4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
3H3ZA 4MGYE 3ELNA 4DINB 4EV0A 2FQPA 4BH9A 2PA7A 5CVRA 3ZDSA 4AVAA 3NW4A 3SHRA 2BEOA 2GC2A 4UBGA 3E5QA 4HN1A 5FPXA 5I93A 4O9GA 5LRSA 1ZZCA 3RDIA 1FXZA 3BPZA 4MH0E 3FFQA 3PLQA 1PM7A 2MNGA 4PIYA 5KBFA 3BALA 4BYYA 2WC2A 5JAXA 3EQEA 4ONUA 3NJZA 3PVBB 3S7EA 4QXKA 4X6QB 3H1YA 4B29A 2IXLA 3S7IA 3SCFA 3ES1A 3WW2A 2XLAA 2ZKLA 3IWZA 1UCXA 5I0SA 3E5UA 1NXMA 4Q0SA 4PIZA 5JCTA 5D1IA 1ZZ7A 2XKPA 4P9GA 2GH2A 3BB6A 4HVRA 3LA7A 4FAHA 2Q0AA 1DZRA 4I09A 4KWJA 3RNSA 3R6SA 2KXLA 4E2GA 4N9HA 3ROUA 4MGKE 2EVXA 2K9ZA 3EBRA 3I59B 3MDPA 4AVBA 2UYAA 5KHKA 5J3UA 2B5HA 4JTOA 3M70A 5HI0A 1RL3A 4IETA 2UY8A 1ZZ6A 4UBHA 1EP0A 2XLGA 1O5UA 4GULA 3E97A 3KSCA 5JSOA 2P17A 2QJVA 4E2QA 4XETA 4KL1A 2PFWA 2OA2A 4OFGA 1ZZ9A 1LKNA 4IEYA 3FJSA 4MGZE 2BNNA 5LRRA 3NSTA 4Q0PA 5J48A 1YUDA 5I8YA 5AVPA 3E6CC 4I2OA 2IXKA 3KMHA 3D0SA 1CX4A 2IC1A 3CF6E 3LA3A 5JR7B 4IEVA 1Q43A 2F4PA 4I0AA 1UD1A 1ZRDA 2OPKA 4HN0A 3OTFA 3CLPA 4RD7A 4D7SA 3LOIA 5EFUA 5LEKA 3EHKA 5BV6A 3N4MA 1Y9QA 4IESA 3CO2A 4Q0QA 3OCPA 2OZJA 3CJXA 2IXCA 2BNOA 3H1MA 2C0ZA 2BYVE 1SEFA 1CAUA 1CAWB 3IBMA 2CV6A 4ORFA 2GC1A 1OFNA 2OZ6A 5I91A 2PYTA 4I0BA 3EJKA 1X82A 4KU7A 1UIKA 4LA3A 1X7NA 1O3TA 4AQ2A 4Q29A 3NVCA 3ES4A 4EWDA 1UW8A 1JUHA 2HKXA 3C3VA 2Q4SA 3L2HA 4Q0VA 3H8UA 4FT8A 3BU7A 1J3RA 5I0UA 1X8MA 2XGXA 1L3JA 3UKTA 1VP6A 1O5LA 1X8EA 4ZU4A 1CAXA 3OGJA 4MUVA 5C6CA 1RC6A 3U11A 1XE8A 4H7LA 2BGCA 4ZU7A 4NVPA 3VHRA 3MYXA 2IXIA 2PHDA 4YRDA 3I59A 4PIXA 3HT2A 1XE7A 2Q1ZB 1UIJA 5I0TA 4XF4A 4YNIA 3FZ3A 4IEQA 3G7DA 2XL7A 4EWAA 4KWLA 1YFYA 2EAAA 1I6XA 2UYBA 2Z2SB 4R8HA 1RUNA 4K8FA 1G6NA 3RPQA 1J1LA 1OD5A 1OI6A 5FLHA 2Z69A 1YHFA 2QCSB 1ZZBA 1LR5A 3RZZA 1GQGA 2V09A 1Q5OA 1YFXA 2MPFA 3FE5A 4QMAA 3LZZA 4UXAA 4L11A 1CGPA 3NL1A 1O3RA 3CL1A 4YYOA 4I02A 4TLFA 4KU8A 1RUOA 1GQHA 1WA4A 2UY9A 4HLTA 4WZCA 5E16A 4JVAA 2H0VA 2QDRA 4XF0A 4Z07A 2XHKA 3KGZA 4X6RB 4LUMA 2O1QA 5FDBA 2PAEA 2GC3A 3FX3A 4LULA 1ZX5A 3E5XA 4XF1A 4XFIA 4MX3A 1RGSA 2H6CA 4LEJA 3H1WA 5FCCA 2ET1A 1NE4A 2GC0A 1LRHA 5KHHA 2K0GA 3U0ZA 1CAWA 4R52A 2QNKA 1ZREA 4JTNA 1Q3EA 4XFCA 4IEOA 4XFGA 4I3PA 4EWEA 1NE6A 3M3IA 5JSRA 2I45A 1SQ4A 3FWEA 5FQ0B 1NZCA 3OD0A 3HQXA 1V70A 4AQ6A 3JZVA 4IEPA 2D5FA 2PAKA 3I7DA 2E9QA 3IDCB 3D0JA 5I8SA 4QGMA 2VQAA 2ZCWA 3ST7A 2WFPA 4YARA 4XFFA 2GU9A 2DCTA 3IDBB 4J1WA 3D82A 1CAXB 3O14A 2D40A 1I5ZA 5BPXA 1CAVA 3OF1A 1QXJA 2D93A 3H50A 3DKWA 2B9UA 2PTMA 4FBFA 3H3UA 3IIAA 4L2NA 1ZVFA 5K8SA 4WBBA 5FPZA 4IEXA 1IPJA 1QXRA 2H6BA 4META 1YFWA 2XKOA 2CAVA 3E6BA 5KHGA 3H9AA 4F7ZA 2VPVA 3KCCA 1WLTA 5E1RA 4O9EA 2HJIA 4QM9A 3WW1A 3MPBA 3USSA 1ZRCA 2BNMA 3FHIB 3B02A 3SMHA 1O3QA 4WVZA 2FMYA 1QY4A 5KHJA 1J3QA 4EROA 4HSJA 3U10A 1DGRA 1XRUA 4QX5A 3SXWA 2Q30A 2XLFA 4HBNA 2Y0OA 2XL9A 4XF9A 1EYBA 3SCGA 4N9IA 1PMIA 4LTAA 3S0MA 4LLOA 3NKTA 1WGPA 1Y3TA 4YSFA 3QACA 1ZZ8A 2EA7A 3SCHA 4BHPA 3E6DA 4Z82A 4MV2A 1HW5A 4XFAA 1ZRRA 2GAUA 3LAGA 1O7FA 3GYDA 4J1XA 1IPKA 1O3SA 4XFBA 5JSPA 3H7YA 3PNAA 3TNPB 1UPIA 3EO6A 1H1IA 4IEWA 2PHLA 4Q0UA 5FLIA 3QOPA 1CAUB 3ETQA 2CGPA 3LA2A 4LUKA 3WW3A 1VJ2A 4HMZA 3I54A 2PAMA 1H1MA 2IXHA 3RYRA 1VR3A 4FAGA 2QVSB 4XEZA 1J59A 5EZWA 1DZTA 4BIFA 1FI2A 1O4TA 3ACLA 5FQ0A 5KHIA 4HVOA 1SFNA 3BCWA 3GBFA 2O8QA 2ET7A 5BXXA 1LB2A 4QGNA 5I0RA 2GZWA 4IEUA 3TNQA 3KGLA 1RTVA 4OLLA 4IEZA 4XF3A 2N7GA 1YWKA 4A2UA 5BY5A 5I8TA 2IXJA 4CYDA 5CU1A 1CAVB 1TQ5A 5CADA 1J58A 3WW4A 5C8WA 1YFUA 2ETEA 2PQQA 4IERA 4HVQA 1NYWA 4I01A 3H7JA 1DGWA 1ZNPA 4MZUA 4JV4A 4D7TA 4HZFA 4ZU5A 4KWKA 4QGLA 1U12A 3DN7A 5F1RA 1J3PA 3HT1A 1QWRA 3DV8A 3DL3A 3CEWA 5T3NA 4E2SA 1YLLA 4HSLA 3RYKA 1EY2A 5BUVA 1ZRFA 4AVCA 4XFHA 2VECA 2OYZA 1FT9A 4F8AA 3UKVA 3MZHA 2D5HA 2B8MA 3RYPA 4QM8A 1EPZA 5J7MA 5LEJA 2ATFA 5FLJA 4PJYA 3UKNA 3HIFA 3LWCA 4AXOA 1OMIA 4MGIE 2MHFA 2CAUA 4LA2A
chains in the Genus database with same CATH superfamily
5EBWC 4GYCB 2WSSG 1E1RG 3SPJA 4GALA 4NMIA 4U3FH 2JG8B 1PD3A 1GOHA 1WBLA 3TN92 3KHCA 4LNUA 3K75B 2WC2A 2FB5A 4CBCA 4XBLA 3DXUA 1VPHA 4EN8B 3PVBB 1FPN3 2YC4A 4X6QB 2CHHA 1J5EB 3UGFA 1SQXH 1G9BA 3OUJA 1YF2A 4TWKA 1VALA 4JTCB 1NOVA 1W8TA 3NV1A 2ZHLA 5KX5A 2ZKLA 3OD4A 3UK9A 2OCCC 1ULGA 3AK3A 1A34A 4FO9A 1U5IA 2VZUA 1ND3C 1QKQA 4DUWA 2XVLA 2ZINA 5FY1A 1UO9A 1I7FA 3ROUA 4O4LB 3FLTA 4JI5B 3NAPC 5FWEA 2CTRA 1BJQA 4JTOA 3M70A 4J9YB 4EEQA 4UW5A 1B06A 4O2AB 4FCAA 1W9TA 4J80A 3TOJA 3VBHC 4XQWA 3GBWA 2WT2A 4M01A 4E2QA 1MG1A 4XJ8A 2FCVA 2P22C 4AR2A 2FDKA 4YZ1A 2BNNA 3NSTA 4Q0PA 1EFRG 2CTVA 1YQCA 4JTDB 3KMHA 3MIDA 3ZXGA 4QT6A 1XUQA 1UOGA 2O8OA 4IEVA 5LGTA 3ZFGA 4R6ZA 3WNKA 3K3OA 5LA6B 2D3SA 2VOVA 5LEKA 3O1UA 4IESA 2JDKA 4RGAA 3BTZA 5KUKA 5JOXA 2EIKC 2DCZA 3ZMUA 1W2OA 1CAWB 2XJRA 2GTSA 4W4ZA 2OZ6A 1G8MA 4X1KA 2PYTA 2ARHA 2P4VA 1AL23 1KP2A 4KU7A 3AMPA 3I3DA 3JAMN 1GP4A 3ECQA 3OT7A 2W3JA 2Y26A 3MI8A 1G8WA 1OCCC 5FNVA 3ZFFC 1CJPA 1HN0A 1SQGA 4H7LA 4NUBA 4Q6GA 5T54A 4MOAA 4A3XA 3AG2B 1AI7A 1K4DC 3FZ3A 5CMUA 5DZEA 5JLVA 2XL7A 4FFHA 2R063 5FWJA 3Q8EA 5CFDA 3L2YA 2Z2SB 3ZFEA 3DPRC 1UOFA 1G6NA 4CEYA 4DR1B 4PT6A 3FE5A 4OHYA 2QE3A 1JODA 3QNEA 4BJ0A 4C90A 3WT3A 4KU8A 1RUOA 4DR7O 3M1HA 4JGYB 4WZFA 4IV1C 4DY5A 4DR1O 3ENRA 1R73A 2XHKA 1EUTA 1L0NH 4QAWA 2ZJCA 1TVKB 5FZMA 1N32B 2YI8A 3Q8FA 4COWA 5E89A 4EFBA 4C91A 1TUBB 4DXZA 2ZT9B 1NE6A 3N35A 3M3IA 2QZ2A 5T50A 2XWBB 2D5FA 2QQNA 1PGL2 4Y24A 5FP9A 4Y3OA 2WNVC 4XILA 1I5ZA 1D4M1 3WNLA 1OQDA 1LUWA 2JDZA 1JW6A 3VBUA 2BQPA 4WBBA 5KMGB 3HD8B 4QKDA 3UCSC 4CP1A 1VRBA 3WV6A 2VPVA 5F2VO 2NP0A 1EV13 1TMF1 2UWCA 1IOAA 3KZ4C 3JATA 5FLXN 5JQGA 5IY5C 5ABJA 2DQ0A 1VQPV 1SQQH 3DYOA 4QX5A 3NRUA 1JZ5A 1XHXA 2XL9A 5HBAA 3S0MA 1AVBA 1F4NA 4LF7B 1Y3TA 1FOD3 3FX7A 4WFBV 1UN1A 4Z82A 1SETA 2A0LA 2TUNA 3O0WA 5C8YB 5GZEA 2A75A 4M3CE 2HHHO 4LO7A 2JDNA 3K4ZA 2CGPA 1OF4A 2W0FC 4I55B 1OUXA 1POV3 1DZTA 1V6IA 2ZOEB 2W91A 4NKGB 1PMHX 1RXGA 2Y64A 1C8M2 5FYTA 2IH1C 4JI2O 1GZWA 5H9PA 1PX3A 4DRRA 5IT6A 3LUTB 3QTCA 4YLZA 1A8DA 1K97A 4I50A 4IGGA 4UB8Z 1CAVB 2Y6KA 2A06H 3ZXJA 2ETEA 2E53A 4YFZA 1HRV1 3M3CA 1HXS1 4JV4A 2QEXV 1VAMA 5KA5A 1AR92 4KXRA 5T3NA 1RSOB 1POV0 1QOOA 5H9QA 3R0RA 3OGSA 4I30A 1RUI1 4IW3A 5TISZ 2Q4PA 1XQNA 1EPZA 2WNEA 2FCTA 2W46A 3U1XA 2D3PA 4DUVA 4MGIE 1BHAA 2ADDA 3N9MA 1XILA 5ACA3 4ASKA 4ES8A 2GC2A 3MO4A 3DPRA 4UBGA 4CRQA 2BWAA 4UXNA 4AGGA 4K40A 3F2ZA 4FFIA 1URFA 3IC9A 1W05A 2JDPA 1BVVA 4ZHQA 3ALQA 5C4WA 1WUVA 3RVZA 1N8RW 1PL4A 3VUOA 2QM7A 2EULA 4QQOA 1B09A 4MW3A 1BK1A 3WZ1A 1QNWA 4QKFA 4RR3A 3D5OA 1H8TB 2DTWA 4HVRA 2PLV2 4XAEA 4IT5A 3OG2A 4JDOA 3R6SA 1P8JA 2BBAA 2EVXA 1KECA 3AG2C 1GWKA 3M7AA 1GH6A 1PO13 5LB6A 5LA0A 3AEIA 2IFRA 5FP7A 1V6LA 3T4HB 1V6OA 3KSCA 4RL7A 3LSEA 2P5BA 5FKCA 3T4VA 4IYIA 2YEVB 2JS5A 3URFA 4YVSC 2E75B 3JBG1 1B3QA 4PDLA 3LDEA 1S5HC 4UVCA 3OUFA 5DN6G 3PUHA 3ZHQA 1DF5A 2BRTA 4O4JA 3T08A 2XUEA 5EFUA 4DV3B 1P4RA 2UUAB 5APAA 4XIOA 2CTPA 1DP0A 1F8VA 3ZS8C 3LPFA 1HB3A 1O8SA 1SEFA 5IUQA 1NCRA 4AG4A 2PHWA 4GX2A 1RUH3 2IW5A 3T0AA 4CH4A 4JAAA 4I4TB 2XMLA 1GK9A 2AXTZ 4I0BA 2YXLA 1OVSA 4MTGA 1LHNA 1BEV2 3AG1C 4J10A 2OTLV 2F95B 4AZZA 3CCLV 1AYM1 4CCOA 5CFCC 2XGXA 4WFAV 2ZGNA 5ITZB 2BVBA 3OGJA 1H30A 4IV3B 5C6CA 1W9FA 4ZU7A 3H8RA 4GX0A 4LBJA 1WW5A 4AHXA 1VQ8V 4XF4A 2YY1A 5BY1A 2ADPA 4XQ4A 4V2VA 3I5DA 3SYAA 3V0BB 2ZGUA 1PO11 4AAPA 1AR93 2QQOA 1XREA 3RZZA 1CESA 2RNBA 3SEEA 4E4SA 1BLZA 3VZLA 2PMWB 4FTSA 3ORJA 3VGIA 2UY9A 3JD71 4P14A 4JGZA 1H4HA 1UYXA 1Y7BA 5FPVA 4BK4A 4KI5M 5FXVA 5LBBA 2PN5A 3WD5A 5FOBB 2SLIA 3AKSA 1AR61 5JPNB 1S0JA 3OBZA 2Z4FA 5C8CB 5FCCA 4B1MA 4MXWB 2GC0A 1PPJH 1LRHA 4DRXA 3B69A 5KHHA 3AL5A 4L97A 2ZIMA 1RVF2 1Y6XA 3SH5A 3CDZB 2IU0A 4YW2A 4X1YA 1ZYBA 3CCSV 3K08A 1ZL8B 3HBKA 3T1MA 5KC6A 3N7KA 2A6VA 3ABLC 2E9QA 2L9LA 1XYNA 2WR9A 5AG2A 4I9QA 1DGSA 4HETA 1GM9A 2DCTA 2ZAHA 1M57C 2FZ2A 1LGNA 4B3SO 2Y6JA 1VMFA 4W6WA 2ZR3A 3CJIA 3SKJE 5CA3A 4FTBA 3BU0A 2Q67A 3IIAA 2QJ1A 1JFFB 1UXZA 3PJYA 2H6BA 3O12A 1JU3A 2C24A 1MS8A 2I74A 3H9AA 5FZGA 3HKEB 4YY3B 4D69A 1FXVA 4QM9A 5FP3A 2NMNA 1XHZA 4DXSA 3OPZA 3P6BA 3N9OA 4KGGA 2BVVA 1M9NA 2QQPA 5FPOA 1HWYA 5B1BC 1NA1C 3B8MA 2X5IB 4GXLA 2CK3G 5FUNA 2V4AA 2EA7A 3M3OA 3CS5A 2GAUA 3LAGA 3BOPA 4J1XA 1NCQC 1Q7YW 3ZRXA 3M8LA 4GH4B 4MT8A 4OPAA 1CEZA 2LROA 3ETQA 2Y8KA 3T0DA 3AX4A 4QPIC 3ASOB 3BTYA 1VBD3 2EAKA 4URAA 1POV1 4LHNA 1CONA 1PK6B 2OUJA 4BIFA 2WZR2 5E6HA 4COVA 2R72A 2LRPA 2B9VA 4PA6A 2YYOA 1A8MA 5DAQA 3BCWA 2HP8A 4QB2A 4CUCA 5FBJA 2BU9A 1TG7A 3TNQA 3VBFC 4UCVA 2Y6HA 4M4RA 2EF6A 3INAA 5FJKA 3ZIAG 4LKEA 2EALA 1B35B 2PQQA 2VNVA 4OYUA 3H1KH 4MGSA 1QWRA 3DL3A 4Z1VA 1YLLA 4D6SA 4JI3O 2VECA 2OYZA 3GJAA 1FT9A 3MZHA 3OPTA 3BPSA 5T52A 5CBFA 1XXNA 2IVIB 3RYPA 3GZTB 4K8RB 2ZDIC 1SHWB 4FXKB 1LHUA 4UB6Z 3WDXA 3K79A 2AW9A 2UUBO 1AVMA 1UAIA 3ELNA 3L73H 3ABKC 3I3EA 5CVRA 2YXYA 3RJRA 4AHYA 1BYHA 5I93A 3RDIA 3FFQA 4IIJB 3M99B 4PIYA 5L19A 2D6MA 4MLOA 3PUQA 2RE9A 2VMDA 3SPGA 3J80N 1YYNA 3G6BA 4FLYA 2QQWA 3LNMB 1XOUA 5FNVB 5F37A 3SKVA 2EIDA 3W7WA 1QVFU 5J2UA 3EB7A 5JR2A 5LYJB 4DV5O 2Q6AA 2QFEA 2PGGA 2VBDA 1SRYA 3A0BZ 1ENSA 3MDPA 5FV3A 1PGSA 2UYAA 5AVAA 5KHKA 2ZXWC 5BNPB 4R9AA 4N53C 5JI7A 4FZ1A 1VAVA 2EIJC 3QCWA 3APQA 4LF6O 2OA2A 1DQ1A 1D5NA 5IK7A 1RSOA 5J48A 2XDVA 3WVJA 3CSXA 4CCLA 5FYCA 2HWE3 1SG3A 4I0AA 3I2JA 1R3LC 1W2AX 4W6YA 5IK5A 4E8CA 4AI1A 3A4UA 3ZRWA 1YI9A 1S76D 3J7AU 3VBOB 2GN7A 2EIEA 1Q6HA 3SEPA 3KV5A 2WDBA 3ZYBA 1FV3A 5IVYA 3B09A 3H0OA 3VD5A 3H1MA 1US6A 3KV4A 4RUEA 4AQYO 3DYPA 4YGCA 5LY1A 3WG4A 4CXWA 2E7AA 3OGCC 1I94O 1AHSA 5KLVH 1PO23 2YDEA 4QB6A 3PIGA 5FKBA 4GX5A 4NRMA 1ZBE2 3AFGA 1HQWA 1XNDA 5LATA 1QJU2 1HLCA 2WSVA 4Q4W2 1K5MC 2A7WA 1OQEA 4LKDA 3POEA 2Q7EA 5GALA 4JF3A 1CR7A 3ASNC 4G9SB 1RUJ3 4KNCA 1QJU1 2WO2A 4K3UA 1WB7A 2VMFA 1TME3 4IXLA 5D8AA 2ZX4A 4YZ3A 5L9RA 1VQ9V 3SJQC 4L11A 5B1BB 1PNLA 2PHTA 4I02A 4BQWA 2E7TA 4LFCB 4CCCA 5DPNA 2A1XA 4INDA 1XSRA 3SISA 2R1BA 5BNOC 4PDRA 4RHV1 2A3XA 1J83A 2WT1A 1EAH1 2G4IA 4MX3A 3JUUA 4G2KA 5EYYA 4NAMA 2Y69C 4P5HA 4YW5A 4EE2A 3ASOC 1Q3EA 4I3PA 2H3OA 2VCAA 2E6VA 1COV2 1SQ4A 4CU9A 1UXXX 3CCQV 3ETDA 1GWMA 5HXVA 4X62B 2B1GA 3O14A 2YZ4A 3LIHA 5HCBA 2V1DA 5FZ1A 1YJNV 1X9PA 4XHXA 3HNMA 4TTGA 4TYSA 4LE3A 4GKKB 1NQDA 2Y4TA 4XCAA 3UV9A 1DLLA 1KXGA 2EINB 2AACA 3HNBM 2RS13 2WLLA 3MHHC 3OPWA 1YXWA 2OQ7A 4CEWC 1IBKB 3CRCA 2Q30A 1VB4A 4LLOA 1AR4A 1MS0A 1UFIA 2AZ0A 3RYHB 3OY8A 2WLNA 4XFAA 4Y20B 3A0HZ 2VQUA 3T1HB 3K06A 1QF3A 1DQ5A 2ZGMA 2ORXA 1R6NA 2PHLA 4CDUB 3A2FA 4MXWA 3GZEA 5FO8B 1FD9A 2B9ZA 2PAMA 1UU4A 2B7YA 3QBQA 3P3NA 4NOTA 2VZOA 4IHJB 3WG7B 5FZDA 1ENQA 2D44A 1VRH2 1W6NB 3C3TA 4PA7A 3Q9OA 2WS93 2VXRA 3HEIA 2P1BA 4FSJA 1FS0G 4IEZA 1ALYA 1WCQA 2E5LB 2VXJA 4MTXA 5C8WA 5GONA 5F3IA 2HYKA 3FB6C 1BE3H 4QGLA 1XNRO 5DAWA 2YIDA 5EK0A 5F39A 4HSLA 2LM3A 2XQRA 4MS2A 1K7DA 1RUG3 4CZZA 3D6EA 3FMGA 4CDXC 1KD1W 1N0JA 4NPMA 1BZWA 4LH6A 1XMQB 5FYZA 2DFCA 4X66B 3MDSA 4XUQA 3K57A 1BVP1 2YC0A 1YNAA 2W52A 2MHFA 4WBNA 3NW4A 1FXKB 4NXMO 3DXTA 2R30A 1FYJA 1AI4A 3B4SA 2DN9A 1A3KA 1ULEA 1NVPD 2VG9A 4BWAA 1K4CC 3AMHA 3OUHA 4ARYA 5FMCA 3MIEA 4BYYA 3N36A 4LF5B 3CP1A 3S6PA 3KVBA 5CISA 1BZKA 1ULPA 1REFA 4G3YC 5C3PA 1RM1B 2YFUA 1JZ6A 4HOOA 1SZTA 1KQRA 2QKAA 2VMGA 1SLCA 3OTOO 2OIGA 2HLDG 3HAGA 4OHZA 1HRV2 5LK7B 4FPCA 5EQUA 3RZLA 5CB4B 2K9ZA 2JJ1G 2FTKA 5J3UA 1NH2D 3CC4V 2XJPA 1RUH1 2XH6A 5D5QA 2DYRC 1QJY3 2P4EA 1S2BA 2P17A 5CFCB 2L35A 4B3SB 3FJSA 3CMGA 5BNNB 4M3CF 4EN9B 1YUDA 5I8YA 2WNVB 3LDCA 4CVUA 2V5DA 1RUC1 2DV9A 5DXDA 5IYDO 5IVFA 4FOVA 3OGGA 1Q43A 3SPIA 1UD1A 4LBNA 4LWSB 3D36C 1WCDJ 3KT1A 4NIAA 3Q8AA 3V0AB 2BOBC 3VHPA 4YGDA 1PL0A 4XDLA 2WFF1 5A3MA 4F4LA 2R071 4XXAA 4FVMA 2ZGOA 3O0XA 1F23A 4IIJA 5BR8O 2BYVE 2QQKA 2Y69B 3DCQA 4DR6O 3UJQA 3CBNA 2J1TA 5D2AA 3J7NA 2ITCC 3FN9A 1JZ7A 5FXXA 3OM3B 1W8OA 4FQZA 1V6JA 3ES4A 4OX9B 1QHDA 1I5PA 2AZ2A 4PBPA 2BPA2 4LBQB 3K46A 3CJIB 4QKNA 2HWB1 1URXA 5LGUA 1H2GA 1XE7A 1LECA 4YNIA 1G9CA 3W7UA 3TGUH 4JI2B 4QPWA 5IWAO 1R6TA 4EWAA 4KWLA 4K1YA 3CMEV 3TEYA 5EC1C 5A7PA 3C8XA 1RUD3 1G9AA 4ZZ5A 1OI6A 4CEYC 3POJA 5FLHA 1R1A1 2QCSB 5CG9A 1JZ4A 4BB3A 1LR5A 4OCTA 1GQGA 3NNJA 1TAEA 4UXAA 4Y5TA 4K6BA 3E2EA 3ZFFB 3CCUV 5IVCA 4JVAA 1CZTA 1JXNA 2M7WA 3BA9A 3B9IA 3VBOA 1CWPA 2Q8OA 2ZQMA 3STZC 1ZX5A 4FPGA 1BCXA 3SR2C 2F6BA 3H1WA 3B00A 1NE4A 2XUMA 4XHBA 3BKZA 4RQEA 2QNKA 5A32B 2WO3A 4HK9A 1T5EA 4X8PA 1JR9A 4YJ2A 4IEOA 4JYYA 5FO7B 2OUHA 5C9AB 1AJNA 1GQPA 1S0VA 3J8F3 3UESA 4P9YA 1NUKA 1Z2GA 1W0OA 1WLWA 1RJ7A 1OOPC 4NO4A 4YWAA 3WF1A 4BWOA 2Y38A 4J1WA 3AXDA 4N90A 1MVQA 3FC0A 4L0PA 3ZHSA 3LKJA 5IWFA 3ATGA 4PELA 4TZDA 2KA3A 4IEXA 4LOTA 5K7PA 1QXRA 2PLV1 2K46A 4D6RA 2XXZA 5KXDA 4H44B 1UF2C 4JGZC 2ZGPA 5LBEA 4LOSA 3O1PA 2F4VO 2DCYA 4GKYA 2AENA 1XL4A 5A6QA 1S2KA 2ZACA 3CRQA 4DK1A 3W7SA 1PNGA 2KG7A 1AYN3 4AK3A 4AEMA 1UZWA 2IUWA 3M2MA 1HKDA 5GLWA 4EJRA 2D6PA 2WLJA 4ZZ8A 2LW1A 1UPIA 3MF6A 2PYLA 2WRAA 5A1LA 2O14A 4JV5O 1VIBA 1KKDA 1GN6A 1VR3A 5BNOA 1WMFA 5CEHA 2RDNA 3HPLC 3MV11 1WA8B 3I8TA 3ACLA 4Q4X3 4QPGA 1JVMA 1AXZA 2UU9B 3GBFA 5G05L 4NPLA 5BXXA 3VL9A 1ULDA 4QGNA 1D0HA 4MHRA 3T1LA 5IE9A 3WQBA 4DR4B 4DEQA 2O0OA 1YWKA 1U0AA 4N23A 5BY5A 1VQKV 1QXPA 2MW2B 1WLCA 4B4QA 2V7QG 2VCMA 1YFUA 4DS0A 3I2GA 2MK3A 2QUOA 3BYWA 4MHUA 2ES3A 1W0KG 2QKSA 4FLZA 2R7EB 3CEWA 4E4HA 1GLHA 3DKQA 1TVGA 3VBRB 1XSQA 5EJZB 4AW7A 4Q26A 2J7MA 3WNXA 4KWUA 3SJBC 4YW4A 1HNZO 2ATFA 4X89A 2JKXA 4UW4A 2D6OX 3IPVA 2W1QA 1RYYA 2ZX2A 1WLEA 2PHXA 1EN5A 4MXVA 1RMU3 4IGQA 4CDWA 4E2LA 3WNNA 4HN1A 4LFAB 3L70H 4DZGA 1MQTA 4DOUA 5DZFA 1H9PA 1FFTB 2ZNIA 4QPGC 1N1VA 2IM9A 3GXUA 4V1PA 2WQ4A 3BIWE 3WP4A 3H1YA 5T5JA 3DGTA 3ZEDA 1ND2A 3K03A 2Q7GA 1W2UA 4BQ4A 3ZN4A 5F6KA 3CJHB 4QB1A 1DQ6A 4CP9A 2FKXA 1WB8A 3ZCCA 2FDJA 5J37A 3RNSA 1W6NA 2RJLA 3K58A 3I97A 3JARB 4ZY9A 1X50A 2JG9B 3E89A 4N9HA 3ZXDA 4F3JA 4ZS2A 3SYCA 4J7JA 4AI3A 4HT1T 4LE4A 2DVAA 2QBXA 4FFFA 5CA0A 3E97A 5JSOA 3MGUA 3ZN5A 2ZGKA 4P9PA 2BGOA 5LZ6A 4PLOA 1UZ0A 4YVSA 4B3TB 2VMEA 1WCUA 2CGOA 5JZGB 2AH2A 4DR2O 4LO8A 2WSUA 3P32A 2OPKA 3POBA 1G6UA 2WQZC 1AP6A 4JI1B 3OTFA 2VTFA 3VHOA 1FAFA 1FMD1 2J1SA 1C4RA 3EHKA 2JS3A 1FMD2 1I94B 4DMIA 3F5TA 5KAFZ 1SQFA 1W8ZA 2QTSA 1AR63 5AFBA 3AMMA 1JHNA 1KC8W 1FKAO 4GH4A 1SZBA 2CH7B 1ROPA 4QPKA 4YZ5A 1HX6A 3A8TA 1OQ1A 1LTEA 2BTVC 3NVCA 4DV2B 2VMIA 1ZUQA 1UW8A 2D6LX 4JI7O 4BQ5A 1VF6C 3NV3A 4FT8A 4DFSA 4RS5C 2R9RB 2JXAA 3RWNA 2FDGA 2K9PA 5A7OA 4OX9O 4O4LA 2WNUA 3WUCA 1SQPH 3WG7C 1R3IC 2E32A 2JDMA 4LKFA 3E86A 2D3OW 2C4XA 4K8FA 2DU1A 5HFLA 2VWJA 2RR12 2CNAA 1SA0A 2JRIA 1ZZBA 4MADA 4Y1UA 4TQDA 3AYDA 4AQSA 1O3RA 1OCCB 1RP3B 4X1IA 1THZA 4UFIA 1AR71 4CU8A 4WZCA 1JOPA 2HBUA 4MO3M 4Q4W3 3WDVA 1F5FA 1Y74A 5LA6A 4X66O 1ZA7A 4LHKA 4KGQA 4OI0A 2DVBA 3CXCU 1TMF3 3APBA 4TN7A 2W87A 5A3UA 2ZBJA 2A6XA 1VIWB 2VOKA 2X6AA 3AC0A 1ZREA 2BZDA 2DF7A 3DUIA 4XFCA 3Q8CA 1MSWD 1K5MA 4YG3A 4X62O 1BCCH 3FWEA 4AEDB 4FFKA 1LOCA 2GMPA 1S2EA 3I7DA 2Q8VA 4ZI7B 1ZBA2 3AZYA 1HB4A 3JAKB 2PHRA 2WFPA 3CC7V 3IKWA 1GM8A 4JPRA 3ZHRA 1LOAA 4LBQA 2RR13 2D40A 4YVWB 3OF1A 4LCUC 4Q20A 5JCOA 3WUDA 2VNRA 4AHZA 2ARXA 3C7EA 4KHPO 1IPJA 3OJBA 5EP9A 4KUMA 4E9KA 4OZOA 4CH3A 5B2GB 4TUYA 2HEVF 3ZX7A 2J1AA 1AB3A 4KMQA 5A80A 1JA8A 4BQ1A 4ZOLB 3MV01 3VL8A 3NNMA 4YJ3A 5FPBA 1KDMA 3B94A 3R4DB 4N9IA 4AYUA 1K73W 3VBRC 1AR82 3SYPA 5C70A 2JG8A 1ZZ8A 1ENRA 4MV2A 1XI1A 2EICA 1HRI1 1SBFA 3WB0A 5JSPA 5FZFA 1OCRB 1H1IA 4X1KB 1ZSPA 5FLIA 4BLIA 3K3WA 5GTIZ 1OFSA 5A32A 4PDWC 1CPYA 3RYRA 1FXKC 2GP5A 1Q8IA 4H33A 3FL7A 3B7MA 5KHIA 3ABTA 3VD7A 3ASIA 4CC5A 1P49A 3LB9A 2VQ0A 2X5IC 1RUC3 3LIGA 1HNWB 4XF3A 1XOYA 2R0FA 3PDQA 4J41A 3VBUB 3K2OA 2A6YA 5IAXA 1ZNPA 4DRVA 2QQLA 3VBUC 1A32A 2HJFC 4CEYB 2WNVA 5FY9A 5LA1A 1AR73 1JJOA 1W28A 4NXNO 1X9TA 3BGAA 3PMSA 2LGQA 5D8AB 5LEJA 2FZ1A 4ZKIA 4X64O 1R092 5FLJA 5IHRA 4ZKTB 2W1WA 1LOBA 2DYRB 2VCBA 2CAUA 1SLAA 2PA7A 4XMAA 1BBT1 1ODMA 5FPAA 1YTFB 1BSMA 5FPXA 4QX2A 2A5ZA 1L7QA 2ZHMA 2Z5WA 1JJ2U 5CIRA 5KBFA 4X65B 4CEWB 1EV12 2I2SA 3EQEA 1ND3B 4GCZA 1BHGA 1DGLA 4S2DA 5CA6A 1JYVA 2FD8A 1NXMA 5BNOB 3H1IH 5LMNO 4YZ2A 4K0KB 3KV9A 1ZZ7A 2QA4V 1WA8A 4FAHA 4LO5B 4I09A 2OVUA 3ILNA 5JJEB 1AX2A 3IN9A 2RJZA 4P08A 3MHSC 4G4FA 2CAZC 3VKLA 3F95A 1EAH3 4O61A 2P3KA 1OLRA 2VQTA 2XAFA 5H5NA 2B45X 5FFOC 4C0BA 3OMNB 4QE9A 3S57A 3OBAA 4UFHA 3LEKA 3E6CC 1WWYA 4O4IB 2JDYA 3BAAA 1Y76A 4H13B 3LA3A 1Q82W 4RAIA 1NH2B 3I2FA 2PI4A 2WN3A 4AVSA 1ZRDA 2MEV2 1W8UA 2HBTA 4GWNA 2YC2A 1PNKA 4UF0B 2JE7A 2VY0A 2YROA 1QU0A 1QMJA 2NN8A 4RD7A 1UJWB 3LOIA 4E4EA 3BTAA 2WIIB 4NTXA 3BRCA 1VEWA 4CU7A 1CN1A 4FPPA 4PLNA 2GN3A 3DGEA 2EIJB 2J22A 1MABG 1W6PB 1DHKB 4CDUA 1NLRA 3QLQA 5C9AA 1SDDB 5FTTC 3AK1A 3TEZA 3MIFA 1W6OA 3OMIB 3WEZA 3C3VA 4JKKA 3GCXA 3RYCA 2QDNA 1RPOA 1Q6IA 4DV4B 1O5LA 3EVKA 1R091 1HW7A 4I50B 4MSVA 2WWWA 1MS9A 5F5CA 3JARA 4YM0A 4P9LA 1OOPA 4DQAA 3SQOA 3NO8A 1M56B 4D6QA 1RMU2 3RSJA 3VZOA 1N1SA 5LBCA 1COV1 2JG8C 1W8HA 3OTOB 5H6QA 4I3GA 2GDSA 2JEXA 5LY2A 3PIJA 2XASA 1CGPA 1F2NA 3OEEG 4WCEV 1GMGA 2DCJA 2W95A 4DV6B 4M0HA 3EYPA 2R042 4YGEA 5FZIA 5JMCA 1RVF1 4TQFA 5GZGA 5FDBA 1XMQO 1FXKA 2DMXA 4R9CA 1RUJ2 3AFKA 5C4WC 1RGSA 5CG8A 3AG3C 1WNSA 3GGLA 3MIGA 3SGIA 3FFZA 4XW3A 1O91A 3VQXA 3S30A 2EIMB 4DO2A 3N3HA 4CDXB 4A5UB 5A7NA 4JTAB 1V70A 1GP5A 2D97A 5KXCA 1I3HA 2WFF3 1UKRA 3IDCB 4BLJA 2PXJA 3KT4A 3ST7A 4X64B 1DYKA 4X9QA 1PIV3 3WG2A 5KC5A 4HZ3A 1J1TA 3ZMNA 1QXJA 3AXEA 1KYOF 3DKWA 1PVC2 2KB1A 1AROP 4DR6B 4YG0A 1FOD2 2CTQA 3M7MX 3VBSC 3I2HA 3HKCA 3CMAV 2QSAA 1V55B 1TUEB 4RUFA 1DGWX 3JB4C 3O1MA 1JYXA 4KBZA 2ZMLA 3TN93 3SMHA 3RMXA 2VVDA 5JZGC 1K42A 2FMYA 2DQ3A 1JQ0A 1QY4A 5KR7A 2DYSC 1IS6A 4LHLA 1R1ZA 1XRUA 3FUQA 2VOTA 1JYTA 4HBNA 1EYBA 5AC93 2UXDB 1H6YA 1I9RA 4ASUG 1PVXA 4Q4V1 4LF9B 3W5MA 3CX5F 4QQLA 2ZE8A 1S0GA 2HWD2 4LF4B 4DK0A 3IAQA 4H0LB 3FUOA 4A45A 2PHFA 3EO6A 5FR3A 2C2AA 4FQ4A 4CSWA 4H3WA 5E79Z 4HMZA 4N21A 1OKOA 4J7ZA 1ODNA 3WLUA 4RR3B 4BW9A 4O65A 1XB9A 2E31A 1SF9A 2BUKA 1LGCA 5KWRA 1OCZC 5CKNA 1YVWA 5CN0A 3E22B 4MTFA 1L7LA 3SC7X 4GKKO 1H0BA 5DG1A 2DCKA 3ABMC 3USUA 2HWF1 4HZFA 4ZU5A 2FDIA 3P3PA 1N36B 3A7QA 1RXFA 1V6MA 3ZFEB 2WAMA 2VZ1A 3CNAA 2Q68A 1VBB3 2YICA 4PBOA 5ISLA 5J7MA 1ZBA3 3HIFA 1QBZA 3RZKA 1GM7A 3GHNA 1RJ8A 5J1XA 3H3ZA 2VZQA 1RUF3 2FQPA 3MLJA 4BH9A 1O9HA 1WN7A 1RUI2 4W8JA 1FXZA 2RM21 1TVKA 1AR91 4FM1A 1H8TC 4XOGA 3LNNA 1VBB1 3S7EA 1DQ0A 2WL1A 2ZA9A 2DUPA 4X8AA 1MR5A 3UL2A 5LW9A 3ACHA 2YS8A 3ES1A 5K0UB 4M3CA 2GUZA 2WZR3 3E5UA 2JGUA 4AQTA 3FYIB 1XBLA 3CCEV 3BB6A 1BMV1 4DUYO 3CCMV 2NPIA 5FY0A 3FHAA 3EBRA 4NR1A 3KQ4B 4LLFA 3OUIA 4A42A 4NIHA 2VR4A 1O6UA 4Q4W1 2B5HA 3ZM8A 5HCHA 2XB6C 5GW7A 4H2AA 2XOKG 3LDDA 1IBMO 4BCUA 1KJLA 3HBZA 1GR3A 4KL1A 1AXKA 1HQNA 4JGYC 2OQ6A 5E1AC 1UWWA 3SJCC 5GZDA 2LQTA 1JHJA 1BQPA 5FP8A 3AM2A 2IXKA 2CY6A 1US3A 4X1IB 3AJZA 1EUUA 4MVZA 4HN0A 3VDAA 4AHCA 2DWEC 2QZ3A 2J1VA 2W2IA 3RT3C 5BNNC 3ZN6B 2EXIA 2KG7B 3T1YB 4R4ZA 4XTPA 3CJXA 4YIOA 4Q5OA 2C1FA 1H38A 4P9JA 3AP7A 1WD4A 5C8YA 2XG3A 1CAUA 4CEWA 3IBMA 2CV6A 4RQPC 5CFDC 1RINA 4ABMA 2VUAA 2X09A 3J7HA 3ZPYA 1TA8A 1HR0B 3CEIA 4JKMA 2G9GA 1CAXA 1GZWB 2WWSA 3J4UH 1XE8A 1MEC3 5JDBA 3ZN0A 4B3NA 1TEIA 5CAZA 2IXIA 2PHDA 3AYEA 4QQHA 2KSDA 1YFYA 5BNPA 2GNDA 4IE4A 3LEMA 4DV0O 3GBGA 5L3BA 3EXUA 4U7NA 1W8NA 1LGBA 4UV9A 4E4ZA 2ADQB 5FPUA 3W5NA 4DXTA 4TWTA 3MICA 2R062 2GP3A 2PLV3 1VBE2 4AWDA 1KITA 3NL1A 1IX9A 3O0VA 2JIGA 4P9OA 1PGL1 5E16A 4UF0A 3KF5A 4Y1ZA 4A6OA 3PHMA 1HB2A 4DXWA 4CXYA 3M4FA 4DR3O 1NG0A 4XBNA 3HR0A 2PHUA 3JQXA 3BHPA 2IJKA 4WM8A 5FMOL 1PK6A 1YITV 2C9KA 1HXS3 1H8HG 5LK5A 1YJ9V 2OT7A 3JZVA 2WUHA 5FYSA 2KKWA 2UXDO 1RUE3 5I8SA 5DZGA 4QGMA 2QKCA 3H1LH 2W92A 1S77D 4MTOA 1H8TA 4CP9B 1H2MA 3ZMOA 2ETNA 3IDBB 4W50A 3TB0A 4ZS3A 4OQ9A 2PY5A 3O1RA 5EWSA 2WLIB 5A3LA 2B9UA 1SDWA 5AC91 3BOWA 1FX5A 1GRJA 2ZM6B 1N3QA 4U3JA 4F7ZA 4PA3A 2YPDA 4MVOA 1QH6A 4O9EA 5D5PA 2LGWA 5A6ZA 4QGPA 1ZRCA 4XMIA 4FM2A 2IBZH 4L8JA 1O3QA 1QIQA 3AK2A 3C90A 1CPNA 3LSQA 5KHJA 2R1DA 3CWBH 3AKTA 3NNLA 1NLSA 1W39A 2UWAA 5A6YA 2ZIOA 4NIDA 1TNFA 2DW4A 4FM0A 3ZIWA 1K3IA 4XJAA 3T4ZA 3JYCA 3QACA 5IW0A 2YUAA 4CXXA 4LKSA 1YCIA 2OXBA 3ZDVA 4XFBA 3THPA 5F7UA 2OTJV 5FOJB 3QOPA 5DUWA 5KXBA 1GFF2 1TNRA 3I54A 2DBNA 2BWCA 5FZ9A 4FAGA 4XEZA 1ASJ2 1C8NA 4J11A 1Q8QA 1QQP2 1JCHA 1Q86W 4Y4YA 1QJZA 1UY4A 2Y4UA 4GWIA 4N53A 2GSYA 2Y34A 1NY71 3AZWA 4CYDA 4LIVA 1RHI2 5FZ0A 4ISRA 1AJOA 4DV4O 5EHDA 3G67A 1NYWA 3WDYA 4F6RB 2YUEA 1HNZB 2A3YA 3VD9A 3IAPA 2EX3A 1SCSA 4NN0A 1MS3A 1EY2A 2ILMA 1NVPB 5A1FA 4AI0A 3V0BA 4UFKA 2RQ6A 4A6SA 5FYBA 2XTAA 3TBDA 4JI8B 3ZOIA 4OUSA 1A6CA 1S4CA 4B4RA 3JALB 1BHBA 3ZRWB 4J6GA 4NRQA 1HNXO 1A78A 2W39A 3PLQA 2ZZJA 5JAXA 3AK0A 4CZSA 2ZDIA 3NJZA 4QHOA 2B39A 2D6NA 4JV5B 3HJRA 1OD3A 3WP5A 3SCFA 2A6WA 1IZ3A 1CZSA 1OLMA 2RMU3 3ZSMA 1YEWA 4Q0SA 4PIZA 2AGSA 1W0NA 3E8FA 5EXOA 1YJKA 3W7XA 4QX0A 4JRAA 1NA1B 5FZEA 1HN1A 2Q0AA 1DZRA 1WW6A 3W9AA 1N1TA 1KUQA 5LWBA 4CE8A 3LOBA 3RFRA 1LUVA 5HPOA 1F4AA 4C1WA 3CCJV 3E22A 1BQZA 2R6QA 5C3OA 4L87A 3ZYRA 3AVRA 2QR4A 2WNOA 1BS3A 2JK5C 1G1XB 4XUTA 2EXHA 1CQ9A 3U4SA 3VQWA 4MGZE 3C3SA 4TUYB 5JOWA 1MS5A 1S5JA 5F2SA 1KB9F 2G9FA 2XJUA 2IU3A 2VWKA 4XBFA 1HJGA 1R093 3RRDA 5FYVA 1C5IA 1D0GA 3O9OA 2ORZA 1X4TA 3VDDA 4ZPIA 2K2SA 3BEHA 3WB1A 4D7SA 1WA6X 2VE1A 5C71A 3OCPA 2P6JA 4DR5O 2XAHA 2XBO1 2P3YA 4Z1MG 1QH7A 1C1LA 4BM8A 5F5QA 4ORFA 3THTA 4L92A 4BMBA 1W3XA 3FKSG 4BK5A 3CB2A 2W94A 5C3SA 5CKQA 3U78A 3AG7A 2LW7A 1X7NA 3IJ4A 4K8XA 4KH9A 3J8F2 3L2HA 3LDBA 1VQ5V 4YM3A 2OCCB 4XJUA 5GJ6A 2AGAA 4C7UA 1S0EA 4ZU4A 4Z92B 1OCZB 3VD4A 3CCVV 3AZVA 4Q1PA 1RC6A 1OPOA 3VHRA 3MYXA 4YPJA 5A3WA 3UT0A 3LQCA 5ANQA 3T2QA 4RS5B 4XCBA 5DG2A 2W08A 4CDQA 3ZFEC 2A9HA 3MW2A 4MVMA 5FBZA 4YW7A 1BMFG 2DVFA 1JU4A 4A7YA 1ORQC 1SQBH 1ST8A 4IQPA 2QWOB 1PIV1 4UCSA 1QJFA 3N7JA 4JGSA 3VDBA 4O4HA 2NZ9A 3CL1A 4YYOA 2VULA 1QJX3 1AYM3 4JKLA 2VH9A 1W6QA 4N43B 3V0AA 4GWMA 4X6RB 5JXIA 4UCOA 3WX5A 1Z7S2 2GC3A 5KXEA 3ZN6A 5BNPC 2GSMB 4FP2A 5FIXA 4E27A 3HKBB 3I3BA 3M3QA 3AP9A 4DO0A 4BPZA 2Q5ZA 1ULCA 2K0GA 1D5AA 4AGVA 3AB0A 3ACGA 5IFPA 3WB2A 3OE7G 4QXBA 1VARA 4W6XA 3WOGA 2CE4A 2QQUA 4AEKA 2W9XA 4OHWA 1VBD2 3D0JA 4FTEA 3FAVA 3SNMA 4IV1A 2GNMA 4YARA 4MSWC 1CAXB 4UW6A 4YHHB 1VQNV 2P34A 3T4DA 5L3CA 4K0KO 4XURA 4Y22B 3H3UA 4JI0B 1X33A 1K5JA 1OA2A 5K8SA 3ZFGC 5CFCA 2XBO2 2OKXA 4IL7A 5BNNA 1MVEA 4DXRA 1OCOC 2PQSA 4GMP0 3MPBA 4BIZA 3M8AA 3IIIA 1J3QA 1H2SB 3WNMA 3WQ1A 4XF9A 1N34B 2FDHA 3NAPA 1SLBA 3H9VA 4QX8A 1NJIW 1AILA 3E6DA 2HEYF 1LHWA 1SACA 2JB4A 1LULA 1TE1B 3QO5A 3LPGA 3PNAA 4GMP3 1UPSA 1R6KA 4PV1B 1W2BU 2OS2A 4FPEA 1W8FA 1NS1A 3P1IA 1YQ5A 1H1MA 5JVDA 1OH3A 3OGVA 5J36A 1XJAA 4YJ2B 4UW3A 1U97A 4FZ0A 3ZRVA 1UYPA 4TSFG 3ABZA 1VBC3 3AKQA 5FQ0A 2E3CA 2QWQB 1YDXA 1EPWA 3RZGA 2VU9A 1S5LZ 3LE0A 4IEUA 5B3SC 1W8WA 1JH5A 1RTVA 1D4M2 1PNMA 1UX6A 3RVHA 1U5YA 3WHUA 2ZTNA 1HJFA 2W6JG 4OMDA 3ZSEA 3ZXEA 4MZUA 5IVJA 3DN7A 3Q4HA 1J3PA 3HT1A 3K5NA 5C3RA 2Y60A 2VMHA 5FO9B 3R4UA 2VOWA 4BW5A 4LF8O 3DEMA 1MZEA 2ZD9A 3STLC 4LA2A 2VZTA 3PVOA 4MGYE 4EB6A 4EV0A 4CCJA 3FHQA 4LXLA 1S0IA 3E5QA 3H01A 2EZPA 3BPZA 1AR81 3BALA 4OHVA 2DYSB 2BV4A 1QNYA 4A7ZA 4YY3O 4NHYA 2B1IA 1VF7A 1Q8SA 3RYIA 5H9RA 2RS33 5F6LB 3C7FA 5FAXA 1Y43B 2IXLA 5LP6C 3MBWA 4UFJA 2BCCH 3VKFC 3RS6A 3K3NA 3MF9A 2GHYA 1DDLA 2F66C 4JI1O 3T09A 2BJSA 5FZOB 2RMKB 2ATKC 1D7PM 4E2GA 1XPWA 1QDCA 4B3MO 3GVMA 1C5HA 3B9CA 3LSDA 3RGBA 1OA4A 3DXRA 4AFBA 1VBB2 4TV9B 1BBT3 4LK6A 1IURA 3RZMA 4FFGA 2JDUA 4HK8A 1OXCA 3BUCA 3ACFA 1Z5WA 3U75A 2QWRB 5J2TA 1GP6A 1G7YA 5FYIA 3RYFA 3D0SA 4A41A 3CF6E 1N33B 1QQCA 1DYOA 3D3AA 4AFAA 4I9WA 2EZOA 4LFBB 1QLEB 4K35A 1NR7A 2JG9C 3HOBA 4UUJC 3OEAA 4NROA 4NE9A 4MVQA 4F6EA 3WHTA 4EYUA 4Z8BA 1CD3G 2PUSA 3L75H 4IV3C 4WM8B 4X88A 2BOJA 3N9NA 1H2KA 5EC2C 3LD8A 2DURA 4B7EA 2ZGLA 3A22A 3VN4A 1GKBA 1H8VA 1PGW2 3KM5A 4J25A 1S3JA 1YC61 2W68A 1GUIA 2QWNB 4YZ4A 3AP5A 1L7RA 2RDRA 2DYCA 3AG4B 5LHHA 1SERA 2ZEXA 1WMEA 4XE9A 5GONB 3OGIB 2HWE1 2RM23 3WFVA 1J95A 4QU1A 5CA0B 3RPQA 4YFWA 1PGW1 2RMU2 4GB31 3SPCA 3O5SA 1FJGB 4GT1A 2V09A 3WQ0A 1EBOA 3T0BA 1AX1A 4Q4Y1 3A0RA 5JZGA 5F3CA 2VMCA 3BI3A 5LOVA 5DABA 1HIXA 4DV7O 4CC6A 1VBA1 5BYNA 4Z07A 1F4MA 3KGZA 1H1AA 3DYMA 5C9AC 2PAEA 1LCLA 2X7RB 4JYAO 3OEBA 4JI8O 5L7OC 3VKNA 1HP8A 3MLLA 4GD4A 5EZYB 4LEJA 3JD2A 2ET1A 1EAH2 1XNCA 4Q4X1 1R1A3 1UU6A 2GH8A 5CA1A 4WFEA 4XFGA 3GNEA 1ZBE3 4EWEA 4Y1XA 4IYHA 1VAKA 1NQTA 5DUUA 3DC6A 4N53B 3WU2Z 3AG3B 3OR6C 4XFFA 4BZ4A 5ANNA 4XUOA 4TT3G 3NWKA 4GKXA 4MVTA 3PN1A 2Y6FA 1UX7A 1E5HA 4PDMA 5EIBD 3O65A 4FVVA 2WQ8A 4LO4B 4XTMA 1ZVFA 1W06A 4DW0A 3NMBA 1FOD1 2XHBA 2VW0A 2XKOA 5KHGA 3ZO0B 1K92A 1MOFA 1HR0O 2VW1A 2RS32 2DE0X 5FP4A 5AFEA 1OSGA 2RDCA 4AFMA 1FPN1 2WAOA 3HWJA 2ZZQA 2KD7A 3TWIA 3CRMA 1ZBE1 5IVBA 3AMNA 1MZFA 2WBKA 2WN2A 3TCUA 3OB8A 3I3QA 1V9U1 1W99A 3O1VA 4YSFA 3NXSA 2UXXA 4B1LA 4B7KA 1VBA2 1Y74B 5L9BA 1JMUB 1NCRB 4GWJA 3H7YA 2DJVA 2HEPA 4WVMB 2Z3YA 4B3RB 3NJYA 1CAUB 2NM1A 5A3OA 3RW0A 4Y4RA 2OYQA 4N7UA 4AGRA 1RUC2 3U4XA 2ZEWA 1GTOA 1I5XA 3AJYA 3ZKUA 1RFYA 5DDJ1 4RFRB 4ATEA 2TBVA 4FPYA 3CD6V 1IBLB 3IAYA 3DSQA 1WCSA 1ZRIA 2O8QA 4ZI7A 3QF7A 5IJ9A 4K21A 2WLPA 2WLMA 2LFRA 2CSGA 4GZ9A 1MEC2 1WD3A 1XQ8A 3KGLA 1K34A 1L1FA 2XJVA 3H7JA 3CRRA 2ARAA 5FXWA 1U5XA 3FLRA 4QJFB 5A1AA 3R65A 3VBHB 1YXBA 1YTFD 3UQ8A 5T5LA 4E2SA 2AHZA 5BUVA 1RUE1 2D98A 4J42A 1GO3F 1HNXB 3ZVXA 1P84F 1P7BA 3CRAA 2Q8CA 5L3GA 3MFCA 3ZYPA 3J81N 2IJIA 5HFMA 1I1EA 1Z7S1 3SH4A 1NTZH 1DF0A 1WBFA 3K4AA 2YXSA 3UT5B 3OOXA 3RI9A 4CCKA 4QDQA 2HG5C 5GM0A 2NN4A 3DC5A 4H55A 3W58A 4JC1A 3RG0A 2CUGA 1YQ2A 5JMOA 4WM7A 2ODMA 3QG5A 3AYAA 4AEDA 1VF5B 4PA4A 4HPKA 1XMOB 4URTA 3U37A 4CA9A 1YRZA 2JJ6A 1V6NA 2DTYA 3JAKA 3WG3A 4P9GA 1K3EA 1UZYA 4J7KA 1BQ0A 1W2TA 4N8MA 5A6XA 2KXLA 4FOWA 3VBFB 2SBAA 2XAJA 3W20A 1N0NA 4A44A 2HWB2 1UKGA 4EKWA 2OW4A 1OUSA 1IKQA 5IATA 4FOYA 3SJAC 4XETA 1M1KW 2VBBA 4RQPA 4U3JB 4ASMB 5A33A 5AVPA 4QD2A 1NKGA 2ZGTA 2VL4A 1CX4A 5C8CC 3JCZA 4LF6B 4PDVA 5ABJB 4M4PA 1AL0G 4LF4O 3WXPA 4QWNA 5EJ1B 1MS1A 3V64A 3N4MA 1IS3A 2ZEZA 3CO2A 1Y67A 3HKBA 4RQFA 2JENA 3TRSB 1AR83 4WVWA 2EILB 5HCAA 3ETEA 2PZSA 3G6EV 1NBMG 5F32A 1LU2A 1SBDA 1OFNA 1K5MB 3RVYA 3J9SA 4UVBA 4YG6A 1PP9H 4AQ2A 4NJ4A 2ARCA 4LITA 4OI1A 2RS53 2DU0A 3OAAG 4I0WB 3K59A 1JTZX 1V00A 5IJRA 5DUXA 3HQUA 1M06G 1QJY2 5FYHA 4QE7A 4DV0B 3KG2A 2E63A 5M0TA 1LEMA 2ZXWB 4JX0A 4CP0A 2CU5A 5J96B 1GICA 3D4KA 1Y4MA 1YSCA 5FK8A 4BR6A 2EJ7A 2RHPA 2AEYA 1G9FA 4JYBA 4DR7B 1QU7A 4XDOA 3VBRA 4WFGA 4GLXA 4B8EA 2VD7A 2LP7A 1JN2P 1YFXA 1GU3A 4AFDA 1YJWV 2ZX3A 5J2TB 1V0AA 4TLFA 1S72V 3ZMZA 4KP4A 5LXTA 4XPVA 1PV0A 1VBA3 2Z79A 3L9JT 1OT5A 1VQ7V 4XF0A 1FJGO 3EXAA 1DLCA 4YVWC 4LUMA 4JDNA 1OCOB 4Q27A 1Y9MA 3VBOC 1MQTB 2VZ3A 2JGDB 5FMBA 3PTRB 1RUF1 4OUEA 2VGDA 1LJ7A 2BW8A 2XT9A 1XYOA 1O8PA 3N7LA 4P9IA 5ACA2 4CPBD 1GNHA 3R4SA 5IYZA 1YIPA 4IEPA 3JQWA 3PU3A 4NIIA 2JVDA 3N2GB 4FI9A 3O1SA 5LYJA 3RYCB 1AYM2 2RV9A 1RHI1 1NA1A 1W0JG 3T1YO 1RUH2 1GN3A 4GJYA 1W9SA 2R0HA 3H50A 1VBC1 3VDCA 2QQJA 2PTMA 4L2NA 3AZXA 3NV2A 5FZCA 3TYJA 4PLMA 5F5IA 5LA2A 4LBEC 5GLVA 1UZVA 4LHSA 1CZVA 4KG0A 1DIWA 3WW1A 5A70A 2Y48A 3TJTA 1R64A 1SLLA 2WYSA 1JMKC 4FLWA 1UY2A 2LFSA 4EB6B 3X2QC 2VZVA 3NNFA 2PF4E 1I08A 1US2A 1XBFA 3D3IA 1DZQA 1Q81W 3S5QA 1O3SA 5DAPA 2J1UA 2XPJA 1T6GC 3GJBA 2VQFO 1F51A 3WW3A 5JXGA 1R1A2 1QOSA 1Y4WA 3POWA 1SMVA 1E57A 4XVHA 3O1TA 3L9DA 1LAJA 3HVDA 1OVPA 4HVOA 3IZOA 1ASJ3 2JKBA 3C7HA 3SLIA 3KV6A 3THOA 1ZA4A 1S0CA 4Q4V3 4XDPA 5AC92 1POQA 3NQHA 3JBG2 2JEMA 1DYPA 4MVUA 1RIRA 2N7GA 2D43A 3JXSA 2QQVA 4K20A 5CADA 4TV9A 4IERA 4OGQB 3JCIA 4A3ZA 5A3NA 5F1RA 2FBEA 4IE0A 2R32A 3HKCB 3DV8A 4GIQA 1V54C 5FUPA 1H9WA 5DQ0A 5F9TA 2R70A 2GMMA 1ZM1A 4UCUA 3U14A 2B8MA 2H94A 4RWUA 3E83A 1WW4A 4UYBA 3MAQA 5CKMA 3IFXA 3KCXA 4JHTA 2F1MA 4DV5B 4JZRA 2BOCC 1RB8G 3B8NA 2RS51 3P30A 2WFF2 3POIA 1IBMB 4LF9O 2MNGA 1IGOA 4NHMA 4XABA 2WLKA 1W3VA 4Q8LA 2BTQB 1W6PA 4CDUC 1O59A 4J9ZB 4U2AA 4YXWG 4B29A 5A9GA 3BVCA 4YW6A 3S3WA 3NJVA 4CDXA 5JOYA 1NT2B 2C5DA 1VQ6V 3RBZA 3ASNB 1PO21 2IZWA 3IWZA 1UCXA 4N7IA 2GALA 1PMJX 1KS4A 2XKPA 4LBLA 4CUAA 5DEDA 5JI9A 3FAVB 2A7AA 2BSKA 5KUMA 4HNAA 1Q8PA 5K4LA 1OOPB 2X05A 3IDAA 1RL3A 2YU2A 3M3EA 1AZDA 1K5QA 4C1XA 1BGYH 4TXWA 4QX3A 1V6KA 1QJU3 3USUB 3ETGA 1LKNA 4QKBA 1N33O 1LU1A 1OH4A 4XYXA 5I0DA 4LIUA 1IS5A 3I2DA 5GLTA 5L7OA 4AILC 2IC1A 4UOJA 4DV6O 2W0XA 3GCWA 1F9KA 1WAZA 5DDJ2 2QWPB 1DQ4A 1XNKA 3B77A 2LTNA 2X5IA 1NZIA 1W9YA 4IE7A 4P5YA 4DUZB 1Y9QA 4Y20A 5K1PA 1NZ6A 5SV5A 3T30A 3BFRA 2ZCEA 4BAYA 3K4DA 4CS2A 1MQTC 5CA1B 2WABA 3THDA 3TXSA 2UXNA 2YIAA 3ZBHA 1RHI3 1VB2A 1YO8A 2NR5A 3H3LA 4XAAA 5FRAA 4M3CB 1VQ4V 4Q0VA 4ZBMA 5I0UA 1AYN2 5T5PA 4W4LA 1X8MA 4ICGA 4G28B 2JD4A 3B01A 3KB5A 4DUXA 4BISA 3VZMA 5FYYA 2XJTA 4CUBA 1Y9GA 4FMTA 4X8NA 2E76B 1XNTA 4FLVA 4YRDA 3C7GA 3QVNA 4DPNA 4IGOA 2CWMA 4QPYA 4QHBA 4YIPA 4LP8A 1VRH1 5FY7A 3LEIA 1FYUA 5A2QN 1QQP1 1RUD1 4JQTA 2Z69A 2JX9A 5JCOC 3KKYA 2NMOA 1T2XA 4COUA 4CS4A 4UAPA 4XACA 2MPFA 4SLIA 2HFEC 1K9MW 2TNFA 5HV0A 4TV8A 5FJHA 4HLTA 2JDIG 3ILRA 4MVSA 1NTMH 4JCKA 1BXHA 3AKRA 5GLZA 4CDQC 2O1QA 1V9PA 3FX3A 3OSDA 4S2HA 4IUGA 3MUZ1 1YI2V 1Q56A 1E1QG 2JB8A 4XF1A 2BBVA 4U7OA 1QEXA 3VBSB 5IYYA 4LBOA 2RJKA 4FLTA 1V55C 1UOJA 2AUYA 3MLKA 2HHHB 1R081 3HMYA 3GALA 4N43C 1H2NA 3JD3A 5KA6A 2OWOA 1YZBA 1AR72 2ZR2A 1JOJA 2N74A 1NCQB 1GZTA 2VQAA 2H8PC 3WF4A 4HKOA 4R50A 1RVF3 5FZOA 5J2UB 4WV8A 5EYXA 2QTWB 4GB32 5DMYA 5IJ0B 5BPXA 3T1CA 2A71A 1DK1A 2VOXA 3UETA 1CP9A 1REDA 1V54B 4META 3ZHTA 3A0KA 2HJIA 3LFMA 4DV2O 3USSA 4Q8KA 5LL6Y 3FHIB 3ZMSA 2XBO3 3ZSKA 4LR3A 2X0LA 3ZHVA 4HSJA 3ZFGB 1P7GA 3U10A 3RYFB 3SCGA 4LTAA 3VKMA 4SBVA 2P90A 3JSNA 1WGPA 2AC1A 2X8KA 1LHOA 2CDPA 4PQ9A 1JS9A 2G19A 1AR5A 4XZPA 4BXFA 2W1UA 5C93A 1ULOA 2JE9A 4WM7B 1ZX3A 4XXPA 4R9BA 2R061 5FXZA 3E35A 4AI2A 1XEQA 4QIWF 1J59A 4CU6A 1FI2A 3L71H 2YBKA 4O2BB 1VQMV 4KBBA 3PVEA 3OYWB 2ZGQA 2VUDA 3JU9A 1Z7S3 3T2TA 1E5RA 2P37A 1XL6A 1LODA 1VBC2 5G04L 3KF3A 3KS7A 1KQSU 2IXJA 1IS4A 1DU3D 2VC9A 5D21A 1R3KC 3KLSA 4DUZO 2DFBA 4D7TA 1W59A 4DR4O 2D3RA 4RQPB 5LMUO 1Q8OA 1ACCA 4BQ3A 3ZR5A 1ZRFA 1QGLA 4F8AA 4YGBA 3ME2A 2WINB 1ULFA 3F5WC 3PU8A 1MZ5A 5B4XA 1CJDA 1YIJV 3UKNA 2WS91 1IXBA 2EINC 3PJSK 4AVAA 3ZDSA 4PDWB 3SHRA 1OURA 2OIEA 3KCYA 5LRSA 1WP7A 1PM4A 3RZJA 1GN4A 4JI4B 5IY5B 4AFCA 1XNAA 3NJXA 3D3QA 4DB5A 1SS3A 4QXKA 3FD9A 4HYOA 3JCUZ 4JYAB 1OHHG 1W0PA 3GZUC 1W9WA 2WNUC 5JCTA 5D1IA 2UU9O 3G71V 2QM8A 4CDWC 2DUOA 1HV1A 3I2OA 5A7WA 1WLDA 2L6LA 3V65A 1NU1H 3NKGA 2LW8A 4AVBA 4CCDA 1K12A 1HB1A 5B5EZ 3JASB 1K33A 2HVKC 3ZSLA 1JPXA 1X36A 5JH7A 5FMOS 2WT0A 1EP0A 2XLGA 1KFXL 1FNYA 1ZTEA 1XNRB 1AXYA 1JZ3A 1IPSA 3PTYA 1OLME 3WQ7A 1RPRA 3JD0A 1O4YA 4QPIA 2WLLB 2G1MA 3JSLA 1IXMA 2JDHA 2VM9A 3VQVA 3ZYIB 5DAXA 4JYCA 2WS92 2P3IA 2WJSA 2E7QA 5H2FZ 2EXJA 2WZ8A 1AR62 2X6CA 3EMRA 2B5UA 2EIMC 5BV6A 5DN2A 3LGRA 3RYHA 3OY8B 3S5AA 4Q4Y3 5FL7G 4BQ2A 4AF9A 4WF9V 2Z5UA 3ZRSA 4EFEA 4FFBA 4OULA 4LNUB 2PI5A 2O57A 2YSUB 3AL6A 4RGKA 3EJKA 2Y6LA 5IYZB 1XE0A 3ACIA 1NY72 3N2GA 1C8M3 1L3JA 4LH7A 4WM8C 3CJIC 4HNAB 4B08A 2Q8DA 3G7DA 3B2EE 4I7ZB 3K48A 1F35A 2RS12 1I6XA 2UYBA 4BQYA 1RUNA 1XMOO 1DBNA 3T2MA 3FBYA 4NWVA 1KP3A 1YI7A 3FLPA 1GANA 5K0UC 1COV3 1GAXA 3B3QE 5JIAA 1PVC3 3TEWA 1TGOA 1UYZA 2TEPA 1B35C 4BQXA 5FYUA 2JICA 1CIWA 3O7OA 4UCTA 5F8PA 1PIV2 2F43G 3A23A 2HWD1 3DPRB 3IB3A 2VAUA 2XJQA 5FPLA 1NT0A 4Q4V2 5BXZA 1VMJA 3KQRA 4NXMB 4FPOB 3N9PA 3OEHG 1SKVA 4JTNA 4GX1A 2P67A 3CZUA 3MIBA 1S55A 2P6HA 2GV9A 5JSRA 2JIZG 2RMU1 3ZJZA 2RR11 3OBRA 1NZCA 3I4IA 1E79G 2JE8A 4AQ6A 4R8CA 4C8DA 2Q1FA 1NKDA 1STMA 1VE0A 2WAAA 3QO8A 2ZCWA 2IFWA 2R043 1GYKA 2J1EA 5EYPB 1GZ9A 2QQIA 1PVC1 2VZSA 4NB5A 1S0FA 4FBFA 5JVVA 4Z2AA 1H4GA 2E26A 4CH5A 1DCSA 4I0XB 1YFWA 1AL21 1WPBA 1FFXA 1UMZA 2CAVA 2VUCA 5EPAA 3ILFA 3KCCA 5CFDB 4YW3A 2BOIA 2IVJA 2DOSA 2YEVA 3MPPG 1OZ0A 4WVZA 4JI0O 4X20A 2HR3A 1MS4A 5FZBA 3SXWA 3VDDB 3RWKX 3IMNA 3VDDC 1JZ8A 3BABA 2A3QA 3NKTA 1IHMA 4L8QA 4JGYA 1VMGA 1E5IA 2VQFB 4ATFA 1BL8A 2P6CA 2YGMA 4UCRA 3H8OA 1R082 4LF5O 1O7FA 4EN6B 3SYQA 4GA9A 4RHV2 4YM2A 1VJ2A 3WDUA 5H6RA 1HDJA 2H0BA 3ZMVA 5EZWA 3W21A 1W03A 1XNQO 1F5JA 1AI5A 1HDKA 3CPWU 2ET7A 1AYN1 3UGGA 5HXMA 1CVNA 5J09A 3AKPA 1QQP3 1LOFC 3NV4A 4A2UA 2Q73A 4OXSA 2Y33A 4FPHA 4ZIBA 5EBMC 1VBE3 4K7JA 1C28A 1WW7A 1F15A 3CCRV 2EJRA 3RYKA 1KKCA 1MZ6A 1W2NA 2OX0A 1R3JC 3G80A 1LHVA 1QVGU 4DR2B 3CKHA 2ZNJA 3LF7A 3LWCA 4CTEA 3KHBA 4UFZA 2P2KA 3KZIZ 3WCSA 5H9CA 4XZUG 1W6QB 4N43A 4ZXEA 4DINB 1HRI2 5JUVA 4MG2A 4DV1O 1BKZA 3NAPB 1OF3A 2YU1A 4ITCA 1SFYA 1MACA 2LO1A 3CE2A 3VQYA 2JGDA 1T6BX 4CCMA 2HKOA 4H14A 4NAOA 2QDOA 1HRV3 4AE2A 5CBHA 2YMZA 3ZXLA 4OVEA 4XBQA 2GNTA 4W65A 3IM0A 3PUAA 5DM6V 1Y66A 4KWJA 1OHFA 4EQVA 3D36A 4QXHA 1QR8A 4P30A 3AMQA 5FZ7A 4ASLA 4RA0A 4FOQA 2YFZA 2NNUA 4Y22A 4GKJB 1N3PA 5K1XA 2BERA 5IAVA 1PK6C 5HI0A 5FUIA 2YG0A 2UY8A 1LEDA 2E33A 2VS0A 5GZFA 1O5UA 5FREA 1UOBA 3RZHA 1ZZ9A 3Q4HB 1D2DA 4E4DX 5LP6A 1YIFA 5LRRA 3K5LA 4HKLA 3CC2V 3C7OA 1VQLV 2NLJC 1NI8A 1PM9A 4O4HB 4LBQD 1C3HA 4QQ2A 4BIUA 3TETA 4COYA 4DR5B 1BT8A 2HWB3 1WCKA 2LS6A 4LK7A 1KEXA 2FDFA 2Q7HA 1C1FA 3UYJA 5T55A 2X29A 4B4PA 4QDSA 2OZJA 2UUCO 3BN6A 4H7MA 2QGNA 3ZPOA 2C0ZA 4UT5A 2Q5TA 5F3EA 2UWBA 5ABJC 5IVVA 4Q4Y2 4CP2A 4E8DA 2ZE5A 4ZHNA 3VV1A 1IQDC 1OKQA 3VLBB 4ES9A 3I3MA 1JUHA 2Q4SA 4XIKA 3LSSA 1NXD1 2CDOA 2KR2A 4BA6A 3HPNA 2VZPA 3APOA 2ZKOA 2BGCA 1QDOA 3HN1A 2CGNA 1MEC1 4ISQA 1B35A 3WP6A 4JI3B 3HT2A 2EILC 1APNA 1U96A 2YI9A 5K9YA 1MNGA 4R8HA 3O1OA 2F17A 3K5OA 1LESA 4FPJA 1KJRA 3JATB 4WFFA 5FPRA 1XC6A 5TSWA 3LZZA 3I2IA 4DUYB 4JI4O 2BFUS 5KAIZ 3OW2U 1GQHA 3NR7A 1WA4A 3JAWB 2QDRA 3ZLIA 2WZR1 2ZGRA 3ZXAC 4LPLA 2X10A 1UZZA 1SQVH 3ZR6A 1WMXA 1VP7A 1GNYA 2VO5A 1MA1A 2YV8A 4JHZA 3T3YA 1ND3A 4JDMA 2H6CA 3WCRA 3JBG3 1FPN2 1UU5A 1NR1A 5JVDB 4I55A 3HKDB 2QKDA 2XQXA 4RO2A 1ND2C 3E8GA 4I4TA 4DW1A 2RS31 1AJPA 2RJ2A 1TMF2 1ND2B 2PELA 4FLXA 5FQ0B 3OD0A 1PX4A 5CBLA 1YHQV 1W6MA 2OPWA 1N34O 3PMEA 3R66A 1FXHA 1RUG1 3LEGA 4JI7B 4D3WA 3N2KA 1OBNA 3D82A 5FZAA 5BNQA 1RM1C 3K5MA 2DVDA 1B04A 1JUIA 5JXJA 5D8AC 1M4UA 2BE3A 3OR7C 2ADEA 3WSOA 3ZHUA 5SV8A 5JWPA 2D7FA 1RUG2 5F5AA 3W7TA 1DGRN 3OBTA 5E1RA 2UXCB 1X59A 2VZRA 2HH9A 4Q1RA 1DGRA 2EBOA 2YXHA 5DUVA 3EHBB 1FV2A 4PDWA 2ARBA 1EN6A 1M57B 1UY0A 2XOMA 4LNVA 4B3TO 3PUSA 4PD4F 1KRIA 5ACA1 2E51A 5B4NA 4JGZB 4RSUA 4Y5Z0 2HJDA 4BOWA 1R1BA 3KT7A 3GYDA 5C4WB 4H37A 3ZYJB 1G4YB 2XR4A 3TXQA 5EZYA 3MD0A 4Q0UA 3K0DA 3GDBA 3LA2A 2V4DA 1Q6UA 4AVTA 4HL0A 2IWGB 1REEA 3ABUA 4PJ0Z 1EM1A 3IDEA 2RN9A 4XUPA 1LB2A 3OUSA 4GAZA 2EXKA 5ITZA 5LMUB 2VRZA 4IV3A 4OLLA 2JIJA 2XHNA 3IGAC 1PO12 2V72A 2DWDC 1GOFA 2VW2A 3WW4A 1W04A 2WZPP 2W47A 1RMU1 4HVQA 2GDFA 2WNUB 1NCRC 4CH6A 4GJZA 2KM2A 4LR4A 4I0XA 4QPIB 4AVCA 2GTAA 3UKVA 2D5HA 1AX0A 1SA0B 2YB7A 1QJY1 4LFAO 4X20B 3CXHF 2RCVA 5LOVB 1OC1A 4XQDA 5LCWL 5CU1A 4O4JB 2Z0AA 4IE5A 2UXBB 3LFIA 2P5OA 3GM8A 3R05A 1XNBA 2UUAO 2BEOA 1LNQA 2HWC3 4AOCA 1GSLA 1ZZCA 2Q69A 4NHKA 4MH0E 3TAYA 1AI6A 4HKWA 3MW4A 2F4LA 3VBSA 3ZN1A 5H9SA 4NRPA 2BDRA 2B42B 3GWOA 1XU2A 4DRXB 2F93B 2XVKA 1U5ZA 2RS52 3HQRA 2ITDC 4MYEA 5FY5A 5I0SA 1DLBA 3RN4A 4RR3C 4QHZA 5CZKA 1J5EO 4NTWA 1DTOA 3X2QB 4IV1B 4KQ7A 5JXHA 5JJJB 3QD6A 1QJX1 2OCHA 3CHXA 2A3WA 2WKKA 5L36A 1ZZ6A 4YW1A 3UO2A 4BU2A 4FLUA 4GULA 1JFFA 1EV11 3ZIXA 2PFWA 4IEYA 1K45A 2XONA 4KFMA 3JB8A 1KS5A 4I2OA 3AG1B 1BBT2 3W59A 1OPMA 5JR7B 3IC7A 2NLRA 1KDKA 2WLHA 2UURA 2ZX1A 5E8AA 3KWVA 5FZ4A 4UI9L 4DY3A 4YJ3B 3E8HA 3F7VC 2HWF3 4PHZA 3QH6A 4LORA 2ZPXA 2V5YA 1D2SA 1RUE2 1FPOA 1J84A 4WVMA 2D2CB 3G4SV 1NTKH 3PURA 5C3QA 3UT5A 3A0NA 3F7YC 4HANA 1HXS2 2NQYA 3TK1A 3SITA 1X82A 2WLQA 3UGHA 1UIKA 2IJJA 3VZKA 2LALA 2ERFA 3H8UA 2XWJB 4LBKA 3UKTA 5IJ9B 3LSUA 1VP6A 2ZS6B 3OYWA 4P2ZA 4OI2A 1IKPA 3U11A 1KD7A 1Z5VA 4P00B 4NVPA 1N36O 5IK4A 1UIJA 2VBPA 2JJ2G 2GNBA 2RG4A 1M56C 4XDKA 3EFFK 2FMDA 2CL2A 4Y5SA 3HKEA 1L0LH 2EAAA 4XJWA 5F2WA 3GHMA 2XJSA 5IVEA 3WDWA 4AQYB 4WFHA 1YHFA 5LP6B 2GMEA 1G86A 5FYMA 2NYYA 4XC9A 2R9IA 2MEV3 1UMHA 3L74H 2HWC1 4LF8B 3HN3A 3NNGA 1UYYA 1ONAA 3JD73 1S0BA 4JRLA 2EIGA 4R52A 3FB7C 4HPKB 1WP8A 2HWC2 5K0UA 1I5YA 5LHGA 4ET7A 5IT9N 2I45A 1ENXA 2R16A 3X29B 3DECA 4IE6A 2Y0PA 3I56V 4XDQA 3B40A 3QH7A 3VBFA 4RHV3 4OMCA 3ML0A 2DUQA 2GU9A 5CB4A 2HYXA 1PHMA 1VQOV 1LOEA 2BP6A 3ICXA 4Y26A 1M4WA 1PKXA 5IK8A 1QR9A 4O2AA 2E74B 5IDJA 3VBHA 2FMLA 5EBLC 3AYCA 4DIQA 3DXRB 4A4AA 1QLEC 5FK7A 4QX1A 1WZXA 3B02A 1PNFA 3ZXKA 4V2WA 5LHIA 4NXNB 4EROA 2F23A 4LMFA 2MEV1 2EIBA 4L99A 2Y0OA 3UNPA 2R9AA 3MHZA 1VLNA 1YQ8A 1MMMA 1JX9A 2JECA 4B3RO 3CIHA 3K77A 4BE3A 3SCHA 3BIEA 1W90A 1B6QA 3UKMA 2GBOA 2IJHA 1IPKA 2W5FA 3RI8A 3E8BA 3N9LA 1QLNA 4FFBB 1SPPA 3VBBA 2Y6GA 1MSDA 3RMYA 5LASA 2VTXA 3WNOA 2UUCB 1CIYA 3CU7A 4CCNA 1SC5B 5J9PC 1IVSA 1VMHA 5FZKA 5CB7A 4NHXA 4Q2FA 1SFNA 4Z2WA 2FCUA 5LMNB 3FYEB 3B93A 1UQXA 5I0RA 2GZWA 5I8TA 4UV8A 3WDTA 1AP5A 4XJZA 5EIYB 5GLUA 1NQJA 3GB7C 1OV9A 2ZM6O 4I01A 4KWKA 1U12A 4CPBA 1BEV3 2W1SA 1F7YA 3T1HO 3AP4A 3J7LA 1PZ9A 3VOUA 5A3PA 2BGPA 1I0HA 4RYDA 1EN4A 1GBGA 4QM8A 1F4HA 4UFLA 2AR6A 3MFAA 1ZAUA 1N32O 1NAEA 2BTOA 2AHYA 4MVRA 3KD4A 2RM22 4NIGA 2JWPA 2WA3A 4JI6O 4UWDA 3RJ2X 2VUJA 4O9GA 2HVJC 4JZ2A 4TOIA 2ID4A 3WINE 3N9QA 3MIHA 3RQ0A 3JD1A 1S0DA 2A73B 2OT5A 3FB5C 3AG4C 2XLAA 3WW2A 3ZXFA 4BXSV 4LJHA 1JYNA 3THCA 4FPKA 3UO3A 1C57A 4AI8A 1FNZA 1N1YA 4I5SA 5FY8A 3LCPA 2VTXJ 4D0QA 3H1JH 1NLQA 4OZXA 1YJLA 3P5BA 4MGKE 3POSA 3WF3A 3I59B 1AR1B 5EYPA 4EN0A 3WF0A 3VB9A 1M90W 4XJ9A 2WO7A 4OQ8A 2YBPA 4IETA 1AUYA 3H42B 1YQ6A 4OUMA 4UBHA 3KVAA 2HLEA 1CPMA 3DF0A 1PZ7A 1IDSA 1JI6A 2QJVA 2P3JA 4BIOA 4Y1VA 2ZHNA 4JI5O 1D2QA 4S2FA 4W4KA 2AREA 4TSVA 2VNGA 2F4PA 4PF5A 3CLPA 1S1AA 5BMVB 3POYA 4TLGA 1N4CA 1DFQA 4NWWA 4WBNB 4K1ZA 2CTWA 2ZGSA 1TME1 4PQQA 1O4ZA 2IXCA 2BNOA 2WPDG 1EZVH 3MW3A 4UFMA 1QNMA 1MPXA 3HKDA 3LDKA 1AF9A 3CYOA 4DV3O 3MUY1 4FXGB 3SH3A 1O3TA 2WWUA 2ZHKA 1W6MB 2G9ZA 4EWDA 2N04A 4IHJA 3BU7A 1J3RA 2CDYA 3N2KB 3G6JB 4KG8A 4LC1A 4DV1B 1X8EA 4MUVA 1COWG 4FJCC 1HQLA 4M00A 2VQEB 5LBFA 4FK5C 3HR9A 4JASA 2BSKB 1GZCA 1OJHA 4D94A 5JOZA 3AVSA 4IEQA 4AI9A 3ETPA 5EIBC 4GH4C 1CXZB 2YIBA 4G27B 4Q4X2 1WMDA 4ZONA 4HG6B 3WG1A 2I07B 1ZLZA 2WO1A 3WY6A 2YBSA 1J1LA 1PO22 4Y33A 2HWD3 4GB33 4DV7B 4M0NA 5T5OA 4QMAA 1IBKO 2J42A 3IPVB 1ZBA1 4FPFA 4CDWB 3K04A 1BK0A 3GZAA 4CS3A 5JJNB 1LOGA 1RUJ1 4GUNA 2DVGA 2FHRA 2ZMNA 3JD72 3E5XA 3UM7A 4PA9A 4XFIA 3N7MA 2HWE2 3MEPA 5IWAB 3U0ZA 1CAWA 5FZLA 3FB8C 1HRI3 3TEXA 3SYOA 4B3MB 3CJHA 1DF4A 2M6YA 4D7YA 5GTHZ 2PAKA 2GUZB 1JOBA 4QNHB 5FZ3A 4MGQA 1F31A 1LNSA 3ABKB 1GN2A 1UPGA 3ZYGA 4LO6B 3ZX6A 4NTYA 3I49A 2D93A 3SPHA 5ERLA 4FPLA 5FPZA 1BMV2 3V56A 4D8MA 4WM7C 1AJQA 4F83A 2OIIA 2B4KA 1UMIA 1WLTA 5C7GA 4FP3A 4Y1YA 4PI0A 5HV4A 4KHPB 5L7OB 2V73A 5A33B 3OFNG 2B46X 1KMIZ 4S2GA 1JYIA 5LA9A 3K51A 1NX9A 3RWRD 3ZFFA 1M93A 4IDZA 4LQRA 3ITQA 4LWSA 1PMIA 1SLTA 2UUBB 1N3OA 4RFT0 2ZABA 4BHPA 2WWJA 4HXCA 1HW5A 1SCRA 3I2KA 4DEVA 5CYYA 1LR1A 4IGPA 2BTQA 2JDAA 2ZEYA 2CH7A 3UJOA 1XNQB 2RS11 1SFPA 1R083 1VBE1 2JD9A 4AAXA 1O9GA 2VNOA 2QE7G 4XUNA 5F3GA 1TUBA 5KX5B 2Q8EA 3D8CA 2DWRA 5DDJ3 1RUD2 3T2OA 2AEZA 4R4XA 3IT8A 1SBEA 2ZMKA 4QPJA 1PZ8A 1IG3A 2YHJA 3J26N 1NCQA 1K5SA 3B5LB 1M5IA 2ENRA 1GWLA 2HEWF 4AHWA 4HFSA 5HCFA 5E88A 2AZ5A 3CQOA 5A7SA 2J1RA 5KMGA 2FL4A 2CYFA 2RDSA 3TN91 5EV7A 4XFHA 1E5SA 2ZX0A 3AP6A 1KBHA 4RGGA 5JIUA 2VJXA 3PUIA 4QQPA 1IG0A 4TV8B 1ENVA 5JQGB 1OA3A 1Z78A 4AXOA 2WA4A 1D4M3 1JBCA 3GF6A 3J8F1 5LXTB 4L9BA 3A21A 3PVNA 3L72H 3GWKC 3JAWA 4DNYA 5L73A 3WP3A 1PM7A 2R041 3SDLA 1WPXA 2Z42A 4MW8A 2V4VA 2PYJA 2C9AA 1TZOA 2E5LO 2P06A 1FATA 4ONUA 4JAVA 2RVAA 3IMMA 1IQAA 4OHXA 1SPPB 4X1YB 1H8EG 3VKOA 3S7IA 1ZWIC 1ZL8A 2BFUL 5B1AB 4YHHO 5B1NA 5A3TA 1Q8VA 4JAUA 1OLQA 1QJEA 2GH2A 4O2BA 4QPGB 3LA7A 2ZE6A 5IJ0A 2WYFA 3HB3B 5IFTA 1GKFA 2JEUA 4COZA 3HNYM 3J7MA 2N05A 4QXCA 1UY1A 2WLIA 4R7CA 5J98B 4BDVB 2A79B 5JPMB 4FIPC 4RN5A 3AZZA 2LUWA 2P7TC 4AVVA 5DAVA 4MGTA 4OFGA 1XU1A 1C8M1 1CX1A 4ARXA 5IYBO 2KQXA 5FY4A 3OMAB 1GMMA 3PJQA 4LF7O 5CBGA 4IL6Z 4P9XA 1GNZA 2D6KA 4ZXKA 4R9DA 2ZE7A 2ZXQA 4PF1A 2UXCO 1SLIA 1WJZA 1AJKA 4P02B 4OPHA 3CZJA 2A70A 3BCCH 3DTUB 3I55V 4DR3B 3ON7A 4Q0QA 3E1F1 1FAYA 2XNDG 5A7QA 1AL22 5C5UA 2IH3C 2ZKNA 1DQ2A 3Q8BA 4AEJA 2GC1A 4CCEA 5BZBA 5I91A 1Q90D 2DBIA 4AL9A 2A6ZA 4LA3A 4PI2A 4Q29A 3H8XA 4NPRA 3K9SA 2HKXA 1RITA 1UL9A 5L3FA 2UXBO 2CWSA 2HWF2 1UNBA 1RUI3 4NYKA 3S3XA 4GKJO 3U07A 1QJX2 3ZYHA 1JYWA 3I59A 4PIXA 2Q1ZB 5I0TA 4EN7B 1JOYA 3ABMB 4U36A 3FBMA 3VZJA 4F6RA 5JH7B 1OCRC 2VQEO 1XYPA 3POFA 5B1OA 1OD5A 1QOTA 4QDRA 2F4VB 3VHNA 1Q5OA 3WF2A 1D4VB 2P4KA 5CNAA 1QCEA 1LOFA 4X65O 2C6SA 5LGNA 1VBD1 1Z0HA 4LFBO 3BY6A 1HV0A 1WKYA 2H0VA 3JALA 1ASJ1 1V9U3 1G9DA 5BMVA 2X6BA 2RDQA 4C0HA 1VRH3 1KFUL 4LULA 1H6XA 3PL0A 5FZ6A <