1P4RA

Crystal structure of human atic in complex with folate-based inhibitor bw1540u88ud
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 215
structure length 589
sequence length 589
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1p4rA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1p4rA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA02
1T36A 2YVQA 1PL0A 2X8WA 1M6VA 1IK4A 5H3LA 1THZA 1EGHA 1WO8A 2XW6A 1C3OA 1A9XA 4EHIA 1OZ0A 2IU3A 1BXRA 1KEEA 1CE8A 1M9NA 1G8MA 1PKXA 1JDBB 3ZZMA 1B93A 4A1OA 1S89A 2IU0A 2B1IA 1CS0A 1VMDA 1P4RA 1S8AA 1C30A 1ZCZA 2B1GA
chains in the Genus database with same CATH superfamily
4PIMA 2YJ5A 1MJ5A 2VSQA 1K5QA 5TISZ 2DULA 3FCXA 5D7BA 5GTDA 3ZDEA 2PMWB 1M3SA 4DR3B 1JF8A 4H6XA 4BNUA 4Y6LA 3LQYA 2H11A 2IRWA 1FUUA 1WXIA 1ANKA 4XPZA 4KQ1A 3V4VB 2J9RA 1GQQA 3I2GA 3PXDA 1EXDA 3BFRA 2HN9A 1P81A 2J59A 3FYTA 2B78A 1EQ2A 4UNNA 5IMBA 5BN5B 4K9DA 4B84A 5K7SA 1CP9A 2FPGB 1VFNA 1HURA 2QN3A 1FJGB 1FE8A 4E46A 1GAXA 1BN6A 1TQDA 5FO0A 4ERXA 5BYAA 3N1UA 5CTAA 2AN3A 1GKYA 1NI5A 2QX8A 3IIEA 2W6NA 4MVJH 3TZHA 5FUBA 3QQPA 2J3EA 2GUGA 3G8DA 4P4TA 4X93A 1ORHA 2OXIA 2AW5A 2MU1A 2JS5A 3FWHA 5TGTA 2F2TA 1A9ZA 4J1SA 2DQKA 1FXKC 1EZZA 2ZYSA 4F8YA 5I7UA 3LQ4A 4JY7A 1P5ZB 1R6XA 3CCLV 2Q99A 3HC7A 4D26A 3EUAA 2G1JA 4TXLA 5IASA 3HCNA 3MOSA 2F3TA 3KV3O 1OZAA 1UMDA 3AM5A 3MWDB 4NOKA 1GA6A 4O4HA 1O6FA 1V6CA 2WMNB 4TTSA 5DGDA 3V3TA 1ZOLA 5K0LA 5G1PA 3RYTC 3AJRA 3AUFA 3VZPA 1TZCA 5K0SA 1BX3A 1OYWA 3E3OA 2I03A 1LSJA 5AM2A 1RQLA 3VU3A 4CC6A 2KSQA 2RJOA 3AQ4A 2EJTA 3RRXA 4IXMA 4L57A 1VK9A 2E1RA 1S7GA 3W4KA 2X4GA 3SLKA 5K0NA 2XTMA 4FYKA 2Q9BA 3ZWNA 1R16A 2ONJA 5CCEA 4NHEA 1W59A 3SLRA 4COOA 4EQ6A 3ZXIA 1D4FA 3WJ7A 2PRJA 2X4DA 2HU5A 3PNLA 1TADA 2ZT5A 3U49A 1AV7A 4QBIA 4JXEA 3FZQA 4AMVA 3ZOZA 3FFXA 1OAOA 2BFWA 5F3DA 3N05A 1UAAA 4C4OA 2O8FB 2EW1A 4KU4A 5TXGA 1AKQA 4LISA 3GCXA 3QFFA 1O2DA 2OORC 4GKKB 2GPJA 2R7MA 2BGJA 3WMRA 1L4KA 5KTTA 3W5CA 2AJBA 3CT6A 3GRYA 5LGUA 2HXVA 3L8ZA 2HFEC 3HPQA 3A9RA 4MGHA 4AZ0B 5KQRA 4GGPA 1NV9A 1CZOA 3B8MA 2CL6X 3AG3C 3Q7IA 1JQ3A 1P0FA 2PEZA 4GYYA 2EFCB 4O8ZA 1IHUA 4PAGA 1P4AA 1NH2B 1S3FA 1FDRA 2FMFA 1UDCA 1KHTA 2ZXFA 1PJZA 2NZ2A 4IOLA 4CG2A 3NM6B 3PUZA 1IK4A 3BHIA 3KWLA 5EJAA 5EK0A 3VO8A 4JHXA 4BKUA 3MRTA 1RR6A 2RI6A 4CIWA 4CKCA 5AVQA 2PKWA 4OK5A 1IAVA 3PPIA 1L7MA 2I3DA 2H1WA 1DT5A 4MA5A 1XDGA 3INYA 5D51S 2MIIA 3OQOA 1GVNB 1ZD8A 2G83A 3TF5A 1FYJA 3BH0A 1WEKA 2X7RB 1F06A 4KODA 1UBSB 1I2MA 3RWOA 2ATCA 3G2IA 3GZNB 4EFLA 3IPAA 4F56A 1RRMA 2QU8A 1L1EA 3PDHA 3WJ2A 4EY6A 3O3MB 2NZ8A 4K03A 4F97A 3UK6A 3JALB 4OD0A 2CN1A 2R4QA 5DW3A 4QQFA 3S3TA 5CEFA 2O59A 1JEEA 1UC5B 1X7XA 2PO5A 4ND4A 4OMCA 5EJEA 4FT4A 5KTKA 2O14A 2IXBA 2XAJA 2O3SA 3GZ4A 3IEKA 1N6RA 1SZPA 3QI2A 4TN5A 2O8BB 1SCNE 2EP7A 4EHNA 2O8CA 2CDAA 2ZSHA 2ZYRA 1JDBC 2LKCA 3JRNA 3AY3A 4G0MA 1E0AA 2OV8A 3ZU4A 2W2QA 4AJIA 4LWOA 5EKUA 2P0EA 5EQJB 1F2TA 3NALA 5A3SA 2C7QA 1P1CA 4NYKA 1KE2A 3LFUA 5CN0A 5LXTA 2EZUA 2IXTA 3BTOA 5J2UB 4RYDA 2F1RA 2G1UA 4K8ZA 2V7XA 2JVIA 3PENA 4WCDA 1C7EA 1US8B 1XLUA 2X7JA 4PZAA 2B3TA 4OKSA 3USCS 2PRSA 3JY6A 5HJ5A 4HVAA 5NULA 1HYHA 1NN0A 2Z6AA 3G1UA 4YFYA 1DRKA 1BHAA 4HQLA 2P4UA 1SF9A 1WXFA 1UPFA 1JJ7A 3EDRA 4IMRA 4XX0B 3TIXB 4FHCA 3N75A 5G0TA 4L72A 1D4ZA 4G8DA 5GAOA 4FGKA 3BB1A 4CMEC 5A3RA 2XWJI 3FD8A 1JDSA 4MP6A 2EIHA 2ILTA 1S8FA 1UMCB 2Q27A 2VO1A 3DDHA 3LDFA 1U8CB 2XY4A 4NG4A 4P4NA 1EDDA 3K5NA 2FW0A 4ZOAA 3GCGA 5AVJA 1NNLA 1MJGM 5KSPA 3NHZA 1J56A 2CJFA 2H9YA 4PM4A 3WHLA 5L3QB 4G67A 3L06A 2XCTB 1PWYE 2F3QA 1MOQA 3MC1A 1LK5A 5E38A 2C5EA 1PG5A 5AK6A 2B3ZA 1GUFA 5FTKA 5I9TA 3DDZX 4EKYA 4QUGA 2J4CA 3DP7A 4KXWA 1S3JA 4NXNO 1EGVB 1MW9X 1E5TA 4Q47A 4AIIA 5CMLA 2BDEA 1GQOA 3UWOA 3K5IA 2ZDIA 4MVJD 2P3OA 2GKSA 1H2ZA 5GTIZ 3G6KA 3PWSA 3FWNA 4UTOA 3U61B 2UYCA 1H8EA 2HADA 4MV4A 3EXG2 3ZMSA 1KAMA 2MSNA 3HCOA 2XAUA 3RUIA 2FPPA 4M1TA 4Z7QB 4IFEA 2WHPB 3JQAB 4J91A 2PT6A 1DL5A 2VKQA 3KEGA 5HCNA 3TQCA 3BORA 1EGAA 1QYWA 2GLXA 3JZAA 2YOFA 2H00A 1Q16A 1MQ0A 1ESCA 4I46A 1N7HA 1OCOB 2YZMA 1ZS9A 1NJFA 121PA 4HUJA 1HE3A 5B6PA 5FTNA 2VPZA 1N8SA 1JAHA 1N8KA 1SRQA 4PPYA 2GXAA 1N9ZA 5TE9A 1EYZA 3DEFA 1EM6A 3TRJA 3CLVA 2NU8A 1ZK3A 2LWIA 5LKAA 3C4JA 2UU9O 1MB3A 4WK0B 1L1FA 1F9AA 4RQAA 4QYMA 2X5NA 3VNSA 1XZCA 5AHWA 1O97D 1G6UA 1UZAA 3E7XA 2DFLA 2EBWA 2OV6A 2YN2A 1WJZA 3LUDA 3ZMVA 1LLCA 2ZQYA 4Q00A 4X3OA 1QU3A 1WNFA 2QVZX 1PDOA 4KL8S 3TQIA 3N2KA 2DE0X 2GTAA 1XF9A 3V32A 3T4ZA 1RC0A 3SQLA 4LMRA 4L3VA 5HG0A 2MCFA 4ZJUA 5C4IA 3BFXA 3BSYA 4MQ4A 1G6OA 2BOCC 3L74H 4G2TA 1TGYA 4CEIA 1RJWA 3VQTA 1U98A 1PV4A 1KEPA 2ZNVA 1V3TA 2HWKA 3GXBA 3J81k 4HWSA 2FEPA 5AIBA 2QNRA 3ZK8A 3IV9A 2FPSA 2PWAA 2XE4A 3DEKA 3N2YA 3ZGXA 4BMYA 5U4QA 4ER6A 2BBWA 2COUA 3SZLA 3C6BA 1CXZA 1ZABA 3L71H 1KKCA 1D5NA 1AI7A 2C83A 1XIVA 3NHMA 3A31A 2J07A 1LDBA 1T1RA 2QSZA 5JCPA 3PRKE 5KHJA 3NHUA 4EG3A 4IG4A 1GZHB 5BXZA 1US8A 1K08A 2N1BA 3ZDFA 4YRNA 3NRCA 1T1IA 1G4YB 2IV7A 1IY0A 4HT3B 4WJLA 2HHHB 1R6TA 1N0IA 3LBFA 1SRYA 1IQUA 3C1TA 3KVOA 3HKDA 1WB5A 4CM9A 1Y74A 5DHTA 4MTXA 1R18A 3VMFA 3KXLA 3TINA 4B4DA 1F2UA 2YJNA 3FETA 5L95A 3HGQA 1U2ZA 3W8EA 4P2BA 2CXOA 2VTKA 2BTOA 4X65B 2P27A 3DYVA 1OFUX 2QVCA 3RYFB 3Q4HB 1E2DA 1SZDA 2BM0A 2DFDA 3DA8A 3FM9A 3GA7A 1NVKA 3QKWA 4RHYA 3TUIC 3FPSA 1XOUA 1LVGA 2AG8A 2F66C 2CJXA 4RA6A 4PGMA 4UQOA 1K7FB 2VH1A 5EHXA 4PXYA 3QPWA 4LNAA 1VG8A 1KPHA 4OQXA 3IMEA 4R2IA 4UFNA 3P9ZA 4YAFA 4QPPA 2HRBA 3EA4A 1PJCA 3MEQA 5GMOA 2VYNA 1TGVA 3AGQA 3FPCA 3IP9A 4JNKA 2Q5LA 3A2NA 1I7FA 1G8AA 2H1HA 1VA4A 2IZ7A 4AC9A 5C31A 3DFMA 1NJ8A 3J7AU 2D0OB 1JYFA 4FYXA 3HKCA 2ALJA 2B7CA 3WL8A 2IZ5A 5LLDA 5DWDA 2QE6A 2P9GA 3OMNB 1V35A 4NTYA 4LF8O 3B70A 5HM8A 3R41A 4IWYA 4LSWA 4BLQA 2Q2VA 2JEOA 5IDYA 3S40A 4DYHA 3ET4A 1KOFA 3NVDA 4TTIA 2AUMA 2OZEA 5ALVA 3I61A 4B4UA 3Q87B 4LMBA 2KBFA 4Y2VA 3OZUA 5J47A 1W88A 1FVOA 5ISMA 3HJUA 4ZZ3A 5TLSA 2WAMA 2ILVA 1NKDA 3CX5F 5KOYA 5L6LB 2HRCA 2II6A 4INJA 3TE6A 2VPPA 4Z1MD 3Q8WA 4GE0A 3OR7C 3DAHA 4OGGA 4AYXA 5BSGA 1YE8A 2CXHA 1LKZA 3VISA 4RMJA 2A88A 1CQJB 1T5DX 2AI3A 2EYQA 3C8ZA 3OZEA 5LXTF 4CIDA 1RBYA 1MQ8B 1SC3A 3KT3A 5K2MA 4DNXA 2IP2A 2QF7A 1OV9A 4K5QA 1RHKA 1GM8A 4Z0TA 4IVPA 3O7MA 2ZSUA 1WUKS 2JGNA 4PDMA 4WV3A 1WF3A 3ANXA 1BEUB 3PPWA 4ME6A 2VT2A 3WTBA 4MVJI 2CXUA 5IWCA 1KDRA 2WBLC 1R4NA 4M0PA 2O8FA 3F4LA 4MUGA 4RTRA 1FX1A 1M6VA 1NLYA 2P6NA 3MSCA 5DT9A 4PHGA 1COWD 4EDFA 5AW2A 2HR3A 2NADA 3ADKA 4HDOB 3L9DA 5BY1A 2Z2JA 1KYQA 1B6TA 1G6Q1 3PWTA 4C3OB 4Q82A 1OLUA 4XTRA 1XUQA 2IHUA 4FGLA 4YS6A 4JVOA 1UOEA 4UXJA 2HPAA 4YP0A 3DF7A 1TYDE 2GZRA 4QOJA 1RCUA 3A1TA 1EZVH 5KA5A 2Z56A 4HWOA 2FMXA 1JSLA 3HJGA 1ACMA 4G3MA 1E1YA 4GLLA 3TGUH 3IVRA 4CLXA 2OMEA 2IPOA 1X14A 1O6BA 1M57B 1MNGA 3BHJA 5TS2A 3MWGA 3REQA 3DE2X 1J95A 5DBOA 3C98A 5I7AA 1YQWA 4C7JA 4MTGA 4ZMBA 1N34B 4NVPA 4UXNA 1H2FA 1VL1A 2GPTA 1WV0A 2IYSA 3ABZA 3H5RA 4JJIA 3CNNA 4EGSA 3IXQA 5KYYA 4I7ZB 5D5HA 1CNFA 1MP0A 4L6IA 4LP8A 3JQFA 1N0HA 4UNIA 4LX8A 4X9XA 4RA9A 3ZWPA 5DNCA 3M34A 4L5BA 2AFHE 4TVOA 4DYLA 3E89A 2QYTA 2OQRA 3AGPA 4HN9A 3WGKA 4C4XA 5C5DA 4UTVA 2GB4A 2Y9PB 3T1OA 2L0XA 2KI5A 1JDBB 1KH1A 2HB6A 4B3SO 1N2JA 2QM3A 2VRBA 2YXEA 3I32A 1S5HC 2JD0A 2I71A 3IX7A 1KFJB 5IAKA 2YI8A 1A5TA 3F47A 1GGNA 3A06A 1V43A 2G76A 2B92A 3G7NA 3ONNA 3QKSA 4EJ6A 2GA8A 3PWZA 4UEQA 5IC6A 3RBVA 2P1RA 2XUMA 2W6JA 4RE6A 2PUCA 1IL0A 1G2QA 3NVMB 2H63A 4FE3A 3C5CA 4IGKA 4IXDA 3IEVA 4R1MA 4BNDB 2OHHA 2XTAA 2ZT6A 4ZVPA 3T38A 1Q7YW 3UUFA 3SKXA 2VF4X 3GX1A 3RD5A 1UMBA 2HL6A 3OP1A 1I24A 4LZNA 1LA2A 2H3OA 3RBZA 4OHFA 5JO9A 3UF0A 5KNDH 2AJDA 2SHKA 1QIJA 2YNMD 3VH2A 5LIPA 1GL9B 2FB9A 2XTJA 3MAQA 4LJ5A 4KR0A 5D6OA 3LX6A 3BWDD 3DBHB 3VSBA 1WX1A 1F7UA 3TX2A 2VJPA 4DQXA 5KOJA 3NHAA 4HYOA 1QXSA 5GZ1A 3H01A 3UYKA 3I9MA 1QFSA 1ISHA 3FRIA 2PFSA 2P5YA 1T1SA 3PFCA 3ML1A 5F5LA 3L1VA 1WHTA 4NP6A 1MABA 2FMKA 1LFDB 1GRNA 2DBZA 1NGSA 1NT2A 3EF0A 4M8SA 4KIWA 4NULA 4AKHA 3JAWB 5DN9A 4OSEA 5JMTA 1CYEA 2C8KA 2NO6A 3CCFA 5KYVA 3FN4A 1DWUA 4Y30A 1K75A 1VQ2A 3VU9A 1P7PA 4LWZA 2F43G 1DQZA 4ZU6X 3NH6A 4DPMA 1QFMA 1V9SA 2PRIA 1QAMA 1C3OB 2CCGA 3LO5A 4GP6A 4Z1OA 2QUBA 1HNWO 1R4ZA 1L7AA 2F59A 4TS3A 4FS8A 4YYZA 3KOYA 4WFKA 5DYWA 4RCZA 3MIZA 3LNCA 1SOVA 3D3IA 2D0PB 3R3VA 4JWKA 4A2QA 4MH0R 1Q44A 3RC7A 2OCDA 2V45A 4O2BB 4ZOLA 1WNTA 4MPJA 1P9NA 3AEUB 4XVUA 3LM8A 4WIAA 5EMLA 1MG5A 5C52B 3WA6A 2WT9A 1PNVA 2V9ZA 3UW3A 1P5HA 5KWVA 3MWLA 1BFUA 1XMQO 2AC4A 4JUCA 3A1NA 4O5AA 4XR4A 3W8NA 4L51A 4YRAA 2AOUA 4CIYA 421PA 3RAEC 4LK3A 3E7WA 5HFNA 4KH1A 4J29A 4JLOA 1CJCA 2CDRA 1CB7A 2DY1A 4HEHA 1GPLA 5CEEA 1U8XX 3WKBA 1UPXA 5EHZA 1XA4A 1E63A 3G2HA 1QCEA 3IP5A 5HFAA 1XX6A 1KY3A 3CIOA 3IOEA 1HNXB 1BGWA 2OV4A 2PIDA 1VF5B 2ZIXA 4NS4A 3ZPXA 4LD4A 4YJFA 1VCHA 1JG3A 3SAJA 1B8OA 3HSSA 3PZRA 3FDZB 1E6LA 3ZKWB 2DETA 3UMMA 3CUYA 5ES4B 4HNVA 5L3ZA 3WQBA 4M4SA 4FNAA 2I1WA 2IU4A 3COVA 4B3IA 1Y37A 4FW9A 5GQSA 5BQ3A 4F4FA 5CDFE 3E8XA 3RWMB 5JXWA 5FHQA 4OX9O 4I3GA 1V5GA 1YT5A 3CSDA 2XA1A 1Z4KA 2VYCA 3CC7V 2YBDA 1FW6A 4P3OA 2P2NA 1YK0A 4KR7A 3G9ZA 4Q5IA 4I2NA 5ER6A 1Y9ZA 2J9XB 3INTA 4P7BA 5I7RA 2XUAA 4YQYA 4UB8Z 2P77A 3JYPA 1POXA 5CLHA 1ODJA 4TTTS 4RS3A 3JARA 1JX6A 2A7WA 5FH9A 4HZGA 3QJ5A 4ZC8A 3OD5A 1UMBB 3LCCA 1E0JA 4KGXA 4KUMA 5J2TB 1DBSA 2RONA 5JZVA 2RI0A 3IKTA 2V0CA 2VHVA 3X43A 2QVBA 1U28C 2B30A 1ES9A 2ZB2A 4O25A 2BZGA 4IH9A 1FSGA 2C1XA 2Z8ZA 2WF9A 4PZDA 1AQYA 1FLDA 2BKAA 3TXSA 2EP8A 4XEHA 4WRRA 4D44A 4D6TH 5AVVA 3OZAA 2X40A 3QVTA 4QELA 5KOJB 5FUVA 3FPAA 3ABMB 3DBRA 3LPCA 5JDCC 1S0VA 4UPDA 4ETNA 1ZSYA 2HMUA 2FR1A 4LI0A 3JWJA 3RROA 3LX8A 3ZWQA 1P2VA 3KWMA 2OCCC 1XG5A 2FWJA 1JJOA 1YDMA 2JDIA 3OEEA 5JW6A 2Q2WA 4X91A 1HEUA 4MVJE 3RW9A 4ZICA 4EVIA 1FZTA 2DG2A 2CXTA 5HTOA 4YHHO 1NI3A 5IJ0A 5DVZA 1ZU5A 1MB9A 2XT6A 3TJTA 3O9ZA 4OM7A 1W96A 1H1DA 4ALMA 3Q3VA 3P26A 4KGVA 3RYHA 1PEKE 4QULA 1KIFA 1WDTA 3QLUA 1LJUA 5GW7A 2CEKA 3FKSD 1VQMV 3H2IA 3O83A 4X89A 3KR0A 2C4VA 1J0AA 4G4JA 3UC9A 3VPSA 4HG2A 1EDOA 2A2ZA 2VUUA 3QUSA 3HXOA 2UXNA 4O5OA 3UAWA 1ZW6A 4Y0AA 1KTIA 1ECCA 2FE1A 5I01A 2JVKA 3TLZA 5ESRA 2OCGA 1QRAA 1YQXA 1Z5NA 5DTMA 2J0SA 1RTKA 4ISBA 5J58A 1QYCA 4I4TA 3UKMA 4R4JA 2M1XA 3TAXA 3LHIA 1DS6A 3OOYA 1JJFA 3UWDA 2V7GA 3KQUA 2DBRA 1ZHHA 3IKJA 1F8FA 1SJ9A 2AD5A 3PUVA 2VP6A 3B9BA 3WNCA 1ID1A 1BROA 2XAGA 2VHQA 4E2LA 1HDRA 1KY5A 4HNGA 1W87A 2OVFA 4C6SA 4WCVA 2CT8A 3FPLA 5FUMA 4BVJA 1UC9A 2FMIA 2IOFA 3NOVA 4EX6A 2BRUC 3EDYA 4NI5A 4FFVA 1T3SA 1Q1ZA 2IF0A 4LQLA 5KHHA 4NBUA 5DM1A 4U7DA 2Y66A 5C2OA 3F1KA 1L4EA 3ACCA 2ACEA 5IF3A 2QRVB 5IW8A 1E2EA 1I8TA 4BBJA 4PLGA 3I0NA 3ZNPA 3AR2A 1NN1A 2P3QA 3R74A 4RK7A 2LDBA 3PBKA 1E61A 4RS4A 2QIPA 3LYAA 1XNRO 4JL6A 1YTLA 5CFLA 4AU1A 2EBFX 3DH1A 2NQ2C 1M2GA 2VPIA 4TRNA 3K0FB 4KRXA 4Y2HA 3BRQA 5KO2A 2NTNA 1K33A 4W4TA 3DQPA 2OP0A 1XTRA 2IM9A 3M9XA 4U6SA 4EYKA 3AR5A 1BE8A 3ZCTA 3G8YA 3ZU6A 2PE5A 1ECFA 2BR5A 4H59A 3EAFA 5E79Z 4RPIA 3DHVA 2CYAA 4WX2B 3DW1X 1II8A 2Q5JA 3ETDA 1EHCA 2H2GA 3GJZA 4MB0A 2XD9A 4X84A 5DB4A 5CLGA 1QU7A 1I80A 3NASA 4Z8YA 3IUQA 1WVIA 4HRXA 4E5KA 3BMNA 2I3GA 3T4DA 4CH5A 1XVUA 1XAGA 2D1TA 1L7DA 1R50A 1W29A 4F3WA 4IP0A 4A1OA 3E18A 1UBFA 2Q1SA 3ZGNA 4Q6GA 4D8VA 1U3TA 5J4HA 2D8AA 1RXYA 1MABB 1TM7E 4QWWA 3KQWA 4CZZA 1TU4A 1SBCA 4PQFA 3EGDB 1N1GA 3HM2A 5B1SA 5BQOA 3RRBA 4HQ6A 3I6ZA 4D0NA 1N7IA 3WKCA 3EVDA 3DE6X 4C22A 2FDRA 2C2AA 2LKDA 2CLCX 2QVYX 2WTXA 1U7HA 1BQEA 1DHTA 1USVA 3L9WA 2O7VA 3FIUA 1VGQA 4DQUA 4R84A 2HVJC 3PUYA 3Q5EA 4PHTA 1IDOA 3MD0A 3OSZA 2BE7A 2RB5A 3N2LA 3RSHA 2HWYA 1E9VA 1AV6A 2BUAA 3TETA 2XCRB 4I9UA 4UQPA 2QTVB 4EI2A 3N8DA 3GLFA 3SJQC 4KLNA 1YZFA 4XGNA 3FAVB 1HXHA 1NXXA 1QJCA 2ZRJA 3O82A 4G89A 2UUAB 5D3ZA 1J23A 4LMPA 1AUPA 2UZAA 5A6SB 2Q7DA 1YS7A 5JQWA 3MYYA 3K0AB 2BR3A 4DIUA 4ESOA 4PDLA 4XYEA 4JJ4A 1UM9A 3G6EV 1N8NA 1X9HA 2GH1A 1DBRA 3FUVA 1FFEA 1Z75A 4H7EA 1N3IA 4EW3A 3U9LA 1NVVR 5BSTA 4QTXA 2Q9CA 4GOOD 2IGBA 2OP1A 1SCUA 1FFTB 3AKEA 3BFPA 3KLOA 3LUHA 4LJYA 1IN6A 1D0VA 1ZJ4A 4WKPA 4Y1RA 5DTJA 1PVDA 2XITA 1FQWA 3AFIA 3K0HA 3VU1A 2WWIA 2ZRNA 4BIZA 1DUSA 1O08A 5JARA 1T13A 2ONKA 3D3WA 4L78A 2QWRB 3DO5A 1D2EA 2BP7A 3GHHA 1OR8A 5KEIA 1GG9A 2H9AA 4ZTUB 4ILEA 5G4KB 4Y6RA 3FVQA 2BR4A 4IDOA 8ATCA 2B5UA 2ATIA 1I0IA 1W581 1NUHA 3KJHA 4INZA 3T95A 3E0QA 4YP1A 3R8CA 3UANA 5FUQA 1DIBA 9LDTA 2PZGA 3G0DA 3GNTA 1P72A 2IQ5A 5B37A 2VNAA 4LMAA 2C2KA 2HR1A 1RE1A 1Z0DA 3CE6A 3TI9A 2Q0OC 1H5QA 2ZRAA 4B2IA 3ROFA 1Q6UA 1WXDA 4M1YA 5AK0A 5A7HA 4DV2O 1WWKA 5IK2D 1DG1G 4E07A 2GN8A 1JPJA 3K96A 4E30A 3I4FA 5B7GA 5DCAJ 1YXBA 1QMGA 4BQIA 2H4YA 2VDOB 1JPXA 1K0FA 2EATA 1YHZA 3SN6A 2P1ZA 4BRUA 3D3KA 3SE0A 3G5MA 4RIHA 5F7ZA 1MFZA 2XV1A 1K5DA 1QH1B 3QX8A 4KR2A 2O8DB 1VBNA 1M56B 1QQ6A 2G07A 2GYVA 2XKBA 5CBGA 3BMQA 3I39X 3TD6A 4JLUA 1CP3A 1S3GA 3OE7D 1IOZA 4LZJA 4BNLA 5KYTA 5C2JB 5CCXA 4B34A 1TIBA 1XSEA 2BWJA 1VJDA 2WOOA 2ISSD 2XF2A 3C6QA 2HK7A 3ORSA 1F0KA 1U0LA 4RHXA 5CVJA 5FF9A 5JNWA 3CLKA 1ADBA 4DPKA 4X92A 4PPGA 1M93A 1FSSA 1ZW1A 2PT5A 2FUCA 3L0PA 3WKAA 2XXAB 1ONBA 2H16A 3FD9A 3M8AA 1RYNA 1YVRA 3QU2A 1ZZEA 5AKGA 3NEPX 3CC4V 3K0CC 4OGLA 4XFKA 3QE9Y 2H0RA 1Y67A 2WYIA 2F4VO 2V1XA 4R0MA 1OU0A 3T0IA 2XZPA 4F04A 1W1IA 4XDYA 3IDAA 3THYB 3DEJA 4MVJF 4RGVA 1GT91 1CUYA 1U8UA 4Y2TA 3DPIA 3OP4A 3QTLA 1CF9A 1PF7E 3DSQA 4B3RB 3KQMA 1C7ZA 1DO8A 2Q69A 4D4IA 1FFDA 3BIXA 4FSXA 2JIMA 4X8HA 3LF1A 1PR6A 1HTWA 2R60A 1U1DA 3R3UA 4L95C 4V0ME 2PCLA 3QUAA 4ND6A 3EK2A 4BLUA 5TARA 1MAHA 2IYOA 5KYGA 1Z6AA 2BCCH 3QE3A 2NXNA 1DXOA 4PYQA 2EIKB 1PJQA 4QSMA 4PZZA 2XMDA 1FUIA 2X6AA 1QG6A 3NHSA 5F1OA 5IVIA 5U1PA 1YHQV 1OROA 3MQ4A 1OVGA 1ISGA 3WK4A 5EYPB 1W75A 3TSOA 2UXCO 3LTEA 2WJYA 5CP8A 2F1KA 2G9VA 5BV1A 3RT9A 3BWXA 5JH7F 1ENYA 3QFCA 1KSHA 3V8VA 2VLBA 4AK9A 1JDNA 1MEJA 2QQ0A 4JELA 4NL4H 1IXKA 1EVEA 1KFCB 5EXSA 2OXEA 4HEA1 1X1RA 4CRWB 4MVQA 2GKOA 4ZO8A 2QAGA 2NT3A 3QE0A 1VE5A 1YR1A 2JIOA 1QE5A 1WO8A 1G3IA 3PL5A 1NT4A 3OIGA 1N4CA 1WL8A 3C3KA 2BFBB 2W6CX 2V7VA 3EX8A 4TUYB 3STLC 3I04A 3USZA 5DM4A 1Q1GA 3CY6A 4D4MA 3FHJA 2JFXA 3VR3A 1JT9A 1YS9A 5I45A 2AX3A 1KMMA 2IY9A 4BIIA 5ALTA 2I6SA 3IHKA 1PJ3A 1X7YA 3V7WA 2QE7D 2J7KA 2R5FA 5THXA 2KHZA 5ELLA 4YVFA 2Y92A 1XZLA 1Y7PA 2XUGA 3OTQA 1V5WA 5E1BA 1M66A 1I3LA 3I5AA 1HRDA 3GEIA 2XUIA 4PZ9A 4WECA 4C6HA 2P2SA 5ALJA 3VI4B 2AOXA 2AHZA 2FPIA 4RORA 2W0SA 2WA1A 4GR4A 2CXSA 4MCJA 4ND2A 1SHTX 4TL8A 3LRTA 4ZQBA 3JAMA 1M1UA 3LC2O 4AO7A 3DE3X 1KYTA 5I6DA 1NX6A 4KDCA 5JMPA 3TYXA 4DCPA 1JHMA 4BLOA 4EY8A 5AVRA 4RPLA 3AU9A 1TMYA 1YB6A 3I58A 5EP3A 4FM0A 1ZO8A 3CNBA 1S2IA 3FF4A 4J0EA 1EDZA 4X6UA 2GZAA 2JFNA 1CVRA 1J1IA 5E7MA 2IY7A 1EUYA 4KLCA 4TUYF 2IEZA 1QYIA 4XRRA 3CSXA 5F1YA 1CDDA 2O0JA 3RI3A 1BDBA 1S4QA 2BGMA 4W82A 1YNOA 1EMDA 1KERA 3V4OA 3CINA 5LHHA 2X6QA 5JLAA 2F48A 3OX2A 2ZYUX 2ODNA 3TMKA 1KEKA 2XUDA 4P4LA 3U56A 4KYIB 1Y7IA 2XBUA 4WBXC 1NG1A 2EILB 5DDIP 1JWLA 1PJ4A 4AN1A 4N41A 2OZKA 5AJTA 1GP2A 1NZJA 4Q34A 2QJOA 4MJXA 1TFRA 1KYVA 1JH8A 3GJ6A 1XU4A 3Q3EA 3SC6A 3TJMA 1XXHB 2Z4TA 9LDBA 2GD6A 4PPFA 3SIWA 1JXOA 1O0BA 2VWGA 3D0QA 5GJVC 4EHBA 3W34A 1ZR2A 4DLXA 4PX3A 5KQMA 4EECA 4BEBA 2VK2A 4YHBA 1EEHA 2I80A 3B5JA 3CMMA 3U44A 1GM5A 1CWUA 4WJKB 3PDIB 1AKEA 2A5GA 2DBQA 3T06B 2ZCJA 3COWA 2VDPB 3K0DA 3DMHA 2O8VA 2V4ZA 5L3BA 3OFND 4OYRA 3V4PB 1G8GA 1FLAA 1WUYA 1O96A 3BXEA 3T9AA 2PNJA 5DK6A 3WFZA 1SHKA 4AQYO 1MEOA 1GPKA 4DR2B 2WJIA 2XMBA 4LOHA 3TLXA 3GPCA 4ZHQA 4F3TA 2W70A 3DMOA 4LCNA 5CDYA 3KQLA 1XEXA 1FOEB 2CNDA 3PFWO 3PR2B 5EGNA 5B53A 1PNTA 3AP3A 4DJJA 1RRFA 3L75H 1QQTA 1BD4A 2NPOA 2PZLA 4G5XA 2W6ZA 4HGYA 4JP1A 4PLHA 3NANA 1K68A 5KTOA 3MCVA 5EPUA 3P5SA 1NKVA 4W9NC 3R40A 2Q3EA 3AKZA 4KR3A 3W7UA 1D9XA 3R5TA 4C7MA 2O1EA 3B40A 4RTLA 4I9QA 1Q1BA 1G4AE 2GCEA 3REFA 4DG9A 3LS2A 4FVTA 5AKIA 5EIEA 3C3PA 4YH1A 4KWHA 2QW1A 1UJ2A 4GM1A 3DLAA 2BE3A 4GPZA 2LQTA 1YR7A 5BN1A 2HU8A 3U19A 1FSPA 1JYSA 3ZVLA 5F52A 2REQB 3QKTA 3F9CA 3QXGA 4HUQA 4K3AA 3FBGA 1NQVA 4HX9A 3LX5A 3W05A 4LVOA 1V48A 4UUMA 4CQMD 4B6EA 3KQKA 4ASUG 3RVNA 1H6BA 2OLKA 1Y6ZA 3IKVA 3DHWC 1K34A 4PQEA 5G0VA 2BELA 3SK0A 5HVNA 1CR0A 3L8GA 4Q3DA 2PUGA 2O3QA 1TJ3A 3WRVA 4IXTA 3K71B 2FSVA 1QRUA 1VLMA 1W88B 4M9XA 3U1VA 3AKYA 2MWMA 3LCVB 1NQTA 2YVAA 4BFYA 1Z0IA 4GCZA 4MUKA 1DMRA 3QVOA 1M6HA 4KTTE 1UT8A 1V1RB 4BLRA 4LGYA 3W4IA 4XYBA 5KNBH 4C9BA 2JFQA 4X90A 1Z5UA 4YRFA 1XZAA 3GGJA 3MIIA 4N40A 3FZYA 4DCTA 4XLLA 4JR0A 1CUIA 1OLOA 1GTMA 1J0DA 4AUKA 4D3ZA 1FPQA 1DLJA 3N8HA 3JQGB 4WERA 3A0RB 3STHA 3QEMA 1VE6A 1DU4A 2XUPA 4IT5A 4GXRA 3AJ9A 4Y3UA 3BWVA 4KREA 1ENPA 3EXHC 4GWLA 1D2NA 3FGPA 4KQEA 5JQGA 5EUQB 2ZINA 3F7VC 5FBZA 4I55A 1W5EA 1USIA 3DF9A 1TO6A 3WMEA 4CLHA 4JC8A 1NQUA 1VQNV 2D5IA 3CLUD 1LXCA 4HXFB 4KDRA 2HLHA 3QWBA 3O1IC 1XMOB 1RRGA 1VF6A 2DM6A 3BPSA 2D2FA 3K72B 3F9RA 3TNLA 4MEAA 1JR3D 1W35A 5J2TF 1Y3AA 4ARUA 2EFYA 2YOGA 3LE8A 4II2A 4N23A 5DU2A 5CB4F 1NSFA 2N75A 2GDSA 3AEIA 1PZMA 1X1EA 2TMDA 3PQ5A 3C6MA 4OB7A 3DEAA 1QYDA 2B4TO 1H2XA 4MLZA 4TTVA 1D3AA 1DAKA 2YV3A 1IM8A 4XJVA 1PQUA 3WA7A 4EPVA 4HMOA 4NBKA 3W6OA 1Q0ZA 2QDXA 3FUXA 2AFRA 1X1AA 1HMPA 2FPLA 3GZTB 2YY5A 1U0SY 1KIMA 2Y0BA 3ROKA 2HQSA 4MA4A 1T5LA 4XQEA 1QVAA 5FL7G 2E2WA 2EKPA 4UBJA 4UUQA 2D3OW 1TECE 1GTL1 2GZMA 3IAEA 3HDJA 4R1UA 4BE9A 4YA6A 4CGZA 1VI6A 2C3UA 4BXOA 3REQB 3IALA 3PR1A 4H7IA 2JIQA 3DMTC 1U0BB 4DV7O 2JBHA 2ANBA 4NDNE 5I4IA 1II0A 4AKGA 2N74A 3KUXA 8LDHA 1N77A 1V5EA 2XJ9A 4PYJA 1K97A 3DLCA 3EWNA 1C81A 4OA5A 1V7CA 4A23A 1N92A 4EY7A 1VP9A 4D6PA 3D8CA 3Q7EA 2XMCA 3FYUB 2J87A 3I5MA 4WPGA 2YIBA 3V1LA 1MIHA 2QA4V 1KI8A 2HTFA 4Q9LA 4B6GA 1SEVA 4EW2A 2HRDA 2QENA 2IYPA 3BCHA 2E5LB 2YJTD 3LOPA 3UEOA 1UPGA 2OV2A 2OCAA 1IY8A 1E1CA 4JHLA 3CZAA 4MUYA 3L6BA 4U2CA 4NAUA 4DS3A 5MGBA 2PTGA 1KKMA 2WSLA 2WVAA 3LJKA 3SM9A 3C85A 4BECA 3V9PA 1KI6B 5CFMA 2R1VA 3PP8A 4RO0A 1YZTA 1FD9A 1J8YF 2EFEB 4DKXA 4Q1DA 1YOVB 3IVMA 2C5FA 5KTYA 4PDVA 3R5FA 3FWPA 5JS6A 1Y3HA 3SS8A 4QEZA 1WUHS 5E9JA 3REOA 3U7EB 3IP1A 1NVXQ 2A0FA 3DCIA 3NGMA 4ZT5A 4YMHA 4JI0O 1JVMA 4K87A 5COBA 1IFXA 2Y1FA 4JJ8A 3ED5A 2HW8A 1COZA 1D6NA 3Q6MA 4XM2A 1U04A 2Y2VA 5DE3A 3ZVRA 4AJOA 4CLRB 3UG6A 5DM60 3ZV3A 2DUJA 5HKAA 2OD9A 4XUDA 5HJ7A 2O6HA 3WNDA 1SG9A 4E03A 3CKKA 3OAAG 2VQEO 1AUVA 1RSOB 4TKUA 1KYOF 1I5EA 3FGOA 6REQB 3GPDG 1NU6A 1UKYA 1HPLA 5AW9A 4JLJA 4Q3CA 1K66A 5K6RA 3QVMA 3ZLBA 4JOBA 1Y5NA 4JVNA 1K8QA 3CRQA 1Q1EA 3KM0A 5A5EA 5TY0A 3MHTA 3R3HA 1FW8A 1T4CB 1IPEA 2EWWA 4ZCQA 2JGKA 3L93A 4EQ6B 2AK3A 3BMOB 5BYKA 3KTAB 1W6UA 4K8RB 1FUKA 1NBEA 1NJ5A 5EZ6B 3UJ3X 3L7AA 2HMWA 1N1DA 3KOUA 3KOWA 2I3ZA 1DAMA 4XDLA 4EKNB 4UU0A 3SJBA 2O1WA 2V7TA 3ZVKA 1THTA 3AI7A 1T5OA 3IVAA 4MWEA 1WB8A 4OHUA 1XZQA 4IQ0A 5KAMA 5FNVB 1L8LA 2CWWA 2LGJA 4RJIA 1I0HA 1CUVA 4HGOA 1M33A 4NZZA 4F1JA 2DAPA 5I7HA 1H3NA 3RVLA 2P6UA 4RHTA 5JAOA 1L5KA 3B1XA 3SJUA 3ETHA 3KVNA 4OJMX 4AMBA 1GAQA 4KRGA 4R3UC 4F92B 3UK0A 3AEUA 1Y1KE 3SPXA 3X1YA 1EA5A 1X7WB 4OP1A 4TOIA 4FEEA 4LRSB 5J5AA 2QN1A 3NX4A 4HPWA 3L7OA 4D3YA 2FN8A 3ICWA 4MPDA 2ATVA 2C4NA 2JVJA 4PZLA 2WWVD 3SBOA 2ADMA 1V9PA 3OA0A 2EIMB 3G9UA 4ZVTA 1XAJA 3AF4A 1DEXA 3OT1B 3NBQA 4UDXX 3OQHA 1WLEA 2BM9A 3BA1A 1SZXA 2HMTA 2NX2A 5C80A 2G1KA 5JSQA 2AGVA 1N5DA 2A0LA 3Q1KA 2V3WA 2QD5A 4DWWA 5JCJA 3NGXA 1ZXBA 3FGZA 4TVSA 6ABPA 4CT5A 2OT5A 3B12A 4XARA 4CIBA 5DIZA 1NLFA 1R64A 2QUKA 1M5TA 3II6X 2SICE 3JYHA 5EQDA 6NULA 4JNCA 1AS2A 4AILC 1E59A 1N7JA 4HYQA 3TTWA 1J5PA 4YGYA 3RW0A 2XOEA 2Y1DA 4BXOB 5DNEA 4A27A 4Q1CA 1P3DA 2AXQA 2FN4A 4LF5O 4HFMA 4Y1GA 4ZCTA 4DARA 3ZMUA 3KQQA 1F4NA 4XWGA 3S2SA 4CN9A 3IPXA 3UB3A 1V8BA 1Z25A 3LY5A 4XUGB 2XYVA 3FPHA 2MINA 3HRKA 4XIFA 2PX0A 4JDPA 4Y98A 2YHUA 4Z2YA 2YIJA 3UYLA 4EH1A 3CJQA 3E1KA 3D2LA 1F2UB 3GLIE 3P2OA 4Q19A 4AXBA 2QMZA 1SZCA 4IQ8A 1H5UA 1QIDA 2YRXA 4QQKA 3T0GA 5IG2A 4NAVA 5JNRA 1TA9A 4FQ7A 1FTSA 4I19A 2XUFA 2B9VA 4L8LA 1TA4A 4BZWA 2LGWA 1TYZA 1UEJA 1RJGA 4DSZA 1FDTA 4CBCA 1L0BA 3QELA 4PG6A 3EGVA 3S44A 3BX1A 2VYND 2BKUA 5BMVB 3VR2D 3NJ4A 3F7OA 5JHHB 1R9GA 1QO7A 1RWOA 2LV8A 5M3BA 2GBLA 4XB2A 2BEVA 1GL3A 3GB7C 2P9TA 3WNQA 3Q8MA 1RSZA 3SHWA 4ESEA 2FV8A 2P4SA 3O21A 3LLCA 1T8SA 3NTQA 3OMWA 2GOYA 3MJCA 4FK8A 4OB6A 5EXXA 3UMRA 5HXAA 1OCZC 4JROA 2HFKA 3WRXA 1PJBA 3AJ8A 4LDJA 3FOFC 1VHWA 2HIGA 4INOA 1TRHA 2JAHA 5C5EA 2COKA 4CC5A 3DKIA 3K2BA 4NX2A 3JZMA 1AKVA 4C4ZA 4UAGA 1ZBQA 4Z1MG 2PGDA 2P2CA 2B0CA 3BERA 1CEZA 2CXXA 3CCMV 1GKKA 2WR8A 3MPOA 4KN5A 1GN9A 1N5MA 5DKFA 2LUOA 3CRRA 2WWXA 4F12A 2OQ2A 5EHNA 3D36C 2AV6A 5I8WA 5JXIA 1ACJA 3HJNA 5K0TA 5B12A 2D3WA 4LQ4A 1XEQA 1D6JA 1U0HC 2ZW9A 1F7VA 4YDRA 5FWNA 2YJ4A 2ZEJA 4TMKA 1TU0A 1GMGA 2X1VA 3AVOA 5KHAA 4EG5A 3D1VA 1P2BA 2Z1NA 3L0YA 2NZYA 3QWFA 3RS7A 4YIHA 3ICXA 2ODPA 4C88A 4RQUA 1ZA1A 3ZCRA 2K7ZA 3HK2A 4BNMA 1ICEA 3O8CA 4PGFA 2BTQA 1HC7A 4PLFA 521PA 1E94E 2ZYHA 3LUPA 1IATA 1O6CA 4LWSB 4I4LA 2ZJ6A 3OU2A 4HQRA 4W5HA 4WFIA 3RT7A 1MZFA 2OB1A 5LB4A 3KZKA 5DI3B 4WCFA 1G8MA 1EX1A 3EGOA 3HO8A 5JDCA 1IXBA 4IS2A 2XI4A 1YJCA 3JU3A 4FZJA 3JQGA 1YMUA 1U2TA 1UODA 4RUFA 1FNNA 1FP6A 3AR3A 3CVOA 3CW2A 1XHFA 2JLRA 4R7TA 4PYLA 4QVKA 4WD3A 4FX2A 4B6PA 4AMZA 3AR6A 3E0XA 4CH4A 1AKTA 4FZ3A 3BD9A 3K94A 4BBAA 1AB6A 1U2DA 2GGSA 2R70A 3RVJA 3EULA 2GPSA 2UXDB 3RHFA 2Z3HA 4INAA 4Z54A 5J23A 1QV7A 1NNSA 1U3CA 1WSBA 2EL9A 4LCBA 2BC9A 4ZPXA 5FHRA 3ORRA 1BVUA 1U7XA 4YJHB 2VDMB 4C0AC 4UTNA 5FOQA 1RWVA 1GXSA 1ONPA 2V7PA 1X19A 1P61B 3AXSA 1ABFA 5DXAA 1BXRA 1T2VA 3AEQB 4BQFA 1UOOA 3KLPX 2IIPA 1Z13A 1YKSA 2H18A 3RGGA 1EE9A 1AGNA 4BC0A 4QNMA 4XE5A 5AVKA 1L5OA 3ONVA 4DEYA 4H3VA 1N25A 2NSLA 3LXMA 3PT5A 1H2YA 2O52A 3WX0A 1RWWA 1W46A 3TKAA 4DWOA 1Z6XA 4AMYA 2HAEA 1XCGB 4J0DA 4I4TF 4LHYA 4MGEA 1U1EA 2ID4A 3BSWA 3NYWA 3V1TC 1LK0A 2EERA 2A9VA 2GNOA 3BMCA 2UV8A 3FPFA 2OGSA 2EX0A 4JLAA 1YCDA 4ZOCA 4NE9A 2QM8A 4BQSA 1F3OA 4K9OA 5AJUA 3DVLA 5A0TA 1QHFA 1XMSA 3D6MA 4YAJA 3H2HA 2A0YA 4XDKA 2HEPA 2ZQ5A 3RSLA 4AMGA 4BLTA 2NO7A 2NT4A 3STXA 4MK4A 3T7SA 7MDHA 4FMTA 2MYTA 3I1JA 4KR9A 5KYWB 1Z38A 3AUTA 3OOJA 4MWBA 5EJ9A 1YRLA 2HA4A 3L8HA 3LH5A 1BWSA 3KHUA 3SMQA 4M76B 1Z15A 1XQXA 3RUHA 4FPPA 2F8TA 4FXOA 4JJEA 2YWCA 2QGNA 1KAGA 4IIHA 5L3RA 3ZIAD 4YXWG 3NQ41 3MS4A 5GZ6A 5LZ7A 1PR3A 1UKBA 2QMQA 2G5TA 5IYZB 2I29A 2QUIA 2ZM6B 1JPVA 3LV8A 3SGIA 2E4YA 2NZUG 5DOZA 5ED4A 1AQNA 3SPHA 2QDOA 4O4JF 4ZQHA 5CH3A 3RGWS 1YASA 4J9UE 4IIVA 3P2IA 3C8MA 5LIRA 4PA3A 1JZQA 2AFHA 5AW6A 2I2DA 1DLBA 1Y4MA 5IBQA 1I7SB 2POQX 1VARA 3MMZA 2D0DA 3A6HA 3MGCA 1TUEA 1XILA 1XRLA 3OTOO 3PWKA 5C1PA 3PDUA 1JEQA 3CEIA 4X1IB 1F12A 1WCWA 4NBLA 1NXPA 3TNYA 3L2OB 3NC0C 2ZYAA 4FCVA 1YI1A 1RWPA 2C5LA 1HNZB 4J9YB 4UARA 4Y0VA 5CT5A 1YJAA 4GO1A 3RLFA 3O3NB 2CGOA 3PHLA 3LVRE 3PX2A 3RSFA 3EVEA 3LXRA 1YRYE 4WLUA 3FGNA 1HT0A 1DQYA 1OFIA 1QCDA 1RQGA 4TLBA 5TJHA 4IHKA 2NU7B 4MUMA 4EPRA 5CA0F 1VPWA 2X86A 4AYWA 4Q7MB 1FMTA 1GVHA 5CA1A 1WPBA 1ODCA 2E4VA 2AFIA 2HNAA 3DZHA 3IILA 4BFLA 4WXRA 4OSPA 4MZXA 4ZYUA 3AUUA 4W5TA 4CHGA 1T29A 1WDMA 2PKRA 3TW6A 5EXDA 2WAXA 3E9CA 4JXJA 1P0QA 3P20A 4WDRA 4FFBB 3D7SA 4NJEA 5DNUA 3I52A 1H23A 5IKEA 3TG8A 2GHYA 4JI7B 1JHZA 3B85A 1JAIA 4AFNA 5K8VA 2ARKA 5ILQA 3ER9A 1BIFA 3TD9A 3CVVA 5ES3A 1YVDA 3IEMA 5C1BA 1EE2A 1R10A 2NP7A 5ALZA 1UT5A 1PHRA 2P2GA 1R66A 2ZIWB 3IMKA 5JY6A 2Y1WA 4DLLA 3Q0EA 4EG4A 1KVSA 1YR3A 3EBOA 3KHKA 3RS0A 2ADPA 1AKNA 2QPAA 3AG7A 2PX6A 4J9ZB 1VSBA 5H3HA 4WJZA 4JJ7A 2L17A 4LF4B 1NZDA 2HBQA 3L0BA 4XSGA 3FOZA 4BNHA 1D2RA 3OO1A 4IZOA 1K3UB 4AG5A 1JR6A 1KL7A 3L77A 2P5TB 1NVVQ 5HWSA 1ADFA 1ZONA 1YSCA 2EIJC 1L3IA 4B76A 5J4YA 3P2YA 2BH9A 4JR2A 1YE5A 3F6SA 1P7YA 3ETNA 5LQSA 3TM5A 3DE0X 1PZFA 3W7WA 1C2TA 3QP9A 1NP3A 5JSZB 1SPXA 5A9TA 3CRAA 1OX4A 2DWUA 2OM6A 2Q8QA 2QRQA 2OWOA 1T3LA 1VB3A 2WUEA 3DXFA 3GDFA 3HO6A 2BFPA 2FXIA 2P4QA 2OD7A 2I22A 3H0EA 1A69A 3NNNA 5FD8A 5TQ0B 3ZY5A 4D9GA 5JPCA 4WNAA 1DP4A 4OHWA 4LDPA 3HBMA 1G3QA 3PLRA 3RFRA 4BV8A 4OWPB 3ELDA 4L02A 2HA3A 2PL5A 3BQ9A 3UA4A 3OCCA 5FUYA 1MQ9A 4AY2A 1DE0A 1XEAA 2O8NA 1TEZA 1E98A 3V8EA 3ANYB 3NNSA 2XCIA 4UMEA 2G09A 2WPDG 2E55A 1CRQA 1Y5LA 2HGSA 2RKOA 1VXRA 3GFSA 6CHYA 2HPZA 3E9QA 1A50B 2DF8A 2ZQZA 3G0CA 4F2WA 2GCOA 4RV5A 3B2NA 3T3OA 3B36A 4MMXB 2C99A 2ZE8A 3OEYA 1MX1A 1C2YA 2PW9A 1AK1A 5EWJA 2J0UB 1BVHA 1VKJA 3AFMA 5GY7A 1NW4A 3H2GA 2QTCA 3JTMA 5EIHA 3UGQA 3JWPA 4A6DA 4C87A 3L84A 3D5EA 2PI4A 1RIIA 4JV5B 2QN2A 4PI0A 3ST7A 4DR1O 1QUFA 1Y42X 3OKCA 3HB3B 2Q73A 4LZAA 1BHBA 1DTSA 1GRCA 4FD2A 3THWA 1YZLA 2JRLA 3QGMA 3F8TA 4YMWA 2W98A 5CAEA 3GEGA 2RBGA 4HK4A 1FTWA 4YJGB 1KFEB 2WRZA 1WXHA 3PHJA 1ZJJA 3JQ8B 2MSDB 5ALDA 3VU0A 4EJSB 3ABIA 3QVNA 2X77A 3IKLA 5BV0A 2XECA 3LQRA 4OY3A 2RHOA 2W6MA 3GUHA 3M9WA 5KU7A 1HO3A 3WBKA 1VQ1A 1GTG1 3ZRSA 5JH7B 3TDKA 1RZRD 2Z6QA 5ALRA 2FLKA 1MCZA 4JN6B 3N7UA 4ZVSA 5JNVA 3EPLA 1ORIA 4OCZA 4U7FA 1UAQA 5A2QN 3DMRA 3O47A 4GYJA 1NYRA 4RQEA 3CEJA 3M3PA 3TM4A 4HDNB 3DBHA 2ZP1A 1B3BA 3VU9B 2AIRA 1T36A 1EQAA 5I5GA 2JJQA 1F9EA 2WC1A 3WWYA 3PNOA 4AJJA 4E6PA 5HKLA 3GLQA 5EINA 1JB1A 4XD2A 4Q37A 5FTLA 2RHGB 3ZG6A 1DX9A 3TAHA 5E3HA 2RNBA 1L7RA 2P2YA 3EXG1 3HKBA 3GBSA 1XCOA 4LFAB 3UOAB 3WDLA 2BBTA 5GV8A 1ZGHA 4DNQA 1DC5A 4C7UA 5CA1B 4UE6A 1J4AA 3THRA 3KFXA 5FYQA 4EGQA 3GDWA 1ZKDA 2QLNA 2CCJA 4GIBA 5FI5A 1YBAA 1IBLB 1NX9A 2Z0MA 1JDTA 3FRJA 4ND3A 1DBWA 2R68A 4UUNA 3RRFA 5ECWA 2J33A 2OZLB 2QK4A 1WUTA 5CX1A 4NTXA 4H6VA 3G0HA 4IJMA 1QVWA 1HZJA 4GMGA 5E3IA 5EXPA 5HX7A 1OZFA 3WWPA 1OIVA 2NZVG 4URXR 4I5IA 5HFJA 3SDZA 1WXQA 4M7WA 2O8BA 1QHSA 3MJTA 4H18A 4J49A 2CNLA 5L9AA 1QU2A 1MNAA 3EVCA 3ZDXB 5IWAB 2OO3A 1X38A 4JBXA 3S5JA 2ZI9A 4DDMA 3MDSA 1SB8A 1SR8A 1Y76A 3BY6A 3TECE 5CMUA 1JEDA 1P9LA 1R8XA 1QVVA 1YA8A 2FOLA 1MTOA 3CYFA 3UK2A 4G84A 1OCRB 2HPHA 5LYJB 4PX2A 4MQBA 4JV5O 1PYOA 2WLSA 3C5VA 4Q9DA 1SQXH 4WZBE 2C2XA 1K92A 1UC8A 4F4DA 3WSVA 4YCSA 3LPDA 3NBKA 5FBQB 1Y6GA 1I6KA 3U4QA 1G41A 3F97A 4M36A 3W7XA 2D2XA 3RYHB 4U5XA 1H22A 3K92A 4HZUB 3VAAA 4ANFA 3QYAA 3OPNA 5B58C 2AFHB 2UUBO 4GP7A 4PV7A 1SHLA 3DBOB 3G68A 2CAZC 3QK7A 1EJ2A 3R0VA 2RHDA 1TUEB 3LKDA 3QH4A 4I55F 5K8CA 3JZFA 1MX9A 2WF6A 1JR4A 1RYZA 2OBFA 4XGIA 1KI1A 1KJNA 2XYHA 4LFCB 5H68A 1WE2A 3KUDA 5J2UF 1QVGU 1J2JA 2BGKA 3U4GA 4Z2WA 4OO3A 1FSZA 2JAPA 1WV1A 2JIBA 1KR5A 3RWRD 5A4MS 4RVUA 3DJYA 2WB2A 4DC9A 2Y1KA 5CB0A 1Q7EA 1EFRD 2NO4A 3HXLA 3QNWA 1QOZA 3Q72A 2EQ5A 3VR2A 4CODB 4ICIA 3GAFA 2QVXX 4ZOBA 4N0QA 4TS1A 5JD5A 4DLSA 1AVMA 2D5NA 2BVNA 5K3FB 1I30A 1E3WA 4LF4O 1E5XA 3G85A 5F2KA 1UBTS 4FW8A 3UIEA 4IRXA 1A8PA 1Q43A 4UZEA 4MS1B 1E7RA 3WGJA 1ABBA 3O1LA 2HIMA 5LL6Y 4JMPA 3HR8A 2VDWA 3ZTTA 4CMIB 2Z4RA 3LNTA 4HRVA 2CJWA 2E21A 1O3YA 5ENZA 2PZBA 4L4ZA 2VTEA 1GKIA 3A3KA 1JHDA 1JSZA 3K16A 4KVAA 4Y1RB 5DX1A 1Z12A 4D7AA 4G0WA 3A3PA 1QP0A 3Q4GA 2ODBA 1HL3A 1E1QA 2ONCA 3A26A 2GJKA 4L2IA 4M55A 4OL9A 5DWQA 3S7TA 3VGPA 3WIUA 3O93A 1DEHA 1YR2A 2PBZA 3KKQA 5FWAA 1A2OA 4YYEA 4BUZA 1JXQA 4D3DA 1ZGGA 4HH4A 4ZIBA 2X3UA 4JASB 3C45A 1J7JA 4K6CA 3C5HA 1F38A 3KALA 4QM6A 1DFHA 3QNUA 4HI0E 5KJ1A 1O0SA 1JG1A 3B13B 2DJ5A 2H65A 4AJ9A 3AVPA 4MQEB 3SJCC 4QRDA 4EGAA 4RTMA 4ZHQF 3H5LA 1N6LA 4ENTA 2HPVA 4ZAXA 4CR7A 1NN3A 2C7RA 3L5KA 4K6MA 4TQDA 3SF8A 5IHXA 4K2AA 1YRHA 2XYPA 4H4DA 1DV1A 3F7TA 1GKLA 4WK2B 3FOWA 4IICA 4R2KA 5JISA 5REQA 3X2SA 5IAGA 3DBIA 5EVCA 3Q10A 4B87A 4D8UA 1J9GA 4BX9A 1XVIA 4UHDA 2YKGA 1N1EA 1ZGZA 1XHLA 3DMNA 3FPJA 4J2TA 1DB3A 4M0EA 2ATXA 3I9V6 1W4BA 4JI8O 3KZXA 3EHDA 5FYDA 3C15C 4TT3A 4E2WA 3JQCA 4RD4A 1FLNA 1J0EA 2WF5A 4EA7A 1EM8A 1SVUA 1YDFA 3PRHA 2CNWA 3IIMA 5CH8A 3UB2A 4LDZA 1M2WA 2GLUA 3EODA 4ZQGA 2ETXA 1PFGA 1NR7A 3NHFA 1HTTA 5E9QA 3ICPA 5DOVA 3K58A 1PL4A 4E88A 4BO9A 2R6DA 1OZ0A 2OPHA 2YFHA 5HUJA 1DIGA 4E08A 2I76A 3QU7A 1G2PA 3CFYA 1C9YA 2WUGA 3H9GA 3L8YA 4OBXA 2Y1CA 3LVBA 4R3WA 1CR4A 1QIHA 1TK2A 1U5AA 2VHEA 3AM4A 3PQ4A 1FXUA 3HHEA 1OKKA 5EWLB 4YXWA 3UK1A 1DTOA 5EC1C 4G0ZA 4OQPA 1XEWX 3OLQA 1RD4A 4ACBA 1M56C 1UXGA 4IUBS 3LCJA 4I8DA 3VKFA 3MLEA 4FMDB 1Q0TA 2W93A 2QTVA 4DIDA 3HADA 3GLFB 4J3NA 1QRSA 2A0WA 2JLYA 1L0LH 2LZ0A 2VZLA 1AF2A 3B9RA 3S28A 3P0JA 4NZYA 4L8FA 2FGKA 5BNFA 3ZQ6A 2P6RA 3IIIA 4RHFA 3TR6A 4GOMD 4MI9A 1ZOOA 2GO7A 4WA7A 1JZTA 1NVGA 2AJ8A 2J5RA 3G80A 2IZZA 3A2LA 3OX3A 5AHRA 6AT1A 1WNSA 1QANA 3TDNA 4Q4AB 4L5IA 4DCJA 1SVMA 2J6IA 4DJ5X 2PLWA 4JJFA 2PX8A 4H7HA 3A9SA 4QC2A 4YMIA 3G2PA 1JQBA 5HS4A 1KRXA 4WDQA 3E70C 3GT0A 4QT0A 1CG6A 2NXJA 3BILA 4G8CA 4MR8A 4RMHA 4U2KA 4UVIA 3C5EA 2O3TA 3SQOA 4ND5A 4BO6A 4RF5A 3MG9A 3AL2A 2A8YA 4TTJA 1RAGA 4BX3A 4J6EA 2M6YA 4NCJA 4BIMA 3D3WB 3M4YA 2KG7A 3OJFA 4HEQA 3HKBB 4NK4A 4P33A 4R6ZA 4RJLA 4BNVA 2F1OA 4ZCIA 3DPSA 4M0LA 3TE7A 5SYAA 4RNCA 5AK3A 2VBGA 4L7QA 5KJ6A 4RL4A 3N2GB 1N5OX 4A0GA 3K5HA 3PGJA 4WADA 3WQRA 5JQGF 2R6FA 4OTZA 4OMDA 4N49A 2HUPA 3OA2A 4RF4A 4ENPA 1R4AA 4ZI7A 1GPH1 1H6AA 1Z47A 1Z7WA 3ABOB 3G3EA 1E3WB 3MF4A 3AIMA 4OLHA 5EUMA 4K9NA 1QLNA 4GSYA 5FWXA 3GN1A 1Q7BA 3F5MA 4K6FA 4NMMA 3R7AA 2O50A 5FB3A 5LN1A 3D02A 4FK5C 1XD2A 3I5YA 2Q1WA 2FMHA 2UVPA 1QQAA 3ISVA 3VX3A 4CKEB 2WJAA 1FMFA 1P0IA 1XT6A 3GGOA 5JJIA 4RY9A 2DRIA 3CC8A 2O20A 1H8HG 3HV0A 5D3KA 4FOSA 4OFWA 4TZTA 4UDOA 3BZWA 3O3CA 4GZMA 4FFKA 2VDVE 2Z3WA 4ND8A 5EOVA 2DECA 4KV9A 3EXAA 2FW7A 1OILA 4FILA 3T7RA 3VR0A 5FAXA 2ZUEA 1MOSA 1ELOA 1XNJA 1KR2A 2QSYA 1N32O 2C2MA 3DC5A 2WWFA 3IUYA 3KOMA 4H33A 5ICSA 4S1PA 4BV3A 1QF9A 1EP3B 3EPRA 1S8OA 2XXJA 2ZJ1A 2JBAB 2XMZA 3BE6A 4HDKB 2DUUA 3W2FA 4C5BA 3B52X 3I3SR 1JTEA 1EN5A 1RAIA 1T34A 3HBAA 2L6LA 3A04A 3BC1A 5AOCA 3UAVA 2PYJA 1AG9A 4LJ9A 3NOQA 3H05A 2BKXA 4MW5A 4DJFC 1SWWA 1EUCB 3QV2A 5CX4A 4KLZA 4INPA 4FM2A 3D36A 2JJ2D 2Q5FA 3NRBA 4JK3A 1Q91A 3UBMA 4JI2O 1YGYA 1RHQA 2AVDA 2HQBA 3H17A 5TF4A 4JI8B 5HRUA 4EHDA 3EHBB 1DG3A 2GPYA 2QZSA 3GJQA 1A7UA 5KCZA 5F98A 2WJVA 3PEWA 3J81N 1FTQA 1MQSA 4RD6A 5CX1B 1A5AB 4A9AA 4TS9A 1M57C 2YXHA 2NTEA 3A0HZ 3IXMA 3PQ3A 4ALNA 4I9NA 5CDGA 3DKVA 1OKKD 2CFOA 3WL6A 1W9MA 5KYKA 1I6WA 3I2YX 2QI9F 2QE7A 3NHWA 2WPDD 1KS9A 1FS5A 1RI2A 3D64A 3SJAA 2QU7A 1DCTA 3VKHA 4MW8A 4FM9A 1EVKA 1Z2NX 1E2KA 2P9QA 2AZMA 1OYOA 1UEXC 1R5BA 2V8BA 4HDQB 1LQUA 2W4QA 3PHIA 3EGXA 2HP8A 4OQZA 4FUTA 2OZPA 5FOXA 1R2QA 2CVFA 4TT3G 2GJ8A 2X23A 2YICA 5BXYA 1UKEA 4X3CA 4D45A 3ILVA 4MR8B 5A02A 5A1JA 5LOVF 1EFLA 3V1MA 2OWDA 2ZNJA 3EXIB 3JR3A 3EMKA 2H2FA 4RJKA 3TQTA 3LWBA 5ALLA 1U65A 3K9NA 4LFBB 1Z83A 3N53A 3IMFA 3CLSD 1GU7A 5ELMA 3S2ZA 2QZ4A 1RMQA 3U0BA 3QYPA 3RUPA 3KSDO 4K81B 1J0BA 5LMNO 1FVHA 3AJEA 1KMIY 2QMUA 3U48A 2B2XA 1IN8A 1IWPB 3ZJYA 2WLIB 2QX6A 4UNPA 4HBGA 4UM9D 1WKBA 4DCMA 1X8XA 1VHJA 1DEOA 1ZN7A 5DV9A 5K0ZA 2E89A 3SVLA 1WQ3A 4MUJA 5L3SA 5EMMA 1VTKA 6Q21A 5CYGA 4C7KA 1DRUA 3WLOA 1FNDA 4QVIA 2FR6A 3DTUB 4JP3A 3IE2A 3T94A 5B4UA 1TJPB 2JA1A 1M5IA 2ON6A 3R8FA 3BULA 1DF4A 3QRWA 3W9SA 1BCSB 3KQOA 1YD7A 3B3QA 3ZW7A 5YASA 5FOTA 3MGAA 2Q8VA 1KAEA 4GLXA 1M2VB 4G01B 4LEIA 2FX3A 1GNPA 2WLTA 3GPBA 4JEMA 4X5OA 2Z9BA 4NCHA 4Q4DA 1M2OB 5FPQA 1FYWA 5HGJA 4DXDA 2FMUA 5KDOA 4IBOA 2FFHA 4P35A 5IDWA 1MHPA 1T2AA 1YBVA 2WA3A 4FDMA 4J7CA 4P3NA 4PRKA 2GD0A 4IYJA 5FUXA 3TRKA 3A4YA 4URZR 4AL4A 2R85A 4UTRA 2NUBA 3RYIA 3L0CA 2PGAA 5GM2A 3DLHA 5ITZA 3VM6A 3N0WA 4D7SA 3F6CA 3VJMA 5HZHA 5BWNA 1YTUA 2JANA 2XWPA 4CEJA 1IVNA 1ZN9A 1BH2A 3NDJA 4QUBA 1R9MA 5EZYF 4G26A 4RKEA 3RUEA 1X1BA 3Q7PA 4NATA 4BKRA 4C7BA 1YRAA 3P71T 5K0BA 3U6BA 2QG6A 1IBCA 2P0YA 3DAFA 2IT1A 2FNAA 4XM1A 4HAXA 4DCGA 5H82A 4CV1A 3RK1A 1FFSA 2X8LA 5E9AA 4H13B 4HV4A 2HSDA 2R62A 5LQRA 2G84A 1G20A 2C94A 3K9HA 2WDZA 3QJYA 2HK6A 2Q6AA 4YPVA 4F21A 2IHKA 2QV0A 3WV4A 2FR5A 4P5EA 2PL3A 4TKLA 1XL4A 3JAKB 3PJSK 1HEIA 4B6SA 4EUNA 4F85A 821PA 1UX0A 1AHIA 3A28A 1WP7A 1H0KA 1SVNA 2A30A 3WQQA 1ZD2P 1Y81A 4Z4HA 3PKZA 1UBKS 1ZMOA 1UBJS 2L69A 4IO1A 2H08A 4Y2UA 3MA0A 1TZ2A 3PKIA 4CM9D 5ITWA 1PKXA 3P9PA 1KU9A 1FMJA 1BCCH 3MFYA 4H77A 1E8MA 1BE3H 2M6RA 4XASA 1NR5A 4TXNA 3PUWA 4HDMA 3SU8A 5ICEA 1KI3A 2FUG6 2OA0A 5GV7A 1ZZGA 3QUQA 4E5DA 3FBWA 5ALOA 4UE2A 3FCCA 4XWWA 4MRRA 2JHGA 3QVGB 4G27B 4ZU1X 4XTCS 1ISRA 3NC1C 5HRCA 4BV9A 1FRNA 1P0MA 1NFFA 4NE7A 5TEWA 1HLGA 3ZHYA 4WGGA 3UT0A 1IMJA 3K9WA 3ZI0A 2UUOA 3FNQA 2Z3IA 3E8FA 3I64A 3U2QA 4EYOA 5B5SA 3FW1A 3OQNA 3B2EE 5AVTA 4HZ3A 2IBTA 3FSEA 4KC0A 2Z5GA 4LH6A 1FS6A 1S89A 3OPYI 4PSKA 2N0SA 3UFXA 4BAUA 1IM5A 1RABA 5KAIZ 2P65A 2QPTA 4JB2A 1YF2A 5BN3B 3AM3A 3NO4A 4FLTA 3WO0A 2NO1A 3NIDB 3ZKAA 2JAWA 5DLDA 5TS3A 4G5QA 4RC9A 1PW5A 1TQ8A 4WOJA 1Z37A 5LXTB 3LHKA 5ESWA 4N5MA 4X65O 4KE7A 5JAUA 1SA0A 4J0QA 4OUDB 5CA0A 3AESA 4N54A 3ZWOA 1UPAA 2C2ZA 1L4GA 5G1OA 2BE9A 4CLRA 5LHIA 4JLVA 2YYYA 4KX5A 2E4AA 2OQIA 3JD1A 3TTUA 3X1KA 5C18A 4D0GA 1HNNA 2ORYA 2WJJA 1U4OA 3AF3A 4C6TB 2HIAA 1PZXA 1P4SA 1YB4A 1ZY2A 4MB2A 3R0ZA 4GI2A 4A6XA 1YQUA 3OZBA 3MELA 2W6OA 1Y4AE 3HB1A 4FEYA 2OAEA 4JSTA 1MJGA 2DQZA 4EBBA 2V97A 2E74B 1YUBA 1KFKB 3VI3B 4CL2A 1EVJA 1A8QA 3LQQA 5BQPA 3TCXB 1WN6A 1NLUA 1R5JA 1SBNE 1A8UA 1U7DA 3NTXA 4QNHB 4ZT3A 2B2CA 5F4ZA 4CH6A 2IX9A 3M6AA 5FL7A 5I8PA 3R2NA 2F95B 3F2IA 3UN1A 3FWKA 3JQ9C 4WZAE 3QVJA 3QEBZ 1YL7A 1VL6A 2H06A 3CRZA 3HPLC 3A6GA 3AK3A 2QTGA 3LL4A 2AYYA 1S2LA 3RBXA 5FBWB 1Y0BA 2GXSA 2AG6A 4MV3A 5A5GA 3F74A 4CR8A 1P39A 2H7CA 4JLBA 4C01A 2IUSA 3MRXA 2PXXA 3DLBA 3QEMB 1IWOA 1Z36A 4CTMA 4G4IA 2E5WA 4DDHA 2ZYIA 4TPKA 1E3TA 2G77B 2R9IA 1E9BA 1Q0PA 1CUSA 1S1CA 3GEDA 2Q0AA 4QM7A 4MW0A 4YLGA 1I1HA 4BNJA 1QE0A 1ZCAA 2CHGA 2F8MA 4R9SA 5HK8A 1N0JA 1V1RA 1ZRSA 2HDHA 3PEUA 3W8RA 5DNYB 1XZPA 2ECKA 3IBGA 2IHNA 4FOTA 2H85A 4IH1A 2PUFA 3F6YA 1FU8A 1PV0A 4Z3KA 1RXUA 4EA8A 1Q8IA 1Y1PA 3R7LA 1DGQA 2YHIB 3PLNA 4RZXA 1Z5PA 1Q3KA 4JUFA 5DM0A 4UNQA 4E1AA 1TB4A 3CSSA 1T6YA 1CE8A 1H69A 4BJHB 2NMVA 5IBCA 3V55A 3ELWA 1F6BA 3HYTA 1LWOA 2O0MA 1FDWA 1M1YE 3FHOA 1ATZA 4OHPA 3BCRA 3O8LA 3KL4A 2RH4A 2ABWA 3DV0A 4YT4A 1DGSA 5CA3A 2V5VA 2YJZA 5JEDA 1ONOA 2I8AA 3PFGA 4OXYA 4J9VA 1VPDA 4JVMA 1EWKA 2FF7A 4J0HA 4OQNA 4KZPA 4RTJA 4YQEA 4ABMA 1GGHA 2J41A 4TMYA 4XZ3A 1GUBA 3P96A 2FZGA 1T0IA 3E27A 3EZ6A 1MA3A 3PPXA 1I7QB 4LCJA 3SHOA 4YJ3B 2XPCA 3MBOA 3KSZO 5CVVA 1MO3A 3KLMX 1WCIB 2Y99A 3ZWKA 3QXXA 4IHJA 1DVRA 4DLRA 2WA4A 1U5CA 4US0R 2OLEA 3BJZA 2Z8YA 5IS2A 3O65A 1SMKA 2XNCA 3PTZA 5EE9A 1XU9A 1AA6A 1NZ6A 3PN1A 4FNMA 1AI6A 2WAYA 3OD1A 2OGZA 4OYHA 1E4VA 5T7BA 1QOPB 2PUWA 3I09A 4NLLA 1U11A 3I8OA 3EVKA 1VHQA 4IJQA 2X9NA 4MB6A 2WUFA 3EC2A 4QHSA 4MV6A 3RU7A 3T52A 4C06A 4CF3A 5KOIA 1G42A 2JLVA 4XVCA 1X4TA 1ZJ6A 2BN4A 2ZRHA 3SJCA 4EG7A 5JAMA 5LQUA 1GM7A 1DXYA 1Y8QA 2HRQA 3GL9A 3KVVA 4IKEA 4J4HA 1QCCA 2AUNA 2PMCA 3PC4A 3S8MA 5L45A 3ZDBA 1PX2A 1TM4E 3P9RA 3GFOA 1RAFA 1U3WA 1XRQA 3KTAA 3KETA 5F3WB 4HTFA 1KZ9A 4OHRA 1WAMA 1R88A 4P5DA 1ZMXA 3M83A 1N9GB 3UNXA 3PI6A 3PXUA 4BP9A 4N18A 1RB7A 3Q9SA 2NUTA 1Z3CA 1RYBA 2GSWA 2WVHA 4C20A 4JEIA 2KSDA 1Z5WA 3FTEA 2I2CA 3P0RA 1CTTA 5H9CA 4YRDA 4A8JB 4JI3B 1A3CA 4B8ZA 1EZJA 3VO1A 3TI7A 1P6UA 3CT4A 1ETHA 4JC4A 3AOEA 2AFVA 4A82A 4EY4A 4U2EA 1ZLZA 1M6YA 2VBFA 4RANA 1PO7A 2FZ5A 2JI4A 3ZEFB 1LLUA 5KREA 2IWRA 3WY9A 3FZNA 5JBNA 4YIOA 2DSNA 1TZBA 1DEAA 2EKQA 2I6UA 2J5XA 2JFFA 4KLAA 4RLHA 4BGVA 4E31A 2NAFA 2XODA 1BVRA 1RJFA 2ZSKA 3MJFA 4K9MA 4P9NA 1T9GS 3D6HA 4P4GA 2WLKA 3W8DA 5ALWA 2W58A 4FGSA 4LY9A 1HQDA 1EESA 1EFAA 4K0RA 3ICEA 3DVQX 3H2JA 2PWZA 2GEVA 3K5WA 2VL7A 3BXXA 3ETCA 1NH2D 5B1OA 4G09A 5AM4A 4BVHA 1XZJA 1D4OA 1M74A 5FJIA 2RK3A 2R8BA 4ZVOA 2C42A 16PKA 1T24A 4WNIA 2TMGA 5IBPA 4J8PA 4L08A 3A8TA 3MTEA 1RPZA 1T43A 3H9EO 3ERCA 1ECJA 1EBBA 1T2CA 5LU8A 3FVVA 3UXYA 4V02A 3PFFA 4V0RA 1TF7A 1N5LA 3VDNB 1SC6A 2R6GA 3MM4A 4ROTA 5HF6A 4C03A 2FJUA 2FVXA 1M1XB 1G4HA 2OYCA 1RP3B 1RU3A 2OSBA 2EJ7A 5JJNB 1XLTC 1WXXA 2NSYA 2ZGVA 3PXAA 5AUOB 2CLIB 1FDIA 5DP1A 2P8RA 5BN4A 1CV2A 2JJ1D 5K3OA 5K4HA 1OU4A 3UG7A 5K09A 3WBJA 1J25A 1NVDA 4ZK6A 2CVHA 1EZ1A 1DV2A 2VZ8A 4A0RA 4P36A 1Z6ZA 3LG2A 1IUOA 3K0KA 1QIMA 3LT5A 3Q9LA 4NU0A 5H70A 721PA 2QG4A 5TF0A 2A7QA 1JMKC 2XT9A 1KARA 1L4UA 1H9BA 1ST3A 2D1SA 3OUFA 2GUWA 1JDUA 1GUYA 3GRVA 3CZ4A 3GFVA 3PL1A 5KNDD 2P5UA 4G5YA 4J4TA 5CNIA 3SS9X 4OQ4A 1ZH4A 2FVYA 3H6KA 4V0OA 1I6LA 2C5SA 2G5PA 3QKIA 3TRHA 3F5WC 1P0CA 3QBTA 4KKVA 1B74A 5K1PA 1I1QB 1K7SN 2NXEA 2WP0A 3VQXA 3OETA 1XPOA 4DCVA 1XLWA 4TMVA 5AI8A 1MAAA 5JJBA 3ZJVA 4DR7O 4FSHA 4Y0NA 2IYVA 3D4PA 4QRIA 5BYJA 1FS0G 4OAPA 4Y67A 4B7EA 3BKWA 1A71A 2QL7A 4ZD6A 3COJA 1VG9B 1BHSA 2FG5A 1Q2XA 2H7YA 3AK2A 4DK1A 1WZEA 2LE0A 3EQ8A 4UU8A 1LNSA 3OTWA 2QWQB 2XGOA 2G67A 4YNBA 2JGRA 5A05A 3M49A 3U7JA 2IS4A 2FSPA 4UTPA 1PP9H 4BATA 3KELA 3ONEA 4DCNA 2D00A 3JQ7B 3MTQA 3R4CA 3G5LA 4MICA 3WJAA 4C0BA 3Q8LA 1W0JD 2ZUCA 1MV8A 2G6TA 3CB4A 1MG0A 3P45A 4X6YA 4QAJA 2O7NA 1NSTA 3SQNA 1XQYA 4G1EB 3SBDA 5JT1A 5JFTA 1LRLA 2WK1A 1UK7A 1Q19A 1S96A 2OUKA 4DAEA 4KV7A 1JA9A 4BO0A 3VHXB 4YAIA 3K9AA 3HDYA 4TTRA 2R00C 3D6JA 3TDMA 4C4SA 5DNDA 8AT1A 1FYFA 5COQA 3GQBB 5AXAA 3ZY6A 2XVYA 1Z2EA 4WZ6A 1LEHA 4IL5A 1JJ2U 3FLAA 3LBNA 1L6IA 2ECFA 4NB5A 2JJ1A 1PZEA 2AZ0A 4UJ5A 3RQIA 4CKYA 5CDUA 2ERYA 4URWR 3HEBA 1CZUA 3HR4A 1KE1A 2HA5A 3X1ZA 1P7BA 5IH3A 2LBPA 4JC5A 1BDJA 1Q6HA 2Z09A 4YREA 1W2HA 1Q17A 4XRGA 5A1TA 5JS1A 1P1BA 2B5VA 4LTMA 4L3OA 3FYDA 4EVSA 2W6IA 4LOLA 4DV1O 2UXBO 1Y48E 4KAFA 1INLA 5IU6A 5M34A 4IGIA 1KTVA 4MYUA 5IM4A 2AL7A 13PKA 2BBSA 1WMBA 1WW2A 4RTOA 4DMLA 1KGDA 5CRIA 3GJXC 1NL3A 3KAJA 5T6MA 2Y3IA 2ZIXB 1TYBE 2RGBA 3ONFA 1NOIA 3O4GA 2ZI7A 3E84A 3PFKA 1RBQA 2REXB 4GR5A 5I9MA 4Z7NB 4NARA 3LLVA 5TQ2B 1Q6IA 1TM2A 3DZCA 1V2HE 3TR5A 3C3EA 2RKBA 1QBGA 3PNVA 4MGKR 5P21A 2M6KA 1KO4A 1GITA 1E64A 1NI4A 1SFRA 2PU5A 2VK4A 2SKDA 3CKYA 3I9FA 4I6JA 1N3LA 5C93A 1IY9A 2ISCA 2JH3A 4P32A 3H6HA 2JI7A 4ARCA 1U0GA 5A06A 3STVA 3MCTA 1LTKA 5EKSA 1O7JA 1W4LA 1Z3IX 2ENWA 3GMSA 4FBMA 4F8EA 1CRPA 3GC6A 4KFRA 3NH9A 4DMUB 3H75A 1XTQA 1D07A 2C5BA 2GFQA 2PY6A 4J07A 4NBVA 2P75A 3LOUA 4PGGA 3QWHA 4P2ZA 3AU8A 4N12A 2VDLB 4HQNA 3DXYA 4JJZA 3B8EA 3C48A 4IGFA 3W2IA 4EHIA 2UXXA 1L8AA 4RTNA 2CLDX 4HAWA 4XGQA 2EP5A 3AF0A 1NBMA 3GARA 3KFLA 2YXLA 4U6NA 2PSHA 3VFDA 4QBGB 4PZYA 3X2FA 5HF5A 4E5NA 1X7ZB 2OM2A 3IEIA 4JU9A 1XEWY 4K2HA 4OLJA 4M6WB 4AZSA 4C29A 3E86A 4H60A 1H1LB 1E4OA 1AY0A 1BOOA 3NBZC 1WCV1 4HL6A 4LWSA 3F96A 4BMSA 4WBNF 3H1KH 4BQEA 3ZGOA 4P30A 4AI6A 3Q41A 3COZA 4XA8A 4WCFB 5KDDA 2AQKA 4IWNA 3UO8B 1ADGA 1VZ3A 1U3DA 3W9YA 4KITB 2VNIA 3ZBPA 1D2DA 3KQHA 4UEOA 2FPUA 2HQRA 3IPCA 3NAGA 2X9VA 1SQSA 1G19A 2CLHB 4G8BA 3I9OA 3NHLA 3JQ6A 1RPOA 1UR5A 2MSWA 4N5LA 4Y2SA 4EG2A 2GEBA 3PCTA 5H6QA 3ICQB 2FZKA 5HGXA 3MRSA 4CTOA 4M9UA 3E5RA 4N3AA 4DLKA 1HYEA 4Q9HA 3PJFA 1AZLA 2R7LA 4Q3KA 4F9GA 1W76A 1YZHA 2IODA 3ASVA 3AHJA 4J7AA 2O7SA 4RH3A 1SUWA 1TCVA 4B8YA 4D80A 4Z9BA 2Z6UA 1XF1A 4K9LA 3JZDA 5FI1B 5DT2A 3M6MD 3DOUA 4AQDA 4P82A 4V2UA 2A9KA 1RBMA 3D6UA 3OOEA 3QI7A 1JEAA 4BMNA 2YSUB 1ZCBA 3I2KA 2AG0A 3WZ2A 2WIKA 3HY4A 1TAGA 2RHCA 3ER6A 3GLVA 4Q1EA 4EY5A 1M2HA 3EG5A 4Y8VA 5DHQA 3SQDA 1E5QA 1CT9A 1QTRA 5IDVA 1CIPA 1QWOA 3ZW9A 1RLUA 5HMLA 1HYQA 1JG2A 3ZE7A 4C4RA 3IOMA 4CFYA 4BYMA 1R27A 2FW8A 1MN6A 4YQZA 3D4BA 2JEYA 1U80A 1ZH0A 3WLJA 3WK6A 3CLRC 3K5PA 4J7XA 1N5JA 2C8LA 1KEEA 5LP6B 5F64A 4D97A 1D0SA 3KEOA 4RPHA 1ZESA 1PEYA 3WDMA 3WGNA 5IJZA 1NTOA 5KQGA 1KD1W 1EJBA 4FB5A 1CDOA 4FBGA 2G4LA 4P5PA 3WGZA 3JW8A 5DBIA 4IV0A 3KKNA 4BC1A 1QB8A 2V8OA 3FFTA 2L82A 1PGQA 2A9HA 2BMWA 2OGWA 3GCZA 2FSIA 3GQBA 3IJEB 4QOHA 4TKMA 5AH0A 2PL9A 2Q1YA 1ZIDA 1F7YA 1VYHA 4R50A 1UL1X 3H9QA 4KN6A 4MWTA 1S3SA 4N3NA 4LNUA 3UO2A 2CL7X 4BLWA 2ZR0A 4CM3A 1V0JA 2Y1LA 1U3FA 4IDEA 4R1LA 3TZEA 3ZCXA 1XDSA 3B38A 5AOAA 4AX4A 2OC4A 2QYOA 2PEYA 1HLDA 4JT8A 4MWGA 2XE7A 4WNCA 2AS0A 3DFIA 2G1PA 1MAWA 3I92A 3JYNA 4V03A 5LZ5A 1XMXA 1J2YA 1DKLA 2CYBA 4P54A 2EGUA 2ZUBA 5JYCA 1NW7A 2O2XA 5BUCA 4OUKX 3S2GA 4M8LA 4F86A 5F2OA 1DLIA 3HMQA 1YO6A 5FUWA 1CR6A 2HK9A 1NI8A 1Y1SA 4FI3C 1KBQA 1BMQA 1DAIA 1CKEA 3K1AA 3C14C 4CKCB 3KTOA 5KNCH 3KHSA 4M8IA 3DR3A 1EK0A 2LTAA 4BX2A 1QNMA 3W5SA 3H8WA 3C5WP 3ICCA 4OIFA 1IJKA 2A57A 4HX2A 1TC2A 1PJSA 4Q9NA 3SKYA 4MVJM 3LK7A 1ADCA 3GJ7A 4FFSA 1JPUA 1KAQA 3BSSA 5CW1A 4O0LA 4HKTA 3DLPX 4F72A 1OCCC 4GX1A 1HDOA 1WTCA 2I4IA 3L7JA 2UUCO 3LQKA 4L4XA 4Q66C 4QQNA 5INTA 2IX3A 3TH5A 2ZKOA 3LGXA 1EIZA 3PGVA 4P7JA 4EFBA 5C8YF 1DUIA 2XKKA 4OCMA 1ECGA 2LCIA 3ONWA 3OJXA 4PZPA 3O90A 3ZW8A 3U09A 5KHIA 2EEZA 2OCIA 2XR1A 1QVRA 4AY5A 2FKAA 4L0CA 1AT1A 2P35A 2PKEA 3ZMTA 2ZITA 4JBNA 3F7NA 2EAUA 4AN0A 5LQCA 3R6DA 1QHGA 3HHPA 1N75A 4GKBA 4ZOQI 4OG2A 4KHPO 1EI9A 2DLDA 3KXDA 2PT7A 1WS6A 3TLCA 2IJGX 4Q1AA 5BPHA 3UXHA 3DMFA 1EUZA 1D2GA 3M6XA 5CM8B 3W7AA 1XU7A 4AJLA 2VHJA 4MQMA 5CGZA 2KS6A 3THXB 1Y66A 1VDZA 3RHSA 2FW1A 3LBAA 1GPUA 2RE8A 4OMFG 1WCYA 1N57A 4FM1A 4JSYA 4DIOA 2ZUUA 2G0NA 3KTFA 4QTUB 1MB2A 3VNRA 1TJYA 3QXHA 5EIBC 4GS5A 2WQ6A 3OQMA 2HY7A 2YX1A 4I4NA 1WUIS 2NVBA 1QKJA 1CTQA 3BGDA 3M8KA 2KKWA 1T36B 3NPAA 2ZPTX 5K4AA 1Z08A 2L18A 5T4HA 2YR0A 1KO8A 2RHHA 3EBPA 4BRWA 1V11A 3T3MB 2ZIFA 2ZWVA 6REQA 1LPSA 1V16B 2HKOA 2WTEA 3ZDRA 1QPBA 4W63A 5DHAA 2DCMA 2CLOB 1MT0A 3JQ9A 4MV0A 3LF2A 3RH0A 3TZ6A 1BNCA 2ACVA 2X8JA 5AKZA 3TOSA 2NLJC 2HF9A 4RVHA 1JFFA 2PGGA 4Z1VA 5JH7A 1SU8A 2BGTA 2BMAA 4QJIA 3TQOA