4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
3D0JA 3SMHA 3MYXA 1WLTA 1OMIA 5LRSA 3GYDA 4IEYA 1RUNA 2PYTA 5JSRA 2OZJA 4IEQA 3UKVA 2O1QA 3I59B 1YFYA 3HIFA 5KHGA 3SHRA 2O8QA 4JTNA 4XFCA 3H7JA 1ZRDA 5LRRA 1I6XA 5KHHA 2UY8A 4BH9A 5I0SA 2CAVA 4YRDA 4YSFA 3WW1A 1YUDA 3PNAA 3NW4A 2XKPA 3E5QA 3FHIB 3NJZA 4CYDA 1QY4A 3IBMA 2WFPA 2GH2A 4I02A 4MGIE 2PAMA 1LB2A 2GC3A 4XFFA 4PIYA 5JAXA 5E1RA 1DZTA 1WA4A 2B5HA 4QGNA 3HQXA 2EA7A 2V09A 5KBFA 3PLQA 4UXAA 2OPKA 4HVQA 1G6NA 3BB6A 3O14A 4I0BA 4XFHA 2XL7A 3TNPB 5HI0A 2E9QA 4K8FA 3MZHA 5I91A 2OYZA 5C8WA 4Q0SA 1J3RA 3FJSA 3D82A 3B02A 1CGPA 3CEWA 2HJIA 5J3UA 4HVRA 5JSPA 3U10A 4R8HA 2XLAA 3WW4A 5FPZA 5I93A 4JTOA 2VPVA 3FX3A 1PM7A 2CV6A 2K9ZA 3KCCA 5BY5A 4MGZE 3S7EA 1O5LA 2ZCWA 1OD5A 3IWZA 4HZFA 4EWEA 1CAXB 5LEKA 4MGYE 1Y9QA 4R52A 3H1YA 2IC1A 4EWAA 1IPJA 3JZVA 4I09A 5FLJA 3R6SA 2UY9A 1XE8A 1O3RA 4AQ6A 3HT2A 1EY2A 3IDCB 2BNOA 4J1WA 4ZU5A 4YYOA 4AQ2A 2XL9A 3MDPA 4HSJA 3RYKA 4AXOA 4JVAA 3N4MA 1U12A 4FBFA 3OD0A 1UW8A 4QX5A 1YFUA 5F1RA 2PTMA 3BU7A 3RDIA 3E6DA 4JV4A 3OTFA 3TNQA 3S7IA 3QOPA 2Q1ZB 2D5FA 4LULA 4YARA 1YHFA 1RTVA 2F4PA 1JUHA 3L2HA 1ZX5A 4HMZA 5FQ0B 3ETQA 4KU7A 1FT9A 4PJYA 1O3QA 3CJXA 3EHKA 3E97A 3RZZA 1H1MA 4QXKA 1YFXA 3RYPA 1ZZ8A 3FFQA 4QMAA 2IXHA 4ONUA 4H7LA 5JSOA 1CAVA 4GULA 2GU9A 1YLLA 4L2NA 2PAKA 3OF1A 5I8TA 1RGSA 1O3SA 3BALA 1YFWA 2ETEA 1NXMA 2FMYA 4Z82A 3VHRA 1OI6A 2BGCA 2MPFA 1CAUB 3H50A 2BYVE 3LOIA 4O9GA 4Q29A 4FAHA 4F7ZA 2D93A 3LWCA 4XF9A 1LRHA 1NYWA 5CU1A 1RC6A 3GBFA 4A2UA 5J7MA 4I0AA 2QDRA 1LR5A 4XFGA 2FQPA 1NE6A 2DCTA 5I0UA 4O9EA 1RL3A 4E2QA 1Q5OA 3ZDSA 3H1WA 1X8MA 4UBGA 4IEUA 4XF3A 3OCPA 3BCWA 3KGLA 3DV8A 3U11A 1ZNPA 4IEZA 2ET7A 3USSA 1I5ZA 3H3UA 3M3IA 1GQGA 2GC0A 4BHPA 4HBNA 4Q0QA 2GC1A 4BYYA 1X8EA 1GQHA 4QGLA 4FAGA 4LA3A 1EYBA 3H7YA 2N7GA 1ZZCA 4DINB 4MX3A 1VR3A 1YWKA 3LA3A 1UPIA 2UYBA 2OZ6A 2C0ZA 3C3VA 3E6CC 3NL1A 3I54A 5I0TA 2D40A 3H1MA 3CO2A 1O5UA 2PFWA 2VECA 4IEPA 5FCCA 2Q0AA 1NE4A 4IEWA 4F8AA 4J1XA 4LUKA 1SEFA 4XF1A 3M70A 1ZZBA 1J59A 1CAVB 2KXLA 5FLHA 1FXZA 1LKNA 5EZWA 3SXWA 4N9HA 1VP6A 3E5XA 4HSLA 5D1IA 1Q3EA 3LAGA 4I01A 2PHDA 2OA2A 3EJKA 2GZWA 4OLLA 3IIAA 3FE5A 3G7DA 2Q4SA 5JCTA 4X6RB 4Q0VA 1Q43A 4D7SA 4IEXA 5I8YA 3E6BA 4XFAA 3UKTA 1J58A 2MNGA 2Z2SB 4Q0PA 3HT1A 1H1IA 2ET1A 4KWKA 5BXXA 3U0ZA 3CF6E 4WVZA 1IPKA 4Z07A 1UD1A 4EV0A 5BUVA 1DZRA 1X82A 1CX4A 1UIKA 3MPBA 5LEJA 1ZVFA 3NVCA 3WW3A 4X6QB 4IERA 1ZZ7A 3EBRA 3DKWA 1CAWB 4WBBA 4OFGA 3I59A 3QACA 4AVBA 4LUMA 2XGXA 3EQEA 5C6CA 4IESA 3I7DA 2D5HA 1PMIA 4QGMA 5T3NA 3RNSA 4LTAA 1UCXA 3E5UA 4ORFA 4XFBA 3FWEA 1O4TA 3OGJA 4MUVA 1NZCA 2QNKA 5FPXA 4B29A 2EAAA 2I45A 1DGWA 3PVBB 2QCSB 1ZRFA 1J1LA 5K8SA 4FT8A 4XF4A 4YNIA 3H3ZA 2VQAA 2EVXA 4E2GA 1O3TA 1SQ4A 1OFNA 3H9AA 2GC2A 3ROUA 4EROA 4XETA 5FDBA 4META 5FLIA 1V70A 2MHFA 2HKXA 2PAEA 5I8SA 2CAUA 4XFIA 3RYRA 3BPZA 2PHLA 1CAUA 4PIZA 2PA7A 2H0VA 2UYAA 5E16A 1Y3TA 2IXLA 4E2SA 4NVPA 2CGPA 3RPQA 2XLFA 3WW2A 1TQ5A 1CAWA 3NKTA 2PQQA 4PIXA 2H6CA 3SCFA 3KMHA 3LZZA 2IXIA 3H8UA 1FI2A 2IXKA 2GAUA 2WC2A 1EP0A 4LA2A 1XE7A 4LLOA 1L3JA 1SFNA 2B9UA 4KU8A 3UKNA 2Q30A 1VJ2A 1WGPA 3CLPA 5KHIA 2XHKA 4XF0A 1J3QA 1HW5A 4L11A 5JR7B 3LA7A 4I3PA 2ZKLA 4ZU7A 1RUOA 2IXCA 5CADA 2ATFA 3LA2A 4ZU4A 1UIJA 5KHKA 3D0SA 4IEOA 4IETA 5AVPA 5BPXA 1XRUA 1CAXA 2BEOA 5EFUA 4WZCA 5KHJA 1ZRCA 4HLTA 4HN0A 3ES4A 4IEVA 2Y0OA 1QXRA 5CVRA 4MV2A 5I0RA 3ST7A 5BV6A 4MH0E 3NSTA 1ZZ6A 4KL1A 4QM8A 3ES1A 2QJVA 2Z69A 1DGRA 1QXJA 4UBHA 4XEZA 5FQ0A 2BNNA 2P17A 1ZZ9A 2IXJA 3EO6A 3KSCA 3ELNA 2B8MA 1QWRA 4N9IA 2XLGA 4P9GA 4KWLA 1O7FA 4LEJA 3IDBB 1EPZA 3DL3A 1X7NA 5J48A 4QM9A 4MGKE 4AVAA 3S0MA 1ZREA 3KGZA 2BNMA 4I2OA 1ZRRA 2H6BA 3FZ3A 4EWDA 4TLFA 4HN1A 3DN7A 4BIFA 2K0GA 4Q0UA 4MZUA 4RD7A 4KWJA 4D7TA 4HVOA 2XKOA 3ACLA 3CL1A 4AVCA 1J3PA 3SCHA 3SCGA 2QVSB
chains in the Genus database with same CATH superfamily
2H8PC 2P34A 3J81N 2IH3C 1EV13 2HWE2 4HPKA 4FPJA 1XL6A 2XJRA 3N2KB 3SPHA 4JI1B 3AG7A 2HWB1 5IT9N 1YFYA 4EN8B 2C4XA 3JB8A 4XFCA 5FLXN 3ILNA 5KHHA 1VBD2 1S3JA 1RHI2 1E5SA 3S6PA 3O1PA 1SLIA 3ZMNA 2QWNB 3AB0A 2XASA 1QY4A 4UW4A 5DG2A 2WFPA 3VKNA 5IE9A 4XFFA 1POV3 3BA8A 1P84F 3K51A 4EN6B 2XAGA 1JYIA 1CPMA 4X66B 1NA1C 4IL7A 4HVQA 4I0BA 4GMP1 4CCMA 4MGTA 2ZE8A 1DQ6A 4XCAA 1I3HA 2NN4A 2IWGB 1ZBE1 4YJ2A 1PV0A 3BABA 3LFMA 2AZ5A 2CV6A 2F43G 3S7EA 1N33O 4CBCA 1DQ1A 4UT5A 2VW0A 5A7OA 3OB8A 1IPJA 5A3OA 4AEMA 4JI2B 4IGQA 4KMQA 5E89A 3JZVA 2WT2A 5F9TA 4CCOA 4AQ6A 1WLEA 4H13B 3ZDVA 3Q4HA 3UO3A 4ZU5A 4YYOA 4MHRA 4LIUA 5BR8O 1HNZO 4LH6A 1H0BA 3BODA 3DXTA 3NNMA 3VD5A 1R3KC 1OSGA 2PTMA 2Y34A 1YHFA 2MW2B 2F4PA 1VQPV 4P9XA 4JI5O 4O2BB 3KLSA 4KU7A 1WKYA 1YQ8A 4AWDA 4U3JA 2RR12 1BZWA 1GTOA 1H1MA 3R66A 1UYPA 5IVYA 3POJA 4QMAA 4A44A 4EFEA 5A3PA 4MT8A 5LBFA 2JG8C 1HKDA 2WNVC 4FTSA 1WPXA 4I4TB 1OCZC 1G9AA 1M57C 4LBJA 1UOBA 3N2GB 3H50A 4DV4B 4M0HA 3C90A 3OUIA 1RXGA 2XMLA 2EZPA 2IZWA 3EYPA 2QDRA 4XFGA 1GYKA 3RMXA 5DPNA 3RVHA 3E86A 1W90A 4IE5A 1PMJX 3W21A 2G9GA 4K1YA 1OBNA 1POV0 1GAXA 3M3IA 3W7WA 4BHPA 5HXVA 1LHUA 4NTYA 5T54A 3DECA 2N7GA 4FFGA 4IV3A 2ID4A 4A7KA 3PUIA 2F1MA 2VQTA 4XHBA 1K5QA 3A8TA 2R72A 1VBC2 4DV5B 3PTYA 1O5UA 5H5NA 2PFWA 5FUIA 5FYUA 1YTFB 2IU3A 1J95A 1RUC2 4WM7A 4NHXA 4DV6B 1F4AA 4J80A 2HVKC 1AR71 1LKNA 1Q6IA 3J8F2 2YB7A 5D1IA 2GZWA 4OLLA 4IGPA 4P30A 5L3CA 3THDA 3WNMA 4MVTA 4Q0VA 4MTOA 2Z3YA 5GW7A 3UKTA 4UAPA 1PNFA 2ET1A 1N8RW 3Q8EA 2YI9A 2G4IA 4CDQC 1UD1A 2WINB 1WCQA 3HNMA 3I2FA 3VBUB 1NY72 3H01A 4I3GA 4QB6A 3KV9A 3PL0A 3BEHA 2RS53 1AR83 2XUEA 3VBFC 5IYCO 3A22A 4AVBA 4U36A 4LUMA 2XGXA 5FJKA 1W8WA 3MIEA 4JYCA 4QGMA 1SERA 2WAMA 2WO1A 4W65A 3TN92 1GP6A 4MUVA 2CL2A 3ZSMA 2CDPA 1YITV 4Y4RA 4V2VA 2VZOA 2X53S 4FT8A 3H3ZA 2ZE6A 4Y26A 2YPDA 3KV4A 1I5YA 3CC7V 4CH3A 3CQOA 4INDA 2EX3A 1KECA 4MW8A 2WO3A 2C26A 5JJEB 2PLV2 3NKTA 1LNQA 1PM4A 1W8TA 3KMHA 1SLBA 1AXKA 4PQQA 1Q8IA 2B9UA 4KU8A 1NTKH 2XDVA 2Q30A 1REDA 2D6OX 4KNCA 1COV1 1H8HG 1M06G 2RMU3 3H1IH 4UCOA 1WJZA 4A41A 3DXRB 1U5IA 4Q4Y3 4D6RA 3J26N 4YGDA 2IXCA 2VXRA 1JJ2U 4AR2A 4XJ9A 4ZOLA 2QFEA 5LGUA 1H8EG 3CD6V 3ZXAC 4FO9A 5JVDB 2ZEYA 4DV7O 3DCQA 2I07B 4YWAA 1JA8A 1QLEC 4AVSA 3CCUV 5C3OA 3HN3A 1QJZA 4X1KB 4NIIA 4F4LA 3NV2A 2DBNA 3LB9A 4UCSA 3K9AA 4LE4A 4AHXA 1OVPA 1NA1B 3IMNA 3CCVV 1SESA 1R1BA 4DUWA 3FHAA 1XQ8A 4JZ2A 5GLWA 4AFBA 1ZREA 3I5DA 5IWAB 4I2OA 4FPOB 4EWDA 3A0RA 3JSNA 2LP7A 2VG9A 4BCUA 4GT1A 3X2QC 1JMUB 1EBOA 2FDFA 3N9QA 2LW8A 1FAFA 1OLQA 2YBSA 2R071 1WA8B 2XPJA 1LOGA 2UXBO 4AE2A 1VE0A 2W46A 2UUBO 3VL9A 4RHV3 1ZRDA 1Q6UA 2NLRA 3J7HA 4CDQA 2LGWA 1TNFA 1K9MW 4H37A 1RUF3 1G6UA 3KKYA 4P9YA 1UU5A 1ZBA1 5IJ0A 5EJ1B 1S1AA 3I3QA 2WN2A 1H8TB 2J1VA 5JLVA 2BSKB 3AG2C 5DZFA 5B3SB 4EB6A 3PIGA 3WFVA 5FYCA 5C8WA 3H1KH 4AYUA 3T1MA 4YM3A 4ISRA 1FAYA 3ZMUA 1VQKV 4FPGA 5GTIZ 1JS9A 1K7DA 2HWF3 3UETA 1O8SA 1E79G 5A2QN 1JZ6A 4LP8A 3POYA 2F4VO 5JXHA 1RUD2 4ASMB 2RS13 3ZHVA 4YIOA 5FLJA 4UCVA 2X6BA 3HT2A 1PGL2 4MADA 5CFDC 2CUGA 4IE6A 5B1OA 1E5HA 3TCUA 3N4MA 2HWC1 2BZDA 1S5JA 2WZR2 1GM7A 2RMKB 2WUHA 1NCQB 4AQSA 1SACA 3O7OA 4H2AA 1F51A 1LOBA 4BW9A 2LTNA 2A6WA 4YVWA 1W6OB 2CE4A 3L2HA 5IAXA 2RDNA 1Z0HA 3WHUA 4OUEA 4AVVA 4QX8A 3ZYGA 4NIDA 1YFXA 1IKQA 2XONA 5KA5A 1UY2A 2DYCA 2RJ2A 3S3XA 3KVAA 1NXMA 3ZJZA 1LOFA 4DEQA 2VRZA 2BYVE 4N90A 2E7TA 3ZX6A 2GUZA 1K42A 1AROP 4DR6B 1KU9A 2VOVA 3NAPC 1WA6X 1NYWA 1GANA 1VF6C 4ZS3A 3NJXA 2PYLA 2BV4A 4DW1A 4E2QA 3H1WA 1OXCA 2BBAA 4XF3A 4DR6O 1VBA2 4RR3A 1OUSA 3T0AA 4YGCA 2RNBA 4NXNO 3DPRB 3GNEA 1W9WA 1W6NB 4B3RB 3L71H 2R7EB 1F8VA 4DV3B 3ZYHA 1Z7S1 3X2QB 3LIGA 4B4QA 2J1SA 2IFRA 4LK6A 1GR3A 2ENRA 3AFKA 5CBGA 5FCCA 2AR6A 3WUCA 3ZIXA 5CA1B 1Y9MA 4OQ8A 2AGSA 3W7XA 1FXZA 4E4HA 4YY3O 5AC92 1XNKA 5FP3A 5FYMA 2OA2A 2I2SA 3G7DA 2XJPA 1NBMG 4CDXA 3E6BA 3B9IA 4CDUA 2Z2SB 3RYIA 2LFRA 4A3ZA 4WVZA 4WCEV 3POGA 1N0JA 2Y4TA 1DZRA 3AMNA 5KMGA 3U07A 1QQP2 4X62B 4CEWC 2ZX0A 3NVCA 5BNPB 5L3FA 1HNXO 3RYHB 4NWVA 5C3RA 3GWKC 1NCQC 4NMIA 4WBBA 4MYEA 2B46X 3HKDB 4AI3A 3THOA 2W52A 4QPWA 4W4KA 5CBFA 4OZXA 1WWYA 2JKXA 4E8DA 3NNFA 4O4LA 2OPWA 1IBMO 5LK7B 4XBFA 3C7EA 4R7CA 2VQAA 4KG8A 1OFNA 3ZN0A 4KHPO 1DCSA 5FYBA 2ARHA 3VKFC 5C8CB 4XFIA 1FPN3 1RVF1 2WFF1 3LGRA 1AR93 3E35A 2X6AA 3M3CA 1MS5A 2YROA 2DVAA 2ZR2A 5CYYA 1RUC1 1C28A 3AYCA 3A4UA 1MA1A 2DBIA 2GH8A 4NRMA 1R092 3O1MA 3C7FA 5FZEA 2FDJA 1AP5A 4BDVB 1I0HA 1CZTA 4TUYB 2JXAA 5D5PA 5GZGA 2VMIA 3TBDA 3LA7A 4FSJA 5IWFA 2DDUA 4I3PA 1GNYA 1VF6A 4ZU7A 3VOUA 3POBA 4UOJA 2NM1A 4IV1B 3C3TA 2CYFA 4WZCA 1S0CA 5HFMA 3V65A 3TN91 1URFA 3ST7A 4MH0E 3S3WA 1BBT3 4D3WA 4KXRA 1W9YA 3VBFB 1WW4A 4YZ2A 4ZHQA 4Y1YA 4CDXC 4K0KB 3NRUA 3PJQA 3T1HB 5DXDA 2ZA9A 3ZYJB 4RS5C 1VLNA 2X7RB 2PY5A 3DSQA 2ZT9B 5IK4A 3CIHA 3KM5A 4YW3A 4Z2WA 5J48A 3QO5A 3J7NA 1W2BU 4JI4O 2RDSA 2WJSA 2Q68A 2VVDA 3T1HO 3LDBA 4GWIA 4MZUA 1KD1W 1P7GA 5A3WA 2E63A 5KUKA 3SCHA 3OGRA 4Y3OA 2XUMA 5CB7A 3AMMA 4I9WA 1NTMH 5FZIA 3OYWB 2XBO1 4FLZA 1VMHA 3I59B 4AFAA 1NLRA 1OJHA 5KXBA 3ZFGB 1CJPA 5JPMB 2SLIA 1CQ9A 4YRDA 5FIXA 2Y38A 4LNVA 3CB2A 1HR0O 2HG5C 3GDBA 3AC0A 1OVSA 2IBZH 4HYOA 1LB2A 3WQ1A 3FUOA 1VB4A 4PIYA 3D8CA 4Q5OA 4QGNA 3OMNB 4DV4O 2HHHO 3P3NA 5B1BC 2K2SA 5LL6Y 5JVVA 5KBFA 1W2NA 1WMFA 1PZ9A 4NRQA 1U5YA 3JASB 1Y43B 1V6NA 1VRBA 4LF4B 3BKZA 1RM1B 1GZTA 5T5PA 2JICA 2JX9A 2D6PA 2TNFA 2CK3G 3K5NA 3N9NA 2GNBA 1QJU2 4PBOA 1KDKA 5LEKA 1QQCA 1BGYH 2R6QA 2VMHA 3ZXFA 4XZPA 1VQOV 4XQDA 2HYXA 3B09A 4EN0A 4XJAA 1UQXA 2KD7A 2VL4A 3BN6A 4QX5A 1NUKA 1DF5A 3RDIA 4BQXA 5ACA1 1W3XA 4JI2O 5J37A 4LF9O 2LS6A 2L9LA 2EF6A 4LCUC 3GCXA 3V56A 4D6SA 3W7TA 3EHKA 4PDRA 4YW1A 5BNNA 4Y1VA 5JOXA 2OT5A 1PX3A 1HLCA 5J36A 3BALA 3HNBM 1I5PA 3ZCCA 2GMMA 1UKRA 5C5TA 2W5FA 3URFA 1K3IA 1X59A 2BUKA 1VBA1 4ZPIA 4DO2A 4UFLA 5FP7A 4RGKA 3KVBA 5L9BA 4W6YA 5CBLA 2R063 3LEGA 1W9TA 3GALA 3TEWA 3Q8AA 4WF9V 1PO22 2WA4A 4XUOA 3HKEB 1HB2A 1VR3A 5JQGB 3I54A 4ET7A 4U3JB 3EXAA 1IKPA 1PP9H 1DLCA 4LUKA 2J1UA 3PJYA 4JGZC 4Z2AA 3GZTB 2V4DA 1UF2C 3SKJE 3EB7A 4FXKB 5EZWA 1SQPH 1VP6A 1SDWA 5LHIA 3HB3B 1OZ0A 4R4XA 3JARB 4RSUA 5CKNA 4LNUB 1PGW1 2RCVA 3WG2A 3K46A 3MF9A 1IXBA 4KP4A 4DR1B 1PZ8A 5FWJA 1H1IA 3IZOA 1GZ9A 4JYBA 2HKOA 3PTRB 4DV6O 1XU1A 3UKMA 3MIBA 2K1EA 4FMTA 1M4WA 4WBNA 2D98A 2BGPA 3SYQA 4JI1O 1CONA 2QQLA 2RMU2 2WS92 3K77A 4FPLA 1OPOA 5LA1A 1TMF1 4MW3A 3LUTB 1CAWB 1RMU3 1SQGA 3ABTA 1GO3F 3KF3A 3EQEA 1YQCA 2JJ6A 1W6MA 5DAWA 4ORFA 3DXRA 2DU0A 4F6RA 2EIKC 2VS0A 5FY5A 1CZSA 4Q2FA 4X1YA 2V4VA 2YGMA 3PVBB 2ARCA 5K8SA 4XF4A 1M90W 4YW7A 4MXWB 1JTZX 5FLIA 3ZN6A 1MS8A 1H6XA 1V70A 5I8SA 1JHNA 1CAUA 2P5OA 5E16A 2W87A 1JZ5A 1TQ5A 2PELA 3K5MA 2O57A 4JGYA 3SCFA 2NMOA 1HXS1 1W9SA 3D4KA 1I94B 1FI2A 2EIBA 1RUE2 2E7AA 2DFCA 1ULEA 3VGIA 4QPGC 3E2EA 4DEVA 1ND3A 3HPNA 4XDKA 4UW3A 1FX5A 1O91A 3BOWA 4E9KA 4Y1UA 3MF6A 1N3OA 2BQPA 3CE2A 1XOYA 4GKYA 3VBHA 5I0RA 2W3JA 1S2KA 1HWYA 1U5ZA 3VBOB 3QH7A 2W95A 3WF3A 5IY5C 4GCZA 3ES1A 1RP3B 3A0HZ 4EJRA 2DWEC 4AOCA 3PVNA 4K20A 3KSCA 1VAKA 2GNTA 4U3FH 2V7QG 4KWLA 1ND2B 1O4YA 1HP8A 2ZGNA 3RVZA 3DL3A 3O9OA 4RHV1 1G9DA 3J8F1 4JDNA 5FXZA 3VBSC 2WDBA 1XNTA 2HWC3 4DXSA 4J42A 3N2GA 4RD7A 2PMWB 4ZKTB 1BJQA 5TISZ 4OMDA 3DEMA 3SCGA 2RJLA 3RZKA 5EYPA 2HWB2 2JG8A 1LGNA 1BQZA 4N7IA 1N4CA 3SHRA 4LORA 3M3OA 2R16A 1SRYA 4BR6A 4GH4A 1JYVA 4RHV2 4XACA 1B6QA 1VBD3 5FZCA 3NW4A 2HWF1 2M6YA 3LD8A 2GH2A 3GJBA 4I02A 2BGOA 5JH7A 1HV0A 1OPMA 2Z79A 3JD0A 3HQUA 1G6NA 4DRVA 1FXVA 4QPGA 5K0UB 5FYZA 5B5EZ 4DK0A 1VF5B 5BNQA 3CEWA 2VNRA 2BP6A 5A3MA 1JN2P 1W28A 2GN7A 1IQDC 1UX7A 4B3NA 1FV3A 4MGZE 4SBVA 3RI8A 4JASA 1Q8SA 1TUEB 1S0JA 4HZFA 2IUWA 1SZBA 5BR8B 1RM1C 4EN9B 2Y6JA 2YSUB 3FB8C 5CB4A 2V4AA 3VD7A 2XVLA 4OUMA 2IJKA 5DN2A 3Q8FA 2JDAA 4CCCA 4MTXA 4XPVA 2JG9C 3BTXA 3BTYA 1YFUA 3BY6A 3UM7A 2VZTA 2CAZC 1HRI2 3S7IA 3ZXLA 1RXFA 2DJVA 1SDDB 5GLUA 3F95A 2JIZG 4GZRB 4P9WA 4NKGB 5BYNA 5LHGA 1BBT1 3LSQA 1Z5VA 4P9LA 2PF4E 4QDRA 1XEQA 5FYIA 2DFBA 2IXHA 4RYDA 4UFMA 4X8PA 4W50A 5IYZB 3ZN6B 1VRH3 1XYOA 5FP4A 3LOIA 1QJU3 1W8FA 4K0KO 1LHNA 4GX1A 4GH4C 3W59A 1MZFA 2YDEA 5C3PA 3LE0A 1JUIA 1MACA 4QU1A 1LR5A 1SBDA 1VQ8V 4PDWB 2VQFO 4BM8A 4PLNA 1FNZA 1C57A 2WR9A 2WLPA 4L0PA 4JV5O 3USSA 1ZA4A 3H3UA 4RAIA 4DR2O 3LFIA 4NPMA 1XNQO 3EMRA 4LA3A 4FAGA 2VC9A 4O4IB 3H7YA 5A33B 4MX3A 3MO4A 2VCMA 1UPGA 3C3VA 2G38A 2YPJA 1LTEA 4HK8A 2JWPA 2WWSA 4IEWA 3CCEV 4J1XA 1ZZBA 2P3JA 1IOAA 3J7LA 4FLVA 1VAVA 2AACA 1F4NA 4QAWA 3JBG2 1LECA 2WNVB 3ZFFB 4N9HA 1IQAA 3C2UA 3LAGA 4LKSA 1KBHA 2J22A 2ZIMA 3LEMA 4GQ7A 5HCAA 4NPRA 1VBE2 4X89A 3WV6A 5JQGA 2ZDIC 3CCRV 4XFAA 5LA0A 5B1BB 4HETA 1ULDA 1XHXA 1XC6A 2VTXJ 2YI8A 1YXBA 2ARAA 2PHXA 2CDYA 1SKVA 1LUVA 3PU3A 1BCXA 3T2QA 2OT7A 4OPAA 4MVMA 3K08A 2FKXA 4R50A 2WNEA 2WLIB 1G8WA 1XI1A 3ZMSA 4BLIA 3P6BA 3W20A 1UCXA 4F83A 4QU2A 4H33A 3OM3B 5A9GA 2A3XA 2VZVA 4PLOA 4HK9A 2EAAA 2I45A 3SEPA 4YNIA 3A0NA 4FP2A 3TOJA 1ZRIA 4I4TA 3KCYA 3J9SA 4CSWA 2EXKA 4JAVA 4OQ9A 4YFWA 5J2TB 1YO8A 1W8UA 1XPWA 1Q90D 3F2ZA 3N3HA 1RUG3 1V9PA 1CAWA 1FV2A 4JDMA 1D0GA 2IJIA 2A7AA 3IKWA 5JXJA 2WLIA 3KD4A 5DMYA 5IFTA 4P9JA 1L3JA 2XXZA 4X9QA 1P4RA 3WG1A 3F5TA 5FY4A 5L7OC 1FOD3 1VAMA 2CGNA 2ZE7A 1AI4A 4G27B 2J42A 3RSJA 2P3YA 2VZ1A 1HQNA 1LU2A 1RUOA 1KS5A 4LBLA 1B3QA 5GLTA 1TUBB 4N23A 1TA8A 1ZRCA 1QXRA 5CVRA 1JYWA 5FKBA 1RHI3 2Y64A 1X50A 4KUMA 4QM8A 3E8BA 3SH4A 3AG4C 3SLIA 1GN4A 4B4PA 3NNJA 2YY1A 3N7LA 2ZOEB 3AG2B 5CN0A 2P6CA 2WBKA 5DUXA 5FO9B 1QJEA 1Q6HA 4QM9A 1RUE3 3SNMA 2UWCA 2AEYA 3PMSA 1PK6A 4JTAB 4AVCA 3VBHB 5CFCA 1SQBH 5FPUA 3ASNC 1SQFA 1XB9A 4KBZA 5L73A 2FBEA 4WM8C 5FP9A 1VPHA 2ZGLA 4XURA 3DUIA 3CMEV 4XABA 3HIFA 1F5JA 1YEWA 2X09A 2R1BA 2BDRA 3OUSA 5GONB 1AILA 1HIXA 1PIV3 2XG3A 4Y5SA 5FOJB 4C0BA 1RUF2 4GMP0 3WF0A 5IJ9B 2VAUA 4NE9A 4UB8Z 3ILFA 3CCMV 2R70A 4LMFA 4UW5A 3A2FA 2XJTA 3RWKX 1XBLA 4X1IA 3HQXA 1RUH1 4JRAA 3M3EA 1G8MA 1CEZA 1N32B 3PURA 1R3JC 3VBSA 1X4TA 4YJ3A 4GLXA 4YZ1A 5FZ6A 1H2LA 4K35A 4COVA 4J41A 3K79A 4NUBA 2DCJA 3B94A 1W0OA 3AMPA 5JSPA 2WWJA 1EAH1 1GN3A 4JCKA 1PM7A 3B40A 4RQPA 3VBUC 3BTZA 1REFA 5LXTA 5A3LA 5LGNA 4OVEA 2RS12 2JD4A 3JD3A 2XJSA 2XWJB 4JC1A 1ST8A 3PUQA 4B1LA 4JKLA 3LEKA 4QD2A 3IAPA 3H1LH 5IT6A 3ABUA 5LMNB 3SR2C 2HWE1 4PELA 2P7TC 3BU7A 1DGLA 2JK5C 4NIAA 4YARA 2XJQA 2OXBA 4XJZA 4LF6O 1QOSA 4CU9A 1QU0A 4NO4A 4UVCA 3VZJA 1DQ2A 3KG2A 1YJKA 4NB5A 1T2XA 5LBCA 5CB4B 2QUOA 2R061 3WVJA 5FMCA 4TWTA 3ZSJA 2VMDA 1WLDA 4LO6B 4GULA 2JEMA 1QVGU 2MEV1 3P5BA 3HOBA 2ZQMA 1ACCA 2D6KA 3W5MA 2BGCA 1F23A 1POV1 3MV11 3LWCA 1ENVA 3J8F3 1NQTA 1KJRA 4AI2A 2R043 1GZWA 2W9XA 2A79B 2WL1A 2VU9A 3WB2A 1Q5OA 3ZDSA 1HB3A 3JU9A 4IDZA 2GTSA 4D0QA 4QHZA 4YW5A 4L97A 1WNSA 1I9RA 3KB5A 1ZNPA 4GH4B 3I3EA 2OIEA 2DCYA 5DM6V 1N36O 5IY5B 4JGZA 2BSKA 4FCAA 4BISA 3ML0A 1HXS3 4BMEA 2QWOB 3JD73 1K92A 2UYBA 1BMFG 1Q8OA 3E6CC 5I0TA 1S0IA 2D40A 3H1MA 5C3QA 5A7PA 1SCSA 3U1XA 2DVGA 3U37A 4UFKA 3OOXA 1OH3A 2YFZA 5EBMC 1V6JA 3QVNA 2SBAA 4WVWA 3ICXA 4H44B 3ZO0B 3AEIA 3T30A 1SFYA 3N7JA 3AM2A 3R4UA 2ERFA 5EC1C 4UWDA 4HXCA 3AXDA 4G9SB 1DF4A 3ZXKA 2BWAA 3I97A 5A33A 2VQEB 3H9VA 4Q0PA 4JGYC 1QJFA 1VBA3 5E8AA 5ISLA 1QQP3 2IW5A 4Z07A 4ITCA 3ZSKA 2F4LA 4XDQA 2EINB 2AZ2A 1ZVFA 5FZMA 3OBTA 2ZGMA 2QWPB 1HRV2 3L9JT 3VBRA 2E7QA 4BQ3A 3DXUA 1MOFA 3Q4HB 5EJZB 5IK8A 1GSLA 1K97A 1BQPA 1YQ6A 2QNKA 2VE1A 1WLWA 1ZRFA 4LITA 1OF4A 4DUZB 1W6OA 3RWRD 3A7QA 1H9WA 3HNYM 3B5LB 2VO5A 5EBWC 1FFTB 1S0EA 2MEV3 1CZVA 4XIOA 1GV9A 2CGPA 3RFRA 1W3VA 1UN1A 2Z5WA 4X8NA 4YHHB 3ZFEB 2P5BA 3ALQA 2RDCA 2IXKA 3ABMB 3OT7A 1AX0A 3CLPA 4DV1B 5B66Z 1AF9A 5DDJ1 4GKKO 2A6YA 2EJRA 2FDIA 3OPTA 1WAZA 3G67A 4NAMA 1AYM3 3GZAA 4PI0A 3FYIB 2ATFA 3LA2A 1UIJA 2BOIA 1OCCC 4JYYA 4L8JA 4X62O 5FNVA 4BA6A 1KQRA 5FZKA 4HLTA 3ES4A 3WT3A 4QHBA 2V73A 1QJY3 3TJTA 3O1UA 1OCRB 4QE9A 1GOGA 2ZGPA 4JV5B 3ZMVA 2DYRB 5KX5A 1B35A 2DMXA 2QGNA 2ZAAA 4DB5A 4E2LA 4MXVA 1VQLV 3WDVA 5BMVA 5C9AB 3T4ZA 3WP5A 1NG0A 2OUJA 1UZZA 4I30A 2ZMKA 3UGGA 2AEZA 1IBKB 1SS3A 3D6EA 5LWBA 2Q5ZA 4FPHA 2HBTA 2Y4UA 2K0GA 1QJY1 1STMA 3RYHA 1AR5A 3K2OA 3AZYA 3KV5A 5AC91 5FOBB 4U2AA 2UUCB 2W08A 5KXDA 2DE0X 4C1WA 5LRSA 2ITDC 1TVGA 1HNXB 2NYYA 2PQSA 3UKVA 5E1AC 2X6CA 3A21A 3N36A 2WQ8A 3RRDA 4DV3O 1JH5A 1WW5A 5IFPA 2VNOA 4Q4X2 4PA9A 5F3CA 1N1YA 3CZJA 4YSFA 1CPNA 1EPWA 4GALA 3WZ1A 5K0UC 4YJ2B 2E51A 2VVEA 3RYFB 2DTWA 3SKVA 5EBLC 4QPIB 2G1MA 3SJBC 1OOPA 4XDOA 4BK5A 1ND2A 2OPKA 4QB1A 2P4KA 3WF2A 2AW9A 4AW7A 2AGAA 2WA3A 4RQFA 4W6XA 2XJUA 2G9ZA 1YSCA 3IM0A 4HVRA 3OPZA 3JATB 1T6GC 4R8HA 4LHSA 5I93A 5F8PA 4JTOA 4E4ZA 2N74A 4FTBA 1W2AX 3G6JB 4WM8A 4BQWA 1FXHA 2JD9A 4K6BA 3IWZA 1X9TA 2Q69A 3IB3A 4MTGA 3MIDA 1MNGA 4I09A 4CTEA 4CUBA 4LR4A 4CZZA 4CH4A 3D3QA 4W8JA 1QXPA 5CNAA 2BNOA 3BRCA 4P5YA 2D6NA 4JI3B 2PHTA 3WR0A 1JHJA 3E6DA 5AFEA 2J7MA 3MW2A 2UXDB 3TXSA 1RTVA 4F6RB 2BBVA 3WHTA 1ZX3A 3LCPA 1T6BX 5B1NA 3FUQA 3SJAC 1UY3A 3LSSA 2VGDA 1V6LA 4FPPA 1V6KA 2N04A 3ZMZA 2VMEA 4BK4A 1YLLA 3AKPA 2E5LO 4DV0B 1WBLA 4UI9L 2DUQA 4O9GA 4COWA 4K40A 5FAXA 2AZ0A 2D93A 4I7ZB 2WWUA 2Y26A 3ZXEA 5JOWA 2CNAA 3H8OA 5JUVA 1Y76B 4I0AA 2XT9A 5E79Z 1RL3A 1OCCB 2RM23 3E22A 1QHTA 1G7YA 2A6VA 1RUI2 1E5RA 3WQ7A 1VMGA 3ABLC 1HW7A 3X29B 3POEA 1HB1A 1PIV1 5EZYB 1AR82 4FTEA 2A06H 1JYXA 1ROPA 1YWKA 2UUBB 1LULA 2VMFA 4C91A 2QQIA 2RDRA 3BIEA 3WNNA 2VECA 2AENA 5CG8A 2MK3A 1NAEA 4XF1A 4BE3A 1H4GA 3NO8A 1IXMA 1IBKO 4E4SA 1LCLA 1Q7YW 4X1KA 4HL0A 4Y24A 2LALA 5FZ0A 5BMVB 2Q9LA 5JCTA 2Q8DA 4A7ZA 3FB7C 4YG0A 3AYDA 4E4DX 1Q43A 4TWKA 4D7SA 2W68A 4NAOA 3VD4A 5EZYA 1IZ3A 4ARYA 1NS1A 3B93A 2WIIB 1CVNA 5LP6B 3UJQA 1XHZA 3IDAA 4SLIA 3VV1A 5FY0A 5IK7A 1W0KG 3FYEB 2DURA 3O0VA 5L7OA 2QJ1A 3K58A 4Q4Y1 3OGIB 5K4LA 1AL0G 4CH5A 3CRCA 2D3SA 2YC4A 4M00A 2X5IA 1MEC3 1QDOA 3UESA 5BNNC 3RZGA 4WVVA 1N1VA 1V6OA 2O8OA 3CYOA 3C7HA 3SDLA 3CCJV 2WLLB 1TME1 1BZKA 2DWRA 2QCSB 1TVKA 4O2BA 4DIQA 4Q4X1 1O3TA 1K4DC 5FL7G 3ZYRA 4DV1O 1F2NA 3BPZA 5GKAC 3LDRA 4GB31 5FZ4A 4FZ1A 4QNHB 5TSWA 4IQPA 3WW2A 4CDUC 2H6CA 3VD9A 3RS6A 2P4EA 1D5AA 3W7SA 4JHZA 4ZOLB 4FOYA 1AXYA 4DO0A 3FLRA 4LA2A 1FYJA 1IVSA 2JGDA 4ARXA 3JXSA 3O1TA 4XF0A 2XHKA 2D6MA 3SPIA 4UV8A 1FPOA 2A0LA 1IX9A 1L8DA 5AG2A 4HPKB 4I0WB 4R8CA 5LZ6A 1FJGB 1J1TA 3RGBA 4G2KA 1IG0A 1AJPA 2Q67A 3FLPA 2OCCC 4C7UA 1CAXA 3LKJA 4IV3B 4M3CE 4LF9B 3M7MX 4MGQA 3RW0A 1LR1A 1E1RG 3SYCA 2XVKA 1PHMA 4AHYA 4DK1A 2QJVA 2DVBA 1EUTA 1UU4A 2F17A 1SHWB 3WB0A 4JI7O 2QWQB 2ZGSA 1D4M2 2Q8OA 3WQBA 3OUHA 3IDBB 1YI9A 3QCWA 2L35A 1AB3A 3JAMN 2BNMA 3MHZA 3LDKA 2H6BA 4CVUA 3JALA 1LEMA 2B1IA 4JZGA 3JARA 1UJWB 4D7TA 5DEDA 2X5IC 1UNBA 4HVOA 3MLJA 3G71V 3MYXA 1SZTA 1FOD1 1JXNA 3N7KA 2EIJC 1R73A 3NR7A 3FBMA 3VBUA 5JSRA 3UQ8A 1W6MB 4PDWA 2XNDG 1RUD3 3DC5A 5FY8A 3GZUC 1YJ9V 3K3NA 2F95B 3ASOC 1MVQA 2F66C 1L7LA 4X66O 1W06A 2YICA 4COYA 2DN9A 4LOSA 3CRAA 5FZGA 3OAAG 3RVYA 1WA4A 5HV4A 4FQZA 1KFXL 5L36A 3PLQA 2Q8VA 1N34O 2C5DA 4IHJA 3O1OA 1TMF2 3VDDA 4XXAA 1CGPA 3C3SA 1H6YA 4GX0A 1SA0A 5J3UA 4MVQA 3DGEA 1NCRC 2XH6A 4EB6B 3RG0A 4LF6B 5FJHA 4YIPA 1C8NA 1BEV1 1AX2A 5T52A 3H1YA 4AAPA 4RGAA 5JIUA 1AXZA 3R6SA 1VQ7V 5BNOA 1F9KA 3FB5C 2JJ1G 4L87A 4AXOA 1EN6A 3JATA 3I49A 4B8EA 1GP4A 3AZWA 2Y48A 4UCTA 4EQVA 2VZPA 1Z7S2 1ZX5A 3HKEA 1K5SA 4PV1B 3AKTA 5C9AA 4PLMA 2DQ3A 2IVIB 3R65A 3RYPA 2PHWA 3HKCA 3K04A 1YIJV 2VR4A 2OKXA 1OT5A 2PAKA 1K4CC 3VQWA 1N36B 1O3SA 4XAAA 4ISQA 5KXEA 1OI6A 3AP7A 3GGLA 3T1YB 3M4FA 1UOFA 4DY3A 3PHMA 5CU1A 3K48A 3BGAA 3ZS8C 2FQPA 3TYJA 4MVZA 5JWPA 5IK5A 1OC1A 5GM0A 1M4UA 2C1FA 4LT5A 1YHQV 1R1A1 3BHPA 1ZBE2 4IEZA 1UO9A 2Z5UA 3CEIA 2GHYA 4K21A 1ZBE3 5LK5A 1ENQA 2CGOA 2P06A 1NLSA 5FZ8A 5FPBA 3WF4A 1K3EA 2TUNA 3ZHUA 1NCRA 4FFBB 4YHHO 2VUCA 1LODA 4FLXA 3RYIB 2HEYF 4A42A 2DWDC 3ZXGA 5H9SA 4QX2A 3RYCA 1Y6XA 4E4EA 2WRAA 2W0XA 1Q8QA 2YS8A 3E5XA 3AK0A 1VBD1 2Y69C 4LHKA 1SPPA 3GM8A 4QX7A 1OUXA 5BNOC 1TG7A 1QOOA 1WCDJ 3MHSC 2XAQA 1AVMA 1BEV3 4K1ZA 1VQMV 2YU1A 5LGTA 2RM21 2Y6FA 2OIIA 4DR3B 1KXGA 1C8M1 2RN9A 1VIWB 5FY9A 4AILC 1R1A2 5FWEA 4C1XA 1DHKB 1ULPA 2DF7A 1VQ5V 3ASNB 4XIKA 1XMQO 4XOGA 2PGGA 3I7DA 3V0BB 1MMMA 3OY8A 2FCVA 1SLTA 3AYAA 1AVBA 2WAOA 3UGFA 1MS0A 4QPGB 4AVTA 2QQKA 4E2GA 1CP9A 4FLUA 3ETGA 3ZRVA 4GJYA 1EZJA 3VUOA 2VBPA 4YLZA 2HP8A 3PN1A 1NY71 2JDZA 2E26A 2W92A 3NV1A 4LKDA 1AR63 3PUHA 4DUYB 2UU8A 3OTOB 3N9MA 1DTOA 5D21A 1YYNA 3SQOA 1AR92 1R093 5J98B 5C8YA 4J9YB 4CCNA 2C6SA 1JR9A 3T2TA 1XE7A 1EN4A 1H2GA 5H2FZ 2AC1A 4YW4A 3ASOB 1EN5A 5FZOA 1G86A 4L11A 1SMVA 1C5HA 4O65A 1MEC2 1VF7A 1UMIA 1Z2GA 2GMPA 1QU7A 1AR61 4XCBA 4AEJA 1JQ0A 4B7KA 1B35C 5KXCA 1QJU1 4Y20B 3CCLV 5FZ1A 5GLVA 1QH6A 1XRUA 4G28B 3B7MA 4JZRA 4QQLA 4LOTA 2NR5A 2WAAA 3HQRA 4O2AA 4KL1A 4X64O 1DQ4A 2EXIA 2VXJA 4QB2A 2BPA2 1ZBA2 1UY1A 2QQMA 2WNVA 1KP2A 1ZL8A 5F5AA 1W9FA 1G9BA 4XZUG 2QQWA 1SBFA 1RUH2 2IH1C 4PA4A 2XLGA 1N1TA 1JFFB 2PZSA 1XNDA 5FKCA 1R3LC 3APQA 4UCUA 4U7OA 3OR7C 4IYHA 3L2YA 4YM2A 4MG2A 1W0NA 1GH6A 4HN1A 1NLQA 5C4WC 3JAWA 3ACLA 1ND3C 3CL1A 3BOPA 4PBPA 3SJQC 1BYHA 4CXYA 3GYDA 3BI3A 2PYTA 1UZ0A 3ABLB 3OEAA 4JKMA 2VMGA 3U4SA 3AVRA 2B45X 1UZWA 1SETA 1C3HA 2E31A 5I0SA 1O59A 5LYJB 2CAVA 1JOYA 4TN7A 1K33A 1LESA 1DLBA 4Y5Z0 3HR9A 4MGIE 4RR3B 2GC3A 1K73W 3F5WC 4YVWB 2BFUS 4P14A 1UXXX 2ADPA 4M4PA 5FPAA 2ZZJA 5LASA 1KQSU 1J3RA 1VB2A 2JRIA 3OTOO 2GTAA 4K8RB 2VZSA 2KG7A 1XDCA 4KGGA 3WOGA 3WW4A 3CCQV 5DAPA 5IVJA 2IJHA 2ZHLA 4LF5B 1O5LA 2ZCWA 3MI8A 1LOAA 4AG4A 4R52A 4MO3M 5B1AC 4S2FA 3AMHA 1UMZA 3HBZA 4LQRA 4KG0A 1QKQA 5E6HA 3WNXA 2UY9A 1O3RA 4OYUA 3CC2V 2VTFA 5KC5A 3P3PA 1HN0A 4QJFB 3BVCA 3OTFA 2KG7B 4QE7A 2DW4A 5K1XA 1PNMA 2D5FA 4UUJC 3GBGA 4HOOA 5FYVA 1NOVA 2Z4FA 1JUHA 1S72V 3VN4A 4HMZA 2QM4A 3ON7A 2D7FA 3I3BA 4TXWA 1LJ7A 3WG4A 3CJXA 3ZN4A 1AR1B 1UXZA 3KCXA 2C9AA 3VBRC 3K03A 3I2OA 3OF1A 3OW2U 3E1F1 2LRPA 5F5IA 1Q8VA 1AHSA 3AZZA 1GN2A 2XOMA 4NR1A 3NWKA 5JOYA 1Y4WA 4Q4V1 2WSSG 1JW6A 4HKLA 1FMD3 3RQ0A 1NE6A 1FFXA 1B04A 3M2MA 2B39A 2ET7A 5EYPB 4R6ZA 2RS31 5ITZB 2GC1A 1X8EA 1Y66A 1Q56A 5T55A 3AP6A 1CIYA 1DQ5A 4YM1A 3ZIWA 1AL23 4Q27A 2OIGA 2A6XA 1BMV1 1ULOA 4KFMA 3OGSA 1HQWA 2ORXA 4RL7A 4F8AA 2JG9B 1V9U2 3KZIZ 1N1SA 4Y33A 5DAQA 4WBNB 1PX4A 4DQAA 4HSLA 4DZGA 5B2GB 4OHZA 1Q3EA 3DC6A 4RUFA 2RHPA 3FE5A 5LA2A 2JVDA 5CFDA 2ORZA 3KZ4C 4RQPB 1QQP1 1MZ5A 4ZY9A 2PHRA 2WABA 5BXXA 3U0ZA 1CIWA 2NZ9A 5BUVA 4Q1RA 2XOKG 1W6QA 2FDGA 4A3XA 1F31A 2ZACA 1VP7A 2FZ1A 4RN5A 4OFGA 1OQEA 3AJZA 1GWKA 3PVEA 1KUQA 1PMIA 5FPOA 2JEXA 1LHVA 2FZ2A 4IIJA 1LOFC 3SPJA 5A3NA 1H2NA 1W39A 4OI4A 5FBZA 2DVDA 1SQ4A 3VD3A 2WQ4A 2WSVA 1FATA 3ZFFA 4K7JA 3ORJA 1QJX3 1BQ0A 2XQXA 3I56V 2IFWA 2ZNJA 4ZHNA 4ZHQB 4IGGA 4Z1MG 2JDIG 1GM8A 3UT0A 4LXLA 1YNAA 4CC6A 5DZGA 1PMHX 3RZLA 1GZWB 4XBQA 2CTRA 2YIBD 4MS2A 2WLNA 2GSYA 3AXEA 4XTMA 3V0BA 1KRIA 3JD1A 4JI8B 2X5IB 5FZFA 2EBOA 5K7PA 1OCZB 4UFIA 3B77A 4E8CA 1J3QA 1GKBA 2W6JG 1RJ8A 1HJFA 3CX5F 3AYEA 5LCWL 3DTUB 2YUEA 3GB7C 4NIGA 2WQZC 1C1LA 5CADA 1QLEB 3V64A 1F15A 3HVDA 4RFRB 3AK2A 1XYNA 2CTQA 4N53A 5BPXA 3DGTA 5H6RA 4JGZB 5DN6G 4WFGA 4QGPA 4XUQA 2ZHMA 4CP1A 4UBHA 5FQ0A 2IXJA 2MEV2 1UZYA 2VZUA 2RMU1 4NJ4A 1OKOA 1ZM1A 3VHNA 4QX3A 3ACFA 4BIOA 1QNMA 3VBHC 3BIWE 3NAPA 2A3YA 1Y4MA 1YVWA 2BOCC 4YZ5A 3S0MA 5JCOC 5L19A 1AJOA 1YIPA 4YM0A 1DYOA 3DN7A 4LBOA 1S76D 4ZI7B 4UB6Z 3N7MA 5ABJA 2AUYA 2X8KA 5A6QA 2TBVA 3G6BA 4DR2B 1WLTA 3WDUA 4QXCA 3B8NA 1FPN1 4R9CA 3JCZA 5KHGA 4GUNA 4NHLA 4MVOA 4BH9A 1ZAUA 4QX1A 5LBBA 4CCDA 3AL6A 4CEWA 5GZCA 5T5OA 1WCUA 3ZX7A 1W6NA 3ZMOA 2VZRA 3FHIB 3OE7G 2C2AA 1RUH3 1E57A 5EPAA 5JAXA 5IYDO 1GNHA 3ZHTA 2VMCA 1DGWX 1A6CA 4WM8B 5DG1A 5HI0A 4K8FA 1BCCH 5CEHA 1AYN1 5I91A 4XTPA 1VARA 1PK6C 2ES3A 2HJIA 3SPGA 3U10A 4Q4W3 3BU0A 4EFBA 1N47A 1VRH2 5J9PC 1JZ4A 2QDOA 4CRQA 5LA6B 2P1BA 1CAXB 4IUGA 1XU2A 4CH6A 1R083 2JE9A 2WLKA 4EWAA 1EUUA 2L6LA 1OV9A 3VBRB 5FPLA 2ILMA 1VBB1 2KSDA 3OBAA 4JAAA 1K5MC 4AI0A 4J7JA 4OI2A 1U12A 5F5QA 2W91A 4G4FA 1RUG1 1MZEA 1S2EA 3VDDB 1XBFA 2ADDA 2QKDA 5GZEA 4CEYA 5A1LA 2BTQA 4EYUA 2A70A 4CP9A 3RZZA 3IMMA 4A4AA 3ZFEA 2GNDA 4CU6A 2M7WA 1M56C 4GWNA 3WG3A 2DOSA 3ZIAG 3VHRA 1NVPD 5FZLA 2WZ8A 4O61A 4FAHA 4TYSA 1O6UA 1WW6A 4X65O 4JTDB 4QIWF 3OJBA 5FMOS 3JD2A 3K06A 1XSQA 3LNNA 1XMOB 4DV0O 3CCSV 1RHI1 4UF0B 2JB8A 2ZDIA 2BTQB 4XJWA 3F7VC 3OCPA 1OOPC 1EAH3 1ZTEA 5JZGA 4CP0A 4HBNA 5HCHA 2JJ2G 1WLCA 4PA3A 2VWJA 2D43A 2BVVA 4WV8A 1MG1A 4PT6A 3ZRWA 4QKFA 5IUQA 1X9PA 4BIUA 3HMYA 4PHZA 4C0HA 1XREA 2ARXA 3AKSA 3ZEDA 5GLZA 5DDJ3 4JF3A 5FLHA 1RSOB 2P4VA 1OA4A 1RIRA 3M3QA 4X1YB 3IIAA 5C5UA 3JALB 2WSUA 5F6KA 4YJ3B 3QNEA 4IEXA 3WP4A 3CXHF 3K4ZA 1MABG 2JEUA 4CS4A 4BWOA 5SV8A 4UFHA 3MLKA 3ZRWB 1S4CA 2EICA 1RUI3 1U97A 4LBQB 2RS52 2UUAB 4CEYC 4LFAB 1YI7A 1R1A3 4AEDB 3ITQA 1OQ1A 3CJIC 3EBRA 3STLC 3I59A 1AL22 3B00A 2OQ6A 4S2GA 5C6CA 4GKJB 1F4MA 1NX9A 1VQ9V 4LTAA 3EXUA 4Q8LA 2QTOA 1VMFA 4YG3A 1RPRA 3FWEA 1NZCA 4JI6O 2VUDA 1YF2A 5IAVA 3TN93 1DGWA 1J1LA 4JYAO 5I0DA 5FXWA 1SG3A 4FXGB 4ZXEA 5CA0B 3UT5A 5D8AC 2LW7A 4BQ2A 3NMBA 4DXWA 4XMIA 1YI2V 4TOIA 2XLFA 4LC1A 3MPPG 2ARBA 1ZYBA 2ZGKA 3VKMA 1APNA 4IE4A 1KB9F 3RYFA 3RN4A 2IVJA 4O7XA 1R1ZA 4FVMA 1JCHA 5KHIA 5KC6A 4H3WA 1MR5A 2GP3A 2XAJA 2XQRA 4JI0B 4GJZA 1I7FA 3ZXDA 3FFZA 5CKQA 3RZJA 1U5XA 4Z8BA 2CTWA 1H8VA 4I0XA 4ZKIA 2TEPA 3ZXJA 4FFKA 1QBZA 1WD3A 2ADQB 4JI7B 4ASUG 1PVC2 2W1QA 4B3MO 1DGRA 3CNAA 2EIGA 2E3CA 4XEZA 3VQXA 5C4WA 1W6PB 5A7QA 5EP9A 3CZUA 3J80N 2QTWB 1CD3G 3ABZA 1LGBA 1S0DA 1GOFA 2QQUA 1OOPB 3ACIA 5GONA 4DUXA 1GP5A 4BIFA 2PYJA 1R091 3M99B 3WDYA 4NXMO 2QVSB 4DYLA 4E27A 3H0OA 1UWWA 1RUNA 1JYCA 2UWBA 5IJRA 4DXTA 4DNYA 5B4NA 1O8PA 1PK6B 3H7JA 2WLLA 4PDMA 2QQOA 1UZVA 3R4DB 5LATA 1Q82W 2VZQA 3CP1A 2VUJA 2ZGOA 3ZR6A 3WW1A 3ZPYA 1YUDA 4IHJB 4L99A 2W39A 4ZI7A 3GCWA 1A8DA 5EK0A 3IGAC 3RWNA 2OX0A 1FMD1 2JENA 3G6EV 4BXSV 4D6TH 3POSA 2BOJA 3N9LA 3BB6A 3O14A 4GXLA 5DQ0A 1S2BA 5KAFZ 4YZ4A 1RUJ3 1UYYA 3AMQA 4LFBB 1D4VB 3MZHA 5A3UA 1SBEA 1VRH1 1WW7A 1SQVH 4P9PA 3BA9A 1BHBA 2AH2A 5DECA 5FZ7A 2VPVA 1JZ7A 2XAHA 5BY5A 3GZEA 2HWF2 3BCCH 3CDZB 3WDTA 1N3PA 1X33A 1ULGA 2NN8A 1CN1A 5LMUO 2R042 1A78A 2WZPP 5IWAO 3ATGA 3LDDA 1RUJ1 1RFYA 4RQPC 2C9KA 4N53B 1SA0B 3SJCC 4LF4O 1DU3D 3UJOA 4IT5A 5FR3A 2KA3A 1ASJ2 1A3KA 2DYSB 4ES8A 3ZHQA 1TAEA 5H9RA 3VLBB 3UYJA 1GN6A 2VW2A 1KEXA 3FKSG 3CRRA 2ZM6B 1JU4A 1R3IC 5KX5B 1B35B 1RGSA 1CJDA 2ETEA 1YJWV 1QLNA 4Z82A 2FMYA 1WZXA 4I55A 2RS33 5F2WA 1D4M1 4K3AA 4LFBO 2K46A 3K4AA 4WVMB 5JPNB 1REEA 3O5SA 3PUAA 5C8YB 5FP8A 5HCBA 3LEIA 1NR1A 4DV5O 2BCCH 3AP4A 5JR2A 3AJYA 4Y22A 2KKWA 1JPXA 1FNYA 1S77D 1COV3 1NKGA 3U11A 1IBLO 4CUCA 1W2TA 4X20A 2ZBJA 2OYQA 3CC4V 3TGUH 5FXXA 3DF0A 4BYYA 3R05A 1DGSA 5G04L 1EYBA 1NJIW 1VBC1 1ZZCA 3VDDC 1GKFA 1UPIA 4X65B 1HXS2 3STZC 1FKAO 3CO2A 2Q7EA 3MIFA 3JSLA 2A6ZA 1W8HA 3SITA 3JBG1 1ORQC 4F6EA 4LKFA 3O65A 3L72H 4L9BA 1POQA 3V0AB 2R32A 4P08A 1HX6A 4DUVA 3UCSC 3MAQA 3FLTA 3UK9A 1NA1A 4PF1A 4O4LB 3SYAA 1Q81W 1ENXA 1GWMA 4AF9A 3FX7A 3E22B 4QPIC 2Z42A 4F3JA 4H0LB 3O12A 2B9ZA 2YXSA 2RS11 1UIKA 3H8XA 1QJX1 4OGQB 2YEVA 1OA3A 2ZE5A 1L7RA 5ITZA 4IE7A 4TQFA 5H6QA 4LF7O 3RJ2X 2QBXA 4XYXA 1AYM2 5EWSA 4IESA 5LYJA 3FC0A 2P6HA 5HCFA 3H3LA 1LEDA 1NKDA 4MVRA 3WU2Z 3WINE 3ZVXA 5JH7B 3OR6C 1CR7A 4AFCA 5DUWA 4JDOA 1L1FA 2R9IA 3HJRA 4JHTA 3MV01 1RUE1 3U78A 1URXA 2YIAA 5KWRA 1BHGA 3H8UA 4P5HA 1HRI1 1EP0A 2VQUA 5FO8B 4JI6B 2EIKB 3BVOA 4N53C 4XC9A 3CRQA 3KT4A 1TME2 4BQ1A 2OW4A 3MDSA 2VD7A 1Y7BA 1MQTA 5KHKA 3S57A 2FCTA 4P9IA 3WCSA 4MTFA 4IW3A 1P7BA 4CDWA 2CTVA 4XMAA 3WG7B 1YIFA 5J2TA 2F6BA 3VZOA 4ZZ5A 4EZ4A 4EEQA 5BV6A 4JI5B 3PIJA 4IE0A 3RI9A 5A6ZA 3T2PA 1OHFA 3TXQA 2P17A 4Y1XA 5EC2C 4J6GA 2Y6LA 4LEJA 1AYN2 1BXHA 2NNUA 2A71A 4MGKE 2ZEXA 3LNMB 3S5QA 4DV2B 2YHJA 1HR0B 1XJAA 4FOWA 1RYYA 1SLCA 1CXZB 3WNKA 1WB8A 4MVUA 2JB4A 3JASA 3ZYBA 1EV12 5K0UA 2JS3A 1MVEA 4OX9B 2R072 4QXBA 4JTNA 1FXKA 1MZ6A 2QA4V 1E1QG 1IS4A 4QXHA 2JDKA 4YPJA 1K5MA 4LHLA 5C33A 5APAA 4CYDA 3OGCC 3IBMA 4L92A 3VKLA 2JIJA 3UO2A 2ETNA 4Q4V3 2GV9A 3LSDA 3WUDA 2OCHA 3K0DA 1J84A 1R081 1RITA 2RJZA 4HONA 3RJRA 3MEPA 3TNPB 3H42B 4FQ4A 1MS4A 1M5IA 2HVJC 1TGOA 5A6YA 1IURA 3D82A 4WZFA 4TV9A 5F32A 1UX6A 2EAKA 1MQTC 5FTTC 3QF7A 4LFAO 1UMHA 3KCCA 4Q4W2 4K3UA 2A5ZA 1WPBA 1F5FA 4YVSA 4NWWA 2YGLA 4LHNA 4YZ3A 2HWD1 1U96A 2IC1A 3VZNA 2VOTA 3I2KA 1GQPA 1MSDA 1AI5A 2D2CB 1RPOA 3ZFGC 3OY8B 2D44A 2Y6HA 2RM22 2P90A 2JE7A 1Z78A 3LF7A 3VBOA 1UAIA 2ITCC 2WNOA 4M0NA 4DPNA 2E32A 1UYZA 1ALYA 4JV4A 3ZFEC 3LQCA 4AEDC 2RR11 5M0TA 1Z5WA 4GYCB 2A1XA 4GWMA 2D97A 3QLQA 4AFDA 1BMV2 1NH2B 1O3QA 2YXYA 2X0LA 3AK3A 1H2KA 4KBBA 3IFXA 2VVFA 4H7LA 4XJUA 3MUY1 3SH5A 3P32A 1YFWA 1AR81 4HNAB 4K8XA 4A7YA 3THTA 3HBKA 4JX0A 1FXKC 4XUNA 5JDBA 4XF9A 4LO8A 4DW0A 1LHWA 4A2UA 3TB0A 1XNCA 2F93B 3FAVB 4LF8O 2JGUA 4CCEA 2ZGRA 4IV1C 1DDLA 4UBGA 3KGLA 2R062 3PU8A 5JIAA 3QG5A 3WQ0A 2EIJB 5H9CA 1AR73 3U4XA 4RWUA 2VH9A 4QGLA 1Y76A 1H1AA 5C3SA 3CJIA 1QMJA 3LA3A 3WCRA 2Y60A 1SLAA 4XUPA 2GDSA 4AI8A 4M3CA 2ZINA 5JJNB 2BE3A 1PGSA 2FMDA 4IEPA 4AGRA 3GHNA 2PI5A 3CJHA 2QZ2A 1WCKA 5L7OB 4FZ0A 1ASJ1 5FZAA 5GTHZ 4O4HA 1BLZA 2PHDA 3U75A 1QVFU 3K5OA 1ODMA 5I8YA 2EILC 1H4HA 4B08A 4DRXB 3ZYIB 2MNGA 3CJIB 1GRJA 3WX5A 1ZWIC 4HT1T 4KWKA 1AI7A 2WNUC 3W58A 3MICA 1IPKA 1GUIA 2JKBA 1NI8A 5JCOA 3B69A 3PJSK 1GU3A 3M8LA 1NCRB 3VBBA 2D5HA 5LMUB 1RSOA 3ZFGA 4CXWA 1ZUQA 1O4TA 4OPHA 4OCTA 1W8NA 5C71A 5HBAA 4HG6B 4UYBA 3SGIA 1KKCA 1VBE1 3H9AA 4YGBA 2NP0A 4O2AB 2ZX2A 2MHFA 2HKXA 4BZ4A 2CAUA 2JDMA 1TUBA 3I2IA 1NVPB 1Y3TA 1SLLA 2OUHA 2NLJC 5EIYB 3LZZA 4BWAA 4QPIA 2IXIA 3EVKA 2O14A 4M3CF 3BAAA 1M93A 2WC2A 2ZKOA 3TETA 1JZ2A 4RFT0 4NTWA 2D3RA 3KT7A 3VKOA 1SFNA 2G19A 1XUQA 4FLYA 1KMIZ 1QR8A 3JAWB 3S30A 5IYBO 3BYWA 3AFGA 5BNOB 4ICGA 2ZX4A 5J2UA 1FFXB 2Q73A 4O4IA 3OGVA 3KQRA 1WCSA 3UNPA 3D0SA 4YVWC 2YU2A 4DR1O 2RQ6A 1BK0A 3WNPA 4LO7A 5FPVA 1W2OA 3IC7A 4PDVA 3NAPB 1NTZH 3APBA 3SYPA 3IPVB 1PVXA 4FLTA 1EM1A 3LSEA 3G80A 1JBCA 2BNNA 1FYUA 1AYM1 3ELNA 3W7UA 1OCOC 1PO13 4N9IA 2QKCA 4DR4O 4A45A 5FYHA 4KH9A 2R1DA 5IJ9A 4FK5C 4UVBA 3FMGA 2VZ3A 1H8TA 4D94A 3K3OA 2CSGA 2HEWF 2F4VB 5KUMA 4Q0UA 4YY3B 2XKOA 4RR3C 1L7QA 4I50A 4QWNA 3R4SA 1QOTA 5FYYA 3NV4A 5C7GA 2CH7B 4OHVA 2O1QA 5ACA2 3WDWA 5LBQA 3B01A 4LJHA 4R9DA 4UCRA 2JDNA 1L0NH 3JD71 1A32A 3D36C 1JZ3A 1K8AW 2CHHA 4MLOA 4NXMB 5F5CA 3PNAA 2XKPA 2E6VA 1M9NA 1DLLA 1OD3A 3NJZA 2DQ0A 5HXMA 1LU1A 5FK8A 5EYYA 1XNBA 3VQVA 1A34A 1CWPA 1S0GA 1WMEA 3TWIA 4AFMA 2JIGA 2VY0A 2E9QA 5DABA 4Q0SA 3BTAA 4DR3O 1I1EA 4K9SA 2CY6A 3L9DA 1G9FA 1YQ2A 3FX3A 2K9ZA 3ETPA 2JGDB 3P30A 4JI4B 1SFPA 3FN9A 1EV11 2OCCB 2XBO3 2JG9A 2R073 4MGYE 3VZLA 2OTJV 1MQTB 1R6KA 4AGGA 5A80A 3K57A 1MSWD 2WN3A 2ZMNA 3QH6A 4J1WA 3CS5A 2UXDO 4AQ2A 2W2IA 5FZOB 3RYKA 1HJGA 4JVAA 5BY1A 3OMIB 4FBFA 5F1RA 1IBMB 1QNWA 1ZLZA 3QOPA 2YUAA 4DUYO 3OEHG 3J7MA 2UU9O 4GZ9A 4PJYA 5GZFA 4UVAA 3E97A 2Y0IA 1GNZA 2YBKA 4ONUA 1LGCA 1NXD1 4P9OA 4GA9A 5I8TA 2D6LX 5EHDA 2UU9B 3W9AA 4BJ0A 4Q4W1 3CKHA 1V00A 1CAUB 3KS7A 1V55B 4Q29A 5F39A 3DYOA 1XOUA 1R082 1OH4A 2YV8A 5IVEA 4RS5A 4V1PA 1TNRA 3C7OA 4MSWC 2HWD3 4GKKB 3GBFA 1QR9A 2R9AA 1M57B 5L3EA 2P22C 1JJOA 4IEUA 4JQRA 4CEWB 4JRLA 3N27A 1FJGO 4JAUA 2XR4A 3TEXA 3VDCA 1I5ZA 4FM0A 4URTA 1JI6A 2VOWA 4N7UA 2QKAA 1PPJH 4DINB 5FNVB 2RDQA 3PVOA 3WNLA 3RZMA 5A7NA 2OZ6A 1DG6A 4RS5B 1LNSA 2KQXA 2Q0OC 2EINC 1KC8W 1IGOA 5T5JA 2RG4A 2WZR1 2VTXA 3O1SA 1G9CA 2Q4PA 5FMBA 2VCBA 1XL4A 2EIEA 3ACGA 3VB9A 4FFBA 2Q8CA 2JDHA 1UKGA 3ZLIA 5AC93 4NROA 5ANQA 3ABKB 4TSVA 3IT8A 2Q7GA 2ZGQA 1BL8A 1HRV1 4QHOA 2PN5A 2W47A 1C5IA 1JMKC 5F6LB 2LJ2A 4X20B 1XMOO 2HH9A 4W4LA 3MIGA 3T1CA 1AP6A 1J5EO 1YXWA 1CPYA 4CDQB 4BW5A 5T3NA 3RNSA 1PM9A 3E5UA 2H94A 1ND2C 2FD8A 4B29A 3CHXA 3VDAA 1OCRC 1JZ8A 4I55B 3N2KA 1V54B 1JOJA 2GBOA 3OFNG 4U7NA 5FDBA 1AR62 1V9U1 1BBT2 1DBNA 2P37A 3TEYA 4BQ5A 2FB5A 2PA7A 2IXLA 2XHBA 1RVF2 2PQQA 2WFF2 3ZRSA 2FYUH 4C8DA 3ZM8A 1OF3A 2K9PA 2PLV3 4DR7B 4M01A 3LOBA 4FLWA 4OHXA 1RUF1 5A32A 2XAFA 2ZCEA 3O1VA 3ME2A 4MSVA 4FPFA 4LLOA 2VCCA 1H30A 4QQ2A 4AI1A 1LOEA 4DV7B 1H2SB 2WKKA 4FOVA 5LP6C 3K0GA 5JR7B 2IM9A 5ERLA 5BNPA 4A6SA 3USUB 2JECA 1O4ZA 2ZHNA 1JFFA 4RGGA 2W0FC 1XNAA 3N35A 5IDJA 3ASIA 5JZGB 5A7SA 3B3QE 2ZXQA 2UXXA 2UUAO 3IDEA 3E8FA 3AG1C 1MS9A 4HN0A 3I2GA 4FFHA 5CFDB 2R0HA 1ZZ6A 2ZJCA 4OHWA 2BU9A 4G3YC 3MIHA 5A7WB 4K8ZA 4Y20A 5LY2A 3CRMA 4WM7B 5B3SC 1O7FA 2QE3A 2E5LB 1MEC1 3HD8B 1VMJA 4CS2A 1A8MA 2HYKA 3JYCA 4HKWA 5DUUA 1ZL8B 2H3OA 3P1IA 1NQDA 1H38A 4QT6A 4GD4A 5KHJA 4GWJA 3D0JA 3LSUA 3I8TA 3VHPA 2W94A 2AHZA 5T50A 3VBSB 4O4JA 2HEVF 1XNRB 1BKZA 2O0OA 3QO8A 2B4KA 2O8QA 1GZCA 2WYFA 2R0FA 3OUJA 1D2QA 3AG1B 3SC7X 2A3QA 3AZVA 4LE3A 5J09A 3BFRA 2QTSA 5D8AB 2A73B 3VBOC 2E74B 4AI9A 4CCLA 3OBRA 1VEWA 2D3PA 2B5HA 3ZR5A 3AG3C 1V6MA 4Q4V2 3MD0A 4XFHA 2LUWA 2UWAA 4JQTA 2KR2A 4HKOA 3HKBB 3C7GA 2W1WA 2Z0AA 2W1UA 3CXCU 2XLAA 2GP5A 4LBNA 2LM3A 4CU8A 5IYYA 2A75A 3FBYA 1ENRA 5JJJB 1OD5A 1HQLA 4CDUB 5ACA3 2FMLA 2VUAA 1SPPB 4J7ZA 3WNOA 3HAGA 1E5IA 1PNGA 5JVDA 3ETEA 2R30A 5JI7A 2RVAA 3OMAB 5EYXA 3KT1A 4LKEA 1YQ5A 3WSOA 5T5LA 2EALA 2BFUL 1PL0A 1YCIA 3OD0A 4J25A 5FK7A 3IPVA 3AZXA 2FL4A 4KWUA 4LULA 4TV9B 1JODA 3OPWA 3CSXA 4S2DA 2V72A 4UV9A 1XYPA 4QXKA 2E75B 1Y74A 1RUD1 1ZZ8A 5BXZA 5C4WB 4XBLA 1H9PA 3SH3A 3RYCB 1V9U3 3MHHC 3B9CA 4LBQD 5CIRA 4F7ZA 1UFIA 2JG8B 4ZIBA 1BK1A 4BXFA 5B1AB 1ULCA 4EZHA 2CH7A 4I0XB 5I0UA 1W8OA 1TZOA 1BSMA 5DUVA 3J7AU 4JKKA 5BZBA 1W59A 5J1XA 1ASJ3 3CMGA 2HBUA 4W4ZA 4Z92B 1H2MA 2A7WA 3A0BZ 1C1FA 4PDWC 1Z7S3 3V0AA 2HLDG 1WP8A 1EFRG 2UXNA 2C0ZA 2RR13 5EQUA 1C4RA 3FHQA 3MW3A 3SPCA 4M4RA 2QQVA 1OLME 5IJ0B 1NE4A 3KHCA 4Y4YA 3NJYA 4XDPA 5J96B 4DR5O 5LMNO 1J59A 4Q1PA 2VWKA 3GVMA 2HWD2 2NPIA 2LQTA 1V0AA 3EJKA 5ABJB 5FPRA 2V5DA 3QD6A 2GN3A 3IC9A 3UL2A 4NHKA 5L9VA 1PO21 3H8RA 1F4HA 1OURA 2ZHKA 1JX9A 1OHHG 2DUPA 3I2DA 2VCAA 2BW8A 3HKDA 4QKBA 4A6OA 2YXHA 4J11A 2R49A 1XMQB 4LK7A 1SF9A 1X82A 3LDEA 3RZHA 3T0DA 1PKXA 3K3WA 1RUI1 4TTGA 3LIHA 4R9AA 1W99A 1DYPA 4P00B 3QO7A 4Q4Y2 3WP6A 3ZFFC 5FY1A 1THZA 1AX1A 5L3DA 2E53A 1QHDA 4XHXA 3OGJA 2WLJA 5FPXA 4C90A 2Q1FA 5IVBA 2UXCB 2YXLA 1NCQA 4ASKA 4QQHA 4YXWG 4DXZA 4LH7A 3JBG3 4PD4F 2ATKC 2GC2A 4EROA 1PVC3 2P2KA 4XQ4A 4B3RO 4MGSA 3RYRA 2UUCO 1CX1A 2BTVC 2PHLA 5C93A 2RV9A 1AR91 1IDSA 1IS6A 1GICA 2Y69B 1Q86W 4XQWA 2ZKNA 1U0AA 2EIMB 4CXXA 2AXTZ 2VJXA 3UKNA 2BJSA 2ZS6B 2B1GA 1XILA 1VJ2A 1DZQA 1L0LH 4H14A 1TME3 3DPRA 2DCZA 3A23A 5KA6A 2Y0PA 1VBB2 2VQ0A 4UFJA 4AQYO 5F3GA 2ZX1A 4IXLA 2HWB3 2HHHB 2KB1A 4IEOA 2VQEO 3AKQA 1BT8A 1HNZB 1KP3A 3A0KA 1DQ0A 4DR7O 4AHZA 2ZABA 1YZBA 3MW4A 3OG2A 2XHNA 2A9HA 5L3GA 1DF0A 1D7PM 2LW1A 1H8TC 4WFFA 2FCUA 4Q6GA 5FBJA 1ZZ9A 3I3DA 4DXRA 5FUPA 1QWRA 4CS3A 1RINA 1ZA7A 4LWSB 3MBWA 1X7NA 5CZKA 4IGOA 3INAA 4AEDA 4P02B 1NR7A 4JGYB 4PJ0Z 5AVAA 2Q8EA 1RJ7A 5LP6A 1DFQA 5BNPC 4AZZA 2QKSA 3Q8CA 4XAEA 3WLUA 3AG3B 1LENA 1NT2B 4B3MB 2IJJA 3T2OA 3JD4A 4V2WA 4LF8B 2Q7HA 3HEIA 4IEYA 4KQ7A 1N32O 2OZJA 4IEQA 1QEXA 4XJ8A 5LRRA 2IU0A 2ZEWA 1AR4A 2VULA 5LHHA 2VOKA 4AQYB 5KR7A 1US2A 4B3TB 4GX5A 4W6WA 5LOVB 2P3IA 2P3KA 2E33A 2B9VA 3PUSA 4N43B 2FHRA 5E1RA 1X36A 1AZDA 2Q5TA 2ZGUA 2XL7A 3FD9A 4QPKA 5E88A 4YW2A 2CWSA 3EHBB 2QM8A 3FJSA 3W5NA 3QTCA 4NYKA 2BWCA 3B02A 3E83A 3L70H 3MLLA 1C8M2 3ZSEA 4RA0A 4PDLA 3ZYPA 4Q26A 4WM7C 3AP9A 1C8M3 3K59A 2CWMA 1G4YB 4NN0A 3D5OA 2P6JA 5H9QA 5KAIZ 4N8MA 4N43A 4P2ZA 4PQ9A 3BPSA 2XBO2 4CZSA 4XE9A 1KKDA 4I9QA 1QH7A 3ZRXA 3Q9OA 1K34A 5FFOC 3G4SV 3WP3A 5CAZA 3DPRC 1QGLA 3JAKB 4YG6A 3K9SA 3ECQA 4LBQA 4WFEA 2CDOA 4D6QA 4L8QA 5A1AA 2HEPA 1YC61 4B3TO 1ENSA 5FQ0B 3JB4C 3OD4A 4H7MA 4LFCB 3VBFA 3NQHA 2QM7A 1UOJA 3N9OA 1W05A 2JE8A 5JSOA 2WO7A 1CAVA 5H9PA 2LROA 3KHBA 1S5LZ 3I3MA 2MPFA 1ODNA 3WG7C 3GHMA 5CISA 3JAKA 5DAXA 2R9RB 1YRZA 2F23A 1HDJA 1VBE3 1O9GA 4FPEA 2YIBA 4OX9O 3E89A 3BCWA 5EIBC 4FM2A 3Q8BA 1AJQA 1IPSA 2GC0A 3WXPA 4Q0QA 4WFBV 2ZEZA 5DZEA 1GQHA 5D2AA 3O1RA 1PO23 4NTXA 4UF0A 1S5HC 4J9ZB 3AG4B 4DMIA 1LAJA 4QKDA 4QKNA 1SC5B 4HAMA 2WLHA 2Y6KA 1P8JA 1RUC3 2VBBA 3K75B 4NRPA 4PF5A 5JZGC 1TE1B 3NKGA 3IAQA 4OXSA 1K12A 3L74H 2GNMA 2E76B 1S55A 1D0HA 3T0BA 1FD9A 4B1MA 5CKMA 1S0VA 4LO5B 5CFCC 2YC2A 4ASLA 2PHUA 3K5LA 4MOAA 4EE2A 2BRTA 2QQPA 5D5QA 1SQQH 2QZ3A 1BVVA 5LA6A 4UFZA 4AL9A 2X29A 1AJNA 1JU3A 1J58A 1XSRA 1Q8PA 2EULA 3OGGA 5FV3A 4LF5O 5HV0A 2PUSA 2WWWA 5HPOA 1YTFD 3CU7A 3MPBA 5A32B 5KLVH 4WFHA 4TUYA 4X6QB 4IERA 1ZZ7A 3DKWA 4XVHA 5K9YA 4QQPA 3ZN5A 1BS3A 3ABMC 4OULA 1BVP1 4FM1A 4CDWB 2RE9A 2GUZB 2J1AA 4LIVA 1GOHA 3IN9A 2VM9A 2B42B 4TV8B 5LOVA 5SV5A 4XETA 3GF6A 1VALA 1ONAA 1UYXA 5CBHA 4ZZ8A 5LY1A 2XVGA 4ABMA 5FYSA 4BPZA 5IVVA 4NVPA 3RPQA 2ZR3A 3APOA 4CPBD 5ANNA 4AHCA 1R6NA 3ABKC 1PNKA 2GAUA 3DYMA 2UXBB 1R6TA 4Q20A 1WUVA 3T2MA 1WGPA 1HW5A 3O0XA 1PGL1 1KDMA 2BOBC 2R041 1GBGA 3ZPOA 1D5NA 4TV8A 1WMDA 1O9HA 2NQYA 2WS91 2VBDA 4ZU4A 2AHYA 5F3IA 4IETA 5AVPA 3ILRA 1I08A 5EFUA 2WT1A 4IEVA 1PIV2 4DS0A 2ADEA 1QJX2 2DU1A 4N21A 3VHOA 3PMEA 1DGRN 1QNYA 1DP0A 4GX2A 5IHRA 4XDJA 2DTYA 4OI0A 3I2HA 3OEBA 3SYOA 2GALA 3KV6A 4FJCC 4CCJA 3OSDA 2WNUA 5G05L 2DYSC 3ZHRA 1EPZA 2VW1A 1QDCA 2OS2A 1ZRRA 3FZ3A 4KGQA 4DR5B 5FMOL 2HWC2 4ZXKA 4D69A 5A1FA 1IS5A 2YC0A 4DRRA 4HZ3A 2JDUA 1OMIA 2PI4A 4KI5M 2ZTNA 3NV3A 3UV9A 5LBEA 4B7EA 5IATA 5IVCA 1I94O 3KWVA 1N34B 1YJLA 2WYSA 3AK1A 5CA3A 1AL21 3AX4A 1PL4A 2ZM6O 3T3YA 2ZIOA 2EIDA 5CG9A 2AYHA 5FZ3A 4YFZA 2PAMA 1UU6A 3GJAA 2ZNIA 4Y1ZA 5CA1A 2W1SA 2EA7A 2QWRB 2V09A 1RUJ2 4B3SB 4UXAA 3T1YO 4AEKA 3MFAA 4FPYA 3ZOIA 1TMF3 1N0NA 3L75H 5FZBA 2W6IG 4JI3O 4LBKA 3AL5A 1SZXA 4OI1A 5BNNB 1WB7A 4DR4B 1W0JG 1NZ6A 3EFFK 4IYIA 3MGUA 4CP9B 5F37A 2Q6AA 3T08A 1Y9QA 3T4DA 2EIMC 4GMP3 1HV1A 3NNLA 3POWA 2V1DA 3ZYFA 1MS3A 4RQEA 1FMD2 3TK1A 4X1IB 3IDCB 1WMXA 1UY4A 1XXNA 1OQDA 4FVVA 2JDYA 3MDPA 3O0WA 1QF3A 2QQNA 1UW8A 3B8MA 4PI2A 5JMCA 1P49A 2J1RA 2YEVB 3ETDA 4QX0A 1S0BA 2Q1ZB 3MFCA 1HRI3 2YIDA 2VOXA 3ETQA 3ACHA 4KHPB 2ZZQA 5K1PA 3OYWA 4FFFA 3FFQA 4M3CB 1F7YA 3WB1A 1GM9A 3DKQA 3TAYA 2ZX3A 2GU9A 4TT3G 3BUCA 2RS32 1ZSPA 3U14A 1XQNA 1NQJA 2D3OW 2GDFA 3JUUA 3QBQA 5C9AC 1RMU1 2CTPA 3DYPA 2N05A 5CA0A 4LF7B 2QSAA 1RC6A 2DYRC 5J7MA 3B2EE 2X10A 1IS3A 3FL7A 4LFCO 2YMZA 3ENRA 1IG3A 2UXCO 1EAH2 4RO2A 3IAYA 5DAVA 5A3TA 1COV2 2B7YA 1GQGA 3HKCB 2YFUA 3T1LA 2WS93 1UY0A 2J1TA 3PDQA 3ZN1A 2ZXWB 1RMU2 1VBC3 3NXSA 1UL9A 1FXKB 4UXNA 1NU1H 1D2DA 3NJVA 1FS0G 2Q1MA 1COWG 3WDXA 4UW6A 2XTAA 1OA2A 2Q0AA 3LPGA 1SEFA 3TEZA 1UPSA 4COUA 5A7WA 4HNAA 2YZ4A 4DOUA 4TLGA 4FIPC 2BERA 2EILB 5KMGB 1LUWA 3UGHA 1JOBA 4QPJA 4JI8O 1QIQA 1OKQA 4QPYA 3RMYA 1PZ7A 2Q4SA 2LFSA 5F2SA 4NIHA 3K4DA 4D7YA 2EJ7A 1GLHA 2ZAHA 2RJKA 5CFCB 3WY6A 2Y6GA 4EV0A 4X8AA 4Z1VA 1CX4A 5LEJA 4XW3A 1PVC1 4YVSB 4CUAA 1XNRO 1DIWA 5B4XA 1GMMA 4NHMA 1PO11 3QACA 2ZMLA 2OVUA 1WD4A 1KYOF 2LO1A 2WLMA 1HNWO 2P67A 5EXOA 4J10A 4PA6A 3IIIA 4B3SO 5LB6A 1PNLA 3N9PA 5DDJ2 1TEIA 3E8HA 2KM2A 2EZOA 2RS51 1VQNV 2C24A 1XNQB 2FDKA 2J1EA 1RVF3 2H0VA 2UYAA 2WFF3 1FPN2 4DUZO 4E2SA 2NMNA 4DRXA 4PIXA 4CCKA 4PA7A 5F7UA 3USUA 1RUG2 4AQTA 5JMOA 4JI0O 1R64A 4FPKA 1SQXH 4CDWC 1IHMA 1KGYA 5FUNA 1LOCA 4QQOA 5FMDA 5GZDA 3JQXA 4DY5A 1JVMA 1W03A 4CU7A 1BE3H 3AP5A 1WN7A 4GIQA 3CWBH 1XE0A 3D3AA 3SISA 4YW6A 4R9BA 4GKXA 4PCRA 2Y0OA 3WD5A 4MXWA 2BTOA 4LBMA 1V6IA 4OUSA 1ULFA 1ZBA3 4Q4X3 5L9RA 3I4IA 2OTLV 1M56B 3NNGA 5IW0A 1HB4A 1QXJA 4LR3A 4OZOA 1PGW2 5FO7B 1W8ZA 2JS5A 4BMBA 3VZKA 4BU2A 3KF5A 4FI9A 1MS1A 4FOQA 1J83A 1GK9A 3HPLC 1AYN3 3KGZA 3WEZA 4ATEA 1CESA 1M1KW 1BHAA 5CA6A 4X64B 5IYZA 4KWJA 4OMCA 4XDLA 4ZBMA 1WBFA 4CUGA 1J3PA 1K5MB 3SEEA 1W6QB 3SMHA 2B5UA 3ZMTA 2VNGA 4BQYA 1AJKA 1KD7A 5HFLA 4MVSA 3LPFA 4N43C 3FAVA 1I6XA 1YDXA 2UY8A 3KQ4B 2HFEC 4LPLA 1W6PA 4I5SA 2A3WA 5L3BA 3THPA 2YG0A 1HNWB 4NOTA 3E5QA 4GKJO 3HN1A 4S2HA 2QQJA 1VIBA 1WP7A 2X05A 5C70A 4HFSA 3HR0A 1OLRA 4YGEA 1DZTA 4NHYA 4CE8A 1US6A 5FY7A 4LWSA 1UOGA 1OLMA 4YVSC 3OUFA 4O4HB 2OYZA 3IJ4A 4R4ZA 5LW9A 5CMUA 3H1HH 3CJHB 5D8AA 5FPZA 1KJLA 2XWBB 2QR4A 1KFUL 2WPDG 3E8GA 4CEYB 4BIZA 4EWEA 1NH2D 3ZKYA 4QDSA 4LBEC 1N3QA 4LNUA 2PXJA 2DV9A 4LLFA 4JTCB 1OFSA 5FRAA 1XE8A 1KITA 4FFIA 1EY2A 1RB8G 1SCRA 5F3EA 2JDPA 2WZR3 2XL9A 4HSJA 4IV1A 5A70A 2I74A 1B06A 4CPBA 2AREA 1N33B 4XILA 1T5EA 2QDNA 1HN1A 3VDBA 3TNQA 4Y22B 4D8MA 1AR72 3OEEG 2ZXWC 2EXHA 1D2SA 3F7YC 5EJ3A 4IV3C 2ZD9A 5JOZA 1FT9A 3THCA 2WZEA 5LA9A 4URAA 1NT0A 5FZHA 3UT5B 4L2NA 1B09A 4LO4B 3M1HA 4BB3A 4NXNB 1GWLA 5JXIA 2QEXV 4CP2A 5C8CA 3LDCA 4OHYA 1LRHA 4NPLA 1PD3A 2LGQA 2ZGTA 3RBZA 3L73H 3ZSLA 2DCTA 2G9FA 2ODMA 4O9EA 1X8MA 1HDKA 3AVSA 3MUZ1 5FYTA 2UURA 3CPWU 4ZONA 3DV8A 5IVFA 4J7KA 2HR3A 3I2JA 4Y5TA 1K45A 2Y8KA 4BQ4A 3GBWA 4GB33 5FZ9A 4QDQA 5GALA 2YBPA 3I55V 4ZS2A 4GB32 4ATFA 4TZDA 4RUEA 1W04A 4BOWA 1AUYA 3NL1A 3GXUA 2DVFA 3POFA 1W0PA 4WVMA 4H55A 3M70A 1VQ4V 5JI9A 4COZA 2GMEA 4CA9A 1CAVB 2KXLA 1NZIA 3T09A 3ZBHA 4B4RA 3SXWA 3JCUZ 1KS4A 5A6XA 2GSMB 4I01A 3VL8A 2H0BA <