4HBNA

Crystal structure of the human hcn4 channel c-terminus carrying the s672r mutation
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
199
Chain Sequence
SDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKETKLADGSYFGEICLLTRGRRTARVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Local and Global Interpretations of a Disease-Causing Mutation near the Ligand Entry Path in Hyperpolarization-Activated cAMP-Gated Channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 199
sequence length 200
ec nomenclature
pdb deposition date 2012-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4hbnA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hbnA02
4FAHA 1YFWA 3RZZA 3FE5A 4O9EA 5J48A 1O3TA 1G6NA 3S7IA 5I8TA 4JV4A 1RTVA 3SCGA 4CYDA 1NZCA 3EQEA 3U0ZA 4XFFA 3PNAA 2CAVA 4IEWA 4PIZA 4AVCA 5JAXA 1Q5OA 1DGRA 1UW8A 1HW5A 3RPQA 1ZZ9A 2IXJA 3CO2A 1SFNA 2OZ6A 1CGPA 5I0RA 3H3UA 2IXKA 1RUNA 3WW3A 1ZRFA 4IEZA 3UKVA 1YFYA 1EP0A 2BGCA 3ST7A 4X6RB 1EPZA 1GQGA 2XKOA 1O5LA 1WA4A 1I5ZA 3O14A 5K8SA 4TLFA 3TNPB 3FX3A 3DL3A 3H1WA 2ZKLA 1RUOA 4EWAA 1O7FA 2WC2A 2FMYA 4AVBA 4N9HA 5FLJA 1X8MA 2B9UA 1V70A 1UIKA 4YNIA 4E2QA 2QNKA 4MGKE 5KBFA 5FPXA 4R52A 1O3SA 4FAGA 4Q0QA 3E6DA 1ZVFA 4IEXA 2HKXA 4ORFA 1WGPA 4KU8A 2EVXA 4E2SA 4Q0SA 5FPZA 4HVQA 2D93A 3G7DA 4ONUA 2Z2SB 3ROUA 2D5FA 4HN1A 1XE7A 1UCXA 4KU7A 4IESA 4QM9A 3EJKA 5BY5A 2D40A 1WLTA 4IEUA 1OI6A 1CAWB 3E97A 2UY9A 2XHKA 4MGZE 4MUVA 3E6CC 4YARA 2GH2A 3EO6A 3H8UA 2PFWA 2ET1A 3ES4A 4ZU5A 1NE4A 2VECA 3EBRA 4MGIE 1CAXA 1YLLA 4HN0A 1CAVA 2PTMA 4PIXA 2GAUA 3D82A 3R6SA 2GC0A 2GU9A 2UYBA 2I45A 2IXCA 4XFIA 4EWEA 1ZRDA 2UY8A 1RL3A 3VHRA 3GYDA 2H6BA 4PJYA 2P17A 4EROA 3HIFA 3E5QA 2V09A 5LRSA 3FHIB 3DN7A 4MZUA 1CAVB 4YRDA 4D7TA 3H50A 3RYKA 2Q0AA 4UXAA 2H6CA 3U11A 3CEWA 2BNOA 2UYAA 4DINB 4WBBA 1OD5A 3LA3A 4XF9A 2GZWA 3C3VA 2BEOA 4I3PA 4IETA 1YFUA 4FT8A 3ACLA 5JSRA 4HSLA 1DZTA 5T3NA 2H0VA 1YHFA 1ZZBA 4HSJA 4QX5A 4IEOA 1RC6A 4HVRA 5AVPA 1NYWA 4JTNA 1OMIA 3NW4A 1LB2A 4IEYA 1H1MA 1CAUA 3RYPA 1FT9A 1UPIA 4XETA 2QVSB 5I91A 1J3RA 3H9AA 5EFUA 4EWDA 1ZNPA 3FJSA 3RDIA 4LEJA 3M70A 5LRRA 4WZCA 3H7YA 4BIFA 3M3IA 3MDPA 3IBMA 3NKTA 1TQ5A 2IXHA 3BALA 5JSOA 4AXOA 2EA7A 4LTAA 3MYXA 2Q30A 4LUKA 4J1XA 2K0GA 4MV2A 2MNGA 3UKNA 4LA2A 4QXKA 3WW4A 5KHJA 4Q0PA 4FBFA 3OCPA 4ZU7A 4Q0UA 3OTFA 1DZRA 1OFNA 3FWEA 4KWKA 4EV0A 3H7JA 4Q29A 5CU1A 1U12A 2K9ZA 4XFHA 1IPKA 2XGXA 2PAKA 3PLQA 4BH9A 4HMZA 4F8AA 3FZ3A 5FDBA 2QCSB 2FQPA 3NVCA 4Z07A 3DV8A 1YFXA 4KWLA 1UIJA 2IXIA 2PAMA 2XL7A 3ES1A 3IDBB 4IERA 2OYZA 3CL1A 2GC1A 1EY2A 1J1LA 4A2UA 3I54A 1XRUA 5HI0A 1ZZ6A 4I02A 1ZREA 5KHHA 4BYYA 4XF0A 3UKTA 4I2OA 3LA2A 1I6XA 5LEKA 4X6QB 5FLHA 3SCFA 5BUVA 5FQ0A 4HZFA 1X7NA 3ZDSA 2PQQA 3LZZA 3PVBB 1QWRA 4QGLA 1QXRA 3D0JA 3CLPA 3U10A 5C6CA 3H3ZA 4D7SA 1EYBA 3IIAA 3LWCA 1FXZA 4R8HA 2ET7A 2PHLA 5BV6A 3ETQA 1VJ2A 2XLAA 1ZRCA 3OF1A 2Q1ZB 2IXLA 2B8MA 3I7DA 5E16A 3BU7A 3NJZA 5FLIA 1ZRRA 4F7ZA 4QM8A 3BCWA 5J3UA 4QMAA 3ELNA 4Q0VA 3E5UA 4UBHA 4XEZA 4N9IA 4I0AA 1J3PA 4GULA 1Q43A 4HLTA 4UBGA 5J7MA 4I01A 3KCCA 3NSTA 2QJVA 2O1QA 2GC2A 2PYTA 3LOIA 2BNMA 5I8SA 2OPKA 1H1IA 1NXMA 1J3QA 1SEFA 2B5HA 3S0MA 5JSPA 5LEJA 1NE6A 3RYRA 2XLFA 4LLOA 3USSA 3I59B 5JR7B 1J59A 4XF1A 4QGMA 4XFCA 3CJXA 1RGSA 1DGWA 2PHDA 3KMHA 4QGNA 4MGYE 3SHRA 2PAEA 1X82A 1QY4A 1YWKA 5I0UA 1LKNA 2XKPA 1SQ4A 3BB6A 3FFQA 4XFAA 3HT2A 4KWJA 2KXLA 4RD7A 4YSFA 2Y0OA 4ZU4A 5EZWA 5I0TA 5I0SA 1CX4A 3L2HA 3LA7A 5CADA 4OLLA 1L3JA 3H1MA 1CAXB 4AQ6A 4B29A 2GC3A 4I0BA 1YUDA 1O4TA 2BYVE 5CVRA 3QACA 3S7EA 4JVAA 5D1IA 1IPJA 2VPVA 4OFGA 3I59A 1CAWA 1XE8A 2E9QA 3KGZA 3KSCA 4H7LA 4NVPA 4AQ2A 1JUHA 1X8EA 1FI2A 4E2GA 4XF4A 5FQ0B 3SCHA 3QOPA 3NL1A 3SMHA 4HVOA 4KL1A 3SXWA 3MPBA 1O5UA 4XFBA 2MPFA 1PMIA 4Z82A 2BNNA 2CAUA 4PIYA 2OA2A 3E5XA 4I09A 1ZZCA 2CV6A 3EHKA 1PM7A 2ZCWA 5KHIA 3H1YA 4P9GA 4BHPA 3IDCB 5E1RA 3RNSA 4IEPA 2PA7A 1Y3TA 4META 2CGPA 3WW1A 2OZJA 3CF6E 2IC1A 2N7GA 5JCTA 3KGLA 1VR3A 3HT1A 3MZHA 4XF3A 4LULA 5FCCA 1GQHA 2DCTA 2ETEA 3E6BA 3WW2A 3JZVA 4IEVA 2C0ZA 4HBNA 3HQXA 1Y9QA 1QXJA 5C8WA 4YYOA 3TNQA 2F4PA 4K8FA 5KHGA 3LAGA 2VQAA 2XLGA 4LA3A 2EAAA 4IEQA 1O3QA 2QDRA 2XL9A 5I93A 1ZX5A 5I8YA 1LRHA 2Q4SA 1UD1A 5BPXA 1O3RA 1Q3EA 1LR5A 3D0SA 3N4MA 4L2NA 4XFGA 4MH0E 2O8QA 4LUMA 3B02A 1ZZ8A 1J58A 5KHKA 2Z69A 4JTOA 5BXXA 2WFPA 4AVAA 3BPZA 2MHFA 4WVZA 5F1RA 2HJIA 3IWZA 4J1WA 1VP6A 3DKWA 3OGJA 1ZZ7A 3GBFA 2D5HA 4MX3A 3OD0A 2ATFA 1CAUB 4L11A 4O9GA
chains in the Genus database with same CATH superfamily
3JD1A 1J83A 1NZIA 1KS5A 1RVF1 3FL7A 2ADQB 2P3KA 3MIEA 1VQOV 3T1MA 1WCKA 1NR1A 5FO7B 4OUMA 2HJDA 1SFNA 4GWNA 3QNEA 4HANA 4UWDA 2IXKA 5FO9B 1W06A 1VF7A 4DV1B 1YFYA 1EP0A 2YUAA 2QQJA 3B00A 3LNNA 3MLJA 2VL4A 5IVVA 1S5HC 1R1A2 4QHZA 2UUCO 3J7LA 4BQWA 1QJX2 4RAIA 1N36O 4A44A 1RUOA 4CPBD 3ILRA 2DFBA 1ZAUA 2VCBA 3N2GB 1NVPB 5KAIZ 3K58A 4N9HA 3N7LA 2VO5A 1X8MA 1UU5A 2FKXA 2WNUA 1WW6A 4E2QA 3U1XA 5CFDA 1D4VB 5FPLA 1SERA 4YZ1A 2YG0A 5A70A 2WINB 2Y6GA 4MO3M 5JOYA 3A0NA 2IJHA 3ABKC 5A7WA 1RUH2 2HWD1 4JI1B 4FXGB 5FZLA 4ZZ5A 4OHWA 3RGBA 2W47A 4QM9A 3T2QA 2E63A 3ZFFA 1V54C 3T0DA 4JI2B 2XHKA 4MGZE 5A3NA 4JI3O 1NTMH 2YGLA 5J36A 1GK9A 1UY0A 3HKBB 3UT5A 4IV3B 3BTAA 1DYOA 4NAMA 3PVEA 5FPBA 1M4UA 2YXYA 5AC91 5LHHA 4IE4A 4OYUA 1M57B 5DAXA 4JGSA 4MZUA 2V1DA 1RHI2 4B08A 4AF9A 2H6CA 5LP6A 3AMQA 4LBQB 4XJAA 2JG9A 2BEOA 1R092 3B3QE 5H9SA 1ACCA 4FT8A 1BS3A 5LA0A 5EXOA 2RCVA 3AG4C 5LMNB 1IDSA 3HD8B 4XETA 3ACIA 1JZ3A 3M70A 4GIQA 3MICA 1D7PM 4JZGA 4OI1A 2CYFA 3B01A 3BCCH 1K9MW 2AEYA 1XL4A 4J1XA 4FO9A 2ZABA 3MDSA 3OCPA 4TUYB 4RQFA 4WM7C 3WHUA 2ZGOA 3E8BA 3J7HA 2CTVA 4NO4A 3ZX6A 5CU1A 5GZGA 4Q2FA 1WZXA 1ZWIC 5KUKA 2WIIB 1CZSA 1K92A 3K08A 2PAMA 4BQXA 3B09A 2GN7A 1N32O 2ITCC 4AEDC 2EAKA 5FZOB 2AH2A 1P7GA 4JQTA 5L9RA 4BYYA 2XQRA 1BHBA 4I2OA 4RQPA 4CCEA 4GKKB 3PUAA 1H9WA 2UXDO 2JG9B 1OCOC 5C6CA 4R8HA 3BIEA 5BV6A 4BXSV 5DECA 2IJIA 5LOVA 1EFRG 5FYCA 2Q1ZB 1FS0G 5FZGA 1RUF3 4JI1O 2WLHA 4P9LA 3MD0A 1RUE1 1PVC1 1YDXA 4QMAA 2M7WA 2ZKOA 2AGSA 3LFIA 2CTRA 5CA1B 4CDXA 2A5ZA 2HEVF 1IBLO 3E5UA 3T1LA 1RUG1 2EINC 3OTOO 1RUD2 1QNYA 1AI7A 4DK1A 4QKDA 2XBO3 4CDWA 1B35C 4D6RA 1S77D 4GZRB 4BU2A 3AK0A 4OI0A 1DP0A 1HWYA 3Q4HB 1E5IA 4HKOA 3I59B 2UWCA 4XF1A 3CP1A 3NNLA 2R9AA 3AK2A 3JQWA 5CB4B 3EMRA 1U0AA 2PZSA 5B1AC 1S0FA 2J22A 5FZBA 3HT2A 2XT9A 4RD7A 3VQXA 4ZU4A 5F6LB 1ASJ1 3G6EV 1RUJ2 3N2GA 1P49A 2OIGA 4Y20A 3K2OA 3FC0A 5D1IA 1JQ0A 4BA6A 2XG3A 1AJQA 3BHPA 4W4ZA 2VUCA 2VCCA 4JZ2A 3SMHA 2ZHMA 3RI8A 3RSJA 4F6RB 3L74H 4K1ZA 1QR8A 1LUWA 3CD6V 2VU9A 3ABTA 3R0RA 3QO7A 1UMHA 2OT5A 4YGCA 2QQVA 1UYXA 4META 5FZOA 4UI9L 3HT1A 3WG3A 4BW5A 3MZHA 4QPJA 4U3JB 1EAH1 4MXWA 3RZLA 4MS2A 2F95B 2OYQA 2VQAA 3I2OA 4WFEA 1PK6B 4LBNA 5JLVA 1PO21 2GTAA 4S2HA 1BGYH 1VQNV 4ZS3A 1O91A 4JRLA 2Q4PA 4X88A 4XFGA 4ES9A 4MTFA 1G86A 1YC61 5T5JA 4IE7A 2EXIA 4WZFA 2R7EB 4CRQA 2M6YA 2BRTA 3P6BA 2HJIA 1D0HA 1BE3H 3SGIA 3WNXA 3SKVA 4O9EA 4EN7B 5A80A 5T55A 2EILC 4JV4A 1WCUA 2YI9A 1VQ9V 1ND2C 5K1XA 1VMGA 1D5AA 3N27A 1UW8A 3THTA 1PIV1 4BWAA 4JI2O 2W92A 3CJIA 4OI4A 2P3YA 4DY5A 1QQP2 2XAGA 2WAAA 2AZ0A 1UX6A 2ARHA 4Q4Y1 5JMCA 5ABJB 3OEEG 2VW1A 3NO8A 4O61A 1GOHA 2Q6AA 4DRXB 3TNPB 3I49A 1VAMA 1NVPD 1ZX3A 2ZM6O 3MFAA 4H13B 3QD6A 2GDSA 5LY2A 4MGKE 1RFYA 3RVZA 4UCSA 3DC5A 3NAPC 2Q5TA 3CXCU 2WLIA 3ZHRA 4GX2A 1BZWA 3KV5A 4HNAB 1YF2A 4AHWA 1STMA 3OEBA 3VZOA 2R9IA 2KKWA 5HCFA 3J80N 4BLJA 4OPHA 3AG3B 5BY5A 1SQXH 2RS13 4CP1A 1HNZB 2FHRA 4N21A 1UPSA 2HKOA 4Q1PA 2ZX2A 5C5TA 3F7YC 1UZ0A 2GC0A 2Y6KA 4AE2A 3GDBA 2UY8A 2DTWA 4EROA 2Y69C 1N3OA 1WCSA 3D4KA 1F23A 2UU8A 4E2LA 4N23A 1SPPB 1GN4A 1YEWA 1OD5A 1VBC1 3C3VA 3K3OA 1URXA 5C71A 1COV2 1S5JA 2A6YA 4I30A 1OLQA 1CXZB 3I3DA 3AVSA 1PNLA 1IS6A 5CA3A 2EIJC 1X9TA 4FZ0A 2P22C 2CY6A 4LFBB 5FOJB 3OY8B 3W21A 3SYPA 4WZCA 4LH6A 2HLDG 1NKDA 4ZKIA 4HFSA 1SLIA 4N90A 1QJX1 4UFZA 3BALA 2UUBO 1UY4A 1JYTA 1GNYA 1HNXB 1JU4A 1CJPA 2AXTZ 2P37A 2RDNA 4Y26A 2EXJA 3RZGA 5F8PA 2P7TC 2Y64A 5JZGA 4QX7A 1DU3D 2VNGA 2DUOA 1RUI3 3FWEA 1GR3A 5SV5A 1U12A 2FDHA 5M0TA 3OR7C 1BHGA 5IVYA 1NLRA 1S0DA 4HMZA 1G9BA 5E79Z 1IBMB 1OOPC 3DV8A 3M8AA 4F3JA 1EN6A 1W6MA 3ABMB 5BR8O 5FP7A 4FLXA 4FMTA 1J1LA 3B8NA 3AMHA 2EJRA 4I7ZB 4COWA 2GSMB 1I6XA 2HBTA 5BUVA 4IV1A 4YPJA 2D43A 4AQSA 3ZM8A 2BOBC 1AL21 4DPNA 1EYBA 5IT9N 2ET7A 3FLRA 3PURA 1VJ2A 2P3JA 4Q8KA 3GBWA 3PUQA 1VQ7V 3VD3A 1Y9MA 3O7OA 3EB7A 4TWTA 1H8TC 2QQPA 1F4MA 3JBG3 4B3SO 4GX0A 3RJRA 5JR2A 3KVBA 4Q0VA 3ZIAG 1EBOA 5F5AA 3VBUA 2R041 5FKBA 4X9QA 3KCCA 3M7MX 4EN6B 3LOIA 3J7AU 1SEFA 4W8JA 4JI3B 4LF5O 1FNZA 1QXPA 1G4YB 1H4GA 3TN93 5B3SC 3AP9A 4M0HA 4LHLA 4TXWA 3WDXA 4LJHA 3KMHA 1N47A 4GB32 4RGGA 2KA3A 3SHRA 1RMU2 5FMOS 4EZ4A 3QBQA 4XDOA 3HEIA 4OVEA 4YSFA 3K59A 1GKBA 1PK6C 2D7FA 5FYTA 5C4WA 5I0SA 2W08A 1MS5A 3TK1A 3GNEA 3KCXA 1OA2A 5LBQA 2D3SA 4I0BA 1RHI1 3O1MA 3APOA 2C24A 4GMP0 2A3XA 1K7DA 1TNRA 5A6YA 3VV1A 1GP4A 3T2OA 5K0UC 1IBLB 1H2NA 5FZKA 3JD3A 4R9CA 1DLLA 1L7QA 1H8EG 1XSRA 3DECA 3D36A 1HJFA 3HKDB 2XB6C 1XYNA 5F5CA 4Y4YA 3ATGA 3VL9A 3POFA 1LEDA 4BE3A 3AG4B 1NY72 2QTSA 3T1YB 3RYCA 4XC9A 5KHIA 3NMBA 4LLFA 4TSFG 3OEAA 2PA7A 2JJ1G 4HT1T 3LPGA 4AFAA 2NYYA 2ETNA 3CPWU 1JS9A 2PUSA 3VGIA 1IG0A 1F31A 4ZY9A 2C0ZA 1Y9QA 3GXUA 3C7HA 1EN4A 1PVC2 2ZMLA 2GH8A 1QOSA 5FZAA 5LASA 2LTNA 1NUKA 4RS5C 1K97A 5I8YA 1HLCA 5A7QA 2W5FA 3N4MA 3WXPA 5G05L 4V2WA 2HEWF 4DFSA 5FWEA 4MH0E 4NPRA 4NRQA 1N0NA 1OUXA 1NQJA 4PHZA 2XHNA 1N32B 4AZZA 2YIDA 5F5IA 4AI9A 4QX1A 4NR1A 4ASLA 1VP6A 1YITV 1QJY2 2R0FA 3R4DB 4GCZA 1HIXA 1VB4A 5A6ZA 1QHDA 4PA6A 3AX4A 3EVKA 4Z1MG 4DR5B 4Y5Z0 3VD5A 3VKOA 2QQMA 1S3JA 4JI7B 4JDNA 5IY5B 2ZMKA 2VZQA 4XDLA 3UV9A 2D97A 4W6YA 4JHTA 2CAZC 3CWBH 3UYJA 2R063 5FBZA 4CXYA 4IL6Z 2DVGA 1GWKA 2JKBA 2P5BA 1UJWB 2QM4A 4QDSA 2AUYA 1AR82 4ZI7B 2B9UA 3VZNA 1IXMA 1V70A 5C4WB 4DR1O 5HFLA 3R66A 1NLQA 4XDJA 1VBB1 2ID4A 1GM7A 2JS5A 1NA1A 4DS0A 3KZ4C 1K12A 4FQ4A 3H1KH 4XIOA 1AJPA 1HB2A 2Z2SB 2JENA 2DWRA 2B45X 5BMVA 3L9JT 3EO6A 3KV4A 4WFFA 2HJFC 4WFAV 2VECA 3Q8CA 3GZEA 1TA8A 5IJRA 1KBHA 4CU9A 2GAUA 4LFAO 4JYAB 3K46A 3B9CA 1ZLZA 1O59A 3VHRA 2VXJA 3N7MA 3AMNA 3E5QA 1M5IA 4AFDA 2DVBA 2W1WA 2VTXJ 2W87A 3FAVA 3IJ4A 1W6QB 3CEWA 2XNDG 3ZVXA 4OMCA 4JRAA 1RM1C 5FTTC 1NLSA 2V7QG 5IJ0B 3VUOA 2X53S 4IDZA 4DV0O 1XEQA 3OR6C 5F2VO 5I91A 2FYUH 3OBAA 1FFXA 4TZDA 1PGL1 2Y33A 3M3OA 1OQ1A 3M3IA 5DAPA 1JW6A 4FPFA 3RMXA 4UFKA 2DCZA 3CC4V 4FLUA 2Q30A 5BY1A 1BT8A 5H6RA 3O1RA 1X4TA 3MEPA 4AHCA 1UOBA 1HXS2 2VW2A 1JJ2U 2YI8A 2VNRA 4MLOA 1UOJA 2MEV3 1OD3A 1Y7BA 1ZRIA 2H0BA 4P9PA 1X9PA 3NNGA 1LJ7A 3VQWA 5EK0A 5B66Z 1LNSA 5GTHZ 5HXMA 3AZVA 3VBRA 5FMDA 2DF7A 1F5JA 2VTFA 2DQ0A 2AC1A 4RYDA 1HDKA 1ZSPA 2QEXV 4CXWA 4DYLA 1AI6A 2NPIA 1KKCA 4A2UA 4M00A 4P9OA 2WLLA 5HI0A 2LROA 1M4WA 2J1RA 3TN91 2JDPA 3LFMA 2UWAA 4IGQA 1EV13 5C3QA 3WP5A 4FTEA 1M93A 3BIWE 3CLPA 2BVVA 3IIAA 4JI6B 1RUH3 1WLEA 4Y1ZA 1CD3G 1TVKA 1VALA 3ZXEA 1OCRB 3ZYJB 3RVYA 3KT4A 1RSOA 4XEZA 3WG1A 1J3PA 4GULA 1F4AA 3SITA 1NX9A 2CDOA 1NXD1 4G27B 3VHPA 1VBB2 3WZ1A 3S6PA 2ZE7A 4KQ7A 2B1IA 4LITA 3IGAC 1BBT3 5JSPA 5AVAA 2VWJA 3VBRC 3WG7C 3QG5A 4MYEA 3M2MA 5A3TA 4X62B 1Z78A 2XJVA 3AB0A 1OA4A 3AG2C 1NT2B 1WA8B 4KWUA 5LW9A 4LH7A 1L7LA 1NZ6A 3FKSG 5CB7A 5LBEA 3ZXKA 5CADA 5DN6G 3V64A 3T1HO 3N9OA 2GC3A 5IYCO 1KP3A 5CVRA 4JVAA 4AHZA 1NCRB 4QHBA 2A6XA 4C8DA 2LGQA 3UO2A 1K42A 1TE1B 3ML0A 4E2GA 2FDKA 3IAQA 4B3MO 1B3QA 4YVSA 4B7EA 4C0HA 1YO8A 4XFBA 1B35A 1UN1A 3SH5A 2VAUA 4NWWA 3E5XA 5BYNA 1ZZCA 1W0PA 4MTOA 3L2YA 5F2WA 4WBNB 3PIJA 2ZPXA 1F4HA 3AZYA 3TNQA 2Q7GA 4I9WA 4UVAA 2MK3A 2R70A 4Q5OA 1V6MA 3LEMA 1GOGA 3AG7A 1BQ0A 1D0GA 4U2AA 3VBSB 4O2BB 4DNYA 2XQXA 4IHJB 5L3EA 3URFA 5EV7A 1OPOA 5EQUA 1OV9A 2P5OA 4JTOA 5BXXA 3N2KA 1HV1A 4AYUA 3KQ4B 1J1TA 1JYCA 1G9DA 4P00B 2DN9A 1IQDC 1QCEA 4LBOA 1KEXA 1W2UA 5DM6V 3N2KB 4XJZA 3PMEA 1Q5OA 4NYKA 2LS6A 5CA0B 2Q1MA 2B1GA 2NP0A 4AGGA 1HN0A 3I3QA 1VBA2 3K4AA 2CDPA 1I5ZA 3O14A 1QHTA 3V65A 4COYA 4DV6B 3OT7A 2Y4TA 4Y20B 2IJJA 1GZ9A 2JJ6A 2WNOA 1V6KA 3FHAA 5FKCA 5A33B 2GALA 1PMHX 4DB5A 1A8MA 2ZHNA 2PMWB 2N05A 4AI1A 4P9XA 3VHOA 1P4RA 3T0AA 4B4QA 1ZL8B 1AYN1 1B35B 3L70H 3LKJA 1UYPA 1UCXA 5CBHA 4JF3A 1RUC3 5DUUA 5E1AC 3H8UA 2A6VA 5HV0A 5F39A 1LHUA 1NOVA 3ZHQA 3GB7C 3A0BZ 2L6LA 4XJ8A 4PJYA 2P17A 4X8AA 3FB5C 2NN4A 1MEC2 4B8EA 4OHYA 3RYIB 3N36A 1KQRA 1HN1A 3N9NA 3LQCA 2EIDA 1WNSA 5DEDA 5JQGB 4NXNO 1QJY1 4PCRA 4CP2A 1GBGA 4JI0B 4NXMO 1BHAA 4A4AA 2ORXA 3LA3A 3GZTB 1GZTA 5JXJA 2UXDB 3OUFA 2AHZA 4IETA 2D3RA 3J26N 1W8WA 1U5YA 1XNRB 3ZFGB 2WFF1 4WVVA 1RUC2 4LBKA 4IEOA 4HVRA 1KD1W 3ZMVA 1K5MA 1FXKA 1YXWA 3G6BA 2YBKA 1OT5A 1QNMA 2ZS6B 1ULOA 5DUWA 1H30A 5A7PA 1S0BA 4CCJA 4NHLA 4ZHQB 1OKOA 3RDIA 3LSUA 5A32A 3TEWA 3BUCA 5DDJ2 4X20B 2EIKB 4FVVA 2KSDA 5FK7A 4K0KO 3I8TA 1VB2A 1VRH1 5APAA 4Q0PA 2UURA 1PD3A 4Q0UA 4NTYA 4NMIA 2X05A 2H8PC 2DYCA 4H7MA 3ABKB 4XFHA 1CQ9A 1HQNA 1HRV1 3ZYRA 4CDUA 1LHWA 4DXSA 2YV8A 5AFEA 5FP3A 1UYYA 3TAYA 4OZOA 4I50A 4UCOA 3NNFA 1LOFA 4DW0A 5I0DA 1VMHA 5H9RA 1VF6A 4I02A 1RINA 3ABUA 4XF0A 1ROPA 3T30A 2XWJB 3PVBB 2JXAA 1HNWB 3K51A 4LHKA 4P30A 3STZC 3SPHA 4PI0A 2UXCB 3HQRA 4JI5B 4D7YA 5C70A 2GNMA 3WX5A 2B4KA 2RS32 1NH2D 5B1OA 2QFEA 2P3IA 1YIJV 3VKLA 2IZWA 5C4WC 1V6OA 4EN0A 1OSGA 2QWRB 1C3HA 3ELNA 3VQYA 3ZN6A 2YROA 4QWNA 1AX0A 2ZJCA 4OUSA 4IYIA 3ILNA 5L36A 4LBJA 1EAH3 1VMJA 1S72V 1Q86W 2VUJA 1PX3A 4JAAA 2KG7B 1OLRA 1C8M2 5IDJA 4N43C 5A7WB 1Q8QA 3W7SA 1LKNA 1SQ4A 2DE0X 3O65A 4NHMA 5JIAA 3BB6A 5D8AA 4J25A 4P2ZA 3I2JA 2KXLA 3OMAB 1DQ0A 1C5IA 5JWPA 1CX4A 2OCCC 1BL8A 4JI6O 4FPHA 5LYJB 1UQXA 2JG9C 1N33O 5LXTA 2A3WA 2R1DA 2GP3A 3ZSLA 4J42A 1BKZA 2WZR2 4MOAA 3OB8A 2WLMA 5IVBA 4JAVA 3HBKA 4XJUA 1AR61 1R3IC 4Y33A 3RW0A 3SCHA 1K3EA 2CTQA 3ASNC 4Z82A 1C4RA 4LR3A 5FY0A 2K1EA 1JODA 2D3PA 2OA2A 1ST8A 2H3OA 4UV8A 3IDCB 1DF5A 2VZSA 1VIWB 5DAVA 4B3RB 4LKSA 1GMGA 1GP5A 1YQ5A 1MEC3 3CKHA 3H1JH 1PO23 2F4PA 1SHWB 4M3CF 2VMDA 1O3RA 4FCAA 4BOWA 4XUPA 3WNPA 1JZ7A 3SLIA 2YPDA 2YB7A 1AX2A 1WD3A 1SQBH 4FFKA 4YW4A 1Y74A 2E75B 4C7UA 3IT8A 1FOD2 1PO12 4L11A 1WLWA 4JTAB 1YZBA 2HYXA 3ALQA 2LFSA 3ZMUA 3O0VA 1JZ6A 5JAXA 1QOTA 1RPRA 3H42B 2IXJA 3CYOA 4JC1A 4OCTA 1CGPA 2QKCA 2VQEB 2WSSG 4BPZA 1VRH2 4TV8B 1LU1A 2R72A 4D6QA 4COUA 3ZXGA 1IBKO 1YHQV 3B7MA 2WRAA 5A32B 2RNBA 2QQIA 4XBQA 5KC6A 1OQEA 5FLJA 5AG2A 2AHYA 1UIKA 3WNNA 2CUGA 3UJQA 3EYPA 4JYCA 3SEPA 4O4LB 4FAGA 4LOSA 1FXKB 1ENRA 5FY9A 5CFCC 4JV5O 1ASJ3 2FCUA 3G7DA 3SPGA 2LP7A 1ZL8A 3Q9OA 3E97A 2JE8A 2DWEC 3AG2B 3KF3A 4JYYA 2UUAB 1GM8A 5CIRA 2GMMA 4DO2A 1ULDA 4Q6GA 1SESA 3N9LA 2WN2A 3T09A 2RDSA 1AR71 4MXVA 3GYDA 3ZPOA 3HIFA 1FYJA 4FIPC 2WO1A 1APNA 4LKFA 3L75H 2R072 4D7TA 4UXAA 3SJAC 2Y34A 3AM2A 3W7WA 4O65A 1KKDA 2CH7A 5FP9A 2DUQA 3O5SA 2VZPA 1YFUA 3D8CA 4J7JA 1PNFA 3DGEA 1CEZA 3NWKA 4DR3B 4DK0A 1VE0A 2JG8A 3L71H 4EFBA 1DQ1A 2UU9B 4LK6A 1PM9A 1GAXA 4PDVA 4FM1A 1CN1A 3LEGA 3GJBA 1SBEA 4XJWA 1DZQA 1PKXA 2EZPA 3G80A 1KDKA 4X65B 2WAMA 3HJRA 2IVJA 1N4CA 5KHJA 1TAEA 3ETPA 3P5BA 1XU2A 4ZU7A 2ZR3A 2PHWA 3NJYA 2HWB3 1QH6A 4KH9A 2E7AA 1XMOO 3N9MA 3OM3B 5JVDB 1Q7YW 5A9GA 5JXHA 2X7RB 5FY4A 1H8HG 4JDMA 4HK9A 4NIHA 4OZXA 2RE9A 4NRPA 2BBAA 2JVDA 3WF3A 4K8ZA 2WS91 4XTMA 2K2SA 4L0PA 1NI8A 1HP8A 5CZKA 2WPDG 1JR9A 2ZEZA 1JYNA 5DN2A 5FLHA 3VBSA 4DXWA 3ZRWB 1X7NA 2RVAA 3HKEA 4O4HB 4B1MA 3D0JA 3BY6A 3JAKB 1OC1A 5LMNO 5L9VA 4BWOA 1THZA 2C9KA 4RHV2 4LOTA 5L7OA 2OVUA 2PELA 2QZ3A 2PI5A 1YQ8A 3IC7A 1J3QA 4AGRA 1ENQA 4YLZA 4RR3C 4PJ0Z 5F3CA 2PLV2 4Z8BA 5FNVA 4JKMA 1AR93 2ES3A 4Q4V2 5I0UA 3CRAA 4O4LA 3CZJA 5L3CA 1D4M2 1TNFA 2WNUC 4JZRA 1PNMA 2QWQB 3IN9A 1QNWA 4JI4O 4OLLA 4EZHA 2GHYA 1YJLA 4IUGA 4YVWA 4AQ6A 3C7GA 4JASA 3OBZA 1XBFA 3S7EA 1RXFA 3OOXA 3MV01 4CCMA 5L3FA 5EWSA 4ATEA 4NOTA 5LWBA 4YM1A 1YQ2A 1FI2A 4LFCB 3WF1A 1GN3A 5DG1A 4HVOA 3USUB 4FPCA 4TTGA 3BKZA 3AK1A 1M56C 1BQZA 4CH6A 3ZFEB 1WMDA 3H1YA 4P9GA 4PDLA 1Y9GA 4SBVA 5IYZB 2G1MA 3JD73 3LCPA 2QWNB 5CEHA 4YVSC 4K21A 1VR3A 2WLJA 1RUH1 2HWD2 1SLCA 4BK4A 2J1UA 2BW8A 1URFA 3F95A 2VRZA 4NHXA 2E32A 4GB33 1W05A 1V55C 2VZTA 4DOUA 2PGGA 1N33B 1MQTB 3VL8A 5J09A 5C8WA 3ZS8C 1VBE2 4Y24A 2QDRA 3R4UA 1LR5A 3P3NA 2B9ZA 4YW5A 5IW0A 4LUMA 1KU9A 1J58A 3DC6A 2WLLB 1AR5A 4AVAA 4Y1XA 3TWIA 4DR3O 4HPKB 4BQ2A 4A41A 2ATFA 3VBFC 1AR1B 3RZZA 4JV5B 2ZGQA 4GKXA 1FXHA 4XURA 4MW3A 1VBD3 3SCGA 2CSGA 1DQ2A 3B5LB 2GSYA 4N7UA 3E8FA 5FXVA 2QUOA 3VZMA 2XWBB 4CXXA 5H2FZ 1ZRFA 1EPWA 2WLNA 3UKVA 1AZDA 4CEYB 1Q6HA 1EPZA 1FAYA 4O4IA 1R6NA 5C3PA 1XOUA 3ZRVA 1S5LZ 1MQTC 4FFGA 2YDEA 3KV6A 2Y4UA 5F37A 2DJVA 2EULA 2P1BA 4MVZA 3UETA 4UFJA 2LO1A 2BTQA 3JATB 4MSWC 3OAAG 4YZ3A 3DPRB 4LFCO 2A9HA 4CBCA 1OUSA 1MSDA 3DEMA 1RJ8A 3ZIWA 4EN9B 3ROUA 3TN92 2V73A 4HN1A 2D2CB 1XE7A 1C1LA 2O14A 1CAWB 3R4SA 4MUVA 3E6CC 1YQ6A 3S30A 1PL0A 4F4LA 2G9FA 5IJ9B 3M3CA 1NG0A 3W9AA 2WO2A 1CPMA 4P08A 2E51A 4KMQA 3OBRA 2XAFA 1F8VA 1OHHG 3ZXAC 3EHBB 4LWSB 4CEYC 5H9CA 5LA2A 3WUCA 4XF9A 1GZWB 3THDA 1W2AX 2L35A 5C7GA 3J9SA 4CH5A 2RJKA 1Z7S1 2BV4A 4AQYO 4NJ4A 4XCAA 2RJZA 4G9SB 3WLUA 1WBLA 2QA4V 4QPIA 4NTWA 3QF7A 1GU3A 4EFEA 5B1NA 4A7ZA 4DO0A 3RN4A 1SZXA 1FT9A 4XTPA 1FV2A 3GVMA 4O4IB 5IYYA 5HFMA 2NNUA 2RR11 5FJKA 1AP5A 3ZSEA 3ZMSA 1FATA 1XL6A 4YWAA 3EFFK 3GCXA 2EA7A 4LTAA 4DV1O 2A73B 5FMCA 1JCHA 3IFXA 2YGMA 2MNGA 1K34A 3UKNA 1UAIA 4RQPC 4KG0A 1AP6A 4X20A 3UJOA 4AAPA 3Q8FA 4BR6A 3T4VA 1O4YA 4EV0A 2BQPA 3WNLA 2FQPA 3B94A 5FMBA 5LHIA 3WUDA 2R042 2R6QA 2LQTA 1W8UA 4KXRA 3JD71 4XHXA 1V6LA 2NLJC 2JDNA 4LKDA 4JKKA 1QJZA 1JZ5A 4GB31 4HL0A 4RFT0 4GMP3 1K8AW 1W0OA 1W8HA 1UZZA 2D98A 4RWUA 5EC1C 4Y5SA 2C5DA 2HBUA 4D7SA 4Z2WA 3ZYBA 1OOPB 5K1PA 4EB6A 2XLAA 1BYHA 3NJZA 1AR81 3POSA 4DV2B 1IS3A 2RS12 5CMUA 2XVGA 2Y0PA 1Q43A 2MEV2 1L8DA 3RQ0A 1UO9A 5EBWC 2GC2A 3O1PA 3ZO0B 2WT2A 3DUIA 4H14A 3K4ZA 1NE6A 4QHOA 3MIGA 1AYN2 5GJ6A 3OPWA 2Q7EA 2R0HA 2ZZQA 3R65A 4RGAA 3ASOB 1NA1C 1NCQB 5LXTB 2RM21 5T54A 2ZIOA 4LF6O 3A4UA 4DR4O 4FPPA 2YHJA 5EZWA 5IJ9A 1E57A 3LA7A 4FPJA 4IGGA 2JDHA 1F7YA 4YIPA 3UT0A 4B4PA 3WNMA 1XYOA 2JGDB 1G9CA 5IT6A 1MR5A 3JAKA 3AFKA 4H7LA 4NIAA 1VQKV 1G7YA 3WOGA 4IV1B 1YXBA 4FK5C 3O1VA 2X5IA 1XNDA 3SYQA 2D44A 5LK7B 4BCUA 1PMIA 4EQVA 4URAA 5IY5C 4PIYA 3ZFEC 2O0OA 3JATA 5ACA3 3POYA 3OMIB 4TT3G 1BCXA 4NHKA 2CGPA 4CEWB 3WW1A 1AVBA 2CTWA 2OZJA 3CF6E 3HWJA 5JH7B 3MBWA 1R3LC 1NT0A 4QX3A 1T5EA 3E6BA 4YJ3A 3BTZA 3SYOA 3OTOB 4BLIA 4XVHA 4UW3A 4CE8A 4DUYB 3JCIA 3BA8A 1XQ8A 2K9PA 1OPMA 4N53A 3MF9A 4I50B 5FBJA 4NRMA 4WVZA 4XZUG 2D6LX 4PELA 4NWVA 1QVFU 1I94O 2LW8A 1SETA 3S5AA 2NR5A 1KFUL 3JD0A 1ND3B 2D6OX 1EZJA 4I4TB 2B39A 1BBT2 4XCBA 5FY8A 1DLBA 1JHNA 3DKQA 1KDMA 4CDXC 2JECA 5CNAA 5C8YA 3VZLA 1HR0B 3UCSC 3RYFB 5BXZA 2YC2A 2QDNA 4G4FA 1G1XB 4W6WA 4CH3A 2ARAA 2VQTA 1JH5A 3LF7A 2DUPA 3DL3A 3ASIA 1I5PA 4AGVA 4FTSA 3SEEA 2HR3A 5L73A 3B93A 4EEQA 1K5MB 5FXWA 3VDDC 2BPA2 1J5EB 3E6DA 3L9DA 1EN5A 2N04A 4Y22B 1DTOA 3K04A 3GWOA 1X50A 3JYCA 5H6QA 2RDCA 1QGLA 5A3MA 2EJ7A 5LCWL 3A21A 1WLTA 4P9JA 4CS2A 5LBCA 1LGNA 2QQUA 2P4VA 4GX1A 4DV4O 1VAKA 4K40A 4XMAA 4YVWB 4DQAA 1B09A 1YLLA 3TXSA 4OMDA 2GTSA 5J2TB 2JWPA 2QGNA 3R6SA 1YI2V 5LBFA 2FZ2A 1RL3A 2UXBB 4WVWA 1Q8PA 4XAAA 5LRSA 5DAQA 3N9PA 3O1OA 1CAVB 4YM0A 2TNFA 4FTBA 1V0AA 3AKSA 3AMMA 1HDJA 2A79B 4RR3B 1YIPA 4PBPA 4JPRA 2VR4A 2UYAA 3CRCA 2KD7A 1L0NH 1COWG 2VVFA 1BVVA 1W8TA 4B7KA 3ME2A 2ZD9A 1Q90D 2VGDA 3ZCCA 4OUEA 3UQ8A 1ZZBA 5LHGA 1RC6A 4UCRA 4QX0A 4JTNA 4DR7B 2E76B 4ARXA 3RZKA 1OVPA 2HYKA 2EIMB 3NR7A 4HOOA 4R4ZA 3H1LH 5KA6A 3T2PA 2EF6A 4LF8O 3UESA 2HHHB 4UB6Z 4LUKA 1R3KC 2ZX0A 4O4HA 4PD4F 3QO8A 3JBG2 1OLME 2IM9A 1I94B 1QQP1 1Y43B 4Q4X1 4LHSA 2PHXA 1N3PA 2ZX4A 2CGNA 5C8CA 1QMJA 1DZRA 2GN3A 3SYAA 5ISLA 2JD4A 2I74A 4MXWB 1VAVA 1NY71 1W6PB 2X8KA 2XGXA 4AEDA 3UKMA 2KM2A 1R3JC 3K57A 1E5SA 4Z07A 4FPGA 2XL7A 1XOYA 3GALA 2GC1A 1EY2A 2OUHA 1OH3A 5FY5A 1ZZ6A 5K4LA 3VBOB 5A1FA 1FJGO 1DF4A 4HZFA 5D2AA 4UB8Z 3ACFA 1WMEA 4FLVA 4ASMB 5A7SA 4AEJA 4I0XA 3ZSJA 4RO2A 5L9BA 2JDUA 5AFBA 2UU9O 3CE2A 5K0UB 1RUC1 3MLLA 2QQWA 4O4JB 1IS4A 1CPYA 2IJKA 1QQP3 5FUPA 4X64O 2EBOA 4HETA 4AILC 2PYTA 4DV7O 5KC5A 3CRRA 1H1IA 5BNNA 1NXMA 1LOBA 3K5NA 3PU3A 1AYM3 1OOPA 2Y6FA 1KXGA 3BOPA 4QGMA 4QPGA 2ZGTA 4QPKA 5FZ1A 1U5IA 2AACA 3PN1A 4XUOA 2VQEO 4NXNB 5KXBA 4ZI7A 4EN8B 1VBA3 2PHFA 4QU1A 4K6BA 2PYJA 1SF9A 4LKEA 2WZR1 1XQNA 3HB3B 2VPVA 1XE8A 1R081 1VBC2 2AGAA 3T2TA 2WQZC 2Z5WA 1QDCA 4QQOA 1IXBA 2ADEA 4E4HA 3IDEA 3IMNA 1Q8OA 4P02B 1XNKA 2Y8KA 1V00A 5FZ3A 1DYPA 2D3OW 3RNSA 4FFHA 3AG1B 5IHRA 5C3SA 2BBVA 3ACGA 4XABA 4XF3A 5C33A 5ITZB 1R73A 4CA9A 4F6EA 1BMV1 2W6IG 3I2FA 4NHYA 4KNCA 1DBNA 5GKAC 4HKWA 2X0LA 2UXNA 2PF4E 2FL4A 5I93A 4YVWC 2Z4FA 1Q3EA 2V72A 5F6KA 3WT3A 2O8QA 3B02A 1AYN3 2QJ1A 3SH4A 1WB8A 4CDUB 4N43A 3LPFA 4DY3A 2GBOA 3PIGA 4ZHQA 4QKBA 3IWZA 4NROA 3ACHA 1VBB3 1SZTA 1LR1A 1JX9A 4H55A 1FOD1 5IVJA 1YIFA 4CYDA 4QXBA 3D3QA 4Q4V1 2R061 4AK3A 2ZAAA 5EZYA 4CDUC 3AJYA 2DVDA 1MQTA 3BVOA 3GJAA 1XNRO 4J10A 4QQ2A 3PU8A 3POJA 2BWAA 3ZN0A 4A7KA 1AL23 3DPRA 3ASNB 2FMYA 4JX0A 4MADA 2WLKA 1RM1B 1DCSA 1T2XA 2J7MA 5FPVA 4O4JA 1YTFD 2YIBD 5FPUA 3ZKUA 1WGPA 2ZHLA 3JALB 2JE7A 1UMIA 2RMU1 3ZBHA 1LGBA 4HVQA 4PDMA 2OKXA 3FBYA 1FXVA 1YNAA 4DXRA 2EIMC 5FZDA 1XMOB 1W6QA 1OI6A 2UY9A 3PUHA 1AF9A 4KBZA 2PFWA 2E7TA 3GGLA 2W39A 2VZVA 4QB6A 3IPVB 2WNVB 1FMD2 2QQKA 1KJLA 3LDRA 1FPOA 4LIVA 1PP9H 3E2EA 2Q73A 1PNGA 4NPMA 2H6BA 4UVBA 4KGQA 3RWRD 1KB9F 3MW3A 3A0KA 2BU9A 4ASUG 4QPGB 3AFGA 4X64B 2B7YA 5FYZA 2JIGA 3ZRSA 5JIUA 2GZWA 5DG2A 1YJKA 2XVKA 4CDQB 4LQRA 3ACLA 2ZOEB 4LNUA 4IGPA 3T0BA 4MT8A 4BQ4A 4D6SA 3NAPA 1RUG2 4E4ZA 4NE9A 2WABA 1J3RA 1QLEB 4CC5A 1ZBE1 3JD2A 1W9YA 2HH9A 1D2QA 4LC1A 1XBLA 5D21A 1XC6A 2DYRC 2IXHA 1X36A 1FJGB 1GO3F 4GKJB 1VBD1 2P6CA 4MV2A 4Y1UA 2WNVC 4FFBB 2XVLA 1MS9A 3OPTA 2QQLA 2ZGMA 1RVF3 2HWF2 4TV9A 1JOYA 1RUD3 2VTXA 1A34A 1BLZA 3WB0A 4Q29A 5T50A 2XDVA 1IPKA 2D6NA 5FY1A 4P9IA 4O2AB 4FM2A 4Q8LA 1LUVA 4CUCA 2BDRA 3N9QA 4NAOA 1UIJA 1QJU2 3H8RA 3IDBB 3ES1A 2CWSA 3E8HA 2F4LA 2SBAA 1BEV3 4TV9B 4LO4B 2FBEA 3I54A 4RS5B 2P4KA 1IKPA 3VDDA 3KG2A 5A6XA 4AI8A 2XJTA 3TXQA 4FLWA 3SCFA 5FQ0A 4MTGA 3ZDSA 1SQGA 1JJOA 4QT6A 2WZPP 2PHUA 1QXRA 4YJ3B 3LWCA 3ILFA 1X59A 3AL6A 5T5PA 2WFF3 5B1BB 2GUZB 1Z7S3 4QD2A 1AI4A 3RG0A 4FPLA 2JG8B 1VBD2 2F43G 4N9IA 2X6CA 1EV12 5J7MA 1QEXA 2QJVA 3T3YA 2I2SA 1KECA 1FOD3 1W0NA 2JKXA 1AR73 2OXBA 4DV3O 4JAUA 1PZ9A 1G8MA 3ZXJA 4C1XA 4LF6B 2W91A 4UW6A 3SJQC 2GNTA 1WJZA 2VQFO 2R30A 2HEPA 5GZDA 4OXSA 2EX3A 3E22B 4D94A 2XKPA 4KWJA 1UZYA 3CMEV 2JB4A 3FYEB 2BCCH 3AYCA 3K0DA 2YSUB 3JAWA 4I0WB 4TN7A 3O12A 4KHPO 2SLIA 4L8JA 5FPRA 1JA8A 3MIDA 4YW2A 2R16A 4GX5A 3POGA 3KGZA 4AL9A 1V9U1 2X10A 3W58A 3ZHUA 4CUBA 1SA0B 2K46A 1LHVA 3I2DA 4CU7A 5GM0A 5C5UA 4OQ8A 4XUNA 4JI5O 1Y4MA 4M0NA 4L8QA 3APBA 4GMP1 2ZGNA 2Z5UA 1Y3TA 1HB3A 4CS3A 2RJLA 1C8M1 4Q1RA 2HLEA 2F66C 1RMU1 5L7OC 1UX7A 4K35A 1D4M3 5IAVA 3BTXA 3WB2A 4IEVA 4HBNA 2IU0A 5FZFA 1BMV2 3QTCA 5LB6A 3LAGA 2JDAA 3OD4A 3THCA 3U14A 5J2UA 1GUIA 5LGTA 4Y3OA 1DDLA 3FB8C 1PK6A 3S57A 1F9KA 1W04A 4FXKB 4CP0A 4LR4A 1OKQA 1ZBA3 2QKAA 5DZFA 1QOOA 3HKCB 1XNAA 4U3JA 1NTZH 2FZ1A 5KUMA 2WA3A 2E33A 5F1RA 1JBCA 1GQPA 1FNYA 1MVQA 1KITA 1H8VA 2Q9LA 3I2IA 5HXVA 1KS4A 4C90A 4O9GA 2QQOA 4CCLA 1O3TA 3ABMC 2XJUA 2V4VA 3JXSA 3KD4A 1CX1A 2YEVB 4XJ9A 3VZJA 3VBOC 4XZPA 4IEWA 4PIZA 1AJKA 1DGRA 3RPQA 1ZZ9A 3ZN1A 3O1SA 3H3UA 3LB9A 1H2MA 3OYWB 1CJDA 2OCHA 4QQPA 3DF0A 1MG1A 1PIV3 4EYUA 2WYSA 1JYIA 5EIBD 4QPGC 4IE6A 5ERLA 4XQWA 2EIEA 1YVWA 1KGYA 5DUXA 4EWAA 3JAWB 1AR91 3FMGA 2BE3A 2BERA 2R071 5KBFA 3L72H 5LA6B 1VQ5V 3DGTA 3CC2V 3ECQA 1OBNA 4EB6B 2RMU2 1GV9A 4FFIA 4DUXA 3EXAA 1LAJA 4ICGA 4KGGA 4ES8A 4JI4B 2F4VO 3KV9A 2JJ2G 3JD72 3NQHA 4IXLA 1G9AA 2ZGPA 3K5OA 3ZX7A 3X2QC 2ZX3A 4QU2A 3SJBC 1XNTA 5A1LA 4Q4W2 4GYCB 3BEHA 4BIUA 3POWA 1IURA 2MW2B 4AEMA 4DUVA 4FOYA 2VULA 3JQXA 4YY3O 4ABMA 1H2SB 3WDWA 1XXNA 4JYAO 1RIRA 2ODMA 3CNAA 4UOJA 1QDOA 2BTQB 2V5DA 2IU3A 1PO11 4QX5A 3TBDA 3U37A 3CCUV 1LB2A 2RR12 3VKFC 4PF1A 1DHKB 2BUKA 4QQLA 1JFFB 2WT1A 4LO8A 5ITZA 1A3KA 1O4ZA 2VXRA 1VQMV 2R062 1Q81W 3PJSK 2WS93 5JXGA 5JJEB 3W7UA 4LA2A 3SH3A 2WLQA 3CMGA 2JDZA 3FBMA 3JALA 5LL6Y 5F3GA 1OQDA 2E7QA 1F15A 4JTDB 5DABA 5KXCA 4X62O 4GD4A 4Q4W1 4YW6A 4HZ3A 5FREA 2Y6HA 5FLXN 1H6XA 1GFF2 4V2VA 1IOAA 3D36C 3NVCA 3I2KA 1QJEA 2P4EA 5B4XA 4K9SA 4P5YA 4YM2A 1AR62 4KWLA 4IERA 4YW7A 4E9KA 5CG9A 2QQNA 4UCVA 3VD4A 3RRDA 3CRMA 1CIWA 5KHHA 3DSQA 4NIIA 4XILA 1SBDA 2GDFA 4XPVA 2ADPA 3AMPA 3ZMNA 2YXHA 2HVJC 3LZZA 5JI7A 2C6SA 3UNPA 3AL5A 3H3ZA 4Q27A 5DZEA 5DPNA 3RVHA 2ARCA 2NMOA 1ZRCA 4DR7O 2B8MA 3AEIA 5BNNB 3POIA 3WVJA 3MW2A 1IQAA 1W39A 1QJY3 4P14A 3F7VC 2LM3A 2RS52 4LE4A 2QTOA 4XQ4A 2HWF3 2VMIA 3K77A 2W1SA 1WB7A 3BOWA 5SV8A 4J7ZA 4CP9A 1T6GC 2FCTA 5IJ0A 4L9BA 3BU0A 4GAZA 2HWC1 1W0JG 1PM4A 4A6SA 2ZM6B 4LLOA 1I1EA 1GYKA 4XFCA 4LF4B 1VF5B 2ZEWA 4ITCA 2OTLV 2JDYA 3SDLA 3NJVA 2B46X 1XUQA 1QF3A 4E8CA 3ZRXA 2XMLA 3G4SV 2X29A 2YC0A 3KHCA 4LBEC 5K0UA 1JZ4A 5ANNA 4Z2AA 1EUTA 1CAWA 3MFCA 1GLHA 5LGNA 2IH3C 4FPKA 3ZFGC 1ZBA1 3K3NA 3MPBA 3T1HB 4LT5A 3MI8A 2BWCA 1JPXA 4TOIA 4J41A 3TETA 2C2AA 2W3JA 5E8AA 1UFIA 1OCCB 2FCVA 5E1RA 3VKNA 3I2HA 1FYUA 4DR5O 2TUNA 2P90A 3ZR5A 1XE0A 3HR9A 3E8GA 2LUWA 1E5RA 3AC0A 1SS3A 1PGL2 3WW2A 4R7CA 2Q8CA 2AEZA 1HRI3 1L0LH 3ZR6A 2AREA 3VKMA 5ACA2 5IK5A 1MS0A 3ZXFA 5FZ9A 4CCCA 4IIJB 1UYZA 5CKMA 4CU6A 3WF0A 3ZYHA 5B4NA 3OGJA 5FP8A 5FP4A 2JEXA 1JFFA 3S7IA 4CEYA 4NN0A 2ARBA 4WVMA 2KQXA 3IMMA 1S0EA 5CBGA 3TRSB 5DMYA 4LIUA 2VW0A 2JX9A 1WD4A 1AR4A 2BGCA 3ST7A 4P5HA 1P84F 1M90W 4G2KA 2WZ8A 4AVVA 1WA4A 3LD8A 1GNZA 2OW4A 1Q6UA 1EZVH 3VHNA 3ZN5A 1RMU3 1U5ZA 2NQYA 5BNOA 1VBE1 1WUVA 4AVBA 3Q8BA 2IUWA 1AR63 2WBKA 1IBMO 2CU5A 1O3SA 4ARYA 5C8CB 2AR6A 1HRV2 1W3XA 4IQPA 4ORFA 3A23A 3ETGA 1BJQA 1US3A 2Y6JA 1F5FA 2WWUA 1DQ4A 5ABJC 2WA4A 3SYCA 2Z42A 1XNQO 4EKWA 1COV3 2CE4A 2E3CA 1E1RG 4J80A 1XREA 3ZYFA 2F93B 3C7EA 3ZRWA 5AC93 3OGVA 3D3AA 3QCWA 5CA0A 1TUEB 1J95A 1TMF1 2I45A 4FQZA 2AENA 3EXUA 1NCQA 1M57C 5BNOB 5B2GB 1F4NA 1N8RW 4BZ4A 2HWF1 1IHMA 2RJ2A 2ZE5A 5FZCA 1ZBE3 3WDTA 2OX0A 5FO8B 5FIXA 1SKVA 5DXDA 1RYYA 1VBE3 2BSKB 3J8F3 3MGUA 4MVQA 1W9TA 1LULA 3V0BA 3C90A 4HONA 4AAXA 4DIQA 1PL4A 4C91A 1CAUA 4X1KB 2D6PA 3VBBA 5BZBA 2F4VB 4IE5A 1XMQO 4X1IA 2Z0AA 4LCUC 1ALYA 1SBFA 2B42B 3ITQA 2EICA 2EXHA 1TQ5A 1S4CA 5KLVH 2XAHA 5DAWA 3LE0A 5HCBA 3I55V 4QXKA 1W6NA 2PI4A 2HWE3 1LENA 3VZKA 1MA1A 2X6BA 2MEV1 3I3BA 4M4PA 3KLSA 2RMU3 1V9U2 1MPXA 2CH7B 2W1QA 2DURA 3OSDA 4KUMA 1OHFA 4E4SA 1UF2C 4Y1YA 2V5YA 3WB1A 1NCRA 4CSWA 1KYOF 1LNQA 3ASOC 3E35A 1AJOA 3PL0A 1QIQA 3ZMOA 2IXIA 2VZUA 4LORA 1MACA 4X1IB 3E86A 3F5WC 1SLAA 3T2MA 1K5SA 3RWKX 2C26A 4F6RA 3CHXA 3RJ2X 3F5TA 1BQPA 4GXLA 2A6ZA 2BSKA 4RS5A 1QWRA 4MVUA 1C8M3 3P32A 3RZMA 2W6JG 1TGOA 1DGLA 4LNVA 2J1EA 1CESA 3S5QA 1GSLA 4QGPA 3O1UA 1Z2GA 3DYPA 1ZRRA 1AXZA 1SLLA 3BCWA 2YU1A 1JVMA 1K33A 1I7FA 2FMDA 3THPA 3I56V 4WFGA 3ZJZA 3T4HB 1Y66A 5EHDA 4MW8A 4Q4Y3 1JYXA 3W7XA 3I5DA 2IH1C 3K4DA 3O1TA 5J98B 2WUHA 4MVSA 2ZGLA 1JOJA 4AHXA 4PA7A 1HB4A 2YZ4A 2EZOA 4HAMA 5JOZA 3I4IA 1XB9A 5FYUA 1L7RA 4XBNA 3IC9A 5KXDA 4JGZC 1KJRA 2R043 1IGOA 4MGTA 1HJGA 1HQLA 2FMLA 3KM5A 4DRVA 1S1AA 2BYVE 5C3RA 5KMGB 1JMUB 4GJZA 3I59A 3CXHF 2ZKNA 2F23A 1UNBA 1JYVA 3PUSA 1JTZX 4BQ1A 4LFBO 3QOPA 5FFOC 2AW9A 1CZTA 1AILA 2JGDA 2VUAA 3UK9A 4I09A 2R073 2CV6A 4D69A 3CU7A 3AKQA 2VVEA 1FV3A 4LF4O 1SG3A 5FXXA 4AQYB 2WNVA 4Q4V3 3OE7G 4C0BA 1HXS1 2W0FC 2Q8OA 3GZUC 3CB2A 2QM8A 5FYMA 2ADDA 2DOSA 4B3TB 4UFHA 4JGZA 4UCUA 2DDUA 5A3PA 5A7NA 3TEZA 3INAA 4Z92B 4RHV1 1UY2A 3J8F1 4ZKTB 3WP3A 5KR7A 1NH2B 4HPKA 4KI5M 2YXSA 5JI9A 3H8XA 4LWSA 3VBRB 5IUQA 5IATA 2HWB1 2D5HA 3VLBB 4FAHA 5IWAB 2EILB 5A3LA 1Z7S2 4XFFA 3U0ZA 4G3YC 5EZYB 2E74B 4HYOA 4R6ZA 1UKGA 1US6A 5EBLC 5BMVB 1HNXO 1RXGA 1DYKA 4M01A 2W95A 3MW4A 4GH4C 3JAMN 2BTOA 1H9PA 3V0AB 3VDAA 5FZIA 3ETEA 5K8SA 4DXZA 1LGCA 1HX6A 1WW5A 4BMEA 1AVMA 4S2GA 3U07A 3LDEA 5L3DA 4ZPIA 1BEV2 2IW5A 3WP6A 1UXXX 1K3IA 3FLTA 3HMYA 3BAAA 4PLNA 3WG2A 1H2KA 1YI9A 1PNKA 4QPIC 4XYXA 5JJJB 4B3MB 3HKDA 2OTJV 2QM7A 1LU2A 1Z5VA 2EVXA 2PY5A 5F7UA 3J7NA 4LBQA 4Q0SA 1SQQH 4RHV3 1JMKC 3AP6A 4XQDA 2ZNIA 4BAYA 3Q8EA 4J9YB 3TEYA 3OG2A 2BGOA 3ZYPA 4RL7A 4GUNA 2W0XA 3RFRA 2ZQMA 2XAJA 1KFXL 3BGAA 4OPAA 1RUE3 2RN9A 4CCDA 3TOJA 3M1HA 4HN0A 4A3ZA 3RI9A 4IL7A 2GU9A 3GCWA 4AFMA 1WA6X 3BFRA 1Z5WA 1S0VA 1KD7A 2RMKB 4DR6O 3UL2A 1H8TA 5EYXA 1Q82W 3A0RA 3BYWA 2GP5A 4YRDA 5LY1A 2GMEA 2WSVA 4UFLA 2Q0AA 4Y1VA 4OX9B 1KP2A 2RS51 4I9QA 1ZBA2 4XE9A 3LNMB 1AL0G 1VIBA 1XILA 3LEKA 1XSQA 4TV8A 1DZTA 5FYYA 1YHFA 2ZGKA 3SQOA 3VBUB 3RYHA 4AFCA 2WS92 3NW4A 1V9PA 4MVMA 4U7OA 2BZDA 5CA1A 2C4XA 2VS0A 1JN2P 2QVSB 4BMBA 1KUQA 3ZEDA 3MV11 1ZNPA 1R1ZA 5CBLA 4BIFA 2F6BA 1A32A 4TWKA 4X1YB 5LP6C 3MDPA 4JI7O 4OHXA 2WQ8A 5H9PA 2DYRB 1W90A 1WW7A 4RQEA 5LATA 3BPSA 5FYIA 2EIKC 1US2A 5CFDC 3OMNB 4UYBA 1X33A 2ZEXA 3KT7A 4KHPB 1W2BU 2YUEA 1H6YA 3CCRV 4J6GA 3RZHA 1W6NB 1W3VA 1ND2A 5J1XA 2J1TA 2CTPA 4KWKA 3BRCA 1VBC3 4XUTA 4R9DA 2JK5C 2PAKA 4LPLA 4CDQC 1GH6A 1SLBA 4IV1C 1R1A3 3HAGA 3ZDVA 1FPN3 3CL1A 2XJRA 2CGOA 4PDWA 1OXCA 5EP9A 1C8NA 3J4UH 2W2IA 2YIBA 2EINB 2GNDA 1SQFA 4X6QB 1S55A 5JXIA 3I97A 4JGZB 3K03A 1DIWA 2FDFA 4PA9A 2WO3A 3H0OA 1FXZA 3OUHA 3DTUB 3T1CA 3UM7A 1GTOA 3CCJV 4YHHB 2BOCC 3WG4A 2CHHA 3I7DA 2YY1A 4BIZA 4F7ZA 1RB8G 1SQPH 3VN4A 1YJ9V 2VOVA 2VY0A 3TCUA 2ARXA 1RP3B 2ERFA 4UBHA 2C1FA 4NB5A 4MTXA 4COZA 4DEQA 3A0HZ 4KG8A 1RUF1 3USSA 5GZFA 1UU4A 4ZS2A 4IGOA 3ZXDA 3HKEB 5BNNC 2KG7A 2PAEA 3HOBA 3POBA 3RMYA 4KBBA 1GZCA 4DR2B 5E6HA 4LO7A 1SQVH 4WM7A 3NRUA 3ON7A 3W5NA 2LFRA 3I3MA 4C1WA 4QB2A 1TEIA 2WT0A 4K3UA 3J81N 2Q8EA 1YQCA 4Q4X2 1W03A 2XUMA 1IS5A 4GH4B 4DEVA 2NMNA 1K5QA 1GOFA 3A22A 1HKDA 2YBSA 1GMMA 3T4ZA 5GTIZ 4W50A 3LDDA 4AEKA 5FJHA 2QE7G 3CCMV 2IVIB 3VDDB 1N36B 4LF7O 4LBMA 4BHPA 5J2TA 2YEVA 5JOXA 4NXMB 3K79A 2IC1A 3HN1A 2WWWA 2Q5ZA 1G9FA 2OS2A 3N3HA 2UWBA 3QO5A 5LGUA 2ETEA 2LW7A 3OBTA 4IT5A 2RQ6A 2VCMA 4A7YA 2QKDA 4CH4A 4IIJA 2ZNJA 4AEDB 3STLC 3CJIB 1O3QA 3FB7C 5EYPA 4AQTA 1V6NA 1UZVA 1MEC1 4K8XA 4LK7A 3ZXLA 3LDBA 4MVTA 1K45A 4DUYO 4MGSA 2XH6A 3AVRA 5E89A 2PQSA 3DKWA 1QKQA 3BI3A 1ZZ7A 1MS3A 2XAQA 3Q8AA 1ND3C 5J48A 4CVUA 2RDQA 1AYM2 1CR7A 3GBGA 4JKLA 3HNMA 5A1AA 1SDDB 5D5QA 3PNAA 3CCEV 5DQ0A 1ONAA 3ZYIB 2OZ6A 2XOMA 1AX1A 4OULA 4CDQA 5FPAA 5JCOC 1YJWV 3CDZB 1FAFA 1AI5A 3USUA 1JZ2A 4RN5A 2DCJA 5D5PA 2XKOA 4JQRA 1FFXB 5FZ0A 3FX3A 4YXWG 1COV1 1R1BA 4D8MA 1QH7A 1IZ3A 5FYBA 2XBO1 1BK1A 2NM1A 4K8RB 1RITA 2DU1A 1VEWA 3POEA 1W8FA 4CCKA 1ZA4A 1ENSA 1K73W 3G71V 1G6UA 5IWAO 4I5SA 2D5FA 3PTYA 3ZSKA 1AUYA 4QKNA 2VD7A 1YCIA 1SCSA 3QH6A 4XMIA 4E4DX 3K9AA 4H0LB 4YARA 2O8OA 3PUIA 3C7FA 4GJYA 1C57A 1HNWO 2YPJA 4SLIA 5IYDO 2XHBA 3RS6A 1CAXA 3IKWA 2VG9A 4XDPA 4V1PA 3K5LA 2DYSC 3ABZA 3BVCA 3JSNA 2UYBA 3CX5F 1ZRDA 1SZBA 2V09A 3FHIB 5F9TA 3H50A 4HK8A 2GUZA 3U11A 2CL2A 3FUOA 1HV0A 4DINB 1JU3A 1QBZA 3CCLV 1P8JA 1POQA 2CK3G 5H5NA 3KZIZ 1NA1B 3MUY1 5T3NA 1WWYA 2HFEC 4WM8A 4UFMA 4HSJA 5IE9A 3KCYA 3GHNA 4YG6A 3U4XA 5LA1A 3JB8A 4L87A 1UPIA 4FVMA 4FPOB 2UUAO 3MIFA 3H9AA 5EFUA 3IPVA 2LRPA 2JDMA 1V54B 3AZWA 4AR2A 4LEJA 1VQPV 3H7YA 3WDVA 4DV5B 3WG7B 3IBMA 4Q4X3 4DR6B 4MSVA 4BIOA 1BEV1 1QQCA 1J5EO 1KC8W 3K48A 4LXLA 2P2KA 5LZ6A 2K0GA 1AL22 2P06A 3X2QB 3VBHA 4TQDA 4FBFA 3VDCA 4J7KA 4Q4W3 2AZ2A 2HWC3 3OTFA 1QLEC 4WF9V 1N1TA 3ZIXA 3ZMTA 4Y4RA 4BH9A 2DVAA 4F8AA 2Y0IA 3CCSV 2X5IC 3FZ3A 1YFXA 5F32A 2Q7HA 5LK5A 3KQRA 5JH7A 2WQ4A 3AKTA 3C3TA 2YMZA 3RYHB 3AP4A 4A6OA 2YU2A 3M99B 2WFF2 1UU6A 2QWPB 5JZGC 1HB1A 1ND2B 2FD8A 5CB4A 5LEKA 5IWFA 4QE9A 1TVGA 2X5IB 1GZWA 3U10A 3MAQA 3JUUA 1V9U3 2FDJA 4UFIA 4W4LA 1W6OA 4LE3A 5JJNB 1Y74B 1OLMA 4LBLA 2ZE6A 2Z79A 1NCQC 4FLYA 2OQ7A 4N43B 5KXEA 1ZM1A 3VBHC 2ILMA 1EM1A 1IKQA 4YG0A 4JCKA 4UBGA 3NSTA 3VDBA 1OZ0A 5JPMB 4CC6A 3NAPB 5T5OA 5A3UA 4FZ1A 4DZGA 2EALA 1DQ5A 4ZXEA 1PV0A 3TYJA 3BN6A 1OJHA 2PHDA 4MHRA 3LEIA 4MGYE 3U75A 1QY4A 1QR9A 1B6QA 1E1QG 1XJAA 3QLQA 4MGQA 5I0TA 3L2HA 1GP6A 1GICA 4QPIB 4B29A 4YHHO 3QACA 2HWE2 3SISA 1IPJA 1VQ4V 2E9QA 1PVXA 3KSCA 4L99A 1X8EA 5GZEA 1HQWA 5FXZA 3PTRB 1XPWA 1FFTB 4XUQA 3AYEA 1UZWA 1O5UA 5FRAA 3AXEA 3M4FA 2Y48A 2HWB2 4YG3A 4QPYA 1WBFA 3VBOA 4CZZA 1QU7A 4OHZA 2VC9A 1RHI3 3BA9A 1RUJ3 2L9LA 1MABG 3B2EE 3ZOIA 2UUCB 3ZFFC 2NN8A 4QPWA 3ZKYA 5A3WA 5D8AB 3HVDA 4JHZA 5FY7A 2WKKA 5FV3A 4Q20A 4QKFA 1QXJA 2BFUS 3RT3C 5FYSA 2P34A 4JI8O 2XLGA 3WNKA 3V0AA 1RUI1 4IEQA 4AOCA 3BABA 1IPSA 2XL9A 1ZX5A 2LW1A 3WD5A 1CVNA 1OF4A 3D0SA 3E1F1 4ZIBA 4YM3A 3ZHTA 1MZ5A 2VE1A 2VQFB 5EYYA 1ZZ8A 2E26A 3O9OA 1IVSA 2Y26A 5KHKA 3AZXA 3SPCA 5LMUO 3DXRB 4XACA 1RUE2 2MHFA 4J1WA 4UW4A 1C5HA 4W4KA 1U5XA 4K7JA 1UY1A 1LHOA 4O7XA 3NNJA 3WQBA 4WM8B 1O9GA 1WMFA 3ZFEA 1Y67A 2CAVA 1HW5A 2WAOA 3FB6C 4MHUA 5AC92 4J9ZB 1WPXA 4YFWA 2ZXWB 4E4EA 4PLMA 1ULPA 4J11A 1DF0A 3ZFFB 5KAFZ 2DBNA 5D8AC 2HP8A 1GQGA 1VBA1 4CUGA 1GWLA 4P9WA 3HPLC 4WV8A 3FN9A 4BB3A 3TEXA 1JYWA 3MHSC 4CCNA 2QZ2A 1BVP1 2IFWA 1O7FA 3RWNA 4LBQD 3HBZA 3WDUA 1RUJ1 5EJZB 1WCQA 1PO13 1Q8VA 4GWMA 4X89A 3JB4C 3WCSA 5J37A 4H2AA 2ZDIC 1J84A 4IV3C 4Q0QA 4ZOLA 3K5MA 1MSWD 3DCQA 1POV3 4IEXA 4PBOA 2D6MA 3WU2Z 5L3GA 2DBIA 5FYVA 1REEA 2ZGUA 3HQUA 5FPZA 4B3TO 1LOAA 3IAYA 1VARA 3WY6A 4E8DA 4P9YA 2WSUA 2GH2A 2JE9A 3W20A 1NE4A 4MGIE 2JS3A 2UXCO 2VNOA 2PTMA 4PIXA 2QSAA 3QH7A 2B5UA 4AI3A 2ZAHA 3VOUA 4UW5A 4OHVA 2F17A 4JI8B 2W1UA 1T6BX 4PF5A 1BXHA 3DXTA 4WBBA 5TISZ 1YYNA 5F3IA 3UGGA 1D5NA 2WZR3 1ZYBA 4IHJA 3AKPA 3LIGA 4RR3A 2WLIB 4YW1A 2UXBO 1HRI1 2H0VA 1KMIZ 2XOKG 1JZ8A 1A78A 1VPHA 1QVGU 5AVPA 2JEMA 2OPWA 4IEYA 5KA5A 5IK4A 1ND3A 2OWOA 3ZHVA 4GWIA 1JI6A 1B04A 4DUZB 3FJSA 1JHJA 5LRRA 5ABJA 3GWKC 2ZTNA 4E27A 5IK7A 1ZA7A 4UUJC 1VMFA 4XXAA 3U78A 1Q8IA 4O2BA 3M7AA 4YZ2A 4I0XB 4Y22A 3VBSC 2ZXQA 4S2DA 4OGQB 1WLDA 3AYDA 1LCLA 5H9QA 2NZ9A 3I2GA 1ULGA 4PQ9A 3H7JA 2DMXA 1SPPA 2ZHKA 2ZE8A 4QXCA 1UOFA 4M3CA 2G4IA 4BJ0A 2VQ0A 3CIHA 5CA6A 1HRV3 5GZCA 3WR0A 1V6IA 1R6KA 3RYFA 1W6PA 5A3OA 2GNBA 5JZGB 3HPNA 3OPZA 2DW4A 4PV1B 4ZHNA 2BGPA 5BNOC 3MPPG 2HG5C 4QGLA 1GWMA 1R082 2VOWA 4BM8A 5EIYB 2RS31 5E88A 1AHSA 3ETQA 5JVVA 4QIWF 4A3XA 4UF0A 2W52A 3O0WA 2OUJA 1OFSA 2FDGA 5FAXA 3TGUH 1BK0A 1F51A 5GONB 3GZAA 3UO3A 1QJFA 4R8CA 3IZOA 2O1QA 1TMF3 4CPBA 3KKYA 1ZUQA 4XAEA 4DRXA 2JGUA 2NLRA 2ZACA 4I3GA 1UL9A 3CS5A 1Y76A 2VMGA 1TUBA 2RS53 1DLCA 4UXNA 1DGWA 2Q67A 1OCRC 4EJRA 3FFQA 2ZDIA 4GH4A 4WM8C 2VMCA 2LJ2A 4XFAA 5DUVA 1N34B 4K1YA 1RUG3 1KQSU 1WAZA 1NS1A 1WKYA 2BTVC 2HWD3 1E79G 1L3JA 2JDKA 3H1MA 3JBG1 1NTKH 1YUDA 3OW2U 1TVKB 2R1BA 1MZ6A 4LF7B 3DXUA 4QB1A 4QJFB 2P67A 2HWE1 4CU8A 5LA9A 2YICA 1RPOA 3NL1A 5EBMC 1FMD3 1W9SA 1UWWA 4HNAA 1D2DA 2YXLA 2LALA 2VOXA 3H3LA 4KP4A 4TSVA 1ODMA 3UGHA 1NBMG 1PM7A 2E53A 4EE2A 5G04L 3KT1A 1FPN2 5JDBA 2OIEA 3IIIA 1ZBE2 2QTWB 2ZT9B 5B3SB 4PQQA 5JCTA 4F83A 4JGYB 3W7TA 3SPIA 1GQHA 2DCTA 1N1SA 4N8MA 5CKNA 4RUFA 3B69A 1E5HA 4YYOA 3FLPA 4K8FA 5IVEA 3ZMZA 2EAAA 5JVDA 3VBFB 3OUIA 1LRHA 4BW9A 5T52A 4Q4Y2 3JD4A 1NU1H 1N3QA 2HHHO 4GA9A 3E83A 1VF6C 4H44B 4OX9O 1TG7A 4DV2O 2VZ1A 2Z69A 3AG1C 2ORZA 4X1YA 2XBO2 4D3WA 2XONA 3KF5A 4LO6B 4PDWB 3QVNA 4YJ2B 4YZ5A 2XUEA 4AI2A 4AG4A 1REDA 4XW3A 1LECA 4B3NA 5TSWA 4OQ9A 3ZYGA 3PJQA 3FE5A 3OFNG 3X29B 1FMD1 3IB3A 1RTVA 3MLKA 4QX8A 4QDRA 3ICXA 4AVCA 4CEWC 2FB5A 2JEUA 3CO2A 2ZIMA 2JICA 4RFRB 2VMHA 3PJYA 5I0RA 3JCUZ 5FZ8A 5JUVA 4ZBMA 4IEZA 5DDJ1 4FFBA 1Q6IA 3Q4HA 4YVSB 2J42A 5GLZA 2ZCEA 3H1WA 1OCZC 3E89A 1WLCA 4HKLA 3C7OA 2VNVA 4K3AA 1PHMA 1JOBA 2ZZJA 5LMUB 2Y60A 5KX5A 2R9RB 4RSUA 4R52A 4CEWA 4XBLA 1K5MC 3WV6A 4R9AA 1TME1 1FXKC 5CBFA 3AKRA 3NV1A 2J1VA 2UUBB 2QBXA 3AP7A 2A70A 4ONUA 4LNUB 3CCQV 2DTYA 3EJKA 4IEUA 1GNHA 2ZINA 3JASA 1H0BA 2OT7A 3CBNA 3P30A 1H38A 3PVOA 3ES4A 5FZHA 1LOCA 5IFPA 4JTCB 3RBZA 5ANQA 3WNOA 2OCCB 4LP8A 5C8CC 3IDAA 2VUDA 2IXCA 4BISA 4LF9O 3WHTA 1U96A 4NIGA 1RSOB 4Y5TA 3WQ7A 5GLTA 3DN7A 4QNHB 2WWJA 1GRJA 3M8LA 3C3SA 1SLTA 1MS4A 1W2OA 3DYMA 4GALA 4JYBA 3WP4A 5CAZA 1IX9A 4DR4B 4I3PA 5IVCA 3CJIC 4L97A 1N0JA 3ETDA 5FWJA 4DV5O 5JSRA 4HSLA 1CP9A 3TJTA 3H1HH 2VZ3A 3K75B 4UAPA 3MUZ1 1HRI2 1NYWA 1SRYA 4M3CE 4CP9B 1H1MA 3O0XA 1VRBA 2XR4A 4UT5A 2EIGA 3CSXA 1Q56A 1MVEA 5LOVB 2HVKC 2A1XA 2RM22 4TQFA 4AXOA 2RDRA 5F3EA 5JCOA 3LSDA 2WO7A 3OUSA 3WW4A 1MS1A 2VQUA 2W68A 1HNZO 2VBPA 1XI1A 3OGSA 3MIBA 1ENXA 5T5LA 2ENRA 1OFNA 4QXHA 3ZN6B 1G8WA 3PLQA 1VQLV 4JGYA 2WZEA 5FDBA 2VZRA 2IFRA 5C3OA 5CYYA 1XHZA 1QJX3 2A3QA 2P6HA 1W0KG 1MS8A 2VVDA 4DV7B 2TEPA 5A7OA 3UT5B 3HKBA 3H1IH 3IM0A 3NV3A 4TUYA 1AR72 3KB5A 2Q0OC 5CKQA 1VP7A 5BNPC 3B8MA 1PIV2 2YYOA 2BFUL 4LO5B 1RJ7A 4JGYC 1DK1A 4D6TH 2PHLA 3T1YO 1AJNA 2JB8A 1W28A 3OF1A 1U97A 3LDKA 2N74A 3A2FA 5CG8A 4QQHA 5FLIA 3SC7X 4NPLA 4YGEA 1W9WA 1XMQB 2G19A 1OURA 4R50A 1S0IA 4I0AA 4HLTA 3PMSA 3PVNA 2O57A 3N7KA 3MF6A 3SNMA 5I8SA 2OPKA 1BZKA 1DFQA 1S76D 3K0GA 1DGSA 3B4SA 1ENVA 2TBVA 2VH9A 5FNVB 5IAXA 4LF9B 4DR2O 5DZGA 3RYRA 1GM9A 3S3XA 2XLFA 5LP6B 4NTXA 1GKFA 1RGSA 1ZTEA 1HXS3 2A71A 2W46A 3WINE 5LA6A 4ZXKA 2Q68A 5JOWA 4PA4A 4BDVB 2OQ6A 3H01A 3KWVA 1QJU3 2ZGRA 3AJZA 1I9RA 4U3FH 4CTEA 4UF0B 1O4TA 1S2EA 4YJ2A 5GALA 2RS11 3ABLB 2XXZA 4YIOA 2VMFA 4AQ2A 4PLOA 3L73H 3CZUA 1AXYA 2UXXA 1I3HA 2A06H 2ZX1A 1S0JA 3LOBA 1YTFB 4W65A 3J8F2 4OI2A 3OGCC 2CAUA 5EPAA 5GONA 5KX5B 1PVC3 2RR13 2JD9A 1SDWA 4IEPA 2ZR2A 1O8PA 3FUQA 3PHMA 1FPN1 2N7GA 4AVTA 3KGLA 1JUIA 4FP3A 1NQTA 3OY8A 1MMMA 3HQXA 2Q1FA 3BTYA 4DR1B 3D6EA 3AK3A 4XBFA 5JPNB 3TB0A 1CPNA 4LF5B 1Y6XA 1SCRA 1WPBA 4U7NA 5KHGA 4BQ5A 4LA3A 2VWKA 4X8PA 1R1A1 5BPXA 4I55A 1WW4A 3OYWA 2BOIA 4CCOA 1PPJH 1CZVA 3THOA 3G67A 3I3EA 3NV4A 5GLUA 1C28A 1H1AA 4AI0A 4LMFA 3D3IA 4PDWC 5LBBA 5C93A 5A2QN 3N35A 3GF6A 4XDKA 2ZMNA 1CAUB 1VLNA 1ULCA 1YFWA 1G6NA 1QLNA 1QJU1 4FLZA 2WDBA 2JIJA 5IYZA 3EQEA 2DV9A 3V0BB 4MG2A 4DUWA 1LOFC 4ATFA 1REFA 1I5XA 2Q69A 1D2SA 5FR3A 4YY3B 5HCHA 4DV6O 5FZMA 2A3YA 2WL1A 1RUNA 5BR8B 3LGRA 5A6QA 2Y69B 1SACA 4JDOA 3M3QA 1O5LA 1MNGA 3FX7A 2Z3YA 4QE7A 5GLVA 2RV9A 4WFHA 4CUAA 1P7BA 4B4RA 5HV4A 1LOGA 2QNKA 2C9AA 5JMOA 2VCAA 1ZVFA 5B5EZ 2ZXWC 5FL7G 4FOQA 4XOGA 4K0KB 1W59A 3LUTB 2HKXA 4E2SA 1TME2 4B3SB 1ULEA 1RUF2 1UMZA 4IESA 5F2SA 3ZN4A 3WQ0A 2ZEYA 3CEIA 4AWDA 3WF2A 3MIHA 1Y4WA 2ET1A 2A6WA 4ZU5A 1JOPA 3A8TA 3OEHG 1XNQB 1W8OA 2VZOA 2RG4A 1CAVA 1W2TA 4DRRA 3A7QA 2XASA 2D6KA 2BOJA 4XFIA 3WQ1A 1N1VA 4FPEA 4IW3A 5CFCB 3DYOA 2HEYF 2E31A 3WF4A 5L7OB 4ISRA 3RYKA 4ET7A 1EV11 2VMEA 2YIAA 3NXSA 1XU1A 2W9XA 4XHBA 4S2FA 2XJPA 4D0QA 4ZOLB 1I0HA 5B1AB 4UCTA 1PZ8A 1Q8SA 4R9BA 4H3WA 1OMIA 2I07B 2VOTA 5GW7A 4W6XA 1R6TA 2DU0A 4O2AA 2Y38A 1POV0 2YBPA 1JXNA 3CC7V 3NKTA 4CDWC 1R64A 1NR7A 3MYXA 1O8SA 5GLWA 3VBUC 3LSSA 2CNAA 1RUD1 5C9AB 1XHXA 1R091 1ODNA 4FJCC 1M06G 1VQ8V 2QKSA 4KFMA 1OCCC 4ZZ8A 4FSJA 1BMFG 2VM9A 3B9IA 1OH4A 4A45A 2R32A 1OCOB 4DMIA 4NUBA 3B77A 3VB9A 4BQ3A 4LFAB 2KR2A 1QU0A 4WBNA 3DXRA 1XNBA 4M4RA 1HW7A 4DV3B 3VQVA 5K7PA 1A6CA 1ZREA 5FZEA 3UKTA 5BNPB 4WCEV 2XJQA 4COVA 3LSEA 1MOFA 1ASJ2 4FOVA 2DCKA 1N1YA 3ZPYA 1H8TB 5E16A 3BU7A 4CDWB 4QM8A 1YRZA 5J3UA 1RUI2 1AR83 2XJSA 1EUUA 2BJSA 4FLTA 3HNBM 4FM0A 4I01A 4BXFA 4DV4B 2VBBA 2BNMA 4UVCA 5FZ4A 5EJ1B 1WA8A 2B5HA 2FTKA 1N34O 4PDRA 5IK8A 3SKJE 1OA3A 4Q26A 1AXKA 1NCRC 2E5LO 5JR7B 3UGFA 3CJXA 2Q8DA 3JU9A 2X6AA 3JARB 5FUNA 1GANA 1X82A 1KRIA 1YWKA 2ZBJA 1HR0O 4AW7A 3SR2C 2GV9A 3HNYM 2IBZH 1LTEA 3NJXA 2RM23 3NV2A 3VD9A 2QE3A 2J1AA 4CDXB 3SJCC 3DPRC 4GKJO 4XIKA 1WN7A 4R4XA 1K5JA 1W6OB 1LODA 3OGIB 4NVPA 1BSMA 1UKRA 4XF4A 4YZ4A 2QR4A 2W94A 2PLV3 1NKGA 5IYBO 3FAVB 3WDYA 2WR9A 4FFFA 1V6JA 2MPFA 1W2NA 2PN5A 2BNNA 1AR92 2PHTA 3GHMA 3W5MA 4DW1A 5LYJA 2J1SA 3EHKA 2ZCWA 2ZA9A 3KS7A 3OGGA 4CZSA 4L92A 3MHHC 1H2GA 2IWGB 4LULA 5FCCA 4XXPA 1O9HA 4YGDA 5F5QA 4QAWA 1PGW2 3OGRA 5BNQA 4N53C 5J96B 3NNMA 4GLXA 3FD9A 4URTA 5K9YA 3CMAV 3VBHB 2A0LA 2Q4SA 1UD1A 1D4M1 3HN3A 3FHQA 4B1LA 2RHPA 1WMXA 2A7AA 3N7JA 4PA3A 3LDCA 4X66O 5CN0A 4TLGA 1FKAO 2XPJA 3CCVV 4PT6A 3R05A 1DGRN 3KVAA 4FPYA 3ZSMA 4MX3A 3OD0A 1WCDJ 1OCZB 1MZEA 2F1MA 1K4CC 2PLV1 5I8TA 2JRIA 3AYAA 4AHYA 1NZCA 5FUIA 3RYCB 4RGKA 4JI0O 4YW3A 4RUEA 4ISQA 1UXZA 3F2ZA 3VBFA 1B06A 1WP8A 2OIIA 3MO4A 1XDCA 4ASKA 3WW3A 3JASB 1TMF2 3AP5A 1W9FA 5FMOL 1DG6A 4X6RB 1GN6A 3D5OA 5IFTA 5EJ3A 3BODA 3K3WA 3LIHA 4TLFA 4TYSA 2ZKLA 4UV9A 3VD7A 1Z0HA 2FDIA 4BK5A 2E5LB 2WC2A 4HXCA 4IYHA 4YNIA 1POV1 2YS8A 1XYPA 5FPXA 1H4HA 4X8NA 4KU8A 1AYM1 1PZ7A 5FPOA 2A7WA 5L3BA 1W99A 2D93A 3H8OA 2WLPA 2H94A 4A5UB 2G9GA 2BP6A 3AXDA 4AFBA 4KU7A 2DWDC 2D40A 3JCZA 3KHBA 1S2BA 1S0CA 5FZ7A 2PHRA 3EBRA 3WSOA 3JSLA 3D82A 4HG6B 1CWPA 5CFDB 3ENRA 4LHNA 4EWEA 2WNUB 3U4SA 4LF8B 1AB3A 1PO22 2WJSA 5C9AC 1SFPA 3APQA 2A75A 1UPGA 4CS4A 1ORQC 2B9VA 1Y76B 2BNOA 4N7IA 5J9PC 4MVRA 1RVF2 5JQGA 2DQ3A 1BBT1 3RYIA 2JDIG 4B3RO 1PX4A 4DUZO 4GT1A 4RQPB 1M56B 1W8ZA 2ATKC 1M9NA 1I08A 3RYPA 2E6VA 4X65O 3C2UA 3FYIB 1W6MB 4EWDA 1L1FA 1SC5B 4AVSA 5CISA 3CRQA 3HKCA 2AYHA 4IE0A 3GM8A 2LGWA 1SFYA 3H9VA 5JSOA 3HR0A 3V56A 1V55B 3RZJA 1PGSA 4GWJA 1DGWX 1LEMA 1ULFA 3G6JB 5EYPB 5BNPA 1K4DC 5EC2C 1I5YA 1TME3 2V4AA 1C1FA 4WFBV 5ACA1 3LSQA 4RA0A 2DVFA 4PI2A 4H37A 5DDJ3 3PDQA 2K9ZA 1OF3A 1TZOA 3IAPA 4FOWA 4M3CB 1NAEA 3WCRA 1O6UA 4NIDA 4U36A 5FZ6A 2QCSB 3OUJA 4X1KA 2YC4A 3K9SA 3ZHSA 1LESA 3ORJA 2CWMA 3S3WA 1S2KA 2DCYA 2OYZA 2AZ5A 1XRUA 4I55B 1IBKB 5C9AA 1SA0A 3LA2A <