB 2R27A 2YGVA 2OYKA 1SLUA 1F97A 5KVDH 5C8JB 2UXTA 4OU3A 1THAA 4QHPA 3WIFB 1FP5A 3QCVH 1NGQL 2YC0A 2EAEA 4NENA 4TVUA 4YFEA 1ZS2A 2IAMC 3K0YA 3LZNA 1T1WB 4UTBL 1JPGB 2LFRA 3FFCA 3IMVA 1GAFH 4J6IA 2Q73A 4HAMA 5BJTB 5D2LF 1ZWIB 3IAQA 2FHFA 3ZRXA 2X70B 3BYTA 4LGPB 4X99A 1RUML 2QHRH 2Y06L 1IAIM 2XYCA 3RFZA 3AS1A 3HKCA 4PRDA 1CD8A 1I3UA 1F56A 5C0BE 2AGJH 1MG3C 1J8RA 4B3SO 4P57A 4DEWA 4P3CL 3WJJA 1K4DA 3BZDA 1RERA 3CFEA 5E70A 3HMWL 4YMPA 4QT5B 2KQMA 1OV9A 1F1AA 1NCCH 3GINA 2LFSA 1IZKA 2ZF8A 1AKJD 3SZ6A 5BOZG 5IV2A 5KAFZ 4AYDC 4GSDH 3T0AA 1YPZF 3QB7C 4JFHD 2QPEB 5IYZA 2CH7B 4DV2B 3GJFA 3PL6D 5AZEH 4K8RH 5DLML 3UPCA 1VQPV 4JZ2A 2G60H 3GS7A 3KGUA 3ZDXB 4AGOA 4CC6A 2A83A 4F6RA 2VQ4A 1G1XB 4UANA 1ZLWH 1GM9A 3EO9L 4QCIB 3GIVB 4GJTB 3RIFF 3STLB 4AENA 1J9CT 2ICEB 4R97C 3OKKA 3DIDA 3TIDB 1IARB 4WGWB 3B5GA 3EOTH 3HA0A 4F80A 1C1EH 1LEGA 4EUPA 5AB2A 1NEZB 2DH3A 3MV8B 4YIQB 4F2MA 2GAZB 3BSZL 3IF1A 1HIMH 4PJ7A 1HEZA 3TT3H 1HHHB 1E2ZA 3LPOA 3QAZB 3R7RA 4FCAA 1ZLVK 1J87A 4O9HH 3QEHB 4YJZL 2J5LC 3FB7C 3EHBD 1MUJA 2EVIA 3P77B 5IESL 4GCZA 4MNGB 4H8VA 2F53A 1PVHA 2GIXA 3T1YO 2Y0IA 4QGPA 2CALA 4LHUA 3RY5A 3O9OA 2O93L 2P5WE 1N4CA 1DO6A 2LVEA 3D30A 4RWYH 2HKOA 4UM8A 1J1PH 4YHIA 5JH7A 5DVNA 1M1KW 3KLKA 2Q5ZA 2WAHA 3N91A 2QEXV 4N0FA 5GRZA 2R0WH 4UUJA 3AROA 3ILQC 4Y4HC 3NJLA 5C8YB 5I19H 2Z8VC 2DMXA 5I18H 5L2JB 3MXVL 3FOLB 4IL6Z 3FQ1A 1KB3A 4OLXL 1UFGA 4DGVH 4Q9BA 4Z7VE 3QUKB 3TWYA 1KXVA 1S9YA 3K57A 5CBEB 2CDFB 4YUEH 5BZXA 1AIFA 1KWGA 4DR1O 3UBXB 3U1SL 4F91B 4XPHL 1TUBB 3MNDA 4ZO8A 3GXDA 3T8MA 1MQ8A 3BVNB 4D8OA 4NUJB 2PTMA 4L5FL 2MJWA 3G6AA 5C0ND 4E41D 5KYXA 3HHSA 4HUCA 4HW6A 3GGWA 1O9WA 3ECBA 4XHJC 3ABUA 3WB1A 2WLIB 2BNRB