5B1AB

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1aB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1aB02
5I26A 2DYSB 1DZ0A 1SHXA 2UX6A 3MX0B 3NJHA 4BWWA 2IDQA 2P80A 3PAUA 3WG7B 3X1BA 3X1EA 3NJFA 1NIDA 1WA1X 1AZCA 2IH8A 1KDJA 1NWOA 3T71A 1PAZA 1E30A 2FQDA 1WA2X 3CZUB 2IDFA 3NJKA 2IH9A 1PZAA 2PP7A 2OCCB 3FPXA 1JZJA 1V54B 1IUZA 1L9SA 1GY2A 4E9TA 3EH5B 4QKTA 3WI9A 2EINB 1KBVA 2UXGA 5B7EA 3TBBA 2CUAA 4DP6X 4E9WA 1A4AA 1EHKB 5AFAA 2N0MA 3WNJA 3T6ZA 1E65A 5A7EA 3ABGA 1ILSA 1NIEA 3FU7B 2AFNA 3BQVA 2PPAA 1AANA 1RKRA 3G5WA 3D12B 3PAZA 2AVFA 2H5UA 2IDUA 2FT6A 2XXGA 3ZIYA 1ADWA 1GYCA 1L9PA 3SBPA 1JZGA 2GB2A 1W6WA 1MDAA 2XYBA 3QJUB 1AIZA 3OD3A 1JZHA 2DV6A 3FU9A 4N8UA 2YAPA 4AZUA 1IBZA 3NJNA 4Q89A 1BEXA 5B1BB 1NIBA 4E9YA 1NPJA 3NJJA 2MRYA 1AG6A 2VN3A 1M56B 2W8CA 2EIKB 2JKWA 4F7KA 3T6XA 1GS6X 1XB8A 2VW7A 2YAMA 4GP8B 3N55A 3S8GB 3T6VA 2XU9A 5B1AB 3FQ2A 3C75A 1ZIBA 2WSDA 3PAVA 2XX1A 3WKQA 3SQRA 2CALA 1QNIA 1JXFA 1A4BA 2GHZA 3T9WA 1XB6A 4G71B 1KV7A 2HX7A 1AQ8A 3ABKB 1FWXA 5I28A 4F2FA 1J9SA 2DWTA 4GXFA 4JKNA 3SBQA 1AG0A 2B3IA 2DYRB 2BHFA 3ZX1A 5I6MA 1BYOA 4X4KA 1MG2C 2PP9A 2BO0A 3GYRA 4DP0X 3AW5A 3FQYA 4W1TA 1JXGA 4BK5C 5I6LA 3OMNB 2BP0B 1HAUA 5LDUA 2J5WA 1UATA 2FWLB 3AG1B 4Q8BA 1T5KA 2DWSA 2XUWA 2AZAA 1GSKA 2X87A 5F7BA 4HCFA 2YXWA 3JT2A 3PPSA 4L0PB 1YLBB 3AG3B 2E86A 1V10A 1PLBA 3OMAB 1CYXA 1SF3A 4JHUA 1GS8A 3FU7A 4HZ1A 3IN2A 1NIFA 4KNUA 4A2DA 3UGEA 1PMYA 2J56A 1PNCA 4NAJA 1KGYE 7PCYA 1EZLA 3V9CA 4DPAX 8PAZA 2AZUA 2Y69B 2AANA 2P80D 4KO6A 1J5DA 2PCFA 2VW6A 1BXVA 3KW8A 1M9WA 3NT0A 2TSAA 4NERA 2ZWNA 2FQGA 1ID2A 3FT0A 1PZCA 2QDVA 4KOBA 3WIAA 1ZV2A 3EH4B 4YVUA 1PLAA 1OE1A 2GI0A 2BW5A 3FQ1A 2CJ3A 3NP3A 1BQKA 2YAOA 3U25A 3DIVA 3ZBMA 1E5ZA 4P5RA 2RACA 3EHBB 1ET5A 2CAKA 1ZDSA 1L9OA 2PPDA 2JFCA 1TEGA 5B1JA 3CVBA 5B1KA 3CG8A 2VSMB 3X1GA 4RH4A 4A2FA 2A3TA 4GP5B 2QPEB 4YVNA 2HX8A 4F2EA 4M4RB 1WAEA 4CSPA 1JERA 2PCYA 2CBPA 2IWFA 2OV0A 4G7RB 3V9EA 4DP1X 2BP8B 2YAFA 2EIMB 3FSAA 4MFHA 1PY0A 1SDDB 4HCIA 4E9VA 1SFHA 1JZEA 1GS7A 1N70A 3GXUB 1NIAA 1NINA 3OM3B 2BP0A 3FU8A 3JTBA 4BWTA 5B7MA 1OF0A 2FTAA 1J9QA 1AAJA 5I6KA 1CURA 4DP2X 2VSKB 3TASA 2XVBA 4DP5X 3AG2B 3ASOB 1KCBA 3WKPA 1OCOB 2XLLA 4YSTA 4YSEA 4YSDA 1BYPA 1E67A 1WS7A 1ZPUA 1OCCB 1NZRA 2I7OA 2Q5BA 5PCYA 1BXUA 1CYWA 3FS9A 2LLNA 2XWZA 2UXVA 3GDCA 1MG3C 1CUOA 1OE3A 1J9TA 3NYKA 5IY5B 1WS8A 2WO3B 4N4YB 4YSUA 4KO5A 3CDZB 4A66A 1FA4A 2HZHA 4AI7A 3FYEB 4KNSA 3FSZA 2I85A 2BWDA 4AX3A 2BWIA 2XV3A 2VM3A 1NPNA 1ET8A 2FQEA 3QJSB 3FPYA 4UAHA 4WKXA 4E9XA 3NJMA 5EHFA 4FA7B 1NWPA 4M3HA 2QDWA 4BDVB 1M57B 3QQXA 5E9NA 4DP8X 5AKRA 1BQRA 1TU2A 3OMIB 3RYMA 4A2HA 2IDTA 2CCWA 1SJMA 1JOIA 3H4FA 4JHVA 1L9TA 1TEFA 2XXFA 3DKHA 1E5YA 3IBOA 1ETJA 1HFUA 1SNRA 3QJTB 1WA0X 4A2GA 2BW4A 2QPDB 4A68A 1ET7A 6PCYA 4DP7X 1V55B 2QT6A 4PAZA 1GR7A 2IDSA 3H56A 3UABA 2VM4A 4HAKA 2IAAC 4GY4A 1BXAA 1RZPA 2BP8A 3S3DB 1SDDA 2WO2B 1AZNA 1X9UA 2PLTA 3EH3B 4ZK8A 5FC9A 4DPCX 2FT8A 1KDIA 1KCWA 1JVOA 2VW4A 2YAQA 3N2JA 3NSCA 1OOWA 5TK4A 1OE2A 1FFTB 3T6WA 3DTUB 4P5SA 4G70B 3S3CB 1OCRB 2ZONA 7PAZA 5D4JA 4E9QA 3S3BB 1AS6A 4YSQA 5I6NA 3CVCA 1J5CA 1JZFA 4HALA 2HX9A 3NP4A 3H4HA 4G7QB 5I6PA 4G7SB 2DY2A 1URIA 4KNTA 4AKOA 1PCSA 3NJGA 1JZIA 3CDZA 3KW7A 4UANA 1AZBA 4YSRA 2XX0A 2HXAA 3NJLA 2GBAA 1PNDA 1L9RA 2H3XC 1OCZB 2XV2A 4YL4A 4A67A 5B7FA 3PCYA 3S8FB 3ERXA 3NSDA 3WNIA 4BWUA 3QJVB 6PAZA 1XMEB 5I5MA 2NRDA 3IE9A 2Q9OA 2I7SA 4CSZA 2H47C 1OV8A 2YARA 2Y1AA 1L9QA 3TU6A 3ZDWA 2PP8A 2YEVB 2PPEA 4KO9A 4BDVA 4BXSV 2YQBA 1NICA 1VLXA 1J9RA 3HEIB 3TA4D 1AZUA 3X2QB 1ZDQA 1CC3A 2IWKA 2GIMA 4ENZA 2W88A 4QLWA 1I53A 2YXVA 4A2EA 1ASOA 5D4IA 4G72B 1A4CA 1R1CA 9PCYA 1NDTA 3QJRB 2VMJA 3CVDA 5D4HA 3OQRA 2GSMB 2J55A 4DP4X 3TBCA 1SHWA 3IN0A 4DP9X 3X1NA 1AR1B 1KBWA 1W6LA 2EILB 1TKWA 2J57A 3BVDB 3NSFA 1GW0A 3UADA 5I5IA 2XV0A 2R7EB 4KOCA 4FAAB 3ASNB 1A8ZA 3ABLB 1ILUA 4TXVB 4EF3A 1F56A 2ZOOA 2YAEA 2OJ1A 5B1JC 1RCYA 4HCGA 3QJQB 3UACA 1RZQA 3SBRA 3L45A 5TK2A 3IEAA 3UAAA 1QHQA 1JXDA 4YSPA 1MZZA 2IWEA 2FT7A 4W9ZA 2HLEB 1AACA 4K9JA 2FJSA 3ABMB 1A3ZA 4GYBA 2B08A 1IKOP 1DYZA 4HHGA 1MZYA 1SFDA 2UX7A 5PAZA 3FYIB 4E9RA 1PLCA 3UAEA 4YSCA 2BZ7A 1PF3A 3AG4B 2FNWA 1N68A 4GP4B 2BZCA 3AZUA 1ASQA 1GY1A 4YSAA 1AS7A 1AOZA 1BAWA 4UF7C 1IC0A 2PPCA 1BQ5A 1HAWA 4AKPA 2JXMA 2ZXWB 3EF4A 4BXVA 2UXTA 3PXLA 3NSYA 1ASPA 1B3IA 2YAHA 4HIPA 4HHWA 3PLYA 5F7AA 4KO7A 4WTQA 4E9SA 4PCYA 3QPKA 1AS8A 3NJIA 4AKQA 5I6OA 4YSSA 2HRHA 1SF5A 1AZRA 1PZBA 1ZIAA 2X88A 2HRGA 3HB3B 5B3SB 4DPBX 1XB3A 1W8EA 1KYAA 2PPFA 2TSBA 2UXFA 1QLEB 2MTAA 3AY2A 3FSWA 1IBYA 2GC4C 1A65A 1JVLA 5I5JA 1NTDA 3FSVA 4NB7A 2GC7C 2R7EA 2EIJB 1X9RA 3MBWB 5AZUA 5ANHA 3X1FA 4YSOA 2FQFA
chains in the Genus database with same CATH superfamily
3QHFH 4YHLL 2WHVA 2H1XA 5EO0A 1NEUA 4RDBA 3WTXA 1EHLL 1BZQK 4NCDA 3TVMA 2EXWC 1H5BA 3SQBA 3ZW3A 3QJFA 3T65B 3KEHA 4OF8A 3JUYA 3LN5B 2ZOTA 5C0BE 2QEJA 2MSPA 2QQKL 3JTTB 1HNWB 2WN2A 3WLBB 2VCOA 3DBXB 3IRCA 3LUTB 3MLTB 5EU7E 4P5TC 1JHLH 1SOXA 1F18A 2YA1A 4IKIA 2VXQH 2E7DA 3RZCA 2D03H 1P7QD 4DR3B 2A4EA 4JI5O 2ZYRA 5JQGA 5E2UH 4IGGA 2BFGA 3WFHA 4F7CA 3K6FA 1SYSA 5DJYB 3ZZSA 2N7SA 2AJUH 2ZUXA 3OGCA 3QUMB 4L4VD 4OT1L 3ARTA 3ULSA 1MNGA 2ZX7A 3TBBA 2XDHA 3F3HA 1EEZA 3X3GH 1JV2A 4Z7OF 4A55A 4M7JL 5D1XB 3HR0A 5IQ9A 3ULVE 2NCEA 3WNJA 1F41A 1ZX3A 2DMXA 2VUKA 2W0PA 3HKEB 5A7EA 1ILSA 4YDLC 1SUJA 4XPTH 4GB9A 3B5TA 1DQJB 3TN0D 3FTWA 5KUMA 1AANA 4P2QB 4MT8A 3ZL4L 3H3PH 3F01A 2Y1YA 2IDUA 1ADWA 4OBRA 2DN9A 5DUBB 1M05B 3T1HO 3BAWA 3VD3A 1YY8B 1JZHA 2QFPA 2BNRB 5I1AA 4RA0C 3WJJC 1PZDA 1S4IA 2H32B 2YAPA 2DJVA 1R3IC 5LMNB 3Q2LA 4NC2B 4PV9B 3KS0J 1KEMH 4X6DA 1KWGA 1PZUB 5ITFA 1HSBA 3HMWL 4D8OA 5J06A 1G6VK 1IQDA 4C55A 1SLWA 3EUDA 5E08L 3S5LA 2DQ6A 4DCQA 1KXTB 2VW7A 3BDBA 1OANA 4OLZH 1OPGH 1CICC 3HE7B 2XN2A 1FL3A 1PDKB 1RH8A 3BWSA 4P2OA 2AQTA 4NQQA 3O11B 1OAYL 3VQWA 4YXKH 4G8GA 2ZG2A 3QWRD 1OAJA 3JVFC 1F58H 4BCZA 3TO4D 2JJSC 4JQVA 3BKMH 4B95C 3T08A 3MU3A 4CNIB 3WEAA 4HAGA 4GXFA 1UM5L 1YNKL 1RVFH 4U7KA 4X9BA 3WKML 2DYRB 4WU5B 4GI6A 5IUSA 4WI5A 3FHEA 1KGXA 1AO7B 1NFDF 1ZE3H 3QQ4A 3AGVA 3QA3A 1Y74A 4R9HA 1JP5A 3DJSA 1IGJA 3VXMA 1PPJH 1RZ7H 1CFVH 3UROR 5I8OH 3DX2A 4JV5O 2P47B 4JG9A 4PJFB 4UQ2A 1E4KC 4QRRA 4J5VA 4M6MH 2ZWYA 3NACL 3C2AL 1BG1A 3TXSA 2WSKA 5G2NA 4HKZB 3D69A 5HDQL 3EJPA 5CZRA 3CHRA 1YPZB 2QMKA 1HHKB 2X42A 4L0PB 1IT9L 2MHAA 1YLBB 5DN6G 5CSZB 5TE6H 2EIZB 3SE9H 4L3FA 4X6FB 5ANME 1KECA 2PN5A 1NGWB 3AGWA 4LR3A 1TPXC 4OGAD 1NIFA 4NKQB 3L7FB 5DK2A 3KLDA 5IB3A 4AT6A 8CGTA 3L48A 2DL9A 2LQTA 4CVUA 3NBNA 3MJ9A 3TVMD 5JHBA 2YXFA 3MYZA 2XSKA 4K7FA 3U9WA 3QR2A 3VGAB 1BDYA 4ZTEA 4CGUB 4JY5H 1T7YA 2R27A 4FYRA 5LNDA 4BQ8A 1BXVA 4QTIL 3TN0B 4Y1TA 5CXPA 4G6ML 3DO7A 1A1OB 1ROPA 1U33A 3NT0A 2A83A 5KYNA 2NY7L 2ZE6A 2A9AA 4L3CB 5ICXB 1KCRL 2V5MA 3C5SA 3NK3A 1JPFB 3H0TB 1XFPA 3HPLB 5F0MB 1Z0MA 2ENQA 2F58H 2EBOA 3JAKA 1Z9NA 3REVB 3VXRA 3WSQH 2G60H 2YAOA 2WYIA 3UTPE 4LFAO 4P9PA 3IGAB 2DEWX 3CK0L 5EU6B 2VT0A 4CA4A 2UUAO 4QNHB 4G7YH 1UG9A 5IIEB 3RBZA 3JYCA 2HJKA 2P5EB 3NCBB 4JO2L 3RA7L 1XMWA 4D6TH 5DO8A 1AP5A 1DQLL 2WIIB 3H1LH 2QPEB 4FNSA 4Z8FH 3KXFB 1PYWA 43C9B 4PG2C 4RQFA 4JUTA 4PYHA 4CSPA 2Z9TA 3M1BB 3EO9L 1VQLV 1K6QH 2IWFA 4CMHC 4DQAA 4CDGC 4XZUB 5GRWA 3UT5B 4LIQE 4RGND 1KEGL 4QGYA 1U8LB 4NHUB 2VDNL 2CMRH 1LEGA 1RUMH 5HJ3B 1QWNA 4N21A 2VDQB 5D7HA 3SOBL 4JI1O 3CH8A 3QEGH 4LLYA 3ARBC 4PLKC 4CJ0A 5MHSD 5F21B 4AM0A 2WLJA 1J87A 4YHZH 1UTDA 2NW3A 5C6TL 5AW0B 3GKWL 1GHFH 5CBEA 2R23A 5IFAL 1EIBA 3OB8A 4ZFOB 1OWRM 3FCUB 4UM9D 4N0RA 5HHPA 3FONB 4W4OA 5DJ8A 1B88A 4PA7A 3W39A 4P59H 1AIFA 2YD0A 2YIAA 4G8GD 4HIEB 4TQIA 3G6JF 1N9PA 3ZMUA 4XCEB 4LPCA 2D8KA 4DIXA 4TOYH 2VAAA 3C5JA 1MH5B 1X4TA 2ZKWA 1QPXA 3NYKA 4GS7C 3D8MA 4RQEA 1OHQA 2VDRH 5E94A 5A2QN 1G1XB 2DDQH 1MUJB 1RK0A 4QPKA 1MAMH 1YHPA 2X3CA 3N9GL 4WW2B 3T4AA 4AX3A 5CCKL 1ZSHA 3L3DB 1XV8A 5JCOC 2GUZB 3VXMD 1C1EL 1SERA 4LDLB 4W4NA 4ORZC 4UZGA 5L8JB 3NDZE 1BL8A 2P43B 4GRWE 3MLWL 2BRQA 4QRRD 4LCCB 4NQXB 2A6JB 4FQLH 1U8IB 3KCPB 2IOOA 4NX0A 5AVSB 4ELMF 2J25A 1B2WL 2FIRT 1TVBB 4Z77A 5LYJA 4AQAB 5KS9A 3UTZB 4JI5B 4L8DB 1UOKA 3VTTA 3OTFA 4K23L 3GSRB 5E1HB 2HJFB 3PGFL 3OKOA 3QJTB 1MIEL 4KBPA 3MGOA 4JQXC 4N8VG 4OZFG 4X4XA 1BQLL 4YHOH 3V4VB 4FXKC 4FP8H 4DW2L 1DUYB 3FMGL 4J8QA 3U2JA 1GR7A 1LHZA 4N24A 1BVKA 4Y2OB 3WNMA 5J6HB 2CE4A 2CBOA 3AWFA 4X1YB 3AMKA 3R4DA 1P49A 2XBTA 2Q7EA 1CE6A 4ZSOE 5ERWB 1C9SA 3K3WA 5IVZA 3ZR6A 2QLVB 3V7AE 1I9RL 4KTGA 5E2UL 4AV4A 3T1HB 1A6AB 1WZ1H 3NIGE 4I85A 5CO1A 3QRBA 4Z7QF 4W9GC 4IKKA 4JDZB 2AJUL 3T6WA 1Z6JT 5LBSH 3VXRD 1OCRB 3QDGD 5D5ME 2VQEO 2ED6A 5D4JA 4A7GA 2LU5A 5C0DA 3S3BB 3X3GL 3MJ9L 1AP6A 3CRMA 1NBZA 5I1KL 4KDVA 3OXRB 5H5NA 3BT2L 2XKNA 3HE6C 2O5ZH 2OSLA 3MFFA 3F7QA 3NP4A 2GK0B 3U1SH 3N40P 2XWRA 5KYWB 4G7SB 4MNHB 4DO2A 4LARH 3GJFH 2GT9B 3IJHA 2YWZA 4F92B 1DANU 4ODVH 3KWUA 3IKCB 2GDSA 4WBNA 3H3PL 3MBXH 3E9UA 3NJVA 4HIJB 1E7UA 3LH8A 4UM9B 2OIEA 2G3NA 3IMTA 2QJDA 5INCB 1HR0O 3PV6B 1R3LB 1IKNC 4D0DA 2HWZL 1TTRA 1OKEA 3ULUC 5IDJA 2CRIA 1UA3A 3ZL1A 1JNHA 1OF2B 2EC9U 4N9GA 3ZE0E 3GBLA 4WFBV 4PUBH 3RWFB 4HHAB 3WUWA 2AQ1A 3CXHF 1SJEA 1KNOB 2C1OA 2I7SA 3QUKB 1GSMA 1LVEA 5CCHE 2DWDA 2CXKA 5IW6B 1O7DC 3VFTB 4GX0A 4XMKH 3E6HB 1TF4A 1MCPH 3K0WA 3QYNA 1CG9A 4JPIA 4S2SB 1K3EA 5HGDA 1J9RA 2M6YA 4WF9V 4RMVA 3DGEA 2IWKA 4N5ED 4JV5B 1BD2B 1N18A 1Q9KB 1T80A 3QO0A 5J0BA 2ZCKL 1ACXA 3T0EA 5CJOH 4ZG1A 1F58L 1Q90A 2VIRA 1G6RA 1ZLSH 2B7DT 3OG4B 4G72B 2YI9A 4PV8B 3N2GA 3HAEA 4NHCH 2MOVA 3AM8C 1KP3A 4QE9A 4BK5A 1QTSA 1SETA 3RVWD 1JHTB 4DP4X 5KHIA 1U3HA 3TBCA 5I15L 1CFSA 1AR4A 4DGUA 4OCRL 3AFLA 3DOIA 1KBWA 1AI7A 1JTTA 3DX8A 4PLJC 1HKFA 4K3DH 2ATKA 5D93B 4PJDF 1S5HB 3W7UA 2JRIA 3D1MC 1JBJA 1GC1C 1C7SA 4X9FA 3HNVL 1LK2B 4I55B 3NVQA 5I8OL 1ENVA 3NCJL 1RZKL 5ACZB 4WI9A 5FYKL 1NGXB 2CO6A 1XGPA 1M6OB 4FFZA 2ZKHL 5AYQA 1MHEA 5EF2A 4W93A 1WP8A 4NQEB 4JPKL 3EYFA 2VQ1A 3ZDXE 1F56A 2WUCL 3RYIA 3GWOA 2X7LA 3GXPA 4F1SA 5FEBA 1OTUD 2F5AH 3KJ6L 4ZOLA 1TIUA 2NNAB 4F37F 2W0LA 3LIZA 5C9JA 4XAWL 4W6XB 5JXEA 1LK3L 4FN0A 5F9JA 3HOGA 5F6IB 2WAHA 1NPUA 2A73B 2K3TA 3QDGB 5EBMA 4OIIL 4BFFA 5B66Z 1IU1A 2OFQA 4W9ZA 4ZZFA 5GHWH 4LFAB 4K9JA 5DFVD 3DX7A 2O26U 3ABMB 2UUAB 1J8HA 1FHNA 2BSSB 5GONA 4HUVB 1KLUA 3LSSA 2E27H 4OLXH 2V5RA 2ZG1A 3EJUA 3IU3A 2DQIH 1EX0A 2BNQA 1UYWH 2KZKA 1Z9LA 3Q6FA 1F97A 1QBLH 1DL7H 4NKOB 3WTSA 4JPWH 4NJAH 2CO7B 3S35H 4G27B 1T03H 4MVQA 3WN5C 4PW4A 4CUCA 2HKHH 4I2XA 3DSQA 4BXVA 1IBGH 4N22A 4L8SC 3CLWA 2PCPA 3LDEA 1Q1JH 1D5BA 3IDNB 3VGDA 1MJUL 2H26A 1GKOA 4UUJB 1SESA 3QIWA 5E9DB 5JORA 3HMXH 3QQDA 4JI1B 4WUUE 4PCYA 1TETH 2LHAA 5GSRA 1NANH 3F5WC 2OTWA 5KVFL 2N3JA 4UOW1 2Z93A 2LW3A 2JWYA 2HRHA 3VGEA 5IFHH 4XBGA 4P2OC 2QADB 1HH6B 4PJIF 4G11A 3MHSC 5MEQB 2N0KA 5FGRA 4Z8FL 3I2CH 3S3PA 2P8LA 1TMCB 4RFOH 2C7UA 4RRPA 1KIRB 3IAPA 4GRLA 2WBJB 3BD5A 3ZKMC 3LAFA 3RKPA 3WNLA 5DS2A 3Q2VA 1LLAA 4D7PA 4MGXA 4LBEA 4PG9B 2F6AA 4N23A 1E40A 4H26A 4A63A 4N2IA 5JW4M 5CM1A 4XCNB 1Z3RA 4YSOA 1EEQA 5SWSE 4YAQB 3D18A 2F61A 4P48A 4YHZL 3WFVA 2X4OA 3TEYA 1P5VB 2QTVA 1K4DB 4ZHQA 2W60A 1I1AC 2F8OA 2W91A 3KYKH 5ALBL 5EIIB 4LHUG 3CH1A 3AT8A 5F7DA 3TJEH 1G8MA 5EUKB 3ZJZA 3K74B 3PREA 5JIMA 4FD0A 4WSJA 4UVCA 4BSWB 2SEBB 3VX1A 3IF1A 1OAXH 4OZHA 4DJMA 3NA9H 1TZHB 3QEQE 2IH9A 3O3UN 4P3CL 1MNUH 5GS0D 1U3HD 5AALA 1W80A 3A3YB 2VITB 4NKDA 4LCUB 1DTOA 3MA9L 4CADB 3EH5B 4HJJL 4E9TA 5C07B 5FYLL 1AE6L 2CKBH 2JVUA 2NY5L 1Z5VA 3IJSB 3JZ7A 5DWUH 1B9KA 4J4PD 2FGWL 1UD6A 3CTTA 2XI9A 3QG7L 1NCIA 2VXTL 3LRHA 3BQUD 1OWWA 2JKNA 4NZUL 1DQQB 2Y7QB 3WFCL 1FYHB 4Q9QL 4LNVA 4G6AD 3W9DA 5DDHB 1OCCC 1G7IA 5HYSB 5GS0L 1YEGH 3VG9C 1MDAA 2XYBA 4UVBA 3OD3A 3L6FA 1CFMA 3G5VA 3JSNA 2DV6A 3EOBA 1XDTT 1NOAA 4MA7H 5HHNB 5JXED 2NSXA 3VI4E 3ZYZA 3QAZB 2VQEB 4FQXC 5C2BH 4HIIA 1V7ML 4WKZB 4JFDE 1P6WA 4U3JB 1J8HD 4N3UA 2VUOA 1TTUA 2RAMA 4LF9O 4O02B 2XT9A 4KTEH 5CB4A 2VZ3A 2WBWB 2XNAA 2MK3A 5JR1H 2X6VA 1B9ZA 5T3ZD 4KKRA 4JI7B 1H3VA 1QHOA 2IFGA 4N1HB 4C56B 4X9YA 2ITDB 1T4KA 1BFSA 1DQTA 3SQRA 4K15A 2BS9A 2VSDA 3VQLA 1CLZL 4KJYA 1WZ1L 1HR0B 1A4BA 4BD4A 1HHGA 1N5AA 3LIZL 5C3IA 1L0XA 4XMWA 1KV7A 2J3SA 5LBSL 5JIIA 3KZIZ 4HZ3A 5KLVH 1SN2A 4HFWB 4KKQA 5CLYA 3M7MX 1JNNL 1A66A 4ZBJA 1HXMB 3ZTJG 3QIWD 3HKDA 1FH5L 4P3WA 4ZW7A 1E1RG 1WZLA 4KI5E 4DP0X 5AG8A 4YXLH 4B96A 2DD8H 3APCA 1JXGA 3AEIA 2KPNA 3P77B 4JFWA 4EDXA 3SKOA 4IIQA 4F93B 4XBMA 1H2KA 1KBGH 3HZKB 1ZT4A 2E7LC 3FSOA 1RZKC 1KJ2H 4LLUA 3CXDL 1Z5LA 1R47A 1QD0A 1GOFA 5E24E 1PX8A 4MTGA 4GRLD 1DN0A 3H01A 5F89A 4QYOB 4JFPA 1B0WA 3QJXA 2X4PB 4WAFA 1V10A 4MD5A 2VLME 3FN0H 1EJFA 2Z34A 1UFGA 3K0YA 3QXWA 4L1LA 2WKOF 3ZTDC 3H9SE 4RWYH 2BPBA 4ZFFA 4Q2ZB 4M1CD 4G6FD 5CZVH 4A2DA 4XMKL 1F4YH 3GHPA 3D0AA 4LNUB 2ARWA 4ANWA 5DD6B 3QG6B 1A9EA 1EFQA 1UEMA 1L7IL 2R9HC 3L2LA 5SX5H 5IQNA 4DAGL 1S8DA 4K35A 5KJRL 2V5SA 3MODH 2VDPH 4BZ1L 1MNNA 3KPPA 3IC9A 4FQ1H 3W2DH 3CZKA 3CVHA 3S8WA 2FECI 1IRAY 4GG6E 1GYAA 4GX1A 2B20A 1CP9A 5CBGA 4GSUA 3VDCA 3BRCA 2FX7H 3K1DA 4GW1A 4KMQA 5JZ7C 1K8DB 4B08A 3FRUA 4XOEA 4DK1A 5T1DH 2CCVA 4V1DE 3DJ9A 5AZEL 4YJZL 3Q6GH 5JNYB 2R4RL 4JFVA 5K1XA 1JN6B 4PDLA 1FZMA 1H8OA 3FUEA 3P3NA 1JWSB 3T2NH 1GL4B 2VERN 2NT1A 3H85A 3BEVB 5D72H 4GQPH 2CAKA 2Z31A 1HSAA 4G82A 1XH3B 1T6WA 3FO2B 1S7XB 1A7OH 1PD1A 4FEMA 3MNZB 4LEXH 1SY6A 1QUNB 4RH4A 3JAMN 1VAHA 3L3JA 4HWBA 1QTYT 2MNJB 4HJTA 1G1CA 4PJHE 4O4IA 4IBUA 3J2PA 1I1FB 4WTWA 1WAEA 2VN6A 1YJNV 4YBQC 2V17H 1VEWA 4KKLC 4WO4B 4O4JB 3IU4H 1HKLL 1H0DB 3QI9B 2P90A 3KLHD 4EIZC 3O6LL 3NZHL 2XQ0A 4ZOCA 2A6DB 2F1BA 4JDVB 5GRVL 2PXYB 2Z7UA 3SE8H 1RZGA 3HNTL 2NY1B 2OMXB 4BWTA 4OH2A 4AC2A 1WA8B 4AQYO 1W2KT 3A2FA 1PJWA 1UXSA 3CN2A 1R6VA 1X5AA 5B8CB 4RDQF 4K8RD 2NR6C 3LNGA 4NNXA 1FXKB 3N04A 4JPWL 4LLWA 5E4OA 3S35L 1JFQH 2XG5B 2LTQC 3U7AA 2VDKH 2FUQA 3MPCA 1H8EG 3ME0B 2C1PA 1T03L 4QGTA 3TFKC 1RSOA 2BJML 5FUCC 2WIMA 5I75B 3CSPA 3HR6A 2OXHB 2OZ4H 4KJWC 4GIPD 4PJEE 4OCWH 2X0UA 4KRPB 2VISB 1Q1JL 1AH1A 2DMGA 7FABH 3TBVA 2FJGB 1G0YR 1CGSH 2Z1PA 5FHBH 3OWEA 4OJYA 4NJ9H 2O5YH 4BFKA 3K8KA 1Y66A 4X4ME 3ULAB 4YDNA 2NY5C 2BWDA 2VMFA 2WAQA 3K6OA 2IW5A 4HPHA 2VAJA 5IFHL 1GCFA 2ARHA 2ZIOA 1A25A 2Y36H 4NAMA 4AK1A 2OBGA 2BMKA 4K8XA 2XN9B 3TV3H 1YVLA 1F6AA 3QUXA 1FXVA 3RU8H 3LKSB 2EYSB 2AZ0A 4RFOL 4K3AA 2VDMH 2XG4B 4ZUTB 4OQTL 3DHJA 4J8RA 2UUBO 1FO0B 1M57B 2MMXA 5HTSA 1B04A 5CLZA 3SDDC 4OD1L 5IWLA 5MERB 4EN3A 4ICWA 4A2HA 2C9RA 2Q7NA 3RWRD 2XXFA 1CN4A 5EA0H 5A2KH 1XMQO 3EUUA 5D7IA 4XNXH 2C9PA 2VDLH 1I7UB 3VJ6B 5CGTA 4OLWL 3L74H 3MGTB 3DRQA 1V55B 3SDXA 4PAZA 3OKNA 4DGVH 4JPVH 3HLAA 3MXWH 1ZLEA 1VZIA 1TITA 2FH8A 4HAKA 4EE2A 5IV2B 1EZVH 3LY6A 4XPGL 4Y7MA 4X5PA 5T1LB 2ZPKL 3KYOB 4H37A 1QKZL 2H1LM 1VZGA 2WO2B 3L4XA 4RSYA 3IDJA 3TH3T 2DIJA 1A4JA 2B3RA 3D3VB 4FFKA 2GSIA 2JIXB 3HZYB 1WO2A 1HQ4B 1FI8C 2WQRA 3K9SA 2GUOA 1NBYB 3FQTA 1WWAX 2EIJC 2I9LA 3P11L 4KTYA 3B6SA 4LSPH 1KCUH 3GKZA 2CKBL 3D52A 3UBXI 4NNPL 2FATL 3ULVH 2Z31D 3COOA 1RPOA 4RZCB 5J7CC 4TNFA 4NP4L 3NGBC 3MRMB 1QI4A 5C1MB 4FL4C 4LFHG 4XP6H 4AKOA 3IDIA 3LKNA 4IRJC 4J28A 1LP9F 1Y6XA 3VFSA 2QE7G 3CVHL 1WPXA 2J8UF 2X9WA 4WI3A 5DFAA 3HFMH 4G5AA 5IF0A 4GSXA 3RT3C 3U30B 1QBML 2A74A 4MYWB 4G9DB 4MS8C 4F5CA 1YEGL 2W65B 2EH8H 1E2WA 1MPAH 4KJQD 4GG8A 1OCZB 1THZA 2PYEE 1AILA 3CMOL 4URKA 5HXMA 4KHTL 3CC2V 3OUSA 1TUBB 2ZYSA 1XMEB 3V4UL 2EJRA 3NIGF 4OQ1A 4XWOD 4WI2A 1ICTA 2PYLA 1WD9A 2CDEA 1FPOA 4I89A 3KPNB 4R2GB 4CSZA 3KPSA 2JXMB 4NBYB 5SWQA 3WYRA 3BIAX 1RXLA 5D5MF 1IZJA 1YEIH 5JPMB 3O45B 4HWBL 4QWWC 3UTTB 3AU1B 5JHAA 4YPGA 5D7JA 5C8JB 1SDAB 2H3NA 3O3AA 4OW6A 3WIIH 1Q0XH 1ANUA 2UXBO 2YXVA 3UIZA 1E6JH 5EN2A 2ZP8A 4RBPH 4BFBD 4NUJA 1T5XB 2VLKD 2KG7A 5HJDA 5IK3A 3SZKC 5KVGE 4UTAH 2FX8L 2Z92A 4QXGH 3QEHB 1IBKO 2D9QB 2H2SD 4P46D 4EUPB 1BIHA 2QSCH 2DQ3A 4LSTH 3ZXAC 5F3BB 4ICGA 2YPVH 3WY1A 5DEFA 4Q20A 4IHOA 4M48H 3TT1H 5LP6C 4A6YA 1XVSA 2BOBA 5ITZB 2DD8L 3KWVA 3ZE0F 3CCLV 4JMNA 3BXNA 4WTZG 4GIAA 4ZDHB 3QUXD 5JPNB 4POUB 2GSGB 3GM8A 3FU0A 2ZAIA 4JW3A 2HVJB 5CP7B 2YSUB 4GAYB 5DYOB 1EFRG 1UA6H 2ZOOA 5LL6Y 3R1GH 4MMZC 4EN3D 4NDMA 4ZO8A 1JPGB 4TLTA 3U36A 1XGQA 1MIMH 3VXOB 1MJJA 1JIBA 1XCQA 1QEWB 2H4EA 4NZTH 3WNNA 3TP4A 4HP5A 2CTQA 1XCTB 3BO8A 3HKZA 3FOMA 1I1CA 3K79A 1EERB 1F4YL 3JWOH 4YX2L 3IDMA 2QHRH 3U2IA 2QMJA 3BPLC 4FFBA 4FVMA 2B08A 2AQRA 3CPUA 1DVUA 4CS3A 2ZCHL 4P2QE 2PO6D 2AGJL 4K7PH 4ZS7H 1YUHB 5DA4A 3REWA 5HVFB 1QR9A 3PWLB 2UZYA 3QDJD 1TZOA 4PV1B 4HJEA 5LG6A 2BNRE 1B0RA 1DVFC 3FQXB 3K71B 4PJGA 2FO1A 1USQA 3D05A 3DX9B 3RVXC 5AKVA 1HINH 2C2AA 1KLGB 1Y18A 1E79G 4A7SA 1F3JB 1YUKB 3LSQA 2XETA 4LVHC 2ZYIA 4E0RB 2DQFB 2QVKA 2BNUA 1A7OL 4XP1H 4AQYB 3CC5B 2HVKA 2QKIC 4UB8Z 2EDEA 3LHAA 5F3HB 3A22A 1LWRA 1SF5A 1PZBA 3NIDB 5CP3A 1K9TA 3HB3B 4MMYA 1N3NB 1T66C 5ADOH 4N8VA 4OZFA 4XOBA 5F8QC 2LLGA 1YC8A 4HOZA 2UUDK 3QIBD 2W9DL 1L7TH 4B27A 2VLKB 3V4LA 3NSXA 5FOBA 5IJVA 3OLEA 1FNAA 1KYOJ 2OMVA 2PW2A 5AKTA 4A37A 1QR1A 2EYTA 2V7HA 2PKDA 4U05A 4PP2B 2YRZA 1AO7E 2CJUL 2G3ZA 4TUJB 5F70A 2JJUA 1X9RA 4P46B 5AZUA 3QPQD 2NW2A 3CD6V 4PJXB 1BE3H 4WI4A 3KPSD 5I5RA 3RFZA 4WFFD 4AILC 1E9OA 4EFEA 3I5DA 2OKMA 3QH3B 1D2OA 1UKSA 1DCEA 3HBGA 4PJFE 2EUWA 5JLZB 4TQEH 4ZI8A 5GRXG 1NGYB 5D7JD 4HK0B 5GGVY 3SPCA 2YMTA 3LRGA 1TZIB 3C90A 4DR4O 5KMGB 5LXTB 1YPZE 3DJRA 2VB5A 1U93B 1KDJA 3TYFB 3QO1A 1MCOH 2UUBB 4HZLB 4PDVA 5AB0A 1CQYA 3N1FC 5H8DA 4GKNB 3VQVA 2L7JA 4M02A 4A2MA 4KK6D 2GEEA 5IG7A 3STLC 4LPVA 2Y0IA 1XMQB 2O6PA 4U3HA 2EVFA 3QNEA 3OAYH 2Z35A 1K5QA 4RFEB 5FV2A 3FUMA 3CE2A 1CFQB 2Y36L 1EHKB 5F96H 1FSKB 4K5PA 4GRWH 1EXUB 4Y5VA 5AQ0A 3U2SB 3TEWA 2PO6B 3O81A 3RU8L 3UBHA 4PN6A 4M61B 5BOJA 2BK8A 5C7ZA 3ARPA 3O4OC 3QDJB 3V7MA 3GHBL 4GBXC 2Q69A 3U6XS 3QDMD 1FE8H 5LQBH 1JWMB 5EA0L 2E0PA 1DGSA 4MCYA 4L87A 2BSKB 1KCLA 3D25B 3OHXB 5DVMA 3HRZB 5EU6E 4I4WB 2E59A 4UT6A 1AD0B 1SN5A 1RHHA 2QV2A 4UQCA 2XAFA 3DYOA 3KDPB 4S1RL 2DMHA 2P5EE 4XO9A 1OARL 2HFTA 2EXWD 3WHE0 1M5IA 5FF6A 1TLKA 1KN4H 5AAMC 4KKAD 5BXFA 4BE6A 3KXFE 4B60A 3VB9A 4HUNB 4BFIA 4AJWA 2UVEA 2VN7A 2EDQA 1MCJA 3OZ9H 1AP2B 2YBRB 4P5TD 1MZFA 1F8TL 1EEUA 5EZOL 2WLHA 4FFVC 4P3DB 2GHZA 3V5DB 5CJXA 5HYQB 4EQ3A 2X4SA 3DBSA 2VC2B 4FXGA 5IB1A 1AQ8A 5HDOA 5EC1C 2PWHA 2WQ8A 3F7VC 2ICES 1CR9H 1KCUL 4TM9A 5DZVA 3UJIL 4ICXA 1KIPB 3T5WA 3ZX1A 4OFKA 4GKSB 4BYHA 1MG2C 2BO0A 4JDTL 1WISA 4UM8B 1K2DA 4YDVB 1SHMA 2P8PB 5E00B 1GJWA 3I02A 5I19L 1NGPH 5IW1A 3H1JH 3QO8A 2AJ3A 1XF2A 3PP3H 2DLFH 4HS8L 3E6FB 3ILQC 4PREA 1AROP 3RUGE 4PB9H 3AG1B 3FB7B 2UXBB 4AV5A 4L3EB 3MBEC 1JZ6A 1G9ML 2XUWA 2AZAA 5F7BA 3I50H 4HS6B 3LRKA 1XGZA 4FQCH 3N41B 1KY7A 5CD3B 1L5GB 4NKMA 4JI3O 4HH9A 4HAMA 3GD1C 4JHUA 2G2NA 3GI9H 1E90A 3FU7A 3IN2A 4NN5B 3QF7A 2GKIA 1D2DA 3T1CA 4JDEA 5DD5H 1OB1B 1WZKA 1QQDB 3CDGA 5C86A 7PCYA 3NH7H 3QXDB 2F9BT 3V0JA 1VFBA 2HFGL 4ZTPH 4MJIB 4JQIL 1DTUA 4IMKA 4G5ZL 4K2UH 4KI5F 4X5LA 3VWJA 3VRJA 3MRDA 4K8ZA 1DBMH 5JTWA 1LEIA 1URLA 4IYHA 1IE4A 1YAIA 1T22A 3ESPA 4JFTA 4YQXL 5I8KH 4YE0A 4HXAH 4NTYA 1U41A 4YJ2B 2BLFA 2YHGA 1NAMB 5EF0A 1N6UA 2L6LA 2J43A 3QDMB 1AGCB 1N34B 1BLIA 3UZEC 1ID2A 1PZ2A 5DSCB 2IQ9L 2XWEA 3HKCA 5HVGB 2PETA 1F1AA 2IV9A 3NP3A 3C6LC 1IKFL 3F7RA 2ADGA 3K04A 3DXAA 2QR0A 1F45A 2R9AA 1GTOA 5E2WH 4O5LL 3JV5A 2XTJD 2WA3A 1JGEB 2IWGA 4FX5A 2BVTA 1WEJL 2FMLA 2OM5A 4JGMA 1S7SA 5IGXL 2CBTA 1MWAB 4NRZA 4P5TB 4RAUA 3RIFK 3LXAA 2MTPA 5E5UB 1JERA 5DMGC 2AMUA 4LHUA 4B3RO 4WHTA 2IQAB 1Q9OB 4FQHB 2HB0A 1OM3L 3V9EA 1MSDA 1FAIL 3TOPA 4GG6F 5DLMH 4J11A 3FSAA 4KQ4L 3FC8A 4NUGH 1SFHA 3MLXH 3V4PB 5MHSE 1YNLL 4K3EL 1IILE 1RERA 2IGFL 5IMLA 2YSSB 1ZHBA 3A47A 1WTGT 2KBGA 2QHRL 3V6OE 1ODUA 4G6KL 3EZ8A 2PW1A 4O58L 5KYXB 4TKWA 3P73A 4YDLB 3TASA 1ZGLB 4H8PA 5CEZD 5I1EH 5T5FA 4MSWA 2IALB 1ODAA 4NXSA 4ZTOH 4PQXA 1AQDB 4C7UA 5IEKA 1PY9A 3ABLC 1SC5B 4PJ7F 4J1UA 4U7MA 1EGJH 3HJEA 1UZGA 1AQKL 4PTUA 2EVGA 4GKKB 4PJHF 3B7TA 1BFVL 3PQYA 5IJKA 1WGOA 1A6VH 4MHHG 1WS8A 4YIQA 2WO3B 4KO5A 1SUHA 3AQDA 2FHCA 1VARA 2EEFA 1T3FB 2PR4L 4IRSA 3PHQA 4YHYC 2QQNH 3VI3B 3CPLA 1XDCA 4JI0O 3IE4A 5AB9A 2D3LA 1IBMB 3ICXA 2NNCA 3OKKB 5DJAA 2BIMA 4C59B 1G4RA 1SOKA 1U8QB 3MOAL 1ZRUA 1T1YA 1DFBH 1LJMA 2OTUB 4YY3O 1BD2E 1UQSA 4XHJC 1CICB 3LNIA 5ADOL 1JMKC 4LCIH 4X5QA 3LQZA 5D1ZA 2YZ1A 4EZLA 2W0KA 2UZXA 1K5NA 4DR4B 2ZJSH 1U8JB 4HISA 4N9OB 3W81A 1L7TL 1KY6A 4E5XG 2QDWA 4TULL 4UT7L 1OGAB 5BUGA 4LCWA 4DP8X 2ZXBA 3E8UL 3MLUH 1BQRA 1I3RA 4TUOB 4XN9A 1N8ZB 1IVLA 5DM6V 3K2MC 4NYKA 2IJIA 3MCKA 4KZ0A 3UPAA 43CAA 5HHXH 4HS3A 1TOXA 5LKNA 3D36A 1SNRA 3VQ2C 1AI6A 1BCIA 5K9QG 4Q9RH 2UYLB 4RAHA 1FDLL 5I8EA 2ODHA 4A68A 2AQPA 2C8NA 2R0KL 4LBAA 4DZBB 3AUWB 5BCAA 2HT2D 3PDOA 5LBQA 5FO8A 3BISA 2IDSA 3WXVL 3RTQA 5DURB 3Q9PA 5D55A 4NQEE 1XNQB 1TTCA 3FHQA 1QZNA 1O7SA 1XGUA 1QOKA 2PTTA 3MUY1 1GXEA 1O9GA 1BJ1H 3RBGA 4HLZH 1KCWA 1ZL8A 3FTUA 3O0RL 4IHJA 4HK3J 2G75B 1N59A 3QDGE 4P5MB 1QPPA 2FEDD 4XR8C 3GI8H 4U1LB 5EIBD 2WVTA 3TV8A 4H8UA 3S3CB 4CVXB 1TPXB 2JK5C 3C60C 1JG9A 1JL8A 5BVJA 5GPRA 4JM2F 4L2LA 3N1MC 3WTYA 4PJAB 1P6FA 4ZFGL 3VFOA 1SJXA 1DLFL 2HLAB 4FQPA 4H40A 2KUTA 2YKKA 2DY2A 3ETBF 1ZA6A 2CKNA 4IIJA 3A4AA 3NJGA 4XVOA 5IVXF 4PVBA 2RCSH 1P2CB 2DRUA 4ETQA 3CFQA 3UYPB 2LR4A 3MV8D 3TA3C 3NFSH 5AVQB 1FE8L 4I9WE 4LHUD 3N06B 3ZR5A 5L8KB 2EUVA 4OLUH 5HDLA 4KTDL 2H3XC 4X80H 3FHAA 4IS6B 5E9DE 1H15A 1VRSA 1LGVA 2J88L 3FT4B 4UTBA 5CHNA 4GAAA 3QZNA 1LDSA 4IBZA 2YD6A 2NRDA 3D06A 3GMQA 4H0LC 2LE9A 1OP3K 3RDJA 4MZ3A 5IREA 4UIMB 1UWGL 2YARA 1G0DA 1RUAL 3UFIA 4BFNA 2J2ZA 3CUPA 1NLDL 1XF5A 2AHZA 2EQDA 3BH9B 2YXLA 1PFCA 2MQ3A 3N85H 5E56A 5HYFA 4ABWA 1AI1H 4WEEA 4X1KA 2H7WA 2R8SL 4LLQB 5D7SL 1ONQA 2KL6A 1R0AL 1S9VB 1BAFH 3QISA 1GN6A 3ARDA 5CINL 3KL3A 4CMHB 1YYLH 1FFPB 4ODWA 5F1IA 4YXHH 2QBWA 1CK0H 5EOCL 5GRZA 1DF5A 2JKRM 1CR9L 6TAAA 3L3KB 5HPMB 4DO4A 3P30A 1I85A 4Y5YC 3RFZC 4NBZB 2YS4A 1T20A 3DHMA 2E8ZA 2ICEC 3ARBB 3DNKA 3HE6D 2WYHA 3HN3A 1HQRB 3QULB 2X4TA 3BUYB 4YLQT 5F0PB 2W80C 3QIUC 3A8TA 2DLHA 5J57B 2DLFL 4F8LA 5EOCJ 5C0EB 1W72H 3FH8A 3QXTA 1F90L 4TSFG 1YYCA 3IETA 4DKAA 3ZHDA 3OV6A 3PGCB 2A7BA 4FE9A 3STZB 3LQAH 1VFAA 3G5XB 3L3IA 4LCWD 3R19A 5CJ8A 3ULUD 4TV8B 3AY4C 2R69A 1TXKA 3QJQB 4GS7B 4HX1B 2CR0A 2WLNA 4L4TD 3LDCA 5C07E 5AVWB 5JOPD 4XNUL 1EHNA 3JWOC 3V0HA 3I6GA 3CHPA 5GGSA 1AACA 3JD4A 1VQKV 1WAAE 5DVKA 2BCCH 1BP3B 1IIIA 4L5FL 5DVPA 3AAZA 1DUZA 4D7BA 1H6FA 2VWEC 3DMMC 3PPEA 4G8AC 4QRTB 5F7EL 1WG3A 2MQ0A 3ML0A 5TH2A 5A6MA 2F1MA 4PJ8A 1KV3A 4H2AA 2BZCA 3LKRB 2YXHA 4M1DL 3MV11 3VX0A 2ED7A 2VXQA 1Z9SA 2AF2A 4I48A 2IAND 5ICYB 1JS4A 3MV8B 3CFCL 1IAIL 2UWEA 2XV6B 1YNTB 3H3KA 1RK7A 4B3RB 2E9BA 1KPUB 3N5AA 3SGEI 4J3OC 3CN0A 3PGDA 5BQ7A 3NAAH 2Q8BH 1MREL 3IS0X 5JXAL 1K97A 4N2EA 4XXDB 1EUUA 4ZW3A 1K72A 3WHXB 3RP1A 4FXKB 3PWVA 5B5EZ 4ZQKB 4C56E 5JW5A 4AL8H 5LJYH 3U10A 4FA8A 4U6XB 2XYCA 5J2TA 1A3LL 4F20A 1D7BA 5C71A 1CT8B 3DX6B 3L7EA 1B0IA 1TQCC 2QQLH 1GYUA 3EVKA 3MREA 4XE5B 4TVPH 2NXZD 4WFEE 3T09A 4BK8A 4F24A 2HFEA 4HBNA 3OXSA 1KCVH 1HWYA 4H13C 1KTCA 4LFCO 5DRXB 3FQWA 1WBXA 1Y1UA 2J4WH 3MBWB 2R70A 3RHWK 1CD8A 4K94H 3EOTL 5ANHA 4JM0A 2AJSH 3QWNA 1GMGA 1D5IH 4HPOH 2XWTB 1H2LA 3TIEB 2Y5EA 1C5DA 4JI0B 3KG5A 3CFKA 3LKQB 2VZ1A 3HE6B 5CIPB 5E1AA 1SVCP 4G42B 1E4WH 2O6CA 4YY3B 3DROB 4E41B 3KGTA 3JZYA 7CGTA 3F62A 2Q76A 5IMMA 1HDJA 3MUUA 1ZLDA 1UB5B 3PAUA 2FJHB 1J5EO 3QCVL 1FNGB 4F7PA 2WCPA 3X1EA 1QLFB 3O41B 4WK4B 4X5WB 3MNWA 1E42A 4FADA 4U2ZA 4FLZA 2EEBA 3ARDD 3RVZA 1PAZA 3CFIC 2MW2B 1Q6UA 3CZUB 4Z7IA 2Q0OC 4LO9A 3TBSB 4UTBL 3HI1B 1GZPA 4OD2B 1R4XA 4L4TB 3UYRH 1FNEA 3L9YA 1WBYA 2Z8RA 3FPXA 1U2CA 3DXRA 1L9SA 1V54B 4Z3FA 3V0WH 3QORA 4UBDD 1RUPL 3CD4A 5H94A 3DPBA 4IMLA 3C12A 1CFTA 3VWJC 1KGCE 2A06H 3WE1A 2XY1A 4JM4H 1UB6A 3H1HH 3LRSB 4X6EB 1IEBA 3SDCA 3B3IB 4YZFF 3BQVA 4IU3B 3WIHH 1AJ7H 2V8LA 5HHOB 3QJOA 3TC9A 3ATAA 4OZ4A 5TDNA 1JGDB 3G3LA 4UYQA 4Z3GA 1YYMH 4XVJH 1BVZA 2BTQA 4YHHO 1KPVA 2FT6A 2IANB 1L9PA 2AK1L 4Y8DC 3U11A 5DU7A 5IJBC 5J6GB 4JFEA 4AE1A 4MVMA 2PUSA 1IC1A 1YPZF 1OOAA 3P30L 3NZUA 5D6CA 5SV3A 4B9KC 2CJTA 1MRDL 1XF1A 2GJZB 3GUTA 1BSMA 2Z6FA 2ZXAA 3F65A 4UDTB 1QI3A 2GCYB 3SZ6A 1ZVSB 3P4LA 4NUQA 3D48R 1NCGA 2MRYA 3M86A 4MNGB 4ZUSA 3KMDA 1Z5YD 4HPYL 3EH2A 5EBWA 3ZKQD 5MI0C 3NEOA 3KPQA 4Y4HA 4GKJO 4HKBA 4JGSA 4LF6O 1XZWA 4I8DA 4NZJA 3VFRA 2ZUQC 2DL2A 4X1IB 4DV6O 2L7EA 2XU9A 4MDIB 2Q20A 4AIZA 2I24N 1NCCH 2NDGA 1HOEA 1WPCA 4XNQB 3R66A 3SCMC 2R69L 4G1EB 5C0JB 1NCTA 3AXHA 4OM1H 5KJ4A 3QEUA 4NKGB 3BUPA 3T9WA 2X4UA 4JF3A 2VZOA 3MX0A 3US1A 4JY4B 3BP7A 2PTVA 1WFTA 3HZMA 1JCKA 2DF3A 1JV2B 4PWKA 4R0LA 1IX9A 3BFOA 5DC2A 1ADQH 2K8MA 1MFDH 5T5NF 1DF4A 2B9ZA 4OCYL 1BYOA 1X5JA 4I0XB 4WFHE 1Q43A 2CHZA 1IM3A 1E27A 2KMWA 1YSOA 2R29H 5EZJB 2PABA 1JNLH 3TGXA 2PWFA 1LNUB 1JYWA 1J5OH 1XI1A 1JGLH 2Q6AA 2VJ8A 4BSVA 5DUPL 4JAUA 1VADB 2WWMD 1AGDA 3PJNA 2APVA 3GVMA 3L73H 3CCMV 1MVYA 4PCSA 3QNZA 5AWNL 4KROC 4WGKA 2HH0H 3WN5B 4Y4KC 1MABG 1RFDL 1MVFA 2ARJA 2EICA 4OKVA 4YFLF 4L8SB 4H8QA 4N0FA 5DFTA 1KB5B 2VO8A 1QO3A 3FTGA 2Y25A 3GSXB 4K3HA 4ALAL 4X8JB 4RWHA 3IRZA 1XXFC 3AQXA 4XPFH 5JQ6H 3FCTA 5CWSA 2ZNWA 2HR3A 4FM0A 2XN9E 4JFXA 3F5WB 1CD0A 4N68A 2RR3A 1TJIL 4CC5A 1S78C 1RURH 1P4UA 1MCNA 1EPFA 3LMJL 5FO9A 2AV1A 1WB8A 1GN3A 1YDPA 3C3TA 1TYEB 3K8MA 3K0GA 2Q86B 1P7GA 1HTYA 3OKDA 1T0NB 3I3DA 2UY7A 1BAFL 1CTMA 4U3CA 1KU9A 4JZGA 2W94A 4LFHD 4F3FA 1CK0L 1MY7A 4GYCB 4UV4L 1ZKAA 1QNMA 4OGYH 4DV3O 2QDVA 1ETZA 1ZHLB 1B4JH 5E1IA 5KSVA 3GM0A 3TIDA 4L1HA 2DE0X 3F85A 4OLVL 5I1CL 1D6VH 1PX4A 4MDJA 2XQYG 3U25A 2F53A 4DR1O 3G6DH 4YUEL 4F8QA 4N2BA 3OR6B 1ET5A 4IGBA 5DTFA 3RTQC 1ZDSA 3D4YA 1I1AB 1Q9LA 3QUHA 4OGZA 4XVTL 1Z1WA 3UTSA 4XX1E 3SDCD 2R2CA 3RL2A 4BRVA 3D3VE 1W72L 4MJ5B 2V9QA 5DFWH 4GW5B 1E4XI 1TZGL 3QCUL 4JKLA 1US6A 4IBYA 3LQAL 2HX8A 2LVEA 5F9DC 1PNMA 1YEFH 3BC9A 4KRMB 4EZMA 5D4QA 5EOTB 3VH8G 2DQDL 3BSHA 4HF5H 4BH8B 3RWDA 3QUMH 3F2LA 3GS7A 1UZ6F 3GEWB 4JFED 3V0VA 1YEDB 4GLRH 4NO3B 4G7RB 2CO4A 3KD4A 3QZWB 1PY0A 3OTOO 1SDDB 1VP7A 4R90L 3VM5A 3BP4A 4X83A 1KELL 3LXBA 2H0PA 2BP0A 2DN7A 1H8LA 3QWQB 4N0UA 2NTFA 1R6NA 3JATA 4AUYA 3CC4V 2WVVB 4LKCB 4WNQB 3H2QA 1RULL 4GLXA 3DI3B 3EDKA 3KVPA 1JPEA 4J3TA 5AZ2H 1BCCH 1H2MA 3B43A 2EE6A 4LQ1A 1U91A 4Y4HD 5A2LH 4WFGE 1R5IA 1TQWA 1PX3A 1BZEA 2YUWA 3D0VA 4AQOA 2ESVD 5L4MA 3SKMA 1E67A 1TQVA 2H32H 3HS8A 1OCCB 4PA3A 4NCC2 5GJTL 4YDKH 1QRNA 2IU0A 3EYOA 1A14L 1FVCA 1R3JA 3VG9B 4BFRA 2CAZC 2BVQB 3RIKA 2LLNA 1X5IA 2DM3A 4X9IA 4APXB 4YS4A 4TUYB 4Y5XB 3SYPA 5GRUH 4LFCB 2X70B 2F66C 3T2PA 5FA4B 3KCYA 1QLRA 3ILEA 4MTMA 4FQXB 1H6EA 3H1ZA 3RGVA 4WY7H 4QUOA 3WO4C 3UTTE 1BQHG 3WFDL 3GIZL 5LLIC 1QACA 2AVGA 5LCVA 2B5IC 2ZF8A 4FNTA 4FZ8H 1YF2A 4PPTA 2J12B 4KDTA 3U4KA 3VMPA 4CN1A 4Z7WA 4IRZA 5AUMB 3WL9A 3FN3A 4NN7C 2R2BB 3OKMB 3VOUA 4YBQD 1OCWL 4JE4B 3W5NA 2AW9A 3L72H 1CXFA 1NFDA 4KKLD 5DS8A 3VXQA 2LU4A 5ABAA 4OUUB 1TU2A 4P4KC 5TISZ 5K9OB 1OAUH 2Z4QB 3BEWA 3ZRFC 5E70A 3IPBA 1XF4A 1E5YA 4X64O 1ETJA 1HI6A 1RZFH 4FI8A 4Y2DC 5FUZL 3RX5A 2XTSA 1S7VA 3KWXA 1ZVHA 4AEHL 1F3RB 4MRCA 4ZAKC 3U0WH 4XNYL 3HKBB 4M4RA 3LDDA 4X7FC 2WNGA 4S1QL 4M56A 3FJTA 3GRGA 4KY2A 4TVSa 3B1UA 2CDFB 4WI7A 2BSTB 4KPHH 5FO7B 3F7YA 1XTLA 2BP8A 2V7QG 2WYZA 2MNUA 3SE4A 3IJ9A 5JVDA 1CDGA 4ELKB 1FNLA 4JB9H 4HMCA 3A21A 2NZ1A 2XQBH 1WQVT 3HZ3A 5FC9A 4E42A 1F4HA 2FT8A 1RFYA 1HZLA 1RHFA 3L3OC 4KJWD 4XDJA 2RB8A 4GX2A 1NUGA 5TK4A 5AVVB 3UYRL 2B2XH 2R2EA 2X9XA 3JTSB 5DMKB 1EDQA 1E8YA 5FW7A 3V0WL 2HN7B 3BJ91 5IBUG 5D2NC 3DWTA 3S37L 2F53D 3T1YB 3GS0A 3V7AG 5IHUH 4IGBD 3RJDA 3O6FA 4G7QB 4JLRA 1XQ4A 2A77H 3Q44A 4JM4L 3BN9C 2DZEA 3UPRA 3UTSD 4GKJB 5HHQB 5F7NC 1AJ7L 1U8HB 5E2TH 5LWYL 1ZV9A 1F11A 4F91B 2ESVB 4UYPA 2WV3A 5ITBH 1DQVA 1VMGA 3OJMB 3GRWA 4OD3L 4J3WA 4OZGB 3FO0H 3J81N 2BRRL 3ERXA 3WFBL 3UXFA 2XZAH 5F88A 3RG1C 2ITCC 1BGXL 1I3UA 5ETUA 3OAUH 1SXZA 2NR5A 2Y1VA 1UHVA 3DDFA 1OV8A 5AD0B 3NIDE 3BGMA 3TU6A 1X4XA 1SQGA 4HFUH 4DKEH 4ZNCD 3CVIL 4NGHH 3QYCA 4BDVA 4TUKH 4YHNB 5BZZA 4JANB 1YN7B 3RGHA 1J7VR 4GRMA 4LNRA 1HCZA 1KENL 5DJZA 2BIOA 4UNUA 3SB3A 2VLKE 3UC0H 3M8OL 4C8XA 2I27N 3J8F7 3HG4A 2B4CL 3O9WD 1GYVA 4L9LC 3SJVB 1CLCA 3FFQA 3IFNH 4UCTA 5FS5A 3ELQA 2V4DA 1NDTA 2VMJA 5D4HA 4I3SH 2ZUUA 4PJXE 1LDPH 2G2RA 2EE2A 2WMPA 5IHZA 2J21A 3L5HA 4MBRA 1J05A 3IN0A 1XR9A 2ARJQ 4M5YH 4X7DC 2EILB 4MW3A 1TKWA 4EB6B 2R29L 3HPJB 3ALWA 3G6JA 3S9DB 2PF6A 3UADA 4MVZA 3AK1A 4L8CB 1CU4H 2CUGA 3T8VA 2YD7A 1PKQA 3LNFA 4QF1B 4ODUB 3GZPA 2LTQB 2CRYA 4NZRL 2FAUA 1GGIH 4BV1A 3NCCB 4KKBD 3LQAC 3U48A 2E7MA 2BOCC 2X4RA 3U0TB 1H2SB 4DR6O 1YMHA 1AD9B 1KCKA 2IPUG 2K70A 2YN5A 3PL6C 4U1KB 1FL5A 5BS0B 2JJ2G 4K3GA 5MP6H 1I1YA 1KC5L 4LRIA 3UJJH 2VDRB 1N67A 4PTTB 2CGNA 3ZMSA 4YHPB 4DV3B 4L1SA 4ZD3H 3SBRA 5HI5D 3LV3A 5TK2A 1G1KA 5JQ6L 2GTQA 1UH3A 1WV7T 4YO0A 4FABL 4PM1A 3L5XH 5LCVL 4DR1B 4ELMA 2Q73A 4UV7H 3DUSA 4L8JA 3BIBX 5J13B 3UO3A 3GLDA 2BX5A 2VQFO 2XJLA 3U79A 12E8L 4UAOC 3UAEA 4IRZL 2XN0A 3VCLA 2BM3A 3VXSA 3FT9A 1NBVL 1OLZA 3JCUZ 1A7RL 2QELA 3WS3A 3Q48A 5L9DH 4M3JA 4LU5L 1BAWA 4NRYB 3VNYA 1NKDA 4IIZA 4RIRB 3U6RB 5KHHA 2XZCH 3SDDB 3EGDB 1N4XH 3UDWC 5KS9F 5BRZD 3CMAV 3HHSA 5D1QA 1KTBA 2YUXA 2YKLH 3WKYA 4QRQA 3UQ8A 5LBGA 1ASPA 1WCBB 1J0HA 1JV5A 3V4VH 3OTOB 1ZWIA 4OY9A 4WRLA 4IOFC 4E5XA 4HUWB 4L8BA 4Z7VB 4PJBB 1WZAA 1UZ8A 2WVUA 3WLWC 1QFOA 3QPKA 2DEXX 2E76C 1AS8A 3O6FD 4AL8C 4PFEA 3T0AA 3IFLL 4EEQA 2VR4A 4B9CA 4DUZO 1CF8H 4M8UA 1WAAF 2E5EA 1PVHA 5J3HC 2ZR3A 2DQHL 2FUTA 2Y06H 2CRMA 3F12A 3FQNA 4HEPG 2P24A 5DJ2B 4BFJA 3NFNA 5B39B 3O9WB 3RVVD 3EFFA 2AXGB 4QRPB 3FBKA 1RIUL 1L4IA 1ZT1B 2CHXA 2O5XH 2VZTA 3CSYA 4UQ9A 4WW1A 2WA4A 3GRBA 1A65A 3CSXA 4MA8L 4ZW6A 2FR4B 3FSVA 2B39A 2EIJB 4RMQA 1NMAL 1PY4A 2IBZY 5EFIB 1CFNB 2YPKB 1C12A 1D6EA 1NVPD 2A9NH 4A7GF 4ZXBC 1AXIB 2ZDIA 4X4YA 1R5WA 4ZMPA 3MRIB 1XR8B 3IS1X 4LL9A 5C08E 3WD5H 2AGAA 3NGBB 3GJFB 5TDOB 4FL4B 1CFBA 5DQJA 1EEYB 2N1KA 5TD4A 2A9ML 1EXGA 2KPWA 4IRJB 2HLFD 2P80A 4L3EE 3DETD 1KTRL 1QASA 5GGTH 3RNKB 4I1NB 5DQ9B 5HJGA 4FG2A 1WA1X 1AZCA 3CFNA 4PS8A 3VW3L 1HL5A 1NCJA 3DUUA 5FUOL 1WA2X 3TTYA 1HL4A 4WWOA 3UBFA 1BBJB 2GTZA 2VQTA 2H26B 5GRUL 2RFXB 2XAJA 4QOKA 3UO8B 1BM3H 2CNZA 1Q7YW 4X64B 4WY7L 3EDFA 2BY2A 3P02A 3WI9A 1HH9B 2WW8A 5HJBA 4MJIE 4YXWG 1RJZB 2HA1A 1FVEB 4HLZG 3W7SA 1P1ZB 1A4KB 2MQCA 4FZ8L 4O2CB 4N90D 5DRZA 5TDPB 3RAJL 4FI7A 2YMXL 4B7EA 1TMQA 1BAGA 4V33A 2AFNA 4Q52A 3LEXB 3OKLA 1I8LA 4YWGH 5JQIB 5SWZB 1IB5A 2ZWZA 2NNFA 1RKRA 1V3MA 4NQSA 2MCPL 1YEKH 3N40F 4G59C 1IAIM 1QP1A 5DWPA 4ZMTA 1SLXA 5FA3B 2GPZA 1FC1A 4JGNA 5BRZB 1SM3H 4NO5B 1UT1A 2MPAH 5IB5A 2D3VA 3LPFA 4PIRF 5AKSA 4MJJA 4ZI7B 2YZ8A 4ONGL 5KSUA 1FV1B 4Y16C 1MRFH 4MCZB 3W82A 4AHCA 3HC3H 3KCXA 5LP6B 5DO2D 3C5ZA 4Z0XB 1S7TB 3FB5C 4N20A 4KPHL 2R59A 4NPJA 1XH0A 3T1FA 1QSEA 1TJMA 3OT7A 1T21A 1A7QH 4OIBA 2PTUA 5JOEA 1HDMA 4JB9L 4HUXB 2P6JA 3FQ2A 3ZHVA 2GTAA 2B4CC 1JPST 2G5BB 4N0CC 3AWEA 4J3XA 4ZNEA 4MA3B 4RMSA 4JJOA 4MMZB 4RGOL 5JOFB 3EOAA 5L4FA 3HG1D 5J1SC 3DTDA 3IBEA 5LNGA 2HX7A 5TPWL 2ADJA 1JHKH 2JV6A 5JMOC 3ZTCC 4U1GC 2D73A 3EIFA 4LF4O 1MAJA 1FN4B 2BS71 1IMHC 1HXYA 1WFNA 1NVPB 2JQZA 4UINH 3FTZA 4X6CB 3TZVA 4CKVX 1T1ZA 2KLSA 4YBLC 2GFBA 3BPLB 3IPEA 4KKZA 3V9FA 4HUUB 1OW0C 1IARB 1U8PA 3EJJX 4LQFH 3O2VL 3RB5A 3WXWL 5AENA 1N0LA 4GAFB 3OPZH 4EEEA 5JHLH 2X5PA 5ITBL 5KSAC 3O0LA 4KU1A 5A1AA 1OGSA 3OJ2C 1DVFB 5EMYA 5A7BA 3QXAB 2WGNB 2DWSA 3ZRWB 1IC4L 1EAPA 3JT2A 2F93B 1NDGB 3WHE1 4H25A 1VFUA 3GMRB 3OJVC 2XZAL 2KHAA 3VI3E 3KDMB 4PGZA 2ILLA 3LH2L 1JR9A 1QPKA 3OAUL 4PJIA 2CDGA 2I32A 4I0PA 1UT2A 4LVHB 1Q72H 3IXAA 1WICA 3BZFA 4K5MA 4NAJA 4XN8A 1SXAA 4LWSA 1N7ML 2QKIB 4JZNB 5FB8B 5T3XH 2Q7YA 2C9UA 3GJEA 3X13A 2P80D 4QTHA 5INDB 4WZ9A 1OGAE 2PCFA 3S35X 3F5TA 1H3GA 4NPKA 4NBXB 2AJYH 1BYNA 3NEEA 5EOQL 1OGPA 4AMKL 2B59A 2DMBA 3CDCA 4DR6B 2R39A 5EBLA 2OZ4A 4ILDA 4KKPA 3JV4B 1LDPL 5L2KB 2LGQA 2HJLA 3D39B 4QOKD 5L7XL 5HFMA 3EH4B 4XCCL 4YVUA 5KTEL 1W8OA 3SPIA 2YUAA 1B3JA 5F9AC 4M5YL 2HHHO 1EO7A 3BN3B 1WT5A 5DEDA 3N44B 1CE1H 2QPUA 3HC2A 4E2OA 3FFCB 2NX5A 4F33B 4LF7O 1V9PA 2WD0A 2PPDA 1V05A 3NFPB 2WJ5A 3PIQA 2MQGA 2VQFB 4O2EA 1P4BL 2WXPA 2DOSA 4JZJC 4A2FA 5T1KA 4XC1H 4GP5B 4KRLB 5F89B 4NS0A 3MBED 2B15A 4FEIA 5KVDL 1HESA 3AU0A 3LS5L 3RIAK 4MJ4A 3ARGA 4AW7A 4GSQA 5EEXA 3TPUA 1LO0H 3D85D 3SKNB 1BF8A 4ZD3L 3GTVA 2Z0AA 5JHDE 1CL7I 2YAFA 3STLB 3BAIA 3RPBA 3CAFA 4PJAE 5DMYA 4R26L 4OM0H 3GFUA 3OM3B 2CKBB 4EIBA 1KIQA 2BSBA 1AR1C 1G4MA 4UV7L 3C5ZD 4LOUC 4BRJA 5CEZE 3V0EA 4Q0XH 5B22A 1JOYA 2ZXDA 5C0BA 1GZQA 3CU7A 1OHZA 3CQFA 5L9DL 4GQQA 4N2KA 4YSTA 3H8NA 3QFDB 3BESR 4GBXB 2AJVL 2WXLA 2WSSG 1LR1A 5J12C 1MFUA 3TNMA 1OJHA 3TFBA 5GGRB 4YDJA 2GABA 2IO5A 1QW9A 3L9BA 4FZEH 1R3KA 1ZTEA 1JF1A 2X9ZA 3JWNH 3RY5A 1KLFB 3BDYH 3C6LD 4XCFH 3TZVD 4Y8AA 1QLEL 4HIHB 3MUZ1 1DANT 1GRWA 1S72V 2I85A 1UACH 2E47A 3Q3GB 3EXLA 4IJTA 4J3VA 2XV3A 2VM3A 3F05A 1GM7A 4KUMA 5AYTA 3QJSB 4LMQE 3STBA 2XUMA 2NY2C 2OMWB 4UAHA 2AABH 3LPWA 2XPGB 4G3YL 4ZS6D 4F7TA 2WPDG 3R65A 1N6VA 4M3HA 5DMGD 3VSVA 3IJYA 2EC9T 4HOWA 1GN2A 2GIXA 1IBDA 2J6EL 3M88A 5F0LB 2ZD0A 1YY9D 3P54A 5DQDH 5HGHA 1ACCA 2FGZA 4XC3L 3U6XA 1YITV 4P8QA 1HHIB 4KJPC 32C2B 5EC1B 3F7VB 4XTRC 4XBPA 5G55A 4IOIA 1KIUA 4PGEA 2BCMA 4JFZH 3VFPA 3H9VA 1TVHA 4MXQC 4ODSH 4U1MB 5DJXB 2JJVA 4G83A 4ZX5A 1IC7L 4GO9A 3RDTC 3T0VA 1QHPA 3RHWF 1MFAL 3FD9A 1KJ2B 5F1KC 5EN3A 5KBDA 1XF3B 1XUQA 5GGTL 4JNXA 4ISVB 3S3DB 3BH8A 3KPRB 5HI3D 3T0BA 4BUQA 5C0FA 2WKOA 2A6IA 1HZHL 3F58L 1OTTC 4ZK8A 3MBEB 1M9SA 1SKVA 2PZSA 4ZUUA 3K59A 1RY7B 4IEFB 5E1GA 2X10A 4KK9D 4UXNA 3LEVL 4PR5A 3D85B 5IB2B 3NSCA 3E9TA 4ZMLA 3L95B 1MFEL 1T1XB 3CQQA 4C83B 3RL1B 5CN0A 1MHPH 1VPOH 3RWJA 1U3YA 4M6NH 4F7MA 2YK1H 5LGUA 4U7SA 4MLIA 5JUEL 1ZANL 5BUPA 1SQFA 3FCSB 2OL3H 5DJ6B 2NX5D 3TCXA 2DYSC 1SDYA 3VWKC 5ID1A 3I6KA 4MJ2A 4XHJD 3HRPA 4U0RC 4FMKA 4BGDA 2XACC 1HIMH 1MHHA 4ODXB 3UTQA 2AQ3A 5T1KD 1CS6A 3MV8E 3MRJA 2KQMA 1CIUA 2CNYA 2WQVA 3CDZA 5C0RL 1UGNA 1UPGA 4YJ3A 2QTOA 3EGSB 3WIFB 3ARGD 1L6PA 3B77A 4AIEA 4O2AA 4DEWA 5D1QC 5EZLA 1F2XK 2J1WA 2F74A 3CMGA 2E8YA 3FXIC 5ANMA 3PCYA 1ZWIC 3FT3B 4AY0A 4CMMB 3KNBA 4HJ0D 5BZDA 3S8FB 4LPTA 3SO3C 1XXDC 3HC0A 6PAZA 2FX9L 1MRFL 3T04D 5EZYB 3TBYB 3C6LB 1EJOL 3OAAG 3C6SB 4AOFA 4F7EB 2MWCA 3ECBA 5C0BD 3GIVB 2WYTA 1EHXA 1NICA 3HEIB 3WTUA 1CWVA 4RISL 4F6RB 3IDJB 2G9KA 2VR8A 4ZFZA 1BVLB 4EQ2A 5L3FA 2YA0A 1RZIA 3JVGA 3GSUB 2IGTA 3K08A 4TRPH 4XMVA 4M6OH 4OCSH 4EDWH 4U1IB 3JAWB 4JO8A 5F7LB 3O3DB 2K4AA 1NJ9A 4YLBA 5GGRY 1IEAA 3US9A 1XBLA 3OE7G 5TF1L 3FULA 5LDSA 2Q7AA 3WB1A 1BFOA 2CO2A 2AAAA 1LO5B 3IDGA 5TF0A 4AYGA 4CL7A 4FKHA 5J2UB 1WAPA 1ZEAH 2YQ3A 3C60D 4BW9A 1UOVA 5CD5C 2JCCB 3R18A 3ULVD 3X1NA 2D31A 4LDEB 2WINA 2AEPL 1W6LA 4JKMA 4E41E 2Y24A 4AWJC 3BVDB 1CGUA 2EIKC 4FLWA 3NK4A 3MLYH 4JHZA 2FD6L 1OPOA 2QFRA 3ESNA 4KOCA 4ZRGA 1FRGL 3NIDF 4Z78A 2VDKB 4X8AA 2ETNA 5GS1C 3ABLB 3FO9B 3ULUE 3O2DA 2EE0A 2HG5A 3E3QC 1VKXB 3L5JA 5DRNA 4EF3A 4L4TE 1MFVA 3EFOB 4ZMXA 3ARRA 5JOPE 2FYUH 3EHBD 3BPNC 4P23A 2AK4B 4XX5A 4Z76A 5DD3H 3B2VH 1O7DE 3CLFH 5G5DB 4YHYB 35C8H 2JE8A 3GSQA 2A9DA 4XVSL 4O4YL 1E9QA 1WBZB 1I7ZA 3P9WB 3S7GA 3VYNA 4PJXF 5HFLA 1A1MB 1N10A 4HETA 5FFGA 4AJYV 5ESVA 4J39A 1A3ZA 2ZCZA 5JJJB 4LF7B 4YPGB 5IHHA 4JI6O 5HHOE 2JKXA 3PJSB 3SR2C 4JAMB 3A6CL 1FO0H 4XNAA 4X42A 2EJ1A 2XHNA 2BZDA 1EJ8A 2IADB 2IANE 2VDMB 5D5QA 4NENB 3WEXB 1BQHA 2MOQA 2P5PA 2Y0SA 4XGZB 4S0TD 4G8EB 4NXMO 1K3ZA 1MJ7H 1INEL 2ZQKA 3UX9B 2B0SH 3TCTA 2MNWA 5EPMA 2YEVA 1UXMA 2HUEA 3MRFA 3PXLA 1CXZB 1HP8A 1J88A 4WIQA 4UVAA 4MNGE 1B6UA 2BSRA 1YEHL 2IXQB 2Q6WB 1JNJA 2VDLB 4KHPO 1YJDH 4PGDB 1NH6A 3WTWA 4H5SA 1JZ7A 2YSTA 4E9SA 1M7DA 1N0XH 2XA3A 2CIIA 1MI5B 2X89A 3O4LB 1MG1A 2WZ0A 2DTMH 3QIUD 1GIGH 1B0GB 1P5UA 4KDWA 4NFBA 2Q3XA 2HP8A 4NM8H 2X88A 4PRPB 3B5HA 2CGRL 3LZRA 3HLKA 5E8EB 1TFPA 3QNYB 5EO9B 5IOPB 2F68X 5AVTB 4LC1A 1NCAH 3QW9A 3LTVA 1ITBB 2AEWA 3MCLH 3O8XC 3VVWA 2XAQA 1A6PA 3FU5A 1EFXB 4HWZB 2VTFA 3MRLB 3MRPB 3EBHA 5IROC 4R4BA 2FRGP 4HDIB 3GS4A 4YC2C 1FVDB 3ESVF 5I73C 1G84A 1RMFH 3BX7C 2JK5B 5GTHZ 1RU9H 3C60B 1LP9A 2GG1A 5ACLA 2J8UA 1FFQA 5A2FA 1QVOB 5F6HJ 1EMTL 2BSEA 1JCVA 1ZA3B 2XWBA 4Q0XL 3IFPB 3DO3A 4JYYA 4XNZC 3D7PA 3K72A 4HG4J 4DV0O 4DKFH 5FO2A 1XIWA 1EWHA 3C08L 4ZSOA 4BWWA 2EDNA 2JJTC 4AVJA 1NMBL 2IM9A 4Y4FC 5FCUH 1P4LA 4JO5A 4PJGB 3JASA 4PBDA 3V6FB 4C4BA 3TA3B 4HNAA 1RPUA 4AYID 1U92A 2DLEA 2W5PA 2FHBA 3QJZA 3V6ZA 3Q0HA 1Y18B 3A67H 3AK2A 2VDOL 4M7KH 5D5MA 3UTPD 3MA7A 4NR1A 1FFOB 3CZNA 1ACZA 3H7LA 4I0PC 4JCWA 2C9AA 4U6HA 3CHSA 3MZGB 4MNQB 4H0LB 1UUSA 2IFFL 3HG0A 4LGSB 1LE9A 1XSOA 1HEZB 3P4NA 1HHHA 1GGBL 2R1WA 2YLHA 2CUAA 4PB0H 2I07A 4BZYA 5GGVH 3V5HB 1YXBA 5EZPA 1WJ3A 3NOIA 1KT2B 1XHHA 1IIKA 4NVPA 2AABL 3BVXA 4L1TA 5AW2B 1TSRA 5BZWA 2ORBL 5KBNC 4W70A 5CLWA 4FNRA 4JG0H 3MFGB 3FQ4A 4JK0D 1UXWB 4I18C 2HCZX 3QJUB 4BELD 1MLCB 2LABA 1B6DA 3AMLA 2ENPA 3N41F 4MAYC 5I16A 3CFTA 1DFXA 2IAMA 5GGUB 1AHWA 3EYUL 4Y5YB 3D33A 1TAEA 3QUZA 2F08A 4ODSL 1BEXA 4MKMA 2ICEB 4MVBC 1NPJA 1ZT7A 4Z95H 4PJ9A 1DBKL 1D5ZA 2VN3A 1BZ9B 2W8CA 3BGFC 4KI1A 2ADIA 4QRSB 4WU7B 2HMIC 4OKDA 2FIKB 3VBBA 3QIUB 3B9KA 2OMTA 4D7TA 5E99L 1CXHA 3DGDA 3KYNB 2K8QA 2DQUH 1IGML 3UP6A 4I88A 2GV9A 1XGRB 4PP1C 3ZYJA 4BFGA 4X20A 3O2DL 4R7LA 4BE5A 1FNSH 2VKWA 2VJXA 4HKJA 3C75A 4LIQL 2P5WA 3UMTA 2ZE0A 4NXNO 1G7JA 2HKAA 4AZ8B 3LKPB 1PG7H 4U33A 1JXFA 2E74C 4S0HA 1HW7A 4X98B 1X7QA 1XB6A 4NM4H 5DHMC 4APQC 3CGTA 3OKYA 3L3HA 2ICCA 3PXHA 3NDYE 4U1NA 2HKOA 3BHBB 1I94O 4OI7A 1NFIA 3UGUA 2OL3L 3GNML 3GMOA 3IGUA 4AUUA 3GYRA 1AVMA 4YPJA 2X89D 4OI9A 3MMEA 4M43H 4ABVA 3X14A 1G7MB 4JFSA 4R7NA 4CC0A 1Z66A 4MJ6B 1H3WM 1QA9A 3DMMB 3OMNB 1BJMA 1QWHA 1I0HA 3H2PA 4S1SL 3W0WB 4WWKC 2PYFB 1Q81W 4HSCX 2CGOA 4OLYH 3EJZD 2Y6SD 5AOZA 1IO4C 1EO8L 3Q4HA 2ROXA 3ISRA 2Z1KA 4IU2A 2X0VA 2YUZA 2ZOLB 1NFKA 4I77H 2WCSA 2CO1A 4KVNH 4QPEA 1UD4A 1T1WA 4NOBA 5F1SA 3BAYA 3BFRA 3FB8A 3GJFK 2N05A 1BIIA 4XP5H 1OSYA 1V8HA 3VH8B 3O9OA 5D6DA 3TJHC 1XGTA 3AROA 3FDWA 4KVPA 3MYJA 4D3CL 3VD4A 1RIVL 4JG1H 3V9CA 1XIWD 4L3AA 4K7PX 1IBFA 1T5WA 3P4MB 1FGNL 1J5DA 1HN1A 1HJBC 1TQCB 2VRZA 1VGEH 2K6ZA 1SXSA 2GAZA 3SDAC 1EGJA 3B9AA 5JDSA 2HP4A 3HNSH 2ITEA 3CCRV 4YNYB 1FBIL 3ARZA 5CEXB 2AHIA 4PWIA 1F6FB 3D07A 3BP5B 1M6UA 4H13B 1G7PA 1MJ8H 2CLVA 2R4SH 4HEPA 4LHJB 1I7RA 4LF3B 2ZT9C 4XN1A 2APWA 1J8RA 4WUUA 2DKMA 2BWQA 4NNYA 5T33H 3G08B 4IW4C 3VI3F 3DV6A 1SBSH 1PD6A 3A6BL 3ZZLA 1MRCH 4XPAL 1FORH 2EIDA 3DVIA 4HSAC 3UERA 4MQSB 1LE5B 3WS6A 4JI6B 5B1JA 3CZFA 5B1KA 4JPSA 3X1GA 1VACB 2WQAA 4R4NC 2EDHA 4LDCA 4PGCA 3HCVB 1JUFA 4AG4H 3S4SB 5I1DA 5EO1B 4YVNA 2X2JA 5AVRB 1KTDB 1IV8A 2OLDA 1C8PA 4IBWA 1HILA 4NXMB 1SMOA 4AYMC 2EDBA 5DRWB 5DJDA 2IAMD 3S96B 3ZO9A 3CLFL 3S34L 1A7NL 2W9LA 5SWSA 3QUZD 1ZTXL 4UCRA 2XXMB 3AACA 4Q6KA 4UB6Z 3IJEB 2VS0A 3QPXL 4HT1H 3I3EA 5AVUB 4KHPB 1NINA 2OS7A 1HNZO 4PJ9D 5GISL 3CCHB 3GGWA 3IFOA 4G43B 5FHAH 2DQGH 5HVWA 4WCEV 5J1AA 1XWVA 3RWHA 5K59E 2DWEC 2NY4C 1U42A 5I6KA 3CC7V 6CGTA 3CHQA 4DP5X 4HXBH 4YMPA 2XFXB 3TURA 3P0YL 3HHRB 5BNXD 4OZGE 3QEQA 4XMLL 2FLRT 1E28A 3U4BL 5GRVK 1H6TA 2B0SL 3Q1SH 2EKJA 5PCYA 2XWZA 3BPZA 1HCYA 3GDCA 5FM4A 1TCRB 1E8ZA 3GHEL 3S36L 1XQ8A 1YJDL 2WP3T 3JWNC 4FULA 5E6SB 4AGOA 3GINA 4B0MM 1N0XL 3KLQA 4KNSA 5IJ9B 3FT2A 2LFEA 3MJ6A 3ZVVA 5MI0B 1T6BX 3DIFB 4P04A 2VXVL 4FNLL 2MH4A 1OSZB 3RX8A 4LLVB 5L6YL 4DV0B 5LA6A 4NO2B 2ICWA 4TSBL 2XRAL 4PHXA 3IAGC 3SJVE 2ZUQB 5IBUB 2CPUA 1A5FH 2NYYC 5CEYA 1B06A 1I7TB 3AG4C 2JB5L 2GIYA 4MQXC 3K6DA 1NGQH 4Y19B 1IC5L 1JGVH 3SCMB 1VF6A 1ZHNA 4Z5RB 5I0XA 2DI9A 3U4EB 4WV1C 3LNEA 5KBMA 4N5UA 3VI4A 3BE1L 2N4IA 4B3TO 3BMVA 2C4XA 2JDIG 1H3TA 4L2YA 4DZ8A 5EU4A 3OR7A 5KX5B 4JFDA 3I9GH 3NPSC 2EZOA 2QL1A 4PS4L 5G4MA 2HFFB 2J1KA 4OSUH 1P4RA 2RNBA 4FXLA 4PDMA 4AIXA 1DHKA 2OR9H 3DSNA 3PABB 5DHXB 2ZUTA 1S7WA 4CW1B 3HZVB 5GW7A 5ESAA 1FG2A 4KV5E 5DI8B 3L4WA 2UY6A 5C0GA 5J9PA 2OJZH 1WP7A 1M71A 3SHSA 3ARFC 5FUCE 5BS0E 1YEJH 2CLZA 4QRBA 4KROB 3MV7B 2QVMA 1B4TA 2FO4B 4Y4KB 2LQRA 4P23C 4JYAO 4NQUA 3ALXA 1T7WA 1MHCB 2VGLM 5E8OA 4I50A 3FB6C 4WUUD 4C4KO 3HR5A 3MRCB 4FQJH 3T2MA 2ZTBA 5DEJA 1M7IA 2CPCA 4QHMA 4KMTH 2APBA 4KXZH 3CVCA 3U9UA 4GQ9H 2K6WA 1PPIA 2F8VA 3JARB 3A4EA 4KRNA 3TWYA 3T4ZA 1NAMH 1XNRB 2XBDA 4J6IA 1K5NB 5TQ0H 2LAGB 5IM7A 4U6YA 3CLEH 3EO1A 1RZJH 4C58B 4MKTA 5DEGB 2AKRA 2NY3C 3I75A 2XX0A 4LHQB 3BZEA 4NXNB 3POCA 2HSIA 4P4KD 5B1NA 1EANA 4Z7VE 2VOTA 3H9SA 4PJBE 1L6ZA 3MRKB 1QG3A 5M94B 4EI6A 1DBBH 2GBTA 3NMEA 5D9SB 5F7UA 4Y2DD 1I9IL 1I9JL 2OJEB 4Z95L 4G1MB 1I94B 3U1QA 3QYMA 5CA1B 2ZSWB 2LT9A 4CSSA 1N4CA 3CFUA 2FECL 3F00A 4P9OA 1GMEA 4BKLB 1L9QA 4JL2A 4UTCA 1P5UC 4BXSV 3ZHFA 4K0OA 3O6KH 3ROLA 2R0WL 1OAKL 2I26N 2FB4H 3L81A 5LHIA 1FNSL 2PUQT 4GG6A 4QRPE 1IAOA