1P4RA

Crystal structure of human atic in complex with folate-based inhibitor bw1540u88ud
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
589
structure length
589
Chain Sequence
GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, hydrolase
total genus 215
structure length 589
sequence length 589
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1p4rA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1p4rA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1p4rA02
1CE8A 1M9NA 1OZ0A 1PL0A 1P4RA 1S89A 2XW6A 1C30A 4A1OA 1A9XA 3ZZMA 2YVQA 2B1IA 1KEEA 1B93A 1CS0A 4EHIA 1BXRA 1T36A 2IU0A 1EGHA 1THZA 1ZCZA 5H3LA 1VMDA 1WO8A 1JDBB 1G8MA 2IU3A 1C3OA 1M6VA 1PKXA 1S8AA 2B1GA 1IK4A 2X8WA
chains in the Genus database with same CATH superfamily
5DIZA 1KP2A 4KRYA 3KFLA 3D3NA 2GO7A 3B2EA 3ZDFA 4HAVA 4QE7A 1R6BX 2HF7A 1Z2AA 3ELUA 4F4LA 2XMSA 4KR9A 4BXOB 4AW9A 3SZMA 3NWPA 3NBQA 3HCFA 2EINB 1EVKA 4U2CA 1I0LA 2W2VA 5LQDA 4LHWA 4EFDA 4X94A 3V1NA 2XI4A 1GTG1 4NONA 2CVHA 1YSDA 4YXWD 4Y2HA 4ID9A 3FCSB 1PV2A 1F7UA 3L7LA 4OXIA 1JHVA 1Z63A 2IEDA 1BN7A 3V2GA 4L3OA 5IY5B 1B3RA 4R6ZA 3UO3A 4WBNB 2MTBA 4QU9A 4ICGA 2OM6A 5KVSA 2RHRA 2EBUA 2ILMA 1TI7A 4RPJA 3EX7C 1DPFA 3FN4A 1RYEA 2E1RA 4MVOA 1U8YA 4PWYA 4PBRA 1RVDA 4YR7A 1XJ0A 2W6PA 1NDQA 4IXWA 1ZYUA 4O1HA 4DZTA 1NBEA 5JMTA 4PFJA 4UCFA 2G88A 5E4JA 5D2CA 3CNOA 3CO0S 5FIUA 2X6TA 2FMKA 3V4VB 2YHUA 4JZ2A 1L4LA 4DMUB 1TL7C 2L18A 2LP7A 1HRDA 3ADBA 4FW8A 2WAXA 4J7CA 4L3WA 3D1LA 2DG2A 5I4BA 2FTKA 2VAXA 4Z7OB 4OQQA 4N8DA 3IUMA 1TECE 4FINA 2HQSA 1CETA 4DEYA 3CXHF 5CX1A 5HF5A 3TVTA 3PDUA 1HL7A 3PQ3A 1M34A 1WG8A 1IEVA 1I0ZA 2J0UB 4AG6A 2X0FA 3EBOA 1P44A 4TZTA 4YIOA 1K92A 3FB5C 2ORED 5DM0A 4PI2A 3MJSA 5AQEA 1VJRA 1VA4A 3VZPA 2ZCVA 3NHMA 3W3AA 3IR7A 4DNFA 4K28A 2FG6C 3AIIA 3RT9A 4PNZA 3GRCA 4NHEA 1XRMA 1YHYA 2RFLA 2N05A 3MQ4A 5CUQA 1JJ7A 3DTVA 3UHAA 5BN3B 2EFEB 2WIBA 3ER9A 3OZVA 2WAYA 1EX9A 3LO5A 4GOLD 4BLQA 3KD3A 1G6UA 1I4DD 2ZKOA 2EG5A 4MSWC 2X3YA 3BJIC 4BHTA 1YVDA 3ZZUA 3TKAA 2HJWA 3HUEA 3OCCA 5FQNA 1Y34E 4MW2A 3ORHA 2UDPA 4E08A 3I1JA 4XJVA 2J5RA 3PRHA 4KPEC 2QWOB 1BS1A 2FZKA 4E2FA 1XDSA 4RL6A 5C8YF 2H4WA 4M6WB 4ZU6X 3L4JA 2WHXA 3IMFA 3EVBA 4WESB 2FQYA 3W7UA 1RXUA 4E5KA 1JKFA 1PAUA 1WBDA 4LJLA 2EW1A 3EZ7A 3AX6A 3MUEA 1TEXA 3ULKA 1QIKA 1LV8A 3T1HO 4PVCA 1JA0A 1CB0A 4RM2A 2CYBA 1FF9A 1XEAA 2HDHA 2JVJA 4HKTA 2IYPA 4TTIA 5D00A 2JDIG 3RSZA 3WLNA 4P4NA 1VF7A 1IJEA 4A8JB 4KXYA 2WUEA 1NN0A 2GTHA 4KIJA 3IHLA 1OX4A 5A06A 3CVWA 2X2OA 4MYTA 2IHVA 4MWZA 3FPSA 2W2LA 2ZBDA 1N3BA 2Q2WA 1AVMA 2JKZA 4CT5A 3EWNA 1SXGA 3HVJA 2ZB3A 5C1OA 1NY5A 1VLMA 3N8IA 3PFBA 2G1UA 4Q3CA 3KB2A 4URUR 4CTMA 4C04A 4M4SA 2QTVA 1SM4A 1UFQA 4EHLA 1V25A 1I1OA 3RTBA 5CCXA 1B6TA 1E0AA 4IICA 2Q41A 2HJDA 1KFCB 3ROQA 3HJCA 5BRAA 3SKXA 3NTOA 1SVUA 4LCEA 1F60A 2C82A 1EVLA 2GJKA 3ZD7A 5BWBA 4LG1A 3W5IA 1IY9A 3O4IA 1X6VA 3ES9A 4RTPA 1ZINA 1T4MA 3SXUB 1NNI1 5AH0A 1NF3A 4C22A 2PO7A 4U2DA 4OAPA 4CF4A 2VDWB 1XFDA 2LE0A 4X1OA 3ENVA 5AG2A 2WLMA 2A5DA 4QOGA 5C7LO 2C2AA 1URFA 3C14C 5CBFA 1P6UA 1KJJA 3V4PB 3PC4A 3WIEA 3HBLA 2PMEA 2O2SA 1BOFA 1U4NA 1XQXA 1GTJ1 4L3VA 4UBOA 1A76A 1E3DA 2UXXA 2FVYA 3GJ0A 2OBMA 1WCYA 1ZNZA 4OCNB 4J9ZB 2ZI5A 2YXDA 4DA6A 2CEKA 1JE0A 2AZMA 1UMCB 1MOFA 2XTZA 4J11A 4OA5A 5AVRA 5KYGA 3EH1A 5AW4A 5TLSA 1C7EA 5F4BA 3QX8A 1WV0A 1GTL1 5FV4A 3SR4A 5CDHA 3EB9A 1R6UA 2NN3C 4QBHA 4OCMB 2X76A 1LC0A 4A27A 1RAAA 1DAGA 4NPCA 2Z3VA 1UC4B 3L5KA 3TZEA 1NTRA 2RGYA 4N03A 4NOLA 2EARA 1JF8A 1RRMA 1KOJA 2J9ZB 2JCVA 1ZSVA 1U8CB 1ZVJA 2J46A 3HXTA 1Z83A 4M3NA 2F62A 1I51A 2R4UA 4B4DA 1V7QA 2OGUA 2H2HA 4U2GA 3K9AA 4X60A 4CR8A 2ONJA 1DWPA 2AGAA 1V6CA 1U9IC 3O8NA 3OJWA 1F6WA 2R3SA 3RTAA 2VJDA 2WD7B 1MJGA 4Q4AA 1HR0O 2ZIWB 4KX5A 3DBLB 5FOWA 3E83A 2KCQA 4MQEA 1Q7YW 3AKDA 4RLSA 5GOZA 4EY6A 3DOCA 5EN4A 2Z2JA 1OHHD 4K9MA 1UBLS 3ZK9A 4XGKA 4CR6A 3IE1A 1U5AA 3JS5A 2A0YA 4P53A 1SCUA 5EJ4A 3ETCA 2WY2D 5IJZA 1F51E 4MS1B 3EUEA 4JJ4A 1L7QA 3TW8A 3QF4A 2IJKA 3TOVA 3MINA 2HF8A 1UOPA 2IYLD 1VQ5V 1X86B 2JJYA 3BA6A 1DKLA 4QODA 4D4MA 5BP7A 3WG7B 1PDWA 1K3EA 4BNDB 3OPQA 1E6WA 4P2ZA 4FI3F 2JA1A 3QVGB 2PMWB 5EZYF 1VHTA 1EVEA 1YS7A 1GU7A 1XKLA 1IH8A 1ID8A 1FMLA 3ASUA 1SF9A 1K06A 3YASA 2I6XA 1L7PA 1N7HA 3KQSA 5GADl 4OQLA 3SFTA 3NC0C 4WCFA 3VYUB 3P0EA 3I09A 4G9GA 2PFSA 1PT7A 4CMIB 4IJMA 3S3XA 5LBTA 4JNCA 3QMMA 4I7ZB 3NS7A 3ML0A 3SJCA 2O9JA 4WZBB 2GHIA 1S6YA 2E49A 3GLFB 3A3PA 3QXXA 2P4KA 2QRQA 2WM8A 2HIAA 2OLJA 4U7PB 1KBQA 1TCAA 3A4VA 1NMQA 1QAMA 1T3ZA 4BMXA 3EIQA 4O6VA 1AV7A 1AMOA 2ZFUA 4HLCA 2ZANA 3G8BA 3AY0A 4ZIRB 4M37A 5K3EA 4NKRA 3CUTA 2ZYVX 1G18A 5JAUA 4TLAA 1BVYF 2IF0A 1RM4A 4D8VA 1HM5A 3V2HA 1WDLA 5C3UA 2J32A 4H1VA 2VHYA 1WSDA 3R7DA 1TIKA 1MX9A 2IOFK 2WIAA 2UV8A 4R8RA 4ZHSA 1OI4A 4CWAA 1OFGA 3BGVA 1VI6A 2OV4A 3DBRA 2GAOA 3KFXA 2V65A 4BNGA 3R77A 4JBLA 4K40A 2FN3A 4Z0TA 1XHZA 4MUNA 3D8SA 5ICCA 4TSFD 2CN1A 1EZZA 3RKSA 1DQNA 1Y8RA 1NP6A 5JTUA 1NASA 3EIWA 4X62O 3U0BA 4FFOA 2JDIA 2O5CA 1O0SA 2NUPB 2YJGA 1AA6A 3S8YA 3D6JA 5I45A 1NATA 1MB2A 3AG4B 1XXLA 3ZOZA 1XTRA 4GSLA 3OJLA 1QPZA 3H8SA 2R6DA 1RPAA 4H44B 1XNQB 3QLUC 3W4KA 3MTIA 4JI1O 1MB0A 5A3VA 2IYSA 3GJ5A 5JMPA 1TJ4A 4PAOA 3F73A 1E4VA 3K2BA 4Z8YA 1MFPA 3DA8A 4JA2A 2JRLA 2BM1A 5E3JA 3LQ4A 2ZS9A 4B4WA 4LQLA 2WTNA 3CRQA 4HH4A 3CMCO 4KIWA 4EFNA 1GNPA 4ZZ1A 1E96A 1SBHA 5GJBA 2BTEA 5LYJA 2NM0A 4JLBA 5KA6A 1HTTA 4XIJA 4YIHA 1SIWA 3TDMA 3N59A 3Q9LA 1O1YA 4PX3A 3A28A 2C99A 2EIKC 3DGEA 1SA0A 3ZDAA 3TF5A 4Q7LA 2VNHA 5MHTA 3PDIB 1PBTA 1P2FA 1KSJA 2CKMA 4EB6B 1NVDA 1P1KA 4B45A 2D7JA 4F97A 3L75H 1DF4A 3PQ4A 2NPIA 4NH4A 3PWZA 1C3JA 5F2EA 5F7OA 2PS0A 5JCOA 3D0RA 2BCGY 2A9RA 5TE9A 4N76A 4YAOA 4F7OA 1X2BA 3ISJA 2IUSA 2I2WA 2NQ2C 4H6VA 3TIFA 2WM9B 3KYJB 1GA4A 5LUBA 4HDMA 3U48A 1FMJA 4QDJA 5THKA 3I5AA 1JYSA 2P2CA 1EB9A 3Q7EA 2NV6A 4IUYA 4QPZA 3HPRA 4MVJM 1RXVA 5EIBD 2CL6X 3R6WA 3ESBA 3LS2A 2RGCA 3BMQB 4M1OA 2NSJA 1KJZA 3CU5A 2WTUA 2W2MA 1RPJA 5FYQA 1YIOA 2XUQA 4RORA 1U9CA 4PV7A 2B1RA 1YH3A 4JUDX 3VQTA 3K92A 3C24A 1LVGA 3H2BA 4J4BA 3LWDA 4KWEA 3JR7A 4YRZA 1DEKA 1S7GA 3K4QA 3MGGA 4GBED 5FA8A 1RADA 3EFHA 1UZNA 1JKIA 4XJSA 1LI5A 3PG5A 2J7PD 4P31A 1CQJB 5FUMA 1EWVA 1PNRA 1GUAA 3Q40A 2UVPB 1NH2B 1XCPA 4JI2O 3U4DA 1KARA 2W00A 3R4CA 3LXRA 4J1NA 3GEPA 1BMTA 1FFXB 4G0OA 4ND6A 3OQVA 4GAEA 4JL6A 3U17A 2LRHA 2ASVA 1VFNA 3K0CA 2YIBD 3FB7C 2C4WA 1Q6IA 2FUEA 4MI1A 4GC5A 1K6MA 1MN6A 2WU0A 1TO2E 4C0QC 4R51A 2C5BA 2ZROA 1GTOA 3FJYA 1XTJA 2PMCA 5EY5B 4RJLA 1ZIXA 2XTNA 1EVZA 5KB3A 5F5XA 4BNUA 1XZDA 1PL0A 4A92A 3ILHA 4FDMA 1OXVA 3HJBA 1R27A 1GFSA 4Y2RA 5AOBA 3AVQA 4DQVA 2VH5R 3BK2A 4MI6A 3E8SA 1WXHA 3FFXA 1ZZEA 1J6UA 4BUJA 1NL3A 4B3GA 2JF0A 3T7AA 5DTJA 2CE4A 3V4LA 2YIMA 4ZA2A 2CCJA 4GL4A 1J24A 1OU0A 2C7BA 3AJRA 2XXAB 2GZSA 3QGMA 1M2GA 1DTEA 8OHMA 4FFRA 2JIZD 4JTAB 1QCYA 3AZQA 1VC2A 1MC4A 1OBFO 2X0RA 1CS0B 4UNIA 3OZEA 4JP5A 1KTVA 3STWA 1H0SA 2XB9A 1I8TA 4CL2A 4B34A 5AXAA 2DM6A 4BRUA 4QARA 2Z9CA 4OI4A 1S76D 3G9TA 4LRYA 4HZUB 5AW9A 3GFRA 3FKQA 1I2MA 2B30A 5NULA 2EKZA 5CT9A 3T7TA 1E7RA 2D5CA 2AJBA 3M0EA 2O23A 2Z4RA 2Q3MA 4KQXA 1YZ3A 4JA0A 2DQZA 4XFJA 3RUEA 1NOKA 2FFAA 4L16A 1E4OA 1C1DB 2HRRA 3KWFA 3MG9A 2ZYDA 5AO9A 2CHQA 3SF8A 1L7VC 3BK1A 2FEXA 4DUGD 2W6MA 1Q0UA 2YVUA 1LLDA 3AJ8A 2GX6A 1GAJA 4ZC8A 4LMPA 3IE0A 4OYLA 4ZOLB 4TOIA 3NALA 4GGOA 1JTVA 4K3AA 2VSOA 4RYLA 4X88A 4JT9A 3LPCA 3QHPA 2VN8A 3DO5A 2BFEA 4TUYA 10MHA 1CR4A 2DAPA 2CXHA 4QGGA 1PUXA 3OHPA 1T36A 4J0JA 4BGUA 3HBFA 5FJJA 2A4KA 1JL3A 4X41A 1GTSA 2P5YA 1P2SA 1M0TA 2P9FA 1YZUA 1C29B 2YUAA 1AHHA 1RYMA 4PIVA 1XZPA 5HJ5A 1CFZA 4RZHA 5IJWA 4KPFC 4JYAB 3DMFA 1R4MA 4LC5A 2ZP1A 1MLDA 2G80A 1E2BA 3C48A 3CNNA 3GP5A 1VLHA 3VH2A 3AG6A 4JOBA 1U0OC 4BV2A 5JG7A 1Z68A 4GH5A 1IPFA 3CLUC 4AP5A 1OZAA 2NV0A 4C03A 1KYWA 3C39A 3K5HA 4FGLA 2QRHA 3WADA 1KBZA 3PHBE 4M1YA 5T41A 3SCZA 1P2BA 1YJXA 4J43A 3A37A 3CCBA 1DX4A 3UAVA 2LVBA 3GRFA 1AGRA 4LZPA 3C8MA 4C4XA 5BXQC 4OK6A 4CKCA 1F0YA 4BZPA 3FNHA 2GM5A 1JHYA 3HYNA 2R85A 4GYCB 4MVJD 3FWNA 1XQ1A 2PSSA 2NNLD 1FXVA 2YXHA 4OSPA 3V7NA 2IPNA 4CV0A 4C4TA 2YI8A 4MH0R 2D1FA 4CI9A 5K0SA 2BEVB 5G4LA 2HIHA 4MYSA 3PJSK 4JI8B 2OT3B 4FYWA 4YO8A 3GZ4A 4KB5A 2BY4A 2C4HA 5G41A 3RUDA 1FJHA 4KBYA 1SERA 3EZXA 3QFFA 3QLJA 4ARVA 2WABA 2WTEA 3WJAA 1H5QA 3J80N 4HGZA 3GBVA 3CC7V 4HATA 1YMQA 1OPXA 1XPRA 4ESEA 1V0JA 2WKSA 4YRSA 4AZ3B 4OLFA 1RWKA 4W4TA 4NARA 3TNJA 1GKIA 1ZIPA 3EVNA 1G8FA 2EG9A 5JALA 1NFFA 1RHQA 1NUQA 3VDXA 4Z2WA 5B30A 4WLVA 2EILB 4R05A 3PIRA 1EFKA 4TQAA 3C3MA 4NDAA 5DLQC 1SHJA 1QZUA 1PTJC 3TLEA 3EODA 4QPKA 5H9VA 4W1RA 5FT9A 3AEKB 3R6TA 4BXOA 1YK0A 4DG5A 2JFVA 5A0VA 1UK7A 2C4UA 2HYIC 4G01B 2MWMA 5IW8A 4R40A 5DNWA 2R62A 4X71A 2Y1GA 4LJ9A 3IB3A 1FXHA 2HMTA 2QTVB 2VYQA 1AGNA 4OG2A 4L2IB 3MWJA 4YJFB 4WFEA 4JNKA 1T5DX 1GXSB 1UDXA 3INNA 3GN1A 1O95C 3BPZA 4A4DA 1RLJA 1G8JA 1KC1A 3FGPA 2CNOA 3H3FA 4WBNA 1SUCA 3SKYA 3IAXA 3GPLA 1OWLA 4FEGA 1QFJA 1XDDA 3RE1A 3DUWA 5CCDA 4GVLA 4K03A 2JAHA 2RGGA 4RWUA 4X7RA 4IJ5A 4DT1B 4X61A 5AI0A 5GV7A 4BNJA 1C3VA 1JG6A 3OA2A 2P69A 4KL1A 1IURA 2QORA 1GQYA 4LYDA 1Q6ZA 1XVUA 3M7IA 5KYKA 1T1JA 2ZWOA 5LZ9A 2OZLA 2BFPA 2L6LA 3EC7A 3RN4A 2ZIFA 2XQGA 4MVJI 1FW8A 3I6IA 1I2BA 1NTMH 1W4BA 3WGJA 5DZSA 2H1HA 1KNQA 2WUVA 4H3SA 3N0TA 1PEDA 3D5EA 2SKCA 3ETHA 2CXRA 1FYDA 2B7BA 3J7TA 1R3UA 5HK9A 3USZA 5ALVA 1C7IA 3S55A 5CB8A 5LR6A 4PZUA 1B26A 3T12A 4CKWB 2BGWA 2J0UA 1J07A 1W1IA 4ZBMA 1C3LA 1M1XB 3BX1A 2W2XA 1YCHA 1QYDA 3ZDYB 5ALTA 4P30A 1BMDA 4QWWA 1WV1A 3NPAA 4DYLA 3TXQA 2B4YA 2IYAA 2Y0PA 4MZDA 3VZDA 4NBKA 3UBMA 1T0UA 3F47A 2JAPA 2VFAA 1MEOA 4EFKA 1N3LA 2WSYB 3QKIA 4HY3A 3LQ1A 4IKPA 4UBMA 5BN3A 2VQSA 3JWGA 1A1SA 5M29A 1YGPA 1P61B 1Q7CA 3U1BA 3WK4A 1E6KA 5HCNA 2XT9A 4JHXA 1D1QA 4WK4B 4GMFA 4DCPA 4KLCA 4OEHA 3A6KA 5DYTA 3O1HB 1Y33E 3IODA 5DXAA 5EXPA 2I2AA 3Q98A 2IHBA 3ROMA 3UMBA 5A3JA 3KLOA 1M66A 1SXJB 3U3RA 1EDZA 3ITKA 1NXOA 3X1XA 3HV0A 2D3TA 1PVVA 2G70A 2XHZA 1R9NA 3QU5A 4D43A 1SIOA 2A9PA 3ESXA 4M6WA 3IUQA 1GAXA 2AEFA 3STXA 3U7HB 1KS2A 4JSTA 2A88A 4WESA 1GUYA 3NR2A 2OMEA 2JHCA 4MP6A 5TMDA 5J4YA 4KQJA 1OWPA 4TRRA 2V0GA 1GR0A 4EW2A 5JNUA 1H9CA 1NQTA 2R00C 4ZCMA 4HN2A 1L4NA 2Q1SA 3DXFA 2H92A 3BQ9A 4WZZA 4RIIA 3KR1A 4LDZA 2X3FA 1AJNA 5FI1B 2E4ZA 4A8JA 1L7OA 3GGCA 3DLTA 2QY9A 3HMKA 5CT8A 3Q7IA 1QPBA 3N28A 2OUKA 4ZO9A 3ZBHA 1ADBA 5HOQA 1DOZA 1CHDA 3RBZA 4G0WA 2XZPA 2C8LA 1OLOA 1VB5A 1UXOA 1TJYA 3RCBA 4EEZA 3OI7A 1D4AA 4UCRA 4YT5A 4CZZA 1ULUA 5AKYA 2Q68A 2FR5A 3RRXA 1E77A 1OYOA 2YS7A 1ZPDA 3K20A 4FGSA 4NK5A 4IOLA 3IELA 3ID6C 3WFIA 4WOPA 3PXGA 3HG7A 4N5DA 2W0MA 4FFNA 5CNJA 2WJAA 2F64A 1TZKA 2QGZA 1HYBA 2C2WA 2RDMA 2YRXA 5B1HA 4XR4A 4BBPA 2ZYSA 3WRXC 2WEKA 3SXUA 4YCLA 2E5WA 1A0OA 4FHFA 4LNHA 4H7EA 2NU7B 1XPOA 3F5TA 2AWOA 3LTEA 2PIAA 4E2ZA 4DW1A 2NN4A 1TF7A 3NGXA 2W11A 5KAIZ 1D8AA 1XL0A 2A7XA 4MTLA 5DYIA 3W5JA 4XJXA 2VNJA 1JQ3A 1ZOOA 5BYAA 2PUHA 4OCNA 3SIWA 4XTRA 1OXMA 5DYNA 3V42A 1AK9A 1UMCA 3DMDA 4ESVA 3IQZA 1B6QA 1EJ6A 1H4SA 5K8LA 3WLKX 1XVLA 4ABTA 2QN8A 3VVMA 3B9BA 1ISMA 1V7PC 2C9OA 3D7NA 3WNBA 4D44A 1BWSA 3DHWC 4F45A 3H5IA 2GD6A 3LC7O 4KXXA 2X9NA 3S29A 4OCMA 1IY0A 3PI6A 3T4XA 1Z4PX 3VJLA 5C1DA 2XGMA 2HBRA 1DFHA 1RCFA 1XTSA 3V33A 2C3PA 2B3DA 4UZSA 4YYZA 3LQYA 4EHBA 1AKMA 3BXXA 2EZTA 5AR1A 3CXCU 1KSHA 2XTMA 1UZLA 4MV3A 1E1DA 3O26A 1P75A 2IYQA 3K32A 4K6GA 3AR2A 3JQRA 3I3SR 3K9QO 3FMPB 2JFHA 1LLUA 3MJ4A 4W6ZA 5C3MA 2YBEA 3OTWA 1R5OA 1ZKMA 4QPCA 1XF9A 4W9NA 3R1IA 4AKSA 2WD7A 3NETA 1YZHA 3DBLA 2NLOA 3I4FA 5AVWA 1Z3AA 1IQ0A 2WVJA 3QYFA 3IA7A 3TLYA 4YCSA 1NSTA 3NHUA 1SXIA 2YIJA 4RK1A 4JI3O 1CY8A 1I3KA 3GEMA 2FG5A 3GLIB 2XVYA 2Q7OE 2ODQA 3TXXA 4KQHA 3MYRA 5I5GA 2CJPA 5BNFA 3PCXA 1H2LA 3ND8A 2O05A 3GLVA 3AIMA 3NI2A 5EJ9A 1UZMA 1L1EA 1E9EA 1PPJH 3BD9A 1HOXA 4IGIA 4FE3A 4BNDA 3CS5A 4XW2A 1MX1A 1K7XB 4CIAA 2D1QA 1P1BA 4A2PA 3B40A 1SRYA 1QH8B 2ZT9B 4Y6OA 4OXXA 2JATA 1Y1LA 1NKVA 1O8BA 4AZWA 2XLCA 4BIMA 4N5IX 1XMPA 5FTLA 3EGEA 1PV1A 4JYBA 4NZMA 5BRJA 3UPUA 1NLYA 4CMIA 1S5PA 1YIDA 4D4IA 4CF6A 3QOXA 2PUCA 1L3IA 1I4TD 3RJMA 4D9KA 1B3QA 2RKWA 1TA0A 2IS4A 1BC5A 2P5OA 2Y9MB 2ZAOA 4WZBA 3KPWA 3GLFA 4XPIB 4LPSA 3NAQA 5BQFA 2B4TO 1KS9A 3ANYB 2FN4A 2HKOA 1GCIA 3AF4A 4LYFA 3LX4A 4JEUA 1ISJA 4K9PA 4LK2A 3DGFC 4P9NA 3RUPA 4ZI5A 4EJ2A 4ZIRA 3RIXA 2P7TC 1XMXA 3L74H 1D2CA 1KQNA 1GZDA 1M1NB 3OIFA 2HHCA 5B53A 2OCXA 4PPGA 3ZVNA 4TL7A 1AQYA 1DC7A 2ZR7A 1E9RA 4XQGA 3OEYA 3VOSA 3B8NA 1US8B 3OA0A 3EVKA 3MWFA 4L27A 3EIUA 1SVKA 4UPDA 4P36A 4JX8A 1UC9A 4ZVKA 1JQDA 1DBQA 1ZCFA 2AG8A 1PNVA 4RPKA 5LN1A 5CBGA 1P84F 1T9GR 2NZVG 3QKTA 5E7IA 4E4RA 2V6GA 5THQA 2NUPA 3J7AU 1Q0ZA 3KAKA 1WQ3A 3IUSA 5ILGA 3WYFA 3C8UA 5G40A 4DDTA 2IH5A 2IZ7A 3ZHUA 1O9HA 3FFBA 2Q5JA 1YAHA 1BSMA 3ZE6A 1YVWA 3QX9A 1R5BA 3ZIDA 1ABEA 1XCJA 1CFJA 4R9RA 4NCIA 4INOA 4BN5A 3RU7A 5AVTA 5BUQA 3G0BA 4QPDA 3TEJA 4P3YA 1I30A 4DJDC 1ABFA 1JXAA 4PA4A 4ZQBA 4PLGA 5LZ7A 4K2HA 1KP3A 1KETA 2FW0A 1T2VA 3P7MA 3E3OA 3IQHX 2JB9A 1RBZA 1CUSA 3CZRA 1O77A 5B58C 5JV5A 2R9AA 5HFJA 1JECA 1XTQA 4X54A 3KT3A 2XQIA 3QMPA 1K3UB 1QQTA 4N3CA 1CTTA 3WNVA 5GONA 1Q0QA 4PA6A 1JR2A 3RV4A 3WK6A 1M93A 3IAAA 3T5MA 3SF8B 4I55B 1TRKA 3Q0IA 3ER6A 3HEMA 3ZQ6A 1BRMA 3IOYA 5HHTA 1U90A 3AWIA 3PDIA 4E03A 5H5NA 4U4AA 2YY7A 4EB6A 3MPOA 2XXBA 1Z6GA 5KLVH 1PGJA 3HZRA 2P2DA 4W99A 3KRTA 1WNTA 4TUYB 3I2YX 1AUOA 2M2IA 4PZZA 3SPCA 3S40A 2WHPB 4L08A 2AWNA 5LSAA 5B4UA 3WGIA 3DKPA 4PZDA 4WFHA 3VH3A 3N9IA 4E22A 3P2MA 3L7BA 2JPDA 4JYMA 3Q3VA 2X7JA 4KXLA 1H2NA 4HLDA 5COAA 4B3MO 1LTHR 3HCCA 2H31A 1UFKA 1B0UA 1PO7A 1L5GB 3A4LA 3G1TA 4LF7B 1Z6AA 4ENSA 4LVUA 1XV5A 3N6RA 2VRBA 3W8EA 3LG2A 3S6JA 1EG2A 4KO3S 4GG1A 5JARA 4HQOA 3DONA 3FFAA 2Q4DA 1Y3BE 3L7CA 1AGXA 3RFXA 4J41A 3SYNA 4E3ZA 1CQJA 1SG9A 5K3DA 4FJ2A 2UVPA 4JT2A 2ODBA 2VA8A 1YULA 2SECE 3HFRA 4JI4O 2YN4A 1FFXA 4M8SA 4WIFA 2O3SA 3DKKA 1SUAA 1HY3A 5K8IA 4LF5O 2WYOA 3PSHA 2DBZA 1RACA 4ETMA 5DNYB 1E79D 1JHZA 3UJBA 5KHHA 3GCDA 3DEKA 3SMQA 1U4SA 3KYIB 1L5WA 4LK3A 4M1WA 4QUKA 1VRWA 4LSGA 1Y0BA 5EUQB 3FUCA 2NSYA 4S3MA 1QBZA 4MWEA 4J1TC 4GBGA 4P9CA 4J94A 1PJ3A 1ZLYA 3PT9A 1QUFA 3L4EA 5F2VO 4JXZA 1V5EA 2C29D 2A30A 3SJUA 3ICCA 1GPH1 1ADCA 3L0CA 3B38A 3T1CA 4WX2B 1I08A 4LBWA 4R69A 4IX1A 3SC6A 2AA3A 5HQJA 5G02A 1RW4A 1L4EA 2QKYA 3IDSA 3RAEC 4L0CA 4JLMA 2FJUA 2XXAA 5ITVA 4YCMA 1E1QG 3R9WA 4EFBA 3R6LA 3P8ZA 4L0QA 3IIEA 3IKJA 3Q8WA 1CS0A 1QQCA 2ZVPX 2GMWA 1A5AB 4LI0A 3HPLC 1L7AA 4WSOA 1M54A 4P3KA 2DYRB 4FDAA 1JP7A 1ZMTA 3BOSA 2HV8A 3I5XA 2CMHA 3B4SA 3AR4A 1T2NA 4HZUA 4K9QA 1JHAA 2ZE6A 4N12A 4U2EA 1NR7A 5GVRA 1G8GA 3RSCA 2MJLA 5EIHA 4BV8A 1B74A 1LI4A 7REQB 1S8AA 3IV9A 3L9DA 3GBPA 3OEHA 1VPVA 2QMEA 2C0CA 3VQXA 2NSHA 2IELA 4LUCA 3HEAA 3ER8A 2QKSA 4LHYA 3BFXA 5BW5A 2DR2A 2AOXA 1X7XB 1Z18A 1NRIA 4R1TA 1NQAO 1TT7A 1S4MA 1C1DA 5AVXA 3PC3A 4AX8A 2KKWA 1ODLA 4GPTA 3W77A 5KTNA 2HCTA 5JAOA 4QGHA 1QLJA 1Z5OA 2PSFA 3RVZA 1TVEA 1IBMB 1UM8A 3B13B 4QFTA 4KVFA 2F1OA 4ZDJA 2PYJA 5ENZA 3NM6B 3AFGA 2AC4A 3MQFA 4IHJB 3ZI7A 1AKEA 4BKRA 1QVZA 4ZOLA 5A4FS 3BWEA 1DCMA 1W0JD 2AFHB 1F8YA 4LGMA 5AVVA 3NONA 3DTNA 4QIHA 3JRWA 2H1CA 4D0SA 2PVCA 1ATIA 1EFVA 1FXWA 2Q5IA 2YEVB 1ZW1A 1JEYB 4OXQA 2HEPA 3AVWA 1IEXA 2XT0A 2WLNA 3A9RA 2OZLB 4Q7QA 3OGCC 1PX0A 2PMFA 2ODPA 2V45A 4QPJC 5JVDB 3GFGA 4K9LA 2C3OA 3P0JA 2QE7D 2VYFA 3UKMA 5BT8A 3HRKA 2YJNA 3KB1A 3BFKA 2A06H 4O0MA 3OX4A 3JARB 1USGA 4RH0A 3ABMC 1G16A 3J7AC 4Q9AA 2M6SA 4WOJA 4MA5A 5L3RA 2CXXA 4PXYA 2P9ZA 2C9BA 1OX5A 1SK8A 3K1AA 5B2EA 2Y3IA 1PZNA 4MUJA 5LWHA 1I2AA 1ZOSA 4JQYA 1L4BA 5CT5A 1RS0A 3GWKC 4LCOA 4Y2YA 3OR7C 3WB2A 4MIYA 4GEGA 3ZHQA 3DNPA 2GYYA 1L5FA 3CRNA 1KI6B 4YRIA 1DFGA 5JAMA 1IAVA 4JC5A 2GPAA 5TMEA 1TQ8A 4CS3A 4DR6B 2JD2A 1RR6A 5L3VA 2G63A 1FJXA 3SR2C 3LFHA 1X3SA 3WL7A 4EAAA 5D3ZA 1G2IA 3O4JA 4FT2A 5K99A 2WLKA 5AHRA 5AKLA 5HKKD 4IG9A 2QKCA 1VLQA 2CY0A 3IEVA 4EKEA 5B3LA 2R6CA 4QXAA 1YQEA 5MFZA 4D0GA 4U7HA 2GUGA 4DB2A 4PX5A 1K6JA 3AFMA 2WT9A 2AS0A 2BEVA 1DK1A 4H77A 2DOSA 3GGGA 4OGKA 1TCUA 3AHFA 3SFVA 3N70A 5LP6B 4O63O 5C4IA 4RNCA 1FB5A 5JWPA 2Z3ZA 1PUJA 1Z07A 3LKVA 3B1WA 1IN4A 5I6DA 2IH3C 5BSUA 1VQKV 3WL3A 3UWKA 3JYQA 2BEUB 4AZ3A 1AKTA 5CIWA 4UAUA 1JHXA 4HX5A 2QAGB 3ZE8A 4LWQA 3HVRA 1UDBA 1FX0B 2AYYA 2JJ2D 2X6AA 3PU6A 5LBIA 4B09A 2RAVA 2VK2A 1N8SA 4JAVC 4MJ7A 4XDKA 2QLLA 4PAWA 2OYCA 3DFFA 1Q92A 3QSGA 1CUFA 5JBQA 2GKSA 2BN4A 1ZGGA 4P9OA 5LU9A 5FBQB 4HNVA 4U9IS 3AEKA 2HY7A 1V71A 1RE0A 3ZTWA 5IVPA 2DETA 5EUBA 4F3KA 2LP4Y 3SC4A 4A6EA 2XEDA 3GD5A 4OIMA 3A2KA 5LM3A 3VTZA 1WTCA 3ZXIA 1WS6A 2O2JA 4L2IA 1JFSA 2UYCA 1AN9A 3IKTA 3G23A 4YJFA 1JGTA 1F6BA 3E3LA 5JJBA 1JDUA 1GXSA 3A25A 2XUDA 4PYRA 4XIIA 4M1EA 2V3VA 3LV8A 5KOYA 4GKVA 1DX6A 1ZMBA 2CSXA 4AILC 1AQNA 3P19A 1AJQA 3K5MA 2I33A 4RE6A 1XXHE 1KSFX 4JGGA 4RKYA 4REQB 3PGKA 1PS8A 3VVBA 1HYHA 3ZLBA 1A50B 1FXKC 2QG6A 4DT1A 1E1LA 4MYUA 1AQIA 2O52A 2QZSA 2BOCC 3X1DA 3S2EA 5LMCA 4DPLA 1NTKH 5AM2A 3U80A 4IFIA 2GKGA 1RYBA 3KT8A 2GTPA 5L51A 3IQDB 4ZVVA 1APBA 4P4UA 4DG8A 2WJYA 1E1QA 3EMBA 3HYTA 3R0QA 4NZ9A 3ZMZA 4HUTA 2JI8A 4HT3B 1FLDA 1UPUA 4NJOA 3DMHA 5ENDA 4GLBA 4M7WA 2PD3A 3KSZO 5GAJA 1ZCJA 3VPGA 4DMFA 3IDAA 1ZNYA 4QJ3A 3DAOA 3ZRXA 4POAA 3U81A 1BXGB 1QMPA 2XOKG 5HILA 1CNMA 2LIPA 4ENTA 4LFBO 2AK3A 4C43A 2IYTA 3O4VA 3VR3D 1DBPA 5CXXA 4CKWA 1G9XA 2RB5A 4EMBA 1QK4A 2IVZA 3BT7A 5LHGA 2G28A 1QLEC 3L4KA 4JN6B 4NXNO 3TLJA 3LBIA 1DQPA 1F6DA 4GLJA 1TUIA 4HFNA 1M6VB 2A0KA 4EGCB 3PJEA 1WF6A 5LMUB 3I01M 2WOJA 3SPGA 4ZYVA 1V3VA 3E1SA 1G4UR 3SYLA 4KN9S 3HCWA 1ILWA 1BHQ1 1L7MA 3LX5A 2V7QD 2X0JA 4GT1A 1C8BA 3BL5A 5J4VA 3GL9A 4XWAA 1SXJA 3TI7A 3OLCX 2CXQA 521PA 2BM0A 1J8FA 3CZMA 1RAIA 2PH5A 1JE1A 5DO9A 1T15A 3P52A 4I9FA 2HREA 4TTTS 3FOEC 1EFTA 1D8TA 3H2IA 3AJDA 3O8LA 4P5DA 3DHNA 4EVQA 2ZUVA 5G0UA 4Q34A 4LC9A 5KC8A 3U09A 4UXNA 5FWYB 4BVGA 3A9SA 1CPYA 3MPUA 2V7XA 5EJFA 1MW9X 3HDGA 4GZ3A 4LR3A 2GXSA 1XI2A 4RTMA 2WSSD 3AK3A 4QXPA 2Z8YA 3GRKA 3F1LA 2CK3G 1MDFA 2PYLA 3PHLA 2I4RA 5HW0A 1QOPB 2J9YB 3CZ4A 1CVRA 4LWSB 1WXGA 5IP5A 1GAWA 1CY2A 1UEXC 5CFLA 2XAQA 4NESA 4EATA 1CJUC 4FNGA 2VNSA 2XMBA 3RHSA 5CDFA 1J0BA 4JT4A 3FHOA 4J7UA 4C6HA 4PLVA 2Q27A 4WIAA 4EBBA 1F7YA 3U7JA 4INPA 3NU1A 5KNBH 1VSBA 5F1KA 1EZVH 2YFYA 1FTSA 1NUPA 3I9JA 4P5PA 4JYCA 1GJRA 4HLUA 2FW6A 2FEMA 4HVLA 3UICA 3THRA 1GGEA 3D4OA 1DAPA 2C7VA 3IV7A 4MQBA 4CMBA 2JW5A 4M7RA 4YX9A 4XWGA 4JUCA 3FNQA 4G36A 1ZO8A 5H6RA 1MOQA 3P9XA 2H8GA 1W5TA 1J5PA 4EHFA 1K8AW 3GOHA 2FW7A 4NYKA 2NU7A 1PT6A 1TM7E 8ADHA 4XR9A 4J7KA 4Y2TA 5HVNA 4Z0NA 3WNCA 1QH0A 3ABOB 4PVDA 4FQ7A 5JCJD 1E2JA 5EXXA 3QOFA 2WSIA 2VHUA 4LJKA 5F5NA 3P32A 1O5TA 1WXXA 2JFQA 2ZWAA 2NZ2A 4BZZA 5AI4A 2CHEA 4Y0NA 3OFNG 1NXXA 1FPQA 4L4YA 2QUIA 3TM5A 1OXTA 4JAUA 3F5QA 1RKVA 2BUBA 3MIIA 1PF7E 5T8KC 5AD1A 4JBHA 3T15A 5CJJA 3I30X 2Q69A 4CGZA 3ZEFB 5LPNA 3GUYA 2QRVA 2YHIB 1JR6A 1CX9B 2CLMB 5EA2A 4DR4B 3Q1KA 4XGRA 2JFFA 3LOPA 2BTOA 2OHHA 2OXTA 4OI1A 1JH9A 4BPBA 1BEEA 3UMFA 2VZ9A 2Q7GA 4RUFA 3AUAA 4IXNA 4V02A 2G8LA 3WTCA 3HLTA 4L0DA 3DE6X 1J8VA 5ILQA 2X0IA 4GMXA 1TZCA 1YRYE 4QA9A 4LYAA 5J23A 4MMYB 1YQDA 3HB0A 5TPWB 1QVVA 3BTVA 4DW0A 4QLAA 2B36A 2HQRA 3RIHA 5GONB 2OPHA 3EGXB 4ZCPA 3KJXA 1GYPA 5EP1A 2XKKA 4GKKO 2C2GA 4DV6B 3CB4A 3JQFA 3V5NA 2XTAA 3CA8A 5JC8A 1H8HD 1RWOA 1NW8A 1NC1A 2YWJA 3NH6A 3OZRA 1B00A 1HG0A 4UOZA 2OCGA 3USCS 3MF4A 4G1VA 5A0FA 3HYSA 3EOBI 4R68A 1PWHA 1YCGA 3VKGA 3V6LA 1MU0A 2Y4NA 4YRCA 5FOXA 1H6AA 4TMZA 2SNIE 4M9QA 4DMLA 1DELA 4DMGA 2YFHA 3A27A 1YQUA 5D1HA 2FR6A 3E81A 3GLIA 2TMDA 1K5SA 5HBGA 5JHHB 3MT0A 4HBGA 4PG5A 3Q85A 3C3SA 1U8EA 2CMKA 4EYOA 1NE7A 1JFFB 2XX3A 1KGDA 1G4AE 5TQVA 5L6LB 4FVMA 1GWNA 3F3MA 2JFNA 5BVHB 4ZAGA 4OB8A 1PJSA 4UM5A 4YJ2B 5JQGB 4PINA 1BA3A 4MPJA 1NQXA 4AJKA 4BOYA 4REMA 1XMQB 1G3UA 2YMMA 1WKVA 4AZ0B 1D2MA 3ABUA 2WIDA 4DV2B 4CCSA 3WK7A 3EEOA 1QH8A 3GGDA 3QTTA 3D2AA 2PZSA 1MEJA 4E2YA 4YHBA 4LXYA 4OQZA 4AP6A 3CX7A 2XF8A 3NBKA 3KZVA 1RLIA 1Z8HA 2QUJA 1ULZA 2PZ8A 2TMYA 4FYVA 1FPMA 1T9HA 3AVTA 1Q21A 1UBFA 2HFJA 2JFUA 3AZOA 1MIOB 4XPIA 1IBLB 2YV4A 1H8ED 2PU5A 4BWVA 3L05A 5AFSA 3L71H 4XSGA 5WRFA 3GK3A 2NG1A 2R48A 5EHZA 4LQDA 3ZVRA 2HDNB 3VTAA 3INYA 4NFSA 4E21A 5EVJA 1WOYA 2IBZH 1MC8A 1U0GA 5FHQA 4JLJA 5FNVB 4HH3C 2IGTA 3H1HH 1M1NA 4OB6A 2OGWA 4XGQA 5DLEA 2B9EA 2TRSB 2VCYA 3JY6A 3T7RA 3KEFA 5A1JA 1LPSA 2WV7A 4BU0A 3APOA 2QJRA 1US8A 3LOUA 1LPBB 4B3JA 3QM1A 1M72A 2YOGA 3GLGE 2PVPA 2ZZNA 3IH5A 2CUGA 1Y3CE 1VQ1A 5KVQA 5LD2B 2G4LA 1FBNA 2BFAA 5F21A 3L70H 3MC1A 1ODJA 4RLFA 3T5BA 1OF1A 4QT4A 4D4HA 5DKFA 1YZKA 1R8YA 1E66A 1HKUA 4FMBB 1E1RG 4BO4A 2HDOA 1FDIA 3ZU6A 5IT0A 1F2DA 2X8BA 3OD1A 2VOEA 1C81A 4D0RA 1V5FA 4LY0A 3OSZA 3ZJUA 2NO7A 5EBMC 3EVEA 2HLDG 2YZ2A 3A4IA 2X15A 1W34A 1XZMA 2BWJA 1W5AA 5K6AA 2WWYA 2OD7A 1JMVA 3T3OA 2WF7A 3VOUA 3KB6A 3A10A 4BX3A 2FPKA 3AM5A 1E2EA 2VZ0A 2PLNA 3KPVA 3ETDA 3NFRA 3T5AA 3HLYA 3GGOA 3TQIA 1RTKA 3HCDA 1KAMA 5LMNB 2XOXA 1V45E 3GY0A 3DEAA 1W4RA 1IB0A 4NNOA 1N32B 4Q4JB 1M83A 3H3XA 4HXEB 1MVLA 1LK5A 3OZFA 4L75A 4XPZA 4B3TO 3DV2A 3HSKA 3P2JA 1LH0A 3MBOA 4MW8A 3DR3A 4I55A 3Q12A 5IKOA 3L79A 2WI8A 1Q16A 2RGAA 3KCQA 1BYUA 2O14A 4PFQA 2ZZKA 3CPSA 1TZ2A 1FQKA 4RJJA 5J3JA 2V9CA 1S3FA 1SG0A 2DPLA 4O2RA 2IVFA 1L0BA 4ERXA 1Y9DA 5JNSA 2JAUA 2DWCA 1GOTA 2WG2A 3NAZA 3WU2Z 3I9NA 3OFNA 4BWFB 2QD1A 1EFVB 5K45A 2WHPA 3UC5A 1CV2A 4CXMA 4YY3O 3GWOA 1LBQA 2PO5A 1HDYA 1GDDA 1JFRA 1ZVKA 1Q0SA 5J9PC 2OBBA 4B8YA 2RGRA 1QVGU 5GJVC 5ED4A 4B75A 2CL7X 3WGTA 1BX3A 4RIGA 4JI5O 1QZTA 4G86A 1G41A 1PNQA 3ZMVA 2M6YA 1JB9A 2QPLA 1Z0AA 1T8SA 3K1AB 3AG7A 1JHDA 5A05A 2DRIA 3GP8A 1KYOF 1OXXK 1X7DA 4FW9A 1Q44A 4UZEA 3BMNB 3O5AA 1SXHA 1EFAA 2W6JD 4PAQA 2ZPTX 2WF6A 3N6VA 2PD4A 3C3WA 4DZRA 4W4LA 1NVVR 4L8GA 4R1LA 3TZBA 4KG7A 5KAMA 2HIMA 5T5QA 2TSYB 2IPAB 3H11B 3HWX1 2XMCA 1A9TA 1BWPA 5KYYB 1PQYA 1LUWA 5HP4A 1JTKA 2UU9O 2XEXA 1GZ5A 2VDRB 4UUJC 4IDDA 2Q6AA 3VTKA 1YONA 3RTCA 2JK1A 3WKBA 2MSEB 2H7XA 4MVWA 2HDWA 1AVTA 4MVYA 1EGMB 4RESA 2V7VA 3PUZA 4RSMA 5B3SB 3ENWA 3H9QA 3DC5A 1URPA 3R75A 3T4EA 4BUZA 1T3SA 3HUUA 4HSGA 1P9RA 2JGDB 1KA9H 4I8IA 1ZLZA 2XE4A 5DHQA 4U7TB 3FUWA 4Q3AA 2CNKA 4GPAA 2ZBUA 3JYHA 3UY4A 1JDTA 2UYHA 2O07A 1YI8A 5GOTA 4JJAA 1CJVC 5HIJA 5I8ZA 4UJ3A 2B8NA 1GPDG 3D4NA 1VLVA 3ZWYA 4M8NE 4BWAA 1YA4A 2JIOA 4QXQA 2YXLA 3HYCA 1E2HA 1I7NA 3BGDA 2GH1A 1S0UA 1FKAO 1EH5A 1R5TA 5F7ZA 3ZNPA 4NPHA 3OLZA 4E1VA 4YALA 5IN5A 1ZAYA 3CT4A 4XE5A 1JQJC 2Q9CA 2XUJA 4MUMA 5FEMA 3P0FA 3FAZA 3L3BA 3EZ6A 5HXAA 3FPFA 5EE1A 3TNDA 2CFRA 4OX9O 2R1VA 5DTEA 3GLRA 4Q82A 4HPXB 2PEYA 1D0VA 2DFLA 2YMQA 7REQA 5HX7A 3SS7X 3E9DA 1ONBA 3ASZA 1FUIA 3KKOA 3BXEA 1SBNE 3KE9A 1HMPA 2RJZA 4EQ6B 1X7XA 2QA5A 1VMAA 3Q3HA 4FM0A 3PJGA 1G8HA 4N3GA 1E89A 3QX3A 3GZTB 1LJ8A 3IHWA 4CNBA 3H99A 3KPJA 5CLLA 3TX2A 1YR2A 1OI0A 1NU6A 2C9ZA 1CQWA 4S35A 1H4VB 1ZXXA 1PJ2A 1IY1A 3GJYA 2X9VA 2OP1A 1N5KA 4UNNA 3E18A 4IHJA 3RVDA 4B1FA 1SD2A 3UCSC 3TLMA 1OSNA 4MS4B 2PH7A 3ASYA 4L15A 1CP9A 4FHEA 2AFHA 2QTAA 4CLHA 4D9EA 4CZ2A 4R1NA 4QLOA 2DT8A 3WOVA 5TRTA 2QAIA 2HW8A 4QULA 1VIDA 3NXKA 2QP3A 1SOAA 4MRNA 2FWNA 1M1KW 3WJ7A 2YEVA 1XA0A 4UNPA 1BNCA 3QBJA 1JEYA 2WYUA 5C51B 2VDUE 3OG9A 4R41A 4D82A 4FD3A 4Q16A 5JVDA 3TINA 4KMSA 2O3KA 3V7UA 4UU1A 4RQAA 2P9EA 2A1UB 3BWCA 5KHJA 1NJ8A 2HLDA 2YYZA 1FSPA 4F3NA 3JARA 2NIPA 2I62A 2R68A 1Z2NX 3OOSA 4P9EA 3OUZA 2EW2A 1FTWA 4KRXA 3MSCA 2IBMA 1HG1A 4FYJA 1DIAA 4C5AA 2IU6A 4MLCA 1BS9A 1IHUA 3GVIA 3OU6A 4JBYA 2XPCA 2VHQA 4XYMA 3NRBA 4CQMD 5G0SA 5CDTA 4R7ZA 1ZM7A 2B5WA 3ZU2A 2P4UA 2EQBA 1IY8A 3U3XA 1QO9A 4WZAE 2XVXA 2C2XA 2CJXA 2HRDA 5CDGA 1UKZA 2QTHA 4BMNA 1KI6A 2Z8XA 4QU5A 4Y9SA 1W76A 1DTOA 3HU5A 1MGPA 3R0IA 4XASA 4G0XA 2FWJA 3NHLA 3GARA 5TISZ 4WBSA 4R0VA 2F66C 1N8RW 3UYLA 4CTNA 5JQWA 3DL0A 2P7HA 3LFUA 1U2RA 5DHAA 3V6MA 2YJTD 4QREA 1GV1A 2IQIA 1Q0TA 4DMMA 4C0HA 4DVGA 4CR7A 4RY8A 1QE3A 5FI0B 1M2JA 1XB2A 4DTCA 3JASB 2P75A 3E23A 2XAUA 2CNDA 4PZPA 5HKOA 3F8WA 2JEXA 3K70B 1BN6A 3G9UA 2E4AA 3T7CA 1Z6YA 2Q1WA 5LP6A 2Q3JA 2XKAA 3KQWA 1AF7A 5JCPA 2YN0A 2YCLA 4OBWA 4V1CI 1RXYA 3L8FA 4GD3Q 3G4SV 1I3NA 2BW0A 3SYQA 2V98A 4HJXA 4A0SA 1Z38A 1JZQA 4V0KA 4IMPA 4OGFA 2L0XA 1VIYA 3K53A 2MCFA 1DJNA 2AXQA 3VR5A 4D3SA 3ZWQA 1PVDA 3GEDA 3ENQA 3KHUA 1NYRA 3OQJA 2BEUA 2QAGA 2Q7DA 1CEQA 4Y2GA 1FX0A 3IIIA 1HZZA 2PUFA 4AO8A 1PJCA 3INTA 1NSFA 4XI9A 4G24A 2VOJA 4M2LA 4WVFA 3OPYI 3CRVA 2E6UX 2LXNA 2EYQA 1Y7LA 3LLSA 1N8KA 4UD6A 4ZVUA 2DKFA 4L1KA 1EHYA 5DVZA 3NJRA 2NAFA 5CB0A 1M7BA 1Y1QA 5LZ8A 3DEFA 1P9NA 4QTXA 3LKDA 1LTKA 4B6JA 3BL6A 1NUUA 1MJGM 4MCJA 4LZOA 1OCZC 4AJ1A 2P2NA 4B4KA 3PA6A 2WYWA 1SC1A 3T1VA 4NH0A 3PFHA 5LKRA 4W5TA 2AMJA 3T7IA 2O6HA 1SHKA 2W2OA 4X65B 2FK7A 4REQA 1OB5A 1UAQA 2NW6A 2FYUH 1YQWA 5U4XA 3WP1B 4MDFA 1YZYA 4J91A 2NO1A 2C92A 2H1LA 2FXVA 3GLSA 1V8ZA 2OFXA 2E9SA 2IY8A 1Z7YA 5ALWA 1N2ZA 2JBAB 2ZLBA 3ZZTA 3AVOA 2VDLB 4J0IA 1SH7A 1DV2A 2XZTA 3QVTA 1E1NA 1G6OA 4PGHA 1KJYA 4YAEA 5CDYA 1ZL8B 5CT4A 1H3EA 3DTVD 2CXUA 4UFNA 3KJQA 1OH6A 2BMFA 3ZN1A 2OCCC 5K0TA 1LDGA 5KQSA 4D6XA 1PWEA 4HDCA 4BB5A 2AK2A 5KWEA 3RREA 2YVLA 2QRVB 3ZHRA 4QL3A 4YUWA 1V3TA 4WFIA 1MJHA 4FGZA 2PZMA 5LNK1 4JUBA 1BXGA 3WKDA 1O94A 2DY1A 2BJHA 2EDAA 2X5XA 1E92A 1Q90D 1MO3A 4XX0B 4E2WA 1CU1A 3SOPA 2E3CA 1DZ3A 2ZNVA 4NCKA 2B4KA 4YUZA 3HKBB 3GRVA 1USWA 3S44A 1OFTA 1R50A 3W7SA 2ZAMA 4HZGA 2DOKA 2BZSA 4HRYA 3RI3A 2Y66A 4F3RA 2P4VA 3B20A 1M6VA 5TS2A 4LOAA 1Y3AA 1Z5ZA 1VHLA 1N4CA 1QMGA 2GD1O 3L06A 1N2HA 2PX4A 3UMSA 3TO5A 3RVBA 3ZQKA 1NLFA 1MA3A 1Z16A 4TLMB 2Q5LA 1SVSA 2IY7A 3U9TA 1YA8A 4IH9A 4HNQA 2F8TA 2NMVA 1DRKA 1SXQA 3K9HA 2R8PA 2HRCA 1DL5A 2DFTA 2QN1A 4QUHA 1EU1A 3EA4A 1WCWA 4YPOA 4JYZA 2R2AA 4O4JF 2HA3A 5CLIA 3ZCTA 5ALRA 3AUYA 4QYWA 4OP2A 3ZDEA 4WFFA 1K0FA 5BXZA 2QTGA 1HNZB 1Z4NA 2P0YA 4IIBA 3MTAA 3WS7A 2ZRAA 3A6EA 2YWEA 5BSTA 4Q1VA 4FCTA 3GNLA 3SICE 1Y6FA 5LVAA 5FWYA 4LF6O 4JWKA 3FTDA 3EHEA 4HWPA 3LBHA 3DLHA 3KALA 3BHPA 1O0CA 2H9AA 2V1UA 3OD4A 4E32A 5DDIP 3FI9A 4DA4A 4NTYA 2H07A 1G5IA 4P8RA 4X6YA 1ZZGA 3CFYA 2EOAA 1JJIA 2XXJA 2F1JA 5GZ6A 3X2QB 5JR3A 1QU2A 5AKHA 4K6KA 1WPGA 4GDMA 3HR4A 4OGQB 3CGGA 4LWSA 4WOKA 3RKUA 3BD8A 1L7DA 4P86A 5AI5A 1P1FA 1T24A 2IYWA 1KMCA 3QI7A 4MCHA 4RHYA 1AKRA 1SWWA 3GT3A 1LPPA 4MUYA 4JLOA 2REXB 1D07A 3L49A 4W1PA 3TIXB 2C42A 1A8IA 4QVIA 3RKRA 4MV9A 3IAEA 3MOGA 3WLIA 3WRYC 3CE2A 2JBWA 5F1YA 2D1TA 2BTQB 1WB7A 4JCOA 4R9VA 4J7JA 4JBNA 1KDTA 3X1ZA 1DX9A 2XOEA 4M55A 1PS0A 4G2KA 3UUGA 5H9CA 3K8OE 5L3ZA 1TEHA 1SUIA 5ICFA 1WR8A 2KLHA 1XL1A 4D9GA 4B83A 1FFTB 1OD6A 5IH7A 1DAEA 2BI4A 3FMIA 1U2SA 2F8LA 1GQOA 3V1UA 1IMJA 3PXDA 3K57A 1JW9B 2NX8A 1D0IA 1NZJA 5J4HA 2DUUA 4JMLA 1RM5A 5KX5B 3SMVA 1ISFA 2UZ3A 2HK6A 2CNNA 3LX8A 3EULA 4EF6A 1AXGA 1W8DA 1MZVA 4UV8A 3ITNA 1PNOA 5AUOB 4KJZA 4YACA 3BRQA 3WWYA 2DFVA 2G8NA 3J80A 5B4TA 3BXZA 1X1BA 4G1MB 4DKJA 1C7RA 2JANA 3Q9UA 5I9IA 4DR1B 3WWZA 2HVVA 3Q72A 2D00A 3PEEA 1LRLA 3FOFC 2YHIA 4FXPA 4HAUA 4K6HA 1G60A 3D6UA 1DVRA 1J1ZA 1NVEA 4Q0MA 3B1YA 5FWDA 3G8AA 4IYJA 3UQYS 4TKLA 4WK2B 5JJCA 2GCPA 1RZRD 4I81A 3N8NA 2P27A 4C4RA 3B8FA 3WFZA 1DV1A 4U9UA 4QD3A 3GDFA 2QMHA 4CFYA 2PZLA 1Q2UA 4JI6O 3FH0A 4EJ6A 1C9YA 2TMGA 4U02A 3AXSA 3NV9A 5TPWA 4TXJA 4P33A 5KJCA 2C84A 4LBEC 3EGXA 2Z3WA 2JLRA 1IZZA 4YJ3F 3IUJA 1Z06A 4K1LA 4BLRA 4F2HA 3I6YA 3ZW7A 3PZRA 2IOQA 1Q1GA 2WUFA 1JG2A 1FRNA 3ECCA 4O4IF 1JLKA 2QSAA 1FXUA 3SHOA 5LB2A 3H7IA 5A5EA 5CA0B 4MI3A 3PHIA 3UUEA 3I05A 3PKJA 3ABQB 3LE8A 4QU8A 3TTUA 4LF9O 3CURA 3W6NA 4S1NA 5JRDS 4GQIA 4BZWA 5ECGC 1GTRA 3UXEA 5FH9A 1Z8NA 2JGKA 4RKWA 3VQVA 1ZI8A 1JFFA 2ZSEA 3FSGA 4CKZA 2CTRA 4R5MA 1OTHA 1QZZA 5BVHA 4MW6A 2GCOB 2F3QA 4YJ2A 1ZUHA 5JQGA 4FI3C 4O8XA 3S0JA 3QUBA 3NNSA 2ZTLA 2HNAA 2AZ4A 4AZ0A 1OILA 1W5EA 2B69A 3ZHSA 2VT6A 1IX9A 3AINA 3EPPA 5KDDA 2IZ5A 3SZ3A 1IZ7A 5IT4A 2IZOA 2YJZA 3SJBA 4FQ8A 4OQ4A 3GIDA 5AXDA 1PYDA 5C8VA 5DWVA 3LVFO 1YB4A 3OMLA 2XCRB 4TXMA 1OX7A 1KHHA 5B36A 2J5QA 1NX6A 1B6SA 2WJIA 4J76A 1MIOA 3GGPA 4H27A 1U3DA 2F4VB 3EPHA 3UQ8A 3IR6A 5AVUA 5EE9A 4MWSA 3LQQA 5B1AB 2ZBRA 2EJVA 3TSWA 2JDID 1NE2A 1UR5A 1P3JA 3OZDA 2AZXA 2WB4A 1DG3A 3AR9A 4FXOA 5J2TF 2BE9A 4X6UA 5FNVA 2A5GA 3F71A 2IIQA 1GD1O 1DO8A 1RXCA 4UVAA 3QU7A 3VYSB 1YI0A 4NDNE 4L5JA 2XUZA 5A4IS 4WIGA 1EAMA 3AOEC 5HZHA 4MCIA 3SZGA 1H3FA 4C1NA 1KEEB 4RH1A 1SOWA 1TM4E 2Q3HA 4FLFA 5AQ1A 4M86A 4R3WA 3NCHA 3DVSX 2C5AA 3L6BA 2V0CA 5CVCA 4G5GA 4WFGA 3JQ9C 2O5EA 4M8IA 1YE8A 1H0RA 3CRCA 1W88B 3HP1A 3F97A 3QXJA 3PQFA 3T0FA 1ND6A 1ZSYA 1VM6A 4FEYA 2PL9A 3COSA 5BMOA 1YI2V 4NFLA 1EK5A 3IVMA 1V9SA 1M7GA 4EW1A 1N4AA 4ACBA 4ABMA 1PCXA 5EJGA 4M9SA 3QXSA 4QZVA 4L5YA 5HTKA 3VTFA 3VSDA 2N75A 2Z3JA 2NPFA 2P06A 2DPMA 1CNEA 2O48X 3HVKA 2SKEA 4PCUA 5DB4A 4EF5A 2AE2A 3AI7A 3MS2A 4BRSA 1PP4A 5B7GA 2R1VB 5HNKA 2GTSA 2QR4A 4OMFG 3BE5A 1UXKA 4JVLA 2YWFA 4IL5A 3WLRA 4IZHA 1NYLA 2C2ZA 4NL4H 3PGLA 3OX2A 2PRZA 5HBRA 4Q4JA 4YP9A 1FSFA 4ZJYA 4E14A 1PFGA 3SZUA 4MINA 3L8MA 4REOA 4MT8A 5FXMA 5TSDA 1QK3A 5DPMA 4F4DA 1U5CA 1XD9A 4CT4B 1U9YA 1WN6A 2QTCA 2O7NA 2H2IA 5KUMA 4U5XA 4RK6A 2XWJI 3CYOA 3K94A 1OREA 3I6BA 3NAMA 1T4CB 1JWLA 5TX7A 2XYRA 3AJAA 2CNLA 5FADA 2PUSA 1PR4A 1LQ2A 4LMBA 4ESHA 3MD0A 2V8OA 3WWDA 4AO6A 3W2IA 1WVGA 2ZXEA 3KSAC 4FIPC 4RA9A 2VDMB 1ESDA 4AECA 5DN6D 1QO0A 1L2TA 3K6SB 4WY8A 5AVKA 3QG1A 3TMAA 3O3MB 4YMVA 2WP0A 3DBHB 3DFIA 1NU8A 4AQDA 1T6BY 5REQB 1E7SA 1OFUX 3LJKA 3J81k 1V26A 2JZCA 2GBGA 3R7NA 5EIXA 2V0NA 2PM8A 1EM6A 4CS4A 1TZMA 3JZDA 3KUUA 4EENA 1YKGA 4BB0A 1J8DA 4G25A 4X44A 1UMDB 1USIA 2VDOB 2CDRA 4L57A 4IDGA 2O0LA 3TSCA 4U1RA 4EHDA 2RGNA 2J3MA 1GGJA 4EF4A 1Q1QA 5JSUA 2GPTA 3BMNA 3TRHA 3ON5A 3JZMA 3CF6R 3BZBA 3QMVA 1G4HA 2AX3A 4R2JA 3H11A 3WICA 4GUNA 3R2JA 4GRAA 1ZN9A 5KYYA 1CTUA 1G1XB 1KH1A 5BV7A 1R9JA 3H0CA 1TLLA 2OM2A 3WL4A 3TFQA 3TEMA 3CV3A 1L5QA 3T9FA 5ITZB 1FU8A 1SULA 4CV2A 3KUDA 1T9ZA 4DNXA 3EUFA 4XIGS 4EECA 4FS3A 2RH5A 5LBQA 2YC0A 2PQMA 2ONZA 3BHNA 3M7MX 2GGSA 3GJRA 2J85A 3C3AA 2YY5A 4M0MA 2JGDA 3BFPA 4M99A 2IH4A 4UVIA 3HCAA 4AIRA 2PHZA 1WUKS 3OZCA 1ENOA 2JFPA 3PQDA 2OG2A 4EQZA 2QGFA 1N2IA 2J07A 4LVNA 1WU7A 5LA6B 3H19A 4KXUA 2XVMA 1MAVA 2XUHA 5JCZA 4KMMA 1BU8A 4DWWA 1KFBB 4UHJA 5IYZF 2AG6A 1YJCA 5BQOA 4BGVA 1W30A 1LPNA 1R1DA 4B47A 4FCVA 4KE6A 1OAKA 1SBQA 3L7YA 4PO3X 4P3PA 3VMMA 4BQOA 4PV1B 3OCVA 5E1AC 3SBGA 3MOSA 4QC2A 4JLNA 2I67A 1Z45A 5I7EA 1U7UA 4C2AA 2JLVA 4B84A 1K6IA 1UFRA 3AZPA 1NVPB 1MH1A 4FYKA 2ILVA 4BFYA 5DASA 1Z12A 3G2IA 1RC8A 3R7FA 4F0JA 4MQLA 4W4KA 1AHNA 1CY6A 2EIXA 4RU1A 1E0KA 1RAHA 2KQUA 3FHTA 2DBRA 4EQ6A 4GNKA 1X94A 4D41A 3M2PA 3VXKA 3MB8A 3WNQA 1AURA 5ALSA 3A04A 3ZDRA 3I73A 4DYDA 1DU4A 1NZ6A 4Q1CA 1P6QA 4DV3O 4R1MA 3LQ2A 4BO6A 4A8HA 5IZCC 1T3HA 4Z1MD 2PQ2A 4D99A 3HU3A 2BMJA 4I8DA 2G9ZA 1GUBA 2R25B 2PZJA 1PHPA 3KLPX 1YR9A 2XUFA 2XUPA 4GOMD 3EXIA 2EF0A 1R6DA 4MS4A 2CLDX 4CFZA 1FDOA 2B7CA 1WXFA 4B4UA 4EEXA 2GSWA 4JB0A 3ZDDA 2C4MA 2XSZD 1SELA 4QYMA 1UFIA 4ZHQF 3MTEA 3CWBH 4IYHA 2Y69B 7ABPA 1IUNA 1QKIA 3JAKB 4H37A 1GPLA 1OXUA 3I53A 3NCTA 4LYJA 3SIRA 4OVKA 2J87A 4WY2A 1WRBA 2VTKA 3F49S 1GM9A 4RANA 1EG7A 1ORIA 1ZITA 2Z98A 2DPXA 4RMNA 3OZAA 4TLCA 1M1YE 3V4RA 2A1UA 5IDXA 3FHCB 3ANTA 4BO5A 4Z54A 5H1YA 1VSTA 1H2YA 3NUQA 5EE5B 4C05A 2IW3A 2OO3A 3I39X 3GLHE 5DBHX 5IF3A 1IUPA 6CHYA 4HXGA 1XLWA 4CG2A 1Q20A 1WWKA 2FAXA 2WYHA 2I6SA 4S2EA 2P9YA 2HF9A 2H2GA 4TT3D 1J2RA 3SSNA 1JZSA 3ICOA 1GK9A 2QVLA 2GUZB 3F1KA 1PG5A 1ORWA 5MGNA 4F2GA 1VQ8V 3K15A 1QR2A 3DE1X 4RETA 3WIUA 5BSKA 3ROEA 3UK1A 4E2XA 3GVPA 5ALJA 1QRUA 3SWWA 1RPNA 5IKXA 3VFDA 1VYTA 5LFAA 2NOAA 3ND9A 3DE0X 1NP3A 1G8AA 4L8LA 4X89A 1R0SA 5FLYA 3UCFA 1IIRA 2RGEA 3FY4A 5DCYA 3FPCA 4P7JA 1RI3A 3ST7A 4KOAA 4HQLA 3EQ7A 3MLEA 3WWCA 2Q07A 4UBLA 2R7LA 3GA5A 2IE0A 1IFXA 4N8EA 1U0FA 4TKMA 2FW8A 1Q2XA 3JASA 3D3JA 2OC9A 3AY7A 5G3ZA 3VAAA 1JI0A 2ZXWC 2QWPB 4DLYA 2AZ0A 2HT6A 1DKPA 4RY9A 3OT1B 4BJ5A 1LBHA 4W1QA 1R6NA 4IHAA 1H1LB 1K33A 5ER9A 5HIMA 4ZK2A 1X7YB 2VHWA 3MBIA 5MFPA 2X6QA 3H2KA 1T9DA 2AHRA 3TZQA 1YFZA 4QO8A 1SO8A 4S1PA 5D7NA 1Y5MA 2PDAA 5ALNA 4JP1A 3RWOA 4RQTA 2OB2A 3D1JA 1MQ8B 3R9IA 3DZGA 3AEUB 3FYCA 4IDCA 3BK7A 3I9MA 1AIPA 4J29A 1KZGB 1OV6A 1GZVA 4NEQA 4OX9Y 1ZD4A 1FS5A 3T3MB 4UCXA 4DL9A 4P4SB 4O2BF 1ZGJA 4GO1A 3RC1A 5K4HA 4JASB 1Y81A 1YR1A 2AL7A 1E2UA 3MGKA 4DLVA 3GJQA 3QLVC 3CLTD 3DMNA 5LHHA 2XNSA 3KB8A 1UOOA 3SZOA 4UNSA 2LBPA 1XNJA 3ICQB 1V7CA 5I8WA 3U5TA 4AMUA 1RM0A 3NR7A 5DECA 4DSNA 3TJTA 4B31A 1VECA 2GM9A 5K0ZA 3M8AA 1CLEA 2OA0A 4B82A 2H2AA 4ECEA 5LNK6 4B74A 3FWZA 3D0KA 2XNDD 1XJWA 4IJUA 2I03A 3JAWB 2IDJA 1W581 5FBZA 1Z7GA 5HZGA 1DRWA 2B6HA 7YASA 4Q9LA 3NT2A 2WJ3A 2R79A 4BNMA 2OG1A 3NHKA 5JATA 1ZRHA 1V9PA 2CHGA 4MKXA 2BFBB 4P93A 1E8DA 1I0IA 5FL7G 5KVCA 3DS8A 2JBAA 2NXCA 1J5XA 4R1OA 5FTJA 1FNCA 4BJ3A 2P67A 3STYA 4B71A 5EZ5A 2EL7A 2WF5A 4MDEA 2ACEA 5GIPE 3T1HB 3WKAA 1ZL8A 1YO6A 1Q15A 5GJCA 3FNIA 1WY5A 1RVV1 3BGSA 1P45A 2GEVA 3E2PA 5HCIA 2CLCX 4F4UA 3V00A 3E9NA 5DXJA 2NZJA 4LV8B 2JI7A 4X92A 3F4KA 2LW1A 4NENB 4R2LA 1GLVA 4PLFA 4Y1EA 5JRZA 3U7FB 4BKQA 5C52B 1W52X 1V48A 2QX8A 3WG9A 2Y48A 2IYOA 4XX0A 4ZQHA 1QBKC 3B6KA 3I83A 3KQPA 5CVUA 3HKBA 1NF2A 2WJ4A 4GZ6A 1RZVA 2G1PA 4DS3A 5SYNA 3IBTA 4TWRA 1KE2A 2A92A 4MW5A 5IAJA 2HLPA 4HHEA 1QRTA 4FJ0A 1DIOB 4QQNA 5C32A 3DDHA 3HO1A 5DP1A 1MR3F 4QVKA 1V4NA 1CS4C 5KEIA 1JXMA 2JLBA 3IQXA 4LJYA 1W36C 2XQVA 3AHIA 1K9SA 4A2WA 4FK8A 5DHRA 1YSBA 3H9CA 1NS1A 2ZIMA 5H0IA 1GZ3A 1JT2A 4BYGA 4N6NA 1MF7A 1TCVA 2HGZA 2VDKB 4M1MA 1KH3A 4IDOA 1XHFA 2JLQA 3C3EA 3A3KA 3RUCA 5GZ3A 1LNSA 2DYSC 2P68A 4QTTB 4EABA 1IQRA 3R7AA 3IT1A 1VLZA 4TZ6A 5FI3A 2IXAA 5HR5A 2XOKA 1JSXA 2EGGA 1IM8A 4E4YA 3DC6A 4O8XB 1QIHA 4ALKA 1PJAA 1KECA 2QJ1A 1NBAA 2RCYA 3T9EA 1P33A 2PBRA 4DCSA 1T1RA 3SX2A 3IILA 2GCIA 2VYNA 4YDSA 3VZRA 4IQ4A 1SCAA 2I1LA 4IBOA 4L51A 4RCVA 2DWEC 4CF7A 3P3NA 4IVQA 5HSGA 2AMVA 4C0AC 1VG1A 1LW7A 1Y8QA 4XQ0A 1YI1A 4CEJB 1JDSA 3L8YA 3G85A 2EATA 1DO0A 1Z5VA 4RVDA 2WWWA 4RMHA 2WJJA 2ZJOA 3U44B 2V6JA 3SLGA 1D6NA 4LSWA 4WUVA 1E3MA 2QJOA 4X7PA 1OI7A 4NCHA 1KHTA 2TECE 3KSBC 1IJBA 4BRZA 2RDCA 2BTQA 4BO3A 5YASA 1CQZA 1PYGA 4P9PA 1FYJA 2RGBA 2IH2A 3CPWU 2F1MA 5DHPA 3W5BA 2FZCA 3EIXA 5HFNA 5CA1B 3AOGA 3WO0A 4D0NA 1HR0B 2RHLA 3TSOA 4J3FA 5CEJA 3TZHA 3NPMA 2WTBA 4KHPO 3IO3A 4XWWA 4L5AA 2CUNA 1ZUIA 4V3CA 2PY5A 4DABA 1UPFA 3L41A 5H6QA 1TLTA 4PDVA 1VZ3A 2IT1A 3KOYA 3SHTA 2CV2A 3AL3A 5F12A 1XLTC 2YWBA 5KTMA 5CEEA 5EJ5A 1JIJA 1XYYA 3B5JA 2EXXA 3IEIA 2WQ6A 3HSYA 5KX5A 3AG3C 1U28C 3QWAA 1KI1A 2YXYA 4H59A 1NVVQ 3R66A 3E5NA 3EC2A 4BLUA 2HXSA 2CK3A 4TWJA 4F1KA 5KINB 2QJTA 4X5OA 2VEOA 2GZ2A 1DQRA 3Q5EA 4FT4A 5LGUA 5KIAA 1QG4A 2B78A 1JR3A 1M75A 2HZBA 4OMCA 4BGIA 2Q2OA 3KOXA 4XBFA 5FBWB 2C94A 1UKCA 8GPBA 4OJQA 3EGVA 4AJEA 1QHIA 3RTGA 3WDKA 5EXEA 4BV9A 4RTQA 1N5MA 4UQLA 5KPDA 2CDYA 4PSVA 2G5TA 3HFGA 4LFCO 3GFSA 3EQ9A 2OIEA 4NI5A 2P30A 3BTUA 3MM4A 2A3QA 2J08A 2FWMX 2HUPA 1L0NH 4TS1A 4E5DA 4FGJA 4KV9A 3LUTB 5EVCA 5HA5A 5D5HA 5LB4A 2VXBA 3H7AA 2OO5C 1CYEA 2G76A 2QZ4A 3NC1C 3QYAA 3CW9A 4LGYA 3OPXA 4DB4A 2J9FB 5CJPA 2AHOA 3QG5A 1A5ZA 1ONNA 5KSZA 1HYQA 3K8YA 1XIVA 4ZEOA 1YXBA 1W9MA 3PSAA 5F3RA 1XPUA 3RSLA 1RHRA 1VPDA 4U39A 5FL7A 5C2JB 4N47A 4EY7A 2PCLA 4F8YA 5CA0A 1V1JA 2V4DA 1E63A 1IUOA 5I9SA 2PE5A 1IDN1 2A9QA 4HAIA 4D8XA 3EG9B 1X38A 4HTAA 2PEZA 2JI4A 2PAFA 4RA9B 2FK8A 1UWKA 4HQ6A 4YRPA 4EK9A 1LF5A 3GN2A 2NNWB 2LD4A 3EGDB 4V0RA 3ADDA 3U7EB 5GJWC 4OYYA 3UANA 3HCPA 3D5QA 2ID9A 1NONA 2BRUC 3PRKE 3LPLA 1R6VA 1VL0A 1XEWX 4LQCA 3B2QA 2GCOA 3AETB 5BYBA 2V5VA 2QWQB 1UJCA 4E0QA 2YRFA 3G89A 4IDFA 1MB4A 4X97A 5I3CA 1M2EA 3DSRA 1NVBA 2VO1A 4JXXA 4EPRA 1HZJA 4D6YA 2C1XA 2QLMA 1Y89A 4I4LA 5JS2A 3M3DA 3MRSA 1TIBA 2QRNA 1U2PA 3TIGA 4US1R 3G02A 3HI6A 4JI7O 2JS5A 2HK7A 3HGQA 4M9UA 3NDPA 1H23A 1CBUA 4IYIA 3KZNA 3Q11A 5CIYA 4E7OA 2FSPA 2N74A 4HL6A 2ZM5A 4ITUA 4F71A 1NNUA 1I94O 4MPPA 4G9BA 1D9XA 1L7XA 3ROGA 3OM1A 3FVTA 2VUTA 4ER5A 4AMZA 4RGVA 2BM9A 4YNBA 2BI7A 2R6JA 1J9GA 2ZQYA 4BKPA 3AVUA 3PFNA 3O93A 4EMUA 3PZBA 5IANA 3FSRA 2WTMA 5E79Z 3K5IA 1VQMV 4GOOD 5TY0A 4IIXA 4HNUA 1CQIB 1MTZA 1KEEA 4HFJA 3GWZA 5B1NA 2XA2A 1OBOA 1P4SA 3MXOA 1O6FA 4PPNA 4PYMA 3TE6A 3U31A 3FE2A 1O5IA 4QGSA 3OT7A 1G21B 2WHEA 1W44A 2XZOA 3E89A 2BGMA 3OF5A 4FZ0A 4ARCA 1W88A 2GM4A 3WQBA 5C5CA 4ZCIA 3TVDA 4D9BA 5KREA 2EKQA 4NRDA 5H16A 1NT2B 5HRUA 1T9CA 4Y2UA 5KHOC 3QMWA 4WFBV 3M1AA 4C6TB 2Z3GA 5I3ZA 5AI6A 4QDOA 4WRRA 1P7PA 3WGGA 4YCDA 3KU1A 1JNYA 3VPHA 2JNWA 3RC3A 3L2OB 1VEWA 1DDIA 5EKXA 2CFIA 4B81A 3GU3A 4YJDA 4TV9F 4PA7A 3L4BA 1NYQA 4WY5A 2YW2A 1TW3A 5CGZA 3OUFA 2HM7A 2SKDA 1I5XA 1GU1A 4QYTA 4Y1GA 4RWEA 4UEWA 4UFPA 5JUWA 4X85A 3RS0A 5KWSA 4KQFA 1IMOA 1TD1A 3N2ZB 4PA3A 2F4NA 4KAFA 2VJBA 4OJMX 4K26A 4B2IA 3FJOA 3KETA 2HGSA 3DYVA 3I9FA 3KDSE 4ZRDA 5AM5A 1KO5A 4N6OA 3HUDA 1ORQC 3EXIB 3VOTA 2VRNA 5AJUA 3G2MA 3C15C 2ZM6O 4UUMA 3E7DA 1FTNA 1T4CA 5JEEA 2J3HA 3L8ZA 3WLSA 5J5CA 1GG2A 1CUXA 2NPOA 1QAOA 1X92A 4DSAA 3CO5A 2QT0A 4UVGA 4O33A 1QHTA 1RJDA 3BE8A 1E1RA 4PEVA 5A9TA 3K6SA 1NH2D 1NXPA 1KSGA 4B3RB 2YMLA 3H75A 3DBHA 3UOWA 4WF9V 2ENWA 1IWPB 5REQA 4CDMA 1JQ5A 2NXNA 3E8XA 1CWUA 3QVWA 4QHTA 2WT4A 3R76A 5F1OA 2G3YA 4JJ7A 3OQHA 4G41A 2OOKA 2EVWX 1DAIA 5SYAA 4UPVA 4JIGA 3CXUA 3RVNA 4YI3A 3N6XA 4CMEA 1UMDA 1RKXA 5JYEA 2HBQA 1XRSB 3G6WA 4MVRA 1E9VA 3PPXA 2J6BA 2P22C 1ZN7A 3ABZA 3S1AB 3QSYA 3G2OA 4DR7O 3OQIB 2FZVA 2AHZA 2F90A 4N6GA 3A3YA 5L4NA 3TS1A 5CFRA 3IDOA 3WWEA 5E0KB 3BWYA 3E6AA 1ZXBA 1TO6A 1O2DA 4BTLA 1U3CA 1QHEA 4WNYA 1IU9A 3CBQA 1K3TA 1T8RA 1JDVA 1YCFA 4UMVA 5AOCA 2RBGA 2WA3A 4GGMX 4MAMA 4YXFA 1IULA 3DJYA 4RIEA 2B1JA 3ROKA 4ARUA 1V1MB 3VU1A 5ITZA 3N5CA 3R20A 5A1TA 2GBLA 1G17A 3CJQA 1GA1A 1YOBA 1YAJA 4OHMA 4QECA 2C9MA 1FVOA 3FNBA 4CF5A 4S1VA 4XLTA 1WZEA 2GUWA 2HRBA 3QTBA 3SX4A 1PSDA 3H1GA 2R5FA 1W19A 4DGQA 2BM8A 1VHWA 4K6FA 2FFRA 1IC6A 3DQQA 3UQZA 4TQGA 1VL2A 1IK4A 3ESRA 2VNAA 4NU0A 3W8NA 3OEHD 4YK7A 2VPZA 4IVRA 1M8JA 4O2LA 1NWHA 1U0SY 3BRWA 3MCTA 3DCYA 3AI2A 5LA6A 1QR9A 1F3LA 3EIEA 4PR3A 2ADFA 1AV6A 2GRAA 3JQ7B 4ROSA 1GCUA 4R83A 4DLBA 1VL8A 1FDVA 3K71B 1S2DA 1FL9A 2DJ5A 3KELA 4D45A 1C14A 4H33A 3R3UA 1B8VA 2FFJA 1GVNB 3KHSA 1T9BA 3FD8A 4FOTA 2RH4A 4OLBA 3IBCA 4EJMA 1HDCA 5M59B 3WZ2A 3HA7A 4DF3A 5CN0A 4KI7A 4LFAO 2BGKA 2W9XA 1TM5E 1CNFA 1ZD1A 4MW9A 4NQRA 1KY2A 2BAGA 4US2R 2OGZA 1AKVA 2MT9A 4FE7A 5DOZA 1ZABA 1ZUWA 3P94A 4E09A 1LFDB 1U8FO 2FFHA 3TZLA 4I1IA 1UX1A 1P29A 2ZSDA 4JQCA 5DYGA 1M6NA 3Q10A 3VX8A 2PS1A 2HJGA 2C96A 4XM0A 1N9KA 2JVIA 3HN7A 4TXHA 3Q9NA 1P0FA 3JSLA 4OJTA 3G71V 4JLVA 3FPBA 2WKRA 3W05A 1LLQA 4C0XA 1O9GA 2OXCA 1ZHOA 1PT8A 2EBHX 1TIPA 5DEOA 2AOUB 1ZQ9A 1NI4B 4C0WA 4GHWA 3FFQA 4UTNA 2JEOA 1SKYE 3LT0A 1H2SB 3AK1A 1WAMA 4RFLA 2YDYA 3SEFA 4AJHA 3SFZA 3FSJX 4LDQA 3M5WA 1DFIA 4XYBA 1E2LA 5H02A 1OLUB 3HR8A 4Y9UA 1ZL0A 4FS8A 1W29A 4G5YA 2E74B 2JKVA 3LSSA 3K09A 5H3CA 2GHTA 3I55V 1T2DA 3BCHA 3OM0A 4ER3A 2WZQA 5K1PA 1GP2A 3W3AD 3JAKA 1UQRA 2B83A 4HQ0A 2L19A 1CY4A 1AGYA 1YJ5A 1SGWA 5DHTA 4G1CA 2Z8YM 2YC4C 1FYXA 1N2CE 4ZO4A 1SKQA 1VL5A 3JWJA 3KTDA 5CD1A 1HQKA 4P6VF 4XM2A 3ZYCA 2B5UA 3RTEA 1P7GA 2ZJ6A 2I87A 3EMDA 1JR9A 2X3UA 1WZ2A 1SUDA 1JB1A 1SQBH 1H2HA 2QUBA 4IIVA 3FPKA 3LT5A 3JD3A 1NM5A 3DDOA 1ZR2A 1YXMA 1JRLA 4KXRA 4I99A 3RVYA 3NHYA 1YHQV 2OV3A 1J23A 1Z0SA 1GN3A 4GX2A 1C80A 1YR6A 2FEKA 2GUZA 3ZV6A 2DLCX 3O94A 3K3WA 3CYFA 5BR4A 2DPHA 4B6OA 1P3DA 1XWIA 1GGNA 1ZH6A 1XEQA 3FMFA 4XWKA 1RWVA 3T34A 1XCBA 5B1BB 3RGWS 1R9GA 3FUVA 3K5NA 1U81A 5CB6A 1YQ9A 1XN4A 1EIWA 1P3Y1 3BE6A 2B3TA 2IS6A 3TCUA 5FUXA 1ZD9A 3FLAA 1QYXA 2XNKA 2YW9A 2HA5A 3HXQA 4X93A 1CUZA 3WZLA 3UJCA 1Z37A 1KEWA 1XVVA 1BJTA 2TYSB 1AROP 2H0QA 4EI9A 2VBIA 2IYVA 1EX6A 3ESQA 1XRQA 2ZBVA 3S3TA 4LYEA 3PE4A 1AQUA 2W2LD 3IUPA 1GG9A 2XB4A 2V3WA 3LXXA 4FWIB 2A5JA 3OT1A 4ZAWA 2AFIB 3KQMA 1E9BA 4DCJA 4E6PA 2CJYA 3CZPA 3RRBA 5CT6A 4PGMA 4W5HA 1H1LA 2F7SA 4NE9A 2WNIA 1AMUA 3BEDA 1X7YA 1IXBA 1KEVA 4CU2A 1MV8A 1U3TA 3BFJA 1ZNWA 1WPQA 4MV0A 4DUPA 4FN5A 2J3EA 4IIGA 3CJHB 5BSFA 3AEUA 2GSMB 3C87A 4MJLA 3GPDG 3EZFA 5ESWA 2OVBA 1E58A 2N42A 2V7WA 1FW6A 1UX0A 1N6RA 3QRWA 2C4VA 3T5GA 3VR6A 4P4SA 2WFMA 3NATA 1KQFA 3CC4V 4TTJA 5HGXA 1Y8QB 3K96A 3B9RA 1NVGA 3W6PA 3GMSA 4PZEA 1CQPA 4JASA 2GFQA 4W7HA 3FOWA 2P9JA 1K3FA 4DK0A 3NQ41 3VR4H 1IG3A 3GX1A 4K0KB 4IKOA 4UM8B 2O06A 2QMZA 3QENA 4NYIR 5KVAA 2YDXA 2FZ5A 1KK0A 1BEZA 1B4DA 3P0IA 2RSLA 1NURA 3D7RA 4J6EA 3THOA 3AJ9A 2KYRA 3REGA 3RVLA 4P2GA 1UPTA 1PLLA 2FMFA 2ZBPA 5JNLA 1GUFA 2JH3A 3N74A 4C6SA 5BYKA 1USKA 4RKFA 3QKSA 3ZEDA 3OEWA 2FKNA 3B9QA 4CL8A 3JAWA 5ERYA 3PUHA 3C98A 1I2ZA 4MUFA 3SF0A 4G37A 5LZ5A 2Q8PA 2B92A 3DLBA 3VYRB 4RK0A 4IS3A 1KYYA 1E1CB 2FP3A 2ZRNA 3KWJA 4FX2A 2HFEC 3NTXA 1Y1SA 2BFBA 2QLJA 5IJXA 2GN9A 2GAIA 4YREA 1F0NA 3NHBA 2RK3A 3IOBA 1X2EA 4NSNA 4TQDA 3HZOA 4NCJA 3OO0A 1G98A 4C88A 4WK6A 3J81N 2ZULA 3OTQA 2GEFA 1ZD8A 3MS7A 4JR2A 2YQ4A 4MRVA 3V1KA 4BE9A 1ORVA 4MMXB 3ZTTA 5HCUA 4RZ3A 4CL0A 3FR8A 5BO5A 1ZJ6A 5K8CA 3DF9A 2J45A 3Q3IA 3LECA 5TIIA 3GNQA 3U3OA 2EIHA 3BABA 4NENA 1V3QE 2F3RA 2V5UA 3W2TA 3A2FA 4EUNA 4BAZA 1FU4A 4D02A 1SXJD 3L46A 1GG5A 4RHCA 1NW5A 3AF5A 3O4GA