1P4RA

Crystal structure of human atic in complex with folate-based inhibitor bw1540u88ud
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
589
structure length
589
Chain Sequence
b'GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 215
structure length 589
sequence length 589
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1p4rA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1p4rA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA02
1PKXA 4A1OA 2B1GA 4EHIA 2B1IA 1CE8A 2YVQA 1OZ0A 2IU0A 1M6VA 1VMDA 1B93A 1A9XA 1WO8A 1P4RA 2X8WA 2XW6A 1C3OA 1S8AA 5H3LA 1ZCZA 1EGHA 3ZZMA 1T36A 2IU3A 1S89A 1C30A 1JDBB 1IK4A 1BXRA 1KEEA 1G8MA 1THZA 1CS0A 1PL0A 1M9NA
chains in the Genus database with same CATH superfamily
1SOAA 2L0XA 1XC7A 1Z7BA 5BMVB 3REOA 1EBOA 1NL3A 4YV0A 1H8HD 2LBPA 4GM1A 2HEPA 2J8ZA 2Z57A 4OQEA 1KQNA 1QDLB 2RGNA 3BH0A 4GGOA 5EBMC 3KRTA 1USVA 1UOEA 2F1HA 2VWQA 1FF9A 3GXOA 3D3IA 4Q20A 3WL5A 3HNRA 3ZHBA 4J94A 4WCFA 3CSSA 1K9VF 3GDHA 3VR6A 3UYLA 5JAHA 2AEMA 4TQ9A 3TZ6A 1XREA 2FRDA 3LDEA 3Q2OA 3A26A 1FVHA 1GN8A 2NU8B 5FI1B 2X0KA 5E1DA 2B69A 1KVSA 3OQHA 1EGQA 1DC3A 2LW7A 3CCMV 3GBPA 4FI3F 1C1DB 4JUDX 1CUUA 1HNXB 3I62A 3BJMA 2VDKB 4UJ5A 4D9BA 5K0JA 1E60A 5AJYA 2ZNIA 2CJYA 4LYAA 4BIIA 2RGAA 1KZGB 4E5NA 2PWYA 4PANA 1G60A 3PFBA 3IC7A 5C9ZA 4M1MA 4ZHQF 1SVWA 2ZWOA 1JG6A 2PD3A 1RYHA 3DH1A 4DBLE 2PJRA 4YR7A 1RLIA 5FPYA 5C53B 2PKQO 3FNRA 2AKEA 1DO2A 4G27B 2SKDA 2QR2A 3DPSA 1NQXA 3HPQA 3JZFA 1OY1A 3U4DA 4Z49A 3BMCA 4QDTA 5G3ZA 1QLWA 5EHQA 3K09C 2X9NA 4Y6RA 2JI6A 1W2WB 5IM4A 2V45A 1UDBA 3B6JA 3HV0A 5ARCA 1MOPA 4ZT7A 5IDYA 2X9VA 2AYZA 1IZ8A 4JI2B 3CXRA 2R7AA 1GKIA 2ZYTX 4JI4B 3OEEG 3RLFA 1EFVA 3T3PB 3B8HA 4NVRA 2N0SA 1R4MA 4AXBA 4JZ2A 5BPHA 1WF3A 4YWJA 3BWYA 2R00A 2W90A 4DK0A 1C2TA 1N2EA 4G5FA 4QNHB 2CV1A 4B9EA 4NMHA 1MCZA 5F1PA 1KR2A 3ICEA 4DCVA 3QVXA 3EOAI 2AR7A 2EV9A 4FNAA 1DCTA 3LUCA 2QWPB 4KDCA 4XVHA 2Z04A 1RPTA 2XRZA 4QELA 3VMFA 2NX8A 3VNSA 2GT1A 2EJRA 1RD4A 3E0QA 5LBIA 4DA7A 5EG5A 1XCBA 1AE1A 3A1EA 1XZNA 2B3ZA 2F3QA 1ZQ9A 3GGJA 2NSLA 1P0PA 4A8JB 2QAGB 1OA0A 4K6HA 1DRJA 1KR5A 2QD5A 5TF4A 3PK0A 4J0DA 2G1KA 1CVLA 1YQQA 1LB1B 3RQSA 1ZP6A 3V1YA 2ZD9A 2GAFA 1RIIA 1D6NA 1KJYA 3NAMA 4CM5A 3AVWA 3LQRA 3O0DA 4PFQA 1WXFA 4KVFA 2XDQB 1QK3A 5D2CA 2V3VA 3FZQA 3I2HA 1DPGA 4NAVA 1OYVA 2QRUA 3R0XA 4V3BA 1TAHA 4L75A 4QG3A 4PLWA 5KSYA 3HJUA 3V7FA 1QH1B 4B84A 4MR8B 4PCAA 1D6SA 3C1OA 2Q7DA 1PK8A 4IYJA 3NQ41 3ZWQA 4CS3A 1PS0A 3RN4A 2I8AA 1SKMA 4UEKA 3HO8A 4JXEA 4ZVVA 3TW0A 3Q4GA 2VL7A 5DT2A 5EZYA 2GPYA 4N41A 1W19A 4EUKA 4B3IA 2UYOA 3B6EA 5LR6A 1SRQA 3RTGA 1FLNA 1N6HA 5DDIP 1PSDA 3D6VA 1S76D 1R6VA 3TG2A 3IAXA 1U3CA 2HJVA 3JTMA 2ETNA 1NBIA 3LG2A 4D5EA 4GD3Q 1OPXA 2X7XA 3KLBA 5IT5A 4HRXA 2RKOA 2QB5A 1GR1A 5LC1A 2Y0DA 1HZZA 2QMOA 4YLEA 2OTJV 2CXHA 3E61A 4IIYA 4X8LA 3HWWA 1VJ5A 3PDCA 3USZA 1VKOA 3CF0A 3KTOA 3QKRA 1AROP 3ZEIA 4PQFA 4NBUA 2Q7EA 3L9DA 4N7BA 2W11A 2KWIA 3BMXA 3K58A 2ORWA 4KZKA 3AY0A 5F9FA 4YJ3A 4NB5A 1AGNA 8LDHA 2Z6QA 2E3JA 4V02A 4OLFA 2BMDA 4HZUA 5CLGA 4I4TB 2FMUA 5FPHA 1VE7A 4B2LA 1X2EA 1EDEA 1M2FA 4OU4A 2PIAA 5BR4A 3CCVV 3EG9B 3QVGB 3ZPXA 2XY4A 3E48A 3UPUA 2XMBA 4B6QA 3M6MD 2GN6A 1MAVA 2Y4TA 3NT4A 4QUEA 1GEEA 3E23A 3TE6A 4JBHA 4V0KA 3MXOA 5DYNA 3DOIA 1H22A 4IVQA 3HJAA 4RE5A 1SUIA 3ETGA 3F4KA 1XHLA 3CLVA 1I6LA 5I7EA 3B8NA 4IUDS 4BBZA 2W83A 2I0FA 1HT0A 4PDMA 3ISVA 3MJRA 2PH5A 4FLFA 4WOCA 5ALZA 1QKKA 3JQRA 3H2SA 1MUUA 3I6BA 4TS9A 3A6FA 4TMZA 2O7QA 3FAKA 5U4QA 1PHRA 3CQ9A 1R6KA 1P84F 5FBQB 2P87A 4HTAA 4M88A 4LFBO 1Q3TA 4C7VA 4E46A 1E3WA 5K6TA 3K94A 4ZDJA 4FLVA 4N39A 2XBLA 1NVVQ 1VE1A 2R96A 4AVYA 4JI8O 3KTDA 4BZZA 3HQ4O 3LUFA 3H1FA 3AR9A 4FSHA 1MB3A 4KK3A 3R7SA 4J80A 3ZG6A 1OAOC 3BULA 1TAGA 5D84A 5EBWC 4GX0A 4IQFA 2DTXA 1MVLA 1KXZA 2R6FA 4IH1A 2IP1A 3WFJA 2PANA 5TS3A 5ICSA 2PGGA 4P7BA 2H2IA 1QGAA 3P19A 5FF9A 4HQ6A 4MITA 2BE3A 4DLLA 2VZLA 2PW9A 1KDYA 4R05A 4PZAA 5KVCA 4L9WA 5IAAA 2GI4A 2AVDA 1VLQA 1RC0A 3OLQA 2P27A 4RVFA 3QNUA 4IMIB 3HJFA 3WBFA 2AGAA 2ZYGA 1UDCA 2HR1A 4C21A 1GYPA 3V8MA 2AFIB 2QSAA 2VPWA 3T5TA 4XUDA 4D7TA 5JALA 2AG1A 3LLVA 2CXQA 1IUKA 4EW1A 1I0LA 4BVBA 4EELA 4QPNA 1DXYA 2PGOA 3DMDA 4WX2B 3G9ZA 2OV1A 3SEZA 3TQOA 2XODA 3A4MA 4O2BA 2HXGA 4BQEA 3ZWBA 4PG6A 4A10A 1S2LA 1H0KA 1G8SA 1KQPA 2WZDA 3C98A 3G2JA 1OGYA 2I2WA 3L0PA 4QPCA 1GZ3A 3C90A 3EX7C 1QCCA 2C5HA 1LBEA 4JQYA 1XALA 3S44A 1G59A 5LYJA 3GJTA 3EUEA 2AR9A 4E2YA 2E4WA 1LVHA 4DNXA 1NBOA 3PC8C 3R3WA 1CK4A 1NKSA 3LZ6A 3UWOA 4DQUA 3QE3A 5KB3A 4QSMA 1XG5A 3M6WA 4YRMA 3U81A 1A5TA 3EZGA 1AH2A 3K79A 3TTYA 1IY1A 4YRZA 4HD8A 4MA5A 3WWYA 1A7KA 5IKXA 4HN9A 3EZLA 5IARA 4JJZA 4XX0B 4BB9A 2X8LA 1KP3A 1X8XA 3E5HA 1NF3A 4YHHO 3IEIA 1ZJWA 2DHEA 3EZ7A 4XUGB 2BGUA 1YE5A 1H6DA 1HYBA 1QLEB 3GFTA 4V0LA 4YLYA 3ADOA 4PYJA 4C0JA 4B48A 5E4FA 3URKA 5EE3A 1Y48E 4UFZA 5C1PA 4DQLA 4Y1EA 1V6AA 2DB3A 1M33A 1YH3A 3TDMA 3C16C 3KJGA 1Y80A 3IKVA 4X92A 4MV0A 3C8HA 1IHDA 3FWYA 3IAFA 4B83A 2XGGA 3U7FB 3K6RA 3EWAA 3FMIA 2I2AA 2IP4A 5K3AA 5AM3A 4LWZA 4GLJA 1B8OA 2CNOA 3M7MX 1TT5A 4MQFB 1K98A 4QYIB 1VF6C 3WO0A 4HRWA 3M2PA 3FCUB 4Y67A 3VR4H 5FJIA 3VPAA 3DUFB 2D2XA 3OR7C 1DJQA 4P2BA 3G2PA 3OEYA 1QC5A 2WY2D 4RLSA 4XEUA 1RC8A 1PVOA 3OPVA 4ZEOA 4GYCB 1IXBA 3ZDYB 2W2PA 1SCNE 1YOBA 3DDWA 1UPGA 4BQPA 1QRDA 4OGGA 2AEEA 1JEDA 3EEOA 4N0QA 3UM9A 3ISJA 2G6VA 1TXGA 3RAEC 4NXMO 3EZNA 3B8MA 2Q4OA 1ZCBA 2GO7A 4KW7A 4QDJA 3QYAA 3ZBHA 2I2BA 1UWLA 1ONBA 3AVUA 3MM4A 2AT1A 4UCXA 2QRLA 1US8A 4EKGA 3AVQA 4KBYA 3UZUA 4CGYA 1YU9A 3APQA 3LW8A 4YDSA 2ETVA 1S96A 1AJQA 1LDBA 1E9FA 4UE3S 4DY4A 3ZE6A 1JHQA 1FX0A 1F7UA 5E7JA 2HA7A 1TUEB 4KXXA 2GTIA 2RAFA 1FTSA 1UDAA 1UMKA 5ALPA 5A02A 4YVFA 4Z1OA 1WBBA 4PVDA 3TW4A 4YO8A 3QF4A 2F8LA 1TYEB 2MINB 3C15C 1DMSA 4TN1A 4YRLA 1OPRA 2P2GA 3II6X 3NHZA 1FFYA 1BYUA 1POXA 5LXTF 2W2KA 2AXNA 3DVLA 3FNEA 2WJ4A 3WLTA 4MKZA 3EISA 3STWA 1PF7E 2QVGA 1X94A 3KSAC 3UEOA 1KI7A 2UXCB 3A4YA 3HZZA 4RCZA 4F7WA 3G8QA 2GJ9A 1L7XA 3ZS9A 3C87A 3SDLA 4TKVB 1N6OA 4V0ME 3U2QA 3GK3A 2CL5A 4KACA 2H5IA 1GSIA 2IOQA 1OJHA 4PYQA 3U1VA 3NC4A 1GN6A 1KOLA 3EGXA 1O6CA 3LUAA 5BWBA 5KEIA 3APOA 1I9CA 4QDKA 3EUAA 1B4DA 3AFNA 4LRQA 2FVYA 3V2IA 3JD0A 4HATA 5H9VA 1V8DA 3FTCA 3DMFA 2OBYA 1TIBA 3HMQA 1VJ1A 1HGXA 1UXHA 4AJPA 3UTDA 2PNFA 4ZA2A 4KFUA 4UCTA 2CMKA 4X5OA 1R3KC 3NBFA 2RDCA 5EKUA 3UATA 4DLBA 5LUBA 2EDAA 3K9NA 3HZOA 5F2VO 1VMGA 4CH4A 1CJKC 3C6BA 5E6RB 1XKTA 1VQPV 2MT9A 3DFMA 4ITRC 3L04A 3TL6A 4O5OA 3ILVA 5DK6A 1RPJA 3ZD9A 2CLLB 1QJ4A 4OPMA 5SZHB 4XUCA 4FZ1A 3G0HA 3SU8A 5H4GA 4DMMA 2SCUB 2WP0A 4LZZA 3AY7A 1DCKA 1XU7A 1WBJB 2NTYC 1UDXA 4TX1A 4EKEA 5DNCA 1UZMA 3B4SA 2CWDA 2QVXX 3F4BA 4A91A 2VQ6A 1H69A 4UDXX 3F0TA 2Z5LA 3JQFA 1X0VA 3JWGA 4IJVA 3M1AA 5DYWA 1RYNA 3C6KA 1YZKA 5ARBA 3VPCA 4LRYA 3NGMA 4AJOA 4Z3DA 4PBSA 1XZKA 1XILA 3G2MA 3MINA 1N2HA 2QP9X 3ESCA 4CMAA 4H33A 4P3NA 4Y9SA 4IF6A 3LUTB 1JT9A 4Y9TA 3CC4V 4W7IA 3SM9A 1HOTA 1DOAA 5IAJA 5CT6A 4JI3O 1Q3HA 1IBCA 1SCIA 1NW4A 4PHHA 4DF3A 4J0IA 1ZUD1 4LF5O 5D85A 3UT0A 1P6QA 3SHTA 3A6LA 4LF7B 1C9JA 3R65A 2QDKA 4WIAA 4GWLA 1FEZA 4A5SA 2ETXA 4OAPA 1P2FA 2O2HA 5E9QA 1E9EA 3I04M 4I8XA 1BRTA 1YL7A 4YV1A 5KSZA 2HSZA 2JA1A 4XIYA 1MIOA 2ZYWX 1NUQA 5FWYA 2EIMB 3U10A 1E0SA 4G36A 1W46A 4YIPA 2XUAA 4FB4A 4XVUA 4BQSA 3LUDA 4HADA 3PNMA 3G1UA 3KYCB 4Z0TA 5BSKA 2A5JA 3IFSA 3W3AA 3U7JA 4GUDA 4BLWA 2VJMB 5IYZF 4MLZA 2DPLA 4FMPA 3QVUA 5IZCA 4CM8B 1B0AA 2Z3YA 1QIEA 1D04A 4QGGA 5LGTA 4DV6B 2WIBA 1JR6A 2FB5A 4WEQA 1M8KA 2ADPA 5K0CA 2FDXA 4OWPA 5B1AB 2FPPB 3ANYB 3ZHSA 3TETA 2X8JB 3QHAA 5DM1A 4I3GA 2ZROA 4G5YA 2PH7A 3ABOB 4DQXA 5A2QN 4IHQA 2V0GA 2VWPA 2BFWA 2YY6A 1C8KA 1MHTA 3QVMA 4PO1A 3T12A 3SHOA 5F1KA 4BLQA 1FAFA 2QZJA 7REQA 3DDOA 4F5EA 3FPLA 5D1HA 3ONWA 1OWNA 3TLAA 1U3WA 3OTWA 2I4OA 2PGNA 3S7TA 3MMSA 2QENA 1QTRA 5LOVF 5K09A 1KZHA 2O7NA 3IAS1 3N53A 2Z9BA 2ZT9B 2ZTHA 3ZQKA 2EDCA 1WTAA 2XOEA 5EHIA 3UO3A 4Z9FA 2A3NA 5M3BA 2DW4A 1JA9A 4P5EA 5FBRB 1FXVA 2B7BA 2NVUA 3TRJA 1GPDG 3R0VA 2WICA 2YV3A 4L73A 3J80N 4CUZA 2PTHA 1SZJG 4CTKA 4EI8A 3W5SA 2PQ6A 1BDBA 4F3RA 2J0EA 3AHHA 2FL4A 4KFCA 3N5KA 4PQYA 2WJVA 1UBLS 4Q03A 1IZ7A 3CUSA 4OO3A 1O6BA 4IIUA 2QPTA 4D92A 1CUSA 1M1YA 1XQXA 5HUJA 1X9IA 3NU1A 5BVGA 1CUEA 4DV0O 3FUCA 5A5DA 4QFBA 1VQOV 2Q6LA 4FGSA 4K6FA 4YRDA 2Q68A 4KR9A 5JSQA 3SS9X 3OKAA 3LC0A 2FJUA 3EFHA 3NVAA 5J5AA 4QICA 4U8GA 5COBA 3KU4A 4XCVA 4URHA 4Q5IA 4DK1A 4EF5A 4YWHA 5L3DA 1FY2A 1CJTC 4MA4A 3CLKA 3WA6A 2NLOA 2AC2A 4JV5B 1JLLA 5LKAA 1HWYA 1FUEA 4XRGA 1EEHA 3FMPB 2YEVA 3WHLA 4ETIA 3PEEA 1BHAA 3W1WA 5ITSA 1YBFA 3ZQUA 3CW2A 5FO1A 3IE1A 1VBMA 3IKMB 3MAGA 1P4RA 4WW0A 4C7MA 1LUAA 3G88A 3LRPA 4KLCA 4NCAA 2Q1WA 4MKRA 4RVSA 2NU6A 3RHFA 3AOEC 3GO4A 1GL7A 3ASOC 1XMOO 3DDSA 2V4MA 3A4VA 2E89A 1IONA 1SN7A 1DO8A 5CYPA 1TAUA 2DBRA 4QOIA 3DDHA 4XTRA 1YFZA 1XCJA 3DE1X 4ZO9A 1XCLA 5F9HA 2VSQA 2UUAB 3QVTA 3D2AA 1FTNA 2YIBA 4GKKB 4C5CA 5IYCO 1IUNA 3PWTA 3PITA 4MS4B 1OZ0A 1T5LA 4IYRA 1VJCA 1TQHA 1V9SA 4RK0A 2IBTA 4FFSA 1NV9A 1CR4A 2QW8A 5KIAA 4L8GA 3N2KB 2XMCA 3BH6A 3F9RA 1VZ3A 3TOVA 4XTCS 2JFNA 1K8RA 3J7TA 1IN4A 2Q3BA 5HXAA 2IHYA 2PEZA 2BR4A 4L51A 3OSUA 3CEAA 3WB9A 1XMXA 1TEZA 1EUDB 2YX1A 4QUKA 2TMKA 2OG4A 4FMTA 3ANNA 3SJCA 1OLXA 4Q3LA 3PQFA 2CTWA 3OT1B 2VCHA 3DAPA 1IBMB 3CPEA 1VQ5V 4PDLA 1B6QA 3GLVA 1V41E 1KIMA 2C58A 3W7AA 4EG1A 3CT6A 4HY3A 5IAKA 1QQCA 2QTZA 3CISA 2G7ZA 3AF5A 1E58A 3H9JA 2W4IA 2Y2VA 4BNNA 1W0JD 2Q8NA 4ZOBA 4HAWA 2WT8A 2DUWA 3A1TA 3EPRA 1L8XA 4B3JA 1II0A 2HW8A 3ANMA 3F98A 4G65A 1NWHA 5JBIA 2GESA 2ZK7A 2QDXA 4B3TB 2JKYA 2VJCA 5JNTA 2J4DA 2P4HX 3SXUB 3IKTA 3L07A 3I2KA 2K2QB 1JVSA 5JXGA 1O5OA 5CHEA 3AR4A 1J2RA 4FK8A 4AIIA 4R8RA 4RPKA 2IH4A 1SUDA 2FMXA 3UC9A 4G2KA 2DYSC 2HZBA 4PC2A 4QUGA 1UKEA 2EYQA 1A9PA 3OCUA 1YBMA 1Q90D 1E6EA 4P4SB 4L9AA 1RABA 5G3YA 4PX3A 1XZCA 2AW3A 5FULA 3E9NA 4RFLA 3CPJB 4KIGA 4BOYA 2Y1KA 2ZDQA 3DHWC 3STLC 2X15A 4RL6A 2AFHA 4KBFA 2ASEA 3H17A 3X1KA 4ZO6A 1MO4A 1SZPA 5ULLA 1H2GA 3GAZA 2HMYB 2W4QA 2BFCA 2AJLI 3A9WA 2B1QA 1KJNA 1MAAA 4CL8A 2W6JD 1JR3D 1PFGA 4POAA 1P45A 1SGWA 5HQ3A 1UUFA 4GRIA 4M8IA 4U7PB 1QB7A 1N9GB 1KH3A 2H1WA 4EA9A 1RSOB 4BN4A 1O7JA 4XCXA 4A8TA 1R1BA 1EM8B 1F48A 1WSAA 3V7WA 5FUYA 5A6SA 2C61A 1EE9A 2ZUVA 5DM60 2P2SA 3TOXA 2DLCX 1QORA 1QPGA 1G2PA 2XNDG 2PBZA 1FDVA 2RBEA 1QYVA 4L2IA 3K4PA 3IOEA 4CS4A 1Z18A 3SX2A 3PJSK 2F4VB 3REQA 4JYAB 1E89A 3QI2A 3ROGA 2EF0A 2PMEA 1JTEA 1I6WA 4D8UA 4R16A 1I4WA 1KI4A 2RJZA 1UFQA 1U4NA 2Q1TA 4O4IA 4AO8A 3OIUA 4QM7A 2Q8PA 1MT3A 1XA3A 2WD9A 1JQBA 1WKQA 1MENA 4OK5A 3WWPA 1QIKA 3HN2A 3BRWD 1QV7A 1SEPA 1E3DA 4X66B 2J9RA 3KEFA 3NW9A 4LCNA 1DKOA 2NZVG 1N7JA 2E87A 3AVOA 1GUZA 2X8WA 3CSDA 4PG5A 3FNGA 5C46F 1ZOOA 5FR2A 4AF6A 1E5TA 4NKGB 2HRQA 4ZGBA 3SNHA 2UYGA 4MVXA 3MF4A 3EFEA 2QBYB 4YMVA 1D2RA 3H7AA 5JYBA 1ZJ4A 2FK7A 1BQ0A 2C7BA 2PKXA 5D01A 4GZ6A 1I3KA 4M0EA 1FMFA 1DQYA 2A94A 3I9V1 4LGMA 1JG1A 3GH3A 3M3PA 1S72V 3GA5A 4OSOA 3G5UA 4LF8B 3PIDA 3FGNA 1WULS 5CW6A 1ADBA 3NTQA 4EYSA 1N1MA 4LJ7A 3COWA 1ESNA 1RYBA 2EINC 1Y9JA 4PI2A 1V5FA 5GJWC 1Z15A 3VQWA 1COWA 1FP4A 2OV4A 4Y1RB 4UDOA 5BRJA 3I23A 4GT1A 1G4HA 4NAUA 2B3DA 2P0YA 1O97D 4C0WA 1EUYA 4AJLA 2WG1A 1S8NA 3QHQA 1R64A 3G0DA 1Q7TA 3REFA 2AOXA 2QWNB 2ZJ4A 1FYJA 2VSOA 3B78A 3HB3B 3B7PA 2EWMA 1BD4A 4ZAGA 3U0ZA 4BNXA 1DAKA 1L4HA 2XMZA 4I5FA 2YWDA 1XMQB 3O1LA 2QRKA 4NMLA 1J0CA 5FJJA 1WW3A 1WJZA 2HVVA 1VXOA 3A3KA 3VR3D 5HJEA 3QVWA 3K2BA 1N8SA 1SQXH 1XKXA 4RD1A 2J41A 2WAOA 1P1KA 4ED9A 3SKYA 2H0QA 3WZLA 3ND5A 1U4OA 3Q41A 1IN7A 4JR1A 2CW5A 3U4QA 4INPA 1EIWA 3FOWA 3IEMA 4IHKA 2M98A 3DBOB 4CFZA 3JAMA 1C0PA 3RAPR 3JYCA 4Q3CA 3I55V 5CA1F 2B7CA 5JNUA 1T8RA 3DV0B 3ZY6A 1O94A 3ZU5A 3KK0A 3U4AA 2CVQA 5T4HA 1MB9A 3T1YB 1GXSB 2OOKA 3MB8A 1QE3A 3DNPA 3I2FA 4CKWA 4KH1A 4BO0A 4FZ3A 2W6JG 2JW5A 3QEOA 3K3PA 2VJNA 1NPDA 2O0JA 3MWEA 4MYDA 3T5AA 2NZXA 2FSGA 1A3CA 5FO0A 1P7BA 3F7YC 2QY9A 2YOHA 4E15A 5FIUA 3CMEV 3MERA 2P69A 2I2FA 5I9IA 1WOMA 4N65A 1SUPA 2QTWB 2D6FA 3IPXA 4CCAA 2I7TA 2YWJA 1YIJV 4C6HA 5JD4A 4JVMA 4FX5A 2CJWB 3Q4HB 2C3MA 2RI1A 1RPRA 2O2XA 4QQ8A 1IZYA 2PUDA 2WVJA 2PSFA 1P6UA 4ROTA 2H11A 2NMVA 3CSXA 3ZCQA 4Q6GA 2V8BA 3EA0A 3QIAA 2P5SA 4RUFA 4ZAFA 3PC6A 2Y4OA 3IHLA 4IIBA 3GLKA 3GFBA 2A9QA 1EN6A 1WU7A 2P9BA 3K8YA 3K1YA 2TS1A 2B21A 3R3JA 4DXHA 3E35A 3CRVA 4XKJA 4K6CA 2Z5VA 1EINA 2VP4A 4TN5A 2D4AA 1PNQA 2Z4RA 5DLYA 3AL2A 4X91A 1HOXA 3Q7IA 3TLEA 1BWQA 3FRHA 1KH2A 3L0YA 1BXRB 3SJBA 5HIAA 2NT3A 4ZQEA 3FFBA 4LCJA 3NDBB 3LVFO 1Y5RA 2NVOA 3LSYA 4YX9A 4MSMA 1MABB 2RHLA 4U3JB 1U8UA 4A23A 1XD8A 4I5SA 4JI5B 1T8WA 1OVGA 2Y0CA 3LUKA 4M9CA 4MI9A 1UP6A 2CBGA 4OH1A 1LK7A 3LHIA 3CLUC 3QWBA 4L8FA 4CW7A 4HNTA 1WDWB 1VIYA 3W8DA 3NOQA 4ILEA 3F6EX 3F90A 5DM4A 4UBJA 4DUYB 3N3BC 3D3WA 3IIKA 5IDWA 4G5RA 1W2GA 4MSQA 3DGEA 2Z3HA 2YWRA 4XLZA 3J81A 4MWOA 2M6KA 2J5XA 1T29A 4X8MA 1QCEA 1P1RA 2XT6A 4OQLA 1SIBE 5DSTA 3ETEA 2WYVA 1RKBA 3CB4A 3GLGA 2CNLA 4OHVA 5KYTA 3IBYA 2Y1OA 2AI1A 2AW5A 1AHIA 3UKJA 4BVKA 1GRQA 1U99A 3GJ4A 3ZU2A 1AKRA 4DR2O 4KGZA 5CBPB 4CH6A 2WZBA 4J2OA 4PLGA 1ZSVA 2IHJA 5CK4A 3I5XA 3CJQA 4JYPA 3TEJA 2VJOA 1IC6A 1JLHA 4RQBA 3UMSA 5EEHA 2C7RA 2HADA 1R0KA 2GB4A 2C04A 3P2EA 1A9ZA 1HLPA 2YNMA 1B6SA 4QUDA 5KHGA 2J0UA 3ZW8A 5A4DA 4ME6A 3M4JA 2ODEA 3P30A 4N4AA 3FB5C 3UOGA 1YU6A 1B41A 3VYRB 5KNCA 2A6PA 1L4GA 2YUAA 2QTRA 2HRRA 5C5EA 2C77A 3RJTA 1FQOA 2VHJA 2ESRA 3FLBA 4FEEA 1Q22A 1SQSA 1F1JA 1H1DA 1U0GA 3N58A 2XITA 1QTQA 3K5LA 3EY4A 3EASA 1R6XA 3KOUA 4DR6B 3THWB 2VQDA 4YRIA 2BYTA 4IFIA 1XRLA 4MQEA 5BOSA 2VATA 4F9FA 3G1WA 2C9BA 4YMUA 3CC8A 1RXSA 5JI3E 5H6RA 5LP6A 4IZ6A 4YQEA 2AZMA 3RRNA 2OQIA 4RQTA 2XUKA 4R1NA 1RWOA 1U0NA 1LK5A 1CEXA 3FD8A 3DTTA 4WTOA 1MFZA 2IU0A 1I2CA 3T4ZA 3L7BA 1P2SA 5H3LA 4ECEA 2VYQA 3CF4G 4P3PA 3RSSA 1IJEA 5FPSA 3ZHVA 1XRQA 5D87A 4PA6A 5NULA 4FMCF 2ZBGA 2VHZA 3VHQA 4W63A 1SBCA 1KJQA 4TTPA 3SZLA 1UP7A 4S24A 1OXMA 2C5EA 3TUJC 1M34A 4WGGA 1K68A 4V0OA 4OHWA 3RFUA 4NULA 5DNUA 5E9WA 2YWCA 1PQYA 2FH5B 4ZQCB 4HJRA 1WXXA 2D3TA 2PU5A 2EZ4A 4AKTA 5BYJA 3DHVA 1LKZA 4B80A 1IXRC 3H86A 2DQYA 4NBRA 4GECA 2VDVE 2ZIEA 1RJWA 3I2JA 1NATA 3V00A 1AURA 1SQ0A 1ZCZA 2H1HA 1O4WA 4LCPA 4ZU3A 1JG7A 1ESEA 4GI2A 2M6LA 4TL9A 1VGQA 4BZXA 3KJHA 1GPMA 2WJGA 4JEUA 4JELA 2OK7A 1I94O 3DG9A 4HDSA 1QFSA 4HX5A 1I7DA 1WBDA 4YP1A 4BBAA 3HH8A 4OBXA 1JJFA 2VPXA 1N3LA 3LU1A 3REGA 3CHYA 3HRHA 1XTRA 2QJFA 3CPHA 1K1EA 1A27A 5DTJA 1TGVA 1ZHHA 4Q1VA 4DSTA 3I4FA 1Z6QA 2E4AA 4YY3B 4IHJA 3WMXA 3VGJA 1LSJA 5AVZA 3GJYA 1O1YA 3WAGA 1KU9A 5J1SB 1KECA 4P83A 2VP5A 5CAEB 4BBJA 3G17A 4IZOA 2E55A 2M1ZA 5GONB 2HXSA 5FOSA 3R7WB 3MTBA 3NOXA 2RE8A 4LNUA 3SYKA 3F1LA 1AT1A 1L5GB 2WJZB 3CZCA 4CT4B 4ARZA 4AQ7A 4WZAB 2BHNA 4CE6A 3DVAB 3EGDA 4GI3A 4XIIA 2C9YA 1H4VB 4C4TA 3IB3A 1X0XA 3AY3A 2LJ2A 5JYEA 1E7RA 1BSMA 5DW3A 1B3RA 3BE6A 1DOZA 4KKXB 1T3SA 3E1UA 2GZMA 1VMKA 4TYMA 1WB4A 1KVUA 4FOPA 4C1BA 3O83A 3QXJA 5T64A 3OZVA 5FADA 1NVGA 1R5TA 1P1FA 1NTKH 3VKHA 1SY7A 1U1CA 4YCBA 3IESA 2M6YA 3N5CA 4R3UC 3BTVA 5LZ5A 1NVWQ 4XM0A 3ZZMA 1Y37A 1WY7A 4KR3A 3R74A 5IYBO 3QTBA 4NDAA 2QSZA 2QRJA 2YW9A 3VR6H 2N05A 4Y9DA 1U81A 4RGYA 5C4MA 3SHQA 4WLUA 2Q0HA 3HS3A 1UKCA 1ZNWA 1M5RA 3MBKA 3AESB 2QTBA 2NM0A 4Q9NA 4JJAA 4IIGA 3JR3A 1Z12A 1ZD3A 4KC0A 3TR5A 4IY1A 3JQBC 5ESRA 3OOEA 5J58A 4G3XA 1B2LA 3WLAA 1BVRA 2BEVA 4B09A 4B3MB 2OT5A 4LQ4A 5MN5A 1AF2A 2ZSEA 1S3SA 3L6BA 3IJRA 3BXGA 2YXDA 3OTOB 1D2HA 5REQB 2XUOA 2KCQA 1KEWA 4AWBA 2RHGB 3FDZB 4C08A 2Q4RA 4H7EA 1N2GA 3K9WA 4B6RA 1L4LA 3K9SA 1EJ2A 3ZV6A 2IS4A 2YRFA 2UZ1A 4A0SA 4BYMA 3LIPA 3TSYA 4LJ8A 4LXYA 3V4ZA 4ZJPA 5TMEA 2F8SA 2LUOA 5CNMA 4CI9A 3H9UA 4DRZA 1NVPB 1HFKA 4J0JA 2PV0A 4G4SP 5FBVB 4CKEB 4QTTB 4M46A 3OE7A 4JXXA 3I5AA 3AHJA 4D0SA 2GK4A 4WLFA 2DBZA 3NBKA 4NENA 2IODA 4ZRDA 5LZ9A 4J6EA 3FMFA 4DSUA 3PWKA 7ABPA 3TS1A 2UUBO 2IYQA 4GBMA 3CIFA 2IUYA 5M7EA 3CF6R 3H16A 3H2KA 5DI3A 2KS6A 3AF0A 4YJFA 2BGNA 2QTNA 3ZWVA 4KODA 4MVZA 4J1TC 5HZKA 3WKBA 2PMWB 2QQGA 4NATA 2YFKA 3JPYA 3LDUA 2OGWA 1H8HG 1NVPD 5AFSA 3ZU4A 2P6PA 2Q73A 2I6SA 2BEKA 3TL2A 4E30A 2VG8A 3KR1A 4CIYA 3A31A 1JVBA 4TT3A 2PRJA 4LDRA 1S89A 5I7SA 1X7GA 5I48A 4MRVA 5AK6A 5L4NA 3JSLA 1FS5A 4BTVA 1FDSA 1KJZA 1Y8QB 2LZ0A 4NH4A 4DMHA 4E09A 2YJ6A 3O4JA 4F45A 4U5XA 4O2AF 2K1EA 2J1LA 1YE3A 1JHXA 2Q1XA 3KJXA 4B7ZA 1G2IA 2BHRA 1ZIOA 2G4VA 1YNOA 4EAAA 4ALKA 3WNQA 3TD9A 2JLBA 3CC7V 9LDBA 4M87A 3VPDA 4XDZA 1GLNA 5JTTA 4QTZA 5E6UA 5KPJA 2O4UX 3HJGA 3WDMA 2R97A 4CMIA 3GDOA 2WM3A 5IWAB 2NU7B 1XL1A 2GETA 3FWNA 3KWMA 1Q6HA 5E9JA 1F9AA 3GU3A 2AMFA 3AC0A 1AZSC 2Q4EA 3DZCA 1V39A 1JE0A 1B7GO 1ZD9A 5CG1A 1USWA 1D1QA 3IR6A 4EFDA 3ZY4A 1GQYA 1TGOA 2X1HA 2KYRA 4HNUA 1BH6A 3T06B 1R3DA 4IMPA 3P94A 3DEZA 1Z5NA 5EZQA 3BFPA 4I4LA 3BWBA 1Q7GA 2V0NA 3VKWA 3HADA 4RNDB 3AFHA 3L7IA 1T9BA 1KEPA 3CEPB 2YMQA 3QI7A 1QTIA 1T2AA 4K3AA 3OPYA 4LX0A 3MHTA 3DMTC 1WUJS 1D1PA 4RTMA 1G4AE 1PQPA 2XBUA 1FP2A 3ML0A 1IVYA 3HKDA 2FZVA 3E1KA 3BM5A 1G41A 3DFUA 4FM0A 5DHTA 4L8LA 4Q3OA 3UICA 4TUYB 3T7CA 4BO8A 4CG1A 5JZOA 3IQIX 1U6JA 3IP8A 1YKFA 4N3CA 2WA2A 4FILA 3IC5A 2HLDD 4DDTA 1P7CA 2H31A 4Y6PA 4CIXA 2GA9A 3B1FA 1YRHA 1JSCA 4XPIB 4KVAA 1J9GA 1Z4MA 2A92A 4YJ2F 2YMPA 5JJKA 2JGIA 1SOWA 5LZ4A 4UAUA 2OPHA 4BNWA 3UK6A 3ZHXA 1SOMA 3CCCA 3CS5A 3W5DA 4OX9O 5IUNC 3KVOA 3ILXA 5JDCA 5K05A 1G8KA 3UMVA 1JEYA 3TZKA 3HO1A 3ZI7A 4G41A 1YDFA 4HUTA 3BBPA 2CH7A 3S68A 2QG4A 5LA6A 1T2NA 2TMGA 3UC5A 1NASA 4CLOB 3RFCA 1Q21A 4IKOA 1X2BA 2NSJA 3C24A 4BEWA 3DUWA 4EH1A 1VG1A 1PWZA 3F3KA 3ABMB 2AC4A 2OAGA 2YUIA 4ENWA 4NICA 2NUTA 4C3UA 1VP9A 1VC2A 1TMYA 2WG0A 3ROXA 1ORHA 4DEYA 3T52A 1XD2B 2OQRA 2OB1A 1GGJA 4JL6A 2DC1A 1LLCA 4O33A 4J3FA 4M99A 1WKVA 1U7OA 3QU7A 1NT2B 3FPFA 1QFMA 2AZ0A 4FYJA 3IMEA 3FKQA 2FP4B 1NRJB 2FMTA 3OE1A 1UC9A 1Y76B 1RJDA 4UVAA 1EMDA 4B81A 4RUKA 4NCIA 1QKIA 3QELB 2DWQA 2ZR2A 2LCQA 4QBKA 1YR7A 3BKWA 3GOHA 3GBVA 4GU5A 3RRZA 1NBMA 2BUBA 3TGWA 2GM5A 2DR3A 5ITZA 4UDNA 2BBOA 4GZ5A 3KXLA 4JC5A 4MRPA 1QQTA 2AHYA 1QVRA 2PRYA 2G6BA 2WDPA 2XYPA 3TRKA 1GGMA 2QAIA 4RC9A 1BWSA 2Z2IA 4AZ3A 3NAQA 2R86A 4MX8A 3CONA 3DM9B 4KQCA 1NS1A 3NHSA 4ER5A 4RESA 3NIGB 3VR4D 2XAFA 4EEXA 3P9NA 4YK7A 4ABYA 1Z5ZA 4CIBA 1AM4D 2FI1A 3SXPA 4RTQA 5I7RA 3C6QA 4MGIR 3W8RA 4IOMA 4RENA 2QLTA 4ESEA 1POWA 4X45A 4ZCSA 1J8MF 2HT6A 4AJJA 2H5JA 4M1KA 1JHMA 4WFAV 4OB8A 4LSGA 1T0HB 5CP8A 4HBGA 3QPDA 1EI9A 5BN4B 3RVZA 2OXIA 4XBFA 5HUQA 5L7WA 1I0ZA 1HNWB 2XMGA 4KN9S 4Q7JB 3ZQJA 1KS2A 3HA3A 4OJKA 3GDGA 3UENA 2XYHA 1V96A 4GYJA 3E5MA 1PV2A 2R6CA 3IH5A 4CFYA 3FPEA 1OAKA 3WB1A 4PNPA 5LWQA 3ZNNA 3KEGA 3L92A 2D2FA 2GD6A 2VT2A 4ACAA 4PDVA 1O8BA 4MHTA 2F95B 2MJLA 4N21A 4LF9B 3M89A 1CVIA 3B48A 3IE0A 1TZKA 1KYVA 1QUFA 1NF2A 3IHTA 1Y7IA 1ZOIA 3TNDA 3JAWA 1JHUA 5FNVF 2YYAA 2ZXEA 1M57B 2ZS8A 2FQ1A 3IDSA 2YCLA 2R11A 1OLUB 4WE3A 4NBKA 4RLHA 4PC3A 2NOAA 3OQ6A 1WV1A 4KPFC 4JHLA 4YDRA 4I43B 2H08A 1EK1A 1KERA 3OZIA 2WFLA 4XR9A 2I1LA 4PRLA 1WN5A 1WHSB 2POCA 1YL5A 1HI9A 2I5PO 2FFQA 4RD4A 2LFSA 2PY6A 3UMMA 2NP7A 2BH2A 3CKLA 4QJ4A 2NXCA 2RG7A 3MJVA 4R2JA 3TSCA 2HLDG 2I4RA 3CU5A 5E2IA 3T54A 5E4JA 2AXEA 5E3JA 3VNVA 4NCNA 1S5HC 2FOLA 3IDAA 2FAXA 3B3QA 5LNK6 3U3RA 1J95A 2BFDA 3GLHE 5LB4A 4Q4AA 1R27A 5FI0B 4HAXA 5F76A 1BDIA 5C8YB 3ROFA 4GHWA 2X5NA 3Q8WA 4MVJF 1DEAA 4EG4A 2IHKA 4CV2A 3EHDA 4EVIA 4DXAA 3PFGA 3DLTA 2CE7A 1Q86W 2QWXA 3DW3X 3N8KA 4RADA 3ZVRA 4B34A 2QTOA 3WE7A 4G0ZA 3RC2A 1GPH1 1II8B 2VFAA 1KRXA 1VDZA 3GCGA 4P92A 2YV1A 1MJFA 4XVQA 3TKLA 2YINC 3D8TA 2VDUE 1ZITA 5FPPA 1F0KA 2AS0A 5ALGA 2YZKA 1KE1A 4FDUA 1Q83A 3OIVA 4Z9XA 1V54B 5EZ5A 3S55A 2W6PA 4CKZA 5KYYA 1XZFA 3RSZA 5HS6A 4DNOA 2BTQB 1MGOA 4MT8A 1DVRA 5H5JA 3M3DA 1EBFA 4QO8A 4MMYB 2QMYA 2Z3GA 2Z8YA 3WBBA 1R0RE 5CCDA 2Y4UA 4LSMA 1JILA 1PT7A 4PZZA 2ZQZA 3WG7C 2YKGA 4ZTUB 1P73A 3UB3A 3B1WA 4BVJA 2DWEC 3M9WA 3R3SA 1AIPA 2HDOA 4WLNA 1ZGCA 4DNFA 1HC7A 2KW5A 2VWGA 1E9VA 4NJMA 3NHKA 5K8LA 4BQOA 3ZBQA 4JI1O 1MQ8B 1ZCFA 3TPZA 1Q74A 2FGKA 3FHTA 1G6KA 3MUOA 2BGMA 5T57A 2XQFA 1CHNA 3Q9SA 1BL8A 4XLTA 1WHTA 1YB4A 2ZJ5A 3BXXA 5EA2A 4B45A 3VNRA 5AH0A 3BE5A 3K92A 3VV2A 2XWQA 1Q1EA 4BDSA 2W6QA 1HE4A 3PPWA 5A04A 1EU1A 4E2WA 4FX2A 3ONVA 1D07A 1ECCA 1KMIY 5D7NA 3RS7A 5HM8A 3F96A 1M9NA 1FOEB 3C3AA 3BEOA 3MGBA 3K73O 1OKKA 4RIIA 2BVNA 1GITA 3VU1A 4JGBA 3RVJA 4PSCA 1J20A 3EVDA 5IVKA 3VAAA 1ID8A 3L6EA 3ZV7A 1T1RA 2D59A 5H16A 2WUDA 1XTSA 1RIFA 1XSEA 1KETA 2IZ1A 1JU9A 2WF9A 1JNXX 3RRFA 1PR9A 3VSDA 4GMKA 1R3LC 1AA6A 4QHYA 1XNQB 3CINA 1TPZA 3AVXA 3CZPA 5ECWA 3ND8A 5DI9A 4EATA 4CLHA 1KI1A 2FW0A 1W35A 3OZRA 2D1FA 2WUVA 2B1GA 4D9NA 1VHDA 2GK6A 3JWHA 1UPTA 1XJQA 4HXFB 1MB0A 2A30A 3Q3CA 2DOKA 3B1YA 2MK3A 3E83A 4M0MA 3OA0A 2B1JA 4NPCA 4ND8A 1JLSA 1AD2A 2OORA 4FMDF 3LI2A 4RMGA 4ZQIA 2HCJB 1NY6A 4JROA 3ORQA 1AQ6A 1MX5A 1X9GA 1EK2A 2OYRA 3ZI0A 2OAP1 5CT4A 4I9UA 3A1NA 1L7OA 4FM9A 1DKLA 5IHXA 2BZ1A 1TU3A 4Z2YA 1EUZA 1DIBA 4PINA 2JHCA 4DW8A 4F4JA 3DD1A 1D6MA 1GA1A 5D00A 3HLTA 2I6GA 5KYNA 4GW3A 2YI8A 3OUZA 4WH0A 8ATCA 1U97A 1Z25A 1YIOA 5K7SA 2QOEA 1JKIA 2G72A 4UBIA 2Q7GA 2V97A 3R1IA 3GJ8A 3O3MB 1TRKA 4Y8VA 1DARA 5KJ1A 4KFRA 1J24A 3BD8A 1G7TA 2G88A 2WQZA 2PWZA 1TZBA 2AK3A 4QGPA 1WQ3A 3ZLUA 3H0CA 2Y2UA 3ENVA 4D8TA 4EJ6A 3IAM6 3R2NA 3DL2A 1E1CA 2VJBA 4ON9A 1NHWA 2ZFUA 2PZKA 2JLCA 1PPJH 4HLNA 1FA9A 1KVQA 3ISTA 4WLOA 3K0BA 3PRJA 2XDYA 4DM4A 4O3FA 4H08A 4RORA 4C6RA 3PHCA 2QM3A 3KJFA 1W9MA 2O1XA 2PLNA 4W5TA 2G0AA 2B6NA 2QR4A 3OURA 3GVHA 2ZRPA 3X2QB 5CA0B 1PZXA 3UG6A 2XT9A 3CE2A 1RP1A 2LE0A 2RSLA 1NF8A 3F2VA 2HIGA 4CLXA 4TPKA 3C1AA 3FMVA 1HXHA 2GD1O 1RLTA 4D4GA 1MC5A 1K8YB 2QZPA 2D1QA 4FQ8A 5HKKD 2HTFA 2CNWD 4KEAA 4KFTA 4WNAB 2G25A 4BTEA 2HRZA 1KEKA 4HDRB 1MG5A 1EWYA 4QBFA 4CM9D 5J63A 1P75A 5CVTA 2QE7A 1Y1SA 5EJEA 4BR6A 4YRQA 3GEMA 1H2EA 2WEKA 2DHRA 1ORTA 3V7YA 4ZREA 5JJJB 4UHJA 1ZM4A 2QGZA 1QPZA 4YV7A 3UY4A 1L1RA 4R1TA 3GFVA 4N5MA 4CMBA 3ZOZA 2J7PD 3D2CA 4AX8A 3ETCA 2FSVA 1M75A 4D44A 2QLFA 3RS5A 5EESA 1UJBA 1SVUA 4ND5A 4DSOA 1M5TA 1GUBA 1OF1A 4B7EA 5IJ9A 3PLNA 5LWHA 2A88A 4PTYA 4W8GA 5HS4A 3OMAB 3M3HA 4R40A 3A0BZ 3OT5A 3NYQA 2GCPA 3WKCA 1LFAA 4AKIA 3I01M 1S2GA 2XGSA 1T5BA 3JQ6A 1FBTA 4G5OA 4GICA 1SIUA 3QXCA 4PR3A 3VDXA 1BU8A 2O7RA 1TM1E 1DLJA 2VHQA 4WKOA 4O8YB 1VRVA 3TM4A 3NM4A 1KB9F 2ZQYA 1KC1A 3B6ZA 3BWXA 4HNRA 1URFA 3HVKA 3INGA 1XNRB 4YN3A 2COKA 4IJUA 4OIMA 4I1PA 3TVTA 1RYDA 1F8UA 5G4KA 1EDDA 3GARA 5E1AC 4NQRA 1R9MA 1YI8A 3VPSA 2DBQA 4BFWA 3TJRA 2GSWA 1J1UA 1BQ3A 1Z75A 4XI9A 2X7RB 1XZGA 3GLHB 2ZJYA 3V42A 2XMRA 1QYWA 3QW4B 2QZ9A 4CEIB 2GLTA 3AEUB 4GR5A 3QYJA 3KAKA 3I09A 1MO5A 4O6VA 4OPAA 1JR4A 4TWBA 1RQXA 5IPFA 3RC8A 4BB6A 5AM5A 3KQSA 3VISA 4NMWA 5DOZA 1SXJC 2LR0A 3OQNA 2Q4BA 1KO4A 4JP8A 3BXHA 1KJ8A 1K6XA 1M2VB 2IPAB 3ZRWA 4WOPA 2NZWA 3EVZA 2UDPA 2EFHB 5BNWA 4I1IA 1Z29A 4BFSA 2OE2A 2YWHA 1GGEA 4KQKA 3L7AA 2ZI6A 2FCAA 3MLBA 1NG1A 2I91A 1P39A 3PI6A 1P9LA 4RU1A 4V1CA 2EHDA 5JXJA 2X4DA 5AI5A 3NIDB 4UUMA 4EKDA 3HJTA 1KDVA 1VQ8V 3RW0A 5HKLA 4R8CA 2VAXA 4UMDA 5A7HA 1PUIA 5ESWA 1IOLA 1H23A 5IJAA 2A0FA 4I3FA 3VV3A 1PEDA 2G04A 2OO5C 4EM6A 1OTHA 2FUKA 3VPBA 2XB4A 3FCAA 3W2IA 3OKFA 1UWCA 4F56A 1N2XA 2LV8A 4P22A 4KYVA 3R0JA 1GPYA 3W06A 1C9MA 5EJ6A 1F06A 4G5SA 2AEJA 4UD6A 4C3ZA 2JHGA 2C2XA 1PD0A 2OHFA 1JJ2U 3QKWA 5JDIC 1UBOS 4ZVQA 5C7YA 2ZDIC 1PWEA 3OY7A 1C7ZA 2ZZMA 3IILA 1G7SA 4DCSA 3G8AA 4N9QA 3KQVA 1L5MA 1LWNA 4QDZA 3O95A 4ZMSA 3S3XA 4UB6Z 5CVJA 1ZVVA 1FXKA 1T8UA 3LPAA 5HNKA 2QMZA 3G0IA 3PFCA 5A9SA 1VJTA 5KWIA 2AB0A 7YASA 3PIIA 5JO0A 3EFBA 3RSGA 1NKDA 1AKEA 3CVVA 1K5SA 2A7WA 2PD4A 4GMXA 3NORA 2ECOA 3FVQA 1ND6A 2GJ4A 4JLBA 3HFJA 3FN4A 5IWCA 3UT5A 5K8JB 5BYBA 3WL7A 2ZZKA 5A3SA 2HT1A 1F0YA 3PGA1 1JXQA 3GCZA 2WDZA 3MRXA 1VI6A 4QFMA 1X92A 3RHSA 1G9TA 5FTKA 1Z5WA 5KOJA 1HL3A 2XUHA 3E9DA 1GUFA 2XQKA 3LNCA 3VTFA 5FFMA 1ZK4A 2FPIB 4P7KA 2BR3A 1CRZA 3ZNOA 1T6ZA 2XEDA 3N86A 1GT6A 3G2KA 3BFJA 1H0HA 2VYNA 3N39C 2FF5A 5MN4A 1TTPB 3WK4A 4KHPB 1ZNYA 3GCDA 1BS3A 4F3NA 3G2OA 3DXYA 3LL7A 3R3VA 3HCAA 4GPBA 2FE1A 1WDLA 3IDFA 2PMDA 1JEQB 4RAQA 2FG7C 4GOJA 4FDVA 1WVIA 3BF8A 2B78A 3K5MA 1M6WA 3PTZA 1TJYA 3FPSA 4ZI2A 2W6ID 4BZQA 2QKCA 1GZHB 1SKYE 3C4VA 3OZBA 1D6JA 1U8TA 3DAOA 3LF2A 3TF5A 1X1RA 3GDFA 3WLHA 4QOHA 3CP1A 2EVWX 1DZIA 5K3SA 4CH5A 4EQ6A 1E5LA 2WNSA 4KYUA 4G84A 5CFNA 5BWNA 3R40A 5DW0A 3SR3A 5T7BA 3CGWA 1N6IA 5BR8O 3T3NA 4PS0A 3P2JA 3TK1A 3LIIA 2P7IA 2HBQA 4HQFA 5TEWA 1QIHA 2WTBA 2UYYA 1AB3A 5BYAA 4YMSA 1EBBA 1XOUA 4MW4A 4W7SA 6GPBA 2H16A 5MN6A 3CMMA 3A0HZ 2PYIA 1YB1A 4YAWA 3U3XA 3TQRA 3Q8MA 5DWQA 2Q2VA 4KQWA 5FPOA 4KOAA 4LE2A 1EJ6A 4JAVC 2Q1SA 1HLFA 1YD7A 4PYMA 4OI2A 1L8AA 1V3VA 3ZXUB 5C8ZA 1ZH6A 5AI4A 2UVPB 2ZI4A 1OFTA 3KOYA 5JH7B 3SZUA 3RU3A 1GPAA 1DV1A 5ALJA 2BM1A 1IXZA 3NATA 2R9AA 4RKEA 4TWIA 1KVTA 2OG2A 1JQAA 4S1WA 3TLBA 3ON5A 3MWDA 2ZGVA 5DTQA 1SC4A 2NADA 4FGLA 1V9PA 4CIWA 3PFWO 3KALA 2A0KA 3P4YA 1ODFA 2X1LA 4BVFA 1RTTA 3O8QB 2Z83A 5KTNA 3TGPA 2DN9A 3BPSA 1NZDA 3ZJUA 2WWTA 1WCXA 1UIMA 3RRJA 1AHHA 1VCOA 4LRUA 1U6IA 3AIOA 3PXDA 3U56A 1TM2A 3AG2B 5ILQA 3TLGB 4C4SA 1A04A 2UAGA 4ZT6A 4OCNA 2IYLD 4UVHA 3P0HA 1RCTE 3A6EA 1SM4A 4PPGA 4LMAA 2NYRA 3WP1B 3PD0A 3RWBA 1Z5UA 3IVXA 2NYVA 3AFGA 4TV8F 2GYUA 3DHYA 4N5LA 4RZHA 3TZQA 4FSXA 4UUBA 5CBKA 1E2GA 2V0CA 2BZSA 2Q49A 4H6VA 1UBCA 1PGNA 4Q9KA 3TB4A 3WMRA 3FB6C 1MW8X 1R8XA 1W73A 4R2WA 1O5TA 1W0JG 3I1FA 3K0EA 1F60A 2J9FB 5FFNA 1EVKA 3BBLA 1DDIA 1CLUA 4L4ZA 1Q91A 1I30A 1CTUA 2VSNA 1G4YB 3N1UA 1A98A 2R60A 5H4HA 3DF9A 3R23A 4YAUA 1F1BA 4Y6QA 2V54A 3QOXA 5AW4A 2BL4A 4AJ4A 1HNZO 5M29A 4CMKA 1K4CC 4DBZA 1N34O 4H0NA 8ADHA 3H1AA 3CCSV 1KS9A 4OOEA 3UWPA 3ASZA 3TGLA 2PXXA 1T9DA 4QPDA 2A5DA 3KQLA 1JQJC 2P5TB 4LNHA 2F43B 3ZGOA 5KA5A 2GTHA 1CS0B 3IVGA 2JZNA 1OX5A 2EZTA 3FSRA 3ZVKA 3AUAA 2Y93A 2J0SA 5EC1C 3KL2A 3PC8A 3CCBA 1T4DA 4MEBA 1YZQA 1NP6A 1GZUA 2IPLA 5AUOB 2EIXA 4LWQA 3ANLA 3QEMA 3BGWA 1UCFA 2WK1A 4NTWA 2PL1A 5IYZA 4XQ9A 2YXYA 5JCJA 1QHSA 2RB5A 4LVNA 3WAJA 1QHHB 2W6IG 1X3LA 3A10A 2B83A 3DYIA 3G6KA 1SULA 5BR1A 3F6CA 4KPEC 5LQKA 3R4VA 3GPLA 1JXOA 3F7TA 3IUNA 5AXBA 1VP7A 4R7CA 3P5SA 1KI6A 4QXOA 2QXUA 3PJRA 5BPFA 3IYLW 2WYWA 4OQMA 3EXHC 3Q3EA 5IFLA 4LE1A 4CJXA 4NEQA 2X4LA 3SR4A 4ERXA 3ZN1A 3H13A 5A9GA 3QVOA 1YDXA 4BRSA 2WPDA 3ZNQA 3A6HA 3WGGA 2EW1A 3OPQA 4RJKA 2CFSA 5LOVA 5FDFA 1D1SA 2OHHA 2W8BB 3RSOA 4EA8A 2EF1A 2JEUA 1BWPA 2HU7A 4B3CA 3KZNA 4ZOEA 3UGQA 4ZCMA 1VF6A 1E3QA 2C29D 3NJRA 4RM2A 4JXKA 5BVHB 1SESA 3EEFA 4HPJB 3W0LB 1GPJA 1QQ7A 2J45A 2HPZA 2KE5A 4R1SA 1XKLA 3PC3A 1N7GA 3KVRA 4KDFA 4KHZA 1E2QA 1CE8B 5FLXA 1U0BB 1NHGA 1R6BX 4MSWC 1IMJA 2G67A 3UOWA 3AM1A 1YR2A 3O4HA 3DBVO 3M8AA 4Y2RA 1PG5A 2P6OA 2VLIA 1RRVA 2WSSD 1M6VB 2P2YA 2H4ZA 4ENTA 2ZS9A 1ZWKA 1SF9A 1M5IA 4OSPA 3U9TA 3U19A 5B3SB 5JVDA 3RYIA 1OTXA 2JS7A 2H63A 5JYCA 3NGLA 2XW6A 4UARA 4PU0A 3GELA 1SWVA 3AG4B 1DIRA 1SU4A 2QTGA 2DPGA 4PLCA 3O5AA 4EI7A 5C5IA 2IBMA 2W00A 3LX5A 4RANA 5AVTA 1G38A 2J6CA 4L02A 1WABA 4FJ2A 2ZRCA 4YNBA 3UK0A 2Q5ZA 1TDJA 5BOVA 4Q34A 3NR7A 3OQPA 3W7SA 2BGGA 2CDRA 4IX1A 1XPRA 5KBYA 1C7RA 3RVDA 3N2NA 4YBZA 1ZXXA 1JZQA 3ITDA 2CUZA 1EUCA 1PR6A 2A59A 4U4AA 2DECA 3KETA 4NJEB 1K66A 1ORIA 3FJOA 3BMNB 1T2EA 3PNPA 2AN4A 1CUIA 4EF6A 1EP2B 4EKYA 4LY9A 5GAOA 2IW3A 2HK8A 3FD9A 1MKYA 3IFXA 1JAZA 2O54A 4G1EB 3UB2A 3SPJA 2VCYA 4R41A 4DV3B 2CUNA 2EQAA 2X42A 1AV7A 1OV6A 4NXNB 1SU7A 1G3QA 4MHOA 3ABTA 2Q28A 4CHGA 4YMTA 4A4DA 1IJBA 2OG1A 3TLKA 3H8VA 2FP3A 4YV2A 4MVRA 4X62O 8AT1A 1P4JA 2A1TR 4EHBA 3BWVA 3PHHA 1IJFA 4IYHA 1U8AA 1A5BB 4B3HA 5IG2A 3QX3A 2CXOA 1CY4A 5K0SA 4UUPA 2CV2A 2ZSIA 2DSNA 3PUHA 4JGGA 5JSKA 1OASA 1SKVA 2CFCA 3VU9B 4MV3A 4PE5B 1YMQA 1QHEA 4JYBA 2VHYA 3TIVA 2AKYA 4A8PA 1S3GA 1IHUA 4YMIA 2IDJA 1J39A 1LPSA 2AN3A 4UBLA 4AY5A 2FUEA 2VUHB 3OEHD 4U6QA 1NUHA 3UK1A 1SZTA 1YC5A 2OCIA 4D4MA 4JEIA 4MV4A 4LYYA 2AKAB 4ARAA 4JI6B 4MW8A 1FRZA 5JC8A 4U39A 1UOOA 3GFOA 3I9FA 4IO0A 4NEHB 4BX8A 4FD2A 1R4NB 3HYLA 4WVFA 5JR3A 2WIJA 5I5EA 1PJ8A 2KG7B 3P9SA 4FYWA 3GLSA 2R7NA 5KWSA 2EJBA 4I19A 3JVIA 3FVRA 5AUNB 3I6MA 2QNBA 3MJEA 2ZJ3A 2WAYA 4ZYYA 1ENVA 4QD3A 3OCXA 5DNYB 1E6MA 1BMFA 1D4OA 1S5JA 3CN9A 2O2SA 2RG1A 1YHNA 4UZSA 3AWDA 4D46A 3RROA 3FPGA 1ADYA 2MYPA 1KZYC 4HYEA 4GMHA 2BSQA 3SYRA 2BJHA 1FE8A 2GX6A 4LXHA 2YYYA 1GNSA 1YQTA 1GTMA 4AN1A 1O89A 3WIOA 1V6CA 3EDMA 4ZAYA 4ZDKA 2OMEA 2QU8A 1OZFA 2R751 2PMFA 1KJ9A 5F7ZA 4AURA 13PKA 3GRPA 3K9HA 3UJ7A 3X2SA 421PA 2J30A 4LBWA 2J3QA 2YZNA 3KDPA 5CH8A 2KKWA 1CY8A 3D6MA 1GGNA 3RRXA 4D4LA 3H1JH 2QMUA 2KJQA 4EMSA 3SQWA 1O6GA 1SELA 2R6HA 4KQFA 1O2DA 5DLQC 4ZOQI 2RJOA 1CBUA 3S8YA 1GAEO 4AROA 2RHRA 2E5WA 1UK7A 5KX5F 2EKLA 1R73A 1P4GA 2FZWA 3V48A 4R01A 2PLRA 1MXFA 5BSHA 5SV2A 4EMTA 5FD8A 2WSSG 1Q0LA 4MTFA 2V6MA 1KO5A 2BLLA 3B38A 2IM9A 3QQPA 3TR0A 1NBME 4F2HA 3V4FA 1XFDA 3Q87B 3BTUA 3TD6A 1X59A 2VF2A 2EFDB 4HMQA 1T43A 2G80A 2HIHA 2VQEB 3IKLA 3C3SA 4QM6A 4HAIA 4EG6A 2A9OA 2OXFA 2XIQA 3D6TB 3D6UA 2PGLA 3EZ2A 5C4GB 5KKCA 4ZQBA 3ZDZB 2CTQA 1MABG 1GUYA 1FUYB 1E9BA 1UAAA 4G07A 4ZPJA 2QUAA 4PO8A 2DERA 2H2GA 3D3EA 4QRIA 5DU2A 4CM6A 4KR6A 2K2WA 3E70C 1C4OA 2IY7A 2DX7A 1YK0A 2B3JA 1N2CA 1L4MA 5HK9A 1FMCA 4MGEA 2HG5C 3QP9A 1EFVB 4QNNA 2C4WA 3WAKA 3ABQB 5AI9A 1I1OA 4NYMQ 3N76A 1FXSA 2V58A 4KMMA 4GBGA 3EQ6A 2YXLA 4MJ7A 1GHTA 1R9GA 1QRSA 2FW6A 1X70A 1YHZA 4FHGA 2L6LA 3ENWA 1P18A 3ZR4B 2DCMA 4L8VA 1QQBA 2Q1YA 3ZWAA 3A8TA 1G5TA 2F1MA 5HUHA 3N8HA 4WY2A 5CIYA 4LQLA 1TZCA 3OUUA 2X0DA 3KBOA 3KWFA 3TTVA 2GN4A 3VSBA 1TK3A 5A1JA 5B7NA 2VH5R 1EVLA 1NR5A 4RSGA 3IMGA 4X8AA 2JLWA 2JJ1A 1NVAA 2YS8A 4D82A 2R6R1 4GE0A 1RQ2A 3GNQA 4ER7A 1SQFA 3CEIA 3RLIA 1AJNA 1E2LA 1Z7WA 3PGXA 4RTKA 4QE7A 4IJQA 1OXSC 3WSTA 3ZE2B 1PWXA 3D6NB 5KWJA 2ID4A 4HDKA 1JWBB 3KQTA 5CVCA 3T0GA 4MEAA 5E8JA 3LHSA 4RQFA 4X61A 1RI5A 3IAEA 1M76A 5H3HA 3K0FB 2BMVA 4ZO8A 2LDXA 4BNVA 3ZGVA 1GAXA 1PFKA 4RELA 3TE7A 2AC7A 3B3AA 1I3CA 1J06A 5AKIA 4MLPA 2I7XA 5B1EA 3OZDA 1EFHA 4WRRA 1GAWA 4K6GA 3HY4A 4DKXA 4GXTA 3BXEA 2GDJA 4EHAA 1OHHA 4F3YA 1EFKA 2Q2NA 2QQFA 1GQ2A 2EXXA 4MI1A 2BHLA 3VTZA 1U8YA 4OQFA 3JYOA 3HBLA 1HDIA 2GH1A 5TQ0B 2Z2ZA 3UJAA 2IOHA 3UFXB 2X6BA 1C0EA 1CJUC 4MW2A 4UCSA 1Y8AA 3JQAA 1TFUA 5HQJA 1RWQA 3MBIA 4IH9A 5D3MA 3UHJA 2WA1A 4NEGA 3PVZA 5T4BA 4OLBA 2ZXFA 2NUAA 2JFOA 1STOA 2IZ6A 1MMMA 5LB2A 5G1NA 5JAUA 1KSHA 1DNPA 1J1ZA 3U3ZA 3HZHA 5KVQA 1PLJA 3RT3C 4LY3A 1ML4A 4OGLA 4R8KA 4X90A 2R8EA 4GO1A 5CA1A 2O8CA 4BFCA 2JK0A 3QKRB 3JXEA 1Z8HA 3ZK9A 2VRZA 3NAGA 3GWGA 4RMHA 4G9BA 3C97A 3C3TA 1VCNA 1FFAA 3HXKA 4HVAA 4YDQA 4YJ3B 1OV9A 3C70A 2PJZA 3O21A 4JQCA 2BFEA 3IBGA 1AVTA 1GTG1 1QFJA 4HZUB 1Z8DA 4LYEA 1JQEA 4PONA 2ZI3A 1H85A 4DIMA 2HXYA 4BAYA 4I46A 4BC0A 4B33A 4C76A 4CR7A 4EG0A 5EKTA 1ICEA 2PWAA 1GRCA 1DFGA 1TTQB 3CT4A 4C7JA 2CHVA 1SH7A 3KSBC 3V7NA 1Z82A 1AILA 2EIKB 2W0FC 1FFDA 2XCLA 3EB9A 1EDZA 1EWKA 2YASA 5J2TB 1ZH4A 2O07A 1K3TA 1OWOA 1IH8A 4M0LA 1D8TA 3FX7A 2CLKB 4RABA 3MDSA 4N03A 1VCHA 3G5MA 1SR8A 1N5JA 4E6EA 2J7KA 3CRZA 1ZMBA 2GCOA 5BQOA 1DEHA 3IUMA 3VAZA 1G6HA 1KJJA 5KWVA 4WXHA 3NEYA 3F3YA 1CEZA 4RMIA 3GDWA 2D62A 3L77A 4RQUA 5DASA 4G0VA 1DRWA 3B6KA 3RE1A 1TZMA 1CUJA 1VJDA 2OCKA 4O8CA 3AETA 4KVZA 3UANA 2TRSB 4EIWA 1QP0A 3D3QA 5ALIA 3ENZA 2LPMA 1BDJA 1RMQA 4DMUB 2AWOA 1DOHA 1U1FA 2QTVA 4PI0A 3TQSA 2BGJA 3TQCA 1XTVA 4ANFA 4P53A 1V8OA 1Y9EA 1IEWA 4K7JA 4GQAA 4IMRA 3A32A 3RDPA 3W5UA 3DEJA 1SQGA 3KXPA 3QEAZ 3BDIA 3HPRA 1ODJA 1X6VA 2ZOSA 4DWJA 3R7BA 4XB2A 2YHBA 2FKNA 4BFLA 4EECA 1YRWA 4JJ8A 4HDMA 3OUSA 3VM6A 4MB6A 1GNTA 5EE0A 3PR2B 1V8ZA 4EGAA 2ZJ2A 4JCOA 1HT3A 2NTVA 2IJJA 5HWSA 4JI2O 1G5QA 4JI4O 5CB0A 4L5CA 1G7CA 1GTJ1 2COUA 4M0FA 2I3DA 3C3JA 1CS4C 3AONB 2LIVA 2NTNA 4ZAVA 4ETNA 4V0RA 1P3DA 1RRFA 3PF8A 3MYYA 2C07A 5H0IA 4YXWA 3F8TA 3RSQA 2V7PA 1I14A 2D7JA 4HK4A 3ZWYA 4DJFC 5CMLA 3N0VA 3G8CA 2IYYA 2J3IA 5IY5B 4EABA 5H3CA 5TGZA 2BP7A 1L5WA 4KFSA 2CMFA 1BFKA 3IJEB 2SECE 1TIYA 1GKFA 4XGNA 3BABA 1XYYA 3PE4A 3WLEA 3IAHA 2HWKA 4JBYA 2AJTA 5CDSA 3AFOA 5LD2C 1XU9A 3N2EA 1V11A 5E0KB 5DHUA 1U8ZA 2D1YA 4KIJA 4RDCA 3ZU3A 4PXSA 4QFTA 1T3TA 3NTRA 2JAWA 3HA7A 2X2PA 1E7YA 1JHOA 1FW8A 1L4BA 4PFKA 4MW6A 1SJ9A 4CMEC 2FQWA 5LYJB 3SM3A 3E6AA 2XRFA 3PCTA 5JFTA 2DMRA 3KKZA 3DNMA 5I4BA 3JCUZ 4Q21A 2FUG6 4ZI7F 2Q3MA 3T5BA 1W4RA 4TLMB 5A5FA 4WESA 2VDRB 1YONA 2RAUA 5LBQA 4EY8A 1OBCA 1QVGU 4AN0A 1U31A 4KQIA 3Q7SA 2GTAA 1AMUA 1N3BA 2BBWA 4ZEXA 5DHFA 2WQ7A 3EAQA 1UPCA 2WKRA 1L5HA 1NT4A 1P1JA 1OZAA 3HFGA 3WDLA 1G63A 3DXXA 1HLDA 3Q0TA 5E1OA 3ZRVA 1O4VA 3W7VA 2DR0A 3TCXB 5C51B 2WKPA 4D6YA 2WTMA 4BX9A 3PDUA 5LMZA 4IDFA 2ABWA 5EJIA 4E13A 3B8FA 4IDOA 1KORA 3TVYA 1MPTA 4I0WB 4M1SA 4U7OA 2HGZA 3R6WA 1WKBA 1L2TA 3OAAA 3TIIA 1L1FA 1ARZA 4IOLA 1ZKDA 1QP4A 2HMVA 3NVMB 3H0EA 1Z26A 3VOTA 4HDNA 5AT1A 1A69A 3ZDRA 1KBOA 3DMRA 4Q12A 3PDIB 2V1DA 3PSHA 1M1YE 1P2VA 3ZD7A 3RVPA 5DYYA 4H13B 5EP3A 1QR9A 2IJKA 3HLYA 1LW6E 4UQPA 3D0RA 5KYXA 4JF3A 3C7TA 3ELBA 4KP4A 1U7ZA 5EQTA 3W6OA 1C14A 1OIWA 3HB1A 5AW9A 3DOOA 4JOBA 5A05A 2C9DA 1UEIA 3LFTA 2FLWA 1O9BA 4UXJA 4N7MA 4CL0A 5GZ1A 4FEAA 1Y5MA 1PR4A 3BS4A 2CCJA 3SKXA 4YPFA 1FSZA 4PIPA 5DGHA 1AKUA 3O74A 1ISFA 2O1EA 1IDSA 3ONEA 2EP8A 3E7FA 1H93A 4ARVA 2ZRJA 4HNSA 2IJGX 1ZZEA 4M9XA 2ZB7A 3GEGA 3PNSA 2GKOA 1ULHA 3JY6A 2C78A 4DMRA 4GOXA 1W0KA 1SC3A 3NTVA 4E5YA 2R8YA 4MWBA 5JIBA 2BUAA 3I3SR 1E4OA 1XJ0A 3L75H 4B6FA 2IU3A 3AT1A 1OCCC 3F8WA 5JJ5A 1VPLA 5KQGA 3AI3A 1W5TA 3LBHA 3CZAA 3QF4B 3CW9A 3IUYA 2MHCA 1EP1B 5AJUA 3ZJYA 5DXAA 3WK8A 3E8XA 5HVNA 3BB1A 4TTTS 2L69A 3I4CA 4OBWA 5ALEA 1TCVA 2X9GA 3FIJA 2NUPA 5C34B 1CXZB 5EGNA 1LK0A 3OCVA 4Z4CA 4FEYA 3GN1A 4JPRA 4NFYA 2RPZA 1B76A 4TT8A 1VQ7V 3EBPA 2RONA 3G9QA 2IHTA 3JVUA 2FCRA 4PC1A 2I80A 4F3TA 3DE2X 3K2QA 2JCGA 4ZHQA 2EILB 1A4UA 5EJ9A 3DDCA 4AMGA 3B60A 3TZHA 5I7VA 3IVRA 1CP3A 4PG7A 2ZPUA 2YWXA 3LKBA 4EVQA 1GNRA 4ISBA 3EGXB 3R8CA 4H1HA 2XMSA 3OTQA 5KMGA 4ZYZA 3OZ7A 3M6UA 4XVCA 1Q6UA 1UBEA 2PF4E 4NBVA 4EKNB 5F5LA 1JALA 4EDHA 3BMOA 4A0FA 2L42A 4Z1MA 2AMJA 1NVFA 1R16A 2BEUB 2X2EA 5L3SA 5KYUA 3JZAA 3NETA 2OWEA 1KPHA 2YZMA 4QC2A 5BN5A 3TTUA 1KKMA 1DC7A 3AZOA 3ITKA 4GVLA 1TJ4A 2GHIA 4W6ZA 2FF7A 3QW2A 3HMKA 4WEOA 4RH3A 5M04A 4F3WA 5CR9A 3KQKA 4XARA 2OHOA 2WUFA 1NUAA 2EKZA 3H97A 4Z3OA 3T1HB 3EGCA 3EIUA 4IRXA 4GUNA 1HDXA 3H05A 3UVEA 3G9XA 1EFLA 1I32A 3HR4A 3H0KA 2OBCA 4R7TA 4BAZA 1KFCB 1G8GA 1CSEE 4AS1A 5G53C 4GR4A 2HHHO 1TLTA 2AFHE 3V4VB 3UAZA 2FQQA 5EAIA 3NBXX 1J5XA 4QUAA 2FR5A 5HDBB 1BCCH 1SBNE 2VI5A 5FLYA 5A4MS 1ISHA 5I45A 4WFBV 3OQMA 1GQFA 2D5NA 1IN6A 1AK9A 3NUQA 5AKJA 5DM6V 1EVYA 3UB4A 4AICA 4DLKA 3L1VA 1UOQA 2B9EA 1CR0A 4G8CA 4XD7A 3G3EA 3B3FA 3KV1A 1QZZA 3DTNA 4PC6A 4DLTA 1GZ7A 3BXPA 2UUPA 1ZUQA 2E1RA 3UMBA 4CL3A 1IHYA 1RRMA 4FLMA 2X0JA 3HABA 3HBFA 3MCZA 4RBNA 4DV2B 3NXSA 5IKMA 3N8DA 3O8CA 1VL5A 3RCBA 4DQVA 1O96A 5TDHA 1EXWA 3E2EA 2J4CA 4AYXA 3OZAA 4BXOB 2ZSDA 3Q12A 3A2FA 1Q5PA 3L8HA 2VSFA 3OMWA 3GV0A 1GKLA 1XNHA 3HDJA 2V59A 3SZGA 1MIOB 1PU2A 3ICQB 4BZPA 5I7WA 4C6SA 3DYVA 4O4LB 3DOUA 3IP7A 4OYHA 4TOIA 3KSRA 4DC0A 1EVIA 4G4JA 2X3FA 3G7SA 3OX4A 1HK7A 3DKVA 4ZVUA 4E4YA 4O2AA 3OFVA 2V7VA 3RSFA 1U7PA 1KPGA 2G1UA 1PNLA 2OCYC 5CM8B 2VXCA 4IJMA 1SCDA 4PVCA 3GUUA 1EYZA 4AMVA 3T5DA 2JDIA 3PPXA 3B89A 1XWIA 1FKAO 3IA7A 4RV4A 1DQNA 4OWPB 4RF4A 3JASA 5DM70 2ST1A 5IF9A 1E7SA 2QN6A 1NTOA 2SKEA 4XYMA 5IHPA 5CVDA 4TS3A 1G3UA 2CL7X 3C3EA 1Z2NX 1BRMA 1ZM9A 2Y9MB 1M83A 4ZYTA 2EX3A 4FUTA 4D4KA 7REQB 5IJ0B 4LIPD 5K5EA 4F21A 5KOYA 1KA9H 4L1KA 2GA8A 1Q11A 4MKGA 2FPSA 4H6XA 1T1SA 4WZBA 4G5XA 1P62B 4L78A 4F7DA 1SA0A 5ISMA 3CR7A 1JQ0A 4PV1B 3CLSD 4UOEA 2G36A 2HV8A 5HRUA 1SKQA 3AJAA 5AVJA 2NVUB 4M0CA 4JMLA 2BMEA 3OLVA 1FSGA 3KS9A 3O8OA 1GCGA 3G7NA 5L51A 2PUTA 5TRTA 4YC7A 4Q16A 3LM8A 5DEOA 2O3JA 1M2OB 1CPYA 1RRGA 3QKSB 3K6KA 1IN1A 2UXCO 1MV8A 1YRYE 1JI3A 3R44A 4RVHA 1LVGA 2PX5A 3CA8A 1Y8RA 1LQTA 4Z51A 2JFZA 3NEPX 1G3IA 4TL7A 3U5ZB 2FN9A 3Q2KA 3BA9A 3WQQA 3NOOA 4FOTA 2WTXA 5D3QA 1ENZA 5FTLA 2C4KA 4UDYX 3R9XA 4RKYA 3W3AH 3E03A 3SQLA 1MX3A 1UT8A 1B3QA 3S28A 3EDOA 1Z0JA 2VHUA 1N9ZA 3K1JA 2PFKA 4B8YA 5TX7A 2IX9A 1NQWA 2IE8A 3BZBA 3E9RA 3RAFC 2VWKA 1HLGA 2GVZC 3DT8A 4LWSB 1MTZA 1X1DA 3ASYA 4YP5A 1ZABA 5BSUA 3SQMA 2ZT6A 4RJJA 4RTLA 3RVQA 5FI5A 3HRKA 1N8TA 3T9FA 3B1KA 2JEOA 1DUSA 1TMKA 4HV4A 5HF9A 5HYVA 2HIAA 4HQRA 4JASB 5CDGA 1JKJB 5HIKA 3HXLA 5CDYA 4Q18A 2HSDA 1NVVR 3ANTA 3BD9A 5EXSA 2J9GA 3G02A 3O84A 2DR2A 2R47A 2CVFA 2OTCA 1UBRS 1WZNA 1FUKA 1RYZA 3CE9A 2A9KA 2NU6B 2OBNA 4ZARA 2FZCA 2QYSA 2HSEA 1HE1C 4L6IA 3NEJA 4TSKA 4ZBMA 3VPHA 4BO5A 4UE6A 3C5CA 2GEVA 3FVWA 1NFQA 5K4AA 4UTRA 1HZJA 3GMDA 1IFXA 1UADA 3TTWA 3EIQA 1PNMA 2V4DA 1GGVA 3FOBA 3HB7A 3NYWA 5HMLA 3HKCA 1C7EA 2JIRA 3PQ3A 4PGAA 2GM4A 4OMFG 5B5EZ 3GFRA 1T6XA 1J0XO 1J2JA 4IX9A 3FKSA 1UM9B 5DMHA 1XXHA 4LJ4A 4RQAA 1F2TB 4DHEA 4A5UB 1X7XA 4S1TA 1KUQA 3K09A 4OQXA 4X1KB 2EKQA 4EVSA 5H5NA 4UCRA 3PKJA 1Y67A 2F6RA 5E8RA 2Z43A 5JHHB 4EGQA 5EXXA 2EX1A 2RCNA 2JH8A 2O20A 2PYDA 1EP3B 3AEQA 3SC3A 1X1AA 4J0CA 2QKYA 3OP1A 5LJLA 1A8QA 3EVCA 1W88A 1Y1QA 3ZUGA 1V6SA 2AMYA 1S9HA 3PR3A 1FP7A 1GH6A 1Y6GA 1AF4A 4LEIA 2PKCA 2WIKA 1OLXB 1SXHA 4EY7A 2XE6A 1IWOA 1CQWA 4JVOA 2YIBD 2CJPA 3JQBA 1VIDA 3TRFA 4L50A 4PNZA 4LOHA 4U9HS 3FWPA 4OOFA 4UU8A 2P65A 4KKVA 2HI0A 4Y2PA 2X1VA 5HE8A 4K2HA 3LDDA 3SVZA 3ACCA 4TSRA 5LQJA 2LNDA 3ETDA 4M8NE 4M8LA 3DXFA 4NZOA 5FBWB 3D4PA 3SYAA 1X7WA 5AOAA 5T3UA 1O54A 1OR8A 2DFNA 1GSHA 3S40A 4DA0A 5KLVH 3LGXA 2AGVA 5T8KC 3GLGE 4QT0A 2IYSA 4XGRA 2UXBO 4RMNA 2ARKA 1HEUA 4QDXA 2P9EA 4ECAA 5CFMA 3PVCA 3I53A 1LJ8A 2ODTX 4WJZA 4DV6O 4CT0A 4XUEA 4MUIA 3EGEA 5B4VA 2ZTSA 3EZ9A 1FVOA 3LW7A 2WWHA 4ZOCA 2WA3A 1K7CA 5LQMA 1XZBA 4TKUB 5HGJA 4J0KA 1ZK3A 2KB1A 1BCSA 3H1BA 2ORYA 4QBHA 3KO8A 1Q20A 5AKYA 5G41A 3B3GA 4AZTA 5JATA 5EE9A 3X3HA 2BFCB 1Q84A 3CRAA 2GR9A 5DHAA 4A26A 2HHCA 2R1VA 4QJIA 1BMQA 3E7WA 5CFRA 4MZXA 2I6TA 3QPAA 1NSFA 2W48A 1T13A 4GLLA 1CJSA 2QV7A 1E94E 2J5RA 1G1AA 1VFPA 1KYZA 3LAWA 3OBIA 4GPD1 1H5UA 2A0YA 1RYFA 4RVOA 5A6SB 4X44A 2E48A 2F3RA 2P9QA 1P81A 1Z22A 2ZIXB 4JZKA 1VFNA 4RGVA 2PO5A 4IO1A 2CUGA 5H70A 3PX2A 4DTCA 4PELA 5FL7A 3S70A 4P3XA 3MRSA 3G7UA 3REQB 1TQ6A 4NVPA 4ZRNA 4WF9V 2Z98A 4YTEA 5IE9A 3ZCSA 4B6SA 3QF7A 4YECA 1GARA 4L08A 2CBZA 3DE3X 3AM3A 3NUGA 4O4IB 5IT9N 1FDRA 1Z6GA 4I6GA 2Z2KA 3PTAA 3TX2A 3CZ9A 5LXTA 2PHZA 4ZD4A 3GJ7A 1XJ5A 5I51A 4C7XA 5KO2A 2W2XA 3LSUA 3BAAA 4OIFA 1AGYA 3NHAA 1V1RA 2CD7A 4LV6A 1LI4A 1M4UA 3G0GA 2I4LA 2P4SA 3W04A 2JEZA 1I9GA 1VYUA 2TSYB 3D0KA 2QL9A 2OLKA 1N8NA 2F48A 2XKKA 1MVOA 3W8NA 1R88A 1WN7A 4QYXA 1VHWA 2NU9A 4X71A 4TGLA 1K2WA 4HVLA 3ZE7A 4CQLB 1Y4AE 1HY3A 3MWYW 1X80B 1M1UA 1WF6A 3ELUA 4OFXA 4DJAA 3D8HA 3GEIA 1M34E 3I1YA 1LS1A 4XJTA 3FUTA 2A9JA 2VHCA 1TJPB 1TVKA 1MC4A 5EP2A 5GZ6A 2GNOA 4D8WA 2Q3FA 1BA3A 3NVKI 4JP1A 1NNUA 1LTQA 2B94A 4Y2YA 4ZJZA 1UFOA 3D81A 1SUEA 3H04A 3I5MA 2O0LA 4N3AA 4Q82A 3LVQE 2QMEA 4LHVA 2FLVA 4M9SA 4UBNA 5A7GA 4ESHA 5JV5A 1EVQA 4BLPA 3SIXA 4XYGA 5CN0A 3CCJV 2JLQA 4BNGA 2X86A 4G5GA 4MYTA 3X1MA 2REQB 1TA9A 1RHRA 4CF7A 1SBHA 1IX9A 5J2UB 3TXXA 3OTFA 1E5VA 4GKKO 3U7QA 3S8EA 2MMCA 1OAOA 2FW8A 1YJXA 5DH9A 3AHIA 2HFEC 3WKAA 3R66A 4RZXA 4IIJB 1KFKB 3VQTA 1ZVQA 1ZRNA 3JQ8B 1E6WA 2X13A 3ET4A 4FGUA 3QJGA 3QE0A 4BLVA 4KIWA 4MUJA 3IR7A 3GLTA 2LGQA 4NFSA 3NIBA 4RZ3A 2J31A 3A2KA 2Q0XA 1COWD 4F06A 3TD2A 5CEFA 3COVA 2F62A 2D5BA 4N5DA 2EL9A 4IS2A 1K7XB 5I9LA 1ZUNA 4EHDA 2YC4C 1UDWA 2XAQA 1MBZA 1B0ZA 1PJ4A 2Z2JA 4E11A 4C7OA 2NGRA 1ZLXA 1C81A 3GLIA 4B31A 3RUHA 1Z37A 2VPPA 3R3UA 5JC1A 2MR6A 1IEQA 2GFQA 4KZPA 1R5JA 4N47A 1O95C 3W1VA 3PS9A 4UTPA 4DT1B 2NZJA 3U1TA 3KTAA 1I1QB 2CLEB 3CN7A 1OI0A 2X6CA 1N4DA 2N47A 4UTXA 5GM2A 1AQJA 4B3TO 1JFFA 1L5VA 3NDRA 2C3OA 1Z7EA 4CKWB 1M2KA 4YRNA 4KXMA 2PJDA 2BELA 4Q9JA 1JJVA 3K57A 4JI7O 3WMGA 3OO1A 3CVJA 2FKAA 2ZSFA 3L4JA 5AUPB 2APJA 5TVGA 2HVKC 1ULUA 2BF4A 3V3KA 4Y6LA 5EJ4A 2VP3A 2D8MA 3G6BA 1KKLA 3HUEA 1PVDA 1WSDA 1JQDA 5FBKA 3EMDA 1FPMA 5E4TA 1UPUA 5IDVA 3H65A 3MAAC 1CNMA 1GAQA 1VMEA 3VZRA 2WJIA 3K20A 1L0NH 1O94D 5LBTA 5EQFA 3EVBA 3PQ6A 1XGKA 3T7AA 1TQ8A 3G2NA 1JFLA 2OCLA 2I7VA 1CUBA 3MFQA 1IBLO 1XTBA 4Q1FA 4RY9A 3RJZA 4URZR 5EZ6B 3FPJA 5IC5A 3HGMA 2X4IA 4C7KA 3TECE 4CN9A 3PXBA 2HHJA 5LPNA 4PSAA 4MJ3A 5L3VA 3HB5X 3ETNA 4ZVLA 1ZCAA 3SE0A 4RZ2A 2CL0X 2ZVPX 1AA9A 3TZCA 1YR1A 2ZQMA 4F8JA 4TXJA 1V4NA 3FMOB 4URXR 3FI0A 4Z9AA 1LSUA 1GTRA 4OCLB 2F4VO 1R8JA 1FDUA 3VZCA 3OIDA 4POOA 2Q67A 2YSUB 5A5GA 1ZHOA 5TQ2B 4MNTA 5LZ8A 3QLEA 4FSDA 2UXNA 4FE4A 4PD4F 1DQPA 1Q19A 4N49A 4UU0A 1N2ZA 1ZH0A 5CCBA 3UCXA 2WKQA 4ZZIA 2XASA 1SZCA 4UUQA 1GU1A 3WLOA 3D3WB 1UK6A 1Z33A 1RM0A 2E4XA 1QS0A 1YSBA 3KYBA 3M4YA 1MA0A 2FWRA 3AW9A 1OYWA 4J3NA 3A27A 2IWRA 3L1JA 3ZBUA 1RMTA 1PW7A 3U49A 1PQWA 4RDHA 3GPCA 1D4AA 3B1JA 2B8TA 2PN1A 1LI5A 3NJ8A 4MVSA 4GM4A 4N5IX 3G6WA 2DQ0A 1MZFA 1RM1B 2VBGA 3T5CA 2IQIA 3NGXA 1JT2A 2H5EA 5KHJA 1CQZA 4DYDA 2A8YA 3MTAA 4F4UA 3COSA 4B7UA 4WZ6A 5LQRA 4UC0A 2CTRA 3ABLB 3DD5A 1WA5A 5B36A 2Q5HA 4C05A 3VQVA 1Z4KA 4JX8A 4LF8O 4ABMA 2RHDA 2C5FA 1KRHA 3V3TA 4Y6SA 1QLJA 1UKYA 1QIFA 1EWVA 4FFLA 1COWG 4J9ZB 5DO9A 5CLHA