1OCCB

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
total genus 61
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1occB02
1KCBA 2DWTA 3X1EA 1NIFA 2BW4A 2OV0A 4DP6X 1DYZA 1ZDQA 1ILSA 2IH8A 2BHFA 5F7AA 2WO2B 2WO3B 1GS6X 4DP5X 2UXVA 3GDCA 1JZGA 5B1BB 1ASPA 1QHQA 1M56B 3ERXA 4E9TA 4YSAA 1AZBA 2WSDA 4YVUA 4AKQA 3KW8A 4G70B 4E9YA 3AW5A 1W6LA 3T6ZA 5PCYA 1JVLA 3QQXA 4AI7A 1PLBA 4BWTA 4G71B 1N70A 2XU9A 1IKOP 3S8FB 6PCYA 1NTDA 3FU9A 2PP8A 1IBZA 2XUWA 5I6KA 2DV6A 4HZ1A 4P5SA 5I6OA 2UX6A 3WNIA 4E9XA 2HRHA 2X87A 2YAEA 5LDUA 4NB7A 3S3DB 4HHWA 4ENZA 3CDZA 3FSZA 4QLWA 2VW7A 4YSDA 3FU7B 3NJHA 4HIPA 3CVCA 1HFUA 4PCYA 2EIMB 3NSCA 3T9WA 5B1JA 8PAZA 1NWPA 2IWEA 1XB8A 2XVBA 4MFHA 1KBWA 1PAZA 3SBQA 2PCFA 5AZUA 2DYSB 3PLYA 4WKXA 1KGYE 2IDFA 1X9UA 2GB2A 3X1FA 3WI9A 4G7QB 3FYEB 5IY5B 2GIMA 2QPDB 1AZRA 3FQ2A 4KNUA 1GS7A 5B7EA 5PAZA 3NP3A 7PAZA 1QNIA 2EIKB 2ZXWB 3GYRA 1BQ5A 3NJGA 2XLLA 5ANHA 2HLEB 3FS9A 1NPJA 2J56A 1BYOA 1B3IA 2PCYA 2IWFA 2W8CA 1UATA 3X2QB 2TSBA 5I26A 4RH4A 2IDSA 3CZUB 4JHUA 1SDDA 3UABA 5B1AB 2FTAA 3N55A 3ABMB 1BEXA 1TU2A 1JZJA 4YL4A 1RKRA 3CDZB 5AKRA 1AS6A 3QJRB 1AG6A 1M9WA 1GY2A 3GXUB 1VLXA 4E9VA 4GYBA 1NINA 2OCCB 4KNSA 1OOWA 3TBCA 2XV2A 2YAMA 4BXVA 4BDVA 1KYAA 3OM3B 1GY1A 1MG2C 4JKNA 4UANA 1J9TA 3UACA 3SBPA 2GSMB 5I6LA 2BWIA 2BP8A 4F2EA 6PAZA 4KO9A 2GC4C 3KW7A 3TASA 1RZQA 2IDUA 1ADWA 2BWDA 3H4FA 1SFHA 2Y1AA 4DP2X 4DP0X 1E67A 2VW4A 2XV3A 1WA1X 3PXLA 2XWZA 5D4IA 2FT8A 1NZRA 1NPNA 2HZHA 1IBYA 1ET7A 1HAWA 1TEGA 3AG1B 4E9WA 1XB6A 2I7SA 4YSSA 2VSKB 1J9QA 1GYCA 3G5WA 2VN3A 5F7BA 3TU6A 2FNWA 2EIJB 1A3ZA 1SDDB 2W88A 1BXUA 2Q5BA 2EINB 1BAWA 4GXFA 1PMYA 3EH5B 4E9SA 3FU8A 4A2HA 1AG0A 1SJMA 1MG3C 3ZDWA 1CURA 3FQYA 1AS7A 1L9OA 2XV0A 3OQRA 3S8GB 4A2DA 2MTAA 1R1CA 5B3SB 1A65A 1GSKA 4BDVB 3NP4A 3T6WA 3NJFA 1CYWA 3QJQB 2J55A 1PLAA 2BP8B 3QPKA 3UADA 2P80D 2BZCA 3NJNA 4YSEA 3FYIB 1AZCA 3FPYA 1ASQA 1WAEA 4F2FA 4NAJA 3EH4B 1KCWA 3EHBB 2B3IA 2Q9OA 2VMJA 3IN2A 5I28A 2HX7A 1KBVA 1GR7A 1URIA 2PPDA 2DWSA 4FAAB 4DP9X 3C75A 1PCSA 4HCGA 5TK2A 3WIAA 4BWWA 1A4BA 1OCOB 1ID2A 3BQVA 4DPAX 2YXWA 1WA2X 1AOZA 3QJTB 1FA4A 1L9PA 2IDTA 1FFTB 3DKHA 2B08A 4M4RB 4L0PB 4BK5C 1JZHA 2GI0A 4AX3A 4AKOA 1NIDA 4W1TA 2I7OA 1OCZB 1M57B 4YSOA 3WKQA 3AG2B 1OF0A 1GW0A 1OE1A 3CVBA 1XMEB 3CVDA 5I6NA 1V54B 2VW6A 4DPCX 3JTBA 3L45A 4TXVB 1IUZA 1L9SA 1JXFA 4AKPA 1CUOA 3IE9A 4YSRA 4A2GA 4BWUA 1ASOA 1KDIA 1NIAA 1RCYA 1KDJA 4Q89A 2CUAA 2HXAA 2YARA 5I6MA 1JZIA 2FQGA 3ABLB 1JZEA 2EILB 2QDWA 2GBAA 3HEIB 1ZDSA 4GP5B 1AIZA 1OE3A 2GHZA 3NYKA 4HHGA 2TSAA 1ET5A 2J5WA 2CBPA 3IBOA 2GC7C 1KV7A 1DZ0A 3ZX1A 4A2EA 3X1NA 2VM4A 3ZBMA 2FJSA 5EHFA 4G72B 4YSTA 4HCIA 1PZAA 3PCYA 3UAAA 1OE2A 3UGEA 3HB3B 1L9QA 1SF5A 2QPEB 1SNRA 4CSPA 2YAHA 3MBWB 3S3BB 4CSZA 2AVFA 1OCCB 3NJMA 1J5DA 5B1KA 1V10A 1WA0X 1AR1B 2YAOA 3DIVA 2IAAC 5B1JC 2ZOOA 3NJLA 1ZPUA 4YSUA 3PAVA 1AQ8A 2E86A 2YAFA 3H56A 1L9RA 2VSMB 1W8EA 3T6XA 4HALA 2JXMA 1CC3A 3PPSA 3WG7B 2FQEA 3NJIA 4NERA 5I5MA 1ZIBA 1I53A 2HX8A 3TBBA 3SBRA 1JXGA 3NJJA 1WS7A 2CJ3A 9PCYA 4X4KA 4GP8B 2XX0A 3OMNB 3SQRA 2CAKA 3ABKB 2PP7A 1TEFA 1BQRA 4A68A 3S3CB 1SFDA 3U25A 2IH9A 1E30A 5E9NA 1WS8A 2QDVA 2I85A 2PLTA 2FT7A 3ASOB 3H4HA 2NRDA 3CG8A 4E9QA 1SF3A 4GP4B 1NIBA 2AFNA 5I6PA 1BQKA 3ABGA 4DPBX 1PY0A 3MX0B 3NSYA 2BP0A 2HX9A 4DP4X 4KO5A 2QT6A 1NICA 2YAPA 4A66A 4W9ZA 4PAZA 4YSCA 1MDAA 3OD3A 3QJVB 4AZUA 2UXFA 4KNTA 3BVDB 3TA4D 2UXTA 4KO6A 2YXVA 3AG3B 1ZV2A 1TKWA 1A8ZA 1NIEA 1QLEB 2BW5A 2H3XC 3UAEA 1V55B 2JFCA 2PPFA 1W6WA 4QKTA 2BO0A 4YSQA 7PCYA 1MZYA 2AZUA 2Y69B 1EHKB 2UXGA 5D4JA 3EF4A 1A4CA 1BYPA 4E9RA 1AANA 3NSFA 3FSWA 1IC0A 1XB3A 1J5CA 1JOIA 5I5JA 3AG4B 1E5ZA 1JERA 4ZK8A 4UF7C 3WKPA 2HRGA 1JZFA 2DY2A 1ET8A 3FQ1A 1BXAA 3AY2A 3ZIYA 4KOCA 1E65A 3NSDA 1NDTA 1PZBA 2YQBA 4K9JA 4N8UA 3FPXA 4A67A 2CCWA 2LLNA 2CALA 2FQFA 4Q8BA 3X1BA 5D4HA 1NWOA 1T5KA 2OJ1A 1N68A 2BP0B 5B7MA 1RZPA 4WTQA 2N0MA 1SHXA 4F7KA 4KOBA 4N4YB 3V9EA 3PAUA 1EZLA 3EH3B 1PNDA 3V9CA 1SHWA 2R7EA 3OMIB 1JVOA 3JT2A 2DYRB 1PNCA 3T71A 4GY4A 1PLCA 1OV8A 1X9RA 5A7EA 1GS8A 4P5RA 2XX1A 4BXSV 1PF3A 2X88A 2IDQA 2FQDA 1J9SA 3X1GA 4HAKA 3DTUB 3D12B 2VM3A 4A2FA 4DP1X 5B7FA 1AS8A 1MZZA 2H5UA 3QJUB 3ASNB 3N2JA 4G7SB 3WNJA 5I5IA 1AZNA 3T6VA 1YLBB 3FSAA 1AZUA 2FWLB 4HCFA 3RYMA 2AZAA 2ZWNA 1JXDA 2IWKA 4JHVA 2XXFA 1BXVA 4M3HA 4DP8X 2P80A 1ILUA 2JKWA 2PPAA 3PAZA 3NJKA 3IEAA 3OMAB 4G7RB 1ETJA 1FWXA 2AANA 1A4AA 2FT6A 4YVNA 1L9TA 4KO7A 1OCRB 4DP7X 3FT0A 2XXGA 2BZ7A 2YAQA 2RACA 3IN0A 2MRYA 2XYBA 1HAUA 2R7EB 3NT0A 2PPCA 3FSVA 4FA7B 2H47C 1ZIAA 5AFAA 3AZUA 5TK4A 2ZONA 2J57A 1E5YA 2UX7A 2A3TA 2PPEA 4YSPA 3QJSB 4UAHA 5FC9A 4EF3A 1PZCA 1AAJA 2PP9A 1J9RA 3FU7A 1AACA 1F56A 2YEVB 1CYXA
chains in the Genus database with same CATH superfamily
5SWQB 3VBBA 4HUVA 1FGVL 2V7NB 5E24E 4NNYA 3ARFC 2RCVA 5GZOA 2BHFA 3UBXB 3CZGA 1N33O 2UXVA 2BS9A 3E8GA 4X6DE 3ETTA 3LB6D 4YSAA 5BR8O 1AZBA 2W95A 1ZE3C 2CHNA 2DH3A 1HHKB 3HKBB 3HZKB 2R9RB 2XPGB 3L3KB 2A83A 5CIPH 3AW5A 2QGEA 1S7RA 1N12A 5PCYA 3KGTA 4R6ZA 5B5EZ 2ZCKL 5F97E 2IXQB 2OKMA 4CL7A 5IVXF 1EGJH 4J3UA 4KTGA 3KEHA 2OMXB 2JMRA 3J81N 1OV9A 4LNVA 4ZDHB 2NPLX 1CLYH 2DV6A 4HYTB 4M7LT 4OCSH 4P5SA 4RVBA 5CGMA 5LHDA 3K71A 4PGCB 1A2YB 3SGEI 3N1FC 2A9ML 2ETNA 4Y5VC 3HI5H 3O3BA 1B06A 5IBTL 3S3DB 1NDGA 5AG2A 2XOKG 3NAAH 1K7DA 5IGXH 4MZ3A 2WNGA 1WAPA 1OAKL 1JWSB 1Z5LB 3IXTB 4GUPB 4KKAD 3U46A 5DD1H 5IJVA 1RHFA 1CFQB 5J89A 5FNVB 1SN5A 1XX9C 1JV5B 2IPTL 1TJIL 1UOVA 1EERB 1T21A 2DM3A 3D0LA 3LNEA 1P1VA 2CHXA 4PCYA 4OGXL 5HI4D 1X44A 1Z5HA 4K2UH 3LNFA 3MHZA 1BQHB 3BLPX 1I85A 4OIIH 3T4AA 4K0OA 1NCOA 2A6KA 1R5IB 3P3TA 1UVQB 4ZUUA 4OI8A 3ARQA 5KAIZ 4FYQA 1A7PL 1CQKA 3N06B 2MKLC 4PJ9C 3Q5YA 4PRPD 4WFGE 1KULA 4JHAH 1PKQE 2DQGH 4ENED 4GSUA 1HZKA 4K7PY 4MDRA 1JPEA 3D3VE 4TNVF 3D25A 2GIYA 4W4OC 3M1BB 2QPDB 3LN5B 4HIXH 4LLAA 4U0RB 3K58A 4NO2A 5LN4A 3OR7C 4WHTB 4XODA 1BIIA 1ZWIB 4AC4A 1N18A 1NCWL 4X5LA 2CGRH 2BNQB 1VCAA 1HL8A 3QH3B 4G7YL 1N0XH 3OWEA 4OCYH 5FV1L 5JPNB 3TZVD 4ZS7L 3AT9A 3AK2A 2V2XB 1IAIM 3TNNB 2PCYA 1T5XB 3B5HA 3JAWB 4LSQL 5I23A 5KYNA 4CMHB 3D36C 4HHAB 3MV7B 4N25A 2DJVA 4P05A 4Q52A 3RZCA 2KBGA 2L6LA 3FCGA 2NUTA 1JZJA 5H5NA 2ZXQA 4G1EA 5EDXA 4WFFA 1OSPH 2K4WA 1FXHA 5F0MB 1BA9A 1NEPA 1EXGA 4B9GA 2VXQA 3IC9A 5SX4I 2DQFA 4NRXA 4PS3A 2ZD9A 2BCKB 4GYBA 2CO4A 1EAPB 4B9FA 4I0PD 3IVKB 5EFIB 2FTKA 1LO0H 3KBFA 3BGMB 3CV5A 4MXQC 4H8WH 5KAFZ 1KYAA 1MG2C 2C4FT 4H1LG 2ICEC 4MVSA 5FL7G 5LP6B 1A0QL 4XOBA 4GG6F 3KCYA 4JYAO 1JGVH 3INOA 1RFYA 4G28B 1JTPA 2JK5A 4NSKA 3KW7A 3STLB 2WSSG 1J5EO 1KYOK 4GX1A 3W81A 2HG0A 3CFIC 5GRJL 4FLOA 3SYCA 1WA1X 2F5BL 3N43F 5HHVH 4QIRA 3WLBB 3V2AR 3U2JA 3TK1A 4XGZA 1SZXA 4TUOA 1SBSH 1J7VR 4KHPB 4XCCH 1CR9L 1DQJB 3O11B 2OL3L 2NZ9C 3CCUV 4X5XB 5H94B 3SO3B 4DGVL 5JQ6H 4FXKC 1E7VA 4XP6L 5E5LA 3QCVL 4JDEA 3FTYA 4LCUB 4YSSA 2F8IA 3GSUA 1QLRB 3CFUA 2IFFL 3QEQD 5H4YA 4BD4A 2ITCC 5DMGD 2HLFD 4LB8A 1T2JA 4TULH 1E4KA 5KSAD 4JI5B 1KEML 3QEUA 6TAAA 3NJVA 2WQVA 1OB1B 1VQPV 4WCEV 1IZJA 2FJFA 4TQEL 1TU2B 1LP9E 5AYUH 4HLJA 5KBMA 1IGJA 2OR9L 4GW4B 3TVMA 4QIWF 2YPLE 1YDPA 4I4TB 1N64L 3AABA 4N1HB 4ZFGH 3F7LA 5C6TH 4F15B 3EVKA 3V4VA 2ITDC 1RHHB 4GG8A 3WIHH 3T3MF 4AEFA 4M6AA 2UY6B 4GBXD 4IBWA 3WXWH 2F08A 4KXDA 3LAFA 1N7ML 3SGJC 3T1FB 3AS1A 5KG9A 2XV0A 1I4FB 1BREA 4U1JA 1MOFA 1ZEAL 3WEBA 2DQIL 4YY3B 1A65A 3LD8B 1AP2A 1JIBA 1IC7H 3BKCH 5DR5H 4EIGB 3C2AH 4W9JC 1P53A 2HN7A 3SD5A 5A2BA 1TJGL 4JFYB 4TNEA 3U79A 3FYIB 1SESA 2UZIL 1YEIH 3LEXB 3GSWA 4Y89A 4ONFH 3CFNA 4MLSA 5CMAA 2AMGA 2Z31D 2CJUH 3CZEA 1JR9A 4L05A 5ETUB 3IDJA 5F7LB 2NY2B 3M8OH 2AQ2A 3C5JA 2V7HB 4P23B 1XZ0A 1ZE3H 4ZO6A 4LLVA 2QSAA 3QCUL 1RSFA 5HJGA 1IBGH 1IGYB 1VACA 3VRIA 3X11A 1REIA 4EFBA 5HVFB 1AQMA 1SXZA 3E3QE 2XTLA 3QRBA 5CCKL 2QHRH 3KYOA 4Z95L 1AOZA 1QMUA 1VZIA 5CSZA 4M93B 5FYKU 2ICWJ 3MV9E 4PJ5D 1OWWA 2VUYA 4Y4KB 4FGMA 5HFLA 2DAVA 1HZHH 1T4WA 4FHBD 3EFOA 4U6VH 4PCSA 2DQ3A 3CC4V 3I6KA 1AI7A 1M57B 3AITA 4HS3B 4N0CD 3WIFA 4D8PB 3TFKD 1K4CC 3K5OA 4NB5A 2M8XA 2FSEA 3MRFA 5F7YC 4DGIH 5KSUB 3MCYA 2JIXA 5D7JD 2XQBL 4P57B 1E2ZA 3QDAA 1EZVH 3QWRD 3ULUF 3RVUD 1HH9A 4HIEA 5GONA 1EJOL 5CZXC 4DETA 4X9YA 1IQWH 4O02H 4XPAL 1CUOA 1FVEB 2D8KA 5BQ7A 3W39B 4BWUA 5IEHA 5E6ID 1K4DB 3CK0L 3SCMD 5IHZA 4FERA 3K2IA 4OJFH 1Z5WA 4MTFA 3ZO0A 1Z66A 3ARBC 1ES0A 4HU2A 4H0IA 5IFHH 3SJCC 3E35A 4U3SB 3RI5K 5GGVY 4AIEA 2EH7H 4PA3A 3MJ8A 1KF9B 4LL4A 4LNUB 2VYRE 4TQIA 1KU9A 4O4IA 4BFKA 1YJWV 4R5TA 4FYTA 1X5MA 2C7UA 1NLDH 4X64O 3QHFH 3HG1B 4WFHA 4QRUA 2BE3A 1A6UH 3BMWA 1S9WA 3CP1A 1NR1A 3EOAB 4QHUB 1TZGL 3Q8CA 3RWJA 2MCPL 2VITA 4U05A 3WO3B 1Y66A 4NN5B 1CK0H 1E1QG 2JTDA 3KLAA 1CD0A 2X6VA 2L35A 2YRLA 2YWZA 4GRLB 4CSZA 4WW2A 4P46D 5GRUH 4MD5B 2J8OA 3QUZC 1WA0X 4TKWA 4YHHO 1WZLA 2HVBA 2CH7B 4UVBA 5DFAA 2Y7QB 4FP8H 5TD4A 5EO1A 2Q87A 1RJYB 4JW3A 4LEXH 4BA8A 5L9DH 2FR4B 3T4YB 2PWHA 3ZMUA 4ABQA 3H56A 1BCCH 3K4DA 4FS0A 4EQ3A 3ZRWB 3ZZLA 1D9KD 3A4AA 4XNXL 1U8NB 4U6XB 1XH2A 3F5WB 1SQQH 4DK1A 3OJVC 5HI3C 4W4LA 3CMEV 3CVIH 4RFOH 3NCJL 1ZAUA 2L7EA 4RRPA 1HL5A 3HA0A 3MHHC 1AMXA 2G60L 1KGCE 5F9WB 1FN4A 2Y4SA 4WSJA 1TYRA 1B0RA 4NXSA 2DWDB 4F4LA 4KI5E 3OPZL 4HK0B 2FX7L 3CHOA 5FK9B 4G43A 1FD9A 1C08B 5CFAA 5F71A 4OGQB 3R7RA 5LGHL 1HJBC 5FLXN 5I1JH 4UQEA 4R7XA 2X6BA 4NHCH 2DRUA 5D1QB 3H4HA 4W9LC 5JXED 5LOVB 2MQ0A 4JE4B 1GL4B 3V0GA 1OGTB 1T1YB 2MMXA 2VDNH 1IBDA 3FTGB 3KPLA 5BUPA 1KCSL 2CNZA 5D1XA 4QYAA 3T8VA 2H4EA 5K39A 3JASB 1LK3L 1B9KA 3EJUA 4O4JB 1HWHB 1PW3A 1T80A 4ZW8A 4KI1A 5IF0B 5J5EA 1N67A 4Y7OC 2NY1D 2R4RL 3OD3A 3MRNA 1DUZB 1XQ8A 3ZKMD 3S8WA 4NRYB 5L2KE 1F6FB 4S1SH 5GRYA 3O6FA 2O30A 2JGDA 2H26B 1V55B 2XG5A 4HXBL 5EF1A 1UZ8A 5HVHC 2ADGB 1AO7A 4QKTA 3SN6N 4BIZA 4JVPA 5B66Z 1J88A 3CBKB 3SJVB 3JVGA 3VRLE 3DMMA 5HHMB 2Y69B 3QO7A 2UXGA 1Z32X 4QRPB 2VL5A 4XVSL 1F41A 1MI5E 3CHSA 4HC1H 2YGVA 3WEAA 5KYYB 2Z93B 4APQD 2OI9C 3P0YH 5ESVA 5GSRA 3GXTA 3QO8A 4M6NH 3TA3B 1R3IH 2LQRA 4F20A 1JZFA 2LO1A 2UXNA 1JWUB 2F74A 4QT5A 2HP8A 4XH2A 3VYOA 4P8QA 2OK0H 2P5WD 4P2QB 5FA4A 3L74H 1RPUA 4G8EB 2ZIOA 4UBDC 4JFOB 5DD3H 4HF5L 1Q6HA 4LHUA 3TJEH 4HGKC 4PGJA 2N7BA 1GCFA 3VFRB 5C0FB 5JLZA 3THOA 1KPUA 1S9YB 4NUQA 1RU9H 4D7SA 5L3FA 3X1BA 3SYOA 4Z7VA 5H9CA 1HCVA 3H9SB 1FNSH 1H38A 3I55V 3VXMA 4K35A 5I30H 2WTRA 1EFQA 2MNUA 2O61A 1TZIA 1XAKA 3C09C 4P5MB 3WGVB 4EI0A 1CVSC 4FX5A 4V1DE 1CE6A 1Y74B 4XNYL 5CEXB 3E86A 4DO2A 4WHYH 5EIVA 2R7EA 1TKWB 3DROA 2Y5QA 1I8MB 1IBKB 3MNWB 3QDHA 5E8EB 5E2VL 2FAUA 5MERA 4P4KB 2HR3A 5TQ2L 1YPZF 4BCZA 4F7CA 4HIJA 5IR1A 2AI0H 5JWPA 3RWGB 5IJDC 2YK1L 2L0DA 2AQ1A 5I75C 4X2UA 5IVXE 1GKEA 2E74B 1RUPL 1FNHA 2DQEL 5JIIA 1ZAGA 3VSUA 4RUFA 1IM9D 4BE6A 2ODHA 4HAKA 5F3BB 5IT2L 2F54A 5MENA 4NHUB 5BOJA 2H5UA 4GI6A 3QJUB 1A25A 4ZOEA 4AYFB 1YVLA 2IO5A 2BC4B 4N5ED 4P2RA 4AEIH 1QA9B 4XCEB 1R33A 2FWLB 1NZ6A 5M94B 1J87A 1G1YA 4DP8X 4OJYA 2GEQA 4LBEB 4G82A 1T20A 3BAIA 1Q81W 3MRCA 2P24A 4BZYA 1O7DE 3SE3A 2WXOA 3GB7B 4N2MA 5KSBA 4WI6A 5HYSA 2X1OA 4I0CC 4EDWL 4PRHA 1WWCA 3CMOH 1OCRB 5DVLA 4DP7X 2QQNL 4I50A 4RAUA 3W7SA 5DEFA 4Z6AT 1CG9B 3LNHA 4D0CA 3ARYA 3DSFL 4EKWA 3KLHD 4JGJA 5TK4A 5DFVD 3BPOC 2AABL 2J57A 5C09A 3WY2A 3Q9PA 4KU1A 3FQRB 1YYLL 5JIMA 3WDIA 4KK6C 4LSDA 3RDTB 5I0XA 2XTAA 2EDTA 4MZ2A 5GTHZ 3WTXA 4MBRA 4KXZI 2GTWA 3DPBA 2YBGA 4HQQH 4ZZFA 2IANA 3W0WD 2F8VA 1US6A 2G9HA 1A3LH 3QFGA 2WO3B 1IBMB 2N59A 1D5MB 1XT5A 2WP3O 5I8EB 2DLGA 3T2MA 1M56B 1KXVA 4KVPA 4D7PA 5FYJD 3IDXH 4HKZB 1JFQH 5BO1H 2WIMA 2LW3A 1N59B 1M4UA 4UUJB 4JKWA 4TSCH 1HHJA 3HMXH 3TO4D 1AKJD 2PY5A 2KPWA 4Z1VA 3Q6FB 3Q8EA 5EZPA 3B9KA 2G2PA 2ZUQB 5FFOA 1JVLA 4BFBD 3PV7A 4M6OL 4N8VG 2F1EA 2P52A 2ADFL 3OBAA 3PWLB 2XU9A 1IXMA 5D71L 1UUNA 2IGLA 5IVZB 3IF1A 3C6SA 4NO3A 4AM0A 3NTCL 4EIZC 1QI4A 3QWOB 4TOYH 3BPLB 4R3SB 1FFPB 1R46A 2J6EL 2HRHA 2BNRB 5IM7B 3S3JA 1XF4B 4FADA 5T5NF 1D7DA 1VFUA 3FRPA 2VL4A 4GG6E 4Y16B 4GMSL 4RQFA 2R1YB 2Y7OA 1KCRH 3D0AA 3FRUB 5I76B 1WB7A 2YEZA 4JKPH 4LHJB 1JDCA 5DD6A 3HHSA 3FC8A 4Z0XB 3F04A 3NH7L 4Z5RB 3IMUA 3ZN0A 4NUJA 3WSQL 1P5UA 2ZE0A 2YDEA 4RISL 3GO1L 1KBWA 4P3DA 4X5PA 1H3VA 4LVOC 5CD3B 4LF3B 1JYWA 4MNHA 2RFXB 4WKXA 3UJTH 5CBGA 3CCHB 1R3JA 3INUH 3BUYA 1IX2A 2UY7A 4PWFA 4HA1A 1A32A 1OGPA 4G7QB 2ZNIA 4HDIA 2OSWA 2GTQA 5LGJB 1DF4A 3EOBB 3SE8L 3UYRH 1EBPA 4CKQA 2UUDK 4PJDA 1HHIB 1JCKA 1NBQA 3SGKA 1BVNP 4DV5B 3NP3A 3VFSB 3ZIMA 2E75C 2WXLA 4U2ZA 3CS5A 2EIKB 3DX6A 1ZT7A 1ZJAA 2R9HD 4MA3B 5C8JA 3O4LE 5C08A 3N40F 5JQGA 4QHPA 4FCHA 3T3ME 4F6EA 4HNAB 2A5UA 4X9FA 1JWMA 2LLGA 3DIFB 5K9OA 1VGEL 4MAYA 2F0CA 4G83A 1LNUA 3MAWA 1UTDA 1MIMH 4IMLB 3LKPB 1MFNA 4JN1H 3WV0A 4NJAL 2DMBA 1SDDA 5HHOA 3L72H 1V27A 1CLZH 1BEXA 1NGXA 4XPBL 4YL4A 5MEOA 3G04A 1IFGA 3L4ZA 1MF2L 3MQIA 3B43A 5I9QB 4L0ZA 1I7FA 6FABH 1HS6A 4BSWA 1BZ9B 4FLXA 3FU0A 5J6GB 1NC2A 1B04A 4WU5B 1A5FL 1F4XH 1KXHA 4FQCL 5I5RA 4ICGA 5D5MB 5DI8B 5DMIH 5C07D 2Q7YB 2ZKHH 4HIHB 3NIDF 4M1CC 1A6TB 3GPEA 4LPUA 3NGBB 3UM7A 4XX1E 1F90L 4GFTB 4HISA 1TITA 2OZ4A 1U3HB 4Z3GA 3FB8A 3IFLL 4AQ1A 3L5IA 1J1XH 2WWKO 4WUKL 2H8PA 4XN2A 4FTDA 5G4MA 5B39G 4DEWA 2NYYD 3THMH 1G4RA 2FJUB 3ABZA 4G8FA 1EXHA 3MJ6A 1FNEB 2D9CA 3FTUA 2XVLA 4PJ7B 4W9HC 3LSSA 5DJ8A 2PWEA 1QZNA 5KS9A 1BGYH 2M6YA 2A06H 2VDLL 4D0BB 1Q3EA 1T22B 2NMSA 1BSMA 4DP0X 5AVTB 2EEXA 2BIOA 3QI9C 3F58H 2OMYA 4I18A 4RMVA 1T89A 5A16B 4UNIA 4KV5F 2ERJC 1TETH 2NQCA 4XC3H 2V9RA 4BZ1L 1J8HD 2AGJL 3EOTL 4JO1L 2ICES 2J1YA 1XL4A 5EUOF 1BZ8A 4LMQE 2VN3A 4RFNB 3UG4A 2EIJB 3HJEA 1YJ9V 3ASWA 1BS3A 4JF3A 4YDZA 4JZ2A 5FDWB 3QG5A 5I16A 1JS4A 2HH0L 4KHPO 2J8HA 1N0LA 1I1CA 2Z8VC 3GRWA 4ODWA 5TGBB 2HPOA 5C2BH 1B88A 2HLFC 2DTSA 3LZFH 2H1PH 2OMZA 1AG0A 4EKXA 2KH2B 4CW1B 2A0LA 1S7TA 3SY0A 3FUDA 3LH2L 1ZLUK 3LIZH 4B3VA 1TG8A 3JVFC 4MNQD 4JI5O 3OQRA 5KVMC 4ZTPH 4BRJA 2OT5A 1HCZA 2WQUA 1A7OL 1NCDH 4W9IC 1EO8H 3FT3A 4GBXC 4QXWA 2A1WL 5CB4B 5JOPD 2VJ8A 1QKZH 1FFRA 2R0WH 3IRPX 3EZ8A 4PRPE 1TZOA 3B6SB 5FYKH 4OFYA 3HKEB 3C5ZB 3BH9B 2K4AA 3O6ML 4JL2A 4PW4A 4UINH 1G1OA 4NAJA 4UCOA 3CLFL 3HCVB 5F9OH 5AW3B 3S35L 1VPOL 4HPHA 4YY3O 5I28A 1KBVA 1SLWA 4BFEA 4DR6B 5DURD 1XIWA 5E2TH 3GIZL 2MOGA 1MUJA 2VMFA 1R24A 3D39D 4LDLB 5BV7L 3RWFA 2Y2TA 3HKCA 2Z31C 5KHHA 1UUSA 2ZWSA 1EVUA 1MXDA 4DQOH 1K3ZA 2ADPA 4R7LA 3OUSA 4KTEH 5D7LA 3V4PL 1RMFH 3CC2V 1PDKB 4KKCC 1D2DA 4G6ML 1FFTB 5HGDB 4K5OA 1ANUA 2WVVA 1FFNB 3GBNH 2R1XA 1IAMA 2J5LB 4XAWH 3I9GL 4NFBA 4HGWB 4QYOB 4FNSA 4L3EB 1YPZB 5DEGA 1WDAA 2HWZH 1FO0B 2ADIB 4KDTC 1DL7H 4W9DC 1X59A 4NKMA 1OE1A 2P5EA 3NA9H 2DLEA 1Z7JA 3BWUF 3CVDA 1GYVA 1RFDH 2YIAA 1DSWA 2CA3A 2JELL 4LU5L 1ROCA 4RGNB 2HRPL 1ND0A 3BKJH 2YGNA 4WQOA 4P04A 3LPGA 2WYIA 1UCBL 1AFVL 2EO9A 4PJ8D 2GT9A 2YMOA 2GUZA 5D7JC 3S37H 1USQA 4A2GA 5BV7C 2Z7UA 2CA4A 3MJ9H 3MRQB 1GGYA 4QHNB 3RVUC 4C56D 4B9CA 4U2YA 5L9DL 1LR1A 1AC6A 4Y1AA 1XCQA 1URLA 2DDQH 2IMNA 4Z7AA 1OTTC 4JJ5B 3ZHTA 1ET5A 2J6WA 2QLVB 4NI3A 5DEZA 2FCBA 5I0VA 1EMTL 2ZINA 3RWEA 1G6RH 4JZJB 4LARH 5CBHA 4PR5A 4K3DL 4OAWA 3CCMV 2W60B 1HT6A 4JFXA 2AJVL 3VI3A 5E7FA 3SDYH 3ZS8C 3APCA 5IQ9A 3MNDA 1HNFA 3JV6A 5ILTL 4F8QA 2XAJA 2F15A 1SGKA 3QP3A 4GAJL 3OXRA 4AYDC 3UGEA 1PZ5A 5FLUA 5IJ0A 1JPFA 2RA1A 4NPYB 2H2PC 4QGYA 4RAIA 2YMXH 3QEQE 4TVPD 4WTXA 4LP8A 3AWEA 2NX5D 3WFHB 2D03L 1AHKA 5I1DA 4IHJA 2NR6D 3QFJD 3HE7D 4OCXH 3AJ7A 1YEDB 3KWWA 1NT2B 4J27A 1UXLA 3T65B 2E6JA 4R90H 4P46C 2YAFA 3K81A 5JHDD 2W9DL 1GSMA 2HG5A 1VFBA 5DECA 4ZXBB 4QXUL 5LAXA 3T6XA 1A1OB 2K8MA 1OZTG 4BA0A 3DOIA 3PNWA 3BUPA 3L7EB 3QNXB 2FH8A 2QSQA 2HVJB 4HPOL 2Z6FA 4B9KC 3GBDA 2AMUA 5KJRL 2DW4A 3JBG7 4XHJD 2FEEI 2N7AA 1D9KC 2G0KA 3NZ8A 2UUBB 4KKBD 2A9NL 3AM8A 4JGUA 2WGXA 1XEQA 4B7IA 2QKSA 4DUWA 1CFNB 1TIUA 4UB0H 4U33A 1BQRA 1NANH 2C1OB 4MJID 1MCWM 5T33L 2V2TA 3K57A 3HPJB 1F18A 1XH0A 2Z91A 3OKMB 4R9HA 2MHAB 5TE6L 1MKFA 2CPUA 1UWGH 3PGFH 3T0EC 4FLWA 1JAEA 3AREB 3L3OA 4PYGA 1JGUL 1YECH 3ZKQD 3ZE2E 1P4LB 3QDGE 3UG3A 3O9WB 4YHZH 2A6DB 1CT8A 2EINC 3PDOA 3MUY1 1UJ3B 4IRJC 1MQ8A 1FLTX 4I88A 2I07B 4PJ5E 4CNIA 3FCUB 1IM3A 1N3NB 2WQAA 3WS6C 3UZEA 4I2XE 2R29L 2BRQA 1F4YH 3DGGB 4Y5YB 3V0IA 4YSCA 4WTZA 5DJAA 2VLKA 1H6UA 4KNTA 5IWLC 2A6IA 4XVTH 4POUB 2MOVA 2VLLB 4XMVA 3SBWC 1QLEB 3FAXA 1NFDA 4YDIL 3C8KA 4Q2ZB 3IDMA 4PJXA 2Y4UA 1BZQK 2PTVA 3DX8A 1W0KG 2HKOA 2W0XA 2JB6A 4H0HB 5DS2A 3BFOA 3BLBA 1WAAA 3ES6B 1UT1A 3UDWC 4LT7A 3GSQA 5ECJE 4J3OH 4LCWA 2VCOA 2EUVA 3MLXL 3R06B 3VXSE 2XUMA 3KPPA 1OAXH 4UQAA 2F7OA 4A5UB 4J3VA 5F89A 1F4AA 3FSWA 4PGZA 3UROR 3ALPA 5FDYA 4TLSA 2NY0D 4UF7C 4DZBA 3BJLA 4NZDA 1MG1A 1SQPH 1J5IA 3GSOA 4DV2B 4WO0A 1M6UA 3WTYA 2JSFA 5C0GA 1KBKA 1VENA 2BSRA 2XKNA 3MCLL 4LAQL 3OWRA 4FQQB 1SQXH 5L3BA 1RJLA 1BXAA 1YEFL 4S11A 5CGYD 4BH7A 1SRDA 5HFMA 1J0JA 1UWFA 2JJUA 3ZUCA 3RYIB 4MCYA 4GQRA 3FQ4A 1BJMA 2JKXA 1YN6A 1MAML 3R0NA 2UVEA 5FHBL 4DKEL 4RNRA 5I66B 1T1XB 2VXSH 3PJLA 4KHTL 3LSOB 1BGXH 1S7UB 3ZMTA 4EKJA 1OCZC 1JV2A 1WCQA 2V4DA 3BVWA 4PGEA 4ODHH 3RYFB 1RSYA 5IWAB 1WD8A 3BUQA 4N4YB 5GZNA 4W4NA 3IJEB 4JL1A 4H7VA 3VG9C 5GGVH 3V9CA 3T1CA 1EEQA 2ED7A 3DUSA 1CDIA 4KITB 5I73B 5H2BA 4FL4B 4PI2A 1L8DA 1J0HA 5CEZL 1BWWA 1F5WA 5HHNB 1MW0A 3OKKB 4LVNB 4MVRA 4XPGH 5GS2H 1YCSA 5BZXA 2ETWA 4F58H 1TUEB 3NFNA 5AOMA 1YN7B 4NKGB 1MCJA 4CN6A 2PO6D 5SWQA 3GMLB 3ZZQA 5BW7A 2YQ3A 2V7NA 1R5VB 3BZFB 4U7SA 4CBZA 4X7SH 1IBKO 1KCUH 4IW4C 3NK3A 4YFDB 3UBXA 1QG3A 5B7FA 3E1F1 1SQFA 3ASNB 5EO9B 2WQXA 2BMKB 1I8UA 1JD7A 1HHKA 3HKBA 3HZKA 2XPGA 3L3KA 1XGYH 2DF3A 2B4CC 3GWJA 3GHBL 3FSAA 2PYJA 4S1QH 3UJIH 3MR9B 2XNDG 4HEPA 3BUBA 5KBNC 4WWKB 1ZHNB 3DK2A 4K3JH 2ZDIC 1SUJA 2EJ7A 1WA8B 3KXFB 1TVHB 2IXQA 4UI2A 5IROC 2ZCHL 2OMXA 4OZFH 5D4QA 3B7UX 3RURA 3VXUE 2WP3T 3W9DB 4G7RB 4DYLA 2V17L 2FD6H 4ZDHA 2Z7WA 1QTSA 1CF8L 2IOOA 4DR1B 4KK8D 4YVNA 1M7UA 4PGCA 1A2YA 5J0BA 1JG9A 3ARPA 1K5QA 1LWJA 1Z5LA 1JWSA 4NQEB 4YOKA 5L0QB 1ZIAA 3IXTA 3KH3A 4GUPA 3QJFB 1CFQA 4A6YL 4BQ6A 5FNVA 3SIKA 1FNAA 1JV5A 2A3TA 2X41A 4EUPB 3MGOA 1RUQL 5LMUB 2RQ8A 2YEVB 3QDMB 4FTVB 5GS1B 1GJWA 3CHPA 4QMEA 4R84A 4DO4A 4JO8A 1R5IA 1XXFC 1UVQA 1ZDQA 3ELAT 3S96B 3B2XA 3CCRV 1E5CA 2Q3XA 2WQSA 3Q5OA 3WJLC 1J0YA 2FX9H 4JQVC 1R5WB 3ARDC 1ASPA 3ERXA 4E41B 3QQ9D 2ZP8A 1ZSPA 4AJ0A 1QR9A 3LN5A 3M1BA 4YVUA 4ELMF 1OT4A 1W6LA 2Z0BA 4GXVL 1J12A 2H0FA 4JDTH 4L29B 4WHTA 2XBZA 6CGTA 1ZWIA 3N41F 1IBMO 1E4JA 1PLBA 1ZLDA 2NTFB 3BGAA 3GM0A 3VI4F 1LGVA 2BNQA 1NLBL 4ODUB 3QH3A 2VR6A 3ZT7A 1H2LA 2VDPH 3PPEA 3GUFA 3TO4C 5JPNA 2HT2D 1QRND 5KYUB 2V2XA 4I0XB 3TNNA 5HDLA 3RZWA 1NH2B 1E9OB 1T5XA 3RPKA 3JAWA 1Z3RA 3L9RB 3WELA 5I6OA 3QRGL 5KVEL 2OMWB 5EC1B 4HHAA 1MZEA 3MV7A 5E4EB 5I1EL 3FFDB 5AVYB 4OIFA 1OAQH 2XWDA 4AUJA 4TRPH 1FCCA 4XMPL 1TQVA 3V0FA 3B2MA 4K9EH 4JUSA 3LS5H 1F13A 1R3LB 3FSZA 4QLWA 3TX4A 3CWGA 2IJJA 4HIPA 3U7YH 1RVFH 3F7YC 5B1JA 1KJMB 2BCKA 4QE9A 2QVKA 2I9LB 1EAPA 2WW8A 4KV5E 3IVKA 4NQSB 1PCXA 3RN4A 5EFIA 3Q6GH 5AZUA 3BGMA 3PLYA 1AI1H 5EUOE 1VRSA 1DVQA 2NY6B 2X0UA 2ZM6B 3QR0A 4L4VD 4MNGE 3JV5A 5LP6A 4E2OA 5BO0D 5EU6D 1KELH 3FFCB 4BINA 3H55A 4GKLA 2GK0B 3STLA 2GIMA 3ALXA 4Y9CA 2WBJD 2OYQA 1KV3A 4LRNL 4N2BA 5B7EA 2QADD 1EANA 1KY6A 3KJ4B 3GSNH 3MHSC 3LZQA 2F9BT 3TTSA 3WLBA 1HSBB 1QX1A 5ID0B 4CH4A 4HS8H 3L4XA 1FG9C 4IU2B 2XLLA 1DQJA 3O11A 4X5XA 5DK0B 5H94A 1MWAL 5IQ7L 2ZX5A 4FFVD 3X14B 3UXFA 3ZR6A 4LCUA 2WWKT 3GK8H 1QLRA 4DV5O 5I2IB 1HL9A 4QUOA 1PZDA 3G6DL 3P0VL 1NMBL 2VDML 1OB1A 1TU2A 5F96H 2DTMH 4GW4A 1AQHA 4ABVA 4I4TA 1ETB1 4LF8B 4ZRGA 4JFUA 2WXKA 4G9FB 3VO0A 4XVJL 3ZJAA 1RHHA 3RIAK 2UY6A 4AILC 3B7SA 1PVHA 4TF4A 3ZZSA 1QWUA 4H8UA 2XA8L 3T1FA 5E08L 5JYLA 1I4FA 1T2XA 1UM4L 2XI9A 3RQ3A 3TEYA 4YQXH 2VQUA 3W0WE 5DD1L 1Y7VA 4L8SB 4ZUVB 1ZVSB 2AXFB 4RGMC 2APFA 5CZVL 3GT6A 1HW7A 4JFYA 2IJHA 4OLUL 5H37G 5FYJE 1PFCA 4H44C 3LEXA 3BWAB 3IKCB 3VD7A 3N0PB 4OIIL 3E8UH 2X6UA 1LWHA 2AJUL 5ETUA 2CCLA 3DARA 3QUMB 4JQIL 3U4AA 3PHSA 2V7HA 3CHXA 2FIKB 4P23A 2XWZA 4LFBB 5JW4M 1IGYA 1SZNA 1I7UB 4QWWD 1DP0A 3OZLA 2BCCH 4E9WA 1E9QB 3BN9C 4PLJC 5DRZB 5F7BA 1BAFH 2CM5A 4JLRB 3ZE0F 3H7LA 1FLRL 1EDHA 2X40A 1GYWA 3PUUA 4P07A 2DL2A 1B6DA 2ZICA 3GI8L 2R8SH 4JRWA 2H32B 4Y4KA 2F43G 3CPUA 2O93L 5DJZB 2OJZH 5BVPL 4HS3A 4D8PA 4DKTA 4N8CL 5F44A 5KSUA 2F95B 3OZ9H 3KEDA 4JGMA 4P57A 2XIBA 7FABL 2Z8RA 1KGJA 1MCOL 4PV8B 4GYCB 1G84A 2EC9T 2C5DC 3KAAA 2HFGL 3QNEA 5FUOH 4ZW7A 4WWPA 4YLCA 1FVEA 3NP4A 1PL3A 4XNQB 3W39A 5IYDO 1K4DA 1Q0YH 4XPHH 3CXHK 4PU2A 2VH5H 3RVTC 1ECYA 1NAKL 2Y1ZA 4RMQA 3F7KA 5HDBB 4C83B 2UWEF 3B56A 1W72L 2ZJSL 3L4WA 4U3SA 2EDRA 2DQMA 1DVYA 4RMTA 2X28A 3IN2A 3PHAA 4P5KB 4MMXC 4LNUA 2ZCEA 1NMCC 1CS6A 2DD8L 1GR7A 4J42A 3BHPA 3QA3B 2JJSC 4H8WL 2AQ3A 4RMUA 3HG1A 3X3FH 2GTSA 2YSUB 1Y1UA 2IC2A 3BD4A 3EOAA 4QHUA 4BWWA 1H2MA 1FE8H 1XUQA 3QR1A 3MLRL 4BUQA 2Y7LA 3FHQA 2VWKA 3F64A 2IDTA 5T5FL 1QPXA 4WFED 4A37A 4DR6O 4Y2NA 4GRLA 1ZLVK 2DZEA 2ESVB 2Z0AA 1QEWB 4MD5A 2HA1A 5C70A 5JR1L 3UAJA 1ZTXH 2XTJD 2CH7A 5DN6G 3GJFB 1CLVA 2Y7QA 2FR4A 1ORQC 1RJYA 2VSCA 3ARRA 4UT7H 2XN9D 3T4YA 1V54B 1BQLL 4LIQH 5D93C 2FX8H 3DXAB 3ZRWA 4HK3N 4O2FB 1T6WA 4HJSA 4TULL 4QOKB 1U8NA 4APXB 5C9KA 2QWNB 5ITBH 4U6XA 2JJTC 2EDQA 3WB2A 3F5WA 2Z7YA 1DGSA 3CZJA 1GGBL 5CSBA 1KDJA 4TVPL 2YARA 5EU7C 3V6OA 2ZCZA 4AG4H 1AC0A 3CLEL 3S4SG 2DWDA 3NYKA 4JY4B 3V10A 4HK0A 3KM2A 5DRXB 5FK9A 5E1AC 5I1HH 1U3NA 4JRXE 2OMVB 3HAEG 1C08A 3IBOA 4CA4A 5EOQL 4EXPX 4B3RB 3SOBL 4P59H 4M7LH 2F19H 2CMRH 5D1QA 4HFUH 5EEYA 4R7DB 4LPVA 4A04A 2YPVL 1DE4B 1DFBL 1SY6A 5LOVA 2BNUB 4OJAA 3X2QC 1J8HE 3BH8B 1OGTA 1T1YA 2YMTA 4FQ2H 1S3RA 3FTGA 4BFOA 3MZGB 3N91A 1TJMA 1BHAA 1SNRA 3QCTH 4K73A 2B8OT 4UXNA 4MVBD 2VR3A 1MSPA 3LYRA 1OP5K 5BUAA 3JASA 4X83A 2ATKC 1YO4A 4O4JA 1SM3L 3D2UD 1IGCH 4LEBA 3L3DB 1CVRA 4PLOB 5IF0A 3GWKC 2VDKL 3EGDB 2YAOA 3JUYA 3K4AA 4WEUD 3UTQB 3NJLA 1W8OA 3GLEA 2XAGA 4EVNB 4YEFA 1DUZA 4IBLT 2ITEA 3ZX6A 3FQNB 4G5ZH 4NRYA 2X09A 2PYEE 5BMFL 4NWUL 2B1GA 4L8JA 1I3RB 3DIDA 2IPUK 2G3XA 5FYKD 4MNQE 2H26A 4Z18A 1YG9A 3JD3A 3HBQA 4YXLL 2ADGA 5LXGH 3WYRA 3H9VA 1EZJA 5LN8A 3Q2VA 4OZIB 3SJVA 4GX0A 4KZ0A 3ZQXA 5JOPE 4EPSA 5EWIH 4QRPA 4GP8B 3V0JA 2O6FA 4GFXA 2J88L 1XTMA 4XNUH 1A7QH 5CGTA 3ZDXF 1TPXC 3ARFB 5F1IB 3HFFA 5KYYA 2Z93A 1SZTA 1TFHA 1JJOA 3N41B 4G9DB 3NG5A 4D2NA 2OIEA 4PJAB 3TA3A 4MJ5B 1J1PH 2DLFL 4W6XB 1TLKA 3VD3A 2UUBO 1U3ZA 4L9LC 1JWUA 4YJ3B 3D39E 4KUCD 4IRZH 4PVMA 5HYJE 4P2QA 1WGOA 4N23A 4G8EA 3RE0A 1CGXA 1WIUA 3G5VB 4JFOA 3K2UH 1EFXB 4AQ8C 4R4FH 3VFRA 5C0FA 1Z6JT 2QM4A 1UOWA 4NYLB 3QW9A 2G38A 1S9YA 4WO4D 1G9ML 4KXRA 3QARA 4XDJA 2LU5A 3H9SA 5DDHB 4E9LA 1QQCA 3LS4L 5I71C 1T7YA 4LPYA 4YHYC 3HVDA 4L5FL 1M1KW 1AGEB 4P5MA 4PAZA 5DZLA 3POHA 1K8DB 5IFJB 3IJ7A 2G2RB 1UFIA 2NDGA 5AVXB 43C9B 5CEXA 1Y74A 3FCBA 4PB9L 4IOSA 4F7MB 4Y5VB 1TKWA 5CP7B 2Q7AA 5BS0B 1I8MA 4YIOA 3MNWA 5E8EA 1K5SA 1F45A 4RWUA 4N2FA 4P4KA 4XPTH 1LO3H 2A4ZA 5IW3A 5CILH 4F92B 1MW3A 5AW0B 4OCWH 3RWGA 3MJGX 4D9QD 3QUXC 1YQVH 3A6CH 5LBVA 4IOIB 4C56E 2V5RA 2BVQB 1JVMA 4FG4A 3BRDA 1KB5L 4TLTA 2Z1KA 5F3BA 5LGUA 1G9MC 3MFGB 3MOQA 4PJ9B 4NHUA 4FI6A 4AIXA 2VXQH 4AYFA 4F37K 2HRGA 1INDH 2BC4A 2ED6A 1UH3A 1QA9A 4AUYA 4XCEA 2CH8A 2NY0C 1O9HA 3W11D 1PL0A 1JPST 4MAZA 1SS3A 3OR7B 4JPIB 1RV6X 1MAJA 1GZQB 1E3XA 4ISVB 3PWUB 5CGYC 3MJ7B 4LBEA 2WN3A 3EJJX 2EXYC 4NYKA 4DV2O 3H1JH 4XBMA 4AZ8A 1DJHA 1PD3A 3RA7L 2NX5E 1S5IL 3GB7A 2CKBL 4Z76B 2YFNA 3CX5K 4JRFA 1KJ3L 4JR9H 4KOBA 5AKTA 1XD1A 4M48H 2D31B 1Q90D 5IREA 3P30L 3I6GB 1CG9A 2AJ3B 5ADPH 1ICTA 3I3EA 5JHDE 1BWMA 1FVDB 2PW1B 3EGXB 1X7SA 4UMGA 5EU5B 4ELME 4ERSH 4PVNA 3OEEG 4HGMA 3FQRA 4X4MA 2WSPA 1IURA 3GNMH 5IWAO 1PLCA 3CAFA 4NM4L 3RDTA 5CJ8A 4YNYB 3VI4E 1SJEB 1I1AC 5KVGH 2FHFA 4PWEA 3VUAA 2FQDA 4S1SL 1DVFC 5DJ0B 4U1NB 4N6RB 3V9FA 1YY8B 1D5MA 3L3GB 1KCKA 2PO6C 4J7RA 3BQUD 3FO0H 5IJCC 5D2NC 1BBDL 2ICEB 4YFLF 3U6XS 3V4VH 4MJIE 4HKZA 1SQMA 3AY4C 5AVRB 1YLBB 1N59A 3TWCH 2OS7A 4UUJA 2QGBA 2WC7A 3Q6FA 2HFTA 3VDBA 3O81A 4DW1A 5HHXL 5SV3A 4DEUA 1NUDA 5E6ZA 3PWLA 2IGFH 1QVFU 3GI9H 2DH2A 5IVZA 1INQB 2HT4C 3OAUH 1ETJA 3QWOA 4FXKB 5AOLA 4LASH 1A4AA 4R3SA 3BOVA 4ZMAT 1FFPA 1V05A 2BNRA 1NGQL 3L2LA 4YGVB 1XF4A 3VU1A 5IM7A 2ITCB 4UZGA 5B1OA 4Y16A 3FSVA 4OZGB 4FLYA 1NKRA 1SDAB 1X7QB 2R1YA 4G59C 5HYQB 3FRUA 4OW6A 5I1GL 3UKMA 4XPFL 5I76A 1CGSL 5D7HA 4EF3A 4Z0XA 1SKVA 1R3HB 2ZXDA 5KJ4A 3U4KA 2COQA 1XAUA 3EYOB 4DR1O 4LDOB 4LSUL 4Z5RA 2ITDB 3SKNB 2ZX7A 2UWEB 2VN5A 2Y0IA 4EO5A 1MRFH 4F33B 2EUXA 2Y36L 2KMWA 2KQXA 3F05A 1HU8A 4LF3A 5CD3A 3IDGB 2RFXA 3M07A 1P9MA 5KAQG 2DQ0A 4WY7L 3N2GB 3CCHA 2PYLA 1QPKA 5DA0B 4GB9A 1T1ZB 5LMUO 4JI2B 2W07B 3X3GH 1WN7A 4PUBH 2OL3B 1UM5H 5LGJA 3EOBA 2WSDA 1GAXA 1HHIA 3NK4A 4NZUH 4PP2B 1EIBA 1HEZB 3OPUA 3VFSA 2VERN 3TF4A 4MA3A 5HI5D 1X5LA 2AQNA 4PJEF 3AEIA 2CPCA 4M6ML 5C0BD 1FXKB 5BZWB 3T2PA 3FU9A 4HNAA 1FH5L 5EB9A 1MNUH 2JVUA 2Z65C 3DIFA 1EUUA 1IGIL 1GZHC 3QNZB 4GINA 5IESH 3LRKA 2OP4H 4H1LB 4IMLA 3LKPA 3IMWA 2DIBA 3UZQB 2V33A 1DLHB 1RIHL 2BJMH 5K59F 4UZSA 1PEZA 1CBVH 1DQVA 2KSDA 4KUCF 1YEKH 3FN0H 3C6EA 3VGHA 4AGNA 5EZYB 4PJCF 1BZ9A 3KS0H 3W2DL 2NYKA 3ZN6A 1K4CB 1WPCA 1DVUA 5J6GA 3LV3B 3VXNB 4WU5A 5D5MA 5DI8A 1ZT1B 1FYTD 1IIIA 2Q7YA 4HIHA 4TLKA 2WHVA 4D9LL 1A6TA 1PLGL 2X1XR 1X9UA 5JQHC 3S3XA 2RIKA 5L2KB 1U3HA 1UA6H 3ZE0E 3OKYA 1A9EB 1MRCH 2P5PA 1GMGA 4AEHH 1N6QL 2JIZG 3Q05A 4HWNA 1F2XK 2ARJB 1FNEA 4PJ7A 3ARBB 4CVUA 3T04D 3VD4A 4H88L 3GBEA 4D0BA 1MQKH 4OLVH 1RSOB 1T22A 4G2AA 3BMVA 1MELA 4BFJA 1EBAA 4G3YL 3CMAV 2ZM6O 4OF7A 5GGQH 5IJKA 5A16A 3RTQD 4S0HA 3ETBF 1A6VL 5CJOH 1WZMA 5BO1L 1RZJL 3O4OC 3TYGH 4XMTA 1FXVA 3H9HB 1ZV9A 4TSCL 1JK8B 3T1WA 5CLWA 5E7BA 3UABA 3B2VH 1KXQE 2FTAA 3WDJA 3PG2A 3ZTNL 5FDWA 3D87B 3MV01 5I18H 3QUZB 2YJLA 5TGBA 4HAFA 2M7WA 1UPGA 1FYJA 1MCPL 1TZHB 2QVTA 3G9AB 3EXLA 1AS6A 4CW1A 3PQYD 2AEQH 4F7TB 3QZWG 2W91A 4L1DA 1EO5A 4A7VA 4NQTA 2WWMD 3CQFA 4YDMA 4JAVA 1EWHA 3RGVD 4NN6C 2BVEA 1Q9WB 3QIWD 1BM7A 5E2WL 5CB4A 3SDCD 1DLBA 4LF8O 2BVYA 1PL4A 3KL5A 4ZFQA 4DJMA 6PAZA 3B6SA 3HKEA 1FZJB 5A3ID 3C5ZA 1KP3A 1RZJC 3BH9A 2HLAB 3ZTJH 1ADWA 2BWDA 4JPWL 2AHYA 3RBSA 1GC1L 3HCVA 2R4SH 5F93C 4UTAL 1XGTB 3LQAH 5JNYB 3TBYB 3UBFA 2YIBA 1MEXL 2CUIA 3CH8A 4OF6A 1YAZA 1LEKB 1EN6A 4FFZL 1CU4L 3GGWB 1BHGA 1VJSA 1YNTB 1ET7A 1SEQL 2P44B 3BFQG 4LP4A 1WIOA 1CXLA 1QRNE 1RPRA 4NO0B 3G5WA 1AGFB 1PX3A 5AQ0A 3FTZA 1PDKA 4QWWC 2XWCA 5GHWL 5HGDA 2APVA 5KTEL 3RFZC 3ZRCC 1FFNA 2XT9A 4LFBO 3MRRB 4YHPB 5C0CB 4HGWA 4QYOA 4L3EA 1YPZA 3P3UA 4WWOA 3ULVD 2ADIA 4PA7A 2WKOF 1IGMH 4F1SA 3TN0D 1H3TA 3BEVB 4G8GB 5GGTL 4LEOB 3CCEV 1WO2A 4IGBC 4JN1L 4LVHC 1B90A 3S8GB 3CU1A 4MS2A 5DD5L 2IBBA 4L4TB 1GSKA 1ZHLB 1T4KB 3MLTB 3C87A 5HVHB 4NNPH 5IHHA 5HPOA 2J4WH 3MRQA 4QHNA 3MJWA 3A6OA 4L4VE 3EYUH 4YXHH 3HFMH 2CK3G 2R9AA 3K1DA 5EU6E 2CE4A 5F3FA 3UYOD 3ARZA 4ZNCD 1JK9B 5T1KB 4LDCA 2PGGA 4J3OF 1U8HB 4M1DL 2CCVA 4JJ5A 1GM7A 4M7KL 2VS0A 3NMEA 5D7SH 4BHUA 5KEZA 4P3WA 1M4KA 4ZAKD 1A02N 3QRLA 4Y2OB 2OI9B 4ORGB 1ZVHA 4OCLC 4JZJA 3RJDA 4QJFB 3OD4A 3ZMRA 1DCLA 5HGBB 3VXRD 3Q48A 2W60A 4KGJA 2P5OA 1FNFA 3MYZA 2V8LA 3DTXB 2VLRB 5TK2A 1SN0A 3SJQC 1HN1A 1E1RG 1EEYB 4I89A 3GLZA 4NPYA 5GSVB 1U6AH 2B08A 1URFA 2BIIA 1EQWA 2FB4L 5K9JH 4AHCA 3WFHA 3HKDB 3AG7A 3CZFB 1AY1L 3J80N 4HUNB 1YEDA 1KLFB 3N6YA 4XC3L 3ZDXE 1R0AH 2WLZA 1Q7YW 2EE3A 2EIMC 4OD2B 3C09B 3T65A 5IOPB 1R17A 5L3CA 2IQ9L 3QK0A 4TL5A 4KTYA 2WUCH 4PWGA 3I6SA 4F2ME 4ZXBA 1L0LH 1D7CA 1WZKA 2D4DA 4FQHB 1A1OA 2X4OB 4LK4A 5CP3A 1NBVL 1YEEL 1PKXA 2BS8A 3L7EA 1KIUB 3GKWH 3QNXA 4HEME 2HVJA 4JPSA 5CGBA 4AW7A 4CJ0A 5GRVK 2B5IC 1JD9A 1O7SA 2ID5A 3IMRA 5C0AD 4P2OC 5I75B 1KP2A 3G3LA 2MJWA 4XE0A 1BFVL 3GMMB 4RMBA 3DX9B 1A6ZA 1CFNA 3NSJA 4JFZH 4F80A 2GFBB 3JD1A 1SXCA 2C1OA 4UT9A 3IKKA 3HPJA 1THAA 5DT1L 3OKMA 4XNDA 2MHAA 1X5ZA 2V0AA 4JO4L 1NMAL 2QTEA 1J95A 1CXKA 3K6OA 4Z7WE 1XBDA 3AREA 2EE2A 1OHHG 2CGOA 4LSVH 5JHMA 3DX0A 1P4LA 1FC1A 2FLRT 3MBWB 3O9WA 4B3RO 3CRQA 2A6DA 1UJ3A 4ODSH 3WE6B 4NBZB 2I07A 1C8PA 4C4UA 1N3NA 5EZOL 1CZ8H 1U93B 4FXGC 3DGGA 2D2OA 2Z34A 1MJJB 4Y5YA 3N2KB 4KTDH 2JJ1G 2IU3A 5DC0A 1BL8A 1AXSB 2MTPA 2VLLA 3SDAD 4Y4HD 2A38A 3QXWA 3MLSL 4Q2ZA 3Q1SH 1KJ2L 3QIBD 3BPOB 1YZZA 5J2TB 4JO3L 2G2NA 3ES6A 1K34A 1I7ZB 4EE2A 3JXAA 3R06A 1UXMA 2Q1EA 3NA9L 4HPYH 3I02B 2FBJH 1F58H 7CGTA 4K07A 2QL1A 5IHLB 1GPOH 1GH6A 1P6FA 4JK0D 4EQ2A 4J4PD 3F7VC 4YR6B 5ALBL 4KRNA 4UFZA 3IGLA 4WFBV 1MJ8H 3S3CB 1Q72L 4PJEB 2WLJA 4RESB 2CWRA 1H15B 3AG1C 4QXTB 4FKKA 4FQQA 1JF6A 3U7AA 1N5YH 2O72A 4XN9A 3OF6D 5C0NC 5BZBA 3RYIA 5IHBA 3ZPDA 5TF1L 2DW5A 4WZ9A 1ZSDB 5I66A 3H54A 2Y5TB 4ADGA 2MCAA 1T1XA 4WFEE 5DUPL 3LSOA 3P2TA 1LDPL 5ITFB 1S7UA 3PWPB 1NICA 3KG2A 4B3TB 5AUMB 2YAPA 1F3DH 4M5SA 3EYQC 4FC3E 2XTJE 3RYFA 2Q9LA 4QO1B 2VZVA 3IJEA 3WAJA 5B3JF 2YXVA 3BW9B 2XN9E 2Y48A 3GSVB 4Z7NB 1S0VA 4LVEA 5IQMA 5AOJA 4ODVH 5HHNA 3OKKA 4JRYB 2ISDA 1H6EA 3OB0K 3EF7A 4X7DC 2FMLA 4UCVA 2TAAA 3K59A 1YN7A 1Z9PA 1J5OH 3GMLA 1CTNA 1R5VA 3BZFA 4PJBB 3L4TA 3R18A 5L8LB 5FV2A 3RNQB 3ZKSD 1QSFB 4V2CB 4LVOB 2W92A 4Z77B 4CS2A 2ZAHA 5EO9A 1DBBH 5GZOD 2BMKA 1NI8A 1MH5B 1W2KT 4B7KA 1O6SB 1HNYA 4KY1H 2IGTA 2YRBA 3MR9A 5EPMB 3TS8A 4PRPB 4WWKA 1MRDL 1ZHNA 3FT9A 3L3HB 1DBJH 4GRWB 1WA8A 2E75B 2AV7B 1TVHA 3KXFA 5I1KH 2OZ4H 3WHXB 1BOGB 2D7OA 2QVMA 1BE3H 2Z8SA 3U1SH 4XXCC 2GY5A 2YXFA 4JM2C 3W9DA 4KBPA 35C8L 4J41A 1L0NH 3VM7A 4PJ0Z 1QFWL 4OQTL 1G9NH 4JFHD 4GPVA 1NCAL 4UV9A 2EDMA 2YFOA 3T3PB 1PNCA 1KPRB 3JWOH 4NQEA 3QJFA 4UDUB 5FYKE 5JOFA 5CZRA 4EUPA 3SY6A 4RDBA 4N8VB 1IT9L 3O0RL 1SYVB 2DM4A 2YEVA 2ZXBA 3JCUZ 2VWEE 3QDMA 4FTVA 5C2UB 5GS1A 3QGVA 4UCFA 1E3ZA 5E5MB 5TDPB 4D0DB 1GK9A 1PPJH 4PA6A 1E6OL 1PY4A 4IK7A 3S96A 3GRWH 5DUMH 4PJIF 2XG4B 1FRGL 2YD9A 3GJFK 4HULB 1I7TB 1R5WA 2OTWB 3ZL4L 4E41A 3O3EB 3N2JA 3IFPB 1KYFA 3Q7JA 5L8KB 5K59E 1CL7H 3LKQB 2R0ZH 3BSGA 3OJ2C 4MXWL 3HB3C 5E4IA 4L29A 1N26A 2WBKA 5J1SC 5I8KH 2BK8A 2Q8AH 3B8NA 4PJCE 4PW9A 3VQYA 4AJVA 3KL3A 2P80A 2NTFA 3QI9B 4U31A 3FAWA 4ODUA 2FH6A 3EYVB 2BDNH 4GQ9L 2WO4A 2ERJB 5KYUA 4MB5A 4I0XA 4KK9C 1E9OA 1TQUA 3L9RA 1HOCB 1L9TA 3B37A 2OMWA 5EC1A 4Z3TA 4K8XA 1CDUA 2IMMA 4DFHA 4EDXB 3PREA 4ZMVA 3FFDA 5DHDA 2ZZUT 1G7LB 2VXSL 3RZCD 2OR7A 3F01A 1R3LA 2VZTA 4PRBB 2LU4A 4YDKH 1JJUA 5IYBO 4KQ4L 4WFFD 1KJMA 3V95A 4D9QE 5F7HA 4NR1A 4LLMB 1L7TH 2GJZB 4PA9A 1A8JH 2I9LA 2JV6A 3KPQB 4NQSA 4PG2C 4UMSA 2VDLB 2ZX6A 1AVMA 2D7TL 4EIUA 3LKNB 3VQLA 2CUGA 4HW6A 3A67L 4GBXB 3SDDD 4BELD 3FFCA 4DTGH 3FB7C 2HJDA 4NP4H 2YD8A 5JA8B 3Q13A 2GK0A 5K1XA 3O65A 4L3FA 3ZUNC 4BSJA 4F7PB 3T6ZA 1CQYA 1NCCH 1QATA 4GSRA 1GTNA 1HSBA 3D4CA 4G71B 4PWJA 4JI2O 3EHBD 4X8JB 5ID0A 4IU2A 5DK0A 2Z31B 2Q67A 1XH1A 2HFEC 2YXLA 3X14A 3FF7A 2GIXA 3LMJL 4RWYH 5D2LF 1GVIA 4FQXD 5EA0H 5B39B 1OHZA 3N9GH 2K1EA 4UV7H 2LTQC 2VDRL 3QAQA 3UAFA 2CHZA 3NCYS 4J80A 2VQFB 1YC8A 4PS8A 3IM1A 3S9DB 3Q2LA 3IU4H 3U30C 4Q0XL 1RY7B 5DJCB 4G9FA 3QF7A 1UKSA 3PJNA 4WCYH 3T9WA 3TVMD 1ZT4B 3GBML 5L6YL 4PJFF 2XVGA 3TIEB 3X1FA 1A9VA 2J8UE 3EJZC 5I15H 5D7JB 4L8SA 3BRGC 3Q2NA 1ZVSA 4ZUVA 5BV7B 5BXFB 2AXFA 4KZCA 2RH0A 1KT2B 1V5JA 2BSTB 5K1PA 3W82A 3LCYA 3BWAA 3IKCA 2UUDH 4GI8A 3UBHA 3V4PB 4PJGF 2WNKA 5FR3A 3U7WL 5I0WA 3QUMA 3L17A 1QO3B 1BD2D 5L3EA 2QDOA 4O4HB 1DVXA 5EMYA 2V2WB 4K94C 1I7UA 4KJYB 5CR8A 2HLEB 1EGJA 3AB0C 4M03A 3WFDH 1B3IA 1E9QA 1AE6L 5DRZA 4JLRA 5T1DH 5EEZA 2J72A 1GGCH 5DHVB 3WNPA 5L7XL 3CZUB 2V6HA 3BKYL 4UQDA 2DYRC 3HZVB 1VCBC 1TTUA 2H32A 2ZOLB 1JRHL 1TMCB 2GSGB 1T03L 4KRLB 4W9CC 5DJZA 5DQDL 3NACL 3ZDZB 2Q7HA 3V0VB 3CVHL 5CS7A 4P46B 2FLBT 3CBRA 4HWBL 4J1UB 1DSFH 1AR1D 3L1OL 2WNWA 3MA9H 4PV8A 5DD0H 3VH8B 1OOWA 3SKJL 1K6QL 2E46A 4IDJH 2JIXD 1OAQL 4LGSB 2R1WB 1J18A 4NTYA 4XNQA 3RTLA 1AKPA 1S46A 3AWGA 4F2EA 5ACLA 2X12A 1D9KB 3VSQA 5F0PB 4C83A 5FM5M 1CN4A 3PP4H 1PZUB 2IDUA 2QJDA 3ULVL 1W9XA 4Z3IA 4HG4J 1DUYB 4P5KA 2MK3A 4NUGL 3FW6A 3L4CA 3PFUA 2QSVA 4NLHA 5JW3H 3V5KB 3FMGL 3QA3A 2ZE8A 1NZRA 3BCCH 1CE1L 1OM9A 1Q0XH 1YA5A 2CK2A 4TNFA 1IBYA 4JI3B 1PX4A 4JB9L 4PLKD 1ZVNA 4K15A 5C0BE 2CRIA 4JFWA 4ACTA 3DSNB 1XB6A 1GYCA 3T0EB 3CU7A 4WFHD 1NBMG 3WAKA 2D9QB 2NNAB 3WFEL 1EX0A 3H1LH 5EYPB 2ESVA 2EINB 4NENB 1QEWA 1XF5B 2QMJA 4U1MB 4IRJB 5KOMC 4BIKA 3TV3L 4E9SA 3MRIB 2VC2L 3GJFA 2QEXV 4XO9A 4ZHQB 4WI5A 5G4NA 4EZLA 1F8TH 3FUFA 3I9IA 3ULVC 3NPSC 1ZLUH 3DXAA 3C8HA 1VF7A 3NJXA 4M8QB 4ACPA 4DKFL 4X20B 2IWGA 2YJQA 4QOKA 1FYTE 4APXA 4BDVB 4YZWA 3JWNG 2Q7GA 3Q2CA 4NZ8A 3VW3L 4ZFOL 1SHSA 2RTTA 1ZS2A 4Y2DC 2WLLB 1AJ7H 4LCIH 4N2AA 5C8YB 2I69A 4JY4A 2MCMA 3PE9A 5DRXA 1RERA 5KANG 5D7EA 3VQ1C 2EVGA 4FZ8L 5EOCH 4PD4F 2AXTZ 2OMVA 2QTOA 3VVWA 4U7OA 2CSPA 4Z3JA 1LUWA 4JANB 4LOVA 3LD8C 1V7NL 3IGKA 3GSNB 3MCKB 4JPRA 4NT6B 2AC0A 4XMWA 2FK9A 2R2BB 3SDXB 3ZHKA 4JO2L 4R7DA 4JFFB 1DE4A 1GRJA 1AQKL 2BNUA 43CAB 4APQB 1GTOA 2AJXL 3BH8A 4KK5C 4KROC 4CN4A 4U1IB 1NFKA 2C34A 1XFPA 3CXDH 3NSXA 2YICA 3H9ZA 1JZ6A 1K85A 4MX7B 5FF6B 4JZNB 1L7IH 4ABWA 2P5WB 1CIUA 4AI8A 4OT1H 4KXCA 1GN2A 5CUSL 5D1XD 3FAVB 1J86A 1OCZB 3BP4B 1XQ4A 3L3DA 1P0SE 2E7HA 4HZ3A 3CVBA 3EGDA 3HW7A 2WCPA 3NN8B 3U0WL 3UTQA 4EVNA 1K97A 1BQUA 4KQ3H 3VG9B 3ZGHA 4GKNB 1I3RA 3HPLC 1D2OA 1OTSD 3IJYB 4OI9A 5HDRA 1G7IB 4PJIB 3VACA 3O41B 4LL1A 3OKLB 4KHXH 1FL5B 3U0PB 4OZIA 4UQ2B 1GN3A 3DOHA 3O6FD 3QRFM 3M99B 3O3DB 2QDWA 4MD0B 3V5HB 1RUML 4JAMB 4NCDA 1P1ZB 1QAWA 1FKAO 3A2FA 3JT0A 3UTSB 3ARFA 5F1IA 4AVIA 2FO1A 1JP5A 1QR1A 3AQYA 4ZD3H 1ZOXA 3LRSB 1RZKL 4G9DA 4PJAA 4MJ5A 3FCTB 4CC0A 5B3JE 4KMTH 1HHHB 4YJ3A 2OM5A 3OKDB 5C0EB 4B9JA 3JWNC 2R56L 3KYAA 4XXWC 5HDQL 3JD0A 2MW2B 1E79G 3G5VA 3PHOB 2O5YH 3ETSA 4HLZG 1EFXA 3KPSB 2C9VA 1MY5A 4NYLA 1NH6A 2B77A 1JRHI 2QZ5A 4LHUD 4NZRL 1E5BA 4ZSOE 4LDEB 2BOCC 2MCG1 2OYPA 4M5ZH 3V0WL 5L88H 4N3UA 1EH9A 3U0TB 1XBRA 1AGEA 4GKOA 4CC5A 1PX8A 1FE8L 1K8DA 5IFJA 2G2RA 3I75B 43C9A 1AQ8A 2IAMC 4F7MA 4Y5VA 2ZE6A 4UVCA 1HE8A 1UT9A 5IHUH 4PGBB 5J57B 5CP7A 5BS0A 1QBLL 4DKAA 3LN9A 3AT0A 1RZKC 2JCCF 3ARXA 4CGTA 4K3EL 1PIGA 4O4YL 2A77H 3MXVH 3T0VA 1HESA 3GC3A 1IXBA 2LHAA 2KG7B 4IOIA 4X65B 2BVQA 4AITA 4POYA 3BGFC 3SYAA 2YC1B 1Y67A 3JSSA 1WICA 4GQPH 1YYCA 1TEFA 2G9KA 3O3AB 5E6SB 4PJ9A 3ROLB 1LM8V 3U25A 2IH9A 2ZIMA 2IH3C 3ARDB 5F7MC 3S3PA 2V9QA 2PLTA 3D07A 3ILPB 2FGWH 3MRGB 3O2WH 3VXRE 5A6MA 5FKPB 1A7RL 1WLEA 1BW8A 4RZKA 5MEND 1SF3A 4W4OA 1QFWM 3BP7B 4OD3H 5FOBB 3AXIA 2F6AA 2YBRB 3OR7A 4P2RD 4JPIA 2CTWA 1GZQA 1SLUA 1WEJL 3HE6C 3KS0J 3MJ7A 3PWUA 4ISVA 5EIBC 2NOYA 4OGYH 1U8MB 4YHLH 1H3PL 3MAQA 4A6YB 1NBZB 3TO4B 1AKJB 3VD1A 4Z76A 1SOQA 2XZQH 3DNKA 2K9PA 2UXFA 2D31A 3D36A 3TA4D 3Q8FA 5DM6V 3RX8A 1HHGB 3I6GA 3VQXA 1UOLA 4D3CL 1YC7A 2AJ3A 4Q56A 1FVDA 2PW1A 3D2TA 3EGXA 4PRHD 1TAEA 4M4PA 3R8QA 5EU5A 2PPFA 4B3TO 4MQ7B 4XBEH 3WFCH 4RFEB 3FN3A 5GJTL 3N85H 5BRQA 1Q6UA 4YNYA 3F7YB 4M1GL 4YE0A 1OAYH 1SJEA 5E2UH 5C09D 5C0AE 3SQBB 2PTTB 2W5PA 1AANA 1TJHH 1WUNT 5DJ0A 3RAJH 4U1NA 4N6RA 1YY8A 3L3GA 4WW2F 1E4XH 1KIRB 2DMCA 1QVOB 1OSEA 2IAND 2ICEA 1Z3GL 3RVXD 1J05B 5F9DC 5E51A 3KBHE 4ZW5A 5KW9H 2VQ4A 3TNMB 5FHAH 1EN5A 5EWIL 1C7SA 3KHQA 2CG9X 2QQLH 3DVFA 5CSGA 2NY4C 4WK0B 2AJSL 1CEZA 3W3BA 5ITZB 2OJ1A 3BDYL 3APMA 3B9KD 1INQA 1P84J 4IEFB 3BT2L 4JZOB 2CXKA 5C1MB 4LFAB 2QVIA 1M42A 2VR9A 4FXKA 5ISZE 2LP7A 1AHWC 3ARWA 4CC4C 3LEYH 3EO0B 2AXWA 2B2XL 4GKZB 4YGVA 2ITCA 1SHWA 3QNFA 4OZGA 1X7QA 5KANI 1RIUH 2B3RA 2R2HB 1WQVT 4X1IB 3T2NL 4UTBA 4OLYH 5HYQA 4LPTA 1TNMA 4X5RA 3B5TA 4FQLL 4NFDA 1V3JA 1G6VK 4KKLC 1R3HA 3I2CH 4HMDA 1II4E 4LCCC 3EYOA 1YNLH 3ABLC 2ITDA 3SKNA 4ZZKA 1GS8A 1FDLH 2UWEA 2WYTA 2E56A 4KMLB 4QLRA 1BIHA 3POCA 4WK2B 5AW2B 3SGJA 4F33A 2H1LM 4FJCC 3L9BA 4N2LA 5T3XL 1TTRA 3IDGA 2VM3A 3BE1L 1N36B 5D2LE 3N2GA 2I26N 4DRXB 2ICCA 4CGUB 1MZZA 1T1ZA 1LO3L 1UB6B 3PGDB 4W81A 3Q4HB 3WB0A 2W07A 5C07B 4R26L 5BPPA 3MVSA 2OL3A 4OCWL 4RGMB 1MWAB 4XNAA 2CLRB 5C9JB 2UXXA 3CGTA 4H44B 4JFSA 4PP2A 1WZAA 5E56A 4O58L 1HEZA 3MLWH 1K5NB 2OXHB 2WXHA 4KRPC 2XZCH 2GITB 2VDMB 3DVIA 1KYOF 5DRWB 1PKOA 3IPFA 1ZTXE 3IDYC 4CADB 5BZWA 2CR3A 4OU3A 4X4YB 3HNVH 3QNZA 4OLZL 2OMTB 4Z23A 1EZUA 3U2SB 4BW9A 5C08D 4NGHH 4H1LA 4LIQE 3P4OB 4PJFE 3UZQA 2BRRL 3K5NA 2I60L 3S0PA 1DLHA 1I8AA 2XXGA 4MAYD 4YK4C 4UT6L 4RQQB 3VWKC 4FQJH 4KP4A 3QEGH 3FO9B 2PPCA 5IQLA 4WEBL 4TPRH 3T4ZA 2PI5A 1X5JA 3GHEH 3IS1X 5EZYA 4YSPA 3QJSB 5HHOD 1ZY9A 4PJGE 4W93A 3EOYG 3DC6A 4OKVB 3VFVB 1K4CA 4YDLC 5CN2A 3LV3A 1W0JG 3M7MX 1G43A 1V7ML 1NIFA 3L5XH 3VXNA 3FFQA 2B15A 1ZT1A 3KJ6H 1TQTA 4JN2B 2EDOA 1NC2D 4Z7VF 3IB4A 2D3NA 5L2KA 4HJ0C 5D9SB 3Q5TA 2JB5H 1QHQA 1A9EA 4BCYA 3CFJB 4MNQB 4BK4A 1MCEA 3MKKA 5J3HD 1G6UA 3LZRA 3GNML 2ARJA 1OPGL 3GPSA 3ARBA 3NIGB 3WN5C 2Y0SA 4J3BA 3SDDC 2ZP0T 1T1WB 1RSOA 1BPVA 2X9ZA 4MMXB 3FZUC 1NMCB 3PUCA 2EXWD 4NJ9L 2HKHH 4ZMPA 1B4JL 3VAEA 3JV4B 4H13C 3ZHVA 3MUUA 2GSIB 4GOSA 5CLZA 1V3MA 2E6QA 4AYEC 1BVLB 4FZ0A 2I24N 5DURB 4YBQC 3H9HA 4M9OA 1ACZA 1PFOA 1JK8A 4PBWD 4FQIL 3H9YA 1AGCB 4K8ZA 4LQFH 2VTFA 3TCTA 1WJ3A 1BAGA 1RP3B 3RVZA 4HHWA 2APXA 4FQXC 1UFGA 2HP4A 1OIOA 1UACH 4S1DD 4MLIA 1LUVA 3QUZA 5TDNB 1SY6H 1TZHA 5SWSD 4F6RB 2BSEA 5JJNB 2Q6WB 1JBJA 4WUUB 3H01A 3HOGA 3PGCB 1ORQB 3WJJC 2AAAA 4RX4D 2VUKA 4PN6A 5HD8C 3QHZL 1W72B 4F7TA 5D93B 1XDCA 2JS3A 1KYDA 4TUKL 1QQDB 2D7MA 4L48A 5H2FZ 1AD9B 1EVTC 2A0LD 2VQFO 3WTUA 4FVMA 1JHLH 1Q9WA 4R8CA 4IGGA 4M62H 1XH3B 4JPVL 2BTQB 4E0RB 4OCRH 5ESAB 4TNWF 1FZJA 5I0YA 2C9RA 3BT0A 3DBXB 5BRZB 3RWHB 4KNUA 3ZJZA 4TSAL 2E5EA 1XGTA 1KBHA 1CLOL 4JG0L 5E1AB 5F2FA 5JNYA 5L4MA 1OQOA 3JD4A 5AVZB 3ZDYB 1QWHA 1AXTL 3GYRA 5D1ZC 3RI5F 1WP6A 3TBYA 4AUUA 1L3WA 1T6BX 5IFAH 3AT8A 1LEKA 3GGWA 2EJ1A 1YNTA 2BOBC 4OGAC 4YDNA 1BF5A 5CINL 32C2B 1NJ9B 1NPJA 1XIWD 2J56A 3MI6A 4JRLA 3CPLB 3ZT5A 2XETA 4G1MB 4X42A 3X2QB 1YI2V 4NO0A 1AGFA 1XCTB 2TSBA 1RAMA 2MPVA 3JWDH 1URZA 1GKOA 2IDSA 4JHUA 4P9MH 1T66D 4DGYH 1XV8A 4BIUA 2NNCA 1NR7A 1HXMB 5ALCL 3K9AA 5BOZG 1AR2A 5HTSA 3HMWL 4TM9A 4GUOA 4XB7A 4B08A 1WWBX 3MRRA 3P1VA 4YHPA 5D7LD 5FWRA 5C0CA 1QUNB 2JCCB 4EI6B 2IH1C 1DQML 2NXZD 4QF1B 3IMTA 4GRMB 4MJJA 4XN5A 3ZKND 2X7RB 4HJTA 1SJVA 2NX5B 2OP4L 3BEVA 3CQQA 3NZSA 1VZGA 1VLXA 4G8GA 4I3SH 3UC0L 2P06A 2JLLA 3BPCB 3QFJB 4LEOA 4WFFE 1A14H 2P5ED 3BXNB 5B22A 2PCFB 4BXVA 4L4TA 1ZHLA 1T4KA 3MLTA 1YMMD 3OKOB 2LW1A 1FNGB 1A1MB 2IPKB 1JPSH 3FULA 2D73A 2Y6SD 2BIHA 4RDQF 2B1OA 1CXIA 5FUZL 4LPWA 1JK9A 4UM8B 1I1YB 3LVTA 5T1KA 2C3XA 1H2GA 1J9CT 1U8HA 1FIGL 1SFHA 4YBHA 3PRZA 1TPXB 2G5BB 3MRMB 4Y1AD 3FD9A 4Y2OA 2DJSA 1F3DJ 3HN5A 4ORGA 1HIMH 3ZTDC 5K1JA 2RJMA 5HGBA 4U3CA 1BLIA 4ZS6C 1GYUA 3B9DA 3DTXA 2VLRA 4L9LB 4MVOA 1BZKA 4FQ1L 4DN3H 1RZ7H 1TSHA 1T0NB 2VDKB 4JY6B 3RZCC 4AL8L 4MTXA 1HE7A 2EO1A 3FT2B 4HT1L 4A2MA 1EEYA 3ZYIA 2CTRA 2MKWA 4CC6A 1TTGA 3ULSB 5GSVA 2PF6A 1OY3B 4X9IA 3FK3A 5HYIA 3S4SB 4O51B 3HKDA 3CZFA 3CFCH 3K0DA 1WT5C 4JI3O 1MCLA 4XB8A 5ANMB 3LUTB 1KLFA 3MACL 3HAEB 5I71B 4GKKB 5JMRA 1IEAB 2BXYA 4QXGH 4YHYB 4AMKL 1N5AB 2OULB 4OD2A 2LW7A 5KVGE 5IOPA 2W6JG 4PJ6A 5FO8B 4PJDF 4FQHA 2X4OA 1R1CA 4HKJB 5FFGA 4M5TA 1YNKL 3LH9A 1MFEH 3HKZA 1CXZB 1KIUA 4L8BB 1VA9A 3NIFB 4G6JH 3T6WA 1TT6A 3QJQB 3FU5A 3QUXB 3T0XA 1IBFA 4ZX3A 1B2WH 4V11A 4YSEA 4DUVA 4LSPL 3KCPB 4AL8C 1ZANL 3D34A 1ODUA 4X89A 1HNZB 1ETA1 4MA1C 3QYNA 1EV2E 3GMMA 1U8OB 3DX9A 4GO6B 4JTAB 2GFBA 1TMQA 4H25B 4QGPA 1MCWW 4WGVB 3MOAL 4EMZA 4K4KA 5CJBA 4CSSA 1CCZA 3RBZA 5DLML 1PJWA 2J1WA 4WGWB 4MDJB 1IL1B 4PJHF 2NY0B 4WEEA 3S88L 3L6FB 3V55A 3VTAA 3AFLA 1AILA 4JAUA 3FKSG 2DYPB 3MBWA 2NNRA 4AGQA 4GKSB 5TE4H 1ZLVH 3DPDA 3WE6A 1NIDA 2ZNWA 1RH8A 2B0SH 1U93A 1K5WA 3DYMA 5CJ5A 4XN4A 1JPTL 1MJJA 1TYEB 3V52L 3KPRB 4DEPB 1IM3D 1B0GB 4TSBL 4ZUWB 4CVXB 2GI7A 5E1GA 3L45A 1BM3H 1AXSA 2GK2A 4NAQA 1KB5B 1IUZA 4BGLA 2VLKD 1PSKL 3ETDA 1VGKB 3GSXB 3QIUC 3VRJB 2AJYH 4YSRA 5J2TA 4Q9RL 3HC0B 4PV9B 2HXAA 1I7ZA 5TE7H 4TLUA 2BS71 1G0DA 2V4LA 3I02A 1I1AB 2DQHL 3KCXA 2AQRA 1UB5B 3EBAA 3NQIA 4KKRA 5J2UB 4LCWD 4YR6A 2FEDC 1DVFB 4IHBA 4Z3FA 2JKNA 4NPJA 2X5PA 4FMVA 3HNSL 2PO6B 4PJEA 1FG2B 3FF8A 2QR4A 5D2NB 3O2DL 5E8DL 1H15A 1VFOA 4QXTA 2CKBB 4DR3B 4CVZB 3V6FB 1QBZA 3IDIB 1QYGL 3RB5A 3RU8H 1HYSC 4UILH 1KY7A 2X4UB 4WFHE 2BIQA 1ZSDA 4Y9FA 2Y5TA 4Q7DA 4I5SA 1E4WL 1OP5H 5ITFA 2DIJA 2FYUH 3MU3A 3PWPA 3CPWU 5AUMA 5K9KB 2J7LA 2VR8A 3AAZB 1PNLA 3FB6C 4ZYKA 4YSUA 4ZMYA 1NA8A 4JM4H 2HLDG 4QO1A 4XCFL 1RPOA 4D9RE 3BN3B 3BW9A 2X2UA 2RQEA 1TVKB 4NXNB 3FSOA 3GSVA 5AD0B 5C6PB 2BCMA 5GZND 2EIEA 3IMVA 3NJIA 1BVNT 2YXYA 1PJ9A 3TBBA 2K3HA 4JRYA 3F7QA 3RIFK 4I13B 4JMXA 3QEHB 4LSSL 1K9TA 2MNJB 1W0VB 4QPEA 4V2BA 2O5ZL 1IE4A 4PJBA 3C08L 2J44A 3KZIZ 1QSFA 1TVBB 3RNQA 4B5ZA 4X0KA 4Z77A 2L8AA 4BYHA 4FNUA 1YMHB 3OG6B 5DJYB 1DBMH 2H41A 1XEUA 1JNLL 3IETB 1MH5A 4X65O 4K5PA 1O6SA 4FULA 4XP1L 5EPMA 4PRPA 2J6EA 2PWGA 1KC5H 1WB8A 2VJ0A 3R4DA 4EBQL 1PQZB 2XIDA 3L3HA 3T2QA 4H20L 2AV7A 1S9XB 3HLAB 1VF6C 4J23A 5F7NC 1BOGA 1IVLA 4JFZL 3WHXA 2Z1PA 5L3DA 2YQ2A 5ACZB 4D6TH 4FRWA 4CKVX