5B1AB

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1aB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1aB02
1RCYA 1JZIA 1NWOA 4E9QA 3IEAA 1A65A 1J9SA 3UAAA 3QPKA 1ETJA 2TSBA 4JHVA 1WA2X 2HRGA 3OMIB 4BXSV 4DP0X 2HZHA 5B1AB 3UADA 6PCYA 2PPEA 4A2FA 1AZUA 3CDZB 7PCYA 2B08A 1KV7A 4KNUA 2I85A 3NJIA 1BEXA 3V9EA 4UAHA 2FT7A 1FWXA 1AZNA 3CG8A 2IWFA 1B3IA 3OMNB 3QJSB 3CDZA 4FA7B 1ZV2A 2MTAA 2AANA 3OD3A 4BDVA 4DPCX 1TU2A 2PPDA 1QLEB 1TKWA 3ABGA 1SHXA 3PAUA 5I5JA 4BWWA 4TXVB 3FQ2A 5LDUA 2I7SA 4CSPA 2FQGA 2YAEA 1JZHA 1XB3A 2HRHA 2W8CA 3HB3B 2QPDB 2XVBA 1HAUA 3ABLB 2XX1A 1JVOA 1SF3A 2J56A 1IBYA 2X87A 1E5YA 4KOBA 4PAZA 1BAWA 2AZAA 3ASNB 2YXVA 4RH4A 9PCYA 2Y1AA 1IC0A 1E30A 4M4RB 1MZZA 3AG4B 3UGEA 1NDTA 3EF4A 2ZWNA 3FSWA 1QHQA 4P5SA 1HAWA 3WKPA 4G70B 5TK4A 4F2FA 4G71B 2CCWA 1J9QA 1ZDSA 3N2JA 3ZBMA 4JHUA 3TBBA 2CUAA 2EIMB 5A7EA 4K9JA 2UXGA 4YSRA 3NJHA 4DP1X 2UXFA 3G5WA 3NSDA 3QQXA 1MG2C 3HEIB 4AX3A 2VMJA 2XX0A 2FQDA 3AG1B 3CVDA 2PCFA 3IBOA 2GSMB 1NIAA 2CAKA 4GP8B 2XYBA 1JZFA 1RZPA 2IDTA 3UACA 4MFHA 1SFHA 3PLYA 1X9UA 1IKOP 5F7AA 1MG3C 4X4KA 4N4YB 5I26A 5I5IA 3QJRB 1AR1B 2VSKB 1M56B 5FC9A 2NRDA 2GIMA 3WI9A 2I7OA 5I6LA 4HZ1A 1RZQA 1GW0A 3FSAA 4YVUA 5I6MA 1ASPA 2PP8A 2JKWA 3UABA 1ET5A 1MZYA 3KW8A 1NPNA 5AZUA 3FQ1A 3NJKA 2HXAA 2XU9A 3SBRA 2XWZA 1W6WA 2EINB 2FWLB 4A2DA 1L9OA 1CYXA 1A4CA 5PCYA 3FYIB 2YXWA 3S3DB 5B7MA 1AZRA 1V10A 1W8EA 1WS7A 5B7EA 4KO6A 1ZIBA 3FPXA 4E9YA 2QDWA 3AW5A 1OCRB 1WS8A 2FNWA 2JFCA 3WIAA 3IN0A 4KNSA 1PAZA 3TBCA 1DYZA 4HIPA 3S3BB 3ERXA 4BXVA 4FAAB 3PXLA 2H47C 4QKTA 2AVFA 2QDVA 2BW4A 1PNDA 4A2HA 1AAJA 5I5MA 3X2QB 1SDDB 1E67A 3FU8A 1JXGA 1SDDA 4HHWA 4A66A 4WKXA 2TSAA 1I53A 2ZONA 3C75A 4UANA 2PPFA 5I6KA 4L0PB 1JZGA 2IWKA 2WO2B 4HHGA 1BQKA 2IDQA 1NIDA 2EIJB 1KBWA 1ILUA 1BQ5A 4DP9X 3MX0B 3UAEA 1PMYA 2YAFA 1OCZB 4AKPA 5PAZA 4E9SA 2E86A 4F2EA 2LLNA 1TEFA 4YSTA 3T6ZA 1BYOA 1BQRA 3FSVA 1IUZA 4DP7X 2YAOA 1ET8A 1OOWA 3FT0A 1OV8A 2BWIA 1SNRA 3PAVA 5ANHA 4CSZA 4UF7C 1KGYE 1E65A 1J5CA 1NICA 3AY2A 1ADWA 3T6WA 1L9QA 1L9RA 3H4FA 3TA4D 2XV2A 2YAHA 1JVLA 4DP5X 2H3XC 1BXUA 4GP4B 5I6NA 5D4HA 2YEVB 5F7BA 1XB6A 3BQVA 4E9VA 2FJSA 1X9RA 5B3SB 3IE9A 4HAKA 5B1BB 2VW7A 1KBVA 4AI7A 2BO0A 3ZDWA 5E9NA 3DIVA 2VSMB 4YSOA 4G7QB 4A67A 1IBZA 1OCOB 1SJMA 2CJ3A 4E9TA 4BDVB 4YSQA 1GYCA 1KDIA 3FU7A 3DKHA 3TU6A 1ASQA 2DYSB 2EIKB 4A68A 2XXFA 5B1JC 2DV6A 1ASOA 1F56A 1SHWA 2BWDA 2QPEB 1OE1A 2HX9A 1NIBA 3RYMA 1ET7A 1OF0A 3DTUB 2WSDA 2Q5BA 4YSSA 3NJFA 3S8GB 2BZ7A 2Q9OA 2IH8A 6PAZA 3JT2A 1PLAA 1AANA 2AFNA 3OM3B 1PZAA 1ZIAA 1A8ZA 3JTBA 4YVNA 1KCBA 2VM4A 2DYRB 3FPYA 1AIZA 1KYAA 2OV0A 5EHFA 4QLWA 1J9RA 2BP8B 3EH3B 1AG0A 4HCIA 4W1TA 2P80A 4GY4A 2VM3A 4DP6X 4HCFA 1L9SA 1NPJA 2BP8A 2Y69B 2OJ1A 5AKRA 1PNCA 3S3CB 3ABKB 3NSCA 3T6VA 3GYRA 3ZIYA 2IDSA 1NWPA 5I6PA 2GBAA 4NAJA 2XXGA 1FFTB 2EILB 1A4BA 2XV3A 3FU9A 4DP8X 3AG3B 4ENZA 3QJTB 3QJUB 4YSDA 5B7FA 1TEGA 2GC4C 1A3ZA 2IDUA 3T6XA 1M57B 4A2EA 3T71A 1CYWA 2XV0A 2GI0A 4N8UA 3FQYA 4NB7A 3U25A 1NIFA 1GR7A 3SBQA 3BVDB 2FQEA 3ZX1A 3IN2A 4AKOA 1AG6A 2FT8A 2PP7A 1RKRA 4NERA 2PPCA 4PCYA 3ASOB 1PCSA 3QJQB 1VLXA 2GB2A 3NSFA 3WNIA 3FSZA 3MBWB 3H56A 3SBPA 3EH5B 3X1EA 1BXVA 2DWTA 1L9TA 3GDCA 4P5RA 4YSPA 2BHFA 3NJNA 4G7SB 1CURA 2VW6A 1HFUA 1ILSA 4WTQA 2WO3B 4DPBX 1AS6A 2XUWA 1GY2A 1UATA 3PCYA 2J5WA 3NYKA 3OQRA 1JZJA 2BP0A 2FQFA 1W6LA 2P80D 2R7EB 3X1BA 1GSKA 2J57A 1M9WA 2XLLA 3FS9A 1GY1A 5B1KA 2W88A 3PPSA 5IY5B 1AQ8A 3CVCA 1WA1X 1BXAA 2R7EA 1J9TA 4DP2X 1ID2A 1WAEA 1QNIA 2OCCB 3PAZA 1OE3A 1GS8A 3D12B 2BW5A 2YARA 1URIA 4KO7A 3CVBA 3NP3A 4Q89A 4AKQA 4YSUA 3NSYA 4A2GA 2RACA 1AS7A 4BWTA 4M3HA 1T5KA 2FTAA 4KNTA 1A4AA 1WA0X 1ZPUA 2UX7A 5I28A 1AS8A 3X1GA 2FT6A 3NP4A 2B3IA 1FA4A 4E9WA 1AZCA 1V54B 2PP9A 1PF3A 2GHZA 3QJVB 4EF3A 4YSAA 1PY0A 1L9PA 2N0MA 4G7RB 2H5UA 4GYBA 4HALA 5TK2A 3EHBB 2UX6A 1PLCA 3L45A 2JXMA 1NZRA 2X88A 3OMAB 3CZUB 1EHKB 4E9XA 5AFAA 1N70A 8PAZA 3X1NA 1KDJA 3FYEB 2MRYA 2CALA 2PPAA 3NJGA 4KO9A 3WNJA 2IDFA 5I6OA 1CUOA 1JXDA 1NINA 4KO5A 1PZCA 2YAMA 3KW7A 1EZLA 3WKQA 3NT0A 3NJMA 1V55B 4G72B 3S8FB 3AG2B 4KOCA 4DPAX 1J5DA 2BP0B 2YAPA 4YSCA 4JKNA 3TASA 5D4IA 2IWEA 1YLBB 2AZUA 2YAQA 3SQRA 2PCYA 2GC7C 4AZUA 2DWSA 2HX8A 4GP5B 3X1FA 1AOZA 3FU7B 2UXVA 1OE2A 1GS6X 1NIEA 4HCGA 2PLTA 5D4JA 2IH9A 1SF5A 2UXTA 2VW4A 7PAZA 1AACA 2CBPA 3ABMB 1R1CA 4GXFA 2ZXWB 1XMEB 1JZEA 1GS7A 2VN3A 1JOIA 1E5ZA 3N55A 2QT6A 4YL4A 1JXFA 1AZBA 1MDAA 2ZOOA 1NTDA 2HLEB 3AZUA 2A3TA 3V9CA 1N68A 4ZK8A 4YSEA 4F7KA 1SFDA 2BZCA 4E9RA 5B1JA 3T9WA 2HX7A 1DZ0A 1XB8A 2IAAC 3WG7B 1OCCB 1CC3A 3NJJA 4BWUA 2J55A 3EH4B 1ZDQA 1PZBA 1PLBA 1BYPA 2DY2A 2YQBA 3H4HA 4DP4X 1KCWA 3NJLA 4BK5C 4W9ZA 4Q8BA 3GXUB 1JERA
chains in the Genus database with same CATH superfamily
2BSBA 4WI9A 5GGQL 3KPLB 1KXQA 1CI5A 3L7FB 3P4MA 3MXWH 4Y4KA 3EDEA 5I76B 2YDEA 3L9BA 1T6WA 3JAKB 1XEDA 3P4OA 3WN5B 1DQQB 3LHPH 1ZHNB 4C8XA 4OZIA 1AE6H 2X4SB 4R7CA 1H6UA 4PA9A 4KHTL 5T33L 2GJ6B 3RX9A 2GY7B 2YQ2A 1YJWV 1ZT7B 5BO1L 2EDOA 4XBPB 3D85B 4XAKE 4I9WE 3VI4A 1P9MC 4DVRH 4TQDA 4TWKA 3TBVB 4JGNA 4HS3B 5DZOA 2WCGA 4OJFH 3LDCA 3ETGA 5AAWA 5IFJA 4FA7B 1NMCB 1BL8A 4R3SA 2WLMA 2VC2L 2OMTA 1SUHA 3MU3A 4XI5D 2EZ0C 3QFJA 1R3KB 3BEHA 4QXGL 1MWOA 5HJ3A 3OMZA 1S7UA 3GF8A 3DTDA 4MVMA 5F9WC 2VR6A 2CO6B 3EOBA 5CB4B 5AG9A 3SPCA 4ETYA 5EZLA 3ZDXB 1EJ8A 1GMEA 1UXWA 4TXVB 3ILDA 4LO9A 4O4LB 4HP5A 2YAEA 1NANI 4NSKB 4ELKA 4E42A 1D5IH 5KZCD 3P77B 1G9EA 4P4KB 1WRFA 2CR0A 1I8MB 1OAKL 3EJJX 5JH7B 5AOLA 1EN6A 1TZIA 2H8PC 1FFPA 3CZEA 4NN6B 5DEFA 2BSTB 4K55A 4LHUB 5JJNB 3RGVB 4LE8A 4DV6B 5DFTA 3HS9A 1IX9A 1ZE3C 2VABA 1F58L 5F9JB 4P2CG 2HLFC 4NLAA 1A6WH 4JKWA 1V3KA 1NC2D 4XWGL 3VFNB 5GRVL 1DVFC 1H15B 3H3PH 1ESOA 4FDWA 4MMYB 1EEYA 1BMZA 4YXKH 3JWNE 4O02L 2WP3O 1MW0A 3KPPA 3CFJB 2E5EA 4GPVA 4P5SA 1DQIA 4AQYB 3PDOB 3N42F 3BO8A 3QO0B 4I77L 3SN6N 3GSOB 1A6UL 3L5JA 4KZEL 2DQCH 4AYMC 2CHZA 1HKLL 3BQUB 2P4KA 1SBSL 3CSYA 4PB9H 4I0KA 2FWSA 2VQUA 5GRJH 5FHBL 4G3YH 4IKNA 4DP1X 3VXQA 1Y1UA 4Y4HB 4BUHA 2BVOA 3NSDA 5EA0L 4NNXB 1L3WA 5E4IA 3ESOA 3KPNB 2CA4A 3GB7A 1FORH 5DEJA 5DJXA 4HJUA 3BY6A 2N7BA 1DO5A 4HWNA 4NNYA 2GSMB 1G0YR 1XFPA 2A9DA 2IV8A 3NJXA 4G8FB 3JWDC 3QARA 3E89A 4IS6B 4KTGA 2FZ3B 2EIEA 2OTLV 1KIQA 4BR6A 2NR5A 1INQA 2X53A 4N5UA 3KH4A 3V4VA 1BREA 1MJJA 3H8NA 4W9IC 2O5ZH 5FK9B 4X4KA 1SBSH 1HI6B 3CFDB 2F74A 3HZYA 12E8L 1UFIA 1M7IB 1P7QB 5LO7A 4AYSA 1L9MA 4Y5VC 2I07B 1VKXB 4HC1H 1F4WL 4N0UA 3QHZL 5EPMB 3UBHA 5BRZE 1HX0A 2VIRB 1HYSD 1HHGB 4AENB 2ZXBA 3BUYB 2HWZH 1QLFA 5DLMH 4YZFE 4X80L 1SJEB 3DO7B 1HH6A 2EINB 2IQAB 3RJQB 2O6FA 4LWSA 5A9GA 3ZKSD 1CF1A 2IH3B 3WO4C 5MHSE 4FFYA 4FG0A 1FUNA 4AQEA 1TZGH 4X5XB 5KYYA 1HWGB 1WD9A 1MCBA 3CSXA 5JCOC 4PJBB 1HHIA 2E6JA 1PAZA 2XAFA 5D2LF 3DA0A 3TBCA 5TFSH 1A9VA 3VXOA 4CS3A 3LRHA 4GQPH 5C0AE 1NH2B 2UWEF 2E9IA 2YBGA 1BBJA 4IDJH 4PR5A 2YGVA 1HXYB 3HC2A 4NPYB 2Z7UA 1ZSDA 3VQVA 2BIIA 4WJ5A 3ECWA 1LWJA 3RVTC 3VJ6A 1JXGA 3CFEB 4JHAH 1ZSPA 4TUYA 3MUGA 4PBWD 4A66A 3HE6A 3HE7B 2NQCA 2WD0A 3ORJA 1QLNA 1MRDL 3WTWA 1MFAH 3P73B 1XGPB 5H6RA 2ZJSL 4BE6A 3JASB 1CIDA 1RFDH 3NCBB 4Q6KA 4XVSL 3NSXA 4PGBB 4Y4HC 4JFXA 1R3JB 1YNTB 3GRGA 2NW3A 5C0BA 3AM8A 4MJ5B 4X1YB 3LPWA 5EORL 2ZKXA 5IQLA 2YGQA 1SOSA 3C60D 4DN3H 1MEXL 1TQTA 1IAMA 3LRSB 5CWSA 1N26A 4Y1TA 2JCCB 4RISL 2ICEA 1BQRA 1G4YB 4W4NA 1WD8A 2KQXA 3D87B 3HZMB 4UCFA 4Z3HA 1YDPB 3C6EA 4LSVL 3ZQXA 1EUUA 1YMME 1X59A 3UOAB 3IF1A 1X44A 3KS0J 4K9EC 3OR7B 3MRPB 5DVLA 4PV9B 2ZT9B 3LN5B 2YS8A 1Q9KB 2F54A 4IYKA 3ZJZA 1KPRA 2ZCKL 1NDMB 4K3GA 4B3VA 3IAGC 5D7LE 1XIWC 3VGAB 1QABA 1SLXA 4DEPB 3FHAA 4TQHA 3DYPA 2BNRB 2VQEB 3STBA 3SJVA 2MNWA 2NY1C 1V8HA 1GA2A 2B59B 3QIUB 4R4FL 5IQ9A 4EB6B 4MASA 2FATL 5J12C 2YXFA 2Y22A 3IE9A 5JIHA 2FNBA 4QRFA 4JF3A 2VW7A 4FLQA 4HKZB 1ZHKB 1IFHH 3PNWA 5DRNA 1JDDA 4ZS7H 5TTRA 4A39A 2QZ5A 4DAGL 2F7QA 5C0AA 2NLJB 3H3BC 2CPUA 4RGND 1JPGB 5B8CA 1EXHA 3DUUB 1U95A 3CLFL 1N10A 1SBBA 3ARBD 4PHXA 2DYSB 5INCA 2NSQA 1I94O 2XXFA 2WXOA 3DPBB 2YC1A 4Z7VB 5I66B 1OE1A 5CZKA 5DD6A 5DWUH 3BOVA 3VDAA 1D5ZB 2JF1A 3Q2CA 2ALAA 4X99B 4JQIL 4KZDH 1WWBX 2BZ7A 4J7KA 4FTVE 5H4YA 2AEQL 2ZG2A 1HNZO 4JM4L 2E8YA 1YY8A 4D0DA 3WAJA 3UX9B 4DH2A 3BPNC 2AFNA 4ZTPL 3D4GA 3ZE2E 5TFSL 3WEAA 3S3SA 1QBLL 1A8ZA 1T5WA 3BUPA 3DJTA 5GGUB 3JTBA 5E79Z 1HOCA 1VFUA 1R3JC 1BQHA 2IADA 5SWSD 1P0SE 1IM3D 3DX3A 2HJKA 5C08D 4DW2H 1JWSB 3WEBA 4UUJC 3WIFB 1EZJA 5I76A 3DV6B 4HIHA 1AY1H 2R9AA 4H33A 1AGFB 3DX1A 1UOWA 2A9AA 1YJDL 4LF6O 4MLSA 4XMVA 1KC5H 4ZMOA 5GHWL 1VA9A 3GT6A 3P40A 1QRNE 2BP8A 5D6CB 4HWBH 5FOJA 1T0OA 4IKKA 1TQBC 4OLUL 4IIZA 3GYRA 1DDHB 4KXCA 4UM9D 5DEGA 3WY1A 2P8MB 4QJ3B 1NWPA 1KJMB 5FB8B 4MAYA 3ZDZE 4CUCA 2BH0A 5D70L 5E00A 2R0WL 3LS4H 3S3XA 3AAZB 4R4BB 1KBKA 1UEMA 2CWRA 3JV4B 1VF6A 3GI9H 4D94A 3MRQA 3H9ZA 3PHQB 2M6YA 2YGOA 5LBQA 1H38A 3H42H 3KWUA 1CU4L 3W9DB 3F2LA 3S2CA 5IW3A 4MDIB 5FA3B 1GR7A 4PRHD 4XT1C 1S8DA 4N2EA 4AKOA 5CJOH 4PWFA 2HJFA 4ZFOB 3BLBA 2PP7A 3GZQA 2V9UA 1PKQE 1IBBA 3EGSB 4PJEB 4HNAA 3T4DA 1AP6A 2CLVB 3ASOB 2CGYA 3AU0A 4FJZA 4JO4L 4PCYA 1YSOA 5IG7B 3VMOA 5K9JH 4RUFA 3L5IA 3S37X 4PTTA 2GABA 3SBPA 2TAAA 3PL6D 3EH5B 1CI3M 4P4KA 1TVKB 4TQEL 4I48A 1F6AA 4AMWA 3Q05A 4LIQH 5E8PB 5GZOA 3MLVH 2PYED 2XUWA 5IB1A 1UATA 3SCMD 5DRWB 2D8KA 2N59A 2OR9H 2WKOF 2XC8A 3PCYA 5DWUL 3VXNB 4A55A 3CFQA 3IDIB 3HC0B 1KWGA 2QR0B 2R1YB 3U7WH 4G7YH 4XOAA 1KPVB 5AQ0A 4OLYH 3QI9D 2R7EA 3CXHJ 3B4NA 2QWRB 3C12A 3L4YA 5I24A 4YDMA 3ULSB 4HWZB 2ZZUT 3X17A 4XI5C 1D5ZA 3EFFA 5CEZL 4Z7WB 1F18A 2XJKA 3QFJE 4CMHC 4GB9A 1AI7A 3HVDA 2DW5A 4PIBA 2Y36H 5KS9F 3LVTA 1QO3A 1T66D 5HPOA 1CK0H 1FE8L 1WA0X 4XMPL 3JSSA 3MBEA 2Z0BA 1TOXA 4L29A 2FKXA 1E5CA 4A7GF 4LVOB 4AG4H 2VLMD 1R3IC 2W0FA 4WK4B 2PXYB 1TQUA 1MUJA 3GEWB 3HUJE 4W6XB 5D55A 1G6VK 1M7DB 4MCYA 5AOKA 3AM8C 1G7LB 3K08A 3D08A 5IW1A 5AVUB 3KNBA 4JPWH 3ARFD 1I8IA 4FK5C 2LP7A 1KGJA 1SLWA 3ECBB 4LFHG 1V5JA 3U4EB 4Q9QH 4PRBA 4P30A 3K0WA 4LCYA 5FFGA 2G3ZA 3L5HA 4R97B 1WJZA 2O6PA 4FKHA 5DF0A 2ZWLT 2WXJA 3VMPA 3WXWH 1V54C 3BEWB 1EEYB 2Y5TB 3L70H 1XF5B 5T3XE 3X1NA 1JJ2U 1QEXA 2PPAA 1NSNL 2X4RB 2FH8A 5IHZA 2VLJA 5DVOA 5E0FA 3TVMC 3EBGA 2DN9A 3IU4L 3KW7A 1A4JB 2CKBL 2ID5A 1V55B 2O61B 3QH3A 4ELMA 3N0PB 5HHOA 3NA9L 1Z3RA 5F7KC 2WCSA 3VCLB 5E1HB 4PA6A 2AZUA 2MQ3A 2UU9B 4HLZG 4JFOA 3FT4A 4KI5F 3WD5L 3ZT6A 2KKQA 4JMNA 4DR6B 2DWSA 3MFGB 1P49A 3AEIA 2DD8L 2HP4A 2YI9A 2Z7WA 4L1TA 3I2CL 4B9GA 1GN4A 3ZMRA 4DQOH 5CIPH 3QFJD 4X1IB 2APSA 2E4TA 3M45A 4G7YL 3CC5A 5E8NB 5TDPB 1MW3A 3Q9QA 3KXFD 1JMXA 1HHIB 3CH8A 2GFBB 2GTWA 1RIVH 4KXZH 1R5WA 4M6MH 2Q73A 2R1XB 2PZSA 3LH2L 5ISZD 3NPSB 4IGGA 3HI6L 2JI3A 4XNYH 3D25A 5T1KB 2A83A 3RIKA 3DJRA 1Y18B 3HC4H 4IRSC 3WB1A 3OL2A 4OIBA 2XBZA 4PJXE 3RWJA 1JCHA 1I7TA 5IB5B 3UTSB 4K5LA 3FZUD 5B4MC 3HZVA 2Y06H 4JN1H 5F7YC 2XPZA 2ESVE 3ZYOA 2Y36L 4O2EB 4FI6A 1T7ZA 1SQMA 4JFZH 1G6RA 3VJ6B 3REVA 4JFSA 3HE6B 5K9OB 4F8LA 2WJ5A 3NSJA 1QLEL 3FQ4A 4UIMA 4YZFF 3VUAA 4AITA 5EZPA 3OKNA 2KLSA 1KPVA 3MD0A 1J8SA 5D5MB 3S37H 4P2QB 1QACA 3IU3A 3ME0B 2D03L 3QYCA 3N42B 4OF7A 1OTSC 3FB8C 4LCVA 5F1SA 2PCXA 2CTRA 5J11C 4UCRA 3EXLA 1JZIA 4WNQB 5KX5A 4YFLI 2H45A 2GY5A 2IPTL 1Z9PA 4X5XA 3W56A 1NS1A 1TQCC 2VL4A 2WKLA 3IWUA 4JI4B 4PJCB 5ILTH 2Z92A 1KEGL 3BAIA 5EIBC 1BZDA 2XNAB 1AGCB 1IQDB 4OCRL 5DJ6B 3CRRA 1KBBA 1S6NA 1TYEB 1YJDC 4L2YA 3UAJC 1IGFH 1AZUA 1XWVA 1HK6A 1HDMB 1TZHB 1HL8A 4IKJA 3VTAA 4Y5XC 2DLFL 5ACMA 2E9BA 2MQ0A 3C8HA 4FCAA 1O9GA 1UXLA 3ETQA 4YK4C 1IIKA 3TV8A 3OMNB 1IXMA 2R56H 3M7FB 3ZHFA 4N9GB 1U8OA 1HP8A 2YJLA 3B9KD 3VE0B 4BZ2A 5IBUB 2XWJA 3T8XB 5DJAA 5A2QN 2VL5B 4MAYC 1U96A 2ZYIA 3TO4A 3AMLA 1EFXA 5SWZB 1QX1A 1F1AA 2QSCH 1WFJA 3KCWA 4FERA 3WTSA 3JV6B 1HQRB 4ATTA 3I2CH 1AI1L 1XHHA 2D31B 1F86A 4OCRH 5ESVA 5FHBH 1KLGA 5I5JA 2JMRA 4NRZA 1IGFL 4UM9B 2NDFA 1BLNA 2WLNA 2LLLA 4P23A 2DJUA 2EYSB 2J1WA 1KTDB 5C97A 2HJFC 4Z7QF 1HAUA 1NSNH 2EULA 4U1HB 3B9KB 1NC4B 3IU4H 1RLBA 1SDAB 2V4DA 4N9OB 5D1QE 1RP3B 3ZHVA 2R0LL 2V7NB 1XF1A 3K81A 3N44B 5D7IE 1CF8L 3FH8A 1P4BL 1RU9H 5E2UH 1USQA 5T1LB 2DQUH 1NBYA 2VLRE 3BKCL 3B2VH 2YEZB 4XNXL 3CRQA 1ZX3A 1UH2A 3Q3GB 4X9YA 3QGVA 1NDMA 3ZRXA 1ZOXA 2CCWA 4ODHL 4QRPB 1S78D 4KRPD 4F5CE 4ECNA 2K4WA 1I7UB 1EJOH 4UUJB 1SN5A 1CFQB 3CXDL 3L3KB 4I2XB 2Z35A 3IDGB 5JH7A 4E41D 4G2AA 4V1DD 1OAYL 1D7BA 1JWSA 1S77D 3BQUC 5CMUA 1KENL 2IPKA 1T7YA 1QUNA 3B2VL 4LRIA 1TZGL 3SQOH 3EJZC 4PJ5A 2P5WE 4KRMB 2G5UA 3LIZA 1VQPV 3GSXB 4JFDB 2VERA 5T1LD 2DQGL 4YGVB 1ZLWH 2PW1A 2IDTA 3N40P 3B4SA 4X4ZA 2DE0X 4WK0B 3ARBC 1X9UA 5E4EB 1ED3B 2YSUB 4BK8A 3EOAA 4X6EB 1XNRO 2Q7NA 3GI8H 4TRPH 1X5JA 1CWVA 2QKAA 4L8CA 4Q0XH 4MJ2A 1NH2D 2I7OA 3SDCB 2V8LA 3NCXA 3MNDA 5ILTL 3VXUD 1FZKA 3FO9B 4FG4A 4N1CA 1N0XL 3Q44A 2AK4D 1D6EA 4P2RD 2ADQB 3CLEH 4FG2A 3GHEL 3CQFA 1I7ZA 1ZPLA 4YFDB 4AI8A 4FULA 5LG1A 3VYOA 5B3SC 1PDKB 4PCKA 5FDWB 4M93B 3HNTH 4A6YA 4LU5L 1S76D 1A6TA 3ULVH 2VSCA 5GSVA 1WS8A 4J3BA 3Q06A 1Z5HA 3WIAA 1WZ1L 1KCVH 1KLGB 3LNHA 1OP3K 4DEWA 4GUQA 1R24B 1S5IL 2HLFD 4GAAA 4J8RA 3VI3A 3DOSA 1SXAA 1U8QB 1SJXA 4I87A 1HSAB 4KY1L 3RYFA 4V2CB 5CP3A 3QUXB 1H6EA 3NIFE 2XAJA 1KG0A 3TA3B 3D52A 3KLKA 3D30A 5C3LD 1MRFL 2UYLA 4AWJC 2EUZA 1HHGA 4AENA 3ZRWB 1XXFC 5EV7A 3J80N 2ZX9A 3JXAA 1WBXB 3LEXA 1E4KC 2QTOA 2R2EB 3ZMNA 3UBXI 5HJDA 35C8H 1A1OB 4MZIA 1I3RA 2BOCA 1VGEL 5F7EL 4K3DL 5G4OA 2HWZL 4MQTB 4G9FD 5B21A 3BAXA 3WHXB 3CPUA 1R3HA 3FQUA 4U2ZA 2JIXB 2UWEB 4GRWB 4FYTA 3P4OB 1MHHA 1T7WA 2IWKA 2HTKD 2ZCHL 3T08A 4KPHH 3PUUA 3HN5A 5HI5D 1ILUA 4DP9X 4JQXC 1UHVA 1ZUQA 3EJUA 4NYKA 3LRGA 1XBDA 3WN5A 4JRLA 5KSBB 3MQIA 1OGAD 2E86A 5DD5L 5IFHH 3FB8A 1MCFA 4I3GA 4YSTA 3QP3A 4XBEL 4WBNA 4EZLA 3Q4HB 4KKAC 1LO0L 4LLWB 5DMJB 3M88A 4ZFZB 1IUZA 1ZLSL 3STLA 2DMHA 4J3OF 2WNXA 3L2NA 4KC3B 5DQ9B 1EGJH 5IROA 1AMXA 4QPKA 1BQLH 1LO2L 3M8OL 4RQQB 5AKVA 3FL7A 4LEBA 4QOKE 5L4IA 1LEKA 4B95C 3VD3A 4GS7C 4NJ9H 3GHEH 5I16B 1KB5H 1D6VL 2QADD 5J9PB 3UM7A 4KI5D 3RVUC 3UAJA 4XWGH 4BINA 4FZ8H 3T8VA 2NTFA 3OKEA 4ZHQA 4B9PA 1FL5B 4IGBC 2OSXA 4JLRB 4F15C 5GGRB 3F7PC 2NR6D 2ZYRA 1XT5A 1VPOH 1JVLA 5E7FA 4M03A 1XEUA 1H2LA 2FX9H 3ZHKA 4H7VA 3Q2LA 3ILQD 3MSPA 4QCIA 4X1KA 4Q97A 5HGHB 3VXMA 5LMUB 4TQFA 1HCYA 2QGBA 3QZLA 3FK3A 2PCPA 4U0RC 2EO1A 5FYLD 3T0VA 2X4OB 3OJDB 3VFSA 3RDTC 3VSUA 1ZEAL 4GQ9L 3FTYA 1KBVA 5IQ7L 4AI7A 4DGIH 4D8OA 3TV3H 4JQIA 4OV5A 4NTXA 1A6AA 1XGTB 2E46A 2RFXB 5F1IA 1KIRA 5LGJB 3A67H 1ZA3B 4PEEA 3G4SV 1K3ZA 2P67A 1FKAO 3WGVB 4PRDA 3RJDA 1IM9B 3JSNA 3JALB 4UT7H 3X3GH 3QNFA 1XZ0B 3M99B 4ENEC 5DJ0B 5IFAH 2RCVA 4P5KA 2BNRA 1BAFL 1FN4A 2MPAL 4E5XB 5J13B 1M6UA 3O4LD 3BKMH 1XF5A 3PDOA 5AKTA 3HJEA 2AQQA 3WFDH 2VLRD 3HS0C 3WXVL 4KKZA 4FP8L 4JFED 2JCCF 5JOFB 1IVTA 3DX0A 1KJ2A 5EEYA 4L4VD 4R50A 5DZNA 2QWNB 1PZAA 3BVXA 3BSGA 3M6DA 4PS7A 2Y2YA 1KT2A 4PN6A 3ISWA 3RWGB 4O02H 3DRQA 4F7MA 4NNYB 1BGXH 5L4FA 5C7ZA 2IMNA 1WBYB 3MV9D 3AG7A 5D1XC 3U6RB 2Z91B 3MGTA 1G7PB 3ATBA 3GMOB 4U7KA 3CC5B 2AXWA 1UB6A 1DQJB 5E1AA 1BQSA 1ZK5A 3L16A 2OJEA 3VA2C 1BX2B 4WNSA 1U8LA 4MA3A 3A0OA 4U1IB 1TPXC 1INDH 3N04A 3ZE2F 5FKAB 2X7LA 2F23A 1V7NL 4LF9O 1WB8A 5F7DB 2VJXA 2V2TB 2RH0A 1IKFH 4FFVD 2RN9A 3T6VA 4D0DB 1OSPL 1KJ3L 4FHKA 4GG8A 1HH9B 1M56C 4BFIB 4RAUB 4J1UB 3AG3B 3RVZA 3H9SA 2BIMA 3QJUB 1HINH 3UTTB 3CMGA 1ZS8A 1NQTA 4JI6O 4S0SD 4HOXA 1SOQA 3B83A 2WXFA 3L4TA 3UBFA 1TEYA 3V0IA 4UNUA 3BVDB 4GKZA 2ZINA 5I17B 1FZOA 3C8DA 3L8QA 3K6IA 1JYWA 4Z7VE 4CNIA 3AUVA 4GO9A 1RJLB 2PW2A 4AMKL 2X1XR 1FD9A 5ESQB 5EU5A 3UDWC 1HJCA 3MBWB 3H56A 4IRJA 4WI8A 4WFHA 5HSFA 3L4WA 4YC2C 1TVDA 3VQXA 1F41A 3RT3C 4I1PA 3DSFH 3EJYC 4FYRA 2VW6A 4LBAA 9CGTA 4KBPA 4IK6A 3PHOB 3K79A 2DQIL 1AO7D 3LKSA 4XVUC 3ATFA 4HGWA 3L74H 4K94H 2VS0A 4NUJA 3OTFA 3IGFA 2VKXA 4GAGH 1RM1C 1IAKA 1BGXL 2W88A 3ARYA 4DCQB 3QIWB 2CUIA 1AQ8A 8CGTA 1WA1X 1QFUH 3BYYA 1R19A 3QB7C 4GFTB 1MWAH 1RMFH 1HE8A 3C6LB 4QUOA 4M1DH 1OE3A 2CRMA 5JW4R 4Z7NB 4ZNEA 4LHQB 3I75B 3GB7C 2W65B 1MXDA 3L7EB 2CK2A 4HK0B 43CAA 4AKQA 3G5ZA 4A2GA 1NBVL 4G7VH 5FYKU 1F6AB 2ZSVB 2X4SA 5A2LH 5CWSB 2Z4QA 1BFVL 3KPRE 3T65B 1A4KB 5C6PB 3OUSA 4K7PL 3B77A 2EIBA 1KTBA 2AV1A 2VLJD 4MWFA 1Z5YD 3E6FA 2M2DA 1CL7H 4Y4FD 3TN0D 2YIAA 3BMVA 4QEGA 5C0JB 5BZWA 1KCRH 1FA4A 3O3AA 5I1HH 2DTMH 4QHLB 1CDGA 2HMIC 4OJYA 3HVNA 4Y5VA 3ISRA 3CDFA 2Z65C 3DI2B 2ITDB 2GUZA 2XQYA 5LA6A 4I18B 4X65B 5IVXB 1WFMA 1NAMB 1VFBB 5IYZA 4LF4O 2VH5L 4XCCL 4GRMB 3W7SA 5IROC 4YOKA 2MRYA 1W72H 4LL1A 5D7KD 4WRLA 2BINA 1ZT1A 5AWNL 1EZLA 2D0GA 5FXCH 5DEFB 3QIUD 3L3OB 3MRHB 1NCCH 2BP0B 3APFA 4R4NC 1UM5L 3SGEI 2QZQA 1YECH 4GAYA 4FLWA 1FH5H 5F70A 2BSTA 4LHUA 4PRPB 5A2KH 5C0FA 3S3PA 3N50A 5FYJU 1OE2A 3JZYA 3LKPB 5CBHA 3MRJA 4MA7L 2NY5L 3DYMA 3TYFB 1I75A 4GCZA 1FDLH 4NKMA 4ZPVB 4MVSA 1WC7A 2MTPA 1WAPA 3V6BR 1SQXH 3Q2WA 1QVGU 1RZGA 1E5ZA 3QORB 4GZRB 2F1BA 2HAZA 3FUFA 4PB0L 4R0LA 4R2GB 1N18A 2CJTA 3RKPA 1H8EG 4RX4D 3C8KB 2XXCB 4PRPE 3C60B 2OCFD 4HUMB 2ZWSA 4YL9A 1GTNA 1BOYA 3MCKB 3DSFL 2VXSH 1KC5L 1JNHA 4DV3O 3O6KL 4DK6A 2JS5A 1HEJC 3WFEH 1KJVB 1HEZA 5J3HC 2JJUA 4NUMA 3KVPA 4NS0A 1IC7H 2E0PA 1SA0B 2Q67A 2VR3A 2ATKA 4XMUA 5DHMC 4FQPA 4ZG1A 4Z1VA 3V5DB 3P4NB 2X05A 5CJOL 1F11B 1CGWA 3D69B 5D70H 3V6OC 2VDNL 5KAIZ 1EXUA 2VNCA 2KPNA 3JWOC 4OZGB 2D0HA 3BH9B 3V4UL 4H44C 4A6YB 3Q6FA 1VDGA 4M8UA 5L8LB 4UQ2A 4O00A 5FGRA 1CO1A 4LEOA 1U8KB 4LDLB 2E6QA 4OLZH 4PLNC 4LLYA 2ATPB 2OI9C 1WA2X 2NW2B 3A0RA 4NJAH 4NRXA 4TQEH 5D1XA 5I8OH 1QCEA 2UXBO 4FQHB 4HUXB 1NC2B 4G7VL 1TIUA 2CDEB 1L8DA 4TMPA 2XTJE 1GO3F 3MRNA 4NQUA 4HJEA 3ZK0A 4A63A 1MNNA 4J6IA 1CBVH 3D3QA 4HU8A 4ANWA 1F4MA 2NCMA 5FA3A 1DVUA 2BOLA 3CFMA 4KJWD 4JGJA 1FAKT 2GUZB 4QJ5B 3SKOB 4CSTA 3IT8D 1DN0B 4HLEA 2RQ8A 3L3IB 3QHFL 4HCRL 5IYZB 3ZE1B 1RJZA 2NY3C 4L8SB 2PPDA 3GO1H 2CTQA 1KEMH 5DCCA 2DKMA 3OR6C 5B38B 4M43H 5HGBA 1O5DT 2NR6C 1SHXA 4G11A 1XGQA 1OO2A 2G2NA 2QQNH 3ZHDA 2AJZA 1OAQL 2VZUA 2YA2A 3O2DH 5FO2A 4F7EA 5I9QC 2FB4H 2PY5A 3KVDD 2R9HC 4PD4K 1WIPA 3GMPA 3OLGA 5H37G 5BVPH 4O9HH 1J5HA 4TS6A 4YBQC 2X87A 5KBDA 4WCEV 3UAJD 3BWUC 5F1OB 2JKNA 4ODBD 1F42A 4LBEB 5J7CC 2D3LA 1AC6A 2FVNA 4TNFA 3VM5A 3G08B 4TN9A 1XD1A 2X4TB 4YO0A 3ZL4H 3JASA 4BQ9A 2Y7SA 3EBIA 3LKNA 2A3QA 4G28B 4POYA 3HMXA 4IJ3C 4HWZA 1KN4H 2ZKHH 4CC5A 4PGJA 3K58A 3LXBA 3ARGC 1VESA 2AXJA 3FTXA 2HR3A 4K3JH 5BVPL 5LKNA 2Y1ZA 3RUGE 3K2KA 3RL2B 5A7EA 1A7QL 4JFYA 2E75C 2ZCLL 1Q0XL 1CT8A 3MA9L 1G9NH 4YGAB 5KVFL 4YEEA 3OX8B 4QY8A 5C0DB 1G7LA 2HVKB 3IXTA 3VG9C 1RUMH 2VZSA 2WWWA 1AI6A 4W4OC 5T1DH 1LK2A 2N56A 1A1NA 4WWNA 5D1ZA 3WFCL 3WUWB 2P7TC 3JARB 4PJHE 4M8QB 5E2TH 3RVWD 3IBOA 1HYSC 1TTUA 2ZXEB 5F97E 4JI4O 1S78C 4KRPC 3KHQA 4XAKD 3P3TA 1R1BA 2FGWL 1Z3GL 4LFCO 3WD5H 3U82B 1AXSA 1SM3L 1E6OH 3VGEA 2DQFB 4L4VE 1HNYA 2WJ7A 3U36A 3AK1A 4LOUC 1AROP 4AQOA 1A4JA 1G9NL 2PWFA 5FC9A 2DOSA 4AXWB 2NRDA 4RAUA 2GEEA 5I8KL 4UU9B 1LNQA 2NY2C 5EWIL 3WBDA 2ZNIA 4OLZL 1MHEA 3BLPX 3GVMA 5E8DL 1ASPA 3D85A 5D2NA 3IXAA 4FNLL 2WANA 1WZKA 2JJ1G 2ZOKB 3FW6A 5ADPL 5JIQA 1JPXA 1NGYA 3HB3C 5DT1H 3PN1A 5BJTA 5MEND 3KCXA 4FQCH 5E6RB 5HI3D 1Z3GH 1OP3H 5IR1B 5AYUH 3BXNA 2VXTL 3MLSH 3SKJH 4X5RA 4FFKA 1NKRA 1LO5B 2YXWA 3OGOE 3DXAD 2OFQA 5JJEB 3S3DB 2D03H 1CBVL 1NTMH 3MROB 4LF5O 5B7EA 4MYPA 2H2SC 4DV1O 1DSWA 5HHPB 1S9YB 3K3WA 1QPKA 3ULAB 3OPUA 3E1ZA 1E90A 5J12B 1EPFA 1SJVA 1AJPA 4GT1A 2H3NB 3MNMA 2PETA 2DWXA 2ARWA 4ELKB 2CE6A 2C1PA 1W80A 5EBMA 1OZTG 2ITFA 4APXA 3HKEA 1G4RA 3BX7C 4AJ0A 3DJZA 5FDYA 1KBGH 4IQHA 1FVEA 3K2IA 2QHLA 3A3YB 3MV11 2IPTH 4GG8B 1CXKA 1K85A 2IAMA 1QSEB 2QKSA 2ZSWA 3MLXH 2A9CA 1M53A 3CDGB 2Z34A 4RFNB 1GGBH 5FUCC 2EDMA 3HI6H 2AQ3A 1LR1A 5GTIZ 4WKXA 3C75A 4XNBA 1GPOL 5LGHL 5IF0B 4JFPB 2D73A 2XTSA 3DXRA 1JRHH 2F4VO 2EJRA 1VQLV 4FQQB 2HRPL 5KHIA 1M05B 5F6HI 5BV7H 3NN8B 3TBTA 1RJLA 1Q43A 4KJYA 1N36B 3VAEA 1MCPL 4P5MA 2JJWA 2ATKC 3BKYL 4WWID 2X38A 3UG5A 1S5IH 3CSYB 4WFFD 3IDJB 3LS5L 2MOGA 4ODHH 5MERA 4ZO9A 3O3UN 4EI0A 2K3HA 4MCZA 4JI3O 4JZJB 1UOKA 4KRLB 2N04A 4XVUD 4PRPD 2OLDA 1EV2E 3E38A 4HEMA 1SUJA 1BV8A 4HPOH 4CSZA 3IPEA 3ZN0A 3L3OC 4X5PA 3SHSA 1CDJA 2ZWZA 5CGYC 1J5CA 4W4LA 1FNSH 5A6LA 4UVCA 1VZHA 2OSLB 1KNOB 3OD4A 2LQRA 1Q72H 4GSXA 3UT5B 5IB2A 1Y74B 2QWPB 4Y2DA 4HZLB 1IBLO 2P8PB 4K9EL 4BA0A 1E5AA 1KB9F 4GP4B 2HJLA 2YZ1A 1GSMA 3BIBX 4HYTB 5C0CE 2R8SH 2YEVB 1FYHB 3HC0A 5E8PA 4P23B 1EDYA 1BVKA 3B8MA 4ACTA 3Q4HA 4LLWA 3ZHQA 3KZ8A 4CMHB 1B88A 3ROOA 3E6FB 3OAUH 3B9KA 4W9JC 5LJYH 1NLDH 4YSOA 5CA1B 2B15A 1HXMB 2XWCA 4YHKL 3G71V 3BXNB 1BPVA 1IB5A 2W60B 3MROA 1QSFB 3P30H 1QLFB 5D7KE 2EIKB 1S8DB 1D9KD 2QGNA 4NQSA 4MAUH 5DHVB 4Z6AT 3LQAC 1H8OA 4QKXB 1ET7A 3RUGF 2UUAB 4D0CA 4Z7UF 2NZ1A 4I4TB 3MNVA 4GRMA 3GWKC 5KG9A 3BSZA 2QHRH 3NJFA 4JFDE 4QGYA 5C7XH 1H5BC 1QR1B 4FFTA 1AZZC 4MKMA 3KWVA 3WTTA 5EUKA 1FV1B 3PV6A 4Q7DA 2ITCC 4J80A 1KV3A 3K6FA 3N91A 1A6UH 3FJTA 2FHFA 4LKXA 4I0PD 4O02B 1TJGH 5EC2B 5IB1B 3K6NA 1WCBA 3BKCH 5EEXA 4JUTA 3EW3B 4PJHF 5IWAB 4ZOLA 3AS3A 1BJ1H 2VM4A 3SDDC 1KGCE 1LD9A 5E6IC 4ZUUA 1KIRB 3QUYC 3DMMA 5F8RC 3ULUC 2PKDA 1DVQA 2BCKB 5CD5C 5D96C 3EH3B 1AG0A 1V05A 3VSVA 4ZD3L 1CN4A 2P80A 5JOEA 2B2XH 5KJ4A 1O7VA 4MQ7A 3ELQA 3MO1B 2BMKB 1OD7A 4Y5XA 5D5MF 3S6CA 4TLSA 1ZRUA 3PGCB 4X6BB 1RSFA 4LESA 4C83A 4NO2B 5F3HB 2QPFA 1M7UA 1MFDL 2YOCA 1FZKB 3FO9A 2HFFA 3FTSA 4P4RB 2B0SL 1JR9A 3R8BB 1XL6A 3MCKA 2BVEA 4AEEA 1QFUL 2Z7ZA 4ABMA 1HW7A 2J8UA 3INOA 5D2LB 5DGRA 4W6YB 4LDOB 3UJTH 3FQYA 3HG2A 4OZFG 2AJSL 2OTUB 3MGAA 3RDTD 5F7EH 3KPRA 1X5HA 3D25B 1YPZF 5KVEL 1WUNT 1TYRA 1X4YA 4X80H 4BZ1A 2UZYA 4GW4A 2OJEB 1BG9A 4XMXA 1JYXA 1BFOB 4JI2B 2X9WA 4XPHH 1R24A 2OL3L 5FYKE 4XN9A 3WS6A 1ZHLB 4L37A 2RR3A 1UEYA 5GSVB 1XMQO 3GBEA 4LSSH 3LNMB 3CZLA 3O0RH 4PCSA 1KGCD 1D3CA 3DGGA 3OXRA 3SE4A 1MCOH 2WO3B 1G0XA 1L7TL 3TK1A 1ORSB 3FFDA 4WV1A 1D9KA 1MOEA 2B59A 4YBQD 5EIQA 1UGNA 3V95A 5JIIA 2E76C 2OMYB 3GXNA 1UD5A 2ICWA 4LCWD 3OKYA 1AYRA 1MCWM 4FFZH 2EZOA 5ISZE 2C1OA 3JTSA 2KZ1B 5KS9B 5LHDA 2UVEA 3L5WA 3EFFK 1V27A 4P9HC 4PUBL 5G2NA 3DYOA 1MAMH 4GXVH 4JVPA 3HAEA 3F00A 1VMGA 2R2EA 4NJ9L 4XCNA 2L0DA 1ZTXL 3CX2A 3H1LH 3OAWA 3PE9A 5D1ZD 2R0ZL 2DQHL 1PY4A 4GLXA 3TBWB 1PL4A 4WFHE 1U3ZA 4OJCA 2IAMC 5INCB 4DO4A 2ZUUA 5EUOA 3ZE0F 2AGJL 2EYTB 2NY3D 1MCOL 4DTGH 2WLKA 3IKCA 3TBSA 1HNWB 2YC1B 4Z7VA 4ZYKA 4OBSA 3KD4A 5JPNB 3ZCCA 4Y9CA 1EIBA 5D93B 3OKKB 1XX9C 4NQVA 1EUTA 4L8BA 4WFGA 1PFOA 2EJ7A 3BP6B 4X6DA 3RILA 4GUPB 4YDJB 3X1GA 2UV3A 2FT6A 4ANXA 3CC7V 5GPRA 3GTVA 2FSDA 3DVIA 1LWRA 2K78A 1AZCA 2RJZA 1JJUA 1OALA 3QXVA 3VQLA 1M3IA 5EF1A 3TT1H 4IW4C 1WLEA 4POZC 1FO0B 1KB5B 1HH6B 2DIJA 1OOAA 5IQMA 4U0RB 2W9LA 1BT8A 1FL5A 1YUHA 4XCFH 3OMAB 4YHLH 1F8TH 4CDGC 1NOAA 3V6ZA 2CR3A 2DKSA 5MI0C 3D50A 4KZCA 2JNZA 1L0XA 3QHZH 3QJOA 3L1FA 1ZWIB 2ILLA 2ICWJ 2CJUH 2JXMB 4I55A 2VZTA 1VQ6V 1FYJA 2ZE7A 1ZLSH 4EBQL 4N2IA 1PKOA 2NYZA 4P2OA 3WXVH 2DM2A 3U4BL 2JGDB 3ROLB 4IBWA 3S8FB 3CEIA 3VXOB 4Q14A 5FWQA 2CK3G 2JQAA 3D06A 2ITDC 4EZJA 4EFBA 4OV5B 1AMYA 4FFYH 1JTPA 5E1QA 2HVKA 3IXTB 3UXFA 4I7ZB 2A9NH 2DIAA 3AG2C 1ROCA 1NGQL 4LSQH 5FO7B 3U2SA 3RTQB 7PAZA 3ABMB 3KYMA 2ZDIA 4WI0A 4A1RA 1JJOA 5LWYH 4Z9KB 4DV1B 1UD6A 2VDRB 4UCVA 3CZGA 3AGVA 3T0ED 4HKXB 1HNWO 1J1XH 1E4KA 2Q2EB 3BVVA 4NXKA 3BGAA 4DKTA 3JV6A 4JFXB 2AJ3A 2K0RA 2JK5C 1J88A 4MX7A 4CC4A 3PFUA 4JYAB 1T1ZA 1I0HA 1RPUA 1EDQA 2Y3NA 2IH1C 5EBGA 3SDYH 4AIEA 1BD2B 1JZ3A 3GPSA 3MOQA 1DZ0A 4ATWA 5C8JA 1AP2B 5FYLL 3I74A 4Y9BA 3RGBA 5SWZD 3KL0A 1FZMA 4X7SH 1SC5B 3O4LB 2ZJSH 4JL1A 5K59E 2B1IA 3V4PB 1Q6UA 2F61A 1WN7A 1CD8A 4X9IA 4ACPA 3FUMA 5T3ZL 1AHWA 2OP4H 4FMVA 5JQGB 3J07A 1IC1A 3ZZSA 4FFWC 2KLRA 4WEUD 4ODSH 5CZXD 5DQDL 1CMOA 1SEQL 3QQ9D 5DWPA 4P5MB 1K2DB 1B2YA 5E1AB 3QNZB 4OM1L 4NP9A 3IJ7A 4E41E 4JI8O 2ICWI 2WXKA 1OGAA 4EI5B 1H8HG 1Q9WA 4JYBA 3JAWA 4Y9GA 2NUTA 4OJEH 1XGUA 2WXQA 5ERWB 5IQ9B 3LKOA 7PCYA 4DK1A 1F1GA 3CYOA 2X6MA 4IGBA 3JAMN 2HPTA 2VB5A 4AV0A 2Z0AA 3HOGA 4YBLB 3S35H 2IAMB 2Q7AA 4OZ4B 4JANB 4GRLB 3WFHA 3QXAA 4P2QD 4YDKL 4P46D 3GI9L 3V6ZB 4OCWL 3RDTA 2HG5A 3KGSA 2WB7A 3W7XA 2X1OA 1BECA 1Q38A 4PI2A 1A47A 2X0VA 2A73A 1JPST 1TQWA 2HT3D 3OJ2C 1LQBC 3N9GL 3L3GB 3COOA 3MA9H 3QXWA 5D71L 5DUJA 2QE7G 2ATPA 3I9GH 3ZMUA 3B8SA 1UADC 1XB3A 2YQ3A 2VLRB 4NEHB 1JHKL 4JRWA 1DUZB 1URLA 2WN2A 2YPLD 4KXDA 4PG9B 5BQ7A 4I5BB 1W0WA 2GITA 4JNXA 2AZAA 4UMSA 4WNQA 4HSCX 4N90D 1GC1L 1CTOA 5KVDL 2CH7B 4ES8A 3S9DB 5KBMA 4YC2B 4LPTA 4NO0A 3WIHH 1ZWIC 1IM9D 4ZOEA 3NZUA 3V6FB 3CXHF 5IE9A 3FRUB 2G5BB 3SE4C 2CIIA 1XQ4A 3EF4A 4OZGF 5CS7A 3VI3E 3ZE0E 4LCWE 2FUQA 1AVMA 3E35A 3DMMD 5AW9B 3RGVC 1PZSA 2GIYA 2L04A 2ZP8A 3I6LD 1E7VA 4K23L 4WHYH 4JGMA 5EWIH 2VLLA 1N0LA 4UV8A 1MCSA 2UUAO 5IB5A 4LB8A 1QR4A 2B1AH 1LTXA 3CZSA 3H6AA 1JE6A 1SOXA 2QQNL 3BWAB 2BC4A 4PJ7E 5A6IA 1CICA 4K7PX 3NCJL 1Z0NA 2JB5L 4PP1C 3UTPD 3G5YA 3KDMA 1MI5A 3NACL 1HU8A 4OBRA 4BW5A 1NGXB 4JEGB 4AIZB 1OAZL 3SCMC 1PYWB 2IVFC 3UYOD 5AENA 1I1FA 4S1SL 4ZQKA 2XYBA 1K2DA 2OULB 4HEPA 4LLQA 1YQVL 4X2UA 4NBZB 5DC0A 5I15L 2ZR3A 3LH9A 2PO6C 4XHJC 5GGSY 1MG3C 1N64L 4JZGA 4NZRL 1AR1B 1OT1A 1E3FA 1C7SA 3RL2A 5HVGB 4M9PA 2HT2C 1GW0A 3QO7A 1BJMA 4Q74A 4HOWA 5IW6B 1HDMA 1MAKA 1TZHA 4AJWA 2OMZB 3T1YO 3KCPB 4UDTB 4O4JA 3UDWA 4I85A 3SE6A 3L2LA 4S1SH 3ECUA 2R9HD 1R75A 1B4JH 5F1IB 1XZ0A 2KZBA 2Z6FA 1TUEB 1U8CB 4NLHA 1EEZA 4MZ2A 1AZRA 1NOFA 3L95B 2LABA 4PRDB 4S10A 4YDVB 4MQXD 5LBSL 5IESL 5JHAA 2XWEA 4E9YA 2QDWA 5JVDB 3WFEL 1TVHA 3L3GA 4FD0A 1X5ZA 4KNSA 4WGKA 1NKDA 4OFQA 4OR1A 5SWSE 4DJMA 2OR9L 5EIIA 5SWZA 3TNMA 3US1A 5D5PA 4ZTOL 2WINA 3LKQA 5CMAA 4YR6A 5I8OL 4UU9A 4FA6A 2CO7B 2VRKA 4L0YA 2WXLA 4JI0O 4QKTA 5HGHA 3V5HA 1P5UC 3T4AB 2ZDIC 2X42A 5D7IA 2R23A 3HPLA 1UENA 3H7LA 2QV2A 1P1VA 1J1PH 5D1QA 3QYNA 4LFAO 5LL6Y 3X14B 3VD9A 5HYSG 1J0ZA 1NUDA 2YPKA 4YQXH 1NJIW 3HHSB 5MEOA 2VDLL 2QADB 3Q6GL 1N34B 3IF1B 1YTFD 3WIHA 2WUCL 3E2EA 5TGBA 1S46A 2PF4E 4MD4A 3HHRB 1WWAX 5L0QB 4OLXH 4HF5H 3FOLB 4A7GA 5DJ8B 1ZTMA 4MTFA 4A6YH 5DDHB 4B3RB 5EU3A 2DD8H 1KB9J 2GJRA 1MHCB 3BH8B 1OL0A 4HSAC 4HGKC 4J3OH 5I5RA 3PWPD 1DQDH 3Q6FB 5EEWA 3UAEA 1FIEA 4G2KA 2CBMA 5E6SB 3DUSA 3WNMA 3FO0L 3ZTEA 2QLYA 2LLNA 3VNYA 1OGSA 3G5YB 3LN9A 4X7FC 4CRPA 1U0QA 2NXYB 1WICA 2DH2A 2BNRD 4PU2A 4Z0BH 4M62L 4M43L 4PYHA 3REWA 4JCMA 4X98A 1AJQA 1JZ6A 1SDYA 1CFQA 1FLTX 5I17A 3SD2A 3FT4B 3FT0A 3SZKC 3B1TA 4CU7A 1GL4B 1JXKA 3GINA 2BLFA 3L71H 4J11A 4N21A 3FHQA 3NACH 5CSBA 1GHFH 4N0FA 4TV8A 4DQAA 4KHPB 4XCNB 4M5ZL 3UJIH 4ABWA 5KTEH 2R69A 1SMDA 3BAEL 3VGFA 3M17B 1BQUA 2XWXA 4PVNA 2LTQC 1BF8A 1RZKH 3DC6A 1K8DB 1L9RA 2HKFL 2JKIS 3TA4D 1EX0A 1DUYB 5KBLA 1PIGA 4XBMA 2X7LB 5I6NA 1R34A 5D4HA 1GGCH 1P6FA 5ETUB 4B7LA 2WXNA 3FUIA 3J8F7 1WAAF 1E40A 3D51A 4NSKA 1J18A 1UFGA 3BFOA 3V8OA 2K3TA 2IG2H 1NQBA 5LGUA 2EEXA 4M6ML 1HOCB 4YPGA 4KU1A 3O0LA 5F72S 3SY6A 4BH8B 3RVTD 4F33A 2X4QA 4A67A 3BPNB 1PZUB 1SJMA 1OM9A 3KWTA 2WXHA 1H2GA 4X9FA 3W57A 2ESVA 2A99A 4L23A 4J3OC 4A68A 2N01B 4KX7A 4QYOA 4R5TA 5DHXB 2BWDA 3OEEG 4F7TB 1PLGH 1COWG 1WTLA 2EIZA 3DVGB 4Z7WE 1OP5K 2AJYL 1HSBA 3DTUB 3IJHA 4JO1H 3KPPB 3V52H 5CA0B 4IOFD 3FN0H 2RDCA 2BJML 1ZWIA 1INEH 1D5BA 2MCPH 5TDNB 4JFUA 2WY3B 2IM9A 1PLAA 1COBA 2G60H 3KR3H 3ZVVA 1U8QA 2CD0A 4TNGA 4YEFA 2GAZB 2VXQA 4RAVA 5E23A 5KANG 2Y6TE 3S97C 5JIMA 3M7MX 1RI8A 1W8OA 1S9VB 4FLSA 5A1AA 3HHMA 2AKRB 4G8FA 2MCG1 3TF4A 2JS3A 3L48A 4CN4A 1IBMB 3CP1A 2IU0A 5MENA 3ILQC 1DLHB 3ZKMC 5CEXA 5AYUL 3ZDZB 4Z7UE 4BKLB 1R0AL 1YTFB 2GTAA 1OXYA 4BYHA 2PGGA 5FGSA 3NUKA 1JZ5A 1CICC 1REIA 3NFSH 4P3CL 5BMVA 3SPVB 1WUZA 3SKNA 2N7SA 4GW5A 5TJWK 3TH2T 5HDQL 4WWOA 5FV1L 3VWJA 5ITZA 1RK1A 1T80A 2I60H 1IGJB 1GOFA 1JGIA 2EXSA 3B7RL 3MBED 4PJEE 2ZUSA 3SJBC 1DANT 3FTZA 4OLEA 5FGBC 2VIRA 2Q7EA 1JV5A 3S5LB 1CQKA 5C70A 5BV7L 4O2BA 4DV6O 1H6TA 3UKMA 5D2NB 3BUYA 1DQDL 5GS0D 5HXMA 3IXAB 4D9QE 3GI8L 5DSCB 1SQ2N 4R2GC 3SDLA 1TMCB 1A3ZA 3HUJA 2NR6A 5E08H 1PX4A 4Y5YA 5LNGA 2FECI 4MS8D 5L9DH 1CXFA 4WBNB 5GJTH 3FO2A 4FQ1H 1H3UA 5CKAA 4ZBJA 2FO1A 2Y24A 4XN7A 1JPSL 3QI9A 5D7EA 1BIIA 2ZKMX 5BMFH 1A64A 1IAIH 1W8NA 2AF2A 2FQEA 4TLKA 5EZYA 4XB3A 3BHPA 5ACLA 1J5EO 1RKRA 3OZ9H 3WJMB 3DX7A 5D8JL 4BCYA 3QUZA 4K5OA 4LP5A 4PRNA 4MBRA 3KBEA 3FSZA 4AYFB 1S9YA 5E8DH 2QBWA 3MLZH 4NKDA 5HDLA 3TCXA 2HEPA 3QO8A 2YEQA 1U8JB 2I5YL 5ETUA 1O7DC 2MH4A 2P5EE 3O2WL 3O3DB 5FCUL 1HCVA 1UCTA 3SE9L 1I1AD 1RZ8A 4DPBX 2DYPD 2WBJD 2Q3XA 2XT9A 2R2CA 1G7QA 1Q9OB 4TUYB 4IMLA 4N86A 4BSJA 4A7TA 3F05A 1YUKB 4D7TA 2BSRB 3ASOC 4IIQB 3TH3T 1YMHB 1LGVA 4YHLL 2GTQA 1DJGA 1FGVL 1G94A 2DWDA 4U1KA 5HI4D 3CCRV 4BJLA 2MW2B 4X5QA 1HC1A 4YLCA 4KX8A 5JDJA 4XP4L 1A3LH 3CK0L 4YIQB 4M48H 4XXWA 4G43A 5INDA 1ECZA 2NY4C 4FKKA 4JFQB 3CVBA 4G6FB 4Q9BA 3OHXC 3PL6B 4YSUA 3TGUH 4CMMB 3CUPA 3ZJAA 1YNTF 3DHMA 1DF5A 3UH8A 4FEIA 2NW2A 4R26L 1TZ8A 4KXZI 3IDJA 1B0WA 1OV9A 4PJGE 5CXPA 2Q86B 4LHJB 4PJAE 3QNYA 1PYWA 4KKNA 2Y07L 2IAND 1S9VA 5GXBB 1DUZA 1WZ1H 1R3LB 2M83A 1QI5A 4NNPH 1PTZA 2XXMB 2NXZB 1C12B 1JRHL 2XWBB 3GS0A 3OKLA 4HJ1A 4JFFD 1JHLL 4X1IA 2NY0B 4DKEL 1ZAUA 5LUMA 1EHXA 3GXTA 3P32A 1MVYA 1LO2H 2UX6A 3NRPA 4U49A 1PLCA 3VFRA 5JPNC 1MAML 3QPXL 1X7SA 5D2NC 3PHSA 1QRNA 4L8SA 5I71C 1GXEA 4HZLA 3ZSSA 1IVLA 4N2GA 3LS5H 2Q8AH 1BOGB 4KKBD 3OGCC 4UQAA 1CGSH 5EZIH 1I7TB 3S3WA 1XIWB 4QRRE 1UYWL 3AWGA 1U2YA 3H3KA 1GJUA 5G4NA 5FO9B 3VQWA 1CL7I 2Y23A 4WEEA 4J9ZB 5FKAA 3CVIH 2J72A 3W11C 4D2NA 2VJ0A 3QJHB 1VPOL 4AGLA 1BVLA 4JFVA 3TASA 2D0FA 1JD9A 2YAQA 5C0IA 5CA1A 1UCBH 4AZUA 3GIZH 4IHBA 2A4CA 1YQ2A 3VA6A 4IBYA 3ZT7A 2Q8BL 3MGOA 4PA7A 3GGWA 1ZLDA 1CXHA 4UVBA 3FU7B 4GOSA 4Z23A 1P84J 3JQOB 4HKZA 3BC9A 5JHDB 2A9MH 1R1CA 4KY2A 1DBJH 1OCOC 3K5MA 2VN3A 5CJ5A 1UC6A 4AW7A 3AG1C 2C9UA 4JN2B 4LNRB 4O2CB 4AGNA 1JFQL 2CO6A 4L8CB 2KDGA 1SPDA 1CFTA 8FABA 4O5LH 3K91A 3AZUA 1DVFB 1BM3L 2G0LA 4JCLA 5F9AC 4J42A 3GIVA 4E9RA 3P11L 3N1FC 1U3HB 4K71C 3X14A 3T9WA 5D72L 4QNPE 4U1NB 3ARZA 2OXGB 4E2OA 3O0RL 2BOBC 3DO3A 2H6UA 4JV5B 4A37A 1KLUA 4FQLL 2W91A 3GDBA 4PJAB 4MJ6A 5BOZG 1CC3A 1FFPB 5D7LD 4DXWA 3HE7D 5IEHB 1A0QL 3QAZC 2DB8A 4OCWH 4U1KB 2A79B 3I9AA 4GAJL 3P30A 3F64A 5F9JA 3VVVA 3HMXL 2XN9D 4NKOA 3V8CA 3AVEA 5ACZA 5HI5C 2J4WH 3T04D 1D5XB 3U36B 1Q86W 1MZFA 4G5ZH 4JL2A 4WUUB 2F1MA 3N43B 4JFTA 4FM1A 4A7QA 1ZEAH 4GQ9H 5E9DD 4GMSH 4IOFC 1QVOB 3W7UA 5TF1H 4HAMA 4BIZA 1HQRA 3DUSB 5LN4A 4F1ZA 1UZGA 4Z7WF 4Z8FL 2W5PA 3P11H 4H1LG 4LF8O 1TJGL 4KK5C 3AXHA 4NRZB 1HN1A 1MY5A 5F1KC 4LSSL 3VMNA 1YCSA 4KHTH 5T33H 1SESA 1NL0L 1CLCA 3UADA 6PCYA 1KXTB 3NEEA 4ZZFA 3QNXA 4HA1A 4X1KB 4WCYH 1YMMA 4P57A 1BSIA 4XPHL 5CSZB 3T4ZA 1RFDL 4P23D 2D9CA 4QXWA 5KSAC 3T2NH 1Q0EA 2C3XA 4UB6Z 5B1OA 4FZ8L 3RX8A 4M1GH 4N0FB 4Y2DC 4HUNB 1FWXA 4QGTA 1ULVA 4N6QA 2HLAB 4B3SB 3RUGB 4R4BA 1JGVL 4TNVK 5CJBA 3BAAA 4D9QD 2X4NB 4DPCX 4Z3TA 5DYOB 1KIQB 3SYOA 1UCBL 3CU7A 3JALA 2VDPB 1Z5WA 4KUZL 2NY2B 4Q2ZA 2B0SH 4LF9B 3PF2A 3TWCL 4HIEB 4Y5YC 4XGZB 1M4KA 2X09A 3UEQA 2I7SA 2B7DT 2ZIMA 1JI1A 4KROB 4YJ3A 1CXLA 1DZBA 3EYUH 1LILA 1GRWA 4DKFL 4OGXH 4Z7AA 3G3LA 4U6TA 2ZUVA 1JFQH 1T6BX 4O51B 4P9ML 4PSPA 4DR7O 2WYZA 2GBUA 2Y7QB 3KGUA 1GH7A 2WUBL 4AVKA 2IQAA 1H5BA 2A2QT 3N3EA 1VQ7V 4R7LA 1D7DA 5DJDA 4GKKO 3Q9PA 2VN4A 3DK0A 1K4DA 1QQDA 3CFBB 1MCKA 3AXIA 3DJSA 3RWDA 3D85D 4MNGB 2V4LA 1N0NA 4QRUB 3D3VB 2I26N 5IBLD 4TVSa 1HAWA 4X66B 3PU7A 3QXUA 1AO7E 1GGIL 1NGZA 1L1FA 1OSZA 2WLZA 3QG7H 4F7CB 4FZEH 3V7MA 1W0VA 3QUYA 2DQCL 3L9YA 4DR2B 2MKWA 2FIKA 3MRCB 4KQ3H 4N24A 5D7JA 4QXTB 3ARDC 2E7HA 1J1XL 2VZOA 3RFZB 2P3YA 4DUYB 1XAUA 2V2TA 2VR5A 4ADGA 4MA1C 4Q6IC 4GQZA 4CC1A 3MDSA 1SYVA 3DARA 3QQXA 3T1CA 4I5BA 5EUOF 1TGOA 4LPVA 5EO0A 3WCYA 2PCFB 1E9PA 3SPVA 1D5XA 3V5DA 2ED6A 4GP8B 4ENED 1S72V 4WJKB 1A22B 1L0YA 3AG3C 2ATKB 4OZGA 2X4RA 5E1IA 4MB4A 2F66C 4UB0H 4WHDA 1J0YA 3P4NA 3JSLA 3MZTA 4GKOA 2OIEA 5KSVA 2AEIT 3WB2A 4XVTH 3U4AA 1T0NB 5T5NF 1RUQH 4OZHA 5DHDA 5JNYA 3VRIB 1CEZA 1H3PH 4GMTL 5CCJA 4JRYB 3LDBC 4TNWF 3VGAC 1W72L 3ZS8C 1RMFL 2P9RA 3P3YA 2IQ9H 1MZYA 5I1DA 5GHWH 4I0XB 2F18A 1CIUA 2IJKA 2FLRT 4RFOL 5K9JL 2GTWB 4JX0A 1F4NA 5C08A 3LAFA 3VU2A 3FQRB 5JMOC 4MDJA 2W94A 2F19H 4UT6H 3B2DC 4LF4B 3E1F1 2HHHB 1D9KC 4OGXL 3FPXA 5FF6A 3QUKA 4LKCA 6FABL 1C5CL 2JFCA 5HGBB 2BSKB 3FO0H 4GUOA 4OCYH 4Z0XB 1Y0LB 3K5SA 3N2KB 3BPOB 4YE4H 3BGMA 5B38A 1GGYA 1TNNA 4KQ3L 3RZCB 4AVJA 4LNUA 3IJ8A 1B3QA 1YEEL 3GRWA 2QDVA 1SEQH 2BW4A 2GTZA 2FX7H 4GXUN 5L2KD 1U8PA 3CCMV 3VD7A 3ZRSA 5LYJB 3T0EA 1N8OE 3W9EB 3GZKA 3OHXB 4IHOA 1DANU 3QO5A 1G43A 4UAOC 5F9WB 2NY6B 3IDYC 3G6BA 1JMZA 4NFDA 3E9TA 4NUGL 4HX1A 3E22A 1MFCH 1H15A 1TZAA 2FEEL 2DI9A 2GK0B 2VDKL 5GGVL 5I16A 2TSAA 5JHLH 3DUUA 4LSUH 2IV9A 3T8MA 2WUBH 2CMRL 4TUJB 5AD0A 4L0PB 1P5UB 3QC5X 3T4AC 4IEFB 3DIFB 2WA4A 3L73H 2OYQA 1CL7L 1WFIA 4F91B 5DMYA 3W38A 5KX5B 2YAFA 1K8IB 3D2TA 3GPEA 1ZTXE 3BP4A 3FU5A 2ZF8A 4A7UA 3Q1EA 4UB0L 2PMZA 4DZ8B 5E2JA 1C08B 3MRHA 3AUWB 1PPJH 1WP6A 1KZQA 1CT8B 1XF3B 1FGNH 2YAOA 4I9WA 2KB1A 2G0KA 3ETBJ 3HZKB 2KS0A 4TTGA 1U8OB 1WCBB 4ORGB 4RMQA 4JYCA 4AY0A 5LN8A 4JUSA 3D9AL 3ES6B 3KLAB 1KYOK 4I18C 3BESR 5FM5O 2Y6SC 1B0GB 4CVUA 5AW3B 4QAMB 1JRHI 2AJUH 1KGYE 4AGOA 5DO2C 5ITFA 3L5XH 3F04A 5C0AD 1PD0A 3ZO9A 5F1NB 3LKRB 3MOAL 3PGDB 2XOTA 3C90A 4KK5D 4G6JL 1N5YL 4U4IA 1NCCL 2F7PA 3QORA 2OTJV 5LP6A 3QDMD 4W9ZA 1ORSA 4BSVA 4U1HA 5L8KB 1IRAY 1XCTA 3OTOO 3RBGA 2GBOA 1PGRB 1E79G 5E9DE 3U7YH 1KKDA 1TITA 4GKSA 3BI9X 4H25B 4UM9A 2GPZA 3UERA 5C0BD 2ZUTA 3T0EE 1JZ4A 4K23H 5E8EB 5B66Z 3FUKA 3L9EA 4UI2A 3WE6A 5E9NA 1WAZA 2VSMB 3F7YB 2EDYA 2DZEA 4TSFG 2YRZA 3K0DA 1FO0H 3L6FB 4LWSB 2FEJA 4PLJD 3LUTB 2WBJC 3WE1A 5IKCB 4CC4C 3UFIA 1WBYA 3DJ9A 1VFMA 1IL1B 3PWJB 4NUGH 4MCNA 2RQEA 3FQTB 3NFNA 4WW2B 3DETC 2JB5H 4H0GA 1M71B 1F56A 4YHPA 5DS8A 4XMTA 2ICCA 3TN0B 3BZ4A 3EO1A 3GSNH 3WY4A 4F37F 4JG5A 1IZ3A 5HHME 3FN3A 5I75B 2OMWB 2Q5BA 2JB6A 5EN2A 3ZUCA 4P4KD 3X12B 3WTYA 3F01A 5EYPB 3RU8L 2AEQH 6PAZA 1P1ZB 1X3DA 3BZ5A 4WIQA 1BP3B 2JJVA 4NQED 5DMKA 5GZND 4J1UA 3GKWL 5H94A 1FJGO 1UUSA 4OV6F 1D9KB 1NC2A 2COVD 3PQYB 4PBXA 1WTGT 3O3BB 1MCNA 4K8ZA 2OK0L 4G83A 4ODXB 1G1CA 2WLJA 1KP2A 2F43G 4R6UA 4UZUA 1NGXA 3QXTA 4HHAA 1ICTA 1A2YA 1RK0A 4LH7A 1L3NA 4X8XA 4FQIL 4IEFA 2GYSA 4OZGE 1L5GB 5CP7B 4G9DA 4DWHA 2WSKA 3WJJC 5IT2H 4LPYA 1EM1A 2CKBB 1ZHBB 4V11A 4I55B 4X20A 3A6CH 4CADA 1J5EB 3TBSB 3ZIYA 2ENSA 2IDSA 2HUHA 3Q0HA 3A4FA 3VOUA 1ADQL 4MCMA 2JCCE 2Q7GA 2WXGA 4RAVB 2IOIA 1TA8A 5DI8A 3ZN6A 4Z76A 5B7FA 3OW2U 3WHE1 4G1MA 3C09B 1UWYA 1CYWA 2EDKA 3BN9C 3W11D 4BEIA 2GEQA 3HG1B 2NNAB 1ZANL 1ZVYA 4NRYB 2J6EH 2SODB 5KOMC 3ULVD 1YNKH 3IN2A 3CMEV 4R7NA 5LAPA 2FT8A 2A74A 3FCTA 5DT1L 4FABL 2DQEH 4NERA 1IEAA 4PGEB 3FQWB 1JN6A 4KK9C 4U6XA 2WYIA 2BP3A 4JKMA 2FJGB 3MOBH 3EIFA 2HVJA 1O7DE 2QV4A 2DOCA 3CHOA 1DVFD 4J3OD 4YSPA 5H35B 3B8NA 3VXQB 4AOFA 4OZIB 5MHSD 1C16A 1DQLH 1YY9D 4WTQA 3R06A 3RKDC 2EYRA 4MSWA 4A5UB 5IVZA 3OJMB 2P8PA 4JFYB 4C59B 4C57C 5F6IB 2X70A 4AEHH 2J5WA 1T4WA 1P7KB 1BZ9A 3B9VA 3BDXA 5DK2A 1AYOA 2A5UA 2GW5A 2E56A 2Z8WC 3O4LA 4F57H 3OWRA 2CXKA 4M02A 4QDGA 4XPTH 1NAKH 3HG1D 4FQ2L 3J7HA 5CCHE 4OVVA 5GGVY 1ZVHA 4OLYL 4PJBE 3RFZC 3MLXL 5TF0A 4D7BA 4DP2X 4UTBL 3KPRD 4FQ1L 3B6SB 1OW0C 4ICWA 4UOW0 5CZXC 5DJZB 2OIGA 1T3FB 3BZ4B 4OIIL 3V4VH 1OWWA 2NXZC 3C5SB 5EU6B 1OAKH 4TPRL 4LSRH 4FNLH 5CBFA 5KVFH 3ZRVA 3NSYA 2DQFA 5K1JA 3L3HA 4BWTA 4MMXC 2GI7A 3K9SA 1LUVA 1T5KA 1RUPH 2EH8H 5BUGA 5KJRL 4OD3H 4U0QB 4HKBA 5CM1A 5IJKA 2A4ZA 5FEBA 5I28A 1CFSA 1NEZA 2MKLC 1BBDL 4BIOA 1S7SA 4N8VG 1JF6A 15C8H 5KYXB 2IADB 2HKFH 2ZX7A 4K0KB 5DFWH 4QXGH 4F7PA 4IRZH 4CDHA 3P3SA 3TURA 1MREH 3GBMH 1GM7A 2HG5B 2YD4A 1L9PA 4I1NB 1OWRM 1EANA 4G7RB 4ZOLB 4JVWA 1OJHA 5TE7L 1AGBB 1HR0O 5E8OB 4QR7A 5JR1L 4MNGA 1TU2B 2E4FA 1BQHG 4HISA 2BNUA 4JAMA 4N8PA 3WNJA 2P43B 3WMPA 1MIML 2NY5C 3VFPB 5D1ZI 5I23A 1NBZB 2QQLL 3CC4V 3WKQA 5EOTB 2Q3ZA 2H9GB 3FMGH 4F15B 1AGCA 1IQDA 5DJ6A 5EBMB 4APXB 4KKLD 3BE1L 3IMUA 2X7RB 1WBZB 4YY3O 3AQXA 3MC0A 5FO8A 3HNSL 4Y4KD 1RPOA 2LO1A 32C2B 1R3LA 5H2BA 1TLKA 1WJ3A 3QDME 3SEPA 4EZMA 1UPGA 1M6OA 3E83A 4PDMA 5LP6C 1GS6X 3ULVL 4F57L 1UGKA 2PLTA 2AVGA 1MW1A 3RW0A 1SF5A 2VW4A 4HUKB 5FUCE 3ATDA 4FQXB 1M42A 1QTSA 3C5ZA 4DO5A 2FE0A 2VLKA 2XY2A 4OAWB 3HPLC 3GHPA 2X6VA 2C9SA 2HHHO 2DQTH 2Z4TA 3V0VA 1G7JB 4XZUA 1EZSA 4NQEA 4Q58C 1DVSA 4UAOB 3CCHB 3GJEA 3MJ7B 2QQKH 3LQZB 1KJ2H 3BWAA 4YL4A 1DP0A 1D5BB 3QDGB 1U8MB 1O5PA 2EH7L 2WVSA 1N5AB 1I9RL 4WU7B 4Y19B 4L05A 4DOHB 5IHBA 3RZCD 4GI8A 5J2TA 1L6ZA 1CLYL 3IJHB 3MOBL 2ADPA 5C9KA 3D8CA 4GQQA 3P69A 2V3DA 3MRGA 3CCUV 1W72A 2NX5D 2YS4A 2Z1PA 4ODVH 4UQIM 3ZTJG 4PY7A 5F7LB 4DO6A 3MJ6A 2OQJB 3CAFA 3EJRA 3F7VC 1TTCA 4Y4FC 3Q5YA 1GPOH 1C7TA 1CFNA 1Q72L 1EFXD 4MA8H 5HHMD 3U48A 5B39B 1A1MA 3MRPA 4ZS6D 4N6RB 3H4HA 2AJVL 3WY2A 3W7WA 4UV7H 1OTTD 4JZJA 4PJ8C 1FI8C 1NI8A 4JFDD 1ZLUH 5CFHA 3D05A 4YDIH 5F9OL 1DLHA 1WO2A 2BPBA 4U1IA 3VGDA 1HJBC 2IF7A 3VRLE 4XHJD 5FF6B 1J9SA 4XMLL 4C56E 1AIFB 3QPKA 3QZWB 1CDYA 2TSBA 3F58H 5D7LB 4YS4A 3U10A 5KEZA 3R8QA 2QQLH 3ZE1E 2QGDA 1J8HB 2QKIA 3MBEB 1QW8A 4L29B 1TVBA 3ESMA 3PRZA 3IFXA 2YWYA 3AK2A 1NBMG 3CWBH 3D0LA 2OXGA 4M61B 3CSBA 5LOVA 4RGMC 4PJAA 3T4YA 1BEXA 4N0YL 2HVBA 1MWAA 5E99H 2VXQH 3CG8A 3MRBA 2IWFA 3DVFA 3V0GA 3H9SB 3T1HB 4OX9B 3LOWA 4DN4L 2R56L 4F1SA 4DVBA 3LKNB 2AANA 4IRZL 3LZRA 4HIIA 2CPCA 3S4SA 1ANUA 1HZHL 2MOQA 3P2TA 3AREB 4RISH 5EMYA 2DL2A 1EN4A 1DLFL 1MZEA 4MNQE 3MV7E 2CO7A 2HT3C 5DU7A 4EDWH 5AAMC 4CSPA 3A0HZ 3J7AU 4W9GC 3SKMA 3O41B 4Y8AA 3TZVA 3ARRA 2YZ8A 1JUFB 2QPDB 3KYAA 2F0CA 4CC0A 3RL1B 1AE6L 4W9FC 1FG9C 5KJ7E 2WBJB 2HPOA 4HS8L 3QG6B 2CR6A 1BAWA 5F7WC 3THMH 3R1GH 3WUZA 4ZXBB 3DUHA 3GWOA 1NZ6A 4C56D 2WV3A 3KL5A 4H40A 3HHSA 5MEOB 1P4BH 1RV6X 4YHOL 1MHPH 1S7WA 4IIQC 4EI6B 1DQMH 2JIXD 4MXQD 2YMXL 3GZOA 2F54B 3VXUA 3LQZA 4MA8L 4GRWH 4NNPL 1SVBA 3TV3L 3W0WD 4ZKIA 3FO1B 5FB8A 4FM0A 1ETB1 3NDYE 4G6FD 3LZOA 4L1SA 2BXZA 4X6BA 3JCUZ 3QQ3B 3QZWG 1MQKH 4KROD 3EJSA 4X98B 4PJ8B 3IJYB 5C0JA 4DTGL 3BD5A 3B1UA 3KBFA 2EH7H 2NPLX 4IOIB 4PJIE 4HOZA 5JW4Q 5AVSB 2QPSA 5SV3A 5FUZL 5IFAL 1A6VH 3VWJC 5FUOH 5E8EA 2F19L 3GB7B 3NIDF 4OD1L 4UT6L 3WE6B 4MNHB 1FJ1A 2QWQB 3ZDYF 2BVOB 2GIXA 4ZBMA 2XAGA 2GJPA 4PJEA 1VB9A 2QVFB 1MCHA 4M7JH 1DVZA 4PTTB 2AHIA 1UB5A 2AJVH 2VDMB 5JLZA 1LP9E 4MD4B 3RNQB 2AABH 4JDTH 2Q8VA 1AQMA 1OSZB 2DM3A 1AHWB 1X9QA 3X11B 4P2QE 3FB5A 3QUYB 1IBFA 2K1EA 2VSKB 2FX7L 3QUMH 4DN3L 2UXXA 5MENE 3ZKMD 2K70A 3QQNA 5FK9A 1RERA 5FHAH 4Z8FH 3FXIC 4RMUA 2NZIA 3UTQA 1DLFH 4TLUA 1ZGLP 2EDRA 4TL5A 1NPNA 5AZUA 3STLB 1KELL 1DF4A 3V4LA 4MTOA 3W3BA 4WSJA 4PS4H 3S8WA 4HLZH 2HKAA 3E86A 4F6RB 1ID5I 2EKJA 1KCUL 4R5XA 2VXQL 1T20A 2CLRA 3KGTA 1YHQV 2Z9TA 4L3AA 4UTBA 4FOMA 2R2HA 3C08H 1II4E 2D31A 3LS4L 2F4VB 1CGUA 1HWHB 2Z31C 4P2OD 4Z7OB 3TJPA 3NG5A 3ZYJA 1UA6H 5D7JD 2EUVA 5AVXB 2DWDC 5C0EA 3ZKNC 3CFKB 1DUYA 5HVFB 2BERA 4OCNC 4JY6A 4JO3L 1MSWD 1SRDA 1KJVA 1KACB 1RUQL 1NFKA 3KBPA 2GAZA 4N85A 3GUTB 1U3HA 4B3TO 1ONQA 1E67A 4TOIA 2BSSB 5HDBB 1SDDA 2XRAL 4H5SA 5CEYA 3UJJL 3ARXA 1T6VN 1RZ7H 3N5AA 3QDGE 1YJDH 1OP9A 3WU2Z 1LE5B 2FBOJ 5HBBA 4K3DH 2E7CA 5HHQA 5J06A 2CIIB 5LB1A 3R0MA 4OKVA 4QHNA 4JI5B 1IGJA 4NO0B 1XGRA 1NR1A 4QYOB 4KVNL 4Y4FA 2IEPA 5FUOL 2G4GA 4U6XB 1CFMA 3SGDH 2APVA 1X7QB 3QXDB 4JO3H 1GTOA 4OFVA 5IOPB 3BH9A 1CG9B 1PZ3A 4JZJC 1JPFB 4PJ8A 2V2WA 3NH7H 1U8KA 3HS8A 4DO2A 1SZNA 5TH2A 1SLUA 4LCCA 2DL9A 4F2EA 1TEFA 4EEEA 4F9LC 5L3BA 1BVKB 1BYOA 1TO4A 2OI9B 5I8CA 1LWHA 2AZ0A 4M1DL 4DP7X 3TWCH 2IJIA 5HDWA 4QGPA 3QEQE 2IFFL 4KUCD 4NENB 1NR7A 5BRQA 2ZNJA 3MRIA 4G8EB 1AQKL 5FYJE 2YICA 1AI5A 4AL8C 1UKTA 2QKIC 3QFJB 4ONFH 4UF7C 2Y2TA 3AY4A 4GRLD 5LXGH 4WNJA 4PV9A 3BT2L 2LHAA 4KQ4L 5B3NA 5AL0A 4GSDL 4KKQA 2WN3A 1NH6A 2XASA 1CTNA 1RURH 1P4UA 2D4FA 3GC3A 3QZPA 5LGTA 2E7DA 1U8LB 3ASNC 5DZ9A 3DNKA 2XV2A 2YAHA 4PGZA 2UUDK 1QWUA 2N74A 4LLDA 5KLVH 1G7QB 1ZA6A 3KGRA 1JWMB 2YPLA 3QG5A 2AJ3B 5CCKH 1G6RL 4EEQA 2FJSA 2WVVA 3FULA 4E42B 3CCVV 4FF9A 1SLVA 3F83A 2G9KA 3PP3H 4MMZB 1HIMH 1RZIB 4O2FA 2VH5H 1NEZB 4HJ0C 1P6AB 3DIVA 5JPMB 5KS9E 1YA5A 1UZ6F 3KLLA 3OQ3B 3QIUC 4JG9A 3C5XA 4RESB 4G7QB 2MIZA 1R4XA 1RZJC 2BSCA 3I3EA 1G7HA 3TZVC 1KDIA 4LOEA 2CGOA 1IGTA 3SJAC 4LSVH 3F7YC 1ASOA 2V7HA 2P49B 3QQDA 4U1SB 3LKRA 1SHWA 3POHA 3WLWD 4G43B 2XUMA 4AM0B 3HI5H 4ICGA 1SY6H 2F53E 2EC9T 2G2RA 3BEWA 4KK6D 4NZUH 3UZEA 4WUUE 3VQMA 3D07A 5MEQB 1W72B 3ZZQA 1WA8B 1V7ML 1OTSD 4PJHB 1HESA 1T2QL 4L3FA 3ABMC 3SY0A 2HFFB 3EUUA 3L1OH 2R23B 1Y66A 3HPLB 3UIZA 1C12A 4YBHA 4OGQB 1A6ZB 2QVKA 3LKSB 5E4OA 3CB2A 4W70A 1L7IH 5KHKA 3ZDYE 4YVNA 1UQSB 2F08A 3QWQB 4OLVH 5IKCA 4PBDA 2OV0A 4ZMNA 1Z1WA 1KD1W 4XH2A 4YIOA 2QSAA 1JTOA 2C8NA 2QGCA 4IS6A 5IROD 5ESAA 3P0VH 3WIFA 1P5VB 2ARJB 5ID0A 4X62B 1MJUH 1PKQB 4M8QA 2J88L 4UIKL 3SO3C 2ITCB 4DK0A 1TJXA 4KRPB 1NPJA 4N2HA 1UT9A 2OJ1A 2W65A 3HR5A 4NZ8A 4ETQA 1PNCA 3QJHA 3W2DL 2ZSVA 1G7IB 4N0UB 4ZW6