1OCCB

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
molecule keywords CYTOCHROME C OXIDASE
total genus 61
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1occB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1occB02
5PAZA 3T9WA 2BZCA 2PPAA 1JXGA 1JXDA 1AS7A 2QT6A 3WKPA 2VW6A 1L9OA 1VLXA 3QJRB 2W8CA 2AANA 3CVBA 2EINB 1SNRA 2FT8A 1NINA 4HIPA 3S8FB 1GSKA 1IUZA 1SHWA 1AG0A 4BDVA 4KNTA 3FU9A 1L9RA 1CURA 1E65A 1SFDA 4JHVA 1PZBA 1WAEA 7PAZA 1OE3A 1T5KA 4YSSA 1AAJA 1CYWA 4N8UA 3EF4A 1AZBA 1JVLA 4G70B 3N2JA 1E30A 4YSTA 2J56A 4KO7A 5B1JA 3SBQA 3ZX1A 2X87A 3SBPA 4E9RA 1E67A 3ABGA 1W6WA 4BK5C 3NSFA 3H4HA 1XMEB 2XV3A 1W8EA 3GDCA 3OM3B 1PAZA 2QPEB 1PF3A 3KW7A 1RKRA 1BXVA 4E9SA 2DWTA 3T6ZA 3NSDA 3U25A 1JZJA 5I28A 1GS6X 2IH9A 1AZNA 3TBCA 1AACA 1GY1A 2ZONA 1JXFA 1MZYA 1ET7A 2VN3A 4W9ZA 4HCFA 3UACA 4QLWA 1XB6A 3V9EA 1FWXA 5I6NA 3IN0A 5TK4A 4UANA 4AI7A 4KOBA 4BXVA 3GXUB 3X1GA 1A65A 1GR7A 1HFUA 1PLBA 2PLTA 1SFHA 4DP8X 4AX3A 2BWIA 1ZV2A 2CCWA 5F7BA 3TA4D 1PZAA 5I6MA 2IDUA 4HAKA 1PZCA 2QDWA 3T71A 4AKPA 1B3IA 4TXVB 4KO6A 3PAZA 3FT0A 3TU6A 2FQEA 3PAVA 3NJFA 3QJUB 2XLLA 2R7EA 1KYAA 1J5CA 1N70A 4F2FA 2PP8A 4E9XA 1IBYA 2DYSB 3EH4B 3WG7B 1KDIA 2AZAA 4MFHA 4KO5A 2BP8A 4HCIA 3AY2A 2VW4A 3ABKB 1NDTA 3IE9A 5ANHA 4GY4A 2HXAA 1KDJA 2J5WA 1KCWA 2PPCA 4YSUA 1KV7A 2DY2A 2I7OA 3AG4B 5E9NA 4F7KA 3FSVA 2MRYA 1SF3A 1QHQA 1IC0A 2VSKB 4RH4A 1WA0X 4E9YA 1NWPA 3NP4A 2FNWA 3BQVA 2GC7C 2XXFA 2GI0A 4A66A 3PLYA 4KO9A 4G7RB 2Q5BA 1OV8A 4UAHA 4GP8B 1ILUA 2BW4A 4YSEA 2VM3A 1ASPA 1AR1B 2DV6A 1NICA 5I26A 3EH5B 3GYRA 6PAZA 2ZWNA 2H47C 2WSDA 3EHBB 4YVUA 4ZK8A 1DZ0A 3HB3B 2AFNA 2CALA 2RACA 1V54B 4DP6X 3C75A 1OCCB 1OCOB 4YL4A 1ZIAA 2FQFA 1ZDSA 3BVDB 5I6OA 1RZPA 2YAPA 2BWDA 3CDZA 1IBZA 4A2GA 2IAAC 2IDSA 4YSRA 1AS6A 2XXGA 2EIKB 3OD3A 3AG1B 2IDTA 4K9JA 2YAHA 3WKQA 1BEXA 1GYCA 1PLCA 4DP1X 5B1KA 7PCYA 2JKWA 2I7SA 1NTDA 1OE2A 1SDDA 2B3IA 3X1BA 4A2EA 3AG3B 3WIAA 2FJSA 2R7EB 5I6LA 2W88A 2XU9A 3TBBA 1BXAA 1N68A 2OCCB 2WO3B 1GS8A 5B1JC 4AKQA 3FYIB 3X2QB 4X4KA 2BP8B 2P80A 1OCRB 1AS8A 5I5MA 3NJGA 1AZRA 5I5JA 3HEIB 1BQRA 1X9UA 3QJTB 3DIVA 3IEAA 1TEGA 3MBWB 1AIZA 3N55A 4HCGA 6PCYA 4YSDA 1CUOA 4E9TA 1XB3A 4YSOA 1ILSA 3PCYA 1A4AA 1NZRA 4QKTA 3NJNA 2UXTA 2H5UA 3FSZA 2VW7A 1L9PA 3JT2A 3NSCA 3NP3A 1BQ5A 3CVDA 4YVNA 4JHUA 1IKOP 3AW5A 3PXLA 2JFCA 2YQBA 4P5RA 3UAAA 1JZFA 3WI9A 2EIMB 1ET8A 4M3HA 1NIBA 1V55B 3QPKA 1UATA 1URIA 2OJ1A 3OQRA 2FTAA 1PY0A 2YXWA 3KW8A 4M4RB 4YSPA 3WNIA 3WNJA 1E5YA 3SQRA 9PCYA 5FC9A 3UAEA 2PPDA 1L9TA 1TEFA 1FFTB 3X1NA 1BYPA 2MTAA 4CSPA 2FT7A 1SJMA 5PCYA 5B7MA 3FS9A 2GB2A 2YAOA 3FSWA 2PP7A 1I53A 2IDFA 4DP0X 2BZ7A 2OV0A 1W6LA 4GYBA 1QNIA 2XYBA 1ASOA 1RCYA 3ZBMA 2N0MA 3QQXA 4GP4B 3H4FA 3UADA 4Q8BA 4BDVB 1WA1X 1PMYA 3ASOB 4G72B 3AG2B 1JZIA 4FA7B 3NJKA 5B7EA 1MG2C 4KNSA 3H56A 8PAZA 1CYXA 5B3SB 2H3XC 2B08A 1E5ZA 1ZDQA 1MG3C 3ZIYA 2AVFA 1NIDA 1NPNA 1A3ZA 2FT6A 2UXFA 3D12B 2YAEA 2HX9A 4A68A 2UXGA 3CG8A 4G71B 2BP0B 2PCYA 4HHGA 3ABLB 1A4BA 1F56A 3MX0B 3X1FA 1HAUA 4DP5X 2HLEB 2YAMA 2CAKA 1EZLA 2I85A 5D4HA 2GSMB 1ZPUA 3NJMA 4DPAX 1PNCA 2P80D 4DP7X 2HRGA 2J55A 3FU7B 4NERA 1A4CA 3FQYA 3DTUB 3T6VA 1RZQA 1KGYE 4WKXA 3NJIA 4CSZA 3S3CB 2YEVB 1JZHA 1V10A 4E9VA 1JOIA 1YLBB 2DYRB 4E9QA 3FPYA 5AFAA 2XV0A 4A2FA 2VM4A 1CC3A 4G7QB 3ERXA 4DPBX 1KCBA 5LDUA 1AANA 1BYOA 4HZ1A 2XWZA 4DP4X 3FU7A 2IH8A 1AG6A 2A3TA 4A2HA 4BWWA 3G5WA 2J57A 2FQGA 1FA4A 2PCFA 4EF3A 2IWEA 1NWOA 2XX0A 2QDVA 1ADWA 3SBRA 5A7EA 1NPJA 3FPXA 2FWLB 3FYEB 1SF5A 4W1TA 3S8GB 2HRHA 4DP2X 4P5SA 4N4YB 5EHFA 2JXMA 3NJLA 3NYKA 4BWTA 2HZHA 1ASQA 2IDQA 1GW0A 4YSCA 1M56B 4JKNA 1J9SA 4DPCX 1NIEA 2UXVA 1R1CA 4PCYA 4UF7C 2NRDA 3V9CA 4G7SB 3ASNB 4WTQA 1JZEA 2E86A 3T6WA 1WS7A 2VSMB 4Q89A 4YSAA 3S3DB 1J9TA 2YAFA 3NT0A 2CUAA 4DP9X 5B7FA 5IY5B 2GC4C 3QJVB 3OMNB 2UX7A 2ZOOA 1ETJA 2PPFA 4HALA 1WA2X 3DKHA 2Y69B 3UABA 2GBAA 1TU2A 2EIJB 4A67A 1GY2A 1NIAA 1PNDA 2TSAA 2VMJA 3RYMA 1OE1A 3JTBA 1A8ZA 2Q9OA 2ZXWB 5B1AB 3NSYA 1J9RA 1KBVA 2QPDB 2X88A 1NIFA 3L45A 3ABMB 2TSBA 3X1EA 3TASA 4A2DA 1JERA 1X9RA 2IWFA 3CDZB 4HHWA 1OF0A 1KBWA 1SHXA 4L0PB 1AZUA 3NJJA 2CJ3A 1ID2A 1TKWA 4E9WA 2XVBA 5D4JA 3ZDWA 1JZGA 2AZUA 3CVCA 2YXVA 1L9QA 2PPEA 4BWUA 1J9QA 1L9SA 3IN2A 2BO0A 1SDDB 1ET5A 3CZUB 3FQ1A 3IBOA 2XV2A 2XX1A 3OMIB 1J5DA 5AKRA 1BAWA 1XB8A 2BW5A 2LLNA 2IWKA 1QLEB 5I5IA 1M57B 3S3BB 1WS8A 1HAWA 2WO2B 3PAUA 4BXSV 1MDAA 5I6PA 1DYZA 4GXFA 1ZIBA 2GHZA 3QJSB 4FAAB 2BHFA 2HX8A 1PCSA 4NAJA 4KOCA 1AQ8A 1AOZA 1OCZB 1BQKA 4PAZA 2BP0A 3AZUA 3NJHA 3FQ2A 3QJQB 2YAQA 4KNUA 2FQDA 3FU8A 4GP5B 5AZUA 5D4IA 2Y1AA 2YARA 1EHKB 3UGEA 2UX6A 3EH3B 3FSAA 3PPSA 2CBPA 4YSQA 2XUWA 4ENZA 4F2EA 1OOWA 1MZZA 3T6XA 1AZCA 5F7AA 1JVOA 4AZUA 5B1BB 5TK2A 5I6KA 2EILB 4NB7A 2DWSA 1PLAA 2HX7A 3OMAB 1M9WA 2GIMA 4AKOA 1BXUA 2PP9A 1GS7A
chains in the Genus database with same CATH superfamily
4XAKE 4X9IA 1CLYH 3NEXA 1NMCC 4X8XA 3ZYZA 1CFTA 2ED8A 2QT6A 3ZRFC 3KCYA 1Y74A 4TF4A 5GGUB 2X28A 3H42H 1IEBA 2HLDG 4WEBH 2W8CA 3N85H 4UUJB 2FT8A 3C08H 5A7BA 5IMMB 1WFNA 3JATB 2X1WL 1ZPLA 4H8HA 5I73B 1T20B 3JZYA 5JW5A 2BNQB 4ZPTB 4AVKA 4M93C 5EK0A 3FU9A 1HDMB 4N5UA 4ERSH 1FRGL 4UV8A 2LW3A 4R8WL 3IDXH 1OE3A 3V6FB 3QUZB 4WW2C 1MKFA 3D2UA 4OLXL 3VQ2C 1T5EA 2OMXA 4ZX6A 1LNUA 3T4AA 2QWNB 1DLFH 4LF8O 1CXHA 2F9BT 3QEQE 2Z7WA 3QA3A 1BPLB 1RZFH 4QRTB 3L73H 4HMCA 3GXPA 4MAYB 4JM2F 1MY5A 2Y25A 4KRPC 4M7KL 1FIGH 1RPKA 3BI9X 3B40A 2PABA 4KDVA 2P42B 5ADPH 3CCHB 5DVKA 4UTAL 5EU7C 3TFKC 1CDCA 4LPWA 1COBA 5DJ8B 3KLSA 3SGKA 2AEWA 4MBOA 1TO4A 4IRJB 4U1IA 4JGNA 3TBCA 1T1ZA 1BBJB 3QWOA 4K5PA 2XN1A 3V0JA 4PELA 5DU7A 1KCRH 1QP1A 5IT2L 4NM8H 5E1AC 1QLRB 5D55A 2WA4A 1BQ0A 2W9EL 1P2CB 4EPSA 1UD5A 1LO3L 3G08A 1D5XB 1NOAA 3Q1SH 1XH1A 4PI2A 4X5RA 2MQ3A 3FW6A 5LHDA 4L4VA 1ZXKA 1MXGA 2HG0A 4R4NC 4IS6A 1H3TA 3U6RA 2WGXA 3B9VA 4S1SL 1NAML 2DPKA 3CD6V 2NNAB 4JY5L 1CFMA 3BIKA 2GJ6D 3MV7B 4ONOA 2ADGB 1QOKA 4WKZB 2YQGA 3EZ8A 1ZX3A 4TQ8A 3RYCB 5C0IB 4H5SB 4N0RA 1GOGA 1RZ7H 5E6ZA 1MCLA 3UC0L 4JGMA 2O5ZL 3NZ8B 3UDWA 1UZ8A 4BIOA 2WO4A 1Q6HA 4X0KA 2TRHA 4UCRA 3IE9A 4YHYC 4LR3A 1ORSA 3C5SB 4XXCA 5E2TL 4P46C 5EU5B 3S35X 4D7BA 1KV7A 4Y2DD 1TNNA 1ZHNB 3UIYA 2VXUL 3JCUZ 3GSOA 2K1MA 3BPCB 4LF5O 4HS6A 1AMXA 4LCVA 3ZTNH 1BJ8A 4M6AA 4WI8A 1P6AB 3ALXA 5GIRA 5C0BD 4IJ3B 2LU4A 3MV9D 1MFCL 4X80L 1NWPA 3WNOA 1LE9B 5K1JA 2Y23A 3DPBA 1EBOA 1ZHLA 5IQLA 4NXNO 1RUPL 4MW8A 2DYSC 4YR6A 1O6SB 4NZFA 5C0BA 1N3NB 3NIFE 5SWQB 4HIJB 3IJ8A 3WFDH 5KN5B 1G9ML 2DBJA 3BSZA 5AB9A 4PBVC 2APTA 4XNMB 1AH1A 2HTKC 4N2AA 1CGVA 1F3JA 4UYPA 2WSDA 2CM5A 4QRPD 3MNVA 1X5JA 2V9TA 3QO8A 1LO5A 1SZXA 2WNXA 2P5EE 3KL0A 4KKCC 5DQ9B 5ID1B 3BN9D 5LVEA 1IZKA 4LSSH 3SEPA 2CALA 3FT1A 3Q8AA 2Q86A 3R1GH 2YS4A 1I75A 5C0JA 5I6OA 5CA1A 4W9GC 1HWHB 3B4NA 3FB5A 2QPFA 4PREA 5AVYB 4LMQE 2JB5H 4DNLA 1R5IA 4M5ZH 2X89D 1HL8A 5JDSB 2J5LC 2YXFA 1TLKA 5KYNA 2X4TB 3KPPB 5L88H 5EBWA 5ANME 1KPRB 1VADA 1JWSB 3VBBA 2AXWA 2YD5A 3MRHA 2EUXA 2WANA 3JVFC 3D0LB 4NUPA 1S9YA 4HIHA 3R18A 4NNYB 2PF6A 1MFBL 1LGVA 4P4KC 4I4TB 4YDKL 4WUUD 3K57A 1X7SA 2ICWB 1NFIB 2KQNA 3V0VA 3X1BA 1IC7H 1LLAA 2IFGA 5C0DA 2JK5B 4PMEA 2W88A 4X7SH 2OCCB 4J4PD 3EFFB 4U3CA 1NOLA 1I4FB 3LPGA 4IGBD 4AV0A 4ZFGH 1ICTA 3X2QB 4ZHQA 3HG2A 1PKQB 2BP8B 1MCFA 3JAKB 1MLCB 5IMLA 2W6JG 1H8LA 1IFRA 4OD2B 5I8OL 3D48R 5D7LD 3M17A 3GI9L 4W9EC 1RH8A 3V5KB 2AJYL 1KIRA 5HI4C 1FPOA 1QLEH 3MLWH 4UQ3B 5F7NC 3N55A 1U92B 4AE1A 1F23A 4E4EA 4KUCD 1AP6A 4G8GB 4LNRA 4TOYH 3ECVA 5HP5A 4XO4A 1KT2B 4X66B 2XUMA 4Z7VF 3KM1A 3VDCA 2UXTA 4KMTL 4LGRB 1M4UA 1KXQA 3HNSH 3JT2A 4F8OA 4PG2C 3O9OA 3CLFH 2IAMD 3KYMA 4PQXA 4NOBA 1GGBH 1U3HA 4IOSA 2JFCA 3MBEC 3FSOA 4PIBA 4UBDC 2QV4A 1WFMA 3MD0A 5LP6B 1FAKT 1ET8A 1WZ1H 3SODB 2WJ7A 3SYOA 4FHJA 4D8PA 2EVJA 4Z1MG 2YXWA 4LPUA 1CXKA 4X4MA 3VMPA 3WNJA 3R19A 1UD6A 3O11B 9PCYA 5IQMA 2BVOB 3OR7B 3MLXH 2D0HA 2P7TB 2PPDA 3FT9A 4AG4L 1Q9OA 1R6VA 2LLLA 1R3IH 2W80C 3AB0B 4C4BA 1WA8B 1CICB 1I08A 2P6JA 1YN6B 1UA3A 3FUKA 1UWXK 3RWFA 1FV1A 4NQDB 1HHHB 4AH2A 3H2QA 4HOZA 4X7TB 4NXMO 3G6JF 4GX2A 1I3GH 1O6VA 2OV0A 1N5AA 4FQXC 3WTTA 5CJXC 4F37K 4GP4B 4HUUB 4B7IA 4BDVB 4ZUSA 5L9DH 1OK8A 1DLFL 4KAQL 1UB5A 4GIAA 3VSQA 5C0CA 5C8YA 4KQ0A 1YY9D 4AQ1A 4D3CH 1K8AW 3QQ3B 1ZV9A 3MV9B 1CYXA 1FHGA 4G5AA 3U7AA 2EC8A 3D39B 4F9PC 1H8EG 1KCUH 1I5YA 1HCFX 3HRZA 1WHOA 4JZNB 1TZHB 4GAFB 5BRQA 2BP0B 1H2NA 2ZCZA 3ZYOA 2Y2WA 3CMEV 5ERWB 2DYRC 2HFEC 1HNXB 2DQCH 2FX7H 3I9AA 4LE8A 4NRYB 2MPAL 1EXHA 2APWA 1IJ9A 1RUML 1ZVYA 5FNVA 4YE4H 2XIDA 5IOPB 3QUMA 4DP7X 1X5ZA 1OZUA 2J55A 2APVA 3ZT5A 5BO1H 2F1EA 1WO2A 5K9OA 4HC1A 1DVFB 2EAEA 3L3DB 4NUJB 5GTHZ 3QDHA 1TTUA 2VRKA 1K7DA 2NY7L 3HZYB 1XSOA 2XWEA 2PYFA 3MLYH 4RWHA 4I5BB 4WNQA 3L5WB 2PR9A 5E0QA 4YXKL 4D9RD 2RALA 5KA5A 1PZUB 3ILQD 1WJZA 4OVVA 3DIFA 3SDDC 1HNGA 3CN1A 4D2NA 4ESKA 3N41B 2Y4TA 5LMNO 1DHKA 4X6CA 4KTEL 3MROA 4QRPA 4JI7B 5LCVL 4J2QA 5TDNB 4OCNC 4S1SH 2WBKA 3IDUA 2R69L 4AJVA 5I8CB 4TQIA 3ARWA 1M42A 3VI3E 5HYEA 3S3JA 4UILH 5GRWA 4Z7OE 4X7EC 1VQLV 2VLRD 3OXRA 1KELH 5D1XA 2FSDA 5DWUH 2XN9D 4WFED 4ODWA 3QVAA 3W7SA 5HJBA 2MCPH 2WXOA 1K97A 3QIBB 4ZSOE 3N1QC 4B3RO 4MCZA 3RNKB 5DEJA 4N2LA 5KJ7E 2F8XC 3FPXA 3FYEB 1GOFA 4DV1B 4NQSA 1VF7A 4F4LA 1I0HA 4I0PA 1CO1A 3L48A 4OZFG 3ZTNL 4N2HA 4O02L 2XICA 3QQ4B 2CRYA 2QQNL 1CDIA 4PCTA 3STLC 4Z7AA 1IL1B 3M7FB 5FUOL 5EC1B 4L1DA 1T83A 1JGUL 3CFEA 3I6GA 1B04A 1IQDB 2H6PA 3Q13A 4KK9D 4X4XA 5IKCB 3L1EA 4J39A 3W3BA 5BXFB 2YEZA 4LLYA 2QM7A 2ZDIA 4NZRL 4PCYA 5KYYA 4ANXA 5JZ7D 2Y6TE 3UYPA 3RVTD 3ZKQD 4UUJC 1BCIA 4JB9H 3KPSE 4U31A 3ECWA 4LBAA 3SDCA 2YFNA 4WTQA 2N01B 1T7ZA 3PV6A 5IHWA 3DROB 3NFSH 4ISVB 2PXYD 3U4EA 1WS7A 3KL3A 5CP7A 1KB5B 4XVUD 5D7IE 4JFOB 1H3VA 4GKLA 2YEQA 5HI4D 3PXJA 1H3GA 5IY5B 1PYWA 2ICEB 2WNGA 4YDLB 1CD8A 2ZYIA 3NSJA 1FJGO 1BD2A 2GTZA 3S3SA 2WA3A 1KGXA 1S7VB 5D7IB 3C5JB 4PJ9A 3ZHDA 1CK0L 1BZKA 1NIAA 1S7QA 4JM2D 4FQXB 2LFSA 1ZANL 4KK8C 3V52H 4F57L 3FO0L 2PTMA 4TL5A 4KUZH 5B1AB 2LW7A 1KCRL 2CK0L 1DL7L 1UJ3B 1P7QD 2YUXA 3UJIH 4AC4A 3L3IA 4QY8B 5GJSH 5KZCD 3B2XA 1WZ1L 2OA9A 4KFMA 1ND0A 4WW1A 3CXHF 2VMEA 2Z34A 1J5IA 2QPUA 3MA7B 3PWUB 3WEOA 3E38A 4ELKA 3ZZQA 3PQYA 3CZEA 4GQZA 3FUIA 3TEZA 3ZTEA 2YRZA 3MRKB 1OW0C 2ATAA 1UJWB 1BVKA 4UCFA 3LPOA 4WV1B 4C47A 3WLWD 4RZKA 4Z2WA 1MAMH 4MXWL 3BKML 3L4ZA 5TFSL 2Q3XA 3RVVD 3MRIB 4FZ0A 4B3RB 1J5HA 1NFDF 2BW5A 3RKDC 4FG6C 2NT0A 5FGRA 2UZYB 4K73A 4N26A 3VXUA 4RZCA 4U3SA 4DEPB 1HNFA 2DMKA 1ZIBA 3JV6A 1Y66A 3BD5A 4F8TA 3O3EB 3SGEH 2QQQA 2LJ2A 3G7TA 4PJDE 4M6NH 3NJHA 3PHSA 1KD1W 3ML0A 4PI0A 2LT9A 4MNQA 5E2VH 2G5UA 4RFEB 3AAZA 2HT2D 3JAWB 2XQBL 2Z1PA 1ZHBA 4PRAB 4FLXA 4NXNB 3UGEA 1P9MA 4PWIA 1ONQA 3FSAA 2ZKWA 4O4HB 1WTLA 4XB7A 3FB6B 4N0FB 4PJ6A 3WGVB 4M8QB 5CCKL 1U8IB 1IGJA 2EILB 3MLTA 3FH8A 4KY1L 1FLRL 3S3PA 4CADB 5DTFA 2FO4A 2D31A 1UKSA 5LBSL 4N8CL 3IDYC 3DTDA 3B2PA 1SN5A 2DWXA 3I9PA 2GVYA 4IU2B 1XAUA 1MQ8A 2EADA 4I0CC 5AZEH 4YBQD 1PM9A 2TRYA 5ICXB 3HB3D 1U8HA 3OV6A 1DJIA 5L3BA 3SKJL 3UH8A 1DQDH 1CE1H 1TO5A 2XTLA 1OTTD 4PGBB 4XDKA 1JZ7A 4L5FL 4XN5A 4N9GA 3LNIA 2ERJB 3SKOA 4NWTH 1AO7D 4UIMB 3CDFA 3OAWA 1QVFU 4RGMB 2XQYK 3FQNA 3GWKC 3RRQA 4X4YB 1E65A 1H8SA 2L7JA 3BMVA 3SGDH 1BWWA 2ATPB 2QFRA 3N06B 5JORB 1T5KA 4HU8A 3PHAA 1NL0H 4HGKC 4CC1A 4EKJA 1LK2B 3VFTA 2EXYD 2W9EH 3AWFA 4Y5YB 1QFUL 4NENB 1H19A 1OQOA 4R4ND 5J4MA 4LWSB 2JI1A 2V5MA 1MSWD 2X87A 3I74A 4OLZL 5E0FA 3ZX1A 1N6QH 5C0CE 1E67A 3THML 2ICEC 2D9QB 3TA3A 4K7PL 1P4LA 2PR4L 1D5AA 1I1YA 2QTVA 2GBVA 4DV4B 1J8HE 3HHSA 2QPEB 4IMLB 1MRCH 3T5WA 1AI4A 4JO3L 3E8FA 4A04A 5B38B 4ZBMA 4YIQB 1NMAL 2VE6B 2E59A 3O4OB 5T3XL 2N04A 1AACA 4LSRH 2HT4C 2IALB 2V7HA 5TD4A 1DBBH 4ALAL 4PJBE 3VXRB 4B08A 2EE9A 1NR1A 1GOHA 3G5YA 1SJEB 4Y7OC 2NY3B 3V9EA 1N19A 3CX5J 5FKPA 4B6ZA 5I6NA 3IN0A 3IGKA 4C83B 1B90A 2N4IA 4BA0A 4ORGA 1X5XA 2VDNB 4M43H 4WCYL 5KSBA 5DRXA 3AGVA 1KN2H 5FGSA 4BKLA 3EGXB 2CHNA 1WBXB 2WXNA 4XT1C 5AVWB 4GBXA 3VD2A 1XIWC 4P05A 2WBJD 2Z4TA 1OT2A 4FLZA 3PIQA 2IDUA 2VTFA 1CLVA 4N3TA 1FNSH 4OQTL 4NS0A 4PJEA 2C9QA 2J6EA 3EFOB 3FT4B 4DFIA 3WXVH 2CKBA 4O2FA 2V37A 4FFTA 4AEIL 2FQEA 2A83B 5L8LB 1NVPB 1MFCH 2VNCA 2R0ZH 2Z0BA 1I1AA 1SY6L 2J4WL 3U82B 4J3UA 1U30A 3LKNA 3RZCC 3S5ZA 2Y06L 4Z7NF 2C1PB 5IHZB 2AZAA 5BV7L 5EC1C 3BVOA 1V3LA 1FNEB 4MVUA 2KLTA 4B27A 5DZPA 1OAZH 4KTDH 4M4PA 3RZWA 4LL1A 4C56A 5IUCA 1HYSD 2R59A 4K9EC 1VACB 1LP9A 4GH7B 1JZ8A 3IJSA 4FTDA 3M7MX 2Y07H 2X70A 3AG4B 1CTNA 1BW8A 2VQUA 1UXWB 4OTXL 1AR1C 5EZOH 3OJMB 2QEXV 1SF3A 1VEOA 3QDGE 4NJ9L 3JD1A 3L4XA 3L6FB 2XTJD 3GXIA 1D3CA 1G5GA 3B2VH 3VGAB 2BIHA 3CHPA 3FD9A 2GBOA 1WA0X 3PWVA 1VQ5V 4Q7DA 4BINA 3MQIA 1IC7L 3P11L 1DVYA 4IRSB 5C2BH 3KVQA 4OCRL 3TO4B 3RZCA 4WWPA 2FNBA 3L4VA 4QO1B 3RPIB 3CZSA 3UJJL 3T3PE 4GP8B 4PM1A 4NUQA 2VM3A 5B4MD 3REVB 3IAPA 1ZSPA 1BG1A 1T0PB 2DV6A 4A38A 1B4JH 3V4VA 4F20A 2J88L 4D7SA 1YA5A 3FO0H 3RZCD 32C2A 3D52A 4OT1H 4TVSa 3QDAA 3OZ9H 1NCAH 1QPPA 4WLCA 1MEXH 1FXKA 5IOKA 4ODSL 4G2KA 1BEYL 4P5TA 5GZNC 3HR6A 2RACA 1V54B 2V9RA 2C4XA 3VXPB 1QBZA 5CGMA 1W80A 1KJ2B 2VQFO 4KTYA 4FL4C 2BWDA 1UACH 4FLOA 1SQQH 4XB8A 4A2GA 4LRIA 2A0LD 5D1ZA 5CD5C 4QXGL 3HCVB 2PWGA 3QG6B 4L48A 3V4LA 3OKLA 1JPXA 4KRNA 3DVFA 4XR8C 1WVZA 5C0GA 4FLHA 4BH8A 1LO2H 1FCGA 1C8QA 2YSUB 4K7PH 2YOCA 3TETA 4DP1X 3TT3H 1TYEB 4FFWD 4MA8H 1OT1A 2XZAL 4K3EH 1BF8A 4D6TH 3RHWF 4I18A 1BM3L 2WSPA 3RUGE 4MYWB 2OQJB 2YXYA 3MLVH 2FJSA 4NWUH 4UTAA 1AXSB 1BAFL 4CMMB 1PX3A 3JSNA 4FQ2L 4OLVH 3CC1A 4I0XB 3KNBA 1F7YA 4MAUL 2R0KH 3OKDB 2AV1A 3QNEA 1QZ1A 3DVIA 5C07A 3FU0A 4WW2F 5SX5H 1R3KC 1WEJH 4QYAA 3LRLA 1AQDB 1QABA 3F7VB 2XACC 1PNMA 4XNZB 2Z7YA 1Z9PA 4P2RA 2EUWA 3GSUB 1QFPA 5CJ8A 3RY5A 4D94A 1M71B 3CXDH 4Y9GA 1A1OA 3K59A 5JQ6H 3RBGA 4TUUA 1F90L 5DJ2A 1PLGL 3QXWA 4JHAL 4DGIL 3BHBB 3WIFA 4QKTA 1G6RL 3IFLH 2NYYC 2R56L 1FAIL 4JFEB 3U46B 1T5XB 4AQ8C 2FJFA 5DLML 5LOVA 3I3DA 4R26H 1FKAO 4JI6B 1I7TA 2JQMA 1YY9C 1AE6L 1RHHB 4L5FE 1NAMA 1XUQA 2EIMB 1LJMA 4LCIH 4PFEA 4C58B 1GYWA 4MJ5B 4XP9H 3QPKA 1V55B 2PTTA 4HV8B 4LFHD 4ODUA 1VF6C 4PDLA 1Q7YW 2FTKA 2CR3A 3JSLA 5L3EA 1AFVH 3PGCB 3G67A 2IPKB 3KPOB 2AI0H 3HZMA 1HEZB 4ZO7A 2B14A 4CN1A 1F4NA 3GWOA 3PDGA 5EN2A 3WS3A 3QIWB 1WCBA 3X1NA 3OJVC 4KMQA 1WAAF 5PCYA 5HJ3B 2EIZA 2FB5A 4K7FA 3VXSA 1P0SE 1YYLL 4CSSA 2DQCL 1OGAB 2F7IA 1ES0B 3WTVA 4ZSOB 2Y7MA 4HS3B 1GYVA 4LDEB 2EIJC 4Y16C 1HNXO 3CC5B 3GBNL 1VQ4V 4HXBL 4XNYL 4PRIE 1ETA1 4TQEL 2CPCA 3MCG1 4GIPD 1HHGA 5IJDC 5J1SC 3FQXA 4WU5B 2XZAH 5HYQB 5HFLA 3NAAH 4NKOB 4B0MM 4LARH 4Z7NE 1MFAL 1KB5H 4XRCB 4MQ7A 2BOCB 2NY4B 2AEIT 4URTB 4RUFA 2KYIA 2NY4D 2ROXA 2VR7A 2X0WA 4J8RB 4KMTH 5K93A 2AVFA 2BSDA 2UXFA 4G28B 4HUMB 2UZPA 4DRXB 1F58H 4RSYA 3CN4A 2QM8A 2OMVA 2Q87A 1FAFA 3Q43A 3H9HB 4HHGA 2OZNA 2X6MA 4R8WH 3UFIA 4BCZA 5I66B 4IIQB 2ZXQA 3EAKA 3PU7A 4QRRB 4XC3L 5DHDA 5MI0B 2P5ED 1NOFA 5D4HA 1GGYA 2GSMB 4K2UL 1NUGA 5F0JB 1OF2A 3T0VA 1RIUH 4ZDHB 2OULB 5E9DB 4WBNB 2CO6B 1I31A 4BFBD 4AEHL 2IADB 4P4KD 3A0HZ 3ARFA 3CN0A 3QG7H 3JASA 4NQTA 4PTUB 5GRVL 3WYRA 3IC9A 1E7VA 1TQBC 3GUTA 5K9KA 1TJGH 2BNRA 2QGEA 3QZMA 1HIMH 3MUZ1 4F37F 4YC2C 5L3DA 1TMQA 2KLSA 2AP2A 2BSTA 4F1ZA 5C0BE 2VABA 3QRFM 5I1CL 2XWZA 4PJBA 3FRUB 4FFYH 4DV7B 3LX9A 2VDRL 1IBFA 3H6JA 1XMWA 5EO0B 5H94A 1Y18B 4HSCX 4G8IA 3HVDA 5C1MB 3TS8A 1Q0YL 5EA0L 1M1XA 4ANKA 2FQGA 4HFUL 3HFML 4IDLA 4BQCA 2XX0A 5T3ZE 2FSEB 1OAZL 2P4AB 4KTDL 4NN5C 1IRAY 3QUXD 5D9SA 4P46B 4F3FB 2W0FC 3BW9B 4DP2X 2I07B 3LVTA 2MQCA 2A6IA 4WJ5A 1UA7A 3GEWB 3HC4H 4BKTC 2XTAA 3IU4H 3MN8A 1U91A 4MMYB 3NFNB 3X3FH 2AQ2A 3L71H 2ZOKB 3QJOA 3IRCA 3RGVA 3BFRA 3BWSA 1OAJA 5CBGA 3MYJB 2HTLD 1E3ZA 3U0WH 3D34A 2NRDA 4YDJA 1AKJA 3IPFA 5DK2B 1HOEA 1XD1A 1P69B 2A6JA 3V0IA 3ZE1E 2R2EA 2XETA 2WKGA 1MCBA 3HE7D 1I85C 1Z5YD 5F8QC 3T6WA 5HPMB 4GXVL 1TPXB 3U36B 3EO1B 1IC1A 3LRGA 3GJFK 5T3ZL 3BVWA 2WIMA 3LRKA 4S1RH 3Q4HA 1CXEA 1JRHL 1IE4A 5JWPA 2ZOOA 2PPFA 3T0ED 4HALA 1IGIL 4EFEA 2PO6D 2RFXB 4JRXE 2HTKD 1MQKH 1F3DH 4JTDB 5KA6A 3C5XA 1N5YH 5KX5A 1C08B 4B9FA 5BCAA 3N6YA 3FFOA 5J1AB 4QWWD 3WIIL 5JHLH 5MENA 1JCHA 1KBVA 1UUSA 3GXMA 3PGFH 1F45A 5BR8B 4JY6B 4F92B 3ELQA 3IAQA 3X1EA 2F53A 3B1TA 4AJYV 3PWNB 4IBUA 5L8KB 1ZA3B 4Z7QB 5IB3A 1T03L 4J7JA 1AGDA 2AJVL 3BEVB 2WK2A 3MJ8A 4J3OH 5DJZB 2IDCA 4AIEA 2HP4A 3GXFA 4H8VA 1EEYB 5F89A 3IRZA 5IBTL 3OKMB 4LU5L 4UV7L 3F7YB 3P3SA 4FDWA 1P5VA 1VGKB 3F85A 2OMWA 2JGDB 4YAQA 1P4UA 2VDKH 4GUPA 3FFDB 2WKLA 5T3XD 1FPTH 1UM5L 2XX1A 3OMIB 4X65O 1L7TH 3IBOA 3IDYB 3MOBH 4BK8A 3MHSC 2JGUA 2UY7B 4RMBA 4Y16D 3QUML 1YCSA 2AJUH 2G4GA 2IO5A 4FXGC 1F11B 4MJ2A 3ZJAA 2B5IB 5FGCB 2AK4A 2Y5TB 3FONA 5F3BA 4TUYB 1UD2A 5C08D 1V7NL 5B4MC 2XAFA 5H37H 3O4LE 5FECB 1RZ8B 2C34A 1F02I 3WFCL 1GZHC 3EOBA 1AJNA 1U8JB 4QLRA 4LKXB 3FQ2A 3QJQB 1B9ZA 2BXYA 5TQ0H 3AQDA 2XIIA 4X83A 1RJCA 2IANE 2FIKA 2UV3A 1PW3A 1AO7E 3ULVE 4Y5YC 5I19H 4Q6YA 4IOIA 3EH3B 2Z3YA 1BOGA 4FABH 4JVUA 1R46A 4U3HA 4JO2L 5BUAA 2K3HA 3K74B 1MZZA 3ZHSA 2AXJA 1XH3B 3KHQA 1TEYA 3RU8L 5D7IF 1Z5LA 4GW5A 1VFBA 5B1BB 4PJ0Z 4KDTC 3CHXA 5F7UA 1JI1A 4ZAKD 3N9GL 3JARA 4NKDA 5EF2A 4AEHH 1HNZO 1MQKL 4B3EA 6FABH 1CF1A 4HBNA 2QKAA 5K1PA 1D6VH 3DXAA 3PE9A 2R23A 5JVDB 2J21A 3C87A 4KJWD 1W0WA 4CILA 1JXDA 4JPVH 1K8IA 4E5XA 4HD5A 2Y7QA 4QHMB 4C4KT 2H41A 1X5MA 2VAJA 2KL6A 4H13B 4WI9A 4UAOC 4ZZKA 6CGTA 2FX7L 5KBPA 4JO3H 3T1FA 2AK4E 4J1UB 4RDQF 1W0VA 1T2JA 2ZYHA 4KNTA 3AG3C 4UV4H 4YPJA 1CLCA 4BELD 2E7LA 5BMFL 5ICZA 3ORJA 3GB7C 1P53A 4ZS7H 3QJFA 3LKQB 1P7HL 1ZLUH 3BAEH 1I8LC 1PG7L 4EJ1C 4F58L 2HG5B 2N7AA 2C4FU 3GRWA 4G70B 2HMID 1QATA 4XP4L 1ZLWK 2G2RA 1XIWD 1J9CT 3V6OC 4MXQC 5BS0B 3H7BB 1QWHA 3QAQA 1BAGA 4DGYL 2ZWZA 1BZDA 1OP5H 1XBRA 3VW3L 4PJCF 4NZTL 5SWZD 1S9VB 4OLUL 1FIEA 3Q01A 1QTYT 4N20A 1EAPA 3H6AA 3OW2U 8FABA 2EVHA 4FLYA 4RIRA 4XBPA 2EE0A 2YD9A 3KAAA 3PUCA 3H85A 3G5XA 4QIRA 3K8MA 4KJWC 2OPCA 4G8AC 3GKZA 5C09E 2A6DB 1RJYB 5AENA 4DN4L 3NCYP 1HCVA 4QNPE 2APBA 2ZUQB 3D36A 3BZFB 2ZONA 3LZOA 4PY7B 4OKVA 5K33A 1JNJA 3O65A 1D5NA 3CDGA 4O2AB 3G04B 3OAYH 3SD5A 2NXYB 4XHQA 3CZLA 4W4OC 1QO3B 4TPRL 3T0EA 4BGDA 5JW3L 4FHBD 1HZLA 5EIBC 3L4WA 2P5PA 4R26L 4OGAC 3CCJV 4EI5A 3JV0A 3VD0A 3MJ7A 5EBMA 4FIPC 1KTDB 4BRVA 4XCFH 4GS7C 3DV6B 2VL4A 3CFBA 5IJKA 2WXLA 4CN6A 3LV3B 3WO4B 5D96C 4RQEA 1S9KC 2JF1A 2YJLA 4QOKD 3SB3A 2EKSA 4JVPA 5I1AA 5D6CB 1BQZA 3NACL 1X5FA 3NTCH 3K8LA 5DQJA 3APMA 1IBYA 2F4VO 2H8PA 3SPGA 1O75A 4S1QH 1KKDA 4BAYA 1KDIA 1ZHKB 2VISA 1E2ZA 4W9LC 1S5HA 3B77A 4PJBF 5IYBO 3D33A 5JIPA 3TNMA 2WTPA 4OAWB 2DWEB 4PRBA 3QFDA 4TN9A 4P23B 3OAUL 4OKDA 1TSHA 1Q38A 2DEXX 2Y3AA 4ZXBA 1MIMH 3W39A 2G5BB 3QO1A 4JN1L 4XOCA 3HG1B 1INDL 1A9BB 3KS0J 1IAIH 4TUKH 4LNUA 3FB8B 2JIXB 2JVDA 5AYUH 4MWFB 4DUVA 2VLRA 1LQSR 4GSDH 4ENEC 4IHOB 5DJ0A 4BSVB 3UZVA 4F80A 5J6HA 1X9LA 3GHPA 3BJLA 4JAVA 1CGSH 3BP5A 3IFXA 5ESQB 4QXGH 3I9GL 4LF3A 1HQ4B 3KMDA 4HJ0D 1GN3A 5E2UL 5HVWA 5KHGA 3CFCL 4F7EA 2B0SH 4PS4L 1SQXH 1TUEB 5DMKB 4XH2B 4TTGA 4JHZA 2H0JA 2P44B 4IOFC 4R4BB 4Z7WA 3MXWH 2JI2A 3KPRB 2Q0ZX 3DVNB 1HCYA 2JH2A 2RBLA 3EJQA 1AR5A 2Z4QB 1A6ZA 2VUYA 3DHJA 2HSIA 3K04A 4RAUA 3APQA 2ATKA 8CGTA 2CM6A 3KPRD 4FI7A 4OZIF 3KPNB 1I8MB 3V2AR 1FGNH 1FO0B 1IM9A 1L3WA 2VDPL 5EIIG 1OHHG 3SPVB 1A7OH 5AAWA 4JTCB 5H37G 4WI2A 4XX1G 2IAAC 3FOMA 3VWKC 5ISZE 3U83A 3TN0B 1KU9A 3ARBD 1HN1A 5IMOA 4OZIB 1LO5B 4K9JA 4TS6A 5HYSA 1H3UA 3PREA 1BEXA 4PYGA 5FYJU 3HI6H 3HMXL 4X80H 3SDXE 1OB0A 5IJBC 4UDTB 3K0YA 3GMMA 5DYOB 3B4SA 5FYKU 1OE2A 4WEMB 1NEZG 4PJFE 4A6YH 2B3IA 2D0GA 5ANMB 2F54D 1WC7A 3DRTB 2X40A 3K6SA 4XC1L 5IFAL 2XOKG 4JB9L 5IEHB 1F2XK 2ZTBA 4F27A 3KH3A 2YPKA 2WLKA 1QLNA 3T08A 4CGUB 4GQPH 4ZS6C 5ILTL 2YI9A 5IGXL 5HDLA 5JUEL 1A6TB 2FCBA 2IAMA 1BHAA 5E51A 1RUAH 1DLHB 3T4AC 1UEYA 5I75B 5D72H 4ODVL 3ZDYB 1O9ZA 3C6SB 1BP3B 3OZ9L 5B1NA 1NGQH 2R4RH 3LIZH 5HYJB 1E4XH 3VGGA 4NQED 2CRMA 5LBSH 3ABLC 2EDQA 4J3OG 1ZSDB 1R6NA 3K06A 3GZOA 4R7XA 4JANB 2VM9A 4O4JB 3NN8B 4YX2L 3ULVF 1OGSA 3NH7L 3X3GH 3G80A 3P4OB 3LQMA 5D2NB 2IOMA 1EDQA 2J6EL 5F9WC 4A5UB 1HH9A 3U1QA 4ELMF 2NZIA 3KR3H 2PETA 1RZJC 4U1KB 5BQ7A 1MCOL 4XP1H 4UDUA 3CSXA 1RM1C 4M9OA 2CIKB 3MRNB 4H0GA 4NKMB 1UT9A 2VLJE 4EN3B 2PCFB 3KLAB 1CZ8L 1FL3B 3AITA 5HY9B 4HJSA 2QLVB 3TF4A 1Q9LA 4PV8B 5AW0B 1VQPV 2MTAA 1P49A 1N0LB 4NB5A 2NSQA 3TH3T 1X5IA 2CU9A 1TR7A 3L5XH 4K23L 3K5MA 4JHWH 2YAOA 4YK4B 3EYQD 2CE6A 1FVDB 4DV4O 2ZZUT 4NO3A 5IESL 5ABAA 5CU5A 3PJSB 1W6LA 4KY1H 2WLLA 5ES4B 1RV6X 2GSGB 1ASOA 5CMAB 1WP6A 3H4FA 4X9QA 3VOUA 3CV5A 2GJPA 5F72S 5L2KB 4DVBA 1KULA 2V7NA 3N2KB 3ASOB 2KLRA 3UJTH 3VXME 2M8XA 4S2SA 5HDOA 3H1IH 4AT6A 5FO9B 2YMXH 3S36L 1HNWB 3J8F7 3EXJA 3AU1A 5L4MA 2FH8A 4RX4D 4GO9A 3W9DB 2O5XH 2H3XC 1HILB 4UNVA 3T0WA 3WCYA 2F5AH 3VCLA 1ML0A 1PZ5A 3EF7A 3V4VL 4LLQA 5AW4B 3BQUB 2UU9O 4M7LT 4A2LA 4ZUTB 1B0WA 1RURL 5EOCH 2V9QA 1R24B 2EO7A 3ZTJG 5D72L 1NC4B 3CSYA 5KOMC 4AQ1B 5CN3A 3FH5A 4P49A 1S5IH 2Z5UA 2AMGA 1SXCA 1IM3D 1MIEL 3K2IA 4DWHA 1QLFB 2JCCB 5K9QG 4QRUA 1IIIA 1U2CA 1BZ9B 4APQC 1AGEB 3FAVB 3WXVL 3KD4A 1GL4B 2XG5A 1DVTA 2JKJA 4H44C 4OJFH 1V10A 3UTQB 1HKFA 4PD4K 4CNIB 2FWOB 1AGCA 2W5PA 3V5DA 1F0LA 3A67H 3NUKA 1ZY9A 2UUBB 3BWUF 3IFOB 4PGCB 2ADPA 4XP1L 3QAZC 5LDUA 3ZW3A 4WTWA 1FXKC 1PTZA 3GXNA 4NGHL 2LQRA 2IH8A 3DRQA 1VFOA 4ONGH 2EEBA 5E8PB 3OLGA 4WNQB 1OTSD 1AP2B 2R2HA 2EDHA 3L5WA 3P0YL 2XT1B 4QHNB 2CTPA 2P5WD 4R0LC 2Q8VA 1JGEB 2J57A 2R1YA 4QTHA 1IQWH 2OSLB 3TCTA 4A7UA 1NDGB 5I15L 2IWEA 4MVZA 1C5BL 2R9IA 4PJAB 1QTPA 4KKQA 4GX0A 4NAQA 2YGQA 3JT0A 5DS8A 1MIML 4Z7OB 2NYYD 4W4LA 2CJUH 4HZLA 5KVFE 1CLYL 1SF5A 2EQDA 3DUUB 3OAZH 2ISDA 3S37H 4JO1H 1NBZA 2QMJA 1G4RA 2ZWLT 1XGYL 4QRBA 4I1NB 2AHZA 3HKDB 1WRFA 1X5GA 5JYLA 1Y76A 3UO3A 3FOLA 4NRXB 5EBMC 3WD5L 4WFBV 4X5WA 1AQMA 4EI5C 1G6RA 4P4RA 5C6PB 4LCCC 1A1NB 3GTVA 3T0EC 1OEZW 1WWBX 3DMMD 3QIBA 5MEQA 1H38A 4J42A 3PWLA 4RISH 4XP5H 5E2UH 3N44B 1IKFH 3CBRA 5I18H 2LU7A 3DX0A 4KRPB 5DVOA 1R5VB 4QUOA 4AEEA 5I0WA 3FX7A 1QHPA 3CWBH 4XPFL 1BM7A 1OWWA 5EC1A 1JBJA 3SY6A 5FW8A 1FZKA 1BFOB 4IJ3C 3ZQWA 4ABVA 3IWVA 4YSAA 2JNZA 4XX1E 5JXAH 1LM8V 1J9TA 2MCG1 3NT0A 3P32A 4BWAA 1JCVA 5B7FA 3PV7A 2HFEA 4L9LB 1AQKL 2QTEA 3OB0H 5T5NF 1A6UL 1J1XL 2R2CA 4M6MH 4W70A 4X7CC 5FAAA 1BXXA 2COQA 5F7YC 1AXTH 4ZQKB 4BUGA 5JZ7C 2WZAA 4GBXC 2D3NA 25C8H 4DR5B 1CDUA 4YK4C 5CINL 3HN5A 4LF4B 4JFOA 4WHTA 1XNRB 5GGSY 2EDOA 4XNAA 2VLLA 4ASUG 1YEEL 3SYAA 2E7LC 5F9OH 1BGXL 2IJIA 2JKXA 3ZUNC 3LQAH 4NO5B 1G7LA 3LKOA 1ZGLP 5ECJE 2ZPKH 4JPKH 1V9PA 5KYUB 1QUNB 2NX5A 5J06A 4K8XA 3NIDB 4KXRA 1I9EA 4TNWK 3ISWA 3O4LA 4NO2B 4NQEE 1TQTA 1QBBA 1KCUL 3ZYIA 3U7WL 3N43F 3ZDWA 1QI5A 1G5AA 3NGBB 4M7ZB 2EVGA 4EFBA 3KDMA 4QY8A 2EXWC 1JTTA 5EC2C 2HUEA 1KPUA 3CFDA 3GSVA 1ITCA 5D7LE 5SV3A 3EYQC 3T8XB 4W6YB 3O6ML 3N43B 4FYTA 4OZGA 3FUNA 4IRJD 4JZOB 1AIFB 5T1LA 3T2NL 3NMEA 2G5RA 2Y6SC 4K55A 5LXGH 2WO2B 3IFPA 1WE5A 1ZV5A 4NFDA 5KS9B 5MHSE 5BRZE 2EDTA 1UXMA 5B22A 5F9AC 3FB7A 3WTXA 2BHFA 5C6TH 5EO9B 1H8NA 3QUXB 3OSKA 2FDBP 2KUTA 2COVD 6FABL 3AEIA 1QX1A 2O4EA 3A4DA 3RWCA 2GV9A 3MFFA 3QZNA 4L9DA 3RJOA 5GS2H 1ZTXH 2VDOL 4C54A 4KNUA 2QADC 1S7UA 4MAYC 4R7CA 1P4RA 1KJVB 2YFOA 3ATFA 5TGBB 3VRLE 4OI8A 1CFVL 4GW1A 2R69H 1OARH 2QSQA 3QCTH 1T4KA 2NNCA 2Y1AA 4Y19A 3X14B 4JUSA 5A2FA 3LB6D 3CJHA 1IB5A 1ZKAA 3BP4B 1JX9A 5EPMB 4CU8A 4R97B 3NRQA 3OMZA 3NCBB 3H1JH 4ABMA 2AEQH 2OJZL 4GX1A 3FAXA 5IM7B 5JHDA 1TJGL 2NSMA 1PZ3A 2MNUA 4RFEA 1JVOA 3CFJB 3HZVA 5C0FB 2YEVA 4OSUL 4PRPA 5DRNB 3QP3A 2VQTA 4Z3HA 2H3NB 4AK2A 2PP9A 4R2GC 5FKAA 5AW8B 3NPZB 3VVWA 4LSSL 4LF8B 1UM4L 3DHPA 1EAQA 2ALWA 5F6HI 1P84F 1NMBH 4F7CA 3MR9B 4XPHH 4M8QA 2G75B 4CRPA 5CR1A 3MRDA 1UWXH 3MRRB 3AJ7A 4X6DF 3IF1B 3NIGF 1X4YA 2QKCA 2EULA 4AQZA 1CTMA 4B9JA 4NQXB 4ZKIA 1QSEA 1RPQA 1I3RB 2WIIB 5CJ5A 5BJTB 3H2WA 1NEZA 3GK8L 2GY7B 5HDQL 5HDBF 4BK4A 1NBMG 4TV9A 1HXMB 5CFAA 4Y5VB 4X89A 1YRKA 3HI6L 4IEFB 4N2NA 4X6BB 5JIQA 5C8JB 2BSCA 2IVFC 3KLQA 1UKTA 3EF4A 5INCA 2H3KA 4XN4A 3STBA 2C5DC 1JVLA 3T0DA 4DO4A 3QEHB 3LKRA 1HHKA 2X7LA 1NUFA 3ZN6A 1OPGH 3BT2L 4Q56A 4XNQA 3CN3A 1AJ7L 3DDFA 2NQCA 4XAWL 5HGGS 1DBAH 1OTTC 1KCVH 3UTOA 2QSCL 3CVHB 3QHZH 5J9PB 3WL9A 2ADYA 2ZXBA 3SJBC 3L4CA 4FQIL 1GAXA 4PRHB 1QR1B 2YQ3A 5EC2A 2DTSA 3ETBF 3F58L 4I18C 2XDHA 4RBPH 1CL7H 1PAZA 1HR0O 4PJCA 2ZX9A 2GJ6E 3VD9A 1FNFA 4HWZA 2XWJA 3KHOA 4MVMA 1CE6A 3C6LC 4CUCA 5I28A 1EHLH 3OLDA 4HKXB 1MF2H 2CO3A 1U8CA 4TVPE 3WKNA 4Q4EA 2WD0A 1TUPA 4AGPA 3K5LA 3SN6N 3POCA 4DYLA 4WY7L 3GKWL 4DXWA 4G7VL 3RYHA 2ZKHL 1UOWA 5GQBA 4ATTA 3FKSG 5C0AD 3QYCA 1LILA 4Z3EA 4FMKA 3KPLA 1CGSL 1DQML 4M3KB 1Q43A 2JJWA 4IBSA 3QNYA 1Q90A 4L1SA 3TYFB 1A65A 5D5QA 2E0PA 2BSKB 1SFHA 4G11A 1HHIA 4X9YA 1FN4A 3QEGH 1YEIH 3UZQB 5IK3B 3BDBA 2FB4H 4GNKB 4K0OA 5DD1H 5GISH 3VXRA 5I6MA 1KB9J 1IAIL 1QPKA 3QNFA 3QS3A 1SJEA 3TZVA 1MREL 1EEUA 3GIZH 3M1BB 3QNXB 4PD4J 5C09D 4EDXA 4O51A 3WY4A 2W0KA 5CGYC 3KGRA 3RUGA 1J5CA 4RAIA 3B56A 4YXLL 3T3MB 3EGXA 5IJVA 3EW3B 5AW3B 3GWJA 1A2YB 1FYJA 2WINA 2LHAA 3C5ZA 1A0QL 3L2NA 3GF8A 2IGTA 3WN6A 3EOTH 3SDCC 3EHBC 5T1MA 3D7PA 2YRLA 5ANHA 4UUJA 4RRPA 4F1SA 2OWOA 2HT3C 4DZ8A 2OYKA 3NDZE 2WXIA 5MEPB 2UZIL 3LNHA 4XMPH 4YDIL 3L5JA 1JFHA 2MRYA 4QT5A 1GZQB 1YNLL 43C9B 5L7XL 4H37A 1LEKB 2NY3C 2VLKA 1IC0A 3ARRA 1GW6A 1CT8B 2XZQH 1U97A 2ZM6O 3BUBA 4PDRA 1C5DA 1GH7A 4FGMA 4HBCH 4HWNA 4IRJC 1T0MB 3SE8L 1IVLA 1ZLEA 3CC7V 4JZJB 1PD1A 3HOGA 4N1EA 3ZE2F 3CHOA 3VYPA 2ZIOA 4DERA 1P1VA 4S0TD 3VFUB 1H2KA 3PHQA 1I1AC 4MD4A 2MHAA 2QPSA 1UXWA 1ZWIB 3ABZA 1XD0A 3IKCA 3TBWB 2XKSA 3FXIC 4ZOLA 4NQEB 1CFBA 1EZVX 4JZ2A 5SWZA 3H9VA 3L72H 3U0ZA 5J13C 4YJ2B 4E42A 3PP3K 2YS8A 2ITCB 4XOBA 4JFHD 4R7NA 1RMFL 4GLRI 5T5NG 1UQSB 2P3YA 1NKOA 4MJ6A 1H5BC 1JWMA 4JFPB 5JR1H 4DP6X 5IEKA 5CU9A 2RQ6A 2X4NA 1SA0A 4PJ5D 3WEBA 1Q6UA 1JYNA 4P46D 1XQ4A 3R0NA 5DHEA 4L3EE 3CDZA 1QLRA 3EYFB 4X6EA 1TENA 5GRJH 3N27A 5BZWA 4X8AA 2BVPB 4ZODA 2QJ1A 3LXCA 5DM6V 1IFHL 4UB0L 2IDTA 1RUMH 3L95B 3P11H 3GRWL 5AAPA 2Z8WC 3NCJL 4AOFA 3F5TA 2HLFC 2D3JA 2DJ4A 3B2MA 2IH1A 5C9JB 2YSSA 4LOVA 1U9KA 1M7DA 4HK0A 1I1FB 2RMKB 2UWEA 2BTQA 5ITZA 4JUTA 5D2LA 2AJVH 5FYLD 4HK3J 1UZ6F 4MNGE 4WFFE 2A0LA 2OTWB 5D5MB 1Q72L 2I5YH 4QOKA 5GSRB 5T1DH 3EFDH 3SZ6A 5IVXE 3Q6FB 5I1KL 2YMTA 3OSVA 2CGYA 4F8PA 3NIFB 3R65A 5DJDB 5MEND 4JI1O 4PCSA 3FYIB 1ORQA 3BKJL 3GSNL 4YUEH 1JPSH 2F19H 5IQ9A 1OAQL 2LQTA 4PU2A 1J0HA 1FQ9C 3JQOB 3RFZC 5I5JA 1N67A 3CSPA 3MRGB 3DIVA 3GJFA 1TEGA 4LSDA 4V2BA 2IXQB 2J1KA 1IGIH 4EUPA 1YUKB 2WOYA 2NXZC 4HOXA 2GK0B 1EQWA 3MGTA 5FO7B 2E27H 1BLNA 3VE0B 4M5YH 1RK0A 3NESA 1CBJA 4YHPB 1L9PA 5GIRB 1DQLL 3X13A 2L04A 2WPDG 1ADQL 3Q9PA 1AJPA 4PHZA 4QE9A 1KLFA 3GMLB 4M3HA 5AG9A 1V3JA 4MDIB 4U6TA 4Q9QH 3O3DB 5DJ2B 1UATA 3SDYH 3QZPA 5BW7C 3BHBA 3KW8A 4JR9H 1XGUB 1SQVH 1KBHA 2AXGA 2F8VA 1D6EB 2YMOA 5DDHB 2OZ4H 3F04A 4G6JL 1BMGA 3VRJB 3VD1A 4NZDA 4ZUWA 4P2OB 2FVNA 1T89A 4LT7A 2CSPA 3II2A 3VM7A 5LOVB 1XL4A 5D96B 1O7DE 5SWZE 1U3HC 4L4TD 4O4YL 3EH1A 2GB2A 3MRQB 4PJHA 4ODUB 4U6HA 1ZLVH 4O4IB 1OK0A 5CLWA 4NPYB 2Y2TA 2QTOA 1SJXA 4B3SO 5B5EZ 4JRXA 4MMXC 2EBOA 3FNKA 1HZHH 4HCRA 5JO5A 1K8DB 1QRND 3G6JA 4HYOA 1SN2A 3DTXB 2BOLA 12E8H 3V4PH 2FIRT 2Y0IA 3BH9B 5JDSA 1MREH 1YEDB 3AG2B 1B3QA 3WJMA 1A7PL 4RESB 4Q6IA 5I6XC 4XPGH 1NCDL 2VT0A 3BGMB 3CAFA 3GZKA 2R9AA 1BM3H 4HETA 3T1YB 4HPOH 3HBPA 4OLYH 3S98A 1YJ9V 3ESOA 1JL8A 2CLRA 2QQLL 2AJZB 5GZNA 2GJRA 5J5EA 3ZIYA 3FCSB 4UVCA 5I76A 2BSEA 1INDH 4LH7A 4N87A 1PG7X 2CH8A 3CG8A 4PGDB 4MZRA 4ODHH 4A68A 1XV8A 3WUWA 1MCPH 4FQPA 4XWGL 4OQ1A 1W0YT 1VQNV 4Q9BA 1EAOA 4WU5A 4MXQD 4R6UA 2BSED 4ZO9A 2M6YA 3IMSA 1EFXB 2FLRT 4NSKB 5T1KD 5JR1L 1YYLH 3DX3A 4B60A 3GS4A 3HIZA 4UQ9A 1KLGB 1QSFE 2P80D 4JN2B 5LN4A 1IE5A 4Z7VA 2XPGB 3QIUB 2HFTA 4JAMA 1SBBA 3K71A 4YHLH 4G8GA 1S7SB 5I5RA 3AQXA 4I9WD 5ECGA 3GXTA 4HKZB 1CGUA 1F4XL 1YLBB 3SOTA 4QRFA 4AENA 3CQFA 3UPRB 4JFDD 1MVUB 5HHPA 3HMXA 1UG9A 3ZZ1A 1T3FA 1DEDA 2HJKB 2LGNA 2VDLH 3WMQA 1HSBB 1NCIA 5LQBH 3II3A 3IGFA 4E41A 1AANA 4PJFA 4NN7C 4FQQA 1DANT 4BE5A 4DP4X 4ZDHA 1K72A 1YNTB 2KDYA 1EEZB 5BVJB 1OP9A 3O0RL 5CEXA 3O41A 4M61B 3NCMA 3JASB 4A2HA 4WU7B 4BWWA 3DXAD 4ABUA 2EDEA 3H1KH 1ZGLB 1LO4H 3DO3A 5GGTL 5IG7A 3GD1C 4OCWH 1UWYA 2WKOA 5EU6B 4G80B 2JI3A 2ZP0T 2FK9A 3ETQA 1DVQA 2VABB 3F05A 3ZHVA 2HVBA 2F2HA 3FRUA 3G9AB 4Y4KB 1GN4A 4N4YB 4XPHL 1OCRC 2BCCH 3IBEA 5EHFA 5ITBH 5C0RH 1TZIA 2AW2A 4PV9A 2OMZB 2UYLB 2FYUH 1GW0A 3QWNA 2AXFB 4FZ1A 4PJGE 43CAB 4GKKB 4K71B 3U1SL 5C07D 4ZMQA 1JF1A 2VN6A 2VLME 4Q9CA 3HG5A 2FSEA 3EH2A 3CRCA 1FL6B 4NN6C 4F5CA 2YGPA 4H20L 1NCGA 1R1CA 3KPMB 3SDDB 4FHKA 4YQXL 2YN5A 3P2BA 1T83C 5C0CB 5JOFB 4G7SB 4NXMB 1PBYA 4MJID 4YNYA 5LGJB 3DIDA 4LLMA 4POZC 1NFDB 4PTTB 2XA8L 2GQHA 5CIPA 2JKTM 4OLWL 3MV01 5ESAA 2EEAA 1A64A 5EZJB 3P0GB 5ICYB 2H32A 3ESNA 1OAYL 3B09A 4RQFA 1RK1B 1AGBB 2H8PC 2J43A 2D2CC 4QAMB 3BO8B 1SHSA 5GS1C 1IAKB 1E6OH 1KLUA 1VAHA 1F4YH 3BPNC 2YAFA 3DX7A 1NJIW 3MUGB 4OGQC 4TUKL 3RURA 1MRDL 1YECL 2N59A 1P5UB 4LMQI 4QXWA 4LEOA 1G7QB 5DHYB 2I69A 5DK2A 2XT9A 3QORB 3JTSB 5C6TL 2EIJB 3RFRA 1B0GA 1DE4A 2ZNJA 1T21B 1X5LA 2A9ML 3H3KA 4TSBH 4YEFA 1N5YL 2NR6D 3QHTC 5T3XH 4AYFB 2Z6FA 2ZCLL 3EGSA 3F7YC 1LE5A 1WT5C 4OUUA 1LDPH 2PMZA 3DBXA 3HW7A 5J7CC 2FR4A 5DUBA 4UINL 4JYYA 2OCHA 1JERA 1GKOA 2CO4A 4QPKA 2PR4H 1AGFB 4U1JA 2JIZG 3IJ7A 4P2RE 3WXWH 3K7UA 4XVSL 2OMTB 1AZUA 4X88A 3DARA 4GI9A 1BE3H 2V6HA 1ED3A 2OLDA 3NCCB 4PBDA 4I3RL 4MKMA 3UTTB 2ARWA 4PR5A 5E6UB 4PJAF 1ZVHA 4HQQH 3EDEA 3ZOAA 2PO6C 3K9SA 5JLZA 2YC1B 2XPZA 4PYHA 2WWKT 1CLOH 2EDRA 3T0AA 5KSAD 5AVUB 5IW1B 2HJDA 1AO7B 4X1IA 5I1EL 2FRGP 2XV2A 4ICGA 4NPJA 2BOBA 5IB3B 2EP6A 2ARJA 2A74C 3ETDA 1NUDA 4ZTPL 5L2KE 2W59A 1OTUD 3VXRD 4KXCA 2YA0A 2ZUWA 4UU9A 5KSAA 1INEH 1WBZB 2XVLA 3RB7A 3RJDA 5DJAA 1JE6A 1WFJA 4XCYB 3QQ4A 4R9HA 4LF6O 5IVXB 4HLZH 5EIIB 4PCKA 3QO0A 2CH7B 2HX8A 1PAMA 4FXLA 4LLWA 4Z7WF 4JYAO 3VFMB 3O9WD 3FFDA 1OCZB 4JVWA 2XZCL 3ZK0A 1FFQA 4B0MB 5LWYH 4AMKH 3DXRA 3N2GA 2WAQA 3HBZA 4PRDB 4GP5B 4A6YA 4X98A 2EINC 4I48B 3MV8E 4KZCA 4OB5L 3WKMH 1WFIA 5T5FH 4P06A 3V0DA 3PPSA 2DQTL 3TIDA 4AQYO 2JJUA 3E3QE 2VR4A 5AL0A 3CQQA 5K39B 1FLTX 2R9HD 1TYJA 4M4RA 4IDJL 2B1IA 2W0FB 2AAAA 4KROD 3VI3A 3UIZA 1PP9H 2KMWA 2G38A 1DVUA 2ALAA 4PJXA 3LD8B 2B1GA 5KYWB 2LP7A 4ZFZA 4NKIL 4KV5F 3U1SH 1I1CA 4GT7A 1TVKB 4BIZA 2VL5A 4EKWA 4JM4H 1HYRC 4TVPL 5TDOA 5AZ2H 1A7BA 3DJSA 2GUZA 3MBEA 3WKPA 1JJ2U 3X3FL 3S9DB 3C8KB 3EADA 5KG9A 4PG2A 1QNMA 3ILDA 3QDJA 3QJRB 2FL4A 3VD7A 1L8DA 3WMPA 2A9DA 3TPUB 1SNRA 3AB0C 4Z0XA 3QC5X 3U2IA 4Y7MA 2OTUB 3JARB 4NKDB 3STZC 4UMGA 5ILTH 1GSMA 3LH9A 1JD9A 3RA7L 5C09B 4JO8A 1X59A 1IGCL 1ZUQA 4HX1A 2XTJE 3VD4A 3MNDA 1Y0LA 4HAGA 4ELKB 3NBNA 3AM8A 4MD5B 4RDQG 4J8QA 1R3LB 5JOPE 3B8NA 1K2DA 3GIZL 4L18A 1AAJA 3MDSA 4FQJH 4JLRB 4WNJA 1M53A 2WTRB 2WXJA 1IFGA 2I9LA 1C16A 1I9RH 4DV7O 2UUCO 1Z2KA 4NO0B 3UO8B 4HIEB 3FF8A 2CJTA 1NPUA 4MVBC 2F4VB 2R51A 3FFCD 3JAMN 3FCTB 4OV6F 1P4BL 3DX2A 4J3WA 4NQVB 1E8YA 1N9PA 1SM3L 1TJIL 1UVQB 2MOQA 5FHAH 2MCMA 3QNZB 1BQLL 3OM3B 3RPKA 4K8ZA 1B6UA 1ACYH 1FL5A 3SJVE 1CD1A 1NLBH 1BVLA 4LFAO 5I1HL 2J8UA 4JI0O 3D06A 3KW7A 4OJDH 4BSWB 3BLPX 1LDPL 4X6FB 1U3JA 5A2BA 1KKCA 2OR9L 1Z6JT 2OYQA 2EABA 4LHUB 4FEIA 4P5KB 4YL9A 3NR7A 3H7BA 3I3EA 5F0LB 2DMGA 2Q8BL 4XMLH 2P8LA 4HH8A 2I9TB 4HUXB 4HKBA 4TUOB 4D9LL 3MHZA 4PG9A 3JWNG 1A7NH 2J12B 5BOJA 5DQDH 5ID0A 3V0GA 4KOBA 1FFOB 2WP3T 3QUYA 2WVVA 2VR3A 1RUQH 1QWNA 1RJYA 4GXUM 2DLFL 4OD3L 3STLA 4MA7H 3UKMA 4FQHB 2BWIA 1CLOL 1JXJA 1E4WL 2JIXD 4PLKD 3OGIB 3QUYD 4DGVH 1DQJA 3K72A 2K6WA 3UJTL 3O6FA 4ZUUA 2NLJA 1XFPA 2C1OA 1JA8A 2FO4B 1K5NB 4HA1A 1TTRA 5ITBL 4PRPD 3DOIA 5MEOB 4U6VL 1KYAA 4ENED 5LHHA 4OW6A 1WBYA 3HE6B 2F5BH 4IU2A 2DB8A 1JHTB 2NUPA 2V5YA 4FNSA 4EIZC 2O5ZH 4PA7A 4J27A 4O4YH 1U96A 1CFSB 5FUZL 2VW4A 3ABKB 2N1KA 3BCFA 4ZFOA 4P2YA 1KXTB 1CL7L 2CJUL 1N6UA 2AHYA 5IBUB 4RMVA 4DT2A 2HXAA 5DRZA 5A16B 3VFRB 3P30H 4N9GB 1I9JH 5L6YL 1C5BH 2BE3A 5D6CA 2DY2A 5E94B 2CR0A 4BH7B 2FJHA 1Q0EA 4F7KA 5HSFA 2CCVA 1YQVL 2VXVH 3SKNA 3L9EA 4OZHF 4JHBA 1EO7A 2VISB 4NZUL 5D7HA 5DJYB 5L0QB 4Y1AB 3E6HB 3RL1B 2YICA 1NSNH 5EFIB 1A4JB 4QNPF 1XF3B 2HLFD 4FQ1H 1TIUA 3BQVA 2EC9T 4NENA 1F6AB 1MAJA 4PRBB 4LWSA 2KPNA 2Q5BA 4DZBA 2VDNL 4FMTA 3TA3B 1UHVA 2QZ5A 3QCTL 2GBTA 3KBEA 5KJRL 5KTEH 1NCCL 4NNPL 2QR4A 1F1DA 1T6WA 1G6RH 3IFLL 5C0EB 2E4FA 1S7TA 4KTGA 1FE8L 2ZXWC 2X6VA 4PY8J 2P8MA 2IH3B 5I0YA 1S7RB 1X7TA 4YIQA 1G1OA 5JPMA 2A38A 5DFAA 4MXVF 1OCCB 4KUMA 1CPYA 1RFDL 4O2CB 4QHUA 3GIVB 5EORL 2FQFA 1FZMA 3UCRA 3LEYH 3Q1EA 2X7RB 3HC3H 1DDHA 3EGDA 3LZPA 1AVMA 3CIQA 5FK9B 4KGLA 5CWSA 5KYXB 2ZNIA 5KSBB 3ZLQC 1W72A 5IJ9B 2WZ6A 2CLVA 4NTYA 2A1WH 2F68X 3AADB 4KQ3L 2EYSB 4LCYB 2E46A 4XAKD 4NN7B 1H5BB 4OCMC 1QQCA 1PLCA 1J87A 3IT8D 3K1DA 3FO1B 1S3JA 1LEIA 1QR9A 5B1CA 5HHXL 3WNKA 3ZDXB 3EBAA 1YDPA 2NY6B 2IQ9H 2R1WB 1SPDA 3FOMB 5AG2A 2ARJQ 2LTQC 4L2YA 5JW5B 1I1AB 1JPGA 3SE6A 1UOVA 1BXAA 2MMXA 4W4NA 4WHCA 4OI7A 4AMKL 3IFNL 3O9WB 3AXIA 1LP9F 3EBGA 1UD4A 3C12A 4LOEA 2Y24A 3G6BA 4PRIA 4WW2A 2RD0A 4UT9L 1YMHA 5DA0B 1BQRA 2IEPA 5E7FA 1RMFH 5LXGL 3MBWB 3LZLA 2AI0L 1LP9B 5INDA 1WC7B 3T2LA 4QRTA 4K8RH 4CJ0A 2X10A 1KV3A 1H3PL 4I89A 1ILSA 3DETD 1J1PL 4L0YA 2DJSA 3KVDD 3TBSA 2PF4E 1BD2D 4WEUD 1ECZA 4YHHO 3FSZA 3G5ZA 3FCGA 3QEQB 2J1ZA 3RVTC 1XSIA 3Q2LA 1DLHA 5L8JB 1HSAB 4M7JL 4XCFL 2Z3FA 3DOSB 4KL1A 4P5RA 5DFTA 1B0RA 1E8WA 4YJ3B 2Z92B 4KAQH 1S3RA 3Q2CA 1JSYA 4XBGB 1T1ZB 3MSPA 5DR5H 5E9AA 4EQ3A 3SPJA 2ZKHH 4HISA 2XTJB 2E5LO 2BRRH 3TFBA 2F1AA 4XN2A 1J10A 3PQYE 2HT4D 4MX7A 4IK7A 5H6RA 5DO2D 5FDYA 2ETNA 1I7ZA 3LKPB 3ZKXC 3UAEA 2UU9B 4IGBC 1TEFA 3E8UH 3G08B 1DJGA 4MZ2A 1KGUA 4ES9A 1OOAA 3GSWA 3MVSA 4CSPA 3RB5A 1BECA 3U0PA 2JJVA 3Q5YA 3TJEH 3WEMA 2NY0B 3O45B 5H5NA 3UP6A 5B7MA 4OFDA 4N90D 3S37X 4KK8D 1HR0B 1QPXA 4WRLA 5IMMA 4LHJB 2EDKA 1BJMA 3BAAA 3RKDD 3WY1A 1U8OB 3TIEA 4KK6D 3Q8CA 2Y06H 3DLQR 3BIKB 3OKLB 4WO4C 2ZNXA 1LP9E 1PMYA 2FBJL 4WKZA 1U58A 1UXSB 4UM9B 5J89A 2AXTZ 1UENA 5C0GB 2YBGA 4FA7B 2UXBO 3QUZA 4XO9A 1DK1A 3NJKA 4HMEA 3QVNA 3LH2L 4LHUG 3BN9C 5D5MF 3E22B 5B3SB 1FVDA 1WJ3A 1OP3K 4JI5O 2OI9C 3TWCH 3VFGL 3KPQA 5LXVA 2X1QA 4I18B 1QHTA 5DO8A 5AWNH 2IMMA 1SJVA 4JRFA 1CFVH 1ADQH 2DTMH 3IDIB 5IE9A 3FRPA 4B5EA 5JIDA 1A4BA 3OKDA 1HAUA 5A6LA 4MNHB 4KI5E 1G7PA 4IQHA 4EZMA 2YZ1A 2CTQA 2B59A 3JV5A 2DF3A 2B3RA 2PO6A 3FT3B 4TLSA 4CKVX 5EEVA 1OANA 2J8HA 3NJMA 4GRLB 3O2DA 1PNCA 4HULB 5JXEA 1JGDB 1RFDH 1S7WA 2GJZA 3KLHD 5DD6A 3KDPB 3C6EA 3CVHH 4WFGE 3QWOB 1EZUA 1H2SB 2D2OA 1BLIA 4XMUA 4ZBJA 3LSQA 1KFAL 4YR6B 3D4YA 1RIVH 4HKJB 4FJ6A 2H9GA 2JQZA 4FQIH 3VRIB 5EIVA 1GVIA 1SESA 3HS0A 1AJQA 2WZPA 4ZW5A 3CSYB 3ROOA 2VM4A 2DQDL 3IETB 5LCVH 3A21A 5EIQA 5TE6H 4LCUC 2OBGA 1PIFA 5E70A 1I7TB 3QS2A 4JO2H 4NHUA 4Q74A 3FQUB 3UDWC 3HNVL 1ETZB 3GHBH 3LDBC 1OP3H 1LO0H 2DD8L 2K6YA 4POZD 5FYLH 4XHJC 4XPGL 5CJQL 5GGQL 5EZLB 3JD3A 1B88A 2V2WA 1F6FB 2J1YA 3O8XB 5JQ6L 1VQ7V 4MCNA 3SPHA 1NWOA 2CGRL 3PHOA 35C8H 1FFNA 4RWYH 5C0IA 1NPJA 3U0TB 3EJRA 5C7XL 1RY7B 1GXEA 1RIHL 3P30L 2F7RA 5E4EC 1T0NB 3CHQA 5AEAA 4OM0L 1B6QA 5L0QC 3R06A 3BWAA 5IYCO 4CVXB 3SE4A 2VRQA 2BX5A 2XIBA 3V6OE 4YXLH 4CS2A 5C0DB 2J88H 4A63A 4E9LA 4WGWB 3IPEA 4GSXA 1NGXA 3NPSC 4FOMA 3OKNA 4IT5A 4BQ6A 3QGVA 2ZOWA 4JRYD 3SCMB 4UVBA 1Y76B 2YPLB 1T5WA 4NRXA 2DAVA 3UT5A 1E50A 3SGKC 1N7ML 4WY7H 2D03H 3EYUL 2AZ0A 4NGHH 1YEFL 4X6CE 5D7KE 4LLVB 4KHXL 1O6SA 4DV5O 2YPLD 1WAPA 2JCWA 3ALPA 2XKUA 2Q69A 5B39G 3D85A 4KPHH 1TVHB 4XCCH 3NCFB 4NYLB 2HA1A 3Q48A 2UX7A 4OJEH 4YLQT 4OBSA 1T04B 4DTGL 2X4QA 1IAMA 1QQDB 2B1OA 1XGTA 1YI2V 2FX9L 1E0OB 4G9FE 5KUKA 2F0CA 2P22C 4X2UA 3UABA 1FYHB 3KYMB 2Q7HA 2V17H 1GHFH 2TSAA 4F57H 3FTWA 1N0NA 3JTBA 4HCRL 4BIUA 4KZEH 5I1IL 3IGAC 5JH7A 2WLIA 2W81C 1JG9A 4HWUA 1FVCB 4QRRD 2EH7H 2R29A 3U30C 2K4AA 2E9WA 4MHHI 4I55A 1BDYA 3MV8A 1WAZA 5I1KH 3VFGH 1YNTF 5F9JB 1GJWA 2Q68A 3OE7G 3WFDL 3FO9B 1YY8B 2XHBA 2ZF8A 3E2HC 1UZGA 1ZTEA 5BS0D 3VQYA 1MOFA 3MRJA 3D87B 4K07A 4LOUC 1HI6A 5D4JA 5KVEE 3ISRA 4IKJA 4IRSD 5C93A 4LPCA 4ZTEA 2YR3A 1S9YB 3L3GA 2VMCA 1WAAE 3NCJH 2MW2B 2GEQA 5EEYA 5F1NA 1SDDB 5F2FA 1RLWA 2XC8A 3E6FB 3V55A 3IJYA 1W59A 1WNSA 1JHLL 2FEDD 1X9QA 2MCAA 1HP8A 3LSSA 1BX2A 3O4LB 5C8YB 3ZVVA 3QEUB 1ZLVK 3AGWA 1FH2A 4Z77B 3CPLA 3IXAB 5DYFA 4DGUA 5K5YA 2CO1A 4UQBA 4GCZA 3NFNA 4WUUE 3ZDZF 4O5LL 1MRFL 4YPGA 4ADIA 4A55A 1A21A 4HPYL 4YDKH 2OZ4L 4G6JH 4R2GD 2BP0A 1ZT7B 1EZSA 1E5UI 1QFWH 1YN7A 2DI7A 3NDYE 4KI5F 5E1GA 5ERWA 5T1LD 4J7RA 1AI5A 3I6LD 3WFHA 4P57A 1AHWB 1XHHA 3QJHA 1RSOB 1MCSA 1DN2A 3FTVA 1LO0L 2DD8H 4FQ1L 4YFLF 1BQHB 5AKSA 3Q6GL 1CI5A 5H4YA 4X50A 2PW2A 1JV5B 2IAMC 4LP4A 5K9OB 3EYSL 1XZ0A 4FFVD 1MCWM 4JFED 3A6CH 3BKYL 3BUYB 1FJGB 1KC5L 4AZUA 5DHXB 5DMYA 4PW3A 4D7PA 3TGUH 1QSED 2Z31D 4OGXL 4R90H 5TDPA 2P1YA 4FFZA 3BWUC 3GJFH 5BW7A 1RIVL 3OPZH 4F15B 3MROB 1YN6A 1VQ9V 3GBMH 1P7KB 4DEUA 2PPAA 2DLIA 4PJ8B 5I8CA 5BZDB 3RWFB 5I30H 1B3JA 3CFMA 4YXWG 1HNWO 1U8QB 3GSQB 3LB6C 5LGNA 2XWXA 3OHXB 4NQUA 4JY6A 1GC1L 1NINA 3S8FB 1XMOO 3ARPA 1VPOL 4ZUSB 5F6IC 3N04A 5MERA 2DBLL 1IBGL 2ZG1A 3RJQB 1KIPA 3L3KA 4TLTA 5F1KC 2D2CB 3ZMZA 4WWKC 5AWNL 3P0VH 4AZ8B 3F7YA 2H2PD 1XVSA 4ONHA 5JPMC 1KBPA 4NEHB 4MZIA 1ORQC 1UPGA 1H3XA 1WWAX 3QCVH 1SMDA 1WFUA 4OB5H 3MAQA 3I6GB 3V7AE 3WKML 4BFIB 1I3RA 4O02B 2PYLA 2VSDA 5D71L 4DW0A 1J8RA 3GBLA 2BNUA 3UZEC 4RGOH 1ACXA 2VDLL 1KBGL 4M62L 5DECA 2UY6B 5C0AA 3S5LG 5L2KD 1JZ6A 2ZCHL 4LEXL 4MJHA 3WFBH 4HCRH 2NZ9C 3W9EB 3VYOA 3ULUH 3DV4A 2JKLA 1QZNA 3M07A 3SYCA 1QFWI 2GCYB 4DKFL 4HG4J 3DROA 3U4EB 4F9LC 4KDWA 3NOIA 2B4CC 2G9HA 1WUNT 3HG1E 1GA2A 1JRHH 1Q6IA 1XWVA 2ZCKL 4ZXBD 5J9PA 3LEXA 3OB8A 5DZAA 5HHOA 2W9LA 1Q1JH 4JFZH 1OGAE 3F5WC 3FHEA 1LDSA 1MJUL 1QR4A 1USQA 3FTUA 3T77A 3NGBC 2BSSA 1OD9A 5HXMA 5BRZD 2CGRH 4JKPL 2YLHA 4RMWA 2J6EH 3ARZA 5D7IA 1BZ7B 1HINH 1XHXA 3PXHA 3TTYA 1DFBH 1HCZA 1SQMA 4R4FH 4Y2DC 1IAIM 5LGYA 4Z0BH 1XH3A 5F7LB 3K5OA 4HAKA 4HSAC 1PZCA 5LGTA 3L3HA 3FQWA 2BIOA 2MFNA 1AOHA 4G1EA 3TU6A 1NCDH 2E7BA 4YQXH 3M46A 2FD6L 2QTSA 3RTQC 1VZHA 4J6RH 2DWDC 2P8PA 3EOTL 1E27B 2D3VA 3OX8A 4KO5A 3RNQB 4MXVE 4JG1L 1B4RA 3F62A 3MC0A 1W0KG 5IJ0A 2X42A 1I1AD 2RMNA 3DMMC 3TEUA 3TNNA 1H15B 4JFDA 1NDTA 4WHDA 3J81N 1IQDA 2ZAIA 3FC8A 4Q2ZA 4X4XB 3UO1L 4KROC 1K5SA 1MHCB 2MKLC 4UMSA 3VA6A 3C8HA 5IP4A 2FLMA 5JQHC 1GGUA 3L4YA 3ZPDA 4FADA 3CCVV 2IPTL 4WHYH 5KS9E 1JNHA 3GQFA 3GNMH 1ODUA 5DK0B 3GINA 4JGJA 3S5YA 5EIBD 2WINB 1K85A 1R34A 3QJFB 2IF7A 4A39A 2OJZH 5JQGB 3WU1A 3E83A 5MP6L 4GRMB 1M05A 2HVKB 1UCBH 2OM5A 3V5HA 1GGIH 2GI0A 1LO2L 3HC0B 4LLDA 3JWDL 4AM0A 1U3ZA 4G9DB 4M3JA 1AD9B 5E00A 1GIGL 3JWNH 5FWQA 4KJYA 4GAYB 1ILUA 1DUZB 4Y19D 4QT5B 5FR3A 2I60L 2JKNA 3B3IB 1NICA 5BNXD 1CTOA 5D1XC 1S7XA 1J8SA 1IGMH 3EH5B 1S5IL 1VIBA 1BHGA 2ZWNA 2H47C 1Q5OA 4OFYA 5TF1L 3V6OA 5M94B 4JRYE 3EHBD 1PIGA 4LF9O 4MSWB 5AW1B 4WFHE 1SEBA 5JPNA 2XG4A 4XHJD 1KXHA 1DZ0A 1QFOA 2AFNA 3DXAE 1U2YA 2ZNWA 3CFUA 5GXBB 1PDKA 5KSUB 5CP3A 5I16A 1MCJA 1ZWIA 3TBWA 3RVZA 1U8LB 5HGAA 3G04A 2NY1B 3FMGH 4NQEA 1IURA 3Q9QA 3OTFA 4X64B 3OWRA 1QO3A 2AJUL 4N2BA 2ITCA 5DS2A 4TWKA 3DO4A 4JFDE 5KLVH 4X9FA 1JHLH 5IW3A 4HAMA 3B9KC 4Z7UE 4LGPB 5IBUG 2KSDA 3TT3L 5DMIL 1YF2A 1V55C 5FYLL 2F95B 3IMVA 4OFPA 3DV6A 4YDMA 2IJJA 1GH6A 2Y1ZA 1NTDA 2IC2A 3LV3A 2P5WE 2KKWA 1CXZB 3EO0B 4DAGL 1T89C 2VQ4A 4XZUA 5FA4A 1N33O 2Z35A 4DJMA 2R7EB 3LN5B 1REIA 1T1XA 3L7EB 5EU7E 3D18B 1TOXA 1NFAA 1I8UA 2LFEA 2DZEA 2ZCKH 4K3AA 3VWJB 2Z8RA 3PABB 5F7FA 3SYPA 5HYJE 1XGRA 1DF5A 1UWEL 5B3SC 5IROA 7FABL 1AZRA 4TQPA 4Y1AE 4Y5YA 3H53A 3BSHA 1DSFH 2DQMA 2DM3A 3WDJA 3WTWA 4E9TA 1OAKH 2WWMD 3DUSA 5I9QC 1NAMH 4GUOA 5DJDA 4FTVB 2VITA 3NJNA 4QYOB 4G3YL 3MNWA 1OM3L 3CCRV 1RSFA 2VLRB 4LASL 4M8VA 5FYKL 1EHXA 3MJ9L 1BQ5A 3WU2Z 2YQBA 5LWYL 4NZ8A 5DLMH 1JZFA 4FFWC 5B38A 3HKBB 4IIJA 1KNOB 2KG7B 4Z7UB 1NIBA 2IM9A 1ZS8A 4WO4D 3UTSB 4LDOB 1KXQE 3MLYL 5DMKA 4LVOB 3MV9E 1H9DA 3E1ZA 4XXWC 4ZFOL 3VXSD 3UO1H 3ZT6A 3AQZA 1FFTB 4B97A 1Z66A 1GAFH 5FLUA 1U3YA 1E4KA 3CUPB 1Q1JL 3QI9C 4JFZL 2AJSL 2Z4QA 3QJZA 5GGVH 3F6IA 1WD8A 5HYSG 1CFTB 1I53A 3KWUA 3SJCC 4PA3A 1NEPA 1IM9B 1RU9L 3RN4A 2NXZD 3PIQB 4G6AC 1QNIA 4GYBA 4IBYA 3SKOB 3VRJA 3L2LA 5IVZA 4RGNC 1NGZA 2JJSA 3W0WA 4V1DB 2VOTA 1HKLH 5CZXD 1N59B 2HH0L 1E90A 1O0VA 4G83A 3FB7C 1U36A 2GTWB 3C2AL 5J6GB 1VMGA 2AK4D 4PJHB 2YIBA 4P9HC 2GIXA 1KYDA 2IANB 3H54A 3X12A 5CBFA 4PBWD 2QZQA 3KPSA 2YK1L 2PCPB 3LXAA 3TN0D 3QA3B 4M7JH 3BP7B 1K8DA 3G6JB 3MNZA 3SBWC 1E42A 3EYOB 4YGAB 3TONA 3MX0B 1QEWB 2WVUA 1XBDA 1H0DA 2CAKA 1PJWA 1K34A 1AB3A 2F7QA 2JELH 3N1GC 1YCIA 5JJEB 1KTKE 1Q94B 2QEJA 2XKNA 4K3DL 4XP6L 2JEUA 3HC4L 3QULB 4FFVC 1BD2E 4RLDA 1YMMD 2XWBB 5DJ8A 4PS4H 1NQBA 4MCMA 1I9IH 4HU2A 3DTUB 1LMIA 1E1RG 2O5YH 4I3SL 4NCC2 3U6XS 1M5IA 4O4LB 4YHHB 1A7RL 1W72L 1A6AA 3C09B 3NJIA 4TLUA 3RKPA 2EUZA 3EJUA 1K9TA 2FATL 1JOIA 1XF5B 4PGJA 4D0DA 2WUBL 3JALA 1QSFA 3HG4A 2GY5A 2BVQA