1OCCB

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
molecule keywords CYTOCHROME C OXIDASE
total genus 61
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1occB02
2VW7A 5B3SB 4GXFA 5I6MA 2PPFA 1TEGA 1AAJA 1BXAA 5B1BB 3EH5B 1GSKA 4G71B 1IC0A 2QDWA 3NJHA 3EHBB 4G72B 2IH8A 1ILUA 1KCBA 2XX1A 4YSSA 4TXVB 5ANHA 4GY4A 4KO9A 4G7QB 3ABLB 2XX0A 4GP4B 1BXUA 2IDTA 1WA1X 2AZAA 1J5DA 1XMEB 1OF0A 4KOCA 4NERA 5B1KA 2EIKB 1L9PA 3QPKA 1T5KA 2BP8A 4F2FA 3ABMB 1SF3A 2WO2B 1OCRB 3GYRA 3CVCA 4AX3A 2IH9A 1BAWA 4KNUA 4WTQA 1BEXA 3UABA 3UGEA 8PAZA 4CSZA 4DP0X 1ET5A 1AANA 1WA0X 3NJFA 1JZEA 1A65A 1N68A 2IDQA 2IDFA 3UAAA 2IWEA 1AOZA 3PLYA 3WI9A 2CCWA 4HHWA 3HEIB 3FU8A 2YAMA 1B3IA 1R1CA 1AS7A 1AG6A 1L9QA 3X1GA 4P5SA 3NYKA 3SQRA 4HIPA 1MDAA 3OMAB 1CURA 4HCGA 4JHUA 4W9ZA 5D4HA 1JZFA 1IBZA 1OCOB 5FC9A 2Q5BA 2GC7C 3N55A 4KO6A 4F2EA 4GYBA 4DP6X 5A7EA 1JXGA 2GC4C 3PAVA 1BXVA 2UX7A 2HRHA 3X1FA 2JXMA 2PPAA 4A2DA 3FYEB 2P80D 2UXVA 3CZUB 2XVBA 4M4RB 1J9TA 1E67A 4Q8BA 3EF4A 1BQ5A 1JOIA 1SFDA 3FSZA 3X1NA 1SF5A 1MG2C 3JTBA 1NIBA 2A3TA 4FAAB 1BQRA 3NJKA 1DZ0A 4UAHA 1M57B 3EH4B 2VM4A 5F7AA 3S3BB 4NB7A 2FQEA 1KYAA 1L9OA 2UXGA 2VN3A 3AG2B 1HAWA 2YEVB 4AKPA 4YSQA 2FJSA 3FSAA 3PXLA 4AKOA 3NP3A 3H4HA 4PAZA 2YARA 1QLEB 3NSYA 5B1AB 4W1TA 2BW5A 2XWZA 2BHFA 4YSUA 2EIMB 1X9UA 4ENZA 2B08A 2PCYA 4E9SA 1M56B 3AW5A 3SBPA 3OQRA 2J55A 3NJNA 1CC3A 3AG1B 4KOBA 2H3XC 4BWTA 5LDUA 3CDZA 5TK4A 3V9CA 1J5CA 4DPBX 2HXAA 2GSMB 5D4IA 1PZCA 2J56A 3QJSB 1AZUA 1NINA 2Y1AA 3NP4A 1NIDA 3BVDB 3QJTB 5I26A 4JKNA 1SDDA 2CBPA 2VW4A 2VSMB 1ETJA 2Y69B 3TBBA 2GIMA 1CYXA 3L45A 1AG0A 4DP9X 4N8UA 3T71A 2LLNA 4DP1X 2TSBA 1XB6A 1FWXA 4E9TA 4BWUA 2DWSA 2YAFA 3FQYA 3QJUB 2QT6A 3OD3A 1NDTA 4HAKA 3D12B 4BK5C 2XV3A 1ZIAA 3QJVB 4E9QA 5I28A 3KW7A 1URIA 3NJLA 1OCCB 1AIZA 2FT6A 2PPDA 2IWKA 3DTUB 4WKXA 2OV0A 1PLBA 2YAQA 3JT2A 4E9XA 1ID2A 1XB8A 4BWWA 2RACA 2I7OA 3FU7A 2EIJB 2OCCB 3KW8A 1AS8A 3WNIA 4EF3A 2X87A 1V10A 2NRDA 4JHVA 4KNSA 3AY2A 4FA7B 2AVFA 2BWDA 3CVDA 1GS6X 1N70A 4E9WA 2XUWA 2VW6A 4K9JA 5IY5B 4E9YA 2XXGA 1SHXA 1KDIA 3CVBA 2HX7A 4YSPA 4P5RA 1PNDA 1ZDQA 2PCFA 1GW0A 3FT0A 4BDVA 2ZXWB 3OM3B 2TSAA 3FYIB 1CUOA 2P80A 5I5JA 4DPCX 4YSDA 1MZZA 4HZ1A 4DPAX 7PAZA 1NPJA 3WKQA 2X88A 2PP7A 1RCYA 1A3ZA 1NIFA 3PCYA 5F7BA 2FQGA 1YLBB 2H5UA 4CSPA 1SHWA 4L0PB 1FFTB 2EINB 3ABKB 2FNWA 2IAAC 2UXFA 3C75A 2Q9OA 1KDJA 3PAUA 4BDVB 1PLCA 2XYBA 4KNTA 1I53A 5AKRA 3TBCA 1V55B 2R7EB 1NWPA 1W6WA 1A4AA 1NPNA 4G70B 3N2JA 1ZIBA 1NIEA 1TU2A 2J57A 1E30A 2PP9A 4KO5A 1E5YA 2OJ1A 4N4YB 1KCWA 4UF7C 2IWFA 1OV8A 3FU7B 1OCZB 5PAZA 1ET7A 1NWOA 1NTDA 1PCSA 2QPEB 3S3DB 3WIAA 1GS7A 1L9RA 1E65A 1IBYA 1WS7A 3TU6A 1IUZA 1GYCA 1ET8A 1X9RA 2XV0A 1ASOA 2IDSA 2IDUA 2XU9A 2QDVA 4YVUA 5B1JA 2PPCA 2BO0A 1J9RA 3FPXA 4DP5X 3BQVA 3S8GB 3IN0A 1AZCA 3ASOB 2CAKA 1PAZA 4Q89A 3ABGA 3S8FB 3T6ZA 4KO7A 1OOWA 4DP4X 2HZHA 3ERXA 2HX9A 4HCFA 2WO3B 4NAJA 1JZHA 3V9EA 1AQ8A 1RZPA 3IN2A 5D4JA 2YXVA 1NIAA 1AACA 1SJMA 2YAEA 5B7EA 3ZX1A 2JKWA 2BZ7A 2DYRB 1VLXA 3WNJA 1KV7A 1W6LA 1A8ZA 4M3HA 4YSTA 5B7FA 1V54B 1E5ZA 4E9VA 1MG3C 1ADWA 3OMNB 6PAZA 2W8CA 1JXDA 2PLTA 3MBWB 3QJRB 1WS8A 2FWLB 2ZONA 3NSDA 3QJQB 2JFCA 2YAHA 2PPEA 2AANA 3FS9A 4MFHA 3CG8A 3TA4D 4RH4A 3UAEA 1TKWA 2DYSB 3G5WA 1PNCA 1RKRA 3NJIA 1OE2A 1BQKA 2FQDA 5EHFA 4YSOA 3ZDWA 3AZUA 1BYOA 1ILSA 1W8EA 9PCYA 1JZIA 2FTAA 2DV6A 2FT8A 5I6PA 1ZPUA 1HAUA 1WA2X 1UATA 3T6VA 2I7SA 1IKOP 3WKPA 5TK2A 2BP0A 2YAPA 1JVLA 3GDCA 1AZBA 1J9QA 3UADA 3AG4B 2GBAA 5I5MA 1HFUA 2PP8A 4HALA 1XB3A 1A4CA 1AZNA 2GI0A 1GY1A 5I5IA 2BW4A 4HCIA 1EHKB 3TASA 1PF3A 4HHGA 2YXWA 3IBOA 2XV2A 3MX0B 3HB3B 3FPYA 3X1EA 1RZQA 2ZOOA 5I6KA 4UANA 3S3CB 2HLEB 1ZV2A 5I6LA 2W88A 4YL4A 1PZBA 2DY2A 1GR7A 3ZIYA 3X2QB 1TEFA 3DIVA 7PCYA 3RYMA 3UACA 4E9RA 1MZYA 1JXFA 1AS6A 1PZAA 3IEAA 2WSDA 3NJJA 4A2GA 4A2HA 1BYPA 1NZRA 1SNRA 2AFNA 2HX8A 5B7MA 2EILB 1PLAA 3FSWA 4AKQA 2J5WA 1SDDB 5AFAA 2YQBA 1FA4A 4A66A 3FU9A 2YAOA 4DP7X 4BXVA 2GB2A 1ZDSA 2FQFA 1AR1B 3PAZA 2VMJA 2UX6A 1JZJA 1JERA 3CDZB 3NSFA 3AG3B 3X1BA 4A2FA 1JVOA 2N0MA 5I6OA 1GY2A 1M9WA 1OE3A 3NJGA 3EH3B 2BP8B 2FT7A 2HRGA 1PMYA 2VM3A 2XXFA 3PPSA 5AZUA 3DKHA 5PCYA 2MTAA 4YSEA 1SFHA 3ZBMA 1QNIA 1PY0A 4BXSV 3FSVA 3QQXA 4DP8X 1GS8A 4PCYA 1KBVA 2DWTA 4F7KA 2H47C 3NSCA 1DYZA 3H56A 1ASPA 4GP5B 1A4BA 4G7RB 1OE1A 4DP2X 1JZGA 1CYWA 2CJ3A 2GHZA 1J9SA 4A67A 4YSCA 5I6NA 3T6WA 2AZUA 1ASQA 2BZCA 2MRYA 3FQ2A 5B1JC 3T9WA 4GP8B 4YSRA 4YSAA 2QPDB 4A68A 3SBQA 2CALA 2UXTA 2I85A 2XLLA 4A2EA 1WAEA 2BWIA 2BP0B 3FQ1A 4ZK8A 1KGYE 1F56A 2ZWNA 4YVNA 6PCYA 1EZLA 2VSKB 3T6XA 1AZRA 3H4FA 4G7SB 3IE9A 3GXUB 1L9TA 4QLWA 2CUAA 2B3IA 1L9SA 2R7EA 4QKTA 3SBRA 1KBWA 4X4KA 3WG7B 2E86A 3OMIB 5E9NA 3NT0A 3NJMA 3ASNB 3U25A 4AI7A 1QHQA 1NICA 4AZUA
chains in the Genus database with same CATH superfamily
2EJ7A 3T0EA 4OFVA 1BXAA 5HHVL 3GHPA 3UKMA 3HN5A 3FUMA 4DQAA 1AE6H 3L5JA 1GJWA 3ZHSA 3WN5C 3VVWA 3D3VA 2WWWA 3LZLA 3V0VB 5K93A 1DVFA 4ONGL 3SYOA 4HXBL 4TXVB 5T3ZD 2EKSA 4OTXL 4LF8B 3G7TA 2IDTA 2Q7HA 1Z9LA 4BYHA 4C8XA 4DV6B 3MHZA 1OF0A 4PS8A 1LK2B 2BS8A 5B1KA 2WQRA 5FDWA 4J8RB 4Y5YA 2OCHA 2GUOA 3EJCA 4FLHA 1D5IH 4P46D 1DE4B 2R1YA 1JGEA 2A73A 4DR6O 2G5BA 3N1GC 3QFDB 5GRUL 2R27A 3S5LA 3SDYH 4C4BA 3UH8A 3BEVB 5IV2A 1YJNV 4OJYA 4F20A 2R56L 3HC2A 4FNTA 2D03L 4NQCA 12E8L 2WJ5A 3EOTL 4ELKA 4L4JA 3L1OL 3I5DA 3K6NA 2KUTA 1S78C 1MN4A 3HZYA 2R0ZL 3MODH 1VQKV 1SUHA 1DSWA 4NO3A 1WPBA 5EUKB 2CCWA 4EOWL 2F8XC 1DLFL 1K5NA 1KJ2H 4M7LH 3W39A 1CEZA 2HJLA 4ES9A 3DDGA 1N7MH 3K0GA 1CICD 4LSQL 2UUCB 4KVNH 3FU8A 1XZ0B 1AD9B 4LQFL 1C08B 4LRIC 3JV6B 4Q74A 4W93A 3CBKB 4HIPA 1G6VK 2W9EL 1D5BB 2DD8L 4LF4O 3I9IA 4YHZL 4NRYB 3GMOA 1OWWA 3ZHDA 1NAMH 3PP4H 5GRWA 3NEXA 4QRTA 5E6IC 1CK0H 3L8QA 3TJHC 4JRYD 1KF9B 3D39B 2NR6C 4RQQA 5FHBL 5KBDA 4BV1A 2EDXA 1TO5A 3ARFC 3P4LA 5JLZA 1KB5B 3RVTC 3WO4C 3L4ZA 3DRQA 5KANG 1X9QA 5E2TL 2ZZUT 3T1HO 4KKCC 5CU9A 3FYEB 4ADGA 2XTJE 1FL5A 4PREB 3SN6N 3P40A 3TF7C 2XNAB 3ZMZA 2YWZA 2Z4QB 1CVRA 5KBLA 3ZMTA 2BVOA 2YMOA 2Y0SA 5LNGA 3RWRD 4J23A 2GIXA 2ESVE 2EXYD 2X9WA 3FUIA 5DD6A 2B39A 5FWQA 5I8EB 3BFOA 2ICEC 2NY3D 1NTZH 3KPTA 4K55A 4L2YA 1V7ML 4NKMA 4OW6A 3RVWD 3RY5A 4AT6B 1XREA 1SQXH 1I9JL 5D71L 1TJHH 2YKLH 4XC3H 3K03A 2QQLH 3JALB 3E8FA 3VI4E 3JATB 3QQ4A 1U8PA 3BSGA 4WLCA 1CI3M 4GZRB 4F7TB 4YSQA 2WLLA 2BH0A 3MJGX 1J1PL 2PNDA 3RT3C 1E6OH 2WA4A 4F5CA 1XEUA 1BIIA 4LLYA 4YXWG 5A6LA 4PSPA 3B7SA 1YEGL 1P0SE 1QLEB 1SLXA 3BWSA 5EIVA 3VDAA 1JVKA 2JTDA 1J1OH 3OAWA 4L2LA 4WDIA 5F21B 1IFRA 4MA8H 2EIMB 1YCIA 3HNVH 4W9GC 3LKRB 3HC3H 4I9WE 4ZXBA 3LX9A 3KPSD 1YJDL 4FYQA 1XCXA 1RPQA 3QS2A 2E75C 5HDRA 3RB5A 3JD3A 3MA7B 1CXLA 3MLUL 4IBZA 2OIEA 4AEHH 3VD0A 1KYUA 2PTMA 3NJNA 1N0XH 4N8PA 2BWQA 4PWHA 4RAUA 2R69L 3M45A 2HAZA 2GEQA 2FWUA 3VTMA 2ESVA 3GM0A 1FXKA 3QCUL 1A9EA 2P8MB 3L3DA 4AQ1C 3FFCB 4RFEB 4Q9RL 2CR3A 5IROA 4AH2A 2ICWJ 3DTXB 3LB6C 3P3YA 4I8DA 3K2IA 1NR1A 3KDMA 3IDMB 4JY5H 5DJDB 3BIAX 1GAFL 1AG0A 3TO4C 1JPSH 5DJDA 2YD8A 3GRWA 3WFBH 3WB1A 2F95B 2APTA 5D70L 3PYCA 4I1RA 4XNUL 4R0LC 1AGCB 1K4CB 3FTZA 4GQQA 4OFYD 2B4CC 3RTQA 4AENA 2B2XH 4OY9A 1R1BA 3DETD 4L3EE 2RCSH 4XP4H 8CGTA 3J27A 2PW1B 4OZ4B 4KMLB 1PGRB 1PLBA 5D7IF 2HVKB 4AMKL 4GRWH 4JASA 1KB9F 1LE9A 4UM8A 1W80A 4X20B 1QSVA 2Z31A 1J48A 4EZJA 4GS7B 1RZFH 3GWJA 2L35A 2YUWA 3VXTB 4RFNC 3U1PA 3IXAA 2XWXA 3TO2A 1SJHB 4JHVA 4D8OA 4FA7B 3NJXA 4WFEA 2OMTA 4R90H 4U6HB 4JFXA 4XX5A 1QBZA 5E5RB 4KZDH 2NYYD 3QUYD 3ZL4L 4UIKH 5JHMA 3J2PA 1ACYH 1MJJA 4DCQA 2IGTA 4JHAL 4B3MO 4LLVA 4QTFA 1U8CB 3SDCC 2RMNA 4LC1A 4RUEA 1WAAE 1QQDB 1UXSB 3C8KB 4NENB 3VXSD 1JNHA 5BZDA 5HHOB 3DUUB 5DJ8A 2A9NL 3DXAA 3EUUA 2HG5A 1UWEL 2TSAA 3PJSA 4HF5L 1I7UA 2G9HA 3NIDB 4J4PC 1IBKB 1KB5H 3TIDB 5IW6B 4JGUA 3TPUB 1SQ2N 2WB7A 3UTSE 2HLFC 1A3ZA 3CFDA 4P3DA 4YZFE 4LRNH 1DJYA 2FL5A 3CRQA 4X9HA 3OZ9L 1W59A 1H3GA 3KGUA 3ULUH 1UJWB 1KYFA 3GZPA 4WWNA 4R83A 3EVKA 3MLZH 4JJHA 4YDLC 2W38A 3T09A 4C47A 1EANA 1NWPA 5C97A 2NYKA 4NO0A 4PG9A 2NSQA 4P3CH 3RUGE 2Z3YA 1XOUA 4GPVA 2VLRA 2J57A 3KR3H 3LZFL 2QVTA 4ZUTB 1EN5A 1GYVA 4HWBA 4L8DA 4LARH 3HI5L 2HLAB 2A9MH 4IKJA 4WW2C 3FU7B 3HR6A 3MV7A 1KMGA 3LXAA 1THAA 3E8UH 2MMXA 4B95C 1F45A 3UT5A 1MNUH 1KSRA 1JGDA 2J44A 3VWKC 5D4QA 4JO3H 5JQ6H 2AQRA 2FEJA 1NFDE 5E6YA 3MLSH 2OI9B 2X1QA 1U8JA 3ZE1E 4M48H 5KS9A 2VIRB 1LP9A 4P23A 4JO5A 3IVKB 4YO0B 5E2UH 3QUYC 4UV9A 5AD0B 1SQMA 3VRIB 2DW4A 4M29A 2WLJA 5H2FZ 5KX5A 2DIJA 4QCIB 1R47A 3S8FB 3RIFF 2YRBA 2QFRA 4R50A 4MNGA 2LABA 3V0EA 2CHWA 3LRHA 4FQXC 5IJDC 3FO1B 4B3RO 3SYQA 4O2CB 2EQDA 2WO3B 1GPOL 1NCCH 3UTZA 3VFGL 1II4E 4CGUB 4U1IA 2X4SB 3LKNB 3S36X 2JIXB 4C83B 1IAMA 5EBMA 4WO4C 1N36O 4HWNA 2JKWA 2AI0L 1NLBH 2NLJB 3HI5H 3U0PA 2M6YA 2BSED 1TZHB 1O9WA 3IDGA 5DC4B 1HINL 4OI7A 5B7FA 2X3CA 2B3RA 4GXUM 5CLZA 4D0BB 4DR1O 4IJTA 3FU5A 3JWDC 1YMME 2BSBA 3QXDA 5C0JB 6PAZA 2W8CA 3KCWA 1JXDA 2XOTA 4XPAH 3RG1C 3B6SA 3QJRB 1UXWA 4PA9A 3QYNA 2CKNA 5DWUL 1FFXB 3IXTA 4OV5B 3T8XA 2JS5A 1AI5A 1XMQB 2GHWB 4XVUD 1SOSA 1RIVL 4W4OC 2COQA 3HE6D 5F9OL 3ZK0A 4D6TH 2IM9A 3V55A 4YJ2A 1O5PA 3PWVA 2R15A 1B0WA 3VFMB 3GT6A 4V1DD 1DFBH 2ODMA 2NUTB 1DBAH 3K0YA 2ZYRA 2V7HA 3BRFA 1YAIA 4M6NH 3HHMA 2MNJB 3AT0A 5GRZA 2A0LD 1WZKA 5CMAA 3ZQWA 1HX0A 2ZCZA 4PJHB 5EHFA 1ROCA 3SJVB 4CC0A 5E2WL 3GMMA 3MMEB 1LD9B 4B50A 1EMTL 3SDDB 5KTEH 5E2VH 3CCVV 5F1OB 1BYNA 5JA8B 4N2KA 3HBGA 2M83A 3OHXB 1WK0A 2PY5A 1F86A 1O5DT 1X4YA 1WG3A 3MRHB 1N3NB 1QUNB 3O9WC 3S97C 4O4HB 5J2TB 3MRHA 2XACC 3QIWD 5HGDA 2AEQH 3C5SB 3KVQA 3CWBH 3RYHA 1YECL 2VLME 3HZVA 3WD5L 4MAZA 4PRIB 4QHMB 1S72V 3ZY7A 5H37H 2EDQA 4PWGA 3O3BA 1Y66A 4EN3A 4K4KA 5G2NA 2E27L 2Q0ZX 4Y19A 3CFQA 3NZHH 5BOPA 3S37X 2XVGA 3HJEA 3O3AB 2OFQA 2F5AL 3GUFA 4IU3A 3K1KC 4XBFA 5ADOL 1X7TA 5CLYA 4M7ZC 3CPUA 3O4LD 3VGAB 2EDBA 4J1UA 2PW1A 2G0LA 2OMWA 1PZBA 1KLGA 3F7KA 2DWDC 1BPVA 4JI8O 2R23A 3L3GB 3ZZQA 5IF0A 1XNRB 4OKVA 2NUTA 5KA5A 3NA9L 1QSEE 5KUKA 4O4JA 3V8CA 3APQA 3HKDA 4ZOBA 2R8SH 1WZ1L 2A9HA 4X8CA 1P1VA 5IHBA 5F97E 1PPJH 2VC2H 1WC7B 3QJOA 4H8PA 2YEZA 3Q1SL 3CZGA 3FH7A 2Q86A 4I4WA 1MFDH 1BHGA 1W0WB 3DJTA 3HBQA 2DJ4A 1NL0H 2YQBA 2LO1A 2GJ6D 5KVFL 4V33A 1FJ1A 4FFBB 2I07A 3NRPA 5IBTL 5LJYH 1LP9F 3PQYA 3U30C 2ADYA 1SY6L 1XAUA 1MCRA 1L6ZA 4OZFG 3T2LA 3HNVL 3ISRA 5GSRA 1PZ3A 1JVOA 4LSVH 4XWOC 4AIOA 4EKWA 2C3VA 1SRYA 2NNAB 1M9WA 3U1QA 5J6GB 2D3OW 5AVXB 5BRZA 2JJVA 2OL3H 4RISH 2JI3A 4KROB 3PPSA 5A40E 1T2QH 3STLA 2ZF9A 5K1NA 4BK8A 3ZR5A 4DERA 3P54A 2QQLL 4WNQA 3NRQA 4JLRB 4GX1A 4WSGA 1UFUA 2WBKA 1GIGH 1J8SA 5FOBA 3R7QA 1F1DA 1AQKH 4X7DC 3ULUD 3SR2C 1XMOO 5BS0B 3QQ4B 5EH1A 4U2YA 1CYGA 1FV1A 5KHIA 3L3KA 4ZOAA 5DFWH 3T1YB 3OJDB 3LS4H 5F7HA 3HRZA 3SZ6A 4PGCB 3VYNA 1F2XK 1ZAGA 1XGUB 3E9TA 1ZSDA 3MJ7A 3BSHA 3GI8L 2A06H 3MX0A 1RUKH 3WEOA 1WB7A 4XAKE 4KHTH 4QPJA 2XLLA 4WENB 4PG9B 5DN6G 3D07A 4YC2C 1CDHA 5BJTB 3QRBA 3RDJA 2VSKB 2DM3A 1IAIL 2R4RH 4OT1L 4ENED 2IEPA 1BVOA 2K70A 3WJMA 1YITV 2BOLA 3D2TA 3FTSA 5FB8B 1L9SA 4I3RL 5SWSE 3RX8A 1MVUA 5F9JB 2BC4A 4Z7IA 1QI5A 3CMOH 3MKKA 1PKXA 3HS0C 4H40A 5ESVA 4H26B 3WHE0 1AQMA 2CBQA 5AALA 2IO5A 4IOFD 4GSXA 2CDEA 5BZBA 1G7IB 2QPEB 3IFLL 1N7ML 4LSQH 1B06A 2LLGA 2MQ0A 5DMGC 2AQNA 3Q05A 1KJ2L 1TEGA 4M7LL 3GTNA 4QT5B 1O7VA 2MIZA 3D05A 4PA7A 4MHHG 1D9KC 3SDLA 4JLRA 1TJIL 2GW5A 3O3DB 1DVSA 2IH8A 3L17A 4OZIE 4XWGL 3OKLB 2FYUH 2ZKYA 3TN0B 2BY3A 5JO5A 2AQSA 1Q0YH 4JZNA 5ESAB 3UYPA 1XR9A 4F5CE 1DTUA 3CZFA 1F3RB 1FYTA 1GA2A 3INOA 4Z7VE 3MLRL 1RHFA 2PO6B 3RVVD 3U46A 2B5IC 3BW9A 3JD1A 3RBGA 3CVCA 3Q5YA 4PYHA 2IH9A 4OAWA 3KLHD 1AXSA 3H9SA 3SE6A 3ZMRA 5K9QG 3V0AC 1ZHKA 4P46A 4I0PB 2HVBA 3F58H 5E6IB 4W9FC 1U8MB 2EXWD 3UTQA 3MLYH 3K72B 3ORJA 3HRZC 4QNPF 2D7TH 3ZHFA 3UAJD 1IE4A 2D0HA 4TVUA 1HS6A 3BWZA 2FO4B 2CIIA 2CLVB 3B2VH 3RWFB 2ZXWC 1GAXA 4C4UA 4N2AA 5IWAO 2EC9U 2VN6A 4PRPD 4NWTH 2IJIA 2OULB 2NTSP 4U0RB 3ZTNH 2P5PA 1YIJV 1B3IA 1NBVH 4XRCA 3K08A 1WTLA 4DKFH 2BVYA 1UD8A 4MCNA 1JP5A 4NI6A 3ZTCC 3LHPL 2AJSL 3V5KB 2IU0A 3AM8A 1IC4L 3WKYA 3ARDA 1Z0MA 4B0MM 3RWIA 1TYEB 5DD0L 3D3IA 2WKOF 4WW1B 4W9ZA 1NBCA 2G30A 3B2DC 2XWJB 1Z3GL 3VQLA 1AHWC 3APOA 1G9NH 1JUFB 2ZUQB 3PAVA 5FUOH 4GS7C 4P5KB 1IC1A 3BGMA 3N42F 3RWJB 4D0DB 4QHUA 4G9DA 3B77A 2QVKA 3FFDA 5IMOA 4M93B 4JYAO 1OAKH 5MERA 2C8NA 1QNZL 3B9EA 2OMVA 4PJAF 1A7RH 5HVFB 1HC1A 3B3BA 1XQ8A 3NXSA 4X6CB 3SGDH 3D2UB 1XCQA 1B6QA 3D51A 1BX2B 3CJJA 2EH8L 3IPFA 4XMZA 5A3IC 2BY0A 5HYEA 1XMOB 1X44A 1U8PB 4A55A 3ILEA 5L3GA 4NB7A 4LSTL 4PTTA 4LE8A 4Y4FD 3ZDXF 3PJSK 3FFCD 2NQDA 4N3TA 1JBJA 2FX9H 3FT2A 3PWPD 4Y16D 4AQ1B 5LOVA 1FYTD 4NNXB 3HCVA 3SDXA 3D69B 2YPKA 4PA3A 2RMKB 5DJZA 3SCMC 3QWNA 4IBUA 3ZE2F 3HI1B 3LAFA 4GSQA 5DK3A 4DUZO 2WUCL 2IFFH 2EX3A 1J8HE 4XP5L 4LCIH 4YJ3B 1KXVC 5EO0A 1R5VB 1F23A 1PJ9A 3X3GL 4TUYB 4Y5XC 1NMBH 3CU1A 1FFXA 5HGBA 1JAEA 3HMWL 1ZSDB 3MJ7B 3QQ3B 5CWSB 3W57A 1XGQB 4DO2A 3WMPA 3CEIA 3RL1A 4PRIE 5KYXA 1QLEC 5EBMB 3AG1B 2ALAA 3QRGL 1DGSA 2H7WA 2HXAA 1VEOA 4RQEA 3TBWB 3CLFH 3GZQA 2VQUA 2Y1AA 2Q3XA 2QWOB 1NCDH 4JFZH 2WXGA 4G83A 3VQYA 4YDJA 1P7KA 3WUWA 4HDIB 1I31A 4EUPA 4AQOA 1I7TA 4MXVE 3O81A 4IDJL 3ML9A 3T71A 4ZW3A 1C5BH 5CEZD 1NMBL 3CBRA 3O3EA 1A6VH 3NH7H 3PWJA 5EU3A 1CFMA 4D8PA 3PGFH 3UMTA 4IJ3C 3O6ML 1RD6A 1WHOA 1YDPA 3KW7A 5TGBB 1A3LL 1MCSA 2JVUA 4UB0L 1S7WA 4XOAA 1MCFA 1SPDA 4X7CC 5E99L 1JHLL 1K34A 4QI3A 5HHXH 5C0FA 3L74H 3RUGA 1VGEL 3GEFA 4GQ9L 3EDEA 1A6ZB 1CFVH 2VDNH 4OD1H 4NPKA 1V10A 3Q9QA 3EBHA 2ZNJA 5CXPA 4U6VH 5E8PB 2CXKA 3UC0L 3AY2A 5LN4A 4N2IA 3VG0H 2FAUA 4UQIM 1EUTA 4HS6A 3RL1B 3OWRA 1SRDA 5B22A 2ITDA 3AWGA 3FQRA 1T6VN 5DMKA 1SHXA 2ADFL 1P4RA 3EDFA 2DWXA 1XXFC 2BVQA 3Q2VA 1EZVY 1CT8A 1ZPLA 4O2AA 3BH9A 2MH4A 3DC0A 4KDTA 5B66Z 1P2CA 3NN8A 4ZX4A 2IBGA 4H8VA 4UDUB 1PBYA 1ZDQA 5TTRA 4NNYB 4NS0A 2X4UB 1N36B 4WY7L 1DN2A 5DFVD 1QYGH 4QR7A 3MSPA 2GAZA 3MBXH 5FCSH 3LUTB 1BCIA 3DIDA 3ETTA 1U8NA 3V6OA 4MLIA 5IFJB 4K3JH 5DA4A 4JFHD 1YLBB 1IEBB 4PV8B 2EVFA 4CSPA 2Z0UA 5EU7C 4TQDA 1J11A 3V0IA 3QUKB 2Q2EB 4ACTA 5HDQH 1OP3H 2ZCEA 2R7EB 2FVNA 2X1XR 5MP6L 1A4AA 3B2EE 3OHXC 4E2OA 1DN0A 5LP6B 4AK1A 4EJ1C 4LVHC 4KO5A 5EC1A 1E30A 1KTRL 3QDHA 5GGTA 1RERA 2K4WA 1M1XB 2OI9C 1N5YL 5GONB 4QHUB 5DQDH 1YY9D 4XVOA 3G4SV 1TSHA 4BHUA 4PJFE 5T1DH 4PTUB 3E80A 1T2XA 1AZZC 1OCZB 3KPRE 3M7MX 1BE3H 1IXBA 2JE8A 1ET7A 3EBGA 3S5LG 3VGFA 3TV8A 4DH2A 2QGNA 4CGTA 2MWCA 1H2SB 4K3DL 4ONFL 5JW3H 1Q8MA 2VR4A 3F5WB 1NOLA 4HWEL 3CMEV 4AEFA 1YZBA 3WDHA 1X9RA 3FB5A 4HU8A 4N0UE 4CU7A 1S7VA 5FM5M 2X4PA 1O9GA 1W72A 4KRPD 3ZQ9A 1HSBB 1BZ7A 3JXAA 4Q89A 3ZKND 1ZJBA 2VDPH 1JMXA 1QTYT 4J3TA 3V79C 3DI2B 3F7QA 4AQYO 15C8L 5CBHA 2Q87A 4FFZH 4LOUC 1EAJA 2JEUA 1XF3B 3GSRB 2ED6A 4O4LB 3F7VA 3FUEA 1O6VA 2HX9A 1F4NA 3WYRA 4DGUA 5GTIZ 3IS1X 2UUBO 4YDNA 3EAKA 4PR5B 5IHZB 1BSIA 1U8MA 4WI2A 2V0AA 2EEBA 1A7QH 3L9BA 1AXSB 4BRVA 1KZYA 2ZE6A 1A6WH 3OX8B 2J5LB 1I8KB 3CH1B 3P0VL 3UTQB 3E7JA 1KPUA 3HNSL 3KMDA 5E4IA 1I75A 2G3MA 5BO0D 1V54B 5T5NG 5L4FA 1KEGL 1MG3C 2FBJL 3WB0A 2XPGB 3M8OH 4DR4O 5KN5B 5IVXE 3S34L 5GGSB 3M6DA 2IBZH 2C4XA 5A2JH 2XPYA 1MLBA 1FPTH 2VN7A 4XH2B 3DJ9A 2BSSA 4XN2A 5GIRA 1T5XB 4NC2B 1L5GB 1Y6XA 2XAQA 1WYJA 4UOJA 4C56E 3L7EB 1OAUL 3DK0A 1DUYB 2DMKA 1NGZB 2EUZA 2ERJC 1RKRA 1X5AA 2FKXA 2QFPA 3NJIA 2C4FT 5IQLA 5IREA 1RI8A 5JJJB 2PWFA 4JRXD 2R2HA 5DD6B 3FKUS 9PCYA 4GG6F 4TV9A 4RO2A 2NNXA 2X9XA 3O41B 5BW7A 2XTJD 4ELMF 1HAUA 5I1DB 1UM5H 1QU7A 2W0PA 2XWDA 2ROXA 1S6NA 5CEYB 4K3DH 4ONFH 3IPEA 1FAFA 3LRSA 3QUXA 5TK2A 4M62L 3UTSB 3AG4B 1L4IA 4J41A 1KGWA 1MPAL 3AXLA 2MPAH 5HJDA 3UIYA 1SYSB 3LRMA 4K23L 5J4MA 2Z35A 2OCJA 1E6JH 3MA9L 1IAKB 2QELA 2C3WA 4XBEH 1RHHA 3CLWA 4HCIA 4OLYH 4PLJD 4WHYG 3KS0J 4X1IB 1ED3B 4HWBL 2FWOA 4CILA 3NZUA 1D5MA 3WKMH 3MX0B 1VFBA 1DEEA 1AR4A 4FK5C 1NMCC 2CQVA 3SBWC 3KGTA 2XTAA 2XN9A 4MZIA 3G5VB 3H42H 3B1UA 4HQQL 2JNZA 3TJEH 4F91B 3O2VH 5AB0A 1WWWX 1Q72H 4RLDA 2EDOA 4Y2DB 5A2QN 5E8DH 3W11D 3JAWB 3E6HB 1CFBA 3RYMA 4FZ1A 2WAQA 2A0LC 2B8OT 2UZXA 5EUKA 1QABA 1V8HA 1AS6A 4XCCH 3UJTL 4JZJA 3VWJB 1U3NA 2A6JB 1MY5A 2AFNA 5BS0E 1A6UL 4LHUG 3I56V 2BJML 4XXDA 2XZAH 5EN3A 2EIDA 2R0WH 2ZYHA 2WLNA 3LZOA 1MHPH 1WBZA 3RUGF 4NBXB 2NNCA 1HI6B 2WPDG 1FI8C 4KKAC 5F96L 5BCAA 5EEWA 4AL8L 2CUGA 3K5LA 2ZKHL 4JPVL 1GJUA 4EIBA 1MZFA 2VLKD 4FJZA 4Z7VA 1U8QB 3NSFA 4FQ1L 1CFVL 3K6SB 2AV7A 4PDLA 4RMQA 3X13A 1VGEH 2J1KA 1OQXA 5EO1A 3QULA 5DZOA 4N9GA 4P2CG 5KVEE 4LLWA 1A1MA 2J2ZB 4NWUL 4Y19D 5LCVL 5E5LA 5F1NA 4IEFB 3RHWK 5GGUB 1XDCA 4JM2D 4L3ED 4Q97A 4TSFG 4EQ2A 3RWCA 4XBGB 3QDAA 3EXLA 2ICWI 2K7QA 4XC1H 1K3EA 1PY0A 1PV0A 1Z2KA 4A37A 3ZLQC 1WA8B 1JNNH 3CCMV 2A9BA 4GEJA 4JS7A 4G82A 5D7EA 1BLNA 3DBXB 5IMLA 2FH6A 1AQHA 1FS0G 1EMTH 1H0DB 1LEIA 1OE1A 1RIUH 4NVPA 2WGXA 4YWGL 4QGYA 5IB1A 1B0GA 1X5XA 4QHKJ 4JFZL 1R5WB 3T0WA 4N2NA 5I6NA 4LU5L 1IX2A 4RGOL 4N26A 2JI1A 2XSKA 1P7HL 1S7TA 1OPOA 3LOWA 4GP8B 3BO8B 2XASA 1W72H 1CLOH 1LUWA 2I85A 4YDVA 1XCQB 3FQ1A 4FERA 4XPBH 4ZK8A 4ZI7A 4E41B 4U3SB 3W9DA 5I1GH 4ABMA 3W0WD 4IU2A 5KAIZ 1LXMA 5EZLB 2Q6WA 1AGFB 1T1YA 1TJGL 2ITEA 4G7VL 3JV0A 4HIEA 3WSQL 1JGVL 1TZOA 3MRBB 5CIPA 2O5YH 3BKCH 3H6AA 5DMJB 3SBRA 3VSVA 4Z7WF 2GAZB 2VQ1A 1QNMA 3LKPA 3NCMA 1QHQA 4N3UA 5LHDA 1A2YA 3RWIB 3CVIH 1TIUA 3QO0A 3FB8B 4MYPA 1AAJA 4YXKL 1QFWH 3JZYA 4H5SA 5C0AE 1F4AA 2FBOJ 1U8OA 3O11B 1B4TA 1WAAA 3Q8BA 1QW8A 1IBMB 2HFFB 2EE3A 1J0KA 3AQYA 4G5AA 5AVSB 2B20A 1J5EB 4PHXA 2IALA 1E4HA 3B8YA 4YFDB 1BXUA 3BUYA 3PF2A 4H20H 2C26A 2H3OA 2AZAA 1N4XL 2AAAA 3BP7A 2E56A 1A64A 3TT3H 3ENEA 3V7AE 2VLJB 4AYSA 1OIOA 2N56A 4MJ5B 4BUQA 4MB5A 1YMHA 4PJ8A 4PN6A 5K39B 5BUGA 3ULVD 4K3AA 5FYJE 3MAWA 1J88A 2FX8L 4JDVA 4KRLB 3O45A 2C9AA 4AXWB 4CMMB 1A6ZA 3B9KC 5EORH 2BP3A 1ITBB 4PBWD 5BMFL 1DQDL 2D7PA 3V4VH 3ESOA 4ABWA 3GS4A 2ADPA 3VDBA 2YMXH 2VITB 1VMGA 3WN6A 2WBXA 3EYSH 4YHIB 2G0KA 3V5DA 4OGYL 1K4DC 3DV4A 4OLWH 3BPZA 4R4BA 4JFOB 4YGVB 2V2WA 1IC4H 2YJLA 3BKYH 3PHQB 2IXQA 2CK3G 2EUWA 3MO1B 4KMTL 3VWJD 3IMUA 4KJWD 1UZ8A 3VFNB 1QMUA 4M03A 5ISZE 1NBVL 3A0OA 3N1PC 4BFJA 3P32A 4RESB 2GYSA 4MJIA 3BKCL 4JM4H 5IB5A 4DEPC 2XTJB 1MW1A 2VDKL 3DX3A 1DCLA 4JI4O 3B2VL 3FQXA 1TJGH 4HG4J 1OGTB 1SLWA 1UJ3B 1ZKAA 2Q5BA 4Y5VB 4HOZA 2X6VA 3BXNA 4QKXB 4F58L 4GYCB 2BRQA 3LTVA 1ZTXL 4MD4A 1A6AA 1B2YA 3JARA 4X5PA 5E4EC 2PPAA 5E6UB 3D34A 5D7LE 3ZMUA 4WI3A 3LEVL 1NFIA 2GT9A 4ZUVA 4LH6A 3E3QE 3ML8A 4DV4B 4AGNA 4NO0B 4ERSL 2WTRB 4Y9BA 2W9LA 3EYFA 1SF5A 2KDGA 2RDCA 5B8CC 1XGPA 4MNQD 5DEDA 2A3TA 2QMKA 4JQXA 4B3EA 1VHPA 2VSDA 4PQXA 3GSNL 1XGUA 4PGBB 5F7AA 2P6JA 2CIKB 3DWTA 3E2HB 1S7SA 5KSUB 1DUYA 1R75A 1SEBA 4WWPA 4RWYL 3VI3E 3E3QC 3KJ6H 2VN3A 1NDMB 3ZBHA 43CAA 5GRXG 5IBUG 3KEDA 2JLPA 2MHAA 3ZTDC 1DVZA 1JOYA 5HFMA 4L1SA 2EDEA 2ORBL 4JFQA 3GKWL 4BQ8A 3T3MB 1FFNA 1J95A 5IMMA 2HB0A 2YXYA 1T7VA 2D2CC 4P9PA 1BZQK 4LVEA 1JWMB 2GTAA 3ARWA 4ZX5A 4AYEC 5KN5A 5JNYB 4S1RL 1WDAA 4KUZL 4F9PC 5AVRB 3SKNA 1UXMA 3HR0A 1O6SA 5C8JA 3ULSB 3DJSA 3MLWL 2ITFA 1G43A 3PHOA 1UWXH 1FL6B 5DJ6A 5I18H 3V10A 2YQ3A 5FGRA 2OA9A 4XPTL 5D1QE 3AW5A 3BLPX 4FX5A 1R34A 1N0NA 1M1SA 4BD4A 2B59A 3MTRA 1CBVH 1WFNA 2XWBA 4PDVA 1F90L 2J6EH 5IIEA 4DPBX 4LF3A 3HZ3A 4ZTOH 1INQB 1FNEA 3BLKA 3K06A 4DUXA 1F41A 3WELA 4ALAL 1HHIB 5LYJA 1D2DA 2VR9A 4WV1C 5K9QI 3QI9B 1AP5A 4XXCA 4YUEL 1RJLA 3OLEA 4OI8A 1NLDH 4OFDA 2CBPA 3HPLC 5E6ZA 3WN5A 1IXMA 4DYLA 3K9SA 5BQ7A 4NGHL 2I26N 3GKZA 1KXTA 4HSAC 1OAQL 3JWNG 3JAKA 3APFA 5E8DL 3N40P 4DP1X 3ZRWA 4FXLA 2P1YA 5CEZH 5C0DB 3NSJA 5C92A 2NXZB 1CDBA 1US6A 4LAQL 1KJVB 4MA8L 3FN3A 3RKPA 5AW9B 4P59L 4Y5YC 5FYJU 2BOBB 1CICC 2OV0A 3FRPG 1YEKL 4LPWA 1NBZA 4LCUC 1SXAA 3N41F 5DURB 4N23A 3PPEA 2QBWA 2FJHA 4E9XA 4X9BA 5LAPA 3VXQB 4LHJB 2OKMA 4X98B 3S6CA 3K8KA 4RAHA 2PABA 3ZTJG 1TETH 1HEHC 4FKEA 1JRHH 1E7UA 1F13A 5C08D 2F4VO 1XEDA 1O0VA 3ME0B 3O8XB 3CCEV 3T0EC 1N70A 5ETUB 2WYIA 4L9LC 2VW6A 1V7MH 5KVFH 4XMPH 1OZ0A 1HNZB 3GSXB 3N2GB 1RP8A 1I94O 5DQ9B 5EBWC 3WS6A 1IC7L 4LVHB 5C6WH 1AI7A 1SHMA 4FNLH 1LWJA 3OKKA 4KHXH 3VGAC 2JKIS 3K5MA 4FJCC 1Y1UA 4XNMA 5ANME 2CDGB 4WWKD 5CGTA 3D3VE 5KJ4A 1U8NB 1E5AA 3VXOB 1WZ1H 2PCFA 3FT0A 5JXEC 1C9SA 1KIRB 1QSFB 2DQIL 5K1JA 3G71V 4Q4EA 5FV2A 1L6XA 3NJVA 3A4AA 4NCC2 2OK0L 5ICYA 5TDPA 4ZMXA 1CPUA 4YFLI 5F7BA 2HA1A 4GINA 3DARA 4GQRA 4KUCD 4GQZA 5I8EA 1BF8A 1MW2A 3PJLA 3UZVB 1FFTB 1NR7A 4XNZC 4JGNA 2YWYA 1EX0A 3D25B 1I1YB 4UBDD 3O9WB 2DD8H 4XBMA 4IRJB 1E3FA 1JWUA 3SOTA 4FQXB 1A7PL 4P2RB 1UZGA 4RBPK 4PW4A 3UC2A 1G7HA 5CCJA 4TUJA 3JZ7A 2XETA 2FK9A 5SWSD 2Y0PA 4N4YB 2IANB 4N20A 1XDTT 2XNAA 2Y2WA 4RZCA 3U6RB 3DO7A 1RZ8A 1OV8A 4N87A 2KG7A 2LE9A 3HPJB 1NFIB 4G6FD 4KV5F 1QR9A 4WCYL 1R46A 3AJ7A 1NTKH 3WTTA 4CC4C 5C0AA 5A7BA 1VFAA 1YUKB 1TZHA 4X99B 4AJWA 1INDL 3JCZA 4M3JA 3EW3B 1RSYA 5KTEL 1DEDA 3LIZH 2XV0A 1A5FH 2G9KA 4NQCD 1RFDL 2OP4L 3OJMB 5AVZB 3VQ1C 4Y4HD 4NN6C 3V4LA 5D1XB 2EVHA 4YDMA 4X7TB 5JDSA 3B9DA 4X66O 1CMOA 3QAZB 3T6ZA 2LFEA 4XOCA 5DFTA 2O61A 4YHOH 4DV3B 3R66A 4MJHA 4Z78B 3RY4A 3DSFH 3ERXA 1OHHG 1ZTXH 1B9ZA 4HWEH 3IWUA 2MKLC 4WI0B 4WUUB 4CJ0A 5D5PA 2ILMA 1BBJB 3IN2A 3WUWB 3CQPA 1DQML 2HPOA 4WFFE 4ZZFA 3RNKA 5ES4B 1HXMA 2V5TA 3V4UH 3E6FA 2JKSA 3OG6B 1UWFA 5E4AA 1Z9OA 5K59F 1MQKH 4XPHL 5DVKA 3APDA 3OL2A 4XOBA 4JQVC 3BWAB 3TK1A 4GG8A 1TR7A 5DT1H 4PR5A 5IHZA 4NAMA 4KMTH 1XMQO 4NKQB 1DQIA 2F68X 1JK9A 4TNFA 2F15A 1J0HA 3HLKA 3IT8D 3HI6L 3N85H 4OGYH 3L70H 4P2YA 4OD2A 3KG2A 5CP3H 3BVWA 4UCFA 2WZPA 2PPEA 3VFGH 2OJEB 4NZDA 1AJQA 1F4MA 4IGBD 5CD3B 2XZCH 1U30A 4MFHA 2AXJA 4NT6B 1TQSA 1P49A 3LRLA 1T1XA 4F7EB 2AEIT 4KC3B 3D3VB 3QORA 2X7LA 3KHOA 5I19H 5IQ7L 2FX8H 2DYSB 2YPKB 2ZAHA 2RBLA 2XTJC 2EXYC 4OPAA 1G5GA 2XHBA 1S46A 1BPLB 2ZPKL 4Y88A 1JPXA 2Y9RT 3ESVF 4OU3A 1E4KA 2A6KA 4Z6AT 2F54B 1FCCA 5DJ8B 3ZUCA 3ZDZE 1R6NA 2X05A 4B60A 1EEYA 4I77L 1T3FA 2PWGA 2V2TA 4M02A 1EEUA 1FC1A 5L3FA 1V27A 2N7SA 3WNLA 4F27A 2FNBA 2ROYA 4I7ZB 2KLTA 3B7YA 3REWA 1AZBA 3CFCL 2EC9T 2P26A 1HFUA 4H1LG 5F7NC 1IT9H 3TO4A 3SJVE 1LYQA 1TQVA 3F84A 5I2IB 3L9DA 1JHLH 2PTTB 3TASA 2GTSA 3DX0A 1AKJA 1KUMA 3U2SA 3CN3A 1Q9LB 3L3OA 2LQTA 4G8FA 2MJWA 3W1ZA 2PW2B 3LN4A 2H1LM 4PGJA 2AF2A 2OXHB 4FKKA 4MHHI 4BBWA 4X7SL 5A2KH 4K8XA 1KTCA 1OW0A 3L71H 4X1KB 2LQRA 1NH2D 1T7XA 2NQCA 4HISA 2ZX9A 3L72H 1UZ6E 1VADB 2W0LA 4PJAE 4IRZH 4WHTA 2ID5A 1RAMA 4LBEB 1PQZA 5H6RA 2X7LB 1FN4A 2W81C 2R70A 1B2WH 1BA9A 1R3HB 1NCDL 2VWEE 1PIGA 3TIEB 5TQ2H 1TPXB 3SO3B 4LU5H 3O4LA 4N24A 3UFIA 4HIHA 4JHAH 3UXFA 4G2KA 2QHLA 3FSWA 3SGIA 5D93C 3I6GB 5MEPB 3V0FA 1YEJL 4I50A 3QUYB 3U7WL 3BVVA 2HJDA 3B5GA 1T66D 3QUMB 3DX2A 1IIIA 3PAZA 5B8CB 3FUNA 4YH6A 2A74B 1OO2A 4DV1B 4BZ1H 4L3EA 4DO6A 3C6LB 3DSNA 4PLKD 1LEKA 1F42A 4BFIA 2WUCH 2UVFA 3OKLA 4IHOA 5HDBB 3P4OB 1QR8A 4R2GB 3SGKA 5EBWB 2FHBA 3QA3A 4MNQA 1FNGA 5I9QC 4RWUA 4YNYB 2UXDB 3AABA 1MRDH 4X6DF 5D96C 4FQ1H 5D1QB 3OB0K 1Q9KB 3BAEH 3PWLB 3TVMC 4HK3N 4NIKB 1WGVA 2AEOA 2XKUA 4YDLB 4U2ZA 1QR1A 3VCLA 3IC7A 4JY5L 1DEEB 1T2JA 2IH1B 1ZLZA 2PYFB 1CYWA 1USZA 5F7DB 1YVWA 5DM6V 3AS3A 4YBLB 2GHZA 2ZQMA 2NMSA 3LMJL 2P24B 4A67A 4Z8FH 2V2XA 4ZFZA 4AYMC 3DC5A 2H2SD 1NEUA 3PDOB 5DFVC 1OAKL 5C0AB 2WW8A 4FG4A 5BR8B 5T1LA 3GMQA 4LPUA 1YJ9V 2GJ6A 1N0XL 4A2EA 2JGDA 1MAMH 1PS3A 3RFZC 2NZIA 3I6KB 3N27A 4Z7NE 1J8KA 3B9AA 3TM6A 4TV9B 3C3TA 2HTKC 4EE2A 1DTOA 1EN6A 4PHZA 2IBZY 4QRPE 5DZVA 4DAGL 2P8PA 4JFSA 2A6IA 4LKCB 5C0CB 1Q94A 3SIKA 3WUWG 2VLRE 3AREB 1M57C 3KPPA 3OVUB 2Q6AA 2AXGA 2QTSA 1BGYH 3ZTNL 5IB2B 1LDPH 2CTPA 4P2QA 4H13B 1CL7L 4IBSA 2WM0A 1XCWA 4FPPA 1AXTL 2MK3A 5JVDA 2A5UA 4PJAB 5DJXA 3NJHA 1WNSA 2AJVL 2VDOB 4YY3B 1J8RA 2RGSA 4NZTL 2DMXA 1QWNA 2PMZA 4HJSA 3C8KA 1P4IL 4L37B 5IHUL 3N42B 2BTQA 2V6HA 3PAYA 2YS8A 1IZKA 2HT2C 2QTEA 4O9HH 3LXCA 5D7IB 4E9LA 4H88H 1SJHA 2YA0A 1DQLL 3CRCA 1BD2D 4NERA 4YK4B 1R4XA 1T5EA 5KSBF 2WO2B 4AX3A 4M61A 4Z7NF 1PW3A 1AHWB 1MOEA 4G1EB 2L7EA 5C0EB 4Y89A 4IMLB 4ZNCD 3SHSA 2QKAA 1TUBA 1YPZB 2VDML 2AEWA 4CSZA 3K81A 3LEYH 1KTLB 1VP7A 3QUZD 3UAAA 3T08A 1LO3L 1YY8A 4LFHG 4ZMVA 3MV7E 1VIWA 4ZBJA 2E74B 3UTPD 5IF0B 4ANWA 1G6RL 2C1OA 5DMIL 3AMKA 5FYJD 2YK1L 5CSBA 2QQNL 1AZVA 3HKDB 4X5RA 5AAMC 3RWFA 3UP6A 5IHHA 1R3JA 4M6MH 5DDHB 3TC9A 2GJRA 4X65B 2XQBH 5E4EB 2LFGA 1JN6A 4PIBA 2VWJA 3KH4A 3NFSL 5C7XL 1U97A 1MUJA 1HN1A 5CA1B 4ELDA 2Y5QA 2ERJB 1T66C 4NOFA 4Y2OA 4L8JA 4JHUA 4XHJC 1T83C 3VXSA 4UYQA 1JZFA 2W1NA 4HLZH 4N2HA 1IBZA 2ODHA 4MRBA 4PEEA 2H32B 2OTWA 5A7EA 5INCB 3LEYL 1ZS2A 1C8PA 1YYLL 5FNVA 1Z9SA 2B0SL 1BXVA 1CR9L 2FYYB 3ARRA 3FZUC 3KPOA 1SMOA 2BSEA 3MKGA 4JO1L 5B39A 4Z0BH 3MCLL 5H35A 4EDXA 4POYA 4BFOA 3AROA 5LLIC 1QLNA 4LF4B 3WTUA 3SDYL 4UTAA 1SN0A 1XSKA 4OF3A 4TQEH 2XVBA 3VMNA 4M4RB 4LBEC 2KZKA 5C93A 2K6YA 4BFGA 2CE6A 5L7XL 4HX1A 4FAAB 4JI3B 4PELA 4FI6A 1RJZA 5C8YB 5EU7E 3VB8A 5EU6E 4ONGH 1U3HA 1GZHA 2WZ5A 3QJHB 4M4PA 2FZ3B 2WSSG 4J3BA 3SDAC 2JDIG 1HYRC 4FLZA 3B9KA 4UT6L 3WO3B 3S8WA 1FG2B 4HUXB 4DV6O 4IGBC 1KN2H 2VLKA 4U1NB 3R65A 1TJXA 3VFVB 3WLWD 2ARHA 5EIBD 4IRSC 3D39D 1UHVA 2WV3A 4RZKA 4KKZA 2EJ1A 2FJFA 2YARA 2CM5A 3BT0A 4TQ8A 5I8OH 1JMKC 1JCVA 5I24A 1G0XA 2DAVA 1X7QB 3FDWA 1M71B 2B08A 1DJGA 2VDLB 2MCPL 1R0AH 1FNHA 5IBTH 4RAIA 3K79A 3FSOA 2NYZA 4NZFA 1IO4C 2OMNA 2EYRB 4ZFOA 2KI6A 3IMBA 2FD6H 5IJ0B 1FUNA 3U83A 1S0VA 4DR5B 1YF2A 1JDDA 3BE1H 2UXCB 2GV9A 4WO4B 3L6FA 3JASB 3ARFA 4X4YA 4HPHA 2VE6B 2CUMA 1X5YA 1Q6UA 3JV6A 5I71B 3ETBJ 3LKNA 2JVDA 2FLMA 3C6SB 1SDDA 5I26A 1FORL 1JV5B 3E2HC 1LHZA 4NCDA 2VZOA 3R18A 1AI1L 4HJJH 4WI0A 1K6QL 5BS0D 2HT4D 1RK0B 1GSMA 1MNNA 1XR8A 2TSBA 3ETDA 3IPBA 4MNGB 4ZHQA 4R5XA 1CD1B 4JO4H 4JTAB 4KUZH 5KYNA 1CXEA 3I6LE 1AC6A 4ATWA 1Y0LA 4PJ8C 1J8HD 3ETQA 5L6YH 1BIHA 1LO5A 4PP2A 4L4TE 3ES6A 4JI6B 4LMQE 3WUZA 1MFAL 4Z1MG 1PL4A 2QSCH 3GKWH 4P57B 4NM4L 3KBHE 4S1QL 1KPVA 3G5VA 3K2UL 3T4AA 4BH7A 3C5JB 3GSWA 2BNRD 5KVMC 3CSBA 4L8DB 1FHGA 2X87A 5JIIA 5LHHA 4LZKA 4Z7QB 2GK0B 2QKIA 2F2HA 5AW2B 2Z31D 4OPHA 1KU9A 3PWUA 2GEEA 3FKSG 4HZLA 1XGQA 3CZEA 3R06A 5AYTA 4F2MB 1D9KA 4QTHB 3W5MA 4JHBA 2WXRA 1JG9A 3Q2WA 1N33O 1MHHB 5HDWA 2WAHA 3HUJA 3OG4B 4MVZA 5FM4A 2YGQA 5J6SA 3V0VA 3AK3A 3VQWA 4AL8C 4UM9B 1WFOA 2H41A 1J86A 3MRNA 4QJ3B 1CUOA 5F6IB 3QR1A 3QRGH 3IFPA 4NQVB 1MZZA 2PW2A 1H8SA 2AJUH 3LN4B 4PJEE 5AYUH 4DR3B 2O6CA 1NPJA 1UKSA 3VO0A 3WTYA 5TE6H 4IRZL 4Z7UF 1CLZL 3AREC 3EJUA 3N44F 4XBPB 4B3MB 1TFPA 5B38G 2FNWA 2V9TA 3D4ZA 1HQRB 4L4VA 4N90E 3FC8A 2TRYA 3CVHA 2W91A 3HE6B 4DVRH 3HFMH 4YJZL 4HXAL 3H9SE 3BAXA 1I53A 2Y23A 5AKRA 1N8ZB 5I17B 1Q9OB 5DD5H 1RJZB 1D7CA 4P4KB 4O4HA 2EO9A 3CVHH 5HYSB 3EDJA 1MEXH 1I3UA 2BIQA 5GS1B 2ZM6O 2JJWA 3VXTA 2XV6B 4ZXBD 4F6RA 4EIZC 2WWMC 1DVUA 4NQSA 5LDSA 5LQBH 4WSKA 2APWA 4GAGL 1NTDA 4XNQB 5HVHB 1F2QA 1EJOH 4MMZA 4XI5D 4DF9A 1WBXA 1ZWIC 2YMXL 3NEOA 2XA8H 3GSOA 3JQOB 5BVPL 4OCWL 1SJVA 4DVBB 2MTPA 4PLNC 3I2CL 2VJ0A 3CX5J 5JXED 3HKBB 2X2IA 1JN6B 1ASOA 3HR5A 2XU9A 4LMQI 2O5ZH 4QMEA 3TCUA 1U8LA 2BMKB 2E46A 2OSWA 1DVFD 3FPXA 1HDJA 3HG2A 2WXLA 4M7LT 1QRND 2NTFB 1FBIH 3C09C 3D09A 4LK4A 4ZDHB 4TQPA 5GGQL 3QORD 3NCXA 3F04A 3MRDA 1TEYA 2AW9A 5IQ7H 1KEML 4LCWE 5JW4N 1BZEA 1K8IA 4HK3J 1Y76B 2HZHA 4XBGA 2ZT9C 2H8PB 4ES8A 1CE6B 1ONQB 4HOXA 3T2NL 5D7JB 3S5ZA 1Q6IA 2ESVB 2F53E 4JFWA 4NQEA 5HHMB 5E1AB 4UB6Z 1D7FA 3NDZE 4G8GA 4NC1C 3N85L 1MCHA 2BZ7A 1GRJA 4KY1H 5DS1A 5T3XD 3FQUB 1QEWB 3R4DA 3K57A 2NXZC 3LZFH 4PVBA 5C09D 4CVXA 4PJCF 4AVIA 1MQKL 2G3XA 4XPHH 4JI1B 1F3JA 1WFMA 1JHKH 2O5YL 4O58H 4EZKA 4HD5A 4X5QA 3V4UL 2I24N 2PO6A 1JGUH 4ODSH 2KH2B 2RFXB 2C7FA 3DRTA 3FTXA 2ZJSH 1A9BB 4B3TB 5DJXB 3BWUC 4PJBF 4G6AD 3QDMB 3GHBH 4Z5RB 5GS1C 1H19A 3A0BZ 3RVUC 3WFZA 2DPKA 3O9WD 3KAAA 3O3DA 4Y5XA 1YUHB 3MNVB 1TZGH 3OKEB 4YHML 1RK7A 2Z93A 3FOLB 2E7DA 3VSTA 4MYWB 4MA3A 2NX5E 5H94B 4ZX3A 3AEIA 1BQKA 2WLIA 1BJMA 3UTTD 3BD3A 1OL0A 1IDSA 2DI8A 2F61A 5IQMA 2AJZB 4DT2A 4NQEE 2X4UA 2H0FA 3LEXA 3ALPA 5I6PA 3BSZA 4L8SA 1F3DJ 3QBTB 4DR2O 1UOKA 3DUHA 3H7BB 3OR7B 5JOEA 5DJCB 4PG2C 4F80A 5I0WA 2V37A 3LY6A 5DJCA 5F7UA 4XC1L 2WB1A 2LTQC 4XVUC 3PDDA 4KTGA 1CFQB 3CTTA 1XXDC 1L0PA 5D6CA 3UPAA 4JKLA 3AAZB 3L5HA 2BVPB 2VRZA 2BW4A 1JVMA 3WO4B 2GJJA 5CP3A 5EOCJ 1OAXL 3TXSA 1UCTA 3PDOA 5EBMC 1NMAL 3KKYA 5ABZA 5LMUB 1A4KA 3FPYA 4XN9A 1KXQE 4ONOA 5CZXC 5I6KA 2YI8A 1Q8IA 3G6DL 4G9FD 1DSFL 2FB4H 4MVBD 2W88A 1IAIH 2R4RL 1IAIM 2AZ0A 4PJ5A 4K35A 3O0RH 3BVXA 1YDPB 5IFHH 1HKFA 1S7UB 3BAYA 2VERA 3U79A 1RZGA 4TSBH 1O7SA 2J7LA 4JPKH 1Q6HA 2OSYA 2BFGA 1PZAA 2D8KA 1RUKL 3VI3B 2EDHA 5D1QD 4MB1A 1FO0H 1TMCB 4BIZA 2IXQB 5LNDA 4ANXA 3QCUH 3BE1L 2XPGA 3KH3A 5EZIH 2FTKA 4RRPG 3UJTH 4JDTL 3H9ZA 4LF9B 1PKQA 4FL4B 5I0XA 4JRLA 2CGNA 3VSUA 2XYCA 4X4YB 3ET9F 4RSYA 4JGMA 1KJMB 4HGMA 3WJLA 3GUTB 2WCSA 3LQZA 3T2MA 4JBSA 2P5WB 5JXAH 1T20A 3FF7A 4AGPA 1CGYA 3FULA 1Q5OA 4LXFA 5EBLA 2N0MA 4LQ1A 5I8OL 2D3JA 3CC2V 2ICEB 3TA3C 5JYLA 1EHXA 1FHNA 1AGDA 1EN4A 2RQ6A 3N43F 3L5WB 2XXFA 3IF1B 3LJ3A 2NY1B 2MTAA 3MXWL 4YSEA 4B3RB 5E23A 1VQLV 4PJ5E 3BOVA 4MJ6A 3QIWB 2WBJA 2Y1ZA 3IDJA 1DVQA 1MPAH 2P22C 5BQ7B 5AG2A 4OVUA 1AP2B 1OGSA 2WWNA 4NN7B 5HHOE 4E41D 1GXEA 2R2CA 2J3SA 4A7GA 1QTPA 3N5AA 3PNWB 3HBPA 4RGNE 5D1ZI 3VGGA 1WZMA 3CFBA 2JS3A 4PV9B 2HJFB 3R1GH 1ASPA 4QNPE 1AR5A 1TENA 1K9TA 3CDCA 3W3BA 5IIEB 2NUPB 1JRHI 3DUSB 4AVKA 3B56A 1NBMG 5GXBB 2OZNA 3M1CA 3PV6A 1J9SA 4Z76A 4RETB 4JYBA 5E0FA 5BVJA 3ZE1B 1FO0L 1GZPA 4Q9BA 3FQ2A 1IGCH 2ZX5A 5INDB 4ALAC 5FL7G 4K5LA 2B1OA 1Q9OA 4JO1H 4XI5C 5JTWA 3D0LB 3EADA 1JK8B 4TUOB 4KI5E 3ULVL 2Y7NA 4A7UA 2D73A 4ZXBC 5BUAA 5GW7A 3H9HA 1FZKA 1UYWH 3GMRB 4FHBD 4HS3A 4PRPA 1GH6A 2G2PA 4OLVL 4PJCB 5KVEH 2VXQH 5F7MC 1F3DH 1SJXA 3H0TA 1YSOA 3PL6C 3JATA 2VLJD 5BXZA 1VCBC 4NQVA 3G67A 1HQRA 2E86A 3OMIB 4I0PC 4L4VB 3UAJA 3VAEA 5DHYA 3K0DA 4HEME 1ZS8B 2VWEC 4OLUL 4RDQG 2OYKA 3V8OA 4DFHA 1MIML 2X4RA 4Y2OB 3QR2A 5LAXB 3QIWA 2HCZX 3VFPA 1RJYB 3BPCB 4TPRH 1GHFH 5HYJA 2GBUA 1BG9A 3UP1A 4RWYH 4F9PA 5D7JD 3WNKA 4UDUA 1XF2B 5A2LH 5CU5A 5FPRA 3MBWA 2FDBP 4YLCA 5D5MB 3T8VA 1YEIL 2AV7B 3QXDB 3NIGF 5CN1A 1WA1X 1WH0A 3X13B 2FO1A 1G7PB 2JXMB 3FTVA 1A7NH 4DGVL 4IBQA 1M3JA 2VDPL 1F1AA 2J1WA 1OCRB 1B90A 4FQIH 5EUOE 1D5IL 5JW4M 3BPOB 1HR0O 3CXCU 3VRLF 3F8UB 4Q6IA 2UUDK 3REVA 1NKRA 4KTDL 2B15A 8PAZA 5F8QC 2O6DA 2EKJA 2OMBA 2V3EA 4NQDD 3NJFA 3EGDA 4TLSA 5FWRA 1B88A 1EDYA 1H6UA 2PYLA 3A67L 3IC9A 1CL7H 1ZK9A 4PJ7B 4JM4L 4R97B 2DICA 4PJ7A 1G87A 2ZTBA 1A14H 2Y7LA 1F58L 2AXWA 3VWJA 4WFFD 4PJ5B 3EGSA 3PGCB 1AILA 3BN9C 3DVGB 4KI1A 2DWEC 1MCNA 2EDMA 1JWSA 4DAGH 1NCTA 4IRSD 2LLLA 1BMGA 3SOBH 4ZS6D 3N44B 1GGCL 3CX5K 3QO1B 4HNAA 4OUUA 1DJZA 3N55A 4OIIL 1GPOH 4HJIA 4Z7WE 1TZIA 3IU3A 2VDRB 4HHAA 4TV3A 2Z35B 4K94H 1JGDB 2DWEB 5KSBE 2IAND 3QQ3A 4AENB 2JXMA 4J7RA 3ULVE 4UOW1 1NGQH 1G7JB 1N26A 2P80D 5GGQH 4DV5O 2YOAA 5EB9A 4X6FB 4JVUA 1Q90A 1GZQA 2WVVB 1FYJA 3PS6A 1OTTC 3FQNA 2F66C 5AVVB 4S11A 5FYLE 3ETSA 1XSJA 1QA9B 1KT2B 2BY1A 2F19H 5DRNB 3ARXA 3QDME 1BQRA 5D2LA 5JQ6L 2VM4A 1QLFB 3GSUB 2OYLA 1F97A 5TF1L 1G1CA 5D7LB 3HHSB 1HXKA 3D85D 3GJFH 3NABL 4NKIL 1ZSPA 4QGPA 2WLIB 2JWYA 5F44A 4XP1L 4UINH 5E6ID 3QXAB 3CVIL 2FJSA 4HIEB 2VS0A 2JCCA 3PQYD 4R3SA 1E5UI 1RZKH 3PXLA 4XH2A 1MEXL 4UCUA 1IAOA 2X70A 5KS9F 4JFYB 5E99H 4R6ZA 4XN8A 3AG1C 3IDUA 2EXSA 4RMTA 4X9IA 5C2BL 3QIBD 5F70A 2CTQA 5EN2A 1XIWA 1GC1L 2LAAA 4YDVB 5HYJD 4BZ1L 1X9UA 3B7TA 3CN1A 3GPSA 1A6VL 3NH7L 2DKUA 4QYOA 4LPTA 2BNUA 1CZ8H 2CZNA 2NNUA 4AY0A 4QJ5B 4PJ9D 5LBSA 1N6UA 4R4ND 3SPJA 3ZRXA 5TE6L 4X9GA 4FI7A 3ZE0F 2WP3T 4MZRA 1Q1JL 2H3XC 2WYHA 4L3AA 2Y06L 3CDGA 3ETEA 3CDZA 3QDJD 5LDUA 1OB0A 2HVKA 1C5CH 2OL3B 5LBSH 4N0YH 2HKFH 3OUFA 2DBJA 4X1YA 1V3KA 1ZHBB 3QG7L 1KLUB 4YEFA 4KZEH 3CLFL 3GLZA 1HCFX 2ADGA 3SYPA 4KZEL 3QHZH 1MCQA 4X5LA 3QJTB 1R9FA 1FKAO 2PR9A 5J11B 2YXMA 1NM4A 3V5HA 1M2VB 5JMOC 4AV0A 1Q1JH 4RNRA 3CFKA 4FFKA 2YPLD 1NBYB 4JY6A 4S1SH 2A4ZA 1QZNA 5TE4L 4ZOLA 1Y76A 1DDTA 1IFGA 1PZ2A 1KCRH 1IGTB 4OGXL 1BMZA 4PJ9A 4AOFA 3V4PL 1OTUC 1P5VA 2PF4E 4LPYA 3QJVB 4HK0A 3SE8H 1URIA 2WTPA 1W9XA 1F6FB 1XH0A 2F54D 4K71B 4WKXA 3WN5B 4DGIH 1QUPA 4NZ8A 3LNEA 4GMSL 5F6IC 1ADQA 4HU2A 3PREA 1KMIZ 3QZWG 3WHXB 3QHFL 2ZUQC 5A16B 4M8RA 2CG9X 4TNVF 4H4NA 3MGTA 3TOPA 1OAYL 1P4BL 1QRNB 1UOVA 2JKLA 3FHAA 4OF6A 5DYOB 5I74C 1UQSA 4I5BB 5CHNB 3E83A 1JPSL 1RUPH 4HC1H 5ACLA 1AI1H 3CQQA 4HJJL 3CVBA 2NSMA 1FORH 4P2QE 1L9NA 4LHUA 5CD5C 2KYIA 3A6CH 1PL3A 1B0IA 4Z3HA 3L9RB 1DN0B 2ZG1A 5IOPB 4AQ8C 3NCCB 4HC1A 2IWGA 5F7KC 5CLTA 2IAMC 1LM8V 5HHNA 3WJJC 3P69A 4HOMA 1SMDA 3VYPA 4BDVA 4PH8A 4OM1L 3CFJA 4P2OB 2P80A 2I9TB 3ZO9A 4PRDB 1WIPA 4KJPC 4LSRH 3FB6A 3GMLA 5FYLH 4PJBA 2WLLB 3MLXL 2PP7A 1ROPA 4ABQA 1Z3GH 1W16A 4NFCA 1Q72L 3QEGL 4KRMB 2EINB 4L0PB 4LGSB 4PWFA 5GGRY 1XCTA 1QO3A 3H42L 1ZE3C 5DMKB 1TAEA 5AWNL 4ODHL 2Z1PA 5IB4A 4IRSA 1NPNA 2WLKA 3LSUA 4JL1A 2RJZA 2DS4A 3QFGA 1I7RA 2YUXA 2BERA 3QCVL 4DR1B 4GX2A 2EINC 3MRLB 4JANA 3ZYZA 1KCWA 1A14L 5J1TC 3K71A 4OVVA 5DUBA 4DV3O 4ZSOA 3A67H 1UD6A 2WSPA 1U3HC 2GJ6B 5E03A 5PAZA 2PXYA 1RZKC 3F83A 2NY6B 3MZGB 3P3PA 3P9MB 2AQTA 3QVNA 4NRYA 1GVIA 4YSCA 1RURL 4Z3IA 3V0WH 5IB3A 1IBYA 5F0MB 4J3UA 4ZQKA 4NFDA 5ELIA 3MZTA 5F1SA 4OZGE 2CD0A 1FVEA 1HW7A 3D36A 5GJTH 2X4OB 1YEFH 3KE0A 4U6TA 5HP5A 1PNLA 3WE6B 4D0CA 4WUUA 3OR6C 1GK9A 3JVGA 4FQIL 4NNPH 1QPXA 5ECGA 3IFNL 4D9LH 2OMYB 2OP4H 5EUOA 3UJIH 4KV5E 1A5FL 2NCEA 2OYQA 4JG0H 3RNQA 4UNIA 2DM4A 1ZT7A 4GBXB 4JZ2A 4R4BB 4YGVA 1AIFA 4XVTH 2Y5EA 5J3HD 4QRRA 2CNZA 5DJ2A 4HLEA 2LT9A 1KTBA 1GGIH 4NO0D 2E7HA 3IRPX 2JF1A 1BZ9A 4FFVD 2XFGB 2R2EB 4RMBA 5T1KD 1I8KA 3T3PE 2VWKA 4BKLB 3WNJA 3KL0A 5MEPA 4PJFA 2K3HA 4H8WH 3UT5B 1KC5H 3W7SA 3EJTA 4KJYA 3KL3A 1KC5L 4MJIE 1ADWA 1JGEB 2A73B 2YGVA 2YSSB 1UC6A 4QHLA 5GZNA 4KUMA 1A6WL 1AVMA 2UWEA 3LPWA 2OLDA 3U6RA 3DO7B 5B5EZ 3GSRA 1HHKA 2GSIB 2VDOH 5C3TA 5I8CA 3SZKC 3AWEA 2R9AA 1S5LZ 3ZDYF 1DBJL 4XVTL 3GLDA 1S8DA 5IQ9A 3UO3A 1KB9K 2OBGA 5DHVB 3SEPA 5B1OA 4Y4FC 4DK1A 3AWFA 2X4PB 4M3KB 2F7OA 1E27B 2IMNA 4Z9KB 2VXVL 3A4EA 3QZMA 2EO1A 2PN5A 3GI8H 4ZFQA 5GRUH 3QXWA 4W9JC 3PL6A 4XN1A 3ZMVA 3FB5C 1IILE 2IPUG 1ZTXE 2P8LB 2W07B 3TETA 1BYOA 3AZUA 4HKJA 5GJTL 1UH4A 1DQLH 3KEHA 4GAAA 4GIAA 4O9HL 1QSFA 4JHWH 4WFGA 1QR4A 5LA6B 2OWOA 3QC5X 1S3KL 2O6PA 4FL4C 3TN0D 1KBHA 3WS6C 3QIBC 3BO8A 5E1GA 2BNQD 3MRQA 3RTQD 2JB5H 5B39B 1E2WA 4E41A 4U3XA 2YZ8A 5IW3A 1A4CA 1HNFA 1N6QH 1OSZA 3PV6B 5I5IA 1U42A 4GLRH 3U11A 1SXSA 2IIJA 4Y16C 3WFEH 5L4IA 2YXWA 1ZGLM 4RISL 4JPQA 1H6FA 3AS0A 1LEGA 1PM9A 1LVEA 5MP6H 5IROD 4PJ0Z 3SJAC 1RZQA 3ZX6A 1EO5A 3GJFK 4X50A 1VF7A 3TH4T 3QZWB 1G84A 3CXHF 3EGXB 2E4TA 1SY6H 4OFPA 1CXZB 2ATKC 3LDCA 5A43C 3BZEB 4P5TC 4PJHA 2D7OA 1DJSA 3BMVA 4MDIA 2X0WA 3SE3C 3EG9A 1CS6A 4D94A 1MVYA 2MNWA 5CD3A 2JB6B 4MCMA 1MAML 5FYLL 5GS0C 1I7ZB 1AGCA 4OR1A 4ONHA 4OM1H 5DRZA 5F3BB 2DQ6A 4WI5A 3NJJA 4ELMB 2CXGA 1BYPA 1NZRA 3QULB 4ZOLB 5L8LB 1K4DB 1IGML 3FXIC 1TYRA 5LB1A 1YYMH 5BQDA 2O30A 3BVNB 4J2QA 4WEBL 4Z8FL 2EILB 4YEEA 4DV0B 3KLHC 3QO5A 2ARJB 2BHZA 4WF9V 3FU9A 5IFHL 1AXIB 2V9QA 3QWRD 4AYBA 1BV8A 3MVSA 1NDGA 1TTBA 5D5QA 1QLRA 2FQFA 4LNRA 1MJ8H 3ATBA 3CSTA 1BFOB 4JFEA 2QPSA 4TV8B 1KNOB 1TQTA 3BN9D 1KIPA 4J3VA 4TVPH 3VH8B 1TLKA 1AHWA 4U7SA 4OD1L 5ID1A 4O2CA 4RVBA 5D7SL 5I6OA 1GY2A 3FUJA 4OGAC 1IURA 1XEQA 1D9KD 1KELH 3LIZA 4U3JA 5E8OB 4JUSA 2JKXA 4QHPA 5FOJA 1S7XA 5BZZA 2WN3A 4DGIL 2QE7G 3DNKA 4BE6A 3N2KB 2J8OA 3DOIA 4QIWF 4L4VE 2N4IA 2Y07H 4CVUA 2ADJB 1ZLWH 3BUDA 1DUZB 2BNRA 4I9QA 4PRNA 4AIZA 5IMMB 6TAAA 3Q7JA 1X5GA 1S9VA 3FSVA 2FR4B 5JHLH 2QR0A 2WPGA 5B1AC 2G60L 3I9AA 3MR9A 4ZMYA 2H47C 1MVUB 1DLHB 1T04B 5CILL 3FO2A 1QBLL 5CM1A 3HB3D 1NGXA 2GY5A 4NO5B 3HAEB 2LGNA 4JKMA 1AP6A 4DR7B 1HILB 1XNQO 3HPLA 1GOFA 3OXRA 1M53A 2WIIB 1IAKA 1TDQA 4DK6A 4TL4A 3ZJZA 2W60B 2Q8VA 2AHYA 2VDPB 5E79Z 1C5CL 5B1JC 5EOTA 5E1AC 3HZKB 2Z1KA 1QG3A 1GGTA 3T4YA 4EI5B 2PWHA 3ECUA 3O4OB 4POUB 4JG9A 2OSLA 1TXKA 4MQXD 3O9WA 4YVNA 1EZLA 4Y2LA 1AZRA 1G9MC 4UMSA 1ND0B 1LILA 4ETQA 1HL5A 3ASNC 4GSUA 3RY6C 1G7HB 4X7SH 3UBGA 2A38A 2A6DB 4OCXH 2BSCA 2B3IA 4FGMA 2VL5B 4EPSA 4QKTA 4XMUA 4FQJH 2XA3A 3Q5OA 3G5YB 5F0PB 4P8QA 2EICA 3UTOA 3F12A 2HP8A 3ASNB 2YPVA 3JTSB 1CGWA 1QQDA 1UXSA 4NENA 1A32A 1BVZA 1NLBL 3ARZA 3C60D 4M00A 4LLQA 1H9VA 1KBGL 4MNQB 35C8H 5IW6A 4QOKD 3NABH 4FDWA 2ZXCA 1VGKA 3P30A 2V4DA 2NY2D 2XTSA 4QRPB 4G8GD 1E9QB 3TNNB 5CZVL 5BRZB 4YSSA 2J43A 4GY4A 5BMFH 3ULUF 2Q10A 1HT6A 2PF6A 1OD9A 4J11A 1J5DA 2OXGB 1NFDA 5T8IA 5KBKA 3P3NA 3DGGA 3G6BA 1T5KA 3DV6B 5DHMC 2ZPKH 3OJVC 4IL6Z 2R9IA 4FFBA 1LP9E 2I07B 2JRIA 4ZOCA 4H0GA 3QG5A 3G6JF 4HLZG 3GO1H 4CVXB 1T03H 4J3OC 3DOHA 2WINB 1JFQH 3T0ED 3MNZB 5AZ2L 2BIHA 3ZN0A 2D9QB 3S3XA 1KB3A 2BOBA 4DP0X 2WXKA 2AXFB 1FSKB 2E4FA 3I2CH 4JO3L 3QGVA 2MCAA 2HKOA 2HUHA 4OCWH 1Z9NA 1P5VB 3D9AH 3B34A 4UZUA 5FDWB 5FGCB 3QO7A 4QRUB 4LF5O 3ZYIA 3FAVB 4JYAB 3T2PA 2AQ3A 5A2IH 1PQZB 4Z7VF 3BUYB 4JPSA 5AW8B 1E40A 4I48A 5CGYC 4BUGA 4GKJB 1BD2B 3KDMB 4XCFH 1R3HA 2NR5A 2YO3A 5JA9A 1AS7A 1C5DB 4YDIL 1IMHC 3ABLC 4M43L 1QHPA 3NZSA 2I32A 3X1GA 5T3XE 1YNTA 3BP6A 2VO5A 1MDAA 3RJQB 1CURA 3IMRA 1IGJA 3CFKB 4HXAH 2IF7A 5E1QA 4HGWA 3LZRA 2WHVA 3CN2A 4WUKH 5HI5D 2BOCB 1JXGA 4DGYL 4ODUB 4FA8A 5MHSD 2YD6A 3D8CA 4XPBL 2EIEA 1HJBC 3GXPA 4ZXBB 1YMMB 3C5ZB 5ITFA 4GCZA 5D1QC 5D7IA 3TJPA 2A83A 1FAKT 4HJEA 4G80B 4DO5A 2ZXDA 3SGKC 5I17A 4QXTB 1CWVA 3KCPA 3MYZA 5H6QA 3ILDA 3QUZA 4JAMB 4KDTC 32C2B 3X1NA 2W59A 3I9GH 1MG2C 3A22A 2XWTA 3REWB 2IOOA 1MRCH 2ZCHH 3DYMA 1NAMB 2XFXA 2GDSA 3EH4B 3E89A 2M2DA 5IEHB 4H25A 1JNNL 1NDMA 1HJCA 4G43A 1GKOA 4AV4A 1IL1B 2H1XA 2Y5TB 4PV8A 4UM9A 4X9YA 1I9RL 1S5HA 4AKPA 2B1HH 4PJGB 3ARPA 2ZT9B 2FGZA 4P07A 1OCWH 2B5UA 1G1KA 4A6YA 2V7HB 2FEDC 4NN7C 5GS0L 5I15H 3TBSB 1GW6A 4A6YL 1ND0A 3RYFA 3W7TA 3WAJA 4F2MA 1T1WB 4OZIB 1UXWB 5D7SH 3A3YB 2B2XL 2PXYD 3K04A 4EB6A 4DV0O 4HJUA 5L4JA 1BJ1J 3NTCL 2WIMA 1UYWL 3S37L 5AQ0A 2GSIA 5DO8A 1P7QB 5F93C 3FT1A 4FTVB 1RM1C 4PWIA 1GAFH 3WNOA 5AKSA 4H13C 5F96H 3OGIB 1VQ7V 1OXYA 4HNAB 5TK4A 1KTJA 2QM8A 3IGAA 1LO2L 3VX1A 3VW3L 5BS0A 5D4IA 3QQ9D 5AYQA 1S7QA 2X40A 2UY6A 3CHPA 1FVDA 1G7LA 4GH7B 3AG3C 1NINA 3NP4A 4NI3A 2VDKB 3RNQB 3LD8B 3ZMNA 3TESA 1Q9KA 1ZHLA 3IJSA 3LN9A 4DK5A 3QE5A 2OMYA 5EUOB 3TL5A 3POHA 5HGAA 1CYXA 5JDSB 5B1NA 1I7TB 2YFNA 3QDJE 1GIGL 4HIIA 4H2AA 2A1WH 4UQ3A 1S7XB 4YO0A 4JZJB 2VZTA 2YAFA 3TYFA 3IS0X 1RK1B 3RWHA 1JRHL 1IBLO 2VE6A 2X4TB 1FCGA 4BSVB 4NJAL 4RUFA 4N0CC 5J0BA 4TWKA 3TXQA 5BR8O 5J57B 4D7BA 3NSXA 5TD4A 5EOQL 2CJUH 4WO4D 3D87B 1K5SA 1XB8A 2NDFA 1J1PH 4Q4IA 4A63A 4DZBA 2A77L 4DV1O 1FRGH 1T1ZB 2ATKB 1KN2L 4UDTB 1N19A 4RZCB 3S2AA 2NRDA 3P9MA 5CGBA 3FONB 2DZEA 4ZUTA 1X7QA 3B9KD 1TJHL 2YKLL 2YUZA 4ODVH 4Y0GA 1E8ZA 4HIHB 2G5RA 4FQPA 3QUXD 5CP7B 2FIKA 2OW7A 1Q0XH 3D25A 1FYHB 4PMFA 1NLDL 3MFFB 4M9PA 2JK5B 4HJGA 1I7ZA 1HP8A 5I76B 4WI6A 3FQ4A 4NRZA 4DZ8B 3OGOE 4DW0A 1EBAA 4FQXA 4P2RA 1SA0B 3BQUD 3BVUA 4OFQA 5E51A 4AILC 3KYOA 5HHQA 4I55A 1XSOA 3A4DA 3OKNA 3OE7G 4Z7AA 1JF6A 4JDEB 2WLZA 4BINA 2AGAA 3QR0A 4FM0A 1CIUA 1LUVA 4NNXA 4LFCO 4YHNB 3BD5A 2QV2A 2H5UA 2N1TE 1HWWA 3GMRA 4HS3B 3L54A 4AW4A 1FPTL 2YIAA 1VAHA 4BDVB 3PAUA 5AW6B 4O02A 5KHJA 4YBQC 3EF7A 4LASL 1XUQA 3S34H 3F00A 4RIRA 1W6WA 4MMXA 3HC0B 1CU4H 1KTDB 3N2JA 3O4OC 3GMNA 2CRYA 4PJEB 3BCDA 3DXRB 1BVKA 1YDXA 1EAPB 1OCWL 4KXCA 1L7IH 4YIQA 1W0VA 1R3LA 5I15L 1AJ7H 3SO3C 5GGSA 2VNCA 4L0YA 1N34B 4UB8Z 5ILTL 4NXKA 4N0CD 2HKHH 4MCYB 3NPZB 4GT0A 3U0WL 5FK9B 3B2PA 2LU7A 2CCLA 4PV9A 3AT8A 3GSNH 1CI5A 1ET8A 1XH3B 2D0GA 5MENB 4NCC1 3DUSA 4O4IB 1VB9A 1TLMA 3TO4D 3OEHG 2P7TC 1R3JB 5DDHA 4JO2H 4DP5X 3Q8AA 5C08B 5D7JA 1AZCA 3KD4A 3RYIA 1KXQA 4ERSH 1KOAA 3ABGA 3H2QA 1DFBL 1ETZA 1OB1A 2V3FA 3RY6A 3IAGC 4JZOA 3GXDA 2YEQA 1BD2A 1D6EB 1FAIL 4HCFA 4F37F 3GTTA 2R9RB 5EYPB 1CTNA 2P46B 4HSQA 4ZAKC 5D4JA 4Z7VB 2WINA 1AGBB 3V5HB 1KCVL 1ZGLB 3P3SA 1AACA 5GRVK 1K97A 1BQUA 2ZE0A 4OLEA 5B7EA 3RQ3A 1ZK5A 1B0RA 1KKCA 3GMPB 4XPAL 2OPCA 3VXNA 4GFTB 2E9BA 1FL6A 1P4UA 1K4CC 4FS0A 4YSTA 3NRFA 3QCVH 5DJ6B 5TE7H 5DJAA 1GC1C 1MIEL 1VESA 2ZUYA 4A38A 1KJMA 4JDZB 2V17H 4LSUL 1GGUA 1U21A 4OAWB 2BTQB 4ODHH 4BW9A 2AQ1A 3VB9A 1XF4A 1S9WB 2L7UA 4OJEH 1C1EL 4GG6E 2FWLB 3BESR 4LCCC 2XIIA 5DK0A 2ZOKA 4AIEA 4L9LA 1T0NA 4TNGA 3VE0A 4PM1A 1UACH 3LB6D 1MG1A 1X5ZA 5I9QB 1QRNE 4D3CL 3T2QA 2BCKB 1BF5A 1JI2A 1T7YA 3B9VA 2EVGA 2UZXB 3MUUA 2ZCKL 1NGYB 5FW7A 4WTZA 2JCCB 4R3SB 3VD4A 1PNCA 2CIKA 2CRIA 2PYEE 4PD4F 2Q3ZA 2Z9TA 3QNZB 1FBIL 1S4IA 5E9DE 4YX2L 1QHTA 3PP3K 5GS0D 4YSOA 3M99B 1IZJA 3Q5TA 2E3CA 2UZPA 2CDEB 43CAB 5IWLA 2F53D 3CPWU 1UVQB 2FTAA 3ESMA 3P3UA 4WF7A 3D0AA 4IIQC 1EXGA 2ADFH 1ZPUA 2EDDA 1BG1A 2KG7B 2HFEC 3ATFA 3DGCR 3QTCA 5K1VA 5ABDE 4JI2B 5CN0A 4D7TA 5IROC 3HVNA 5F7LB 3X17A 1M6OA 4U6VL 4D9QD 3OTOB 1KJ3H 2NY7H 1P4BH 3C60A 3L95A 5DZPA 1GCFA 2EZOA 4PGEB 1Z5LB 3VFRA 4ZFOL 1P84J 4LARL 2X89A 1E50A 3HPLB 5HVWA 2H6OA 1IEHA 4FVMA 4X66B 1PF3A 3RVXC 2HHHB 2ZUWA 4UCTA 2CHZA 5AOZA 4ZUUA 5H4YA