5B1AB

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1aB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1aB02
3NJMA 3ABGA 1BXUA 5ANHA 1BXAA 3MBWB 3T71A 4KOBA 1OV8A 3OMNB 1NZRA 2XV3A 2QT6A 4AI7A 1AOZA 1AANA 1L9SA 2CBPA 1NIAA 2WO3B 1T5KA 1BEXA 4HCFA 3UABA 2EIKB 2BW5A 3OMAB 1XMEB 1KBVA 1ZPUA 3OD3A 1BXVA 3NYKA 1GS6X 2R7EA 2Y1AA 4GP8B 4YSCA 3WI9A 3UACA 2DWSA 3FYIB 1NWPA 1AZBA 2PPDA 2IWEA 3NJJA 2YARA 2FQEA 2H47C 1AZUA 3X1FA 4G70B 3S8GB 2BP0A 4YVNA 1JVOA 1CYWA 3AG2B 2HX9A 3QJQB 1NINA 1EZLA 2JFCA 2PPCA 4UANA 2J55A 2YAMA 4F7KA 4M3HA 4P5SA 3SBPA 1ASPA 2DY2A 4Q89A 4HCGA 2YAPA 2GC7C 1SDDA 2YAFA 2ZOOA 4WKXA 3FS9A 5D4HA 5FC9A 4DP7X 5I26A 1J9TA 1NIBA 3DKHA 3MX0B 3T9WA 2XV2A 4MFHA 2B08A 1BAWA 3S3BB 1J5DA 3HB3B 1NPJA 1PLAA 1KDJA 3NSCA 4WTQA 1TEFA 3H4FA 2J5WA 3H4HA 1GY2A 3FSZA 1FA4A 2EILB 3UGEA 3T6VA 2FT6A 1E5YA 1CC3A 1DYZA 1DZ0A 2XX1A 3FU7A 1JZIA 4GP5B 3TBBA 4RH4A 4DP6X 3FPXA 1ZIAA 2AFNA 3NJLA 5TK2A 3U25A 3CG8A 2GIMA 4TXVB 2OV0A 1BYPA 3IE9A 1X9UA 3JTBA 3KW7A 2YAOA 1JXFA 4YSDA 1XB6A 5I6MA 2P80A 1W6LA 2GC4C 1MZYA 8PAZA 3N2JA 2VMJA 2BZCA 2J56A 4DPAX 1NDTA 4PAZA 3FSWA 3NP4A 4A66A 4A68A 1OE3A 1SFDA 2HLEB 2BWDA 2IH8A 2PCFA 2GBAA 2XX0A 3FYEB 1ILSA 1AG0A 3NJIA 3OQRA 5D4IA 1IC0A 1SJMA 3T6WA 3G5WA 3AG1B 5B1KA 3EHBB 1IUZA 1ZV2A 1ZDQA 2I85A 2YAQA 1RKRA 5AZUA 2PP7A 3TASA 5B1AB 1ILUA 1QLEB 4E9TA 1KYAA 1RZPA 5F7AA 1KCWA 2E86A 3X1GA 2VW6A 1MG3C 4G71B 3ZIYA 2FT7A 1PZCA 4BK5C 3AZUA 4KNUA 2XXFA 3ASNB 1WA1X 3CVCA 3WNJA 4BWTA 1BQ5A 2X88A 4E9VA 4DP9X 5PAZA 3GDCA 3OM3B 4DP2X 4HCIA 1FFTB 1GSKA 4L0PB 1ADWA 2VM3A 1PY0A 4E9QA 2FTAA 4AX3A 1QNIA 1GY1A 4A2EA 5PCYA 1BQKA 4YSAA 3ASOB 1ZIBA 3UADA 2GSMB 3DIVA 2CJ3A 1CURA 3QJSB 4ENZA 3KW8A 4BWUA 5B1BB 4AZUA 1JOIA 3UAEA 3SBQA 5A7EA 1OCZB 4W9ZA 5I6LA 3BVDB 1AAJA 1PLBA 3NJKA 1ET5A 2XYBA 1AZRA 1OF0A 1PZAA 1PMYA 4AKPA 1ASOA 4BDVA 4E9XA 2XUWA 3SQRA 2DV6A 3EH3B 1KGYE 1A8ZA 1YLBB 1JERA 2BZ7A 1BYOA 1PZBA 4YSOA 4QLWA 5I5MA 3ABKB 5I6KA 1X9RA 2JXMA 1HFUA 2FJSA 1JXGA 4HAKA 5AFAA 4BXSV 3QJUB 3AW5A 4FA7B 5LDUA 1JZJA 1KBWA 2UXVA 2YXVA 1GR7A 2QDVA 4Q8BA 3ABLB 1PNCA 5TK4A 1RCYA 4YVUA 3IN0A 5B7FA 4YSPA 3CDZA 2DYSB 2J57A 1TEGA 1MG2C 2I7SA 2XWZA 2TSBA 5AKRA 1A4BA 1ID2A 1M9WA 1WAEA 1IBYA 1ZDSA 1J9RA 1VLXA 2QDWA 2TSAA 2UXGA 3NT0A 2VW7A 2VSKB 4AKOA 1JZHA 2QPDB 3PAVA 5I28A 2VSMB 3PPSA 2P80D 3CVDA 4UAHA 3CZUB 3WG7B 2EIMB 2CUAA 4A2FA 3OMIB 4A2GA 3WKPA 4KOCA 2PPAA 3GYRA 1WA2X 4JKNA 1ASQA 1WA0X 2AVFA 4W1TA 2BWIA 4GY4A 3S3DB 4KO7A 5I6NA 2IDFA 4A2HA 4JHVA 2PP8A 2UX6A 1A4AA 3PCYA 4A67A 1IBZA 2PP9A 3D12B 3WKQA 4E9SA 3T6XA 2NRDA 1J5CA 2YXWA 2GB2A 2VW4A 4YSEA 4DPCX 2WSDA 4FAAB 3FQ2A 3QJVB 2Q9OA 2AANA 1XB3A 1I53A 4A2DA 3PAZA 2BP8A 1L9QA 1SF3A 4DP8X 3NP3A 2IAAC 2R7EB 2XXGA 3FU9A 2DYRB 4F2EA 4KNTA 1NIFA 2FT8A 2H5UA 2BO0A 2N0MA 3EF4A 3FQYA 1OE2A 2BP0B 3L45A 4YSSA 4E9RA 1A4CA 2PCYA 3GXUB 4GXFA 4DP1X 3FSVA 3FT0A 1PLCA 4KNSA 1SDDB 2IWFA 1F56A 4N4YB 1ET8A 5D4JA 3T6ZA 5B7EA 2A3TA 1E30A 2HRGA 2HX8A 1SFHA 1M57B 2JKWA 1PCSA 4HHWA 2YQBA 4K9JA 1PF3A 2XV0A 1AR1B 1AACA 1OE1A 2XU9A 2XVBA 1L9TA 1R1CA 3BQVA 2PLTA 1MDAA 2W8CA 3QJRB 1W6WA 3NJGA 1GS8A 4DP4X 7PAZA 2GI0A 1SHWA 1AQ8A 2MTAA 3NSYA 4GP4B 4HALA 1E65A 2FNWA 3X1EA 6PAZA 3QQXA 1L9RA 1SNRA 1OCRB 1L9OA 2OCCB 4M4RB 1FWXA 3FU7B 1AS6A 1RZQA 2IWKA 2VN3A 3X2QB 1KDIA 4X4KA 1AS8A 1A65A 2BW4A 4DP5X 2FQDA 3TA4D 1AG6A 1SHXA 1AIZA 4BWWA 3ERXA 9PCYA 4GYBA 2IDQA 4HHGA 1ET7A 3PAUA 3RYMA 3WIAA 1SF5A 3X1BA 1BQRA 1N70A 2RACA 1W8EA 4NERA 5B7MA 5EHFA 4G7RB 1MZZA 2IH9A 3FSAA 2FQGA 3AG3B 3S8FB 5B1JA 3X1NA 2DWTA 3TBCA 1JZEA 2BP8B 1N68A 2I7OA 3EH4B 1JZFA 3NJNA 2CALA 3FQ1A 1NWOA 3ABMB 4EF3A 2HXAA 1L9PA 4YL4A 1EHKB 3CVBA 3IEAA 3QJTB 4F2FA 1GYCA 2ZXWB 2UXFA 1NPNA 1J9SA 3ZBMA 2VM4A 2WO2B 4G72B 2W88A 2HRHA 3NJFA 3SBRA 5IY5B 7PCYA 5I5IA 3NSDA 4NB7A 2Q5BA 1E67A 5E9NA 4G7QB 4N8UA 6PCYA 3EH5B 2PPEA 4KO5A 2HX7A 1TKWA 1AZNA 3PXLA 1CYXA 2BHFA 3C75A 4HIPA 4DP0X 4NAJA 4CSPA 2YAHA 1OCCB 4P5RA 4YSTA 4CSZA 4E9YA 1AS7A 1OCOB 2Y69B 2B3IA 2LLNA 2OJ1A 2MRYA 1NICA 2UX7A 1OOWA 3HEIB 4AKQA 2EIJB 1CUOA 3FU8A 1HAWA 4BDVB 1B3IA 3IBOA 1GS7A 3AG4B 2YAEA 1NIEA 3N55A 1V54B 4PCYA 2PPFA 3NSFA 4KO9A 3S3CB 3V9CA 3QPKA 1JZGA 5I5JA 1KV7A 1WS8A 4HZ1A 3NJHA 3WNIA 2UXTA 1M56B 2FWLB 2IDUA 1TU2A 1WS7A 1KCBA 1A3ZA 5B1JC 1IKOP 2XLLA 3PLYA 4DPBX 2QPEB 1PAZA 4E9WA 3CDZB 4YSUA 3ZDWA 1QHQA 1V10A 4YSQA 1NIDA 2CAKA 1XB8A 1GW0A 3TU6A 3AY2A 4QKTA 3DTUB 2IDTA 5F7BA 3ZX1A 1J9QA 2ZWNA 3JT2A 1NTDA 2H3XC 2X87A 2ZONA 4G7SB 2EINB 2AZUA 4KO6A 5I6PA 1JXDA 3H56A 2YEVB 3UAAA 4JHUA 1ETJA 5I6OA 3FPYA 1UATA 1JVLA 3V9EA 2HZHA 1PNDA 3IN2A 4BXVA 1URIA 2CCWA 4YSRA 1HAUA 2FQFA 1V55B 2IDSA 1AZCA 4ZK8A 2AZAA 2GHZA 4UF7C 5B3SB 1E5ZA
chains in the Genus database with same CATH superfamily
2OSYA 1V3LA 3T1FB 4GAAA 2V5TA 4DQOL 1K92A 4BD4A 3UTTB 3MA9L 2EIEA 4FFBB 2H7WA 3VFUB 3BX7C 2CK0H 4WCYL 2QT6A 4IMLA 1FGVH 1EXUA 2K3TA 3TNMB 4IBWA 1ZD6A 4PLNC 1K9TA 3HUJB 3IXTB 3MI6A 2DMCA 3SDCC 5EOTB 4WW2B 1GS6X 2ZM6B 3OJDA 2D7OA 1S7RB 4TNGA 3TVMB 4B7IA 4DAGL 3P30L 2R1YA 2B0SH 4ZODA 2Z5UA 1U96A 1JYVA 2F6AA 2Q69A 3HZYB 3L7FA 1MCWM 2FQEA 1YNLH 4MBOA 3H1LH 1RZJH 5F7EH 2WTRA 4PY7A 2WMPA 4YVNA 2HX9A 1JNLH 2Q0AA 4XVJL 5DHDA 3WY4A 4CMMA 3QNXB 4I3GA 2CA4A 2CSPA 4Y1TA 4K35A 3HPLB 5BR8O 4HCGA 1P1ZA 3ILDA 4UUJB 4AYDC 1JV2B 2YAFA 1KOAA 5FCSH 1OEZW 1SOSA 1XQ4A 5E8OA 2AEPL 4IK7A 1AHKA 3CFJA 3RUGB 3VWKB 4QJ4B 4L8DA 3EW3B 4PJXE 1B6UA 4ZPVA 1OP5H 3NGBB 4OCLC 3AREC 3TX4A 3WJJC 2FH8A 1ESOA 3H4FA 5JH7B 1I94B 3VFTB 2NY3B 3F64A 2VDQL 3RX5A 1G7LB 5DMKB 2EDOA 1P4UA 3CRQA 1NCAH 3BRCA 2IPTH 2J6EH 1VKXB 3FD9A 1TIUA 2XZAL 3CH8A 1RZIB 3B4SA 1SMAA 4M6OH 5DT1L 3BRGC 1KB5L 2M8XA 5K93A 4FZ1A 2AFNA 5TK2A 3ETSA 2P7TC 3FAVB 5FHAL 2X4NA 4K94C 2EYRB 1WB7A 4P2OC 3V0GA 5AKVA 2BVEA 1C7TA 1JMZA 3P4OA 3ZRWA 2W0FB 4JGNA 5I1KH 3TJPA 1F58H 3QJFA 4RQQA 1KJVB 3GTNA 2C3HA 5DUJA 5AZ2H 1FN4B 1G1CA 4JHWL 4AQOA 3ZX6A 4OV5B 2ARWA 2BSED 1XCQB 3I6KB 3CN4A 2VDRB 1NR7A 1XEUA 3VFOA 1U3HB 4NXNO 2PYEE 2VLRB 4GMSL 5AB0A 1KTDB 3ZN1A 3QORA 4MQXC 4AG4L 3ZO9A 3FOLB 4RO2A 2JCCB 5FK9A 3VGDA 4JPVH 4DIXA 2P8LA 1SJMA 4XP5H 4ZMPA 1QKZH 1MEXH 3PJSK 2WXNA 4I48A 2I85A 3P0YL 1IBGL 5HHNB 5AZUA 5JR1H 2QM8A 4HV8A 2ITFA 4X5PA 5AVSB 2DB8A 1OAKH 2AEQH 1RZPA 1NAKL 5F7AA 4QXUH 2V4LA 4UT7L 4ZTEA 1FNSL 2GTAA 4FC3E 4H8PA 5E2WH 5F7LB 4O9HL 4JVWA 4LHUB 4B9YA 1VQMV 2NUTB 3SJBC 3GEWB 1PU0A 3QZWA 1GKEA 4UDTA 2QJDA 5DQDH 3F7VA 4UIMA 1WIPA 2BOBC 2BJMH 3SJVA 3M86A 4PR5B 1HZHL 5BW7A 5HYSB 4GG8A 3ARGB 3ZDYB 3SGDI 5PAZA 3KBEA 1BWMA 3GXNA 4HZAA 5DC0A 2KH2B 2IGLA 3ZKXB 1AI7A 2IW5A 4MJIA 4XPBH 2KLRA 1PY0A 4K5NA 4GBXA 3SKNA 3LEXB 4MAYA 4XNXH 5FYLL 3LNEA 3KWXA 4F33A 4ABVA 2MIZA 2V7NB 4OKVB 4ORGB 1BQKA 1IGIH 2BM3A 2E5EA 3KR3H 4FQXC 4MNGB 4YSAA 1S9WA 3FFCD 2XKNA 3J27A 1CURA 2WB7A 3LDBC 3QYCA 3OLGA 5HPMB 4HKXA 4OLZL 5JHAA 4TULH 2MNJB 4ZUVB 3WD5L 5J2UB 4PJBB 2R4SH 2NNCA 4O4IB 3QCTH 4UCTA 2FWOA 2CG9X 5F71A 3QCUH 1TPXC 3UTSE 1DANU 1ONQA 2ZD0A 4P2QE 1CFTB 5J3HD 3N3EA 3ABKC 1OKEA 1NU1H 1EANA 1RZGB 2DI7A 2HT4C 4EI6A 1A8ZA 4PIBA 4V2BA 3AS3A 3B9VA 4WBNA 3KD4A 1KELL 1NGWA 3MRDB 1HNXO 4M7LH 1MOEA 5I5RA 3QEGL 5IB3A 5LOVA 2A83A 1EO8H 5JOPE 1ANUA 2E8ZA 3MV8A 1WN7A 2DI8A 3AW5A 4E0RA 1LD9A 4FNQA 1ZA6A 1NKRA 1OAQL 4Z7VB 2ADPA 3I3BA 4NN5B 3LIZL 5DA4A 1PNCA 4XMUA 4LF4B 1A4KA 2XN0A 3IN0A 4G6KH 3V6OE 1VQNV 3WFEH 4ELKB 3KG2A 4WI0B 5AVZB 5HVHB 1A4BA 1JPTL 1KBPA 3QCVH 4WENB 2ZXWC 5HGBA 5GS0D 3APMA 4L1BA 5LKNA 1U8LB 2DOSA 4IYHA 4RMTA 4NM4L 4WNQA 1NC2D 3LZFL 4P57B 3W2DH 2Y5TA 3S5LG 2J73A 2HMID 3IDIB 3ZE2B 5GJSH 5B3JF 1W8OA 4I0XB 4J3UA 3Q6FB 3SB3A 3RU8L 4Z78B 2AK4D 2Y7OA 4ZG1A 4FRWA 3BSZL 1JGEB 2QSTA 3RZCD 3I75B 5KS9A 4DVRL 1VAHA 3LZQA 3WG7B 1S5HC 3WFCL 3TWCH 2OJZH 1GJWA 1HL8A 5C0BD 4PJEF 4A2GA 2VQ1A 3H2PA 3U9PH 4AQYO 2V7HA 4ELDA 1PDKA 1QOKA 4WSJA 4UVCA 4W1TA 4JO3H 3PIQA 4OD3H 1TNMA 5T3XE 3IJSA 1DDHB 2A73A 4X9IA 2FO4A 4DR4B 1FORL 3E8UL 4A67A 1Y4MA 4KRPB 2JB6A 2VWJA 2IAMA 2Q67A 4UCVA 3EJPA 3RVUD 2A5UA 2WWOA 3KYKL 4Z3HA 3EGDA 5EEVA 3BZEA 3RL2A 3SPVB 1HIMH 2G3XA 1GRJA 4ZSOB 4DPCX 4YSEA 4CKQA 4HC1A 5JPMA 2WSDA 4UQAA 1F0LA 3CMEV 1JFFB 2EDKA 2Y6SD 5CHNA 2F58L 2XPGB 3GS4A 1U4EA 4MA8L 4LSDA 1MFEL 2D4FA 1NPUA 2A38A 4MNHB 3REVB 3HKBB 2CDGB 4HSCX 2LV4A 1JHKH 4HC1H 3V52L 4WK2B 1BFVL 3FCTA 1IKNC 4YFDB 1JE6A 1OV9A 4F2EA 1JZDC 4FI7A 5DJXA 5H6QA 4PI0A 4BYHA 4OI7A 1UCBH 4FLUA 5GXBB 4HIIA 3I9AA 5DD0H 4PA6A 1RK7A 1OE2A 3JWNC 1M56C 2N3JA 4KI5C 2WXIA 4M1CC 1U8HA 4NFCA 3T1HO 1S0VA 1U8QB 2WBXA 4J4PA 4ZW3A 1YHPA 3B43A 1UA6L 4OX9O 3GGWA 4FLWA 2RDCA 3BH4A 4XPFH 4UM9A 1C16B 3AU1B 5FGCE 1MW1A 1MW2A 3NRQA 1KXTB 5CIPB 3RTLA 1JZ6A 5I24A 2ENPA 1ZUQA 3MV11 4JO4L 4JYCA 1ZLWH 1BGXL 1KPUA 2XXCB 4NQUA 1BJ1J 4GRWH 4K5LA 5D72H 5L7XH 2VRAA 3FCGA 3O6FA 3E7JA 4LESA 1IFHH 5HI4D 3MRQB 1YIJV 5F0MB 3SDXB 3UBXG 4QRQB 2WGXA 2DQUH 3IMUA 3JCZA 3BEHA 4UQDA 2ESVD 4UBDD 5IMOA 4HALA 2PXYB 1CK0L 1E65A 4ODHL 1W80A 4MNQD 3TXSA 2WB1A 3GKZA 3KLAB 3P3SA 2F7PA 3AQYA 3U48A 4HGKC 5CM1A 1OJHA 2WN2A 1K72A 3KGUA 4ZMAT 1E40A 1Y6XA 5ADOH 4OT1L 1HNZB 2PUSA 1MZFA 3UPCA 2FUTA 4ZAKB 2BW4A 4DR3B 4PJDA 1QLNA 4JRYB 5FFLA 3REWB 4WK4B 2WNKA 1M6UA 3ZE0E 4LSSL 3OGCA 2VMEA 3D9AL 1HJCA 1OZUA 4DTGL 1AGCA 1WD9A 1SHSA 5DXWA 2OYMA 1G7QA 2Q73A 1KZYA 3RYMA 1NCDH 5I18H 2CO6B 1AO7A 1SF5A 1WTGT 3WIAA 1KTKE 2YS8A 3RVXD 2IFFH 4HJJH 1NCUA 4WW2C 1C9SA 4NERA 3V8OA 3TVMC 4OIBA 2VC2L 1EHAA 1DLFL 4AEFA 3K06A 3UAJC 2J25A 3C3TA 4JI5B 4J12A 2PO6D 3OHXA 2ZUQB 4MW8A 3VWJD 3X1NA 2YI8A 4X98A 4E41E 2IWGA 4GRWE 1ZHBA 2NXZD 3K4DA 3L5JA 3MUUA 1TCMA 4CNIB 4AK2A 3TBVB 1TJIL 1CFBA 1SUJA 2GBTA 4ZUTA 3CHPA 4A7UA 3ABMB 3HPLC 1AGDA 4PGDB 2VUOA 4YIOA 1FL5B 1WP8A 3L1OH 1J0HA 5AVVB 5T1LB 5TFSL 5D1ZD 5CA0B 5ERWA 4F2FA 3VWKC 1ZRUA 3O6KL 3QO0A 4YIQA 1YYML 5ETUB 1JFHA 1O9ZA 2W88A 4OZGE 3NJFA 2W5PA 5IY5B 3NGBC 4KROB 1XD1A 2NQ3A 5JMRA 4U49A 5FF6A 5KAQG 1GGCL 1VF7A 1QRNB 4LIQH 2D7NA 2VN6A 4EOWL 3CVHH 2CMRL 5IW3A 3BIKB 2NY3C 4OZIE 3UYOD 5C0EB 2UXNA 5G4NA 3RWGB 4G80A 2LJ2A 3UDWC 3VDAA 3R8QA 1U6AH 3WS3A 3FQTA 3V2AR 4RZCB 3KL5A 3O0RL 4MQ7A 3ZTJH 1K6QH 1LYQA 3C75A 2R83A 3O4OB 5HJDA 1MRCL 3JV6B 3LN9A 2BNQB 1IEBA 1KFAL 2NOYA 3L95B 4HLJA 1H0DA 2W0FC 1FYHB 5JXAL 2WWNA 4I0PB 4BKLB 5DFVC 1SBSH 5LBVA 4RAVB 1Z9MA 3C5ZA 4AEIH 4C7UA 5MHSE 1Y76A 1JNHB 4B0MB 1L0QA 2ODHA 2YN3A 3RQ3A 1B4RA 3L3OA 2ZYHA 1UYWL 1U3HC 3PHSA 1QFUL 4N0UA 1W0JG 2ARJB 4AHCA 4C56A 4J1UA 5AAWC 3HMWH 3BUDA 3NSFA 4U1MB 5DVPA 2VAAA 3R1GL 4JDZB 5BV7B 3C5SA 3D8MA 3VXME 4D7SA 3APFA 4QXGL 4Y19E 1KV7A 3X3GL 4TV3A 1IGFL 3QRBA 4OCNC 1XBLA 3UGUA 4FJYA 1N59A 5IFJA 4LARL 3AK1A 3ZL2A 2HT3C 3WENA 2BVPB 4DO5A 2JIXD 3QUYD 2WYHA 2H1LM 2O57A 3EYVB 2HJLA 3KZIZ 2GJ6D 4MA1B 1IXMA 2WJ7A 3LVEA 1DK1A 1XB8A 4YJ3B 5H4ZA 2AI0H 5AW5B 3EH1A 4DCQA 4Z23A 4QTIL 1OQXA 2Z31A 3DYMA 5G4OA 1W15A 3AQZA 3RDTB 4DXWA 3A6BH 3ARGC 4IOFD 1FZMB 3DX8A 3L7EA 5G55A 4B9KC 3TCLB 2FBRA 5B1OA 1ZTEA 4KZEL 3ZKXC 1IO4C 1SY6L 3W7WA 5CGYC 3I6LE 3GHBH 4MZIA 4ABUA 4BKTC 5F6HJ 3BD5A 1UJ3A 3GS7A 1V55B 3CLFL 2CGRL 2HR3A 2FB5A 5BZBA 1S2EA 2P5PA 3WGUB 2G2RB 2Q86A 5EUKB 3VXTA 3D39E 4AK1A 3QTCA 5LAPA 3VVWA 4X6DA 5TQ0H 3RT3C 3MBWB 1XCTA 4I9XA 3VFRB 1ETA1 4AZ8A 1OV8A 2AJSL 2XV3A 3BVOA 3RAJH 1QD0A 2BDNH 2BNUA 2XDHA 3CMOH 3OC8A 5D7HA 1JIBA 1M9NA 2WO3B 2WKGA 4GSRA 4HCFA 1HC1A 1KULA 4MKMA 2ALAA 5FX3A 4LNRB 1KZQA 5CFAA 4M9OA 4X1KA 4BSVA 5F70A 2IOMA 2E7CA 2R23B 3N04A 4Z8FH 1LO5A 3UACA 4K8RC 2DWSA 2UUBO 3QO7A 1FCGA 5DI8A 4AIOA 4OD2A 5LHGA 2NZ9D 3GUFA 5E08H 3J8F7 4Z7WB 1AZUA 4OCRL 4KI1A 1OTSC 5F8RC 2BP0A 3N2GB 4ZW5A 4R5VA 2HLFC 4UV4L 1OAYH 1WG3A 3QWQB 3NFPB 3CSFA 2VZSA 4NN5C 2DM7A 2XN9D 4JM0A 4OIIL 4F7TB 4MDJA 4FQ2H 2ZZUT 3R8BB 3VI4F 4AGMA 5CMUA 4S10A 1ZL8B 2DS4A 3KPRB 4DP7X 2N1KA 2WXKA 3FUFA 5DO2D 3D52A 1R3HA 4YDLB 2W95A 4PV8A 4RMQA 2XTAA 2B08A 5HVHC 2ZINA 1F3DJ 3ALPA 2VLKE 2Z9TA 5AAPA 4I9WE 1JSYA 2VMCA 3QA3B 4NZUH 5C1MB 3FHEA 2HWZL 4IHBA 1QW9A 3FMGH 1NPJA 3NN8B 5I1EH 3M1OA 4WVRA 5DJDA 5GS1C 4Q6YA 3NSCA 2BTQB 2OMVA 3CTTA 3E6HB 4M4PA 2FEDC 4R7DB 1WNSA 1F4XH 1JGUH 5AEAA 3TA3A 3BHPA 4K5MA 4NHCH 2HTLC 3EVKA 1M05B 4BQ9A 2JKNA 2C7UB 3EOAA 5DD5L 5FFGA 1KMGA 1OAXL 1U91A 1VARA 1R5VB 4ICXA 4LPTA 3ZYIA 3DX7A 1Y6NR 2YIDA 4LSTH 4M4RA 2B1HL 5IBLC 4W9LC 3FPXA 2EULA 3WG7C 1C5CL 1YDPB 4M48H 5KSUB 1RULL 3KCYA 4NQDB 4XPGL 2V2TB 3BAKA 5EIIB 4I5BA 3MHHC 3T8MA 3MBEB 1XR9B 4HJ1A 3RDJA 4NUQA 4XN7A 2AQTA 4HIHA 3GD1C 4RMWA 4J7RA 3WUWG 3CRAA 3PWLB 4QY8B 5IT9N 2GT9A 2WIIA 3CPLA 3DO4A 4AC4A 3ARDA 2MJWA 2WYIA 2KZWA 4KRPC 5JUEL 1UTDA 3NRFA 4NO5A 4ES9A 4FKKA 1QHPA 3ULAB 4G8FB 3QYNA 2X4UB 1WGOA 4GKJB 4ZTOL 1IX9A 3IBEA 2HLEB 4JFFB 5LL6Y 2WBJB 2D31A 2OW7A 2A6JB 3LS4H 4UYQA 1ZV9A 1RUKH 5D4IA 2X42A 3PDGA 1I85A 4Z7UB 43C9B 3MA7A 4PP1C 5KX5A 2OXHB 2WPDG 4TV9A 5CU5A 4X50A 5BRPA 5E1IA 1N4CA 4X4YB 2WXHA 3V4PB 2WSKA 1TVKA 4XBFA 4EE2A 3S4SA 1G6RA 1IM9A 4ZMYA 4Y1AE 4DQOH 2AGAA 2PW2A 3ZZQA 3MA9H 5D5MA 1TZGL 3BUBA 5I1CH 3FTWA 1L7TL 4UU9B 4DKAA 4TVPE 1G6RH 3T3PE 3P30A 1LWRA 1GGIH 4MT8A 2KYIA 2XXFA 3CCSV 3B09A 2DLTA 1MHCA 1NGQL 4HH9B 4K3HA 3QDMB 1BREA 2NYYD 1D6EB 1JDDA 3GKWL 4DAGH 1TQBB 4JRXD 1ZHKA 2CPUA 4EZMA 3P30H 1A25A 2YLHA 2DKSA 3GSNA 5E5MB 2C26A 4P3WA 4HEPA 3S3PA 1GSKA 2C9AA 4EKJA 5FW8A 3TJTA 4ZS6D 1NGPL 3HJ0A 3OSKA 1K2DB 2VM3A 1J5HA 2BSKB 4ZRGA 2B1AL 4YL9A 2QKIA 1J1XL 1H15B 1R24A 4N85A 2PXYC 2G5BB 4NAQA 2H3KA 2PTMA 2PYJA 2EIDA 3UBHA 2BS71 5KBPA 2Y7QB 1DSYA 4ZMNA 2ATKA 4YQXL 2IJ0C 4NRYA 3KW8A 4OZGF 4OLVL 3KKYA 5FAAA 1QSFD 5TDOB 4DV7O 2XRAL 2AEPH 3ATBA 1OCZB 4D9LL 4ZAKC 3TWYA 4NEHB 1SJEB 4L9LB 4Z77B 2VDMB 3QO8A 2DMKA 3MRCB 4EZJA 3RWHA 4X9QA 1AIFA 4G8IB 5CJQL 1BP3B 5J5EA 1GZQB 5GGRB 3MGAA 3T4AB 2FLRT 4E9XA 1OCWL 2NQCA 3SDYL 1H3PL 3ISRA 4L3ED 2LR4A 3EH3B 1A6UL 4UAOB 2VDQH 1RSYA 3CE1A 5IKCA 4PJ7F 1KIPA 1DQKA 2P52A 5EC1B 4ZMOA 1O7VA 5LXTB 3LKQB 2XZAH 4X20B 3OG4B 4QOKE 4X9YA 3ZIAG 3BPOB 4P2RA 4ZUUA 4H5SB 3QXUA 4OLYL 5FHAH 4G8EB 3C6LD 2PI4A 2ZUQC 4PPTA 5LDUA 4X5LA 1OZ0A 1X4XA 3QE5A 4OF8A 2IADB 3L3KB 1RCYA 1JRHL 3QQ4B 4Z76A 4M62H 1WAZA 3QEQE 3ZW3A 3D25B 2FR4A 2X1PA 4PRAA 1Z9OA 3ABMC 4Q9CA 3KWTA 1GMGA 1JCHA 3CD6V 2OJEA 5GGUB 4G8GB 2AEOA 4GINA 2NUPB 1VP7A 1XF1A 4HFWB 4AG4H 3W7SA 4IKIA 4JFDD 1KXVA 5H2FZ 5GRXG 1VQLV 4ZDHA 4PGJA 5IY5C 1RPKA 4KDTC 4KROC 4X4XB 4JPIA 1KCUH 5FO9A 5EIVA 3P0YH 4Q74A 2HP8A 2VR5A 3HVNA 1YEGL 3CE2A 3B9KD 1JPST 4K2UH 5I28A 4DERA 1GCYA 2WLHA 1M3JA 1PX8A 3MOAL 3QUZD 4ZUWA 1ACZA 4R26H 2VWEC 3VE0A 4CU7A 2HG5B 2ZKHL 1NAKH 3QDGD 2OYPA 4V1DD 1LP9F 4JNXA 4KBPA 4UT7H 1OPGH 4A7QA 1D5MA 1RZKC 3JALA 4PRIB 4FVMA 1FRGH 2B1GA 1FG2B 2IDFA 4TOIA 4WY7L 4UTBA 5E9DD 4DW0A 3P3TA 2H2PC 2DBJA 1EGJL 3SR2C 4I0PC 3S2CA 4EKXA 1IBZA 4L8BB 2B4CL 2VZ1A 3FUDA 5J6HA 4MAUL 4Y9FA 4UTBH 4IMLB 4G7VL 4KKQA 4QTFA 3G08A 4JK0D 4WKZA 1OW0A 5CBEA 3G4SV 3T1YO 4GNKB 3WNKA 2AQNA 5E8PA 4QLRA 5FYLH 2BP8A 1L9QA 1XTMA 4ODXA 2YICA 3OJDB 1GOFA 1ZLUK 2R1YB 3CD4A 1R6VA 1EAQA 4WGVB 2AJYL 2GJRA 3P11L 3L7FB 2FKXA 4OLZH 2WTRB 1EWHA 2WMPB 4PY7B 2MWCA 2XIIA 2P9RA 4Z3EA 4AYGA 1K33A 3BQUA 3LH2L 1A6VH 5BOPA 3K5RA 4CMMB 4DEWA 4N2OA 4XC1L 1IAII 4Q0XH 5INCA 4YLCA 5E2VH 3QT2A 1GXEA 4PS4L 1P1ZB 1LUVA 2ZNIA 1HHIA 1UH4A 4MA1C 3G6BA 2A79B 3ZMTA 2XNDG 3CFJB 1U97A 3AU0A 4YLBA 3ELAT 4L8DB 1E4HA 1KELH 4LCUA 4XNUH 4F24A 4XMZA 1IC5L 4ZPVB 3RDTC 4EZLA 3BVWA 2RH0A 3H1IH 5FKPB 1BD2A 3KPSA 2ZXGA 4P4KD 3JD2A 4NQEA 3D30A 3NSYA 1TZAA 2LW3A 4OJCA 2E6PA 1V55C 4JFPA 4LSQL 5AOIA 5EZIH 5JQ6L 3DURA 2F54E 1HEHC 2V5MA 3A67L 5J9PA 1JPTH 4CN4A 2M2DA 1AG6A 3P4OB 2D9QB 3QZPA 4I87A 3ZRWB 4J3OD 3FN9A 2IDQA 3OGOE 1D7BA 3LZFH 4P46D 4HHGA 4RQQB 3BH9A 1N9PA 1R6KA 1HQ4A 3L3DA 3SDDA 2VSCA 4JRFA 1NA8A 2FX9L 4LLWA 4PJAE 2ZX5A 1DHKA 3K57A 1F6AA 2QLYA 1A1OA 3A0BZ 5HHVL 3BSZH 1BZOA 1YEJL 3CZGA 3LTVA 4MA3A 3DI2B 4FP8L 3QORB 3WFCH 3V7MA 1P1VA 2Q7YA 2EC9T 1ZWIA 3A24A 5FK9B 2FQGA 1EJ8A 2NY6B 2B5IB 4XDKA 3ZDXF 2P8LB 4P2QB 5EUOF 3VU2A 1N2RA 3TURA 3CRCA 2CKBL 4FTVE 4I48B 5C0CA 4QHMB 3T2OA 1HWGB 3TO2A 4Y9EA 3PS6A 4RAUA 4AVKA 2FVNA 3FUKA 1COBA 4HV8B 1KTRL 2B14A 5LXVA 4Y4HD 3CWGA 3JD0A 2GUOA 3KYKH 1W72A 3RX7A 3JTSA 1TQWA 2XG5A 3NA9L 2P4KA 4UINH 4YDLC 2RFXA 2VL5A 2F58H 4MA8H 2HT2D 4WFED 4XPAH 4UDTB 3QZWB 3RIAF 1MFEH 3M8OL 3T09A 1W72H 5FUOH 3F7VB 4UIMB 3SJVB 5LO7A 1EFXA 3L4TA 5I5IA 1TFPA 4URKA 3V52H 5AKTA 3W5NA 4GG8B 4XB7A 2XZCL 5CEZD 2P5WA 2ZOLA 3BW9A 3NCEB 3VM7A 1EUTA 5GRWA 4YR6A 2HX7A 4MJIB 3HKZA 4LOFA 3B2DC 5E4AA 1OM3L 3O2DL 2XWEA 2VRZA 4GBXB 1OM9A 2YN5A 1JI1A 4MAYB 3SKNB 4HJEA 3JSLA 4KKLC 3VRLE 2VZVA 4GAJL 2BFVL 1S9WB 4L37A 2XKNB 2G5UA 1QFPA 1ZTXL 1UA6H 3FSOA 4YSTA 3MBEC 5BMFL 2CRYA 5I1DA 4N87A 4HKXB 2PW1A 4YDVA 2FBJL 3D85D 4HAGA 2E7DA 1G4RA 4NKQB 5CKAA 4JO4H 1AVAA 4HWZA 4BIUA 2FWOB 1HDJA 2MCMA 1AE6H 2BHYA 4KTDL 3TS8A 1ONQB 2DM2A 4JFVA 3AGVA 4GLRH 1U95A 1HCFX 1XGYL 5DZJA 3L4WA 3FB7A 4OH2A 5AVQB 3PN1A 4EI6B 2WBJC 3KXFD 1B2WH 1CK0H 1YA5A 3Q0HA 4ODHH 3V5KB 4F9PA 3NACL 4G2AA 4WBNB 3QRGH 2GFBA 2BFGA 5I0XA 1XF3A 5I2IA 5IB3B 4NWTH 4WF7A 5A40E 2A83B 3FAWA 3S88L 5DGQA 4PHXA 3MV8B 1IV8A 1OARH 1KC5L 4OT1H 5AG2A 2JKSA 2OCFD 2P26A 4E0RB 1LD9B 2Z4TA 3V6BR 1ZA6B 2JELL 5JW4N 5JXED 5H4YA 1XNRB 4FXKA 4LSSH 3D9AH 1Z0MA 4DTGH 2YGVA 4ZXBA 1A4KB 5DD1H 1JPXA 3ZYZA 4NTXA 5E1AB 4PRDB 1D2PA 4JG1L 4GLXA 4YSQA 1V10A 4S1DD 4QWWD 1THAA 3OKNB 4LF9O 2DLGA 4GRLA 1CB4A 3S97C 3KH4A 3BPNB 4HS3B 1TDQA 3GUTA 1U2YA 3CGTA 4OPHA 1TQBC 5HGBB 3JT2A 1UOWA 2IANA 4JVUA 4WNQB 5DWUL 1DLFH 4LR3A 1WZ1L 2Y5TB 3UAAA 4XWOC 4K7PH 4HNAB 3FPYA 4X8AA 2HZHA 5FXCH 25C8L 4BW5A 2GW5A 2H8PA 5KS9B 4X7SL 3ZHFA 5B3SB 2ZP0T 4K3DL 2VQ1B 3MLYL 2V7HB 2E8YA 1PDKB 3O9WD 4I85A 2NY5C 3O6KH 1OCZC 3LPWA 3PIQB 4OCXL 5SWZA 1N36B 3IJSB 3PQYD 4L9LC 2A73B 1KTLA 2E9BA 5ABZA 2FO4B 4W4OC 3A2FA 4R83A 4NKOA 5E2UL 5HHQA 4RMRA 5JW4M 2JB6B 3KCPA 2OTJV 2YFOA 1VPOL 3BZEB 1HH9A 3BWUF 3EGDB 2CMRH 4EOWH 2VKXA 3RL2B 3ZL1A 1R75A 3ECVA 4BELD 3OTOO 1QCEA 5JPMB 4H2AA 4UAOC 2L35A 4UT6L 1ORQA 3R4RA 5CHNB 5EC1C 2BY2A 1H8HG 3MMEA 4PLJD 1AZBA 1Q90D 3O0RH 5EMYA 4IKLA 2VZOA 2H47C 1EN5A 4MTOA 2L7UA 3BPOC 3FCTB 5C70A 5FM5M 1X44A 5DJXB 1HH6A 1KFAH 2VR3A 3L75H 5L3DA 1SGKA 4NKDA 4RUEA 4HIIB 5JXAH 1G9HA 2Z1KA 2H6OA 4YPJA 1DVTA 2ZOOA 4MSWA 4WFGA 4GQZA 3DMMA 2CHZA 1U8HB 2ZQMA 1TSHA 1WHPA 3WOVA 5IIEA 1YEWA 3VXRE 3STLA 4DV4O 3GGWB 1YZBA 3TT3L 1QFUH 4ATWA 4NP9A 4W93A 4UM9B 2VR6A 1OTUD 1VF5B 4LL4A 1KDJA 1CIDA 1OY3B 4XC3L 2Q8VA 1KPUB 2AJUH 1J8HE 4CN6A 3QR1A 1NMCB 3X3GH 3O6FB 1IGFH 1DYZA 1DZ0A 5GISL 1IB5A 5IMOB 1I1YA 1P5UA 3WS6A 3ULUC 4LARH 4RBPH 2FGWL 1RLBA 2QM7A 2HG5C 4JPRA 5J8OA 4YMPA 5BNXD 2NR6D 3P54A 3T2MA 3KW7A 5J0BA 4EQ2A 5CN0A 3RZWA 1ZLDA 2ICWJ 4DFHA 4XNYL 4HDIA 2CO1A 3QIWD 2VUYA 3JYBA 3DK2A 4ZQTA 4CN1A 8PAZA 2EE0A 3L72H 3FC8A 4OD1L 3OGCB 1NJIW 1LGVA 1AGCB 3CC4V 5GGTL 2MKWA 1PD3A 2DIEA 1G7QB 2Y36H 4PAZA 3FT9A 1QLEL 1I3UA 2HKHH 4H33A 1SFDA 3V4VL 2K4WA 1AO7B 3B40A 4QMEA 1MVYA 1T2JA 4RRPA 2V8MA 5IWAO 1T3FA 2P5ED 3S6CA 2CGRH 2UWEA 3T6WA 1RZJC 5B1KA 1QI4A 3P1VA 4Z9KB 5AW7B 1R3IH 5C93A 2W38A 1T0NA 4I89A 5B1AB 3BMVA 1TJGL 3OHXB 2P4AB 3BLKA 3W7TA 1S77D 4X98B 4JFZL 1S78D 2X28A 4FG4A 4LLMA 1A32A 4PJAF 1ZHBB 5F44A 1R5IA 2EDJA 2E86A 3BWAA 1LR1A 4NIYE 4L8JA 3X1GA 3DETC 1KENL 2VN4A 4P0DA 4X6EA 3DTXA 5EU3A 1AGDB 1NC4D 1P6FA 4MVOA 3DGDA 3SGKA 1BT8A 2IXQA 3CX5J 4R90H 3W9EA 5ERWB 2L3BA 2QZQA 3QHTC 3LIUA 1D7CA 2EDEA 3QO0B 4YIQB 5EFIA 3CVHB 4D0BA 2CM5A 3V55A 1UFGA 4YXWG 3RVTC 3OAYH 4O02L 3PXHA 3E8GA 3EXLA 1PG7X 2VLJA 2UZPA 5FF6B 1M6OA 2UVFA 1MWAA 3QJZA 5F1OB 4UV4H 4GO6B 1BWWA 1ZHLA 2ILMA 5EO9A 1FD9A 1YEFL 1EZVH 1BJ1H 4OIIH 4G80B 1F3RB 1MWAH 3QIUB 3WS3B 2DLFL 3FQTB 5DEDA 4MQ7B 3IMTA 1CFVL 1UZ6F 3CWBH 3NSXA 1IFRA 1IEBB 2PF6A 2F43G 2HWZH 5FEBA 4LC1A 2K7QA 1O9HA 1NT2B 3GSRA 3I50L 5KANG 1RK0A 3C5ZB 4ODVL 4OLUL 5E56A 1PM9A 1YJDL 4S1SL 4OGXL 3MRBA 3FUEA 3DJRA 2DV6A 1O5DT 3CX5K 2UY7A 3U0PA 1KY7A 3FT4B 3VRLF 2ALWA 2GSGA 4RQFA 3L3OB 1OAXH 4PV9A 5A2LH 5I6KA 2BNRE 5FCUL 2HTKC 5GZOD 4U1GB 4XPHL 4Y8AA 4N0UB 2B1HH 1GN6A 2NNFA 5D7KD 4F8LA 3QORC 1C5CH 5AW1B 4J1UB 1VZIA 5FLUA 4P59H 4X7TA 4C56B 1DUYA 1TZIB 2NY6C 2B5IC 2FCBA 3N41B 4FI8A 4XPGH 4JN1L 2VAAB 3O4LD 4JFTA 1IBKB 1KY6A 2BOCA 3C5SB 5FYKU 1WLEA 1H3UA 2VISA 5E94A 1N59B 3NCBB 3WLWD 5IFJB 1SQXH 1MCHA 3WEBA 4PJEA 1E8XA 2PCPA 3EJZD 4MXQC 3EBGA 3ZMVA 4H8UA 3MJGX 2HJLB 4ZTOH 1WAEA 3DGEA 4KP4A 3QNZA 4NO0A 5HHOD 1XSIA 5L88L 1YYLL 4I4TA 1MHPL 2Y0PA 2OZ4L 5IGXL 4DR7B 1YF2A 3MHZA 4DCQB 4F7MA 3F7VC 3FO2A 2R9HC 5BW7C 3S3WA 2Z31B 2YDEA 1JZHA 4KPHL 4KUZL 3LZRA 1PKQA 4CKVX 1KWGA 3DX8B 3L7EB 3KS0J 3OAWA 3IYLW 2HJKA 4MJ4A 1WLHA 3PPSA 1DVUA 1XX9C 2ZE6A 1KEGH 5BO1L 1R0AL 3GRGA 4K07A 4PFEA 3OMIB 1S9XA 1Q72L 4GBXC 1TZGH 4Q4IA 4MAYC 4LQFL 4KGLA 3EUUA 3WKML 1L7TH 4W9EC 4JREB 3BDBA 3ZHDA 2Q86B 4GUNA 3VXTB 2K6WA 1NGQH 4ZOLA 4MMXA 4X6DB 4G9FA 4LAQL 3L16A 2KQMA 1XCTB 2V33A 3RP1A 3HC2A 3HNSL 4YXHH 1RUQL 3GJEA 5SV4A 1SLXA 4AZ8B 3FFCE 2YXWA 2DKMA 3CFBA 2BNUB 1YY9D 1G87A 4Z7QE 3MV9D 2G2PA 4NNXA 4CH4A 5FYJU 4X1KB 3O11A 4BSVB 1SF3A 1GPOL 3L73H 1O9WA 1BPVA 3UYRL 1LO5B 4JFEA 5DI8B 1UEYA 4OD2B 3JD4A 1QPKA 1YEDA 4IHOB 4S1QH 5KJ4A 4OLVH 1KJ3H 2BP0B 2XRAH 2XG4B 4GXVL 4XH2A 3VNZA 2AQPA 4KHTL 1BJ8A 2QGEA 5CR8A 1O75A 3QXVA 3OT7A 4N6RB 1L6ZA 1MCIA 1CLOL 4U1KA 3KGRA 4APQA 4DW2H 5CJQH 5L3BA 5LGUA 3WHE1 2CUMA 3NIDB 1DR9A 1KN4L 5TPWL 1H3PH 3SDYH 4P2OD 1F51A 2WUCL 4C4BA 2JCWA 5IJDC 1SXBA 1E9QA 4GSQA 4EN3B 1A6UH 1QG3A 1R3HB 1UUSA 1CF8L 4PV8B 3UCRA 5IQOA 3BPNC 3STBA 4ECNA 1DBML 5IOKA 4HUKB 1E6JH 1MLBB 4L1SA 3M88A 5ESVA 1B6QA 4RISH 4KRLB 2XVBA 5IFAL 5EEXA 5BR8B 2X9ZA 5DJDB 5ECGA 4G6AC 3QZOA 1EDYA 2OMVB 4XODA 3ELQA 4YHPA 1KGXA 3TA3B 2YLKA 2ZX6A 3UTZA 3EOAB 1WAAA 2HLAB 4YEEA 1MCSA 3RY4A 1U91B 2CE4A 3DX7B 4M4RB 2DTML 1NEZA 3F6LA 1YNTA 4JM4L 5CXPA 3GDBA 5B3SC 4Y89A 1ITBB 1E7UA 1JJUA 2AK4E 4I5BB 4DP5X 4OJDH 2FQDA 3MGTA 3P0GB 2PYFB 4LBEA 3MREA 3TTSA 5CLWA 4MCNA 4UNUA 5HYSG 1BBJA 1MSPA 2EH8L 5LBSA 4A38A 2GT9B 2WIIB 1ET7A 3CPLB 1P7HL 4AOFA 3D69A 5SWSE 3ARDB 5KVFL 5FR3A 1ES0A 1JWSA 3X1BA 2FBOJ 2IAMC 3TH2T 4NO5B 2DH2A 5BMVB 1N70A 1YEGH 2L7EA 3ZRVA 4N9GA 4DR5O 5LBSH 3NUKA 5JHDD 2RACA 4FPPA 1K5QA 1MWOA 2J1WA 2X6CA 3FQUA 5B7MA 5JPMC 5L8LB 2P4VA 5EF0A 2K78A 2Y1VA 4OZHA 1SMOA 4FA6A 2D31B 2Y22A 3WBDA 3MUGA 2ZKHH 1EDQA 2EDLA 4G3YL 2QEXV 4JFHD 3K46A 4Z7AA 2LW7A 1JI2A 2F15A 4KH2A 3MA7B 4HBCL 1N33O 3QXDA 1A47A 5KX5B 2I27N 3TO4D 1P5VA 4TV9B 3DVNA 4KU1A 4M7LT 1N68A 2YGQA 1UZ8A 4WY7H 4KXCA 4NLHA 1YMMD 2BY3A 3KYAA 1PX3A 1TVKB 1EGJH 3S4SB 5IMKA 1G6RB 3GTVA 6CGTA 1IM9B 3V0WL 1AJQA 2PW2B 5D5MB 2B4CH 2Q2LA 3D3VA 3F7LA 1G1YA 3IEAA 4G7VH 3FT1A 3MHSC 1TTGA 3AY4A 4J4PC 3TJHC 1MHCB 4N2DA 4ANUA 1IGMH 5GGSY 1KJMA 1JQ0A 1AGBB 4Y5XA 4NO3A 5E6IA 5L3EA 1VF5C 1ZHKB 1UM4L 1OLZA 2FD6L 1HINL 1P7GA 2AJYH 3GPEA 4WRLA 3C8DA 2HFFA 3O6FC 4KZCA 4X5WA 4CS2A 2OS7A 3BZFA 3RVVC 5DJZA 1UUNA 3LH2H 2QKIB 1NCOA 2KMWA 4AGQA 4CS3A 2AS5M 4E4EA 1MREL 4MRCA 4PS4H 2ADJA 4U1SB 5KLVH 4KKCC 3HKEA 2ATKB 4XMVA 4NRYB 1BF2A 5A6MA 2NY0B 2LABA 2VXVH 1IXBA 3K0GA 4MNQE 4HPOH 5DURD 5K9KA 1IC5H 3OGCC 2YA2A 2RQ6A 2VDQB 5CZKA 3RWHB 1G1KA 1AIFB 1BFSA 1TZHA 3V9FA 4L2LA 3VXSA 1AJ7H 3ZEDA 3WXWH 1B3IA 5EU4A 2V37A 4BQ8A 4EIBA 4X0KA 3MYJA 5MERA 1OGAD 2CLRA 1CBVL 4JMXA 3BJ91 3J07A 5EA0L 3VTMA 5IKCB 2HPOA 3AK3A 1BZQK 4XMXA 1KIPB 3U1QA 2NY7L 3PG2A 4RMSA 2E9WA 4LSQH 1HR0O 3PHOA 5JQ6H 3NJHA 4H7VA 4UVAA 4P2RB 4U1NA 4ZUUB 1XH1A 5B1AC 3OHXC 2XTJB 5C08E 2Z1PA 1EEZA 4PG9B 2VM9A 1P0SE 5JPNA 3T8VA 5JVDB 1HNXB 1BBDL 2D3LA 5D6DA 4K7FA 2FR4B 1NI8A 1UH2A 2OA9A 4PRAB 4IDJH 1RJZA 2VXSL 4M6ML 4QHPA 2OJEB 4TNWF 3DX4A 1YEJH 3ZX1A 5CSGA 1N34O 4DR1O 1NTDA 4G7SB 5D2NE 2ZCKH 3H56A 1SXNA 4ZDHB 1Q82W 2BXZA 5EN2A 4JPIB 1UATA 4LPVA 3T0VA 2P49B 3VD5A 5FO9B 2WVVA 4M5YL 4R7NA 4HPHA 5L3CA 4ZMVA 3DOSA 1RAMA 1H2GA 5JMOC 1A0QL 3B9EA 4HF5H 5IB5A 3B2PA 2AAAA 4ZUWB 3VW3L 1H2NA 3VE0B 3AGWA 1PYWA 3VXUE 4BZ1A 2GHZA 5IK3B 1S72V 3QIUC 4Q89A 2X0WA 1NCJA 3O41A 2G60L 1P7QA 3PRZA 4JPKL 2NQDA 3POCA 1AJNA 1KIUA 4Y9BA 1D5MB 3GLDA 4F2MA 5KYNA 3JALB 4I1PA 3TL5A 2KT6A 4M1CD 2Z8RA 3M8OH 2KDGA 4MWFA 3MFGB 3H7LA 4JO2H 5C0IA 2CNZA 2JWYA 1AQHA 1HVXA 3BFOA 3GSQA 2VGLM 1BMZA 3VI4A 3C5ZC 4Z7NB 5DM6V 4RAIA 4B9ZA 4WU7A 5J6HB 1U3JA 1BXVA 1F4HA 2X09A 1TTUA 2Z7WA 1UJTA 4WKZB 4YSCA 3L3OC 5CBEB 1NBZA 5C6WH 4MAZA 1OM3H 4LLDA 4U1GC 5E8PB 3OB8A 2QPUA 4RX4D 4ODXB 4ZPTA 2JTDA 4GAJH 4ZZFA 1QX1A 2BFVH 2YBGA 4XCNA 1B06A 1R47A 4UANA 2OR9L 3JV0A 3LKPB 4TLKA 4F7KA 4K9EL 4Y2DA 1TA8A 4QR7A 4Z7QF 1Z0NA 3LD8B 5DVOA 4AYEC 3JV4A 4NYLB 3VSQA 3DKHA 3OKMA 4BFGA 1AGEA 1TU2B 2H41A 3JYCA 2Y7SA 1SRDA 2YGNA 1SQFA 3JSSA 1HHIB 2VO5A 4A1RA 5KZCB 2XQYA 2QGNA 5I1IL 3UTTD 2H6UA 4IGBA 3NACH 1YTFB 5ISZD 4LCUB 3ARWA 2Z31C 2VE6A 2GJ6E 3GXIA 1O9VA 1T1YA 2R27A 3T1HB 4FD0A 4H37A 5IBUB 3HNTL 4QRRA 4L8CA 2UUAB 2CR3A 1WJ3A 5F72S 2X3AA 2XWJA 3GRBA 4HKJA 1T0MA 4DP6X 3O3UN 2JELH 4NQEB 3ZKMC 3NJLA 3TVMD 3U25A 1XGQA 4ADJA 1LEIA 1UJ3C 4FJ6A 4FNTA 4JFPB 1GM9A 1KEML 3UAJD 4JG1H 2ZYRA 4DV2B 4JREC 3ULVD 3PNRB 1A7NL 2KI6A 2P80A 1X4TA 1N64L 3DURB 3FTGA 4HBQA 3M99B 5J9PB 2BS9A 3E8HA 2W92A 4DH2A 4LDOB 4OFKA 3T0ED 1ZTXE 3ZQ9A 3TCXA 1S8DA 3N40P 3EJUA 1AP5A 4WHYG 5DWUH 3D87B 3BH9B 4AQ8A 5I8CA 3SDDB 1HQ4B 3L3DB 4LLWB 2YD3A 4U2ZA 2F53A 5LN8A 3DPDA 3MOBL 4EBQL 1F6AB 2ODMA 2E3VA 1A1OB 3MRHB 4PWEA 1M1KW 5IVXA 3LPGA 5LA6A 1MCEA 4X7SH 2Q6AA 3P73A 4MA3B 1ZDQA 3UPAA 3PGCA 2Q7YB 1HWHB 1ZWIB 2EDTA 3PGDA 4ANXA 3ESNA 1ETB1 2VQUA 2BK8A 3UKMA 5C3LD 3GB7A 1N2RB 1XL4A 2NY3D 1CR9L 4NWUL 5C0CB 4OCXH 1KYAA 5F1IA 3TO2B 4RAUB 1CFQA 5H94A 1CI5A 3GT6A 2VABA 4NN7B 1D5XA 5E2UH 4KMTL 1PZCA 3WFDH 4XOBA 1BQ0A 1VPOH 2GUOB 1W72B 3CVCA 3JTSB 5GSVA 2XG5B 2F7QA 1WT5A 4EN3C 4DVBB 2P1YA 2RFXB 2XN9E 5DFTA 1N26A 2VL5B 5E1QA 1T03L 1JAEA 5KHKA 1KCVH 4DP2X 3GLEA 4GT0A 3HIZA 2XCMC 4PVLA 5DHYB 5HI3C 3RNQA 3F58L 2P5WB 2A2QT 1JTTA 2CBQA 2ZOLB 3BW9B 1R46A 3FUNA 4AEHL 3H9SA 1U3HD 4YHLL 1T0OA 3TA3C 4YR6B 5KJRH 3S37H 3SDAD 4PJ7A 1YQ2A 4XP6L 1JD9A 2Q9LA 3DV6A 4QRUA 1OB1A 2OMUA 1U8KA 3L17A 2CJ3A 3ZZLA 4TTGA 4LNUA 3N5AA 2GSIA 1XGUA 2IVFC 4L37B 4RFOL 1YJNV 2X4QA 5I1DB 5K9OA 3L70H 1KPRA 4GS7B 4XX1G 3CIAA 4YDVB 4AKPA 2O1AA 3CUPA 1A21A 3AFLA 4HWZB 3ARDC 4XC3H 4J9ZB 3FCBA 3MCKA 4MQSB 4NQTA 1KGYE 4UOW0 1YLBB 1SOXA 2BZ7A 1PZDA 3FONA 4LHUD 4PRPD 1F11A 3U10A 1U95B 4FLQA 4MXWL 2Y0SA 3FB7B 3GZPA 5GISH 1JK9A 3ATDA 3BJLA 1DQLL 2Y48A 2GFBB 3ETEA 2JH2A 1XF3B 5I2IB 1I85C 1IC4L 4YDJA 3IMSA 5B1CA 5LXGL 5CGYD 2NXYB 2YA1A 3CAFA 5TK4A 3L9DA 5IR1A 3I2CL 5GGTA 3N6YA 4QE7A 1AR1D 2JKTM 4ZNEA 3V4VA 3DC6A 2D3JA 4OD1H 4KJPC 2I7SA 5T3ZL 1PEZA 4ZXBB 2JNZA 1LP9A 3MSPA 5GGTH 2R69A 4HJIA 3V4VH 4PI2A 1J1OH 4GRLB 4MX7A 2AJXL 3WY1A 2X6AA 2UXGA 3ZTNL 4ZBMA 3GUTB 1H3XA 2VSKB 1B4TA 2VERA 4JGMA 1F4WL 4PWFA 4DUZO 1FIGH 2YXYA 3GMRA 3CC5A 2D3VA 3B2VL 4CSSA 3E89A 1J0ZA 1XUQA 3H7BA 1HK6A 4BZYA 2X44D 3ZHRA 1BMGA 2AC0A 4JRXE 3CPWU 4JFZH 4K8RD 3P32A 1LEGA 1TVDA 2QKIC 1KTBA 3VQYA 1KENH 1ASQA 1AI6A 3K6FA 1YZZA 3ASWA 1OTSD 1K85A 3NPZB 1AQMA 3MBXH 2ATKC 2HLFD 3FUJA 1ZHNA 1I31A 2Y9RT 1KKDA 5IHBA 1HKFA 2NY0C 4H0LB 5SWZB 1KTLB 3M45A 2WTOA 4O02H 1CXKA 4EB6A 2DDQH 4LXFA 4NKOB 1A7PL 1QSFE 4IQHA 2O6PA 4BFRA 3H1HH 3KCPB 3JAWA 2VDKB 1R5WA 1I53A 1HH9B 2MSPA 5D71L 4EVNA 1YN7A 3Q3GA 4FNSA 1YEFH 3Q5TA 3NP3A 4DWHA 3KEDA 1XCWA 5C09E 1ORQB 1QATA 4HJ0C 1OP3K 3PV6A 1AZVA 4UIKH 1XDTT 3MMEB 2MCAA 3O2VH 5BO0D 2XN2A 5EIIG 3EF4A 5IQ7L 2ITCA 2G3NA 2FJFA 5CSBA 4PN6A 4E9RA 1C5BL 1U41A 4WGKA 5DC2A 2XTJC 3KLSA 3WL9A 3QZNA 3PGFH 3LPPA 1KGJA 4NKDB 5IBLD 1DL7H 2VH5L 3I50H 5FM5O 3U0WL 3JWOL 3LSSA 4ODVH 4OLUH 4S1SH 4OGXH 3RY6A 5DD6A 4RLDA 3DMMB 1AFVL 3E22A 3ZHVA 2OSWA 4JTCB 4XP9H 5D1QE 4XZ4A 5IIEB 2IU0A 3STLB 1SFHA 1OAZL 1NDMA 5FCUH 4XPHH 3D33A 4TPRH 4M3JA 1QO3A 3WFZA 3SHSA 4F80A 4KRPD 4JTDB 4GUQA 1LTXA 1QUNA 2V5SA 4R4NC 3ABZA 1KXVC 2PLTA 1WA8A 5DHVH 1CXEA 3W7XA 5F0JB 3OAZK 4MRBA 7FABH 2M26A 4L3CA 4WTZA 4AQAA 3B9AA 3MLTA 1I9IH 4JFDE 4GQ9L 5HHMB 1F4MA 3EFOA 4J3SA 1I1YB 1P5UB 3FB6A 5T5NF 1IAOA 4PP1D 4LCWE 4P8QA 3ZR6A 1JYWA 4FZEL 5EUOA 2D7PA 3VNYA 1THCA 1BZ7A 4PJIF 2XTLA 2MMXA 1A02N 5L88H 1YYLH 3CXHJ 1MHPH 2K9UA 4ONGH 4S1RL 4HDIB 2P22C 2YIHA 1YITV 3EOTL 2WWKT 2I5YL 4B95C 1M1XA 1A9VA 1SQBH 2Q8BL 4GJTB 4ODSL 4HGWA 3WNPA 2ADFH 2HCZX 3ZSTA 1QSEA 4HSAC 5EOQH 4M1DL 4ZJ9A 3G6DL 5BO1H 2R59A 1R0AH 1OW0C 2OL3L 5C71A 4LPUA 3VB9A 4F93B 4DN4H 8FABA 1PIGA 1T3FB 4LQFH 2UWEB 2CH8A 1ORSA 4H13B 3EYUL 2P8PA 4FQIL 2FX7L 1JZEA 1E79G 5MEPA 2I7OA 1KD1W 1T0NB 4LAQH 1C12A 1X59A 3LD8C 1NWOA 1F4AA 3PHAA 4JHBA 1S4IA 3CK0L 2PXYD 4EF3A 4DUVA 5HYQA 5E9AA 3BQUC 2ZX9A 1R5IB 4ODUA 3BWAB 2NSXA 4JANA 5DFWH 3DTXB 5EU3B 3CXHK 3N1FC 4S0SD 1YXBA 3LDDA 1RUAL 4MS8C 4YY3O 3G5ZA 5DJCA 4ZAKD 1FV1A 2IXQB 3SBRA 1MY7A 3HMXL 2BSSA 1GPOH 4ERSL 3QK0A 2M6YA 2YIAA 1DBAL 5EFIB 4CVXA 1UT2A 4GSXA 1Q4NX 4H8QA 4LCUC 4D0BB 2RCSH 4N23A 3M7MX 1YMHA 3CDCA 2VLJB 4FCHA 5D2LF 2MOVA 1M6OB 2YWZA 1MWAB 5HDBE 1IRAY 3I85A 3LNHA 1ZHLB 5EO9B 4GG6E 1VGKA 4FZ0A 4C47A 4YZWA 4GYCB 3DDFA 1NMBL 4PCTA 3H9VA 3RWIA 2NSMA 5JWPA 2C8NA 3STZA 1KN4H 3L9BA 1AS7A 2WUCH 2YZ1A 1OCOB 4PSRA 4P9HL 1P49A 2VJXA 1DBMH 5J9PC 1GGBL 5I8OH 1HHHA 1F23A 3BT0A 3NQIA 1IIKA 4N5UA 1AMYA 4IBQA 3FU8A 3GSRB 1HAWA 4DPRA 1QR9A 5IFAH 4WV1A 4AIZA 5L8KB 3SDDC 2APFA 5T1LD 4FNLL 4GKKO 3ZMEA 3PP4L 1MAKA 2UY7B 3U0PB 4DV7B 2G5RA 5HP5A 2ZOKA 3GINA 4B3RB 2XBTA 1O5PA 3B4NA 4HAMA 5AVXB 2LQTA 2PR4L 2DTMH 3E3QE 4KROD 2Q2EB 3BUTA 2WVTA 5I5JA 2WLMA 2AHZA 1ZWIC 4X7TB 3QAQA 1DUYB 4ZI7A 1B2YA 1LEKA 4LVEA 1DBKL 4LHJB 4OJFL 2BOCB 1IKOP 1S3RA 3CYOA 2HHHO 4QHNA 4OVVA 3EGXB 2ZKYA 2VISB 4NN7C 5E94B 4LNVA 5KVFH 5FKAA 3LSOA 2ROXA 3ZKQD 4HUNB 4WUKH 3ILEA 5F7MC 4PJEB 4DT2A 2PCPB 3ARBA 2KPNA 3HC0A 2Q7GA 3WUWA 2V17L 3MV01 5IHUL 3DTUB 1JDAA 4NO0B 3QNZB 5JW3L 5JYLA 4I4TB 1WBXA 1DJXA 2J6WA 1W16A 3P2TA 3FUHA 4F7MB 4DV6B 3FO2B 5LUMA 1PPJH 3FTUA 1F18A 3V9EA 3IN2A 1PKQB 4HBCH 3WFBH 1X4ZA 2HJKB 3F83A 5I30L 2W6JG 4GKZA 2GAZB 2ZPKH 1MCPH 3VRIA 4OFYA 4B97A 3KMDA 2JGUA 2WC7A 3V0WH 1KIQA 4X2UA 1S9XB 3C60A 4XCYA 4HG4J 5D1XA 5CUSH 4UFZA 1P7BA 2CH7A 2WPGA 2BSRA 3OJVC 4LASH 2G38A 2WWWA 3TEXA 3D48R 4ZOLB 4MMXB 4Z5RA 4G9FB 4W9HC 1AB3A 1A1MA 2BPBA 4PJ9D 3BIBX 2RGSA 3UMTA 3DUHA 3GJEB 5BQDA 3OMAB 2EXYC 2FD6H 2DQEL 1HINH 3CFBB 3D50A 1N6QL 5L2KE 4OGYH 2X5PA 3W0WA 2DIJA 1RK1A 5KVFE 1BVNT 4IDLA 1HSBA 4C4KO 3FB7C 3ILQC 1WFUA 4HD9A 4NNXB 4PJFF 4UOQA 3O11B 4WU5A 1AP2B 3RDTD 2EE6A 4JASA 4CVUA 4F9PC 1CYWA 4JFEB 2E5LO 4TLTA 2JFCA 1EZLA 4GRMA 2NT0A 1CU4H 1EMTL 1YEDB 2HB0A 2UZIL 4M3HA 5JIIA 4GLRI 3EDEA 2NXYC 3E2HB 4HUMB 4WUUE 5FYKD 4BK5A 1ASPA 4XH2B 1KGUA 1MAMH 1URZA 3KXFE 1EN6A 4FG6C 3RGHA 2K1EA 2Y23A 1ACYL 4W68A 4FXKC 4APQB 5K59F 5FO2A 4U1KB 3LEYL 3S35L 5CN3A 4ZXBC 4AM0A 4RGNE 3HG1A 1XGRB 3QUXA 3QPXL 1MFNA 3C87A 3ZYJA 1SVZA 1E9QB 5BRZD 3VSUA 5A2JH 4XR8C 2YIBD 2N1TE 4GRLC 5CB4A 3LNDA 4N2KA 4OUUA 4DV3B 3GMLB 2FNBA 3LV3A 4PWKA 2ZDIA 2J5WA 1VENA 4K0KO 1BMWA 3GRWL 5ESVB 4LDLB 1JGDA 3I6SA 4PV1B 1JZIA 2BIMA 3A4EA 4YHPB 1WIUA 4G28B 1TJHL 3UTZB 4K3EL 2FX8L 2H8PC 2VXUL 3ZSSA 2DQGL 5DVLA 1BBDH 1X9UA 4DV1O 3FH8A 3ZRFC 1NEZB 4DNLA 2KG7A 1ZOXA 2H0JA 1YNTB 3IS1X 2VZUA 3LRKA 4HJSA 4JJ5A 3HHRB 5I1AA 1UH3A 2GC4C 1J88A 2R2BA 2VXSH 4J28A 4M6MH 5ANME 3MGTB 1NMAL 3MREB 4LBEB 3HOGA 3N2JA 4H0LC 3OPZL 1BBJB 3GBEA 2BZCA 4L4VD 1US6A 4JDVA 4RIRA 3BAYA 4PP2A 4A66A 3IGLA 4P5TA 2JJVA 4DOHE 3ZGIA 1J12A 3FU6A 1ES0B 1JWSB 2DMBA 4Z3JA 4S2SA 4DO2A 4M5YH 2JJ1G 2XX0A 5FYJD 4N9GB 3PQYE 5KHGA 3FQUB 1A0QH 1R34A 1ORQC 3VW3H 2EUWA 4OZHB 4J8RA 3CFKA 3HG0A 3VFPA 2C5DC 2Q0OC 3RYIA 5IHHA 4FXLA 5IHLB 5KVEE 3D06A 1ILUA 1EXHA 5E00A 2BIOA 1DQMH 1U8OA 3QXDB 35C8H 1P5VB 4NN6B 1J8SA 4NC2B 3EOBA 2QR4A 3DXAA 1UZ8B 5C0AA 1JCVA 3NCYP 4Y2LA 4KKLD 3UGXA 5FFOA 2CIKA 3K9SA 4NQDD 1LO4L 3TT1L 1AD0A 1G7JA 5FO8A 3D3VB 4NZRH 3MBED 3DMMC 4FG2A 4NKGB 1S3JA 1INDL 4ZO6A 3STLC 1BFOB 2EECA 6FABL 5MP6H 3O6LL 3TCTA 5B22A 1KJMB 4H8WH 3HC3H 4Y5XB 4NO3B 5E6IB 4F92B 3QHFL 4R4BA 2DLEA 1GH7A 2AJ3B 2J88H 4NOBA 5AB2A 4JZ2A 3CN1A 2C7FA 4K9EH 1F8TH 1T1XA 2HFFB 4JFFD 3SPIA 4JHZA 4X5WB 1JF1A 3FRPA 5DJZB 5BRQA 5JIDA 1CL7H 3UTOA 3ZS8C 1G94A 1P5UC 3WS6C 3RJDA 5I66A 4KMLB 5IYZA 2B2XL 4W9ZA 3HKEB 2OBGA 1MMMA 5JYMA 3IS0X 3PYCA 4I0KA 4FABL 2YD4A 5I1IH 1F86A 1QWNA 4WFHD 4IRSA 2VDLL 2C9UA 3RIKA 3SYQA 2QHLA 3VXUB 5K9KB 1HHGA 4PS8A 4M3KB 5KN5A 1JERA 3IC7A 5C6TH 2DE0X 2GDSA 1TZHB 1WCQA 3VXSB 5I5MA 3VXPA 3CC1A 5EU4B 2WP3T 2BVYA 4X0KB 3MYJB 5MERB 2CLRB 5A2IH 3DOHA 1RZ7H 3G9AB 1UCTA 1J5EO 4NUJA 1ROCA 2WWMC 3NFNB 3BD4A 4WI5A 3FNKA 4WZ9A 5GRUL 5IP4A 1R3IC 4HIJA 4DUYO 2WXMA 1KEMH 2G3MA 1E8ZA 1DJGA 4FLHA 3N27A 4U7KA 2WXLA 3PHOB 4H13C 2NX5B 5DK2A 4NNPL 1A7NH 4U1NB 1VFBA 4QRPE 3MRJA 5B7FA 5KSBE 4O2CA 2P5EE 2Z7UA 1TQCB 3ESPA 3F85A 1TEGA 1OALA 1EEZB 4GT1A 1CD8A 2QQNL 3ARYA 4G42A 5JPNB 4J3OF 4XO4A 1WC7A 1MJUL 1HYSC 4JF3A 5C0JA 2KB1A 4K7FB 2CO7A 1DQDH 2Z35A 3OC5A 1O6SA 1RJZB 1MA1A 3MOBH 3LDCA 2X2JA 2YEVA 3SGKC 2ZXDA 3FAXA 3ZL4L 1L0XA 1XBRA 3MYZA 2DMGA 4OM1H 5FM8A 4NCDA 4EI5B 4YDKH 5LNDA 5EN2B 1EN4A 1JZ5A 3S5YA 5GRZA 3D51A 3AADB 2AQ3A 1CR9H 1TR7A 2G0LA 2WVVB 4R7NB 4LCVA 3QF7A 1IBFA 3DOSB 4F5CA 1DBBL 1Z5VA 4O5LL 3UZQA 3WN6A 5IB5B 1MNUH 5KSAB 4G7YL 3T1WA 2KKQA 1PYWB 4WAFA 1JTPA 1KGCD 3O41B 1P7QB 2PP8A 1W8NA 1OCOC 3HI1A 1YEKH 1KXQA 2H0FA 4D7TA 1KIUB 4F2MB 5BXFA 1T0PB 1X5XA 4DN3H 2NRDA 7TAAA 2G0KA 2GB2A 3DHMA 5TH2A 5C0IB 3GK8L 3GSQB 3AC0A 3HRZA 3QJVB 3VI4B 3Q6GL 2IBBA 2X53A 1P84J 3K9AA 1XGPA 1CDIA 4WU7B 4YHLH 2IJJA 2D4DA 1B6DA 3WXVL 4YXLL 1JPSL 1GIGL 1N3NA 2NTFA 4IGGA 1NBZB 4XP6H 1D6VL 1IBLO 4LLDB 4RDQG 4DKTA 4IKKA 2QE7G 2HFGL 3QQ9D 4ZPTB 2JS3A 3WJMA 4BH8A 4F37K 3LB6C 1N7ML 2C3XA 4GXFA 4RFOH 4QRSA 1MRDH 4XCNB 1GYVA 2BOCC 4Y2DB 1HZKA 3MR9A 2WQSA 1ZV5A 1VQ9V 2DQIH 5F7HA 2GBUA 3JV4B 5F21B 1QHTA 2ZCZA 2WVSA 1S46A 2IALA 1NGXA 2ZOTA 3WEAA 3QWRD 4N4YB 2EIZA 5IYBO 1HL4A 3OKMB 5F9JA 3ZE1E 1GYAA 1M42A 1AGEB 1XH2A 1L0NH 4PRID 5DMYA 1UURA 3V95A 2FYYB 4U3CA 4W81A 1FBIL 2ZP8A 4TQ8A 4QHKI 2GBVA 2P06A 2I9TA 4X7FC 2E74B 2EEXA 2XU9A 12E8L 4JHAL 1DQLH 1LL1A 3QZBA 1CF1A 4EZKA 4MD0A 2AJVH 4L1LA 1P84K 1HCYA 1MW0A 2VE6B 1Q3EA 5HHOE 4JO1H 1T1YB 5K39A 4GP4B 5LXGH 1CLYL 4NFBA 4PJCE 4QRRB 4L8CB 1MCBA 2A0LD 2XWJB 4G43A 1DLHA 4HKJB 1K8IB 5HYJE 2OTPA 4DV4B 1T0MB 5JDJA 4B3TO 1LEIB 1XGQB 1MVUA 2YUZA 1WB8A 1A65A 1UHVA 4XMKL 3SD5A 4B9FA 4B9GA 4DR2O 3VD2A 2OLDA 1KUMA 3H1KH 3FTGB 1NGYA 4MMXC 2ZUSA 3PAUA 4U0QB 3U4EA 2E7HA 1VQ6V 1S8DB 1E8YA 1WTLA 2Z92A 3B2VH 4HXBL 5I8CB 4MTXA 3EJRA 5DQJA 3ROOA 4BQCA 1G9EA 3B7YA 2F53B 4QPJA 2B77A 3IE4A 2KDYA 2WOBA 5IUSA 5MEOA 2XVGA 5IVXB 3RVTD 5LA6B 5AW2B 2B15A 3P73B 3KPQA 3PGCB 3FKSG 4HKBA 3PGDB 3UFIA 1KBGL 4OLWL 4KVNL 4TQFA 1E4XH 3GB7B 3DBSA 3E2HC 5AW6B 2Q87A 3SGDH 1Z2KA 2ZYIA 4LOVA 5F1IB 4M1GL 5IWAB 4ODTL 3VVVA 1CFQB 5H94B 4EUPA 4APQC 2VABB 2GTSA 3BN3B 2CXKA 3Q9QA 1A7PH 5GPRA 2XT9A 1PY4A 2XIDA 3ARTA 3ML9A 4JO5A 5GSVB 2AITA 5D71H 5T3ZE 4EUPH 3HW7A 1ZK5A 1J5OL 2FTKA 2V8LA 2P8MA 2G30A 1FPOA 3G04A 3TXQA 2B9ZA 2IBZY 4FFZA 1MCNA 2GCYA 4PD4F 3LSQA 4HU2A 4O2BA 4PEEA 5ITBH 2CGOA 1FC1A 1W2BU 3BUQA 3F7PC 3EH5B 3FULA 2CO3A 5SX4H 4JFSA 3PXLA 3RNQB 4I88A 4PV1C 3MJ6A 1C5BH 3JCUZ 1CYXA 2HTKD 3H9SB 3BKCL 4HA1A 2LVEA 4BAYA 1IAIL 1QU7A 4AVIA 4G27B 1I9JL 4BH7A 2HKFH 3U0WH 4PJ7B 4HWEL 3JWOH 3ZMNA 3DV6B 1OB1B 2OMUB 1U8KB 4P2QD 2VXQL 4CL7A 3EYQC 1USZA 1AFVH 1M90W 4LNUB 2GSIB 1XGUB 2LLNA 4FGMA 1TUBA 1QFWI 2ADGA 2BCMA 2X4QB 3SCMA 5K9OB 4LBEC 1MPAL 2ENJA 1KPRB 4TSAL 1HT6A 5JO5A 1IC1A 4YHIA 1BIIB 1D5BA 2VXTL 1S3KL 3CQQA 3CUPB 3D07A 1BLIA 3GI8H 3OL2A 1L1FA 4AITA 1I08A 1SKVA 4ASUG 2JV6A 3MCKB 1DVFA 3QJHA 1CBJA 4OI9A 3FONB 2WQWA 1F11B 1DEEA 5FW6A 3UL4A 2ITDA 2EDNA 4GQ9H 2BSEA 3T0AA 2R9HD 3QPKA 1O9GA 1LDPL 1KC8W 4HZ1A 4PB9L 4AM0Q 1XMQO 2DI9A 4U7OA 2VITA 3M46A 4L2YA 2IDUA 4JI2O 4I18A 4OFVA 5JHDE 5T33L 3OKKA 1VFUA 4YDJB 4D9QD 4MJID 5BUAA 4S1RH 2B4CC 4F4LA 3EOTH 5IR1B 5C09B 3GBDA 1CLVA 2I5YH 5D7SL 4XHJC 4JFHE 5FYKL 4HS6A 2Q8BH 3KLKA 3V4VB 2BSBA 4I3RL 2OL3A 3ZRSA 4HQQL 3MROA 4LKXA 2IJKA 1FQ9C 1FL6A 4UV9A 1LP9B 4MJJA 4NO2A 1YMME 4M1DH 2EP6A 5F7BA 3TH4T 2ZWNA 3G6DH 4TL4A 2EE2A 3AY4C 2OL3H 3VU1A 4MX7B 3BAWA 1L9NA 1DFXA 1TETL 3EGSB 2EVJA 1Y18A 3O8XB 2APVA 3DHPA 3L3GA 5IJ0A 5I6OA 4Y5XC 5E6IC 1PNDA 3QQDA 4Z0BL 5KMGA 1EZJA 1OGTA 4YSRA 4N8CH 4FQIH 4O4YL 3W81A 5D7IE 1AYOA 1TFHA 3CC5B 3GMRB 3BKJL 1J8RA 4ZHQA 3BN9C 5D1QB 2VDPH 5F7YC 3H7BB 1AH1A 1JNNH 4ZK8A 3S7GA 5E99H 1P9MA 5L3FA 3BLPX 1LEGB 4G1MA 1MUJA 3T71A 1SA0A 1LNQA 4ELMA 1TMCB 3UJTL 1O0VA 4KOBA 3MV8D 4U6YA 2YD5A 1QYGL 1GTNA 4LCYA 1IL1A 1ZHNB 2VR7A 2YKLL 4O02B 3MVSA 4QF1A 5KVGE 3RYHA 3HMXH 2N56A 5CD5C 4ERSH 3ARUA 1T5KA 3ALWA 4OSUL 3UABA 4PELA 5I8KL 3DO3A 1EBPA 4NSKA 5IROD 4LCWB 5D7LA 3N50A 4EB6B 1H8EG 1A3RL 1WZLA 3MJ9L 5DQ9A 1MFDL 4ZW6A 2EUXA 1E3FA 3OHMB 1R5WB 5SWQA 4KL1A 3E6FA 1YN7B 3Q3GB 4G70B 2V5YA 2QWRB 4ZOBA 3NCXA 1NMBH 4A7TA 1HEZB 3KWVA 3K5SA 3PV6B 2ZXCA 1ZJBA 2ZXAA 3UIZA 3CXDL 3RW0A 1NQTA 1MABG 1S7XA 4QAWA 1D5AA 2WLLA 5ID0A 3SBPA 1M4KA 1Q0XH 1TCRA 2FJFB 4P9HH 1QFHA 5LAXA 3ZHQA 1GGBH 2QMJA 2WNWA 1E5AA 1TQCC 4DV0B 3WL9B 4KJQD 1T4KA 2YD2A 5EIQA 3CFDA 5JPNC 1S76D 1MJ7L 3IJ7A 5EORL 4YZFF 4J2QA 5D6DC 5DD6B 2N01B 4FNLH 1S9YA 5T5FA 3E22B 4X1IA 3A23A 1YEEH 2UXBB 3H3KA 2DJ4A 1Z9NA 5F89A 2ZOWA 4JG5A 5DHVB 1NDMB 1NTKH 4XVOA 4ZX5A 5F8QC 2PR4H 4KX9A 3UO3A 4JI7B 1TTAA 2CGZA 1KWKA 5T5FH 3ZCCA 1QUNB 3VDCA 4EI5C 2MHAA 1MCJA 1NC2A 1WA8B 2ERJB 4PLKD 3RKPA 4OJFH 1DBKH 4YX2L 5FIEA 4L5FL 4L3CB 3UZVA 3ZE1F 2COQA 4AQAB 3BISA 5GS0H 1S7QA 3MLTB 5C2UB 3EFOB 3RZCA 3CFEA 2ZSWA 3JV5A 4PBVC 1IAOB 3VOUA 3ZDXB 1NKOA 5C0BA 3SQOL 2V17H 5EUOB 5IHUH 4Z3IA 3HLKA 1P69B 1BZ7B 4X6CE 4DGWC 3DWTA 4WDIA 4P2AA 4I13B 3QVNA 3V4PL 1PNKA 4KKBC 2K6ZA 5EZLA 4PJCF 2IC2A 1M1XB 2PNDA 4U3FH 3HRPA 4HGWB 4CDHA 4DZ8A 3AG1C 4JEGB 3JWNE 4KI5E 1QSEB 3VTTA 3TJHD 5JCOA 4E41D 2F7IA 1N5YL 4UM9D 3F7RA 2J2ZA 4PGCA 2QGDA 4K73A 1FZOA 1K8DA 4A2LA 8FABB 1S7SA 1FFQA 2JJUA 3G71V 1ORSB 3O6FD 1NZ6A 4Y4FA 1YUKB 2P8PB 1QNZH 2QDOA 4R0LB 3T6QC 1CFSA 4DR5B 2UY6B 5MEPB 4ZUSA 4WWNA 4Y2DC 3W38A 1C12B 1FHGA 1FYTA 5HYQB 5AYTA 5IJVB 4DKFH 4FLVA 1N6UA 5C97A 2DQEH 4KKCD 4ODUB 1X7SA 3EG9A 1R3KA 1I3VA 4JFOA 4BWTA 2EABA 4WLCA 4JANB 3EFFK 3D18A 3ETBJ 4EIZC 1BF5A 4TSBL 2J20A 3G5ZB 5DJCB 3W39A 1FV1B 1U8IA 4AJYV 2NY5L 3C12A 2BSSB 3P9LA 2E74C 1JN6A 4R2GD 3HR6A 2VDML 3MLRH 5FWQA 1CXZB 5GHWL 3APDA 1EMTH 2UZIH 4HGMA 1YMHB 2C9SA 1AO7D 4LEEA 3N1PC 4AY0A 4B27A 2O26U 3UTTE 4TNVF 5C7XH 4QNHB 4G9DA 1JHLL 4QGTA 1VGKB 3MLUL 3LEYH 15C8H 1DVSA 5GRJL 2ESVA 3RWIB 2O6DA 2CBOA 3QQ3A 4YHYB 3EH2A 2V9RA 3STZB 4ZNCD 2D3NA 4BW9A 1DUZA 3GSOB 3MPCA 2A6DA 1PZAA 1U8JA 1H6EA 5J1AA 1HHHB 2ZUWA 4GIOA 3F84A 4TQPA 3LJ3A 2GG1A 2WYZA 3BE1H 1R4XA 3NJVA 1Z66A 4FFWD 4XBPA 3VFMA 4Y19D 4WV1B 4AIZB 4RSYA 4UT9L 4AQ8C 4EMZA 5B8CA 3AT9A 3L2LA 1WQVT 1TJHH 2EO9A 5AVTB 2ZOKB 1LK3L 4K3EH 1UKSA 2FX8H 4L3FA 3VGHA 4N24A 2DQGH 1ODUA 4QGYA 1E50A 2M7WA 4X7CC 4X64O 3EJJX 1GAFL 4BGLA 5LG6A 5EZJB 3RUGE 4YVUA 3C2AL 5FA3B 2YFNA 1JMKC 3CDZA 2DYSB 4ZI7B 1LEKB 3GB7C 3HG3A 3VX0A 4QJ3B 1MFBL 3KPMA 4K0OA 3VCLA 2PO6A 3MN8A 3OPZH 4QHNB 3GLAA 3BAEH 3QIUD 1ID2A 4IRZL 2BHUA 2Z6FA 3ULUL 4U31A 5L9DL 4XXDA 1HR0B 2UVEA 5FKAB 2WQUA 4RETB 1NR1A 3QEHA 2XJLA 2VS0A 3ARBB 3BGFB 3K6NA 3WUWB 3I6LD 1RSOA 2E4FA 1WT5C 4OI8A 3P0VH 1HJBC 2ZG2A 5D1ZA 1WBXB 2CK0L 1FGVL 3C5ZD 5K9JH 3D39D 4GQQA 1BAGA 3A47A 4A2FA 2UUCB 4ZIBA 3FQWA 3HG5A 3T2QA 3D3IA 2DOCA 3QRLA 1G4MA 2YBRA 1F42A 3OX8A 3ZQXA 1AXTH 3BVTA 4WWOA 1GCFA 3LKNA 3VRIB 4DR1B 3DVGA 4KO7A 1KIQB 1LO4H 1YNLL 1KYUA 3LQAH 4RMUA 3PE9A 4XCYB 5DMGC 2FIRT 4MASA 5D1XB 3RWDA 3RYCA 2VLRE 4DKEL 2CH7B 3CDFA 1JNLL 2Z4QA 1INDH 1EX0A 5LGKA 2OR8A 2XICA 5DUML 6FABH 1FO0A 2JCCE 1J5CA 1BG1A 4EEQA 3L4XA 1GGTA 4Z5RB 1FAIL 3O6LH 5JORA 1A1MB 1RHHA 4Y7MA 3A6CL 4K55A 4IOIA 5KBKA 3WJLC 1FO0H 3JAKA 3T0WA 3UXFA 5FPIA 2XAHA 1II4E 2CO4A 2MOQA 3W0WB 5C0NC 5C9JA 5C9KA 4JJHA 1FJGO 3O81A 1N32B 4K23L 5FOJA 1HSBB 3BEVA 4Z95L 5E7BA 4ZS7L 1ZGLA 3OLEA 4F1SA 4WU5B 3CZNA 4NXSA 4OGAC 2F93B 3HN8A 4GRMB 5DUPL 2IPTL 1DN2A 2WLIA 2VLKD 3WSQH 3ZKMD 4FABH 4I9WD 2FE0A 3ZDYE 2VDLH 2IWFA 1UXWA 2LP7A 2CJTA 4GB9A 1ZA3B 4K5PA 2GHWB 4OFIA 1C8PA 5EYPA 1BDYA 4AM0B 3L74H 3HG1B 1MI5E 3QUXB 4EIGB 5DEFA 3IJ4A 4PJIA 2YQBA 5I1KL 1F58L 4FJCC 1CXFA 5C07A 5CB4B 1L9TA 1X5HA 2C9VA 2R2CA 4V33A 4OQ1A 1MDAA 4N1CA 1ZGLM 3LV3B 3FZUC 3SPHA 5JOFA 2WLJA 4E9LA 2X05A 4F27A 2YRLA 1JGDB 3HBPA 4NNPH 4PJBE 4GXUM 1LDSA 3D3QA 4TQEH 2WHVA 4PW3A 4XP5L 1QKZL 1MEXL 4PJGA 4MVSA 3K2UL 4HS8H 1MJUH 4MS6A 2KG7B 1ZX3A 1T7ZA 1KECA 4LWSA 1B0IA 4JJ5B 3TPUA 3GXDA 2YK1H 1ZSPA 2R2BB 4QUOA 5ICZA 3RWFA 3OZLA 3ZMZA 2I60L 3BDYL 4RQEA 4IBSA 3ZL4H 5E5LA 1DJZA 4JI1B 1OAKL