1I94O

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
molecule tags Ribosome
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1i94O00
2LW7A 4JI6O 5BXZA 4OX9O 1FYJA 1NS1A 1FJGO 4DV0O 4JI4O 2UUBO 4B3SO 2VQEO 5IWAO 1HR0O 4B3MO 1N32O 1I94O 2HHHO 1YZBA 4JI8O 2UXDO 4LFCO 5H5NA 4LF4O 1A32A 4GKJO 1IBKO 4LFAO 4LF9O 4X65O 5LMUO 4JI1O 1IBMO 4DUYO 4YHHO 4JV5O 1FKAO 1F7YA 2ZKOA 1J5EO 1DK1A 1HNXO 1X59A 2UU9O 2Z0AA 2N74A 4AQYO 4DV3O 4DUZO 4DR7O 3R66A 4A5UB 5BR8O 1XNQO 3T1HO 1XMQO 2VQFO 1G1XB 4DR6O 1AB3A 2UXCO 2ZM6O 1XMOO 5A2QN 2UXBO 2DJVA 4DV6O 4LF5O 3O65A 1HNZO 5IT9N 1D2DA 3J7AU 3J81N 1R1BA 4DR3O 3SDLA 4YY3O 4GKKO 4LF7O 4DR2O 4X66O 4LF6O 1IBLO 5LL6Y 2UUAO 1HNWO 2FKXA 4X64O 5BY1A 4KHPO 4DV7O 4LFBO 1XNRO 2JRIA 4DR5O 1KUQA 2UUCO 1N34O 2AGAA 4JI3O 2DOSA 3JAMN 5FLXN 1N33O 1R6TA 3OTOO 4DV5O 4NXMO 5LMNO 4DV2O 4DR1O 4B3TO 3RT3C 4DR4O 2E5LO 4LF8O 4JYAO 4JI0O 1XEQA 4NXNO 4OPAA 3T1YO 4X62O 4JI5O 4JI7O 1AILA 4OPHA 4DV1O 3M8AA 4DV4O 3F5TA 4JI2O 3J80N 4K0KO 4B3RO 2F4VO 1N36O
chains in the Genus database with same CATH superfamily
2OWOA 2CGNA 4FPPA 3K5MA 3MDSA 2CTQA 1HDJA 4JYAB 2WSSG 1GAXA 1V55B 1YJ9V 5JWPA 2PYLA 2BSKB 3FB5C 5IJ0A 5BR8B 5B1AB 1YF2A 5DM6V 1FXVA 4MW3A 4FK5C 3T4DA 3SPCA 2PGGA 1F7YA 4TQFA 1COWG 1HNXO 3LDEA 2Y0PA 4DUZO 4B3SB 4TSFG 1BL8A 2CDYA 4N21A 4JI6B 3HKDB 4RQFA 3VBBA 5D5PA 5JCOA 5EC1C 3EXAA 4LH7A 2JEUA 3DC6A 3UKMA 3CXCU 1PL0A 2LFSA 2PUSA 2EBOA 1HNZO 2XAHA 1Q82W 3CD6V 2ADQB 1N0NA 4JI5B 1HW7A 2QE7G 3LNMB 4LF6O 2UUAO 4X89A 1NTZH 2M7WA 2Q8VA 4FLWA 1OCRC 1SQVH 1VF6A 3L70H 3QO7A 1OHHG 1B3QA 2FTKA 3JAMN 3E8HA 2RMKB 4NXMO 3LDDA 3ABKC 2EIJB 4ZBMA 2KG7A 2OTLV 3AG1B 4PJ0Z 1AP6A 5JQGB 1L0NH 4YY3B 2YI9A 3S3WA 2CTWA 5EIBC 2MW2B 1XEQA 1GM7A 4JTDB 1R6NA 1YIJV 1NR7A 3JASA 5H6QA 3T1YO 4YJ3A 1P4RA 4X1YB 3ZRWA 1SQXH 1BE3H 4UCTA 2R9RB 1HNZB 3G6EV 1ZL8A 2F4VB 3E89A 5JH7B 3D3QA 2QWQB 3B2EE 2ZIOA 2H3OA 4O4JA 3P30A 2UU9B 1NS1A 1VQ6V 1MG1A 2E75B 5KLVH 1FJGO 4JYBA 1YZBA 2YEVB 1A32A 4QJFB 4DUYB 2W0FC 4DW0A 1XNQB 3ASNC 1IZ3A 4I5SA 1QNMA 3ZN1A 4RUFA 3JALB 5EC2C 2QKCA 1K92A 4I7ZB 2Q7HA 1MZEA 4TOIA 4H13B 2QEXV 2Q9LA 3RYFB 4J9YB 1M56B 4I0XA 3T1HO 2ZXWC 5IJ0B 3U11A 2P90A 1HP8A 4DV4B 1S5HC 1ZUQA 2QM7A 5IYZA 5LXTA 3RYCA 1K7DA 3OEHG 1K34A 1ZLZA 4NYKA 3SYOA 1WPBA 3G80A 3W7XA 1URFA 1Q81W 4TUYB 4WFHA 5KMGA 1N34O 2RCVA 3CRQA 4FLTA 4TV8A 1K73W 4AHCA 4FM0A 2CGOA 3B8NA 1SA0A 4LWSA 4PDRA 4B7EA 2YIBD 5LGUA 5J2UA 4DR1B 2UXNA 1QVGU 1KC8W 1SF9A 5JJJB 2QGNA 1WP8A 4GUNA 1FXKC 4X88A 3I5DA 3TCUA 5JJEB 1VQOV 2HVKC 1KYOF 3JARA 3E86A 1GN4A 2LW7A 4JAAA 4OX9O 3JD0A 3HKEA 3A0BZ 3ASOC 2RN9A 3WU2Z 4PA7A 1SQFA 1M93A 1BCCH 4JASA 3CCSV 5CBGA 1G8MA 4LF4O 2F1MA 4MVMA 3U10A 1NR1A 5BMVA 2IU0A 2JJ1G 3HR0A 2IM9A 4IT5A 3WFVA 3H1LH 2HLDG 1OCZC 2UU9O 4I9QA 3QTCA 1FS0G 4DV5B 5IY5B 1NT2B 1V9PA 5IYBO 4O2BB 5CA3A 1W59A 2EZPA 2LP7A 3RYIA 2PYJA 1QBZA 3JD3A 3IJ4A 1NH2D 4IYIA 2UXXA 4DV6O 1VF7A 3OW2U 3IFXA 2HG5C 4DR3O 1VQNV 4LF7O 4ZKIA 2NNUA 1HNWO 1EN6A 2XT9A 2ZE8A 4FFBB 3CWBH 4FZ1A 3WB2A 3H1HH 2DOSA 3SPGA 1N33O 1RPOA 5EK0A 2L6LA 4RAIA 2HFEC 4HNAA 5EYPA 3LNNA 1AI4A 4PD4F 2LFRA 1KKDA 4LFAB 2F93B 1H38A 1KU9A 2UXDB 1WLEA 1Q6UA 2ZE5A 4R7CA 1K4CC 1WAZA 3Q4HB 4DV1O 2CH7B 1BGYH 4E4EA 1YI2V 1CEZA 3BY6A 4K0KO 2YXLA 1L8DA 1LNQA 3LDCA 2XTAA 2HJDA 2ZDIC 4AQYB 2EZOA 3QF7A 1DF4A 1N32O 1OZ0A 1Q8IA 2HJFC 3LSUA 1P7BA 4JF3A 4BIOA 2OYQA 1GM8A 2Y4UA 4X65O 1LR1A 2N05A 3K58A 1NTKH 3AK3A 4GKJB 2WPDG 4O2AB 3QO8A 5JQGA 1N4CA 2ETNA 1KKCA 1US6A 1QLEB 3ZMVA 4RWUA 4BIZA 3SYPA 1SZTA 2L35A 3TETA 1HNWB 2FMLA 2EULA 1K5SA 2KSDA 5LOVA 3JYCA 5H6RA 2CE4A 1GTOA 2V1DA 1MMMA 3K59A 4X64O 4BW5A 4KHPO 2IH3C 2JRIA 1GN3A 1Z5VA 3CC2V 1Y74A 1QR9A 4LC1A 1V55C 1XQ8A 4DO2A 3JALA 4YIPA 3CRCA 5KHJA 2GTAA 4J10A 2D2CB 3FYIB 3CYOA 1S77D 4F6EA 4K8XA 1AJNA 4GKKB 1THZA 3OE7G 4FLYA 2BSKA 4DV2B 1BHBA 1H2MA 1TVKA 3JD1A 3K03A 3C3TA 5L3FA 4EFBA 4LF5B 1QVFU 3ZJZA 4JI2O 2PZSA 2WLKA 1K4DC 1Q90D 3ZCCA 5F2VO 3ZHRA 2IW5A 4O4IB 3KCYA 2QJ1A 2NN4A 5GTIZ 1KP3A 3SJCC 5LMNB 1YITV 4JZ2A 4MTFA 4JI8O 2A3QA 5E79Z 1E1QG 3CE2A 4CH3A 4TV8B 3JAWB 1E1RG 3OMIB 4LF4B 1Z2GA 5KAFZ 2GSMB 1YEWA 4RO2A 4EB6A 1AP5A 1J5EO 5FNVA 2LGQA 2P22C 3CMAV 2Q67A 1FFXA 1RFYA 2EINB 2YC0A 2Q68A 2ZT9B 5B66Z 1MABG 1AJQA 2DQ3A 1EFRG 3RWRD 4BR6A 1XOUA 4DW1A 3BPZA 1AJPA 4ZOLA 5JVDB 2WLIB 4O2AA 3SDLA 3JATB 3X2QB 5E1AC 1LUWA 3OD4A 2IJIA 5CBFA 4H0LB 5BY1A 1VARA 4BWAA 1SQBH 4RUEA 1G6UA 1K3EA 3BA8A 3GVMA 4NR1A 4NVPA 2F23A 4FFKA 1D5NA 5BMVB 4GCZA 5EBLC 1GRJA 4DRXB 2Y69C 3D8CA 3AG4B 2QTSA 2Y0IA 4LF9B 3G71V 1NVPD 2NR5A 5L3DA 2Q5ZA 1K33A 3FX7A 4OPAA 3E8FA 1M5IA 3RVYA 4XDKA 1BQZA 3JAKB 2YXHA 1TUEB 2HEPA 4I50A 1SQQH 2HKOA 3HKCA 4PDVA 2R72A 2JDIG 1S72V 5B1AC 3D3IA 2ZM6B 4X1IB 4WF9V 3ZS8C 1AR4A 2EJ7A 3JCUZ 1N8RW 3RVZA 2Q69A 4FM1A 1NI8A 5EZYA 4I0XB 1VQMV 2DE0X 3L9DA 3ETGA 4ZHQA 1BT8A 3IC7A 1XHZA 4D7SA 2V4DA 3UO2A 3JD4A 4QE7A 1IBMB 4DR4B 5L3GA 3D36A 1OCOC 2A0LA 2CH7A 2NLJC 4HNAB 3AG3B 4DUYO 4TV9A 3ZRSA 1Y66A 4JV5O 3ZEDA 2ARHA 3X2QC 2IH1C 5GTHZ 3BFRA 4DK1A 1N36B 3CCLV 4FM2A 1PV0A 4DR7O 5J2TA 3F7VC 1P84F 5LHGA 2JJ2G 3JAWA 1VQ4V 4KFMA 2A79B 2IBZH 4P9OA 2QKSA 3CCVV 4TT3G 4UB8Z 2N04A 3CJHB 3LUTB 3TGUH 3C3SA 5J2UB 1M4UA 5FNVB 1GM9A 2AHYA 2BE3A 1WPXA 1GK9A 1PNMA 3A0RA 3K0DA 4KUMA 4P9PA 3NR7A 1H8EG 3MHHC 4JI8B 3GB7C 2LW1A 5CA1A 2QWRB 4DR1O 3HKEB 3RT3C 2RDCA 4JI0B 2C2AA 3K06A 4ZOLB 5JVDA 4K35A 4PA3A 4O4JB 1OCCB 2ZNIA 4PELA 3N2GB 4JI7B 3W7TA 1EBOA 1ZL8B 1FJGB 4MT8A 3ZRXA 1IXMA 1ZAUA 3RFRA 4U7OA 5IDJA 2X6BA 2Z5UA 2IJJA 1WNSA 2A7WA 3WB0A 3HKBA 1HR0O 2Z3YA 2VWJA 1NQTA 3G6BA 4W4LA 3PN1A 3BABA 2HHHO 1Q43A 3RYFA 5HFMA 3OT7A 3WG7B 3BAAA 5C93A 1DTOA 2LGWA 2F43G 2OIEA 3CRAA 3BHPA 3OUSA 2IJHA 1X59A 4JV5B 1Y76A 3N2KA 4UXNA 4EEQA 1YVWA 5DECA 3W7WA 5JCOC 1IBLB 5FPOA 5B1BC 4B3RB 3CPWU 4I55B 1KMIZ 4LH6A 3QVNA 1SQGA 3SYAA 2YUAA 4LF5O 3OMAB 2JK5C 3CCJV 3K04A 4YY3O 2PY5A 1DLBA 4UCOA 2X6AA 4O4IA 2ZE7A 2GUZB 1SQPH 1VQKV 3VQYA 3B4SA 3RYHA 4EB6B 1VP7A 4FZ0A 1YSCA 2E76B 1OV9A 4WBNA 4PA4A 4UVBA 4AILC 2EINC 1J5EB 4MTOA 1S3JA 2WA3A 3THOA 5FLXN 1QCEA 3OGCC 4X1KA 4O4LB 1QLNA 3ASNB 2Q4PA 2ITDC 2K9PA 2LO1A 2KKWA 3JARB 2UUAB 4IHJB 2W6JG 3ZMZA 5A9GA 4IYHA 3UCSC 4YJ2A 4K0KB 3E8GA 1JMKC 1SC5B 1PD3A 2YIAA 4X66B 3JSNA 2X6CA 5B1NA 2IU3A 4O4HB 1GN2A 2QWPB 4DV6B 5EBMC 4JI2B 3H1IH 1W0KG 4U3JA 5KUKA 2OCCC 4DRXA 1F4MA 5KX5B 5LA6B 4JAUA 4B3MO 5K1XA 2QM4A 2UXBB 2Q0OC 4LFCO 4WFFA 4QIWF 3K9AA 4U7NA 5LMUO 4HZ3A 3VOUA 4DUZB 1U97A 3RN4A 2EX3A 4K8ZA 2ODMA 3FYEB 5LYJA 5ITZA 2ATKC 3T1CA 2P7TC 1VQ9V 2EIMB 4AQYO 4J41A 4FFBA 1WA8A 2B9ZA 5BR8O 3CCQV 1OJHA 3IC9A 1G1XB 4IGGA 1NBMG 3CP1A 4LR3A 3AG2B 1O9GA 1OCRB 1XMQB 2DYSC 1AR1B 5KUMA 2LQTA 3FD9A 2CK3G 3TXSA 1JOYA 4UVCA 1XNRO 4DR5O 4KXRA 2XNDG 3ZHSA 1I0HA 1IVSA 1EZVH 4NKGB 5LBQA 4HAMA 5IJ9A 4DV5O 4BAYA 4GT1A 4QGPA 4TV9B 4BW9A 4LNUB 3CRRA 1RPRA 3OUFA 2ZR3A 1GMGA 4LF8O 5KHKA 4X9QA 2PF4E 4MVRA 3Q4HA 4N23A 2XAFA 2WLLA 4F6RA 1IDSA 5J2TB 3H1KH 1VF6C 1K97A 5KHIA 3SPIA 3M8AA 3LSSA 5BZBA 1H2KA 4LFBB 2VWKA 1GN6A 3MHSC 3CSXA 1FYJA 3KZIZ 4DV0O 3MAQA 4YJ2B 2PTMA 4JI4O 4UFZA 1VMGA 1NKDA 3ETEA 2AW9A 2UXDO 2F66C 1Z5WA 3RGBA 4JYYA 3JATA 5LGNA 1IBMO 5KHHA 3CCUV 3CCEV 4FLUA 3ABMC 4YHHO 3R65A 5LOVB 3K0GA 2KB1A 4MW8A 5LA6A 2N74A 3ZN0A 1VEWA 1H8HG 1YDXA 4TWKA 4F4LA 3N2GA 4OX9B 3ZRWB 5HFLA 1L0LH 1XMQO 1SZXA 1AB3A 2BTQB 4IIJA 5LP6B 2DN9A 4CC5A 4NTYA 4DV3B 1NJIW 2DYRC 3RW0A 1Q3EA 1DF5A 4NB5A 3JD2A 3O9OA 4GX0A 2FYUH 2VQFB 2EIMC 4J9ZB 1KBHA 1H2NA 3SJBC 1J95A 1SKVA 1VQ8V 1WA8B 2CTRA 3L74H 4X1IA 4JPRA 1Q5OA 3OTOO 2ZE6A 1YTFD 3SYQA 1RM1C 4UUJC 4LCUC 3OTOB 1AVMA 3GWKC 2YXYA 5EZYB 1PNKA 1JFFB 2WAMA 4NXNO 1OCCC 1O9HA 1S5LZ 3HKDA 3STLC 3RYHB 4H44B 4EKWA 5CMUA 1UPGA 3H9VA 1KECA 1V54C 4DXWA 4DV4O 1PM9A 3F5TA 4WFBV 3OFNG 3QG5A 2DMXA 2BOCC 4J7KA 4LNUA 4O4LA 1I5XA 3GWOA 2ZDIA 3A2FA 2JS5A 4B3SO 1UJWB 3K08A 3SYCA 1TA8A 2GHYA 1R3KC 2WLLB 3E2EA 5H5NA 2UXCB 3OM3B 4KL1A 2WLHA 2ZQMA 4LFAO 2H94A 2DQ0A 1CPYA 2JEXA 3MD0A 1ORQC 3LSQA 1FXHA 1OCZB 4PV1B 2YICA 3T2MA 2KG7B 2XOKG 1UFIA 3RBZA 3BVOA 5IE9A 3E22A 2QSAA 2QA4V 3K5LA 4LWSB 2HVJC 2AZ2A 2BTOA 2Q73A 3BEHA 3APOA 4UV8A 3VQWA 2O57A 1YHQV 3A0HZ 1F4NA 2ZM6O 3BA9A 3ABMB 3ICXA 1G4YB 4JTCB 3DXRA 1WP7A 4GX2A 3H01A 5KA5A 4YHHB 4NXNB 5KX5A 1NVPB 3AG1C 3JCZA 4FMTA 4LBEC 4DR7B 3ZHVA 1K9MW 3W7UA 2XHBA 5GONA 1QHTA 2DWEC 4AI8A 3CHXA 1TUBA 2ZR2A 4B3TO 1FXKA 1GH6A 1BSMA 2Q6AA 4QNHB 1QQCA 1QLEC 2CAZC 3I55V 2OCCB 4E2LA 3AK1A 3ETQA 4HYOA 4JI0O 3ZRVA 4ABMA 5CA0A 5DEDA 1VF5B 3W7SA 4OPHA 3SR2C 1FPOA 2VQEB 4I50B 3J80N 3OMNB 4MSWC 1N36O 1M9NA 3CRMA 4JZGA 3N2KB 2QTOA 4Q6GA 3SPHA 1NU1H 3TJTA 5B3SB 1KD1W 1HNXB 1I7FA 5LHIA 3ABLC 3K79A 1IBKO 1M56C 1U96A 3H1JH 1P49A 3CCMV 2P6JA 2ZNJA 4GX1A 3P32A 3OEEG 1ENVA 3CC7V 3M7MX 2HP8A 4MVQA 2A06H 2OT5A 2EJRA 5C8YB 4WBNB 4DV0B 4FLXA 3HPLC 4CS2A 2ZCEA 1SESA 2K1EA 3P3PA 1AI6A 3ZIAG 4DR6B 2R70A 4X1KB 2QWOB 1VIBA 4KHPB 3CB2A 2UXCO 4UCVA 2WLNA 2QR4A 3CJHA 3OGIB 2GDSA 5JJNB 5DN6G 1D2DA 3F7YC 3J7AU 5CBHA 2EIKB 3J81N 4DR2O 3T1HB 1JPXA 1FD9A 1AI5A 4UB6Z 4CBCA 1JQ0A 4JYCA 1M57C 1V54B 4DV7O 3TK1A 2R9IA 2XAQA 1XDCA 5CA1B 5LGTA 2Q7EA 4YIOA 4PA9A 3T4ZA 3K5NA 1R6TA 4CS4A 1GO3F 2DWDC 3STZC 3HB3B 4WFEA 4I4TB 5IYDO 5KHGA 1PL4A 4QPKA 3TXQA 4JTAB 2RQ6A 1XUQA 5B5EZ 4X64B 5CN0A 5LMUB 3OR7C 2EIKC 4X65B 2YS8A 4X62O 1XREA 3VQXA 3ZHUA 2JGDB 4B3MB 3ABUA 2QM8A 3ZMUA 2UUBB 1WB8A 2JVDA 2YI8A 2F4VO 1FXKB 4FLVA 1BQ0A 4R6ZA 3PJSK 3DGEA 2M6YA 4PA6A 2A9HA 2E3CA 5CA0B 3UT5A 4WCEV 4J7JA 2PI5A 3E8BA 1AI7A 3D36C 1Y74B 1VQLV 1EN4A 2P67A 2P4KA 4CH6A 1I94B 5EYPB 2OCHA 4LF7B 2XUMA 1Y76B 4X8AA 1YCIA 1DK1A 1W2BU 3A8TA 2WWWA 1BZKA 1L1FA 1H2SB 4QPJA 5IJ9B 1PPJH 3CX5F 2GBOA 4DR6O 1XL4A 2BOBC 2XASA 1D5AA 4D6TH 1JJOA 4PI0A 1JCHA 4NTXA 3QO5A 2D3OW 4X20B 4FVMA 5C8YA 1Q6HA 5J9PC 2ZD9A 1NH2B 3IGAC 1MSWD 1KUQA 4I9WA 3AG7A 2RNBA 1PP9H 1XNRB 4DV2O 2ZXWB 3FAVA 4LP8A 2JIZG 3CEIA 3UO3A 1S5JA 4IHJA 1PNLA 4X1YA 4UCUA 4JYAO 5AG2A 2XAGA 1ZSPA 4O4HA 4MVSA 4MTGA 4P2ZA 1KP2A 2YIBA 2CTPA 2Y48A 3BRCA 2YIDA 4UV9A 4ZI7A 5JH7A 4DV1B 1SETA 3FFQA 2VQEO 4PDLA 5LP6C 1I94O 3K9SA 1MOFA 3JASB 4YJ3B 4Q20A 1I5YA 3FB7C 4PHZA 3WG7C 2JGDA 4OGQB 3CMEV 2W0XA 4JI1O 2GTSA 1IURA 2G38A 4IL6Z 2DYSB 5IY5C 4L87A 1R73A 2X7RB 1EN5A 5L3EA 3UT5B 3JAKA 3R66A 3F5WC 3CCRV 2AXTZ 4DR2B 3HKCB 5A2QN 2UXBO 5GW7A 1TGOA 4GLXA 1S76D 4ASUG 4MTXA 1ZX3A 1R1BA 3KG2A 1R3JC 4DK0A 1JFFA 3SPJA 1IBLO 5FPRA 5H2FZ 4MVZA 2F95B 4FIPC 1Y4MA 3OTFA 3B40A 4RQEA 3ETDA 1PKXA 4GZRB 2ITCC 1R3LC 2YDEA 4B7KA 4EFEA 3M99B 1MA1A 4CS3A 3RYCB 3ABKB 1N34B 5CB4B 3AG3C 4G27B 2B1GA 4QE9A 4X20A 3ABTA 2P06A 3DC5A 4NTWA 1QR8A 1WN7A 1TAEA 3UM7A 1N33B 4JI5O 1H2GA 1AILA 4CZZA 3OR6C 2ZINA 3OAAG 2MK3A 5L3BA 4DV7B 3ASOB 1K5QA 1RP3B 1SA0B 5BXZA 4R50A 3S3XA 3AG2C 4ICGA 1SERA 1EZJA 1EM1A 3L75H 1GKFA 2Y69B 3L71H 3ZX6A 3AEIA 4CC6A 3UQ8A 1ROPA 3C90A 5LHHA 1FFTB 1IX9A 1X4TA 3K3WA 4I4TA 2LJ2A 1RSOA 3AG4C 1Q6IA 2YSUB 3APQA 3CXHF 1Q7YW 2Z0AA 4DV3O 2FB5A 2FL4A 4O2BA 2VRZA 4R8CA 1T5EA 1I08A 3RYIB 2CUGA 1VQ5V 4B08A 1F23A 5B1OA 3EHBB 4CH5A 4FJCC 1IXBA 3B8MA 4H33A 4B3TB 2KQXA 4J42A 5H9CA 2XAJA 4ZHQB 1WJZA 4UCRA 2EIJC 4JI3O 4W4KA 4JAVA 4MS2A 3ZBHA 5LMNO 4CH4A 4G28B 1Y67A 1KQSU 3WB1A 2P5OA 1P7GA 1AROP 2WLMA 1VQ7V 4XBFA 1AR5A 1N0JA 1CP9A 1JR9A 2QKAA 1ZWIC 4LF8B 3K5OA 1XL6A 4JI6O 3ZHTA 1H2LA 2GUZA 4PDMA 1K8AW 2AZ0A 1WB7A 3T1YB 1R3IC 3SGIA 1JX9A 3ZMTA 1JVMA 4C7UA 1BMFG 4LF9O 4HBNA 3ZHQA 3JSLA 3E22B 3VQVA 1KB9F 3FAVB 3EFFK 1RM1B 2E5LB 3DXRB 4YXWG 5K1PA 2ZKOA 4JI3B 4J80A 3ZMSA 4BIUA 1R6KA 2VS0A 1XMOB 3FKSG 5FL7G 3G67A 4A5UB 3DTUB 1XILA 2Q0AA 3CC4V 1XNQO 2B5UA 5GONB 5B1BB 4P30A 3L72H 2E74B 4ZI7B 1JJ2U 1SRYA 1MZFA 4Z1VA 1CXZB 2WLJA 1F51A 4X66O 1BS3A 1FAFA 3HKBB 2FKXA 3DSQA 2P4VA 4L8JA 1YTFB 2YEVA 2HR3A 1TUBB 4Z2WA 3G4SV 2IJKA 3N27A 2EILC 2R9AA 2W6IG 5KAIZ 4MVOA 5EIBD 4DR4O 1HWYA 1Q86W 3NXSA 4MVUA 1XI1A 5ITZB 4WFAV 1B04A 1JA8A 3SJAC 4DR3B 5D5QA 1DGSA 3I56V 4JI4B 2WA4A 4Z1MG 1TVKB 4I55A 4XDJA 2OTJV 1LUVA 4H37A 2GV9A 2RJZA 5LXTB 1B6QA 4LF6B 1NTMH 1YJNV 4G2KA 3SJQC 3QNEA 2V7QG 4GYCB 3ML0A 2UUBO 4WFGA 2DW4A 2H8PC 3L73H 4D7TA 5IWAO 1S0VA 4PI2A 4TQDA 1NZ6A 4GKJO 2ILMA 5IYZB 2B1IA 3BCCH 4XDLA 1M90W 4NXMB 5CB4A 4LFCB 1FKAO 2ZIMA 1XHXA 1N32B 4UCSA 3E83A 2HHHB 4J7ZA 4TUYA 5KMGB 1B06A 2BCCH 1M57B 4JI1B 2QWNB 4K3AA 4F6RB 3ABLB 2OIGA 4J11A 4UVAA 2QDOA 1FFXB 2VQFO 3K57A 3KCXA 1XMOO 3AK2A 3IAYA 4KP4A 4GX5A 2DJVA 3U0ZA 1Y6XA 3O65A 5IT9N 3FB6C 4U3JB 4FLZA 1QU7A 4GKKO 4X62B 2PI4A 4ZIBA 4JGSA 5L3CA 5LL6Y 1BHAA 2WLIA 3CS5A 4OXSA 2JGUA 4LFBO 1YJWV 2UUCO 3P3NA 2AGAA 1W0JG 2Y4TA 3B09A 2DYRB 5IYCO 1MSDA 1OCOB 2UUCB 1ZTEA 5EBWC 1SS3A 1HR0B 4U3FH 1M1KW 1RSOB 2Q7GA 5B3SC 3EVKA 1E79G 2AHZA 3E35A 2E5LO 2ADPA 5LYJB 1MNGA 3FB8C 1YXBA 3KKYA 4DYLA 1IBKB 1XBLA 5IWAB 1VQPV 2JS3A 4JI7O 2EILB 2BTQA 4IIJB 5LP6A 4DR5B 5TISZ 3B77A 4B3RO 5KA6A 2X0LA
chains in the Genus database with same CATH topology
2LW7A 4JI6O 5BXZA 4OX9O 1FYJA 1NS1A 1FJGO 4DV0O 4JI4O 2UUBO 4B3SO 2VQEO 5IWAO 1HR0O 4B3MO 1N32O 1I94O 2HHHO 1YZBA 4JI8O 2UXDO 4LFCO 5H5NA 4LF4O 1A32A 4GKJO 1IBKO 4LFAO 4LF9O 4X65O 5LMUO 4JI1O 1IBMO 4DUYO 4YHHO 4JV5O 1FKAO 1F7YA 2ZKOA 1J5EO 1DK1A 1HNXO 1X59A 2UU9O 2Z0AA 2N74A 4AQYO 4DV3O 4DUZO 4DR7O 3R66A 4A5UB 5BR8O 1XNQO 3T1HO 1XMQO 2VQFO 1G1XB 4DR6O 1AB3A 2UXCO 2ZM6O 1XMOO 5A2QN 2UXBO 2DJVA 4DV6O 4LF5O 3O65A 1HNZO 5IT9N 1D2DA 3J7AU 3J81N 1R1BA 4DR3O 3SDLA 4YY3O 4GKKO 4LF7O 4DR2O 4X66O 4LF6O 1IBLO 5LL6Y 2UUAO 1HNWO 2FKXA 4X64O 5BY1A 4KHPO 4DV7O 4LFBO 1XNRO 2JRIA 4DR5O 1KUQA 2UUCO 1N34O 2AGAA 4JI3O 2DOSA 3JAMN 5FLXN 1N33O 1R6TA 3OTOO 4DV5O 4NXMO 5LMNO 4DV2O 4DR1O 4B3TO 3RT3C 4DR4O 2E5LO 4LF8O 4JYAO 4JI0O 1XEQA 4NXNO 4OPAA 3T1YO 4X62O 4JI5O 4JI7O 1AILA 4OPHA 4DV1O 3M8AA 4DV4O 3F5TA 4JI2O 3J80N 4K0KO 4B3RO 2F4VO 1N36O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW7 A;  4JI6 O;  5BXZ A;  4OX9 O;  1FYJ A;  1NS1 A;  1FJG O;  4DV0 O;  4JI4 O;  2UUB O;  4B3S O;  2VQE O;  5IWA O;  1HR0 O;  4B3M O;  1N32 O;  1I94 O;  2HHH O;  1YZB A;  4JI8 O;  2UXD O;  4LFC O;  5H5N A;  4LF4 O;  1A32 A;  4GKJ O;  1IBK O;  4LFA O;  4LF9 O;  4X65 O;  5LMU O;  4JI1 O;  1IBM O;  4DUY O;  4YHH O;  4JV5 O;  1FKA O;  1F7Y A;  2ZKO A;  1J5E O;  1DK1 A;  1HNX O;  1X59 A;  2UU9 O;  2Z0A A;  2N74 A;  4AQY O;  4DV3 O;  4DUZ O;  4DR7 O;  3R66 A;  4A5U B;  5BR8 O;  1XNQ O;  3T1H O;  1XMQ O;  2VQF O;  1G1X B;  4DR6 O;  1AB3 A;  2UXC O;  2ZM6 O;  1XMO O;  5A2Q N;  2UXB O;  2DJV A;  4DV6 O;  4LF5 O;  3O65 A;  1HNZ O;  5IT9 N;  1D2D A;  3J7A U;  3J81 N;  1R1B A;  4DR3 O;  3SDL A;  4YY3 O;  4GKK O;  4LF7 O;  4DR2 O;  4X66 O;  4LF6 O;  1IBL O;  5LL6 Y;  2UUA O;  1HNW O;  2FKX A;  4X64 O;  5BY1 A;  4KHP O;  4DV7 O;  4LFB O;  1XNR O;  2JRI A;  4DR5 O;  1KUQ A;  2UUC O;  1N34 O;  2AGA A;  4JI3 O;  2DOS A;  3JAM N;  5FLX N;  1N33 O;  1R6T A;  3OTO O;  4DV5 O;  4NXM O;  5LMN O;  4DV2 O;  4DR1 O;  4B3T O;  3RT3 C;  4DR4 O;  2E5L O;  4LF8 O;  4JYA O;  4JI0 O;  1XEQ A;  4NXN O;  4OPA A;  3T1Y O;  4X62 O;  4JI5 O;  4JI7 O;  1AIL A;  4OPH A;  4DV1 O;  3M8A A;  4DV4 O;  3F5T A;  4JI2 O;  3J80 N;  4K0K O;  4B3R O;  2F4V O;  1N36 O; 
#chains in the Genus database with same CATH topology
 2OWO A;  2CGN A;  4FPP A;  3K5M A;  3MDS A;  2CTQ A;  1HDJ A;  4JYA B;  2WSS G;  1GAX A;  1V55 B;  1YJ9 V;  5JWP A;  2PYL A;  2BSK B;  3FB5 C;  5IJ0 A;  5BR8 B;  5B1A B;  1YF2 A;  5DM6 V;  1FXV A;  4MW3 A;  4FK5 C;  3T4D A;  3SPC A;  2PGG A;  1F7Y A;  4TQF A;  1COW G;  1HNX O;  3LDE A;  2Y0P A;  4DUZ O;  4B3S B;  4TSF G;  1BL8 A;  2CDY A;  4N21 A;  4JI6 B;  3HKD B;  4RQF A;  3VBB A;  5D5P A;  5JCO A;  5EC1 C;  3EXA A;  4LH7 A;  2JEU A;  3DC6 A;  3UKM A;  3CXC U;  1PL0 A;  2LFS A;  2PUS A;  2EBO A;  1HNZ O;  2XAH A;  1Q82 W;  3CD6 V;  2ADQ B;  1N0N A;  4JI5 B;  1HW7 A;  2QE7 G;  3LNM B;  4LF6 O;  2UUA O;  4X89 A;  1NTZ H;  2M7W A;  2Q8V A;  4FLW A;  1OCR C;  1SQV H;  1VF6 A;  3L70 H;  3QO7 A;  1OHH G;  1B3Q A;  2FTK A;  3JAM N;  3E8H A;  2RMK B;  4NXM O;  3LDD A;  3ABK C;  2EIJ B;  4ZBM A;  2KG7 A;  2OTL V;  3AG1 B;  4PJ0 Z;  1AP6 A;  5JQG B;  1L0N H;  4YY3 B;  2YI9 A;  3S3W A;  2CTW A;  5EIB C;  2MW2 B;  1XEQ A;  1GM7 A;  4JTD B;  1R6N A;  1YIJ V;  1NR7 A;  3JAS A;  5H6Q A;  3T1Y O;  4YJ3 A;  1P4R A;  4X1Y B;  3ZRW A;  1SQX H;  1BE3 H;  4UCT A;  2R9R B;  1HNZ B;  3G6E V;  1ZL8 A;  2F4V B;  3E89 A;  5JH7 B;  3D3Q A;  2QWQ B;  3B2E E;  2ZIO A;  2H3O A;  4O4J A;  3P30 A;  2UU9 B;  1NS1 A;  1VQ6 V;  1MG1 A;  2E75 B;  5KLV H;  1FJG O;  4JYB A;  1YZB A;  2YEV B;  1A32 A;  4QJF B;  4DUY B;  2W0F C;  4DW0 A;  1XNQ B;  3ASN C;  1IZ3 A;  4I5S A;  1QNM A;  3ZN1 A;  4RUF A;  3JAL B;  5EC2 C;  2QKC A;  1K92 A;  4I7Z B;  2Q7H A;  1MZE A;  4TOI A;  4H13 B;  2QEX V;  2Q9L A;  3RYF B;  4J9Y B;  1M56 B;  4I0X A;  3T1H O;  2ZXW C;  5IJ0 B;  3U11 A;  2P90 A;  1HP8 A;  4DV4 B;  1S5H C;  1ZUQ A;  2QM7 A;  5IYZ A;  5LXT A;  3RYC A;  1K7D A;  3OEH G;  1K34 A;  1ZLZ A;  4NYK A;  3SYO A;  1WPB A;  3G80 A;  3W7X A;  1URF A;  1Q81 W;  4TUY B;  4WFH A;  5KMG A;  1N34 O;  2RCV A;  3CRQ A;  4FLT A;  4TV8 A;  1K73 W;  4AHC A;  4FM0 A;  2CGO A;  3B8N A;  1SA0 A;  4LWS A;  4PDR A;  4B7E A;  2YIB D;  5LGU A;  5J2U A;  4DR1 B;  2UXN A;  1QVG U;  1KC8 W;  1SF9 A;  5JJJ B;  2QGN A;  1WP8 A;  4GUN A;  1FXK C;  4X88 A;  3I5D A;  3TCU A;  5JJE B;  1VQO V;  2HVK C;  1KYO F;  3JAR A;  3E86 A;  1GN4 A;  2LW7 A;  4JAA A;  4OX9 O;  3JD0 A;  3HKE A;  3A0B Z;  3ASO C;  2RN9 A;  3WU2 Z;  4PA7 A;  1SQF A;  1M93 A;  1BCC H;  4JAS A;  3CCS V;  5CBG A;  1G8M A;  4LF4 O;  2F1M A;  4MVM A;  3U10 A;  1NR1 A;  5BMV A;  2IU0 A;  2JJ1 G;  3HR0 A;  2IM9 A;  4IT5 A;  3WFV A;  3H1L H;  2HLD G;  1OCZ C;  2UU9 O;  4I9Q A;  3QTC A;  1FS0 G;  4DV5 B;  5IY5 B;  1NT2 B;  1V9P A;  5IYB O;  4O2B B;  5CA3 A;  1W59 A;  2EZP A;  2LP7 A;  3RYI A;  2PYJ A;  1QBZ A;  3JD3 A;  3IJ4 A;  1NH2 D;  4IYI A;  2UXX A;  4DV6 O;  1VF7 A;  3OW2 U;  3IFX A;  2HG5 C;  4DR3 O;  1VQN V;  4LF7 O;  4ZKI A;  2NNU A;  1HNW O;  1EN6 A;  2XT9 A;  2ZE8 A;  4FFB B;  3CWB H;  4FZ1 A;  3WB2 A;  3H1H H;  2DOS A;  3SPG A;  1N33 O;  1RPO A;  5EK0 A;  2L6L A;  4RAI A;  2HFE C;  4HNA A;  5EYP A;  3LNN A;  1AI4 A;  4PD4 F;  2LFR A;  1KKD A;  4LFA B;  2F93 B;  1H38 A;  1KU9 A;  2UXD B;  1WLE A;  1Q6U A;  2ZE5 A;  4R7C A;  1K4C C;  1WAZ A;  3Q4H B;  4DV1 O;  2CH7 B;  1BGY H;  4E4E A;  1YI2 V;  1CEZ A;  3BY6 A;  4K0K O;  2YXL A;  1L8D A;  1LNQ A;  3LDC A;  2XTA A;  2HJD A;  2ZDI C;  4AQY B;  2EZO A;  3QF7 A;  1DF4 A;  1N32 O;  1OZ0 A;  1Q8I A;  2HJF C;  3LSU A;  1P7B A;  4JF3 A;  4BIO A;  2OYQ A;  1GM8 A;  2Y4U A;  4X65 O;  1LR1 A;  2N05 A;  3K58 A;  1NTK H;  3AK3 A;  4GKJ B;  2WPD G;  4O2A B;  3QO8 A;  5JQG A;  1N4C A;  2ETN A;  1KKC A;  1US6 A;  1QLE B;  3ZMV A;  4RWU A;  4BIZ A;  3SYP A;  1SZT A;  2L35 A;  3TET A;  1HNW B;  2FML A;  2EUL A;  1K5S A;  2KSD A;  5LOV A;  3JYC A;  5H6R A;  2CE4 A;  1GTO A;  2V1D A;  1MMM A;  3K59 A;  4X64 O;  4BW5 A;  4KHP O;  2IH3 C;  2JRI A;  1GN3 A;  1Z5V A;  3CC2 V;  1Y74 A;  1QR9 A;  4LC1 A;  1V55 C;  1XQ8 A;  4DO2 A;  3JAL A;  4YIP A;  3CRC A;  5KHJ A;  2GTA A;  4J10 A;  2D2C B;  3FYI B;  3CYO A;  1S77 D;  4F6E A;  4K8X A;  1AJN A;  4GKK B;  1THZ A;  3OE7 G;  4FLY A;  2BSK A;  4DV2 B;  1BHB A;  1H2M A;  1TVK A;  3JD1 A;  3K03 A;  3C3T A;  5L3F A;  4EFB A;  4LF5 B;  1QVF U;  3ZJZ A;  4JI2 O;  2PZS A;  2WLK A;  1K4D C;  1Q90 D;  3ZCC A;  5F2V O;  3ZHR A;  2IW5 A;  4O4I B;  3KCY A;  2QJ1 A;  2NN4 A;  5GTI Z;  1KP3 A;  3SJC C;  5LMN B;  1YIT V;  4JZ2 A;  4MTF A;  4JI8 O;  2A3Q A;  5E79 Z;  1E1Q G;  3CE2 A;  4CH3 A;  4TV8 B;  3JAW B;  1E1R G;  3OMI B;  4LF4 B;  1Z2G A;  5KAF Z;  2GSM B;  1YEW A;  4RO2 A;  4EB6 A;  1AP5 A;  1J5E O;  5FNV A;  2LGQ A;  2P22 C;  3CMA V;  2Q67 A;  1FFX A;  1RFY A;  2EIN B;  2YC0 A;  2Q68 A;  2ZT9 B;  5B66 Z;  1MAB G;  1AJQ A;  2DQ3 A;  1EFR G;  3RWR D;  4BR6 A;  1XOU A;  4DW1 A;  3BPZ A;  1AJP A;  4ZOL A;  5JVD B;  2WLI B;  4O2A A;  3SDL A;  3JAT B;  3X2Q B;  5E1A C;  1LUW A;  3OD4 A;  2IJI A;  5CBF A;  4H0L B;  5BY1 A;  1VAR A;  4BWA A;  1SQB H;  4RUE A;  1G6U A;  1K3E A;  3BA8 A;  3GVM A;  4NR1 A;  4NVP A;  2F23 A;  4FFK A;  1D5N A;  5BMV B;  4GCZ A;  5EBL C;  1GRJ A;  4DRX B;  2Y69 C;  3D8C A;  3AG4 B;  2QTS A;  2Y0I A;  4LF9 B;  3G71 V;  1NVP D;  2NR5 A;  5L3D A;  2Q5Z A;  1K33 A;  3FX7 A;  4OPA A;  3E8F A;  1M5I A;  3RVY A;  4XDK A;  1BQZ A;  3JAK B;  2YXH A;  1TUE B;  2HEP A;  4I50 A;  1SQQ H;  2HKO A;  3HKC A;  4PDV A;  2R72 A;  2JDI G;  1S72 V;  5B1A C;  3D3I A;  2ZM6 B;  4X1I B;  4WF9 V;  3ZS8 C;  1AR4 A;  2EJ7 A;  3JCU Z;  1N8R W;  3RVZ A;  2Q69 A;  4FM1 A;  1NI8 A;  5EZY A;  4I0X B;  1VQM V;  2DE0 X;  3L9D A;  3ETG A;  4ZHQ A;  1BT8 A;  3IC7 A;  1XHZ A;  4D7S A;  2V4D A;  3UO2 A;  3JD4 A;  4QE7 A;  1IBM B;  4DR4 B;  5L3G A;  3D36 A;  1OCO C;  2A0L A;  2CH7 A;  2NLJ C;  4HNA B;  3AG3 B;  4DUY O;  4TV9 A;  3ZRS A;  1Y66 A;  4JV5 O;  3ZED A;  2ARH A;  3X2Q C;  2IH1 C;  5GTH Z;  3BFR A;  4DK1 A;  1N36 B;  3CCL V;  4FM2 A;  1PV0 A;  4DR7 O;  5J2T A;  3F7V C;  1P84 F;  5LHG A;  2JJ2 G;  3JAW A;  1VQ4 V;  4KFM A;  2A79 B;  2IBZ H;  4P9O A;  2QKS A;  3CCV V;  4TT3 G;  4UB8 Z;  2N04 A;  3CJH B;  3LUT B;  3TGU H;  3C3S A;  5J2U B;  1M4U A;  5FNV B;  1GM9 A;  2AHY A;  2BE3 A;  1WPX A;  1GK9 A;  1PNM A;  3A0R A;  3K0D A;  4KUM A;  4P9P A;  3NR7 A;  1H8E G;  3MHH C;  4JI8 B;  3GB7 C;  2LW1 A;  5CA1 A;  2QWR B;  4DR1 O;  3HKE B;  3RT3 C;  2RDC A;  4JI0 B;  2C2A A;  3K06 A;  4ZOL B;  5JVD A;  4K35 A;  4PA3 A;  4O4J B;  1OCC B;  2ZNI A;  4PEL A;  3N2G B;  4JI7 B;  3W7T A;  1EBO A;  1ZL8 B;  1FJG B;  4MT8 A;  3ZRX A;  1IXM A;  1ZAU A;  3RFR A;  4U7O A;  5IDJ A;  2X6B A;  2Z5U A;  2IJJ A;  1WNS A;  2A7W A;  3WB0 A;  3HKB A;  1HR0 O;  2Z3Y A;  2VWJ A;  1NQT A;  3G6B A;  4W4L A;  3PN1 A;  3BAB A;  2HHH O;  1Q43 A;  3RYF A;  5HFM A;  3OT7 A;  3WG7 B;  3BAA A;  5C93 A;  1DTO A;  2LGW A;  2F43 G;  2OIE A;  3CRA A;  3BHP A;  3OUS A;  2IJH A;  1X59 A;  4JV5 B;  1Y76 A;  3N2K A;  4UXN A;  4EEQ A;  1YVW A;  5DEC A;  3W7W A;  5JCO C;  1IBL B;  5FPO A;  5B1B C;  4B3R B;  3CPW U;  4I55 B;  1KMI Z;  4LH6 A;  3QVN A;  1SQG A;  3SYA A;  2YUA A;  4LF5 O;  3OMA B;  2JK5 C;  3CCJ V;  3K04 A;  4YY3 O;  2PY5 A;  1DLB A;  4UCO A;  2X6A A;  4O4I A;  2ZE7 A;  2GUZ B;  1SQP H;  1VQK V;  3VQY A;  3B4S A;  3RYH A;  4EB6 B;  1VP7 A;  4FZ0 A;  1YSC A;  2E76 B;  1OV9 A;  4WBN A;  4PA4 A;  4UVB A;  4AIL C;  2EIN C;  1J5E B;  4MTO A;  1S3J A;  2WA3 A;  3THO A;  5FLX N;  1QCE A;  3OGC C;  4X1K A;  4O4L B;  1QLN A;  3ASN B;  2Q4P A;  2ITD C;  2K9P A;  2LO1 A;  2KKW A;  3JAR B;  2UUA B;  4IHJ B;  2W6J G;  3ZMZ A;  5A9G A;  4IYH A;  3UCS C;  4YJ2 A;  4K0K B;  3E8G A;  1JMK C;  1SC5 B;  1PD3 A;  2YIA A;  4X66 B;  3JSN A;  2X6C A;  5B1N A;  2IU3 A;  4O4H B;  1GN2 A;  2QWP B;  4DV6 B;  5EBM C;  4JI2 B;  3H1I H;  1W0K G;  4U3J A;  5KUK A;  2OCC C;  4DRX A;  1F4M A;  5KX5 B;  5LA6 B;  4JAU A;  4B3M O;  5K1X A;  2QM4 A;  2UXB B;  2Q0O C;  4LFC O;  4WFF A;  4QIW F;  3K9A A;  4U7N A;  5LMU O;  4HZ3 A;  3VOU A;  4DUZ B;  1U97 A;  3RN4 A;  2EX3 A;  4K8Z A;  2ODM A;  3FYE B;  5LYJ A;  5ITZ A;  2ATK C;  3T1C A;  2P7T C;  1VQ9 V;  2EIM B;  4AQY O;  4J41 A;  4FFB A;  1WA8 A;  2B9Z A;  5BR8 O;  3CCQ V;  1OJH A;  3IC9 A;  1G1X B;  4IGG A;  1NBM G;  3CP1 A;  4LR3 A;  3AG2 B;  1O9G A;  1OCR B;  1XMQ B;  2DYS C;  1AR1 B;  5KUM A;  2LQT A;  3FD9 A;  2CK3 G;  3TXS A;  1JOY A;  4UVC A;  1XNR O;  4DR5 O;  4KXR A;  2XND G;  3ZHS A;  1I0H A;  1IVS A;  1EZV H;  4NKG B;  5LBQ A;  4HAM A;  5IJ9 A;  4DV5 O;  4BAY A;  4GT1 A;  4QGP A;  4TV9 B;  4BW9 A;  4LNU B;  3CRR A;  1RPR A;  3OUF A;  2ZR3 A;  1GMG A;  4LF8 O;  5KHK A;  4X9Q A;  2PF4 E;  4MVR A;  3Q4H A;  4N23 A;  2XAF A;  2WLL A;  4F6R A;  1IDS A;  5J2T B;  3H1K H;  1VF6 C;  1K97 A;  5KHI A;  3SPI A;  3M8A A;  3LSS A;  5BZB A;  1H2K A;  4LFB B;  2VWK A;  1GN6 A;  3MHS C;  3CSX A;  1FYJ A;  3KZI Z;  4DV0 O;  3MAQ A;  4YJ2 B;  2PTM A;  4JI4 O;  4UFZ A;  1VMG A;  1NKD A;  3ETE A;  2AW9 A;  2UXD O;  2F66 C;  1Z5W A;  3RGB A;  4JYY A;  3JAT A;  5LGN A;  1IBM O;  5KHH A;  3CCU V;  3CCE V;  4FLU A;  3ABM C;  4YHH O;  3R65 A;  5LOV B;  3K0G A;  2KB1 A;  4MW8 A;  5LA6 A;  2N74 A;  3ZN0 A;  1VEW A;  1H8H G;  1YDX A;  4TWK A;  4F4L A;  3N2G A;  4OX9 B;  3ZRW B;  5HFL A;  1L0L H;  1XMQ O;  1SZX A;  1AB3 A;  2BTQ B;  4IIJ A;  5LP6 B;  2DN9 A;  4CC5 A;  4NTY A;  4DV3 B;  1NJI W;  2DYR C;  3RW0 A;  1Q3E A;  1DF5 A;  4NB5 A;  3JD2 A;  3O9O A;  4GX0 A;  2FYU H;  2VQF B;  2EIM C;  4J9Z B;  1KBH A;  1H2N A;  3SJB C;  1J95 A;  1SKV A;  1VQ8 V;  1WA8 B;  2CTR A;  3L74 H;  4X1I A;  4JPR A;  1Q5O A;  3OTO O;  2ZE6 A;  1YTF D;  3SYQ A;  1RM1 C;  4UUJ C;  4LCU C;  3OTO B;  1AVM A;  3GWK C;  2YXY A;  5EZY B;  1PNK A;  1JFF B;  2WAM A;  4NXN O;  1OCC C;  1O9H A;  1S5L Z;  3HKD A;  3STL C;  3RYH B;  4H44 B;  4EKW A;  5CMU A;  1UPG A;  3H9V A;  1KEC A;  1V54 C;  4DXW A;  4DV4 O;  1PM9 A;  3F5T A;  4WFB V;  3OFN G;  3QG5 A;  2DMX A;  2BOC C;  4J7K A;  4LNU A;  4O4L A;  1I5X A;  3GWO A;  2ZDI A;  3A2F A;  2JS5 A;  4B3S O;  1UJW B;  3K08 A;  3SYC A;  1TA8 A;  2GHY A;  1R3K C;  2WLL B;  3E2E A;  5H5N A;  2UXC B;  3OM3 B;  4KL1 A;  2WLH A;  2ZQM A;  4LFA O;  2H94 A;  2DQ0 A;  1CPY A;  2JEX A;  3MD0 A;  1ORQ C;  3LSQ A;  1FXH A;  1OCZ B;  4PV1 B;  2YIC A;  3T2M A;  2KG7 B;  2XOK G;  1UFI A;  3RBZ A;  3BVO A;  5IE9 A;  3E22 A;  2QSA A;  2QA4 V;  3K5L A;  4LWS B;  2HVJ C;  2AZ2 A;  2BTO A;  2Q73 A;  3BEH A;  3APO A;  4UV8 A;  3VQW A;  2O57 A;  1YHQ V;  3A0H Z;  1F4N A;  2ZM6 O;  3BA9 A;  3ABM B;  3ICX A;  1G4Y B;  4JTC B;  3DXR A;  1WP7 A;  4GX2 A;  3H01 A;  5KA5 A;  4YHH B;  4NXN B;  5KX5 A;  1NVP B;  3AG1 C;  3JCZ A;  4FMT A;  4LBE C;  4DR7 B;  3ZHV A;  1K9M W;  3W7U A;  2XHB A;  5GON A;  1QHT A;  2DWE C;  4AI8 A;  3CHX A;  1TUB A;  2ZR2 A;  4B3T O;  1FXK A;  1GH6 A;  1BSM A;  2Q6A A;  4QNH B;  1QQC A;  1QLE C;  2CAZ C;  3I55 V;  2OCC B;  4E2L A;  3AK1 A;  3ETQ A;  4HYO A;  4JI0 O;  3ZRV A;  4ABM A;  5CA0 A;  5DED A;  1VF5 B;  3W7S A;  4OPH A;  3SR2 C;  1FPO A;  2VQE B;  4I50 B;  3J80 N;  3OMN B;  4MSW C;  1N36 O;  1M9N A;  3CRM A;  4JZG A;  3N2K B;  2QTO A;  4Q6G A;  3SPH A;  1NU1 H;  3TJT A;  5B3S B;  1KD1 W;  1HNX B;  1I7F A;  5LHI A;  3ABL C;  3K79 A;  1IBK O;  1M56 C;  1U96 A;  3H1J H;  1P49 A;  3CCM V;  2P6J A;  2ZNJ A;  4GX1 A;  3P32 A;  3OEE G;  1ENV A;  3CC7 V;  3M7M X;  2HP8 A;  4MVQ A;  2A06 H;  2OT5 A;  2EJR A;  5C8Y B;  4WBN B;  4DV0 B;  4FLX A;  3HPL C;  4CS2 A;  2ZCE A;  1SES A;  2K1E A;  3P3P A;  1AI6 A;  3ZIA G;  4DR6 B;  2R70 A;  4X1K B;  2QWO B;  1VIB A;  4KHP B;  3CB2 A;  2UXC O;  4UCV A;  2WLN A;  2QR4 A;  3CJH A;  3OGI B;  2GDS A;  5JJN B;  5DN6 G;  1D2D A;  3F7Y C;  3J7A U;  5CBH A;  2EIK B;  3J81 N;  4DR2 O;  3T1H B;  1JPX A;  1FD9 A;  1AI5 A;  4UB6 Z;  4CBC A;  1JQ0 A;  4JYC A;  1M57 C;  1V54 B;  4DV7 O;  3TK1 A;  2R9I A;  2XAQ A;  1XDC A;  5CA1 B;  5LGT A;  2Q7E A;  4YIO A;  4PA9 A;  3T4Z A;  3K5N A;  1R6T A;  4CS4 A;  1GO3 F;  2DWD C;  3STZ C;  3HB3 B;  4WFE A;  4I4T B;  5IYD O;  5KHG A;  1PL4 A;  4QPK A;  3TXQ A;  4JTA B;  2RQ6 A;  1XUQ A;  5B5E Z;  4X64 B;  5CN0 A;  5LMU B;  3OR7 C;  2EIK C;  4X65 B;  2YS8 A;  4X62 O;  1XRE A;  3VQX A;  3ZHU A;  2JGD B;  4B3M B;  3ABU A;  2QM8 A;  3ZMU A;  2UUB B;  1WB8 A;  2JVD A;  2YI8 A;  2F4V O;  1FXK B;  4FLV A;  1BQ0 A;  4R6Z A;  3PJS K;  3DGE A;  2M6Y A;  4PA6 A;  2A9H A;  2E3C A;  5CA0 B;  3UT5 A;  4WCE V;  4J7J A;  2PI5 A;  3E8B A;  1AI7 A;  3D36 C;  1Y74 B;  1VQL V;  1EN4 A;  2P67 A;  2P4K A;  4CH6 A;  1I94 B;  5EYP B;  2OCH A;  4LF7 B;  2XUM A;  1Y76 B;  4X8A A;  1YCI A;  1DK1 A;  1W2B U;  3A8T A;  2WWW A;  1BZK A;  1L1F A;  1H2S B;  4QPJ A;  5IJ9 B;  1PPJ H;  3CX5 F;  2GBO A;  4DR6 O;  1XL4 A;  2BOB C;  2XAS A;  1D5A A;  4D6T H;  1JJO A;  4PI0 A;  1JCH A;  4NTX A;  3QO5 A;  2D3O W;  4X20 B;  4FVM A;  5C8Y A;  1Q6H A;  5J9P C;  2ZD9 A;  1NH2 B;  3IGA C;  1MSW D;  1KUQ A;  4I9W A;  3AG7 A;  2RNB A;  1PP9 H;  1XNR B;  4DV2 O;  2ZXW B;  3FAV A;  4LP8 A;  2JIZ G;  3CEI A;  3UO3 A;  1S5J A;  4IHJ A;  1PNL A;  4X1Y A;  4UCU A;  4JYA O;  5AG2 A;  2XAG A;  1ZSP A;  4O4H A;  4MVS A;  4MTG A;  4P2Z A;  1KP2 A;  2YIB A;  2CTP A;  2Y48 A;  3BRC A;  2YID A;  4UV9 A;  4ZI7 A;  5JH7 A;  4DV1 B;  1SET A;  3FFQ A;  2VQE O;  4PDL A;  5LP6 C;  1I94 O;  3K9S A;  1MOF A;  3JAS B;  4YJ3 B;  4Q20 A;  1I5Y A;  3FB7 C;  4PHZ A;  3WG7 C;  2JGD A;  4OGQ B;  3CME V;  2W0X A;  4JI1 O;  2GTS A;  1IUR A;  2G38 A;  4IL6 Z;  2DYS B;  5IY5 C;  4L87 A;  1R73 A;  2X7R B;  1EN5 A;  5L3E A;  3UT5 B;  3JAK A;  3R66 A;  3F5W C;  3CCR V;  2AXT Z;  4DR2 B;  3HKC B;  5A2Q N;  2UXB O;  5GW7 A;  1TGO A;  4GLX A;  1S76 D;  4ASU G;  4MTX A;  1ZX3 A;  1R1B A;  3KG2 A;  1R3J C;  4DK0 A;  1JFF A;  3SPJ A;  1IBL O;  5FPR A;  5H2F Z;  4MVZ A;  2F95 B;  4FIP C;  1Y4M A;  3OTF A;  3B40 A;  4RQE A;  3ETD A;  1PKX A;  4GZR B;  2ITC C;  1R3L C;  2YDE A;  4B7K A;  4EFE A;  3M99 B;  1MA1 A;  4CS3 A;  3RYC B;  3ABK B;  1N34 B;  5CB4 B;  3AG3 C;  4G27 B;  2B1G A;  4QE9 A;  4X20 A;  3ABT A;  2P06 A;  3DC5 A;  4NTW A;  1QR8 A;  1WN7 A;  1TAE A;  3UM7 A;  1N33 B;  4JI5 O;  1H2G A;  1AIL A;  4CZZ A;  3OR6 C;  2ZIN A;  3OAA G;  2MK3 A;  5L3B A;  4DV7 B;  3ASO B;  1K5Q A;  1RP3 B;  1SA0 B;  5BXZ A;  4R50 A;  3S3X A;  3AG2 C;  4ICG A;  1SER A;  1EZJ A;  1EM1 A;  3L75 H;  1GKF A;  2Y69 B;  3L71 H;  3ZX6 A;  3AEI A;  4CC6 A;  3UQ8 A;  1ROP A;  3C90 A;  5LHH A;  1FFT B;  1IX9 A;  1X4T A;  3K3W A;  4I4T A;  2LJ2 A;  1RSO A;  3AG4 C;  1Q6I A;  2YSU B;  3APQ A;  3CXH F;  1Q7Y W;  2Z0A A;  4DV3 O;  2FB5 A;  2FL4 A;  4O2B A;  2VRZ A;  4R8C A;  1T5E A;  1I08 A;  3RYI B;  2CUG A;  1VQ5 V;  4B08 A;  1F23 A;  5B1O A;  3EHB B;  4CH5 A;  4FJC C;  1IXB A;  3B8M A;  4H33 A;  4B3T B;  2KQX A;  4J42 A;  5H9C A;  2XAJ A;  4ZHQ B;  1WJZ A;  4UCR A;  2EIJ C;  4JI3 O;  4W4K A;  4JAV A;  4MS2 A;  3ZBH A;  5LMN O;  4CH4 A;  4G28 B;  1Y67 A;  1KQS U;  3WB1 A;  2P5O A;  1P7G A;  1ARO P;  2WLM A;  1VQ7 V;  4XBF A;  1AR5 A;  1N0J A;  1CP9 A;  1JR9 A;  2QKA A;  1ZWI C;  4LF8 B;  3K5O A;  1XL6 A;  4JI6 O;  3ZHT A;  1H2L A;  2GUZ A;  4PDM A;  1K8A W;  2AZ0 A;  1WB7 A;  3T1Y B;  1R3I C;  3SGI A;  1JX9 A;  3ZMT A;  1JVM A;  4C7U A;  1BMF G;  4LF9 O;  4HBN A;  3ZHQ A;  3JSL A;  3E22 B;  3VQV A;  1KB9 F;  3FAV B;  3EFF K;  1RM1 B;  2E5L B;  3DXR B;  4YXW G;  5K1P A;  2ZKO A;  4JI3 B;  4J80 A;  3ZMS A;  4BIU A;  1R6K A;  2VS0 A;  1XMO B;  3FKS G;  5FL7 G;  3G67 A;  4A5U B;  3DTU B;  1XIL A;  2Q0A A;  3CC4 V;  1XNQ O;  2B5U A;  5GON B;  5B1B B;  4P30 A;  3L72 H;  2E74 B;  4ZI7 B;  1JJ2 U;  1SRY A;  1MZF A;  4Z1V A;  1CXZ B;  2WLJ A;  1F51 A;  4X66 O;  1BS3 A;  1FAF A;  3HKB B;  2FKX A;  3DSQ A;  2P4V A;  4L8J A;  1YTF B;  2YEV A;  2HR3 A;  1TUB B;  4Z2W A;  3G4S V;  2IJK A;  3N27 A;  2EIL C;  2R9A A;  2W6I G;  5KAI Z;  4MVO A;  5EIB D;  4DR4 O;  1HWY A;  1Q86 W;  3NXS A;  4MVU A;  1XI1 A;  5ITZ B;  4WFA V;  1B04 A;  1JA8 A;  3SJA C;  4DR3 B;  5D5Q A;  1DGS A;  3I56 V;  4JI4 B;  2WA4 A;  4Z1M G;  1TVK B;  4I55 A;  4XDJ A;  2OTJ V;  1LUV A;  4H37 A;  2GV9 A;  2RJZ A;  5LXT B;  1B6Q A;  4LF6 B;  1NTM H;  1YJN V;  4G2K A;  3SJQ C;  3QNE A;  2V7Q G;  4GYC B;  3ML0 A;  2UUB O;  4WFG A;  2DW4 A;  2H8P C;  3L73 H;  4D7T A;  5IWA O;  1S0V A;  4PI2 A;  4TQD A;  1NZ6 A;  4GKJ O;  2ILM A;  5IYZ B;  2B1I A;  3BCC H;  4XDL A;  1M90 W;  4NXM B;  5CB4 A;  4LFC B;  1FKA O;  2ZIM A;  1XHX A;  1N32 B;  4UCS A;  3E83 A;  2HHH B;  4J7Z A;  4TUY A;  5KMG B;  1B06 A;  2BCC H;  1M57 B;  4JI1 B;  2QWN B;  4K3A A;  4F6R B;  3ABL B;  2OIG A;  4J11 A;  4UVA A;  2QDO A;  1FFX B;  2VQF O;  3K57 A;  3KCX A;  1XMO O;  3AK2 A;  3IAY A;  4KP4 A;  4GX5 A;  2DJV A;  3U0Z A;  1Y6X A;  3O65 A;  5IT9 N;  3FB6 C;  4U3J B;  4FLZ A;  1QU7 A;  4GKK O;  4X62 B;  2PI4 A;  4ZIB A;  4JGS A;  5L3C A;  5LL6 Y;  1BHA A;  2WLI A;  3CS5 A;  4OXS A;  2JGU A;  4LFB O;  1YJW V;  2UUC O;  3P3N A;  2AGA A;  1W0J G;  2Y4T A;  3B09 A;  2DYR B;  5IYC O;  1MSD A;  1OCO B;  2UUC B;  1ZTE A;  5EBW C;  1SS3 A;  1HR0 B;  4U3F H;  1M1K W;  1RSO B;  2Q7G A;  5B3S C;  3EVK A;  1E79 G;  2AHZ A;  3E35 A;  2E5L O;  2ADP A;  5LYJ B;  1MNG A;  3FB8 C;  1YXB A;  3KKY A;  4DYL A;  1IBK B;  1XBL A;  5IWA B;  1VQP V;  2JS3 A;  4JI7 O;  2EIL B;  2BTQ A;  4IIJ B;  5LP6 A;  4DR5 B;  5TIS Z;  3B77 A;  4B3R O;  5KA6 A;  2X0L A; 
#chains in the Genus database with same CATH homology
 2LW7 A;  4JI6 O;  5BXZ A;  4OX9 O;  1FYJ A;  1NS1 A;  1FJG O;  4DV0 O;  4JI4 O;  2UUB O;  4B3S O;  2VQE O;  5IWA O;  1HR0 O;  4B3M O;  1N32 O;  1I94 O;  2HHH O;  1YZB A;  4JI8 O;  2UXD O;  4LFC O;  5H5N A;  4LF4 O;  1A32 A;  4GKJ O;  1IBK O;  4LFA O;  4LF9 O;  4X65 O;  5LMU O;  4JI1 O;  1IBM O;  4DUY O;  4YHH O;  4JV5 O;  1FKA O;  1F7Y A;  2ZKO A;  1J5E O;  1DK1 A;  1HNX O;  1X59 A;  2UU9 O;  2Z0A A;  2N74 A;  4AQY O;  4DV3 O;  4DUZ O;  4DR7 O;  3R66 A;  4A5U B;  5BR8 O;  1XNQ O;  3T1H O;  1XMQ O;  2VQF O;  1G1X B;  4DR6 O;  1AB3 A;  2UXC O;  2ZM6 O;  1XMO O;  5A2Q N;  2UXB O;  2DJV A;  4DV6 O;  4LF5 O;  3O65 A;  1HNZ O;  5IT9 N;  1D2D A;  3J7A U;  3J81 N;  1R1B A;  4DR3 O;  3SDL A;  4YY3 O;  4GKK O;  4LF7 O;  4DR2 O;  4X66 O;  4LF6 O;  1IBL O;  5LL6 Y;  2UUA O;  1HNW O;  2FKX A;  4X64 O;  5BY1 A;  4KHP O;  4DV7 O;  4LFB O;  1XNR O;  2JRI A;  4DR5 O;  1KUQ A;  2UUC O;  1N34 O;  2AGA A;  4JI3 O;  2DOS A;  3JAM N;  5FLX N;  1N33 O;  1R6T A;  3OTO O;  4DV5 O;  4NXM O;  5LMN O;  4DV2 O;  4DR1 O;  4B3T O;  3RT3 C;  4DR4 O;  2E5L O;  4LF8 O;  4JYA O;  4JI0 O;  1XEQ A;  4NXN O;  4OPA A;  3T1Y O;  4X62 O;  4JI5 O;  4JI7 O;  1AIL A;  4OPH A;  4DV1 O;  3M8A A;  4DV4 O;  3F5T A;  4JI2 O;  3J80 N;  4K0K O;  4B3R O;  2F4V O;  1N36 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...