1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP PROTEIN
molecule tags Transcription regulation
source organism Escherichia coli
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
1ROPA 2IJHA 1F4MA 2IJJA 1RPOA 1RPRA 1B6QA 1PD3A 1GMGA 2GHYA 1NKDA 2IJIA 2IJKA 3K79A 1F4NA 4DO2A 1GTOA
chains in the Genus database with same CATH superfamily
3CS5A 3N27A 1L0LH 3RYHB 2Z5UA 2Z0AA 5IYBO 4U7OA 3RWRD 3ZCCA 3CX5F 4LF5O 1W2BU 4PA3A 5TISZ 1YCIA 4E4EA 4NXNO 1AJNA 1QCEA 2QWRB 2ODMA 1F23A 1MMMA 5CA0B 4YJ2A 5E79Z 3AG1B 4G2KA 1FXHA 3Q4HB 3QF7A 2QTOA 3F5WC 5EYPA 4FM2A 3D8CA 2CAZC 5J2UB 2R9RB 2WA3A 3BEHA 2YI9A 3APOA 1SQQH 2BSKB 1V55B 3HKBA 2PTMA 1NVPD 1ORQC 3G71V 4O4IA 1MOFA 3K79A 3A0RA 4DR2B 1N36O 4J11A 3GB7C 4W4KA 1R3KC 2GTSA 1NR1A 1K9MW 3RYCA 1K5QA 1D2DA 4DV2B 3W7WA 3S3XA 4DR7O 1W59A 1Q6IA 3B8NA 1V9PA 4JYBA 4CBCA 4LFAB 2CH7A 1IXBA 1VQNV 2E76B 5JQGB 1HNZO 3IC7A 4N23A 2DJVA 2PYJA 3RVYA 4AI8A 2ZR2A 2N05A 4JAVA 4TT3G 4DV4B 2OWOA 1XI1A 4I55B 2XOKG 1VF6C 4JI4B 3CYOA 2EX3A 2HKOA 1SA0B 2ZD9A 4DV3B 4B3SB 2DWDC 1MG1A 3STLC 4FZ1A 1FS0G 2WLJA 4P30A 2UXBO 3MD0A 4WFFA 4XDKA 1PL0A 1OCRC 3QO5A 2DE0X 3L75H 1PV0A 3SJQC 4I9QA 1PP9H 2CUGA 3ZHRA 4QJFB 4NXNB 3EVKA 2YIBA 3ZHUA 3ZN1A 4LFAO 4FFBA 3ZMTA 2XNDG 4CC5A 4LFCO 4JGSA 2ZM6B 4DR1B 2YUAA 1A32A 4BIZA 4DUZO 4JTDB 5B3SC 1YJWV 3VQWA 2QGNA 3DC5A 2OTJV 3LUTB 4BWAA 2HJFC 3DTUB 1PPJH 1OCCC 1I5XA 1OCOC 1NH2D 4LF7B 3CC2V 2HHHO 2ZDIA 3AG3C 1VQ8V 4QPJA 4GX2A 1YIJV 3IC9A 2O57A 2X6CA 3AG4B 4OPHA 1V55C 1N33B 4GKKB 4LNUA 3WG7B 2IJJA 3MHSC 1YSCA 1FXKA 1U96A 3HKEB 5KMGB 1CP9A 4B3RO 4X1IA 2DYSC 1IDSA 5ITZB 2RJZA 1ZX3A 1DF5A 3CRQA 3K5NA 2JIZG 2F93B 1M1KW 2BTQA 3MAQA 4DR4B 2ATKC 1NQTA 4JI4O 4BR6A 1K97A 3RYFA 2HVKC 2IU3A 2H94A 3ZHSA 2OT5A 1VQ7V 3AG4C 1JJOA 1Y76B 3SPJA 4PA6A 4DR3B 5KAIZ 2ADQB 2Q0OC 4NTWA 5LMUB 4F6RB 3RYCB 4JYCA 3ETDA 1K92A 1OCCB 1Q82W 1BQ0A 3OFNG 4I50B 2P90A 4UVCA 5JQGA 3CCRV 2LFSA 2E5LB 3EHBB 4I50A 3RYFB 2CH7B 4N21A 2C2AA 5IYDO 5JJNB 5JH7A 4PHZA 4U3JA 1SZXA 2KB1A 5B1BB 4J42A 5JCOC 4BIOA 4F6RA 2WLHA 2A3QA 3B4SA 3FFQA 2QTSA 1Z2GA 3Q4HA 2V1DA 4YJ2B 2Q7HA 5D5QA 4JI7B 2ZXWB 1B6QA 4ZHQB 4J7KA 1DF4A 4DV6B 5L3FA 3ASOB 3E89A 1N8RW 2BSKA 3HKBB 1GN2A 3CP1A 3HKCA 2UXBB 4LR3A 1XBLA 4NTXA 4WFHA 5LHIA 2JVDA 4LF7O 3K04A 4NXMO 4FM1A 4PDMA 2VWJA 1PNKA 4B08A 2CTPA 1KBHA 2KG7B 3SDLA 2HJDA 4FLZA 4O4JA 3W7SA 2PF4E 3OTOO 5FPOA 1L1FA 3ZN0A 5LGTA 3OEHG 3PJSK 1P84F 1WLEA 4FVMA 4X9QA 3QNEA 5F2VO 2NLJC 3ABMB 4PDLA 1B3QA 2FYUH 1L0NH 4P2ZA 1E1QG 4W4LA 4AHCA 4CH3A 4IIJA 5LA6A 4DV5O 2LW1A 3ZBHA 4GYCB 4RWUA 1G1XB 2FTKA 1QVFU 3SYCA 4R8CA 3ZRSA 2UUAB 4I9WA 1Z5WA 1XHXA 4JV5B 4ICGA 4L8JA 1Y74B 4YIOA 2N74A 4CC6A 4F6EA 1CXZB 2ZE6A 5CA1A 4LFBB 3JD2A 4FLXA 1TUBA 1AR5A 1GM7A 1Q8IA 4H0LB 2AXTZ 1OV9A 4MTFA 3ABKC 3ZX6A 2WLIA 2WWWA 2HR3A 2X6BA 1VF7A 3M8AA 1Y6XA 4DRXA 1VQ6V 4JI8B 1AB3A 1BE3H 3X2QB 2ARHA 1KYOF 4JAUA 2HG5C 1XNQB 1UFIA 1FFTB 2LFRA 2CTQA 2OYQA 1BT8A 1IURA 4TOIA 3JCUZ 1QLNA 2ZXWC 2FL4A 2R9IA 4KL1A 2ZNIA 4GX0A 5K1PA 5JVDA 2EZPA 4X66B 3H01A 1GM8A 3RYIA 4K3AA 3MDSA 1KC8W 2P6JA 3JALB 4J9ZB 3HPLC 4DV7B 5L3DA 4DUZB 2IBZH 1JJ2U 2ILMA 1NVPB 3L9DA 4FIPC 2Q6AA 5LL6Y 5B1BC 4DUYO 4IHJA 2JDIG 3OMNB 1VIBA 5GTIZ 3F5TA 1FXVA 4WFEA 2OCCC 3TK1A 4X88A 4GUNA 1I94O 5J2UA 3I5DA 4DV4O 2Y0IA 5BY1A 4DK1A 4YY3B 3ASOC 1OJHA 4O4LB 3CXCU 2Y69B 4LF8O 2XAJA 4B3SO 4MW3A 3E8GA 3DC6A 3KZIZ 2DQ0A 2IJKA 4WFGA 2QDOA 1QVGU 1I08A 5HFLA 4TV8A 4YJ3B 4KHPB 2F23A 4GT1A 5LP6B 5IJ9B 3BA9A 5LYJB 3OR6C 2XAQA 4I5SA 4PJ0Z 4UFZA 1AI7A 1S0VA 1WPXA 5LBQA 1AI6A 3P32A 3ABUA 1YI2V 2Y69C 2B5UA 1M5IA 3BA8A 1ZLZA 3SGIA 3CRRA 4IYIA 1EZJA 3B8MA 2P67A 1AI5A 1N34O 2Y4TA 5KHGA 5IYZB 3SYAA 1KP3A 2W6IG 1BSMA 5E1AC 4UCRA 4JAAA 1SS3A 3UKMA 4YXWG 3TXQA 2WAMA 5DN6G 4MT8A 2FKXA 1GK9A 2WA4A 4Z2WA 4KHPO 2GUZB 4J41A 2QM4A 1FFXA 2GDSA 3SJBC 4QE7A 1OCZC 1PNMA 5C8YB 4CH4A 3AK3A 1H8EG 2QKCA 3KKYA 2UXCB 1MZEA 5EC1C 1XMQB 3OEEG 3AG1C 2LJ2A 3AK2A 2ADPA 4EB6A 3NXSA 1XEQA 3ZRWA 5BR8B 2EIKC 1PL4A 4GKJO 1KKDA 1IBMO 4FLUA 2YXLA 4OGQB 4B3TB 1VQOV 1VQMV 3THOA 3L71H 1M57B 3NR7A 1XDCA 3X2QC 2E75B 1ZSPA 3C90A 4BIUA 1AR4A 4R50A 3C3SA 4U3FH 4MVMA 2BTQB 1QU7A 3G4SV 4JTCB 3ABMC 4CH6A 3FKSG 1G6UA 2EIMC 1DLBA 3G6EV 2DQ3A 2DYRB 5EIBC 1JVMA 3ZS8C 5KMGA 2GSMB 3L70H 5GW7A 3SPIA 2Q68A 5EBMC 1R6NA 1JX9A 1NJIW 1Q90D 2HVJC 3RGBA 1BS3A 1EN5A 3JARB 4MVUA 4LFBO 4WF9V 1HR0O 3SYQA 5IYZA 3ASNC 4FLVA 2UUBB 1I5YA 1M56C 3RYHA 2X6AA 4AILC 3ZRXA 4WBNB 2HEPA 3OR7C 3ICXA 4BW9A 1QR8A 4DV0O 1EBOA 1KUQA 4NKGB 2GV9A 3CRCA 3E22A 2ZE7A 1S3JA 3U10A 3D3QA 3K0GA 4NR1A 3CWBH 1XL6A 4O4JB 4BAYA 2KKWA 1XOUA 1AP6A 5KLVH 4DR4O 1K8AW 2PYLA 2GTAA 3ZHTA 2QWNB 3EXAA 3K5LA 1XNRO 4PV1B 4UCSA 2YIAA 4PI2A 2ZM6O 4LF9B 4RUFA 5KHIA 4FK5C 4H33A 4MS2A 4MVRA 2P06A 1BMFG 3JSNA 3JARA 3OD4A 4PA9A 5LHGA 1LUVA 2QWOB 3WB0A 4IHJB 1AR1B 4ZHQA 2WLMA 3QO7A 3HR0A 5EZYB 3CCUV 3FB5C 3JASA 3ZMZA 2VQFB 5DEDA 4ZOLA 4JI2B 4JI6O 3ETGA 5B5EZ 5IWAO 4OX9O 4EEQA 5L3CA 2Q73A 4J10A 3P3PA 2BOBC 2LGWA 2QJ1A 4GX5A 3B09A 2N04A 3ETEA 3JAKB 5BR8O 2ZKOA 3B77A 5KHHA 4TUYA 4QPKA 2DYSB 3UQ8A 5BXZA 3B2EE 3R65A 2ITDC 1VQLV 4NYKA 2GUZA 4ZOLB 4FFKA 1Q6HA 1YTFB 1LR1A 3B40A 4RAIA 4PDRA 3RT3C 3CJHA 2VQFO 4OXSA 1OCOB 5KX5B 2B1GA 3ML0A 2QKAA 3M99B 1GKFA 4JYAB 4UVAA 2M6YA 2DWEC 3ZHQA 3VOUA 2LO1A 1J5EB 2XAHA 3PN1A 4UV8A 1SQBH 2JGDB 4ZI7A 1ZTEA 3OMIB 3KCXA 4FLTA 5CB4B 3QTCA 2HFEC 1H2NA 3CC4V 4TSFG 4FLWA 5CA0A 4E2LA 2ZIMA 4AQYB 1QLEB 3AG7A 1XNRB 4LNUB 2A06H 5CA3A 4JYAO 1SZTA 5K1XA 4I0XA 2Y4UA 3DSQA 1JFFB 4UUJC 1UJWB 1F51A 5JJJB 4B3RB 4TV8B 4YJ3A 3OMAB 2YIBD 4B3TO 4GX1A 3AEIA 2EINC 3K9SA 4CH5A 1D5AA 5FLXN 5D5PA 1HDJA 2QM7A 1K7DA 3T2MA 3LNMB 4XDLA 4O4LA 3K08A 4JI5O 4DR3O 1CEZA 1TA8A 2AGAA 3APQA 4DR1O 1AJPA 1V54C 4IT5A 2M7WA 2WLNA 3P30A 4LH6A 2PY5A 4B3MB 1FJGB 2YSUB 1RM1C 4DV1O 2ZNJA 3OT7A 5B1AC 4HNAB 3N2KB 4ZBMA 3BVOA 4DR5B 5CB4A 1H2GA 5FL7G 1VQ4V 1W0JG 5IJ0A 4O2BB 1N34B 1KD1W 4JI7O 4XBFA 1N33O 1LNQA 3U11A 1AVMA 3L73H 1SQPH 4X1YA 2Q4PA 3JSLA 3K5MA 1Y4MA 5LXTB 3G80A 4RO2A 2QA4V 1L8DA 1OCRB 4PA4A 4K0KO 1LUWA 1B06A 1N0NA 5L3BA 5LMNB 1JR9A 2CGOA 4K8XA 1SETA 4YHHB 1SQFA 4CS4A 4QE9A 3FB7C 1FD9A 1Q7YW 3CHXA 4R7CA 4DW1A 5LP6C 4UCTA 4QIWF 2R9AA 1K4DC 2G38A 3SR2C 3ZEDA 4CS2A 1FXKC 3CSXA 5H6QA 2PI4A 3K9AA 3A0BZ 1YXBA 3JD3A 5KUMA 3JCZA 5LXTA 5J2TA 4FM0A 1RM1B 2CTWA 2CK3G 4YHHO 3TXSA 4BW5A 1KB9F 1Q43A 4J80A 1Y74A 1JPXA 4FMTA 2A9HA 1SESA 4LF8B 3QO8A 4IGGA 4MVOA 3OW2U 5B1NA 4WCEV 2XUMA 2EIKB 2L35A 1R73A 3ZHVA 4Z1VA 4JI3O 5LA6B 4X1KA 4MVZA 2EINB 4H44B 2RDCA 4O4HB 4HNAA 1FXKB 4XDJA 2FB5A 2PGGA 1X4TA 2XAGA 3CCMV 4MVQA 1H8HG 1O9GA 4H37A 5LOVA 3TETA 4DR5O 1WA8B 4GLXA 1BCCH 4IIJB 5KUKA 3T1HO 2K1EA 1XNQO 5EC2C 1IBMB 3T1YO 1VEWA 2YICA 4NTYA 2IH3C 1F7YA 3WFVA 2LW7A 1AJQA 3CEIA 3DGEA 1NBMG 2XT9A 2Q0AA 4DUYB 2D3OW 5DM6V 5KA5A 4LF4B 2ZE8A 4GKJB 1SKVA 4CZZA 3IGAC 1M93A 3VBBA 1UPGA 5LGNA 4JI1O 3ZMUA 1MA1A 2R72A 1DK1A 1NI8A 2ZINA 2A79B 1K33A 3E2EA 1ENVA 4J9YB 1XILA 1AILA 2Q7EA 1TVKB 1E79G 3GVMA 1N32B 1M9NA 3A0HZ 3JALA 2KSDA 2ZE5A 2X0LA 2OIEA 4I4TB 4DV7O 2WPDG 1O9HA 3FAVB 1ZL8A 2CE4A 1RP3B 1VMGA 3GWKC 1IBLB 4DV1B 5KX5A 1GN3A 4GZRB 3T1YB 1WN7A 3RW0A 3BAAA 1BHBA 2YC0A 2ZDIC 4DR6B 4EKWA 2UU9B 3E8FA 2OCCB 1K34A 2E3CA 1NR7A 4DYLA 1OHHG 4Q6GA 1S76D 2Q5ZA 1BZKA 1URFA 3ZIAG 3L72H 1Y76A 5KHKA 1WNSA 3UO2A 3CC7V 1I7FA 1H38A 2QEXV 3E86A 3JAKA 1GAXA 2QWPB 4PELA 4QNHB 1KKCA 3OGIB 4G27B 1HNXB 5A2QN 4JI3B 4UB8Z 3SPHA 3BCCH 4LP8A 3IAYA 1MNGA 5JWPA 2A7WA 5KHJA 4O2AB 4FPPA 1X59A 1BQZA 1QQCA 3CCJV 2IW5A 1TVKA 3SJAC 5L3GA 3LDEA 1GRJA 2JGUA 5EIBD 3HKEA 2XAFA 4NXMB 4DK0A 5L3EA 3BHPA 1FKAO 1SQVH 1KMIZ 3FAVA 5IDJA 2F4VO 2Y0PA 1J5EO 3A8TA 3RN4A 1N32O 2JK5C 3AG3B 1ROPA 3T4ZA 1Z5VA 5FPRA 1WB7A 1PM9A 1P7GA 1YTFD 3N2KA 1R1BA 3CCSV 4PDVA 3O9OA 5IJ9A 4NVPA 1FYJA 4R6ZA 3DXRA 2IM9A 3CCLV 1THZA 1E1RG 4TV9A 4UB6Z 3W7UA 4JI2O 1WA8A 3FB8C 2F95B 5IE9A 4YY3O 2Q9LA 2KG7A 4FZ0A 2QSAA 4JI0O 1JFFA 1MZFA 3L74H 5BMVA 3LDCA 5H5NA 3W7XA 1EM1A 5FNVB 4LF6B 5FNVA 2DOSA 1GM9A 2E5LO 4O4HA 1S5JA 1ZWIC 2Q8VA 1IXMA 2AW9A 1R6KA 3C3TA 2MK3A 3CRMA 1M56B 1NTKH 2VS0A 2YXYA 1VQKV 1XMOO 5CMUA 1NH2B 4MTOA 2B9ZA 4F4LA 3FYEB 2UUCB 2QWQB 5LOVB 2B1IA 2RQ6A 2HLDG 4OPAA 4UV9A 4X65O 3BABA 1SA0A 3CCVV 3WB2A 4DV6O 1YEWA 1HNWO 3H1HH 3OGCC 5J2TB 3CMEV 1NTMH 1HR0B 3AG2C 2EZOA 4ZI7B 4MTGA 1PKXA 4HYOA 1V54B 2UUCO 1QLEC 2EIMB 3M7MX 4EFBA 3GWOA 3N2GB 3FD9A 3LSUA 1Y67A 2YDEA 5B1OA 3S3WA 5B66Z 2UU9O 1Q3EA 1XUQA 1SQXH 3ABTA 4I55A 4G28B 2AZ2A 4YIPA 4ABMA 3OM3B 3ASNB 3OTFA 4IL6Z 4GCZA 4UCUA 1K5SA 4DW0A 4DR7B 4IYHA 1ZAUA 2AHZA 4DRXB 3ZRWB 3W7TA 1R3LC 3JASB 5CBFA 2PUSA 5EK0A 2JS5A 3K03A 4JI6B 1FAFA 2UXDB 3K06A 2XTAA 4JTAB 3E8HA 1NKDA 2WLLB 3H1KH 1IX9A 2UXCO 2IU0A 2BTOA 2NN4A 4JF3A 4ZIBA 1IVSA 4Q20A 4D7TA 1J95A 3J7AU 1HWYA 1KECA 1VQ5V 1COWG 1EN6A 2A0LA 2YEVB 1YVWA 2H3OA 2BE3A 1QBZA 2Y48A 1XMQO 1I0HA 3CMAV 2W0FC 2EILC 3MHHC 1QNMA 1KU9A 1YHQV 2JEUA 4UXNA 1N0JA 5EBLC 1H2MA 3ZRVA 5IWAB 1GO3F 4KFMA 4PD4F 2EJ7A 5HFMA 4J7ZA 3T1HB 1NTZH 2ZCEA 3BFRA 5CBGA 1RPRA 2RNBA 1JMKC 3QVNA 3IJ4A 4X64O 5A9GA 4FFBB 5IT9N 2BOCC 3D3IA 4DR6O 1HNZB 4DO2A 1BHAA 3HKCB 1US6A 3VQYA 4K0KB 1G4YB 5IY5B 1AP5A 1WP8A 1YDXA 2IJIA 3CPWU 5JCOA 4PA7A 1QHTA 1NS1A 3FYIB 1U97A 3E8BA 2EBOA 4DV3O 4MVSA 5GONA 3JATA 1M90W 2ZQMA 2YS8A 2ZR3A 2CTRA 1JA8A 1SF9A 2JGDA 5B3SB 2EULA 3WB1A 3RYIB 1CPYA 1F4MA 3ZMVA 2QR4A 1WPBA 2YIDA 4DV2O 1WJZA 4LWSA 3K5OA 1VF5B 3F7VC 1BL8A 5J9PC 2AHYA 3HKDA 3CJHB 1MSWD 1IZ3A 3OE7G 3P3NA 5GTHZ 3SJCC 2NNUA 4DR2O 1N36B 1SERA 3OTOB 3O65A 2UXDO 3SYPA 1RFYA 1Q5OA 1FPOA 2YI8A 5LMNO 3WU2Z 2UUBO 3A2FA 3ETQA 4JI0B 4U7NA 4HZ3A 2VQEB 4OX9B 2IH1C 4TWKA 4D6TH 1R6TA 3T1CA 4HAMA 4Z1MG 1P49A 4P9PA 2WLIB 3HKDB 2GBOA 5CN0A 4RUEA 3TCUA 5C8YA 1Q6UA 1ZL8B 2DMXA 3UM7A 3U0ZA 2JJ1G 1GTOA 4X8AA 3T4DA 4JPRA 4L87A 4P9OA 2R70A 3JATB 4X1YB 3RFRA 1YF2A 1OZ0A 3D36A 3KCYA 4JYYA 4RQEA 1DGSA 3SPCA 3UT5B 2HHHB 1P7BA 4LC1A 1YJ9V 4TQDA 1XREA 1Y66A 2WSSG 2NR5A 4UCVA 3KG2A 4X66O 4LF9O 3CXHF 2P7TC 3FB6C 3JYCA 1VP7A 2Q7GA 2F66C 4KUMA 5IJ0B 1TGOA 1NU1H 1H2LA 2UXXA 2CDYA 2XASA 2DW4A 1RSOA 4B7EA 4LH7A 3JAWB 1NZ6A 5KAFZ 5H2FZ 3K57A 3STZC 5AG2A 2JS3A 1TAEA 4WBNA 5LP6A 4X20B 2ITCC 2D2CB 4CS3A 1EZVH 2F1MA 4J7JA 4TV9B 2GHYA 5B1AB 1G8MA 2K9PA 5LHHA 3G6BA 3F7YC 2JJ2G 3FX7A 4KP4A 3JD0A 3IFXA 3JAWA 2W6JG 2XHBA 2P22C 1OCZB 3K58A 2YXHA 2EIJB 2JRIA 4DV5B 4H13B 4WFBV 1R3JC 3ZJZA 2Q69A 2YEVA 2FMLA 4I0XB 4LF6O 3H1JH 4X64B 3UCSC 1R3IC 2X7RB 5EBWC 3LNNA 1XQ8A 1I94B 4K35A 5H6RA 5CBHA 2IJHA 5LGUA 1B04A 2HP8A 3CCQV 3K59A 1WB8A 3UO3A 5JVDB 2DN9A 4JI5B 4KXRA 2LQTA 1JOYA 4I7ZB 1SQGA 2AZ0A 2P4KA 3ABLC 1WP7A 2MW2B 1VQ9V 4LFCB 3LDDA 4ZKIA 2V7QG 1N4CA 3CCEV 3BY6A 1S5LZ 1M57C 4EFEA 5GONB 1AI4A 4TQFA 4EB6B 5EZYA 4O4IB 3K3WA 4DV0B 4C7UA 4LWSB 3H1LH 2OIGA 1PNLA 3LSQA 1P4RA 4WFAV 2KQXA 4I4TA 1TUBB 2RN9A 2ETNA 1GN6A 1SC5B 4JASA 1ZUQA 3RBZA 5EYPB 2OCHA 4B3MO 1FJGO 2QM8A 1MABG 1S5HC 3EFFK 4UVBA 4X65B 5JJEB 4B7KA 3BRCA 4JZGA 1YJNV 5LYJA 1IBKO 1QR9A 2RCVA 3RVZA 1GH6A 1T5EA 1EN4A 4JZ2A 1HNWB 1BGYH 1YITV 1M4UA 1KP2A 4JI8O 5BZBA 3E22B 4JI1B 1H2KA 1MSDA 1H2SB 1IBLO 1JQ0A 2Q67A 3D36C 1XHZA 1VARA 5BMVB 3JAMN 1D5NA 4DXWA 3TGUH 5KA6A 2L6LA 4X20A 3I55V 2DYRC 3CRAA 3CD6V 1HP8A 4UCOA 4GKKO 3I56V 4JV5O 2W0XA 3SPGA 2EILB 1JCHA 1HW7A 1PD3A 1XMOB 4K8ZA 2VWKA 4X1KB 3VQVA 4LF4O 3ZMSA 2F4VB 1AROP 3LSSA 4FJCC 4U3JB 4PI0A 2P5OA 3UT5A 1WAZA 2EIJC 2LGQA 3CB2A 1K73W 3JD4A 2H8PC 2P4VA 1Q86W 3ABLB 3CE2A 2WLLA 3J81N 3H1IH 1RPOA 4O2AA 3ABKB 2OTLV 2VQEO 4ASUG 5JH7B 2UXNA 4TUYB 3AK1A 3HB3B 3K0DA 1F4NA 4X89A 3E35A 4MTXA 1W0KG 1K4CC 1VQPV 4FLYA 3N2GA 5C93A 2CGNA 3R66A 5LMUO 2ZT9B 3AG2B 5DECA 3H9VA 1Q81W 2E74B 1S72V 1HNXO 2V4DA 3WG7C 1FFXB 5CA1B 2LP7A 1SRYA 3J80N 5H9CA 3E83A 4X62B 3QG5A 3OAAG 1XL4A 1TUEB 3VQXA 2Z3YA 2BCCH 2JEXA 5IY5C 3BPZA 4AQYO 2PZSA 1DTOA 4A5UB 2UUAO 1K3EA 4O2BA 2WLKA 2VRZA 5ITZA 2PI5A 5IYCO 2EJRA 4X1IB 4X62O 1NT2B 3OUSA 4RQFA 3OUFA 3JD1A 4MSWC 4D7SA 4LBEC 4MW8A 1KQSU 1YZBA 1EFRG 3TJTA 1GMGA 3G67A 3DXRB 1GN4A 2QE7G 3SYOA 4LF5B 4NB5A 1VF6A 4HBNA 2F43G 1RSOB 2QKSA 2RMKB 1S77D 4QGPA 4LCUC 1IBKB 2ZIOA
chains in the Genus database with same CATH topology
4X88A 5B3SB 1FXKC 5H6QA 2PI4A 2Z5UA 3K9AA 1CPYA 5IYBO 3JD3A 4U7OA 5KUMA 3JCZA 3ZCCA 1RM1B 1F4MA 2CK3G 3ASOC 3ZMVA 1W2BU 4PA3A 4BW5A 3CXCU 3F7VC 1BL8A 5J9PC 2AHYA 2Y69B 1AJNA 1QCEA 2XAJA 1F23A 1JPXA 4FMTA 1MSWD 2A9HA 1SESA 3OE7G 3QO8A 3AG1B 4G2KA 2NNUA 1FXHA 4MW3A 1SERA 3E8GA 4MVOA 2DQ0A 5B1NA 3OW2U 3SYPA 4WCEV 2IJKA 2QTOA 3F5WC 4WFGA 2EIKB 1QVGU 1R73A 5HFLA 2R9RB 4U7NA 3BEHA 4GT1A 4HZ3A 2IH1C 4TWKA 4MVZA 1V55B 2EINB 3T1CA 1NVPD 1ORQC 4HAMA 4Z1MG 3OR6C 4P9PA 2WLIB 1FXKB 2XAQA 4XDJA 4I5SA 1AI7A 3G71V 1MOFA 2XAGA 3K79A 3CCMV 3A0RA 4MVQA 1H8HG 5CN0A 1S0VA 1WPXA 5LBQA 4RUEA 1AI6A 3TCUA 3GB7C 4H37A 3P32A 1R3KC 3ABUA 3TETA 1YI2V 1NR1A 2Y69C 2B5UA 1K9MW 1K5QA 1EZJA 3B8MA 3UM7A 2P67A 1AI5A 3W7WA 2JJ1G 5KUKA 1GTOA 2K1EA 4X8AA 3B8NA 3T4DA 4JPRA 5EC2C 4L87A 4P9OA 3SYAA 1KP3A 4JYBA 4CBCA 2W6IG 5E1AC 1VQNV 3UKMA 1OZ0A 3D36A 4YXWG 2IH3C 2WAMA 3WFVA 4MT8A 5DN6G 4RQEA 1AJQA 3SPCA 3DGEA 1NBMG 1P7BA 3IC7A 1GK9A 4LC1A 1YJ9V 4N23A 1Y66A 2WSSG 2D3OW 3KG2A 5DM6V 2P7TC 5KA5A 3RVYA 3FB6C 3JYCA 2ZR2A 4KUMA 4QE7A 1OCZC 1PNMA 4JAVA 4TT3G 4CZZA 2UXXA 1H8EG 3IGAC 2XASA 2DW4A 3VBBA 2XOKG 5LGNA 3CYOA 3ZMUA 2HKOA 5EC1C 3OEEG 2ZD9A 3AG1C 2A79B 1K33A 3E2EA 1ENVA 4J9YB 3NXSA 3STZC 2DWDC 3ZRWA 1MG1A 3STLC 1E79G 2WLJA 1FS0G 2ITCC 2EIKC 4P30A 1M9NA 3MD0A 4WFFA 4XDKA 2X0LA 1KKDA 1PL0A 1OCRC 2GHYA 3QO5A 5B1AB 1G8MA 5LHHA 2WPDG 1VQOV 1VQMV 3SJQC 1M57B 3F7YC 2JJ2G 4QJFB 4KP4A 3X2QC 3JD0A 3ZN1A 3IFXA 2W6JG 4BIUA 1OCZB 3ZMTA 2XNDG 4R50A 3RW0A 1BHBA 4MVMA 2ZDIC 3G4SV 4EKWA 4JGSA 2EIJB 3E8FA 4JTCB 2OCCB 1K34A 3ABMC 1NR7A 4BIZA 3FKSG 1OHHG 4JTDB 1S76D 2EIMC 5B3SC 1DLBA 4WFBV 1R3JC 3G6EV 2DQ3A 3ZJZA 1YJWV 2DYRB 2Q69A 2YEVA 3ZIAG 1JVMA 2OTJV 3LUTB 2GSMB 2HJFC 3DTUB 5GW7A 3SPIA 1OCCC 1I5XA 1OCOC 3CC7V 1H38A 2QEXV 2Q68A 5EBMC 1R3IC 1R6NA 3E86A 2X7RB 1NH2D 1JX9A 1NJIW 2HVJC 4PELA 5EBWC 4QNHB 3CC2V 2ZDIA 3AG3C 1VQ8V 4G27B 4QPJA 4GX2A 4MVUA 4WF9V 1YIJV 5H6RA 3SYQA 3ASNC 5CBHA 3SPHA 4LP8A 1I5YA 2IJHA 1M56C 2X6AA 5LGUA 2X6CA 4FPPA 3CCQV 3CCJV 3AG4B 2IW5A 3ZRXA 5L3GA 1V55C 3LDEA 3OR7C 3WG7B 2IJJA 3MHSC 1QR8A 2XAFA 1YSCA 1FXKA 1EBOA 1JOYA 5L3EA 1CP9A 3ABLC 5IDJA 2DYSC 1S3JA 1VQ9V 3K0GA 3LDDA 1DF5A 2JK5C 4ZKIA 4BAYA 1XL6A 2V7QG 3AG3B 1ROPA 2JIZG 3T4ZA 1M1KW 3CCEV 3BY6A 1M57C 1AI4A 2ATKC 1NQTA 1K97A 1YTFD 2HVKC 1K8AW 2IU3A 2H94A 3K3WA 3CCSV 2OT5A 1VQ7V 3AG4C 4PDVA 1PNLA 4R6ZA 3SPJA 3LSQA 4PA6A 1P4RA 4WFAV 3CCLV 1THZA 4RUFA 1E1RG 4FK5C 4H33A 4MS2A 3W7UA 4MVRA 3FB8C 4JASA 3RBZA 1BMFG 2QM8A 4JYCA 3ETDA 1MABG 1S5HC 3EFFK 4PA9A 1K92A 5LHGA 4UVBA 3LDCA 1OCCB 1Q82W 3OFNG 1AR1B 3W7XA 2WLMA 2P90A 4UVCA 3QO7A 3CCRV 2LFSA 3EHBB 1YJNV 3CCUV 1GM9A 3FB5C 4N21A 3ZMZA 1QR9A 1ZWIC 2C2AA 1IXMA 5IYDO 3RVZA 1R6KA 2MK3A 2KB1A 1M56B 3ETGA 1YITV 1KP2A 5B1BB 1VQKV 5BZBA 2WLHA 5CMUA 1NH2B 4MTOA 5L3CA 4F4LA 3FYEB 2B1IA 2BOBC 2V1DA 2HLDG 4GX5A 4UV9A 1JQ0A 2Q67A 3ETEA 2ZXWB 1B6QA 3B77A 3CCVV 1DF4A 5L3FA 3ASOB 4DXWA 3E89A 4QPKA 1N8RW 3OGCC 2DYSB 3CMEV 3AG2C 2EZOA 5KA6A 4MTGA 3R65A 2ITDC 3CP1A 1PKXA 1VQLV 4HYOA 1V54B 1QLEC 2EIMB 3I55V 2DYRC 1YTFB 3CD6V 3GWOA 4WFHA 4RAIA 5LHIA 4PDRA 5B1OA 4OXSA 3I56V 1OCOB 2B1GA 3ML0A 3ABTA 1GKFA 3M99B 3SPGA 2EILB 3K04A 1JCHA 4G28B 4UVAA 4PDMA 1PNKA 2DWEC 1PD3A 3VOUA 2XAHA 3OM3B 3ZMSA 3ASNB 3W7SA 4GCZA 4UV8A 1L1FA 3ZN0A 5LGTA 1AROP 1K5SA 3OEHG 3OMIB 3LSSA 4FJCC 3PJSK 2AHZA 2HFEC 1WLEA 3ZRWB 3W7TA 1R3LC 3CC4V 2EIJC 3QNEA 4TSFG 4E2LA 2NLJC 3ABMB 4PDLA 5CBFA 1QLEB 1K73W 5CA3A 1SZTA 3JD4A 4P2ZA 4UUJC 2H8PC 1E1QG 1UJWB 1F51A 5EK0A 1Q86W 3ABLB 3K03A 2WLLA 1RPOA 3ABKB 3K06A 4JTAB 2OTLV 3OMAB 3E8HA 1NKDA 2WLLB 2FTKA 4GX1A 4ASUG 3AEIA 2EINC 3SYCA 1QVFU 4R8CA 3ZRSA 2UXNA 4I9WA 3HB3B 3K0DA 2IU0A 1F4NA 4X89A 3E35A 2QM7A 4MTXA 1W0KG 4JF3A 1K4CC 1K7DA 3T2MA 3LNMB 4Q20A 4XDLA 1VQPV 1J95A 1HWYA 5C93A 1KECA 3K08A 1VQ5V 1COWG 2A0LA 2YEVB 3AG2B 1Q81W 1CEZA 1S72V 1AJPA 3JD2A 3WG7C 1V54C 2M7WA 2WLNA 2LP7A 3P30A 1SRYA 1GM7A 1QBZA 2YSUB 1RM1C 2Y48A 3CMAV 5H9CA 4MTFA 3E83A 3ABKC 2W0FC 3OAAG 5B1AC 1XL4A 1TUEB 2EILC 2WLIA 2WWWA 3MHHC 2HR3A 2X6BA 2Z3YA 4ZBMA 1YHQV 2JEXA 5IY5C 2JEUA 1VQ6V 4UXNA 5EBLC 1H2GA 5FL7G 1DTOA 3ZRVA 1VQ4V 3X2QB 1GO3F 4KFMA 1W0JG 4JAUA 2HG5C 1K3EA 5HFMA 2WLKA 2PI5A 5IYCO 1FFTB 2EJRA 2LFRA 1KD1W 3OUSA 4XBFA 5CBGA 1RPRA 1LNQA 4RQFA 2BOCC 3OUFA 3D3IA 3JD1A 1QLNA 2ZXWC 4MSWC 2R9IA 4LBEC 4GX0A 4DO2A 4MW8A 2EZPA 1KQSU 1BHAA 1Y4MA 1EFRG 3H01A 1GM8A 4RO2A 2QA4V 1OCRB 4PA4A 1GMGA 1KC8W 2P6JA 4J9ZB 3HPLC 1G4YB 5L3DA 5IY5B 5L3BA 1JJ2U 2QE7G 1NVPB 2IJIA 3SYOA 1SETA 3CPWU 4FIPC 2Q6AA 4QE9A 4PA7A 5B1BC 3FB7C 2F43G 3FYIB 3E8BA 2QKSA 2EBOA 1Q7YW 1S77D 4MVSA 2JDIG 3OMNB 4R7CA 4LCUC 1M90W 1FXVA 4QIWF 4WFEA 2ZQMA 2OCCC 3TK1A 2ZR3A 1K4DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROP A;  2IJH A;  1F4M A;  2IJJ A;  1RPO A;  1RPR A;  1B6Q A;  1PD3 A;  1GMG A;  2GHY A;  1NKD A;  2IJI A;  2IJK A;  3K79 A;  1F4N A;  4DO2 A;  1GTO A; 
#chains in the Genus database with same CATH topology
 3CS5 A;  3N27 A;  1L0L H;  3RYH B;  2Z5U A;  2Z0A A;  5IYB O;  4U7O A;  3RWR D;  3ZCC A;  3CX5 F;  4LF5 O;  1W2B U;  4PA3 A;  5TIS Z;  1YCI A;  4E4E A;  4NXN O;  1AJN A;  1QCE A;  2QWR B;  2ODM A;  1F23 A;  1MMM A;  5CA0 B;  4YJ2 A;  5E79 Z;  3AG1 B;  4G2K A;  1FXH A;  3Q4H B;  3QF7 A;  2QTO A;  3F5W C;  5EYP A;  4FM2 A;  3D8C A;  2CAZ C;  5J2U B;  2R9R B;  2WA3 A;  3BEH A;  2YI9 A;  3APO A;  1SQQ H;  2BSK B;  1V55 B;  3HKB A;  2PTM A;  1NVP D;  1ORQ C;  3G71 V;  4O4I A;  1MOF A;  3K79 A;  3A0R A;  4DR2 B;  1N36 O;  4J11 A;  3GB7 C;  4W4K A;  1R3K C;  2GTS A;  1NR1 A;  1K9M W;  3RYC A;  1K5Q A;  1D2D A;  4DV2 B;  3W7W A;  3S3X A;  4DR7 O;  1W59 A;  1Q6I A;  3B8N A;  1V9P A;  4JYB A;  4CBC A;  4LFA B;  2CH7 A;  1IXB A;  1VQN V;  2E76 B;  5JQG B;  1HNZ O;  3IC7 A;  4N23 A;  2DJV A;  2PYJ A;  3RVY A;  4AI8 A;  2ZR2 A;  2N05 A;  4JAV A;  4TT3 G;  4DV4 B;  2OWO A;  1XI1 A;  4I55 B;  2XOK G;  1VF6 C;  4JI4 B;  3CYO A;  2EX3 A;  2HKO A;  1SA0 B;  2ZD9 A;  4DV3 B;  4B3S B;  2DWD C;  1MG1 A;  3STL C;  4FZ1 A;  1FS0 G;  2WLJ A;  4P30 A;  2UXB O;  3MD0 A;  4WFF A;  4XDK A;  1PL0 A;  1OCR C;  3QO5 A;  2DE0 X;  3L75 H;  1PV0 A;  3SJQ C;  4I9Q A;  1PP9 H;  2CUG A;  3ZHR A;  4QJF B;  4NXN B;  3EVK A;  2YIB A;  3ZHU A;  3ZN1 A;  4LFA O;  4FFB A;  3ZMT A;  2XND G;  4CC5 A;  4LFC O;  4JGS A;  2ZM6 B;  4DR1 B;  2YUA A;  1A32 A;  4BIZ A;  4DUZ O;  4JTD B;  5B3S C;  1YJW V;  3VQW A;  2QGN A;  3DC5 A;  2OTJ V;  3LUT B;  4BWA A;  2HJF C;  3DTU B;  1PPJ H;  1OCC C;  1I5X A;  1OCO C;  1NH2 D;  4LF7 B;  3CC2 V;  2HHH O;  2ZDI A;  3AG3 C;  1VQ8 V;  4QPJ A;  4GX2 A;  1YIJ V;  3IC9 A;  2O57 A;  2X6C A;  3AG4 B;  4OPH A;  1V55 C;  1N33 B;  4GKK B;  4LNU A;  3WG7 B;  2IJJ A;  3MHS C;  1YSC A;  1FXK A;  1U96 A;  3HKE B;  5KMG B;  1CP9 A;  4B3R O;  4X1I A;  2DYS C;  1IDS A;  5ITZ B;  2RJZ A;  1ZX3 A;  1DF5 A;  3CRQ A;  3K5N A;  2JIZ G;  2F93 B;  1M1K W;  2BTQ A;  3MAQ A;  4DR4 B;  2ATK C;  1NQT A;  4JI4 O;  4BR6 A;  1K97 A;  3RYF A;  2HVK C;  2IU3 A;  2H94 A;  3ZHS A;  2OT5 A;  1VQ7 V;  3AG4 C;  1JJO A;  1Y76 B;  3SPJ A;  4PA6 A;  4DR3 B;  5KAI Z;  2ADQ B;  2Q0O C;  4NTW A;  5LMU B;  4F6R B;  3RYC B;  4JYC A;  3ETD A;  1K92 A;  1OCC B;  1Q82 W;  1BQ0 A;  3OFN G;  4I50 B;  2P90 A;  4UVC A;  5JQG A;  3CCR V;  2LFS A;  2E5L B;  3EHB B;  4I50 A;  3RYF B;  2CH7 B;  4N21 A;  2C2A A;  5IYD O;  5JJN B;  5JH7 A;  4PHZ A;  4U3J A;  1SZX A;  2KB1 A;  5B1B B;  4J42 A;  5JCO C;  4BIO A;  4F6R A;  2WLH A;  2A3Q A;  3B4S A;  3FFQ A;  2QTS A;  1Z2G A;  3Q4H A;  2V1D A;  4YJ2 B;  2Q7H A;  5D5Q A;  4JI7 B;  2ZXW B;  1B6Q A;  4ZHQ B;  4J7K A;  1DF4 A;  4DV6 B;  5L3F A;  3ASO B;  3E89 A;  1N8R W;  2BSK A;  3HKB B;  1GN2 A;  3CP1 A;  3HKC A;  2UXB B;  4LR3 A;  1XBL A;  4NTX A;  4WFH A;  5LHI A;  2JVD A;  4LF7 O;  3K04 A;  4NXM O;  4FM1 A;  4PDM A;  2VWJ A;  1PNK A;  4B08 A;  2CTP A;  1KBH A;  2KG7 B;  3SDL A;  2HJD A;  4FLZ A;  4O4J A;  3W7S A;  2PF4 E;  3OTO O;  5FPO A;  1L1F A;  3ZN0 A;  5LGT A;  3OEH G;  3PJS K;  1P84 F;  1WLE A;  4FVM A;  4X9Q A;  3QNE A;  5F2V O;  2NLJ C;  3ABM B;  4PDL A;  1B3Q A;  2FYU H;  1L0N H;  4P2Z A;  1E1Q G;  4W4L A;  4AHC A;  4CH3 A;  4IIJ A;  5LA6 A;  4DV5 O;  2LW1 A;  3ZBH A;  4GYC B;  4RWU A;  1G1X B;  2FTK A;  1QVF U;  3SYC A;  4R8C A;  3ZRS A;  2UUA B;  4I9W A;  1Z5W A;  1XHX A;  4JV5 B;  4ICG A;  4L8J A;  1Y74 B;  4YIO A;  2N74 A;  4CC6 A;  4F6E A;  1CXZ B;  2ZE6 A;  5CA1 A;  4LFB B;  3JD2 A;  4FLX A;  1TUB A;  1AR5 A;  1GM7 A;  1Q8I A;  4H0L B;  2AXT Z;  1OV9 A;  4MTF A;  3ABK C;  3ZX6 A;  2WLI A;  2WWW A;  2HR3 A;  2X6B A;  1VF7 A;  3M8A A;  1Y6X A;  4DRX A;  1VQ6 V;  4JI8 B;  1AB3 A;  1BE3 H;  3X2Q B;  2ARH A;  1KYO F;  4JAU A;  2HG5 C;  1XNQ B;  1UFI A;  1FFT B;  2LFR A;  2CTQ A;  2OYQ A;  1BT8 A;  1IUR A;  4TOI A;  3JCU Z;  1QLN A;  2ZXW C;  2FL4 A;  2R9I A;  4KL1 A;  2ZNI A;  4GX0 A;  5K1P A;  5JVD A;  2EZP A;  4X66 B;  3H01 A;  1GM8 A;  3RYI A;  4K3A A;  3MDS A;  1KC8 W;  2P6J A;  3JAL B;  4J9Z B;  3HPL C;  4DV7 B;  5L3D A;  4DUZ B;  2IBZ H;  1JJ2 U;  2ILM A;  1NVP B;  3L9D A;  4FIP C;  2Q6A A;  5LL6 Y;  5B1B C;  4DUY O;  4IHJ A;  2JDI G;  3OMN B;  1VIB A;  5GTI Z;  3F5T A;  1FXV A;  4WFE A;  2OCC C;  3TK1 A;  4X88 A;  4GUN A;  1I94 O;  5J2U A;  3I5D A;  4DV4 O;  2Y0I A;  5BY1 A;  4DK1 A;  4YY3 B;  3ASO C;  1OJH A;  4O4L B;  3CXC U;  2Y69 B;  4LF8 O;  2XAJ A;  4B3S O;  4MW3 A;  3E8G A;  3DC6 A;  3KZI Z;  2DQ0 A;  2IJK A;  4WFG A;  2QDO A;  1QVG U;  1I08 A;  5HFL A;  4TV8 A;  4YJ3 B;  4KHP B;  2F23 A;  4GT1 A;  5LP6 B;  5IJ9 B;  3BA9 A;  5LYJ B;  3OR6 C;  2XAQ A;  4I5S A;  4PJ0 Z;  4UFZ A;  1AI7 A;  1S0V A;  1WPX A;  5LBQ A;  1AI6 A;  3P32 A;  3ABU A;  1YI2 V;  2Y69 C;  2B5U A;  1M5I A;  3BA8 A;  1ZLZ A;  3SGI A;  3CRR A;  4IYI A;  1EZJ A;  3B8M A;  2P67 A;  1AI5 A;  1N34 O;  2Y4T A;  5KHG A;  5IYZ B;  3SYA A;  1KP3 A;  2W6I G;  1BSM A;  5E1A C;  4UCR A;  4JAA A;  1SS3 A;  3UKM A;  4YXW G;  3TXQ A;  2WAM A;  5DN6 G;  4MT8 A;  2FKX A;  1GK9 A;  2WA4 A;  4Z2W A;  4KHP O;  2GUZ B;  4J41 A;  2QM4 A;  1FFX A;  2GDS A;  3SJB C;  4QE7 A;  1OCZ C;  1PNM A;  5C8Y B;  4CH4 A;  3AK3 A;  1H8E G;  2QKC A;  3KKY A;  2UXC B;  1MZE A;  5EC1 C;  1XMQ B;  3OEE G;  3AG1 C;  2LJ2 A;  3AK2 A;  2ADP A;  4EB6 A;  3NXS A;  1XEQ A;  3ZRW A;  5BR8 B;  2EIK C;  1PL4 A;  4GKJ O;  1KKD A;  1IBM O;  4FLU A;  2YXL A;  4OGQ B;  4B3T B;  1VQO V;  1VQM V;  3THO A;  3L71 H;  1M57 B;  3NR7 A;  1XDC A;  3X2Q C;  2E75 B;  1ZSP A;  3C90 A;  4BIU A;  1AR4 A;  4R50 A;  3C3S A;  4U3F H;  4MVM A;  2BTQ B;  1QU7 A;  3G4S V;  4JTC B;  3ABM C;  4CH6 A;  3FKS G;  1G6U A;  2EIM C;  1DLB A;  3G6E V;  2DQ3 A;  2DYR B;  5EIB C;  1JVM A;  3ZS8 C;  5KMG A;  2GSM B;  3L70 H;  5GW7 A;  3SPI A;  2Q68 A;  5EBM C;  1R6N A;  1JX9 A;  1NJI W;  1Q90 D;  2HVJ C;  3RGB A;  1BS3 A;  1EN5 A;  3JAR B;  4MVU A;  4LFB O;  4WF9 V;  1HR0 O;  3SYQ A;  5IYZ A;  3ASN C;  4FLV A;  2UUB B;  1I5Y A;  1M56 C;  3RYH A;  2X6A A;  4AIL C;  3ZRX A;  4WBN B;  2HEP A;  3OR7 C;  3ICX A;  4BW9 A;  1QR8 A;  4DV0 O;  1EBO A;  1KUQ A;  4NKG B;  2GV9 A;  3CRC A;  3E22 A;  2ZE7 A;  1S3J A;  3U10 A;  3D3Q A;  3K0G A;  4NR1 A;  3CWB H;  1XL6 A;  4O4J B;  4BAY A;  2KKW A;  1XOU A;  1AP6 A;  5KLV H;  4DR4 O;  1K8A W;  2PYL A;  2GTA A;  3ZHT A;  2QWN B;  3EXA A;  3K5L A;  1XNR O;  4PV1 B;  4UCS A;  2YIA A;  4PI2 A;  2ZM6 O;  4LF9 B;  4RUF A;  5KHI A;  4FK5 C;  4H33 A;  4MS2 A;  4MVR A;  2P06 A;  1BMF G;  3JSN A;  3JAR A;  3OD4 A;  4PA9 A;  5LHG A;  1LUV A;  2QWO B;  3WB0 A;  4IHJ B;  1AR1 B;  4ZHQ A;  2WLM A;  3QO7 A;  3HR0 A;  5EZY B;  3CCU V;  3FB5 C;  3JAS A;  3ZMZ A;  2VQF B;  5DED A;  4ZOL A;  4JI2 B;  4JI6 O;  3ETG A;  5B5E Z;  5IWA O;  4OX9 O;  4EEQ A;  5L3C A;  2Q73 A;  4J10 A;  3P3P A;  2BOB C;  2LGW A;  2QJ1 A;  4GX5 A;  3B09 A;  2N04 A;  3ETE A;  3JAK B;  5BR8 O;  2ZKO A;  3B77 A;  5KHH A;  4TUY A;  4QPK A;  2DYS B;  3UQ8 A;  5BXZ A;  3B2E E;  3R65 A;  2ITD C;  1VQL V;  4NYK A;  2GUZ A;  4ZOL B;  4FFK A;  1Q6H A;  1YTF B;  1LR1 A;  3B40 A;  4RAI A;  4PDR A;  3RT3 C;  3CJH A;  2VQF O;  4OXS A;  1OCO B;  5KX5 B;  2B1G A;  3ML0 A;  2QKA A;  3M99 B;  1GKF A;  4JYA B;  4UVA A;  2M6Y A;  2DWE C;  3ZHQ A;  3VOU A;  2LO1 A;  1J5E B;  2XAH A;  3PN1 A;  4UV8 A;  1SQB H;  2JGD B;  4ZI7 A;  1ZTE A;  3OMI B;  3KCX A;  4FLT A;  5CB4 B;  3QTC A;  2HFE C;  1H2N A;  3CC4 V;  4TSF G;  4FLW A;  5CA0 A;  4E2L A;  2ZIM A;  4AQY B;  1QLE B;  3AG7 A;  1XNR B;  4LNU B;  2A06 H;  5CA3 A;  4JYA O;  1SZT A;  5K1X A;  4I0X A;  2Y4U A;  3DSQ A;  1JFF B;  4UUJ C;  1UJW B;  1F51 A;  5JJJ B;  4B3R B;  4TV8 B;  4YJ3 A;  3OMA B;  2YIB D;  4B3T O;  4GX1 A;  3AEI A;  2EIN C;  3K9S A;  4CH5 A;  1D5A A;  5FLX N;  5D5P A;  1HDJ A;  2QM7 A;  1K7D A;  3T2M A;  3LNM B;  4XDL A;  4O4L A;  3K08 A;  4JI5 O;  4DR3 O;  1CEZ A;  1TA8 A;  2AGA A;  3APQ A;  4DR1 O;  1AJP A;  1V54 C;  4IT5 A;  2M7W A;  2WLN A;  3P30 A;  4LH6 A;  2PY5 A;  4B3M B;  1FJG B;  2YSU B;  1RM1 C;  4DV1 O;  2ZNJ A;  3OT7 A;  5B1A C;  4HNA B;  3N2K B;  4ZBM A;  3BVO A;  4DR5 B;  5CB4 A;  1H2G A;  5FL7 G;  1VQ4 V;  1W0J G;  5IJ0 A;  4O2B B;  1N34 B;  1KD1 W;  4JI7 O;  4XBF A;  1N33 O;  1LNQ A;  3U11 A;  1AVM A;  3L73 H;  1SQP H;  4X1Y A;  2Q4P A;  3JSL A;  3K5M A;  1Y4M A;  5LXT B;  3G80 A;  4RO2 A;  2QA4 V;  1L8D A;  1OCR B;  4PA4 A;  4K0K O;  1LUW A;  1B06 A;  1N0N A;  5L3B A;  5LMN B;  1JR9 A;  2CGO A;  4K8X A;  1SET A;  4YHH B;  1SQF A;  4CS4 A;  4QE9 A;  3FB7 C;  1FD9 A;  1Q7Y W;  3CHX A;  4R7C A;  4DW1 A;  5LP6 C;  4UCT A;  4QIW F;  2R9A A;  1K4D C;  2G38 A;  3SR2 C;  3ZED A;  4CS2 A;  1FXK C;  3CSX A;  5H6Q A;  2PI4 A;  3K9A A;  3A0B Z;  1YXB A;  3JD3 A;  5KUM A;  3JCZ A;  5LXT A;  5J2T A;  4FM0 A;  1RM1 B;  2CTW A;  2CK3 G;  4YHH O;  3TXS A;  4BW5 A;  1KB9 F;  1Q43 A;  4J80 A;  1Y74 A;  1JPX A;  4FMT A;  2A9H A;  1SES A;  4LF8 B;  3QO8 A;  4IGG A;  4MVO A;  3OW2 U;  5B1N A;  4WCE V;  2XUM A;  2EIK B;  2L35 A;  1R73 A;  3ZHV A;  4Z1V A;  4JI3 O;  5LA6 B;  4X1K A;  4MVZ A;  2EIN B;  4H44 B;  2RDC A;  4O4H B;  4HNA A;  1FXK B;  4XDJ A;  2FB5 A;  2PGG A;  1X4T A;  2XAG A;  3CCM V;  4MVQ A;  1H8H G;  1O9G A;  4H37 A;  5LOV A;  3TET A;  4DR5 O;  1WA8 B;  4GLX A;  1BCC H;  4IIJ B;  5KUK A;  3T1H O;  2K1E A;  1XNQ O;  5EC2 C;  1IBM B;  3T1Y O;  1VEW A;  2YIC A;  4NTY A;  2IH3 C;  1F7Y A;  3WFV A;  2LW7 A;  1AJQ A;  3CEI A;  3DGE A;  1NBM G;  2XT9 A;  2Q0A A;  4DUY B;  2D3O W;  5DM6 V;  5KA5 A;  4LF4 B;  2ZE8 A;  4GKJ B;  1SKV A;  4CZZ A;  3IGA C;  1M93 A;  3VBB A;  1UPG A;  5LGN A;  4JI1 O;  3ZMU A;  1MA1 A;  2R72 A;  1DK1 A;  1NI8 A;  2ZIN A;  2A79 B;  1K33 A;  3E2E A;  1ENV A;  4J9Y B;  1XIL A;  1AIL A;  2Q7E A;  1TVK B;  1E79 G;  3GVM A;  1N32 B;  1M9N A;  3A0H Z;  3JAL A;  2KSD A;  2ZE5 A;  2X0L A;  2OIE A;  4I4T B;  4DV7 O;  2WPD G;  1O9H A;  3FAV B;  1ZL8 A;  2CE4 A;  1RP3 B;  1VMG A;  3GWK C;  1IBL B;  4DV1 B;  5KX5 A;  1GN3 A;  4GZR B;  3T1Y B;  1WN7 A;  3RW0 A;  3BAA A;  1BHB A;  2YC0 A;  2ZDI C;  4DR6 B;  4EKW A;  2UU9 B;  3E8F A;  2OCC B;  1K34 A;  2E3C A;  1NR7 A;  4DYL A;  1OHH G;  4Q6G A;  1S76 D;  2Q5Z A;  1BZK A;  1URF A;  3ZIA G;  3L72 H;  1Y76 A;  5KHK A;  1WNS A;  3UO2 A;  3CC7 V;  1I7F A;  1H38 A;  2QEX V;  3E86 A;  3JAK A;  1GAX A;  2QWP B;  4PEL A;  4QNH B;  1KKC A;  3OGI B;  4G27 B;  1HNX B;  5A2Q N;  4JI3 B;  4UB8 Z;  3SPH A;  3BCC H;  4LP8 A;  3IAY A;  1MNG A;  5JWP A;  2A7W A;  5KHJ A;  4O2A B;  4FPP A;  1X59 A;  1BQZ A;  1QQC A;  3CCJ V;  2IW5 A;  1TVK A;  3SJA C;  5L3G A;  3LDE A;  1GRJ A;  2JGU A;  5EIB D;  3HKE A;  2XAF A;  4NXM B;  4DK0 A;  5L3E A;  3BHP A;  1FKA O;  1SQV H;  1KMI Z;  3FAV A;  5IDJ A;  2F4V O;  2Y0P A;  1J5E O;  3A8T A;  3RN4 A;  1N32 O;  2JK5 C;  3AG3 B;  1ROP A;  3T4Z A;  1Z5V A;  5FPR A;  1WB7 A;  1PM9 A;  1P7G A;  1YTF D;  3N2K A;  1R1B A;  3CCS V;  4PDV A;  3O9O A;  5IJ9 A;  4NVP A;  1FYJ A;  4R6Z A;  3DXR A;  2IM9 A;  3CCL V;  1THZ A;  1E1R G;  4TV9 A;  4UB6 Z;  3W7U A;  4JI2 O;  1WA8 A;  3FB8 C;  2F95 B;  5IE9 A;  4YY3 O;  2Q9L A;  2KG7 A;  4FZ0 A;  2QSA A;  4JI0 O;  1JFF A;  1MZF A;  3L74 H;  5BMV A;  3LDC A;  5H5N A;  3W7X A;  1EM1 A;  5FNV B;  4LF6 B;  5FNV A;  2DOS A;  1GM9 A;  2E5L O;  4O4H A;  1S5J A;  1ZWI C;  2Q8V A;  1IXM A;  2AW9 A;  1R6K A;  3C3T A;  2MK3 A;  3CRM A;  1M56 B;  1NTK H;  2VS0 A;  2YXY A;  1VQK V;  1XMO O;  5CMU A;  1NH2 B;  4MTO A;  2B9Z A;  4F4L A;  3FYE B;  2UUC B;  2QWQ B;  5LOV B;  2B1I A;  2RQ6 A;  2HLD G;  4OPA A;  4UV9 A;  4X65 O;  3BAB A;  1SA0 A;  3CCV V;  3WB2 A;  4DV6 O;  1YEW A;  1HNW O;  3H1H H;  3OGC C;  5J2T B;  3CME V;  1NTM H;  1HR0 B;  3AG2 C;  2EZO A;  4ZI7 B;  4MTG A;  1PKX A;  4HYO A;  1V54 B;  2UUC O;  1QLE C;  2EIM B;  3M7M X;  4EFB A;  3GWO A;  3N2G B;  3FD9 A;  3LSU A;  1Y67 A;  2YDE A;  5B1O A;  3S3W A;  5B66 Z;  2UU9 O;  1Q3E A;  1XUQ A;  1SQX H;  3ABT A;  4I55 A;  4G28 B;  2AZ2 A;  4YIP A;  4ABM A;  3OM3 B;  3ASN B;  3OTF A;  4IL6 Z;  4GCZ A;  4UCU A;  1K5S A;  4DW0 A;  4DR7 B;  4IYH A;  1ZAU A;  2AHZ A;  4DRX B;  3ZRW B;  3W7T A;  1R3L C;  3JAS B;  5CBF A;  2PUS A;  5EK0 A;  2JS5 A;  3K03 A;  4JI6 B;  1FAF A;  2UXD B;  3K06 A;  2XTA A;  4JTA B;  3E8H A;  1NKD A;  2WLL B;  3H1K H;  1IX9 A;  2UXC O;  2IU0 A;  2BTO A;  2NN4 A;  4JF3 A;  4ZIB A;  1IVS A;  4Q20 A;  4D7T A;  1J95 A;  3J7A U;  1HWY A;  1KEC A;  1VQ5 V;  1COW G;  1EN6 A;  2A0L A;  2YEV B;  1YVW A;  2H3O A;  2BE3 A;  1QBZ A;  2Y48 A;  1XMQ O;  1I0H A;  3CMA V;  2W0F C;  2EIL C;  3MHH C;  1QNM A;  1KU9 A;  1YHQ V;  2JEU A;  4UXN A;  1N0J A;  5EBL C;  1H2M A;  3ZRV A;  5IWA B;  1GO3 F;  4KFM A;  4PD4 F;  2EJ7 A;  5HFM A;  4J7Z A;  3T1H B;  1NTZ H;  2ZCE A;  3BFR A;  5CBG A;  1RPR A;  2RNB A;  1JMK C;  3QVN A;  3IJ4 A;  4X64 O;  5A9G A;  4FFB B;  5IT9 N;  2BOC C;  3D3I A;  4DR6 O;  1HNZ B;  4DO2 A;  1BHA A;  3HKC B;  1US6 A;  3VQY A;  4K0K B;  1G4Y B;  5IY5 B;  1AP5 A;  1WP8 A;  1YDX A;  2IJI A;  3CPW U;  5JCO A;  4PA7 A;  1QHT A;  1NS1 A;  3FYI B;  1U97 A;  3E8B A;  2EBO A;  4DV3 O;  4MVS A;  5GON A;  3JAT A;  1M90 W;  2ZQM A;  2YS8 A;  2ZR3 A;  2CTR A;  1JA8 A;  1SF9 A;  2JGD A;  5B3S B;  2EUL A;  3WB1 A;  3RYI B;  1CPY A;  1F4M A;  3ZMV A;  2QR4 A;  1WPB A;  2YID A;  4DV2 O;  1WJZ A;  4LWS A;  3K5O A;  1VF5 B;  3F7V C;  1BL8 A;  5J9P C;  2AHY A;  3HKD A;  3CJH B;  1MSW D;  1IZ3 A;  3OE7 G;  3P3N A;  5GTH Z;  3SJC C;  2NNU A;  4DR2 O;  1N36 B;  1SER A;  3OTO B;  3O65 A;  2UXD O;  3SYP A;  1RFY A;  1Q5O A;  1FPO A;  2YI8 A;  5LMN O;  3WU2 Z;  2UUB O;  3A2F A;  3ETQ A;  4JI0 B;  4U7N A;  4HZ3 A;  2VQE B;  4OX9 B;  2IH1 C;  4TWK A;  4D6T H;  1R6T A;  3T1C A;  4HAM A;  4Z1M G;  1P49 A;  4P9P A;  2WLI B;  3HKD B;  2GBO A;  5CN0 A;  4RUE A;  3TCU A;  5C8Y A;  1Q6U A;  1ZL8 B;  2DMX A;  3UM7 A;  3U0Z A;  2JJ1 G;  1GTO A;  4X8A A;  3T4D A;  4JPR A;  4L87 A;  4P9O A;  2R70 A;  3JAT B;  4X1Y B;  3RFR A;  1YF2 A;  1OZ0 A;  3D36 A;  3KCY A;  4JYY A;  4RQE A;  1DGS A;  3SPC A;  3UT5 B;  2HHH B;  1P7B A;  4LC1 A;  1YJ9 V;  4TQD A;  1XRE A;  1Y66 A;  2WSS G;  2NR5 A;  4UCV A;  3KG2 A;  4X66 O;  4LF9 O;  3CXH F;  2P7T C;  3FB6 C;  3JYC A;  1VP7 A;  2Q7G A;  2F66 C;  4KUM A;  5IJ0 B;  1TGO A;  1NU1 H;  1H2L A;  2UXX A;  2CDY A;  2XAS A;  2DW4 A;  1RSO A;  4B7E A;  4LH7 A;  3JAW B;  1NZ6 A;  5KAF Z;  5H2F Z;  3K57 A;  3STZ C;  5AG2 A;  2JS3 A;  1TAE A;  4WBN A;  5LP6 A;  4X20 B;  2ITC C;  2D2C B;  4CS3 A;  1EZV H;  2F1M A;  4J7J A;  4TV9 B;  2GHY A;  5B1A B;  1G8M A;  2K9P A;  5LHH A;  3G6B A;  3F7Y C;  2JJ2 G;  3FX7 A;  4KP4 A;  3JD0 A;  3IFX A;  3JAW A;  2W6J G;  2XHB A;  2P22 C;  1OCZ B;  3K58 A;  2YXH A;  2EIJ B;  2JRI A;  4DV5 B;  4H13 B;  4WFB V;  1R3J C;  3ZJZ A;  2Q69 A;  2YEV A;  2FML A;  4I0X B;  4LF6 O;  3H1J H;  4X64 B;  3UCS C;  1R3I C;  2X7R B;  5EBW C;  3LNN A;  1XQ8 A;  1I94 B;  4K35 A;  5H6R A;  5CBH A;  2IJH A;  5LGU A;  1B04 A;  2HP8 A;  3CCQ V;  3K59 A;  1WB8 A;  3UO3 A;  5JVD B;  2DN9 A;  4JI5 B;  4KXR A;  2LQT A;  1JOY A;  4I7Z B;  1SQG A;  2AZ0 A;  2P4K A;  3ABL C;  1WP7 A;  2MW2 B;  1VQ9 V;  4LFC B;  3LDD A;  4ZKI A;  2V7Q G;  1N4C A;  3CCE V;  3BY6 A;  1S5L Z;  1M57 C;  4EFE A;  5GON B;  1AI4 A;  4TQF A;  4EB6 B;  5EZY A;  4O4I B;  3K3W A;  4DV0 B;  4C7U A;  4LWS B;  3H1L H;  2OIG A;  1PNL A;  3LSQ A;  1P4R A;  4WFA V;  2KQX A;  4I4T A;  1TUB B;  2RN9 A;  2ETN A;  1GN6 A;  1SC5 B;  4JAS A;  1ZUQ A;  3RBZ A;  5EYP B;  2OCH A;  4B3M O;  1FJG O;  2QM8 A;  1MAB G;  1S5H C;  3EFF K;  4UVB A;  4X65 B;  5JJE B;  4B7K A;  3BRC A;  4JZG A;  1YJN V;  5LYJ A;  1IBK O;  1QR9 A;  2RCV A;  3RVZ A;  1GH6 A;  1T5E A;  1EN4 A;  4JZ2 A;  1HNW B;  1BGY H;  1YIT V;  1M4U A;  1KP2 A;  4JI8 O;  5BZB A;  3E22 B;  4JI1 B;  1H2K A;  1MSD A;  1H2S B;  1IBL O;  1JQ0 A;  2Q67 A;  3D36 C;  1XHZ A;  1VAR A;  5BMV B;  3JAM N;  1D5N A;  4DXW A;  3TGU H;  5KA6 A;  2L6L A;  4X20 A;  3I55 V;  2DYR C;  3CRA A;  3CD6 V;  1HP8 A;  4UCO A;  4GKK O;  3I56 V;  4JV5 O;  2W0X A;  3SPG A;  2EIL B;  1JCH A;  1HW7 A;  1PD3 A;  1XMO B;  4K8Z A;  2VWK A;  4X1K B;  3VQV A;  4LF4 O;  3ZMS A;  2F4V B;  1ARO P;  3LSS A;  4FJC C;  4U3J B;  4PI0 A;  2P5O A;  3UT5 A;  1WAZ A;  2EIJ C;  2LGQ A;  3CB2 A;  1K73 W;  3JD4 A;  2H8P C;  2P4V A;  1Q86 W;  3ABL B;  3CE2 A;  2WLL A;  3J81 N;  3H1I H;  1RPO A;  4O2A A;  3ABK B;  2OTL V;  2VQE O;  4ASU G;  5JH7 B;  2UXN A;  4TUY B;  3AK1 A;  3HB3 B;  3K0D A;  1F4N A;  4X89 A;  3E35 A;  4MTX A;  1W0K G;  1K4C C;  1VQP V;  4FLY A;  3N2G A;  5C93 A;  2CGN A;  3R66 A;  5LMU O;  2ZT9 B;  3AG2 B;  5DEC A;  3H9V A;  1Q81 W;  2E74 B;  1S72 V;  1HNX O;  2V4D A;  3WG7 C;  1FFX B;  5CA1 B;  2LP7 A;  1SRY A;  3J80 N;  5H9C A;  3E83 A;  4X62 B;  3QG5 A;  3OAA G;  1XL4 A;  1TUE B;  3VQX A;  2Z3Y A;  2BCC H;  2JEX A;  5IY5 C;  3BPZ A;  4AQY O;  2PZS A;  1DTO A;  4A5U B;  2UUA O;  1K3E A;  4O2B A;  2WLK A;  2VRZ A;  5ITZ A;  2PI5 A;  5IYC O;  2EJR A;  4X1I B;  4X62 O;  1NT2 B;  3OUS A;  4RQF A;  3OUF A;  3JD1 A;  4MSW C;  4D7S A;  4LBE C;  4MW8 A;  1KQS U;  1YZB A;  1EFR G;  3TJT A;  1GMG A;  3G67 A;  3DXR B;  1GN4 A;  2QE7 G;  3SYO A;  4LF5 B;  4NB5 A;  1VF6 A;  4HBN A;  2F43 G;  1RSO B;  2QKS A;  2RMK B;  1S77 D;  4QGP A;  4LCU C;  1IBK B;  2ZIO A; 
#chains in the Genus database with same CATH homology
 4X88 A;  5B3S B;  1FXK C;  5H6Q A;  2PI4 A;  2Z5U A;  3K9A A;  1CPY A;  5IYB O;  3JD3 A;  4U7O A;  5KUM A;  3JCZ A;  3ZCC A;  1RM1 B;  1F4M A;  2CK3 G;  3ASO C;  3ZMV A;  1W2B U;  4PA3 A;  4BW5 A;  3CXC U;  3F7V C;  1BL8 A;  5J9P C;  2AHY A;  2Y69 B;  1AJN A;  1QCE A;  2XAJ A;  1F23 A;  1JPX A;  4FMT A;  1MSW D;  2A9H A;  1SES A;  3OE7 G;  3QO8 A;  3AG1 B;  4G2K A;  2NNU A;  1FXH A;  4MW3 A;  1SER A;  3E8G A;  4MVO A;  2DQ0 A;  5B1N A;  3OW2 U;  3SYP A;  4WCE V;  2IJK A;  2QTO A;  3F5W C;  4WFG A;  2EIK B;  1QVG U;  1R73 A;  5HFL A;  2R9R B;  4U7N A;  3BEH A;  4GT1 A;  4HZ3 A;  2IH1 C;  4TWK A;  4MVZ A;  1V55 B;  2EIN B;  3T1C A;  1NVP D;  1ORQ C;  4HAM A;  4Z1M G;  3OR6 C;  4P9P A;  2WLI B;  1FXK B;  2XAQ A;  4XDJ A;  4I5S A;  1AI7 A;  3G71 V;  1MOF A;  2XAG A;  3K79 A;  3CCM V;  3A0R A;  4MVQ A;  1H8H G;  5CN0 A;  1S0V A;  1WPX A;  5LBQ A;  4RUE A;  1AI6 A;  3TCU A;  3GB7 C;  4H37 A;  3P32 A;  1R3K C;  3ABU A;  3TET A;  1YI2 V;  1NR1 A;  2Y69 C;  2B5U A;  1K9M W;  1K5Q A;  1EZJ A;  3B8M A;  3UM7 A;  2P67 A;  1AI5 A;  3W7W A;  2JJ1 G;  5KUK A;  1GTO A;  2K1E A;  4X8A A;  3B8N A;  3T4D A;  4JPR A;  5EC2 C;  4L87 A;  4P9O A;  3SYA A;  1KP3 A;  4JYB A;  4CBC A;  2W6I G;  5E1A C;  1VQN V;  3UKM A;  1OZ0 A;  3D36 A;  4YXW G;  2IH3 C;  2WAM A;  3WFV A;  4MT8 A;  5DN6 G;  4RQE A;  1AJQ A;  3SPC A;  3DGE A;  1NBM G;  1P7B A;  3IC7 A;  1GK9 A;  4LC1 A;  1YJ9 V;  4N23 A;  1Y66 A;  2WSS G;  2D3O W;  3KG2 A;  5DM6 V;  2P7T C;  5KA5 A;  3RVY A;  3FB6 C;  3JYC A;  2ZR2 A;  4KUM A;  4QE7 A;  1OCZ C;  1PNM A;  4JAV A;  4TT3 G;  4CZZ A;  2UXX A;  1H8E G;  3IGA C;  2XAS A;  2DW4 A;  3VBB A;  2XOK G;  5LGN A;  3CYO A;  3ZMU A;  2HKO A;  5EC1 C;  3OEE G;  2ZD9 A;  3AG1 C;  2A79 B;  1K33 A;  3E2E A;  1ENV A;  4J9Y B;  3NXS A;  3STZ C;  2DWD C;  3ZRW A;  1MG1 A;  3STL C;  1E79 G;  2WLJ A;  1FS0 G;  2ITC C;  2EIK C;  4P30 A;  1M9N A;  3MD0 A;  4WFF A;  4XDK A;  2X0L A;  1KKD A;  1PL0 A;  1OCR C;  2GHY A;  3QO5 A;  5B1A B;  1G8M A;  5LHH A;  2WPD G;  1VQO V;  1VQM V;  3SJQ C;  1M57 B;  3F7Y C;  2JJ2 G;  4QJF B;  4KP4 A;  3X2Q C;  3JD0 A;  3ZN1 A;  3IFX A;  2W6J G;  4BIU A;  1OCZ B;  3ZMT A;  2XND G;  4R50 A;  3RW0 A;  1BHB A;  4MVM A;  2ZDI C;  3G4S V;  4EKW A;  4JGS A;  2EIJ B;  3E8F A;  4JTC B;  2OCC B;  1K34 A;  3ABM C;  1NR7 A;  4BIZ A;  3FKS G;  1OHH G;  4JTD B;  1S76 D;  2EIM C;  5B3S C;  1DLB A;  4WFB V;  1R3J C;  3G6E V;  2DQ3 A;  3ZJZ A;  1YJW V;  2DYR B;  2Q69 A;  2YEV A;  3ZIA G;  1JVM A;  2OTJ V;  3LUT B;  2GSM B;  2HJF C;  3DTU B;  5GW7 A;  3SPI A;  1OCC C;  1I5X A;  1OCO C;  3CC7 V;  1H38 A;  2QEX V;  2Q68 A;  5EBM C;  1R3I C;  1R6N A;  3E86 A;  2X7R B;  1NH2 D;  1JX9 A;  1NJI W;  2HVJ C;  4PEL A;  5EBW C;  4QNH B;  3CC2 V;  2ZDI A;  3AG3 C;  1VQ8 V;  4G27 B;  4QPJ A;  4GX2 A;  4MVU A;  4WF9 V;  1YIJ V;  5H6R A;  3SYQ A;  3ASN C;  5CBH A;  3SPH A;  4LP8 A;  1I5Y A;  2IJH A;  1M56 C;  2X6A A;  5LGU A;  2X6C A;  4FPP A;  3CCQ V;  3CCJ V;  3AG4 B;  2IW5 A;  3ZRX A;  5L3G A;  1V55 C;  3LDE A;  3OR7 C;  3WG7 B;  2IJJ A;  3MHS C;  1QR8 A;  2XAF A;  1YSC A;  1FXK A;  1EBO A;  1JOY A;  5L3E A;  1CP9 A;  3ABL C;  5IDJ A;  2DYS C;  1S3J A;  1VQ9 V;  3K0G A;  3LDD A;  1DF5 A;  2JK5 C;  4ZKI A;  4BAY A;  1XL6 A;  2V7Q G;  3AG3 B;  1ROP A;  2JIZ G;  3T4Z A;  1M1K W;  3CCE V;  3BY6 A;  1M57 C;  1AI4 A;  2ATK C;  1NQT A;  1K97 A;  1YTF D;  2HVK C;  1K8A W;  2IU3 A;  2H94 A;  3K3W A;  3CCS V;  2OT5 A;  1VQ7 V;  3AG4 C;  4PDV A;  1PNL A;  4R6Z A;  3SPJ A;  3LSQ A;  4PA6 A;  1P4R A;  4WFA V;  3CCL V;  1THZ A;  4RUF A;  1E1R G;  4FK5 C;  4H33 A;  4MS2 A;  3W7U A;  4MVR A;  3FB8 C;  4JAS A;  3RBZ A;  1BMF G;  2QM8 A;  4JYC A;  3ETD A;  1MAB G;  1S5H C;  3EFF K;  4PA9 A;  1K92 A;  5LHG A;  4UVB A;  3LDC A;  1OCC B;  1Q82 W;  3OFN G;  1AR1 B;  3W7X A;  2WLM A;  2P90 A;  4UVC A;  3QO7 A;  3CCR V;  2LFS A;  3EHB B;  1YJN V;  3CCU V;  1GM9 A;  3FB5 C;  4N21 A;  3ZMZ A;  1QR9 A;  1ZWI C;  2C2A A;  1IXM A;  5IYD O;  3RVZ A;  1R6K A;  2MK3 A;  2KB1 A;  1M56 B;  3ETG A;  1YIT V;  1KP2 A;  5B1B B;  1VQK V;  5BZB A;  2WLH A;  5CMU A;  1NH2 B;  4MTO A;  5L3C A;  4F4L A;  3FYE B;  2B1I A;  2BOB C;  2V1D A;  2HLD G;  4GX5 A;  4UV9 A;  1JQ0 A;  2Q67 A;  3ETE A;  2ZXW B;  1B6Q A;  3B77 A;  3CCV V;  1DF4 A;  5L3F A;  3ASO B;  4DXW A;  3E89 A;  4QPK A;  1N8R W;  3OGC C;  2DYS B;  3CME V;  3AG2 C;  2EZO A;  5KA6 A;  4MTG A;  3R65 A;  2ITD C;  3CP1 A;  1PKX A;  1VQL V;  4HYO A;  1V54 B;  1QLE C;  2EIM B;  3I55 V;  2DYR C;  1YTF B;  3CD6 V;  3GWO A;  4WFH A;  4RAI A;  5LHI A;  4PDR A;  5B1O A;  4OXS A;  3I56 V;  1OCO B;  2B1G A;  3ML0 A;  3ABT A;  1GKF A;  3M99 B;  3SPG A;  2EIL B;  3K04 A;  1JCH A;  4G28 B;  4UVA A;  4PDM A;  1PNK A;  2DWE C;  1PD3 A;  3VOU A;  2XAH A;  3OM3 B;  3ZMS A;  3ASN B;  3W7S A;  4GCZ A;  4UV8 A;  1L1F A;  3ZN0 A;  5LGT A;  1ARO P;  1K5S A;  3OEH G;  3OMI B;  3LSS A;  4FJC C;  3PJS K;  2AHZ A;  2HFE C;  1WLE A;  3ZRW B;  3W7T A;  1R3L C;  3CC4 V;  2EIJ C;  3QNE A;  4TSF G;  4E2L A;  2NLJ C;  3ABM B;  4PDL A;  5CBF A;  1QLE B;  1K73 W;  5CA3 A;  1SZT A;  3JD4 A;  4P2Z A;  4UUJ C;  2H8P C;  1E1Q G;  1UJW B;  1F51 A;  5EK0 A;  1Q86 W;  3ABL B;  3K03 A;  2WLL A;  1RPO A;  3ABK B;  3K06 A;  4JTA B;  2OTL V;  3OMA B;  3E8H A;  1NKD A;  2WLL B;  2FTK A;  4GX1 A;  4ASU G;  3AEI A;  2EIN C;  3SYC A;  1QVF U;  4R8C A;  3ZRS A;  2UXN A;  4I9W A;  3HB3 B;  3K0D A;  2IU0 A;  1F4N A;  4X89 A;  3E35 A;  2QM7 A;  4MTX A;  1W0K G;  4JF3 A;  1K4C C;  1K7D A;  3T2M A;  3LNM B;  4Q20 A;  4XDL A;  1VQP V;  1J95 A;  1HWY A;  5C93 A;  1KEC A;  3K08 A;  1VQ5 V;  1COW G;  2A0L A;  2YEV B;  3AG2 B;  1Q81 W;  1CEZ A;  1S72 V;  1AJP A;  3JD2 A;  3WG7 C;  1V54 C;  2M7W A;  2WLN A;  2LP7 A;  3P30 A;  1SRY A;  1GM7 A;  1QBZ A;  2YSU B;  1RM1 C;  2Y48 A;  3CMA V;  5H9C A;  4MTF A;  3E83 A;  3ABK C;  2W0F C;  3OAA G;  5B1A C;  1XL4 A;  1TUE B;  2EIL C;  2WLI A;  2WWW A;  3MHH C;  2HR3 A;  2X6B A;  2Z3Y A;  4ZBM A;  1YHQ V;  2JEX A;  5IY5 C;  2JEU A;  1VQ6 V;  4UXN A;  5EBL C;  1H2G A;  5FL7 G;  1DTO A;  3ZRV A;  1VQ4 V;  3X2Q B;  1GO3 F;  4KFM A;  1W0J G;  4JAU A;  2HG5 C;  1K3E A;  5HFM A;  2WLK A;  2PI5 A;  5IYC O;  1FFT B;  2EJR A;  2LFR A;  1KD1 W;  3OUS A;  4XBF A;  5CBG A;  1RPR A;  1LNQ A;  4RQF A;  2BOC C;  3OUF A;  3D3I A;  3JD1 A;  1QLN A;  2ZXW C;  4MSW C;  2R9I A;  4LBE C;  4GX0 A;  4DO2 A;  4MW8 A;  2EZP A;  1KQS U;  1BHA A;  1Y4M A;  1EFR G;  3H01 A;  1GM8 A;  4RO2 A;  2QA4 V;  1OCR B;  4PA4 A;  1GMG A;  1KC8 W;  2P6J A;  4J9Z B;  3HPL C;  1G4Y B;  5L3D A;  5IY5 B;  5L3B A;  1JJ2 U;  2QE7 G;  1NVP B;  2IJI A;  3SYO A;  1SET A;  3CPW U;  4FIP C;  2Q6A A;  4QE9 A;  4PA7 A;  5B1B C;  3FB7 C;  2F43 G;  3FYI B;  3E8B A;  2QKS A;  2EBO A;  1Q7Y W;  1S77 D;  4MVS A;  2JDI G;  3OMN B;  4R7C A;  4LCU C;  1M90 W;  1FXV A;  4QIW F;  4WFE A;  2ZQM A;  2OCC C;  3TK1 A;  2ZR3 A;  1K4D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...