1P4RA

Crystal structure of human atic in complex with folate-based inhibitor bw1540u88ud
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 215
structure length 589
sequence length 589
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1p4rA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1p4rA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA02
1P4RA 2IU3A 1IK4A 1T36A 1EGHA 1C30A 1CE8A 1C3OA 1B93A 2YVQA 1PKXA 1VMDA 2B1IA 1WO8A 1S8AA 1JDBB 1BXRA 3ZZMA 2B1GA 4EHIA 1S89A 5H3LA 1OZ0A 1KEEA 2IU0A 1THZA 4A1OA 1A9XA 1CS0A 2X8WA 1M9NA 1M6VA 1G8MA 1ZCZA 2XW6A 1PL0A
chains in the Genus database with same CATH superfamily
5KUMA 2QMYA 1K3FA 4K35A 1PR0A 4LWPA 4D8XA 2OCXA 4Y1EA 4LFCO 3LIIA 4KO1S 3QHAA 5KTOA 3J81k 3W8NA 2YN2A 4FSHA 5AW0A 4RY0A 1Y6RA 4JI6O 2JEZA 4UZEA 5J2TF 2XUJA 4GEGA 4EPVA 2EIKB 3PS9A 5PNTA 3UW1A 1QLJA 1U2TA 2C99A 1JG4A 5B1BB 3P45A 4GKAA 4Z9XA 4C3ZA 4KFSA 3CX6A 4INPA 1I32A 4WOJA 1ES9A 4TKLA 2IJJA 2VUSA 3AG5A 1IQ0A 2XZDA 3MELA 3VSCA 2OR3A 1S01A 3W2HA 5DLPA 3RABA 3ZU2A 1Z7WA 3DPSA 3ZGLA 4AF7A 3H8WA 3I83A 2PD4A 5AKEA 4MYHA 1K0FA 1RIFA 1G55A 1EZZA 1KY4A 1YS7A 2Z58A 4G5YA 3B6IA 3S2EA 4RGBA 2ZKLA 2XCRB 2WEKA 4J6FA 4JI1O 2NZWA 3LUKA 3OGIB 2P30A 1FUKA 1R8YA 3KVOA 1P7PA 4R2XA 4CKEA 3I4CA 4CIXA 3KTOA 4WBSA 3I0MA 4B6OA 1EUZA 5KJEA 1FZQA 3BM5A 4JFAA 1X4TA 2RB5A 2EL9A 3LFHA 5EJ5A 5JANA 1K7XB 2FK7A 2ZTMA 3ELUA 3QYJA 3OH8A 4ODIA 1G1MA 1DC4A 3IT3A 3L8EA 4AY6A 3A25A 1NQVA 3TW8B 3W9YA 4YHHO 4IRXA 2B9EA 2CXUA 4NQZA 2P9JA 3RREA 1BJKA 2XZTA 3A05A 3HYLA 1QHGA 1PR5A 2RHWA 1K3UB 4H3SA 4BQEA 3EYWA 2OSVA 3TLJA 4HRXA 4QUGA 1DEAA 2K7FA 5CX1A 1PDWA 4EB0A 2C2AA 4EP1A 4EVSA 4QSMA 2EF1A 2LDXA 3DMNA 5EE9A 3C7CB 5J23A 3LSYA 2C2XA 2ZPTX 1D2NA 3LUBA 2DH5A 3V4ZA 1EX7A 5TSDA 5L3ZA 3V8PA 2DUNA 1IZ9A 1F1BA 1NQWA 2IVFA 3PA8A 1NVPD 1SD2A 1NZFA 2FDXA 2QX8A 4QRIA 2F7SA 1USGA 4L9WA 1DLIA 3DVSX 4FYPA 1U8UA 1PV2A 1SIWA 2AC4A 1L5ZA 3EE6A 2XSZD 1HC7A 1COZA 4J49A 4RQBA 4D4HA 5JCPA 2X6TA 1IXYA 5LUAA 1E2DA 1U90A 4DIDA 3R6TA 4H1UA 1C9MA 2PIAA 5DGCA 1JR3A 1Z8NA 2JFFA 3PUXA 3WSVA 5JU6A 3DWEX 1VJTA 2EULA 3D8RA 2ZNJA 4WESA 5FBQB 4Y2HA 1EFRA 4C7JA 4NJOA 3JYOA 2F48A 4UB6Z 3LUDA 4R51A 2VAXA 2HA6A 3ZCXA 2PUGA 1AKMA 3O94A 4B7KA 2LRHA 4HB0A 5IRCD 5IEJA 5TF4A 4U3JB 4PX9A 5CGQB 4OX9B 1NASA 2R48A 1MO3A 4PLWA 5AVJA 3T1NA 4OTZA 5A0VA 3P0FA 5IXYA 3RU2A 3WO1A 3IO3A 1YSBA 4ROSA 3FFXA 4QJBA 4UHHA 3UWOA 3OZDA 1B0PA 4G5XA 1SUBA 4GW3A 1PQUA 5HQ3A 3JQBC 1YU9A 5IJZA 2FXVA 3WLTA 1AU9A 4WZAA 1ZHFA 2XB2A 2Y1FA 3MJDA 4OP1A 3MWEA 4M9UA 4EX7A 5B3JC 3PP8A 3HBJA 4J2OA 1BN7A 3QX3A 2R7NA 1NRXA 1J0XO 1UPGA 1JUDA 4BFSA 2NX2A 3TCNA 3LSTA 5HIKA 2O06A 3ZBHA 1P5JA 4A10A 1VG0B 1AQ6A 5JJ5A 2YWHA 4PCLA 3K8ZA 2VHYA 2HX1A 2HLPA 2IH4A 4AI6A 3QKTA 2C98A 1T1RA 3PL1A 3O03A 5AT1A 4JTAB 2O1EA 3H3XA 4MT8A 1GSOA 4JEUA 1SZPA 2ETVA 3FPKA 1UWZA 3PJGA 4ZVRA 5LNK1 3AF5A 2V03A 3E58A 3RBZA 4PGMA 4UHJA 5LDDC 3PKIA 2PXHA 2ISQA 1N3LA 4H13B 1DAFA 2XVAA 3MCVA 4G9BA 1KHHA 3ESBA 4W1QA 4YC7A 4EUHA 3VDQA 4ILKA 2JKYA 4BRUA 5BY2A 5KOHA 4NCAA 1QR9A 1C8BA 4NBRA 1ZSVA 2O7SA 1C2YA 2FZKA 3RAJA 1WP4A 4EBBA 1Q0RA 3SNKA 1DAPA 1V35A 2PSJA 1SOWA 5I8PA 1HNNA 1H6AA 2OWEA 4ABMA 2FQ1A 4KIUA 3AEUB 3V48A 2Z2ZA 2IUEA 4F96A 2IKSA 2VBCA 4FX5A 1U8TA 1UC9A 3WV5A 1X7HA 2J9FA 4G8DA 2V7QG 3LT4A 5CNIA 4E3ZA 2PGAA 3AKCA 4NXNO 3GWKC 1FTYA 3ONFA 5D3MB 3UK0A 2VP5A 4B0PA 4E2ZA 1ZD2P 2RHJA 1DRKA 3OQIA 1R16A 2FFHA 3C3SA 2IOHA 2G04A 3FJOA 3FMFA 3IUNA 3DE3X 4JI4O 3BB4A 2UUPA 3JQCA 2WIKA 4CXMA 1IZ0A 3LX6A 1AS3A 1TJNA 5EWMA 3QF4B 3WOVA 3TG2A 1ZZEA 2H51A 2JK1A 1T1GA 2JBAB 4PPFA 2LIVA 1RC1A 4E5KA 4KPEC 3UA3A 3AF0A 3P9ZA 4G5QA 1FTSA 5J4VA 3G6WA 1WA8A 3VA7A 2OBCA 5KPJA 4X1KA 3KWFA 5L3RA 4J11A 1IBLB 2J0UA 1MD9A 2FP3A 5AOVA 3KL2A 1UAQA 4HGOA 4ZGGA 1THGA 3KM0A 1K7DA 1GITA 2XKAA 1EXMA 3ACCA 2ADOA 3C4VA 2C9DA 2H63A 3LSUA 4GOJA 5I7EA 3OY7A 3ZV4A 3ZWCA 3MBOA 3ICPA 4K87A 1VP9A 4X1YA 1QKKA 4OCNB 2NWQA 3CCCA 2ODQA 2HA5A 5A62A 3TM4A 3FUXA 4FDAA 2HVKC 5HIIA 3STWA 2R44A 3ORHA 2ZBPA 3QMMA 2VTBB 1NBEA 4URUR 3N8KA 4JA0A 4Q3DA 3LHDA 1E77A 3AGQA 3OE7G 1ZA2A 3BWEA 1IDSA 1JKIA 1WY7A 3F9IA 4G56A 5CLHA 1VE6A 1DBQA 5H5JA 2FEAA 4F5DA 5EP1A 3FGZA 2BFBB 4O3MA 4Y2XA 4IOKA 3R3WA 3WYBA 4F8JA 1Z4OA 4BV3A 3AEQA 2XHBA 2WHRA 3P19A 2P2GA 3IFSA 1AN0A 2H7XA 4DS3A 3MLAA 1AKNA 1OLXB 4I55B 2HLNA 1DKPA 1P0FA 1QG2A 2QXTA 3GXBA 5JSQA 4HZUB 1SVIA 3N8IA 2PI5A 1SCIA 1KECA 3FYDA 4GKKO 2MSDB 4BC1A 1GNTA 2X77A 1T9ZA 4G1MB 1A5SB 3GGJA 4TT3A 2Q3BA 4IXDA 4NYJR 5DTEA 4Y98A 4YV7A 2WJAA 5ALDA 5F78A 2HBRA 1TYZA 2F8TA 4NYIQ 1P49A 2CDAA 1M6EX 4LVCA 3TQFA 3WMEA 4EHJA 3W06A 4TMTA 4LCEA 5EBLC 4OL0A 2G06A 2NXJA 1W85B 4WBNF 2V59A 3TUIC 1ZGAA 1Z33A 2RHLA 3B3JA 5ICGA 4K3UA 3NVMB 3L1JA 4J7UA 3SJ7A 2P90A 4Y2RA 2OCKA 1SBZA 5TPWB 1DEOA 1K9MW 1R1DA 1FS5A 1CUEA 1S2OA 3K04A 2CD9A 2YJGA 3ANXA 3IAAA 1IQUA 1PT6A 4Y9DA 3UFBA 4XLZA 1UPAA 5FHQA 3RC3A 2H3HA 2XTNA 2A5GA 4EH1A 5B5EZ 5LU8A 2UV8A 3TNYA 1WZNA 5HDQA 5TQ0B 1XMXA 2H7VA 2Q6TA 1MRZA 1XAJA 1RFYA 3M6FA 1ONBA 3I0NA 1JI0A 3L7KA 1S96A 4GM0A 1KH2A 1E79D 3GLHE 5AOAA 1JDJA 1PS8A 2CLCX 4J1TC 3C1OA 4KZPA 3PIIA 3V1YA 4R69A 5H8WA 2PUDA 1NKDA 3K16A 1JTVA 3AR2A 4OYHA 3I1YA 4HLQB 3M4YA 3PXCX 4UM8B 3DOJA 3T4PA 2QUJA 3K9QO 4XX1A 3GLFE 4GT1A 1GN4A 1GAXA 2Z5FA 4JSRA 3WLJA 5FRDA 1T5DX 4HGQA 2SHKA 1I5OA 2ZT6A 3AF2A 3R5HA 2A5YB 3O83A 1YXBA 3G1TA 1KI3A 5B1SA 4BJ3A 3COVA 2A9HA 4IDAA 1IOLA 1Z5UA 2I99A 3ZWYA 4AJ2A 2Z6UA 2ZT8A 1XQ1A 2FUKA 3LIPA 3MT9A 3QM1A 3QLJA 3U16A 2E37A 5HKKD 3W5BA 2RGRA 4Q03A 2YVAA 4BFLA 4D8TA 4YRGA 3N27A 4RVDA 5KCMA 3CCFA 3T54A 1QFZA 2J30A 4IV8A 2O2XA 4B31A 5TNXA 3U4AA 3DZBA 5AKKA 2C9ZA 1QIDA 1RYFA 1PZHA 3D4LA 4HG2A 5CW2A 3RJMA 1JHQA 4RIEA 3RS3A 2RJZA 3VKWA 4CG1A 4MPTA 4EIWA 1ECFA 5GADl 3AOEA 3W2IA 2FR6A 2Q68A 3ZD9A 1DJPA 2RHGB 1KY3A 2V0CA 2Y4NA 4ONEA 3E84A 1NW5A 3A31A 3HCPA 3NM6B 5EHXA 1M7HA 1CQJA 3PWSA 2DULA 3TQIA 4DE5A 5DNUA 1K2VN 3C5WP 4KYVA 3PQEA 5EE0A 1GDTA 1DE0A 4D9NA 1KKUA 5T6MA 2MYTA 4BO0A 3MA0A 2UUAB 2P4QA 3ENZA 4HTFB 4OKNA 4D97A 3M99B 5B5SA 4I2VA 4FFSA 3RN4A 1EWTA 5FNZA 2A5LA 4DV4B 2JJ8A 5HRAA 2Q8VA 2MSLA 2W2VA 3L9WA 4CQLB 3A2NA 2FPOA 2QM8A 3J80N 5JBQA 1RRGA 5LZ4A 2QWRB 2RIPA 4JYMA 5DI9A 1XFDA 4Z8YA 2DTXA 1C50A 1Y1SA 1BU5A 1YCIA 2K2QB 2YJ6A 1IEXA 4K81B 4LI0A 2VCHA 4U7FA 4N0PA 2Q49A 2QRHA 2ZKIA 3RVLA 3SBXA 4G2KA 5B12A 2G0AA 4JI3B 2AZ0A 2I8CA 1FU8A 2VSXA 1ABEA 2HREA 1HLGA 1C7EA 1VXRA 3LX4A 3HCDA 2Q45A 3FOWA 2EFEB 3W6OA 4NOJA 3BGOS 4NE9A 1XLTA 2MSNA 2PW9A 5JSKA 1RFLA 1TKBA 2HRZA 3NEAA 2RMKB 5AJHA 4BQOA 3M34A 4Y9UA 1D8AA 1M57C 5L3CA 2OGTA 3KAQA 1ZGCA 4JKYA 1DDGA 1TI7A 1SNYA 4Q4CA 4ASUA 2F1HA 2NV2B 3H5NA 4D98A 4F9FA 1G0OA 1GZ6A 2Q7HA 1N1EA 4G67A 4FIZA 3VV3A 1FL9A 4DJDC 4NTYA 4B4KA 2ZNRA 1YA8A 4O8XA 4TKVA 2VWKA 2W4IA 1WDLA 1T2VA 2CMDA 4C0AC 1YE3A 2OO7A 5A06A 4AVYA 3L0PA 1BCRB 2CVHA 5H9CA 4LHVA 1CEZA 3OE7A 4XPIA 3S2UA 3QNEA 1M83A 1KMHB 2C61A 1R12A 2SKDA 4KPFC 3PUKA 1QV9A 4JC5A 3S4YA 4HPXB 3DBRA 1QCDA 1YR8A 4HBNA 4UVHA 5KNDH 2IH2A 4PELA 4K26A 1IIBA 4NAHA 1O08A 1K9SA 1NI4B 3C45A 4KGXA 4FB5A 1M0SA 1XL1A 4UEWA 3K9NA 1CRPA 1UBSB 4HD8A 1GVNB 3ROQA 4AX8A 3GK3A 4JI2O 3OFKA 3UWPA 3NR7A 4OQDA 1NT4A 3S7ZA 1UKAA 1OLXA 2PWBA 4EI2A 1KFCB 3AR9A 1I51A 2QD1A 8LDHA 3A3YA 2Q4BA 4YQZA 5FPHA 1R5OA 2ISSD 4AW9A 2IPMA 3K08A 1SC9A 4YXWA 4CYMA 1XMSA 4BLOA 1JU3A 1JQEA 4WH0A 2ZITA 4WKNA 5GOTA 3UENA 3KJQA 3L7YA 5YASA 2V4UA 4F4JA 2UUCB 1O8CA 1BXRB 2EFGA 4MB2A 1JFSA 1I3OA 1OIVA 1F8GA 1R5NA 1WXQA 3B53X 4Q02A 2OLKA 2B6HA 3HK2A 1HYGA 2ZIEA 1L4MA 1N6IA 3NFRA 1AZLA 4G2NA 5IC5A 1DBIA 1M6VA 2ZCVA 2ZQ5A 3ZHOA 4DMMA 3D5TA 2G6TA 1ZJZA 3DAOA 4R7GA 1U80A 1HYBA 1Y9JA 1PLKA 4BNJA 2I03A 4J9YB 1J0DA 3IIMA 3JQ6A 3K0AA 4QYWA 3EW7A 1FW6A 3HKDA 2PKRA 1B06A 4PDRA 2WPDD 2QRPA 2WHPA 3GGDA 1UM9A 2A67A 1DEHA 4JGSA 2F9LA 2QQGA 2VQSA 3KOZA 3K5OA 3L4BA 4S24A 5TS3A 3I6BA 4LXTA 1HM5A 3OZWA 4JMPA 4UMVA 3NJ4A 3ED5A 2RQ6A 5B3SC 3LVFO 3W2EA 4DPMA 4YAKA 3GLFB 1R10A 5TVGA 1D2RA 2P41A 3NBUA 4HWKA 1YASA 2WD7B 4AP9A 1FFBA 1MJNA 1XXLA 1GN6A 5C93A 1L0BA 2G70A 3MINB 1DPFA 4JR0A 4L7VA 4OATA 4MVJA 3SX2A 3U7RA 2FZ5A 4KU4A 5EJFA 4HJRA 1H85A 1B6TA 1FYFA 1OASA 1SF9A 2OBFA 4DCUA 4BLTA 1TCCA 2FR5A 1JSCA 1JLSA 1Q0PA 3CT4A 3TO5A 3GJRA 1T3SA 3U5ZB 2WU1A 3LHFA 2QN1A 3SGIA 1G41A 2QZPA 2ETNA 2R1UA 4UXNA 5KUTA 1NLMA 2WTMA 5ISMA 5KDDA 4YRAA 5K03A 3T94A 3MFYA 1W0KD 2PKXA 3WY9A 3LDUA 1Q1QA 3UGKA 2WLLA 3ZWPA 4AUNA 4QC2A 4UBNA 4ZJPA 1G19A 1WCV1 1AUQA 1ZMRA 4P38A 5AK0A 5DM70 2CFIA 3W4IA 1E9SA 4UTNA 2JGLA 4F2WA 1FFXA 5JS8A 4B2IA 2R1VA 2WWTA 3FMOB 2R60A 2CNKA 4LBEC 1H22A 2GEDA 2J7PD 2WM9B 3JAWA 1L6RA 4MKHA 3NKVA 4IVNA 4QNRA 3LLVA 1VPTA 3PQ2A 4RTPA 4P4GA 3KHTA 3HXTA 4JYZA 4F5WA 5ICSA 2QVLA 2WFZA 3LVQE 4HNRA 1NI4A 1JA0A 4TXHA 1JJ2U 2Q21A 3L0IB 1P74A 3LF1A 1YTUA 1WWKA 1KWKA 4OGWA 1AF7A 4EHKA 3JQDA 5ESDA 3GEDA 4QIWF 4M0CA 1THTA 2ZQMA 1CIPA 4E09A 3B2QA 1NBIA 3GDWA 4OBEA 3ZG6A 4LC5A 4M2LA 3GFQA 4DEXA 1DLBA 2DPHA 5BR4A 3TB4A 3ZTYA 3GPLA 3G9TA 1IAQA 1TT5A 1Q2UA 2OAP1 2C20A 2FF5A 2X6RA 5GWXA 4E2WA 4F9GA 1CS4C 3HVJA 5CEFA 4J4TA 2P8RA 3ESQA 5T64A 2QMEA 2VLIA 2ZLBA 4X20B 4QJFB 1PJCA 1C80A 3P20A 2QR5A 4FW9A 4L08A 5BNWA 4YQEA 4TL6A 3DDCA 5KMGB 5HFNA 2ZRCA 3WQHA 3ZY3A 3PVSA 4FFDA 5JI2E 4GZLA 1EN5A 1WSAA 3N76A 3ZWQA 1I3NA 1RPTA 2AXEA 1DKRA 4W8OA 3OU2A 4UREA 3F96A 2W0XA 1EHIA 2CXQA 1XTBA 3PVZA 1BX0A 2BEVB 3IOMA 3W3AH 1Z4MA 4D8YA 3ANLA 2ZTUA 5D3KA 2O3UA 4ZVUA 4BRSA 5FUMA 5KNBD 5KTMA 2FP4B 5IAGA 1F0YA 1FNMA 2WAMA 3VTAA 3I6MA 2UUCO 3OC0A 3OM0A 1GT6A 3A6KA 4TXLA 1SVMA 3GJ3A 4FBMA 1V6AA 3KR1A 2CMKA 3O8OB 2VHCA 2KSQA 3UNXA 5LQAA 1QU7A 3CWBH 5DHAA 4DJJA 2ZYTX 1JQ0A 2R4UA 1GPNA 3TL6A 2E1RA 4M3NA 3B3AA 4YB8A 3HB9A 3M7IA 3CRNA 4PHTA 5FT9A 3ROXA 4CR6A 1NXSA 3TXAA 1CB7A 4CMIB 4X1IB 3HDVA 1NYTA 4BR6A 1SXGA 2P9QA 3DHNA 4FDMA 3KKOA 2VH5R 3Q3JB 4KPGA 3MWJA 3WDLA 4N1AA 5LOVA 4LK3A 5AJZA 3NWOA 1T4CA 2EHDA 3ODGA 2LQTA 3ABMC 4PSAA 5HE9A 1T36A 1BKDR 1N36O 2O3KA 1JBQA 2P0EA 3F4KA 3KFXA 2O50A 4FHFA 3U9SA 3ZDCA 4YDSA 4DB2A 3NORA 4KXRA 2ANBA 1KY5A 1N1DA 1A5ZA 1XZMA 2AV6A 3UJDA 3DP7A 4L8YA 1KPGA 3WXBA 4CN8A 2CBGA 3O4RA 3VNQA 3U26A 4RTLA 4CKBA 1JFFA 2OHOA 5DN9A 2AOTA 4YCMA 4RK7A 2E4AA 2RGNC 1EXNA 1K27A 2OK8A 3WDMA 2KE5A 2EIJC 3CHXA 3DD5A 4NONA 1LCIA 2EOAA 5EWJA 4LDNA 1TUGA 1KEKA 1MW8X 2OPBA 2PGJA 4DOMA 3UCFA 2H9YA 2C8KA 3WWZA 2O59A 3H6HA 3OD4A 1N9GB 1UIMA 4UFOA 1XZEA 5KLVH 1KAGA 3HA2A 2DYRB 3AR7A 4LY0A 4IYRA 3NRBA 4GXRA 3L3BA 4I66A 4Q24A 4QBFA 4YQYA 1EP1B 3A9UA 5E3JA 4C05A 4DQVA 4R0VA 5CEEA 3HQ4O 3A6DA 3AVXA 3RE1A 1ONPA 2HJ9A 1W7AA 5IEBA 3OKFA 3OEHD 4GXNA 2ZANA 1GRVA 1P2SA 3THSA 2JVIA 4L3VA 1ZL2A 2PZGA 2C2OA 5JAQA 4JZGA 4L8FA 1LDYA 1OA0A 3NFYA 2GS9A 4H16A 4K46A 3ZDBA 4ARIA 1XQVA 3S5UA 9LDBA 2ZRLA 1GEGA 2AKYA 3ETJA 4MVYA 1I4TD 2FCAA 2WA3A 1JBKA 3L4SO 4FT4A 4JUAA 3W2GA 3WK8A 4ARVA 1UFRA 1XI2A 3HA5A 2H57A 4C07A 3MW8A 3OF3A 2C97A 3CUSA 5B2ZA 2Q5FA 2GSMB 1JHMA 1XDSA 3DVLA 2DN9A 5EXXA 4DZZA 3AJAA 4CLRA 2GSWA 2OZEA 4PLPA 4HUQA 1XEXB 2VF4X 2H92A 1H6CA 3BG5A 3QFFA 4FPPA 1S02A 2QRNA 4O6VA 2NVUB 2GD0A 2CLSA 3OT1B 4RELA 2VG8A 4CIBA 1GA4A 1DUIA 3PGA1 4PSVA 2IV2X 4YRIA 4WLNA 1D1SA 4S04A 5IVHA 2JATA 1PGJA 1L0LH 3LF2A 5HS4A 2RDCA 3IDSA 2ZRIA 3A4TA 2GJKA 1VIVA 3ABTA 4JJ7A 1UADA 2BE7A 1E58A 2Q4RA 5ICEA 2KX7A 1NJGA 4AY2A 3SZLA 3A3KA 3GD7A 3LYHA 2X1VA 5A3QA 2OQVA 1LWNA 3OQMA 3BHMA 4Q4AA 4IT5A 5I5EA 5FR1A 4JP1A 3IQXA 5LOVB 1Z2PX 3OHSX 1IN6A 1CE8B 3OP1A 5C8XA 1UPXA 3SFZA 2VI5A 3IEMA 3RYIA 1PF7E 2CNBA 4L8VA 5EMHA 2I65A 2PL5A 5GGYA 2W0FC 1JE1A 2B9ZA 1ISPA 4UUOA 2RMKA 3PU6A 3E9ZA 3WG7C 3AZPA 4KYIB 1Y7LA 4ND1A 5ESXA 4KVFA 3VC2A 2FSGA 1CUUA 2G1AA 2H2AA 2RH5A 2C4VA 4TLMB 4A8PA 4MJLA 4ZJUA 1MNAA 2Q28A 1AI6A 2ZWIA 2GTAA 5HF5A 4F3WA 4P9DA 2QKSA 1G59A 1JKJA 1P1CA 5CBGA 1T10A 1HKUA 2GFHA 3A14A 2NU7A 4QD3A 3RNOA 1P5RA 1R8JA 1UJBA 2B20A 4N5IX 4RF3A 4ZOQI 1G18A 2ZZMA 5JJIA 3GDOA 2YZGA 3N3BC 4KNWA 1F48A 1EXVA 5DU2A 3N8NA 3GPCA 1QS0A 5LP6F 2C5GA 4GMKA 4F5EA 2ZDIC 4H33A 1E9FA 1R0XA 3BK7A 2X7RB 5KHIA 2BJVA 1PNTA 3DL4A 1M6NA 3LI2A 3MGAA 3ABUA 3CH5A 3HYSA 4NS1A 4Q93A 3GLIB 4PVDA 1U0SY 2A9JA 2I5PO 4AMYA 1U5BB 3JD3A 5FBRB 4OHZA 3RPEA 4EVRA 2VBGA 1N9KA 5J4YA 1SCNE 2BR5A 4DGSA 3I9KA 2FN4A 3FHLA 2HF8A 3NWJA 1MOFA 1THMA 3GH1A 3FUUA 1KEVA 5CM9C 5AJWA 3FXAA 3EIEA 4QWMA 4DR5O 3R5KA 3PLNA 1UIRA 2PRIA 3QUSA 4GVPA 4NL4H 2WJZB 3IAS1 2MT9A 3FB4A 5DYTA 3S44A 2QAGC 1G8KA 5AVUA 3EVNA 4KB5A 2PFSA 2FR0A 4KPYA 3CW9A 4AKEA 3TW4A 4KN5A 4C5BA 3QXJA 2ZIWB 1K7EB 2EJBA 1AK1A 4AQYB 2F6RA 3CNLA 3MXOA 5BYAA 1P7YA 3NDRA 3MOGA 3ZK7A 2ENUA 5LVAA 1HDJA 3O9VA 2P9BA 5ALQA 1VHJA 3HJHA 2ATXA 4UE2A 3TKLA 2KW5A 3ZY4A 4M0PA 3E8XA 4IYIA 1R9JA 2WV9A 3OQ1A 5KKCA 2WYOA 2AT1A 4CM9D 4V0NA 3OT4A 2O23A 1TD9A 4O4HB 1G20B 1NVMB 5KQRA 1UC5B 1T9HA 1H1LB 1JAXA 2CEKA 2PKEA 4FE7A 5AP9A 3V9AA 3WTBA 1WN6A 3AVQA 3FMIA 4C06A 1YFZA 4K8RB 3PC6A 1ND5A 1IB0A 5CM2Z 5TIIA 1B00A 2C0QA 2XLBA 4L07A 3MTAA 3PUJA 4IH9A 4WW0A 1XTKA 2QMQA 1P4RA 1R6KA 4DR1B 2DKFA 2ZULA 4B1FA 1VJDA 2BSKA 1FNBA 3RBXA 3GUHA 3ZNQA 2WLNA 1EKXA 3WADA 1J56A 5C8YB 5C34B 2GFQA 3N6VA 1FUEA 2J6CA 3FYHA 2B3DA 3D2CA 4HDQB 1O5OA 4KO3S 5FWXA 2PX2A 3UMSA 1V6CA 1M56C 3BZBA 4DJTA 4GL4A 1ALNA 2MINA 3HPQA 4OX9Y 2J6IA 3BJZA 1XZJA 3O73A 4IUBS 2Y9MB 4TMKA 3CF6R 3J7TA 4AS2A 1ZK0A 5DW0A 4DJEC 4M98A 1YONA 1TK9A 1V55B 2GTIA 3C6MA 3QYAA 1G2OA 4AY4A 2RGBA 2OV4A 3DMFA 2CH7A 1V3VA 1KR2A 3G0BA 2NIPA 4H3KB 4R3WA 4MZXA 4BV9A 1UBMS 3NH6A 2J9ZB 3N1UA 1U6KA 3UG6A 1UT8A 4NU8X 4CU5A 2W22A 3CPSA 3IT1A 5GJWC 1J07A 3B9RA 4A2QA 4YQFA 2C2YA 1I8TA 4P4TA 3R5TA 3QFSA 2IHKA 2WOOA 4ZK6A 4ZGWA 1ECBA 3PA6A 1WDTA 1WTAA 1XKLA 2QP9X 1HLDA 5L6MB 4OD0A 1AR1B 2GBLA 3I9FA 1O89A 2EQBA 3M8KA 4PCVA 1BT8A 1LVHA 1XG5A 5BN3A 1XEWY 3TAHA 1XDGA 2A78A 4ME6A 1Q77A 2VL7A 1OOEA 4X8MA 2XMPA 3VPHA 1VK9A 3CC4V 4DUZB 2C84A 1FFYA 2WJJA 5CXXA 3D81A 4N3CA 5FA6A 3VSEA 1O6CA 1E8NA 3UAYA 2R72A 1RDFA 2R7KA 2QRQA 4M8LA 3ZWNA 2XIJA 4W1RA 4F72A 3C90A 5AVYA 4FYVA 1B7GO 3BX1A 1QXSA 3BTUA 3T95A 4OLBA 2RH8A 4RO2A 1E1LA 1K5HA 3I04M 1J0BA 3ZI4A 4C78A 1W5AA 4LZZA 1SY7A 5KA6A 3KPJA 5FTJA 2NYTA 4GPIB 3LK7A 5HJ7A 3K9FC 4JQOA 5JQGF 3AESB 1OBFO 3I42A 4U6SA 2XAQA 4YI5A 3NVAA 5EAIA 3WJ7A 3R2NA 2VDWA 1JB9A 4H17A 3RSOA 4YDQA 1I7SB 4MS7A 1KHTA 3CYOA 5TISZ 1M34B 4UCUA 2AC2A 3I9V6 4CFZA 4ZYVA 1QZUA 1XK7A 4BTLA 5A9SB 4Q1AA 2B34A 3E22A 4PCAA 1F3LA 1MEOA 3L06A 3N59A 3LXUX 4MYRA 1SPBS 1DQRA 2CUNA 2ILVA 2W4QA 2X5KO 4DZTA 3NDBB 1TU4A 2AR0A 5CT5A 1YACA 4F6LA 5GOZA 2ICAA 2QI9F 3GLKA 3GXOA 2ZJ7A 3BCRA 1S7CA 2CMFA 1A9YA 1W5TA 2IYQA 4TT8A 1WPBA 4DSNA 3RU9A 4ZVMA 4F9TA 3BFVA 4RV4A 3VMMA 3TGLA 1RE0A 4HRQA 1CUBA 1BXGA 3G68A 4HVCA 2PRSA 4R6WA 3CS3A 2V6MA 2Q6LA 3NU1A 1EJBA 4KH1A 3R9XA 3ZZMA 1Z4JA 1PL7A 1SC3A 4G0ZA 3O2JA 4UDOA 2AMLA 4AO7A 2HTFA 4CGZA 4XRRA 2ZSEA 1Z63A 1O7JA 3KUCA 3NS7A 2Q0HA 4KWEA 2VT6A 4D43A 2EKQA 3OE4A 2R4QA 1IHDA 5LQCA 1XRMA 1IXSB 1UPBA 1NN5A 3KKEA 1HDYA 2WU8A 1N7JA 4QODA 3OEEA 3ABQB 4EF6A 4DMRA 3DOFA 3AEUA 3HYRA 3UJPA 5FBWB 3V8MA 3G6BA 3UMGA 2N05A 2WKPA 3IVGA 1BGVA 5CA1B 1YUNA 1N6OA 2AK2A 4Q3NA 5H82A 5LL6Y 1E7QA 4MQEB 4KUHA 1KE1A 1H1TA 4HYOA 2HO5A 4GLFA 1L8LA 5LGTA 4QPJA 3GVHA 2ZEJA 1OBCA 1U1IA 3A9TA 3SF0A 3NCHA 3ZWDA 5ALUA 2HVWA 3KQQA 3OTWA 1VMDA 2EKZA 4PC7A 2ZIAA 3EZXA 2OLEA 5FWDA 1N4AA 4L5CA 2SICE 3D6JA 2DMXA 3B78A 3GEPA 3PT9A 2Y0PA 3KALA 1A27A 1GTVA 2YTZA 3K59A 1MTOA 5DBFA 1UR5A 4ZQFA 3ZPCA 4QYIB 1MR3F 4AKHA 4L9SA 3IKLA 4AZ3B 4CR7A 5IT5A 4D74A 4UCRA 2QVGA 3JQ9A 3FPCA 4HH3C 3AGPA 4FEEA 4WIAA 4B85A 2HLDA 1UPTA 1XVTA 3ETNA 3G1WA 1WXIA 3EXFB 3RG2A 4A6XA 1O6ZA 4DBLE 1P18A 2AMVA 5JEEA 3PHCA 2FRDA 3IBTA 1CPYA 2G0TA 2QAJA 5KX5B 2B8EA 2FGKA 2I80A 4KQCA 3OURA 4HLCA 4HSGA 4FFKA 4MS3A 4WCFC 4C7BA 3IQEA 3L4BC 1L7BA 3VPDA 2IEAA 4PFSA 1GPH1 5C0OE 2Q6OA 1ZHOA 3IC5A 1NW8A 1W5FA 1WUHS 2RJOA 5AW1A 3D1JA 3B70A 1P75A 5HW0A 4YR7A 3WQSB 3Q0EA 3INRA 4KXVA 1YHQV 2W2KA 3C3YA 2DCMA 4MCJA 1L4UA 2VXCA 2MINB 3B3FA 5C8VA 4K0KB 3BCCH 5U4QA 3GJQA 4X65B 3O7MA 3ORFA 4Q3BA 4UAGA 2GAFA 4WK6A 2PUWA 3G5UA 5FWNA 4I1PA 1A9XB 3T3HA 1YTFB 2JIZA 1AF4A 3D6NB 3SM9A 5T8KC 1KMMA 2Q2VA 4HYTA 1E5DA 3L8CA 5AW2A 4BQSA 4NJMA 2I55A 4NZZA 1AGXA 1QC5A 1UMCB 2CNNA 1RHJA 2RH4A 2FVYA 4QOFA 4KTVE 3S0JA 4JC4A 4HZ3A 1PJ8A 5BWNA 1T4MA 1F4NA 2NT3A 2HAEA 4NYKA 5IJ0A 5DHTA 1OGJA 1JEAA 1E2FA 4Q3LA 4WSOA 4I0XB 3M3HA 1N2GA 4LFBO 1J6UA 2VBFA 2H54A 3HFRA 1QGUA 3VKHA 1U0TA 1VQ2A 3C41J 2CL7X 3Q9SA 4OHPA 1RWQA 4OMCA 1WKBA 3R75A 5BURA 1WP8A 1DG9A 1F9AA 4YIPA 2HRQA 5DNWA 2CJWB 2OC4A 2NP6A 4C88A 2P9CA 3QEAZ 2FN7A 2OUIA 1E3SA 4AMBA 4RY8A 4LXYA 3F4LA 2AYZA 1WCIA 1LEHA 4KVAA 4FYKA 2D3TA 2X6QA 4DA9A 4F97A 3BD7A 3H8SA 3U7QA 4RM3A 4L6CA 1DKOA 3N0TA 4MRRA 5IDXA 4WFHA 2LKDA 3Q72A 4EGAA 3OESA 3VYRB 3I62A 1RJWA 5KYXA 2HKOA 1S8NA 1IDN1 3EN0A 4U7WA 1AURA 2L6LA 2DFNA 3PEVA 3LBIA 1UT6A 8GPBA 4GPD1 2I8LA 5HRUA 3I45A 1VKHA 2C7OA 2BBTA 1UXOA 1H8ED 3TW6A 2ABWA 4MV3A 3VO9A 1WXEA 3BMXA 3RASA 3JQRA 5KTYA 2NZXA 4CEJA 3EJWA 3U31A 4EITA 3FVRA 1I4LD 4QDTA 5D8DA 5LB4A 3G0HA 4NQRA 4I3HA 1JL3A 3OA2A 3PXEA 1NU1H 4UKDA 2YWJA 1SU6A 3H0EA 3D9QX 4IHQA 1NMXA 1KSGA 3UICA 4D9GA 2OHHA 3DV0A 4MTFA 3B2EE 3RS2A 5L3VA 5FXMA 1D5NA 1JHVA 1D5AA 3QYPA 1MVLA 3M2PA 4P2GA 1AMOA 3T99A 2PWPA 2B83A 4PA6A 1NW6A 1QU3A 4MTLA 1DWQA 1NRIA 2YMMA 2IE8A 3FHCB 4KO2S 3TI9A 1IUNA 1DIGA 3AHIA 1CUIA 4HDMB 2GPJA 4RH1A 2B78A 3VAYA 4E5SA 4I50F 4YMUA 1UDWA 4G0MA 3X44A 1ULTA 3LRPA 1NBAA 6REQB 1RCTE 4FLUA 2X3YA 2I87A 4IY1A 1C3OB 4JTCB 2G28A 1GU1A 4AI8A 3OEHA 5D85A 4ZRDA 4C1BA 4N5HX 5K2OA 2MSKA 4ZDJA 2ZWOA 3VBCA 3VBBA 2QX4A 621PA 1I33A 1K75A 3LHIA 4J8PA 4PQGA 2DPLA 4YV0A 4UHFA 1GCGA 3R6WA 4M55A 4R83A 4WOPA 4XIIA 3I5UA 5EMKA 5IAKA 2ZB2A 4F1KA 1EE9A 2F1IA 2ZE5A 1RWOA 4FD2A 1Z4IA 2Y76A 1CY8A 1YBVA 5AK4A 2WFLA 3UK7A 4DLKA 3O8RA 2WSSG 3D43A 3EBPA 1R7RA 2XUKA 4TGLA 4DSZA 1FXWA 3VSBA 4R40A 3REOA 4XQ0A 5HILA 1ZO8A 3SR0A 5EWJB 2O0JA 4XYLA 3IUYA 1USKA 1OUMA 1PIWA 2B4RO 3FBWA 3ZV7A 3QO5A 4JLMA 3ROMA 1XYGA 5HYVA 2PGIA 4O4JA 4MW2A 1VLZA 1UKEA 1ECLA 1JFVA 2BFDA 3D1VA 4HN9A 2P4KA 1WS6A 2QRMA 2H1CA 2PRJA 2HU7A 2YN0A 3F7OA 5CLIA 4YNBA 4Z99A 3W5DA 4O2AA 1KQSU 1Y8RB 2COEA 3BILA 1Z3IX 3QMPA 3GFGA 3C8HA 3HJTA 3NJ8A 4MR7B 1X80A 1HDXA 2ZYUX 4RDCA 1MHPA 2XA9A 3D3WB 2AXTZ 1N92A 1Q7RA 1UL1X 2XWPA 5DGHA 2PUCA 1GZHB 3OU6A 3IQHX 2CZQA 4WNIA 5B64A 1ODJA 2A9VA 1CY2A 3G8QA 3FROA 3VR3A 1X6VA 3ELWA 1KS9A 3ZNNA 3E05A 2IX3A 4MVCA 4C2AA 1NS1A 4EI7A 3ABIA 4HDMA 4F06A 4IJ5A 5HA5A 4WASA 2ZI9A 4OXYA 1Z6ZA 3JWIA 4K9QA 4D79A 2WJHA 2Y05A 3C5CA 1EUYA 2WIGA 2C4UA 3WWDA 4PAGA 4PG8A 2OG2A 4L3OA 4QDJA 4KO8A 2PO5A 1DGSA 3H42B 4L4ZA 1J8FA 2J0VA 2LPMA 4E5NA 2FW1A 1Q3TA 1AQYA 1LK0A 1F38A 2EWWA 1L5GB 4B3SB 2H9IA 3NX4A 2I6XA 2JCBA 3FYCA 3KNZA 4U8GA 1GGFA 1QFXA 1ZK3A 4D5GA 2RHDA 4GOKA 2R8OA 3FETA 3HGQA 5FL3A 1GTRA 1GNVA 3LW8A 1H2HA 1JR6A 3IPRA 1Y81A 1ROPA 1PEAA 2HBYA 3HG7A 3PE3A 4FP9A 5FLKA 4FFPA 2IH1C 4LN1A 4MB0A 4X54A 4QNMA 5CJ2A 4DLYA 1JHXA 1RYHA 2GPYA 2HMUA 4FJCC 3O3NB 3PUIA 2RCNA 5FQOA 2JLZA 4XYBA 3BIJA 3T4XA 1DX9A 2O3TA 4EPXA 4ASUG 3N0RA 1HT1E 4RQAA 3CRAA 2BFPA 5HOQA 1PNRA 3HJCA 4YONB 2XE7A 3WHIA 1IBCA 1ZIYA 4FX2A 4DR7O 2JC3A 4NJEA 3DT6A 1HLPA 4XVHA 5HM8A 4DYLA 1FU7A 1IY0A 1AK2A 1RPAA 3BF7A 3N05A 4O08A 3M70A 4P92A 1F6BA 3DP9A 4BNVA 5JTTA 3BE6A 4L3WA 5E2BA 4EF5A 1NSYA 2QA4V 2J9GA 3CCJV 4IDCA 2QLLA 3BWDD 3BHPA 3CWZA 4BAUA 2XKKA 3EULA 5E6RB 2DXIA 2BEWB 4IJKA 2C8JA 1EM8A 2PLWA 3O0TA 2RI6A 1IN4A 3G2PA 4EG4A 1AR4A 3R0XA 1PLJA 4B47A 3UPTA 3UKMA 4B8WA 1EQAA 1Z08A 4MARA 5JQWA 1P5HA 4MWTA 1EIZA 3PGKA 4BO8A 4CL0A 1EE2A 3LFUA 2XCOA 1QWOA 4DHWA 2FWBA 1CHDA 2CKMA 1P2TA 4MRSA 3OTQA 1OCOC 1J5EB 3ELDA 2J45A 2NPFA 5BMVF 1H8EA 3BZWA 1KQFA 1U0LA 3LC1O 3R3ZA 3DCYA 4IF4A 1FVOA 4JQZA 3DYIA 4WCVA 1WPQA 1N34O 3N0VA 2ECFA 3M9WA 1OWOA 4E11A 3EQ9A 5JNUA 1AO0A 2NUBA 4CM7A 2HXGA 4UQPA 2HPVA 2F3TA 4G36A 3NHBA 5DT2A 5JD6A 1PGPA 2HCRA 2ZKOA 4ZAGA 4R4JA 4NFYA 3KJZA 1MUUA 3MNFA 4HFRA 2HMWA 1RLTA 3HCAA 1E2QA 2P67A 2Z83A 1AC5A 1TF7A 1TYCA 1Y1PA 1T34A 2A1TR 2BI4A 2WFAA 4PA9A 3D6MA 3WNDA 2YC2C 4BKOA 1US6A 4E1AA 3FMPB 1RBMA 1ZGBA 2VPWA 3UJAA 2ZS8A 4EEZA 4BIMA 2FY8A 2B3JA 2VSYA 3K58A 1R27A 1NLZA 1F0KA 4Q7KA 4C6TB 3RAEC 2C07A 1S72V 1YRYE 1MAHA 1U3TA 4KSYA 5IK2A 3S2SA 5B36A 1FYXA 1QHYA 4RW0A 3TUZC 3NVKI 2ID7A 4MVJI 4IZOA 4JF3A 3QVVA 1CDOA 2IXEA 4DUPA 5JCJD 3UBTA 4H18A 3P9SA 1TD1A 3JSAA 1IHXA 4XD7A 1XCLA 1HFWA 3DLAA 5A0TA 1HNZO 3CEJA 1O4VA 1H1LA 4D96A 4HCJA 1V5WA 2QRGA 3Q3VA 2JJ2G 2VXOA 3NQ41 1VG1A 4V0OA 3GQBB 3IH5A 3RVDA 2DE0X 5EBMC 3SSOA 2VEOA 4N7JA 5C8YA 2NO0A 4UB8Z 2XMCA 2E82A 1SBCA 3LMKA 1DRUA 4I5DA 4MYSA 1CVLA 1WKVA 3HBFA 3R0VA 4ID3A 3IP8A 4GP6A 1JFLA 4ALKA 1XVLA 4RTQA 4RKYA 3L0YA 2Y27A 2VRCA 4MS1B 3W8FA 1CR6A 2IODA 4QUDA 5K6AA 2Q1TA 3EX7C 1ZRHA 3LUHA 2A9QA 1KZ9A 2MJLA 4D9IA 5JC1A 4TRMA 5C80A 4W9MC 1UDXA 2DT5A 3LLCA 5BUCA 5CT4A 2AW3A 4EL0A 3L07A 3OE1A 1VCIA 5H3LA 3ZIAG 2XITA 5H9VA 4YFVA 4N65A 4WUTA 5JCOC 4C5CA 2VJNA 3MILA 2JGNA 4JV5O 3A2FA 3AK4A 4BWVA 3C5HA 4G24A 1R3KC 3GN2A 3KLNA 4R01A 4QJ4A 2EDAA 2FA9A 3B1ZA 3I28A 4HGYA 2WDPA 1RZVA 1GADO 4FOPA 4X93A 4NARA 1HDEA 1GLNA 3JWEA 4RABA 4QBIA 4TV9A 1MAUA 5DP1A 5BV8A 5C5DA 4V2UA 3UHJA 2QL5A 1WJZA 2WWHA 4C2UA 2ZZNA 4IM7A 3PQ8A 1ELOA 3PGXA 3HDHA 3TFOA 1PR2A 1VRVA 5KWVA 3LDAA 3SM3A 1ZBQA 2D2EA 2ZWVA 3QQPA 1J42A 1RWKA 1BZKA 1Z88A 1ZITA 1ZJ6A 2DFTA 3AIIA 3NBXX 3R0IA 4B4UA 4XDGA 5A1JA 3T5TA 4U4AA 2RAUA 1QK5A 3WRVA 4YRCA 1KR5A 3F71A 1TC2A 3H1AA 3ZWOA 1WAMA 2YIAA 1KFJB 4F04A 3CX3A 2XF8A 4AICA 4IIHA 4AWXA 2HP8A 4JKIA 3QKUA 3TVTA 3S8MA 1TYDE 1Z0DA 2SECE 1T8PA 4RLFA 1Z5PA 1L4EA 1T2EA 1WZCA 2YV1A 4G1CA 4UU0A 2WHYA 4UHKA 3VR6A 2QJWA 1HDIA 1UJ4A 3TRFA 3AJ9A 1SKBA 4HDRA 5HG0A 4OL9A 2CF6A 3GZJA 4ACBA 3MJCA 4U7OA 4JA2A 4HDNA 4RGQA 3RS4A 2B1IA 4DUZO 1Z35A 2Y0CA 3HZZA 1XVAA 5ALZA 4EJSC 3OEED 3JQFC 3RSCA 1D03A 2IIPA 5ES4B 2ORVA 3ECSA 3JTEA 3GAFA 3L0BA 4HFNA 4PG6A 2GCGA 1BE6A 1KQNA 3SYTA 1C7JA 2HJRA 3PICA 1E1RA 4NMHA 4E6EA 2VYFA 4DNOA 4YDRA 2GJ8A 2GK4A 2LR0A 4KDEA 1UWCA 3ZCCA 4ECAA 1H8HG 3JWGA 2BGNA 2A9RA 2QUKA 3LKDA 4LXQA 2YJNA 2RGXA 1U7ZA 1E1QD 4B7XA 2AZ4A 3WZ2A 1ESCA 3CKLA 4GAEA 1MFZA 3Q1LA 2P75A 3W5CA 4EF4A 2IYEA 4RU1A 1OZFA 4DMHA 1HOTA 2IF0A 4A5UB 4CLRB 1UKCA 2H94A 1WLEA 5IN4A 1NNI1 1FEZA 2FGJA 1EDDA 2ZBGA 2YCBA 4MR8A 3CIFA 1NJ1A 3CEIA 1WO8A 1L5HB 4EB6B 1BE0A 1VBKA 2EZ9A 1Y4UA 1JHDA 2VNSA 3O21A 4AN4A 1AR5A 1NZ6A 2A7WA 4D4MA 4ZCTA 3AJEA 3DEFA 1SB8A 1T8WA 1OLUA 3OUZA 2OBXA 4CTNA 4H7HA 2WYIA 4D92A 3NOQA 1RVV1 1U31A 3AEZA 5A4DA 5A4JA 3WAJA 3UMMA 4BUCA 8OHMA 1USUA 3FNRA 4HUQB 4WXPA 1ZISA 3OCJA 1BHJA 3M8AA 1TKRA 2VYNA 3B82A 3CV3A 4B46A 3OOEA 2YVKA 3SAJA 3B6ZA 2AJCA 3L93A 4IPTA 4QECA 5DPMA 1P9WA 5CA1A 2WFLB 3HA3A 3HBAA 4C6RA 1GPMA 2D13A 3BAAA 1TK3A 1DQSA 2IITA 2P1RA 3H7IA 3OD5A 5E1BA 3PR3A 2H4ZA 2X15A 2XUZA 4HLUC 1UJ2A 2WLSA 4MQUA 1MSDA 5LC1A 4LJ7A 3QUBA 5A4FS 3RS0A 2QM7A 1QZ3A 4BDTA 2VDNB 4B7EA 3OBIA 4PV7A 1N8TA 2XXBA 4TX1A 1QGYA 4FMDF 2FJ0A 1GUBA 3A36A 4O1IA 1AO3A 4KAJA 1W59A 1QV7A 1C9JA 1NHGA 5EOVA 3MERA 3CVWA 1OVGA 3SKYA 3IALA 1ZLYA 3A0UA 4HVAA 1A9RA 3EFEA 3P5SA 4ZCLA 3SSAA 1MMMA 1QX4A 2IXFA 1I7NA 1PWEA 1R6AA 1RZ3A 2QSYA 4GZ3A 2R6GA 1ENPA 5CW6A 2IW1A 4E5UA 4MRNA 4OQLA 1QFSA 4AJ1A 4TL9A 1QRTA 4PRZA 3P9RA 2V54A 4IJQA 1SUWA 3CUKA 4G1BA 3GMIA 2WLIA 1O97D 2IA5A 1U8FO 2JB9A 1AN9A 5B58C 4EHNA 3A58B 4J1SA 2VJAA 1CD5A 1F7YA 1Z75A 4MVQA 3CZRA 4KR6A 2G4VA 3H11A 6ADHA 3C6BA 1KGSA 1N5OX 2IEDA 3L82B 4Z51A 1RLIA 3OY2A 3IJ4A 4XPIB 3LZDA 1AB5A 2ZTLA 3PENA 1OJ7A 3TBFA 3HWWA 1VF6A 1Q81W 3ZN2A 3BJRA 4F12A 3DUWA 4IEFB 4INZA 5FP0A 4YLGA 1DOHA 5TARA 1UJNA 1E5TA 3ETCA 3SJBA 4MW0A 5EFZA 5IBRA 3TQHA 3GG9A 3TTVA 4EFBA 4B3RB 1QQBA 1KVTA 5E1OA 3V2UA 3A6HA 2G9VA 2QMUA 2TECE 4RVHA 1KETA 1Z9BA 1RYMA 2FSFA 1LK5A 2GXSA 3M5DA 4Z0NA 4HB2A 4NK5A 1QIEA 5FPTA 3RRJA 4BC0A 3E3NA 5IBCA 4DNFA 3ESYA 4PQYA 4ROTA 4RNDB 1K6XA 3NC0C 3O93A 4BATA 4UVBA 2I33A 5JO0A 3DBIA 3OZXA 4J7AA 2DFDA 3Q7PA 2VNKA 1V1RA 2VHJA 2XUIA 1SVWA 3WKEA 5IS2A 2LCFA 1ZTEA 3A27A 4MW1A 2PT6A 3RIYA 1FXWF 1JPXA 2XUQA 5HMLA 5TS2A 4YRLA 1GPAA 3A6JA 4AJHA 2AQKA 3SVTA 1XVUA 4HQ6A 4GSKA 5LZ9A 1OJHA 4GI5A 4MKIA 1CUZA 5I48A 3X43A 3I53A 3FOAA 3FMGA 3QA3E 3L0ZA 1I24A 2WWXA 3E6AA 1WHTB 2AQIA 3TE7A 3L4KA 5FPOA 1NDQA 1HDZA 2VZ8A 1TVMA 3KOMA 2PT9A 3J80A 2H1RA 3DLTA 4J91A 1RYZA 1VL2A 4LRYA 4RK4A 3WFJA 1FTNA 2XCQA 3RADC 2OXTA 4M8KA 3T1HO 1SUPA 3K94A 4H08A 1KOGA 3F7VC 1J06A 1TIKA 2NLOA 3IMGA 3PGVA 5AM0A 5CA0F 3Q3HA 2GDSA 1ZJ4A 1SXJC 1XWIA 2GZHA 3FOCA 4F6RA 4MV4A 3SJZA 3V1TC 4Z3OA 3RRZA 2VOEA 4AYTA 4MSUA 4ZI7F 5DGXA 5JRZA 2D7DA 3BSYA 3TVYA 5KNDD 1BQEA 3AG4C 1JBEA 1RIIA 3II6X 1NF3A 3RKUA 4IIEA 3PFBA 1NV8A 3P9NA 5A3VA 5KYXB 2HVVA 1HSOA 4YRFA 1EI9A 2G8NA 1XF9A 4PLVA 4DANA 2I2BA 2VTBA 1XNQB 4PQTA 1NL3A 2MTBA 1GQ2A 1W9MA 1QH0A 1NMSA 2BEWA 2PX0A 3HJUA 3KPUA 5ALPA 2XQFA 1XEAA 3TLAA 1RZRA 1XPRA 1JAIA 4TMFA 1KU6A 4GWGA 1VBNA 5ALNA 1D4AA 3TIVA 4MUAA 4YIOA 1P1JA 3QIVA 4MGEA 4MW7A 3KJXA 1NM5C 4DWWA 4OJYA 4MUXA 3HPLC 4PDMA 5CA0B 4N0MA 1FP4A 4KUMA 4UM7A 3HCFA 1ZCJA 4UTZA 2BHSA 4RTJA 2AKAB 4UOQA 1X0XA 2E87A 3FZEA 3CZMA 4LMBA 4Q4LA 4XOUA 4GYYA 1NJFA 5FOUA 3SQWA 5DVZA 5FADA 3VOAA 1L3IA 2ZUTA 4X0EA 5IUNC 3FNIA 1MO5A 5DTRA 3NWPA 3K35A 4WINA 3PV0A 4S1PA 6CHYA 4YAEA 3A0BZ 2CZCA 3B6EA 3Q1KA 1ACJA 4BLWA 4DCSA 1CF4A 1EMDA 3CMCO 4K03A 4LEIA 5JVDA 5F52A 2WLHA 2HCBA 3WLPA 3I9JA 1A2QA 1DC6A 1R6XA 1W25A 1POWA 1XKXA 2CSUA 2EW2A 3AKYA 3EH1A 5E7MA 2QWPB 4TVOA 4Q01A 3NHWA 1D2GA 4JLNA 3ENVA 1G66A 2H2DA 2Q6AA 1NKVA 1RWPA 4DTCA 2JDIA 4TWZA 3LPCA 5DCUA 2FEKA 5AOCA 3H17A 4QREA 4UBIA 2VTEA 3C3MA 4OHXA 1AUXA 4PIVA 3WGVA 3TZCA 2YUIA 4DV0O 4GRAA 2FPPA 3ORSA 4OHFA 3ML1A 3RSZA 4F6RB 3ZU5A 3QXHA 2D74A 5B3AA 1I4OA 5E7QA 5BN5B 4RESA 2P9ZA 3OUSA 2QJOA 3F67A 1HK7A 4PC2A 4TWAA 4BKMA 1CBUA 4QGAA 2V0GA 4B71A 4WFAV 1FDSA 1XHZA 5H5NA 5JMTA 1UFQA 2PWAA 1XD2B 2PMEA 5IT9A 3GNSA 3CH7A 4R8SA 2OFPA 2Z4RA 5L3BA 1X7WB 1JEDA 1Z2EA 2CUTA 3UEOA 4UUAA 1P4SA 4IKPA 1YS9A 1YJAA 1KKLA 1O94D 1O0SA 1OW3B 3WAKA 1FNCA 5DN6A 1X1DA 2J3HA 3QPCA 2CSXA 1MV5A 2NPIA 4UXJA 1X80B 5KVCA 3HH8A 1V47A 1Z5GA 4E5PA 4QE7A 3UO8B 2XMQA 1QG0A 2WICA 4KZKA 3SMQA 4XVCA 4IIXA 2A0KA 3P71T 2PAFA 3AUFA 1JDTA 3BE8A 4XDYA 2D5CA 1CEQA 3NATA 5KSWB 4IIJB 4EKNB 4MWEA 2FSUA 3H9BA 4MPJA 2W4MA 3QVGA 5F1OA 2IF2A 4NBNA 4JX9A 4DV7O 2H85A 2WYHA 1O57A 3PFKA 2C78A 1LY1A 3LH5A 4MIYA 1A9PA 5C7YA 2O3RA 4PZYA 4JI2B 2RG1A 4OHRA 3M4NA 2PZMA 3VU0A 3GFFA 2MSEB 5BV2P 4UBOA 3GP3A 1TL7C 4DLVA 4DUGA 3UCSC 2IV7A 3BWBA 3U62A 2B8JA 3KYJB 1R8XA 1R3LC 2UXCO 2ZUBA 3RK0A 4MULA 5I6DA 3EVEA 1GHTA 2QZ4A 3K6RA 5DYWA 5KTKA 1XU4A 1VP7A 4K8XA 2QQ0A 1JXAA 3PFIA 3CSSA 4LTDA 3E9DA 5C18A 3EUFA 2WDZA 4TSFA 2FSHA 2FRDC 2WSMA 4PTLA 2XYHA 4HXGA 4HQ0A 2QLJA 2O2HA 1E7YA 5AXCA 1O54A 5EXPA 2LCIA 3CZPA 1ZSPA 1RKVA 1ZI6A 3LNCA 3WNBA 1RM1B 3CMMA 2GDJA 2V1XA 5LBTA 2OHFA 1U1GA 2Q9CA 4L8GA 4UCXA 1JYEA 2DGDA 3GFOA 3UK1A 2WMOB 2R1TB 2DKNA 1UT5A 3KZMA 1JPJA 1D1TA 5AW6A 2VR1A 4L22A 4XWOA 4K6KA 2GPSA 5DT9A 5A6SA 5KS2A 1YQ9A 1GA6A 2OCYC 1OTYA 4RIGA 5DBIA 3RIHA 3ZOKA 1CJKC 4MVJM 3MTBA 1X7WA 1ZJYA 3BMOA 3T6KA 2WZDA 2NTVA 5IYDO 4HRVA 5ER9A 3OPVA 3G8CA 2OYRA 1ZFNA 1NH2B 1U9IC 5KC9A 1U8XX 2B82A 1Y5NA 4MVZA 1VE1A 2W6CX 1N5RA 2CV2A 3FKSD 4FKMA 3HKEB 2VPZA 2GF2A 4L15A 2HHHO 4LVOA 4PG7A 2X0DA 2R6CA 1OCCC 2Y9PB 4O3FA 1FXKC 3P2EA 1AI5A 4ETMA 3HR4A 4DA4A 3HXKA 4R2JA 4Y6OA 4DR5B 3U3DA 5KZMB 4PLYA 1SC1A 1V5EA 1ZNXA 3JVUA 1VF5B 4C0QC 5KB3A 3QPVA 4OQYA 3TMAA 5KTTA 1NUPA 1SBNE 4MUKA 3AUJB 1DAIA 3V7UA 3DV2A 4YEDA 4KWIA 3K0SA 5A3JA 3RBAA 1RI4A 1SKYB 3A10A 2ASVA 3PNOA 4H6PA 4E5DA 3U11A 5FJIA 5CFNA 4HNUA 4GMFA 3C1TA 3RKRA 1SPXA 4QUAA 1WU7A 1EUDB 2X4IA 1XRPA 2POCA 3A1EA 2WBLC 3I1FA 4MUYA 4WY5A 4RTMA 3OOSA 3SYAA 1WNFA 3TOXA 3ZS8C 1GPJA 4JCOA 2C5EA 3DO5A 2DQZA 5B57C 3U44B 5KQGA 4E7OA 5DF1A 5B1HA 1P7GA 4JI0O 5BN3B 3D4BA 2GPBA 4ZQEA 1RSOA 3BERA 2E75B 1G8SA 2JDID 3V4PB 1U9JA 3D36C 3AZQA 1PT7A 4LD2A 1A8PA 4KIGA 3T15A 3M9XA 4KIWA 1R64A 2IBMA 3D3EA 4TRNA 4XDZA 4XSHA 4ZO4A 4BO7A 3MHTA 2B1QA 1XVIA 4JDPA 1XXHE 4B08A 3CLRD 2BFNA 4RS4A 4BNHA 4FVTA 2IYRA 5I01A 5DYYA 3WWCA 3O9ZA 1ESNA 3DUFA 1LLCA 4IQFA 5D1HA 5JBNA 3F73A 3HSYA 1ZJ5A 3HNRA 4NTXA 4DC1A 3ABLC 3Q6NA 1F4MA 1D0IA 2IQIA 2Y99A 1J90A 1G8YA 2HDNB 2RI1A 1WAZA 4N8EA 3W8EA 2ZI3A 5I7HA 3P9QA 4R9VA 5GONA 1LSSA 1VPVA 4IG4A 1RSZA 3N87A 4LW8A 4DV7B 2BEUA 1XLTC 3DE6X 3V2GA 3CXCU 2G0NA 3VHRA 5JD5A 2UYHA 3OBBA 4W4TA 3AT1A 4MCHA 4X60A 4W5NA 1HT2E 1PNQA 3SEZA 4UAJA 1BN6A 1WVIA 2ZYWX 3PHBE 1VL6A 4MLPA 3SQXA 4L27A 4YP6A 4F7WA 3QVLA 4KBYA 1ZU5A 3WOHA 4LA4A 4MV1A 2FMUA 3K57A 4URWR 3G5MA 3MOSA 4CG0A 1Z62A 4UV9A 1FJHA 3OPQA 3WXMA 3WVNA 4HBZA 3LDFA 2JFQA 3LT1A 5G1OA 4EWLA 1JLKA 4HFMA 1WLYA 2B35A 1SZDA 2O48X 4DK0A 2VTVA 3C16C 3I5AA 2ADPA 2DWOA 3BH1A 1E1KA 2Q7EA 3IUEA 2OV2A 2YMPA 2HQRA 2CUGA 2DKOA 3W5AA 1PK9A 1I94B 1YBMA 1XBTA 3P0IA 1EDOA 1VSUA 2PWYA 4CTKA 4PLGA 1PWXA 1N5IA 3ZRSA 5JSZA 2P5UA 3G8BA 4UFPA 3E23A 2DH6A 5A4AA 4UNIA 5K99A 2FKXA 3RWRD 1XE3A 4H7DA 1G20A 3R5SA 4KSCA 4BYGA 1ULBA 3TXQA 4Q9KA 4NYMQ 2DX7A 3UJ8A 4JYPA 4F38A 4GICA 4GXQA 4CVNA 4RO0A 1QPGA 3UWSA 3HPRA 5U9CA 4K9PA 4S12A 4TLBA 4A8JA 3CJTA 3PE4A 3QLTA 3G6EV 1W9HA 3BEOA 3SYNA 1A4IA 4PNZA 3WGHA 1M1XB 3DC7A 2V6FA 1T5OA 2H5LA 3IQDB 1GCUA 1JPNA 4ADSG 3AUTA 3AU9A 4YUWA 1N2ZA 1RYYA 3OZFA 2QPOA 1PR9A 1KOFA 4FIDA 4M76B 4L6AA 2PBZA 1WG8A 2X9GA 4ZV4A 2DRIA 2IW5A 1E89A 4X6LA 4LYAA 3RRYA 5DX0A 3LQQA 3ASNC 2GJ4A 1CDEA 1NQXA 4M83A 2IUTA 3MJFA 2GBCA 3FYSA 3I92A 3IQZA 4GYCB 3T7JA 1W36C 1YI0A 1M6YA 1TQ4A 2YMLA 3K8QA 3UWDA 3QH4A 4CI0B 3EC2A 4JJZA 3ZEIA 3V4OA 4X3CA 1VF6C 5C35A 3AK3A 1DQYA 2WJ4A 3AR3A 3JZAA 1Y3DE 2EVWX 2G7MC 4DW0A 1EGVB 1I3CA 1EK2A 3GZ4A 2F1KA 4BBPA 2TMGA 2F59A 2VDQB 4TWBA 3TLEA 1Q92A 3NHJA 1VECA 3JQFA 1YQTA 7REQB 2OA0A 2YDXA 3M5CA 2XMGA 4WVLA 3P0HA 4U5XA 4A23A 1UH5A 1GU0A 2W6ZA 2WB4A 3WGLA 2J9FB 4N8SA 1I2AA 1FY2A 3VQWA 1QIFA 3O91A 2AUTA 4WGFA 4AJOA 3W5SA 4FHGA 2X1LA 4RXUA 2ACWA 7MDHA 4JPRA 3K5PA 1BNCA 4BKRA 3RWOA 2G67A 2ZSIA 4BGUA 2ZPAA 1F2UB 3CB4A 2AN1A 4L76A 2W6NA 1IVYA 1KXJA 1AXRA 3AINA 4M60A 1Z5OA 2OO5A 4XTCS 3RTEA 5JHHB 1SC5B 3MJVA 4U9IS 5C32A 3U6BA 2ZJ6A 1G42A 2DWPA 3OLVA 3DULA 5A4KA 1S2GA 2X22A 4LFBB 4CETA 3ETDA 2R00A 2ZRGA 1RM1C 5D7NA 1K6JA 3DLIA 2B3TA 4P1ZA 5FLXN 1WB8A 3EJ6A 4KQKA 3LCVB 3P2MA 3VO8A 3K9LA 4HB4A 1TJ3A 3DBLA 3GRFA 1WUIS 4XOIA 3OEEG 2KSDA 2ZI5A 5JROA 1SRYA 4PAOA 1YCHA 2QHXA 3CSDA 2H3OA 1Z47A 3CLHA 2AD5A 5TT1A 4DG8A 4EY8A 4CLEA 3T7RA 2Y66A 4OGFA 3CR7A 2Z5VA 4RFLA 4CMEA 1APBA 1KWGA 5C2OA 3WAGA 1NURA 5JY1A 3GU3A 3NTVA 5HVNA 2KWIA 3AUYA 4LOIA 5IWCA 1UK8A 5CCXA 4I9GA 4E13A 1TMOA 4HMOA 3C1UA 1RWVA 1XZDA 2ZRNA 5C1PA 1K0UA 4EUKA 1BHAA 2FFJA 2L35A 4XM1A 2I1WA 4BQFA 3W79A 1W4BA 3ADCA 5LZ5A 2XAJA 1T2CA 1XTPA 1QIMA 4TKVB 2XA1A 3PGMA 1Y98A 4O4HF 2VCYA 1HTWA 3GG2A 3CTMA 2ZDQA 3GRYA 3V3KA 4BP9A 1G7RA 2R70A 3TTSA 5JMPA 1GL9B 3R7BA 4PS0A 1Q1EA 2R9AA 4TUYA 1W6RA 1XU9A 3EQZA 4BQIA 4MWOA 4FLEA 1LXCA 4Z9AA 1T6ZA 4Z2AA 2I7TA 2JIPA 3JU3A 4XDHA 3DLHA 2VN8A 4D6TH 4GKJO 1V4NA 2H07A 3MWYW 4BDSA 2C2GA 4UUQA 4OI1A 2Q67A 3HE3A 4QULA 3ZKWA 3K05A 1BXGB 2W2LA 4E03A 4D9CA 1JR4A 1SUSA 1Z2CA 4HF7A 1XQWA 3CUUA 4MHSA 3UKDA 1HURA 4GPAA 1NQUA 3AWDA 2WSIA 3W7TA 4JLVA 2RGEA 5CT6A 1O87A 3WMGA 3K09A 4PGAA 1RKQA 2K2WA 3DL7A 3FG9A 1GQSA 5ER6A 5JYDA 4BJHB 2GCPA 3VI3B 3U10A 1PU2A 2R1ZA 3GLHA 5KYUB 2G71A 1PZMA 2PNJA 3CRMA 1PK7A 2JW5A 4Z1VA 3RJ9A 2W9XA 3EPPA 4MDHA 1AMNA 1NG9A 1RB7A 4JL6A 4PA7A 7GPBA 4OHVA 1LF5A 2DTEA 2F8MA 1YE5A 3CVVA 3EOZA 1Q6IA 4Q4AB 3G02A 3RUCA 1LUAA 3L6CA 3QUTA 4ER0A 5BMOA 4QAJA 2OG4A 1LSOA 1OFHA 2Q4DA 2HEPA 4P36A 1QO0D 3OSUA 4C4RA 3MAQA 4FC7A 3BK2A 1FX0A 1SUDA 1GG8A 4JR2A 1O3YA 3OT7A 4LF8B 1GPYA 3F6RA 1ONOA 1SCKA 3CPEA 3PT5A 4PG5A 4HDRB 1EVYA 2AYXA 3TCXB 1XZFA 4L85A 2IHVA 3AESA 4LGYA 1YDGA 2ZRPA 4TKZA 4DCNA 2EIMC 1ZH4A 4LHSA 3ZXYA 5I3ZA 4EW2A 4B76A 4IL6Z 1UC8A 3TETA 2EJVA 3KJGA 2ZCJA 4Z3KA 4TS4A 5CB4B 5EK0A 1Z17A 2NSDA 5DNVA 2B25A 4WJLA 1T8YA 4CIAA 1J0EA 1E32A 2NXNA 5JNWA 4BPBA 1SU4A 3PC8A 1J7KA 2I9PA 5LD2C 3NHMA 2OCCB 4JOBA 1P1FA 5B1IA 5T4EA 1F4LA 2X40A 1GGHA 3LKBA 1DQNA 1US8A 3QNWA 1Y5LA 1YZGA 4KH0A 5CAEA 3O92A 4ZHQB 5GAOA 2DHEA 3EXIA 3PC7A 1GNSA 2DPXA 3W6PA 1WF6A 2AZMA 1PZFA 2YHIA 5AKIA 3KQUA 4NSNA 3RS5A 2TS1A 4GLOA 2YFYA 2Q5LA 1J1ZA 1A9XA 4DRXA 4C4XA 2Q4EA 3F3YA 1QIKA 2TSYB 3OETA 3PZRA 4R9NA 1Z8HA 1XNJA 2NP7A 2NU6B 4JROA 3INYA 4H27A 5FAKA 1FU4A 5E0KB 1R5JA 4TUYB 4UQLA 5JIBA 2V65A 3DQZA 1M7BA 3DG9A 4B6SA 4JLUA 4IGAA 2VK1A 1PBNA 1Z06A 4G65A 5EP2A 4WN3A 1S3IA 1ZD3A 2X86A 3T1QA 1LI7A 2QX6A 3NXKA 1KARA 4U2GA 3CCEV 3BHIA 4IIJF 4F11A 3NIFB 3E8HA 1VXOA 4YK7A 4BWFB 4OMUA 4B3JA 4A8JC 1E59A 3LAWA 4JITA 1Z29A 2OORA 3H6GA 4YUYA 4LYYA 5C3MA 2VWGA 3DNFA 3E27A 3WGTA 3H9UA 2C5AA 1N25A 3JAWB 1P0QA 4WD3A 1CZNA 1EAMA 1JQBA 1YK1A 1ZDMA 2P69A 4D81A 1IE3A 3N5KA 4YJ2F 1GDHA 3SPIA 1WB5A 4EVQA 2H1FA 4LRUA 4QUEA 2QPTA 4O0LA 4CHGA 4ERNA 3THWA 4BYMA 5G2OA 1TQ6A 5JVDB 1ZN2A 2WPNA 1FUIA 1M8JA 4AZ3A 1K34A 4M0MA 2AVNA 2CZGA 2Z08A 4AJNA 2E3CA 1RXYA 4H7PA 4LBVA 2OCDA 1W6UA 5D84A 2OKGA 1BXKA 3SYCA 1JKMA 1PKXA 1TQHA 1KIFA 2ZSKA 2FMFA 4HDSB 4C3VA 3EA4A 4BE4A 1DAMA 3ADKA 1JR2A 4MUBA 4J9VA 3LUJA 2GO1A 4OP2A 1W75A 1KEWA 3FUTA 5IAJA 1YRAA 4M9QA 1EM8B 3SDLA 2OLJA 3B5EA 4ZALA 3E7DA 3OPYB 5F76A 1GUFA 1L5QA 2D3WA 3MIIA 3HV2A 5HP4A 2XVZA 3DC5A 1NXTA 4G37A 2QMOA 2XJ9A 2AEFA 4KRFA 1H65A 4LBWA 1OPRA 2GN0A 3LG2A 3ZZNA 3IGFA 1AKWA 2V7TA 2BEVA 3QOWA 2GV9A 1KNXA 2JRIA 3M83A 2H65A 1F2TA 5F5NA 5FF9A 3JY6A 4JWTA 5AD1A 1HEUA 3CZCA 4H6VA 5DEIA 4NMMA 4UFZA 1UFOA 1VLQA 2OZLA 2W58A 4RXTA 2R4TA 4AZWA 4ZHQA 4JNCA 4IGGA 1Q7YW 1P31A 1Z18A 1ZS9A 1ULSA 2HU2A 2NVBA 3ZQ4A 1XQXA 3WBKA 2DR3A 2W42A 1S9HA 1Q21A 1T4GA 2QUAA 1U2SA 3ILSA 5C5CA 2RKOA 3AEKA 3GJYA 3CR8A 3S55A 4EA8A 1HORA 1S2LA 4LYFA 3OU7A 2GUZB 3UJ3X 4BRWA 5K8LA 3B9PA 5DE3A 1M6VB 2VYCA 3KBBA 5BT8A 3HN6A 1SKQA 1V1RB 3DO6A 4KN9S 1OV6A 4R98A 3DDUA 1K7SN 3HB5X 1Z5WA 4WZAE 2IS2A 4A1FA 3JWPA 1Z34A 1BMQA 1M2NA 1NQOA 4ILGC 3TD6A 4CDRA 2KCQA 4DR6O 4NV0A 4C0SA 1T2UA 1QOZA 4TYWA 1SU8A 3DBOB 4DEYA 5A6SB 4DXHA 4XVUA 3L2OB 1YB7A 3WLFA 3KJNA 3PDWA 2V5UA 1OVMA 3NHLA 4NMXB 5SV2A 1JLLA 2MYPA 4RHYA 4DHEA 4REMA 3FSEA 3OAAD 4AN0A 5JAMA 3MIZA 1QP7A 4KLCA 1OE0A 1ZL8B 3ABZA 3EHDA 5FLYA 1X2BA 4OCNA 4D0SA 1W0KG 1QO0A 1WCIB 5EJMA 3V2HA 1P80A 2WHQA 3EG5A 3G80A 1G3IA 3THOA 1K8ZB 2HA7A 4RZ2A 4Q7EA 5H16A 4CM3A 2YX1A 4ZTBA 1T6YA 4R3UC 3C6KA 1VBMA 2HL6A 3EODA 3THWB 3WHLA 1W94A 2Q9BA 1FK8A 3ZQKA 3JYLA 1W4LA 1YMUA 1D5WA 4M9RA 3UGJA 1FA9A 2DUUA 2REXB 3M0EA 3OLCX 3S2GA 5IHXA 3GA7A 5T67A 1ABBA 1QQ5A 3VOTA 2N1MA 1NHWA 4REQB 2ANCA 4MYUA 4FNGA 4KIJA 3KOWA 5ILQA 1JQJC 1CT9A 3EZ9A 3H11B 4MI1A 5I7RA 2KYRA 3PUVA 3DE5X 3RU7A 1T4DA 4MVJF 4NU6A 2O2CA 4WTOA 3WJ1A 5KDOA 2P87A 4DR3O 1ZCZA 5GJCA 4PINA 4MVJG 4E5VA 1E3LA 1F51E 2FEXA 4ILEA 4PI2A 5F35A 3GOQA 3U49A 4BFXA 4YIHA 3LT2A 4ZZ0A 1FS4A 1LRLA 4P3XA 4D9BA 1L4BA 4BNGA 3ND8A 4IH4A 3TLMA 5BQPA 2OXFA 4I08A 1SA0B 2HG5C 2DQ4A 4QFCA 2J46A 4ZC8A 5LFAA 3UC9A 3GFVA 3QIAA 1OKKA 4DG5A 4UVCA 1J1UA 2P7IA 5B4UA 3H04A 4ND4A 2OZLB 2VPQA 5EJEA 2H31A 4P7GA 2P2SA 4CF7A 2JAXA 4G81A 4S0XA 3IGAC 4Z8XA 1KK1A 1U3CA 2XQJA 5KQSA 3O4VA 2OORC 4BFZA 2IZ7A 1T29A 2IYZA 2J3QA 5FO0A 1L5WA 2JAQA 1P81A 3CC8A 3V8BA 2C3UA 1N75A 1NP7A 4YMTA 3BWCA 2CLOB 3K1TA 4RZHA 2F23A 1D6MA 3M82A 1E1CB 2XBUA 4GBMA 2PKQP 4OJMX 3VBEA 1PJZA 4LJLA 1MG0A 2X9NA 1UC4B 1QGED 4QOIA 5EC2C 2B4AA 2D1QA 1NJSA 1XTZA 3GT7A 3NV7A 4TUYF 1QMGA 1UP6A 2BY4A 1O0BA 5IDWA 1T15A 1AZTA 1ZONA 4GEKA 1P2VA 1VI2A 3RG8A 4D4JA 3U3KA 1A82A 3KCNA 4O4JB 3DAYA 1H4QA 3HDQA 2XWBF 1GK9A 4Z1OA 1KYVA 2QL6A 3N5CA 2J3KA 3NEYA 1Y8CA 2LNDA 2LUOA 4JR1A 4CL2A 3E5RA 4DCGA 1NYLA 4IINA 4K40A 2WLMA 1NP3A 1M8GA 1KNQA 2C9OA 5A5GA 1BVYF 2DETA 1JX6A 1OHHA 3T38A 3CUTA 1KORA 4YRNA 2C3OA 1TJPB 1UBCA 3ETGA 4DLRA 3B1YA 1LC0A 1NJ8A 1DKLA 2Y1GA 3MC1A 4KFMA 1F0PA 3D8SA 3QI2A 3W1EA 5DNCA 2CK3A 4MUNA 3V1LA 1SHZA 4EGCB 2CGOA 4IIJA 3AG3C 2G09A 2W2XA 2EC5A 3GZTB 2IEZA 5CB4F 1OX6A 4MVSA 2VP3A 4YPOA 1DEKA 1RAFA 2JFNA 2KS6A 4K6OA 4S0ZA 2C83A 1U5BA 1L3CA 3CXUA 5JCOA 1KFBB 3PB3A 3ZN0A 3RVOA 3HFJA 3AEXA 2PUSA 3R77A 4G5SA 4MI6A 3MD0A 4D4GA 3BL6A 5T3UA 4OPHA 1FBNA 4C6TA 2B4YA 3JCZA 2CFTA 4YBRA 1DIBA 2QWQB 5ALHA 1QTNA 2AE2A 1GN2A 3D8HA 4Z9YA 4PZ0A 2ZZKA 4I0XA 2WUEA 4B3HA 2VWQA 1E4YA 3UF0A 1W88B 3BOSA 2E4YA 1VTKA 1WDKA 3O26A 5IYZA 2FTKE 1FBTA 2V6JA 3RAGA 4D02A 2AD1A 1RHQA 2Q5HA 3RD5A 2ZT7A 4Q7MB 5FFFA 2PXAA 2WTEA 3CU5A 3G3EA 3GRPA 4TMWA 4U63A 4C7XA 1DDIA 3AHFA 1QH1B 2DYRC 2QRKA 5JYEA 3E3OA 3WL4A 3D3QA 2JS7A 1DS6A 3BE4A 3LE8A 4MKRA 2VHVA 1KJJA 4Y6QA 1TCVA 1LX7A 2Y77A 3G67A 3WL3A 1U4OA 2WKRA 1LTKA 4I0WB 2DZDA 4OSEA 4RAOA 2MSWA 4TWRA 2P5OA 3DE1X 4M22A 4PGFA 2WF5A 5HGJA 1SK8A 2YICA 1V9SA 5CHYA 2VHZA 5LMCA 3T1YO 3WWPA 1LTQA 4YMVA 4TTTS 3ELYA 3NBYC 3UXYA 2GXQA 2WZBA 3EWIA 4MP6A 5TJHA 4QEDA 5JZVA 4WA7A 1IM8A 1ZSYA 3JVEA 1PJ3A 3HKBB 4RTRA 5LNK6 2L82A 1M6HA 2O2SA 4YUZA 3PXDA 1BCCH 2QW1A 1ILEA 3IEVA 5ITZA 3VR2D 5KTRA 1OAKA 1ST3A 3C7KA 1KJIA 3KTFA 3PNVA 1VRCA 4U1RA 5P8WA 4B4VA 1CV2A 2VJYA 4IX9A 1Y4DE 2LBPA 4JAVC 1U96A 1YTFD 2DMRA 4LGCA 5I9MA 4GHWA 1FNSA 1R73A 1OJLA 1S77D 4MQ4A 5AM4A 1Q0SA 4PO3X 5K3DA 2J3LA 3WBBA 5LLTA 3UV3A 3W77A 3OFVA 1U9YA 5K20A 1HNXB 1CUSA 1NBME 4EJ0A 3BVPA 1MT0A 3GIDA 1K4DC 2WLIB 3JD2A 1YZHA 1JVMA 1F7UA 1WXHA 4PVCA 5LSAA 1B76A 3CNEA 1RPRA 2OQRA 2XXAB 1ZICA 3GPIA 3B09A 3JVDA 4EFEA 4PE5B 5SZJA 1RWWA 3RKSA 2IYSA 3SIPA 3FWNA 1UBUS 4ZO8A 5FL7D 3AEYA 4LNUA 4RJJA 5J1TB 3RT9A 3ZVNA 2J9XB 4ZT4A 2XAFA 3ESDA 1G5IA 1Y6FA 2W70A 1OTXA 4YWJA 1MG1A 2YOHA 3OOHA 5JS1A 1FFHA 1NH2D 5TGTA 5C7IO 2J41A 1KEUA 1UXHA 4WNAA 1GGMA 4LOHA 3GD5A 4DV1B 1MDBA 2C2WA 1S5PA 3PJEA 5THQA 3ZWWA 1A7UA 4FCWA 4ENQA 1ZUNB 4TXNA 1X1RA 4UM9D 1I7QB 1IM2A 1TZ2A 3CO0S 3IR6A 1MABG 1KMNA 4FFNA 4RA6A 1SA0A 1L5NA 1R50A 4EQZA 2UYYA 1QOPB 1VLLA 3LBHA 2X8WA 2YIMA 4MUGA 4QTYA 3WMXA 2XWJI 4ZVOA 3AI2A 4AZTA 4DV4O 4J7CA 4LUCA 3BICA 4WZAB 1ZOOA 3WKAA 3ZGXA 1S0UA 2ENWA 4YXWG 4MRMA 1W47A 2QU8A 5C8DA 2DUJA 3W7VA 3CRCA 1JQLB 2VPXA 1J9GA 3DHVA 3O1IC 3R41A 2WHPB 4YMGA 3E8FA 3L72H 1LI5A 2Q0QA 4OSOA 3CMAV 1JHOA 3EOAI 1XYVA 1LA2A 5H4GA 4D3DA 4R41A 3MPZA 2Z9DA 3VGPA 4U7PB 1DTWA 1JW9B 3QUCA 5ADUS 1NZJA 3TSYA 1F17A 5E1MA 1GZUA 1TTTA 3LGSA 4G8CA 1EK5A 1JLHA 2FWIA 4BX3A 1E2LA 1B41A 4RS3A 1E60A 1GPLA 3AL0C 3LUTB 1HE8B 4AM8A 2O96A 1N0VC 3X1MA 3MHPA 1W581 1VKZA 1DC5A 1XNRB 1KAQA 2J4CA 3HYNA 1FUYB 4UNPA 3OM1A 3ZIDA 5A4MS 3EEQA 3NM4A 2ATCA 1KQ3A 3IOBA 2IXGA 2X19A 2I4RA 5BVHA 1NXPA 3KP1A 3TRDA 4FYXA 3TE6A 5ELMA 4ZN6A 1F8YA 4KN8A 4PSDA 1VGVA 2O2DA 2VLBA 4RVOA 5ARDA 1L5KA 4B3IA 1MA0A 5BW4A 3UG7A 4X1IA 4MV5A 2HA2A 3AKZA 1XMJA 2I34A 4MVJE 4FN5A 4N8DA 4KREA 2ZJ8A 3STTA 1MC8A 5C1DA 4PO9A 1MPXA 1G1AA 1JZSA 1P45A 4DNXA 2HSZA 1V3UA 3KOYA 4N3GA 3UMRA 3K5LA 3I32A 1R18A 4R1NA 5EZSA 3MMPA 5HBRA 5JDCA 1ZR4A 2PUEA 4WIFA 1OH5A 1L8OA 1TZBA 4NBLA 4JI0B 4ZXPA 4DMFA 1JHZA 4JL8A 4AJEA 1A71A 1L4GA 1GAEO 1RAHA 1WX1A 3HVUA 3I9LA 4EGFA 1H6BA 2O8DB 1T1IA 1HGXA 4GI1A 1PX0A 2ZJ4A 3C3XA 3HP4A 4FTWA 1MAAA 4ZTZB 4FQ7A 3HHEA 3SZOA 3M89A 3CPHA 4JYAO 2PS9A 3EVTA 4CQLA 1HYEA 2GEJA 2JNWA 4NZOA 2CB0A 2QTNA 2HLDD 1GYPA 4ER7A 2H2HA 2X5JO 4M1YA 2MU1A 4N0DA 4EKDA 3U56A 3OCQA 1GSAA 2DTDA 3C3CA 3H2ZA 4E2FA 3BWVA 3IP6A 1RCFA 4JI3O 4UE6A 1E0DA 2V7QD 3UAGA 4LYEA 3AHGA 2EJRA 4FMDB 4BV2A 1TC1A 4ZJYA 3JAMA 1W4ZA 3MWDB 4L8JA 1IL0A 1E20A 2FWNA 3PJFA 2G9NA 1RKBA 3R7WA 3CS5A 1U8AA 1NXXA 4XDJA 1ULUA 4IFTA 4V0KA 5MGBA 1FJGO 1HFEL 2BEKA 1V55C 4P4SB 1FS6A 5AKGA 2P06A 4RCYA 3PNYA 4L6IA 3EXFA 1XO1A 3L1UA 1IAVA 1EP2B 1U9ZA 2BW0A 2WABA 1SXJE 1Z2AA 1R0RE 2G1UA 4P82A 4QO7A 4WKCA 4XEUA 4Y0VA 2F95B 2IEIA 5G41A 3RC8A 2QTAA 3MTGA 4HN4B 2IZOA 4QBTA 4EEKA 3GV0A 3CWCA 1IUKA 4NICA 5I4IA 2DY0A 2I2DA 1W44A 3AG2B 4MS4B 2BMAA 3K92A 2XNDG 1Z56C 3IEIA 4FUTA 4O4LB 1LBHA 3IYLW 5LM3A 1NNLA 4CV1A 1NDHA 1KP3A 4GZ5A 3D7KA 4R8KA 3ANTA 2ECQA 2GJ9A 3WLMA 2EZPA 1A7JA 3DWGA 4MEJA 4TQGA 1NTZH 1O94A 1PAUA 4MP8A 1P3Y1 2Y0DA 1G6Q1 4TTIA 4IF6A 1XTQA 5CUQA 1PQWA 3ABOB 1E9DA 3ZGYA 5CB8A 4FLYA 4QG3A 4BB0A 5FI3A 3FTNA 5B6PA 3HVRA 4X66B 1FYWA 3Q6MA 4NWIA 3LD9A 4CCAA 1FXSA 2QQFA 5AKZA 5KIAA 2GEBA 5JYCA 1I1HA 3TPZA 4W8GA 4XH9B 1QVVA 1LFDB 3PX7A 4ZIRB 1G9SA 1ITZA 3T3PB 4CKEB 2VF2A 1QGDA 3K5MA 2ZAMA 3H9EO 3NTLA 3CLVA 3D7NA 2PDAA 4OH7A 4MR9B 4RZUA 5FA5A 4F4HA 1RP7A 1UMCA 4J0DA 3H86A 1IK6A 4PR0A 3UKOA 3DC2A 4MI3A 1JMYA 4D3ZA 1KO4A 3EXAA 3K6SA 3BCSA 3PNQA 2TMDA 1YVRA 4JI7O 1ZM2A 4FR0A 2K7ZA 4HUJA 2QKYA 2IHBA 2CNWD 3UQ8A 4OBBA 1NUUA 5J40A 4MWDA 4GWLA 2D4HA 3BXOA 1V9LA 3B8EA 2HCTA 3F8SA 5ILGA 4V03A 1AKTA 5BR7A 2CFRA 2I3AA 3H16A 4IBOA 3IODA 4B3TB 3LA8A 1RRPA 3FPBA 1CF9A 2YZKA 1IQRA 3DEJA 4CT0A 1N2HA 4JJ6A 4EAQA 1KJZA 2Z2IA 3BFJA 3CEHA 2DVMA 2WD7A 3OHMA 2BFDB 1UBGA 3VDNB 2I3DA 1YGPA 1ZEMA 2OUKA 2Q46A 3DLCA 3G8DA 3U81A 3NDPA 4K9OA 4LGMA 4EJFA