4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
b'SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
2UYAA 3FJSA 2WC2A 3MZHA 3NVCA 2UYBA 3EO6A 1CAUB 2D93A 3I54A 4KWJA 2ETEA 4PJYA 2PAEA 1RC6A 2Z69A 3NL1A 4EWDA 1SQ4A 5K8SA 3IIAA 3H1YA 2UY9A 3MPBA 3UKTA 4L2NA 4QM9A 3SCGA 1UD1A 4YYOA 4R52A 1ZX5A 4BIFA 3OCPA 1EY2A 3IDBB 2VQAA 1ZZCA 2XHKA 1O5LA 5FLJA 3ES1A 2GZWA 3ETQA 1O5UA 3RNSA 4QGLA 1SEFA 2V09A 2VPVA 4XF1A 1J1LA 2GC3A 3SHRA 2BYVE 3FWEA 2IXJA 1GQHA 5EZWA 5BPXA 3SCFA 1ZRFA 1LRHA 3FHIB 3LAGA 4EV0A 3DV8A 3DKWA 1NXMA 5LEJA 4QMAA 5T3NA 4HSLA 4XF9A 3DL3A 1YWKA 4UBHA 4KL1A 5EFUA 4MGIE 4BHPA 3S0MA 3FX3A 1DGWA 4D7TA 5KBFA 4Q29A 3HIFA 2BNOA 2EVXA 4ZU5A 3H8UA 4META 2Y0OA 1YUDA 2GC1A 3NW4A 5FLHA 2MPFA 2GAUA 2CAVA 2XL9A 4LUKA 3U0ZA 5FPXA 4YNIA 3D0SA 1CAXB 4MUVA 3RDIA 1X7NA 4B29A 3BU7A 2XL7A 2ET7A 4OFGA 3RZZA 4DINB 3EQEA 4WVZA 2ZCWA 5I91A 2IXKA 1O7FA 2QVSB 3D82A 4ORFA 1Y9QA 3E5QA 2MNGA 2F4PA 2IXLA 3CJXA 1JUHA 4XETA 3RYKA 1YFYA 2XKOA 1J3PA 4AVBA 4IEXA 2MHFA 3ST7A 1V70A 4ONUA 2Q30A 4XFBA 4QGNA 4BH9A 4MZUA 5I0RA 1ZZBA 2GU9A 1NZCA 3CF6E 4HN0A 4YARA 5BV6A 1ZREA 2ET1A 2K0GA 4IEQA 2XLGA 4MV2A 4FBFA 3LA2A 4PIXA 4EWAA 1J59A 4F8AA 4IEOA 5I8SA 3OGJA 4KWKA 3H1WA 1UIKA 2B9UA 3WW2A 4NVPA 3D0JA 3GBFA 4IEYA 3M70A 4RD7A 2PFWA 4XF3A 4Z07A 1O3RA 4TLFA 4N9IA 4IEVA 3TNPB 4OLLA 4UXAA 5KHGA 3ROUA 5KHHA 1DZTA 3L2HA 2D5HA 5BY5A 1PMIA 5E16A 2ATFA 4Z82A 3BPZA 1RTVA 4PIZA 3KSCA 3FZ3A 4I2OA 4KWLA 2O1QA 3KGZA 5C6CA 2C0ZA 2XLFA 4Q0QA 3WW4A 2D40A 2CGPA 2BNNA 1Q5OA 2OZ6A 3HT1A 5JR7B 5I93A 2OYZA 4I3PA 5FQ0B 3EBRA 1O4TA 2OA2A 4XFAA 2PQQA 1WLTA 1IPJA 4I01A 4XF0A 3WW1A 2GH2A 4JTNA 4P9GA 3E97A 2DCTA 5KHIA 1ZZ9A 2XKPA 1EPZA 2B8MA 2Q4SA 5E1RA 1SFNA 5CADA 1J58A 1RGSA 1TQ5A 1RUOA 3LA7A 3QOPA 2XLAA 3IWZA 4JV4A 1FXZA 1WA4A 4E2SA 3H7JA 4X6QB 4HMZA 4XFFA 1OFNA 3GYDA 3UKVA 5CVRA 2IXHA 1PM7A 1VP6A 4I02A 5JSPA 1OI6A 5FCCA 3USSA 2K9ZA 3WW3A 4A2UA 5FDBA 3H50A 1CAVA 4FT8A 3MDPA 4HZFA 1QY4A 1QXJA 1O3TA 3E6BA 3U11A 1X8MA 3I7DA 5BXXA 1ZZ6A 1UCXA 2CAUA 4R8HA 1CAUA 3RYRA 2QJVA 3NKTA 5I0UA 3U10A 3QACA 3I59B 3HT2A 5JCTA 3S7IA 2P17A 4WBBA 3LZZA 4XFCA 1CX4A 3O14A 4QX5A 4IEZA 2IXIA 3OD0A 4ZU4A 2EAAA 5BUVA 3G7DA 2BGCA 4HLTA 4MH0E 1QWRA 4IERA 4F7ZA 3SMHA 4HBNA 1CAWA 2PYTA 3LOIA 1EP0A 2FMYA 3ACLA 1YFUA 1ZRRA 4BYYA 5KHJA 2PHLA 4L11A 4I09A 3ELNA 5I0SA 1YLLA 3H3UA 1RL3A 2VECA 2ZKLA 3DN7A 4UBGA 4AQ6A 3H7YA 2Q1ZB 3PVBB 5J3UA 4JTOA 2D5FA 2Z2SB 1Y3TA 2B5HA 4KU7A 1I6XA 3ES4A 1NE6A 1VJ2A 4IETA 4HSJA 3NSTA 1CAXA 4AVAA 2I45A 1ZZ7A 2CV6A 3RYPA 1WGPA 3KGLA 4QXKA 1ZRCA 4Q0VA 4LUMA 1UPIA 1FI2A 5CU1A 1OD5A 3LA3A 5I0TA 1L3JA 2EA7A 4J1XA 2QNKA 2FQPA 4E2GA 1J3QA 4H7LA 1ZVFA 3E5UA 3PNAA 4JVAA 1GQGA 3JZVA 3IBMA 3SXWA 1Q3EA 2Q0AA 2QDRA 1XE8A 2H6BA 3VHRA 5I8YA 4EROA 1XE7A 2QCSB 1XRUA 2PHDA 3HQXA 5AVPA 2GC0A 5KHKA 3TNQA 3RPQA 1I5ZA 1IPKA 2IXCA 2KXLA 2H6CA 5FPZA 2HKXA 2UY8A 1YFWA 4XFHA 4HVOA 5JAXA 4LLOA 3M3IA 4XFGA 1O3QA 4PIYA 4O9EA 2BNMA 5LEKA 4LULA 2IC1A 4MGKE 4MGYE 4LTAA 1CGPA 2PA7A 3EHKA 4LEJA 3CO2A 4AQ2A 5J7MA 1CAWB 1LR5A 3EJKA 3H1MA 4EWEA 1O3SA 5FLIA 3E6DA 3S7EA 2PTMA 4Q0PA 1YHFA 3E6CC 4LA2A 5I8TA 3UKNA 2BEOA 4IEWA 2N7GA 1G6NA 3B02A 3C3VA 4J1WA 4XEZA 4I0BA 4Q0SA 1X82A 4YRDA 4IEUA 1UW8A 3FE5A 1Q43A 5F1RA 3OF1A 4IEPA 1DGRA 4QGMA 5FQ0A 5C8WA 4D7SA 4HN1A 4AVCA 3BALA 3OTFA 4MGZE 1ZRDA 3ZDSA 1NE4A 2H0VA 4Q0UA 2O8QA 5LRRA 3PLQA 3CLPA 3H9AA 1H1MA 4HVRA 4HVQA 1H1IA 3CL1A 4ZU7A 4QM8A 1J3RA 4E2QA 2PAKA 3H3ZA 4FAHA 1NYWA 2E9QA 4X6RB 5JSOA 1LB2A 4XFIA 4LA3A 4MX3A 1UIJA 3KMHA 1X8EA 3R6SA 3KCCA 1U12A 3SCHA 1OMIA 4XF4A 1ZNPA 5JSRA 3NJZA 4I0AA 5J48A 4GULA 3BCWA 1RUNA 1HW5A 4K8FA 2PAMA 4IESA 1YFXA 3BB6A 1ZZ8A 1QXRA 2OZJA 3LWCA 3CEWA 4CYDA 5HI0A 4FAGA 2GC2A 2OPKA 3E5XA 4YSFA 1FT9A 2HJIA 4AXOA 4KU8A 1EYBA 1DZRA 5LRSA 2WFPA 3FFQA 3I59A 4O9GA 4N9HA 4WZCA 1CAVB 3IDCB 3N4MA 1LKNA 3MYXA 1VR3A 2XGXA 5D1IA
chains in the Genus database with same CATH superfamily
5D21A 2YV8A 1MQTB 1BLZA 1ASJ3 2Y64A 4GYCB 3H1YA 1YEWA 3F5TA 2P37A 3QBQA 2P3JA 3MPBA 4H0LB 4IV1B 3V0AA 1QJX1 1ZX5A 4BIFA 2YEVA 4XZPA 5F39A 3ES1A 1O5UA 4JYAB 4A6OA 2V09A 4QJFB 1QVGU 2GC3A 1W99A 1ZYBA 4QQOA 3N2GB 1H2LA 2E5LO 4XDOA 2RN9A 2TUNA 1WNSA 3E8HA 4FO9A 1LGNA 5T3NA 4HSLA 4KNCA 5LK7B 1WA6X 4Q5OA 4D7TA 1DYPA 3ZXFA 2GV9A 2ZMNA 1GR3A 5FJHA 3M3OA 2GMEA 5T55A 2JDYA 2W94A 4LUKA 5B1OA 4YGBA 1U97A 1SLLA 3RYHA 1RUF3 5KXEA 4SBVA 3OGSA 1NS1A 4EEQA 5L3FA 2RM22 4DV1O 2OPWA 4DR3B 3P3NA 1RXGA 5LMUO 2ZZQA 3RYKA 3CJIC 1V70A 4OI2A 4XFBA 3FBYA 4XHXA 1HNWB 4JI4O 1RUC2 2YC0A 3N9NA 5BV6A 2WLPA 3VD3A 1S5HC 2F17A 4TUYB 1NCRA 3D0JA 3J7LA 4IEYA 4PBPA 2HYKA 2AH2A 3SH3A 5EC2C 2YGMA 1AL22 2CGNA 2PLV2 4M01A 2JK5C 4EZHA 1L7QA 4OI1A 1WJZA 5CYYA 3PMSA 4OMCA 4NR1A 2RVAA 4Q27A 3KGZA 5CB4B 4BMBA 2CGPA 4EFBA 4CU7A 2HWC3 3MFCA 4NIAA 2VOXA 2NLRA 1FOD2 4Y5SA 2ERFA 4ASUG 4IE4A 3OG2A 2EXJA 4A45A 2GH2A 2OIGA 4R4ZA 2DF7A 2ARCA 4RHV1 3P1IA 2QBXA 2VUDA 1KFUL 1RGSA 4N53A 2YROA 4IHJA 3LA7A 4BQ5A 2YXYA 1RYYA 1GM8A 4JHTA 2QKSA 2Q69A 2RS52 1D4VB 5A7SA 5LGTA 1GO3F 3VB9A 1J83A 4LP8A 4NYKA 4Q8KA 4Z8BA 1JN2P 3ZYIB 3SPGA 2X29A 1LOFA 5A32B 3JYCA 4HNAA 1LUVA 3E1F1 1RJ7A 2VOWA 3Q8BA 3LKJA 3VQYA 3BTXA 4O2BB 1SLTA 4Y1ZA 4YIOA 3H9VA 3ZFGC 1A6CA 3OGVA 4U7NA 2PYTA 3O1MA 2X7RB 3ZYHA 1GM7A 5JI7A 5FKBA 2R72A 3V65A 1C5HA 4QE9A 4JI0B 3QH6A 3GBGA 3K06A 1R082 4NXMB 1YSCA 5T5PA 1KU9A 3H7YA 1AF9A 1W8TA 2AGAA 4ES8A 2KG7B 1KKDA 1B04A 2WAOA 4YWAA 5J3UA 4JTOA 2MK3A 4DR3O 1EBOA 2RM21 4WV8A 4JGYA 3HKBA 1FNYA 1CAXA 2K2SA 2CV6A 4P9JA 1QJU2 4Q0VA 1V55C 3FUOA 1OD5A 3LDKA 2EXIA 2XBO3 3KF3A 4YW3A 3RZKA 5C3SA 4JVAA 2LALA 2LQTA 1LCLA 1H38A 1OF4A 1CR7A 1KP3A 3T2QA 5CKMA 4BQWA 5SV5A 1GYKA 1V0AA 1AL21 2P7TC 4LLOA 5JAXA 5FUIA 4LULA 1N34B 5IT6A 1Z5WA 3B01A 3ZMVA 3R4SA 4AQ2A 1HNZB 1GOFA 4K9SA 1UY3A 4QPIB 4Y5TA 1SKVA 3LUTB 4BISA 4WFFA 4CCDA 2QWPB 4AHXA 4CDWC 5EBLC 4GKYA 1VB4A 1Q43A 4JKKA 4RGAA 1AJOA 5F1RA 1NOVA 3FL7A 3TEWA 1W9WA 1GWKA 1UPSA 2DQ0A 2IU3A 5K9YA 3ZMNA 3GWOA 1JHJA 4M3CA 3OYWA 1NE4A 4M0NA 4H7MA 2RS51 2VNVA 4HVRA 4K8ZA 1J3RA 4P9IA 2R073 2AYHA 3I5DA 3OMAB 3D36C 5JDBA 3CCSV 1OOPA 2LRPA 3FX7A 2B7YA 5IYCO 4LCUC 1FMD2 5F5IA 3ZKYA 1BMFG 2VUCA 1GN4A 4X62B 2YXHA 2BUKA 3T4ZA 2GC2A 3JD2A 4JX0A 1ZBE1 1DLCA 1W2TA 4AXOA 3OBTA 5DG1A 1N3PA 1W59A 1W6QA 2WFPA 4N9HA 4AQTA 3N4MA 4AZZA 3THCA 1Y7BA 3AKPA 5B4XA 3ALQA 2FZ1A 1NLRA 3D8CA 3TXQA 4D8MA 4WM8B 2ITDC 1R081 4NXMO 1YIFA 4TOIA 3OUJA 4QDRA 4X1KB 2QQOA 5HV0A 1XBFA 1VALA 1WN7A 4S2FA 3OCPA 3ZXKA 4HXCA 1EN4A 3I2FA 3ETQA 2ZXWC 4MVRA 4UVCA 1YXBA 1QJU1 4LHKA 5C4WC 1IS5A 2WNVC 5BPXA 1UY4A 4FFGA 3WDUA 4G2KA 2BERA 2VZQA 4JZ2A 1NA1A 5BNNB 2Y48A 3AG2C 5FZHA 3F7VC 5A6XA 5A3OA 4P14A 5A7WB 1N34O 5KA6A 1ENVA 2WSUA 1X7NA 2ZNIA 1HNZO 4L8JA 4QHOA 4MGQA 5LCWL 1Y9QA 4FQ4A 3R65A 5DUWA 3VDDA 3S6PA 4Y4RA 3K08A 4Q4W3 3HKEA 4BH9A 3U4SA 3CC2V 3CB2A 2A3WA 5FY5A 1XSQA 4X64B 2ET1A 5FZ7A 4PIXA 2ZGKA 3UK9A 2WNUA 3OGJA 2NYYA 4AHZA 2JGDA 3WG7C 2XHBA 3FMGA 5FK8A 4DR2B 4LWSB 3CXCU 1WW5A 4OI4A 5IY5B 1DGWX 1DFQA 5F3EA 3HKCB 3SH4A 5FR3A 3NNMA 5B5EZ 4XUTA 4FLUA 2KD7A 1RTVA 4RR3A 2R9RB 3S57A 3HD8B 3WDYA 1BK1A 1M4WA 4WM7A 5IVEA 2WT2A 1WLCA 5LA0A 3OMIB 4DQAA 1PNLA 3RT3C 3EBRA 4Z1VA 1FMD1 5LA6A 2PQQA 1XI1A 3ASOB 4LIUA 2C2AA 2XNDG 3AG4B 1IBLO 1BS3A 1JOBA 4TSVA 1WWYA 5CBFA 5CVRA 2HJFC 1V6IA 5JLVA 2I74A 3UQ8A 4TYSA 1KC8W 1ZZ6A 1ULCA 1CAUA 4MT8A 4CPBD 1EM1A 3NV1A 4XHBA 3ZRXA 3QACA 3HT2A 3G67A 3Q8CA 1W0OA 1P4RA 4QPYA 4ZY9A 2LJ2A 2ZR2A 1KXGA 2ZPXA 5GLZA 4FI9A 3DPRC 4H2AA 4MLOA 5ANQA 4J7ZA 1AR81 1AXKA 3W9AA 1NTMH 2IFRA 4FPJA 5KUKA 4LBQB 3WEZA 1Q90D 1QJFA 5BYNA 4OZOA 4EN7B 3F7YC 2Q8DA 2QZ3A 1UFIA 1R1A3 1UXXX 3H1LH 3PDQA 3NMBA 3ZOIA 3T2PA 4DZGA 1ULOA 3IM0A 5D2AA 5FMCA 1BYHA 1RUI1 4ZZ8A 4HSJA 4NMIA 1CJDA 1SACA 1C3HA 5IUQA 1CEZA 3IIIA 5HCAA 3ML0A 3B9CA 4QQ2A 1K4DC 4DXRA 1Q3EA 4QQPA 5C9AB 5CFCC 1H4GA 1VQ5V 5AVPA 2GC0A 1X9TA 5DZGA 3WNKA 1BEV2 2QZ2A 1I5ZA 3H01A 3L9JT 4UCTA 4H44B 4M4PA 5J1XA 3CJIB 2AENA 3KF5A 1W8FA 2PA7A 1JYIA 3Q8AA 4BDVB 1CAWB 2WLKA 4QDSA 4CSWA 2WS92 1WCDJ 3M3QA 2VCAA 3ME2A 3LDDA 4UFZA 2Y33A 2DWRA 2JE7A 5ACA1 1AR92 1S76D 4G9SB 3T2MA 2HWF3 4TV9B 2UWBA 4YVSC 5A7PA 3O1VA 4CXWA 5JQGA 4UCRA 5LK5A 1ENQA 5GZEA 1RUD2 4UI9L 1AJKA 2JX9A 3ZFEC 1POV1 4D7SA 3VKOA 4HN1A 5EJZB 1CONA 2HWD2 1ZRDA 5H2FZ 2XMLA 5AC92 5FZLA 3NO8A 1Y66A 2LFSA 5ANNA 3A23A 4B4RA 3ZYPA 2DUOA 3VKLA 3VL8A 3ZFFC 2QUOA 5B2GB 2PZSA 2QGNA 2EX3A 2WWJA 2R063 1NT0A 3FFZA 3O65A 5KAIZ 1NXD1 1QH7A 4B1LA 5EK0A 1UL9A 5FZKA 4O4HA 3CJHB 3K03A 4CYDA 2CH7B 2WZR1 3E5XA 4AEMA 4OHVA 1OCOB 5LB6A 3PUQA 2ZNJA 3MF9A 2A6ZA 3RYFB 2XGXA 4K3UA 3ZN0A 1YJWV 3LDBA 2ZHLA 4WVWA 2YI9A 5L3CA 4R6ZA 4MGSA 3ZN1A 2BSKB 3RWRD 3CMGA 3SCGA 4COWA 1Y76A 2XHKA 5LATA 3RNSA 1CZSA 1OCCB 4XDKA 2XVKA 3ENRA 5F9TA 3JAWA 2AC1A 2WABA 4AVTA 1L0NH 1NXMA 2C24A 5LEJA 1VQ8V 4X89A 4BQ2A 1XNRB 5KMGA 3JUUA 3MAQA 2YIBD 1ZA7A 3KCXA 1BBT2 1RUG1 1PD3A 1BEV1 2VCMA 2GC1A 3AYCA 5FLHA 2CAVA 3T1CA 1PVC2 2JGUA 1CPNA 3JQXA 2UU8A 2PHXA 2JDZA 2IH1C 5A3MA 1UY0A 1S4CA 2WS91 4QU2A 1JUHA 5F7UA 4XETA 1MS1A 3WSOA 1VQ7V 1TUBB 1WB8A 5I0RA 2VR4A 4LO5B 4NPLA 5JJJB 1MA1A 1NR1A 2GU9A 4HN0A 1JYTA 3HR9A 4XC9A 1AUYA 4IEQA 1WA8A 4JI6O 3SYPA 4O4IA 2VWKA 1VQNV 4MW8A 5LP6A 1K5JA 3M70A 5J98B 3BCCH 3JALB 1UKRA 4XF3A 3WB2A 2M6YA 1IKQA 2VW1A 5AC91 1IBKO 3J9SA 1S5LZ 1UF2C 2NLJC 4HPKA 1WW6A 1HQLA 4EE2A 1H9WA 5GZGA 5G04L 2WINB 5E16A 2ATFA 4Z82A 4D94A 1W8WA 3VDCA 2JECA 1WCKA 5H9SA 3WNNA 3IZOA 3HR0A 1NCQB 3LE0A 2HEPA 2BTQB 5FYSA 3CS5A 3MUZ1 4RYDA 5IJRA 4WFEA 1HRV2 4AI3A 4LBKA 2FCTA 1EZVH 2CTRA 3PU3A 4WVMA 1Y4WA 5FZ8A 4UFKA 4CC5A 3LSQA 4PD4F 3INAA 4JI1B 1W6PB 1XSRA 3ZYBA 3LEGA 2K9ZA 4A2UA 5FDBA 5AFBA 1FXKB 3B4SA 4K20A 5GKAC 5JJEB 2QA4V 5IT9N 1GP6A 5H9CA 3I7DA 4D6QA 1W9TA 1CD3G 1BGYH 3WF0A 1UPGA 1RINA 3MFAA 5IFPA 1ND2A 4ZHQB 2HEYF 3UETA 2XJUA 4CEWA 4IEZA 4UV9A 1QHTA 4ZU4A 3KB5A 5EYXA 1F31A 1VBC2 1XNRO 2VE1A 2RJLA 5BR8O 1BBT1 1OA4A 3ABTA 4Q4V3 5BNOA 2VMIA 1PVC1 4AQYB 2NN8A 2ZXWB 2BTVC 4CCMA 1M93A 3DN7A 1RPRA 1X9PA 2VULA 3GF6A 4ASMB 5C4WB 3SJQC 4GIQA 4CS2A 5DM6V 1M57B 5C5TA 1X36A 4HZ3A 5A70A 4AVAA 3RYPA 3KT4A 5A3NA 3E8GA 3AP9A 3GVMA 1QJY3 2CHHA 3A21A 2QNKA 5FYZA 2FQPA 3SH5A 1ENXA 2LGQA 5EPAA 4OPHA 3CMAV 3M2MA 3S3XA 1PGW2 1MOFA 1S3JA 4ARXA 1PO21 3FLTA 1G4YB 4JYCA 2H6CA 4E27A 1O9GA 2CTWA 1E5IA 1ZTEA 1NX9A 1AR71 4JDNA 4O9EA 4LH6A 2B9ZA 4W4LA 2IC1A 3OBRA 2PMWB 3ZX6A 3VZKA 2VZ3A 2ARHA 3ZSKA 4EWEA 4B4QA 3WDXA 1DF4A 4JI3O 2HBUA 2QDOA 4S2HA 2W2IA 2KQXA 5B1AC 4AVVA 3NNFA 3MW4A 3DEMA 3ABZA 3HMYA 1HRV1 1UU4A 1LOBA 1CZVA 2H94A 4F3JA 3OTFA 3MIBA 1OQEA 5C5UA 3WHTA 4UVBA 2E7TA 5TSWA 4FPPA 4OYUA 1W8NA 3WQ7A 4FAHA 4GJZA 4CP9B 3UM7A 2LFRA 2F4VB 4XF4A 4GB33 5FY1A 3OUIA 3JAKA 3K9SA 5AVAA 4PA9A 3K48A 3MEPA 5EBWC 4PELA 4FPLA 2WPDG 4FAGA 4B1MA 4CA9A 1D2QA 3DKQA 4IGGA 1OLMA 2E74B 2D3RA 1W39A 4OHZA 4IIJA 4X9QA 3PJYA 5JZGC 3ZBHA 3E22A 4J25A 4O9GA 4WZCA 1ZX3A 1W0KG 2OIEA 5CZKA 3VBRC 5HCFA 4RQPC 3DUIA 2ZE7A 4AQYO 4DV2B 2A3YA 1IBMB 3ZRWB 4UFHA 3JU9A 4TZDA 3O1UA 3GB7C 3VBHC 5LL6Y 3KV6A 3WNPA 2LW8A 4PDRA 1XXNA 3LEKA 3VBFB 4YYOA 4XBFA 1PO13 4DO2A 1D5NA 4CCNA 5T5LA 1O5LA 3RG0A 4NOTA 4N43C 1J1LA 3DPRB 4QU1A 1AX1A 5FYVA 2Y6HA 2VUJA 5IW0A 4DV6B 2E26A 1LRHA 2ZKOA 1G9DA 1S55A 3WNLA 3SJCC 4XIOA 1N36O 4P5HA 5C7GA 1PIV2 2FDIA 1BE3H 4BHPA 2Q0OC 4LO6B 4J9YB 4AGGA 1RHI2 3K51A 1PNFA 2BNOA 2VC9A 1OQDA 3H8UA 4MO3M 4E4DX 5LW9A 2VQEB 3AX4A 3GALA 2XL9A 1NVPD 1TVKB 3K3WA 2VBPA 2AZ2A 1GNZA 4Y4YA 4I4TB 4GT1A 4A44A 4YJ2A 4DUZB 3ABMC 2FB5A 3WP5A 3RQ0A 3UV9A 1YITV 1RPOA 5A9GA 2D44A 2MNGA 5E79Z 5JCOA 5ERLA 2QWOB 1GZ9A 3O9OA 1JJ2U 4JGZA 3ST7A 2QJ1A 4FOYA 3P30A 1YQ6A 3WDWA 1S1AA 1W03A 2ZGPA 2AZ5A 4FPHA 3ZEDA 1J59A 2KB1A 4Q6GA 2WNUC 1AR4A 4BM8A 2JD9A 1VBA1 4WFBV 1Y43B 1OSGA 1JPXA 4OHXA 1UKGA 3I2OA 4AR2A 1NTZH 1DZTA 2RS33 5C8CA 5FY4A 1D2DA 1NLQA 1ONAA 3VDBA 3SNMA 2ZAAA 5GZDA 2XLFA 2BNNA 3SEPA 2CU5A 3DYOA 1ASJ2 2P22C 5LY2A 1SRYA 1N1TA 4FOQA 4QDQA 1W05A 2PY5A 3C90A 1IPJA 4YM0A 4SLIA 1CQ9A 1XJAA 2HWB2 2GUZB 1RIRA 3FHAA 1DBNA 2XTAA 3JB4C 5CG8A 3AFGA 3JATB 1IBMO 2WRAA 1SPPB 3IGAC 4XFFA 5L9BA 4FTBA 1WBLA 4PDLA 3K59A 5BNPA 3C3TA 3OGCC 3JCIA 3USSA 4I30A 4HANA 3ECQA 2IVIB 3NXSA 1OPMA 2PXJA 1QXJA 4QXHA 2ETNA 3WF1A 3RYCA 1YRZA 3AC0A 5D8AB 3O0XA 1H2MA 5KX5A 5IYZB 5IVBA 2WLNA 1W6OA 2X8KA 4QX8A 1WKYA 1D7PM 3T4VA 2E33A 2X5IA 1PM4A 2V1DA 3SYAA 1W0JG 3OD0A 2EAAA 3FB5C 4PQ9A 4PI2A 4YW4A 5FZCA 4F7ZA 1PIV1 4JAVA 1RHI1 2RG4A 1JZ4A 2VQEO 1AYN1 2JEXA 3LIGA 2YEVB 1AP5A 4DUZO 5ABJC 2ZKLA 2DV9A 2AHYA 2J1EA 3RVHA 3PN1A 1GRJA 1RUC3 2QWRB 5JPMB 1H1AA 4F83A 5GJ6A 4Q1PA 2BVBA 3ZR6A 3AVSA 3AG3C 1N32O 4AI8A 2HJDA 4JCKA 2VH9A 4LUMA 4KBBA 3N2KA 2XJQA 2X6AA 3JD72 2PLV3 1J3QA 3N3HA 1AP6A 1GQGA 2HWC2 3JZVA 3QCWA 2QDRA 2Q0AA 3AG7A 3KKYA 3RYHB 2VQUA 4P9PA 5FPZA 1AHSA 1FOD3 1IXMA 2GNTA 1UYXA 3OBZA 1V9PA 3VHOA 3EHKA 3RMXA 4HETA 3VQWA 5FLIA 3E6DA 1WLDA 3A0BZ 1YHFA 1GOHA 1ASJ1 3WP3A 1Q86W 4QB2A 1I08A 2W1QA 1NCRB 1NG0A 3FE5A 5L7OA 3S5QA 3K4DA 3OF1A 4YFWA 2W0XA 4JTAB 4JDOA 2C5DA 5C8WA 1CESA 1W06A 2ZX0A 4X8AA 4Q0UA 1AR63 1H1MA 3CL1A 4JI2B 3H3ZA 3CRQA 1KS4A 1LB2A 2ARXA 2VTXJ 5DPNA 1UIJA 4RUFA 1I5XA 3CHXA 5FBZA 1RUF1 1SQBH 1W2OA 4N53B 4IHJB 5A7NA 1QXRA 2D43A 1RSOA 2P5BA 1S0BA 2ADPA 4ZZ5A 1EYBA 4NB5A 3TYJA 3PU8A 3VBSC 2E7AA 1PGL1 4P5YA 3BU0A 3HN3A 2GDSA 3HKDA 3JD3A 2UYAA 1U5ZA 1S0DA 3AEIA 4HNAB 2BPA2 4I55A 2H0BA 3AP6A 5FYIA 4TQFA 3AZWA 3T09A 5EP9A 4CDUA 4DV3O 4NN0A 5FZAA 4O4JB 1NH2B 2P3KA 5CNAA 1R6TA 4N90A 2Y0PA 3MHZA 2M7WA 3WDVA 1TME3 3W7UA 1AX2A 4X88A 3PTRB 2JD4A 2VRZA 2HWC1 3OW2U 1PZ9A 3BTAA 4MXVA 4UBHA 4ZONA 4NTXA 4L92A 3S0MA 3ETEA 1CZTA 4JKLA 2UU9B 5DN2A 3CRAA 2ZIMA 4JGYB 1K3IA 1CAXB 4HONA 2QTOA 2XL7A 2ET7A 5L19A 3RMYA 4TXWA 3MIEA 5FZOA 4HKWA 5A3UA 4FFKA 3N7JA 3E35A 2X10A 2R072 4EN8B 1VAVA 3TRSB 1EUTA 2J1RA 2JG9A 1TE1B 3ZIAG 2XKOA 4IEXA 2WWUA 1JS9A 2Z0AA 5FPOA 4GKKB 1TVGA 3K5NA 3KD4A 4UYBA 3QF7A 1DQ1A 4BXSV 3RYIA 1NZCA 4CU8A 3Q8FA 2B4KA 2RMU1 4YPJA 3WG3A 1NH2D 4F8AA 3B93A 5FPBA 1LHWA 3V0BA 4CDXA 4M3CE 4XQWA 3NJXA 4JGSA 2IH3C 4RD7A 1C1FA 4TLFA 3L2YA 4NIIA 3L75H 2A75A 2JEMA 4IEVA 3ZIWA 3LIHA 3O1PA 5KHGA 2G9ZA 4DV0B 2IVJA 1IG0A 2GTAA 3I55V 5EHDA 4DV7B 5JMOA 3CMEV 1C8NA 2B1GA 2D40A 4ASKA 3CC4V 3CU7A 1D4M2 1JA8A 3HT1A 1OJHA 2LTNA 4YVWC 2VMDA 4A5UB 4CUBA 4UWDA 5H5NA 5FZIA 4UAPA 1B09A 4M3CB 3UT0A 3OYWB 4XQ4A 5K0UA 3SJBC 5CADA 3RZHA 2ZDIA 4BAYA 1JMKC 2XBO1 3C3SA 2BVVA 4CTEA 2BOBC 2BOCC 4V2WA 1NR7A 2Q7HA 1F4MA 1DF0A 5J36A 1OLQA 2WLIA 4H37A 2Z42A 1XU2A 4DR7O 1JCHA 2DCJA 1OOPB 4Y33A 4PQQA 3I2DA 3BYWA 1QJZA 2RNBA 5FKCA 3CRMA 1GNYA 3UGHA 2RMKB 3OUHA 1I3HA 4DR5B 3URFA 1HDJA 1JZ2A 3NKTA 1W6QB 4OI0A 5C8YA 4EN0A 1FAFA 3CE2A 4NIGA 2PF4E 2NP0A 4PV1B 4A42A 4YZ1A 3ASNB 1GTOA 4CEYC 2VGDA 4Q4W2 2AGSA 2WA4A 5BUVA 5H9RA 4MH0E 3UJQA 4B3MB 4IERA 2FYUH 3SITA 1BZWA 2N05A 2LO1A 5FRAA 1SA0A 1OA2A 2VZ1A 2W6IG 3DC6A 4NIDA 2CL2A 5CG9A 3IJ4A 4N43B 2H3OA 5CBLA 5LYJA 2W39A 4CP1A 4HYOA 2GMMA 5L3GA 4PLNA 3HPNA 4LH7A 1B35C 2R071 5JR2A 1NA1B 4LNUB 1WGPA 3OPZA 4QXKA 1UOFA 5LXTA 2EA7A 4BR6A 1SZXA 3IAQA 1FFTB 4CDQA 2VQFO 4KH9A 1PKXA 5KXCA 1N0NA 2DMXA 1ZA4A 1XREA 1YXWA 1JYVA 4XURA 2KXLA 4BW9A 2Q6AA 1YFWA 3VDDB 1O3QA 4JI5O 3WZ1A 3T2OA 3HKEB 3KZ4C 5FV3A 3EJKA 3HEIA 4RFRB 5FP9A 2XUEA 3PVNA 2F4LA 1VF6C 2WNUB 3ZPYA 2FKXA 2EINB 3ZHUA 2JGDB 3QH7A 4RA0A 4L9BA 5FYCA 4AEJA 2WBKA 4DNYA 4Y1YA 3OOXA 2A9HA 1RM1C 2W0FC 4DW1A 4M00A 2A7AA 2Y60A 1JU4A 4R9CA 4RR3B 3BALA 5F5QA 1V6LA 2CK3G 1SFPA 3SPHA 3H3LA 3G6EV 1SS3A 4BQ1A 1QQP2 1MABG 4DUYB 2DCZA 2P2KA 2ZEYA 5JSOA 3UO3A 4DR5O 1I9RA 1W6NA 4ZOLA 2ZMKA 4AFDA 1L8DA 1VAMA 4MOAA 2GNBA 4P9YA 2ZAHA 3NAPA 4GULA 3GZUC 3AKQA 3WF2A 4FPFA 4EFEA 4CC6A 1F23A 5JJNB 2F43G 4Q4W1 1FT9A 3SR2C 4L0PA 3W5MA 1DZRA 3WX5A 3UGFA 5GONB 1WUVA 2W5FA 5A3WA 4LOTA 3WVJA 2O57A 3SYCA 4JTCB 3M3EA 1TA8A 3LF7A 5H9PA 3ILRA 2VMFA 3U37A 1J5EB 3JARA 1CAUB 1U96A 2XOMA 2UY9A 2UUBO 1LGCA 3GHNA 1UD1A 3FC0A 5CBHA 4HK8A 4CXXA 4AI2A 1QOTA 2Q4PA 3CCJV 5LBQA 3HNBM 1SEFA 1F4HA 2Y69C 2JDNA 3FWEA 1J1TA 4O4LB 2IXJA 4EQVA 2WZ8A 2C1FA 3DXRA 4XF9A 3ZN4A 4FLZA 5ABJB 3CCLV 1OF3A 2HWF2 2BE3A 1XQNA 2JG8C 1BQZA 4DY5A 4PDWA 2XONA 3SDLA 1AVBA 4H14A 2W1UA 1AR93 4GLXA 1FPN2 3CCRV 3O7OA 3RDIA 4LOSA 4GWMA 4AI0A 3BABA 4DINB 2WYFA 1RUD3 5M0TA 2E76B 2CTQA 4IV1C 5L3DA 2CE4A 5AG2A 1N47A 5GW7A 2HWD3 4JGZC 4KHPO 2N74A 5HCHA 2RDSA 4I50B 3I49A 3ZRVA 3FN9A 4EWAA 4DS0A 3EXAA 4Q4Y3 3CCEV 1VQ9V 3KM5A 5EYPA 4BLJA 1NBMG 1XE0A 1QLNA 4DUYO 1DP0A 3T30A 5C8CC 1K7DA 4AFAA 2VO5A 5C3OA 2ZXQA 4YW1A 4Z2AA 2WAMA 1WMDA 2AXTZ 1JHNA 3WUDA 4Q0QA 1R1A1 2HWE3 5JQGB 2LP7A 4JI8B 2JDPA 4NXNB 3FYIB 4HKLA 3O1RA 4NKGB 3N7KA 1PNGA 1Q8PA 1J58A 4AE2A 4K6BA 4ES9A 1PPJH 2DVDA 2FDJA 1J5EO 4YW2A 2XJRA 3CPWU 1H8TA 1W6MA 2JDMA 1PM7A 1VP6A 4I02A 3QO5A 2CY6A 1JR9A 1H4HA 4BA6A 2ZJCA 4O4HB 4LO4B 4QKDA 1UX7A 1F4AA 3NNLA 3TBDA 4X65B 1VQLV 2WO3A 1SLIA 4OGQB 1WCUA 3LZZA 1W9YA 4QX5A 3ITQA 4NTYA 1RJ8A 2WLLA 3K4ZA 1IS6A 1QCEA 2YC4A 4FXKB 4HLTA 4B3TB 5FY8A 1BHAA 4ATEA 3O1SA 3ETDA 2HWF1 4BYYA 2BGOA 4FPCA 1LULA 4FFIA 1XNCA 1UAIA 1Y76B 4XOGA 3H3UA 1XYPA 2WJSA 4B8EA 4P9WA 1J84A 1G8MA 1JH5A 5FREA 5JMCA 4PA3A 1QJX3 3JAWB 1LU1A 2NMOA 3OT7A 4LE4A 2ADQB 3ES4A 4XQDA 3AKRA 5CN0A 1XMOB 4Y22B 5IWAO 4X8NA 5J2TA 5HXVA 1MG1A 2R061 4D7YA 4X66B 4COZA 5IHRA 3IBMA 4YGEA 5I8YA 1XNDA 3VHRA 1NUKA 1PK6A 2BWAA 4CCOA 3HQXA 3AYAA 4IL7A 2CYFA 2XUMA 1IQDC 4Y1XA 3RPQA 4GD4A 3ABLB 3KCYA 4LHLA 2J1SA 4DIQA 3R0RA 2P3YA 4C1WA 1DLBA 4UFMA 3VKNA 1U0AA 3K0DA 2LW7A 4ZIBA 4JI8O 2HVJC 4GQ7A 1WA8B 5B3SB 2ZGSA 2BEOA 5LP6B 1NTKH 1FXHA 2VVFA 4Q0SA 1MQTA 1MZFA 3H1HH 2VS0A 2P6HA 2E63A 1GBGA 4HPKB 4QIWF 2FHRA 4NROA 2WLQA 5GLWA 2CNAA 4IEPA 1LJ7A 3E8BA 4NIHA 2YY1A 4LPLA 4LF7O 3VHPA 5DQ0A 3LGRA 1PMJX 1XNAA 3GHMA 4Q4V2 5E8AA 3T1HB 3FB7C 1NYWA 1VBC3 2CDPA 1QR9A 2R49A 4IE5A 1ZNPA 4M4RA 1UU6A 4GMP0 1VRH3 4QPIC 5J48A 4DRXA 4WVMB 3AMHA 1Z2GA 3NV3A 2ZGMA 2P67A 1HB4A 4IESA 4CCCA 3RI9A 2OPKA 2EILB 4B3TO 1ST8A 5LHIA 2OYQA 1HR0B 4QX1A 1YNAA 5LRSA 4GH4A 1GZCA 2GN3A 1QJY2 3ZR5A 3IDCB 3MD0A 4FM1A 3T2TA 2BTOA 1QOSA 1A78A 1VBD3 4E8DA 2UYBA 3I54A 4KWJA 3E2EA 3NL1A 5JIAA 1ND2B 4BQYA 5CAZA 1SQVH 1QEXA 2ZGRA 4CEWB 4R52A 5BY1A 1TMF3 1XMOO 4JZGA 4AW7A 3BTYA 4DV4B 4FPYA 4G27B 3SHRA 1N3OA 2HBTA 4FTSA 4XMIA 5BNOB 1VMFA 3ZN5A 1JZ5A 2ZGNA 4RGGA 1K45A 1ULPA 2BBAA 3ILNA 3HPLC 2EVXA 2XB6C 1B6QA 1DYOA 1KJLA 2JJ1G 3CZJA 3O12A 4KG8A 2FD8A 2GP5A 1GKFA 4URAA 4BW5A 2QQJA 4XABA 3TAYA 1NZIA 1O7FA 4IL6Z 3VZLA 2JKBA 4KUMA 3B77A 1F5JA 2VOVA 2XXZA 4C1XA 3CSXA 3ETPA 3R66A 4YARA 2K0GA 4XDJA 2MW2B 4IEOA 1R73A 3JD4A 4KWKA 1MZ6A 5F2SA 5BNNC 1AI4A 4Z07A 2Y26A 2XAFA 3ZRSA 1CPMA 5A1AA 4MG2A 3POJA 4Q4V1 3NWKA 4YW6A 2XAJA 3UT5B 1NU1H 3Q9OA 3FB6C 4ZPIA 1I5YA 5LOVB 1C5IA 2E5LB 1OH4A 3AB0A 4P2ZA 2ZTNA 3G6JB 5JR7B 2K46A 4HG6B 2XQRA 3LDRA 1OLME 4C91A 3VQXA 1UZWA 4D6SA 1HR0O 2DCTA 3W58A 5JOXA 4XCAA 1SFNA 2D6LX 1P7GA 3A7QA 1QJY1 2EZOA 1LHUA 3J81N 2YBPA 1Y6XA 4PLMA 4PT6A 3RBZA 1YQCA 4XJWA 4LE3A 4M0HA 5FO7B 1NQTA 1WBFA 2FDHA 3MDPA 4DV1B 2RCVA 3I2HA 4LKEA 1QHDA 5B4NA 2RV9A 1M56C 4DV4O 4FZ1A 4IIJB 3WDTA 4JI4B 2Z5UA 1TUEB 2HLDG 3ZXGA 1K8AW 1GP4A 1G6UA 2GBOA 1ZBE3 4GX5A 1YJNV 3B7MA 5DAQA 2HR3A 1VQKV 1GOGA 4YLZA 1ALYA 1EP0A 1MS0A 1YFUA 1ZRRA 4ZHNA 1K4CC 1B06A 2QQIA 2K9PA 1OLRA 1XNQO 3U07A 4Y20A 3GXUA 2GN7A 3NJYA 1FS0G 1ND3A 3F95A 3LQCA 4XILA 4YW5A 1OKOA 3LB9A 2Y6LA 1I6XA 5FMBA 1OCZB 2I45A 1ZZ7A 3QVNA 3KGLA 4DR1B 2DBNA 1H2GA 3ZXJA 5IK5A 4AK3A 5ITZA 1KDKA 4I0XA 4GB31 2E7QA 4A7KA 3UJOA 5I0DA 3T1YO 1C8M3 2DU1A 4YJ2B 5KHKA 3ETGA 4JRAA 1VQMV 1Z7S2 5DDJ3 1V6NA 3AMNA 4E4HA 3OPTA 4JGZB 4FM0A 3WV6A 5ISLA 5DG2A 5A6YA 2HWB3 5FY0A 2WFF3 5I8TA 1ZL8A 3B02A 1LAJA 3LEIA 3APBA 3NJVA 1PO11 1IXBA 3B3QE 4WM8A 4PDMA 4HAMA 1GWMA 5LA2A 2Q7EA 3BA8A 2JDUA 4X1KA 3SJAC 4FLVA 3AG1B 2BBVA 1W0NA 3U1XA 5C8CB 5C9AC 5CKNA 2A3QA 1JZ3A 4YM3A 4QB1A 4OCTA 5JVDA 5DZFA 3RZJA 2IWGB 4B4PA 4XBNA 5CA3A 3CLPA 3PLQA 4IV3A 2ZGUA 2UXDO 1V9U2 2YU2A 4QM8A 3C7EA 2AEYA 1VB2A 4X6RB 1JVMA 1K33A 4ZI7A 4J42A 2ZGTA 4WCEV 1GSLA 3R6SA 2VCCA 3KCCA 1U12A 1ORQC 2OUJA 4QWNA 3VZMA 5T54A 1QXPA 4K1ZA 1Q7YW 2FCVA 2YDEA 4ISQA 4ZS3A 1BHBA 1S2BA 3CQOA 5BNPB 1MEC3 1RUJ3 1Q8IA 2R1BA 3HOBA 3K5LA 1VR3A 2WZEA 5D1IA 4YG3A 3RYCB 3N9MA 1WAZA 1GQPA 5KX5B 1CPYA 3M7MX 5FXVA 3IPVA 3JD73 1NKGA 4QQHA 1W6OB 3AKSA 5FZ3A 2V7QG 5A33A 3S30A 1S2EA 3DXTA 2ZACA 2X5IB 4NPMA 3ACGA 4QPGC 3B8MA 5IJ0A 1GU3A 2UUCB 5EZYA 1YHQV 1LESA 5FLJA 2KM2A 2RS31 4DOUA 4I9WA 4DR1O 2JDKA 1P84F 5FXZA 5F6KA 2OIIA 2XWBB 5F3GA 3STZC 1YI9A 5L36A 1TNRA 4OQ8A 1DHKB 5FOBB 2ZX1A 1LHNA 4B3SB 4B08A 4GWIA 3FX3A 1AR83 1GMGA 1OCOC 3M99B 1IQAA 4UCVA 1XEQA 4ZU5A 2XJTA 3TWIA 1T5EA 3U78A 1Q8QA 3I2KA 5CFDC 4YNIA 1NKDA 4K35A 1UNBA 1LOGA 3EYPA 4J7JA 5FZ6A 1SBDA 4DXSA 4OFGA 4UW6A 3E86A 1ODNA 2DUQA 3HBKA 2EIMB 3D5OA 5JWPA 1AR62 4O61A 4GKJO 3A4UA 4UFIA 4L97A 2L9LA 2YXSA 3T0DA 4JI7O 1SQXH 2OQ7A 3K3NA 1ZAUA 1OCCC 4MTGA 1W28A 2YFUA 1MS3A 4OXSA 3TN93 3N35A 4FBFA 2QM8A 3VGIA 1W9FA 2WAAA 3EHBB 1UIKA 4AF9A 4DV5O 3GBFA 4WFGA 2JXAA 1NT2B 4N9IA 1GN3A 5FUPA 3LFIA 5BMVA 2GMPA 1GZWB 3KSCA 5L7OB 3W21A 5LMNB 5IATA 2R0HA 2XJSA 1RUC1 2LUWA 5EJ1B 3LSDA 5ACA3 4LBQA 1EFRG 3VBUC 4XUQA 1M5IA 1RMU3 5A1LA 2QKCA 3PVEA 3KV9A 1W8UA 5KAFZ 2ZM6B 1TME2 2JIZG 1MMMA 2RDQA 3L71H 2PLV1 1F51A 3HN1A 2ZIOA 3QOPA 1WA4A 3I4IA 3I97A 3ZMSA 2BCCH 4LIVA 4LF8O 5EIBD 3C7HA 3VQVA 3KHBA 1RUE2 2W3JA 2JDAA 1K97A 1QY4A 3E6BA 2UUCO 1DGLA 2AREA 1RSOB 4MTFA 2ZGOA 1FOD1 3ZSMA 2R32A 1KB9F 3JSNA 3U10A 2HEWF 3OUFA 1STMA 1NCQC 4UB8Z 1GUIA 2X0LA 2YPJA 4CVUA 1V6JA 2B1IA 2A6VA 3CJIA 4B3SO 4BE3A 2IJIA 2WQ4A 4HBNA 2SBAA 5GLUA 1CAWA 4MVZA 3UYJA 5C3PA 1R092 5A7QA 4LF4O 4CDUB 1DTOA 4TV8A 2VNOA 5FUNA 3POFA 4I9QA 4LBJA 1QNYA 4QXCA 1GKBA 1Y3TA 1AR61 1FXKC 4KU7A 2FZ2A 4XMAA 4LF5O 2Y6GA 1PP9H 1HRI2 1KD7A 3ZSLA 1E5RA 4Y5Z0 1AROP 3N7MA 1IBLB 2XJPA 4GXLA 4YGDA 1X50A 5C70A 3TNQA 1ZM1A 5FZOB 1D4M3 4BOWA 2YUEA 4XFHA 2Y6KA 3B69A 3WINE 2ITCC 2JG9B 3PUAA 3TEYA 1R3JC 4LO7A 4ARYA 1YJLA 3H1MA 5LMNO 4X1IA 5GTHZ 1LEMA 3CXHF 4F6RB 4KMQA 1M57C 3V0BB 4CDXB 1XB9A 3K4AA 4IGPA 1L7RA 4W8JA 3K3OA 2WLJA 2CTPA 3X2QB 1AJPA 3HNYM 2ZM6O 4Z92B 2YFZA 3PJQA 4MS2A 1TME1 1UY2A 3GZTB 5B1BB 3OJBA 3QD6A 4GAZA 4PLOA 2GSYA 3RZLA 1KBHA 1OBNA 4E4SA 4Z1MG 3ZFGA 3KT1A 4W4ZA 4FFFA 4FSJA 4KBZA 3ABKB 2OVUA 2W92A 3HAGA 5IFTA 1O4YA 4MXWA 4HVQA 1O6UA 1BVP1 3VZOA 3AL6A 3TEXA 4BWOA 4U36A 5FBJA 3BIWE 3LSUA 5JSRA 2DCYA 4I0AA 4FMTA 3ZXEA 2KSDA 1Z78A 3AXDA 4K8FA 4LBLA 2BP6A 4ABMA 2WLIB 3TGUH 5IVFA 3FFQA 2XAQA 2R9IA 3WU2Z 2RJZA 1YVWA 1SQGA 2YXLA 4NUBA 1M56B 2HP8A 1VBB3 1GN2A 4AOCA 2PAEA 1TGOA 3O1OA 1JQ0A 5C8YB 4LXLA 4V1PA 4NE9A 5BZBA 3USUA 1VE0A 1X33A 4W6WA 2VPVA 4XF1A 4MTXA 1JJOA 4C0BA 2D6OX 1UMZA 1SA0B 5FXXA 5CKQA 2ATKC 1ZRFA 3BN6A 2VQTA 1U5YA 4CH5A 4CDWA 5LYJB 5L9VA 3W59A 2JE8A 3NW4A 2WYSA 1LODA 4FCAA 3U0ZA 3D0SA 3H1KH 3QLQA 4E2LA 5LXTB 3RZZA 1VEWA 1YCIA 4ORFA 3VBFC 1KGYA 3CJXA 2GALA 4X20A 4OUEA 1C4RA 3H1JH 4CDQB 2RR13 5C93A 3C2UA 2P34A 1J3PA 1K5MC 2MHFA 4ONUA 2A3XA 3PIGA 1XOYA 4MZUA 4DR4O 5EWSA 1ROPA 1QQP3 1XILA 2V4VA 2YC2A 1GH6A 4MV2A 3ZYRA 4A7YA 2GHYA 3H1WA 2Z79A 1WMXA 1Q82W 3WW2A 1HLCA 2JDHA 1I7FA 3FYEB 4ZHQA 4AG4A 3CCQV 3OGGA 4OVEA 1YYNA 4P00B 1MSDA 3CRRA 2DN9A 1HN0A 5FAXA 4PIZA 3DCQA 1BXHA 5H9QA 4FPOB 3AK0A 1HXS3 3BGAA 5I93A 5FNVA 3J7AU 3M8LA 4I3PA 4U3JA 3POIA 3E89A 4XFAA 5L9RA 4QE7A 5D5QA 1WLTA 3OSDA 3WW1A 4J41A 2VZTA 3CEIA 1URFA 3C7FA 2OWOA 4PF5A 5BXZA 5C4WA 5J2UA 2WNVA 2V72A 1H2SB 5IK8A 2MEV3 2LS6A 4RQFA 2WO7A 5J09A 4LORA 1AI7A 4ZOLB 3T4DA 2Y38A 1F2NA 1O8PA 4AILC 3RVYA 5BXXA 5K4LA 3WB1A 3JBG3 5JVVA 2IJKA 1U5XA 1WLEA 5LBBA 2RJ2A 3S7IA 4YM1A 3AKTA 4JI6B 4I3GA 4W65A 1FPN3 1KQSU 3JARB 2BGCA 4B7KA 1G9BA 1IBKB 3ACLA 1VF5B 1JUIA 4IDZA 4QPGB 3VV1A 1C57A 3MO4A 4Q4Y2 1F9KA 2JIJA 5F3CA 1RL3A 4Q4X3 5IAVA 1R3IC 5HV4A 4NHLA 4AQ6A 3J8F2 2TEPA 1KRIA 1H30A 1O91A 1W8OA 2WO1A 4LK7A 2BU9A 1VJ2A 5CB7A 1XU1A 4BPZA 1LOCA 4E8CA 5D8AC 2BFUS 4UCOA 1DIWA 1SBEA 1ZBA3 4G28B 4J1XA 2VM9A 4I7ZB 2C9AA 4H7LA 2XQXA 4PDWB 2HWE2 5CFDB 3ZVXA 4INDA 3HB3B 2FCUA 3ACHA 3WCSA 2PHDA 4NAOA 1IURA 5FTTC 1VMHA 3I2JA 3AZVA 2OKXA 4XAEA 3AMQA 2UY8A 3KZIZ 5KA5A 5L3EA 2RHPA 5FPVA 3OTOO 2NN4A 1QNMA 2UWAA 4ZXEA 2ZKNA 4LTAA 2ZD9A 2E6VA 1KUQA 2ZGQA 5J7MA 2R7EB 4XIKA 3JASA 4Y3OA 4K0KO 1AI5A 3ZDVA 4IEWA 1G6NA 2ZHNA 3OE7G 4XBQA 3CIHA 4MHUA 4I5SA 5LA1A 5EYPB 4OZXA 3SPJA 5EIYB 2E75B 5BR8B 1TZOA 2D6MA 3WNOA 4YIPA 1EAH2 1BK0A 5FQ0A 3RFRA 3LSEA 2VVDA 1JYNA 2YICA 3K79A 2OQ6A 3BUCA 2IJJA 1G9FA 1PNKA 3DPRA 2J1TA 3KV4A 1QIQA 3IB3A 1HJFA 4XJ8A 4J11A 3VBUB 5KLVH 1W3XA 3OAAG 3KQRA 3PURA 3CKHA 1AR91 1OMIA 3LOBA 4AVSA 5APAA 1SFYA 2VOKA 1QJX2 1HW5A 3WOGA 5CA0A 1RUD1 4NPRA 3LNNA 1NCRC 4I4TA 2VMEA 2HWD1 2PYJA 1W6MB 5LBCA 4G4FA 2CTVA 1YQ2A 4FLXA 4MYEA 2DOSA 2OXBA 2QKAA 5KXDA 1LKNA 3WB0A 1S0GA 5FO8B 2D7FA 2WC2A 3VUOA 5CFCA 4LF6O 1XUQA 2FDFA 3GGLA 4Q4Y1 4I0WB 4LT5A 1LU2A 2VBDA 4JI3B 1XNTA 5C3RA 2VQAA 3K46A 2Q8CA 1S0IA 5F5AA 2F6BA 2GTSA 4FP2A 2JENA 2RJKA 1E1RG 4N53C 3BIEA 1NJIW 3FHIB 2HWE1 1AZDA 2KR2A 2OX0A 4LHNA 4UT5A 5DZEA 4CH6A 1S0EA 3HIFA 5FYHA 4X1YA 4C90A 2PHTA 4YVSA 3G71V 4G3YC 4TWKA 3LDEA 4XVHA 1YUDA 2ZCEA 2W1WA 2CDOA 3ZFEA 4IXLA 1BHGA 1LOFC 1EPWA 4COYA 1UMHA 4N7IA 5FYTA 4C8DA 3TOJA 3N27A 5J2TB 4TTGA 2DWDC 5DUUA 1Z5VA 5SV8A 4XPVA 2GUZA 4F4LA 2W68A 3ZFFA 1RUH3 3AXEA 3KG2A 5IVYA 1PK6B 1F5FA 1SPPA 1PM9A 2OS2A 5DECA 3LFMA 1HNXB 2DFCA 1GNHA 1OC1A 1ZREA 1VRH2 1R1BA 2XVGA 4DUWA 3K2OA 2CUGA 2WN3A 1QKQA 1VAKA 2XR4A 2DDUA 2JJ2G 3OEAA 1EV13 4N7UA 4RHV2 1E5SA 1K34A 1JW6A 1OXCA 2UXXA 3T4HB 4Q20A 2DVAA 3L2HA 4H13B 4CRQA 3CC7V 5K7PA 2EICA 4JGYC 4DK0A 3GJBA 3D3IA 3BPZA 1XHXA 4DFSA 1KJRA 1VBD2 1ULDA 1G8WA 3DGEA 3ZX7A 3MIDA 1TAEA 3WW4A 3DYPA 4WFHA 2VXJA 4LFAO 2D97A 4HOOA 4AHWA 5A3LA 5DN6G 1N36B 1TMF2 5FMOS 5JI9A 2VCBA 2UXNA 5HFLA 1VRBA 4AEDA 2DVBA 3SKJE 3QNEA 3GYDA 1GWLA 5JSPA 1RFYA 2IUWA 2YUAA 4DRXB 1CAVA 1A34A 1UO9A 1XMQB 4V2VA 4LFBB 1O3TA 3FD9A 2AUYA 2NMNA 2A6WA 2QR4A 1UCXA 3APOA 1Q8SA 3VKMA 3RYRA 1VQPV 3H1IH 3B40A 4GH4B 2DQ3A 3KWVA 4OHYA 4QT6A 1TNFA 2A6YA 1SQPH 1UZZA 2VNGA 3MLLA 2F95B 1M06G 3G7DA 3BKZA 2C9KA 4ZKIA 1WP7A 3THOA 5LHGA 4XJ9A 5A7OA 3MLJA 3QO7A 2RS13 5DUVA 3PL0A 3ZIXA 3OD4A 3ELNA 4CP2A 1WW7A 4LR3A 2VZUA 3ABUA 2JICA 1OOPC 2F1MA 4QQLA 1NVPB 4IETA 4EN9B 2DURA 2A70A 3TCUA 1VQ6V 1HNXO 1VBC1 2E3CA 1OA3A 4Q1RA 3ZPOA 3ASNC 1VRH1 3SXWA 4K1YA 1XE7A 2PHUA 4EB6A 4DRVA 1XL6A 1DQ2A 2ZR3A 1XNKA 4YJ3B 1UQXA 2KKWA 4FXGB 2QKDA 4MGYE 1K5MB 3K9AA 3WF4A 4LEJA 4NWVA 1VBD1 2WDBA 4IUGA 4HK9A 1HW7A 3L72H 4OULA 1R6KA 1FFXA 4C0HA 2PI5A 2A7WA 1NA1C 4JYAO 1PGW1 3WHUA 1TMF1 4MVSA 3VHNA 2RMU3 3R05A 4IQPA 3B00A 5DXDA 4O4JA 4QGMA 4K7JA 5E88A 4GMP3 1ZBE2 3WQ1A 2J1UA 4AVCA 4OQ9A 2F23A 2QM4A 4UW5A 1JYCA 4IT5A 1VLNA 2O8QA 3NNJA 1KS5A 3VDDC 3IAYA 1XMQO 4E2QA 4LFBO 2AW9A 2W6JG 4QXBA 4DY3A 4BMEA 4LJHA 1N33B 1N32B 2OTLV 1JX9A 4FZ0A 1YI7A 2JS3A 1MS9A 1L1FA 2GNDA 4CE8A 2EIGA 2ZQMA 2ZS6B 4QPWA 3WNXA 2JIGA 3C7GA 3VN4A 3LPFA 2BJSA 2EINC 1S0JA 1H2NA 2XDVA 2PN5A 1HIXA 1HNWO 1GANA 5EV7A 4WVVA 1OUSA 1R6NA 3I59A 1SQFA 3OMNB 4MSWC 4QX0A 5GLVA 2DVGA 4O65A 2G19A 3MZHA 1D0GA 4RR3C 1C8M2 1PGSA 3BOWA 2XWJB 4EWDA 4RL7A 2HVKC 4WM7C 2NR5A 5DDJ2 2I2SA 2FTKA 1Y74B 1KKCA 4UFLA 3CCUV 4GKXA 1MVQA 5KC6A 1MS5A 2F93B 1OHHG 1Z7S3 4FTEA 1PX4A 3ZLIA 4NRPA 2SLIA 2WFF2 2E31A 3IDAA 5FY7A 4Y20B 1DDLA 3SISA 1IDSA 3I2GA 3ATGA 1SETA 3A2FA 1ND3B 2QQLA 3A0HZ 1CN1A 5E89A 2B5UA 4FOVA 4BQXA 1VMGA 1POV0 4QB6A 2PGGA 3WFVA 3GCWA 2ZCWA 3H8OA 3UKMA 2R1DA 3E5QA 2F4PA 1AYM3 5ITZB 4I0XB 2VU9A 3V56A 1OCRB 1WCQA 1US2A 4LNVA 4COVA 2P4EA 5FK7A 3WLUA 4JV5B 4D69A 1JYWA 4JASA 1V9U3 1BL8A 3V0AB 4ASLA 1N1VA 4QD2A 4NHKA 1EZJA 2PFWA 2DW4A 4KG0A 5JZGA 4AQSA 1MEC2 1RUJ2 4DV3B 3VBRA 2OCHA 1G1XB 1ZL8B 2HHHB 1N33O 4RQPA 3UESA 4JI0O 2BGPA 2V5YA 3ZYJB 3VBHA 2LM3A 2QQNA 3Q4HA 1Q5OA 3VD9A 4XDQA 1AL0G 3B09A 3MIGA 3ZO0B 5GTIZ 5JVDB 1W9SA 4JTNA 4N43A 4YHHB 2Z4FA 3ZHRA 2QDNA 2WA3A 1COV3 4JPRA 4IV3B 4BIZA 2XHNA 3ZKUA 4C7UA 2BOIA 1RUOA 5FZEA 1HB1A 1LOAA 5JXJA 4ZI7B 3FLRA 3MUY1 4LNUA 1AR82 2YG0A 1C8M1 2EXHA 2NM1A 1OI6A 2ORXA 1GZTA 4HZFA 3AMPA 3KV5A 5DDJ1 2WKKA 3VOUA 3GNEA 3POWA 4EJRA 2P4VA 1H6YA 2A1XA 2ZGLA 4DO0A 2CDYA 1K5SA 2ZE8A 1BT8A 1GMMA 4DB5A 5JCTA 2IJHA 1RUI2 2HWB1 2RDCA 1YQ5A 2JJ6A 3JCZA 1S0CA 3I3MA 2WFF1 1UX6A 4FM2A 2QWQB 2OCCC 3J7MA 1VP7A 3IPVB 3LOIA 2B42B 3J26N 2FMYA 5A33B 2WWSA 3TN92 5IJ0B 1DZQA 5EZYB 2PHLA 4GJYA 1LTEA 4U2AA 1YI2V 1BKZA 1AB3A 2HKOA 1FNZA 1WMEA 1DYKA 2JB4A 4AFCA 5FP7A 1OD3A 5IJ9A 2W1SA 5FY9A 1MVEA 2XPJA 1EN5A 1GV9A 1OUXA 1UPIA 4XW3A 3QG5A 4MVMA 3WR0A 1FI2A 4E4ZA 2NNUA 4JV5O 3LA3A 5I0TA 5A2QN 3W20A 1ZVFA 3PNAA 3SGIA 5K1PA 2DTWA 4X62O 5ACA2 1G9CA 1RMU2 2YB7A 2VNRA 4RSUA 4L99A 4A3ZA 1H8VA 1OT5A 3ZXLA 2R6QA 4DR7B 4DPNA 3SLIA 4FJCC 4HVOA 1XC6A 1MEC1 3M3IA 4XFGA 3IT8A 4AWDA 4PIYA 1RUJ1 3M7AA 4CP0A 2HHHO 3CDZB 3CWBH 5DUXA 1CGPA 4LKSA 3CO2A 4S2GA 5GONA 1UYPA 2B45X 3E6CC 4KGGA 3JD71 1WB7A 4UOJA 1HWYA 2ID4A 2YIAA 1QLEB 2G38A 3W7SA 3UCSC 4IEUA 4YHHO 5EYYA 1RUE3 1BJQA 2JWPA 5IK4A 5BMVB 4FQZA 4YFZA 1OVPA 2WZR2 1RITA 3HKBB 5J96B 2XOKG 4MGZE 2A71A 3H8RA 3MBWA 4O4LA 3ABLC 5FPAA 1H1IA 2Y8KA 4ZU7A 2PAKA 3T08A 1PMHX 3BVOA 5F5CA 4NJ4A 1SLCA 1R1ZA 5ABJA 4BWAA 2D6PA 4LLFA 1R093 3VBOA 2P4KA 4YZ2A 1WP8A 5B3SC 1WD4A 4GX2A 1COWG 2VQFB 4WFAV 5LP6C 4A4AA 3CEWA 1IOAA 2G4IA 2D2CB 1VPHA 3JCUZ 4TN7A 2FDGA 2O0OA 1F8VA 3WXPA 2NPIA 4URTA 3LCPA 4X64O 1SZTA 4R9BA 3MHSC 2JDIG 3N9LA 4GA9A 3TN91 3OBAA 4JI5B 1BSMA 1YQ8A 3VL9A 3D4KA 1RUG2 3ACIA 1HRI3 1AXZA 2ETEA 4DR2O 1CIWA 4CH3A 5FPRA 2EIEA 4AFMA 4I50A 3BY6A 5DEDA 5C3QA 2OT5A 5FZMA 2WSSG 4YY3B 1ZZCA 4K21A 5FL7G 1XBLA 2VZVA 4AI1A 1G7YA 2JVDA 4QKFA 4L8QA 3P32A 1C1LA 3EXUA 3WP6A 1WPXA 4B3NA 4YG6A 3NKGA 1OKQA 1WLWA 4XBLA 2Y0IA 4BB3A 1E1QG 4TV8B 4LBQD 4H55A 4BLIA 5IAXA 4D3WA 1BCCH 1IS4A 3DL3A 2EILC 5EFUA 4MGIE 4BIUA 1RMU1 1W2AX 4R9AA 2TNFA 1MZ5A 4KQ7A 1D5AA 4FFBA 1Y9GA 4META 3SPCA 3GJAA 3K57A 4UV8A 1OQ1A 4FLWA 5FYMA 2GDFA 1UXZA 3PUHA 4DUXA 2K1EA 2BW8A 2ZEZA 3QTCA 1ND2C 4B3RB 4AYUA 2Y6FA 1V54C 4CEWC 5LWBA 1RB8G 2JRIA 4AHYA 3DSQA 3W7XA 2Y4TA 5FP4A 2WN2A 3ZXDA 3LSSA 3CF6E 5F8PA 5BNOC 1VMJA 4JKMA 5J9PC 3LA2A 3I3QA 3FAVA 4XJAA 5T50A 1PX3A 3MIFA 3ILFA 2B9UA 3MIHA 1K9MW 1XHZA 1K92A 1MSWD 1SCSA 4X1IB 1HJGA 3VBSA 5EJ3A 2UUBB 4M3CF 1T6BX 1MACA 5F2WA 2Q5ZA 3CBNA 4OHWA 1MS8A 1AILA 2QQUA 2DYRC 5F2VO 3FZ3A 1W2UA 1VBB2 3POGA 4P9XA 4NHYA 1P49A 1SLBA 1N4CA 2OYZA 2ZZJA 3G80A 2BRTA 1K12A 4O2AA 2OA2A 5CISA 2ZMLA 1F7YA 4XF0A 1J95A 4R4XA 3ZFGB 3RRDA 1ULGA 4CUGA 2XKPA 4MXWB 4AEDC 1PL4A 3D6EA 3NV4A 4MSVA 1DLLA 1UN1A 2XLAA 3POSA 3H7JA 4CXYA 4Y22A 3UKVA 4S2DA 1JOYA 2IXHA 1ZSPA 3AL5A 3POYA 1YO8A 3RVZA 4UB6Z 1D4M1 3O0WA 4YY3O 3EB7A 1F4NA 5T5JA 2CAUA 2Y4UA 1WCSA 4KHPB 4LK6A 4YW7A 3TETA 1IPSA 1V55B 5JH7A 1GK9A 5BNQA 4RO2A 4WBBA 3B5LB 2CWSA 1S5JA 4XYXA 1YDXA 2IXIA 1SDDB 1NQJA 1THZA 2RR12 2W47A 1QWRA 4COUA 2C26A 1JFFA 5DMYA 4WM7B 4LHSA 3OEBA 1HQNA 2YGLA 2R30A 4UF0A 4PBOA 2IW5A 3USUB 4NWWA 5LA6B 1XPWA 3IKWA 3J80N 4MADA 3ZXAC 5I0SA 1PO22 2EIKC 5GM0A 4P9LA 1X4TA 1MS4A 2PELA 4B3RO 3I8TA 1AR72 3OR6C 3WG2A 3T0AA 4Q8LA 3ACFA 2WLHA 3ICXA 4OX9B 5FIXA 4D6RA 4CDWB 4QKBA 2RDNA 1ULEA 1W3VA 3E5UA 1HXS2 2J22A 4YVWA 2H8PC 1XE8A 3ZJZA 3WG1A 1XRUA 2VMGA 4HL0A 4ET7A 3EMRA 5L73A 5IYBO 2P06A 1HKDA 4X20B 3VD4A 2MEV2 3VDAA 2P6JA 1IGOA 3TB0A 2Q68A 1VBB1 1O3SA 3STLC 4Q0PA 2ZABA 1L7LA 5IWFA 1LNSA 3AK3A 1QJEA 2JE9A 1OCZC 2D3OW 3JBG2 3KQ4B 2VTXA 5FPLA 4D6TH 1X82A 3R4UA 1KD1W 3KVBA 4RN5A 1GM9A 4WZFA 4E4EA 4CEYA 3J7NA 2ZX2A 1JYXA 1QVFU 2VZPA 1KYOF 2FL4A 1IHMA 1IS3A 2HFEC 4RS5A 3JB8A 3WT3A 5LRRA 1LNQA 3H9AA 2EIBA 3B9IA 4NAMA 2YI8A 2VL4A 2X09A 5JCOC 2PYLA 5LGNA 5FNVB 2VXRA 4U3JB 3GM8A 4J10A 2E9QA 1JOPA 3ZN6A 4MX3A 3JAMN 1X8EA 3MICA 5IWAB 4ITCA 3L74H 4Q4X2 3UGGA 4MVTA 3SYOA 5J2UB 1OURA 2WNVB 4OUMA 4HKOA 4PF1A 2OZJA 1CWPA 1QH6A 1B35A 3AZXA 1KP2A 2RR11 3R4DB 4KU8A 4XTMA 3J8F3 3AG2B 2OW4A 3NRUA 3WP4A 3GBWA 1ZBA2 3AG1C 1PNMA 2JB8A 1KMIZ 4OUSA 1GFF2 1QQP1 3P3PA 4CCKA 1YC61 3T1MA 1F15A 4B7EA 2Q67A 2D93A 1RXFA 4P30A 2Z69A 1I94B 2EALA 1RVF3 1N3QA 1KQRA 4NO4A 2ZINA 4L2NA 2EIJC 4QM9A 1PVXA 3S5AA 4OX9O 1QDOA 4IGOA 1CIYA 1HDKA 4WBNA 2Q1FA 3RZMA 2R043 5FP8A 2OCCB 4FPGA 4HT1T 4K8RB 2QFEA 1ODMA 4QGPA 5EZWA 3IC7A 1ENSA 3LAGA 3PUIA 1AXYA 1HXS1 1VF6A 4XE9A 3DKWA 1AR1B 4AGVA 2VJXA 3UT5A 3WG7B 1XYNA 4QHBA 5BNPC 5LOVA 3OEHG 2UUAB 4LF7B 3CZUA 5DABA 2YIDA 4N23A 1UYYA 1VBA2 1VBE3 5KUMA 4JI1O 1W2BU 2MEV1 2UXCB 1Q8VA 4FP3A 2DCKA 2DU0A 1JBCA 5IK7A 3D3AA 4MGTA 5I91A 3RWNA 2IXLA 2X5IC 2ZBJA 1EAH3 3WNMA 3WUCA 3I3BA 3WF3A 5FZFA 1LGBA 3JBG1 2FBEA 2EJ7A 3BEHA 1R3LC 3JSLA 3HBZA 3DC5A 2P3IA 4Y1VA 4IYHA 5I8SA 4GUNA 3HJRA 2ZE5A 2QE7G 3RGBA 1BQPA 3AYDA 1RP3B 3SYQA 1FPN1 2D6NA 1I0HA 4AEKA 5FPUA 3JASB 3OM3B 1U5IA 3ROUA 5IVJA 4ZS2A 2R0FA 3B2EE 1OVSA 5KMGB 4DXTA 3P5BA 4CS4A 2R16A 2ZX3A 2EIMC 4Q4X1 1MNGA 2D6KA 2VQ0A 2BFUL 2EJRA 4R50A 5CA1A 4KP4A 1S0FA 5FQ0B 1CP9A 5JOZA 4I01A 5EIBC 1KECA 3AZZA 1LR1A 4YM2A 2B8MA 4LKFA 4DK1A 1ZBA1 1JOJA 3IWZA 4QX3A 4E2SA 2P5OA 1FPOA 2VZOA 4RFT0 1UYZA 2Z3YA 3T3YA 1I94O 4Y1UA 4TLGA 3OY8A 1AYN2 5FZBA 2JG8A 5FCCA 4K3AA 5H6QA 4JQRA 2PHWA 5E6HA 3RJRA 4AFBA 5JIUA 2DTYA 3GCXA 3CX5F 1LECA 4JQTA 5CA0B 4O4IB 2VMHA 1X8MA 2E53A 1FV2A 3KVAA 1FYUA 4AAXA 3IAPA 2YSUB 1M4UA 3Q8EA 5IYYA 5L7OC 2QWNB 3CD6V 5I0UA 2XH6A 2P17A 2WT1A 4YZ3A 2WQZC 4IV1A 1UU5A 3FLPA 4CS3A 3RZGA 4FPKA 5CFCB 1RUH2 4ZKTB 2XG3A 2HEVF 1YZBA 3PJSK 5KR7A 1HV1A 2UUAO 2ODMA 3VZNA 3BFRA 3N2GA 2DWEC 1H9PA 3NV2A 3N7LA 1Q6UA 4GZRB 4IE7A 2QQVA 3F2ZA 3I2IA 3MLKA 2UXCO 1N1YA 2EBOA 4UUJC 1QQCA 1EV12 1JZ6A 4KXRA 2AHZA 3NQHA 4FFHA 4DW0A 5A80A 5L3BA 4ICGA 2YPDA 2WNEA 3AZYA 3NSTA 2F4VO 4RHV3 4X1YB 5JXGA 3MF6A 4YVSB 1UZYA 2QTSA 3ZHSA 4P08A 4NRMA 3ZFEB 4FPEA 4EROA 2QCSB 1O4ZA 2A6XA 3S3WA 2IXCA 4CDUC 4A3XA 2DYCA 1GLHA 1V54B 3ZFFB 2BNMA 2J7MA 5LEKA 2OTJV 4DV2O 3OPWA 4TUYA 3ZHVA 4QKNA 4PI0A 2X05A 2FMDA 3IDEA 1HB3A 1OH3A 4LBEC 1FJGB 4J1WA 4XEZA 4I0BA 1RUF2 1UW8A 5B66Z 5CB4A 2WIIB 4BCUA 4DV6O 2NQYA 4HFSA 1NAEA 3LNMB 1A32A 3OGRA 5LBEA 5LY1A 1XNQB 5FYYA 4JHZA 2DYRB 3W7TA 3ORJA 2EXKA 1SCRA 2L6LA 1PGL2 3GZAA 1O8SA 2RM23 3EVKA 3RWKX 2ORZA 3CNAA 3A0KA 1NZ6A 2RS12 5FZGA 2DBIA 2JG9C 4MW3A 4LA3A 3UNPA 2PHRA 4MVQA 3SCHA 1DK1A 3VKFC 3W5NA 1K3EA 3VBOC 2X6CA 2J1AA 1RUNA 5FFOC 4AEDB 1A8MA 4BU2A 5A6ZA 4FIPC 2PAMA 3U75A 4CDXC 3AP5A 5A32A 3BI3A 3T1YB 2YHJA 1RUH1 3X2QC 1AL23 2WNOA 5DAXA 5F37A 4NRQA 1D0HA 2WL1A 4UCUA 1CAVB 5C33A 4O2BA 5B1BC 4QX7A 3EO6A 2FMLA 2PI4A 2QEXV 1YIPA 5KXBA 3ABKC 1EV11 1QU7A 4BQ4A 1IX9A 3AM2A 2UXBB 1SMVA 2PQSA 1EY2A 1M1KW 1UY1A 1UZ0A 1OV9A 5IYDO 5LASA 2VD7A 4MHRA 5K0UC 3SEEA 2B9VA 1GAXA 2KG7A 3LPGA 3ZS8C 3KHCA 5FMOL 1QGLA 2ZDIC 3UO2A 4K40A 4RAIA 4EV0A 2I07B 4FVVA 3I56V 4QMAA 1GZWA 1YWKA 4R8CA 2Q1MA 2RS53 2EIKB 5KBFA 4DRRA 3H0OA 1JXNA 2A79B 2RMU2 2Y0OA 3JQWA 3JAKB 2UXDB 1QU0A 4YZ4A 2Q7GA 4NTWA 4XCBA 3CYOA 1DF5A 3IN9A 1SZBA 3T0BA 1CJPA 4DXWA 2P6CA 4N8MA 3BU7A 4CU9A 3E22B 4CZSA 4WVZA 3D82A 2DJVA 1Q56A 2Q8VA 3HVDA 4XJUA 1LHOA 2IM9A 1FJGO 1YFYA 4P02B 1FV3A 4TT3G 4EB6B 2DYSC 3JXSA 4QPIA 3MV01 1APNA 4QAWA 3ZHQA 1R083 1HV0A 5GZFA 2YYOA 1VARA 1O3RA 4IYIA 3ZMUA 1NQDA 5FMDA 2XBO2 4OLLA 4UXAA 5EC1C 1FFXB 3RI8A 5BY5A 1PMIA 4LBNA 3AP7A 2RS11 1QJU3 1ENRA 4JZRA 3F5WC 3U14A 1V6MA 4I2OA 2ZA9A 1O59A 5HBAA 2QTWB 3K5MA 4CDQC 1HN1A 3ZYGA 5B1NA 4P9GA 5G05L 2A73B 5KHIA 1ZZ9A 1SBFA 2V4AA 1EPZA 2Q4SA 3POEA 1DGSA 5F6LB 1KITA 4LITA 1US6A 3DXUA 4BXFA 1FKAO 1FXZA 3AYEA 3ZHTA 4UW4A 1HB2A 3L9DA 5HPOA 2V4DA 3H50A 4GKJB 4FT8A 1QOOA 4UW3A 2OUHA 2UXBO 3D3QA 2QM7A 1PV0A 3VBBA 4JI7B 2QSAA 1S77D 4R8HA 2DE0X 2ZT9B 3OUSA 2YBSA 3G4SV 3I59B 2ZX4A 5HFMA 3IC9A 2D3SA 1UOGA 2HH9A 4XFCA 1M90W 1KDMA 3O14A 1AYM2 3WCRA 5IVVA 4RQEA 4U3FH 4MVOA 2VWJA 4DV5B 1P8JA 2Z5WA 2EULA 4JAUA 1W2NA 4F6RA 1QNWA 2EIJB 5KHJA 2EAKA 2OT7A 2G1MA 1SQQH 4L11A 4AAPA 5DAPA 3RW0A 5BNNA 4UCSA 2VECA 1ZUQA 3BA9A 5FWJA 4UBGA 4GMP1 1XYOA 3AP4A 4RWUA 3PVBB 3L73H 3MV11 3NAPC 2Z2SB 1FMD3 4JI2O 5A7WA 1QMJA 1YF2A 4PDVA 1XDCA 5B1AB 1W90A 4FK5C 1QR8A 2GNMA 4XAAA 4FLYA 2RDRA 1V6OA 4E2GA 5A3PA 1H2KA 4ZBMA 3THPA 2E32A 4J7KA 4A6SA 2N04A 3VZJA 1H8EG 2A5ZA 1E5HA 1FATA 2C6SA 4XACA 4GZ9A 4LF8B 1DQ0A 3VD5A 4AI9A 2JKXA 3SC7X 4LQRA 1COV2 2HKXA 3OFNG 1WPBA 3POBA 2VAUA 2VTFA 4JYBA 1REDA 3RS6A 4CPBA 5GLTA 4P9OA 2Q5TA 4PA7A 1BCXA 4LWSA 1LOEA 2PTMA 4BQ3A 2WR9A 4Y24A 2KA3A 4FLTA 4EYUA 2WQ8A 3HKCA 3FKSG 3C3VA 5KC5A 4U7OA 3N9OA 5CBGA 4JAAA 2VG9A 2O8OA 5JZGB 3GDBA 2W52A 4W6XA 4LF4B 4PDWC 4JF3A 1Z7S1 2ADEA 3VBRB 1DGRA 4J9ZB 2J1VA 4RQPB 4YGCA 3OEEG 4XXAA 2AACA 1F35A 3WD5A 3VBHB 3N2KB 4RS5C 2XAHA 1YIJV 3DYMA 3Q4HB 5C71A 3K58A 2LGWA 1RUI3 2UU9O 5FYUA 5T52A 3RJ2X 1IVSA 4DMIA 4CCEA 1JODA 2Q8OA 3TJTA 4LF5B 2W46A 2WZPP 3B94A 1XOUA 4AHCA 1YFXA 1V6KA 2ZHKA 1AYM1 4BK4A 4QPJA 2HYXA 3H8XA 3ZM8A 5F3IA 4GKKO 4OPAA 2HJIA 1K42A 1NY72 3MPPG 2BOJA 1AX0A 3SQOA 1V9U1 2D98A 1W0PA 3FJSA 3NVCA 5FJKA 4PCRA 5HCBA 1Q8OA 2GSMB 3DTUB 3I3EA 2YMZA 3GZEA 1VIBA 3ABMB 4PJYA 1SF9A 1SQ4A 5K8SA 2VBBA 3UKTA 4IE6A 1HQWA 1FXVA 1SDWA 4EN6B 5LBFA 2WO2A 3PMEA 4DV0O 3IDBB 2GZWA 1JU3A 4QGLA 4DV7O 1CX1A 1KFXL 3DGTA 4LO8A 1E79G 4PHZA 3SCFA 1POV3 5EBMC 4LKDA 3ZMOA 4AGRA 4KL1A 4Q26A 1DGWA 1T6GC 1LUWA 1H8TC 4Q29A 1UWWA 5IJ9B 1COV1 2MPFA 5C9AA 2X53S 5FPXA 3IMMA 1XL4A 1MPXA 3PUSA 1MZEA 1IKPA 3DECA 2QQWA 3WQBA 3EQEA 2IXKA 2VUAA 3ZSJA 2VZRA 3HKDB 2WZR3 4A41A 4GWJA 1DU3D 4DEQA 4AVBA 3JD1A 4I55B 4QGNA 1ZZBA 1D2SA 1AVMA 1R1A2 2BQPA 1R3KC 2Q73A 5DAWA 2Y34A 3NR7A 2EF6A 4NVPA 4B3MO 3KLSA 1IZ3A 1JZ7A 3MHHC 4TV9A 2ZHMA 3TNPB 2WLMA 5KHHA 1P7BA 4GALA 3N9QA 1K73W 4RUEA 1SG3A 4NHMA 4CU6A 4KWLA 2O1QA 4LR4A 1MR5A 3MI8A 1H6XA 2WSVA 2B39A 3FHQA 1W04A 2HLEA 3M4FA 2AR6A 4BIOA 4QPGA 1E57A 4K8XA 3AMMA 1O4TA 1PK6C 1TG7A 1RUG3 3ZMZA 5FOJB 2YIBA 1BEV3 1WD3A 3E97A 3J7HA 5FLXN 1NY71 2EZPA 5E1RA 4F6EA 1TQ5A 2QE3A 4XTPA 1EUUA 1V00A 3CJHA 4JC1A 4JV4A 2CH7A 4X6QB 4HMZA 5CMUA 4LMFA 4UVAA 3K0GA 2UURA 4CUAA 5TISZ 2WS93 3VBOB 3RYIB 3FB8C 3O5SA 2IZWA 1DGRN 4H33A 1FX5A 5CFDA 4CZZA 3RYFA 4JYYA 2A0LA 3AJYA 1AJQA 3AG3B 1MQTC 2QJVA 4DR4B 3ZCCA 1QF3A 3PIJA 3LEMA 3ON7A 2BSKA 5F32A 1VQ4V 2GH8A 3CCMV 2AEZA 1GICA 3AJZA 1PZ8A 3T1LA 3BTZA 5AC93 2R062 1TEIA 2CWMA 5CA6A 3L70H 3LDCA 1BZKA 1C28A 3MDSA 4CCLA 3I3DA 1N8RW 1RUE1 3PHMA 2TBVA 4I09A 5EQUA 1BQ0A 1UJWB 5GZCA 1ACCA 2Q1ZB 5K0UB 3QO8A 3TEZA 2P1BA 3K77A 2D5FA 5A1FA 1NE6A 4FOWA 3LD8A 4TWTA 3THDA 2ZOEB 1W8ZA 4JRLA 4D0QA 4XJZA 1ZRCA 1FD9A 4KFMA 4Z2WA 4PA4A 1GN6A 4NHXA 4FFBB 4GH4C 4R9DA 4ZXKA 5EXOA 1R091 4EZ4A 2D3PA 1REEA 4KI5M 3VBUA 5JOYA 3P6BA 1TUBA 3BPSA 3SPIA 4E9KA 1H8HG 1IPKA 3RSJA 1NLSA 2X6BA 2W87A 5LZ6A 3AK2A 2J42A 1N1SA 1G86A 2BZDA 2WWWA 2W95A 1OZ0A 3JALA 2DYSB 1LR5A 2W91A 3S7EA 1HRI1 4KGQA 1EN6A 4J80A 4LA2A 1UOJA 3HNMA 3UKNA 2G9FA 3FAVB 2ARAA 3BVCA 5JUVA 2UWCA 2YZ4A 1G9AA 1BBT3 4YRDA 1GP5A 1SLAA 1H0BA 2XVLA 4OMDA 3VBSB 4WF9V 5FZ4A 2XAGA 1NCQA 1PVC3 4GCZA 2BTQA 2VW2A 3MGUA 4EKWA 1DCSA 3OB8A 2HG5C 4BZ4A 3VLBB 4L87A 2H0VA 3WG4A 1QDCA 1VF7A 4LC1A 1AJNA 2ES3A 2JEUA 4O2AB 3C8XA 4PJ0Z 1US3A 2ARBA 1K5QA 3X29B 1YTFB 3KMHA 1W6PA 2WUHA 3ZSEA 4ATFA 3D36A 3A22A 3OR7C 3TK1A 4XUPA 4W4KA 4LBOA 4BJ0A 1FXKA 4DUVA 5HI0A 1PO23 2VZSA 2NZ9A 4LF9B 1PHMA 3K04A 5LA9A 3IFXA 2FDKA 1AR73 2QQMA 3V64A 3MYXA 5A3TA 5FXWA 3OTOB 5CEHA 3BODA 3J4UH 3H42B 3HQUA 4LFCB 1RC6A 5JH7B 3IIAA 1JI6A 4K0KB 1KEXA 3TXSA 1CXZB 4RGKA 1JMUB 2VVEA 3BOPA 4AL9A 1ZRIA 1HRV3 3W7WA 2BYVE 3N9PA 3BHPA 1JFFB 5IE9A 1GQHA 2Q9LA 1URXA 1W8HA 1Y9MA 3C7OA 4UF0B 1PZ7A 1OHFA 2ADDA 1Y4MA 3DV8A 2R9AA 2V5DA 1AR5A 4NXNO 3O0VA 1Y67A 5FP3A 2W9XA 3BRCA 3B8NA 3E83A 1REFA 1YTFD 1W6NB 2BV4A 1S0VA 2BDRA 2Y6JA 3NAPB 4IW3A 2VW0A 2GAUA 4MTOA 3WY6A 1SERA 4JDMA 5FYBA 4MUVA 3ASIA 4XDLA 3M3CA 2JS5A 3AVRA 4B29A 3WQ0A 4XUNA 2R70A 2DUPA 3A0NA 1QBZA 3VD7A 2QVSB 3CP1A 3DF0A 3NNGA 4YVWB 5CIRA 2GP3A 4X65O 5IDJA 1HX6A 2Q30A 2XJVA 2LROA 1PL0A 3IMNA 3ZMTA 4KWUA 5A6QA 1I5PA 1A8DA 5D5PA 1SESA 5AFEA 5K1XA 2EIDA 2WT0A 2XLGA 2ZEWA 5JOWA 1B3QA 4LF6B 4BK5A 3RN4A 3AK1A 1IG3A 2F66C 2YBKA 1ND3C 1AI6A 5JXHA 1R64A 1Q6HA 3CCVV 5LHHA 2D5HA 3DXRB 1BMV2 2IU0A 2QQKA 2G9GA 1WZXA 5FZDA 5C6CA 2C0ZA 1POQA 3M8AA 1T2XA 2OZ6A 4TQDA 4XDPA 1RVF2 4W50A 4CUCA 1OCRC 2ILMA 2V73A 1ZLZA 1UMIA 2C4XA 4CEYB 4CP9A 1HP8A 4LF9O 1A3KA 3AFKA 2AZ0A 4IE0A 2R042 4RS5B 1CVNA 4X66O 1XQ8A 2PHFA 4DR6B 2ZEXA 3APQA 4A7ZA 3ZN6B 2ENRA 1OFNA 4LFCO 2W08A 1JZ8A 1NI8A 4PA6A 2VMCA 1Q6IA 3WW3A 3SKVA 1SC5B 4YXWG 1L0LH 4UFJA 4YZ5A 3U11A 4O7XA 1B35B 1ULFA 3EFFK 2CAZC 3ZRWA 3M1HA 1VBE2 4WM8C 4H3WA 4CH4A 4X8PA 4TSFG 5J37A 2YS8A 3VBFA 1CX4A 4YJ3A 1N0JA 4Q2FA 1VBA3 2RE9A 2RQ6A 3FBMA 5T5OA 1K5MA 2B46X 4ISRA 3SMHA 4IV3C 1Q81W 4DEVA 1LHVA 5DAVA 4GB32