4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neuropeptide
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
3B02A 2EA7A 3LOIA 4H7LA 2PAKA 3TNQA 1TQ5A 4D7TA 1NE4A 3CF6E 3RDIA 2MPFA 3CEWA 4L11A 3SHRA 2QDRA 4ZU4A 4MGYE 1NE6A 4FT8A 4MX3A 5KHKA 1XE8A 1DGRA 3MDPA 1U12A 5LEJA 5BPXA 1NXMA 1ZREA 4IEUA 3RYPA 2O8QA 4RD7A 5BUVA 4L2NA 1LRHA 2IXJA 4QX5A 4IESA 1O4TA 4KWJA 3CLPA 1GQHA 1J58A 4WZCA 3ES1A 4FBFA 1ZRFA 2VECA 1SFNA 3SXWA 1QXRA 2GC1A 4HLTA 2EVXA 2OPKA 3G7DA 2PQQA 3H50A 3O14A 2GH2A 3U10A 2QVSB 4K8FA 3HT1A 3L2HA 1RL3A 4LA3A 1Y9QA 4QM8A 4YRDA 3WW4A 2WC2A 1O3SA 2CAVA 3QOPA 1LKNA 1CAVB 1QWRA 1FI2A 4LLOA 4E2SA 4Q0SA 2FMYA 3DL3A 2H0VA 3DN7A 4YYOA 3HT2A 3E5XA 4LTAA 5FLHA 3SCHA 1CX4A 3ST7A 3FX3A 3NL1A 4UXAA 4OLLA 4YNIA 1O3QA 1RGSA 4O9GA 3CL1A 2OA2A 4IEWA 1PMIA 1WGPA 1ZRRA 2DCTA 1PM7A 3PVBB 3GYDA 5K8SA 2I45A 4QMAA 4JTOA 1EPZA 2UY9A 3ACLA 3C3VA 4A2UA 1Q43A 4LUMA 3CO2A 3PNAA 4ONUA 5T3NA 4IEVA 4Q29A 1I6XA 5I0RA 4P9GA 5J48A 3I54A 2UY8A 3BU7A 4R8HA 1ZVFA 3NKTA 4QGNA 3M70A 1YFWA 3H3ZA 4GULA 2XL7A 4XFGA 1O3RA 4Q0PA 4E2GA 2D40A 2XL9A 5KHHA 2F4PA 3E6DA 3BPZA 2HJIA 5C6CA 1VR3A 3HQXA 5BY5A 1LB2A 1J3PA 5FCCA 2QNKA 1EY2A 2CV6A 3RPQA 4HSLA 3ELNA 4EWDA 2D93A 2Q30A 4YSFA 2QCSB 2IC1A 2PHDA 3FWEA 1IPKA 1HW5A 4Q0VA 4IERA 4BIFA 3D0JA 3SCFA 3UKVA 1JUHA 2MNGA 3EQEA 3H8UA 2IXCA 5FPXA 1ZNPA 2IXLA 4XFIA 3FZ3A 1O3TA 4IEYA 3WW2A 3VHRA 4HSJA 5CU1A 1ZZCA 1X8EA 5FQ0B 1J1LA 5I93A 3KGZA 4KWLA 1RTVA 5JR7B 1CAWB 3E6BA 3FJSA 4EWEA 5I0SA 1VJ2A 4Z82A 3S7EA 4WVZA 1UIKA 5E16A 1NZCA 1FT9A 4MUVA 3RYKA 4AQ2A 2UYAA 1X8MA 1UPIA 4AXOA 2XHKA 4QXKA 1Q3EA 1UCXA 3BCWA 3H1MA 1CAXB 3IIAA 3OF1A 1I5ZA 5LEKA 5FLJA 5FQ0A 1DZRA 5FDBA 5CADA 4XETA 3S0MA 4IEQA 2XGXA 1CAWA 2PA7A 3FFQA 4FAHA 4I02A 3KCCA 4HN1A 4N9IA 4EV0A 3MZHA 2KXLA 2GZWA 3LA2A 2OYZA 5EZWA 2UYBA 5I0TA 1VP6A 3OCPA 2C0ZA 3H7YA 5JSRA 1J3QA 1CAXA 5C8WA 4HVRA 4MGIE 1O5LA 2QJVA 4LUKA 2CGPA 4I0AA 5JAXA 1XRUA 3RNSA 2XKOA 3WW3A 4LULA 2PYTA 1L3JA 3NSTA 4MGKE 2D5FA 1WLTA 5KHIA 1QY4A 1YHFA 4O9EA 1CGPA 2D5HA 3USSA 3H7JA 5I8YA 1G6NA 1RUOA 5BV6A 4AVCA 1O5UA 5J7MA 4X6QB 5HI0A 1CAUB 2WFPA 2GC3A 1ZZ8A 4XF0A 2Q1ZB 4XFAA 2IXKA 2PHLA 2XKPA 4ZU5A 3OTFA 1X82A 3E5QA 3LWCA 1IPJA 4LA2A 2PAEA 3OGJA 3H1YA 3LAGA 5I91A 1DZTA 2Z69A 3IWZA 3BALA 3D0SA 4Q0UA 5KHGA 4IEOA 1CAUA 2GAUA 5FPZA 4XF3A 3EO6A 1EYBA 2IXIA 3N4MA 2B9UA 3UKNA 4J1XA 3SCGA 3WW1A 1OI6A 2Y0OA 4META 4X6RB 2ZKLA 1Y3TA 2XLAA 1UIJA 4HMZA 5I0UA 3H9AA 4QM9A 1ZRDA 3ES4A 3ETQA 4BHPA 3PLQA 2B5HA 4KU8A 4QGLA 1O7FA 4I0BA 4Z07A 2BNMA 2FQPA 4IEPA 1YLLA 1Q5OA 1YUDA 3U11A 4LEJA 5JSPA 3KGLA 3I7DA 2MHFA 5LRRA 1UW8A 4IEXA 4KU7A 3H1WA 2BNNA 4AVBA 2GC2A 5JSOA 1GQGA 3S7IA 2B8MA 4HVQA 5F1RA 4AQ6A 2K0GA 4JV4A 1QXJA 3QACA 4PIZA 3R6SA 4XFBA 1UD1A 2EAAA 4XEZA 1ZRCA 3OD0A 1OD5A 2BYVE 1NYWA 2ET7A 4XF4A 4HN0A 5D1IA 3NJZA 4R52A 4N9HA 2HKXA 5LRSA 2V09A 2N7GA 5EFUA 1DGWA 4XFCA 2BNOA 4DINB 4BYYA 4KL1A 3IDCB 5I8SA 2ETEA 4HVOA 1SEFA 3EJKA 1X7NA 3FE5A 4I01A 4PJYA 2BEOA 4ORFA 2ATFA 1H1IA 5KBFA 4EROA 4QGMA 3BB6A 2PAMA 3TNPB 2PTMA 3MPBA 2VQAA 4XFHA 5FLIA 3UKTA 2E9QA 5AVPA 1OFNA 1YFXA 2H6CA 3RYRA 1WA4A 4MGZE 3RZZA 4JVAA 1OMIA 4I09A 4E2QA 5KHJA 2PFWA 4JTNA 5J3UA 4UBGA 4EWAA 3EHKA 3SMHA 1ZZBA 3D82A 2XLGA 3E97A 2P17A 3EBRA 4MH0E 2Q0AA 4PIYA 2ET1A 2OZJA 4CYDA 4BH9A 2BGCA 3KMHA 4ZU7A 4NVPA 1J3RA 1EP0A 2OZ6A 4XF9A 3E6CC 2IXHA 1CAVA 2GU9A 1ZX5A 4WBBA 3IDBB 4J1WA 2XLFA 3JZVA 1RC6A 1J59A 3M3IA 2Q4SA 4I2OA 4HBNA 4UBHA 3I59B 4KWKA 1RUNA 1ZZ6A 1XE7A 2GC0A 3E5UA 2CAUA 4PIXA 4IETA 1FXZA 4OFGA 4TLFA 3MYXA 3HIFA 4FAGA 3NW4A 3ROUA 5E1RA 4MZUA 1ZZ9A 5CVRA 3ZDSA 3DV8A 5BXXA 4B29A 1H1MA 3IBMA 2K9ZA 4MV2A 4XF1A 3LA3A 5JCTA 1YFYA 3U0ZA 4IEZA 4D7SA 3I59A 3NVCA 4Q0QA 1ZZ7A 2Z2SB 3DKWA 1SQ4A 4AVAA 4YARA 3CJXA 3LZZA 3FHIB 3GBFA 4F7ZA 1YWKA 3LA7A 3KSCA 5I8TA 4F8AA 4I3PA 4HZFA 1LR5A 4XFFA 1V70A 2O1QA 2ZCWA 2VPVA 3H3UA 2H6BA 1YFUA
chains in the Genus database with same CATH superfamily
3LSEA 4YVSA 4KMQA 3MW3A 5HXMA 3OBTA 2YXLA 4IV1B 1BZKA 2IUWA 4ZU4A 1K34A 1PL0A 3DXRB 4AE2A 3WU2Z 1NXMA 1UMHA 3RYPA 3CCMV 3GZEA 4IESA 1H8VA 4NTXA 1H9WA 4KWJA 5HCFA 2Y0PA 1N0NA 3L75H 2ZM6B 2W3JA 2JDUA 1US6A 2WYSA 4UFKA 1PK6C 2GTSA 2W0XA 3UK9A 2VCCA 4CCMA 4J6GA 3FYEB 1QWRA 2Y26A 2YFZA 3E5XA 5FLHA 4B3RB 4I9WA 2UUBB 3J7HA 1NVPD 4ASMB 2Q8OA 3ZN1A 1GWLA 2DCTA 2XNDG 2VZRA 1CZSA 3Q8AA 1REEA 2ZPXA 2WSUA 3NNLA 4GX2A 2ZHNA 1KJRA 1XREA 1BS3A 4XHXA 1N34B 4XBQA 4AGGA 4QX0A 3VD3A 3U75A 2FZ2A 2JG8A 4FFIA 1RPRA 5H9PA 2P22C 1YFWA 4GULA 2ZGQA 3ECQA 3ABMC 1Y74A 1OUXA 2RDSA 1VP7A 5KHHA 3HKEA 4DV2B 3E6DA 2AHZA 1ZX3A 5DABA 1S0EA 5F32A 4MTXA 3SJBC 1WPBA 3GB7C 4DV0B 2Q7EA 4CZZA 4C0BA 2VQFO 1YITV 4R9BA 2HWD2 1W8OA 3BABA 1IPKA 1HW5A 3RGBA 5C5TA 3SCFA 1KEXA 1KECA 1H1AA 1NJIW 1W2TA 4IEYA 1JYIA 4HSJA 1MSDA 2CUGA 1AI4A 3LEIA 3ZLIA 5D5PA 2VMHA 2JG9A 5BXZA 3KT1A 4MUVA 1L1FA 1UPIA 4ZS3A 4NTYA 1UX7A 1SS3A 3T0DA 3O1MA 5L19A 1VQPV 5FQ0A 5JOXA 4AL9A 4HN1A 1AZDA 1JU4A 3MAQA 4Y5Z0 4D6QA 3H8XA 5A1AA 2W91A 1STMA 1QJY1 1CAXA 1OFSA 3WB0A 1O5LA 5LA0A 1XNRO 2JICA 2JECA 1APNA 5JAXA 3NAPB 3E1F1 4DEVA 2D5FA 1R1BA 4FOVA 5B2GB 5AG2A 1EAH3 1C1LA 1MEC3 1RUOA 2WFPA 4W6YA 3WQ1A 3LEGA 2QKDA 5ABJB 1N32O 1MA1A 3E5QA 3PURA 1GWKA 2RR12 1KMIZ 3SNMA 4LCUC 2JDNA 1PO11 4IGOA 4F3JA 1QLEC 3ACIA 4OHVA 1YJ9V 5LCWL 1HB1A 2OT7A 4TV9A 3WP6A 3WW1A 1HRV1 2BOIA 4AR2A 4K8RB 1RUG1 3HB3B 1ZRDA 1H2SB 2VW2A 3ETQA 3D3QA 1VAKA 1O9HA 4FLVA 1XUQA 2ZHLA 4LEJA 4RGGA 3S5QA 3LF7A 4LFBO 3ACHA 4HYOA 5KX5A 2WA4A 2K0GA 2G38A 5LB6A 1GKFA 2BTVC 4QHBA 3GF6A 5LASA 5KXCA 3AG3B 1OCCC 2J1RA 4JI7O 1OBNA 1GZWB 2AC1A 2IWGB 5E8AA 4Y22B 3IDCB 4L99A 4Q1RA 1HJFA 4KGGA 5EIYB 1NLRA 3AEIA 2W92A 2VD7A 2VL4A 4MO3M 5F3CA 2B9VA 5IVEA 5DAQA 2PTMA 1LOCA 3UO3A 2WN2A 3TEXA 2E9QA 2J1EA 2B42B 4W8JA 4MVMA 2IBZH 2XG3A 2AZ2A 4L8JA 2HHHO 1SCSA 1FYUA 3JD0A 3F95A 1TUBA 2UXCO 3OGCC 1SA0B 2HJFC 4MVOA 2WT0A 3EBRA 5C8CB 4A7KA 3APOA 3C2UA 4KFMA 4IE5A 4I55A 4CU9A 4NVPA 1G7YA 2R6QA 2CNAA 4XJZA 4DRVA 1PO23 4YW4A 2ZXWC 5FYVA 1V6JA 2GNMA 3PJSK 1LHOA 1TME3 2OKXA 4CP0A 3E5UA 3AFGA 3WB2A 4UW4A 1KFUL 5E88A 2JGDA 2ZR2A 1QQP1 4D0QA 3ZDSA 3H8OA 5C71A 1VAMA 4KXRA 1VAVA 2JEXA 2RG4A 3SEPA 1SMVA 1BT8A 1SQ4A 3ABUA 3O65A 1KITA 3LA7A 3WOGA 3CBNA 5LY2A 4CCLA 5EZYB 2Z79A 2JXAA 2EA7A 4CEYB 3DPRC 1REDA 5DAXA 4RQPC 3PU3A 3OYWA 3WZ1A 3QCWA 3ZIWA 4JYAO 5ACA3 2ZX2A 5ANNA 2DJVA 1CWPA 1U12A 4N53B 4IEUA 5J36A 4DV4B 3DYMA 3MEPA 5BUVA 2AR6A 1FV3A 3C3TA 5IAVA 2D6MA 3RRDA 2A73B 1NTMH 3RI8A 1J5EB 1J58A 2CY6A 1UL9A 3E83A 1MS8A 1I7FA 3SXWA 1UU5A 5L3EA 4K20A 5FAXA 3KS7A 1CZTA 5FBZA 1YSCA 5A7WA 4DW0A 4K35A 3WW4A 2R062 3KT7A 2QEXV 3IAYA 1OHHG 2P90A 4AI8A 1R082 3DN7A 5JPNB 5KUMA 1NTZH 5HXVA 1R092 5E79Z 2UXBO 3EMRA 4XUTA 3RG0A 2LW8A 2A71A 4ET7A 5FR3A 3ZN0A 3JATB 1GR3A 1PM7A 3I55V 4NOTA 2ATKC 3RJ2X 1RUC1 1HQWA 1XOYA 5LHGA 3ZHQA 1VRH3 1YNAA 2Y48A 5IK7A 2XVKA 1S0CA 1XDCA 5FZAA 2RVAA 2HWE2 4ZXEA 2DWEC 2AENA 5DUUA 2UUCO 2O0OA 4YLZA 2Y0IA 2Y4TA 2D40A 2ZEWA 4K21A 3ZMUA 2RN9A 5BMVB 2BFUS 2HWC3 3KD4A 4ATFA 3OAAG 4XPVA 2QWNB 4JF3A 1DDLA 3WT3A 3J80N 4ZI7B 3CJHA 4J10A 2QTWB 1LNSA 3ZYIB 2RS13 4M0HA 1GOFA 4URAA 2RM23 1RUD3 3D5OA 1YO8A 3WDWA 1ZBE3 1OLRA 1EN4A 4M3CB 4EN8B 3RT3C 1NOVA 1VJ2A 4GLXA 4DR3B 1G8WA 4NB5A 1D4VB 4QXKA 4XZPA 3H1MA 2GSMB 4Q4X3 5FZLA 3O1VA 1Z0HA 1K4DC 2PA7A 3H0OA 3W5NA 1MNGA 2YSUB 2BGOA 1FAYA 3JQXA 4EB6A 3JD4A 4NRPA 2WSVA 1NR7A 1OA2A 1IURA 3ASNC 2KG7B 1JODA 4DR5O 5GONA 1NA1A 4R4ZA 2OIGA 4COUA 1XNBA 5IUQA 3MW2A 4BU2A 3CCVV 1I94O 3L9JT 1H2MA 2WNEA 4YW2A 4LBKA 2ZXQA 3J4UH 1JXNA 5CNAA 3UQ8A 1QY4A 2R7EB 5JDBA 1ST8A 4OQ8A 4FPYA 5JH7A 2ZM6O 1W2AX 4RS5A 3K03A 2E33A 2JDIG 2QKCA 4FOYA 3KZIZ 3VBBA 3MIBA 5I91A 4OI2A 5IYCO 4K7JA 5KHGA 4IEOA 4D6SA 2QWPB 2QM8A 2VTFA 5A70A 2Q73A 3H42B 2XDVA 5A32B 4WM8C 2IXIA 1EV12 2WUHA 5EYPB 3UKNA 3ZFGB 5LK5A 1K5MC 5EXOA 3ZHRA 4MVUA 4RR3B 3TCUA 3C7GA 2FD8A 1J83A 4MVQA 1JHJA 3CJIC 1SBFA 1S0GA 5AC91 1G86A 5LA6A 3WDUA 5LK7B 1G1XB 4LHNA 4FZ1A 3AC0A 3H1HH 4CSWA 5JMCA 2ZMLA 2Y69C 5FY1A 4BB3A 2B8MA 4CDUC 3CRMA 4NXMB 1D2QA 3R6SA 1ND3A 4DK1A 4O2AA 4XFBA 3ZMSA 1BHGA 4XEZA 4H44B 4IGGA 1KFXL 1ULDA 2Q8EA 1KGYA 2HBTA 1QU0A 5D1IA 5IY5C 1GUIA 3NJZA 5CKMA 5IK5A 2Y69B 3JARB 4DV0O 3FE5A 1F5FA 4ASLA 1DQ5A 3GCWA 2JRIA 1RHI3 1VQ5V 4ZONA 5H9RA 3VB9A 3O1RA 3A22A 1JCHA 2ZZQA 4TT3G 2NMNA 1RSOA 3RYFB 4AG4A 3K3NA 1WA4A 1VBA3 4LR4A 2JE9A 5LXTB 3NWKA 3FFZA 3TXQA 1Y9GA 2C9AA 5AFEA 1OHFA 2RCVA 2E75B 1FPOA 1UYYA 2ET1A 2GNDA 2YICA 5FTTC 1GMMA 3ZMZA 4S2HA 4CYDA 3N9QA 2L35A 4R6ZA 1Z7S2 2UU8A 2IXHA 2GU9A 4J1WA 2PHUA 3IMMA 1C8M2 2XAFA 1R1ZA 4KWKA 4A5UB 4A42A 4CP9A 1D4M2 1W6PB 2XJRA 1OCZB 2C24A 1VBE2 2W6JG 1RUJ1 5GTIZ 4MHRA 4JZ2A 4O4HA 1GN2A 5DM6V 3LDRA 1PHMA 1HXS3 2BCCH 2VZSA 3NVCA 3I59A 1EPWA 5CN0A 1TE1B 4X88A 5IJ9B 2XB6C 4DRRA 4FQ4A 4I3PA 4FPFA 4DV6B 1HX6A 3FB7C 4C91A 1JZ8A 2FDIA 3MUZ1 3CU7A 2BBVA 3APBA 3H8RA 4MSVA 1VPHA 3CE2A 4GB33 4RSUA 1DGRA 3K5OA 4CCEA 2A3XA 2QQLA 2DVFA 3JBG3 2O8QA 4UFLA 2WZEA 1ZL8A 2LTNA 3UGHA 1LRHA 4E2LA 3WUCA 3N35A 1VQNV 1L0NH 1VF5B 3K59A 2BBAA 5CG9A 2WQ4A 1Y76B 2OPKA 2PQQA 1F9KA 1R6TA 4YW7A 2ZABA 4HKOA 1P84F 4LFCB 2PHWA 3D3IA 4IV3A 3ZX7A 1ZRIA 2ZTNA 3FLPA 3AK1A 2XBO3 4OLLA 5JVVA 5T52A 1FS0G 4IW3A 3EVKA 3T1HB 3T0AA 3D6EA 5FZ8A 3C7HA 5CAZA 4YVSC 4GWNA 3OEAA 3CMGA 2N05A 3M3OA 5B5EZ 2EXJA 4H7MA 4K0KO 3W58A 2HR3A 3PNAA 4ONUA 4DR7O 2VGDA 3VBHB 5I0RA 4YM1A 4P9GA 5J48A 4WVMB 3U14A 4C7UA 4LFAO 1UOGA 3E8BA 5JQGB 1TEIA 4BJ0A 3RWRD 2X5IA 4ZY9A 3OFNG 4E2GA 1BK0A 1DLLA 1LCLA 2W68A 4KUMA 3ETGA 3T4VA 2Y6GA 1EY2A 4XW3A 3CRAA 1OJHA 2CDPA 4MLOA 5T50A 2QE7G 3QD6A 2ZZJA 2BFUL 5APAA 1WN7A 2ARXA 1A8DA 2UUAB 3SITA 4IERA 1ULCA 1NG0A 3HNYM 1QHTA 1AP5A 4UFJA 4FI9A 2LGQA 1QJX1 2IXLA 1I5XA 1O3TA 4QQHA 2Q0OC 4FLTA 3RMYA 3SPHA 1X8EA 2PQSA 3KGZA 1RTVA 4GWIA 1CAWB 1UNBA 4DZGA 3DTUB 4ZBMA 2R073 5JZGC 2W9XA 2GMMA 2IJJA 1JOYA 4NO4A 2ZT9B 1FMD1 2UYAA 5A6QA 2BTQA 1PL4A 2XHKA 2EULA 5K9YA 4KP4A 2DCJA 3IFXA 2QUOA 2LW7A 2WAMA 3S0MA 1GK9A 4D3WA 2JG8C 4XJAA 5F5AA 5IYZA 1WP8A 4V2WA 5AFBA 2QZ2A 3OOXA 1QEXA 3DUIA 4LJHA 4MYEA 3WP5A 1AXKA 5F5IA 5BNPA 4XQWA 3H7YA 3TEYA 4LUKA 4BMEA 5CISA 2JG8B 5LA2A 3WW3A 1Y6XA 3J26N 3O5SA 3OUIA 4DUWA 3H1JH 1VMJA 1HB4A 1Y74B 4CP2A 2WPDG 4XQ4A 3AB0A 3CKHA 1E5RA 2CSGA 1GMGA 3VDBA 5FZOA 4RYDA 1VB2A 4HANA 1CQ9A 1P4RA 1DZTA 2JG9C 1UPSA 4QDSA 1Y4MA 4P5YA 3EB7A 3GCXA 2DBIA 3SDLA 3ABLC 4H55A 1BBT2 4QPGA 2LW1A 1F7YA 2OQ7A 2Q7HA 1EZJA 4GMP3 2ZIOA 1WCKA 4P9LA 2HWB1 3I3EA 1WCQA 1YZBA 3D8CA 1GN6A 2CTRA 2EBOA 2GDSA 1YIJV 5CFDC 2LJ2A 4BW9A 5DN6G 1GQGA 1O8PA 2HLDG 3HQUA 2ODMA 3MIGA 1M93A 1NZ6A 1MOFA 3ZR5A 1UZWA 5F6LB 4P2ZA 4DUZO 4P14A 1TMF2 2WS93 4FTBA 5I8SA 1WPXA 4DR4B 2OTJV 1VBC2 3ZYHA 1QGLA 2BPA2 4WM7A 1KS5A 1FV2A 5F37A 3TNPB 5J9PC 4TV8A 2EILC 5A6YA 3MIDA 1OMIA 2Y6FA 3JUUA 3AM2A 5FZ7A 1PGL1 1UKRA 3G67A 4AI2A 3Q8BA 4BAYA 4Q4W2 2EIMC 4RQFA 3JAKB 3ZMNA 4LHLA 2DWDC 4O61A 5BNOB 4C1XA 3I56V 1OCRC 4AF9A 5H6RA 3U78A 1OURA 3JB8A 3UM7A 4YW1A 3AYCA 2WNUA 3V0AA 2ZKOA 4B3SO 2UU9B 4FXGB 1PGW2 1BEV1 2YV8A 2VO5A 3ZSMA 5BXXA 5KX5B 5D8AC 5FMBA 1YFYA 4A44A 3MIFA 4JI4O 3CJXA 4B4RA 3N9LA 1JH5A 5E89A 4EYUA 1QR8A 1OH3A 1V70A 2O1QA 1F4MA 5FYYA 1DQ1A 1ZBA3 1SBEA 3OY8A 1HJGA 1TQ5A 3NV1A 1RXGA 4BMBA 3CEWA 4OI0A 1DLCA 2EINC 4JYYA 2ZGRA 1LJ7A 3A21A 2MEV3 1D0HA 3OGGA 1HNZB 4CH3A 2E7QA 3A2FA 3JAMN 1QLNA 3K9AA 3AG4C 3GWKC 3Q4HB 4CEWA 4E4HA 1JI6A 1UY4A 5FZHA 3SKJE 2XVGA 1EFRG 1QJFA 1ZLZA 1SG3A 3RZHA 2G9ZA 4X9QA 3BAAA 3N9OA 4YVWA 2ARBA 1DIWA 4IE7A 1A32A 2ADDA 4I5SA 4K8FA 1FNZA 2V1DA 1JA8A 4LA3A 2FL4A 1Y9QA 2K2SA 4N43A 1ENVA 4P9WA 1LENA 2R9RB 3K3WA 1CPNA 5FY8A 1XB9A 2ZAAA 4XURA 4KWUA 2X6CA 4A3XA 4CXXA 3G6BA 4YNIA 4NXMO 2CTPA 5FPUA 4DV5O 2JD4A 1UAIA 4OUSA 3ZRVA 1WW4A 4MGSA 4HETA 4DYLA 2UY9A 4K3UA 3X29B 5FP8A 3T2MA 2GBOA 2YXHA 3N36A 1SF9A 4DV7B 4ASKA 4E8CA 5FL7G 4U3FH 1YXBA 3ICXA 5IK4A 1MZFA 4L0PA 2WLKA 1Q90D 1WMEA 3PN1A 3NKTA 1WMXA 1R1A2 3B8NA 2P37A 4HL0A 4G3YC 4PT6A 1F2NA 1PP9H 5BNNB 2A6ZA 2W0FC 3BPZA 5BY5A 1LB2A 1CVNA 3MO4A 5EJZB 4HSLA 3CRRA 3TXSA 2D93A 5C3SA 1BQ0A 3WG1A 4YSFA 3UCSC 5FZBA 3D0JA 1W9FA 4GH4A 2ZGNA 4ZOLA 3UV9A 3OT7A 2V73A 5JOYA 4RAIA 1RJ8A 2HEPA 4AK3A 1D0GA 3J8F1 5E16A 3HN1A 4MXWB 1XMOB 3URFA 3T30A 1L7QA 3POWA 3NV3A 1ACCA 4OHZA 4LF8O 1LULA 3I2DA 4ES9A 2GZWA 4B7EA 2WNVB 5JIAA 1A3KA 5ERLA 4DV6O 3VZNA 1JYTA 1VBB3 1AR91 1LGCA 5F2SA 4YGBA 3M7AA 2QJVA 4Q8KA 3BYWA 5FZGA 2VH9A 5LYJA 3GBGA 2XKOA 3CXHF 3KVBA 3LSSA 2D5HA 3F7VC 3USSA 2L6LA 3RS6A 2ZNIA 1M57C 2YPDA 1LECA 1S5JA 2WWWA 1K45A 1X82A 2YS8A 2HFEC 4Y24A 1FXKB 1KS4A 1AI5A 3P3NA 5JCOC 3NMBA 2H3OA 4AI0A 3MHZA 3VBOB 3EO6A 1M57B 4BIZA 5L3GA 2F6BA 4J1XA 4IYIA 3CCLV 2YMZA 5BY1A 1V54B 3SJQC 1US2A 1ND2B 4MTFA 5JI7A 1B04A 2XJSA 2DTWA 1THZA 3AYAA 2D6PA 4AI3A 1IS4A 1K5JA 3R4SA 1NA1C 1AL23 3RW0A 4N21A 2VNVA 4BLJA 1URFA 1GH6A 5EYXA 1RFYA 1QXJA 1AR73 4X1YA 5A33B 3VD4A 3PVEA 3GJBA 1PNGA 3W21A 2J22A 1N1TA 1NA1B 4RS5C 2BNOA 4KL1A 1K5QA 4Y26A 1KP2A 2F4LA 2BDRA 4LF6O 2RS53 5FUIA 2W46A 3G4SV 3O1TA 5FOBB 1EAH2 5JXIA 3O0XA 4R8CA 2UUAO 1Y67A 1MEC2 5A7SA 4OXSA 4FFBA 3O0WA 5JH7B 5CG8A 2HWD1 1D5AA 3ZDVA 1RUG2 4UBGA 5HFMA 1IXMA 5DEDA 2XWJB 2E51A 4N8MA 4MOAA 1M4WA 2BTOA 4YWAA 2A3QA 4RA0A 3CEIA 4X8PA 5FYHA 3GBWA 3RZGA 4JI2B 1ND3C 2VBPA 3TAYA 3LE0A 4CUGA 1RYYA 4ZKIA 1TA8A 4D6RA 2DUQA 2FYUH 4FAGA 4YW5A 4LIUA 3SJCC 4MZUA 3VDDA 1H2KA 5JUVA 4JTAB 3VZOA 2K9ZA 3JD73 5JVDA 2NMOA 2VNGA 1Q82W 3ZS8C 1KD7A 2QM4A 3K75B 3CYOA 3BOWA 1I08A 1ZWIC 3HAGA 1LR5A 2X29A 3ZFEA 1QXPA 5DDJ1 2K9PA 1QNMA 1YFUA 4JKLA 2VQ0A 1YRZA 3VBUB 2Q9LA 2YI8A 2B39A 4FLXA 5K0UC 1O8SA 5DG2A 5T5PA 4TUYB 4ZZ8A 4XYXA 1PPJH 4OQ9A 3QTCA 2WABA 1SDWA 5KHKA 4GA9A 3MDPA 4U3JB 3T1CA 1GTOA 3TWIA 2D6NA 1BGYH 4OI1A 2D98A 4I50B 3S3WA 5FPBA 1KJLA 5D5QA 3AKSA 3O14A 4OZOA 1AJNA 2WC2A 1MPXA 2MW2B 1PO22 2CGOA 3VQYA 2AZ5A 4Q0SA 3DL3A 5BYNA 1IBLO 3BKZA 1TME2 3SYPA 4GKYA 5KA6A 1KQSU 5FMCA 4JI1B 2KA3A 3QO7A 4FVMA 4CP9B 5FO9B 4PA3A 2DCZA 3BUCA 2OA2A 3PDQA 4COYA 3WHTA 1LOFA 2QKAA 1BHAA 2EICA 5A3NA 1WB7A 1H0BA 2I45A 4QMAA 1LHNA 4LO5B 1GN4A 5ITZB 1NCRA 2F1MA 3W7SA 3UT5B 4DR4O 1DTOA 5IFTA 3MUY1 4NHYA 3JASA 4XFGA 3GDBA 1H8TA 2JK5C 4FLWA 1DLBA 4XUOA 1QH7A 2R16A 4G9SB 5ACA2 4RFT0 4CDQC 4YFZA 4TOIA 3PTRB 2PGGA 1ZSPA 2ZMNA 3WVJA 2BW8A 2TUNA 1Q6HA 1ZL8B 1S2KA 2VR4A 1W2NA 2CH7A 3QVNA 3N9MA 1BYHA 1TGOA 4IV3C 2IXCA 5FWJA 5HCBA 2OIEA 1JFFB 2QDNA 3FZ3A 3LIGA 4LKEA 1PVC3 1QU7A 2JIZG 4TZDA 4JHZA 3T09A 4Z82A 3SKVA 3POGA 1P49A 1FXHA 4LNVA 1AYM3 4QT6A 4HT1T 4JI0B 4I02A 2X5IC 2DW4A 2W5FA 4XILA 4CUAA 4YZ2A 1UF2C 1VRH2 1MQTA 4TLGA 2WL1A 5A1LA 4L87A 4UXNA 1W8HA 2EIDA 3MF9A 5C8WA 4CCJA 2VZQA 4DUXA 1HNZO 1XRUA 2VC9A 4LE4A 3IPVB 4GKKB 2V5DA 3HOBA 2X5IB 4UFMA 2RJKA 5EV7A 2F93B 5FLXN 2HWC2 3LNNA 5J7MA 5LMNB 2P6CA 2VWJA 4AEDA 4XF0A 2WFF1 3AK2A 2Q1ZB 4FIPC 4UB8Z 2QWRB 1G9DA 2Q4PA 2XJVA 4Y4RA 4UW5A 1NVPB 1MS0A 4OULA 2RS12 4O4IB 3UO2A 4QE9A 4FPHA 3KQ4B 1EYBA 4WVVA 1H8EG 4DV3B 2B9UA 1RUD2 3ZMTA 4J9ZB 5L36A 1HB2A 2R061 2Y0OA 2ZKLA 1ZBE2 3B94A 4ZKTB 5FPRA 1GP5A 4Q5OA 4Z1VA 4LF4B 4YGCA 1W6MA 4UCVA 1DGLA 5BNPC 5C9AB 1R091 4Y1VA 3N7JA 2XASA 3U11A 5C3QA 3HKDB 3I7DA 4Q4X2 5LRRA 1N36O 4ZHNA 5IHRA 4BQWA 3ZOIA 1T2XA 1PIV3 3QACA 3KZ4C 3AMMA 1TUEB 3AG1B 2DYRC 3AP5A 2VWKA 2DYCA 4E4SA 2R043 3LFIA 1XNQB 2YYOA 2PHFA 2HWE1 2E53A 5L9BA 4E4DX 3ZRWA 4HVOA 3R05A 1K73W 3EJKA 4PDVA 2VCMA 4B08A 2JENA 2G1MA 3QF7A 3MPBA 1CR7A 5LA9A 1VARA 2E63A 4NR1A 2Y64A 1B35A 1S2EA 2Q69A 4QPGC 3STZC 5LZ6A 4NHXA 1R6NA 2VOKA 5KWRA 5B3SB 1IKQA 4YG3A 3THOA 4YM3A 4ZHQA 1L7RA 4XAEA 2OZJA 2V7QG 4DW1A 1XMOO 5C4WA 1EP0A 4XF9A 4CCCA 2VCBA 3SPIA 1M90W 5EJ3A 2VQTA 4JGZA 1WB8A 1C5HA 1UU4A 1I9RA 4DFSA 2Y6LA 3CZUA 3KM5A 4XTPA 2D3PA 4LK7A 5B1BC 1V6LA 5FUPA 1RUF3 4QB1A 3QG5A 4FM1A 1UQXA 3BRCA 2AEZA 3LB9A 1YVWA 3OUHA 3AJYA 1ZZ9A 4TWKA 3RWNA 1HN1A 1TZOA 3LA3A 1WMFA 1URXA 3Q8CA 4WM7C 1ZZ7A 4HPKB 1RUI3 3ZSEA 4YGEA 1KRIA 3T2TA 2IZWA 5CBFA 4JQTA 3WV6A 1W04A 3A0NA 2PAKA 3OTOO 3TNQA 3DC6A 3GWOA 4FMTA 2VZ1A 2A06H 1RHI2 5FXXA 3OR7C 1WAZA 3NJXA 3CC2V 1M56B 3QO5A 4RD7A 2PMWB 4AAXA 3A4UA 2ADPA 4B1LA 4P08A 2IXJA 3LPGA 3K5LA 1X9TA 1IS3A 3DXUA 5JR2A 2A0LA 1ULFA 3U4SA 2WNUC 5LMUB 2YU1A 4IUGA 2ZGUA 4FPPA 3W7UA 1EV11 4HNAA 3ASOB 3DC5A 4QM8A 1V55B 2FDGA 3K57A 1D7PM 2B7YA 1VIBA 2IW5A 4OHWA 2A75A 3N3HA 1G8MA 3KF5A 1WW7A 4QD2A 1E5IA 1ZRRA 3NJVA 2WO2A 1HXS2 5JWPA 5JXJA 5HV4A 3ZKUA 5L7OB 2J1UA 1FKAO 1Y7BA 2FB5A 2AXTZ 5CFCA 3UKMA 3RYHA 2F23A 2Q1FA 4ARYA 3VHOA 5K1PA 1NT2B 2DQ3A 1RUH3 1AR83 3B2EE 4YVWC 5J2TB 4DRXA 2P6HA 4PF5A 3NV4A 4GB32 2NN4A 3V64A 3LEKA 1N47A 4N43C 5JIUA 1DQ0A 1LUVA 4UUJC 2QZ3A 5FY0A 3OE7G 4CEWB 1M5IA 2WLIB 2K46A 1WA6X 5BR8B 1R64A 3ENRA 1UXZA 2WAAA 4YJ2B 2ZEZA 3SLIA 3N7MA 4YVWB 2HYKA 4A6SA 2Q8VA 4XJ9A 4J41A 1Z7S1 3FB8C 4IXLA 1NCQA 4X20A 2VZPA 5IAXA 2CDOA 3MLJA 3CCRV 1C8M1 5GTHZ 1MACA 4AXOA 2J1SA 1D4M1 3DCQA 5GKAC 3LDBA 2XBO2 4X1KA 4NPRA 3WG7C 5LEKA 5C8YA 3THCA 2HEYF 1QVFU 1VRBA 1K42A 2DUOA 3LSUA 1JHNA 3E22A 3ABTA 2XJQA 1BKZA 4Q1PA 1W8FA 1OV9A 1F4HA 3DPRA 3NSTA 4RQPA 5J2UA 3UT0A 3V65A 4PDLA 5DAPA 3NNMA 4GH4C 1NKGA 4PDWB 1O5UA 3RYCA 1WLDA 3S30A 1UMIA 3ABZA 2Z0AA 4JI5B 5C3RA 4QPWA 4B3TO 3LSDA 1JN2P 1CAUA 5IATA 3TK1A 3CX5F 2VQUA 2RS33 2DVGA 1U5ZA 5J1XA 4JI1O 2WNOA 1YIFA 4QQPA 2R072 1U5YA 3ES4A 2NNUA 3BI3A 4LKSA 4CRQA 5HFLA 1OOPB 2DQ0A 1FPN3 4QKFA 1AJKA 4W4ZA 4DXTA 1NAEA 2E5LO 2O14A 3ZXKA 3RZKA 3H1WA 1S0BA 1OLME 3CD6V 4DEQA 4ZXKA 3E89A 2FKXA 3S6PA 2RV9A 3AKTA 2Z4FA 2ET7A 1FJGO 3CS5A 2KSDA 3JD1A 2N7GA 4DQAA 2QJ1A 5KXDA 5E1AC 2VTXA 1SQQH 2WZPP 1BQPA 1X7NA 5GZGA 5A6ZA 1Q86W 4WFEA 4B3MO 4W50A 5H9SA 3BB6A 2X53S 4Z1MG 4GQ7A 2NP0A 4MGZE 1QCEA 1V00A 2Q8DA 3T1YO 3X2QC 4JQRA 3ZM8A 3VKFC 4AVVA 2ERFA 2XLGA 3E97A 4O4LA 3T08A 3FLTA 3KMHA 2JB4A 1A6CA 2ITDC 5IVFA 5H2FZ 2FCTA 4CXWA 1SHWB 4UCTA 2HG5C 2GV9A 1C1FA 4V2VA 3PMSA 2R9AA 1YIPA 1MS1A 2DCYA 3TN91 4CE8A 4G27B 3WNKA 2OCCC 4LF7B 4NPMA 3RVHA 2WZ8A 4QIWF 2YI9A 1OT5A 3E8GA 3ZCCA 3MD0A 5IJ0A 5FNVA 1M4UA 5CVRA 3OSDA 2JD9A 3VD9A 3JALA 4LO6B 4D7SA 1XU1A 2E32A 4DUYB 1W8TA 4GKKO 4AW7A 4AVAA 4LF9O 1XBLA 2QKSA 4O7XA 2WJSA 2QWOB 2FDHA 3KWVA 1XU2A 4NXNO 3VL8A 1IBMO 3SHRA 5DUXA 1Q8IA 5LBQA 1QJU3 4LH7A 4MX3A 4YM2A 1WA8A 1L0LH 2W39A 4JGYB 2JEUA 4FP2A 3IJ4A 5H6QA 1OCOC 2ZDIA 4NRQA 4I0XB 3ZFFB 3CLPA 4DR1B 1QJEA 4WZCA 3GM8A 4FBFA 3VBRA 4OX9O 3AL5A 2P4VA 1BQZA 3ZXJA 2WA3A 2QVSB 2UXDB 1N3QA 1G9BA 4LF4O 4MGTA 4BCUA 3VQVA 3VDDC 1QHDA 1BBT1 3CJIA 5G04L 3M3QA 4LLOA 1QQCA 3J7MA 4FPOB 4YYOA 2VMGA 3HKBA 4WFBV 1XC6A 4AHWA 1YYNA 4X65B 1IXBA 2VVFA 1VLNA 4BE3A 2FDFA 1EBOA 3S3XA 4IEWA 5GZEA 5K8SA 3AZYA 1JJ2U 4OVEA 4CDUA 1POV3 3ACLA 2GDFA 3CB2A 3Q9OA 5JVDB 4DOUA 4DMIA 3P5BA 1MVQA 2W6IG 5FZ0A 5JMOA 1UPGA 1SQVH 4LQRA 4BQYA 4QJFB 3MGUA 1TMF1 2WWUA 3ZFEB 2H94A 4XVHA 4H13B 1DYKA 1AI7A 1H6YA 1ZBA2 1VBC1 4Q0PA 1COV3 3CCUV 1ALYA 1VR3A 4XUNA 3ZN4A 1DHKB 2MEV2 5D21A 2DFCA 1BVVA 3TEWA 3ELNA 1JX9A 1YI2V 4WZFA 3FWEA 2DBNA 4BIFA 4ASUG 1HB3A 4BR6A 2F4VB 2BE3A 1O59A 4NYKA 2QFEA 4LHKA 2V72A 5T54A 4IE6A 4UWDA 5L3FA 4Q4W1 1KB9F 1ZZCA 5IVBA 3RZJA 1Q81W 2XR4A 4IGPA 1GP4A 1LOFC 4UCRA 3IAPA 2TEPA 5CBLA 4HFSA 4HK8A 1N4CA 4HKWA 4LNUA 3SGIA 5KMGA 4GZ9A 1NCRC 4TSFG 5FXWA 2GMEA 1PGW1 2F17A 5B1NA 4BM8A 3ZO0B 1H8TC 2OYZA 3K79A 2NZ9A 3A0KA 3OCPA 4MGIE 1RM1B 4QPIA 4LP8A 1WD3A 4ES8A 2OX0A 3JASB 2RJLA 4LULA 2C9KA 4L8QA 2QQNA 1FFTB 1XMQO 2VUJA 4WFAV 4NPLA 1H8TB 1UOJA 1S1AA 3BIEA 1RIRA 2ZACA 4P00B 4GX5A 3HEIA 5LMUO 4LA2A 5IE9A 3J8F2 3DF0A 4YW3A 1PNKA 3IWZA 3D0SA 4Q0UA 5IWAB 4XF3A 2ARAA 4UCSA 1M06G 4AEMA 3FBYA 2YEVB 3AG2C 1Y3TA 2XAHA 1W39A 4J9YB 5FREA 3VBFA 1PD3A 3B09A 4HKLA 3THPA 4H0LB 1SFPA 2RR13 4XDJA 1FAFA 1MQTC 5LP6B 2JGUA 2W1UA 2G9GA 4YY3B 2IH3C 4QX7A 3NRUA 2WAOA 1SQXH 4KU7A 3HMYA 5A7PA 2A3YA 3FAVA 3MW4A 4RHV1 1AL0G 1R6KA 2XHNA 1UD1A 1VBB2 2BYVE 4AEDC 2MK3A 3I4IA 3K58A 3FUOA 1Z5WA 1R1A1 1E1QG 2ETEA 3AFKA 2I07B 1KDMA 1IGOA 4W6XA 5SV5A 1KU9A 1H1IA 1XNTA 3AP9A 4G4FA 4IHJA 1JTZX 3IB3A 3LKJA 2VZTA 2B1IA 5FRAA 4Y4YA 2CTWA 3SR2C 4LBEC 3V0BA 5FZ4A 5CA0B 2ZGOA 5L73A 2BGCA 3AKRA 3EFFK 2R1BA 4JI3B 1PK6B 1J3RA 1JU3A 4B7KA 1HDJA 3UYJA 5JZGA 5LBFA 2ZX3A 2NLRA 2D3OW 3BVCA 2A79B 2JEMA 2Q4SA 1TVKB 3GZTB 2ZAHA 1V9U3 1W6MB 2ZA9A 1WBFA 1W8ZA 4OFGA 3MYXA 3ATGA 3VKLA 5F2VO 1AL22 4NMIA 1FOD3 5E1RA 2BOJA 5A3MA 4Y1XA 1IOAA 1AYN3 1PM9A 4XF1A 4XJ8A 2B9ZA 2YIBA 4FLZA 2ZGPA 2ZGKA 1UYPA 1AR72 3OJBA 1XHXA 4K3AA 4XDKA 2WR9A 3L74H 4GX1A 3AP6A 4F7ZA 1MSWD 5KAFZ 4N7UA 4XFFA 2Q8CA 4AFAA 4LOTA 2ZCWA 5FYIA 2W52A 1UZ0A 4YW6A 1B35C 4PA6A 3ABMB 5IYBO 2RS52 4L11A 2NQYA 1JMUB 4J42A 2YIAA 2UURA 4FT8A 3WDTA 4JAVA 2EALA 1W05A 1BCXA 1GWMA 2VJXA 5C4WC 1S5LZ 3ZSKA 1S77D 2KD7A 1O9GA 3ZXDA 1W03A 4JGZC 1V6IA 1B35B 4Q6GA 4IV1A 3ES1A 1SFNA 4U7NA 3ZMOA 4OYUA 2JWPA 3HQRA 1AR4A 2QM7A 1O91A 1V0AA 3VBSC 4AVTA 3H1KH 4YHHB 4GALA 5FP4A 4JI8B 5FZKA 3WNMA 3HT2A 4D6TH 1IX9A 4UXAA 2A3WA 1MABG 4Q4V3 1F4AA 3ILNA 5DDJ2 5CFDA 4FQZA 1IZ3A 1OF3A 4GJYA 3PVBB 3ALQA 4XBLA 4CCKA 1HIXA 4XUQA 3JD72 1O4ZA 4O4JB 3RYIB 5LOVB 1BE3H 3GHMA 1VQKV 3TEZA 4GXLA 4GWJA 4NUBA 3WUDA 1ULGA 3SQOA 2AW9A 1NY72 4QGNA 4B4QA 4XXPA 4BIOA 1RUE3 2XL7A 1LEDA 1GBGA 1R3JC 1EAH1 1HV0A 2Y8KA 2WLLB 1YJKA 4TN7A 1MEC1 1J3PA 5FCCA 3OW2U 1H8HG 3RPQA 2EZOA 4CTEA 3AX4A 3KG2A 3BPSA 1NQTA 1MG1A 1LGBA 5DAVA 2VBBA 2Y6JA 2R1DA 3UKVA 3FB6C 5C3PA 1ZNPA 4OHYA 1QLEB 4LC1A 1NZIA 1KUQA 4NIIA 1ZTEA 1OA3A 2LRPA 2WYFA 1ASJ3 1FNYA 4LF7O 3B40A 1DCSA 2EZPA 4JKKA 2JKXA 2C5DA 5CFCC 4JGSA 3CXCU 1JYWA 4A7YA 2IJHA 4E4ZA 4DUYO 2LO1A 1ENRA 4URTA 2KXLA 3WF0A 1PZ9A 5D8AA 4Y33A 4O2BB 2C6SA 2ARCA 5EZWA 3PTYA 4EJRA 2XVLA 3PUSA 1QKQA 4JTDB 1I5PA 4DR2B 5FP3A 2A5ZA 5IT6A 3HR0A 1HKDA 2ADEA 4CPBA 1OCCB 2NPIA 1SZXA 1S3JA 3K04A 3K5NA 4AAPA 4FOQA 2UWBA 3TETA 2D3RA 2ZKNA 2P1BA 4X66O 3SPJA 1C28A 3ZN5A 3DGEA 4DRXB 4PQQA 3ZYFA 4X6QB 1ZZ8A 3K4AA 1PMHX 1SPPB 5FPAA 1UYXA 1NCQC 1IPJA 3NAPA 5LWBA 4U2AA 4K40A 4OZXA 4YZ4A 4G2KA 1WWYA 4J80A 1QVGU 4EN6B 2ORZA 5FPZA 4BISA 3OEEG 5ABJA 3NR7A 1PVC2 2DV9A 1NXD1 4META 4X6RB 4KHPO 1PO21 1UIJA 2ZXWB 4X20B 2ADQB 5E6HA 1TME1 2B5HA 4X64O 2PELA 4D94A 1LODA 4UFHA 4EZHA 1LHUA 4YPJA 3AG7A 1AYM2 2HWF3 4X1KB 5FO8B 3W7XA 2R30A 4UYBA 2PI4A 1WKYA 2JDKA 2CL2A 3S7IA 4HVQA 4U7OA 4AQ6A 1WBLA 3PL0A 4QE7A 4XQDA 5EC1C 4LORA 4R9DA 2WO1A 3N9NA 2WFF2 4I4TB 2R9IA 4COWA 4N9HA 4CP1A 1DZQA 2WLPA 4Q4Y3 3PVNA 3ZMVA 4YJ3B 1SEFA 3DPRB 1AVMA 4RQPB 4I01A 3OMIB 3UETA 1KP3A 2QR4A 3B7MA 5ACA1 4FFHA 2F4VO 3RYCB 1GZWA 3O7OA 4Y22A 1C8NA 3VHNA 3TGUH 3I5DA 1YEWA 2A7AA 4DY5A 3EHKA 3IGAC 1GNHA 4Q8LA 3THTA 4IQPA 2EIKC 2SLIA 3LOBA 3SJAC 1DP0A 5FYBA 3U37A 3IZOA 5DQ0A 1ZZ6A 4I9QA 4QPJA 1FXZA 1RPOA 2J1AA 3VD7A 5DG1A 5LY1A 4IL7A 4LBOA 5KAIZ 2YZ4A 3QLQA 1GANA 4DXSA 1VRH1 1PIV2 3IDEA 4LMFA 4JI6B 2NN8A 4WCEV 1VBE3 2R042 2RDCA 1B3QA 4PA9A 3USUA 2WT2A 1MS3A 4K1YA 3R66A 1W28A 3VN4A 1Q8SA 3MHSC 2HWC1 1EN6A 3ZYRA 3I2JA 4UT5A 2GTAA 1OD3A 5IWAO 1V6NA 1Y43B 4CEYA 1O4TA 4DR6O 2WBKA 5JCOA 5FY9A 2QQKA 2RS11 2OTLV 4M4PA 1I5YA 1GRJA 3C90A 1X50A 1W6OB 1X9PA 2H8PC 2RM21 4N53A 3HT1A 2JIGA 1RL3A 3RFRA 3H1LH 1RUD1 2OPWA 3CRQA 5CKNA 4X8NA 1ZBE1 1GM9A 4YY3O 2M7WA 3ZRXA 1LKNA 4FPGA 2YXYA 1FI2A 2EIJC 2M6YA 1XL4A 3WSOA 1GYKA 2VQFB 3SCHA 3ST7A 4FTSA 3STLC 1RUF2 3A0RA 3LEMA 4Q4X1 3CL1A 2N04A 1LOBA 2W87A 4P9JA 5JXGA 2YBPA 1W0NA 2C26A 3WFVA 4LUMA 2EIJB 4QQLA 4NROA 2ZQMA 3ASNB 5KC6A 1JOJA 2LALA 2BSKB 1RUI2 1SACA 3PIGA 1VALA 5JJEB 1AR63 4DUVA 4LBJA 1E57A 4LOSA 3JATA 4AEJA 1XSRA 2ZDIC 2HJDA 1OKQA 1D5NA 5L3BA 3H3ZA 2EX3A 4BQXA 3N2GB 5BNQA 4MS2A 3I2HA 4Y1YA 1K97A 4BQ1A 3VBRC 3ETDA 2JVDA 2CWSA 2CV6A 3J7NA 3BA8A 3D4KA 4B3RO 2UUBO 1AR61 5B66Z 2EIBA 3B9IA 2PHDA 3JCUZ 1VBD3 4CU8A 4LWSB 4JI3O 3I2IA 1JUHA 4QDRA 1XNRB 3AJZA 3VQWA 5T5OA 4GX0A 4XFIA 1FD9A 4QXCA 4CDWC 2YBKA 2W1QA 3ZN6B 4WM8B 1OVPA 4ZI7A 2PLV3 4KWLA 4GD4A 5JR7B 1N34O 5GLTA 1K5MB 1PVXA 4LH6A 3E6BA 3C7EA 5A1FA 1JYVA 4WVZA 1UIKA 1XI1A 1BK1A 3PJQA 3T2PA 3CJIB 3WP4A 2ZNJA 4E27A 1YQ8A 3BCWA 2B5UA 4DV2O 1JYXA 5IJRA 4M3CA 2KM2A 2CGNA 4I30A 2WLHA 5GLUA 4CDUB 2Y6HA 2GNTA 4JRAA 3LUTB 5KXEA 2WO3A 3SYAA 1YDXA 5IY5B 3ZX6A 3POIA 4MGKE 5DUWA 1AR82 5KHIA 5K0UA 1WCSA 4FPEA 4Z2WA 2KG7A 4Z8BA 4BQ3A 5I8YA 1RHI1 1RMU3 5C5UA 2I2SA 4MTGA 2VVEA 3KHBA 4UVBA 3POFA 1BLZA 2AACA 2TBVA 2B45X 2LS6A 3I3MA 1VBA1 2RE9A 4UW3A 1PNLA 2BOCC 1XNKA 3FUQA 1WLCA 1SESA 2VMCA 3ABKC 4JI7B 4DIQA 3LPFA 3ZJZA 4I3GA 4F6RA 3JAWB 2ZD9A 5GLWA 3OD4A 4UAPA 1GZ9A 1GKBA 4JASA 1XNDA 1NBMG 2HYXA 1HRI3 5JLVA 1UOFA 4XDLA 1CJDA 3ABKB 4IL6Z 5KMGB 1OPOA 5A32A 2HHHB 4QPIC 5FOJB 2ZCEA 3ZFGA 2XPJA 1UW8A 4RR3A 5J98B 1X36A 3ZSJA 1HXS1 1GOGA 1QR9A 5CB4B 4GKJB 3CCQV 2W1SA 4R52A 2DCKA 4XFCA 4NAOA 5JPMB 2JKBA 1YXWA 4RGKA 2VTXJ 2BERA 2YUAA 1YCIA 4GB31 3ZRSA 4CDQA 2W95A 4DB5A 1YFXA 5IT9N 4JVAA 3JBG1 3VBFC 2QQIA 3JARA 4LO7A 1CP9A 3RN4A 2PFWA 4EWAA 4GJZA 2YB7A 1XYNA 2Q0AA 3RYFA 2ZHKA 1CN1A 4NAMA 2V4DA 2RS32 4JYAB 2N74A 1CAVA 4CA9A 5K1XA 4IGQA 2XAJA 5C70A 1J59A 3KVAA 4C0HA 2DU1A 4JDOA 5GJ6A 2PYLA 2VBDA 4YZ5A 1RVF3 2XBO1 4FZ0A 1LGNA 1DK1A 4DO0A 3HIFA 3OBAA 3NW4A 4DR2O 3T2OA 4GMP0 1DGSA 2ZGMA 3SPCA 2Q6AA 4YVSB 3IBMA 1W3XA 1GFF2 5JCTA 3FAVB 1OSGA 1XEQA 1W6PA 3KQRA 3VZLA 4QU1A 2OT5A 4HZFA 3FX7A 2WO7A 1AJOA 1AUYA 1IKPA 2BQPA 3POEA 5B1AC 4P02B 2ZHMA 1NE4A 2UXBB 1F51A 3TB0A 1YI9A 5IJ9A 3WNXA 2ZX4A 1PX4A 3WNPA 5DN2A 4IHJB 3CQOA 2R70A 4AEKA 4X62B 1VF6A 3TN92 2VECA 1Q56A 3AXDA 2X0LA 4O65A 1H6XA 1OQEA 2GC1A 3AMPA 3H50A 5FPOA 1ZUQA 2JB8A 4WFGA 3L2HA 1AR5A 2P4KA 5DAWA 1KQRA 4YIOA 4QQ2A 1K33A 2R071 1BMV2 3CC7V 5JZGB 3SYOA 4FOWA 3L72H 3A23A 3HKCA 1Y76A 1UU6A 1PZ7A 1EUUA 1VQMV 1O3QA 5IVJA 1ENSA 2YDEA 1V9PA 2R32A 4JZRA 3ZPOA 2QQOA 1S0FA 3MBWA 2BWCA 1WUVA 4CDXC 4JTOA 3C3VA 4DV4O 2OQ6A 4UOJA 5DXDA 3KCYA 1QOSA 3HKEB 4IEVA 3O1PA 3S57A 1J5EO 3ZEDA 3ITQA 3LNMB 1U96A 4QHZA 3IC9A 3C7FA 5EIBC 1UKGA 5CA6A 5LL6Y 4IV1C 2F4PA 1LHVA 2E74B 4GCZA 4HZ3A 1AJPA 3VBHA 4WVMA 1AILA 4XIOA 1YQCA 4DV1B 4X1IA 1XQNA 4ZS2A 4CC5A 2QCSB 1K3EA 1XNAA 4IE0A 4DR5B 3OPWA 2ZJCA 1C4RA 4TSVA 3EQEA 2JG9B 2SBAA 1UN1A 5TSWA 1I94B 3NNFA 4YIPA 3WW2A 3VHRA 3O0VA 5FQ0B 2VMIA 3ABLB 1CIWA 3BVOA 2AGSA 5FP9A 3FJSA 4H33A 1JYCA 3CPWU 3AXEA 1ZAUA 4GMP1 3VHPA 1CAXB 3IIAA 5FLJA 5CADA 4IEQA 2XGXA 1CAWA 4JI6O 4LK6A 5FMOS 5CFDB 5B1OA 2WKKA 1W6QA 2RJZA 4NN0A 4Q20A 5I0TA 2QGNA 3RJRA 2ZIMA 2VZ3A 2CWMA 4FSJA 2C0ZA 1HQNA 3W7WA 2WQ8A 2CGPA 5DUVA 4XJWA 2WS91 1HR0B 5A6XA 2XJPA 4MXVA 4O9EA 1COV2 1BCCH 1MZ5A 4P9OA 3JCZA 1GLHA 4CCOA 4DR3O 2FBEA 1X4TA 1H2LA 1SC5B 5CMUA 4XFAA 1GN3A 2PHLA 2KKWA 5FZEA 4TV9B 1W99A 2EILB 3K46A 4J25A 2JS5A 1QOOA 3F2ZA 4PDRA 2X05A 3CCJV 1QIQA 3G80A 1GM7A 3O12A 1FYJA 4A7ZA 1MR5A 2EIMB 4WF9V 4HMZA 5I0UA 4KQ7A 5ANQA 2PY5A 1OCRB 3E35A 2GN7A 4QGLA 1U97A 4I0BA 2DYSC 4IEXA 3WF1A 2GC2A 1JZ3A 3B93A 1CZVA 5EJ1B 5D8AB 3WY6A 2GUZA 5CBGA 4TQFA 1QJY3 4YGDA 1X33A 4AHZA 1HWYA 2WSSG 2DYSB 1HLCA 1YHQV 4DINB 3NAPC 3CP1A 1ZBA1 1AROP 3OB8A 2HBUA 1TUBB 4HG6B 3HJRA 2EINB 3WD5A 2MEV1 5F5CA 5FLIA 5GZCA 5ABJC 4I55B 1GZTA 5AVPA 5JOZA 5FZ6A 3AG4B 2R0HA 1TVGA 4OUEA 2O57A 3FL7A 1N1VA 5KHJA 2IVJA 5J3UA 1YF2A 5FY7A 3T4ZA 1PO13 2WRAA 2P17A 2X6AA 1NLSA 3AZVA 4YXWG 5FK7A 4NIDA 2A7WA 4P9YA 1RJ7A 4EFEA 5CA1A 5H9CA 2L9LA 3ZXAC 1HRV3 5FWEA 2JGDB 5LHIA 3AP7A 1RUG3 4M00A 4MW3A 2XLFA 5FPVA 4LIVA 5FXVA 3M8LA 1A78A 1RC6A 4RHV2 5EBMC 1PX3A 5J09A 2XUEA 3CWBH 5LATA 1FX5A 4JCKA 4XIKA 3B8MA 5IVCA 3CIHA 4N7IA 3JAKA 3C3SA 4AGVA 1IQAA 4Y3OA 5HCHA 1C57A 3B69A 5BNOA 2WT1A 1NQDA 4FPJA 3OYWB 4IEZA 1MZEA 4EE2A 3ZXFA 3AG3C 4YARA 4R50A 3KSCA 4FM2A 4DNYA 4OHXA 2VPVA 2DUPA 3SISA 1GICA 4AHCA 4TYSA 4PLNA 3RDIA 2OW4A 4ISRA 5L3CA 5L9RA 1VMHA 5FMDA 3WHUA 5LEJA 5A7WB 5FZ9A 2ZINA 4K0KB 1ZM1A 1XE0A 1F35A 1LNQA 4DR7B 2HKOA 2YUEA 1V6OA 5C8CC 4LFAB 1K7DA 3Q4HA 4LT5A 3H1IH 1R3LC 1O3SA 3U4XA 1E79G 2CAVA 4D69A 1FATA 1SQGA 4PD4F 3I8TA 4CVUA 4LTAA 2DMXA 1CX4A 1F23A 4S2GA 1V9U2 1LEMA 3FHAA 3WLUA 5IW0A 4JZGA 1CD3G 1F15A 3MF6A 1QQP3 1JJOA 4GKJO 4J7ZA 1FOD2 5FYCA 2JDMA 1ODMA 1RITA 2IFWA 3SC7X 1AYN2 4MVTA 3LGRA 4QKDA 1SLAA 3WNLA 4BDVB 1ZA4A 4ICGA 1VBB1 3L9DA 3CMEV 5LBBA 3I49A 4R8HA 2X7RB 1HW7A 4LE3A 1R3IC 1JOBA 4MT8A 4CEYC 3USUB 3CJHB 2YGLA 4QX3A 5FYUA 4FLYA 1DQ6A 1UMZA 2XL9A 3ETPA 1H2NA 4MGQA 4LFCO 1P7GA 1TG7A 3T4HB 4N53C 4OMCA 5FV3A 2Q5ZA 1AI6A 2ES3A 4RL7A 4NE9A 3RZMA 4Q0VA 1LOAA 3T1HO 1OA4A 5BNNA 5IFPA 3POSA 4E4EA 3LDEA 5A3WA 5C33A 4AI9A 4CH5A 2BVVA 2CE4A 1AJQA 1J1LA 5F3IA 1EUTA 1PM4A 3W59A 1OF4A 4EWEA 5I0SA 4EB6B 2DDUA 1W9TA 2OUJA 4BLIA 2NYYA 2EAKA 3TBDA 5GONB 4GUNA 4B3NA 1AL21 1DZRA 4Q4V2 3FFQA 1VQ7V 4QU2A 1RUC3 3P1IA 1Y66A 3IC7A 2VE1A 4MXWA 2PHRA 1LU2A 4RUEA 5IWFA 3NKGA 1AR71 5K4LA 5FMOL 1J3QA 1K92A 3OM3B 1HQLA 4PV1B 4XTMA 2P7TC 3LSQA 1HNXB 2VUDA 5CIRA 1BL8A 2WNVA 4RS5B 1L3JA 1RUE2 2RS51 3JQWA 1G6NA 2XMLA 1K4CC 4X62O 3FN9A 1NU1H 1QOTA 1ZA7A 1F31A 3H1YA 3OUJA 1Z78A 3IMNA 4V1PA 4GT1A 4DUZB 1GU3A 2OWOA 5LA6B 3ZYPA 5EYYA 2BVBA 1N3OA 4OGQB 3L73H 2JE7A 2J42A 4P9XA 5F8PA 5F39A 4CH6A 1ASJ2 2P2KA 1FXKA 2CAZC 3GNEA 3GZAA 4FFGA 4NJ4A 1W8WA 3PLQA 1GO3F 1ND3B 3VBOA 4O2AB 3HBZA 4C90A 4IEPA 1Q5OA 3WQ7A 5A2QN 4W4LA 3M99B 4L97A 1OUSA 2J7MA 5F3EA 3ORJA 1ND2A 4EN7B 3JD71 5F1RA 2AGAA 2YHJA 4JV4A 5EBWC 1XPWA 3I3BA 3VKMA 1H9PA 3P32A 3MHHC 2DE0X 5FZDA 4QPKA 4P30A 1MZ6A 5DZFA 3JD2A 1RSOB 4HN0A 1NY71 4FLUA 2HKXA 3K3OA 2V09A 1IG3A 1DGWA 4UVAA 1BJQA 2D7FA 4DV1O 1KBHA 5CB7A 4B3SB 4PJYA 5K0UB 4PHZA 1VQ4V 4ZIBA 3HR9A 5A33A 1WNSA 4EEQA 3KV5A 3WB1A 3JD3A 1NI8A 1DYOA 3LCPA 4JI4B 2WLJA 4DXZA 3QH6A 3M8AA 3W7TA 4I7ZB 3ZFGC 2CK3G 2HVKC 4RR3C 4F6RB 3EXAA 4O4HB 1XQ8A 4H14A 1YTFD 5AC93 5FO7B 3I59B 4PIXA 4ZPIA 5I0DA 2HWF2 4GYCB 3OEHG 4K8ZA 1KKDA 3BTZA 1DG6A 4NHLA 1K3IA 3U0ZA 4CCDA 4UV9A 5FIXA 4QKBA 3VQXA 1HR0O 3DYPA 3RQ0A 1YWKA 2OYQA 3THDA 4AWDA 4UF0A 4Z92B 1G9FA 3HVDA 3MIEA 3H3UA 2V4VA 1ROPA 3WF3A 2F95B 4Q4Y2 2PHTA 4H7LA 4CCNA 3ML0A 5EK0A 2HP8A 3RWKX 4DV5B 1SERA 4AOCA 1XE8A 4LBNA 4CDQB 1AXZA 5CZKA 1DGRN 3VBUA 1ULOA 5K7PA 4PCRA 2UU9O 2EJRA 1W9SA 3Q8FA 4AQSA 4TUYA 3WEZA 4IV3B 3WCRA 5JJJB 1ENXA 3W9AA 4TXWA 4U3JA 4PBOA 2IVIB 1PVC1 5A7OA 4CU6A 2EXHA 1U5IA 2XHBA 4BPZA 5EQUA 4I50A 1CAVB 1SKVA 3LDDA 2BUKA 5A3TA 2NR5A 4LO4B 2FCUA 2GN3A 4R7CA 1OCZC 4JAUA 4UFIA 4O9GA 1AYM1 1Y4WA 1RUJ3 2A70A 3CRCA 1PMIA 2DU0A 1FXVA 4QAWA 3GYDA 4B4PA 3T1MA 4XE9A 1EPZA 4QWNA 2WINB 4YG6A 3JXSA 4NTWA 1SLTA 1I6XA 4HK9A 1SQFA 3I54A 3OBZA 4K9SA 1F5JA 3PIJA 1ZVFA 1YI7A 3IDAA 1OPMA 3E8HA 2FHRA 5FY4A 2XAGA 4NIGA 4CC6A 4XBNA 4A45A 1VF6C 2XQXA 5D2AA 3UESA 4IYHA 5ITZA 5H9QA 5C6CA 3SYCA 2LQTA 4LF8B 3UT5A 2RM22 2VULA 2WZR3 4EN0A 3BFRA 3Q8EA 2D44A 2A6VA 1HV1A 3H8UA 2EXKA 2BTQB 3VZKA 1AXYA 3UGFA 1KKCA 2WZR1 2F43G 1S4CA 4DV7O 4YZ1A 1A8MA 5IYZB 2WWJA 1UYZA 3H3LA 1K5SA 2W94A 2QQMA 4AQ2A 3LIHA 3HKCB 1JFFA 4PI0A 5BNPB 4UFZA 4QNHB 1N8RW 4PI2A 3SH4A 3BIWE 1NH2D 4FAHA 4LBQA 4MTOA 5FJHA 1Q7YW 1CONA 3O9OA 4ATEA 3E86A 3LA2A 5HPOA 3KF3A 3T2QA 1PIV1 1IQDC 3VBHC 2DYRB 3BCCH 3OGRA 3CHXA 2YIBD 1AR62 2R041 4M0NA 3WG3A 2F66C 5FZOB 3ZVXA 4P9PA 2D97A 1CESA 2P3YA 5HI0A 3O1SA 3WNOA 4BQ5A 2LUWA 3IPVA 2LROA 2DN9A 1CXZB 4X1IB 2Q68A 1UX6A 4IDZA 4JDNA 1VBD2 1EN5A 4QPGB 4G28B 3BTYA 4QPYA 4Y5SA 5EIBD 2VM9A 3HPLC 3VDCA 1W8NA 1QJX3 1XXNA 2P3IA 2E7TA 3VUOA 3FC0A 3T0BA 1ONAA 4LF6B 3VBSA 4JKMA 3J81N 2PLV2 1W0OA 3K9SA 1FMD3 5FBJA 3N7KA 4O4IA 4IT5A 1X59A 1PNMA 2FQPA 5B1BB 1RUF1 4PA7A 3VLBB 2XXZA 2EXIA 3KGLA 2MHFA 3KT4A 2D3SA 1NLQA 2Q5TA 4F83A 2BWAA 3SPGA 1QJZA 2ORXA 4XXAA 4COVA 1W6QB 4PIZA 4DY3A 1QDOA 5C9AA 4WM7B 1RUI1 1PNFA 3HKDA 2ARHA 2VOTA 1W90A 1HNWB 4TV8B 1VBA2 3POYA 3P6BA 2ZBJA 3ZBHA 2LFSA 2UWAA 1SLIA 3FB5C 4U36A 4ORFA 3ACGA 4PJ0Z 3ASIA 3HN3A 1RMU2 2IU3A 3ZHSA 3OG2A 3WQBA 1XSQA 3UKTA 4XMAA 3QH7A 4IIJA 2C4XA 2YBSA 2A6XA 4LLFA 1S0IA 3VKNA 3SMHA 2VXRA 1JZ5A 1VQ6V 3WINE 3D36A 4AQYB 2WNUB 3W5MA 1UOBA 3V0AB 4BH9A 2VVDA 2JE8A 3E6CC 4Y5TA 1KYOF 3PU8A 3JZVA 3ETEA 3ME2A 1JZ2A 4I2OA 3MICA 2PF4E 1HRI2 3M3CA 2HWB3 4WBNA 4TLFA 3WDYA 2JDHA 3AZWA 5IYYA 4H2AA 2Y33A 3WG4A 4AILC 3DV8A 1BMFG 3OY8B 4B29A 1HP8A 5JJNB 5C93A 3HNMA 2FTKA 2Z2SB 1HNXO 2GUZB 3DKWA 3INAA 1Y9MA 1S5HC 2QE3A 1LHWA 1XJAA 3FHIB 3GBFA 2EIGA 3BA9A 5CKQA 1VEWA 1Q8OA 3ZR6A 3JBG2 1IBLB 4CPBD 4J11A 3K5MA 4QXHA 1RUH1 1AR81 1T5EA 1EZVH 2ZE7A 4HPKA 4CS4A 1Q8PA 3S5AA 5GLVA 5KUKA 3KLSA 4MVRA 4JI2O 4GWMA 1ZREA 5EHDA 4Y20A 1JW6A 4N43B 3K77A 4L2NA 2CDYA 5GW7A 4BIUA 2QQUA 1ZRFA 3BY6A 2ZX0A 3EXUA 1RP3B 1JOPA 4CUBA 1SRYA 4BXFA 2GH2A 5LGTA 2LP7A 5CA1B 3I3QA 3DYOA 5TISZ 4HAMA 2ZEXA 2X6BA 5BNOC 5IVYA 2BZDA 3HPNA 4E2SA 2FMYA 3DKQA 2H0VA 2BP6A 3FX3A 3N7LA 2GHYA 1RVF2 4QB6A 1T6BX 1TNFA 2RHPA 1POQA 3WG7B 1BEV3 3MDSA 4FP3A 4LBMA 1UFIA 1NT0A 2GH8A 4RO2A 3K2OA 1Q43A 4UV8A 3BHPA 1CJPA 5T3NA 1NQJA 1UY3A 2W1WA 1N33B 1V6MA 1D2DA 4DXWA 1O3RA 4MW8A 4BQ4A 5L7OA 2HJIA 2EF6A 3JCIA 4GH4B 3NNGA 4ZOLB 1UY1A 5HCAA 2YG0A 3OMNB 4XDOA 1JBCA 3M4FA 1AX0A 5FYZA 4B1MA 1UZZA 3K0GA 4PF1A 4HOOA 4KBZA 3VD5A 1E1RG 1Q6IA 5J2TA 5CEHA 1TAEA 4OPAA 1UO9A 2ID4A 4FPKA 1DF5A 5LHHA 1GQPA 4JRLA 2RS31 4KG0A 3K48A 3RMXA 2WLIA 3ZXEA 3S7EA 2JS3A 1CX1A 2P06A 3N2KA 4YJ2A 1X8MA 2J1VA 1LTEA 1SLLA 1AP6A 4H37A 4W4KA 1FPN1 3T3YA 5FDBA 1NS1A 4EKWA 3AMHA 5LYJB 5HBAA 1W06A 2OS2A 2Y34A 2Y6KA 3BU0A 3CZJA 4ITCA 2HEVF 2VRZA 2P5BA 3VDAA 4SBVA 1POV0 1VQLV 2VMEA 4PQ9A 1AB3A 3B9CA 4KH9A 4A41A 4I0AA 3ZXLA 3P3PA 2H0BA 2RMU3 5FYSA 5BNNC 3ZYBA 2BRTA 5C3OA 3H7JA 3TJTA 3DSQA 1N36B 3MV01 4AVCA 3ZYGA 5FZ3A 2GC3A 5A3OA 4W6WA 1K12A 3B00A 1LESA 2CHHA 3WDVA 5L9VA 3AMQA 2B46X 2BGPA 3X2QB 2RMU1 2VW0A 4CUCA 1W0PA 1GOHA 3BEHA 4JI0O 4PDWA 1JQ0A 3CC4V 4LHSA 2X8KA 3N4MA 2I74A 5CBHA 1R3KC 3R4DB 3SCGA 5M0TA 5FUNA 3K51A 1BMV1 3J8F3 3H9AA 4QM9A 1Q8VA 4LITA 4LO8A 5EWSA 3ZSLA 5KC5A 4XMIA 3HWJA 4KU8A 3E8FA 4X1YB 1M9NA 2OCCB 2ZGTA 2IFRA 4Z07A 2ZE6A 3NNJA 2BV4A 3VZJA 1DGWX 5LMNO 2WS92 2WNVC 5JSOA 5A7QA 1OOPA 3WXPA 2DTYA 1ZRCA 1AR93 3OR6C 5DZGA 4FFBB 3GXUA 3WR0A 5LRSA 2UWCA 4XACA 3ILFA 3NXSA 2ZOEB 4BQ2A 2DURA 4DV3O 4BWAA 1WLWA 2W2IA 3B01A 2ATFA 4RWUA 3ON7A 1QJU1 2VOVA 4XUPA 2XOKG 3RYRA 2H6CA 1VMFA 1OCOB 1J84A 2D6LX 1FXKC 3DGTA 3UJOA 4MVSA 3MIHA 2GP5A 1WD4A 4W65A 1Q8QA 4FTEA 3VBOC 4MSWC 2D6OX 3R4UA 4CDWA 2VY0A 2QQJA 3ZHUA 3KV9A 3OTOB 2OZ6A 5H5NA 3BGAA 3PVOA 1V54C 5ISLA 5CYYA 3IDBB 3MLKA 3VDDB 2VMDA 1ND2C 1XNQO 1PV0A 3CCEV 4UBHA 4DPNA 1LOGA 1MS9A 2GC0A 4IETA 4LF5B 4LKFA 3ROUA 5F6KA 1K8AW 4AVSA 3A7QA 1YJLA 1QDCA 3SEEA 4FFKA 2R0FA 1POV1 2VS0A 4JYBA 1QJY2 1AX1A 4WFFA 2RQ6A 5F5QA 2G4IA 2BJSA 1SFYA 4F8AA 4QKNA 5GZDA 4I0WB 3ZIXA 4UB6Z 1ODNA 3QNEA 3B02A 4AQTA 3FKSG 5EBLC 1I3HA 1VQ8V 2EIEA 3CF6E 2VMFA 2QBXA 2E6VA 1COV1 2QDRA 1RB8G 2C1FA 4COZA 1NE6A 4YZ3A 4A4AA 4NHMA 2HWD3 4AGRA 5FFOC 2VZUA 2ILMA 4LPLA 4FFFA 1PO12 4XJUA 4HLTA 3G7DA 5A3UA 3U10A 4JGYA 4JDMA 1HN0A 2E7AA 2GNBA 3AVRA 1QH6A 4YRDA 1HRV2 4I0XA 5FKBA 2FDKA 5IVVA 3C8XA 3NV2A 3ZFFA 5BZBA 2WWSA 2JDZA 5FPLA 1LAJA 4JYCA 2CYFA 4XHBA 1G9CA 1NCRB 3AKPA 3BTAA 4QXBA 3GHNA 1NKDA 3K08A 1Q6UA 4L9BA 3NO8A 4N90A 5DECA 1DFQA 3FLRA 4PLMA 2AH2A 1HNWO 1H30A 2VZVA 4ZZ5A 3CCSV 2W08A 5FZCA 3CO2A 2G9FA 1VIWB 4XCAA 2XTAA 2Z42A 3AKQA 4PELA 4EQVA 3BU7A 5DDJ3 4UF0B 1W59A 1OLQA 3VBUC 3OUSA 3CMAV 3GALA 1DYPA 1P8JA 2ZEYA 3WQ0A 2CH7B 3MPPG 4MVZA 1ENQA 3D3AA 1H38A 1OH4A 2VNOA 4LKDA 4WVWA 2Y60A 1XNCA 4AQYO 4QX1A 1YJWV 1UY0A 3A0HZ 2P3KA 4ABMA 5FPXA 4XBFA 4RUFA 1JZ4A 5A80A 1GNZA 2QSAA 1COWG 2P67A 1TNRA 3ZHTA 3AG2B 1QNWA 2RDQA 1GV9A 1J1TA 2VUAA 4QGPA 4JTCB 2RR11 2TNFA 4TTGA 4AFBA 3AK0A 2K1EA 1IS5A 1MQTB 3VOUA 5FP7A 3CNAA 1E5SA 1UCXA 3VL9A 4SLIA 3OF1A 1I5ZA 2IJKA 4XETA 4B3TB 3KV4A 3BOPA 1O4YA 1QQP2 3KCCA 4EV0A 4BZ4A 2G19A 5EC2C 2OCHA 2UYBA 1VP6A 2PYJA 1E5HA 2DVDA 2O8OA 3IM0A 3V56A 5BR8O 2B1GA 3JYCA 4AEDB 2Q7GA 2X09A 1G6UA 2V4AA 3I2OA 2PYTA 3FD9A 1NX9A 3FHQA 1DF4A 1S2BA 2XH6A 4FVVA 5KR7A 4QX2A 1W9WA 3K0DA 1YHFA 2CU5A 1CGPA 2E5LB 5DMYA 2VG9A 1W6NA 5JXHA 2WDBA 5BV6A 4H3WA 3AL6A 1W3VA 2IXKA 3I97A 4ZU5A 3VGIA 3UJQA 3ZYJB 2QWQB 2FMDA 2W47A 2Z69A 3BALA 1FJGB 5A3LA 5IK8A 2YC2A 1IG0A 1R73A 1L7LA 1S0JA 4NWVA 1CEZA 1IBKB 3VKOA 2WLNA 1DQ4A 3MLLA 4M4RA 1BVP1 4F4LA 4KBBA 3FBMA 3ZIAG 4B3MB 4P5HA 2R72A 3QO8A 2JJ2G 2AZ0A 2RNBA 3PJYA 3O1UA 1ULEA 1O7FA 3SH5A 4PDMA 1V9U1 2X10A 1OXCA 2BNMA 3K06A 3T1YB 1YLLA 1FFXA 1AF9A 3IAQA 2YEVA 1ZYBA 1FOD1 1GP6A 1UXXX 1SZTA 2YPJA 3ZRWB 4LBQB 1RUC2 4CDXA 1AYN1 3M7MX 1N33O 5LP6A 4L92A 5IDJA 2AYHA 4JI5O 4RGAA 1OD5A 2CTQA 5F2WA 2E76B 4KNCA 4LR3A 5FY5A 1XL6A 5A9GA 1W0KG 5LA1A 5EFUA 1SZBA 5FKCA 2A6WA 4CBCA 3AYDA 2DVAA 1BSMA 1GAXA 3T4DA 3WF2A 3RVYA 4Q2FA 3DXRA 2E31A 4UI9L 3AYEA 4ZHQB 4JC1A 2WFF3 5FJKA 3PUHA 5C4WB 2A9HA 1DF0A 2ZX1A 4JGZB 4I09A 4NIAA 2VOWA 4LF9B 1AVBA 5J37A 2PXJA 2YC4A 3I2FA 3W20A 3ZPYA 4MH0E 2KR2A 2NM1A 1V6KA 1SETA 4ZU7A 3L2YA 3DXTA 1HDKA 4NXNB 1IBMB 2R063 3AZXA 3IN9A 3VBSB 1US3A 1ZX5A 2LM3A 1R083 3R65A 4XZUG 1WMDA 2HH9A 4BWOA 5CA0A 4JV5B 5C9AC 2WN3A 1R093 1SLBA 2DVBA 1LUWA 2D43A 1U5XA 3M3EA 4Q4V1 3M1HA 1PK6A 3WG2A 3WDXA 4B8EA 4CU7A 4NWWA 3WNNA 3HD8B 4OX9B 1RINA 4Y1ZA 2VQEB 1TVKA 3AG1C 1R081 4Q0QA 1W0JG 3IT8A 2Y38A 5G05L 2YIDA 5IYDO 1IHMA 1I0HA 3POJA 5FZFA 5I8TA 5GZFA 2VOXA 2HWE3 1P7BA 4XDPA 4MG2A 1YQ2A 1JZ6A 2Z5WA 3LOIA 4MHUA 1RUE1 1CPYA 3VV1A 1XHZA 3JB4C 4MGYE 4JX0A 3D36C 3PMEA 4CZSA 5BPXA 2IH1C 5FXZA 4HNAB 4IIJB 2ZS6B 3EYPA 3MFCA 1DU3D 4QX5A 1PZ8A 1W8UA 1N1YA 1QMJA 4K6BA 4BK4A 1GQHA 5B3SC 1JR9A 3EHBB 3ACFA 4NKGB 2EVXA 2DF7A 3UGGA 3OGIB 1N3PA 3HNBM 1B06A 1OZ0A 3JSLA 1ASJ1 3I2GA 1W9YA 4QDQA 3OGVA 3QOPA 2VAUA 3OUFA 5AC92 4AFCA 1RGSA 5CFCB 2E3CA 1OLMA 4WBNB 4D7YA 3RYHB 1WW5A 2NLJC 2VNRA 2FCVA 1WGPA 1WLEA 1J95A 2YROA 1QBZA 3B77A 2FZ1A 3U1XA 2OIIA 2Q1MA 1U0AA 4Q29A 1K9MW 3NJYA 3RI9A 4DR1O 4MADA 1SQPH 2UY8A 1T6GC 1XILA 1WCDJ 3KHCA 3WCSA 2GP3A 2UXDO 3LDKA 4O4JA 3RYIA 5LOVA 4XABA 2AUYA 5GLZA 3CSXA 4INDA 4K8XA 3I2KA 4YFWA 1M56C 2PZSA 5JOWA 4JHTA 2IU0A 4Y20B 4X65O 1AHSA 1NCQB 1H4HA 4GAZA 4PLOA 3IIIA 4UCOA 3M2MA 3CDZB 2WLLA 4DXRA 3TRSB 1OQ1A 1EV13 1IVSA 3ASOC 1UZYA 1V55C 3KKYA 2DWRA 1DQ2A 1XMQB 1KC8W 1XBFA 2WIIB 5C8YB 3P30A 3FYIB 4GKXA 3PUIA 4LF5O 4QB2A 1NZCA 4AHXA 3E22B 3F5TA 4DS0A 3GGLA 4FPLA 2DFBA 2JJ6A 4AHYA 1C5IA 1ORQC 1ULPA 4Q26A 4BW5A 1RUJ2 2HWF1 2QA4V 2LGWA 4TWTA 4N9IA 4BA6A 3GVMA 5JI9A 2YY1A 2QTSA 5J2UB 5L7OC 1KXGA 3LD8A 3UNPA 4BK5A 4HVRA 4E9KA 4R9AA 2XONA 5LBCA 3APQA 1OQDA 2FDJA 3RNSA 4Q4Y1 1GM8A 4O2BA 2ITCC 1WLTA 4NIHA 3OBRA 1PKXA 1LR1A 4X8AA 2PN5A 2XWBB 1CAUB 3A0BZ 2WZR2 2QQVA 2XKPA 3KV6A 3OTFA 4CEWC 2QQWA 2KQXA 3OGJA 4OUMA 1SA0A 2JDYA 5LGUA 5C8CA 2VZOA 3OEBA 4XAAA 2ENRA 5J96B 5LW9A 2P5OA 1VB4A 3GZUC 1SPPA 1OC1A 1Z7S3 3J7AU 1OI6A 2EIKB 2VU9A 3FMGA 4QHOA 1S0VA 4UVCA 2JX9A 1JMKC 1C8M3 3AVSA 4D8MA 1MS5A 3LQCA 2JDPA 5T55A 1D4M3 3N2KB 1WP7A 1YUDA 3GJAA 1VE0A 1M1KW 2PUSA 5F3GA 4TQDA 2IJIA 4A3ZA 2HLEA 1QNYA 3F7YC 3J7LA 1C3HA 1N1SA 1GZCA 4XC9A 2PHXA 3SH3A 3K4DA 2XAQA 1VBE1 1YQ5A 5EZYA 1WZXA 4M01A 1N0JA 2BOBC 4NHKA 1S55A 2BEOA 4PDWC 4EROA 3WX5A 4O4LB 1WW6A 4I4TA 1OFNA 2RJ2A 4YJ3A 4JTNA 5KA5A 5EP9A 1ZZBA 1LU1A 3PHMA 4X89A 1QJX2 2P6JA 3TYJA 2OUHA 4KI5M 4K1ZA 3H9VA 1IPSA 5C7GA 5IJ0B 4WBBA 5FNVB 4XCBA 4QQOA 3M3IA 4KGQA 1NR1A 1OOPC 1WCUA 3JALB 1FMD2 1RUNA 4EN9B 1XE7A 4HONA 2RDRA 3BTXA 2LFRA 2ZE5A 4PA4A 1JUIA 4JAAA 3G71V 4CH4A 2GSYA 5T5LA 3PUAA 2YFUA 3B5LB 1PGSA 1IS6A 1BZWA 4J7KA 5FK8A 2RMKB 2AEYA 3LZZA 1DBNA 3IKWA 1WA8B 2OVUA 2UXXA 2H6BA 2P34A 4Y1UA 1NUKA 3RSJA 2R49A 4D7TA 2KB1A 4WFHA 4RQEA 5BMVA 2MPFA 3BODA 3MI8A 5LBEA 1SCRA 5SV8A 3VBRB 3B3QE 4N23A 3OMAB 5LGNA 1IBKO 1PMJX 1VQ9V 1VBD1 2XT9A 2XUMA 2HEWF 3VZMA 2YXSA 2B4KA 1N32B 5F9TA 1QXRA 1Z5VA 1YQ6A 3O1OA 3HKBB 1KD1W 4CDWB 1B6QA 4UW6A 4E8DA 3N27A 3K4ZA 2PLV1 5FYMA 4C1WA 2WQZC 2XJTA 1UZVA 1OKOA 3TN93 3WF4A 1CPMA 3TOJA 2DOSA 4M3CF 1I1EA 3NL1A 2Y4UA 1W6OA 2GALA 2HWB2 5B4NA 3NQHA 3U07A 3AP4A 1JYNA 4S2DA 1RUH2 1AX2A 1W2OA 1A34A 5EPAA 4A2UA 1CIYA 1UWWA 4LFBB 1YC61 3J9SA 4FCAA 1NTKH 2ZE8A 1JPXA 1JS9A 1G9AA 4OMDA 2AREA 4AYUA 3M70A 1G4YB 2D2CB 1XYOA 2WLQA 1Z2GA 1OVSA 1JVMA 1UJWB 1L8DA 4YHHO 3OPZA 4IE4A 3HQXA 4JI8O 1RMU1 4S2FA 2BSKA 2QNKA 4FJCC 4JGYC 5T5JA 3T1LA 4EWDA 2D6KA 2Q30A 2Z5UA 1YTFB 2IC1A 2P4EA 3F5WC 3ZFFC 3N2GA 4XOGA 2ZR3A 2MNGA 3RBZA 1QF3A 5FYTA 3KCXA 3ZKYA 4LNUB 1MS4A 3MV11 1W2BU 4FPCA 4DO2A 4HXCA 1PGL2 2XQRA 3MFAA 5F7UA 5EYPA 3AZZA 4LXLA 4A6OA 5CU1A 2UXCB 3I3DA 4JV5O 5I93A 2E26A 4EFBA 4X66B 3N9PA 2V5YA 4XDQA 1BBT3 4GIQA 4LWSA 1SBDA 3LFMA 1FT9A 3RYKA 1HRI1 3POBA 5FZIA 3RZLA 1AR1B 3E2EA 1D2SA 1Q3EA 1EM1A 3ZN6A 4WM8A 2VQEO 4QPIB 4AFMA 1YJNV 3OPTA 3L71H 1K5MA 1BEV2 3MZHA 1LOEA 4RFRB 2UXNA 3OGSA 4J7JA 1B09A 2Z3YA 2JDAA 4YG0A 4KHPB 4NRMA 5JSRA 4RN5A 5B4XA 2EJ7A 3ZFEC 4OPHA 1TMF3 1S76D 3JSNA 1VF7A 4X64B 2BU9A 2YGMA 2P3JA 1VBC3 1REFA 3SYQA 2QDOA 1JZ7A 5A7NA 4R9CA 4AZZA 4CS3A 5DPNA 4P9IA 5KXBA 2WLMA 4FXKB 4ARXA 4DK0A 3L70H 2ZGSA 5LXTA 3C7OA 2GMPA 3LWC