1OCCB

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
total genus 61
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1occB02
1OCOB 3GDCA 3OQRA 3ZDWA 1E65A 1AR1B 4E9SA 4E9XA 4AKQA 3OD3A 5I5IA 4DPCX 4KOCA 1ZIAA 4PAZA 3ZIYA 7PCYA 4YSPA 3QJRB 1JZFA 1NWPA 4HCIA 4YSTA 2YAHA 1AG6A 2HX7A 5TK2A 3IE9A 3FSVA 3PLYA 2DWTA 1ZV2A 4HAKA 4DP4X 5B7MA 1M9WA 1FWXA 5I6LA 1XB6A 1BXAA 3BQVA 2PP7A 1M57B 3NJIA 2TSBA 4YSAA 4KO7A 3X1GA 2UX7A 4G72B 1JOIA 4QLWA 1GY1A 2W88A 1PCSA 4HALA 1NTDA 3CVBA 2CBPA 4DP2X 1PZCA 1SJMA 2QT6A 1HAUA 1ASQA 2AANA 4YSRA 1GS6X 1X9RA 2I85A 3FPYA 1BQ5A 1E30A 3FPXA 3IN0A 3PAVA 1ID2A 2IWFA 3ABKB 2GHZA 1TEFA 4EF3A 4F2EA 2DYSB 2EIJB 1PNDA 1SHWA 2BHFA 2H47C 3AZUA 4KNTA 3TU6A 3NP4A 1J5CA 2BZCA 1XMEB 3BVDB 2XU9A 3FU9A 4AKPA 2FWLB 2XLLA 1QHQA 3QPKA 5I6OA 3UADA 4DPBX 4CSPA 3IBOA 3T6ZA 2JXMA 1JVOA 5LDUA 4E9QA 1CYWA 2VM3A 4N8UA 2XV3A 1GYCA 2IWEA 4AI7A 1TKWA 2XX1A 1M56B 1AACA 1AZRA 3FSWA 2QPEB 5D4IA 4E9RA 5I28A 3WKQA 2GBAA 3FU7A 2GC7C 1L9OA 4YSSA 1A4BA 4KNUA 2EILB 2Y69B 2FJSA 1ILUA 3SBRA 4HIPA 1ZIBA 2YAPA 1ADWA 4PCYA 1KBWA 1AZUA 1L9TA 3TBCA 3FU8A 4E9TA 5B1JC 2FQDA 1OCCB 1OCRB 3WIAA 3DKHA 4AKOA 4HHWA 3FQ2A 4YSUA 1ET7A 4DP0X 8PAZA 4ENZA 3AG3B 4A68A 4HHGA 3X1NA 4YVNA 1GW0A 2R7EB 2FQEA 2J57A 1IUZA 4DP1X 1HFUA 4UAHA 4WKXA 3T9WA 2FQFA 3UGEA 1JVLA 1DZ0A 3T6WA 1L9SA 2P80D 1B3IA 1MDAA 1XB8A 2J5WA 1AG0A 2AZUA 3H4HA 3ABMB 9PCYA 1OOWA 2RACA 3TBBA 2QPDB 2VW4A 3QJTB 1SFDA 1KCBA 3IN2A 5I5JA 3CDZB 3EF4A 4KOBA 2JKWA 1MZZA 4K9JA 4F7KA 1CURA 2YAQA 1NIDA 2H3XC 5F7BA 3X1BA 3HB3B 4HCFA 3CVCA 3V9CA 3QJSB 2AZAA 3SBPA 2P80A 2EINB 3NJLA 1W8EA 1SDDB 3QJUB 4A66A 2YAFA 2NRDA 3NSCA 4KNSA 3N55A 1HAWA 2CAKA 1JZHA 3S3DB 1DYZA 1TEGA 5I6PA 2OV0A 2FQGA 1ET5A 1YLBB 4GYBA 1E5ZA 1X9UA 4A2EA 4DP8X 3WKPA 3FQYA 4GY4A 4ZK8A 3UAAA 1L9QA 3QJQB 1J5DA 1GS7A 3PXLA 1JZJA 4M3HA 2CUAA 2CJ3A 3UABA 1V55B 1BYOA 2IDQA 3ZX1A 2WSDA 4GXFA 3NJHA 2BWIA 2OCCB 2ZXWB 1IKOP 1RCYA 5F7AA 4UF7C 1AQ8A 2PPFA 2QDVA 4E9VA 1NIEA 1NIAA 1ILSA 5I6MA 3DTUB 1J9RA 5B7FA 2PPEA 1KV7A 3FYIB 2HX8A 3L45A 4JHVA 2XWZA 2FTAA 1WA2X 4WTQA 2BW5A 2HXAA 4Q89A 4BWTA 2XV0A 3OMNB 1L9PA 5I26A 6PAZA 1AOZA 4BXVA 1JERA 1PLCA 2VW7A 3SBQA 3PCYA 5B1JA 1SF5A 4AX3A 3ASOB 2R7EA 3NJNA 2YAOA 1JZIA 4AZUA 4KO6A 4YSOA 1QLEB 2YARA 2PPDA 1T5KA 2GB2A 1RZPA 1NICA 1BAWA 3ASNB 1AAJA 4JHUA 2A3TA 4Q8BA 4FAAB 1AS6A 2HRHA 1L9RA 5AKRA 2MTAA 2HRGA 1QNIA 2X88A 2ZOOA 3T71A 1NINA 2YXWA 3NP3A 4YSDA 1A4AA 1KYAA 4YSEA 3FSZA 3CDZA 1CYXA 1NPJA 2CALA 1FFTB 1IBZA 2IAAC 4GP5B 4E9YA 3GYRA 1V54B 3TASA 1J9TA 3AG1B 4W9ZA 1SNRA 4YSQA 2B3IA 2YAEA 2IDSA 1ASPA 1ASOA 1EHKB 1SDDA 2XV2A 5E9NA 2IH9A 2EIMB 4G7QB 3WI9A 3FS9A 1CC3A 3OMIB 1A3ZA 2XVBA 3ABLB 1AIZA 4P5SA 3AG4B 1BYPA 1JZEA 2QDWA 2VW6A 4HZ1A 4G7RB 5AZUA 3S3BB 3T6XA 2AVFA 2GC4C 2YEVB 5ANHA 4DP9X 1MG3C 1I53A 2YQBA 4KO9A 1W6WA 1URIA 2BP8B 1OE3A 2HZHA 2UXVA 3G5WA 7PAZA 1JXFA 3NT0A 1OE1A 2FT6A 2WO2B 1EZLA 1N70A 1AS8A 2XXFA 4A2HA 1W6LA 2GSMB 2BP0B 3H56A 1OV8A 4MFHA 4F2FA 4HCGA 1PZAA 1OF0A 3T6VA 3WG7B 2HX9A 2ZONA 3FQ1A 3U25A 1BQKA 2PP8A 1IC0A 4BDVB 3ZBMA 3NJJA 4TXVB 1AZNA 1VLXA 2LLNA 2UX6A 2J56A 4P5RA 1BXVA 1RKRA 1WAEA 2PCYA 4DP5X 1KDIA 1BXUA 2N0MA 2DYRB 4M4RB 1WA0X 5D4JA 3UAEA 1CUOA 4BWUA 1AZBA 4DPAX 2MRYA 3PPSA 4N4YB 2H5UA 3JTBA 2X87A 4L0PB 4YL4A 1PNCA 1XB3A 2GI0A 2EIKB 3KW7A 4G70B 3WNIA 3NJGA 1SF3A 1J9QA 3AY2A 1PY0A 3AW5A 5A7EA 2XXGA 3D12B 2UXTA 1NWOA 3QQXA 4A2GA 4NERA 3NSFA 2BO0A 1WS7A 3X1FA 2UXGA 5I6NA 4G7SB 2XUWA 3CG8A 2IDFA 3QJVB 2AFNA 4KO5A 2PP9A 2PPAA 3NJFA 2J55A 4QKTA 4G71B 4BK5C 4A2FA 1SFHA 2E86A 2OJ1A 1PZBA 2IDTA 2YAMA 4RH4A 4FA7B 1E67A 5PAZA 1AZCA 3FSAA 3RYMA 2VM4A 3CVDA 3NJMA 1ZPUA 2Y1AA 4BXSV 3WNJA 3MBWB 1JXGA 4JKNA 2FNWA 1ETJA 4DP7X 1FA4A 3GXUB 2ZWNA 1NIBA 1NZRA 2XYBA 2BZ7A 3PAZA 3S8FB 3N2JA 1KGYE 3DIVA 4X4KA 1E5YA 2PLTA 2IWKA 5B1AB 1NPNA 2CCWA 1AANA 6PCYA 3PAUA 1GY2A 3FYEB 1F56A 3NSDA 2B08A 2DV6A 3X1EA 2BWDA 3NSYA 2BP8A 3EH3B 2WO3B 2I7OA 4DP6X 3AG2B 4W1TA 1MZYA 3S8GB 2JFCA 2Q9OA 1A4CA 1PF3A 2TSAA 3EH4B 2BW4A 5PCYA 1R1CA 5TK4A 4GP4B 4A67A 1KCWA 2BP0A 1PMYA 1PAZA 1RZQA 1UATA 1N68A 3ERXA 2XX0A 3UACA 2W8CA 3CZUB 1PLBA 1A65A 2UXFA 4BDVA 3ABGA 5D4HA 1NIFA 1V10A 1TU2A 3IEAA 5I5MA 1ZDQA 2VMJA 3NJKA 5AFAA 1PLAA 3H4FA 3SQRA 3V9EA 4A2DA 3NYKA 3HEIB 2DWSA 1MG2C 4YVUA 2Q5BA 2IDUA 4YSCA 4E9WA 3S3CB 2GIMA 2FT7A 2YXVA 3FT0A 1A8ZA 1OE2A 2FT8A 2I7SA 1GS8A 1JXDA 1NDTA 3JT2A 4GP8B 5IY5B 4NB7A 1KDJA 1AS7A 2IH8A 3TA4D 4CSZA 1IBYA 1KBVA 1JZGA 1GR7A 4UANA 2VSKB 5FC9A 3MX0B 2VN3A 5B1BB 3C75A 1BQRA 3OMAB 3KW8A 1SHXA 5B3SB 1OCZB 4BWWA 5EHFA 1J9SA 3X2QB 3EH5B 2VSMB 5I6KA 1BEXA 1WA1X 2DY2A 3OM3B 1WS8A 2HLEB 4NAJA 1ET8A 2PPCA 3EHBB 3FU7B 1GSKA 2PCFA 5B1KA 5B7EA 1ZDSA
chains in the Genus database with same CATH superfamily
3I75B 3SPHA 1X4ZA 2BCMA 4J42A 1OXYA 3UO3A 2FWSA 4LU5L 3HKEB 2QSCH 1KBKA 4MMZB 3LEXA 3E8VA 5IQ9A 5EUOF 2EYRB 3UPCA 2ZOLB 1A5FH 4N0UA 3CGTA 1N64L 1Y6KR 2YD4A 4X6DB 1QWNA 4PV1B 4XNMA 1C5BL 3MRCB 1L7IL 4KI5C 2YPLB 4W9EC 3IJSA 3ZN6A 1PZUB 5F9WC 3KPOA 3Q8AA 2AP2A 3K7UA 2B9AA 2XETA 4GZRB 4DYLA 1ORSB 3HPLA 5EIIG 5FUZL 4GAYA 5GGQH 4MKTA 3QG5A 4EXKA 1DJXA 4LEOB 4PRPD 4AGQA 2K9UA 3P4MA 1WZ1H 3VXRD 1GHFH 1SPDA 3DHJA 3OKDB 5E5MA 4PD4K 5I1GH 4RFNC 1CE1H 3HKFA 2UZIL 2K3TA 3AY4A 3UDWC 4KU1A 2Y7SA 3AU0A 5EOCJ 3PUCA 2VMEA 5BZZA 4L8CA 1SZTA 1MCWM 4YFDB 4OJDH 2CBPA 4IOSA 2WMPA 2EZ0D 4FL4C 1U8HB 3U4AA 2CXGA 2BNRA 3LD8B 4JFFB 2EDMA 3PWLB 2EIJC 3W82A 4NO5B 1DTOA 3PHSA 3RYIB 2HB0A 2YMXL 4A55A 4FA6A 2VQUA 5HGHA 1M42A 2LGWA 4N5ED 2MMXA 5IWLA 3C3TA 3PAVA 4I7ZC 3MGAA 4JASA 2J43A 1BJMA 4JKPH 3JALB 1AHWC 1BVZA 1ZTEA 1TAEA 4CH4A 2Z91A 4ANUA 3WNKA 3VXUD 5ACLA 3BUTA 2IC2A 3GBNH 3BXNA 2XAGA 4ENED 1I1YB 1H9DA 5LXGH 3OLDA 2KI6A 3QDGE 4AKPA 1QR4A 5JHDE 5CKAA 1BOGA 2YLKA 4GXVH 2ZG3A 3FO0L 4MD4B 3IRCA 5BNXD 1B0WA 1MFEH 3JAWB 4NTXA 1RZFH 2VITA 4NT6B 4EI0A 4CSPA 2D0GA 3LNIA 3H85A 5AD0A 3QUKB 2QVMA 3C6SB 5F6IC 1R17A 3IDUA 4HWNA 1FFQA 4LLVA 1OEZW 3L5HA 3PJLA 5CP3H 1UOVA 1ETB1 1KLFB 2IIJA 3GMRA 4NQVB 2RCSL 5TDPA 5D7JA 1NSNH 4A39A 1J10A 2V9UA 5GGSA 1LM8V 5GS0D 2EUVA 1MWAH 4EFBA 3F7KA 3L3KB 2XBZA 1YCSA 2HUHA 3HN8A 4FLXA 2KHAA 4KNUA 5CINL 3B9KA 2FJSA 1N0JA 3JSLA 2ZQKA 1B9KA 4BAYA 3VFRB 3DIFB 2AQ2A 2NY1C 1L9TA 2JB6A 3AG3C 2P5ED 1NC4D 4LL1A 4JO1L 4ELKB 2A06H 3I2CH 5I19L 2DLIA 2Y4SA 4F1SA 2QHRL 4JMNA 3WIAA 5H6RA 4AKOA 3WOVA 5EIVA 5L2KE 1M7UA 1Z5HA 4YSUA 1GPOL 1KWGA 4HIIB 2RMKB 4NHCL 1P6WA 3BEWB 1B6QA 5C0ND 1ZHLB 4HPOL 1K4CC 4JFVA 3V6BR 4Z3HA 3CC2V 1XF4A 2PO6B 5EA0L 3QYCA 3O6KH 5T5FL 4GSXA 3LKPB 4RGOL 3FB6B 2ITCB 1KYUA 1RI8A 2H4EA 3FN9A 2FYUH 4IKIA 4P2OB 1AG0A 2D7QA 5C0DB 5EO0A 4JFED 4OCXH 2CIIA 3APMA 3ILPB 1VQLV 4MCZB 2R23B 5IVOA 1Q9KA 3SQOH 2P46B 1J87A 3N42B 9PCYA 1LE5B 1L0PA 5E8OA 5C6TH 3N44F 2D2CC 1RFDH 1EUUA 4TV9B 4X1YA 1N12A 4PJGA 3GBDA 2BNQE 1HEHC 3E8FA 1A2YA 4BH8A 5CKGA 3L72H 3SJAC 2J25A 5FYKL 1WTGT 2BFVL 4E0RA 1TEYA 1MHHA 3RYFA 1U4FA 3CHPA 1YRKA 3CSGA 3S3WA 3FONB 4U6HA 3NIDF 3RX8A 3PG2A 3F58H 4BYHA 1SDDB 3H3BC 3IM1A 4HEPG 5DQDL 2R1YB 1I7ZB 2PYEB 2NRDA 4JRYB 4KUCF 1XF3B 5AVQB 5HGAA 3VD4A 2WZPD 4MA8L 3VQWA 5D5MB 4JFHE 3H2QA 1AGEA 4KNSA 2YIDA 4JGJA 5AW0B 1VQNV 2LFEA 4URTB 5LAXB 3S3DB 3WNLA 3IS0X 3TX4A 3O4LD 1DBAH 4Y9BA 3VFSB 1M53A 1G7HB 1DBKL 3O6FD 3UG4A 2ZSVB 1ET5A 1DDHA 4JPIB 5BZBA 1JWUA 4JY6B 2DQFA 4PH8A 4XPGH 2FLBT 3KH4A 4I48A 4QKXB 4M5TA 3FQUB 3WNOA 3V6FA 4X9QA 4ZUWB 1JTTA 4G1MA 5BRZE 2EXTA 2OULB 5CN3A 2Z0AA 2CJ3A 2VZ1A 3ISRA 4ICGA 4KZ0A 4BWAA 2IJKA 1FL6B 3A47A 2EJ7A 3EJCA 4ZKIA 1MJUL 5E9DB 3RVUC 3HG4A 5AW4B 5IMMA 3KNBB 1PY4A 3VXSB 1EEYA 1CFMA 2OTUB 3KWWB 4PB9H 4LFCB 3Q3GB 5AZ2H 3STLA 2PPEA 4R7VA 1FIGL 4P4KA 4KKBC 2DQTH 2YBRB 2YSTA 4Y9EA 2ZUXA 1Z5LB 3B43A 3MRQA 3OTTA 1WWCA 4K0KB 4I18C 4IRSD 2EDTA 4ZOLB 4PJDF 2D4FA 5KUMA 2ITDC 5JIIA 4LHUB 2KERA 1DBJL 5CILH 4GPVA 3ZE1E 3FTGA 5KSAC 5GRXG 2VRZA 2CUMA 2E7CA 4LASH 5BY1A 4N2NA 2CTRA 2UXNA 2ZNJA 4KO6A 4PRPE 2CKBL 1LO0H 1PEZA 2GB2A 2WXQA 3M7MX 2XSKA 1BAWA 2CH8A 3VXRE 3BN9C 4UV4L 3SDDA 2J2ZA 2HRHA 2PF6A 2YFOA 3QRFM 3MRDA 3T09A 4G28B 4NUQA 1N3NA 2G5BA 1AQKL 4HWEL 5EU5A 3UTZA 3FU6A 1HKLH 4B9GA 1T03H 4HGWA 3VFUA 2YXWA 2X6CA 2W1NA 3D69B 3NP3A 3O2DL 4G9FB 1SQFA 1A4AA 4HWUA 4J3OC 4MAYA 1KYAA 3N44B 1JRHL 1BVLB 1YN6A 3FF7A 4Y1AB 4WV1A 4Y19D 3GRWL 1TTBA 5H35A 3JWDC 1QFUH 3MV9A 5C1MB 1HWYA 4FFZA 3ZMTA 3QUZA 5JJJB 4NXNO 4PRNB 2YI9A 2MPAL 3B3IA 2AK4B 1Y6NR 4NYLA 1TVBA 4AIOA 1XCQA 5A2CA 5B39A 1NOAA 3TCLA 3PV6A 2ZYHA 4MS8D 3VXUE 3NIDB 1V3KA 3PNRB 1OSPL 5I15H 2ALWA 1T21A 4J7RA 3RVTD 4OXSA 1QSFD 2XFXB 1OQXA 3IGUA 5ENWA 4GG6A 4UOW1 4QDGA 4LBAA 5LAPA 2ZE5A 4NNPL 4FQQB 5TDNA 1J5EO 1AR2A 1ODAA 3SDXF 3C5JA 4HK0B 1YDPA 4U3SA 5D7LD 2YFNA 3GMQB 4OV5A 3QEHA 3RUGF 3V0DA 1URIA 3AVEA 2W65B 5HHNB 3MNWA 3NT0A 2LGQA 1MCNA 5DT1H 2FT6A 5D2LE 4MRCA 2RQ6A 3EYVA 3CCLV 2O5ZH 3L5XL 5IV2A 1FNFA 3GNML 4NWTH 2Y72A 1AS8A 1KTCA 3S35H 3PIQA 2HT3D 4ONFH 1ZV9A 3H56A 2Q20A 4F2FA 1YAZA 1W0JG 4UNVA 4W6WB 4PGCB 4S1RH 1JWSA 1WF5A 2P5EE 1CF8L 1QTYT 3ZE0E 4GSRA 1D5XA 1NBCA 2VXUH 1M7IA 2JV6A 4JAVA 5CEXB 2DYRB 3KM2A 5KYWB 1K85A 1X5YA 4KQ3L 3VAEA 4RMUA 4RSVA 2R1XA 5IROC 3C09B 1JGVL 4AM0B 3HC2A 4LCWB 3MV7D 1PNCA 5AVZB 2EH7H 1JZ6A 4KRMB 4MJ5A 1E9PB 4G2AA 2DRUA 3GD1C 1QTSA 1JBJA 3GIZH 4R7LA 5IHUH 4OAWB 2WNGA 3MR9A 3N85H 2AXFA 3PV7A 3CPWU 4YDJA 4BFIA 2B1GA 3PFQA 5I74B 4ODTH 3UCRA 3A23A 1ZT4B 4UCTA 4LOVA 1SGKA 2EP6A 1BBJB 3Q6GH 4AT6B 4KHXL 5CLWA 3ZO0A 4PM1A 3WN6A 2XOKG 4JFEE 4G42A 5D7HA 4L4VD 3NDZE 4WK0B 1TFHA 3V5KA 3VQYA 2E75C 3F62A 4JI6O 1T83C 4G71B 4NN6B 3K5MA 1HINL 3WE6B 1JOYA 4A2FA 2Q87A 5IT2H 1CFTB 4P3WA 2E86A 4LF4B 1S3RA 3QUXC 3NFPB 2LTQC 2MHAB 2FSEB 1DL7L 1IQWH 1X9QA 3LD8C 3VG0H 1S7QB 3ULUD 2QKIB 2J21A 2WINA 3GMPA 4M48L 2OMWA 2DOCA 4CBPA 2Y1AA 3UYRL 5CZRA 3D39E 5IJ9B 1BGYH 2ZWKA 2QADD 2P28B 3A24A 1JWMB 4BIUA 3DUHA 4NM8L 1IAOA 1YPZE 3WNNA 3CSYA 1JPTH 2FB4L 2X3AA 4FP8L 5F7KC 4ODHH 2XYBA 4FG0A 4ZAKB 4ZPVA 3QXVA 1LEIA 4LO9A 4KQ0A 1Z3RA 3BGFB 3ESNA 1D5NA 1H3PL 1SMOA 2IWKA 4EIZC 3KGTA 1KB5A 2VLRB 3L9BA 2ORBL 2EDDA 2P8LB 3IJEB 5TD4A 4UQIM 3RZCA 1V27A 1HDMA 3O4LE 2XTSA 2AQTA 2DWYA 4DCQA 1WG3A 3LV3B 4TL4A 5JPMA 3L3IA 2LAAA 2JGUA 2VZOA 3AG2B 2AXWA 4MTFA 1QLRA 1AGFB 4PJ6A 1IKNA 2CDYA 4H25B 3VXNB 1G9ML 1S9YA 3QF7A 4LBEC 1MY7A 1PF3A 1E4KA 3DJ9A 4LSSL 4Y5XA 1VARA 4ZXBD 3B3BA 3CEIA 4KX9A 3QCUH 1DBBL 1F11B 4GINA 3D05A 4TUYA 1O7DC 4N87A 4J10A 2OSLA 4OFVA 4X7SH 1TQVA 5LMNO 2X4NA 5FNVA 1XIWC 2DQDL 4PMFA 2DMHA 1AKJB 1PG7H 2AXGB 4XH2B 2N59A 1QZNA 2APFA 2QTEA 4OCSL 1EH9A 4PW3A 4UIMB 5CSBA 3ML8A 4KY1L 4A37A 3DPBA 5GZNC 4GUPA 2WPDG 2VDOH 1E2VA 1ND0A 4LZKA 1LK3L 3QJZA 1FGVH 5LGKA 4DUZO 2DWSA 3EO9L 2GCYB 1FZMB 4WGVB 4HWBL 3UM7A 1A7QL 4K7PL 2JVDA 2BSSB 2JMRA 4Q6IC 1HR0B 2HTLC 3ARDB 4JO5A 1H2NA 5LG1A 1YNLL 3T0ED 2RH0A 3QQDB 4M1GL 3UO2A 1PEWA 3Q1SH 3ZE2E 3CE1A 5L3GA 4X4YA 1YJDH 1ORQB 4O9HL 1O6VA 3FH5A 1E27A 4Y16D 4QHNB 4XOBA 2ZIOA 4UCRA 3NTCH 3QJFB 2LR4A 3R8BB 1Q4NX 4P2QB 4P2OC 4X6EB 4Y4HC 5ECGA 1DEEB 3BSGA 1IBYA 1WA8A 4OIFA 3S37X 1TYJA 2YIBA 4E9LA 3EFDL 2AQ1A 4PA4A 4BZYA 4GQZA 5LCVL 1QACA 3KW8A 4P2YA 3TEUA 4WI7A 5GGUA 3US0A 4IIQA 2YD7A 4Z7WE 4X1IB 1T1ZA 3FCTB 2XAJA 5LBSH 2FSDA 2ZUUA 4QRQB 2C5DC 2H3KA 1BEXA 5I2IB 5FPRA 3BAIA 3P9WB 1PIFA 1UM6H 1ZDSA 1QFPA 3HZKA 1CWVA 3N1MC 2Q3AA 1YEJH 1NUDA 5JO5B 1ZVYA 1M05A 4JJ5B 4E9SA 5J7CC 2OAAA 1QSFE 2X3CA 5CA1B 3FFCB 3KAAA 2V5TA 4UQ9A 2BOBA 4BFKA 1IZKA 5F7EH 1H3VA 3SDYL 2EX3A 4UCVA 3AGWA 2Z8WC 5C09A 1D5MB 1HT6A 1NBVH 1SQGA 5LXTB 2X9WA 3V4VH 3MSPA 1UD2A 3SDCD 3MOQA 5D7LE 1C16A 3IKKA 2QSTA 2X4SB 4JI8O 1MCKA 3DARA 4BUGA 4M62L 3FSVA 3HHMA 1BFOA 3PLYA 4BZ1H 3QUGA 3LKNB 4NSKB 5EDSA 5CN2A 3VI3A 1AVMA 1ZMYA 2CHXA 4NUGL 1F3RB 5EUKA 5TF1H 2WXLA 1CD9B 3ET9F 3UAJD 5CD5D 1BF2A 3CVHL 5ALCH 5I1LA 3WIFA 3C5ZD 3L5IA 4XMWA 4GLRH 1MZEA 3WFBH 4KKQA 5AW9B 4Y9FA 2J1KA 3K4AA 3L5JA 3OD4A 3IAYA 3ZRVA 2PNDA 3E1ZA 4MNGE 2A7WA 2K1EA 2CPUA 4GKLA 3FQRA 5ESVA 3AU1B 1MNNA 4KDTC 3GBEA 1X9RA 5GZOC 1X7SA 2NXZC 3FPYA 1J1PH 3BYYA 3CJJA 4ZFFB 1WICA 5E6ID 2V3FA 1EJOH 4KROD 1KZYA 3FAWA 3L3JB 3ABKB 3COOA 3MV7E 4UNTA 3VE0A 1FYTA 4E5XB 1RIHH 2IAMC 3PGFL 2D7OA 1OW0A 4OZFG 1SHWA 1A7OL 3MUJA 1PPJH 4FMTA 3BMVA 4OZ4A 1LQBC 4WJ5B 4X0NA 3G6DL 1MAJA 4WW1B 1RHFA 1O5PA 1XGUA 4G7YH 1AB3A 3E8UH 4WO0A 1CE6B 7TAAA 3K6NA 3ZHLA 4JHWH 2C7UA 4OFYA 1U8CB 5EOCH 2P9RA 4GLXA 4HYOA 1MVYA 5EZLA 3ZZLA 5A6LA 5I0VA 2OKMA 2JKNA 3SCMD 1CBVL 1U95A 2HLAB 4L4VE 4NP9A 3KDMB 1Q6IA 1XBLA 2JEXA 2WTRA 1HZHH 4ZFQA 1VPOL 4HDIA 1QLFB 1SYSA 2R59A 5DJ8A 4LP8A 4L9LB 4N2GA 4LEXL 4UUJA 5JQGB 2FO4A 1VQ4V 4GAGL 4R97B 1FCGA 3KYNB 4UILL 3IPEA 3O9WD 3BQUD 5D4IA 3ULUE 2VDQL 1ZLVK 3H2WA 2GBAA 3C08L 4J4PA 1L9OA 3LRLA 4BKLA 1UJWB 2F43G 2CO1A 3QIBA 2X0VA 1ZL8B 1YQVH 3JASA 1EXHA 1JXJA 4JFQB 3QWOA 1HTYA 3BH8B 3THOA 3CMOH 2E5LB 3H7LA 4AUYA 3E7JA 2UXCO 4E9TA 5D8JH 1ADQA 5EF0A 1CFVH 3DX7A 3PWPD 3WD5H 3OPUA 2EC9T 3DDFA 4PJIE 3S2CA 3RWRD 6FABH 4L3EB 1N8ZA 4ENZA 8PAZA 5FOBB 4OGXL 5HYSG 2AW9A 4NXKA 5JORA 1OJHA 4ZFGH 3HE7B 2EUZA 4YVNA 3RBZA 4V2CB 1GXEA 2A9CA 1UYWH 5IKCB 4UAHA 5FF6A 2Z93A 2APWA 3GXIA 3MLYL 3OKMA 5E70A 3IFLL 5AVXB 1FJGB 3UMNA 1YHPA 1LNUA 4M6OH 5IB3B 1AJNA 2YGQA 4JFYB 2D7NA 4RQQA 3P40A 3QZLA 4HV8B 2PXYD 3GZKA 2R69L 5C07A 3H4HA 3FMGH 4KJYB 5TFSL 5GS0H 3QIWA 2SODB 2GT9B 1E7VA 4NN5C 5IF0B 4G3YH 3UTQA 5DUPL 2D7MA 4HUUB 4F8TA 4UT7H 2IU3A 2YUAA 5C97A 1HVXA 2YAQA 3BVXA 3EBIA 3WLBA 2BSBA 1FL5B 3I6LD 1TT6A 4HULB 2DYRC 2H3XC 3B2VH 3NN8A 2J4WH 2J88L 2Y5TB 3CZFB 4I9WA 2F53D 4YHOH 1YNKH 5I18H 1X4XA 1S7UB 4NN7C 3LXCA 3Q2VA 1U3HD 2JJSC 4HLZG 1MFAL 4O51B 3VFOA 3VYNA 1RULL 2Q8VA 4U6XA 3P30H 1INQB 5DD0L 3T0EE 3GIVA 4RDQG 2ID5A 1VMGA 4JM2A 4L5FE 5F7YC 4FNUA 2WZ0A 1D5AA 1FDLH 2AEPH 3SOBL 2QEJA 2NX5D 5ADOL 2C3GA 1VQ7V 3GGWB 1R6NA 1A3LL 4WW2F 3ZDZB 4G27B 2IANA 1WD9A 5MP6L 2ENYA 2EEDA 3QARA 4QY8A 3CCMV 2GBUA 2HKFH 2WOYA 1ZK5A 1I85C 3ARFD 4Z0XA 3U1SH 4EI6A 1MCLA 1X59A 2N3JA 3CVIH 1M2OA 4PJ7E 1JZJA 2YD8A 3BUBA 3LSQA 1EZUA 3MV8E 2H1PL 2QKIC 2WBJD 4RMBA 5BJTA 2ZUTA 4TRPH 2QDVA 3Q9PA 2AQRA 2SEBA 4J28A 4WTXA 1ZE3C 1K2DB 4Y9CA 3BKCL 2L8AA 1NCTA 2QSAA 2PWEA 5FL7G 3QFJD 1NDMA 4GUCA 5F71A 4WTZG 5IJVA 2H6PA 3D07A 4W9HC 2NNFA 1NQTA 3VFGL 5I9QC 1T80A 4UQ3A 1W0YT 5I26A 4JI4O 1YUHA 3IDGA 4G80A 4JPWL 3DV4B 5E2TH 4L9DA 2VDRB 2VDLH 1U2CA 4N90D 3PGCB 4GI8A 1XD0A 1AROP 2IQAA 1F02I 3AG2C 1N2RA 5KSUA 1NICA 2EYSB 4UM9A 2OTJV 1F97A 1T2QH 3FCSA 3PL6D 3WKMH 4TTGA 5E94B 1U3YA 1G7MA 5D2LF 3MXWL 2Q0AA 2Y7QB 4Y5YB 1C9SA 1ZAUA 3CYOA 2DH2A 3L1OL 4X4MA 1DBML 2W0FA 4HX1B 4MJID 1L6XA 2Z35A 2GJ6B 5K1VA 4F5CE 4P5MB 5ADPH 3HZ3A 2D3JA 3FSZA 3U4BH 3S36H 2CALA 3AB0C 1NEZG 4FS0A 1WAAF 2IAAC 4HFUL 4AZ8B 3GYRA 4IQHA 3SKOA 3PJSA 3WO4C 3B7UX 3SPJA 3ZE0F 3DVIA 4D9QD 1J9TA 1YVWA 1O6SA 1XCTB 2B1HL 2J7LA 2YGPA 3D3VD 4FRWA 1FC1A 3TEZA 3JVGA 4KV5E 5EC1B 1KWKA 3GMOA 4NQSB 4IGBA 5CCGE 2XV2A 4U33A 3OVUB 2FGWL 5ABZA 4DV0O 1HCYA 2LLLA 2MSPA 3CXHF 4O2EA 4OT1H 4U1GC 4G7QB 3ZE1B 3O0LA 3ZHSA 4YAQB 3CN4A 5HDBE 4FI6A 3JUYA 4I3RH 3TTSA 2ODIA 3CRAA 1MHPH 3B37A 1U8NA 1VGKA 3V0WH 5K69A 4J3SA 3W0WB 4LK4A 1F4NA 2F54D 1YEEL 5T5FA 2EUWA 4Z7IA 2WYTA 2XWDA 2AITA 4NQEE 2UXBB 1I53A 1AYOA 1W6WA 2WN3A 4JPKL 4GKJO 1MFCL 3CMGA 3F2LA 4RISL 5IYDO 2APXA 5KYXB 4FFYL 3T65B 3VFTA 1XOUA 1RJLB 2ZWLT 4A7QA 3QQ3B 4XNUH 4HHAA 3HG1A 2WLKA 3EFOB 4H88L 4LSVL 1OV8A 1N6UA 4JZJC 4X83A 1W9XA 1NMBL 1WFIA 2K7QA 3BOVA 5CLXA 3ZQ9A 1OT1A 1OPGL 1Y18B 2NUPA 3L95B 3P02A 2ODMA 3T0VA 1QPKA 4L3AA 1YPZF 4M5ZL 4BW9A 3VWJC 3NJJA 4JZOA 2VLKD 4M7JH 1S7XA 1XF5A 3PWPE 1RJZA 3BPCB 1TQSA 3U82B 4HIHA 2Z7UA 1BBDL 4OI9A 3MRHB 2X09A 1S5LZ 1P49A 2JTDA 2ADPA 4LCCA 4NWUL 5ESAB 1BWMA 3WFDL 5G2NA 4ZZKA 1ZSDB 2CWRA 3RWGB 3WSQL 2DQ6A 1DK1A 1R5IA 2UYLB 3JARB 1ZJBA 4I1NB 1FNHA 2F5AL 3U0PA 1BIHA 1MRCH 3CFIC 3NPSB 5D7EA 5F0MB 1K5NB 4BHUI 1XH3B 4UT6H 4ONGH 1BD2D 5T8IA 4NVPA 1NFAA 1JV2B 3VQMA 5GONB 1TJGL 2UXGA 5AKSA 1A6WL 5FXCH 1QQDB 1UFGA 4Z0BL 1Z0MA 5C0EA 2YEZA 4H1LH 4IBVA 4JYBA 1BIIB 4ZUUB 4DZBA 4OM1H 5JVDA 5FYLL 4BK5C 4A6YH 4FN0A 2FD6H 1Y6MR 4XRCA 1PZBA 1D9KD 1GGBL 1OGTA 1TVHA 5IJ0A 3RHWK 1N7MH 3GWOA 2G2RA 3IGFA 2J12B 4FM1A 4PDRA 1N18A 3L1GA 4DW0A 1HXYA 3KCPA 1XH2A 2O5NA 4FQXD 1ZVSB 2F53E 1ZHKA 4TVPL 3ZHNA 1QI4A 1QNZL 3N41B 3KGRA 4JKNA 4JVUA 4LLMB 2LO1A 3ABKC 4CC4C 5EPMB 2ZWNA 1JG9A 1EN6A 3KEDA 3O8XD 2XVLA 4WFFD 4EVNA 5LA6B 2OMNA 1OWWA 2EABA 4KAQL 2JB5H 4R4FH 5EBLC 3AT8A 5F3BB 1I1AC 2JKJA 2NX5E 3VRJA 3F84A 1MELA 5JH7A 2OR7A 4FQ2L 1XBDA 2Z3FA 4HZLA 3O4OC 3U46B 3ZE2F 3LKQB 4BGDA 3EGXB 3NSDA 4L1DA 2DV6A 4TNFA 3JATA 4WUUA 3TJHC 2CKBA 5BXFA 3P3UA 4KKLD 5T3ZD 1H2LA 2I7OA 1KG0A 5E1IA 4G59C 5G5DB 3NCXA 4B9PA 4L9LC 4GKZA 5E8DH 5DHVH 2Q9OA 4XO8A 1K7DA 2TSAA 1C08B 2NXYB 5DFVC 3RURA 1NT2B 3WXVL 4NXNB 1EFXA 3FRUB 4XPFH 2Z7WA 4Z7WF 5JIPA 4APQD 1HL5A 1KCLA 1RMFH 3O2DA 1BGXL 4N20A 4LSRH 5LP6A 1R3IL 3ZK0A 5EU3A 5JXED 1BLNA 2CLVA 3ULUH 3GRWA 1YMHA 3D39B 5IEKB 4G6KH 4MSWB 5HXMA 1RLWA 4JQVC 1TU2A 3DX9B 3QFJE 5DUBA 3ZDXE 3FAVB 1TZIA 5CMAA 2F19H 1JNNH 1ZDQA 3CD4A 3HE6C 3RWIB 3P11L 4V1DA 2V3EA 2J5LC 1J5EB 2UZYA 4MBRA 1H8HG 1MCEA 2I32A 2DIAA 1A6UH 2WBWB 4KKNA 1ZLSL 3SBWC 1EQWA 1MG2C 1Q0YH 2GK2A 1OAJA 3GS0A 1EO8H 3G04A 4WSGA 3LHPL 2DTML 2DL9A 5INCB 5K9OB 3LRHA 3MROA 4N90E 1KLUA 2DQGL 4ZTEA 1KIPA 2W07A 3W5MA 2O5XH 4WJKB 4NO0A 4FXKA 3VG9C 1JF1B 4QRTA 3CXDH 4F6RA 1K8DA 2FT8A 3ARTA 4DR3O 3BUYA 1Q86W 4AJ0A 2VWJA 4YHPA 2W6JG 3D4CA 1AS7A 2KKQA 3TXAA 2FJUB 4JN1H 3GM8A 4MJIE 5KSBE 2V2WB 1RZGA 4P46A 3LS5H 5EB9A 2I9LB 2H26A 2WLNA 1NAML 2DICA 3BKJH 1CXHA 2A9DA 5DD6B 1XO8A 2H3OA 1MJJB 2X4UB 3NFNB 2DAVA 1XQ8A 3C2AH 2BSDA 4GT7A 4JFZL 5IIEA 3KLDA 3VRIB 3PQYB 4HEPA 5EHFA 2EEAA 3QC6X 5GGSY 3QA3B 4TSBH 4D9QE 3EH5B 3D3VE 2HJFA 1M3JA 2VC2H 3KWUA 3ES6B 5B38B 1G7PA 1HHKA 3JXAA 2AGJH 1JGEA 3VFPA 5EBWC 3TBVB 1IGTB 1KGJA 1J1XL 1R9FA 2WSPA 4U1HB 3P2TA 5HBBA 3CQQA 3RIKA 1CGVA 7FABH 2GW5A 4JI1O 3DI3B 2B77A 2PR4H 2MK3A 1Z9MA 2DLEA 3EO1B 2Q6AA 1O9VA 3SE8L 2OSWA 3QDJA 5A2LH 3CFNA 4PRAA 3QXDB 5IK3B 4IOSD 2F54E 2VQFO 2VDNB 4YJ3B 1NBZA 3HBQA 3P0VH 5FK9B 2R4RH 4JPVL 2IM9A 4JI6B 5BMVA 3SHSA 1WDAA 2BNRD 3JSNA 1S3KL 3F65A 4O2CB 1SBSH 2Z7YA 3BUQA 4GCZA 1UT2A 4GAJH 5L3DA 2RDCA 3UKMA 3BYTA 5L3CA 4ZQTA 2XRAH 4PWJA 2BVUA 3ULUF 3GKWH 3T0XA 4JO3L 3KMDA 3TNMB 5E5RB 3LQZA 4PJHB 2KH2B 4L2LA 4MMXA 5J1AA 2ZYIA 1V7NL 4PLJD 5JPNC 1S7RB 4O4HB 4WWPA 4BM7A 1JPSL 2BCKA 5JOFB 3QHZL 3REVA 5JA9A 4ALAC 2DYSC 3BSZL 3BT2H 43CAB 4PLNC 5D7SL 1PYWB 1U2HA 1K6QH 3CFBA 3LEYH 4JREB 3CWGA 4HISA 4PJIF 5D7JD 1ZGLP 1S4IA 4ACTA 5T3XL 5DYFA 3QCTH 4OLYL 43C9A 4IBTA 2BHZA 4ZUTA 4JB9H 1KGUA 3V8OA 2EAEA 3EHBD 5KJ7E 2R8SL 1KBGH 1BD2E 1XMEB 1D3CA 2K9FB 3B9KD 2R1WA 1EV2E 5EEZA 3HI1A 3PWVB 1D5ZB 4GKOA 4Y5YC 5BRPA 5LMNB 1AR1D 3L3GB 3CHXA 1UC6A 5KYUA 3MYJB 2OZ4L 5DJCB 4KDVA 3RTQB 4YBQC 2GTSA 3NSJA 4ILDA 2YS8A 1FFPB 4FVMA 2EILC 4LIQL 3WJLC 1ZHNA 3KPRA 1FAIH 4WCYL 4YWGL 4NKDA 1KCKA 5IREA 2XG5A 4F8OA 1NL0H 2WUBL 1DSFL 1RK0B 3CDGA 3ZY7A 2BFGA 3ZZSA 1KCVH 1V3JA 1IBLO 4JW3A 3UZEA 4QPKA 1LD9A 4M6MH 1P2CA 2E0PA 4WFFE 3QB7C 3WAKA 4NHUB 3DLQR 4W6YB 3BP5A 1YZBA 5FHBH 3EOBA 3RL1A 1T6WA 3FB5B 4E9QA 3ESVF 4X8CA 4XXDB 4HWBA 3IBEA 2ILLA 2QPFA 2J73A 1OCRB 3V0GA 4AY0A 1R6KA 3DUUA 5D2NC 1Z3GL 4FYQA 1F1DA 2WW8A 1GL4B 2OMYB 5JR1L 5JW4M 3CFDA 2GTZB 5T3ZE 2MQCA 1BZ9A 4N0YH 1GW0A 1UB5A 4RCAA 4K8RH 1E1RG 1RU9L 2H9GB 2Q7YB 1JYWA 1ID5I 3KBHE 4OI8A 4H33A 1WAPA 2VR5A 3MRNA 1QYGH 1KKCA 4MNQB 1BJ1H 4LCVA 4DGIH 1PL3A 3MLWL 4PJ7F 4RRPG 4L8SC 5LCVA 1QFWM 4XVTL 4H8PA 4Z7VE 1BVNT 3BAXA 1SRYA 1JFFA 5E2VL 1NCIA 3C2SA 5AOKA 4JF3A 4P2ZA 4LSQH 4F33B 1UB6A 1OLZA 2PW1B 3IJYA 5FW8A 1GGIL 2D7TL 4P59L 3HB3C 3BVNB 1KKDA 1SXNA 1OTUD 4GQ9L 1ENVA 4AL8L 1JP5A 4Z7UA 4XPHH 4N28A 1G7LA 3QJOA 2B2XL 3EJQA 3HN5A 2O6CA 3QIUB 2IGLA 1JGLL 5KA6A 3HR6A 4MD0A 4LPVA 1CGTA 1I7RB 4JI8B 4NJ9H 5F8QC 5EV7A 3A0BZ 4TUUA 5T1MA 5C8JB 3NJLA 3TYGL 5ABDE 1O0VA 3AC0A 3GK8L 2V1DA 2VUOA 4A66A 1JYXA 4QXTB 4MXQD 1UENA 3MUY1 1A25A 3EFFA 4CSTA 2MCG1 3OGCA 3FO2A 4Y88A 3B5HA 1JZ2A 2APVA 3CIQA 1OAZL 2A9NL 4LGRB 4DNLA 3OKEA 3UL4A 2BZDA 5HDOA 5J6HA 2L7UA 3FQTB 4GRLB 4PTTA 4AGLA 4R50A 4N0UE 1AGBA 4BV1A 4U4IA 1NTZH 4F8NA 4P4KD 5IOKA 1UVQB 4DR2O 2KQXA 4X8XA 5F7DA 1GS7A 1LMIA 2XIDA 3CVHA 2FBJH 2NLJB 3WFHB 2D9CA 4XVOA 5DSCB 4YUEH 4RZKA 1Q6UA 4JO2H 4N6RB 4PSRA 3EJJX 1YMMB 4MZ3A 4P57B 5DZPA 4KV5F 2A9BA 4OF3A 2MIZA 3GSNH 1AC0A 4PGBB 4CC1A 1GIGL 3SDDD 1GKEA 1TTCA 1DQDL 3VFNA 3ZKXC 5D1XB 2J8UA 3QUMB 2LU5A 4UIKH 3ARQA 2XWZA 3NJXA 4M1CC 1GZPB 1R3JC 2WAMA 3KVPA 5FUCE 5HDBF 3IAPA 5EZYA 4XHQA 3TV3H 1B9ZA 4MAYD 4IDJL 5FKAA 1T1WB 1AC6A 4AX3A 4ANXA 3VGFA 2UXDO 4R84A 1E28B 3MV9D 4HPYL 2IGFH 1CD0A 3K1KC 1H0DB 4M7ZB 2XG4A 3QUZD 2OXHA 3ARBC 3VFWB 4XNXH 4JHUA 1JI2A 2NXYC 3N0PB 4J41A 2BSRB 1JPGA 1JDAA 2MTAA 1YVLA 3PAYA 2VWEE 3MV8B 4NO3A 1V54C 4JGUA 1GMEA 1DFBH 5J56B 1JK8A 2UXCB 4MSWC 1ZTXL 2K0RA 3C6LB 5ICYB 3TFKD 2CH7A 3PYCA 4TSCH 4YDIH 1ZK9A 2OW6A 5DMJB 5E4EC 4EN3A 3KYKL 4JBSA 3RVZA 4OLUH 4GRMA 5FFLA 3ABLC 3OUSA 1X5IA 3SGDI 3KYMA 3MXVH 4DTGH 3MLXL 1A1NB 3FD9A 2DKUA 1Y74A 2EDJA 4FGMA 4KPHH 3W9EA 2GJRA 1NI8A 1CL7H 4LKXB 5KS9B 5DEJA 4YZFF 4HIJA 2DEXX 2FECL 5KW9L 4UXNA 4MJ6B 3WXWH 3NEXA 4JMXA 2HFEC 3AG4B 1BYPA 4DFHA 2VLLB 1OAQH 4PRHA 4H20H 3LDDA 4HIXL 1J12A 2VW6A 2Y07L 2WQVA 4HZ1A 4AE0A 1WN7A 1BZKA 4DQOL 3SGJC 4DV6O 5I1JH 2GC4C 4DP9X 4FQLH 4GQPH 2H7WA 3M8AA 2FJGA 4HT1L 4NCDA 4O2AB 4CH6A 4XNZC 2DWDB 4PDMA 3OB0K 4NFCA 2GIYA 2YQGA 3FUIA 4OZGF 1JHTA 2R69A 4GSDH 3MNZA 3P0YL 4R83A 4A2HA 1DVFC 2QPUA 1KT2B 4P9HC 5DMYA 4H44C 3NCJH 3ZXAC 3WG7B 2D0HA 2HX9A 3L9YA 4OH2A 1SUJA 4XCNA 1HH6A 4DN4H 5AOMA 1E9OB 5ESQB 2WB1A 5I1DB 5EU6A 3NCEB 4OPHA 1NUGA 5IMKA 2Y4UA 1A8JH 3REWB 3FT4A 3N2KA 3WDIA 3RU8H 1CUOA 2VXVL 3L9RA 1A6PA 3PPSA 4J7ZA 4K5LA 3MUGB 5DFAA 2X87A 1T1XA 3EDJA 3ZMNA 3S3PA 1XB3A 2ZCLH 3FQWA 4AIZB 5IOPA 3TVMC 3RL2B 1IGML 4J1UB 4LLAA 1GGTA 4FK5C 1MWOA 1E1QG 4NQEB 4L0ZA 2Q86B 4NERA 1NGYA 1GW6A 3MLTA 3GI8H 3OAZK 3LPOA 1KNOB 2KLSA 3MREB 2EYTB 5CBAA 3A6BL 3HNVH 5JW5B 4YXWG 3L3DA 1Z9SA 4IT5A 2QLYA 1F8TH 4EB6A 3DSFH 4WEMB 2X1WL 3TWYA 3MU3A 3V6OE 1LXMA 3DV6A 4MX7A 4NZTH 3SKMA 3RZCD 1ZD6A 2LU3A 5PAZA 2ILMA 2RR3A 3ZDXF 1V7ML 4JI4B 1IFHH 4OTXL 4R5TA 4X9HA 2QGCA 3GVMA 5BUPA 3WTXA 3ISYA 1VESA 3FU5A 1JVKA 1OAXH 4OZHB 1MAKA 3F7VA 2GSIA 2YXMA 4L8BA 3KG2A 1BXXA 4ZX3A 2NW3A 2FYYB 4ZMLA 2CIKB 4ELMB 5CIPB 2FX9L 3PAZA 3S5ZA 4X4KA 1UGNA 1LL1A 5JZ7D 1MFMA 3L16A 3B4NA 1O9HA 3O11B 3ZJAA 4RZCA 4L29B 5FA4A 5FUOL 1FLRH 1U6AH 2ZXCA 1J88A 3HZMB 3LKRB 3OKKB 3QI9C 4GX5A 2PYFB 4MXWL 2GAZA 3VH8A 2YUWA 1L5GA 1P1VA 4FI7A 3O9OA 1TXKA 4WWOA 1TETH 2BP8A 2E7HA 1DJYA 5KSBF 3RTQC 2V7HB 2XN1A 5AB2A 3T77A 4Y2LA 4X20A 4HK3J 4O02B 2ICWA 1FNAA 3E6HA 4EDXB 5BZDA 4FZ0A 4N1CA 4OFQA 1KCWA 2AJYH 5LGHL 4N9GB 2Y7OA 4ZX6A 2M6YA 5EC2A 3EOAA 3CFQA 4PRDB 1FFXB 5CN0A 5EZOL 4NZUL 1T5EA 5JLZB 1JS4A 4DV0B 2EE6A 2J6WA 3GSOB 4WBNB 1PLBA 4DK5A 1EJ8A 4JFPA 3UO1L 3NFSL 4JS7A 2FATL 3W2DL 2VQEO 3EJSA 4OV6F 2RFXB 5F6HI 2D3LA 1XT5A 3GRBA 4A2DA 2YIBD 4MJHA 5AYUH 2C1OB 4PGEA 4KUMA 4XGZB 1UEYA 1RJYB 1S5IL 4UOZA 4GKJB 5BW7C 4HCRH 4XHJD 3BZEB 3MLZL 3MV9E 4YDZA 5T33L 2E6PA 2O61A 1DTUA 4ODUA 1DQML 2P43B 4RWHA 4B95C 5ID1B 1MHEB 1H2GA 4G2KA 1A9BB 3M1CA 2CUIA 3AWGA 5T3ZH 5IWAO 5DLLA 4AYID 1LE9B 3CC4V 1U8JA 5B3SC 4XE0A 2JSFA 5KVGL 1AI7A 5ICXA 1E9QA 4FFYA 4LB8A 4QT5B 2FWUA 4XP4H 2ARJA 1C1EH 2DLTA 4BZ2L 1NJ9A 1SM3H 2WP3O 3BIAX 4GG6E 5C09D 5I8EA 2H2PC 3CWBH 1FN4A 2TAAA 3LSUA 5AOJA 1TVKA 1DN2A 5C0FB 3UBXB 2P5WE 4BSJA 4EE2A 1ZT7B 3AXLB 4LQFL 5I6KA 2QZQA 1RP9A 1RZKC 1K97A 4TNEA 1IBKO 1PU0A 4HF5L 3LS4H 5E5UB 3NIGB 4ZX5A 1NLDL 2BS9A 4U1SA 4Y89A 1UG9A 2QMKA 2COQA 3K8KA 1E65A 1CXLA 2BSTA 4KXRA 1GGYA 4DR7B 4Y2OB 3ZIYA 5H4ZA 3K03A 2KQMA 1DO6A 5ANMA 2AJUH 2AXTZ 4AQ1B 2YC1A 4XWOC 3H7BB 5CEZD 2H0PA 4QRPB 4G6FD 1JV5A 4GO9A 1XF2B 2BC4B 3RWJB 4GRLC 2ADFL 2JJTC 5K9KB 1RUPL 5AYQA 5DHEA 3MOAH 1JDDA 5CZKA 4KKAD 5I6LA 2ALAA 3PE9A 5FGCE 3CFEA 2YD2A 3TTYA 4QXWA 4XCYA 6TAAA 3O3DA 2V17H 5IFHL 1FYTD 4YDKL 5F70A 3R8QA 4GFXA 4N2HA 1MNGA 5FYJE 5I76B 4JZNB 2HR3A 1F90L 2X7RB 1IB5A 4AXWA 2H2SC 4K9EC 4JHAH 4Y4KC 2Q5ZA 5AW8B 1DCLA 5KYYA 4OFYD 1LQSR 2AJSL 2VCOA 3LOWA 5C0GA 2K4AA 4HJEA 1HAUA 4Y5VB 1HEZA 3SKNA 1ZAGA 3FL7A 1SXCA 2BVPA 3OT7A 1KACB 1TYEB 3LB6D 1WCBB 4OJFL 1WB8A 4JGSA 3WJJC 3FUHA 1L8DA 4BJLA 1YC7A 5BQ7B 1HYSD 3GUTB 3ARGA 4HJSA 4RAVA 1I8KB 3BA8A 1UFIA 5T1KA 2VE6A 4D8OA 3CRMA 1FO0H 1J5CA 2FECI 4J4PD 4NUMA 3CBKB 1H8OA 1U41A 2VDPB 1JHKH 1N0XL 3QIBD 4PTUB 1HOEA 2FWLB 3BP4B 5DWPA 2XXCB 4C59B 2WWKT 3WU2Z 1XGQB 5KJRH 1NEZA 4L3CA 1TJIH 25C8H 2A83A 4NNYA 3F04A 2MCAA 4NC1E 5E8EB 2I60H 4WWKB 3APCA 3T6ZA 4RDBA 1R5WA 1RUMH 2IG2H 2JXMA 3P69A 4Z7VF 1X7QA 1O7SA 5FCUH 3T3MB 1KU9A 4KXZH 4WNJA 4KXCA 1DLBA 2Q7HA 3DRQA 1MCDA 3OKLB 5IDJA 2XBTA 4D8PA 4QOKA 5DD1H 5L6YH 2ZG2A 2QPEB 3MRJA 2L3BA 4YGAB 3STZB 3FU7A 3BFWA 5DD5H 4IU2A 3DGGA 1CT8B 2YXLA 4I5BB 1ETZB 1I9IL 1MPAL 3I75A 1UZ6E 4B3SO 5J1TC 4OJEH 4ATTA 3HKEA 4MMZA 3GSVB 3SJVB 2ZDIC 3GBML 2EYRA 1WPXA 4DR3B 1UWGH 2XQYK 2ZOLA 3LH2L 5IFAH 3FU8A 3OMZA 2VXQL 4X6DA 5K9JL 4IW4C 3IRPX 3KLLA 1OCCB 3MRCA 4PJXB 5C07D 2EQDA 4MVMA 2YPLA 5EORH 1EDYA 5IROA 3QIWD 1E4WH 5KVFL 4FZEH 4DP0X 3SEPA 5G4NA 3UPRB 3VW3H 2FR4B 4UB0L 4RMVA 1TZGL 4I8DA 4CH3A 1ORSA 3ETQA 5C6WH 2EJRA 3NG5A 5H37H 5HHXH 1CICC 3ZOAA 4LEOA 1N32O 4OLXH 3VM5A 3IETB 5ELIA 5C3LD 1PD6A 3CRQA 2FQFA 5DS8B 5SX5H 1MCHA 2R2CA 3OKDA 3K5OA 1IVTA 2YN3A 3ECWA 3RY6C 4FTDA 4DUYO 4I9WD 1QFWL 4LLUB 1EVUA 5GTIZ 4B5EA 1BHGA 4ZNEA 3UYOD 2XXMB 3ECVA 3U6RB 4RA3A 1QW9A 1DUZB 4MTGA 3KBPA 4JM2D 5TE7L 1FNLA 1PBYA 4XMUA 1U8HA 4TNWF 2RJZA 1INEH 3AS0A 1AMYA 1SFDA 4BCZA 4FLVA 4JFFA 3PWLA 5DR5H 3E80A 3LAFA 4NO5A 1BQSA 3RYIA 1WC7B 2IAND 2R9RB 1S5HB 3FCBA 4OSUH 3MUHL 1YEFL 2IXQB 5IBUG 3PP3H 1KCSL 5EWIL 2VQFB 2OIGA 3T2MA 3H2PA 5F7BA 5F7UA 4QR7A 1VEOA 3QO1B 3CK0L 3JALA 2ZX8A 3QJSB 1HWHB 2X9XA 4MNHB 5INDB 1ONQB 2Q1EA 3U0WL 5D5PA 2CGYA 3QNFA 4YXLL 1I1YA 3RG1C 4HSQA 4UFZA 2VDRL 3QNXB 4YDVB 2XZCH 5HYJB 2OYQA 4MD4A 5CGMA 3GLDA 3JAWA 1Q9WB 3S34H 4CMHB 3F6LA 5F0PB 3V6ZB 3GTTA 3HNSH 5DHYB 3QUKA 2BY2A 3VXMB 2RTTA 3ZIAG 2DN9A 1DN0B 4NTYA 2EEFA 3C6SA 1TDQA 4FMFA 4Z7VB 3ZKMD 1NM4A 1KLFA 2X10A 3BPLB 1HCVA 1MIEH 4HGMA 4NQVA 5C09E 2XWXA 4EDWL 3HKZA 4P05A 4R4BB 4FKKA 4JFXB 1B90A 3GPEA 3WIHL 1V55B 3L3KA 1PLGH 2NY2D 3F7YC 1UD3A 5L8KB 3OPZH 1M90W 2DYPB 5F7AA 1V3MA 2A9AA 2QQNL 4WKZB 1IX2A 5AKVA 3TGXA 3DIFA 1FXKC 3B9AA 4G1EB 4UM9D 3VFRA 5I6MA 3BSZA 3RKPA 3VNYA 4KFZC 2K70A 4ELKA 4DO2A 5GZNA 5C6PB 1IZ3A 2LHAA 5FO7B 5B7FA 4ZRGA 4OLZL 1ZLWK 5DVOA 3U7WH 4LAQH 4XN2A 2F7PA 1F18A 2CSPA 2HVKC 4WTQA 4HIIA 3OEEG 1AOZA 1DVSA 3BEWA 5CEZE 1IX9A 1BSIA 1ZHLA 3HC4L 1T4KB 1OM9A 2F58L 4LSUL 3MODH 2PO6A 12E8L 1XXFC 4TNVF 5AVRB 2K8QA 5AWNL 3V2AR 1YECH 2EZPA 5I8OH 5F97E 1QLEB 3LKPA 2WLYA 3FB6A 4JM0A 5HHVL 4CUCA 4IHBA 3ZHQA 2ITCA 2OZ4A 5IGXL 3V4UH 1FYTE 1KV3A 3STBA 3S6CA 2JRIA 2PCPB 4IGBD 4P2OA 4Z9KB 1IBLB 5C0DA 4ODSH 5D1QB 4YHML 1ERNA 3IAQA 1WIOA 4WCEV 3W56A 3U0ZA 3ILPA 4MCZA 1AXIB 2R23A 1LE5A 2V5MA 3I85A 2NZ9C 1ICTA 2DW4A 2WVTA 4TV9A 4L4TB 4G8IB 1CK0H 1MFVA 2CK3G 4B3RO 4XWGH 1KB9J 2R0ZL 1LVEA 1MQKL 3INOA 3JTTB 3RVWD 4AC4A 2DIEA 3VWKD 4LDCA 1AFVH 2QM7A 2GJJA 3FONA 4U0RB 4DGYH 2JQAA 3D18B 2OM5A 3LZFH 1SDDA 1VGEL 4HSCX 1UOKA 3GSRB 1JZ7A 2R1YA 4Q74A 4X2UA 1I7ZA 2PYEA 4JRYA 2P26A 1XF3A 3HG1D 1XEQA 5D5MA 1XGPB 4LPTA 4N6QA 4ZW3A 3CP1A 1EK3A 5LAXA 3VXPB 4FFZH 5F9OH 3HKBA 4XMLL 3VFSA 2Z65C 1CLOH 2FEEI 1G7HA 5AZUA 3S3BB 5B1OA 2ZSVA 1G9NC 2OWOA 3RDTC 5FYKD 1TGOA 4JPIA 2IMMA 1RIUH 4JY6A 2UXVA 3FQUA 5DRXB 4X66O 1LP9B 3HR0A 4MS2A 3P3RA 1OF2B 3KVQA 4ZUWA 4BKSC 4WIQA 1SBBA 4XCEB 3ZVVA 1FL6A 1QWHA 2X0LA 2R27A 5E9DA 4QXUH 3KNBA 4NP4H 5GSVB 3VXSA 2NN4A 3MJWA 2OTUA 3KWWA 4PLKD 3Q3GA 4Q2ZB 4KDTA 1ECZA 3U1PA 1YYML 1N59B 2YBRA 1HP8A 4PJAB 2ZKYA 1FORL 1Z5LA 2NY0D 5C07E 4M4RB 1ROWA 4ZOLA 1AZBA 1PG7W 1S78C 1UD4A 3ARPA 1VFMA 4E4EA 3I50L 4LHUA 4LDOB 5D93B 3MAQA 2LW1A 4Y2DC 3NA4A 2QKSA 4DR2B 3U6XA 4J9ZB 2VUKA 2BOCB 2L7QA 4L1HA 3I6GB 1KLGB 4I9WE 5F1NB 1LO5B 2DWEC 3M1OA 1KYOK 4FE9A 1VFUA 2XUWA 4AYFB 1N0LB 3ZT5A 3IJ9A 4KO5A 1I31A 3L8QA 3D69A 4G9FA 2PPAA 5CO1A 1KN2L 3IDMB 3H9YA 4U3JB 4QKTA 1KEGL 1BVLA 2BTQB 3GO1H 4Y1AA 3DGDA 2IANE 2A9HA 1AZCA 2DI7A 2ZAIA 3HI6H 3LQMA 3FBQA 3BIKB 4PRNA 3CVDA 4JCMA 2AK4A 2HEPA 3RIFF 2UXDB 2H1LM 1FBIH 4JFWA 1JTOA 2E3VA 5GS1C 1QVFU 1EFXD 2DBLL 3P4NB 4P3DB 1J5HA 4R0LB 2XFXA 2BS71 1NBYB 2NDFA 2BIPA 4FJZA 4GW1B 5KX5B 1VQMV 4IKNA 3WKML 4FQQA 1J86A 4Z1MG 5CBHA 1FZJB 1ZANH 2ZUVA 3QRLA 4HK0A 1MIML 5DJ2B 3I02A 3GMQA 3ZLQC 1YIJV 3QXUA 3X1EA 4EZMA 2HMID 3K72B 4X7TB 3ZL1A 1JZ5A 1FD9A 2W65A 1NGPL 4V1DD 4W1TA 5HHNA 4Z3JA 4ABVA 3QK0A 1PPIA 2K6ZA 4GG6F 1D7DA 3D9AH 1UH3A 4BA8A 5KLVH 2JKSA 1NCHA 1KB5H 1KMGA 3G6AB 3DK0A 1BFVH 3STZC 2KLRA 3BH9B 5L88H 4NO0D 1DCEA 2EDHA 4PGCA 4JAMB 1ZS2A 4XP9H 1WFMA 5DUMH 4FFVC 1DLHB 4H13B 5DC2A 3LRKA 4JO4L 1NIFA 1DF5A 4L3FA 5D4HA 3SO3B 1HI6B 1UCBL 3K2UL 3NJKA 5E2WH 5CEXA 2XA8L 2ZYSA 5KYWA 3L7EB 4I3RL 4P46D 3BMWA 4NZJA 5DRWB 1DEDA 4DV6B 3GXFA 4AM0A 4XCCH 4LCWA 2YGOA 2ZAGA 5HI5D 1PX8A 1E9PA 4GBXC 3VQXA 3P3TA 2E56A 1OCWL 4OBRA 5L0QC 1OP5H 3S3CB 4OAWA 3IMBA 4GXUM 4B9JA 2VDNL 2H32B 2YXVA 4U1JB 4X6FB 1FPTH 4JYCA 1AZZC 1T22B 1ZT4A 2NY3B 4LSTH 1CGXA 1BBJA 4AT6A 1F58L 5DMGD 5A16B 1CQYA 5KHHA 1SN0A 3TA4D 1I4FB 2JJVA 5SV4A 1XL4A 1QOKA 4RMTA 4ZMQA 4M43L 3APQA 3AQDA 4GLRI 3WE6A 1CFTA 1QP1A 2YK1L 2AK1H 5LBGA 3MAWA 3NFPA 2MHAA 2FSEA 5TE4L 3QDJD 1OCZB 5KHGA 1Q7YW 2DF3A 1S7QA 4BWWA 3JT0A 2QKIA 4BIKA 3CCUV 2CA4A 2R9HC 1S5HC 1Y66A 3KBFA 4JDTH 5IJ9A 1USZA 1JWMA 2EDRA 4X98B 1KJ3H 3AREB 1QBAA 3RFZC 2WXNA 2B5IC 3ZMSA 1CIUA 3HAEG 4YXHL 2PKDA 2ZG1A 5EYPB 4K3EL 4ZAKA 1I8MB 3GDCA 5ALBL 1GZHC 4Z7OE 3BFRA 2DDQL 3RX9A 1EHLL 3HG1E 2WCSA 4AKQA 1MCOH 5BMFL 3KZ8A 3S96B 4K7PY 2VLRA 2XTJB 2P8LA 3IJEA 2LABA 4JY5H 5GISH 1SN5A 1CDHA 4KH9A 1NAKH 1BP3B 1O75A 4N8VG 3WJMB 1W2KT 4NXSA 3LV3A 1F6FB 1JXKA 5FYKE 2OMBA 3BN3B 1CDBA 2E76B 4WUKL 1BREA 2CM5A 4K4KA 1AGFA 5E08H 3DHPA 3BPLC 4H25A 3VXNA 3UT5B 1MRDH 2DJUA 1P4LB 4XBGB 4CNIB 4I1PA 3RGVB 3OAYK 1F11A 1KMIZ 3PABB 3HMWH 4YSAA 1FV1B 1QBLL 3JV4B 3T1YO 2P5WB 2WYIA 2ZUQB 4XH2A 5BZWA 1A9EB 1EGJL 4DJMA 1AKJA 2AXGA 5E8PB 4O58L 2YZ1A 3HS0C 4KRNA 4UIMA 1UZ6F 4G9DB 1CGYA 4BKTC 3MQIA 2WUCH 3M17B 4YSRA 1Z7JA 3I3DA 5JIQA 4DEWA 1N5YL 2BHUA 2GCYA 3IN0A 3O0RH 1FZMA 1QEXA 4OF5A 5LQBL 4DR6O 1T2JA 3KPQB 2K6WA 1A7NH 3QEUB 5E6SB 4DW2L 1PZ5A 3KPRD 5LO7A 3X11B 2BSSA 3FOLB 4XXCA 5CJXC 3ARDA 2FX7H 4KJQD 4MZ2A 5CEZH 2BHYA 4C47A 2CCVA 3QQDA 1QLEC 5FLUA 9CGTA 2ZUYA 1ORQA 2WLHA 3UJTL 4PD4J 4QHNA 3CE2A 1R33A 2DQHH 4RGND 3QJFA 4J39A 1LWJA 4P2QA 4X6EA 2AHIA 3RGHA 1DEEA 4L1LA 5D1QC 3TN0C 5DJAB 3US9A 3D34A 3SQBB 4EN2A 2ZP0T 5I71B 4LC1A 5DECA 1CYWA 5IJKA 2C9QA 1CPUA 2X5PA 2XV3A 3MRGB 2VQEB 4XBEL 1UJ3B 4J5VA 2Y69C 4X1IA 4RMQA 3FCTA 4QRQA 5DZLA 1OTTC 4IU3B 2MPVA 5I2IA 4X9GA 4IOIB 4IRJC 4XMKL 1SXZA 3D6GA 1ZLDA 2EDXA 4QD2E 3SBRA 1LUVA 1RFYA 1LEKB 1S7VB 1AI1L 2FUTA 3MDSA 4HKBB 4U0RC 4TV3A 5AW2B 2JF1A 4DETA 1AJ7H 3D25B 4B9ZA 5HFLA 4JJ5A 3IPBA 3WKYA 5JO5A 3TO2B 5CA1A 3FFCA 3VA2C 2XWTB 3UJJL 5IWAB 2O5XL 2GEEA 3LDBC 1CR9H 1XQ4A 4OIAA 3GUFA 3IXTB 5BV7H 1GYUA 1D5MA 3GI9L 1PS3A 4JE0A 1NBMG 3O2WH 4Z95H 1OSZB 3SKJH 2XWBB 4PUBL 2OSXA 1HH9B 1JR9A 2X4SA 1X5GA 2OMVB 1SN2A 4HHGA 2XWJB 3LKNA 4NSKA 2PWFA 3HN3A 4V1DE 5IVNA 4EZJA 4P23B 1U8OB 3UGEA 5E0FA 4RWYL 1IGCH 3MCKB 3RGBA 1ADQH 3ZPDA 4AIXA 1IBMO 4I77H 5DWUL 4JI3O 4BZ2A 1KCRL 1E42A 1SKVA 4FKHA 1IBKB 4I3SH 4TQDA 3INUH 1QHTA 4BEIA 3BD5A 3QVNA 4N2KA 1AP6A 2L0DA 4CSSA 4P2CG 4F57H 1P4BL 4UBDC 2EIEA 3VI3F 2XZAH 3AU1A 5B5EZ 4NJAH 4XMPL 4GNKB 4LF3B 1PZDA 2YD6A 1FQ9C 4F7KA 1V3LA 3BT0A 4ZFFA 4BH7B 4ZBJA 2IW5A 2VMCA 5HI4D 5AAWA 1T7YA 3L3JA 5F3HB 3NESA 1KF9B 5HJ3B 1NCDL 1QWUA 4E5XA 3SBPA 1Z9LA 4L5FL 1OT2A 3QPQD 1FSKC 4U3XA 3IGKA 3OR6B 4WJ5A 1MQ8A 4WW1A 3CSXA 1C8QA 1RZJL 2AV1B 3DMMB 5DJ0B 4BE5A 1CE6A 5EBGA 3DNKA 4L1TA 4NENB 1AXTL 2CGRL 1LDPH 3FULA 2XAFA 1R3KB 1U8CA 2IBZX 5DJXB 3ZGHA 4DR4O 4QIRA 2OMUB 2WNKA 2CAKA 3DSNB 2HLAA 4LU5H 2X44D 3NVQA 3KDMA 1DYZA 3LNEA 2VAAB 1QLFA 2FQGA 4L9LA 1N64H 5JQGA 2R2HB 1ITBB 1C5BH 3V5HB 3KYNA 3QDJE 5LGJB 1L7IH 3SYCA 2AXJA 3GPSA 3UAAA 5KHIA 5LG6A 3UABA 4X5PA 2IDQA 3AMKA 3QW9A 4JEGB 3HKCB 5FUZH 4RO2A 3GJFB 1ZL8A 2ZKOA 1N8RW 1IGIL 4JFQA 5DVMA 2YXYA 1M71B 5I1IL 4JQVA 3BH8A 3PWNB 2ODHA 5F96L 3HIZA 4A2LA 4TTDD 4AGOA 3BWSA 1US6A 4IKJA 3QCTL 1BV8A 2UZIH 4YBLB 3ASOC 3E83A 2H6UA 3WU1A 1CGWA 2LLGA 2PUQT 4L3EA 5FOBA 5K59E 3CFCL 5J13B 1N6QL 2Q9LA 4M5SA 4BGLA 2WSKA 1BLIA 4DPRA 2EVGA 3HE7A 3SDAA 4K7FB 2C3HA 2YAOA 5IKCA 2YMXH 4O4JB 2JGDB 5E2JA 5LDSA 4EN3D 1RZ8B 1RZPA 1BQHB 4KJPC 3JYBA 3F12B 5J9PC 5IB3A 4S1QL 3WFEL 4JFYA 4KRPB 2ENSA 4CN1A 4HV8A 4UOJA 4B3SB 4EKWA 4KJYA 1BECA 3B40A 1VKXB 2GT9A 1X5HA 1XDTT 4AWJC 5DK2B 3MLSL 5IF0A 3OX8B 4ZMOA 4DR5O 2GEQA 3FO0H 4HUUA 4PRHD 3SO3C 4PJ9C 3PHQB 2E27L 1FL5A 3N3EA 3OC5A 2WKGA 3JVFC 4W9ZA 1J95A 3GMMB 1G1KA 3NEEA 5EBMA 2Y5TA 3CZFA 2B3IA 2RCSH 3ZYZA 2CTQA 1S7UA 2VXQA 2ZPKL 3VTMA 4E2OA 4J7JA 4O51A 2NY6B 1N32B 5E9NA 1RUKL 5H5NA 3SODB 1INQA 3UBXG 4GIOA 5LLIC 5E5LA 3CN0A 2JVUA 1BVKB 1CC3A 2N7SA 4FXGB 4DUYB 2M26A 2XVBA 4N2LA 5CINH 2YIAA 1WBYB 3T4AC 1KELL 2W0KA 3GGWA 3GSXB 2F95B 2JS3A 2UVEA 3NK3A 1G4MA 2WWMD 5E79Z 4JO1H 4M3JA 4NQTA 4PWEA 5EU6D 3DX1A 2N56A 5G4MA 5I19H 4LPUA 2J1WA 1T3FB 2QHRH 1OE3A 3SSGA 4JM2F 3ZYIA 3DTDA 4BK4A 1GPOH 3WKNA 4P5TB 2EVIA 4XP5L 4NHCH 1FL3B 4D7PA 4M8UA 4HPOH 3QNEA 3M88A 1I8UA 4XPBL 5DTFB 5EA0H 3UIYA 3VGHA 4QRUB 5T5FH 1VF6C 1YJDC 3LZQA 4RGOH 1GC1L 1K2DA 1ULVA 4XN5A 5KTEL 2PP8A 4Y1TA 4BDVB 2FL5B 2LLNA 3FB7B 1RKRA 1QAWA 3SN6N 4IHJB 4GS7C 1BXUA 3UAEA 5KAIZ 1CXFA 4F6EA 3DV4A 4PG2C 4DPAX 5CEYB 2GK0B 2EZOA 3HCVB 1G9EA 3ATDA 2FDBP 3PGCA 3GHBL 3QZPA 4Z7UE 4H2CA 3NJGA 2E76C 4TULL 5J11B 5JMOC 1Y0LB 4PCTA 4BSWB 1NWOA 2EYSA 5J6GB 5FYKH 2BFVH 2Z31B 3EKCA 1YITV 5E94A 4C58B 2Y7QA 4Y5YA 4QHMB 4NLAA 4MA1C 3GQFA 5D1ZC 4QE7A 1YC8A 2OR8A 4HX1A 1QRNB 2OXGB 4O02L 5DQDH 3ZKNC 2GJ6A 5EO9B 4NKGB 2DMCA 3ETBF 4P5MA 4A7GA 4MA8H 3ASWA 2X1PA 3WIHA 5DRNB 4QWWD 2BX5A 4ZTPL 4ABWA 4AZ8A 2A6DB 2OJ1A 2MCMA 4RQFA 1I82A 2UY6B 1U93B 1AP2B 2XN0A 1KBBA 2VR4A 1XF1A 3L4XA 1PL4A 1XCTA 4X6CB 3E8HA 1E5BA 4H5SB 4U49A 5ITFB 4PS8A 5EC1A 4PJCB 3WELA 4GMSL 4NQSA 3B2UD 3R7RA 4NGHL 2PCFB 2NY4D 3EYQD 3AABA 4PA3A 1NIBA 4G6JL 4YAQA 4FQIL 4X1KB 3FHAA 3N2JA 5SX4H 3ZZ1A 4I0KA 3SGEI 3JTSB 1MJUH 3R06B 4YFLF 4O2FB 3W0WA 4H0IA 2ICWJ 4KK5C 5AVUB 4XOEA 4NIKB 3POCA 1MCCA 3FCGA 2Q0ZX 1KB9F 2J8UE 1FIGH 1AD0B 3V7MA 1D7BA 3TEWA 1BMFG 4HYTB 4RGMB 4B3RB 4ZSOB 3T65A 5KYXA 1RJLA 4JDEB 3QQ3A 2ETWA 3BAEL 4DESA 1B0IA 1MF2L 5CUSL 2Q69A 1DBJH 3EFOA 3LN9A 4AC2A 1U92B 5AAMC 4ZI8A 4BSVB 1CXIA 1NKDA 4NBZB 3HHRB 1WWWX 1Y18A 1XEUA 3L95A 4LDEB 1I3VA 4I9XA 3DX8B 5IR1B 2CKBH 2VMFA 4UV4H 2RNBA 4BRJA 1XSJA 2J72A 1NOFA 4Z7OF 3BPCA 1AQKH 3ATBA 3MO1B 4WW2C 3MRHA 4PVLA 3SE4C 1AI6A 4HEME 4HWEH 1ACYL 4X7FC 5ESAA 3T1CA 3A3YB 5DHVB 1ZEAL 2Y24A 3O2DH 3HEIB 3ALWA 1ZSDA 1L0XA 3RWGA 1T5WB 4W4NA 2UYLA 1JRHH 3JARA 5F89B 2WJ7A 5IY5C 3NIFB 2EZ0C 2ICEB 2Z1KA 3GRWH 1D7FA 4X66B 1K5NA 1XMOO 1FHGA 5JOPD 1XH3A 4FQLL 1BEYL 2MPAH 1LNQA 3FT0A 1JV2A 2DLFL 5GGTL 2X4TB 5GONA 4N5EC 4MB5A 5BZXA 4NB7A 1QQDA 3W9DB 1SJEB 1DVUA 4R2GB 1H3TA 1OSPH 3ZTNL 3EGSB 5D55A 2ZQMA 4KKBD 1BIIA 4ZUUA 3CMAV 5C70A 2DB8A 2BY1A 2VN3A 4KI5E 4NRYB 5F72S 2ARWA 4ENEC 3VTTA 2EEXA 4K5OA 3K71B 4NNPH 4XO5A 4PRHE 3G6JE 5DZVA 3T5WA 3JWNE 1WJZA 4YC2C 3N1PC 3M46A 3FRPG 3M99B 4DVBB 2C9PA 4R7NB 2VTFA 4GOSA 1A6AB 1ZVSA 1RXLA 2VR7A 4LLMA 2A2QT 4K23H 5B1KA 4J3BA 5EPMA 1VQPV 4V11A 2YI8A 3L5XH 4TVUA 1VEPA 3GNMH 3HBPA 5LA6A 3TCUA 2F1AA 3P77A 4GFTB 4B9YA 2DMXA 5F3BA 3MI6A 1OGAE 4JV5O 5FYLD 1S9WB 3DMMC 4UQAA 5GS0C 5E9AA 4DPCX 3I56V 2FL4A 7PCYA 4J3OD 3U46A 2JI3A 3LKQA 5GS2D 3EGXA 4K3AA 1JZFA 5B3NA 2VDPL 4K7PX 4M93B 4MVBC 5EU6E 1CF8H 5GPRA 5MENB 1AG6A 4XOCA 4JQXC 3QTCA 3OAAG 5G5DA 4TVPD 5JIDA 4HAKA 5IB1B 5EZIL 4M8VA 1C08A 1Q1PA 2NMSA 4KQ3H 3FRUA 3D8MA 4L8JA 5GTHZ 1JGVH 1BXAA 2QVIA 1M57B 2BIQA 3ZR6A 2G3NA 4UMGA 1M6UA 2QGNA 2BRQA 1IIKA 3ARGD 5LL6Y 3IMTA 5T1KD 3T3PB 1FH5L 2HVJC 5L8LB 4ICWA 2CO4A 3D39A 4WI8A 5IEKA 1P5UC 4MSWA 3WEOA 2GBOA 3UOAB 4MWFB 4FMKA 1E79G 3DX9A 1PZCA 4K94L 3FAVA 2BSEA 1X3DA 4KHXH 4HH8A 3CUPB 3RWIA 1RPOA 1CI5A 4YBLC 4FQCL 3W57A 5I75B 4WI2A 2CO7B 1KPVB 1J8HB 4ZODA 3VXOB 1JCHA 2CRMA 5AVYB 1HINH 5J13C 5INCA 5K9OA 3G5ZB 1ZXKA 1DL7H 2V2XB 3BGMB 3GHPA 1ZA3B 3BRCA 2CHNA 4QOKD 3F5WC 1C12B 1JF1A 4IJ3B 4P2RE 1T66D 4M48H 2CJUH 3ETTA 2CR3A 2MKWA 3UYRH 2OS7A 3TJPA 1X6LA 3OFNG 2WQAA 4NM8H 3N9GL 4G6AC 2FB4H 3CSBA 1T6VN 4FP8H 1XL6A 4FZ1A 4L23A 2V2WA 3PS6A 1FUNA 1U8QB 3AT0A 4JFOB 4DEPC 2ATAA 1OY3B 2I9LA 1H3PH 4JR9L 1MHCB 4TUOB 2YRPA 4XNQB 3BIBX 5DD6A 1DJZA 2AMGA 3UC0L 2X4UA 3HKDB 1MJJA 3NFNA 1GH6A 2FX8L 3IJ8A 4W9LC 2ORBH 2JIZG 3NBNA 2YPLD 3RNQA 3EADA 1DFXA 3VRIA 2DQMA 3PQYA 5IROD 5TISZ 3PFUA 2YEQA 3VU1A 3K8LA 3QA3A 2EE3A 3ARVA 2OTPA 5T1JA 4HUWB 1SS3A 4PJEB 5ISZB 3ES6A 5B38A 3DETC 5JHAA 3QFDB 4YSSA 3O6FC 4KTEL 5B3JE 2WHVA 4OFPA 1UH4A 3TBVA 1EAPB 1G9MH 4LSSH 1IGTA 3ORJA 3W39B 4NXMO 2QGBA 2RBLA 4U1HA 2B0SL 4ZMZA 3C8HA 1DBBH 2H41A 3L13A 3U30B 3EO1A 2P7TB 4P49A 2IMNA 1UD5A 2DQDH 3QXDA 4F7PB 5IK3A 1J48A 2V0AA 3N43B 4YJ3A 1E4JA 5FK9A 4OCSH 4QNPE 2G3MA 4NQXB 1JSYA 5E2UL 4KY1H 3MA7B 4JFFD 3LVEA 2AVGA 3VQ1C 1P7BA 4O2CA 2MEJB 2J57A 4HIEB 4XP4L 4HOWA 2CRZA 5I8CB 2H0FA 3S98A 3EO9H 4RIRB 2AQPA 4PLOB 4RAIA 1P1ZB 1VEMA 4HWBH 3ATEA 1I8LA 3NUKA 4IRSC 1A7QH 4K7PH 5D6CB 4N2IA 1MDAA 3KCWA 3TNMA 1NH2B 4WTWA 4PJHA 3W7TA 3ZQXA 4LGSB 1YNLH 1VERA 3CZEA 3O6LL 1TR7A 4M1GH 4CVZB 1S7RA 4O4HA 4DIXA 3T4YB 2QPDB 1FZKB 3K80A 4O9HH 5AG9A 5JOFA 2D7PA 2CDEB 1JF6A 4WI0B 1DANU 3ZT6A 43CAA 1PYWA 5IQMA 2X2UA 3EFDH 3OW2U 3FOMB 1VHPA 2EKSB 1S7TB 3MRMB 5LCVH 3KCXA 4HCFA 4CC0A 1FNEB 2JWYA 5K59F 4B27A 4UQ2B 1UHVA 4PBDA 5JOPE 4Y4FB 3GXTA 1IMHC 3QQNA 3X3FL 3R65A 1D5IL 2GABA 4PR5B 1TUBB 1RZIB 2DEWX 2NQDA 2TRYA 4RWUA 3JD4A 4OCRL 1HAWA 1IAIM 3PWVA 1D5ZA 3T1YB 1QLEL 4AH2B 3L3GA 4FQ1L 3MYJA 4MS8C 2XNDG 3QEQE 4LE8A 5GZND 3RWFB 1IEBB 5DJCA 3RTQA 5T1LB 4KHPO 3KLHD 5LWYL 1LDSA 1UD6A 1FFPA 3SDYH 1FNSL 5JOEA 5ANME 3RVTC 4A2EA 3FQYA 4C56B 1CTOA 4I89A 2ZR3A 3WN5C 2A4EA 2E7MA 3O45B 1EGJA 1WP8A 4S11A 2ZT9C 2CUAA 5EEUA 1PIGA 1N8OE 1V8HA 4MASA 5BS0B 1RK0A 4DR6B 4FLRA 5ITBL 4M3KB 4M62H 2PO6D 3GMNB 5FO2A 3IGAC 2OCCB 3UBXI 4ZUVB 4PHXA 1AQ8A 4TUJB 4QRAA 2XFGB 2EDFA 4M02A 4PD4F 4HMEA 1MEXL 4NHUA 4YLCA 4NUGH 5JDSB 3WB2A 3FB5A 5TE6L 4KI1A 5FYLE 1M6OB 4P2OD 4XXDA 1EFQA 1CL7I 1UOLA 2WWNA 1NDGB 3P73B 3ZUNC 3CVHH 4TQPA 6PAZA 5AEAA 1PP9H 2HKHL 4BWTA 4AHCA 1XSKA 4JHZA 3S3SA 2EXWD 4BXVA 2OMYA 3QS3A 2GTZA 5I1HL 4OGQB 1OAYL 5B1JA 4U1LB 2NTSP 2XKSA 4ZX4A 1P7QD 4TVPE 1XCWA 2W81C 2H9GA 2Q7YA 3LDCA 3RJQB 5IFJB 2LE9A 2WXIA 2ZOKB 3SYAA 4H0LB 4RGMC 4GKSB 3ASNB 3FTYA 4PYHA 4MNQA 1ZWIB 4X5XB 5DFWH 5B21A 3F8UB 1I94O 3PGFH 2W60B 4F15B 2F66C 1A7OH 1U58B 3G6DH 2PYED 3B83A 4JRYD 4F33A 2PW1A 5BXZA 5JW3L 3AG1C 3BABA 3GJFK 5CJ5A 1JJ2U 2FNBA 3BVNA 3ZKQD 4YHHB 1I1CA 3B2XA 3DYOA 1BQUA 1FFTB 1CBVH 2WXJA 4ZW8A 3HZYB 3QIUA 2EIMC 3MDJA 1VPOH 4OX9O 3KXFE 3A67L 2B9ZA 1AP5A 1I7RA 1Z32X 4LEXH 3HRPA 3ECQA 5C8JA 4GAGH 3CLFL 2XIIA 4UILH 4DGWC 4ETQB 4QOKE 2KBGA 1A7PL 3BKML 3K5NA 1S76D 4QXTA 4QI3A 4Z7UF 3OTOO 2VDQH 1H3UA 3C08H 5DZ9A 3D09A 3IDNB 3AROA 2XT9A 1IBMB 3ULUC 5LXVA 3M8OL 5E9DD 1ZA6B 1EIBA 1W8NA 3V10A 3TCTA 3VXSD 3BWUF 1JZEA 1X5FA 2E9JA 2QADC 4G8GB 4ERSL 1L0QA 3FQTA 1X5JA 3CH1B 2IH3C 4R2GC 4GRLA 5SWZB 1SZXA 2J44A 4LWSB 1MW3A 4X6DE 3TL5A 1MG3C 1UVQA 1KPUB 2HZHA 1AQDB 2P48B 1KJVB 3G5WA 1JD7A 2YPLE 3EO0B 1F4WL 3CFUA 4X7EC 1GN3A 4LVEA 2NLJA 3WFHA 2JK5C 4OGXH 1RV6X 4LHUD 5DSCA 1CTMA 3ZMVA 2BINA 2VSCA 3IFXA 5MHSD 3Q4HB 4N6RA 1YMMA 4W81A 4P57A 3LPGA 4EAEA 4N22A 1WZMA 3JWNH 4PGBA 4I3GA 3MLYH 4Q0XL 3F83A 3IFLH 5C7ZA 2EICA 3B1UA 5D1XA 4X89A 4ZNEE 3QUMA 4MMYB 4ZXBC 5CB4B 4DR4B 2G4GA 2J56A 1Z2GA 1GZPA 3CC1A 3LZOA 5EF1A 2R69H 3O81A 4G9FD 3CPUA 5TFSH 2BSKB 4P48A 3T2OA 4Q9RL 1GCFA 3ZRSA 1OPOA 1J5IA 3ECBB 4Z7QB 1S9XB 1T1WA 3BW9B 5GRUL 1P53A 4JFFE 4Y1AD 5DUPH 1E28A 2K45A 3NDYE 3QZMA 1UA6L 4NUPA 3B8YA 5TH2B 1H0DA 1SF3A 5A7EA 3AW5A 2J8UF 4UYPA 3RWHB 5K1NA 3VFWA 2AKRB 2AK4D 2EUXA 2J88H 2ATKB 2BSRA 3ZMRA 3NRPA 2KZBA 4DV3O 4J80A 2FO1A 1BHBA 3MV8A 4PRIB 1HHJB 1MFAH 3SYPA 1RULH 5DD0H 3UTTE 4M61B 4HJUA 4C4UA 2RJMA 3SOBH 2C4FT 3C6LA 1F41A 2R0LL 1YNTB 4ORZC 4HLEA 5ADOH 2CTWA 4D6TH 4JZ2A 4AQ8A 5ICYA 2IDTA 4YHZL 1A3LH 3FFDB 5TQ0L 5MP6H 4Y16C 3RNKB 4WEBL 4EMZA 3BISA 1Z9OA 3HG5A 5ICZB 1G0DA 3QJHB 2RALA 2JCWA 3L70H 2RA1A