4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
3SCGA 4KWJA 3R6SA 1YUDA 4LUMA 3G7DA 2P17A 2ZCWA 2BNNA 3BB6A 1O3SA 4QXKA 3MDPA 3I59A 5K8SA 3L2HA 3SCFA 3SCHA 1CAXB 4IEWA 2IXLA 1L3JA 1DGWA 1NXMA 4XFIA 1CAWA 2XL9A 3D0SA 2MNGA 1J3QA 4I2OA 3CL1A 2Q0AA 3NL1A 2XKPA 4KU7A 1J3PA 3SXWA 4O9EA 4EWEA 4IERA 4YYOA 4LA2A 4IEYA 1RC6A 3H1MA 2DCTA 2GC0A 4YSFA 4D7TA 3OCPA 1O7FA 1CAUA 3IDBB 3PVBB 1QY4A 1X7NA 1VR3A 1PM7A 3S7IA 3DKWA 4AVCA 4Q0VA 3E97A 2IC1A 4Q29A 2QDRA 3EHKA 4Q0PA 1XE8A 3E5XA 4META 3OGJA 2UYAA 2UYBA 1ZRFA 5FQ0B 4A2UA 4PIXA 5C8WA 4PJYA 3CLPA 3FHIB 2ET7A 1ZVFA 1O3RA 1EPZA 5FCCA 4FT8A 1XRUA 3U0ZA 4I09A 3H3UA 4F8AA 1OI6A 1ZZ8A 4IEPA 3I7DA 2PA7A 2GH2A 1EYBA 4XF1A 1NZCA 3FZ3A 1YLLA 1NYWA 2GU9A 1EY2A 3E6BA 2XL7A 4Z07A 1X8EA 2GC2A 3CF6E 3HT2A 2QNKA 2IXKA 2PQQA 4KWKA 4QGMA 1PMIA 3EQEA 2GC3A 2BGCA 3RYPA 1IPJA 1YWKA 3DV8A 5CADA 1LB2A 2BNOA 3H9AA 2OZJA 2IXHA 3WW1A 3ES1A 4E2SA 1Q3EA 1J3RA 2Q4SA 5BUVA 4ONUA 5I0TA 4KL1A 4I0AA 3H3ZA 5I91A 1EP0A 2CGPA 1OD5A 3C3VA 4IEQA 5I8YA 2ZKLA 2E9QA 5CVRA 1Y3TA 4O9GA 3H8UA 1O3TA 1DZTA 3MZHA 4MH0E 4MUVA 4WBBA 1J58A 1I5ZA 1ZZBA 3LWCA 4AVAA 3H7JA 1RL3A 3WW2A 5JAXA 3QACA 1ZZCA 1X8MA 4Z82A 3DN7A 3ZDSA 4EV0A 4ZU7A 5CU1A 1Y9QA 3EJKA 4HVOA 5KHJA 1VP6A 1QWRA 4LA3A 2KXLA 1NE4A 1UCXA 4AQ2A 2IXJA 4L2NA 5HI0A 2EAAA 1DZRA 4EROA 4HZFA 4QGLA 4XFBA 3LOIA 2Z2SB 1XE7A 3FX3A 3USSA 4CYDA 2XGXA 4MX3A 1ZZ7A 2QJVA 2FQPA 4IETA 5C6CA 2N7GA 1YHFA 3HIFA 1RTVA 3NSTA 5FPXA 4LEJA 4QMAA 4BYYA 5FLHA 3SHRA 3E5QA 1CAVA 2F4PA 3RYRA 2PFWA 3RDIA 4XFFA 3GBFA 1WA4A 3KMHA 4FAHA 4LULA 5J7MA 2ETEA 2XLGA 3OTFA 3BALA 4YARA 4XFCA 4BHPA 4IEOA 1OFNA 1CX4A 5FPZA 1LR5A 5FLJA 3NJZA 3BCWA 3LA7A 2XKOA 5EFUA 2PYTA 5AVPA 3D82A 3NW4A 4I3PA 4WZCA 3VHRA 2WC2A 2PAEA 4XF3A 4WVZA 1FXZA 3IIAA 3FJSA 1JUHA 2EA7A 4D7SA 3JZVA 3LZZA 1O4TA 3NKTA 5E16A 5D1IA 3FFQA 4JTNA 3O14A 2Z69A 5I0UA 5KHGA 1GQGA 1ZREA 1GQHA 4N9IA 1RUNA 3H7YA 4LUKA 2XLFA 2H6BA 4MGYE 3IWZA 4MGIE 5JR7B 4XETA 4P9GA 4Q0SA 4DINB 1ZZ6A 2PHLA 5JSOA 4JV4A 3I59B 2GZWA 4ZU5A 4K8FA 3HQXA 3S7EA 1UIJA 3IBMA 4RD7A 1FI2A 1CAWB 3PLQA 1DGRA 3RYKA 2Q30A 1RUOA 2D5FA 1LRHA 4H7LA 4AXOA 3HT1A 5FDBA 3U10A 3EBRA 1CAXA 4QX5A 2ATFA 1J1LA 1O5LA 1RGSA 3BPZA 2B5HA 5BV6A 2CV6A 4MZUA 4UBHA 2VQAA 2Y0OA 4HN1A 5I93A 1CAUB 2XLAA 4X6RB 5J48A 1ZNPA 3D0JA 3LAGA 3EO6A 2QCSB 3N4MA 1WLTA 4ORFA 1G6NA 2I45A 2FMYA 5LRRA 4YRDA 4EWDA 1H1IA 1ZZ9A 4YNIA 4FAGA 3ROUA 3FE5A 5LEKA 4I02A 4AQ6A 5LEJA 3CO2A 4L11A 2MPFA 3RZZA 4E2GA 3PNAA 4F7ZA 5FQ0A 5JSRA 3KGLA 4J1WA 3ST7A 4R8HA 5J3UA 3DL3A 3KSCA 2H0VA 2IXIA 2PTMA 5E1RA 1UD1A 4EWAA 2K9ZA 1UW8A 4XF9A 4HBNA 1NE6A 4IEVA 2HKXA 3M70A 3KGZA 4PIYA 4KWLA 5LRSA 1OMIA 1ZRRA 4XFAA 1ZRCA 1X82A 3FWEA 1UIKA 2GC1A 2OPKA 3WW3A 1J59A 4IESA 3KCCA 5KHKA 1HW5A 3ELNA 3LA2A 1SEFA 2MHFA 4IEZA 4XF0A 2BEOA 4UBGA 2B9UA 4N9HA 3S0MA 3NVCA 5FLIA 4B29A 1V70A 1U12A 2EVXA 3BU7A 4HMZA 1YFXA 4J1XA 3TNPB 3E6DA 5BY5A 2VECA 2OYZA 3QOPA 4Q0UA 1FT9A 2ET1A 1H1MA 3UKTA 3E5UA 5KHHA 1YFYA 4OFGA 4XF4A 2B8MA 3CJXA 4Q0QA 4E2QA 2H6CA 4MV2A 4PIZA 4XFHA 2Q1ZB 2PHDA 4GULA 4X6QB 3CEWA 3E6CC 4QM9A 2BYVE 4LTAA 4HSJA 2VPVA 1IPKA 5I0SA 3H1YA 3LA3A 4I0BA 2D5HA 4HN0A 2XHKA 2D93A 1TQ5A 4UXAA 4IEUA 2OA2A 2D40A 3U11A 1VJ2A 3MPBA 2UY8A 3I54A 3UKVA 1LKNA 4XFGA 1CAVB 2GAUA 5F1RA 2PAKA 4AVBA 2UY9A 3H1WA 4MGKE 5BXXA 4TLFA 3H50A 3RNSA 3UKNA 1CGPA 1YFWA 5EZWA 1Q43A 1SQ4A 3ES4A 4QGNA 2HJIA 2QVSB 1I6XA 4LLOA 3RPQA 3IDCB 4NVPA 2V09A 4XEZA 2OZ6A 2BNMA 4HSLA 5I8TA 4OLLA 1ZRDA 3MYXA 4R52A 3OD0A 4KU8A 2C0ZA 1O5UA 4I01A 4MGZE 4JVAA 5KHIA 4ZU4A 4FBFA 3ACLA 4HVRA 5JCTA 3OF1A 4HVQA 3GYDA 5JSPA 4QM8A 5I0RA 5BPXA 3B02A 2CAVA 1ZX5A 2K0GA 3M3IA 2PAMA 5T3NA 5KBFA 4JTOA 2CAUA 3TNQA 1QXJA 1UPIA 3SMHA 2O8QA 2O1QA 1YFUA 4IEXA 3WW4A 1WGPA 4HLTA 3ETQA 1Q5OA 4BH9A 5I8SA 2IXCA 1SFNA 1QXRA 2WFPA 4BIFA 1O3QA
chains in the Genus database with same CATH superfamily
3SJCC 2WT0A 3T2TA 3MDSA 3CD6V 3KT7A 2XJRA 2JE9A 1GN2A 4N53A 4CH4A 2IU3A 3FB7C 2MNGA 3TJTA 1AHSA 1I1EA 4YG0A 4LBQD 4Y1ZA 2A9HA 1G9DA 3JD71 4JI7O 4IEYA 5IWAB 2NZ9A 2DCTA 2IJKA 1O7FA 3IDBB 1RM1B 3NKGA 3PVBB 3O1SA 4XBNA 1QNMA 1W05A 3THTA 2YC0A 1K5JA 4RHV1 2VR4A 2LO1A 1SPPA 4ZONA 2J7MA 1SA0B 3ZN6B 4LIVA 4LNUA 3WG7B 4DXZA 3LQCA 5EXOA 4JKKA 1MVQA 2XASA 2X29A 1FPN2 4NRPA 2R061 1XRUA 4UW3A 1MS9A 4JGZB 1RUF2 5FZ8A 2HLEA 2BOBC 4OHZA 2N04A 4MW3A 2HH9A 2Q73A 4QX8A 5FP8A 2RDQA 5CADA 2GC3A 1LB2A 4G2KA 4GT1A 2WZR3 1GOFA 5LK5A 2BVBA 2JDAA 3VBOB 3OYWA 4R7CA 1YNAA 2WO7A 4MTOA 3GCWA 3IB3A 4E2SA 1H2MA 4KL1A 3B8MA 3OPTA 4RUEA 2AHZA 3H3ZA 5F3EA 3VQYA 1M90W 2OKXA 1A34A 3T08A 1FXVA 1Y3TA 1DZTA 2P37A 2V4DA 3OJBA 3ECQA 1ST8A 2G9ZA 3U78A 4WBNB 4NMIA 2YBSA 2OIGA 1IBKO 3JU9A 3J8F2 3G6EV 4KGQA 1ENRA 3IGAC 4L2NA 3NAPB 2Z2SB 1D4M1 1KFXL 4UCVA 1VRH3 3POYA 1PO22 5FPXA 3CRRA 4RL7A 2G1MA 2F23A 4NPMA 3VBSA 4J7ZA 4UWDA 3RYRA 1JW6A 1XC6A 4FVMA 3M3OA 3GBFA 4OMDA 1VF7A 4A7KA 1FXKA 3NWKA 4A7YA 4YARA 3PJSK 3MLLA 5IJRA 4E4SA 4MG2A 5EFUA 2ZE8A 2VCCA 3KVAA 2ITDC 2DF7A 1IGOA 4JI7B 4CP1A 2F66C 1C57A 2ZMNA 2EA7A 4CCOA 4D7SA 3AG3C 5E16A 1JUIA 2ADDA 1KB9F 3J7AU 1L7LA 1G8WA 1W8WA 4PLNA 2A7AA 3WCRA 3K06A 4FM0A 5J37A 2OUHA 3JAWB 2XBO3 2Y48A 2QZ2A 1QLEB 2RS52 4LBMA 1WN7A 2X10A 5JR2A 5LHHA 2L6LA 4PDVA 3VBFC 2JGDB 3C8XA 3POEA 5EHDA 4ISRA 1NBMG 1J1LA 5JJEB 1Z5WA 3Q8CA 4H3WA 4BE3A 3INAA 2K9PA 4PQQA 1OXCA 4MZUA 2VQAA 3S5AA 3OUFA 1RUI2 3G6JB 1WLTA 1GUIA 1LODA 2FMYA 4CH5A 4W4LA 2P4VA 2R1BA 2BTQB 3G80A 5JI7A 5CFCA 1JZ6A 1PO21 1BXHA 3A8TA 3CO2A 4Q8LA 3JXSA 4NUBA 4HFSA 1NLSA 4S2GA 4I0XA 2VGDA 3KGLA 4J1WA 1SFYA 5LHIA 3ABMB 1BL8A 3ON7A 1IBKB 4CU9A 2R32A 3ABLC 4XYXA 5JOYA 1OA2A 1W0OA 2EJRA 1H2SB 2EXHA 2K9ZA 1H1AA 3WOGA 1W0NA 1WP7A 2HKOA 2PQSA 1G9BA 2XMLA 3M70A 2GTAA 1VB4A 3ZPYA 1JS9A 3T1CA 1GOGA 2BEOA 4M4PA 2WN2A 4AFAA 1MS8A 3N9NA 4B29A 3JD0A 1KDMA 2NMNA 1YFXA 1W6OB 4ZBMA 1GMMA 2RS51 2B8MA 3CJXA 2JS5A 4EE2A 4LITA 3E6CC 4LPLA 4PDMA 1JYTA 4TYSA 4Q8KA 3QNEA 1AXYA 1NS1A 1NVPB 3AVSA 3MPBA 1RUI1 2HWE2 4XFGA 1M5IA 2GUZA 4UYBA 3T0BA 3RI9A 3ALQA 5J1XA 3LOBA 4AVVA 5EZWA 1ODNA 4PDWA 5CBHA 3W20A 4IQPA 3L72H 5FZKA 5H9QA 3RZMA 5B1BB 4URAA 3Q8BA 4HKOA 1ZA7A 1KITA 3WX5A 3RGBA 2CAUA 5H9SA 4F6RB 1ORQC 1YFUA 3L75H 2GDFA 5LGUA 3RYFA 3FX7A 4CTEA 2MK3A 1E57A 4GD4A 4AAPA 1LUWA 1LHUA 4P30A 2O57A 1CAXB 3ATGA 1L3JA 1NXMA 3QCWA 4XJ9A 5JH7B 3AK2A 1W8TA 3H8OA 4GH4B 2XXZA 5IVYA 2A3YA 4KU7A 4O9EA 1QDCA 1B09A 1DGRN 3LSEA 2ZHNA 3LGRA 2ORXA 2BBVA 1YTFD 4YVWB 4Q27A 3FAVA 1P4RA 1JU3A 5AC92 2NYYA 3IAQA 1OVSA 3FHIB 2HBTA 4MXWB 3JD1A 1QOOA 1ZZ8A 1HJFA 1NZCA 3SITA 1CEZA 1X8EA 4AK3A 5BR8B 4SBVA 3WQ1A 1G1XB 1N3QA 2BGCA 3M1HA 1DG6A 5FOJB 2YXHA 1H6XA 1LEMA 1VQ4V 1BS3A 5LK7B 5DG1A 2Q4SA 4BLJA 1ZX3A 3ILRA 4XAEA 4EZ4A 1JOYA 3WU2Z 3CJIA 1NQDA 3T1LA 3AVRA 5GTHZ 4LF8O 4O9GA 1O3TA 3URFA 2WJSA 3UL2A 3WHTA 3ZOIA 4AVAA 1JMKC 4DR7O 2WNUA 2LJ2A 4LBQA 1QQP3 4HVOA 4IYHA 1VP6A 1P7GA 1NE4A 4AOCA 2JWPA 2EAAA 2VCAA 4HNAB 5J96B 4FVVA 2XGXA 2QDNA 1VRH2 3C7HA 1SRYA 3DC6A 4KQ7A 3ZXKA 3IIIA 5FOBB 4CEYB 3C7GA 1DF4A 3SHRA 2HJDA 3FUOA 2F4PA 5FMOL 2P3IA 1F51A 3DUIA 2VZUA 5AC91 2YXLA 4JRLA 1FYUA 1UPSA 2VMIA 3FHAA 3ZXFA 2VZ3A 5FZCA 1HQNA 4FAHA 4L8QA 2F6BA 4Y5TA 3C7EA 3HQUA 2WYSA 1ZAUA 2N74A 1TAEA 3O0VA 5CYYA 3ZXLA 3RQ0A 5LYJA 5FKCA 2BWAA 1LHNA 2JECA 1JUHA 3K57A 1CVNA 3JZVA 2CAZC 4P9YA 5ABJA 2YDEA 5D1IA 1YCIA 1ZREA 5E8AA 3JBG3 4RGGA 1NH2D 1US3A 4AVSA 4B3SO 3ZFFA 1BT8A 3S6PA 3WNPA 5F37A 2XBO2 1W9TA 4EN0A 2KA3A 3I97A 1BLZA 3S7EA 4OX9O 1MG1A 1KEXA 3TCUA 3OMAB 1RM1C 1UL9A 4DR3O 5LBCA 2QJ1A 1A8MA 1EPWA 4JGYB 1MR5A 1W2BU 2A5ZA 4HXCA 3JAKB 3AMNA 2HWB2 5D5PA 3A0NA 4UBHA 3HN1A 1XL6A 5CNAA 2GNMA 2WPDG 2Q7GA 1S76D 1VRH1 4TSFG 2UXCO 4QJFB 3MHSC 5LMUO 1FOD3 4X8NA 1STMA 3FB8C 4LF8B 3WLUA 4XCBA 3VDAA 1X36A 1L0LH 1DQ2A 4OUMA 3OM3B 5FQ0A 4TV9A 4FFKA 3VBOC 3ST7A 4F6EA 1SACA 1XQ8A 4X64O 4EB6B 4RQFA 5C93A 5BNPB 3MD0A 1V54C 2CU5A 4XXPA 4YIPA 3EVKA 4GA9A 1NE6A 3CQOA 5EZYB 4CC6A 4XFAA 1ZRCA 1W6QA 1QH7A 3R05A 2ZXWB 2FKXA 3N2GA 1H6YA 2PHUA 2VZPA 3CSXA 4XBFA 3KCCA 5FV3A 3GZUC 5L7OB 4CP9A 4CUCA 1RXFA 4CU6A 4FPPA 5GLZA 4J6GA 3S0MA 3VKOA 3NAPC 5H9CA 3GVMA 4J80A 5CN0A 1NTKH 4FPFA 1AI7A 2XBO1 3B8NA 1CQ9A 4BQ2A 2WZ8A 1Q8VA 1BQ0A 3ZYRA 3VQVA 2JG8C 3JCUZ 3N9PA 4ET7A 3CEWA 2LTNA 1N8RW 2VOXA 2QE3A 4CS3A 2YPDA 2ZOEB 3AP6A 2XAHA 5L9BA 2Y60A 3B7MA 2FZ2A 3ASNB 2HWB1 1K12A 1SF9A 5IYZA 4HN0A 3CCQV 4I55A 1AJKA 2C2AA 5GJ6A 2CHHA 3HD8B 1FFXA 1OC1A 4B3SB 4AE2A 2LGWA 2RS13 2A6VA 4CU7A 4LFBB 2WLQA 4OX9B 4YZ3A 1MZ6A 1SDDB 3HPNA 2HJIA 3BODA 5K7PA 5FMBA 4DV5O 1H30A 4DR3B 5FZGA 1ZRDA 4M0HA 1K5MB 5F5CA 4I01A 1IDSA 3ZFGB 5KHIA 4UFIA 2W87A 3IZOA 4QGPA 1WA8B 5LP6A 1PIV2 2FCUA 2X05A 4WM7A 5I0RA 4R50A 2GN3A 3AL5A 4QU2A 3HKCA 1QLEC 3CMGA 3A0HZ 3POIA 2O8QA 4FLYA 3WR0A 3WW4A 1HR0O 2UXCB 4TOIA 4DR5O 1AI4A 5LMUB 1BBT2 2IXCA 1AJQA 2FB5A 4PLMA 1O3QA 3H1IH 4YM3A 1URFA 5LWBA 4DW0A 3O12A 4HETA 1I5XA 4LF5O 4Z92B 3I3MA 5F32A 4QE9A 1XNQO 2IXLA 1DGWA 1NUKA 4X64B 3SH4A 3ZMSA 3AMPA 2DCZA 4K8ZA 4K8RB 3NL1A 4XE9A 1R093 2QQIA 5CKNA 2VWJA 3H1JH 3CU7A 4BB3A 3OEAA 1VQKV 2K46A 5CA0A 4YSFA 2VOVA 1XNAA 1VR3A 3ASIA 3AP7A 3ABMC 2VMEA 5F6LB 3AYAA 4WF9V 2IC1A 2B7YA 1M56B 1X59A 3OGJA 2VS0A 5GONB 1J5EB 4AHYA 4CDXB 1PVC3 3ZM8A 2BOJA 3LEIA 5CA6A 4AI8A 1AI5A 2WA3A 1JYNA 1BZKA 3IC9A 1PPJH 2BERA 1VBD2 1NR7A 3R4UA 1XXNA 1DLLA 4K1YA 1Y9MA 3VL9A 1PIV1 1E1QG 1N1VA 2D3OW 1OKOA 4PA6A 1RSOA 5LW9A 3CX5F 3T4DA 1DHKB 2YBPA 1XNRO 5LXTB 2ARCA 5I8YA 1BBT1 1LUVA 1FXHA 3OOXA 4WBBA 4DV5B 2M6YA 1X8MA 5KLVH 1E5RA 1A32A 5FZFA 1Y9QA 4B4QA 4QPIA 1NI8A 3SGIA 2TUNA 2ARBA 2EINB 3SEPA 3CE2A 1DZRA 3ABKB 1PD3A 1S1AA 4HYOA 3N2KB 4Z8BA 3ASOC 3QO5A 1YHFA 1HR0B 4DR5B 4LEJA 5IWFA 5KXEA 3S57A 4XPVA 1TEIA 1GP5A 2ZEYA 1MEC2 4LF5B 5EBMC 1XNQB 3PU3A 1DCSA 2Z5UA 2IUWA 1AYN3 1O9GA 4QPGB 5FLJA 4O4IB 3LSUA 1I5PA 3IDEA 4NE9A 5E6HA 1VBD1 3P5BA 2ENRA 4XBLA 3B09A 2ZEZA 1OCCC 5A70A 3H7YA 1W6MB 4V2WA 4FI9A 2DQ0A 1ZA4A 3IWZA 4GH4C 4KMQA 1RJ7A 2Q1MA 1VQ8V 3I59B 4UF0A 4LR4A 3CB2A 1H2GA 2QFEA 5FYCA 1CAWB 2RR12 2WKKA 2Y6FA 1VQPV 1NLRA 3BAAA 4N7UA 2A6XA 4YVWC 3DXTA 3SKVA 4DUWA 4FOVA 3VZMA 1LEDA 5FZ6A 4A7ZA 3T2MA 1WZXA 5A32A 5IVVA 4K21A 1UMIA 5FYYA 3ZYHA 1YXWA 3D0JA 3AP9A 5C4WA 4BQXA 5LRRA 1J95A 4CCLA 1AI6A 3ZYFA 3VBUB 5J2TA 2E51A 1GFF2 1XNRB 5LL6Y 3TETA 2D6KA 5FUPA 3UGGA 3DXUA 3LIGA 4E2GA 3OUJA 4JPRA 3WDWA 1QF3A 1MEC1 1AJOA 1QVGU 5J3UA 3UO2A 3NNFA 4Q4X2 2WLIA 2QQKA 1MQTA 4YM2A 1CZVA 3MV01 1ZBA2 2QKDA 2J1AA 3USUA 1T6BX 4W4ZA 2HR3A 4ZXEA 1R1ZA 5H9RA 4IESA 3LA2A 1WJZA 4Y1YA 2Y0IA 5KXDA 3SPGA 4PI0A 3V0BA 1H8TA 3VGIA 4AFDA 4W6XA 2YGLA 3I55V 1V70A 4ZKIA 4CH6A 3HWJA 3GM8A 3TNPB 3E6DA 3QOPA 3RFRA 1P7BA 1H38A 3N9LA 3UT5B 2RR11 5FTTC 4CEWA 4XFHA 2IVJA 4CEYC 1IXMA 4YFZA 2EICA 5A6XA 4W65A 4DR6O 4ASKA 3F7VC 4I0BA 4LH7A 1LHVA 2D93A 2QWRB 1N32O 3CZJA 3R4SA 1VJ2A 3I54A 2C24A 1VAMA 5I0DA 1GR3A 4ASLA 2D6OX 2GSMB 4QQLA 1U5YA 2RS12 3RNSA 1OLRA 3ETDA 1FOD1 5B1AC 2JGUA 4CDUA 4AEDB 4CCKA 4UFZA 2V09A 3O9OA 4HONA 2NN8A 1OPMA 4IXLA 4JVAA 5EYPB 4ZU4A 1K5QA 4Q4X1 3VQXA 4GCZA 1TUBB 1XNBA 2XH6A 2CAVA 3UM7A 3P3NA 1ZBA1 3ME2A 1B35A 2ZD9A 3IN9A 5ANNA 2DYSB 4OULA 1G86A 1H2NA 4JGYC 4GALA 4B3TO 2OVUA 1XNTA 1BMV2 2WSUA 4YM0A 3WP4A 4JHTA 2XAJA 3ILFA 3L2HA 1LHWA 3KM5A 1RUC3 5BNNB 5K0UB 5IVCA 5CG9A 2AH2A 3DYMA 3LDEA 4U7OA 5FZ3A 4EWEA 4ATEA 4JKLA 2ZINA 5FYVA 4YYOA 1VBA2 1AYM3 3OEEG 3BEHA 5IFPA 3K59A 2YY1A 1RITA 4O4HA 1PM4A 2UUCO 2E75B 1NKDA 5EC2C 1BHBA 4Q0VA 1SETA 1KUQA 5BNPC 4CCEA 5EIYB 3W7WA 4DUXA 5IJ0A 3CLPA 2RS11 4JQRA 5FZ1A 4MVZA 2Q8OA 5CBGA 2Q1FA 2ZXWC 2HEPA 2GH2A 3W9AA 2ZKOA 2OT7A 4LOTA 1BCCH 1S0GA 5L7OC 4K3UA 3TOJA 1LGBA 4DR6B 3A7QA 3HT2A 5FREA 4PF1A 5BNOA 1TE1B 2OWOA 4M01A 4J25A 1N32B 3JD2A 3N35A 3ZHUA 1QQCA 3OB8A 4NHLA 4I7ZB 4GZ9A 4EN6B 2RS32 5L36A 2RM23 1BZWA 5JXJA 3H8UA 4NWWA 3ASNC 2Z79A 5B2GB 3ZHVA 3K9SA 2A3XA 3AX4A 5FYSA 1PNKA 2J1EA 1BMV1 4C1WA 1DK1A 4IHJA 1X9TA 4LO8A 2AEZA 4ARXA 4XVHA 2YEVA 3K48A 2WLMA 5KHJA 5JZGB 2VUCA 2GTSA 2PHFA 5LZ6A 1R091 2FMLA 1IQDC 1W2NA 3FX3A 2F1MA 4OHYA 4CYDA 1VBA1 1SQBH 2QJVA 1YYNA 2A6ZA 4IETA 2JDIG 3PDQA 3VHNA 5C7GA 3I2DA 4PBOA 5FR3A 3LSQA 1K5MC 5FLHA 1A6CA 2VTXA 3ZFGC 1R64A 2ADPA 2VW0A 2QQPA 5DPNA 4IYIA 1GZWA 1HRV3 4LULA 4B7EA 3BALA 4LIUA 1WCDJ 4AFMA 4QQOA 2JDUA 1W9WA 1W9FA 3LIHA 4TTGA 3QO7A 4AI0A 1RHI2 3SJBC 5FL7G 1YIFA 2CY6A 2UUCB 4LHKA 3O1PA 4FM1A 2ZXQA 2Y4TA 4JZGA 5DZEA 1T6GC 1JZ7A 4JV4A 4DOUA 2RS31 3FYIB 1LHOA 2EIMC 3RYKA 1RUOA 5EWSA 1LOEA 1SZTA 2D5FA 4QPJA 1OURA 1OQ1A 4ZI7B 2CE4A 4AR2A 5FY7A 5CEHA 4FP2A 3RYCA 2DJVA 4CDXC 2XLAA 4YW7A 1GN3A 3SYOA 1ZNPA 2EIJB 1QJEA 1ZL8A 3J26N 1SC5B 3C3SA 1PNLA 3FYEB 4YNIA 3ZJZA 1POQA 2UURA 3VBFA 3ACGA 2V4VA 5FBZA 2JS3A 5IYCO 1LJ7A 3L73H 3RG0A 3BVCA 2HWC3 4OVEA 5DUVA 5A7WB 2D43A 2I2SA 2P1BA 4AL9A 2LW7A 5IFTA 5BMVA 1UD1A 2RMU3 4AF9A 2ZGMA 4W6WA 3WF3A 4DV7O 5EPAA 2Q8DA 5F3GA 1MOFA 4I50A 3FWEA 4YFWA 2YC4A 4DUZO 3AKSA 3ZHTA 5FNVA 4IEZA 1VEWA 4AEKA 1COV2 2WBKA 2EINC 3PVEA 4JI6O 2E33A 3X29B 3WCSA 4YIOA 1L7QA 3VKLA 4LBKA 3VN4A 4U2AA 3L9DA 4C8DA 1UPGA 4E2QA 4MV2A 4ZS2A 3FL7A 5FZ7A 1N1TA 5IE9A 4RSUA 4A5UB 3V56A 2XR4A 1W6NA 2YS8A 2GAUA 4QPGC 3N36A 4LBOA 5KMGB 3AL6A 3CMEV 1PNFA 4XURA 5FMDA 2J1RA 4TQDA 4GX0A 3AB0A 3MIDA 1BE3H 1AP6A 5JPMB 4DRXB 4PJ0Z 4BZ4A 2ZHMA 2C0ZA 4XDJA 2HYXA 1Q81W 3ACLA 3MHZA 3L74H 4DXWA 4HVQA 1XI1A 3QBQA 4QM8A 3UGHA 4MHUA 1VQ5V 1QXJA 4YJ2A 1HN1A 5C8YB 4HLTA 2ZX0A 3HOBA 5L3FA 5I8SA 2EX3A 3G71V 4WFFA 3EB7A 3K58A 1B6QA 2P17A 2BNNA 3HBKA 1COV1 3SCFA 3JYCA 3RT3C 2KG7A 3AEIA 2Q67A 3MIGA 4P9PA 4R9CA 1V9PA 3VBUC 3IAPA 5FP4A 2XKPA 5EQUA 3C2UA 1I9RA 1AYM2 4DV7B 1VQOV 1DQ4A 3MPPG 4P00B 4DUZB 4UV8A 2XHNA 1PM7A 2WO3A 3S7IA 4Q29A 1NVPD 1T5EA 1SMVA 4IE6A 4JI6B 5D5QA 2ES3A 4YVSB 1UZ0A 2YB7A 4BQ4A 4B1MA 1ULCA 5LA6A 4ASUG 2QWPB 4YW2A 5FPLA 1NYWA 2JIJA 3PUQA 4DV6O 1N34O 3CF6E 5GZGA 4BJ0A 4QGMA 2QQMA 3EQEA 1G9FA 1IS4A 3ENRA 5JVDA 1ND2B 3FBYA 3HN3A 1TME2 3ACIA 5DUXA 1B04A 3KCXA 3T1HB 5I91A 3WNKA 4TWKA 2ZHLA 3VZKA 2B46X 5KWRA 1QJFA 4UFLA 5CVRA 5IDJA 1PNMA 3X2QB 2Y34A 5EIBD 2JIGA 1ZZBA 2XAGA 5FLXN 1L8DA 2PHTA 5IYDO 4RO2A 2CWSA 2ZMLA 4XDQA 5FPUA 3N9QA 2NNUA 4DR4O 1SESA 3NO8A 4H55A 2RHPA 1IOAA 1ALYA 4IE4A 3OBZA 3APQA 3LOIA 1WW4A 2YC2A 1KKDA 4YY3O 1HRI2 3W7XA 1AYM1 1ULOA 2QTSA 3ORJA 4AEDC 3K4ZA 1WD3A 5L9RA 1PNGA 2E6VA 1IKPA 1CJDA 3GDBA 2NN4A 2Q6AA 2UUAO 1QMJA 1W9YA 2A06H 5J7MA 4IEOA 4A3XA 5ISLA 3TEYA 4RS5A 3K03A 3OGCC 4WZCA 4XBQA 1UYZA 2FDJA 3U4SA 3WT3A 4COVA 2Y33A 2FTKA 4QHBA 4QX7A 3WNMA 5KUKA 4JI5O 3WZ1A 1POV0 2ARXA 4IGGA 3T3YA 2X5IA 3GBWA 5BNNC 2ZZQA 5K0UC 4UCSA 1OQEA 2CH7A 4P9GA 4K0KO 5LY1A 3GJAA 2ZR3A 2LROA 4UVCA 4YLZA 5FDBA 4XUOA 3U10A 5DDJ3 2IZWA 3FKSG 1R083 5IVEA 4DV6B 1N34B 2PGGA 3A0BZ 4NXMB 1CD3G 2VMGA 4Q4Y2 4FPKA 3K0GA 3KD4A 1PMJX 2DOSA 2WAOA 3EO6A 4INDA 5A3UA 2I45A 1HRI1 3RWRD 1HWYA 1OA3A 4I02A 1SA0A 3RZZA 1K3IA 3VD9A 3ZN6A 4XQWA 2ATKC 2E5LB 3PNAA 4F7ZA 3T2QA 2HWC2 5JXHA 4D6TH 3PIJA 4JGZA 4DR4B 3OUIA 4E4HA 2XUMA 2RMU2 4XW3A 2WNEA 1FV2A 3N9MA 5AVAA 2RN9A 3CJHB 2ZBJA 2B1GA 4LK6A 3VBOA 1HW5A 2YI9A 1GZCA 4CH3A 1JZ8A 4DEQA 5JZGC 4O4JB 4N9HA 2FL4A 2UUAB 1K92A 3M7AA 2W1WA 3O5SA 2BQPA 1JYVA 1U97A 2R043 1D0HA 2XDVA 4Y5SA 3BIEA 3RW0A 5T50A 1SCRA 1SERA 3ICXA 4WBNA 4D6RA 2DE0X 4RAIA 2JDYA 1PZ7A 4NN0A 2JE7A 3PHMA 3LA3A 4JI5B 3NAPA 3AYDA 1BHGA 2JKBA 4IEUA 2OA2A 2SBAA 3ZHRA 1E1RG 5BY1A 5F6KA 4TQFA 1A3KA 4DV3O 1DYPA 5GLTA 4K0KB 3JASB 3Q8EA 1NZIA 1YFWA 3OW2U 4FZ0A 4MVQA 5IVBA 1NLQA 3UGFA 1W8HA 3AJZA 2J1UA 3WD5A 2HWC1 2ZGUA 1V6JA 4BQYA 4P9LA 5JCTA 1D2QA 3OF1A 5JSPA 2RMU1 3IJ4A 1HNWO 2NR5A 1R1A2 1N0JA 1YHQV 1GK9A 1PX4A 4WV8A 4CPBD 2XVLA 3KHBA 2A6WA 1GM7A 4CRQA 1GRJA 3R6SA 2ZCWA 3BB6A 3JAWA 1XYPA 2LW1A 2DU0A 5L73A 2EXKA 2UU9B 1ZBE3 2VTFA 2OW4A 5FK8A 1RINA 5DN6G 3OBAA 1H9WA 1IPSA 3ZRXA 4QAWA 3FD9A 2JGDA 1J3PA 3SXWA 4XUNA 1US6A 2IW5A 2UXXA 4PCRA 1LU2A 2EXJA 3TEWA 1UXZA 4X66O 1QU0A 5JMCA 4KGGA 1QY4A 3VZNA 2Y64A 1VBC2 1U5IA 3ZHQA 4F3JA 3JD3A 2DUPA 1YIPA 2BTQA 4DR1O 4LHSA 2OPWA 4META 1YC61 2DYCA 5JQGB 1IS5A 2WN3A 4D0QA 1FV3A 3W7TA 4I09A 3H3UA 3MUY1 5T55A 4R6ZA 1D4VB 1BEV2 5LCWL 1AB3A 2CTQA 2D97A 5DG2A 1M06G 3G6BA 1H9PA 2ZE6A 1IPJA 1YWKA 3DV8A 2HBUA 2NP0A 3SH3A 1S5HC 4AI1A 1UZYA 1GKFA 2BTOA 4DFSA 4DV3B 1R1A1 1VF6C 2VZ1A 2BOCC 5BUVA 5LA9A 4RQPB 3HJRA 2WLLB 2QTWB 1ZRIA 1WB7A 2VTXJ 4O2AB 5B4NA 1SBEA 5C9AC 2WSVA 4FO9A 1S5LZ 2WWSA 3W59A 2EZPA 1I5ZA 2AENA 1C8M3 3CC2V 3M8LA 2P34A 1CZSA 1W6OA 2CGNA 2VRZA 5CU1A 3VD3A 4A41A 4RR3B 2Y38A 2D3SA 5L3CA 1HNWB 1MS1A 1NY72 3HR0A 1AXZA 3USSA 4PA3A 3AZWA 1SQGA 4FPEA 4WFGA 2X8KA 2VQEO 2WLPA 5FYHA 5KX5B 2KR2A 3DYOA 1YJKA 3J7LA 1FAFA 4NO4A 1Q86W 1OVPA 1MS5A 3O0XA 3JCZA 1YQ8A 2ZGLA 1BSMA 1LNQA 3HKEB 2E7TA 3R65A 1OFNA 4EN8B 1LR5A 3GJBA 4IDZA 3SJAC 2PYTA 1VBB3 2VD7A 1LOBA 3K5MA 4Z2AA 2DVAA 4UOJA 1BEV1 3SPCA 1G8MA 1SFPA 2VOKA 4X66B 4AQSA 2HWF2 3AK3A 2Z69A 3BTXA 4LLFA 1IURA 4LUKA 3LSDA 3GF6A 1WLEA 4F6RA 5JVVA 4DR1B 1W99A 3OGRA 3CKHA 2W6JG 4PELA 2QWQB 5EP9A 3I5DA 5JSOA 2IJHA 1R6KA 3G4SV 2MEV3 4XJAA 4D7YA 4H7LA 2RJ2A 1CAXA 1JJ2U 3D36C 5JH7A 4CXXA 1FNZA 1RPOA 5FY4A 3DGTA 5FUIA 1XSRA 5J48A 4YVSC 3DEMA 3KHCA 2ID4A 1XU1A 4YVWA 3FE5A 4A45A 3AMMA 4LO5B 4CDWB 3PMSA 4AQ6A 3FLPA 1IZ3A 1YJWV 5D2AA 2EJ7A 2QZ3A 4P5YA 3S5QA 2VCBA 3RVHA 5JSRA 1FD9A 3CIHA 3BOWA 2VBDA 2BV4A 4GXLA 4DO0A 2Q8CA 2EIBA 4RN5A 4EFEA 5A3WA 2Y8KA 3A0KA 1B06A 4YW4A 4QXHA 1UMHA 3RJRA 1RUE2 4PIYA 4Y24A 2J1TA 2R30A 3X2QC 3BPSA 5JMOA 1JOPA 2ADEA 2HWF1 4AHCA 3ZSKA 1S0FA 2P90A 3SQOA 4DXRA 1Q8PA 3MW2A 1EAH3 4K7JA 4B08A 3JSLA 2ZS6B 4LKSA 4LWSB 1GZ9A 2R49A 1HIXA 4V2VA 1WB8A 1HKDA 2OUJA 1REEA 1WAZA 2W47A 2P3YA 4Q0UA 2X6AA 5A6ZA 1Q8QA 1GNHA 4UXNA 5BZBA 2PHDA 2P3JA 4JTAB 5DDJ1 1R081 1DQ0A 3BFRA 1JFFB 3K9AA 3KV9A 5C3SA 4YJ3B 2ZACA 2PHRA 4CE8A 1N36B 4HNAA 1SCSA 2FYUH 2DMXA 1SLCA 3H1WA 4E4DX 4LBLA 4CEYA 1TVKB 1CGPA 5C70A 1Q43A 4WZFA 5EJZB 4QGNA 1FS0G 3QO8A 4O2BB 1XNDA 2R9AA 2QVSB 1Y66A 4FPLA 3ABUA 1UYPA 5HXMA 1K3EA 4P9XA 1E79G 2A1XA 5F2VO 1FMD3 3SEEA 1VIBA 1DF0A 2E63A 1CPMA 4JRAA 3IC7A 3VD5A 3QH7A 4Y1UA 4XQ4A 1DZQA 3ETEA 3SYQA 2EAKA 1QJY3 3G67A 3T2OA 5KBFA 3P32A 1RUE1 4X8AA 1OH3A 3MFCA 4D6QA 3RVYA 2X7RB 1R1BA 3VBRB 1AR83 3ETQA 3ZEDA 2ITCC 3OGVA 3P1IA 4RFRB 4GUNA 4I4TB 5H6RA 3MDPA 3IKWA 1ZBE2 3AP4A 3E86A 3ZXDA 2RJZA 3B5LB 3TWIA 3WF0A 1QVFU 4B4RA 4EJRA 5D8AC 3FC0A 1H2LA 4GJZA 1NTMH 4BA6A 4JGYA 1L0NH 3JAKA 5FZ9A 2DBNA 4QPWA 1W9SA 4ATFA 2GMPA 2P7TC 1L7RA 3UK9A 1YXBA 5ACA3 5IAXA 1JJOA 2CTVA 4COUA 4Q4W3 4DV4O 4ICGA 4PIXA 1HNZB 2ET7A 1O3RA 1EPZA 5BYNA 2DTYA 3BTAA 3I7DA 4XF1A 3LB9A 5FYBA 4EB6A 3PVNA 5BNPA 4YW1A 2PXJA 1URXA 1RVF2 4CPBA 3HVDA 1R3LC 5EZYA 3NNJA 3PUSA 1XSQA 1UYYA 4MXVA 3ZRWB 1GP4A 4CXWA 4DZGA 1LU1A 2YU2A 5L7OA 4R4XA 1WNSA 3ZPOA 3VZOA 5IT6A 5FYIA 4JYYA 3DYPA 2Y69B 1WPXA 1BJQA 1ZBE1 1S0IA 4AQ2A 4U3JB 5HI0A 4QGLA 3K5NA 2WRAA 1W0JG 5C6CA 2N7GA 3WHUA 4LE3A 3A0RA 1FPOA 4NIDA 2ZTNA 4QDRA 2LQTA 1S2BA 3E5QA 2Q69A 1UY4A 2PFWA 1CIYA 5JOZA 3SKJE 1RXGA 4XFFA 3L71H 2DVGA 1DFQA 2WS92 4Y1XA 3TBDA 1VBB2 1K5MA 2ZGSA 1BGYH 3ZFGA 5KXBA 1QJU3 4BXFA 5JDBA 1WA8A 4LBNA 4K35A 5DAPA 4DNYA 3O14A 5I0UA 4NHXA 1Q8SA 3N9OA 1HXS2 2DUOA 3WP3A 1WD4A 2Y6KA 3RN4A 3JD72 4J11A 2VY0A 2JICA 4HPKB 3UJQA 4NIHA 1YI7A 4DINB 4LFAO 4IV1B 4JDNA 2RNBA 1OD3A 3B9IA 4HKWA 3I2HA 3I3EA 1GNYA 3QD6A 1CZTA 4LKFA 2ZGOA 2HEVF 1Y7BA 1QH6A 1AP5A 2VG9A 3K3NA 5ITZB 1S0BA 3T1YO 2E74B 1IG0A 5BV6A 2CV6A 2HLDG 5FXXA 4D94A 5F7UA 2AHYA 4YRDA 1KU9A 4CUGA 3LDBA 4YGDA 4LT5A 3ZMVA 3Q8AA 4FLTA 3VBSC 5ANQA 3LDRA 3VV1A 2XJSA 5LEJA 4L11A 2Y6JA 3ZSEA 2Q4PA 1RJ8A 3VD4A 5GONA 4CDXA 4JQTA 3VDDB 1VB2A 4R8HA 2PUSA 1U5ZA 3OPZA 4JCKA 3J7MA 2PHWA 5K1PA 3ZYBA 2DCYA 2UUBO 4RQPC 4MO3M 4UW5A 1DP0A 4XF9A 1VBB1 3I8TA 5FBJA 3U37A 3KGZA 1QXPA 4S2FA 2VXJA 4FOWA 1J1TA 3AM2A 4JX0A 4GJYA 1OH4A 3WW3A 2BFUS 3D3IA 2I07B 1RFYA 1GKBA 4Q1RA 1HXS1 4IT5A 4NOTA 1EAH2 4RR3C 3GALA 2AC1A 2B9UA 1D4M2 4AHWA 3WFVA 1BMFG 4JYCA 3OUHA 4IGQA 1H8VA 1AX1A 2PLV3 4WVMB 3WQ7A 4XJZA 5LXTA 3BU7A 3CEIA 2Y6LA 3N27A 2MEV1 1UFIA 3TXSA 4IGPA 3E1F1 3ZKYA 2DW4A 4PIZA 4Q4V2 5DAVA 4X6QB 2WINB 1AL22 2W94A 1QJX3 5LA1A 4FP3A 3QF7A 5B1NA 3H1YA 1UKRA 1RUG3 4PBPA 1X4TA 4IE5A 4R9BA 3AG4B 5C3QA 4GWNA 4A4AA 4IW3A 1C3HA 1WUVA 3ZMNA 1V0AA 3N2KA 3J7HA 2PAKA 2HEWF 4LFAB 4QU1A 4CZZA 2BWCA 2LM3A 2WA4A 2XONA 4YWAA 2BNMA 5H6QA 4N23A 1FNYA 1NOVA 4LHNA 3BUCA 3MIHA 3T1YB 4QPGA 4O4IA 1V54B 2NPIA 1OSGA 3ILNA 4LF4O 5BPXA 2H8PC 4DS0A 1KRIA 2PN5A 4PLOA 2AYHA 3PMEA 3WEZA 2VAUA 3NJVA 2W1UA 1AX0A 1AR82 1WGPA 5IATA 1Q5OA 1OOPB 1W6MA 3VD7A 4CXYA 1HV0A 2QEXV 4OHVA 1AVMA 1UQXA 2Q5TA 3CCJV 1EAH1 4YPJA 4NHKA 3I59A 4FOYA 3RZJA 1GSLA 3UO3A 2JJ2G 1HDKA 1CAWA 3ZKUA 2JG8B 2UUBB 2E31A 1AR5A 4CDWC 5A3OA 4Q4V1 2DTWA 1K8AW 3NJYA 3MIFA 1AL21 1WCSA 1OCRB 4RWUA 3T0DA 1NT0A 4KH9A 3OCPA 4JI4B 5A2QN 3HNYM 3A2FA 5LA2A 4AVCA 1R6TA 2YU1A 4NTXA 4XUTA 5IVFA 1NQJA 1XE8A 4Q4W2 3VBUA 4B8EA 5CAZA 1ZVFA 1AR93 2RDNA 3M2MA 4MVRA 2A79B 3I2KA 5DECA 3F5TA 4L87A 1QIQA 5IJ9B 1DLBA 3ZRVA 1WCQA 1EY2A 3E6BA 2CSGA 4CS4A 4L0PA 1H4HA 2QNKA 3MF9A 1DIWA 3JARB 4CSWA 4HANA 4OZOA 4JTCB 3AZZA 2GMMA 2VW2A 4A3ZA 4CVUA 1RB8G 3VUOA 4I0AA 1EP0A 2CGPA 1AR81 3S30A 3E22B 2JENA 4R9DA 5K9YA 1JX9A 5GLUA 2EULA 3A21A 2BSKB 3ZX6A 3DN7A 4UT5A 3UT5A 4MSVA 2D7FA 2VZOA 4BQ5A 1CWPA 2XT9A 1E5HA 4Y5Z0 5TISZ 2Y26A 4LF4B 3ZXAC 5A1LA 2RDSA 4UI9L 2EXIA 1KS4A 4X8PA 3I4IA 2D3RA 4AYUA 3BABA 5JPNB 4N43B 1NQTA 1LOGA 4QMAA 4BYYA 4OHWA 4NHMA 2D2CB 5ACA1 4WM8B 1S0CA 3UYJA 4Q4W1 4TXWA 4KNCA 4O65A 3ZN1A 4AEDA 5A1AA 3BCWA 2XKOA 3VBRC 4RGKA 2QKAA 3VHRA 3L9JT 3AG2B 5EBWC 5EYPA 4WVZA 1E5SA 4OPAA 3RWNA 1TUBA 3E2EA 4HK8A 3FFQA 4I9QA 1PZ8A 3P3PA 4DV2B 1GU3A 4CU8A 4CA9A 1RUNA 4L92A 3KQRA 2JDKA 3KQ4B 5FWEA 2OTJV 4MGIE 4YW3A 4Q0SA 1ZZ6A 3H1HH 1VARA 2PHLA 5BR8O 4DV0O 3LSSA 4ZU5A 1YZBA 4RD7A 3HKBB 1SZXA 1DGRA 1AZDA 3HT1A 3VKFC 3B77A 1VE0A 2F43G 3WDVA 5BNNA 3T1MA 5K0UA 3LEKA 2KB1A 4BK5A 1Y76B 2B5HA 1XEQA 2DWRA 1R3IC 1GBGA 1EUUA 1SLLA 1VIWB 4HN1A 3I49A 4FLXA 4X6RB 2WNVB 3ASOB 3HBZA 3B00A 1XU2A 2TNFA 4XDOA 4NHYA 1SLAA 3WINE 4BM8A 2IWGB 4BR6A 2B9VA 2AGSA 4AAXA 1FATA 1ZLZA 2UWCA 3F7YC 1GN4A 4XIOA 4GMP1 2ARHA 3WUCA 3AK0A 5JIUA 3N7KA 1KQRA 1NG0A 1OHHG 2H0VA 2Q9LA 2L35A 3EXUA 3APOA 2PELA 4E2LA 4HBNA 2XAQA 2QTOA 3AXDA 2HKXA 3IDAA 1OMIA 4C0HA 4QT6A 1OCCB 3NV3A 2OPKA 4TN7A 1DBNA 2Y69C 3I3BA 4QQPA 4GQ7A 1NA1B 3BYWA 2ZE7A 1XBLA 2GDSA 3NVCA 2V5YA 5FLIA 5CKMA 4Q6GA 1SQXH 1Q82W 1TNRA 3ZYJB 2ODMA 4L97A 1ULPA 4WFBV 1US2A 1UAIA 3K5LA 2KSDA 1IPKA 4MSWC 5JZGA 5M0TA 1F4HA 5FO7B 4XJWA 3VKMA 5HFLA 4BIZA 4O61A 3DXRB 2D40A 3H8XA 3OMIB 2UY8A 1LKNA 1CAVB 1F23A 1SBDA 1H8EG 2UY9A 1O4YA 4TLFA 4FPOB 3AZYA 3H1KH 4DV0B 2WZR2 2C26A 2EIKB 4Z2WA 5GKAC 2PI4A 2QM4A 5CG8A 2DVFA 1IVSA 1OQDA 4R52A 5B1OA 5CIRA 3N7JA 1VF5B 2C6SA 5C8CB 5GALA 3AG7A 4IV1C 3UKMA 2FBEA 1K4CC 1JXNA 3PTYA 4DEVA 2AEYA 1S5JA 1HNXO 2XJQA 3B4SA 5F5AA 5CKQA 4XDLA 2YBKA 2QM7A 2ZGRA 3R4DB 3F2ZA 4KWJA 1YUDA 4GWIA 1VQ7V 2XNDG 5KC5A 1QGLA 1F4MA 2CTWA 4PHZA 3GHMA 4XFIA 2JVDA 4ZI7A 2Q0AA 4FLWA 3NNGA 2W91A 4GKJO 4AFBA 1QJX1 2GC0A 2DCJA 5FYUA 3VDDC 3DKWA 3E97A 4IL6Z 3RZKA 1XJAA 5B1AB 3SJQC 1RUJ3 3DCQA 2AZ5A 5FCCA 3ZYGA 2WZR1 4FXKB 4GWJA 4RHV3 4OPHA 3MBWA 5FMCA 1BCXA 4FIPC 2KKWA 3ETGA 2GU9A 1KD1W 5GLWA 5A7WA 3T0AA 1JOBA 2XB6C 4Z07A 2CGOA 4FPCA 3WV6A 4LFBO 1W03A 1N47A 5LATA 5A9GA 3DSQA 3H01A 3SYCA 1XILA 4ONUA 4GWMA 3PJQA 4NROA 4X65O 4MTGA 2DFBA 1Q8IA 3W7SA 1PK6B 1YEWA 3AG4C 2J42A 2KM2A 5JAXA 1ZZCA 2YFZA 4ZU7A 3RYIB 3R66A 3ACHA 1VF6A 1DU3D 3EJKA 5A80A 1NKGA 1KS5A 4LA3A 4MVSA 2CUGA 3HNMA 1Y67A 1MSWD 4R8CA 4HZFA 1SS3A 2HFEC 1GMGA 5H5NA 2ZE5A 4H44B 5AG2A 4FQ4A 4HK9A 3VBHB 3H0OA 5JXGA 1HNXB 5AFBA 3NSTA 1IBLO 1KDKA 1GOHA 3AFGA 2R7EB 5CB4B 4TWTA 4KUMA 5KMGA 4QX0A 3RDIA 2WT2A 1UYXA 4DUYO 4P5HA 1AR91 1UY1A 2B42B 3SPJA 4DRXA 4XHXA 1OOPC 4GKJB 2OQ7A 5A3PA 2PAEA 4X1IB 3B9CA 5LOVB 1J5EO 2BGPA 4BCUA 1FPN3 5T52A 1GQGA 4P02B 2UXNA 3OY8B 1RUF3 2JEXA 4YXWG 1R3JC 4MGYE 3POWA 5C8YA 4BIOA 2P6HA 3E8GA 4H37A 2WZPP 2GZWA 1QCEA 3WF1A 3IBMA 1OCRC 5F39A 3PLQA 1WLCA 2W08A 5FK7A 4F4LA 1JZ5A 2ZDIC 1VQ6V 3OTOO 1YVWA 2E7QA 3POSA 3CCEV 5L3DA 3PIGA 4CZSA 3EYPA 2BJSA 2N05A 4JI8B 1CAUB 4MT8A 1K97A 3LAGA 5GZDA 3B93A 3K04A 4EWDA 3LDCA 4NTWA 2C9AA 3WB1A 3J8F3 3D36A 2UU8A 4CCDA 1WCKA 5GZCA 4X65B 2OS2A 1JTZX 3ZYIB 1ZUQA 4X1KB 4BWOA 4C0BA 2KQXA 1HJGA 2WIIB 4YGEA 1UNBA 4YVSA 1K42A 4S2DA 5FXWA 1NCRB 2NLJC 4CS2A 1GV9A 2VMHA 1UW8A 3D4KA 1RYYA 4ZOLB 4AVTA 4BMBA 1YQ6A 5A6YA 4X1YB 3JATB 1K4DC 4EKWA 5SV5A 1ND2A 1F8VA 1IBLB 2YUAA 3SNMA 1SEFA 1GWLA 2C5DA 5LB6A 2V73A 4QQHA 1M57B 4DUYB 1XL4A 2EIMB 1ULEA 5JWPA 4J1XA 5A3NA 2Y0PA 2VECA 4ZHQB 1H1MA 3E5UA 2BW8A 4Q0QA 4N43C 5A7SA 4BISA 2BYVE 2R0FA 1MS4A 4WM8C 2JG9B 5DM6V 2RS53 1IBMB 1ENSA 3TXQA 1V6MA 2YIBD 4JAUA 1OA4A 4A42A 3H50A 4DYLA 3AG2C 2B5UA 3B40A 1VQMV 2JRIA 4FTBA 4KWUA 2WL1A 2ETNA 4NVPA 2OZ6A 2VQ0A 3IM0A 4J7JA 3MEPA 4KFMA 5EK0A 3OTOB 3IFXA 3O7OA 2VJXA 3HKDB 1GLHA 2BUKA 4OZXA 4FLUA 4N8MA 1AR4A 1O9HA 2X0LA 3SMHA 1QQP2 4QX3A 3H8RA 4IEXA 1S0VA 5LASA 2RV9A 1TZOA 1H8TC 1QDOA 2FDHA 1QXRA 2D44A 4G27B 3WY6A 1ULGA 2B1IA 2ARAA 2OT5A 3MI8A 4P08A 2WNVC 1S4CA 5IK4A 1AR63 2VMCA 3WF4A 5A3LA 5IVJA 4QWNA 1W2OA 3D0SA 5DUUA 3VBBA 1J3QA 2JD4A 4QIWF 1PZ9A 4YZ5A 2JEUA 2Z5WA 4IERA 2V5DA 2R72A 4MHRA 5JLVA 1XREA 3AK1A 4FCAA 3WP6A 1BK0A 1SQFA 3J7NA 5EIBC 1V9U3 4CUBA 3BA8A 1JR9A 2IVIB 5C5TA 5LBFA 1VRBA 3JBG2 3DTUB 5IW0A 2HWE3 1SQPH 1MVEA 5FRAA 1P84F 3UV9A 3CXCU 2NM1A 4N90A 2GC2A 4TUYB 1NA1C 2WFF3 4EYUA 2VUJA 5CB7A 1XMQO 1HQLA 3CJHA 3ES1A 2PY5A 3DPRB 4RUFA 2P06A 1VQ9V 1QQP1 1K33A 3BTYA 4O4JA 2B45X 4MH0E 2VVEA 2C1FA 4FFFA 3H7JA 1W6PB 3MLKA 3WW2A 1UX7A 3SYAA 5FXZA 1FOD2 1CIWA 1ZSPA 2EIKC 1O59A 1XE7A 1ZZ7A 1TMF3 1UXXX 3L70H 3FBMA 2DVDA 1B3QA 2CNAA 2Z4FA 3BCCH 1OF4A 2WO2A 5FY1A 5C8CC 3JASA 1YRZA 1IXBA 3ZFEB 2VQUA 4LBEC 4CP0A 1J84A 5HV4A 2VZQA 3KMHA 1RUJ1 2XLGA 2XWBB 1CPYA 4AG4A 3MIEA 1MNGA 2QGNA 4UFJA 1ENVA 4JZRA 5AC93 5F2SA 1J83A 1CONA 3JBG1 4I3PA 2DWDC 2DBIA 3SYPA 5A7PA 2WC2A 5BNOC 1GO3F 2CDYA 3F5WC 3NKTA 1S2EA 1GP6A 4U7NA 4NXNO 3LPGA 2CTRA 5C5UA 4WFAV 4E8CA 1HQWA 2XTAA 4IL7A 4ASMB 1X33A 4K40A 5FFOC 1QOSA 4XETA 1F4NA 1YDXA 1LULA 2V72A 3E8HA 3K4AA 3VHPA 4UW4A 2LP7A 5FZMA 4OUEA 2PYJA 5FYMA 2D98A 5T5PA 1M93A 3GZEA 1KD7A 2WDBA 5A33B 3ZSMA 4X20B 3OBRA 2ATFA 1O5LA 3CZUA 4FFGA 2JIZG 4NJ4A 3ZVXA 4ITCA 1OZ0A 3LDDA 4UCOA 1WA6X 1G9AA 1W2UA 1XMQB 2RCVA 2M7WA 1G4YB 4FPGA 1EZVH 4LC1A 4GB33 3K0DA 1MACA 2VQFO 1VP7A 3U75A 2AUYA 5JQGA 2BFUL 3JQXA 1WMFA 3RYHB 3WXPA 1X9PA 1GANA 1EN6A 4BXSV 2CWMA 1GM8A 3UESA 3WVJA 3M3CA 3CBNA 1K5SA 1PK6C 1H2KA 1FPN1 4UFKA 4IV3B 5C33A 3HR9A 4M3CE 1Y74B 3S3XA 5HCHA 1R092 1MPXA 1RUF1 3ZCCA 4RQPA 2WLLA 3POFA 4LQRA 4O2AA 3K08A 2Q0OC 2PHXA 2Z0AA 4ISQA 3VBHC 5APAA 3AZVA 1OT5A 5KHHA 3AC0A 4PQ9A 2RQ6A 2Q1ZB 2JE8A 1M9NA 4PV1B 4RR3A 1ULFA 5F3CA 2RJKA 4NXNB 1PVC2 1UN1A 1ACCA 5CBFA 1TGOA 3CCSV 5F1RA 2PMWB 4M3CB 5KR7A 5KX5A 5IUQA 5BXXA 2O14A 3MIBA 2HWB3 2DWEC 4KP4A 4MVMA 4MGSA 1VLNA 4B3MO 4DK0A 4YG6A 3J8F1 4XEZA 4LBJA 3ZMTA 5I8TA 2VOWA 3TN93 3HKEA 5JJJB 4KU8A 4JI1O 3D8CA 2HYKA 3ZBHA 5FIXA 1S72V 3LFMA 1WPBA 3WDYA 2LALA 1HN0A 2VULA 3U07A 5KAFZ 4E8DA 1YITV 2QE7G 1AF9A 1LESA 2VQFB 1C4RA 2GP5A 3AXEA 3G7DA 2AZ2A 3O1OA 1O3SA 2BRTA 4XAAA 3P6BA 1UOJA 1N3PA 1AR62 5EV7A 2XOKG 2LFSA 3BHPA 2ZM6O 2VNOA 2ZIMA 1OHFA 2XJUA 2RE9A 1LNSA 2RJLA 3V0AB 3PUAA 4J7KA 4MVUA 4JC1A 2YIBA 3IAYA 1AYN2 2VOTA 1PVC1 1VMGA 2DURA 4Y3OA 2UXBO 3N7MA 1NCRC 3S3WA 1W8FA 1V9U2 4A6OA 3CCUV 3BTZA 4HT1T 3ZR5A 5K4LA 1W3VA 4CDWA 3JALB 1G7YA 4FT8A 1RP3B 4B1LA 2GBOA 3GZTB 2R16A 3E35A 5B3SB 3AG1B 3IMMA 3CCMV 1HP8A 4HL0A 1GTOA 3GNEA 3KS7A 4I9WA 4QNHB 4COYA 2IXKA 3NV1A 2WFF2 5DUWA 2K2SA 1M57C 1SKVA 4P9IA 2DDUA 4QXBA 4XUPA 1MZ5A 3H9AA 4OHXA 2IXHA 4YGBA 2W39A 4G9SB 2JDNA 3RMXA 4FQZA 2FCVA 4TV8B 1Z5VA 5B5EZ 1D7PM 3O0WA 2VXRA 3K5OA 2AZ0A 1W2AX 1YIJV 4B3MB 1VPHA 3K3OA 1YQ5A 1PIV3 4LWSA 2JG9C 1SHWB 1I7FA 2NMOA 1J58A 1GNZA 2VZRA 3LWCA 1VAVA 4O4LB 1VMHA 2P2KA 4JI1B 4Z82A 2WLKA 4EV0A 4WVWA 1AR61 4YZ1A 3OGSA 3FLRA 1QWRA 2VM9A 3F95A 1BBT3 3PU8A 1EN4A 2ZX2A 1DF5A 5DZFA 1JFFA 3H1LH 4J9YB 3K77A 1WBFA 3ZIWA 3CC7V 4FOQA 1XPWA 1IX9A 1TMF2 4YJ3A 1JBCA 3K75B 1AYN1 4HKLA 1LOFC 2QWNB 3GWOA 5FZAA 2CL2A 4FFBB 3BN6A 1V9U1 4Y33A 1TG7A 5J2UA 1TVKA 3NRUA 1OCOB 2ETEA 3ZS8C 1JZ3A 1C1LA 4O2BA 2FCTA 5FZEA 4HG6B 5T5OA 2ZM6B 3D82A 2HWE1 2BE3A 5IY5C 3HMYA 3PL0A 4H33A 4ZKTB 2OCCB 2WFF1 3P30A 1CJPA 3Q4HB 2UXBB 3AMHA 5CFDB 4EEQA 5FZOB 3KKYA 3VBRA 1OLMA 5C9AB 1VBD3 1VQNV 1UIJA 3BKZA 4I4TA 1ZTEA 3SR2C 2Q30A 5HCAA 2GHYA 3EBRA 2A3QA 2P6CA 1SLIA 3T1HO 2WLNA 3ZXEA 2GN7A 3ITQA 1TUEB 4W8JA 4KBBA 4M3CF 3W7UA 3ZLIA 2YHJA 3ZMUA 5C71A 5EC1C 4XJUA 1H1IA 3HQRA 4Y22B 3RI8A 5LEKA 1TMF1 4GB32 1UU6A 4PA9A 2MPFA 1W2TA 4QDSA 1W0KG 3OFNG 1QU7A 1H8HG 4WVVA 5HCBA 3SC7X 4HAMA 1KJRA 3CC4V 2ZIOA 4RS5C 3DPRC 1M4UA 4G3YC 2WWUA 4QD2A 3RVZA 1Z0HA 1I08A 1MEC3 1XYNA 4DIQA 5LRSA 4AILC 3U1XA 1RUC2 1UIKA 2X5IC 2WNOA 5SV8A 5KHKA 2GMEA 4NRQA 5L19A 3ZRWA 3RRDA 1HB1A 3BRCA 4LMFA 5IK7A 1JOJA 2E7AA 1U12A 2EVXA 1W8ZA 2P22C 4ARYA 3DKQA 1W8NA 2YFUA 1GWKA 4QQ2A 2H6CA 4CCMA 3OEBA 4G28B 2WR9A 5FYTA 1C8NA 1F2NA 5B4XA 3DGEA 3ZFEC 4U3JA 3WNOA 2RR13 1S2KA 3K51A 1DGLA 4Y20B 2IH3C 4NXMO 1F15A 5DAQA 3WG7C 1OF3A 4GB31 4JYBA 5J98B 3RPQA 1N1YA 4RQEA 1JCHA 2EBOA 1P8JA 3HAGA 4HSLA 1BYHA 3CDZB 4JGZC 2VNVA 1XB9A 3TN92 3W5MA 4YZ4A 4FJCC 4LFCO 3MYXA 3OD0A 1WKYA 1IKQA 4FZ1A 2RM22 1OCZB 3CRQA 2WWWA 1R73A 2WZEA 3B02A 2VC9A 1ZX5A 4R4ZA 2E5LO 2JXAA 1R6NA 4MADA 3WNNA 3M3IA 1QKQA 3M3QA 4DR7B 4J41A 1LGNA 5G04L 3KT1A 1RUC1 2JB8A 4Q4X3 4UFMA 4BH9A 1SFNA 2YZ4A 4HPKA 1MSDA 4LUMA 1ZBA3 1AUYA 3CHXA 4IV1A 2H3OA 4AI3A 3IMNA 3SCHA 1GQPA 5KXCA 4XMAA 4AZZA 3O1MA 4MYEA 3VDBA 1KYOF 3GHNA 3FN9A 4I2OA 3CL1A 1JHJA 3NNMA 3O1VA 1LTEA 3VOUA 1UZVA 1ND3B 5ITZA 3UJOA 3H1MA 1HRV2 2OXBA 2R1DA 4UCTA 4LKEA 2ZX4A 3TB0A 3UT0A 4RGAA 3ACFA 4E4EA 1XMOO 4NRMA 4AEMA 4Q0PA 3MLJA 4DK1A 2UYAA 2GNDA 2IBZH 2ZCEA 3IPVB 4IIJB 2ZKNA 1KKCA 2YGMA 2W68A 2AREA 1OI6A 1K73W 4IEPA 2X6CA 4NAMA 3VDDA 2PA7A 3OR6C 4IV3C 4DW1A 4V1PA 2ZX1A 3AP5A 3TN91 1MS3A 3STLC 5J36A 4KWKA 2JX9A 2RM21 3K46A 1WMEA 4GYCB 2IH1C 1QBZA 3C90A 4PA4A 3WG2A 1F5JA 3PUIA 2JDPA 1A78A 5I0TA 4I0WB 1BQZA 4QKNA 3U14A 3CYOA 1NCQB 1YQCA 4IEQA 2OCHA 2ZKLA 2W3JA 2WUHA 4MUVA 2VVFA 1JH5A 4WVMA 1UY2A 1LENA 5IHRA 4PI2A 3ZR6A 2BU9A 4LFCB 5D8AB 2BP6A 4ZS3A 2R0HA 5TSWA 3KV6A 2AW9A 1O8SA 3D6EA 3AKRA 3EXAA 3ZX7A 1XOUA 2P67A 1BQPA 4BIUA 2UU9O 1HRV1 2ZX3A 3VHOA 1W04A 5LMNO 5HV0A 2ERFA 1SG3A 4BAYA 5FZ4A 5CA1B 3VKNA 1JZ2A 2VUAA 3U4XA 1YJLA 4L9BA 2JK5C 1VBA3 3ZMZA 1JYXA 4RA0A 4XOGA 4C1XA 1LECA 1Y9GA 4FFHA 1W0PA 4PDLA 4BPZA 1W28A 3NNLA 3GWKC 1V6LA 5EJ3A 5GZFA 2FDIA 1K45A 1AR1B 4CDQB 3IIAA 2X6BA 2CYFA 4L99A 3KWVA 1C1FA 1O4TA 4DY3A 3PVOA 1UO9A 4JGSA 1W90A 2L9LA 1K9MW 5L9VA 3FFZA 1QLNA 1XMOB 2HJFC 2WQ4A 2QWOB 4NYKA 1OOPA 3J80N 1MA1A 4K8FA 1AJPA 3PJYA 4N53B 4XHBA 3THPA 1Q90D 3D5OA 5A6QA 4MLOA 4OQ9A 5FPAA 2W46A 2JG8A 1PL4A 2OQ6A 2RS33 4BW5A 1OUXA 4Q5OA 5E79Z 1QNYA 3ZXJA 5CZKA 3Q8FA 5H9PA 1PGW2 2DV9A 1G6NA 1SPPB 1NT2B 4XIKA 2JB4A 5B3SC 4UW6A 4JYAO 2ZDIA 3AG1C 4LNUB 1PKXA 2QQJA 4YZ2A 2DUQA 5GLVA 3J81N 3HB3B 5DAWA 5BNQA 4QB1A 4CCJA 2LS6A 3O1TA 2ZGKA 3D3AA 4IUGA 4BDVB 1F7YA 3KSCA 5E1RA 2HVKC 5B1BC 1PO13 5IJ9A 4NPLA 4EWAA 2HHHO 1KMIZ 4AQTA 2QM8A 3OYWB 3ZSJA 1F9KA 3H9VA 3FHQA 1W3XA 1CESA 3JARA 1AROP 1H4GA 2ZA9A 1WBLA 3N7LA 1J59A 5LMNB 5FZDA 4QDQA 4LO4B 1PHMA 4NAOA 4DO2A 2GP3A 3OSDA 3TRSB 4LKDA 1RHI3 2Q7EA 1XDCA 4MS2A 3E22A 1DLCA 5DN2A 2VUDA 5C3OA 4JF3A 1RUH3 1U0AA 2W92A 4XF4A 4QKBA 5IT9N 2B39A 2BSKA 4XDKA 1IHMA 5F2WA 3ML0A 1OLQA 5DAXA 3WUDA 1HLCA 4URTA 2EF6A 1OCOC 1OV9A 3MICA 3UKVA 1WP8A 2QUOA 3VBSB 4DQAA 1PGW1 1QEXA 1PM9A 2FDKA 1JYCA 4PA7A 4QHZA 4N43A 3OGIB 5CA3A 3UKNA 1FXKB 3WQ0A 4WM8A 4UCUA 2OCCC 4AW7A 1MMMA 4Q1PA 2LFRA 4OLLA 3MV11 3WB2A 2D3PA 1Y4MA 4GX1A 5CFDC 3LDKA 5CMUA 4GLXA 3OT7A 2D6MA 2A6YA 2DFCA 3TNQA 3JSNA 4JYAB 4QPYA 3W21A 5FP3A 1OBNA 1XUQA 2OYQA 2J1VA 1N4CA 4JTDB 3I2OA 2ZNJA 1WW6A 2H0BA 4C7UA 4IEWA 2V7QG 4P14A 3HKBA 3GGLA 1KQSU 5AFEA 2HHHB 2CK3G 4NWVA 2ZMKA 4D69A 1COV3 1Y76A 3AKQA 2ZT9B 1RC6A 2RDCA 4CUAA 4S2HA 2OTLV 2DQ3A 3SDLA 5CFCB 2WNVA 2CDPA 1N1SA 4B7KA 2JD9A 5FO9B 3OAAG 4GMP0 1ZRFA 4AI9A 4I0XB 2EIGA 5T5LA 4PJYA 2FD8A 1X50A 1N36O 5JCOC 3HNBM 5F8PA 2VH9A 4OGQB 4P2ZA 3FZ3A 1Z7S3 2DVBA 3ZN0A 2BDRA 2IJJA 2J1SA 1AR73 4X9QA 2JDMA 5FZIA 3RZHA 3RYPA 1NAEA 4XDPA 1AL0G 3MFAA 2C4XA 4Y4RA 1O4ZA 1VMFA 2WQZC 1JI6A 4JV5O 5DDJ2 1R082 1Q3EA 1J3RA 2FHRA 1W8UA 3THOA 4GH4A 1UOGA 4KI5M 1MZEA 2E9QA 1NA1A 1QOTA 4QB6A 1Z2GA 3KG2A 5FZLA 4Q20A 3QACA 1WWYA 4QHOA 3DF0A 4D8MA 2KXLA 3T4HB 1ENXA 3D3QA 4EN9B 2BGOA 4JI0O 1NU1H 1Q8OA 1K34A 1ENQA 2VZVA 5LGTA 3M3EA 4LH6A 4MX3A 4MXWA 4UFHA 2PI5A 2GUZB 3DXRA 3SPIA 3T09A 2KD7A 1JYWA 5JJNB 3LF7A 5LBBA 2YICA 1Z78A 1CAVA 3TEXA 3AKTA 4PDWB 1OCZC 4W4KA 1WA4A 1WMDA 4FPHA 2W95A 5E89A 5A7NA 1KP2A 4GAZA 4COWA 2VMDA 1YJ9V 5LGNA 5IYBO 1NTZH 3TAYA 1D0GA 2R70A 2FZ1A 1N3OA 4DY5A 3I3DA 5C8CA 2R042 1QR9A 1HNZO 2P5BA 3LZZA 4XUQA 1XHZA 3T2PA 1GQHA 2ZGTA 3OUSA 2XLFA 2BTVC 3RYFB 1GAXA 2AR6A 1VMJA 1DDLA 2XQXA 1I5YA 1O6UA 2HWD3 3JB8A 2RMKB 3Q9OA 1ND3C 2WQ8A 3HQXA 1FI2A 1TME3 1COWG 2UXDO 3E8FA 3WG1A 2D6NA 1APNA 3RS6A 1DQ6A 1UOBA 3AYEA 4B3RO 1S77D 2W1SA 3KV4A 3FAVB 3FB5C 4XMIA 1JODA 4KG8A 4JV5B 1ZZ9A 4KG0A 4J42A 1Y43B 1HB2A 4JI3O 1NZ6A 3K4DA 2I74A 4XXAA 1HB3A 4LHLA 1HRI3 2B4KA 2A7WA 4FMTA 4N21A 2PTMA 3SPHA 1XNCA 1PO12 4QB2A 4B3TB 1NCQC 3ZMOA 4JI0B 3LNMB 3I2GA 5LHGA 4I3GA 1CPNA 3WF2A 4MTFA 2R041 5FO8B 4X62O 1ROPA 5FJKA 4PDRA 1BVP1 3CJIB 3ELNA 5GTIZ 3QTCA 1I94O 1C5HA 3WP5A 4FK5C 1JHNA 1MZFA 1YF2A 5EJ1B 4BMEA 2WNUB 4LBQB 4C90A 3NMBA 2Q8VA 4JAVA 1PK6A 1F4AA 4OFGA 1RUH2 5A7OA 2H94A 4GULA 4QM9A 3RYIA 4QE7A 5EYYA 2ZHKA 3LUTB 5GZEA 1UY3A 2QQNA 1QHTA 3MO4A 4XTPA 1W59A 3CRMA 2JDZA 3U11A 3VBHA 3GBGA 4FPJA 4JDMA 1JZ4A 4ZXKA 4MGKE 5IYYA 2WT1A 4ZY9A 5C3PA 4MGQA 4LF6O 1U5XA 5CB4A 1M56C 4CDQC 4SLIA 2WSSG 2VBPA 3LCPA 1UMZA 3A23A 4LLOA 4Q4Y3 2R073 2UXDB 1IG3A 5LYJB 4HZ3A 5G05L 1O8PA 4HOOA 2XJVA 4HVRA 4CBCA 3I2JA 1AX2A 2R6QA 4UVAA 4H7MA 3RZLA 5ABJB 4B3RB 1PO11 2ZAAA 4AGGA 3OD4A 3POGA 1JVMA 4X1IA 3QG5A 2R9RB 5LOVA 4PD4F 1FX5A 1REFA 2A75A 1C8M2 2PAMA 4N53C 1JN2P 4NIAA 1BVVA 1T2XA 3ZFFB 5KAIZ 4MOAA 3TGUH 3OY8A 2G38A 5CBLA 4JI3B 4AEJA 2B9ZA 1XOYA 3BOPA 3SCGA 2XVGA 2WABA 3MAQA 1I3HA 3E8BA 1E5IA 1PL0A 1RHI1 2Q7HA 2XL9A 4NB5A 3WB0A 1RUH1 3PUHA 4TSVA 1RPRA 1ODMA 3OR7C 2BBAA 1IQAA 3PN1A 2ZPXA 3NXSA 4BOWA 3ABKC 4XCAA 1CAUA 4CC5A 4X62B 4A44A 2EIEA 3ZN5A 1NX9A 1N0NA 1I94B 2IFRA 3EHKA 3JAMN 4Q2FA 5DMYA 5FQ0B 4TV9B 1VALA 1QJZA 4L8JA 4MVOA 3KF3A 4UB8Z 4X1KA 3ABTA 3KZ4C 2X09A 1Z7S2 4ZPIA 1NCRA 5IK5A 1VAKA 3AJYA 1AR72 2PQQA 2MEV2 1W6QB 3AMQA 3N2GB 4ZOLA 2OZJA 5E1AC 5HPOA 2DN9A 2RG4A 4NIGA 4CP9B 5F5IA 4X1YA 3JATA 1C8M1 2XHBA 1LGCA 3A22A 3MW3A 5EYXA 1OFSA 4LF6B 3AFKA 4CCNA 2HVJC 5FPVA 3MZHA 1R1A3 3E83A 3PURA 4JZ2A 1UZWA 5ERLA 1F31A 4ZHQA 1G6UA 3DECA 4IGOA 4DXTA 4FXGB 4XC9A 1UCXA 1GWMA 5A3MA 5IYZB 4DRVA 2W6IG 4I55B 4EROA 3NV4A 2ZJCA 2LGQA 1FXKC 4XFBA 2HG5C 3RSJA 4KHPO 2VVDA 1PX3A 1FFXB 3K3WA 2JG9A 1PP9H 5C3RA 2O0OA 4XABA 3HIFA 3I3QA 1YQ2A 1CP9A 4Y26A 1JYIA 5HCFA 1GM9A 5KA6A 2ZGQA 3LEGA 5GM0A 1D5NA 2E76B 1LCLA 4GKXA 4XZUG 1UJWB 3OEHG 4XFCA 4BHPA 4JI4O 4MVTA 1CN1A 5FPZA 1VBE3 3MW4A 1VBC3 3CCLV 2DCKA 1CR7A 3MHHC 1KP3A 5LP6B 2RVAA 2TBVA 3WDUA 1HV1A 4WM7B 3HKDA 1Z7S1 4FTEA 3HKCB 1LOFA 3KCYA 1SBFA 1AR71 5KC6A 4JTNA 5DABA 3JB4C 3AZXA 1DQ1A 5DEDA 2H6BA 2JKXA 2XQRA 1SLBA 1Q6UA 4FPYA 1BEV3 1WW5A 1UU4A 1DQ5A 4DXSA 2HWD2 4Y4YA 4E9KA 2VL4A 1VQLV 2UWAA 3HPLC 5KA5A 4QX1A 4OCTA 2HP8A 1LRHA 1GZTA 1AILA 5CFCC 1NXD1 2W9XA 5FZ0A 3K79A 4FSJA 4AFCA 4B4PA 5J09A 5CA0B 4COZA 3VZJA 5H2FZ 3ZIXA 4OI2A 4NIIA 1F35A 1FFTB 3N4MA 4C91A 3CNAA 2WLHA 3ROUA 1V6OA 1WCUA 3KVBA 1FMD2 2FDFA 2QQWA 1TVGA 3VL8A 1S0EA 3RWKX 4OI1A 1FJGO 1QJY2 4BK4A 1YO8A 4OI0A 5FP9A 2ILMA 5F5QA 2IXIA 4XTMA 4FTSA 2VZTA 3C3TA 2XPJA 1W8OA 1WLDA 2QKCA 2JDHA 2QQOA 4ES8A 4KHPB 4TUYA 2VNGA 3O1RA 4KWLA 1ZRRA 2GALA 2QKSA 1RSOB 1V55B 4LORA 5HFMA 1YJNV 1AXKA 2MHFA 2DYSC 3LFIA 1U96A 3DPRA 4UBGA 4JAAA 4LR3A 4EFBA 2HWD1 2HWF3 1DTOA 2QQUA 1FT9A 4DV2O 3UKTA 3ETPA 1YFYA 5ACA2 1TME1 4QPIB 5FP7A 1W6PA 4LTAA 4CCCA 4HSJA 1YTFB 3STZC 4PDWC 5IAVA 3BY6A 3B94A 3CXHF 1YI2V 4G4FA 1TQ5A 4BLIA 1CX1A 2IJIA 1L1FA 4E27A 3CMAV 3T30A 3BA9A 3I56V 2QR4A 3CS5A 2XAFA 1FMD1 3BIWE 4W6YA 1WMXA 4P9JA 3ZFEA 1I6XA 5FPBA 2R072 4LP8A 2JJ6A 1W39A 2E3CA 1QJY1 2LUWA 3POBA 2R9IA 1A8DA 3KZIZ 4J10A 4U3FH 4MGZE 5BXZA 3EHBB 4GX2A 2W1QA 2EILB 5JOWA 3KV5A 2JJ1G 3VLBB 3THCA 4JTOA 4JI2O 2O1QA 4H13B 4BWAA 3BU0A 3O1UA 4UF0B 3QVNA 1FJGB 4Y1VA 4P9WA 1RUE3 4YY3B 3ZXGA 5CISA 2UWBA 2YMZA 4N7IA 5JI9A 4BQ3A 2ZNIA 2AACA 5L3GA 3J9SA 5A32B 1PV0A 1FYJA 4X88A 5A33A 4X20A 4YM1A 3MUZ1 1Q56A 2F4LA 4QXCA 5C4WB 1JU4A 4LF9O 2RDRA 4K3AA 3C7FA 4D7TA 3GXUA 4MW8A 3UCSC 3E89A 1LOAA 5FAXA 5J2TB 1UX6A 3DC5A 2VO5A 1ASJ3 3NR7A 3I2IA 1Q7YW 3V64A 2W52A 2YROA 2QDRA 2G9GA 4P9OA 1QJU2 2ADQB 4ZIBA 5FXVA 5D21A 1REDA 3LEMA 1RMU3 2VZSA 4GZRB 3QLQA 4D6SA 5FY5A 2WLIB 1SDWA 1XE0A 5EBLC 1MQTB 3RJ2X 4Q4Y1 1EYBA 2R071 1YLLA 3CJIC 3M7MX 3RYHA 1IS3A 3QH6A 3USUB 3VQWA 1EZJA 4NTYA 2BNOA 1NH2B 2YXSA 2WNUC 3WW1A 4DR2O 3GCXA 1V6KA 3V0BB 1H8TB 2AXTZ 1WLWA 4IV3A 1Y74A 3WDTA 2WYFA 1RUD3 1SZBA 3ZO0B 3UNPA 4JKMA 2GNBA 4CEWB 3LKJA 3ZN4A 4PF5A 1ZYBA 1P49A 4PT6A 1KGYA 3CRCA 4AHXA 2Z3YA 2VWKA 1UU5A 3WSOA 2IXJA 1CXZB 2EIDA 1ZM1A 3CP1A 2FQPA 4JI2B 1JMUB 2EIJC 1RTVA 1S3JA 4XACA 2VW1A 2OIEA 4M3CA 2PYLA 4CDUB 3L2YA 5ABJC 3AYCA 2P5OA 4OMCA 2CTPA 3ZSLA 4ZZ5A 4ZHNA 4OYUA 1QJU1 2OIIA 1C5IA 1NR1A 3BGAA 4XZPA 2QSAA 4ABMA 3VZLA 1VBE2 3NJZA 2VE1A 3LA7A 1PMHX 5AVPA 5FY0A 3ZFFC 2D6PA 2P3KA 3OMNB 2DYRB 4RYDA 4XF3A 2PLV2 5FMOS 1XQNA 3FJSA 4LF9B 2W0XA 2D6LX 3W58A 4OQ8A 5K1XA 5FJHA 1B35B 1S0DA 3VB9A 5KHGA 1GYKA 3LNNA 4IE0A 1LR1A 2W2IA 4X89A 4Z1VA 3MGUA 4GIQA 2BVVA 5JR7B 1QJX2 5HBAA 3R0RA 4AGVA 3WG3A 2E53A 4K9SA 3M4FA 4YGCA 1YI9A 4LO7A 2AGAA 4MTXA 1RUG2 5L3EA 2NQYA 1RIRA 1RVF3 1UY0A 1D5AA 1WW7A 2VQTA 4LO6B 1S55A 1MS0A 1BHAA 1D2DA 1RGSA 5KUMA 1ULDA 5JUVA 3OE7G 2VNRA 2VMFA 4O4HB 4WFEA 4IE7A 5T5JA 4F83A 4ORFA 3V0AA 4DR2B 1XYOA 2YUEA 3FLTA 1EFRG 4FAGA 4EZHA 3WQBA 5LY2A 3GZAA 1PGL2 5DQ0A 5IJ0B 2BZDA 3OG2A 4KXRA 2JEMA 1EBOA 2IFWA 1EV13 3NJXA 3JALA 2XVKA 3IT8A 4LOSA 2VBBA 4JASA 3A4UA 5FUNA 2C9KA 2V4AA 2YIAA 3DL3A 5LA0A 2ORZA 5BNOB 1VBE1 2WWJA 3EMRA 1VBC1 4OXSA 4IEVA 4UAPA 3H42B 1I0HA 1OPOA 4H2AA 2PLV1 5JOXA 1X82A 3THDA 2GC1A 1Q6HA 2P6JA 4FLVA 2WS93 4BQWA 2NLRA 1BK1A 1POV3 4XF0A 4TV8A 1HDJA 3APBA 4OI4A 1KECA 4R9AA 1G9CA 1N33O 3UETA 4UVBA 2MW2B 4IHJB 3RMYA 2V1DA 4DV1O 1RUG1 2XWJB 2ZZJA 2ET1A 2YEVB 1HXS3 1EUTA 1UKGA 1HX6A 3FUQA 4O4LA 3JD73 2QQLA 4MGTA 2YG0A 3KF5A 2D5HA 1BKZA 4LE4A 1AR92 2XHKA 2O8OA 1ONAA 4XJ8A 2YIDA 4DUVA 2FDGA 3KLSA 4AVBA 3JUUA 5LP6C 5GW7A 4XILA 1V00A 4WM7C 5JIAA 1PGL1 2R063 1GZWB 3W5NA 3VDCA 4JI8O 1JPXA 1SQ4A 3ES4A 1KC8W 4FFBA 3NQHA 3LD8A 2HEYF 2P4EA 3JD4A 2YV8A 1NY71 4FM2A 2ZEWA 1O5UA 2QBXA 4FBFA 3V65A 1LOCA 4YW5A 5F9TA 2K1EA 2YXYA 2QDOA 1K7DA 4QKFA 2IM9A 4K1ZA 1QR8A 5A1FA 5T3NA 1ND2C 5FZBA 3M99B 4QPKA 3Q4HA 2X53S 2WFPA 4BIFA 4M00A 1JQ0A 3ABZA 4AQYO 5CFDA 4A6SA 4CP2A 5F3IA 3KT4A 2IU0A 5FZOA 3AG3B 4NKGB 4QXKA 4K8XA 3OGGA 5K8SA 5C9AA 2LW8A 4YHHO 3UQ8A 1QNWA 2VQEB 4U36A 3AKPA 4DB5A 5DZGA 3RYCB 5FWJA 2A0LA 1HB4A 1D4M3 4GX5A 2G19A 4LA2A 1ZL8B 3B01A 3H3LA 1X7NA 4WCEV 1H0BA 3VBFB 4NPRA 1ASJ2 2Q68A 2VU9A 5LBQA 4Q4V3 4QKDA 3CRAA 4OUSA 4Y22A 1AL23 3LPFA 5FPRA 1OJHA 3E5XA 1AJNA 2UYBA 1N33B 1GH6A 1EN5A 4A2UA 5C8WA 4O7XA 3KB5A 4LNVA 2XG3A 4GKKO 3B69A 3B3QE 4LF7O 2E32A 4DV1B 1RMU2 5FYZA 3U0ZA 2F17A 4F8AA 1V55C 4ES9A 1IBMO 5BMVB 3O65A 1OLME 2J22A 5A7QA 2XL7A 4H14A 5J2UB 1UF2C 1PMIA 2ZR2A 4I50B 4UUJC 3FB6C 1GICA 3RBZA 4AI2A 2QQVA 5FNVB 1PGSA 3ABLB 4JHZA 5JCOA 4QPIC 2F95B 1OD5A 3ZHSA 3OPWA 3C3VA 2GV9A 1TA8A 2F4VO 1RUD2 2XOMA 5FKBA 3SLIA 1O91A 3ZYPA 4BQ1A 3T4ZA 1THZA 4EN7B 1XBFA 3K2OA 1RL3A 3ZDSA 3B2EE 1TNFA 5HXVA 2YYOA 3EFFK 4Z1MG 1DGSA 3MF6A 5T54A 3BI3A 3ZDVA 2EALA 2Y4UA 4AHZA 2ZAHA 2Q5ZA 2FMDA 4FFIA 1W6NB 2ZGPA 2BOIA 1PO23 3M8AA 4TT3G 3SH5A 3J4UH 4ZZ8A 4AQYB 3TK1A 1OUSA 1XHXA 2CDOA 1FKAO 4JDOA 1ASJ1 5FY8A 5FPOA 4Y20A 2EILC 1V6NA 2Y6GA 4W50A 4YHHB 5LBEA 2BCCH 5DXDA 3OTFA 3GB7C 3ZRSA 2ZABA 5FY9A 1CX4A 3SISA 3HEIA 1RMU1 3JQWA 1HW7A 2DU1A 4DPNA 5L3BA 1DYOA 3NW4A 2P4KA 1FXZA 2A3WA 5A3TA 4YJ2B 1KJLA 2YPJA 4UB6Z 1M1KW 1KBHA 4QX2A 4N9IA 3FMGA 3CCRV 4K20A 3N3HA 2GH8A 4GKKB 4LF7B 4UCRA 3RZGA 5C4WC 1EM1A 4BW9A 2WO1A 4DMIA 1KXGA 4K6BA 1RUD1 4H0LB 2KG7B 4AXOA 1V6IA 4QX5A 4YG3A 2YSUB 2W0FC 3BPZA