5B1AB

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1aB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1aB02
2FT6A 3GYRA 4M4RB 4Q8BA 5I5IA 1L9OA 1A65A 1AS7A 1V10A 1IBZA 4UANA 2FQDA 3OM3B 1A4AA 1XB8A 1KDJA 4W9ZA 1W6WA 2DWSA 4BK5C 1PF3A 2FT7A 3ABMB 4JHVA 1KDIA 4KOBA 3AG4B 2UXGA 6PAZA 1UATA 4FA7B 1ET7A 2HZHA 2AANA 1ZV2A 2OCCB 1XMEB 1NDTA 2B3IA 3CDZA 4A2FA 4BDVB 4YL4A 2FJSA 1URIA 3BVDB 2CUAA 1CYWA 1WA2X 2XV2A 1EHKB 2PP8A 3NYKA 4PAZA 4BWWA 5B3SB 3FU7A 4A66A 2EILB 1AZBA 4NAJA 2BP8B 2J55A 3UADA 1SFHA 2FQFA 3QQXA 2CALA 3PXLA 2XXFA 4G7QB 1JZJA 3FQYA 2VN3A 2RACA 1ILUA 3PAVA 4GP5B 5F7BA 3UAAA 1MDAA 3MBWB 3SBQA 2VM3A 3PAZA 3CVDA 2DY2A 2HX7A 3V9CA 4KO6A 2BW4A 4Q89A 5I26A 3NJKA 3FQ1A 3QJSB 3WKQA 1GS8A 1GS7A 1PY0A 2IDUA 4GP8B 3AY2A 1ASOA 1CUOA 1GSKA 3D12B 4DP8X 3NSYA 4YSUA 1J5CA 4E9SA 4UF7C 1NIAA 1PNCA 1BQRA 3L45A 1BEXA 3ZX1A 1PZAA 3RYMA 1ASPA 1SDDA 1ET5A 2MRYA 3NJHA 4EF3A 1WS7A 1XB3A 2VM4A 2YAQA 3ZDWA 1L9PA 5I28A 1MG3C 2Y69B 3WG7B 2H47C 4YSOA 1JZGA 1AZNA 3FPYA 1OE2A 3PLYA 9PCYA 3NSCA 2I7OA 3NJFA 1ZIAA 2QDWA 2Q9OA 4N8UA 3AW5A 3IBOA 5F7AA 1SNRA 2ZWNA 1BXAA 3WI9A 4G7SB 2AVFA 2P80A 1AZCA 4DPBX 1MZZA 2DWTA 2ZOOA 2GIMA 4YVNA 1GS6X 3BQVA 2CBPA 5ANHA 8PAZA 4GXFA 3DKHA 2CJ3A 3N55A 2BP0A 2VMJA 2QPEB 4HCIA 2R7EB 2WO2B 1T5KA 3H4FA 4DP9X 3ABLB 1OCZB 3NP4A 4KO5A 3EH3B 2TSAA 3T9WA 3EH5B 4TXVB 3N2JA 4BXSV 1AIZA 1KGYE 2IDQA 3FSZA 1BQ5A 3FSVA 5D4JA 1B3IA 3DIVA 1X9RA 2XVBA 3OMIB 7PCYA 3H56A 1NWOA 1GY2A 2PLTA 2XX1A 3U25A 1QNIA 2GSMB 1KBVA 2OV0A 4ENZA 1I53A 1SFDA 3ZIYA 1PMYA 1NIBA 3FT0A 1YLBB 4KO7A 4BDVA 2BO0A 1J9RA 4F7KA 1BXVA 1WA1X 2QPDB 3FYEB 1PLBA 5B1JA 3S8FB 3DTUB 1PLCA 2B08A 2XWZA 4G70B 2BP8A 4JHUA 2BW5A 1BXUA 2HXAA 2GB2A 1J5DA 1DYZA 1GYCA 2FQEA 3OQRA 2IWEA 4CSZA 3X1NA 4AKOA 3TBBA 2W8CA 4DP5X 2BZ7A 2N0MA 3AZUA 5B7MA 1ZDQA 5I5JA 4AKQA 2VW7A 1IUZA 2XV0A 2XU9A 2GI0A 1QHQA 5I5MA 2PPAA 1L9SA 3CVBA 3WKPA 1WA0X 1GR7A 3TU6A 3QJTB 5I6KA 2AFNA 4DPCX 1NZRA 4F2EA 2HRGA 1ILSA 4HIPA 1RCYA 2HLEB 1TKWA 3PPSA 2UXVA 4YSRA 1HAUA 4E9RA 4WTQA 4E9QA 4DPAX 1X9UA 1JXGA 5LDUA 5I6OA 1AG6A 1AG0A 3AG2B 1JOIA 1F56A 1RKRA 4HHWA 1RZPA 2NRDA 1OOWA 3NP3A 2HX9A 1SF3A 4AX3A 5AFAA 2VW4A 2YXWA 4A67A 1PLAA 2IH9A 4K9JA 1A4BA 1E5ZA 2ZXWB 1JZIA 3T6ZA 4N4YB 7PAZA 1WAEA 3JTBA 4F2FA 4HHGA 4BXVA 5PCYA 3PAUA 3T6WA 2CCWA 3NJIA 1PZCA 1RZQA 2P80D 4DP0X 3CVCA 1R1CA 2R7EA 1J9TA 3CDZB 4BWUA 1A8ZA 1NINA 4G71B 4AKPA 5I6MA 2EIMB 5B1BB 3AG1B 4CSPA 1J9QA 2YAMA 2UXFA 4P5SA 1OCRB 3FU7B 1AQ8A 4DP1X 1EZLA 1HFUA 1TEFA 2JXMA 3NJGA 3IN0A 2GC4C 1KCBA 3UACA 4KNUA 2DYRB 4YSCA 3S3CB 1TU2A 2X88A 3IEAA 2HRHA 1QLEB 3WNIA 3WNJA 4GY4A 3ABKB 1XB6A 1SJMA 1A3ZA 1OV8A 2IWFA 3NJNA 1L9RA 3T71A 1ASQA 4WKXA 3KW7A 4E9VA 2QDVA 1FFTB 1BYOA 1OCCB 1E30A 2VW6A 5B1AB 1AS8A 2H5UA 4A2EA 1FWXA 3MX0B 3OD3A 1PNDA 4A2GA 1MZYA 4A2DA 4YSSA 2XV3A 1NIEA 3T6XA 5FC9A 6PCYA 5I6LA 2GC7C 1JVOA 2UX6A 1AR1B 3X1GA 4DP6X 5AKRA 2J5WA 3QJUB 4BWTA 2EIJB 5TK2A 1W6LA 2TSBA 4MFHA 4YSTA 4ZK8A 3KW8A 1BYPA 3NJJA 3S3BB 2DYSB 2VSMB 4E9TA 2YAHA 4HZ1A 2EINB 1E65A 1WS8A 3UABA 2AZUA 3NJLA 1IC0A 4QLWA 1ADWA 2XUWA 2IDFA 3EH4B 2PCYA 2FT8A 3GDCA 1M9WA 3JT2A 2PP9A 4G7RB 3OMNB 5B7EA 1NTDA 1NICA 2MTAA 4QKTA 3OMAB 2YQBA 3X2QB 1PAZA 1L9QA 1FA4A 1IBYA 1N70A 3ZBMA 2I85A 1AACA 1NWPA 4X4KA 3PCYA 1SHXA 2DV6A 4GYBA 5B1JC 4E9XA 2YAFA 2GHZA 3FYIB 2W88A 1ETJA 1JXFA 1AZRA 5IY5B 3HEIB 4DP7X 3NSFA 1V54B 1AZUA 5TK4A 2E86A 1GY1A 1VLXA 4KNTA 2WSDA 1MG2C 3IE9A 1E5YA 1JVLA 3V9EA 2A3TA 3X1FA 4KO9A 3X1EA 1JZEA 2VSKB 1OE1A 3FSAA 4JKNA 1KBWA 2FNWA 2XX0A 2YARA 3ASOB 2IAAC 2LLNA 4W1TA 5A7EA 1E67A 1NIDA 1TEGA 2BWIA 1J9SA 3IN2A 3UAEA 2ZONA 1JXDA 2J56A 5E9NA 2IH8A 2PP7A 5PAZA 1IKOP 1OF0A 2OJ1A 5I6PA 3TASA 4YSPA 4P5RA 2PPDA 3S8GB 3NJMA 3G5WA 1SHWA 3X1BA 1V55B 3FSWA 3T6VA 2YAOA 2FWLB 1ZPUA 5D4IA 2I7SA 4YSQA 2YXVA 4M3HA 4FAAB 4YSEA 2JFCA 4NERA 3UGEA 1BAWA 1CYXA 2J57A 2PCFA 4DP4X 5AZUA 4KOCA 3TBCA 4A2HA 5EHFA 4E9YA 1GW0A 2WO3B 2UXTA 1OCOB 2XLLA 3C75A 3TA4D 3QPKA 4HALA 4PCYA 1DZ0A 3WIAA 1M57B 2Y1AA 1KV7A 1ID2A 2YAEA 2QT6A 3EF4A 3FU8A 3NSDA 2BZCA 3EHBB 1HAWA 4AZUA 5I6NA 1KCWA 2YEVB 1PCSA 1NPJA 2GBAA 4YSAA 2IDSA 4AI7A 4UAHA 1SF5A 1NPNA 2JKWA 2IDTA 3ABGA 2PPEA 4GP4B 3FU9A 2YAPA 2PPFA 3FQ2A 1OE3A 3NT0A 3FPXA 4RH4A 3QJVB 1AANA 2PPCA 2EIKB 3ERXA 1ZIBA 3SQRA 1AS6A 1CC3A 1BQKA 2UX7A 5B1KA 1AAJA 2CAKA 2FQGA 2BWDA 3AG3B 4YSDA 1ET8A 4HCGA 3SBRA 4L0PB 1JZFA 2XYBA 1W8EA 1SDDB 3CG8A 1KYAA 3CZUB 2H3XC 3ASNB 4HCFA 4A68A 2X87A 2BHFA 4HAKA 4E9WA 4G72B 1JZHA 1AOZA 1CURA 4DP2X 3H4HA 3S3DB 3HB3B 1N68A 5B7FA 3GXUB 1JERA 5D4HA 1NIFA 1L9TA 4NB7A 3FS9A 1M56B 1A4CA 2IWKA 2XXGA 1ZDSA 2HX8A 3QJRB 4KNSA 3QJQB 4YVUA 2AZAA 2FTAA 2Q5BA 3SBPA 1PZBA 2BP0B
chains in the Genus database with same CATH superfamily
1XGTB 2AKRA 2HT4D 3OJDA 5CP7A 2EH7H 4WHYG 3H42H 3BP7B 2GUYA 2Z93A 2R27A 1N32B 2M7WA 1PL3A 1QG3A 1TVHA 5KSBA 5E9AA 1L0YA 4GT1A 6PAZA 4EXPX 2RJZA 3WTYA 1UH3A 4UQEA 4KC3B 4NUQA 2A79B 3A47A 1E4JA 1T89A 2K70A 4FXGA 2VWEC 1B6UA 3DECA 1KTCA 5FF6A 3WLWC 4YL4A 1J8HE 4AK2A 2JI2A 4LF9O 3V0FA 3OKDA 3S5LA 3EFOB 2UU9B 2FATL 4OF8A 5JCOA 1XXFC 3GBDA 4AGMA 4KY1H 1T6VN 1DQVA 1UWFA 3I2CL 5I1KH 3E7JA 1AIFB 2XG4A 4KHPB 1CGWA 3IRZA 3M17B 4JFDB 1HYSC 5F9OL 4HH8A 1CBVH 2QSCH 1ZA3B 2X7RB 2YIAA 2CLVB 4RBPK 4A39A 4AMKL 1JK9B 2R56L 1R5IA 3JYCA 2FD6H 4HJJL 3VW3H 3EO1A 4YGVB 1MLCB 1KT2A 4L87A 4GB9A 3RY6C 2A9AA 2VLKE 3NCYS 4WU7B 4KKAD 3S34L 4BFOA 2H3OA 3LQAL 1XZ0B 4R4FL 1YHQV 3ULVH 1BF5A 5ITZB 1DLHB 4YDVB 4RMBA 3B7RL 5FUCC 4YX2L 2WLZA 4Z0XB 3JATB 1JPFB 4Z0BL 3VXSE 2K9UA 5TJWK 3ZKXC 4LBAA 1KN2L 3FFDB 5DZAA 3DX6A 1AMXA 4HSAC 1S5HA 2XWRA 1YF2A 3CJHB 1IGMH 2CIKB 3WKYA 3O6FD 2XN9D 1YJ9V 1XDTT 3TZVB 1BT8A 2QSVA 5FYLL 5EUOF 3HE7B 1HKLH 2IPUG 3O6KH 4HZ3A 4TLSA 3DUUB 4O2CA 5AW7B 1WZMA 1QLRA 4HKXB 3K8LA 4UB6Z 1BQUA 3PREA 4PREA 4BE6A 2V4LA 4QIRA 2NY4B 1I8IA 3PLYA 2YD5A 3P73A 5MERB 4FFVC 1HK6A 2X6CA 1BQHG 3CRMA 3BW9A 1GZQA 4Y1TA 4ZYKB 2BNRA 3NA4A 5FYKD 1MIMH 1MCWW 5EO9B 3O4OC 2PXYB 5LO7A 2BOCA 5ANHA 4H8UA 4PRDA 3K80A 3LPOA 1CTMA 4HK0A 1QBZA 3DKHA 3L95A 2PTMA 4Y2DB 4YIPA 4WNQA 1M4KA 2XKUA 2XASA 4LSVH 3RFZB 2HN7A 1ZWIC 4TLTA 1X5LA 3E22B 2R1WA 1KCSH 2LT9A 4CS3A 5DFVC 3HG1B 4LLVA 3GXFA 5K59F 3LMJH 1RIVL 1KTJA 2D3LA 3L73H 4JAAA 2WZAA 3FSVA 3OKEB 5FO7B 5C0EB 2YFNA 4J6IA 4ZOLB 2WJ7A 2XVBA 1TSHA 2ZSVA 3E8HA 1GAXA 1E4KC 1PQZA 3OAUH 3VMPA 1QNIA 1N0JA 4DV0B 3O3DB 1TU2B 3OXRB 1QSZA 4PJHE 1UADC 3CDCA 5AW6B 4LB8A 3QNYB 1IVTA 3G6AA 1YLBB 4O4HA 4HUNB 4HX1B 1QBLH 1DVTA 5EU5B 4A04A 2GEQA 2VLKD 3CZFA 3VSTA 3WN5A 1FXKA 1J11A 2YLKA 5I0WA 1YCIA 5GS0D 3PWJB 3DTUB 4O4IA 2VB5A 2W59A 4KTYA 5DJYA 4OI8A 2XAJA 4NXNB 2P7TA 2HTKD 5EOTB 4OCXH 3KPMB 1DQJB 3DVFA 3UG5A 4WO4A 4YDKL 2F93B 5ENWB 3VXSD 5JPMC 2CD0A 2CM6A 1G9ML 8CGTA 2NY3B 1ZS8B 4KXZI 5IB1A 1KIRA 1V7MH 4GRLD 4KXDA 4UU9B 1INEH 2NYYD 4MA1B 2BZ7A 3CE1A 3ZRFC 4TSAL 4ETQB 4A7QA 4JHBA 5EZLB 2EVFA 3RPIB 5C0ND 5JVDB 3CXDL 3E6FB 4OFVA 5EN3A 1NC2A 1TA8A 5I5JA 4BINA 2YDEA 3EZ8A 5JIPA 3CCHA 3VD4A 3CPUA 5LP6C 1KGJA 2DWEB 4R3SB 1BA9A 1Z2GA 3UP6A 4MB5A 2VZSA 2KERA 1SF9A 3GB7C 1AGDA 2A74C 2BVOB 4JREB 1CQYA 4LSRH 4OLZL 3UJJH 4M6AA 5AYTA 2APBA 1ZVHA 5EOCJ 1DE4A 1GGIL 2WZPA 3T4AA 2HVBA 2Z4TA 3B2VH 5T1MB 3M7FB 4AIZA 3GSXB 4FXKC 4QTIL 4LSSH 1F41A 5JQHC 4HWBL 5BRPA 2E9BA 5EUOB 4IRSA 4WTQA 5CN1A 4YDLC 3LY6A 3VQ1C 2WUCH 4IGGA 1SESA 1AGFA 3WFCL 1YEFL 4QRPA 5E9DA 4JRXA 3U4AA 2D31B 4I3SL 2FUQA 1YI2V 5KG9A 4H37A 1XH3B 3I50L 2IOMA 2CBMA 3GEFA 1IE4A 3ZIAG 2MQ0A 4RA3A 4XWOC 1DBML 1FZOB 2ICWI 1IGCL 3KVDD 2OXHB 4TS6A 4NTXA 3E3QE 1NAKH 4FLOA 1BCCH 3FTGA 5CJXC 5D2LE 2VSDA 3FONB 3NEOA 4Y4FB 3L1GA 4PRPE 4RAUA 4NCDA 4DV6B 3U83A 1U8MB 4IK7A 3ME0A 3MOBL 4YNYA 1TLMA 5PCYA 4KKLD 4F1ZA 2V9TA 1RSFA 1OHZA 5LQBH 3H1HH 3ASWA 3BVVA 1KYOF 3MRNA 4LBEC 1FKAO 3OD4A 1J7VR 1J9TA 1XF5A 3V79C 2DQDH 3CZEA 1GOGA 4GRWE 4ELDA 3BA9A 4WW2F 3EIFA 1DP0A 3V4PA 1DQLL 1OCRB 1EO7A 4RIRA 4FCHA 2N05A 2XTJE 4QE9A 1JCHA 1E9OB 2D0HA 3OLDA 5IEHA 1N36B 3C09B 3SPJA 3UOAB 5LWYL 5IFAH 1KB3A 4TUJB 4HPOL 2BY1A 4JQVC 4ATWA 3O3AB 1JZ2A 2YPLE 1KCVH 1CZ8L 2VDOL 1MNGA 2B1AL 3AROA 5IBLC 2MCMA 4YJ3A 3DUHA 4MTFA 4N0FA 3ZO0A 3AVEA 3J07A 2MNJB 2AQPA 4L5FE 3C2AH 4LPTA 4D8OA 4Z7NB 5F1IA 4PJXB 3MRLA 5C0FB 2EZOA 1JGDB 3MUGB 4L1SA 1IARB 3HKEB 2RB8A 3PGFL 5GRXG 3JALB 1N2RA 1UM4H 5L7XH 1QR4A 5C6PB 3WY4A 3QI9C 4KUZH 2GC7C 4KNQA 4RVBA 2R59A 3S3PA 1NCWL 1KBHA 2RR3A 4I18A 4UTAA 2O4EA 1F13A 1W6LA 5IK3A 3OKLA 2Q76A 2EICA 3L9DA 5J13C 3KLAA 5D7EA 5JWPA 2AK4E 1A2YA 3NJJA 5E6ID 1X3DA 4X4ME 4UILH 3EOTL 3ZLQC 2HFFB 1P4LB 1DSYA 3BT2L 1T4KB 1FH2A 4L9LB 1Q1PA 1G9NL 1N4XH 4Z76A 1BECA 3UYPA 2P45B 4N1EA 4ZDHA 1YNKH 3CCEV 4ODSL 2VLJA 3WIFB 2V7NA 2E9GA 4QLWA 1WQVT 4Y5YA 2ZKYA 3I55V 1FL6A 2WTRB 3V10A 5I8EA 1DJHA 2GSIB 2YBRB 4KAQH 3HE6B 3DURB 1U33A 1CDUA 3V6OA 4PRPD 4V11A 1P7KA 5EZOH 2BVUA 1FP5A 2ARJB 4BR6A 4N0CC 2ESVA 2N74A 5A16A 3DC5A 4GT0A 4L2LA 1HT6A 2VQEO 1PAZA 4LFCO 1WZ1H 1L9QA 2IFFL 2R1XA 2X28A 3P30L 1N33B 4XB8A 5EEWA 3U0ZA 4GSUA 5LN8A 2ENQA 3EJYD 3V4PH 4JJOA 4X5XA 4FQLH 4U3SB 3DX9B 2XTJD 3CHQA 5BRZA 3SGEH 2YAFA 3RURA 2XJLA 4M61B 2GHZA 1R75A 4PW4A 5EF3A 4KWUA 2R0KL 4WWOA 4XR8C 4TQHA 3QO0A 2WXMA 1CFTA 4PQXA 4WNJA 2YXHA 2EDYA 2Q3AA 2YPLD 3ZMZA 2E9IA 1ROCA 1T83A 2P42B 3F7KA 1MG1A 2CO6B 4QRSA 2CIIA 4J3TA 3GSRA 1SXCA 5A2KH 5IJ0B 5E8OA 1YTFB 1A64A 4UIMB 2VRQA 5KYYA 5ERWA 3EYUH 1G7IB 4ZUVB 1N64H 1AR4A 4NYKA 2VSKB 2JKTM 4FTVA 4M29A 4JFQA 1FNSL 3V0IA 5A2JH 3ML0A 1LQBC 3HKBA 2AKRB 3APCA 3OJDB 1EWHA 4JO4L 4KTDL 4PS3A 5CJ8A 5CP7B 2IQ9H 3ECBB 2Z93B 3ARED 2DBLH 1GYUA 3MHZA 2NW2A 2LW1A 4NZDA 1CE6B 2VDOB 5HHVH 1GRJA 3W7TA 1JXDA 2ZD0A 4AJWA 4QTFA 4CA4A 5KVEL 5KSBB 1CEZA 3I3EA 5G55A 2O6PA 2AMUA 4PS7A 1DLFL 3QAZB 2AK4D 2OTLV 2BVYA 1IC7L 2WTOA 5FF6B 4D0CB 2R15A 1S5JA 2EAEA 3NIFF 4NTYA 3CFEA 5DEJA 3OSKA 4K8RH 3V4UH 5DR5L 2VXSL 4HFUH 1IRAY 3CFDB 1VARA 2J57A 3EJJX 4CMHB 4AILC 4KPHL 4M7LH 4NVPA 3LXUX 2E7LA 3ZHRA 1A9EB 4YE4L 3L9BA 3MUZ1 4UINL 4M00A 4XNXH 5E2JA 2F4VB 3ARGD 2E9WA 4KRPC 1UT1A 3G6JF 4HK3N 1SOXA 3BYYA 5DD6B 2EDTA 1GZHA 2OCHA 3K6SB 3LIZA 2TRHA 4JFSA 3EHBB 1J5EB 3EO1B 2ADFH 3QHFH 1KT2B 4ODTL 3GVMA 1DUZA 2Y1ZA 4NAQA 4OGYH 2GTZA 3OHXB 2HJFB 1HEHC 2EDRA 2YN5A 5L3BA 1QI5A 2PTUA 1Z5LA 2HVKC 1DJWA 2D03H 2DS4A 2WXFA 3EXJA 2PWHA 4HXAL 4S1SL 1B4JL 4MHHI 4HYTB 2NXZC 3L3DA 3IPBA 3FTYA 4N0UE 4OLYL 1PKQA 4FQXD 5J3HC 4ELMA 1S72V 2E76C 3DX6B 3M88A 1S5HB 2H32B 2VNCA 1WFNA 2F1BA 5ITBL 4A38A 1A6TA 2E7DA 3QYMA 4NLAA 4L3EA 5C3IA 4GKKB 1W8EA 2O26U 1ERNA 4FQCL 4PLKD 5EF2A 4Z7WA 4NENA 4HUVA 4HQQL 1TJGL 4O2CB 1SLUA 3MJWA 1QLRB 2X41A 3QZMA 5I18H 2X87A 2BHFA 4D9RE 3HMWL 4PREB 1DSFH 4FQ1H 3ZHFA 4NWTH 3RE0A 3WL9A 3W2DH 1CURA 1I8IB 1BFVL 3P73B 2HKFH 2WYIA 3BEWA 4ZTOH 5BQ7A 3FF8A 1ZTXE 2O6EA 4ZO9A 5D4HA 5ACMA 2WNXA 4BE5A 3RT3C 1NGQH 4KHTH 1Q9OA 3D4YA 3US9A 3FS9A 4KKNA 3ZHQA 3BY6A 2BNRB 3VOUA 1TAEA 3T6QC 2WBXA 3L4WA 4FJZA 3Q44A 4Y9CA 4PRDB 4LF6O 3QJRB 1JHKL 2MSPA 1IX9A 4CJ0A 2VLMD 3DVGA 4TYUA 3L95B 2WBJC 2IU0A 4FD0A 1E40A 4WNQB 3IU4H 3NSXA 2FX7L 1D9KC 2B59A 2HN7B 2PN5A 1OTUC 1UJWB 43CAA 1EGJA 1A4AA 2YA2A 3LXBA 4KKCC 5F3HA 4P4KA 1XGZA 3K4AA 4M3KB 1GJWA 1PF3A 5IW1A 3FB6A 4XBGA 1KDIA 5F7UA 2A0LC 3BN9D 4X7FC 1X4TA 1G1CA 1T0NA 1Y7VA 1P5VA 5D4QA 2V7QG 3X12B 2ZSVB 1BQZA 1CLCA 1PQZB 2AANA 4LOEA 3FRPA 5DQJA 3VGFA 3LIZH 4OGAD 5DZJA 3NIFB 2DLFL 3Q1SL 1RJLA 1N59A 3G6AB 4L1BA 5KANG 2FJSA 4XP9H 4X64O 1WAAE 5EC2C 3JWDC 3IGLA 4NO0B 3CZFB 4MXVE 3WN5B 1FXKB 1LO5A 5B3SB 3AK1A 4O4IB 1YEHL 2FGZA 3ARDD 4NAJA 5DJYB 4UI2A 1B4RA 1XIWD 3GWJA 2CALA 5DK2B 3L74H 3MSPA 3PXLA 4G7QB 1N9PA 4WO4B 2G60H 4JQIL 3QXWA 5E1QA 4DUZB 3KL5A 5I1CL 4JY6B 5HHQB 2XQBH 5IB1B 1KIRB 3FZUC 3BKYH 5D1ZC 3L17A 4UTAL 4PHXA 3WO4B 4U1GB 4PA6A 4KL1A 4YO0A 2Y6SC 5H35A 1NC2B 4P2OD 1O6VA 3CP1A 3CCHB 4MNHA 2PCPB 2DY2A 4OCYH 2OKMA 5I26A 3VVVA 5DMJB 2VDLH 4M6ML 4Z1PA 1GS8A 5I6XB 1F90L 1AGDB 4D9RD 1RPRA 3LTVA 2PYFA 5EYPB 1F3DH 3H1LH 3CHPA 4GNKB 3LRHA 2M83A 4GW5A 4MVOA 1IVLA 5FYKL 3ZHNA 3H9SE 4M1CD 3T4AB 1NGZA 3IDJA 4JTCB 1WP7A 4CH5A 4QXUL 3SOBH 4AIZB 1I9JH 4G1EA 1YSCA 4KJPC 1MUJA 1IZJA 1LNUA 2XIDA 3L45A 4DV5B 4IRSB 2DQJL 3TT3H 1IAII 3MRKA 3GXPA 1XX9C 4P9OA 4EVNA 4IKJA 1K33A 2BXYA 4QRPB 5E9DB 5GGTH 3DROA 4JRXB 3MLZH 2I60H 5A2QN 3ZDZE 5KG9B 3B2MA 1EGJH 1BMGA 3AWFA 2H47C 3T2NH 3NSCA 2MPAL 2CK0H 4D2NA 2Q9OA 2OZ4A 2BY0A 3F00A 4G8EA 2EO7A 2B0SL 1QW9A 1JGVL 1WLHA 3M8OL 1GPOH 3FTGB 3EBIA 1AJNA 4YH6A 4B53A 3CN1A 4RAUB 5DF0A 1EHXA 4DSYA 1CGUA 1SQFA 5CILL 2FYVA 3ME0B 2RMNA 4YNYB 1FXHA 5GS0L 3INOA 4NC1E 1IEAA 4I13B 4ZO7A 1AYRA 1XF5B 4PJ9C 4M7KH 5GGSA 2YD8A 5CIPA 5F7LB 4DO2A 3V4PB 4GUOA 1FVDB 3OVUB 1GC1C 2YQGA 4RIRB 5AL8A 5BUPA 4JHAL 5E99H 2AHZA 3A6BH 1Q8IA 4HJSA 4N23A 4L0ZA 5CLWA 4RISL 4LNRA 2NUTB 1YAIA 2KLSA 3B2XA 1QO3A 3MV7A 4M7ZC 2OV0A 4FCAA 4Z23A 2UUBB 4LFHG 4TSBH 4ZFOA 4ZW8A 4YJ3B 4A37A 4N0FB 1VF7A 1E90A 3CH8A 12E8L 4UVAA 2H0EA 2XFXB 4HOMA 2CO3A 2UXCO 1G87A 5HGBA 4L8BA 3LB6C 4X9HA 5F1IB 3IJ9A 1EDYA 2ILLA 5F96L 2MEJB 2NCEA 1BXUA 3AB0C 1RZFL 4MRCA 2GB2A 2P5EE 2ARHA 1T1XB 1U36A 1XR8A 2ORBL 4CSZA 3H9SD 1EAQA 4G9FA 2ZM6O 1FRGL 1RUAH 3HAEA 3MRMB 4I18B 2YPKA 1CGTA 4JKKA 4LEBA 2PGGA 3WB2A 1L5GA 1IGJA 2ADJA 2BS8A 2VXUH 3AS2A 4N68A 4XO4A 5HGHA 1RZIA 2Y07H 4ZOBA 3X3GL 3KLAB 2C9AA 1I8MB 5KVFH 3RKDC 2XU9A 1AXTL 3BUPA 5BXZA 2HFGH 4FLHA 4Z76B 4IGBA 4HWNA 4AJ0A 3UYPB 5I5MA 4PGZA 1LWRA 4R90L 4ZDHB 1VQ8V 1H3XA 1GR7A 5E4AA 3D25A 4PJAA 4Y5YB 1VGEL 3MD0A 3V5DA 4X6BA 3C6LC 4ZMZA 1FL6B 2ZKOA 1F4XH 4PJ5E 5I8EB 1FSKB 4CC0A 4CVWA 4ENED 5LYJA 2HKHL 5FW6A 3KPNA 3JAMN 1ILSA 2HKOA 1PG7L 1LE5A 1TQBC 3ARSA 1P7KB 5AWNL 1P6WA 4PJHF 4EKWA 2ESVB 5D7JC 5IV2A 1KFGA 2K8QA 4HWEL 3X3FL 3O2DL 4ZUTB 5IB4A 5E2WH 4DR1B 1DQTA 5I74C 2R1XB 4N22A 1RZPA 3VXUE 4HS3A 5CINH 5T3XL 4PV9A 4YBLB 4M02A 4UTCA 2WSKA 1OP3H 4X5XB 4JG5A 3OZ9L 4G80A 1U3YA 5BRZB 5DVNA 2WUBH 1MZEA 1WC7A 3UBXA 1FV1A 3QO0B 2EYRA 4F2FA 2F7QA 5GGVH 2E46A 1WWBX 5DDHA 4R9HA 3H3KA 1OM9A 3ZKNC 5ESAA 3QO8A 4QRSB 2CIIB 2VRAA 1EHLL 3RL1A 1Y6NR 2DQ6A 3GSRB 4PJFE 3IFOB 4BWUA 2P26A 3M7OA 3HMXA 4KI5C 3OB0K 4MVBC 5E8OB 4PYHA 3SD2A 5KYYB 3JTSB 4BQ8A 3T4YA 5ERWB 4MJIA 3RVUC 1JNHA 3UTZA 5I9QB 4FTVB 4P23D 3E8UH 4JFQB 2P5ED 3HKBB 2P22C 1FG2A 4GRLB 2CKBH 2EC9T 2DYRB 2BSTA 3NTCL 4GAYA 3HAEH 4C56E 1I94B 2NW2B 2R29A 3A6CH 3Q1EA 4UWQB 4FULA 3KCXA 4FFZL 4WF9V 3WKMH 2EIJC 1FLRH 3EYQC 3O2WL 2WZ5A 5GRVL 1OV8A 3N43F 4S1RH 4XVJH 4NWUL 4UV4L 2W60A 2P67A 1IFHH 2XZAL 2UXDB 2EYSA 4J6RH 5BO1L 3RUGE 5BNXD 1AS8A 1MFBH 3HZMB 2XZCH 3BIBX 4UM9A 2O6DA 2F95B 2C8NA 4PJ5D 2WB1A 4AM0A 1WAZA 4PRBB 1WPBA 1KCRL 3MBEC 5D2LF 4GO8A 15C8L 4NXMO 4JM2D 1NQBA 3FCSA 1ZLVK 4F33B 4LASH 1J1OL 3QF7A 1IAKA 5CU9A 4BUHA 3TONA 1XWVA 2P5PA 5DHVA 5HD8C 2LGNA 3HI1A 5I30L 4GRWF 5MP6H 3VXUD 3X11B 4OF6A 2K78A 4A7VA 1JZ7A 3UABA 2MKWA 2AZUA 4M5TA 1DUZB 5DD0H 5MHSD 3CFBA 5I75B 2DEYX 2GTZB 3RHWK 2UZYA 4QXWA 2ZOLB 1LP9A 3OC8A 4GLRH 4Y89A 4JDEB 1T66C 1UACH 1Z5LB 3GDCA 4TF4A 3A4DA 3WE1A 5ECGA 5A40E 3ELQA 3TA3A 2CJSA 4WHCA 3BFOA 5FGBA 4B9FA 3EO9L 1PKQB 4L5FL 3QCVL 4ELMB 2R2BA 4HV8A 3ZTDC 3L3HA 1D5NA 4E41A 5FOJA 4GKJO 1QI3A 1WBXA 1CDGA 4R4BB 3HMXH 1W0YT 1Q43A 1A6TB 1YITV 4L3EB 1EBPA 2TAAA 1TQTA 2QTEA 4UT7H 4HUVB 1W0VB 1LD9A 4NENB 4Z7WB 1IQDA 3PCYA 1FAIH 4GYBA 4HPHA 3U0WL 1JZ3A 1MAJA 1ZD6A 1FGVL 1HH9A 4WCYH 1YMME 2CLRA 1JXFA 1G7HA 2GQHA 3ZZSA 3KL3A 3WL9B 4C56D 1IBBA 1GMIA 2OZ4L 5H4YA 3BEWB 5BQ7B 4B97A 1RHFA 3F7LA 3TM6A 5BOJA 3ZN0A 4FNSA 2YC1B 1EPFA 1Q9OB 2EH8L 1MF2H 5DTFB 3UDWA 1JDDA 2CO2A 1MG2C 1ONQA 4W9CC 3SDYH 3V9EA 3FDWA 3AMLA 3X1EA 2GJ6D 1OHHG 5F6HJ 1OSPL 1ITCA 1KBWA 3C5ZD 4MMZC 2MQ3A 2B59B 4JVWA 1QBBA 43CAB 2OMYA 2ZXAA 5F3HB 2Y48A 2YPVA 3B2UC 4P4KB 1KIPA 1NIDA 3CC5A 2YS4A 4R0LA 1J9SA 2JI3A 3N43B 3ESUF 4L8SC 1Q81W 3FB6B 5IYZA 4UNTA 3P1VA 4XBGB 2QM4A 5IW1B 4CKQA 1VEWA 4LVHB 5E6IB 4YZWA 5CCJA 1DBKH 4RGOL 4WHDA 1AQDB 4IBUA 4P5RA 3C8HA 1KBPA 5DHVH 3E89A 1B90A 1IC5H 3FRPB 5DQJB 1M57C 2V37A 3UG3A 1PS3A 2ADGB 4PGEB 4LPWA 3Q6FA 1RJLB 1N59B 3U30B 2P1YA 4GMSL 2HJLB 2Z7YA 1U8JA 2Q73A 2XXMB 4PU2A 4AYEC 5M94B 4UXNA 2WKOA 1LO5B 1MNUL 1DO5A 1K34A 2DTMH 2JFCA 3P2BA 4JR9L 4MDJA 4X9GA 1P84K 2BHZA 5AYUL 1U3NA 5F44A 3NG5A 5DRXA 2IOOA 1H3TA 1HHGB 3P4OA 4RMUA 2X38A 1HWHB 2XLLA 3T5WA 1EJOL 1DJXA 2VT0A 3KS0H 4JUSA 3QQ4A 3QULA 5ANMA 3JWNE 4HXBL 4GRWB 2YZ1A 1DZ0A 2NYKA 4OX9O 2Y1AA 2L6LA 4K0KB 2A6KA 1JN6A 2BZCA 2D2OA 3O2VH 4YO0B 4P05A 2EE0A 4U33A 4R7NA 4OV5A 4O4JB 4MNHB 3ARFD 3WNKA 4YSAA 2IDSA 35C8L 1P9MC 4MT8A 4QY8B 3GIVB 2FB5A 2GDSA 2CXGA 2GTQA 1YMMD 2PYFB 2V3FA 3FMGH 3V0VA 2V9RA 3FQWA 2OSWA 2VITA 5IQOA 2FBJH 3ZBHA 4GW5B 1QUNA 1AS6A 2KHAA 1NGZB 1JNNH 1BQKA 1I3RA 1TIUA 5EBMC 3ARUA 4G1EB 5L3GA 4XAWH 4Z7UA 3IC9A 1MUJB 3Q6GL 1LNUB 2R4SL 1K3IA 3MRKB 3L75H 2X1PA 3AQDA 3QXAA 3QDJE 1D5XB 3ULUL 4EVNB 3HPLC 4OQTA 4B41A 1KYAA 4F8PA 4R5XA 1V7NL 3DROB 3P2DA 5DK0B 3UYRH 4A68A 5BCAA 3JBG7 1G84A 4FLQA 2QSTA 4WI9A 3QIBC 4PV1B 1TJMA 4DP2X 3HB3B 4RZCA 3VRJA 4OI9A 1SM3L 2EECA 5GS3A 5T5NG 2G38A 1HU8A 2QKIC 3BIAX 4G8EB 1F1GA 3HG5A 2WA4A 1GGCL 2AK4B 3CVIH 2Q8AL 4NB7A 5JO5B 3WUWG 2RMKB 2YUAA 2RTTA 3HRZC 4G8GE 3NIGB 2IWKA 4KDTC 1E2ZA 4D3CL 1EZJA 5D6DA 3CRAA 1QFWI 3BN3B 3PWPA 4I9WA 1JA8A 2FX8L 3N9GH 3CN3A 3V6ZA 4BFRA 1MAMH 2UWEA 1XH1A 4NJ9H 4RMVA 4PWFA 1SVCP 2N56A 1KPVB 5IROA 4I0KA 1QP1A 1A7QL 5GGSB 3BXNA 5CIPB 5C7XL 3VG0H 4JX0A 4L4TE 2PWGA 3V5HA 2FT7A 4KOBA 3ARGB 4OFQA 2CKNA 2DOCA 4H7VA 3APFA 1H3GA 3UPAA 2J44A 1O9GA 2MK3A 2X9WA 3H55A 3U0TA 4B50A 3D36A 1LILA 2QPFA 3MV7B 4ETYA 2DMCA 5T1JA 2D0FA 1YEIH 4AVKA 3G08A 3QZPA 2V0AA 3QPXL 1DBJL 3ZRSA 2NCMA 4KKZA 2F0CA 3VFNA 1CYWA 1U0QA 4L8BB 1EHKB 1QSEE 2ZE7A 3GTVA 3VD2A 1V55C 2QADC 1NMCB 3W7UA 3UADA 5LOVA 3LSSA 3BKCL 5EULV 3QNZA 3ZRXA 1LO4L 3EDJA 3BSHA 1I7TB 1QOKA 5FA4B 1IT9H 3FQYA 4KQ3L 3W39A 4FA6A 4HLZH 2Q9LA 3UIYA 3ZSSA 4NGHL 5BZDA 3IJHA 2ZWKA 4G9FB 1URFA 5ES4B 3HAEB 3BLBA 4W70A 1VDGA 4CN6A 2EDBA 2F5BH 5B3JE 5J12B 5CZKA 5J1SC 1J1XL 2GBOA 2VWJA 1IGJB 2ADJB 3BO8A 4X9YA 1L9MA 5HGHB 2X7LA 4PWGA 3QDJD 4YEFA 1RZIB 2VO5A 1JFFA 3QUXC 2X10A 3ILQC 4NFCA 4F7MA 4ZI7A 3AITA 1FZMA 1Z9OA 3VFGH 4UTBH 1GS7A 3JWNG 5IOKA 4DT2A 3OWRA 1A6PA 2VZ3A 2FAUA 4WI7A 3D25B 3V5DB 4EI5C 1FF5A 2HUEA 4X6BB 4PRHD 5LYJB 1L3NA 3KPNB 4N0YL 1OAUH 2BSEA 4G8GD 4RUEA 2CTPA 3B09A 2NSMA 5D9SA 4X6DE 4WAFA 4QE7A 1NMAH 2HT3C 4EUPG 5IHUL 1RZKH 1YQVL 4K5MA 3RYMA 4EKXA 5IV2B 3ZL1A 1WAAF 4IT5A 2A9BA 2GYSA 4J23A 4X7EC 4LL4A 4YE0A 1FO0A 3ZQWA 4P04A 4FDWA 3B83A 1L9PA 2ED7A 2GAZA 4I2XE 1FL3B 4HS3B 1M7IA 4NRYA 4PV9B 1T4WA 5I28A 3S36L 1J0KA 4JV5B 3FPYA 1QSFA 1UXWA 3EYSH 4G80B 4L4TD 5GPRA 4B6ZA 1I7ZB 1ZIAA 1U96A 2Q20A 1E5UI 2E4TA 4XI5C 4XPFL 1P4BH 4Y2LA 4A6YA 4E0RB 5CZXD 1OAYH 1WC7B 4UDUB 4ABUA 4YHZL 1FV1B 2EYRB 3LZPA 3WI9A 4OAWB 5LNEA 1HOCA 2YS8A 4LARH 3UIZA 1IQWL 4PBXA 1Q90A 2ZJSH 5I19L 5ESAB 3AS1A 4Z7NF 2J8UA 5ACLA 2UVEA 1MCSA 3RL1B 2AI0H 5B38A 1JFQL 2D7TH 5KWYC 3SYPA 4DV1O 1QSED 1YJDC 4M4RA 4DKDC 2BH0A 4AE1A 3GMLA 2OBGA 1CDCA 4XOEA 4WFEA 1BQLH 1ZHNB 1I8LC 3FO2A 3BP4A 4MJIB 4BCYA 1AI6A 2AQTA 4BXSV 4W4KA 1JNHB 1TJIL 4BUQA 1NBVL 3HFMH 3RFRA 4UOQA 2FCBA 4DERA 1HNWO 2BSTB 3DRTA 4GAYB 2YPVL 2XX1A 1B9KA 4Y4KA 3AMKA 1XREA 3H01A 5HGAB 4DK5A 3IVKB 3SO3B 5LMNB 4NZUH 3VRIA 4OZHE 1YVWA 4OLUH 3RWCA 2NY6C 1VACA 5HJ3A 2R2HB 3K59A 2QPDB 4UAOC 3HS9A 2C9XA 2MOVA 2W60B 3L7FA 2XWZA 4N8VG 4H13B 5C6TH 5B66Z 4DR5B 1CI3M 3EZJB 3ZDZF 5IJKC 4P3CH 4UM9B 3OFNG 2ZOWA 3HS0B 2Y5EA 2ZG1A 5CA0B 1HNFA 4AM0B 4KXRA 3IWUA 2HVJC 3TBBA 3W3BA 1RJCA 4O58L 3STZA 2Q8VA 2ZNWA 1VEMA 3FCSB 4FTDA 4MNQA 5BW7C 1KB5L 2YN3A 3RNQA 1IAKB 1FO0H 4ALAH 1P6FA 3FCTB 4NXSA 2FATH 4XN8A 4XN5A 3HI1B 1K92A 5KANI 1U6AH 4P5TC 1L9SA 2DD8L 4UT9A 1HQRB 2E27L 4P2RA 3CFBB 3U36A 1VIBA 5C0AE 4UQBA 3MREA 4A6YH 1LP9B 5F9OH 1UT2A 3I74A 3QTCA 3LRGA 2ZUSA 2MW2B 1ADQA 5I71B 1KLUA 2CHWA 4IJ3B 1A47A 2G75A 3L5WB 4G6KL 4UCFA 3TA3B 1HAUA 8FABA 4WSJA 5IHHA 1S9WA 4UBDC 3RVTD 2O1AA 2RQ8A 3BAIA 2R2BB 4S1QH 3L3HB 1JXGA 1N34O 4KK9C 3DMMC 4KHXH 4XP6L 1SRYA 2VWEE 5F3BA 1WBXB 5KBMA 1TR7A 3N2GA 2BRQA 2WWKO 3EG9A 5HY9B 4OQTL 3AG1C 1BP3B 1LD9B 2DN7A 4OLEA 1IQDB 4TUOA 1BDYA 5K9JH 3F7VC 5D2NC 1OLLA 4TQ8A 4NPJA 4HIEA 4CN4A 1E5ZA 4LR3A 2QQLH 1HH9B 4QI3A 4IYIA 3OAZH 5ICYA 2CLRB 2ZQKA 4N2GA 1G7HB 4AYDC 1OB0A 1TMCB 1WD8A 3HI5L 4AWJC 3S6CA 1EVTC 4X62B 3MRDB 4FMKA 4RRPA 2P46B 1XBRA 1QLEC 4Y5XA 4FNLH 4HG4K 1YEWA 4GUPA 2YD7A 4RQFA 1JPST 2EXYD 1IJNA 5INDB 3CDZB 5FECA 1E6OH 1OGPA 2ZICA 4IOFC 4IIZA 4FZEL 1XSOA 1YN6A 1PZ3A 3KPLA 4K07A 5IEKA 1DL7H 5AAWC 1AQ8A 3NJGA 1TEFA 4N85A 5EEVA 4N24A 2VR8A 1KIUA 1NH6A 4MVMA 1RUPL 1SVZA 1L3WA 3ETSA 4H0HB 4JO3L 4OSUH 5FUCE 5ABAA 4F8NA 2P52A 1BEYH 2J5LB 2OMYB 1AQKL 4XNQA 5J1AB 4BRJA 2HP8A 2KBGA 4R0LB 4X99A 1AR1C 1KIPB 2ATPA 2WNGA 3GSWA 4DFIA 3IEAA 3UTOA 5IYZB 2VDPL 4JM2F 4Z2WA 1NC4A 1H8NA 5JXEA 4WI8A 3TPKA 1MREL 4IRZA 1LWJA 4IKIA 4U6TA 2Y0SA 3QUMA 5EWIL 1N18A 4WFHA 5FUOL 4K2UH 1IEBA 2EINC 4UT9H 4A2EA 3KS0J 4GI8A 5KMGB 1U8JB 3CTTA 4K94L 5LUMA 5CF3A 5C0AD 5GGRB 1RIVH 3PABA 4Z1VA 4JFFA 1TLKA 3QFDA 5IVXE 4MDJB 5EZIL 3LDCA 5DUJA 5L88H 1VF6A 5DRXB 3P4OB 4G42A 4LPVA 4YBHA 3NRFA 4Q7DA 3QQ4B 1CR9H 5ANMB 1WB8A 1KB5B 3MJGX 4JKMA 1NEZA 5CBEB 4J28A 1BHGA 4BFBD 3WLWD 1JN6B 2H0PA 2VIRA 2A5UA 5CZVL 2JCCE 2VKWA 4AQYO 1HHHA 1QYGH 4OV5B 3EH4B 5IGXH 1B0IA 1D6EA 3MRPA 4OLWH 1G9MH 4JMNA 3RPKA 4X4YA 1P7GA 3OLIA 1X44A 1LDPL 4GBXA 3B8YA 1HYSD 3V0VB 5FPOA 4GI6A 3FQWB 2JELL 2XWXA 4GZRB 2QM8A 2CDFB 5F88A 2X05A 5IHZA 1QUNB 2ZXDA 2DQEL 4LKXB 1G1KA 1I3RB 3SQBA 4JPWH 3VCLA 2Q6AA 4Z7UB 1NBCA 3NZUA 1UKTA 4YC2B 1A14L 1BD2A 2XY1A 1Q0YH 3FAVA 2ODIA 3QXAB 3RUGF 4BZ2L 1XR9A 4OLZH 1SMAA 3K4ZA 3EVKA 2WP3O 3FYIB 2WO4A 3RIAK 2XTSA 4DQOL 5BV7L 1GGIH 4NT6A 4DW1A 3S37L 2Q0AA 3EUDA 4QTIH 5GZNC 2ZCLH 1ZANL 2XICA 4HEPA 5C0BD 1MXGA 3BGAA 4RZCB 5AVWB 3AT0A 1NJ9A 1AZUA 3MO1B 1MI5A 4X6CE 5CA1A 1MCOH 3JWOC 2NSXA 3UO1L 2OI9C 1GY1A 1X5ZA 4RGNB 5AVRB 3SKJL 1GK9A 2BIPA 5E1AA 1VESA 1MSPA 5EC1C 4JQXA 1ZCRA 3CC4V 3V8OA 2HYMA 2HCZX 3PWPB 4NP4L 3V6ZB 2UWEB 3GDBA 3NZ8A 1AI1L 4M43H 4OZGE 1DBMH 3UMNA 1WGVA 1YYLL 1DCEA 2OPCA 3BXNB 3UROR 3W57A 4NKOA 3K0GA 1U8HB 1BW8A 4HC1H 3V5HB 4N8PA 5KSUB 2AGJL 4E36A 3TN0A 2XA8H 1HQ4A 3HTLX 1C16A 5FIEA 3FOLA 4L8DA 2ZCKL 3U0TB 3CLFH 2X4NA 4I55A 5B8CC 3GIZL 2OTWA 3S8GB 3D69A 4QGYA 1DQKA 3FT2B 4FFYH 1H3PL 3G08B 5T5NF 4P30A 4NQDA 1CL7L 1DQLH 5E0FA 3MX0A 3VFNB 3QB7C 3DXRA 1L8DA 4M3HA 2OMWB 1FD9A 1I1YA 1TSRA 2YRPA 2DTSA 2EDDA 4OJFL 5DFVD 5LOVB 4N8CL 3R7RA 1VQ7V 1XSKA 5C09A 4DP4X 3IGUA 1XL6A 3MQIA 3MOQA 4XDKA 2B1AH 4PG2A 4MMXA 3T8MA 3RI5K 3VSQA 1JHTB 2DQIL 2C9RA 2OR8A 3W39B 3R8QA 5IQ9A 2GCYA 1TETL 1NBZB 3GINA 4WIQA 4I77L 5BZDB 4PCYA 3IJHB 1PBYA 3GMPA 1DHKA 3FQTB 5I15L 1IILE 2ZQMA 2CWRA 2VXTH 3C5JA 1OWRM 1RZ7H 4RMRA 4X1IA 4LP4A 2LW7A 2VDRL 1DLBA 1P4IH 2N7SA 3BO8B 4JN1L 5DEFA 5F2FA 3UTPE 1PNLA 2J73A 3PGFH 4PS8A 4MX7B 3OB8A 2F58L 1JFFB 2P90A 4TSCH 2YJLA 4ZI7B 3UJTL 2IJJA 1A1MA 1HXMB 1TYJA 3BAKA 2Q7YA 4GXVL 4AMWA 1TQSA 4OGQB 2CUIA 4GP4B 3HHSA 3BRFA 3ZE2E 1TYEB 4XMKH 3D50A 3V7AE 4UCUA 5JH7A 4N2DA 3WMQA 4FLTA 2APSA 4OZIA 4MAZA 2LGQA 3PDOA 3UPCA 2ZT9B 4FLVA 1WT5A 4IHJB 2JQMA 1P1VA 1YPZA 3D5OF 2XT9A 4LOFA 4K3EH 1BF8A 3KBFA 3VDAA 3RUGB 2BOBB 4A2LA 5I8OH 4P4RB 2GJ6B 3CFMA 5GIRB 3WEXA 4IIQC 5FO2A 2DQUL 3QGVA 4LEXL 4JGUA 3BD5A 4KX7A 4R8WH 5EIVA 5EO0B 4DEPC 2BC4A 1VCBC 3QQ9C 4NRYB 1F86A 1M7IB 5D93C 1K72A 5BV7B 3V4VA 2IGFH 3FHQA 4W81A 5DWUL 5LGHH 1QSFB 1UXWB 4H8WL 2ZTBA 2YD0A 3PAYA 1WUZA 3GXUB 4MA8H 4A6YB 3RZCA 3T4ZA 2JLPA 2APFA 4OY9A 2DI7A 3F12A 3ZZQA 2QGDA 4YFLF 4HIHA 1FNGA 1S9XA 1SHMA 1IAIH 1HOCB 3V5KA 3P30H 1R33A 3P4LA 1HP8A 5CP3H 3QARA 2ICWJ 4WLCA 5B39B 2AZAA 2J8UB 1JZJA 4QR7A 5B38B 4OD1H 1AJ7H 4M4RB 4P2QD 5DA4A 5HVFB 4JI4B 1NGPH 1QRNA 1NM9A 4S0TD 3GMLB 4MNGA 1IE5A 5TDOA 3SDCA 1E9QB 4QRRA 3BP4B 4YXHH 4FLZA 4XWOD 2AF2A 1JTTA 1F02I 3MC0A 4XVSH 5KAIZ 4C58B 2FH6A 2ZUWA 2YSTA 3DRTB 4O51B 3NJVA 1ZGLP 3CK0L 3OMZA 4J4PA 1G7LA 4TQEH 5IMOA 2Q2LA 2VL4A 4AGPA 1TNNA 3VRIB 4DR3B 5HFMA 4RWYH 3RWCB 2V5RA 1VACB 2B2XL 3TBSA 2AW9A 3ARBA 3NQKA 3ATAA 1LR1A 3GXIA 2K8MA 1XAUA 3OBAA 4PJBA 3L7FB 1YEKL 3CQFA 4G82A 2G3XA 4Z1MG 4TULH 4J3OC 1AKJD 3D8MA 3ROLA 1FXVA 3I6SA 2D4FA 4MZRA 4F92B 4C47A 5JJEB 4M93B 5H2BA 1JYVA 4CGTA 5GZOC 5JW3L 1DLFH 4U1IA 5IBLD 4QAWA 2H9GA 4KMTL 3STZB 5JW5B 4JRLA 4EEQA 4LHQB 3QQDA 5E94B 3TZVC 5F7WC 1BGYH 3HE7C 3U7WL 1DFXA 2GY7B 1ZEAL 1KXVA 4HBCH 4PGBB 5DR5H 3CZSA 1Q72H 3UEZA 4IRJA 3DGGA 2AJ3A 4WHYH 3V4VH 1EEYA 4KPHH 5KVGL 3QI9D 4P2RB 1EUTA 2NY4C 4RFOL 3Q05A 3ZRCC 4DP8X 3MREB 2EO9A 3NSYA 3H2QA 4Y9FA 3SBWC 1E4WL 1KLUB 3DJZA 5C86A 1HEJC 5F7YC 5TE7H 1BQRA 2ZUYA 5KUKA 1NCDL 3II3A 3QFJA 8FABB 2H8PA 4IBTA 3INUL 1X5MA 4KKBC 1BG9A 2PXYC 4JFPA 5EIIG 4P9PA 1PZAA 3TNMB 3U6XA 1N5YL 4OQ1A 1KGCE 1L6ZA 2F23A 3V7AG 4EF3A 1DJGA 3ULSA 2CJTA 3LVTA 4Y2DC 1IXBA 5DUPL 3N2GB 4AXWA 5I1EL 1DQDH 1DJIA 3RFZC 1MG3C 1GL4B 3HI6H 1B4JH 1JZGA 1AZNA 1TFHA 3I3BA 3G4SV 4TUOB 4XN4A 3MOAH 5HHOB 2LLLA 1FNFA 3SGKC 4ANXA 3ZTNH 1K9TA 4LCCA 4XP4H 2XN9A 4DZ8B 1IGFL 2AJUL 1BXAA 3IDYB 4JO1H 5ICYB 1F1AA 1AZCA 4DPBX 1IGYA 1MZZA 5J8OA 4N0CD 5AKTA 2P49B 5ADOL 1GS6X 4P46A 1UEYA 1KU9A 1XF1A 4DO5A 4CC5A 1VQ9V 5B3JF 2OSLA 3IB4A 2R9IA 1WEJH 1TT6A 2NNFA 2PW1B 3NGBB 4Y5XB 5HI5C 4GUPB 1KTLA 3AK3A 2ZOTA 4HCIA 4GXUN 1KJ3H 5FECB 1MFCL 3QQ3A 4H2CA 3VE0A 2RQ6A 3KPLB 2F53E 5IEKB 3LCYA 1BFVH 3A24A 1G4RA 4LFBO 1KIUB 5LBQA 4QWWC 1B3IA 3IK2A 1P2CA 2Z31C 5I1IH 2BFVH 5KYWA 4XNQB 2NY3C 1SOSA 2DLEA 2PLTA 2Y06L 5D5PA 4WV1A 5SX5H 3SE9L 3C90A 4X99B 5T3ZE 3TF7C 4MA1C 1J8HA 3GSWB 3ES6A 1DVXA 2VJXA 3IGAB 1HCFX 4X6DF 5DWPA 1NC4B 4JFZL 2AK1L 3GMRA 4M5ZH 2H94A 1EFRG 2DWEC 3FYEB 1CL7I 3HOGA 3QUMB 3MLRH 4DAGL 1S78C 1IEBB 1SS3A 2G3MA 5IYCO 4M5YH 1OAXH 4JREC 2X89D 3ILDA 4PRHB 4JG1H 4OLVL 5I16A 1Z7JA 3PABB 3OQRA 1UOLA 3AU0A 4JFFB 3QFDB 1MKFA 3ZOAA 1MVUA 1EN6A 2MTPA 3VH8G 2QGCA 4NQEA 2QVFB 3AZUA 4G42B 4AH2B 3CSXA 1Q82W 5B7MA 1VFAA 4XB3A 4JDTH 3VQMA 2NMSA 2CK2A 1J8KA 1KGCD 5FOBA 1MW2A 2YK1L 4IMKA 4PD4K 4QXGH 1NEZB 2EULA 1IUZA 5TFSL 4WFBV 3LPWA 1CLZL 5MENE 3T0EA 2VIRB 4K23H 1INQB 1RP9A 1SPDA 2K4WA 1X7TA 5HVHB 4U3XA 1IBKO 5K1XA 1HHHB 3ZCCA 1T5XA 2BIHA 4P3DA 4WUUA 3T77A 4M8VA 1D6EB 1T20B 2BMKB 3MRPB 4FJYA 4JQIH 4FQ2H 5DMYA 4PJEA 5ICXA 3NPZB 5I1CH 1T5EA 3O9OA 2DMKA 3S98A 2HLEB 3GUFA 4Y1AA 4GBXB 2WHVA 4P9HL 4Y4FC 3DSFH 5IQLA 2NNUA 2WWNA 3SJVE 5CKGA 5DSCA 1C7TA 5C97A 2Q2EB 1X9UA 3M7MX 4OZHF 3I9PA 2IBZX 3SQBB 3H7LA 3VCLB 4MA3A 4DO6A 4LPYA 3MV8E 1RKRA 4LVNC 2RJMA 4M6MH 3CXHK 2X2UA 3FAVB 3L13A 4AX3A 2F53D 1XR9B 1OCRC 2YXWA 1FPOA 2IH9A 1XHZA 1QLFA 4TTDC 5AYQA 5DZNA 2I9TA 1XH0A 5KVMC 3F85A 3OGCA 4YFLI 1JHLH 3C09C 4PB9L 2NXZD 5CEYA 4D0DA 2HG0A 3MJ9L 1GIGH 5T3ZD 5J3HD 3O6ML 3CFUA 1NLBH 5GGQH 4FLWA 1NJ9B 3LH2H 1MI5B 5FA3A 1BJ1H 5CA1B 5CGYC 1PZCA 5L2KE 1RZQA 2P80D 3P32A 1SQBH 1UWEH 3E6HA 1BVNP 1UKSA 5E1AB 3WNLA 3SKOA 4EIBA 4G27B 5TF1L 5I6MA 2F54E 1W2KT 4NQCA 4HUUA 3BZDA 1EZLA 4W9FC 3NZ8B 9CGTA 1MFEH 2V5MA 4U31A 3UACA 4OJEH 1ZMYA 4U6XB 4XGZA 3TVMA 5AD0A 1UM5L 4H8VA 4NKOB 4X6DB 3ALXA 3G5YA 1T0PB 3CN0A 4HT1L 1PD0A 4OKVA 5KTEL 4K3DH 3VX1A 2VC2L 3H54A 3DTXA 1MABG 3Q2NA 2MQGA 2RALA 3QRGH 1HQ4B 1C16B 2XZZA 3FOLB 4L8DB 1PD3A 2V33A 4LSUL 2X4NB 2W0XA 2OTWB 3D69B 1UUSA 1UT9A 2VW6A 3I5DA 3I6GA 4L9LC 3IGFA 2WBJD 4NQDB 3FB7A 1IBGH 3MX0B 2CDYA 2XAFA 3DXRB 2MKLC 2TRYA 1XMOO 1D9KD 4JHAH 5CLTA 1OTUD 1I1YB 1PY9A 3CXFA 4JVPA 5FC9A 4KKCD 3ZR6A 4XN2A 3STLA 4ONHA 3WDJA 1KJMA 5C09B 3SDXE 4DNLA 1FS0G 1L7IH 2D3OW 3HE6C 1FI8C 5GTHZ 1SBSL 4MMXB 1IIIA 2OK0L 2IWGA 4YHIA 3SJVD 1PZDA 3II2A 5IQ9B 5EU6E 5D8JL 2GCYB 1R5WB 3FW6A 1WBYB 2MNWA 2VDMB 3ZUNC 3GMPB 3WXVH 2AZ0A 2WXLA 3CCJV 3QBTB 3MUY1 4E9TA 1FQ9C 4B08A 4CILA 3C5JB 3MV8D 3BESR 4URKA 4X1IB 1MCJA 1S4IA 1AP6A 5G4OA 5F96H 1JYWA 2CXKA 3DETC 4YHMH 1ZJBA 5E2TL 2IDFA 3JCZA 3O4LA 4JI8B 5A6IA 4PJDE 2AHYA 1H3UA 4WBNA 3H0TA 1A1MB 4XTRC 2IJKA 2Q7YB 3EFDH 3HHSB 4OF3A 3ULVC 4G7RB 2ATKA 2QVKA 4HP5A 3OZKA 2EIZA 2R0LH 5JH7B 4LIQL 4JGJA 1T7YA 1UM6H 2EDJA 4WDIB 3U9UA 4F6RA 4WVRA 3PDOB 4FZ0A 1P7HL 3MKGA 4GIOA 1FN4A 4XN7A 5DD3L 5EU4A 4F3FB 2J21A 2R0ZH 1YPZB 3L3KB 5D1ZD 2IBGA 1I1RA 2KS0A 1ACYL 4HHAA 2ENJA 4XHQA 3WCYA 3RDJA 3A4AA 1Y74B 2Y6SD 4APQA 2G9HB 1ZVNA 3E8FA 1A21A 2F54D 3WEXB 4ONFL 1NKGA 2A99A 1BLNA 1FFQA 2HR3A 1A02N 5DUBA 2Z8RA 3MXVL 3K4DA 3UGXA 2HHHB 2YD4A 1ZLWH 5KHGA 1IB5A 4PRPA 5FB8A 5IVXF 3RWJA 4ZUUB 3SODB 1S9VA 5L9DL 3RTQA 3HEIB 3NA9L 3EGXA 5AWNH 1E27B 4MJ6A 3BH8A 3RZCB 3GKWH 4PRNB 2EXTA 4MBOA 1KEML 5D7LE 2ZXCA 2I69A 4XPAH 3F12B 2ADYA 4KJPD 1VZHA 3QAZC 1FNGB 4OTXL 5K93A 4HSQA 1T89C 4TV9A 4FXGC 1LEIA 2BCKA 2JTDA 5INCA 5JIIA 4DV3O 1JZEA 2JCCF 4MLSA 3OZ9H 2WCGA 1I9IH 3U10A 3L48A 3NK3A 2CRZA 2BSDA 4FZ8L 1ZGLM 3ATDA 1QRNB 4LMQI 4JEGB 5JCOC 4MNGB 5TDOB 3SDCB 2YARA 4HLJA 4QRRB 4CC4A 4UQ3A 4CMHC 3FCUB 1TEGA 3TETA 1CU4H 3FU6A 4YHOH 1IV8A 2VC2B 1OK0A 1QFUH 3LKPA 3MRHA 5EU6D 4KTEH 4J8RB 4H25A 4OM0H 2WYHA 3M1BA 4ANKA 1QVOB 1QFWH 5IMOB 3W0WD 1UCBL 4Z5RA 4X6FA 3U48A 3WB1A 3EHBC 1X5JA 4V2BA 1LO2L 1NI8A 4PJGE 4PJ9D 4NNYA 3TNNA 4H40A 5JW4Q 1ZSHA 1CG9A 3TBSB 2AQ1A 1OJHA 3N40F 3OHXC 3OF6A 4I89A 3KR3H 4PJBB 3F6LA 2VH5H 4NZRL 3NTCH 4GAGL 4E9YA 2DL2A 1A0QH 2N3JA 2A4ZA 5DUMH 3K0WA 4MZIA 5ISZE 4FFZH 4NZFA 4FXLA 3JCUZ 4HALA 2NZ1A 4D7TA 4X6CF 5BVPL 1P69B 4U1IB 5L8JB 1S5HC 2H9GB 2ZWSA 4MVZA 3QQDB 3VQYA 2CO7A 1PCSA 3WEMA 3LB6D 3P3PA 4KI5E 1QLNA 1IGTB 4XMTA 4HGMA 2OX5B 1K4CA 3QDHA 1UB5A 2FWOB 3FNKA 3ZKXB 3DGGB 1IU1A 2AJ3B 5C0BB 3TBWA 1GM7A 1EEYB 2XIIA 3P3SA 4PJCA 3FPXA 1AJPA 5LGTA 2VMCA 3DYPA 1ZIBA 3HIZA 3O81A 4FQHA 4K5PA 4WGWB 4CH6A 3U6XS 1RUKL 2PTVA 3ETDA 1SZNA 4DV7B 5D7LD 4A5UB 3AXLB 3VM5A 1AAJA 1WK0A 4H1LG 3F84A 3POCA 2BHYA 4ZHQA 4JI3O 4TV3A 2RBLA 3BH9A 4YSDA 4UZSA 1KZQA 5I30H 2H8PB 1RZJL 4ZMNA 1ANUA 3KL0A 4WRLA 4JFPB 3NCJL 2BOCC 4E41E 4G5ZL 1NSNL 3AK2A 4B3SO 4PA9A 1A6UH 3GBLA 4JPVL 3RKDD 3GC3A 1URZA 3CG8A 4OCSH 2H3XC 3KHOA 4XP5H 3ULSB 5IVXB 4AXWB 1UFIA 3DI2B 5LAPA 4DR4O 3K2MC 3KZ8A 1FG9C 3C6LD 1KGIA 4YBQD 5D70H 4BD4A 2X3BA 3EO9H 3FTUA 4L5FH 1GTFA 4LCCB 5GRJL 5DRNA 1L9TA 4DQAA 4FABH 5LGKA 1R3KA 4FFBA 4D6TH 2DRUA 2R23A 1IGYB 4OFKA 2AJVH 4YHKL 5D7JD 5CAYB 5IB3A 4P46B 3VXTA 2HX8A 2XWBB 4OFYA 4XCCL 1JFHA 5E08H 4M48L 1PZBA 1KTLB 4GSDL 1BZ7A 2AXJA 4MAUH 3CLWA 5AB1A 4AYGA 4MAYA 3WN5C 4DVRH 5C0RL 1FXKC 1IGIH 5B3SC 4K3GA 2A6IA 2CAZC 2CA4A 4C4UA 1A5FL 1TZIA 3QQ3B 3VE0B 2X6BA 2YICA 4UB0L 2CCLA 3KG2A 3ZE2F 1MOFA 3WIIL 1T03H 4WO4C 4ZI8A 3GRWL 1RFYA 1B3QA 4OVUA 1XEQA 5KYWB 5MEOA 2FO4A 5BMFH 2OSXA 2JK5B 4LFAO 1ZV2A 3BLPX 4PRAA 3KGRA 4B3MO 3ZKND 4H33A 3WO4C 2IG2H 2DQGH 4YL9A 1E7UA 3VGHA 3GMRB 3BVDB 5F0MB 5FKPA 4MVBD 3WE6B 3SE3C 3RGVA 3RVUD 5JPMB 1JD7A 1SFHA 3DHJA 5I6XC 2XHNA 4GIAA 3ML9A 5KBDA 1J1PL 2WMPA 3VWKA 5I16B 3WTWA 1U8QA 2RACA 4PS4H 2YIBA 1U2HA 2W07A 4GP5B 3T4AC 2GBUA 1VERA 1KYDA 4JRYA 4NQEB 5C2BL 3E1F1 1XF2A 2QR4A 1GYWA 3EYQD 3R19A 2CDEA 4IRSC 4N26A 4EPSA 4E41D 4NNPH 3NACL 3T2QA 1A4KA 4U1HB 4Q89A 4O2FA 3NJKA 4JR9H 3RWRD 1TXKA 1DF5A 4AE0A 2EEDA 4JN2A 2JIXA 4PLJC 1WG3A 3T0EB 1KY7A 3E38A 4CW1B 3QWNA 5L4IA 3W37A 4P3DB 4WUUB 1UZGA 4M6OL 2X6VA 1F4AA 4FXKB 1XMQO 2CHZA 5T1KD 3GM0A 1DANU 4AOFA 4PJEB 1ZA6A 3MBED 4PA7A 2ZYRA 2HLAA 1G9HA 4HXBH 1XFPA 4UF7C 4Y1AB 1LO3L 5SWSE 3ZMRA 1VQNV 4JUTA 4H8PA 4Q97A 5DSCB 1RSOA 4PVMA 4P2QB 5HD8D 2EXWC 2DQFA 3MCLH 4LDOB 1OGAE 1EERB 3TWCL 5I66B 3O9WA 4MA3B 4X66O 2BS9A 1BQ0A 2GI7A 4X65B 3ZDWA 1KN4H 2G0LA 2IPKB 2VDQH 2GPZA 4GKLA 3WIHL 4J5VA 3QT2A 1CDBA 4IYKA 3FH5A 4PB0L 1BJ1J 1T66D 3QSKB 1QLFB 3J2PA 2ED9A 5F7AA 2FEEI 3NUKA 4U3HA 1G9EA 3OGCB 4XPGL 3AWEA 3LVEA 4XBPA 2ZWYA 2XQYK 2GIMA 3D39E 4XRCA 5JHDA 3NAAL 4LBEB 1AQMA 4PY8I 2R4SH 3MN8A 1F6AA 4XCEA 4XAKE 5FA3B 4KKAC 5LHGA 2AEQL 5JNYA 5D55A 5D5ME 2F19L 3E6HB 2PF6A 3SKOB 3L6FB 4QOKA 1R17A 2NZIA 3LZOA 2TSAA 2ZE8A 1QPPA 3TEUA 4BKSC 2OJZL 3W9EA 4NQCB 3PWNA 3QDMD 4X8JA 2HAZA 2ZCEA 2WOYA 1AOHA 3RBSA 5FWRA 2CGOA 1IBMO 5FGCE 3TVMB 2Q8AH 5AD0B 4KXCA 1GY2A 2IJ0C 3G5YB 4JFYA 4ENZA 4OKVB 1G7PA 1DN2A 3KJ4B 1ZLEA 3DTXB 4I18C 2VR5A 1F4WL 5TGBA 2XC8A 2X2HA 4AIOA 1LK2B 4X4ZA 2XVKA 3SE4C 1F4YH 1YECL 4U6HA 5F8QC 1A7QH 2ENSA 2XPYA 2UZPA 1U3ZA 4WEMB 1JJOA 5A2AA 3FB7B 1CGSL 4E42A 5HYEA 4PVNA 1VKXA 4JI6O 4LF5B 1S3KL 2DQTH 3QORA 4Y5YC 4DRXA 2IWEA 4GQZA 4CSPA 3MMEA 4E5XA 3BCCH 1FSKC 4JFOA 1HILA 3ESPA 4ONHB 5FXCH 1KJMB 5SWSD 5L6YL 2IVFC 3BZEA 1M6UA 3P0GB 2WWOA 4AKQA 5JW4M 2JJSA 1WJZA 3U1SL 4LRIA 2VW7A 3RHWF 4DHLA 1TZHA 1OGAD 2P5WA 5KAQG 4K7PH 4W9LC 4ZAKA 1FNLA 3JD2A 4ONGL 4JAUA 5AW4B 3LSUA 3CVBA 3O3UN 1ZTXH 3GO1L 1S9YA 3OSVA 4IHOA 5JOEA 3O4LB 3HC4L 1I85A 2DWDB 4WBNB 2FGWH 3AU1A 2DEXX 2KZKA 3FQ4A 2ATKB 2Q68A 3C60A 3SZKC 4X7DC 3D39D 4ZZFA 3U9UB 1SQGA 3KYKL 4F6RB 4MJ2A 4AYFA 2B9BA 1J1XH 1T83C 3E9TA 1FN4B 3NCXA 4XAKD 3AJ7A 4ZG1A 4HEME 1AG6A 3NCFB 2R4RL 4HHAB 3K5LA 5HYSA 4YDIL 2Z0BA 4Z9KB 4FI8A 3U46A 4OJYA 1ECYA 4APQB 1E5BA 4ZUSA 1KYOK 3KXFE 4ZRGA 3VGEA 3KKYA 1KJ2A 2VW4A 3OKOA 1BLNB 3L08A 1KB9K 1KTRL 5DUBB 1RJYA 1TNMA 4A67A 3CXCU 1WZAA 5I9QC 4C54A 2Z34A 1FFXA 4J9ZB 4RMWA 4N21A 5FB8B 3RWJB 2DYRC 3SE8L 2X4QA 3Q2CA 1S9VB 3RTQB 4WWPA 4QRTA 2H0JA 1X5KA 5IHUH 4X20A 4MJ6B 3BH8B 1HJBC 3PRZA 2NY0B 5IBTH 1TYRA 4JE0A 4P48A 3OV6A 2V2WA 5DEZA 3WKML 4J7ZA 2VLRE 5LGNA 2VMFA 1LEIB 4TV9B 1YUKB 2WXJA 4NZJA 2BCKB 1HFUA 3T3PE 3WNOA 4R97B 3QHTC 3ZYJA 5KBNC 4IOIB 3QIBD 1BE3H 2A77L 1T1ZA 4FQQA 2KKWA 4UQ3B 2LTQB 4Q0XL 4ZW7A 2E7LC 1B2WL 2LABA 4GIPD 3JV0A 4NC2B 4PJ7E 1XQ4A 3WNIA 5T1LD 5I19H 3MRHB 3PWLA 4FM2A 1FJGB 1QHOA 3NJNA 4H25B 3ZZ1A 3JWDL 3M1BB 3ISRA 4Q14A 2DW4A 1P84F 3MTRA 1GZHC 2ZIMA 5B1AB 1N6QH 1Z32X 3ZL4H 1EZVX 4P3WA 1PNDA 3TNNB 4EN3A 3QRBA 1TJIH 1XGYL 3IPFA 1IM3D 5I75C 4JW3A 1NBVH 3F58L 4ZNCD 4OFIA 1KC8W 1NCAH 2NY5H 3X1GA 4GFTB 1KC5L 1NUFA 2YUXA 4O9HH 3GBML 3SKNA 2J5WA 4AEHL 4MD5B 5EO1A 4IL6Z 1B2YA 4XPBH 1V9PA 1D2OA 3U4EA 2AQ3A 2B1GA 4TV8A 1S9KC 2VZ1A 1JMXA 4BIUA 3S3SA 1MLBB 4X8CA 2IO5A 5CB4A 4M8RA 4B9GA 3U1QA 1KULA 2ZDIA 4PBDA 1AI4A 2VDKH 3VFSA 3KXFD 3K5SA 4TQDA 1KJ2H 2O6FA 2Y36L 4TKWA 2QADD 3WU2Z 2NXZB 3PJSA 1K4CB 4UZUA 1UB5B 2VJ0A 3N1QC 2RNBA 3UPRA 3LEXA 3MZTA 4HMCA 3TBWB 4PJCB 4NKDA 2VABA 4G6ML 1A7OH 3DBSA 1QR9A 1GM8A 4KVCL 3OMAB 3MRQB 3SIKA 1SRDA 4EDXB 5FK9B 2XRAH 3I84A 3GSNA 4WEEA 3IWVA 2CUHA 1MWAA 1DVFA 1VFUA 1I3GH 3BH9B 2VLRD 1CICA 4YAQB 3VU1A 2XBTA 3LPGA 3KMDA 2C9UA 4X4KA 3QUXD 2WLHA 4ABVA 3ILQD 3EJTA 5GRYA 2OL3L 4JI7B 4YWGL 3REVB 4AQEA 1OPOA 5L3FA 4M6NL 4JG0L 2BWQA 1S7TA 3SQOL 5DC0A 4U1MA 5DECA 4JI1O 1SJVA 2OP4H 2X12A 3SDXF 4LAQL 2AEIT 2YXMA 4P4KC 4JCMA 4QPEA 4TVPE 4BJLA 3S36X 2H1LM 3ZHVA 3FB6C 3PYCA 4PJFA 3TBYA 2J1XA 5DRNB 4OIAA 4LVHC 1T0OA 3QUYA 4KMLB 4XP6H 1VLXA 1R3KB 4KNTA 4FFBB 2HT3D 2R23B 5I5RA 2I9LB 1ID5I 3N2KB 5DMKB 3SPIA 4N2EA 2FMLA 4CC1A 3VXTB 2VDNL 2ZOKA 1FORH 3PHAA 1GJUA 1G0XA 2GTAA 3TBVA 1SLVA 3U30C 1GC1L 3B7TA 3H53A 1BZ7B 4LE8A 3D0LA 3GSOB 4PJDF 5IE9A 1U21A 1CLOL 3ARQA 2A6IB 2HPOA 5A2BA 1W2BU 1TZIB 3OTOB 3DXAA 1Y66A 2C3XA 1W80A 3HI5H 3K5RA 2ZP8A 4XI5D 3ZHDA 1AP2A 4ZQKA 2CRYA 5PAZA 4X7SH 4GEJA 4CU8A 1CD0A 3TASA 2BNUA 3HC0A 4IM8A 5MEOB 2FO4B 3D18A 3VRLE 4OGXH 3FHEA 4PRAB 5EC2B 2YD2A 1NFIA 3HUJE 2RA1A 2AJXH 3KCWA 1KLFA 3N1MC 5DHMC 3X1BA 3QZWG 2ICCA 1L6PA 3SKMA 5FKPB 2B39A 32C2A 4NERA 3RGVB 4YXLL 2UUDH 5CJOH 5AZUA 5D2NE 5K1NA 2PO6A 2WMPB 4MBRA 4NN5B 3VWKB 2HH0L 4X1KB 2VDPH 4B5EA 1TUEB 4DVBA 2FRGP 4MJHA 2I5YL 4JI2O 3JTTA 1T04A 5BVJA 3GSNH 4JRYB 3WIAA 4LNVA 2W9EL 5DHEA 5EWIH 4JRWA 4WO0A 3M1CA 2DKUA 3VYOA 3RJQB 2NY6D 3FTVA 1R0AL 3TO4A 5CHNA 2OTPA 1TCRA 5CLXA 1A4KB 1MJ8L 4URTB 3U82B 4O2FB 3ABGA 2WYZA 1NS1A 1H19A 1UCTA 3NFPA 2FEJA 4Q9RL 4LCIH 2JIXB 1S46A 1W8NA 2PPFA 3KPRE 5AOIA 1JCKA 4PV1C 4ES9A 4TVPD 3HB3C 1Y18B 4YUEL 1ZA6B 1I4FA 2HLAB 1BIIA 2QZ5A 1OXYA 1JZDC 2RIKA 2EE6A 3TCTA 3GBEA 3KPSE 4NJAL 5KEZA 3QUZA 3WUWA 5FCUL 5CFHA 1E3FA 1KENH 4U7MA 3MRFA 4HUCA 3SSGA 4QRQB 1RSOB 5KS9E 2E74B 4BZ1L 4KVNL 2JEXA 3QS3A 4HLEA 2DQFB 3EJPA 4PJGF 1PX8A 1U58A 2O30A 4FQJL 3O9WB 1YMMA 4B3TO 4KJWC 4P5TD 3BHBA 4QPKA 1UJ3A 3CIQA 5ESVA 2IANA 1KCUL 2WXGA 3EO0A 1X9LA 4PFEA 3VSVA 3RA7L 4ZMVA 1O6TA 1AQHA 4N2FA 3VWJA 2QV2A 1ZHKB 5SWQA 1JVMA 1KV3A 4PA3A 4UCTA 1N6VA 4JZNA 3W0WB 4U4IA 4XBPB 2HWZL 1CB4A 1PLGH 4UBDD 4XRCB 5JHDB 4Z8FL 5J11B 4KK9D 4ODHL 3DMMD 1F6AB 2YSSA 1BSMA 1KELH 5AVYB 4GPVA 3OKKA 5JNYB 2ICEA 2JKJA 3JSNA 4H88L 4MQXC 4PJIE 1FVEB 1L9OA 4K5NA 1A65A 4QOKB 2VQEB 1JXJA 1B0RA 4NB5A 5DVPA 3OM3B 3S37H 3W9EB 3X13B 2KDGA 3HS8A 4W9ZA 3NXSA 1JF1A 3PWNB 5JR1H 2YMXH 4C4BA 4R2GB 1FYTE 2IGLA 1UATA 5I1JL 3TYFA 4EI0A 4EBQL 3ZJZA 1NKDA 2HG5B 4NP9A 4MJJA 4JFYB 3D07A 1A6ZA 1FAKT 5EOQL 5HHNA 1JAEA 1G7PB 2G3ZA 5CM1A 4JFHE 1CI5A 5J12C 1NDTA 3FQRA 5TGBB 1N0XH 3FKUS 2PNDA 1OOAA 1X5FA 4KHPO 2K7QA 1URIA 3F01A 4O4YL 2DIBA 3NYKA 5IEHB 4GKNA 1CO1A 2UY7A 5CEXB 3FU7A 4IBYA 1WRFA 4OM1L 4U6HB 5I1DA 2CLZA 4NUGL 1YYLH 3EBGA 5BR8O 2WLYA 3TJEL 3B9AA 2A9HA 1INDH 3KPRD 4IGBC 4R83A 3O0RH 4E42B 4YEEA 1VKXB 4FOMA 3SY0A 3QORB 3P11H 2IM9A 4DRXB 2AGJH 1YEJL 3MMEB 5D1ZI 4E5XB 4N2AA 4JFOB 1DQQA 3CX5K 1AR1D 2ZCKH 1MDAA 2NR5A 2V9UA 3PP4H 1CBJA 3AQXA 1IAOA 3GIZH 3KPSD 4UIKL 3LOWA 4U7SA 4F7CA 2EJRA 3F04A 4AIXA 2XTLA 1KG0B 4LXFA 5JQGA 2CGRL 3GSVA 3IDIA 3KVQA 4KO6A 4RBPH 1TZHB 2P5WB 1DVQA 1O5PA 3HNSL 4DEUA 2IQAB 3ULUC 4HKZA 1HX0A 4N3UA 4UV9A 1PY0A 5GJSL 3CVHA 5B1OA 4IEFA 1G6RA 3IS1X 4O5LL 4XP1H 2OW6A 3B37A 2DQIH 4I5SA 5GW7A 5KAFZ 3WD5H 3AU1B 1JDAA 4OGAC 4ADJA 1PNCA 4JPIA 5LXGL 3C60B 1BPVA 5I15H 2EE9A 3ZU8A 1UZ6E 3VQLA 2VDRH 1QTYT 2X6UA 3O11A 3CC2V 1PZUB 4L29B 2VM4A 5ABDE 5IW3A 3ZHLA 3D4CA 4IMLA 5HYSB 4Q9CA 1IKNA 3UJTH 4L9DA 3U46B 3RL2A 2H6PA 5E79Z 4DN3H 2E6PA 3WG7B 1A7RH 2VDKB 3IMRA 4HD9A 5A6MA 5JPNA 3AY4A 1AGBB 1NCNA 1V8HA 2J7LA 1WP8A 2ZE6A 2Y5QA 3OKOB 4FEIA 3T8XA 5KAQF 4N8UA 4KUCD 1FYTD 1XHXA 2B4CH 1NL0L 4BA0A 2GT9A 2HUHA 1G7JA 3LN9A 2QQKH 3OAWA 2QWOB 2DWTA 2ZOOA 2YMTA 4QRTB 3S37X 3QEUA 3VVWA 2QGBA 4JFHD 4X20B 3FT1A 3SO3C 4WZ9A 3VYPA 1DZBA 2HKAA 8PAZA 3I75A 2GIXA 1M7DA 5CZRA 3BSZA 4RNRB 3L1OL 1J5IA 4KO5A 1NCTA 3O3BA 1JI1A 4QHKI 1W72A 4DV0O 4QTHA 4AT6B 5IFHH 3MCYA 1TOXA 4R6ZA 4AVHA 3BEVB 2N59A 4H8WH 3IAYA 3JWNH 3NZHL 1JVKA 3N27A 2J1YA 3VXRE 5GZND 3QJHA 1T1ZB 2G4EA 4DIXA 4FQQB 3PL6B 4NZTH 1O6SA 3QJOA 3BUYA 1W0KG 1CK0H 4F58L 4Y19D 2Z0AA 4MMYA 3OW2U 2HRPH 4EUPH 3PWLB 3S88L 5F1NB 1PDKA 4YLBA 5B1JA 2DB8A 1MXDA 2I26N 4YOKA 3SYAA 4JASA 4GRMB 2DQHL 4XVTL 1OP5H 1DVUA 5CO1A 2QKCA 4KX8A 3KBHE 1G6RH 2CUMA 4MZ2A 4EN3B 3SPHA 4KZEL 3BDYL 1KGUA 4YGAB 4F57L 5LMUB 4EB6A 2W8CA 2X4RA 5I71C 5LA6A 2Y7QA 4IJ3C 3SKNB 3TA3C 2ZIDA 2F5AL 3CMGA 2N0MA 5LNGA 5EO1B 4EQ3A 4GINA 1KXHA 5FGBC 4ONOA 3PS6A 4TV8B 4K5OA 3L81A 3N0AA 5C08A 5A2FA 5EBWA 2Q7GA 1DDHA 1WF5A 1EO8L 4NOFA 4ZW3A 2F8OA 5JHBA 4L4JA 3K71A 4J39A 5AZEL 1WH0A 3HZYA 3MROA 5CB4B 2WBKA 5D5MF 1UWGH 4N6RA 3VFTB 1MN4A 3RVZA 5FDWA 1HSAA 3LIUA 2H26B 3VFSB 3WKPA 3LHPH 1JGLH 1OTTD 3S3JA 7FABL 3PJSB 1LL1A 4W4LA 2ZX9A 4LU5H 1R3IL 2Y23A 1MQKH 3ATEA 2ZNIA 1PVHA 3Q3GB 4OGZA 3UPRB 5JW3H 4X4XA 3LSOA 3CQPA 4XMLH 1ECZA 3ILPA 4NAMA 4NKDB 4JFDE 2VABB 1GGBH 3G71V 3B7UX 4C8XA 1DQIA 4RQQB 3T65A 2XPGB 3O8XA 3MDJA 4OIIL 5HVGB 4AZ8A 2YWZA 4XPTL 5LHIA 4I2XA 5IMLA 1F58L 1RUMH 4NRZA 3UDWC 1MWAB 1DVFB 3B9EA 3V6BR 1QWHA 1BZ9A 3TJPA 3QDMB 3WUZA 1CICB 1W72H 4BKTC 1NEUA 4NQUA 2WGNB 2EIBA 1T0MA 3KWXA 3LNHA 4DGVH 1PLAA 1BSIA 4AQEB 3KLQA 3KJ6L 1VP7A 3VXRD 3L3JB 2Q10A 2C3WA 1E4WH 2UZIL 2NXYB 1IZKA 2J5LC 3DX7A 1HE7A 3T3ME 3A21A 4LZKA 4R0LC 5B22A 2C7UB 3CZKA 3INUH 3WTVA 1UOVA 2DQCL 3TBYB 5BXFB 1SZTA 2L0DA 4FMFA 1N5YH 3LAFA 3QUYB 2UUCB 1SJEA 1VPOH 3OKYA 2EDOA 2QZQA 4L3CA 4MS2A 5H5NA 1RVFL 2EIMB 1GTNA 1JPSL 1HSBA 2ZOKB 3FUKA 2AITA 5LAXA 4MMZB 1G8MA 4NI6A 3TBVB 2JXMA 3CPLA 3MLYL 4F2ME 3D0LB 1F3RB 5J6HA 3QQ9D 3S4SG 1FNHA 3U0PA 4L8SB 1TCMA 4BHUI 1MJ7H 3DXAB 4PJ8A 2RHEA 3CCVV 5ADOH 2HRHA 2JKSA 1KPRA 1AP2B 1FIGL 4JPQA 4FP8H 4DF9A 2K9PA 2A9CA 3DI3B 3L70H 2YFOA 2X0VA 2BNUB 3HC0B 1SHSA 3D18B 2Y3AA 1GHFH 3PWVA 4AMXA 1NFIB 4NHCL 2ATAA 2L4OA 2OMZA 2VRKA 5DZLA 5IBUB 3TYGH 1KLFB 5LHHA 2EZPA 1TZOA 1TTAA 1YA5A 1D5IH 4OZFB 3HNVH 3RI5F 4WFFA 1LXMA 4P07A 5H94B 3SKMB 1E7VA 1M3IA 3TXSA 32C2B 4DR6B 5I6LA 4PELA 3HG1E 4I3RH 4A7GA 2PO6B 3SE9H 3QJUB 4JFDD 5TK2A 3B3IA 4CVXB 4MFHA 4MD0A 4YSTA 5FUZH 4DVBB 1BAFH 2YIHA 4NUMA 5BVJB 3JTTB 1CJYA 2C1OA 2ITDA 1GSMA 2VSMB 3C87A 2X53A 1AO7A 3L3OA 4M03A 5IQ7H 3CX2A 2J88H 5J6GA 2IGTA 4YC2C 5CHNB 3TO4B 1TCRB 5TE6H 2PR4L 4LCYA 4MTXA 4QHLA 4RESB 3T3PF 4JKPL 4J3OD 3R66A 2FL5B 2UXCB 3NFPB 3GMMB 3CVHL 2CTWA 1NDMA 4LSQH 5D1XA 5FEBA 1HW7A 1VEOA 1M05B 2VR4A 1IAMA 1L0NH 5DJXA 1N7MH 3WSQL 4AJYV 3FO1A 5K9OB