1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP PROTEIN
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
1NKDA 1RPOA 1GMGA 1PD3A 1F4MA 2IJJA 4DO2A 2IJKA 2IJHA 1ROPA 1RPRA 1GTOA 1B6QA 3K79A 2GHYA 1F4NA 2IJIA
chains in the Genus database with same CATH superfamily
3J80N 4BIOA 2QR4A 4FVMA 4TV9B 2DYSC 1DGSA 1D2DA 4CC6A 3BCCH 2Y69B 1N8RW 1EN6A 3VBBA 3JD1A 2UXDO 2JVDA 1XREA 2BOCC 4RUFA 3ZN0A 5CBHA 1AVMA 4Z2WA 4B7KA 4DR3B 4EFBA 3JD3A 3K5LA 5EIBD 1YDXA 1EZJA 4LCUC 5LXTA 2LO1A 4WBNB 2WLNA 3K0DA 2ZIMA 3H1HH 3T1YB 4OX9O 3JYCA 4UB6Z 3U10A 1JFFA 1VARA 3THOA 1FKAO 3JARB 1G8MA 1JJ2U 2PGGA 1WNSA 1XOUA 1NTMH 2D2CB 1B6QA 2WA4A 1P4RA 1NJIW 4DV3O 4DRXA 2YXHA 3CXHF 2YI8A 1N36O 3HKBB 2QDOA 1I7FA 2BSKB 3LNNA 1WP7A 3IC7A 1YHQV 4GX2A 4RWUA 1P7GA 2Q7EA 1Q6UA 3L70H 1BQ0A 4JYBA 4DYLA 1XMOO 4FJCC 1BS3A 2YEVA 1JR9A 3JSLA 4LFAO 4ZOLA 2ZE5A 1K92A 1FXKB 3OTFA 5KHHA 4JI6O 2BE3A 4CC5A 4XDJA 3DXRA 4LF6O 3ZRWB 5EC2C 4LH6A 4K0KB 2UUCO 3HKEA 5BMVA 3CEIA 5C8YB 2UUBO 1S0VA 4NTXA 3TXSA 1JOYA 2YC0A 4JI7B 3WB2A 2Z0AA 4MTXA 2UXCB 4DW0A 4X8AA 3B8NA 1WB8A 2BOBC 4WFAV 5BZBA 3T1HO 4GKJO 4B3RO 4U3JA 1K97A 2W6JG 1W0KG 3OAAG 3OR6C 2MK3A 2GUZB 5LMUO 2A3QA 1H8HG 3GWOA 4I9WA 5KAFZ 4HNAB 3QO7A 3ASOB 3K59A 3DC6A 3AK3A 3JAKA 4IHJA 3UO3A 1KBHA 5IWAB 2ZM6O 1ENVA 1K4DC 4LBEC 4Q6GA 3APQA 2AXTZ 5B1OA 1ZWIC 2OCCB 5KHJA 4X62B 4X64O 3C3TA 1Q82W 4I0XB 1PNMA 5GONB 1KD1W 4JYYA 1WLEA 4O2BB 2X0LA 2XUMA 3G71V 5L3CA 3A8TA 1I0HA 1Q8IA 1DF5A 3ZRSA 4CS3A 3MHHC 3JD2A 2Q67A 4TV8B 3AG4C 1XHZA 1XDCA 1N33B 2CH7B 2E5LB 2IJIA 4H13B 4JI2O 1TVKB 1YXBA 3AEIA 3JAWB 4JTAB 2HVKC 2YIBA 3D3IA 1WA8B 2E76B 2HR3A 2CTWA 1PD3A 1EM1A 1R6KA 3SJBC 4DV4B 5EZYB 3BPZA 1VF5B 4PELA 3UCSC 5F2VO 3RT3C 5KX5A 4PA6A 5D5PA 1V55B 3EFFK 1CP9A 5LOVA 1E1RG 1VQ9V 2WSSG 2IJKA 2YXLA 3BABA 4UCOA 1H2KA 3RYFA 3CC2V 3E35A 3C90A 3MDSA 5FL7G 3X2QB 1RSOB 1JQ0A 1VQMV 2ZNJA 1Z2GA 2QEXV 3F5TA 1OCZC 2ADQB 3RYHB 1IURA 3CRRA 2LGQA 2R9IA 5B1NA 5CA1B 1JVMA 5K1XA 3Q4HA 1TUEB 1EN4A 4D6TH 4XDKA 2HHHO 2PI5A 4YXWG 1M57C 4IIJA 4RQEA 3OD4A 2UUAB 3E83A 1XI1A 2PUSA 2JK5C 1DK1A 1WJZA 1K3EA 3A2FA 1URFA 4CH5A 1X4TA 4O4LA 2QTOA 2YDEA 4CBCA 1PL4A 3M99B 4X1IB 3SPJA 1VF7A 2JIZG 4BIZA 2CUGA 3SPIA 4CS2A 2PTMA 4G2KA 1GH6A 2FL4A 4DR3O 1AP6A 5FNVA 3E22B 3VQWA 2O57A 4BIUA 1F4MA 2GV9A 3VOUA 1XMQO 5IY5C 3RYCB 2H3OA 2ZIOA 3P3NA 2B1GA 3T1YO 1ZTEA 1KP2A 4CH6A 2DJVA 2X6AA 1A32A 4DR1B 4FLZA 3ETQA 4PI0A 2YIDA 1XEQA 2BTQB 4ZHQA 3OR7C 3AG3B 4O4HA 1RM1C 4DXWA 4OGQB 5JCOC 2WLLA 4LWSB 1RFYA 3JAMN 3A0RA 3ZX6A 4TSFG 4GX1A 1R73A 2Q7HA 5A2QN 1QLNA 4QIWF 4K0KO 2WA3A 4N23A 1GM8A 4LF7B 1Q6IA 3OE7G 4H37A 2Q0AA 1LNQA 3LNMB 4J7ZA 3RFRA 4JI7O 2P06A 4P30A 4LNUA 1NZ6A 2GBOA 1ZAUA 3ZHTA 2RN9A 5ITZB 4JZ2A 2PY5A 2R9RB 5CMUA 3EVKA 1KYOF 3VQXA 4AILC 4PA3A 3UO2A 2DMXA 1HNXB 5KAIZ 2KKWA 4J41A 2P22C 2LQTA 3W7XA 3BEHA 3SJCC 1R3KC 1Q5OA 2UXBB 3ZRXA 2EZOA 1R3JC 3M7MX 5DEDA 3L74H 2ZINA 5JH7B 3JSNA 2ZE7A 3M8AA 2UXNA 1D5NA 4OX9B 1IVSA 2XNDG 5LHGA 2DQ3A 3OMNB 4X62O 1QVGU 4KP4A 5CN0A 1JJOA 5KMGA 1OZ0A 4IT5A 2DWEC 1BHBA 3BHPA 4PJ0Z 3WG7C 2N74A 3P3PA 1Q7YW 2VWKA 4JASA 4X1YB 3TXQA 4F6RB 4ZBMA 3ZHSA 4IGGA 2FYUH 4FIPC 4EFEA 3R65A 3AG7A 4HZ3A 2YXYA 1N33O 3W7SA 1FFXA 1NTKH 5J2TA 2E5LO 2M6YA 3QO5A 3H1IH 2CTPA 1Q81W 2OYQA 1RP3B 3CCJV 1YI2V 1AILA 4JI6B 1IBMB 1HR0B 3SR2C 2VQEB 4LF6B 3CC7V 3G80A 4K35A 1SQGA 2UUCB 4DV4O 2LFSA 1U97A 4QPKA 5HFLA 1AB3A 4QGPA 1K4CC 4NTWA 3AG2B 4GYCB 1N0JA 2E75B 5L3FA 4FM2A 2ZKOA 5LXTB 4PA9A 4ABMA 1AI6A 1YSCA 1D5AA 1GRJA 3ZHVA 1JFFB 4MVZA 4TWKA 2FTKA 2IU3A 1AI5A 3FKSG 2XT9A 3CRCA 1NH2D 1PKXA 4RQFA 4AQYO 2YIAA 4YJ3A 2LJ2A 4DRXB 4EB6A 2ZM6B 1TUBA 1PP9H 1YZBA 2QWPB 1WP8A 5J2UA 3DC5A 2DYSB 3AK2A 2UUAO 4B3SB 1QVFU 2DYRC 2WLHA 2AZ0A 5LA6A 4QNHB 1JPXA 1GKFA 4ZOLB 5LYJA 3K9SA 1DF4A 5LBQA 2HP8A 3DXRB 4YY3B 3G6BA 2JGDA 3HKEB 5LP6A 1DTOA 5BR8B 4LF8B 5KHIA 3NR7A 1JX9A 4J11A 4AHCA 3RW0A 4WFGA 5IJ0A 4JGSA 1NVPD 4KXRA 4DUYB 4U3JB 1PPJH 4DR1O 3OUFA 1N32O 1UPGA 1GM7A 4J7KA 2UXXA 2XTAA 4FZ1A 2LW7A 2ZD9A 1NVPB 4IHJB 4W4LA 2BCCH 2FKXA 4LF5B 2A7WA 4JAVA 2ZR3A 1S3JA 1NT2B 3NXSA 4NXNB 2OTJV 4FPPA 1V54C 1QLEC 1N0NA 4MVMA 4PHZA 4LF7O 1ZX3A 4DR5B 2DQ0A 4UVBA 3CCEV 3OMAB 4LC1A 3T2MA 4F4LA 3J7AU 5B1AC 4EEQA 3E8FA 4JTDB 1PV0A 2HHHB 2LW1A 3L72H 2L35A 2EILC 1HNWB 1NR7A 1GO3F 2WLIA 4HBNA 2IJJA 1KP3A 1FD9A 1T5EA 1YTFB 2IBZH 1HNXO 1RPOA 5DN6G 1GN6A 3L9DA 3H9VA 5D5QA 4BWAA 4Z1VA 1E79G 4JAAA 5LGNA 1AP5A 3ZIAG 2UXBO 4YIOA 4O2AA 1BZKA 5KA5A 3T4DA 5KX5B 1XMQB 5IT9N 4ASUG 1Y67A 4GT1A 5LOVB 4I55B 3K06A 1EFRG 2AZ2A 3F7VC 3K04A 3RYFB 1Q86W 5JJEB 1GTOA 3OMIB 4DK0A 1BE3H 2ILMA 1XL4A 3TK1A 4JI3B 5LMNB 1W2BU 2JRIA 1VIBA 5E79Z 3N27A 2VWJA 3Q4HB 4FM1A 2XAFA 5B3SC 2H94A 1LUWA 1OCRC 4IIJB 1K5QA 2WLJA 4MVOA 4DUZB 2CTQA 1IBMO 1HR0O 2VQEO 4HAMA 1AJPA 2PF4E 4IL6Z 4O4LB 4ZIBA 3E8GA 2IH1C 3B77A 1R3LC 3VQVA 3RWRD 1ZL8A 2QKSA 5FNVB 2P90A 4J9YB 3ASNC 3BA8A 1FJGO 3CCSV 3MD0A 4PD4F 3F7YC 2A06H 2RNBA 3MHSC 1BMFG 4MVRA 2W0XA 4KL1A 1YJWV 2EBOA 2Q9LA 1BL8A 2EIJC 1SQBH 1GAXA 1YIJV 1O9GA 2IJHA 1M57B 5H5NA 2EIKB 2EULA 1S5JA 1HWYA 2JGUA 3B2EE 2Y69C 2EJ7A 2DE0X 3CS5A 4O4HB 1P49A 4B3SO 3ABKC 4CH4A 2OIGA 2WLLB 2DOSA 4Z1MG 3I55V 3CCVV 4B3TO 3CHXA 5JVDA 4DV2B 3G67A 4GZRB 1QNMA 5LGUA 3L73H 4R6ZA 4UXNA 3UQ8A 2QE7G 1F23A 4KUMA 5IYZA 4YY3O 3D3QA 4I5SA 3RVZA 4FMTA 2F1MA 3B8MA 1SQXH 5BR8O 4LF8O 5DM6V 5LHHA 1G4YB 5HFMA 5EIBC 1P7BA 3CD6V 1R6TA 3CRMA 2KSDA 4DUYO 3CWBH 3QNEA 1GM9A 2CE4A 1QU7A 2GTAA 1M1KW 1QHTA 2QJ1A 3CYOA 3OGIB 1GN2A 4WCEV 4UVCA 4QE7A 3BFRA 1XBLA 3E2EA 3SYAA 4TUYA 1W59A 4GUNA 2CDYA 3APOA 1O9HA 3I56V 1SZXA 4LF5O 3K3WA 1P84F 3HR0A 2JEUA 5IJ9A 2XAJA 3FAVB 4NXNO 1MABG 4NR1A 4FLXA 2HKOA 4UCTA 4H33A 5CBFA 4DR5O 5FPRA 4RO2A 5CA0A 4AQYB 3P32A 4P9PA 3GWKC 2WWWA 5FLXN 3SPGA 1HNWO 1PL0A 3CCRV 4X20A 3RYIA 1FFXB 5J2TB 3ASOC 2V7QG 4UCRA 4IYIA 1GMGA 4C7UA 1Q3EA 4QE9A 2QWOB 1ZLZA 2YICA 3CCMV 2ITCC 2VQFO 5EBLC 3UM7A 1KU9A 2JJ1G 1NR1A 1VQNV 2NNUA 4K3AA 3U0ZA 2OCCC 2KG7A 2D3OW 4DR4B 5L3DA 5JWPA 3CXCU 1SRYA 3SGIA 2V4DA 3CJHA 3HKDA 2QKAA 4B3MB 3IGAC 3CRAA 2Q4PA 1OHHG 3WG7B 2Y4UA 3K08A 1N32B 4MVUA 1VQKV 5L3EA 1Q6HA 1AJNA 1SETA 3ABMC 2CAZC 3SDLA 2PYJA 4BW5A 5KUMA 3R66A 4JI3O 5LMNO 4U3FH 2EIMB 2YI9A 3O65A 4NVPA 2W6IG 3PN1A 4YJ3B 2Q6AA 4J80A 3JASA 4JI0O 1L0LH 4EB6B 4DR2B 5KHKA 4WFEA 3A0HZ 1TUBB 2JDIG 1FYJA 5E1AC 4JAUA 5J2UB 4GCZA 4DUZO 2XAHA 3D8CA 3LDCA 4BAYA 5LA6B 2GSMB 4JI8O 3ML0A 3SJQC 4X1KA 5DECA 3WFVA 4TQFA 4XDLA 4ZI7B 1OV9A 4RUEA 1U96A 2R9AA 2JGDB 1SQPH 3L75H 4OPHA 1H2SB 5LP6B 2YS8A 2CK3G 5KUKA 1K7DA 1MOFA 3N2GA 2AHYA 4JYCA 1MZEA 2HFEC 1IXMA 4F6EA 3TJTA 3QO8A 5IJ0B 3OUSA 3IJ4A 3T1CA 3TGUH 4I9QA 3JCUZ 5JCOA 3BY6A 4UUJC 5GTIZ 4JTCB 4MTFA 3HB3B 2F93B 3ZMVA 3G6EV 3TETA 2ARHA 5J9PC 3FD9A 5EZYA 1OCOC 3K58A 4NXMB 2Q73A 3SYOA 4DV2O 2G38A 3ABLB 3PJSK 2P67A 1TAEA 4YHHB 1PNKA 1X59A 2N04A 3L71H 3LSSA 1LR1A 1B06A 2K9PA 2QM4A 1Y74A 1YCIA 1W0JG 4X9QA 3K5MA 4K8XA 3JALB 3FYEB 5EC1C 1PM9A 4DW1A 3HKCB 2DW4A 5EBWC 1YVWA 3W7TA 1OCCC 1KB9F 1SA0A 3J81N 1Q90D 4FLWA 1Y76A 2WLIB 2HG5C 4FFKA 3AG3C 3HPLC 1J5EB 3OTOB 3GB7C 3OGCC 1WPBA 1H2MA 3BVOA 1HDJA 3UT5A 3ZJZA 4DV1B 1CEZA 4ZKIA 5LL6Y 1SERA 4O2AB 3K5OA 1FJGB 4JF3A 5L3GA 3DGEA 1BGYH 2HJDA 1V54B 1NKDA 3KKYA 2ZXWC 1M4UA 1M93A 5CB4A 4FFBA 2Q5ZA 1M56C 4LFBO 5B1AB 5B1BC 4WFFA 3CCQV 4MVSA 5EK0A 1Y4MA 1Q43A 2EINB 1AR1B 2EILB 3ZMUA 3ZN1A 3A0BZ 2GHYA 4XBFA 3IFXA 1KKDA 5BY1A 2IH3C 4B3TB 2YEVB 2PZSA 5LGTA 4JZGA 1YF2A 3CB2A 2KQXA 4R50A 3BRCA 4LFCB 4FK5C 2ZE8A 1MSDA 3FX7A 3KZIZ 3W7UA 1KMIZ 3ZHQA 1MMMA 5BMVB 4UV9A 2FB5A 1GN3A 2CGOA 4DR4O 1KUQA 5JQGA 2YSUB 5AG2A 4UCUA 1ZL8B 4ICGA 1IXBA 1HP8A 4B3MO 2QGNA 2WAMA 1XHXA 4UVAA 4PDMA 3RN4A 2Y48A 3KG2A 1DLBA 2Y0PA 1XILA 2ZT9B 4J9ZB 1QQCA 1KC8W 5EBMC 4E4EA 3JAKB 1I94B 5B3SB 3CCUV 1OCRB 4DR2O 4DR6O 2OTLV 3ETDA 1FFTB 5K1PA 3P30A 4H44B 2RJZA 3K9AA 1G6UA 5IYBO 2LGWA 3S3XA 3AG2C 5JVDB 1M90W 1R6NA 3CCLV 1K8AW 1NBMG 1YTFD 2IU0A 2ZE6A 1VEWA 3CE2A 2OCHA 3GVMA 1VP7A 5IYCO 2YIBD 4JV5O 2PYLA 1AI7A 1VQ4V 3ASNB 1MA1A 4L8JA 1AJQA 2UU9O 2EJRA 3CPWU 2Z5UA 2ETNA 2JJ2G 4UCVA 3FYIB 1Y66A 2HLDG 3D36C 4JYAB 2EIJB 3OFNG 1LUVA 2VQFB 1YJ9V 4FLUA 2HVJC 4A5UB 2A0LA 2IW5A 1PNLA 3ABKB 4TUYB 4DV5B 2RDCA 3FB6C 4NXMO 3AK1A 1IZ3A 2CTRA 3ZCCA 2X7RB 4JI5B 4I50A 5IJ9B 2L6LA 2XAQA 3FFQA 1SESA 1SKVA 1R3IC 4MW8A 4I4TA 2ZCEA 4YHHO 4LF9B 4O4JA 2K1EA 1HNZB 1QCEA 2F4VB 1S72V 1IBKB 3JD4A 3AG4B 5CA0B 1S77D 1UJWB 1IBLB 1TA8A 4YJ2A 1ZUQA 2AW9A 4JI0B 5IE9A 1SQFA 3D36A 5A9GA 4R8CA 3K0GA 4DR7B 1H2GA 3ABUA 4X20B 1FXHA 4UV8A 4WFBV 3RYIB 5GW7A 1QR8A 3B40A 1J5EO 2QWQB 5CBGA 4JI8B 1VQLV 3OTOO 3B4SA 4PDLA 2AHZA 4NB5A 4DV1O 4G28B 4Q20A 4R7CA 2Q7GA 3VQYA 4GKKB 1CXZB 3N2KA 1MNGA 5IYDO 5KHGA 4NYKA 4U7OA 1FAFA 3KCXA 2KG7B 3TCUA 1NS1A 2LP7A 1XQ8A 1OCZB 2A79B 4CZZA 4X88A 4JI4B 3CJHB 3HKDB 4FLTA 1NU1H 3SJAC 4E2LA 3AG1C 5H6RA 3ZRVA 1VQ7V 4PA7A 2QM8A 3OT7A 4PDRA 4TOIA 4ZHQB 4B08A 1F4NA 4B7EA 3EHBB 1WN7A 3JASB 1BHAA 4MS2A 5EYPA 4WFHA 4O4IA 4P2ZA 1WPXA 4DV7B 1BQZA 3CMEV 1H8EG 3RVYA 3WB1A 4D7TA 4LR3A 5KLVH 4LFCO 3SPCA 4DV0B 2ODMA 2P4VA 2FMLA 3FB8C 3BA9A 4X66B 5IY5B 4X1KB 1I5XA 4LNUB 4LF4B 3WB0A 4CH3A 2B1IA 3N2GB 3JATA 4FZ0A 3CC4V 5L3BA 4TV9A 3ABMB 2Q68A 1K73W 1H2NA 1XNQB 2HEPA 2ZNIA 1RM1B 4MT8A 4J42A 1VQOV 1FXVA 3JCZA 1I94O 2M7WA 3ZHUA 5KA6A 2ATKC 3EXAA 2HJFC 2W0FC 1FXKC 3ZMZA 3OEEG 1BSMA 3LSUA 2F95B 4L87A 4J7JA 4RAIA 1JMKC 2OT5A 4JPRA 4HYOA 1MG1A 2NLJC 3E8HA 4WBNA 2JEXA 2Z3YA 3H1LH 2RQ6A 2R70A 5KMGB 1L8DA 4LFBB 3CMAV 4I55A 4X65O 3JARA 4U7NA 3CRQA 3ETGA 3E8BA 2QA4V 2BTOA 3ZBHA 1WB7A 4NTYA 3IAYA 1K34A 1JCHA 1YITV 3HKBA 2GDSA 2VS0A 3K57A 1Y74B 2BSKA 1I08A 1N34B 4JI1B 2OIEA 2E3CA 1K33A 2F23A 3QG5A 3ZMTA 1SA0B 4JYAO 2XAGA 1Y76B 1ROPA 3CX5F 3RGBA 1ORQC 2EIKC 1VQ5V 4MW3A 3STLC 3STZC 3WU2Z 1J95A 1FXKA 3LSQA 2GTSA 4GX0A 3ZRWA 4TT3G 2Q69A 1OCOB 5C8YA 2ZR2A 1SQQH 3UT5B 3OW2U 4P9OA 4DV5O 1AI4A 2ITDC 1JA8A 2ZQMA 4YIPA 2A9HA 4JI5O 1SF9A 1IX9A 1M5IA 1WAZA 1BT8A 1Y6XA 4KHPB 4MTGA 2GUZA 2VRZA 4LH7A 1HNZO 1H2LA 4LF9O 2F4VO 1GK9A 5CB4B 4FFBB 4IYHA 2EZPA 1NTZH 1SC5B 1IBKO 5C93A 3QVNA 4HNAA 3H01A 3ZS8C 1IBLO 4LP8A 4DR6B 5B66Z 1OCCB 4I7ZB 3MAQA 3OEHG 2H8PC 2AGAA 3F5WC 4DR7O 1SQVH 2JS3A 4MTOA 1EZVH 3K79A 2Y0IA 3E86A 2QKCA 3S3WA 1XNRB 1V55C 2WPDG 4DO2A 3T4ZA 3SPHA 5LYJB 2Q0OC 1F7YA 4I0XA 3QTCA 3ZMSA 5GONA 4CS4A 4G27B 3X2QC 4JV5B 4GKKO 4O2BA 4OXSA 3W7WA 2P7TC 2UU9B 2QM7A 5JJJB 4TV8A 5JQGB 2ZXWB 4DV6B 2KB1A 1GN4A 1HW7A 3SYQA 1AR5A 4JI4O 4FLVA 3QF7A 1Z5VA 1M56B 2CH7A 2UXCO 5JJNB 1TVKA 3JAWA 3K03A 4QPJA 5B1BB 1B3QA 1M9NA 2XHBA 4UFZA 5H9CA 1K9MW 1WA8A 5FPOA 3FB7C 1E1QG 2P4KA 4BW9A 2DYRB 5GTHZ 2UXDB 1YEWA 2Q8VA 4AI8A 3LUTB 4DV7O 3FB5C 5IWAO 1KECA 2Y4TA 3ZEDA 1OJHA 4DV0O 3FAVA 2WLMA 1RSOA 5B5EZ 4UCSA 1EBOA 3H1KH 1AROP 4X66O 3RYHA 5CA1A 2P6JA 1AR4A 3UKMA 1VF6C 1MZFA 4DV3B 3ABTA 1EN5A 2QTSA 3LDDA 4LF4O 1N36B 2N05A 2EIMC 4NKGB 4PA4A 1FS0G 3I5DA 4FLYA 1QBZA 1XMOB 4EKWA 1XNQO 4LFAB 1UFIA 3U11A 1XL6A 2R72A 4X1IA 2DN9A 1B04A 2QSAA 5CA3A 2XASA 4UB8Z 1MSWD 3OM3B 4DK1A 3DTUB 2ADPA 2UUBB 4H0LB 1CPYA 3ETEA 3E22A 3JD0A 1L1FA 4PDVA 1N4CA 1QLEB 1RPRA 2NR5A 5H2FZ 3RYCA 3SYPA 2ZDIC 1K5SA 4I50B 1BCCH 4PV1B 2CGNA 1F51A 1NQTA 2LFRA 3T1HB 4GKJB 4I4TB 1VF6A 2PI4A 4B3RB 5LP6C 5TISZ 5H6QA 3BAAA 4O4JB 5LMUB 1H38A 2BTQA 4MSWC 1L0NH 2E74B 1N34O 4JI1O 1TGOA 4YJ2B 4BR6A 2YUAA 4LWSA 1VQPV 2P5OA 2QWRB 3H1JH 3B09A 3IC9A 2C2AA 1NH2B 4X89A 2B5UA 1ZSPA 3O9OA 4X64B 1KKCA 2V1DA 2JS5A 1I5YA 2F66C 1VQ6V 4QJFB 1Z5WA 4WF9V 2ZDIA 3ABLC 3C3SA 4KFMA 1R1BA 2X6BA 4ZI7A 3N2KB 1S5HC 1SZTA 3KCYA 2WLKA 4OPAA 4MVQA 4TQDA 5ITZA 1VQ8V 1KQSU 4KHPO 4J10A 1NI8A 4JI2B 5BXZA 3G4SV 2NN4A 2OWOA 4W4KA 2RCVA 4D7SA 2EX3A 1V9PA 2XOKG 2RMKB 1SS3A 3K5NA 5IDJA 3DSQA 4FM0A 1XUQA 1G1XB 1S76D 2MW2B 2DWDC 5JH7A 4N21A 1YJNV 2QWNB 5EYPB 1THZA 1XNRO 4O4IB 2B9ZA 4X65B 3CSXA 3ICXA 3ZHRA 1VMGA 1S5LZ 3RBZA 5IYZB 1COWG 4K8ZA 1FPOA 4PI2A 1IDSA 2X6CA 4X1YA 4F6RA 2IM9A 3E89A 4DV6O 3JALA 4GLXA 2F43G 3HKCA 1QR9A 1US6A 3CP1A 3AG1B 5LHIA 3SYCA 4GX5A 3JATB 2EINC 3LDEA
chains in the Genus database with same CATH topology
2W6IG 2Q6AA 2DYSC 5L3FA 5IY5B 2Y69B 4WFEA 4PA9A 2JDIG 1N8RW 5E1AC 1I5XA 1AI6A 4JAUA 1YSCA 3VBBA 3JD1A 4GCZA 2XAHA 4MVZA 4TWKA 2FTKA 2BOCC 2IU3A 3LDCA 4RUFA 3ZN0A 1AI5A 3FKSG 4BAYA 2B1IA 1NH2D 5CBHA 1PKXA 4RQFA 2GSMB 3CC4V 5L3BA 3ML0A 3SJQC 3JD3A 3ABMB 2Q68A 1K73W 1EZJA 3WFVA 4LCUC 4XDLA 1RM1B 4MT8A 2WLNA 4RUEA 2DYSB 3K0DA 1VQOV 1FXVA 3JCZA 2M7WA 1QVFU 3JYCA 5KA6A 2DYRC 2ATKC 1G8MA 1JJ2U 2HJFC 2CK3G 2WLHA 5KUKA 2W0FC 1FXKC 1K7DA 1MOFA 2AHYA 3ZMZA 4QNHB 4JYCA 2HFEC 1B6QA 1IXMA 1P4RA 1NJIW 3OEEG 4L87A 4RAIA 1JPXA 1GKFA 3QO8A 1DF4A 5LBQA 3OUSA 2OT5A 4HYOA 4JPRA 1MG1A 2NLJC 3E8HA 3T1CA 2JEXA 2Z3YA 3BY6A 4UUJC 3IC7A 4JTCB 1YHQV 4GX2A 4MTFA 3CMAV 3HB3B 4U7NA 3ZMVA 3ETGA 4JYBA 3E8BA 1DTOA 4FJCC 3G6EV 2QA4V 3TETA 2YEVA 5J9PC 1JX9A 1OCOC 3RW0A 1K34A 1JCHA 4WFGA 1YITV 1K92A 1FXKB 4JGSA 4XDJA 1NVPD 3ZRWB 5EC2C 3SYOA 1K33A 3OUFA 3ZMTA 1S0VA 1GM7A 3ABLB 3PJSK 2UXXA 2P67A 1JOYA 2XAGA 1ROPA 1ORQC 1PNKA 2EIKC 1VQ5V 4MTXA 4X8AA 3B8NA 2BOBC 2ZD9A 4MW3A 3STLC 3LSSA 3STZC 1J95A 4WFAV 1NVPB 1FXKA 3LSQA 5BZBA 1W0JG 4GX0A 3ZRWA 1K97A 2W6JG 3FYEB 4TT3G 5EC1C 2Q69A 2ZR3A 1W0KG 3OAAG 4JAVA 3OR6C 1OCOB 2MK3A 1S3JA 2DW4A 2ZR2A 3NXSA 1H8HG 5EBWC 3GWOA 3W7TA 1OCCC 4I9WA 2OTJV 3OW2U 4FPPA 4P9OA 1AI4A 1V54C 2ITDC 2ZQMA 3QO7A 1QLEC 2A9HA 2WLIB 4MVMA 3ASOB 2HG5C 2DQ0A 3AG3C 4UVBA 3CCEV 3OMAB 4LC1A 3T2MA 4F4LA 3HPLC 5B1AC 1ENVA 4MTGA 3E8FA 4JTDB 3GB7C 3OGCC 1GK9A 1K4DC 4LBEC 3ZJZA 2EZPA 1CEZA 5C93A 4ZKIA 3H01A 5B1OA 1ZWIC 2OCCB 2EILC 1SERA 1NR7A 1GO3F 2WLIA 2IJJA 4LP8A 1KP3A 4JF3A 1OCCB 1YTFB 5L3GA 3DGEA 1Q82W 1PNMA 1V54B 1NKDA 1RPOA 2H8PC 3OEHG 5DN6G 3F5WC 2ZXWC 1KD1W 4MTOA 1WLEA 1E79G 2X0LA 3K79A 3G71V 5L3CA 3E86A 5LGNA 1M56C 1DF5A 3ZRSA 5B1AB 3ZIAG 1V55C 2WPDG 5B1BC 4DO2A 3MHHC 3T4ZA 3JD2A 2Q67A 4WFFA 3SPHA 3AG4C 5KA5A 3CCQV 4MVSA 3T4DA 2IJIA 5EK0A 1Y4MA 2EINB 3AEIA 4ASUG 4JTAB 1AR1B 3ZMSA 2EILB 3ZMUA 4G27B 2HVKC 4GT1A 3ZN1A 2GHYA 3X2QC 4XBFA 3K06A 3D3IA 3IFXA 4OXSA 3W7WA 1EFRG 2P7TC 1KKDA 2IH3C 3F7VC 3K04A 2YEVB 2HR3A 2QM7A 5LGTA 1PD3A 1Q86W 1R6KA 2ZXWB 2KB1A 1GTOA 3SYQA 4PELA 4R50A 3OMIB 1M56B 4PA6A 4FK5C 1XL4A 3TK1A 1V55B 3K03A 4QPJA 5B1BB 3W7UA 1M9NA 1W2BU 3EFFK 5H9CA 1CP9A 1E1RG 1VQ9V 2WSSG 4UV9A 2IJKA 1K9MW 2XAFA 5B3SC 2H94A 3FB7C 1OCRC 3CC2V 3E35A 1E1QG 5FL7G 3X2QB 1K5QA 2YSUB 2WLJA 2DYRB 1JQ0A 1VQMV 4MVOA 2QEXV 1OCZC 5B1NA 2R9IA 3LUTB 4HAMA 1AJPA 1JVMA 3FB5C 2WAMA 3E8GA 1KECA 1TUEB 2IH1C 4UVAA 4PDMA 2Y48A 4XDKA 2PI5A 3B77A 3KG2A 4YXWG 1M57C 1DLBA 1R3LC 2WLMA 4J9ZB 1KC8W 4RQEA 5EBMC 1EBOA 2QKSA 1AROP 5B3SB 2P90A 3E83A 3CCUV 2JK5C 2P6JA 1OCRB 1K3EA 4J9YB 3ASNC 3UKMA 2OTLV 3ETDA 3CCSV 3MD0A 1FFTB 3F7YC 3P30A 3MHSC 3ABTA 1BMFG 2QTOA 3LDDA 4CBCA 3M99B 3SPJA 3K9AA 4MVRA 2JIZG 4BIZA 1YJWV 2EBOA 3SPIA 1BL8A 2EIJC 5IYBO 1YIJV 4G2KA 3AG2C 1M90W 1R6NA 2EIMC 3CCLV 4PA4A 2IJHA 1FS0G 1K8AW 1NBMG 1QBZA 1M57B 4BIUA 2IU0A 1YTFD 2EIKB 4EKWA 1F4MA 3VOUA 5IY5C 1HWYA 2Y69C 5IYCO 2B1GA 1XL6A 1KP2A 3ABKC 1AI7A 1VQ4V 3ASNB 2WLLB 2X6AA 1AJQA 5CA3A 2XASA 4Z1MG 3I55V 3CCVV 1MSWD 3OM3B 2EJRA 3DTUB 3CPWU 1CPYA 2Z5UA 3ETEA 3JD0A 1L1FA 2JJ2G 4PDVA 3FYIB 5LGUA 1Y66A 2HLDG 1QLEB 4R6ZA 4UXNA 2EIJB 1RPRA 3OR7C 3SYPA 2QE7G 3AG3B 1F23A 4KUMA 2ZDIC 1K5SA 3OFNG 1RM1C 4DXWA 1YJ9V 1F51A 1NQTA 4I5SA 3RVZA 2HVJC 2LFRA 2WLLA 4FMTA 2PI4A 3B8MA 2A0LA 5DM6V 5H6QA 2IW5A 3A0RA 1PNLA 5LHHA 1G4YB 3ABKB 4TSFG 5HFMA 1P7BA 3CD6V 4GX1A 1R73A 1H38A 4MSWC 1QLNA 3FB6C 4QIWF 3QNEA 3ZCCA 2X7RB 1GM9A 1GM8A 4N23A 3OE7G 2XAQA 1M1KW 1SESA 1R3IC 4MW8A 4H37A 3CYOA 1LNQA 4WCEV 3LNMB 4UVCA 1VQPV 4QE7A 3E2EA 2K1EA 3SYAA 1QCEA 4P30A 1S72V 3I56V 3JD4A 3AG4B 2C2AA 1NH2B 4X89A 1S77D 2B5UA 1UJWB 2R9RB 5CMUA 3K3WA 2JEUA 2V1DA 4PA3A 2XAJA 3D36A 1I5YA 1MABG 4R8CA 3K0GA 1VQ6V 2HKOA 4QJFB 4WF9V 2ZDIA 3ABLC 4KFMA 1H2GA 2X6BA 4H33A 3W7XA 3ABUA 3BEHA 5CBFA 1S5HC 1SZTA 4RO2A 1R3KC 1FXHA 4UV8A 2WLKA 4WFBV 4MVQA 5GW7A 1QR8A 3ZRXA 5CBGA 3P32A 1VQ8V 2EZOA 1R3JC 1KQSU 1VQLV 4PDLA 4P9PA 2AHZA 2WWWA 3G4SV 4G28B 3SPGA 2UXNA 4Q20A 4R7CA 2XNDG 5LHGA 2DQ3A 2XOKG 1PL0A 3OMNB 5IYDO 1QVGU 4KP4A 3CCRV 4U7OA 5CN0A 1OZ0A 3TCUA 5IDJA 3ASOC 2DWEC 2LP7A 1BHBA 2V7QG 3WG7C 1OCZB 2A79B 4CZZA 1GMGA 4X88A 1S76D 1Q7YW 2DWDC 4QE9A 4JASA 4N21A 3CCMV 1YJNV 4ZBMA 2ITCC 1THZA 5EBLC 3UM7A 2JJ1G 4E2LA 1NR1A 3AG1C 5H6RA 3ZRVA 4FIPC 1VQNV 2NNUA 3R65A 4PA7A 1VQ7V 2QM8A 2OCCC 4HZ3A 3W7SA 4PDRA 2D3OW 3QO5A 1F4NA 3RBZA 1COWG 1Q81W 5L3DA 3CXCU 1SRYA 3CCJV 3EHBB 1YI2V 2X6CA 1BHAA 3CC7V 3IGAC 4MS2A 4WFHA 4P2ZA 1WPXA 1OHHG 3WG7B 3E89A 2LFSA 3CMEV 1H8EG 3K08A 3RVYA 4MVUA 1VQKV 5L3EA 4QPKA 5HFLA 1AJNA 1SETA 1K4CC 3ABMC 2F43G 1QR9A 3CP1A 4BW5A 5KUMA 3AG2B 3SPCA 3AG1B 5LHIA 3SYCA 2EIMB 4GX5A 3FB8C 2EINC 3LDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKD A;  1RPO A;  1GMG A;  1PD3 A;  1F4M A;  2IJJ A;  4DO2 A;  2IJK A;  2IJH A;  1ROP A;  1RPR A;  1GTO A;  1B6Q A;  3K79 A;  2GHY A;  1F4N A;  2IJI A; 
#chains in the Genus database with same CATH topology
 3J80 N;  4BIO A;  2QR4 A;  4FVM A;  4TV9 B;  2DYS C;  1DGS A;  1D2D A;  4CC6 A;  3BCC H;  2Y69 B;  1N8R W;  1EN6 A;  3VBB A;  3JD1 A;  2UXD O;  2JVD A;  1XRE A;  2BOC C;  4RUF A;  3ZN0 A;  5CBH A;  1AVM A;  4Z2W A;  4B7K A;  4DR3 B;  4EFB A;  3JD3 A;  3K5L A;  5EIB D;  1YDX A;  1EZJ A;  4LCU C;  5LXT A;  2LO1 A;  4WBN B;  2WLN A;  3K0D A;  2ZIM A;  3H1H H;  3T1Y B;  4OX9 O;  3JYC A;  4UB6 Z;  3U10 A;  1JFF A;  1VAR A;  3THO A;  1FKA O;  3JAR B;  1G8M A;  1JJ2 U;  2PGG A;  1WNS A;  1XOU A;  1NTM H;  2D2C B;  1B6Q A;  2WA4 A;  1P4R A;  1NJI W;  4DV3 O;  4DRX A;  2YXH A;  3CXH F;  2YI8 A;  1N36 O;  3HKB B;  2QDO A;  1I7F A;  2BSK B;  3LNN A;  1WP7 A;  3IC7 A;  1YHQ V;  4GX2 A;  4RWU A;  1P7G A;  2Q7E A;  1Q6U A;  3L70 H;  1BQ0 A;  4JYB A;  4DYL A;  1XMO O;  4FJC C;  1BS3 A;  2YEV A;  1JR9 A;  3JSL A;  4LFA O;  4ZOL A;  2ZE5 A;  1K92 A;  1FXK B;  3OTF A;  5KHH A;  4JI6 O;  2BE3 A;  4CC5 A;  4XDJ A;  3DXR A;  4LF6 O;  3ZRW B;  5EC2 C;  4LH6 A;  4K0K B;  2UUC O;  3HKE A;  5BMV A;  3CEI A;  5C8Y B;  2UUB O;  1S0V A;  4NTX A;  3TXS A;  1JOY A;  2YC0 A;  4JI7 B;  3WB2 A;  2Z0A A;  4MTX A;  2UXC B;  4DW0 A;  4X8A A;  3B8N A;  1WB8 A;  2BOB C;  4WFA V;  5BZB A;  3T1H O;  4GKJ O;  4B3R O;  4U3J A;  1K97 A;  2W6J G;  1W0K G;  3OAA G;  3OR6 C;  2MK3 A;  2GUZ B;  5LMU O;  2A3Q A;  1H8H G;  3GWO A;  4I9W A;  5KAF Z;  4HNA B;  3QO7 A;  3ASO B;  3K59 A;  3DC6 A;  3AK3 A;  3JAK A;  4IHJ A;  3UO3 A;  1KBH A;  5IWA B;  2ZM6 O;  1ENV A;  1K4D C;  4LBE C;  4Q6G A;  3APQ A;  2AXT Z;  5B1O A;  1ZWI C;  2OCC B;  5KHJ A;  4X62 B;  4X64 O;  3C3T A;  1Q82 W;  4I0X B;  1PNM A;  5GON B;  1KD1 W;  4JYY A;  1WLE A;  4O2B B;  2X0L A;  2XUM A;  3G71 V;  5L3C A;  3A8T A;  1I0H A;  1Q8I A;  1DF5 A;  3ZRS A;  4CS3 A;  3MHH C;  3JD2 A;  2Q67 A;  4TV8 B;  3AG4 C;  1XHZ A;  1XDC A;  1N33 B;  2CH7 B;  2E5L B;  2IJI A;  4H13 B;  4JI2 O;  1TVK B;  1YXB A;  3AEI A;  3JAW B;  4JTA B;  2HVK C;  2YIB A;  3D3I A;  1WA8 B;  2E76 B;  2HR3 A;  2CTW A;  1PD3 A;  1EM1 A;  1R6K A;  3SJB C;  4DV4 B;  5EZY B;  3BPZ A;  1VF5 B;  4PEL A;  3UCS C;  5F2V O;  3RT3 C;  5KX5 A;  4PA6 A;  5D5P A;  1V55 B;  3EFF K;  1CP9 A;  5LOV A;  1E1R G;  1VQ9 V;  2WSS G;  2IJK A;  2YXL A;  3BAB A;  4UCO A;  1H2K A;  3RYF A;  3CC2 V;  3E35 A;  3C90 A;  3MDS A;  5FL7 G;  3X2Q B;  1RSO B;  1JQ0 A;  1VQM V;  2ZNJ A;  1Z2G A;  2QEX V;  3F5T A;  1OCZ C;  2ADQ B;  3RYH B;  1IUR A;  3CRR A;  2LGQ A;  2R9I A;  5B1N A;  5CA1 B;  1JVM A;  5K1X A;  3Q4H A;  1TUE B;  1EN4 A;  4D6T H;  4XDK A;  2HHH O;  2PI5 A;  4YXW G;  1M57 C;  4IIJ A;  4RQE A;  3OD4 A;  2UUA B;  3E83 A;  1XI1 A;  2PUS A;  2JK5 C;  1DK1 A;  1WJZ A;  1K3E A;  3A2F A;  1URF A;  4CH5 A;  1X4T A;  4O4L A;  2QTO A;  2YDE A;  4CBC A;  1PL4 A;  3M99 B;  4X1I B;  3SPJ A;  1VF7 A;  2JIZ G;  4BIZ A;  2CUG A;  3SPI A;  4CS2 A;  2PTM A;  4G2K A;  1GH6 A;  2FL4 A;  4DR3 O;  1AP6 A;  5FNV A;  3E22 B;  3VQW A;  2O57 A;  4BIU A;  1F4M A;  2GV9 A;  3VOU A;  1XMQ O;  5IY5 C;  3RYC B;  2H3O A;  2ZIO A;  3P3N A;  2B1G A;  3T1Y O;  1ZTE A;  1KP2 A;  4CH6 A;  2DJV A;  2X6A A;  1A32 A;  4DR1 B;  4FLZ A;  3ETQ A;  4PI0 A;  2YID A;  1XEQ A;  2BTQ B;  4ZHQ A;  3OR7 C;  3AG3 B;  4O4H A;  1RM1 C;  4DXW A;  4OGQ B;  5JCO C;  2WLL A;  4LWS B;  1RFY A;  3JAM N;  3A0R A;  3ZX6 A;  4TSF G;  4GX1 A;  1R73 A;  2Q7H A;  5A2Q N;  1QLN A;  4QIW F;  4K0K O;  2WA3 A;  4N23 A;  1GM8 A;  4LF7 B;  1Q6I A;  3OE7 G;  4H37 A;  2Q0A A;  1LNQ A;  3LNM B;  4J7Z A;  3RFR A;  4JI7 O;  2P06 A;  4P30 A;  4LNU A;  1NZ6 A;  2GBO A;  1ZAU A;  3ZHT A;  2RN9 A;  5ITZ B;  4JZ2 A;  2PY5 A;  2R9R B;  5CMU A;  3EVK A;  1KYO F;  3VQX A;  4AIL C;  4PA3 A;  3UO2 A;  2DMX A;  1HNX B;  5KAI Z;  2KKW A;  4J41 A;  2P22 C;  2LQT A;  3W7X A;  3BEH A;  3SJC C;  1R3K C;  1Q5O A;  2UXB B;  3ZRX A;  2EZO A;  1R3J C;  3M7M X;  5DED A;  3L74 H;  2ZIN A;  5JH7 B;  3JSN A;  2ZE7 A;  3M8A A;  2UXN A;  1D5N A;  4OX9 B;  1IVS A;  2XND G;  5LHG A;  2DQ3 A;  3OMN B;  4X62 O;  1QVG U;  4KP4 A;  5CN0 A;  1JJO A;  5KMG A;  1OZ0 A;  4IT5 A;  2DWE C;  1BHB A;  3BHP A;  4PJ0 Z;  3WG7 C;  2N74 A;  3P3P A;  1Q7Y W;  2VWK A;  4JAS A;  4X1Y B;  3TXQ A;  4F6R B;  4ZBM A;  3ZHS A;  4IGG A;  2FYU H;  4FIP C;  4EFE A;  3R65 A;  3AG7 A;  4HZ3 A;  2YXY A;  1N33 O;  3W7S A;  1FFX A;  1NTK H;  5J2T A;  2E5L O;  2M6Y A;  3QO5 A;  3H1I H;  2CTP A;  1Q81 W;  2OYQ A;  1RP3 B;  3CCJ V;  1YI2 V;  1AIL A;  4JI6 B;  1IBM B;  1HR0 B;  3SR2 C;  2VQE B;  4LF6 B;  3CC7 V;  3G80 A;  4K35 A;  1SQG A;  2UUC B;  4DV4 O;  2LFS A;  1U97 A;  4QPK A;  5HFL A;  1AB3 A;  4QGP A;  1K4C C;  4NTW A;  3AG2 B;  4GYC B;  1N0J A;  2E75 B;  5L3F A;  4FM2 A;  2ZKO A;  5LXT B;  4PA9 A;  4ABM A;  1AI6 A;  1YSC A;  1D5A A;  1GRJ A;  3ZHV A;  1JFF B;  4MVZ A;  4TWK A;  2FTK A;  2IU3 A;  1AI5 A;  3FKS G;  2XT9 A;  3CRC A;  1NH2 D;  1PKX A;  4RQF A;  4AQY O;  2YIA A;  4YJ3 A;  2LJ2 A;  4DRX B;  4EB6 A;  2ZM6 B;  1TUB A;  1PP9 H;  1YZB A;  2QWP B;  1WP8 A;  5J2U A;  3DC5 A;  2DYS B;  3AK2 A;  2UUA O;  4B3S B;  1QVF U;  2DYR C;  2WLH A;  2AZ0 A;  5LA6 A;  4QNH B;  1JPX A;  1GKF A;  4ZOL B;  5LYJ A;  3K9S A;  1DF4 A;  5LBQ A;  2HP8 A;  3DXR B;  4YY3 B;  3G6B A;  2JGD A;  3HKE B;  5LP6 A;  1DTO A;  5BR8 B;  4LF8 B;  5KHI A;  3NR7 A;  1JX9 A;  4J11 A;  4AHC A;  3RW0 A;  4WFG A;  5IJ0 A;  4JGS A;  1NVP D;  4KXR A;  4DUY B;  4U3J B;  1PPJ H;  4DR1 O;  3OUF A;  1N32 O;  1UPG A;  1GM7 A;  4J7K A;  2UXX A;  2XTA A;  4FZ1 A;  2LW7 A;  2ZD9 A;  1NVP B;  4IHJ B;  4W4L A;  2BCC H;  2FKX A;  4LF5 B;  2A7W A;  4JAV A;  2ZR3 A;  1S3J A;  1NT2 B;  3NXS A;  4NXN B;  2OTJ V;  4FPP A;  1V54 C;  1QLE C;  1N0N A;  4MVM A;  4PHZ A;  4LF7 O;  1ZX3 A;  4DR5 B;  2DQ0 A;  4UVB A;  3CCE V;  3OMA B;  4LC1 A;  3T2M A;  4F4L A;  3J7A U;  5B1A C;  4EEQ A;  3E8F A;  4JTD B;  1PV0 A;  2HHH B;  2LW1 A;  3L72 H;  2L35 A;  2EIL C;  1HNW B;  1NR7 A;  1GO3 F;  2WLI A;  4HBN A;  2IJJ A;  1KP3 A;  1FD9 A;  1T5E A;  1YTF B;  2IBZ H;  1HNX O;  1RPO A;  5DN6 G;  1GN6 A;  3L9D A;  3H9V A;  5D5Q A;  4BWA A;  4Z1V A;  1E79 G;  4JAA A;  5LGN A;  1AP5 A;  3ZIA G;  2UXB O;  4YIO A;  4O2A A;  1BZK A;  5KA5 A;  3T4D A;  5KX5 B;  1XMQ B;  5IT9 N;  4ASU G;  1Y67 A;  4GT1 A;  5LOV B;  4I55 B;  3K06 A;  1EFR G;  2AZ2 A;  3F7V C;  3K04 A;  3RYF B;  1Q86 W;  5JJE B;  1GTO A;  3OMI B;  4DK0 A;  1BE3 H;  2ILM A;  1XL4 A;  3TK1 A;  4JI3 B;  5LMN B;  1W2B U;  2JRI A;  1VIB A;  5E79 Z;  3N27 A;  2VWJ A;  3Q4H B;  4FM1 A;  2XAF A;  5B3S C;  2H94 A;  1LUW A;  1OCR C;  4IIJ B;  1K5Q A;  2WLJ A;  4MVO A;  4DUZ B;  2CTQ A;  1IBM O;  1HR0 O;  2VQE O;  4HAM A;  1AJP A;  2PF4 E;  4IL6 Z;  4O4L B;  4ZIB A;  3E8G A;  2IH1 C;  3B77 A;  1R3L C;  3VQV A;  3RWR D;  1ZL8 A;  2QKS A;  5FNV B;  2P90 A;  4J9Y B;  3ASN C;  3BA8 A;  1FJG O;  3CCS V;  3MD0 A;  4PD4 F;  3F7Y C;  2A06 H;  2RNB A;  3MHS C;  1BMF G;  4MVR A;  2W0X A;  4KL1 A;  1YJW V;  2EBO A;  2Q9L A;  1BL8 A;  2EIJ C;  1SQB H;  1GAX A;  1YIJ V;  1O9G A;  2IJH A;  1M57 B;  5H5N A;  2EIK B;  2EUL A;  1S5J A;  1HWY A;  2JGU A;  3B2E E;  2Y69 C;  2EJ7 A;  2DE0 X;  3CS5 A;  4O4H B;  1P49 A;  4B3S O;  3ABK C;  4CH4 A;  2OIG A;  2WLL B;  2DOS A;  4Z1M G;  3I55 V;  3CCV V;  4B3T O;  3CHX A;  5JVD A;  4DV2 B;  3G67 A;  4GZR B;  1QNM A;  5LGU A;  3L73 H;  4R6Z A;  4UXN A;  3UQ8 A;  2QE7 G;  1F23 A;  4KUM A;  5IYZ A;  4YY3 O;  3D3Q A;  4I5S A;  3RVZ A;  4FMT A;  2F1M A;  3B8M A;  1SQX H;  5BR8 O;  4LF8 O;  5DM6 V;  5LHH A;  1G4Y B;  5HFM A;  5EIB C;  1P7B A;  3CD6 V;  1R6T A;  3CRM A;  2KSD A;  4DUY O;  3CWB H;  3QNE A;  1GM9 A;  2CE4 A;  1QU7 A;  2GTA A;  1M1K W;  1QHT A;  2QJ1 A;  3CYO A;  3OGI B;  1GN2 A;  4WCE V;  4UVC A;  4QE7 A;  3BFR A;  1XBL A;  3E2E A;  3SYA A;  4TUY A;  1W59 A;  4GUN A;  2CDY A;  3APO A;  1O9H A;  3I56 V;  1SZX A;  4LF5 O;  3K3W A;  1P84 F;  3HR0 A;  2JEU A;  5IJ9 A;  2XAJ A;  3FAV B;  4NXN O;  1MAB G;  4NR1 A;  4FLX A;  2HKO A;  4UCT A;  4H33 A;  5CBF A;  4DR5 O;  5FPR A;  4RO2 A;  5CA0 A;  4AQY B;  3P32 A;  4P9P A;  3GWK C;  2WWW A;  5FLX N;  3SPG A;  1HNW O;  1PL0 A;  3CCR V;  4X20 A;  3RYI A;  1FFX B;  5J2T B;  3ASO C;  2V7Q G;  4UCR A;  4IYI A;  1GMG A;  4C7U A;  1Q3E A;  4QE9 A;  2QWO B;  1ZLZ A;  2YIC A;  3CCM V;  2ITC C;  2VQF O;  5EBL C;  3UM7 A;  1KU9 A;  2JJ1 G;  1NR1 A;  1VQN V;  2NNU A;  4K3A A;  3U0Z A;  2OCC C;  2KG7 A;  2D3O W;  4DR4 B;  5L3D A;  5JWP A;  3CXC U;  1SRY A;  3SGI A;  2V4D A;  3CJH A;  3HKD A;  2QKA A;  4B3M B;  3IGA C;  3CRA A;  2Q4P A;  1OHH G;  3WG7 B;  2Y4U A;  3K08 A;  1N32 B;  4MVU A;  1VQK V;  5L3E A;  1Q6H A;  1AJN A;  1SET A;  3ABM C;  2CAZ C;  3SDL A;  2PYJ A;  4BW5 A;  5KUM A;  3R66 A;  4JI3 O;  5LMN O;  4U3F H;  2EIM B;  2YI9 A;  3O65 A;  4NVP A;  2W6I G;  3PN1 A;  4YJ3 B;  2Q6A A;  4J80 A;  3JAS A;  4JI0 O;  1L0L H;  4EB6 B;  4DR2 B;  5KHK A;  4WFE A;  3A0H Z;  1TUB B;  2JDI G;  1FYJ A;  5E1A C;  4JAU A;  5J2U B;  4GCZ A;  4DUZ O;  2XAH A;  3D8C A;  3LDC A;  4BAY A;  5LA6 B;  2GSM B;  4JI8 O;  3ML0 A;  3SJQ C;  4X1K A;  5DEC A;  3WFV A;  4TQF A;  4XDL A;  4ZI7 B;  1OV9 A;  4RUE A;  1U96 A;  2R9A A;  2JGD B;  1SQP H;  3L75 H;  4OPH A;  1H2S B;  5LP6 B;  2YS8 A;  2CK3 G;  5KUK A;  1K7D A;  1MOF A;  3N2G A;  2AHY A;  4JYC A;  1MZE A;  2HFE C;  1IXM A;  4F6E A;  3TJT A;  3QO8 A;  5IJ0 B;  3OUS A;  3IJ4 A;  3T1C A;  3TGU H;  4I9Q A;  3JCU Z;  5JCO A;  3BY6 A;  4UUJ C;  5GTI Z;  4JTC B;  4MTF A;  3HB3 B;  2F93 B;  3ZMV A;  3G6E V;  3TET A;  2ARH A;  5J9P C;  3FD9 A;  5EZY A;  1OCO C;  3K58 A;  4NXM B;  2Q73 A;  3SYO A;  4DV2 O;  2G38 A;  3ABL B;  3PJS K;  2P67 A;  1TAE A;  4YHH B;  1PNK A;  1X59 A;  2N04 A;  3L71 H;  3LSS A;  1LR1 A;  1B06 A;  2K9P A;  2QM4 A;  1Y74 A;  1YCI A;  1W0J G;  4X9Q A;  3K5M A;  4K8X A;  3JAL B;  3FYE B;  5EC1 C;  1PM9 A;  4DW1 A;  3HKC B;  2DW4 A;  5EBW C;  1YVW A;  3W7T A;  1OCC C;  1KB9 F;  1SA0 A;  3J81 N;  1Q90 D;  4FLW A;  1Y76 A;  2WLI B;  2HG5 C;  4FFK A;  3AG3 C;  3HPL C;  1J5E B;  3OTO B;  3GB7 C;  3OGC C;  1WPB A;  1H2M A;  3BVO A;  1HDJ A;  3UT5 A;  3ZJZ A;  4DV1 B;  1CEZ A;  4ZKI A;  5LL6 Y;  1SER A;  4O2A B;  3K5O A;  1FJG B;  4JF3 A;  5L3G A;  3DGE A;  1BGY H;  2HJD A;  1V54 B;  1NKD A;  3KKY A;  2ZXW C;  1M4U A;  1M93 A;  5CB4 A;  4FFB A;  2Q5Z A;  1M56 C;  4LFB O;  5B1A B;  5B1B C;  4WFF A;  3CCQ V;  4MVS A;  5EK0 A;  1Y4M A;  1Q43 A;  2EIN B;  1AR1 B;  2EIL B;  3ZMU A;  3ZN1 A;  3A0B Z;  2GHY A;  4XBF A;  3IFX A;  1KKD A;  5BY1 A;  2IH3 C;  4B3T B;  2YEV B;  2PZS A;  5LGT A;  4JZG A;  1YF2 A;  3CB2 A;  2KQX A;  4R50 A;  3BRC A;  4LFC B;  4FK5 C;  2ZE8 A;  1MSD A;  3FX7 A;  3KZI Z;  3W7U A;  1KMI Z;  3ZHQ A;  1MMM A;  5BMV B;  4UV9 A;  2FB5 A;  1GN3 A;  2CGO A;  4DR4 O;  1KUQ A;  5JQG A;  2YSU B;  5AG2 A;  4UCU A;  1ZL8 B;  4ICG A;  1IXB A;  1HP8 A;  4B3M O;  2QGN A;  2WAM A;  1XHX A;  4UVA A;  4PDM A;  3RN4 A;  2Y48 A;  3KG2 A;  1DLB A;  2Y0P A;  1XIL A;  2ZT9 B;  4J9Z B;  1QQC A;  1KC8 W;  5EBM C;  4E4E A;  3JAK B;  1I94 B;  5B3S B;  3CCU V;  1OCR B;  4DR2 O;  4DR6 O;  2OTL V;  3ETD A;  1FFT B;  5K1P A;  3P30 A;  4H44 B;  2RJZ A;  3K9A A;  1G6U A;  5IYB O;  2LGW A;  3S3X A;  3AG2 C;  5JVD B;  1M90 W;  1R6N A;  3CCL V;  1K8A W;  1NBM G;  1YTF D;  2IU0 A;  2ZE6 A;  1VEW A;  3CE2 A;  2OCH A;  3GVM A;  1VP7 A;  5IYC O;  2YIB D;  4JV5 O;  2PYL A;  1AI7 A;  1VQ4 V;  3ASN B;  1MA1 A;  4L8J A;  1AJQ A;  2UU9 O;  2EJR A;  3CPW U;  2Z5U A;  2ETN A;  2JJ2 G;  4UCV A;  3FYI B;  1Y66 A;  2HLD G;  3D36 C;  4JYA B;  2EIJ B;  3OFN G;  1LUV A;  2VQF B;  1YJ9 V;  4FLU A;  2HVJ C;  4A5U B;  2A0L A;  2IW5 A;  1PNL A;  3ABK B;  4TUY B;  4DV5 B;  2RDC A;  3FB6 C;  4NXM O;  3AK1 A;  1IZ3 A;  2CTR A;  3ZCC A;  2X7R B;  4JI5 B;  4I50 A;  5IJ9 B;  2L6L A;  2XAQ A;  3FFQ A;  1SES A;  1SKV A;  1R3I C;  4MW8 A;  4I4T A;  2ZCE A;  4YHH O;  4LF9 B;  4O4J A;  2K1E A;  1HNZ B;  1QCE A;  2F4V B;  1S72 V;  1IBK B;  3JD4 A;  3AG4 B;  5CA0 B;  1S77 D;  1UJW B;  1IBL B;  1TA8 A;  4YJ2 A;  1ZUQ A;  2AW9 A;  4JI0 B;  5IE9 A;  1SQF A;  3D36 A;  5A9G A;  4R8C A;  3K0G A;  4DR7 B;  1H2G A;  3ABU A;  4X20 B;  1FXH A;  4UV8 A;  4WFB V;  3RYI B;  5GW7 A;  1QR8 A;  3B40 A;  1J5E O;  2QWQ B;  5CBG A;  4JI8 B;  1VQL V;  3OTO O;  3B4S A;  4PDL A;  2AHZ A;  4NB5 A;  4DV1 O;  4G28 B;  4Q20 A;  4R7C A;  2Q7G A;  3VQY A;  4GKK B;  1CXZ B;  3N2K A;  1MNG A;  5IYD O;  5KHG A;  4NYK A;  4U7O A;  1FAF A;  3KCX A;  2KG7 B;  3TCU A;  1NS1 A;  2LP7 A;  1XQ8 A;  1OCZ B;  2A79 B;  4CZZ A;  4X88 A;  4JI4 B;  3CJH B;  3HKD B;  4FLT A;  1NU1 H;  3SJA C;  4E2L A;  3AG1 C;  5H6R A;  3ZRV A;  1VQ7 V;  4PA7 A;  2QM8 A;  3OT7 A;  4PDR A;  4TOI A;  4ZHQ B;  4B08 A;  1F4N A;  4B7E A;  3EHB B;  1WN7 A;  3JAS B;  1BHA A;  4MS2 A;  5EYP A;  4WFH A;  4O4I A;  4P2Z A;  1WPX A;  4DV7 B;  1BQZ A;  3CME V;  1H8E G;  3RVY A;  3WB1 A;  4D7T A;  4LR3 A;  5KLV H;  4LFC O;  3SPC A;  4DV0 B;  2ODM A;  2P4V A;  2FML A;  3FB8 C;  3BA9 A;  4X66 B;  5IY5 B;  4X1K B;  1I5X A;  4LNU B;  4LF4 B;  3WB0 A;  4CH3 A;  2B1I A;  3N2G B;  3JAT A;  4FZ0 A;  3CC4 V;  5L3B A;  4TV9 A;  3ABM B;  2Q68 A;  1K73 W;  1H2N A;  1XNQ B;  2HEP A;  2ZNI A;  1RM1 B;  4MT8 A;  4J42 A;  1VQO V;  1FXV A;  3JCZ A;  1I94 O;  2M7W A;  3ZHU A;  5KA6 A;  2ATK C;  3EXA A;  2HJF C;  2W0F C;  1FXK C;  3ZMZ A;  3OEE G;  1BSM A;  3LSU A;  2F95 B;  4L87 A;  4J7J A;  4RAI A;  1JMK C;  2OT5 A;  4JPR A;  4HYO A;  1MG1 A;  2NLJ C;  3E8H A;  4WBN A;  2JEX A;  2Z3Y A;  3H1L H;  2RQ6 A;  2R70 A;  5KMG B;  1L8D A;  4LFB B;  3CMA V;  4I55 A;  4X65 O;  3JAR A;  4U7N A;  3CRQ A;  3ETG A;  3E8B A;  2QA4 V;  2BTO A;  3ZBH A;  1WB7 A;  4NTY A;  3IAY A;  1K34 A;  1JCH A;  1YIT V;  3HKB A;  2GDS A;  2VS0 A;  3K57 A;  1Y74 B;  2BSK A;  1I08 A;  1N34 B;  4JI1 B;  2OIE A;  2E3C A;  1K33 A;  2F23 A;  3QG5 A;  3ZMT A;  1SA0 B;  4JYA O;  2XAG A;  1Y76 B;  1ROP A;  3CX5 F;  3RGB A;  1ORQ C;  2EIK C;  1VQ5 V;  4MW3 A;  3STL C;  3STZ C;  3WU2 Z;  1J95 A;  1FXK A;  3LSQ A;  2GTS A;  4GX0 A;  3ZRW A;  4TT3 G;  2Q69 A;  1OCO B;  5C8Y A;  2ZR2 A;  1SQQ H;  3UT5 B;  3OW2 U;  4P9O A;  4DV5 O;  1AI4 A;  2ITD C;  1JA8 A;  2ZQM A;  4YIP A;  2A9H A;  4JI5 O;  1SF9 A;  1IX9 A;  1M5I A;  1WAZ A;  1BT8 A;  1Y6X A;  4KHP B;  4MTG A;  2GUZ A;  2VRZ A;  4LH7 A;  1HNZ O;  1H2L A;  4LF9 O;  2F4V O;  1GK9 A;  5CB4 B;  4FFB B;  4IYH A;  2EZP A;  1NTZ H;  1SC5 B;  1IBK O;  5C93 A;  3QVN A;  4HNA A;  3H01 A;  3ZS8 C;  1IBL O;  4LP8 A;  4DR6 B;  5B66 Z;  1OCC B;  4I7Z B;  3MAQ A;  3OEH G;  2H8P C;  2AGA A;  3F5W C;  4DR7 O;  1SQV H;  2JS3 A;  4MTO A;  1EZV H;  3K79 A;  2Y0I A;  3E86 A;  2QKC A;  3S3W A;  1XNR B;  1V55 C;  2WPD G;  4DO2 A;  3T4Z A;  3SPH A;  5LYJ B;  2Q0O C;  1F7Y A;  4I0X A;  3QTC A;  3ZMS A;  5GON A;  4CS4 A;  4G27 B;  3X2Q C;  4JV5 B;  4GKK O;  4O2B A;  4OXS A;  3W7W A;  2P7T C;  2UU9 B;  2QM7 A;  5JJJ B;  4TV8 A;  5JQG B;  2ZXW B;  4DV6 B;  2KB1 A;  1GN4 A;  1HW7 A;  3SYQ A;  1AR5 A;  4JI4 O;  4FLV A;  3QF7 A;  1Z5V A;  1M56 B;  2CH7 A;  2UXC O;  5JJN B;  1TVK A;  3JAW A;  3K03 A;  4QPJ A;  5B1B B;  1B3Q A;  1M9N A;  2XHB A;  4UFZ A;  5H9C A;  1K9M W;  1WA8 A;  5FPO A;  3FB7 C;  1E1Q G;  2P4K A;  4BW9 A;  2DYR B;  5GTH Z;  2UXD B;  1YEW A;  2Q8V A;  4AI8 A;  3LUT B;  4DV7 O;  3FB5 C;  5IWA O;  1KEC A;  2Y4T A;  3ZED A;  1OJH A;  4DV0 O;  3FAV A;  2WLM A;  1RSO A;  5B5E Z;  4UCS A;  1EBO A;  3H1K H;  1ARO P;  4X66 O;  3RYH A;  5CA1 A;  2P6J A;  1AR4 A;  3UKM A;  1VF6 C;  1MZF A;  4DV3 B;  3ABT A;  1EN5 A;  2QTS A;  3LDD A;  4LF4 O;  1N36 B;  2N05 A;  2EIM C;  4NKG B;  4PA4 A;  1FS0 G;  3I5D A;  4FLY A;  1QBZ A;  1XMO B;  4EKW A;  1XNQ O;  4LFA B;  1UFI A;  3U11 A;  1XL6 A;  2R72 A;  4X1I A;  2DN9 A;  1B04 A;  2QSA A;  5CA3 A;  2XAS A;  4UB8 Z;  1MSW D;  3OM3 B;  4DK1 A;  3DTU B;  2ADP A;  2UUB B;  4H0L B;  1CPY A;  3ETE A;  3E22 A;  3JD0 A;  1L1F A;  4PDV A;  1N4C A;  1QLE B;  1RPR A;  2NR5 A;  5H2F Z;  3RYC A;  3SYP A;  2ZDI C;  1K5S A;  4I50 B;  1BCC H;  4PV1 B;  2CGN A;  1F51 A;  1NQT A;  2LFR A;  3T1H B;  4GKJ B;  4I4T B;  1VF6 A;  2PI4 A;  4B3R B;  5LP6 C;  5TIS Z;  5H6Q A;  3BAA A;  4O4J B;  5LMU B;  1H38 A;  2BTQ A;  4MSW C;  1L0N H;  2E74 B;  1N34 O;  4JI1 O;  1TGO A;  4YJ2 B;  4BR6 A;  2YUA A;  4LWS A;  1VQP V;  2P5O A;  2QWR B;  3H1J H;  3B09 A;  3IC9 A;  2C2A A;  1NH2 B;  4X89 A;  2B5U A;  1ZSP A;  3O9O A;  4X64 B;  1KKC A;  2V1D A;  2JS5 A;  1I5Y A;  2F66 C;  1VQ6 V;  4QJF B;  1Z5W A;  4WF9 V;  2ZDI A;  3ABL C;  3C3S A;  4KFM A;  1R1B A;  2X6B A;  4ZI7 A;  3N2K B;  1S5H C;  1SZT A;  3KCY A;  2WLK A;  4OPA A;  4MVQ A;  4TQD A;  5ITZ A;  1VQ8 V;  1KQS U;  4KHP O;  4J10 A;  1NI8 A;  4JI2 B;  5BXZ A;  3G4S V;  2NN4 A;  2OWO A;  4W4K A;  2RCV A;  4D7S A;  2EX3 A;  1V9P A;  2XOK G;  2RMK B;  1SS3 A;  3K5N A;  5IDJ A;  3DSQ A;  4FM0 A;  1XUQ A;  1G1X B;  1S76 D;  2MW2 B;  2DWD C;  5JH7 A;  4N21 A;  1YJN V;  2QWN B;  5EYP B;  1THZ A;  1XNR O;  4O4I B;  2B9Z A;  4X65 B;  3CSX A;  3ICX A;  3ZHR A;  1VMG A;  1S5L Z;  3RBZ A;  5IYZ B;  1COW G;  4K8Z A;  1FPO A;  4PI2 A;  1IDS A;  2X6C A;  4X1Y A;  4F6R A;  2IM9 A;  3E89 A;  4DV6 O;  3JAL A;  4GLX A;  2F43 G;  3HKC A;  1QR9 A;  1US6 A;  3CP1 A;  3AG1 B;  5LHI A;  3SYC A;  4GX5 A;  3JAT B;  2EIN C;  3LDE A; 
#chains in the Genus database with same CATH homology
 2W6I G;  2Q6A A;  2DYS C;  5L3F A;  5IY5 B;  2Y69 B;  4WFE A;  4PA9 A;  2JDI G;  1N8R W;  5E1A C;  1I5X A;  1AI6 A;  4JAU A;  1YSC A;  3VBB A;  3JD1 A;  4GCZ A;  2XAH A;  4MVZ A;  4TWK A;  2FTK A;  2BOC C;  2IU3 A;  3LDC A;  4RUF A;  3ZN0 A;  1AI5 A;  3FKS G;  4BAY A;  2B1I A;  1NH2 D;  5CBH A;  1PKX A;  4RQF A;  2GSM B;  3CC4 V;  5L3B A;  3ML0 A;  3SJQ C;  3JD3 A;  3ABM B;  2Q68 A;  1K73 W;  1EZJ A;  3WFV A;  4LCU C;  4XDL A;  1RM1 B;  4MT8 A;  2WLN A;  4RUE A;  2DYS B;  3K0D A;  1VQO V;  1FXV A;  3JCZ A;  2M7W A;  1QVF U;  3JYC A;  5KA6 A;  2DYR C;  2ATK C;  1G8M A;  1JJ2 U;  2HJF C;  2CK3 G;  2WLH A;  5KUK A;  2W0F C;  1FXK C;  1K7D A;  1MOF A;  2AHY A;  3ZMZ A;  4QNH B;  4JYC A;  2HFE C;  1B6Q A;  1IXM A;  1P4R A;  1NJI W;  3OEE G;  4L87 A;  4RAI A;  1JPX A;  1GKF A;  3QO8 A;  1DF4 A;  5LBQ A;  3OUS A;  2OT5 A;  4HYO A;  4JPR A;  1MG1 A;  2NLJ C;  3E8H A;  3T1C A;  2JEX A;  2Z3Y A;  3BY6 A;  4UUJ C;  3IC7 A;  4JTC B;  1YHQ V;  4GX2 A;  4MTF A;  3CMA V;  3HB3 B;  4U7N A;  3ZMV A;  3ETG A;  4JYB A;  3E8B A;  1DTO A;  4FJC C;  3G6E V;  2QA4 V;  3TET A;  2YEV A;  5J9P C;  1JX9 A;  1OCO C;  3RW0 A;  1K34 A;  1JCH A;  4WFG A;  1YIT V;  1K92 A;  1FXK B;  4JGS A;  4XDJ A;  1NVP D;  3ZRW B;  5EC2 C;  3SYO A;  1K33 A;  3OUF A;  3ZMT A;  1S0V A;  1GM7 A;  3ABL B;  3PJS K;  2UXX A;  2P67 A;  1JOY A;  2XAG A;  1ROP A;  1ORQ C;  1PNK A;  2EIK C;  1VQ5 V;  4MTX A;  4X8A A;  3B8N A;  2BOB C;  2ZD9 A;  4MW3 A;  3STL C;  3LSS A;  3STZ C;  1J95 A;  4WFA V;  1NVP B;  1FXK A;  3LSQ A;  5BZB A;  1W0J G;  4GX0 A;  3ZRW A;  1K97 A;  2W6J G;  3FYE B;  4TT3 G;  5EC1 C;  2Q69 A;  2ZR3 A;  1W0K G;  3OAA G;  4JAV A;  3OR6 C;  1OCO B;  2MK3 A;  1S3J A;  2DW4 A;  2ZR2 A;  3NXS A;  1H8H G;  5EBW C;  3GWO A;  3W7T A;  1OCC C;  4I9W A;  2OTJ V;  3OW2 U;  4FPP A;  4P9O A;  1AI4 A;  1V54 C;  2ITD C;  2ZQM A;  3QO7 A;  1QLE C;  2A9H A;  2WLI B;  4MVM A;  3ASO B;  2HG5 C;  2DQ0 A;  3AG3 C;  4UVB A;  3CCE V;  3OMA B;  4LC1 A;  3T2M A;  4F4L A;  3HPL C;  5B1A C;  1ENV A;  4MTG A;  3E8F A;  4JTD B;  3GB7 C;  3OGC C;  1GK9 A;  1K4D C;  4LBE C;  3ZJZ A;  2EZP A;  1CEZ A;  5C93 A;  4ZKI A;  3H01 A;  5B1O A;  1ZWI C;  2OCC B;  2EIL C;  1SER A;  1NR7 A;  1GO3 F;  2WLI A;  2IJJ A;  4LP8 A;  1KP3 A;  4JF3 A;  1OCC B;  1YTF B;  5L3G A;  3DGE A;  1Q82 W;  1PNM A;  1V54 B;  1NKD A;  1RPO A;  2H8P C;  3OEH G;  5DN6 G;  3F5W C;  2ZXW C;  1KD1 W;  4MTO A;  1WLE A;  1E79 G;  2X0L A;  3K79 A;  3G71 V;  5L3C A;  3E86 A;  5LGN A;  1M56 C;  1DF5 A;  3ZRS A;  5B1A B;  3ZIA G;  1V55 C;  2WPD G;  5B1B C;  4DO2 A;  3MHH C;  3T4Z A;  3JD2 A;  2Q67 A;  4WFF A;  3SPH A;  3AG4 C;  5KA5 A;  3CCQ V;  4MVS A;  3T4D A;  2IJI A;  5EK0 A;  1Y4M A;  2EIN B;  3AEI A;  4ASU G;  4JTA B;  1AR1 B;  3ZMS A;  2EIL B;  3ZMU A;  4G27 B;  2HVK C;  4GT1 A;  3ZN1 A;  2GHY A;  3X2Q C;  4XBF A;  3K06 A;  3D3I A;  3IFX A;  4OXS A;  3W7W A;  1EFR G;  2P7T C;  1KKD A;  2IH3 C;  3F7V C;  3K04 A;  2YEV B;  2HR3 A;  2QM7 A;  5LGT A;  1PD3 A;  1Q86 W;  1R6K A;  2ZXW B;  2KB1 A;  1GTO A;  3SYQ A;  4PEL A;  4R50 A;  3OMI B;  1M56 B;  4PA6 A;  4FK5 C;  1XL4 A;  3TK1 A;  1V55 B;  3K03 A;  4QPJ A;  5B1B B;  3W7U A;  1M9N A;  1W2B U;  3EFF K;  5H9C A;  1CP9 A;  1E1R G;  1VQ9 V;  2WSS G;  4UV9 A;  2IJK A;  1K9M W;  2XAF A;  5B3S C;  2H94 A;  3FB7 C;  1OCR C;  3CC2 V;  3E35 A;  1E1Q G;  5FL7 G;  3X2Q B;  1K5Q A;  2YSU B;  2WLJ A;  2DYR B;  1JQ0 A;  1VQM V;  4MVO A;  2QEX V;  1OCZ C;  5B1N A;  2R9I A;  3LUT B;  4HAM A;  1AJP A;  1JVM A;  3FB5 C;  2WAM A;  3E8G A;  1KEC A;  1TUE B;  2IH1 C;  4UVA A;  4PDM A;  2Y48 A;  4XDK A;  2PI5 A;  3B77 A;  3KG2 A;  4YXW G;  1M57 C;  1DLB A;  1R3L C;  2WLM A;  4J9Z B;  1KC8 W;  4RQE A;  5EBM C;  1EBO A;  2QKS A;  1ARO P;  5B3S B;  2P90 A;  3E83 A;  3CCU V;  2JK5 C;  2P6J A;  1OCR B;  1K3E A;  4J9Y B;  3ASN C;  3UKM A;  2OTL V;  3ETD A;  3CCS V;  3MD0 A;  1FFT B;  3F7Y C;  3P30 A;  3MHS C;  3ABT A;  1BMF G;  2QTO A;  3LDD A;  4CBC A;  3M99 B;  3SPJ A;  3K9A A;  4MVR A;  2JIZ G;  4BIZ A;  1YJW V;  2EBO A;  3SPI A;  1BL8 A;  2EIJ C;  5IYB O;  1YIJ V;  4G2K A;  3AG2 C;  1M90 W;  1R6N A;  2EIM C;  3CCL V;  4PA4 A;  2IJH A;  1FS0 G;  1K8A W;  1NBM G;  1QBZ A;  1M57 B;  4BIU A;  2IU0 A;  1YTF D;  2EIK B;  4EKW A;  1F4M A;  3VOU A;  5IY5 C;  1HWY A;  2Y69 C;  5IYC O;  2B1G A;  1XL6 A;  1KP2 A;  3ABK C;  1AI7 A;  1VQ4 V;  3ASN B;  2WLL B;  2X6A A;  1AJQ A;  5CA3 A;  2XAS A;  4Z1M G;  3I55 V;  3CCV V;  1MSW D;  3OM3 B;  2EJR A;  3DTU B;  3CPW U;  1CPY A;  2Z5U A;  3ETE A;  3JD0 A;  1L1F A;  2JJ2 G;  4PDV A;  3FYI B;  5LGU A;  1Y66 A;  2HLD G;  1QLE B;  4R6Z A;  4UXN A;  2EIJ B;  1RPR A;  3OR7 C;  3SYP A;  2QE7 G;  3AG3 B;  1F23 A;  4KUM A;  2ZDI C;  1K5S A;  3OFN G;  1RM1 C;  4DXW A;  1YJ9 V;  1F51 A;  1NQT A;  4I5S A;  3RVZ A;  2HVJ C;  2LFR A;  2WLL A;  4FMT A;  2PI4 A;  3B8M A;  2A0L A;  5DM6 V;  5H6Q A;  2IW5 A;  3A0R A;  1PNL A;  5LHH A;  1G4Y B;  3ABK B;  4TSF G;  5HFM A;  1P7B A;  3CD6 V;  4GX1 A;  1R73 A;  1H38 A;  4MSW C;  1QLN A;  3FB6 C;  4QIW F;  3QNE A;  3ZCC A;  2X7R B;  1GM9 A;  1GM8 A;  4N23 A;  3OE7 G;  2XAQ A;  1M1K W;  1SES A;  1R3I C;  4MW8 A;  4H37 A;  3CYO A;  1LNQ A;  4WCE V;  3LNM B;  4UVC A;  1VQP V;  4QE7 A;  3E2E A;  2K1E A;  3SYA A;  1QCE A;  4P30 A;  1S72 V;  3I56 V;  3JD4 A;  3AG4 B;  2C2A A;  1NH2 B;  4X89 A;  1S77 D;  2B5U A;  1UJW B;  2R9R B;  5CMU A;  3K3W A;  2JEU A;  2V1D A;  4PA3 A;  2XAJ A;  3D36 A;  1I5Y A;  1MAB G;  4R8C A;  3K0G A;  1VQ6 V;  2HKO A;  4QJF B;  4WF9 V;  2ZDI A;  3ABL C;  4KFM A;  1H2G A;  2X6B A;  4H33 A;  3W7X A;  3ABU A;  3BEH A;  5CBF A;  1S5H C;  1SZT A;  4RO2 A;  1R3K C;  1FXH A;  4UV8 A;  2WLK A;  4WFB V;  4MVQ A;  5GW7 A;  1QR8 A;  3ZRX A;  5CBG A;  3P32 A;  1VQ8 V;  2EZO A;  1R3J C;  1KQS U;  1VQL V;  4PDL A;  4P9P A;  2AHZ A;  2WWW A;  3G4S V;  4G28 B;  3SPG A;  2UXN A;  4Q20 A;  4R7C A;  2XND G;  5LHG A;  2DQ3 A;  2XOK G;  1PL0 A;  3OMN B;  5IYD O;  1QVG U;  4KP4 A;  3CCR V;  4U7O A;  5CN0 A;  1OZ0 A;  3TCU A;  5IDJ A;  3ASO C;  2DWE C;  2LP7 A;  1BHB A;  2V7Q G;  3WG7 C;  1OCZ B;  2A79 B;  4CZZ A;  1GMG A;  4X88 A;  1S76 D;  1Q7Y W;  2DWD C;  4QE9 A;  4JAS A;  4N21 A;  3CCM V;  1YJN V;  4ZBM A;  2ITC C;  1THZ A;  5EBL C;  3UM7 A;  2JJ1 G;  4E2L A;  1NR1 A;  3AG1 C;  5H6R A;  3ZRV A;  4FIP C;  1VQN V;  2NNU A;  3R65 A;  4PA7 A;  1VQ7 V;  2QM8 A;  2OCC C;  4HZ3 A;  3W7S A;  4PDR A;  2D3O W;  3QO5 A;  1F4N A;  3RBZ A;  1COW G;  1Q81 W;  5L3D A;  3CXC U;  1SRY A;  3CCJ V;  3EHB B;  1YI2 V;  2X6C A;  1BHA A;  3CC7 V;  3IGA C;  4MS2 A;  4WFH A;  4P2Z A;  1WPX A;  1OHH G;  3WG7 B;  3E89 A;  2LFS A;  3CME V;  1H8E G;  3K08 A;  3RVY A;  4MVU A;  1VQK V;  5L3E A;  4QPK A;  5HFL A;  1AJN A;  1SET A;  1K4C C;  3ABM C;  2F43 G;  1QR9 A;  3CP1 A;  4BW5 A;  5KUM A;  3AG2 B;  3SPC A;  3AG1 B;  5LHI A;  3SYC A;  2EIM B;  4GX5 A;  3FB8 C;  2EIN C;  3LDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...