1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords ROP PROTEIN
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
2GHYA 3K79A 1RPOA 2IJHA 1GTOA 1NKDA 4DO2A 1B6QA 1PD3A 1F4MA 1RPRA 1ROPA 2IJIA 1GMGA 2IJKA 1F4NA 2IJJA
chains in the Genus database with same CATH superfamily
5F2VO 5HFLA 1YDXA 4I5SA 4MTXA 4NXNO 3L70H 5B1OA 2UXNA 4LF5B 4JASA 2HVKC 4DV5O 4MSWC 4X62B 1M9NA 2UXDB 4TSFG 3AG4B 3ETEA 4X1IA 3JATB 5BZBA 4B3RO 3H9VA 4KXRA 4YJ3A 5FPRA 2LP7A 2NLJC 2H3OA 5FLXN 2EIJB 2CK3G 3THOA 4LBEC 1W59A 3KZIZ 3EFFK 3ABLC 3I55V 2AGAA 5H6RA 5LP6C 3KKYA 2VRZA 4YHHB 1Z5VA 1WAZA 2ADQB 4DR5B 4WFEA 2QTOA 3NXSA 1JFFB 5EYPB 4O4HB 4RQFA 2QEXV 1VF5B 1XL6A 1R3KC 1OJHA 4DR1O 1PM9A 3RYFB 4YY3O 5C93A 4LF7O 4DV1B 2KSDA 2CH7B 2HFEC 3H1LH 5K1PA 1ZX3A 4R50A 2WLJA 1ZWIC 3DTUB 1PKXA 1JJOA 5J9PC 3OAAG 1K97A 3QO5A 4DR4B 1R1BA 5ITZB 2NNUA 1BMFG 1GN2A 1GMGA 3GWOA 2A9HA 3CPWU 3DGEA 1QR8A 1OCZB 2YXYA 4UVBA 3CCRV 5LXTA 1WN7A 5JQGB 2PYLA 2Q6AA 5L3DA 1K3EA 4J42A 4LF8O 2CAZC 3JAWB 4UCSA 5JWPA 3BABA 4XDKA 5DM6V 2CGNA 1EN5A 4UXNA 1QLEB 3CP1A 1XUQA 5LGUA 3CYOA 1P7GA 1VF6C 3W7TA 1JPXA 4I7ZB 3CCJV 2P6JA 2ZXWB 4O2BA 2OTJV 3APOA 4ZI7B 2XAJA 4WFFA 3CXCU 4JI0B 1OHHG 2OTLV 4DRXB 2K9PA 2IH3C 3JAMN 2YC0A 3ZCCA 2CDYA 3JASA 2D3OW 2Q9LA 3DC5A 1DLBA 5LMUB 4UCOA 1AI7A 2B9ZA 3U0ZA 3EHBB 2KKWA 1WP7A 2VQEO 1QBZA 2QDOA 4ZOLB 5E79Z 3D3QA 1JCHA 5EIBC 3D3IA 3BEHA 3M8AA 3SYQA 3IGAC 4DV0B 5DECA 4H13B 2Y0PA 4DW0A 3CCVV 2UUBO 2JS5A 4JV5B 4X9QA 3JYCA 3UKMA 2KB1A 1Q8IA 1VQ9V 2QWQB 1KKDA 4IL6Z 5CA1A 3H01A 2EZPA 3K0GA 3SYOA 2R70A 4IHJA 1U97A 2UXBO 4JYBA 4DV7O 2PI5A 3S3XA 2YDEA 3RFRA 1P4RA 1FXKB 1XMQB 1IZ3A 2A79B 2R9IA 2IJJA 4PDLA 1V55B 3P3PA 1CEZA 4MVRA 5A2QN 1J5EO 1VQ7V 3ETGA 4J41A 1PP9H 2ARHA 5L3EA 4DR7B 1OCOB 2M6YA 5TISZ 1VQPV 3N27A 1NVPB 2P22C 3R66A 2A3QA 3AG2B 3U10A 1N36O 3OFNG 4K8XA 1M1KW 3ZMUA 4LP8A 3B09A 1Y67A 2OIGA 1XQ8A 4OXSA 2W0FC 3AG4C 3P32A 3HKEB 1X59A 1YIJV 4HZ3A 3FYEB 2IU0A 1R3LC 1EZJA 2IJKA 2ODMA 1Q86W 2EIJC 3FX7A 1FFXB 2ITDC 1FXHA 4WF9V 1R3JC 4Q20A 1OZ0A 3IC7A 1I0HA 2P5OA 1U96A 4JYCA 1KP3A 1N33O 2DYRB 2CTRA 3N2GA 2ZDIC 3EVKA 3X2QB 1K33A 4BR6A 2F4VB 1E1QG 1H8HG 5JJJB 1G8MA 1X4TA 4Q6GA 4QPKA 4MS2A 1US6A 1H2KA 1CPYA 2Q67A 2XNDG 5IYZB 4FLYA 4AILC 3E8FA 5LXTB 3L74H 2YI9A 4MVSA 4P9PA 2XTAA 4DXWA 1VQ4V 2XUMA 1KMIZ 3LDEA 1QNMA 5LMNB 4KHPB 1EN4A 4DR3O 1VQLV 2WPDG 4NTXA 4B08A 5LA6A 2JJ1G 3ZEDA 5BXZA 1SETA 3D36C 2YXHA 1H38A 1GN6A 1VARA 1R6KA 4JI8O 2JS3A 2QSAA 4HBNA 1JX9A 1SQFA 2ZT9B 2OCCB 3MD0A 5IWAB 3CWBH 2PI4A 4WCEV 5IDJA 5B5EZ 1IDSA 1OCZC 2XOKG 4GX2A 2WLHA 3VQXA 4YXWG 3SJAC 1PV0A 1RPRA 2EZOA 5KUMA 3U11A 1VF7A 4H37A 1XHXA 4BW5A 3N2KA 1ORQC 1BHAA 1KUQA 2WLLA 5LP6B 2Q73A 2ZE6A 5H9CA 1K4CC 1LUWA 2LO1A 3T4ZA 2HVJC 3JASB 1QLEC 3VQYA 3QTCA 3CRMA 5H6QA 1NTZH 4PDVA 3JCUZ 2CUGA 3T4DA 4JAAA 5GTHZ 2DYSC 4O4IA 2ZXWC 1JA8A 5IT9N 1XNRB 3W7XA 3UT5A 2JK5C 5CBHA 4JI5O 1HDJA 4LFCB 1MG1A 3L72H 5JJNB 1MA1A 3ZMZA 1YTFD 5L3BA 1XMOO 2QM4A 3ZRXA 1SA0A 3HKBA 4AQYB 5B1NA 4I0XB 4UB6Z 4IHJB 3KG2A 2BOBC 1ROPA 3JD2A 1KB9F 3RT3C 4LH7A 1M5IA 3CC7V 1FXVA 3ZMVA 2Z3YA 1D5NA 4DK1A 1SKVA 4LF4B 2EULA 4B3SB 3CX5F 4U3FH 3AK3A 2N05A 2LFSA 1S0VA 3OR6C 4MVMA 2FYUH 3HKCA 2DE0X 1H2NA 3ABMB 4FIPC 2BOCC 1HNXB 1H2GA 1VEWA 3ZIAG 3B4SA 3I56V 4JYAO 5LGNA 1I94O 4TWKA 1BZKA 2PYJA 4DV6O 3FKSG 4BIUA 2F1MA 2QKSA 4BIOA 2GTSA 1SRYA 2HHHB 1XNQB 4ZIBA 4LFBO 1FXKC 4TT3G 4GYCB 2HP8A 3I5DA 3RYIB 4E2LA 1V55C 1QU7A 1CXZB 3RYHA 2X0LA 4LF6O 3OR7C 1OCOC 2P90A 3E22B 4G28B 5GTIZ 1HR0O 1HNWO 4X1YB 1SZTA 3WB1A 4LH6A 1ZTEA 3D8CA 1MOFA 1PNLA 3STLC 1NI8A 3AG2C 4XDJA 1YEWA 1WB7A 3CCMV 1WPXA 5C8YA 3OM3B 1GM7A 2ZIOA 4JI2B 1M4UA 1FKAO 3CSXA 3MDSA 1WB8A 1RM1B 1EBOA 4UFZA 2EINB 3W7SA 3Q4HB 3SPIA 4FFBB 4NXMO 2QJ1A 2YS8A 4DR6O 1HP8A 1UPGA 5KX5A 2ZE5A 3W7WA 3EXAA 4LC1A 2OWOA 5LA6B 4JI1B 2DN9A 4UB8Z 3SJCC 4MW3A 4OX9O 4PI2A 2QWNB 2JDIG 5L3FA 1S72V 2X6AA 3BVOA 2UUAO 1MZEA 1PPJH 2DYRC 3B8MA 3OMAB 3ETDA 2OT5A 3X2QC 4DW1A 3SGIA 1AR1B 2QKAA 2EJ7A 3CJHB 3OT7A 5A9GA 4JI6O 4I50B 4O2AA 2DQ3A 4GZRB 4FVMA 1N34B 1I5YA 1OCRB 5GONB 2QKCA 1IBLB 4I9QA 2HKOA 2P4VA 3N2KB 2P4KA 2WLLB 4DUYO 1JOYA 2ADPA 4WFAV 4IYHA 2A0LA 1PNMA 2GHYA 1SF9A 4LFAO 2Y48A 2XAGA 2EIKB 1KU9A 1DK1A 1COWG 2OCCC 2GUZA 3F7VC 3QO7A 3H1IH 3ZX6A 5KA6A 4YIOA 2Q5ZA 2XAQA 1BQ0A 2XHBA 1QHTA 3C90A 3OTOB 2E5LO 3UT5B 2E75B 1UJWB 1N33B 1PNKA 3H1JH 2X7RB 3DXRA 1N32B 4D7TA 4TV8A 2CTWA 3JAKA 4RUEA 2PGGA 3SYPA 4FLZA 1SA0B 3FB5C 4X66B 1IVSA 1Q6IA 4CH5A 1NT2B 1SC5B 5JCOA 1VQKV 4B7EA 4RUFA 2YSUB 1XBLA 4UCUA 5KHJA 1FYJA 1Y74A 3GB7C 2LJ2A 2GBOA 3T1YO 1Q43A 1S3JA 2F93B 1OV9A 1QR9A 3K5OA 2AHYA 3HKCB 3C3TA 1FJGB 2WLMA 5DEDA 1JR9A 3IFXA 1JVMA 4DV3O 3LDDA 4JI4O 4FM2A 4ABMA 3ZJZA 4PD4F 2H94A 3BAAA 2RMKB 4K0KB 1GAXA 1GN3A 3T1HB 1F7YA 4CH6A 1LUVA 4ZHQA 2CE4A 1B3QA 2JGDA 1CP9A 4JGSA 1GK9A 1URFA 2AXTZ 4DV4O 2UUCB 1P84F 4IIJA 1IBMO 2OIEA 5JVDB 4B3MB 1IXBA 5BMVA 3RGBA 4GKJO 3LDCA 4X89A 4I4TA 1RSOA 3ABMC 1ZLZA 4U3JA 2JEXA 4CBCA 2ZCEA 3J7AU 2DW4A 4X64B 3K57A 4Z2WA 5KAFZ 4WFBV 5CB4A 2UU9O 1Z2GA 1NS1A 3A0HZ 2EBOA 1AI6A 2MK3A 5IYBO 5C8YB 2DYSB 3L71H 2YIDA 3K59A 2BTQA 3RBZA 1XILA 1KC8W 4DV2O 2Y4TA 3ABKB 4FMTA 1D2DA 1NTMH 1L0LH 2BSKA 5LHHA 4DR2B 5KMGA 1AB3A 5KX5B 5H5NA 1SERA 2UXCB 3JALB 5KA5A 1TA8A 3IJ4A 3OMNB 5LYJA 3E89A 4RQEA 1KECA 3B2EE 1VMGA 3ZRSA 3K08A 3CB2A 3WB2A 4JI7O 1TVKB 3HPLC 4O4JB 4EFBA 3DSQA 1YJ9V 3ZRWA 4DUZB 1Z5WA 2Z0AA 2JEUA 1RM1C 4GT1A 1SZXA 2RDCA 3O9OA 4X1KB 3W7UA 2EINC 1HWYA 1T5EA 5BR8O 3UO2A 1K4DC 4PDMA 1YI2V 4O2AB 2QGNA 2HR3A 3ZN0A 4F6RA 3BA8A 1SQQH 3VOUA 1Y76A 3K0DA 1GN4A 1HNZB 4JI3O 3K3WA 1XI1A 4MVQA 3PJSK 4LFBB 4O4LA 1THZA 1WP8A 1G1XB 5EK0A 3F5WC 4HAMA 1YHQV 1P7BA 3BRCA 2EX3A 1KP2A 4UV9A 2ZR3A 4X1IB 1NH2D 1IBKB 4YJ3B 1E79G 1TUBA 3STZC 4GKKO 2P06A 4FZ1A 3ETQA 4LF9B 1QLNA 3P30A 3FFQA 1Q90D 2YUAA 1OCRC 4W4KA 2UXXA 2Y69B 2G38A 2RN9A 4TV8B 2KG7A 3ASNB 3O65A 3JAKB 5LOVA 1VQMV 3RW0A 1BT8A 3E83A 3CCSV 4WBNA 1BSMA 2EIKC 4MW8A 1EZVH 1FS0G 2IJIA 1R73A 4MVUA 4Z1VA 5IY5B 1AJQA 3CRRA 4B3TO 3HB3B 1K5SA 2PF4E 2VQFB 3TK1A 1W0KG 1RPOA 3OGCC 2L6LA 2Q8VA 2B1IA 2UUAB 1XREA 2YI8A 4LF5O 5B1BB 1K5QA 3G67A 1V9PA 5EZYA 1QQCA 4X62O 2UXDO 3FAVA 5JH7A 4CH3A 3CMEV 2QE7G 3SDLA 3K04A 5EBWC 5KHKA 2R9RB 1AROP 4PA3A 4NXNB 1G6UA 2FL4A 2JIZG 1Q3EA 4ZHQB 1AI5A 4GUNA 2JGDB 3OE7G 4IIJB 3ZMTA 2E76B 3JCZA 4DV5B 1YJWV 2C2AA 3TXSA 4I4TB 3TGUH 5IJ9A 4YHHO 4A5UB 1K8AW 1BL8A 4TV9A 4MTFA 4U3JB 4B3RB 3B77A 5B3SC 1IURA 5LL6Y 3CHXA 1PD3A 4EKWA 1NU1H 1FFTB 1MSWD 1F4NA 3QNEA 4DV1O 1H2SB 1H8EG 4O2BB 1NH2B 4XBFA 4PDRA 1GM9A 2BE3A 3K5LA 4QGPA 3TCUA 1BQZA 5KMGB 4DR4O 3CC4V 4YJ2A 1JQ0A 1BGYH 3MHSC 4UCVA 4DR1B 1MSDA 2ZINA 4PJ0Z 3ZRVA 4YY3B 2PUSA 4LNUA 4LF7B 1AP6A 4P2ZA 4JZ2A 4H44B 1VQ5V 4L87A 1V54B 3LSSA 4GX5A 2JRIA 2F43G 4G27B 4NTWA 5J2TA 4J9YB 4CZZA 2QR4A 2BTOA 3ABKC 1K73W 3ICXA 5E1AC 3G80A 1Q81W 2CTQA 1H2MA 2CTPA 1IX9A 4RO2A 2WLIA 1IXMA 3OUFA 4BIZA 2M7WA 4RAIA 4CS4A 5CA1B 1JJ2U 4O4LB 2LW7A 1W0JG 2OCHA 3NR7A 3IC9A 3FD9A 4JI0O 1ZSPA 1L1FA 4LF8B 4F6EA 5LHIA 3M7MX 1JFFA 2ZDIA 1YCIA 4O4HA 3ZMSA 4JTCB 1NR7A 1R6TA 3SPJA 3RYFA 2IW5A 3CCQV 4JTAB 1S5LZ 2CH7A 2F66C 5LMUO 4R8CA 1KKCA 5LOVB 4N23A 3F5TA 3JD3A 3AK1A 1SQXH 4ICGA 5CBFA 3H1KH 4J9ZB 1WLEA 4NTYA 3RYCA 4TOIA 2Q68A 4AI8A 3D36A 4WBNB 1FAFA 5IYCO 3LNNA 4DV0O 2DJVA 2F23A 4C7UA 3ZS8C 4GLXA 1WA8A 4OPAA 4JV5O 3CXHF 4PA4A 3SJQC 3SPCA 2L35A 1G4YB 2JVDA 4KP4A 2ATKC 2VQEB 3WU2Z 4MTGA 3SPHA 4CS2A 2Y69C 4CC5A 1F4MA 4PELA 2VS0A 3ASNC 4UUJC 5JQGA 1PL4A 3FAVB 4D6TH 3QO8A 3N2GB 2P67A 3BA9A 2UUBB 2H8PC 1Q7YW 1L0NH 3A0RA 4UCTA 4I55A 5JCOC 2ZE8A 5IY5C 3WG7B 3M99B 4DR7O 1M93A 1M56B 3BCCH 1JMKC 5EBLC 2PZSA 1Q5OA 4FLWA 1AR4A 2UXBB 3TXQA 2YICA 5B1BC 4DV7B 1YTFB 1J95A 5IJ9B 3OD4A 3WB0A 4PA6A 2HJFC 4PHZA 4TUYA 4MT8A 3DC6A 2A7WA 1D5AA 2QTSA 1J5EB 1S77D 5LHGA 1AILA 3FB6C 2NR5A 2YIBA 1S5JA 4X65O 1GTOA 3KCYA 3JARA 4TQDA 4JTDB 3ZHVA 3G6BA 3RVZA 4AHCA 2VWJA 2EJRA 4JPRA 1YZBA 1N36B 4PV1B 3VQVA 1XHZA 3AEIA 1N0NA 4ZOLA 4UVAA 5CA3A 4YJ2B 1SQPH 1SQVH 4QPJA 1AJPA 3K9SA 1K7DA 1WNSA 1NBMG 2XASA 5L3GA 2F4VO 2P7TC 1B04A 4H0LB 1K92A 3AG1B 1ZL8A 5KUKA 1P49A 3K5MA 3OGIB 2RQ6A 1Q82W 3LSUA 4O4IB 4LCUC 3CCLV 4LWSA 3UM7A 3GWKC 5J2TB 2WA3A 1SQGA 5LMNO 4KHPO 3FB7C 4PA7A 2FKXA 3TJTA 4TQFA 3CRCA 2QWPB 2WWWA 4FZ0A 3LNMB 1FXKA 2WLIB 4D7SA 3ZHUA 4QJFB 5EBMC 4J10A 4X20A 1R3IC 3HKBB 5IWAO 1V54C 1M57B 2YIBD 2QA4V 5CBGA 1F51A 2O57A 3JD4A 4DR3B 1NZ6A 4MVZA 3OEEG 3SYAA 2E74B 2ZM6O 4JI8B 3HKEA 3JD1A 4Z1MG 3APQA 2HEPA 5B3SB 2ZR2A 3K5NA 4ZKIA 1FFXA 4JAVA 2CGOA 4R6ZA 1KD1W 3RYCB 3R65A 4NYKA 3G4SV 4JYYA 1XNRO 5KHHA 1AI4A 2Q7HA 2IH1C 4MTOA 3VBBA 2W6IG 4IGGA 4JF3A 4FLVA 4P9OA 3S3WA 2IU3A 1WA8B 1YJNV 3RYHB 4LFCO 3UQ8A 5KHIA 1M90W 3ZHSA 4FK5C 3G71V 4NKGB 4X88A 2DMXA 5IYZA 1NQTA 2RCVA 2X6CA 4GX0A 1VQ6V 4AQYO 4K8ZA 1SS3A 3SPGA 1GH6A 1NKDA 3JD0A 2AW9A 3RN4A 4OPHA 1F23A 3AG3C 3ASOB 4JI5B 2ETNA 4LF4O 4B3SO 3ABTA 5HFMA 1NVPD 1UFIA 4B3TB 2FB5A 4EB6A 1XEQA 2V7QG 4I55B 1OCCB 3HKDA 2Y4UA 2EILB 3ZHTA 1HNXO 1XMOB 4UV8A 2Q7GA 4PA9A 5CA0A 2GTAA 1NTKH 1DF4A 2AZ0A 4IT5A 2N74A 4H33A 3ABUA 4IYIA 1DGSA 2HHHO 4TUYB 1XDCA 2YIAA 3IAYA 1XNQO 4J80A 4FPPA 4NVPA 3CC2V 5LP6A 3A8TA 1BE3H 2ZKOA 2WLKA 2Q69A 3JARB 3WG7C 4JYAB 1GM8A 1I94B 5D5QA 1MMMA 1M56C 1QCEA 4DV6B 1YXBA 1I5XA 2IBZH 4I9WA 1YF2A 5IJ0A 3P3NA 2MW2B 2HJDA 4QIWF 5FPOA 3QF7A 3FYIB 4JI2O 2GSMB 4K35A 3ZN1A 1LR1A 1ZL8B 3K9AA 1Y4MA 4P30A 4LF6B 2GUZB 3G6EV 1VQ8V 4BWAA 2Q0AA 1HR0B 1HNWB 1WJZA 4LWSB 5KLVH 1EFRG 1W2BU 2FMLA 5CN0A 4I0XA 1XOUA 2KQXA 4W4LA 1VQOV 3SR2C 4RWUA 4WFHA 4JI1O 2FTKA 5J2UA 2XT9A 2W0XA 5GW7A 5K1XA 1WPBA 3DXRB 1PL0A 4CC6A 2VWKA 4L8JA 2X6BA 5LBQA 2DOSA 4U7NA 4G2KA 2D2CB 2ILMA 3BHPA 4OGQB 1AP5A 4MVOA 3AG1C 4X20B 2A06H 4NXMB 5B66Z 3CEIA 5B1AB 5KAIZ 4DR6B 3ML0A 1KYOF 3F7YC 2W6JG 1RFYA 3MAQA 1Y74B 1DF5A 4N21A 1N34O 1VF6A 3CRAA 2RJZA 4OX9B 1IBLO 1Q6HA 2N04A 2JGUA 3RWRD 3K06A 1SESA 5L3CA 1YSCA 2R72A 5H2FZ 2WSSG 2NN4A 4JAUA 4JZGA 3RYIA 2YEVA 4X65B 4JI6B 3E8GA 2GV9A 3A0BZ 3K58A 2AHZA 1VP7A 3E22A 4DO2A 4X1YA 1AR5A 1R6NA 1RP3B 1M57C 3OTOO 1H2LA 4DUYB 3HR0A 4HNAA 3JSLA 3CMAV 3PN1A 1GO3F 4KFMA 1QVGU 3VQWA 5BMVB 3K79A 1N32O 1SQBH 4LFAB 3C3SA 4FJCC 3E35A 4GCZA 1NR1A 1RSOB 4DR5O 1N0JA 3Q4HA 3SYCA 2Q0OC 3LSQA 2ZNJA 3ZBHA 4QNHB 4FFBA 4U7OA 2EIMB 1B6QA 4X66O 5CB4B 1EN6A 3FB8C 2E5LB 3B40A 1AVMA 2BTQB 1KQSU 4NB5A 4FLXA 4EB6B 3SJBC 4QE9A 1AJNA 2XAHA 3HKDB 3E8BA 2BSKB 1FJGO 2V1DA 4J7KA 4K3AA 4FLUA 5FNVA 2BCCH 3BY6A 5CA0B 2E3CA 1TAEA 1KBHA 3CE2A 3CJHA 1DTOA 4FFKA 3OMIB 5LYJB 1S76D 4I50A 4BAYA 4XDLA 3UO3A 5GONA 3ABLB 4KL1A 4K0KO 5IYDO 3ZRWB 3JSNA 4QE7A 3MHHC 3T1YB 2JJ2G 3T1HO 2ZM6B 3ASOC 3E86A 1XL4A 5EC1C 2IM9A 1YVWA 2UUCO 4B3MO 1MABG 4CH4A 2ZQMA 3GVMA 2DWDC 1OCCC 4FM1A 2EILC 3A2FA 5EC2C 4F6RB 4DV3B 3ZHQA 1VQNV 4EEQA 1ENVA 3JATA 4JI4B 1Y76B 4HYOA 3L75H 5EIBD 4X64O 5IJ0B 2DQ0A 5AG2A 4CS3A 5KHGA 4ZBMA 4LR3A 1B06A 1N8RW 1K34A 5CMUA 2B5UA 4DV4B 1IBMB 4BW9A 3TETA 4GKJB 3CRQA 3L9DA 4UCRA 2ZNIA 5LGTA 4DR2O 1TUBB 4ASUG 5EYPA 1TUEB 4NR1A 2LW1A 1K9MW 2UXCO 2UU9B 2WLNA 2WA4A 5IE9A 5J2UB 3OW2U 1I7FA 4KUMA 4B7KA 2KG7B 1TGOA 4PI0A 1GRJA 2LFRA 4DV2B 2R9AA 4E4EA 2HG5C 3AG3B 4GX1A 4DUZO 2HLDG 2AZ2A 1A32A 3QVNA 1Q6UA 2ZE7A 5ITZA 4J7JA 1EM1A 1BHBA 3CCEV 5DN6G 3CS5A 1VIBA 3T1CA 3E2EA 2DWEC 2ZIMA 3WFVA 4FM0A 2WAMA 1HNZO 4JI7B 2F95B 1MNGA 4J11A 4F4LA 2B1GA 2QM8A 2V4DA 3H1HH 1Y6XA 1HW7A 3L73H 3UCSC 5EZYB 2QWRB 1LNQA 2YEVB 5JVDA 1I08A 5JH7B 5BR8B 3CD6V 3LUTB 1XMQO 1IBKO 1L8DA 2ZD9A 3JAWA 1ZAUA 2XAFA 5B1AC 2ITCC 2RNBA 4FLTA 4LF9O 3OEHG 3T2MA 4JI3B 4DK0A 1GKFA 3BPZA 2OYQA 1QVFU 4HNAB 1E1RG 3CCUV 1NJIW 2LGQA 1FD9A 4YIPA 4ZI7A 2PY5A 3OUSA 4TV9B 5JJEB 1N4CA 3AK2A 3E8HA 3ZHRA 3QG5A 2Z5UA 1BCCH 4DRXA 1BS3A 4GKKB 4EFEA 2YXLA 3RVYA 2GDSA 3JALA 2Q4PA 4R7CA 3J80N 2VQFO 1MZFA 3J81N 1TVKA 2LGWA 3AG7A 3K03A 4O4JA 2LQTA 4UVCA 2IJHA 1S5HC 3B8NA 2QM7A 4X8AA 5FNVB 2QWOB 4DYLA 3OTFA 5FL7G 3KCXA 3BFRA 4X1KA 1YITV 1O9HA 1Y66A 4J7ZA 1ZUQA 1O9GA 1FPOA 4LNUB 4WFGA 2Y0IA 5BY1A 2PTMA 2EIMC 2K1EA 2Q7EA 5D5PA
chains in the Genus database with same CATH topology
1OCCB 5HFLA 3CC7V 1FXVA 2EILB 3ZMVA 4I5SA 4MTXA 2Z3YA 4UV8A 5B1OA 4PA9A 3CMEV 2UXNA 2QE7G 4JASA 3K04A 5EBWC 2LFSA 2R9RB 3OR6C 1DF4A 1S0VA 2HVKC 4MVMA 1AROP 4MSWC 4H33A 4PA3A 3ABUA 3ABMB 1M9NA 2BOCC 4FIPC 1H2GA 4TSFG 3AG4B 3ETEA 2JIZG 3ZIAG 1AI5A 3I56V 5BZBA 5LGNA 3OE7G 4FPPA 4TWKA 3ZMTA 3CC2V 3JCZA 2LP7A 2NLJC 3FKSG 4BIUA 1YJWV 2C2AA 2EIJB 2QKSA 1SRYA 2CK3G 1K8AW 1BL8A 4LBEC 2WLKA 2Q69A 4MTFA 3WG7C 1GM8A 3EFFK 3ABLC 3B77A 5B3SC 1FXKC 1M56C 1QCEA 1PD3A 4EKWA 3I55V 4TT3G 5H6RA 1FFTB 1I5XA 4E2LA 1V55C 1MSWD 1F4NA 4I9WA 3QNEA 4WFEA 2X0LA 2QTOA 1H8EG 3NXSA 3OR7C 1NH2B 1OCOC 4XBFA 4RQFA 2P90A 4G28B 2QEXV 4QIWF 4PDRA 1XL6A 1R3KC 1GM9A 3FYIB 2GSMB 1SZTA 3TCUA 3ZN1A 1MOFA 1PNLA 3K9AA 5C93A 1Y4MA 4P30A 3STLC 3AG2C 4XDJA 2HFEC 3CC4V 3CCMV 3G6EV 1VQ8V 1WPXA 4R50A 1JQ0A 2WLJA 3OM3B 1GM7A 1ZWIC 3MHSC 3DTUB 1PKXA 1EFRG 1W2BU 5CN0A 1RM1B 1EBOA 5J9PC 3ZRVA 3OAAG 2EINB 1VQOV 1K97A 3W7SA 3QO5A 4P2ZA 4WFHA 2FTKA 1VQ5V 3SPIA 5GW7A 4L87A 1V54B 3LSSA 1PL0A 2NNUA 2X6BA 4GX5A 5LBQA 1BMFG 4U7NA 4G2KA 1GMGA 3W7WA 3GWOA 2A9HA 2F43G 4G27B 3CPWU 4LC1A 4J9YB 4CZZA 3DGEA 3ABKC 1QR8A 1K73W 4MVOA 3AG1C 1OCZB 4MW3A 5E1AC 4UVBA 2JDIG 5B1AB 5L3FA 1Q81W 1S72V 2X6AA 3CCRV 3ML0A 2DYRC 3B8MA 3F7YC 2W6JG 3OMAB 3ETDA 2OT5A 4RO2A 3X2QC 1DF5A 2WLIA 4N21A 1IXMA 2Q6AA 3OUFA 1AR1B 4BIZA 5L3DA 2M7WA 1K3EA 4RAIA 1JJ2U 3K06A 1SESA 5L3CA 1YSCA 4XDKA 2DQ3A 5DM6V 2WSSG 1W0JG 4UXNA 1I5YA 1QLEB 3CP1A 1OCRB 5LGUA 3CYOA 4JAUA 2YEVA 2HKOA 3W7TA 1L1FA 1JPXA 2WLLB 3E8GA 1JOYA 3CCJV 5LHIA 2P6JA 2ZXWB 2ZDIA 2OTJV 2AHZA 2XAJA 4WFAV 4DO2A 3ZMSA 4WFFA 4JTCB 3CXCU 2A0LA 1PNMA 1R6NA 2GHYA 1M57C 1OHHG 1NR7A 3SPJA 2Y48A 2IW5A 2XAGA 2OTLV 3CCQV 2EIKB 4JTAB 1COWG 2OCCC 3CMAV 2IH3C 3F7VC 3QO7A 4R8CA 1GO3F 5KA6A 4KFMA 1QVGU 3K79A 3ZCCA 4N23A 3JD3A 2XAQA 5CBFA 4J9ZB 1WLEA 4FJCC 3E35A 4GCZA 1NR1A 1UJWB 2Q68A 2D3OW 3D36A 3SYCA 1DLBA 1PNKA 3LSQA 4QNHB 1AI7A 3EHBB 2X7RB 4U7OA 5IYCO 2EIMB 1B6QA 1QBZA 3FB8C 4RUEA 3SYPA 4PA4A 3SJQC 1JCHA 3SPCA 3D3IA 3BEHA 1KQSU 1G4YB 3FB5C 3SYQA 3IGAC 4KP4A 2ATKC 4QE9A 1AJNA 4MTGA 3SPHA 3CCVV 2Y69C 2XAHA 1VQKV 3E8BA 1F4MA 4PELA 4RUFA 2YSUB 3ASNC 2V1DA 3JYCA 4UUJC 2KB1A 3UKMA 3GB7C 1VQ9V 3BY6A 3QO8A 2P67A 1KKDA 1DTOA 1S3JA 3H01A 2EZPA 3K0GA 3OMIB 2H8PC 3SYOA 1Q7YW 1S76D 1QR9A 4BAYA 2AHYA 3A0RA 2WLMA 4JYBA 4XDLA 5IY5C 3WG7B 2PI5A 3M99B 3ABLB 3IFXA 1P4RA 1FXKB 1M56B 5IYDO 3ZRWB 4QE7A 3MHHC 2JJ2G 1JVMA 3ASOC 3LDDA 2A79B 2R9IA 5EBLC 2IJJA 4PDLA 3E86A 1XL4A 5EC1C 1V55B 1CEZA 4MVRA 1VQ7V 1MABG 5B1BC 3ETGA 1YTFB 5L3EA 1J95A 3ZJZA 2ZQMA 4PA6A 2H94A 2DWDC 1OCOB 1OCCC 2HJFC 2EILC 4MT8A 1VQPV 5EC2C 1VQNV 1NVPB 1ENVA 1CP9A 4JGSA 1GK9A 4HYOA 1S77D 5LHGA 3AG2B 3FB6C 3OFNG 2DQ0A 3LDCA 4X89A 1M1KW 3ZMUA 4LP8A 1GTOA 3ABMC 4OXSA 4ZBMA 2W0FC 3AG4C 1N8RW 3P32A 4JTDB 1YIJV 3RVZA 1K34A 2JEXA 2B5UA 5CMUA 4CBCA 4HZ3A 2EJRA 3FYEB 4JPRA 3TETA 2IU0A 2DW4A 1R3LC 1EZJA 2IJKA 4WFBV 1Q86W 3AEIA 2EBOA 1AI6A 2EIJC 2MK3A 5IYBO 4UVAA 5CA3A 2DYSB 5LGTA 4ASUG 2ITDC 4QPJA 1AJPA 1FXHA 1K7DA 4WF9V 1NBMG 1R3JC 1TUEB 2XASA 4Q20A 1OZ0A 3RBZA 1KC8W 5L3GA 3IC7A 2P7TC 3ABKB 4FMTA 1K9MW 1K92A 2WLNA 3AG1B 4JYCA 5KUKA 3OW2U 1KP3A 4KUMA 5LHHA 1Q82W 2DYRB 2LFRA 2ZDIC 3X2QB 1K33A 4LCUC 3CCLV 1SERA 1E1QG 3UM7A 1H8HG 1G8MA 2HG5C 5KA5A 3AG3B 4GX1A 3OMNB 2HLDG 3E89A 4RQEA 4QPKA 1KECA 4MS2A 3FB7C 3ZRSA 1CPYA 2Q67A 2XNDG 3K08A 4PA7A 3HPLC 2WWWA 3LNMB 1BHBA 3CCEV 3E8FA 1FXKA 5DN6G 1YJ9V 3ZRWA 4P9PA 4MVSA 3T1CA 4DXWA 1VQ4V 3E2EA 2WLIB 2DWEC 3LDEA 2JEUA 4QJFB 1RM1C 3WFVA 4GT1A 2WAMA 3W7UA 1VQLV 2WPDG 2EINC 2JJ1G 1HWYA 5EBMC 1R3IC 1SETA 1K4DC 4PDMA 1YI2V 1H38A 4F4LA 2B1GA 2QM8A 2HR3A 3ZN0A 1V54C 1R6KA 1M57B 2QA4V 1JX9A 3VOUA 5CBGA 1F51A 3K0DA 3JD4A 1LNQA 2YEVB 2OCCB 4MVZA 3OEEG 3MD0A 3CD6V 3SYAA 3K3WA 3LUTB 4MVQA 4WCEV 2PI4A 3PJSK 5IDJA 1OCZC 2ZD9A 1THZA 2XOKG 4GX2A 5EK0A 2WLHA 2XAFA 5B1AC 2ITCC 3JD1A 4YXWG 3F5WC 4Z1MG 1RPRA 2EZOA 4HAMA 1YHQV 1P7BA 5KUMA 3OEHG 3T2MA 4H37A 1GKFA 4BW5A 5B3SB 1KP2A 1QVFU 4UV9A 2ZR3A 1NH2D 1E1RG 1ORQC 2ZR2A 1BHAA 2WLLA 4ZKIA 1E79G 3CCUV 3STZC 1NJIW 4JAVA 5H9CA 3OUSA 4R6ZA 1K4CC 1KD1W 3T4ZA 1QLNA 2HVJC 3P30A 3R65A 3G4SV 1QLEC 3E8HA 1AI4A 1OCRC 2Z5UA 2IH1C 4MTOA 3VBBA 5H6QA 2W6IG 2UXXA 4PDVA 4JF3A 2Y69B 3T4DA 4P9OA 2DYSC 2IU3A 2ZXWC 3ASNB 1VQMV 1YJNV 3RVYA 3W7XA 4R7CA 3RW0A 1M90W 4FK5C 3G71V 2JK5C 3E83A 4X88A 3CCSV 5CBHA 1NQTA 2EIKC 4MW8A 1FS0G 2X6CA 4GX0A 2IJIA 1VQ6V 1R73A 3K03A 4MVUA 4UVCA 3SPGA 2IJHA 1S5HC 1AJQA 5IY5B 3B8NA 1MG1A 1NKDA 2QM7A 3JD0A 4X8AA 3ZMZA 1YTFD 3HB3B 1K5SA 1F23A 3AG3C 3TK1A 1W0KG 5FL7G 1RPOA 5L3BA 3ASOB 3OGCC 1YITV 3ZRXA 3ABTA 5HFMA 1Y66A 2B1IA 1NVPD 5B1NA 5B1BB 4WFGA 2V7QG 2BOBC 3KG2A 1ROPA 1K5QA 3JD2A 2EIMC 2K1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHY A;  3K79 A;  1RPO A;  2IJH A;  1GTO A;  1NKD A;  4DO2 A;  1B6Q A;  1PD3 A;  1F4M A;  1RPR A;  1ROP A;  2IJI A;  1GMG A;  2IJK A;  1F4N A;  2IJJ A; 
#chains in the Genus database with same CATH topology
 5F2V O;  5HFL A;  1YDX A;  4I5S A;  4MTX A;  4NXN O;  3L70 H;  5B1O A;  2UXN A;  4LF5 B;  4JAS A;  2HVK C;  4DV5 O;  4MSW C;  4X62 B;  1M9N A;  2UXD B;  4TSF G;  3AG4 B;  3ETE A;  4X1I A;  3JAT B;  5BZB A;  4B3R O;  3H9V A;  4KXR A;  4YJ3 A;  5FPR A;  2LP7 A;  2NLJ C;  2H3O A;  5FLX N;  2EIJ B;  2CK3 G;  3THO A;  4LBE C;  1W59 A;  3KZI Z;  3EFF K;  3ABL C;  3I55 V;  2AGA A;  5H6R A;  5LP6 C;  3KKY A;  2VRZ A;  4YHH B;  1Z5V A;  1WAZ A;  2ADQ B;  4DR5 B;  4WFE A;  2QTO A;  3NXS A;  1JFF B;  5EYP B;  4O4H B;  4RQF A;  2QEX V;  1VF5 B;  1XL6 A;  1R3K C;  1OJH A;  4DR1 O;  1PM9 A;  3RYF B;  4YY3 O;  5C93 A;  4LF7 O;  4DV1 B;  2KSD A;  2CH7 B;  2HFE C;  3H1L H;  5K1P A;  1ZX3 A;  4R50 A;  2WLJ A;  1ZWI C;  3DTU B;  1PKX A;  1JJO A;  5J9P C;  3OAA G;  1K97 A;  3QO5 A;  4DR4 B;  1R1B A;  5ITZ B;  2NNU A;  1BMF G;  1GN2 A;  1GMG A;  3GWO A;  2A9H A;  3CPW U;  3DGE A;  1QR8 A;  1OCZ B;  2YXY A;  4UVB A;  3CCR V;  5LXT A;  1WN7 A;  5JQG B;  2PYL A;  2Q6A A;  5L3D A;  1K3E A;  4J42 A;  4LF8 O;  2CAZ C;  3JAW B;  4UCS A;  5JWP A;  3BAB A;  4XDK A;  5DM6 V;  2CGN A;  1EN5 A;  4UXN A;  1QLE B;  3CP1 A;  1XUQ A;  5LGU A;  3CYO A;  1P7G A;  1VF6 C;  3W7T A;  1JPX A;  4I7Z B;  3CCJ V;  2P6J A;  2ZXW B;  4O2B A;  2OTJ V;  3APO A;  4ZI7 B;  2XAJ A;  4WFF A;  3CXC U;  4JI0 B;  1OHH G;  2OTL V;  4DRX B;  2K9P A;  2IH3 C;  3JAM N;  2YC0 A;  3ZCC A;  2CDY A;  3JAS A;  2D3O W;  2Q9L A;  3DC5 A;  1DLB A;  5LMU B;  4UCO A;  1AI7 A;  2B9Z A;  3U0Z A;  3EHB B;  2KKW A;  1WP7 A;  2VQE O;  1QBZ A;  2QDO A;  4ZOL B;  5E79 Z;  3D3Q A;  1JCH A;  5EIB C;  3D3I A;  3BEH A;  3M8A A;  3SYQ A;  3IGA C;  4DV0 B;  5DEC A;  4H13 B;  2Y0P A;  4DW0 A;  3CCV V;  2UUB O;  2JS5 A;  4JV5 B;  4X9Q A;  3JYC A;  3UKM A;  2KB1 A;  1Q8I A;  1VQ9 V;  2QWQ B;  1KKD A;  4IL6 Z;  5CA1 A;  3H01 A;  2EZP A;  3K0G A;  3SYO A;  2R70 A;  4IHJ A;  1U97 A;  2UXB O;  4JYB A;  4DV7 O;  2PI5 A;  3S3X A;  2YDE A;  3RFR A;  1P4R A;  1FXK B;  1XMQ B;  1IZ3 A;  2A79 B;  2R9I A;  2IJJ A;  4PDL A;  1V55 B;  3P3P A;  1CEZ A;  4MVR A;  5A2Q N;  1J5E O;  1VQ7 V;  3ETG A;  4J41 A;  1PP9 H;  2ARH A;  5L3E A;  4DR7 B;  1OCO B;  2M6Y A;  5TIS Z;  1VQP V;  3N27 A;  1NVP B;  2P22 C;  3R66 A;  2A3Q A;  3AG2 B;  3U10 A;  1N36 O;  3OFN G;  4K8X A;  1M1K W;  3ZMU A;  4LP8 A;  3B09 A;  1Y67 A;  2OIG A;  1XQ8 A;  4OXS A;  2W0F C;  3AG4 C;  3P32 A;  3HKE B;  1X59 A;  1YIJ V;  4HZ3 A;  3FYE B;  2IU0 A;  1R3L C;  1EZJ A;  2IJK A;  2ODM A;  1Q86 W;  2EIJ C;  3FX7 A;  1FFX B;  2ITD C;  1FXH A;  4WF9 V;  1R3J C;  4Q20 A;  1OZ0 A;  3IC7 A;  1I0H A;  2P5O A;  1U96 A;  4JYC A;  1KP3 A;  1N33 O;  2DYR B;  2CTR A;  3N2G A;  2ZDI C;  3EVK A;  3X2Q B;  1K33 A;  4BR6 A;  2F4V B;  1E1Q G;  1H8H G;  5JJJ B;  1G8M A;  1X4T A;  4Q6G A;  4QPK A;  4MS2 A;  1US6 A;  1H2K A;  1CPY A;  2Q67 A;  2XND G;  5IYZ B;  4FLY A;  4AIL C;  3E8F A;  5LXT B;  3L74 H;  2YI9 A;  4MVS A;  4P9P A;  2XTA A;  4DXW A;  1VQ4 V;  2XUM A;  1KMI Z;  3LDE A;  1QNM A;  5LMN B;  4KHP B;  1EN4 A;  4DR3 O;  1VQL V;  2WPD G;  4NTX A;  4B08 A;  5LA6 A;  2JJ1 G;  3ZED A;  5BXZ A;  1SET A;  3D36 C;  2YXH A;  1H38 A;  1GN6 A;  1VAR A;  1R6K A;  4JI8 O;  2JS3 A;  2QSA A;  4HBN A;  1JX9 A;  1SQF A;  2ZT9 B;  2OCC B;  3MD0 A;  5IWA B;  3CWB H;  2PI4 A;  4WCE V;  5IDJ A;  5B5E Z;  1IDS A;  1OCZ C;  2XOK G;  4GX2 A;  2WLH A;  3VQX A;  4YXW G;  3SJA C;  1PV0 A;  1RPR A;  2EZO A;  5KUM A;  3U11 A;  1VF7 A;  4H37 A;  1XHX A;  4BW5 A;  3N2K A;  1ORQ C;  1BHA A;  1KUQ A;  2WLL A;  5LP6 B;  2Q73 A;  2ZE6 A;  5H9C A;  1K4C C;  1LUW A;  2LO1 A;  3T4Z A;  2HVJ C;  3JAS B;  1QLE C;  3VQY A;  3QTC A;  3CRM A;  5H6Q A;  1NTZ H;  4PDV A;  3JCU Z;  2CUG A;  3T4D A;  4JAA A;  5GTH Z;  2DYS C;  4O4I A;  2ZXW C;  1JA8 A;  5IT9 N;  1XNR B;  3W7X A;  3UT5 A;  2JK5 C;  5CBH A;  4JI5 O;  1HDJ A;  4LFC B;  1MG1 A;  3L72 H;  5JJN B;  1MA1 A;  3ZMZ A;  1YTF D;  5L3B A;  1XMO O;  2QM4 A;  3ZRX A;  1SA0 A;  3HKB A;  4AQY B;  5B1N A;  4I0X B;  4UB6 Z;  4IHJ B;  3KG2 A;  2BOB C;  1ROP A;  3JD2 A;  1KB9 F;  3RT3 C;  4LH7 A;  1M5I A;  3CC7 V;  1FXV A;  3ZMV A;  2Z3Y A;  1D5N A;  4DK1 A;  1SKV A;  4LF4 B;  2EUL A;  4B3S B;  3CX5 F;  4U3F H;  3AK3 A;  2N05 A;  2LFS A;  1S0V A;  3OR6 C;  4MVM A;  2FYU H;  3HKC A;  2DE0 X;  1H2N A;  3ABM B;  4FIP C;  2BOC C;  1HNX B;  1H2G A;  1VEW A;  3ZIA G;  3B4S A;  3I56 V;  4JYA O;  5LGN A;  1I94 O;  4TWK A;  1BZK A;  2PYJ A;  4DV6 O;  3FKS G;  4BIU A;  2F1M A;  2QKS A;  4BIO A;  2GTS A;  1SRY A;  2HHH B;  1XNQ B;  4ZIB A;  4LFB O;  1FXK C;  4TT3 G;  4GYC B;  2HP8 A;  3I5D A;  3RYI B;  4E2L A;  1V55 C;  1QU7 A;  1CXZ B;  3RYH A;  2X0L A;  4LF6 O;  3OR7 C;  1OCO C;  2P90 A;  3E22 B;  4G28 B;  5GTI Z;  1HR0 O;  1HNW O;  4X1Y B;  1SZT A;  3WB1 A;  4LH6 A;  1ZTE A;  3D8C A;  1MOF A;  1PNL A;  3STL C;  1NI8 A;  3AG2 C;  4XDJ A;  1YEW A;  1WB7 A;  3CCM V;  1WPX A;  5C8Y A;  3OM3 B;  1GM7 A;  2ZIO A;  4JI2 B;  1M4U A;  1FKA O;  3CSX A;  3MDS A;  1WB8 A;  1RM1 B;  1EBO A;  4UFZ A;  2EIN B;  3W7S A;  3Q4H B;  3SPI A;  4FFB B;  4NXM O;  2QJ1 A;  2YS8 A;  4DR6 O;  1HP8 A;  1UPG A;  5KX5 A;  2ZE5 A;  3W7W A;  3EXA A;  4LC1 A;  2OWO A;  5LA6 B;  4JI1 B;  2DN9 A;  4UB8 Z;  3SJC C;  4MW3 A;  4OX9 O;  4PI2 A;  2QWN B;  2JDI G;  5L3F A;  1S72 V;  2X6A A;  3BVO A;  2UUA O;  1MZE A;  1PPJ H;  2DYR C;  3B8M A;  3OMA B;  3ETD A;  2OT5 A;  3X2Q C;  4DW1 A;  3SGI A;  1AR1 B;  2QKA A;  2EJ7 A;  3CJH B;  3OT7 A;  5A9G A;  4JI6 O;  4I50 B;  4O2A A;  2DQ3 A;  4GZR B;  4FVM A;  1N34 B;  1I5Y A;  1OCR B;  5GON B;  2QKC A;  1IBL B;  4I9Q A;  2HKO A;  2P4V A;  3N2K B;  2P4K A;  2WLL B;  4DUY O;  1JOY A;  2ADP A;  4WFA V;  4IYH A;  2A0L A;  1PNM A;  2GHY A;  1SF9 A;  4LFA O;  2Y48 A;  2XAG A;  2EIK B;  1KU9 A;  1DK1 A;  1COW G;  2OCC C;  2GUZ A;  3F7V C;  3QO7 A;  3H1I H;  3ZX6 A;  5KA6 A;  4YIO A;  2Q5Z A;  2XAQ A;  1BQ0 A;  2XHB A;  1QHT A;  3C90 A;  3OTO B;  2E5L O;  3UT5 B;  2E75 B;  1UJW B;  1N33 B;  1PNK A;  3H1J H;  2X7R B;  3DXR A;  1N32 B;  4D7T A;  4TV8 A;  2CTW A;  3JAK A;  4RUE A;  2PGG A;  3SYP A;  4FLZ A;  1SA0 B;  3FB5 C;  4X66 B;  1IVS A;  1Q6I A;  4CH5 A;  1NT2 B;  1SC5 B;  5JCO A;  1VQK V;  4B7E A;  4RUF A;  2YSU B;  1XBL A;  4UCU A;  5KHJ A;  1FYJ A;  1Y74 A;  3GB7 C;  2LJ2 A;  2GBO A;  3T1Y O;  1Q43 A;  1S3J A;  2F93 B;  1OV9 A;  1QR9 A;  3K5O A;  2AHY A;  3HKC B;  3C3T A;  1FJG B;  2WLM A;  5DED A;  1JR9 A;  3IFX A;  1JVM A;  4DV3 O;  3LDD A;  4JI4 O;  4FM2 A;  4ABM A;  3ZJZ A;  4PD4 F;  2H94 A;  3BAA A;  2RMK B;  4K0K B;  1GAX A;  1GN3 A;  3T1H B;  1F7Y A;  4CH6 A;  1LUV A;  4ZHQ A;  2CE4 A;  1B3Q A;  2JGD A;  1CP9 A;  4JGS A;  1GK9 A;  1URF A;  2AXT Z;  4DV4 O;  2UUC B;  1P84 F;  4IIJ A;  1IBM O;  2OIE A;  5JVD B;  4B3M B;  1IXB A;  5BMV A;  3RGB A;  4GKJ O;  3LDC A;  4X89 A;  4I4T A;  1RSO A;  3ABM C;  1ZLZ A;  4U3J A;  2JEX A;  4CBC A;  2ZCE A;  3J7A U;  2DW4 A;  4X64 B;  3K57 A;  4Z2W A;  5KAF Z;  4WFB V;  5CB4 A;  2UU9 O;  1Z2G A;  1NS1 A;  3A0H Z;  2EBO A;  1AI6 A;  2MK3 A;  5IYB O;  5C8Y B;  2DYS B;  3L71 H;  2YID A;  3K59 A;  2BTQ A;  3RBZ A;  1XIL A;  1KC8 W;  4DV2 O;  2Y4T A;  3ABK B;  4FMT A;  1D2D A;  1NTM H;  1L0L H;  2BSK A;  5LHH A;  4DR2 B;  5KMG A;  1AB3 A;  5KX5 B;  5H5N A;  1SER A;  2UXC B;  3JAL B;  5KA5 A;  1TA8 A;  3IJ4 A;  3OMN B;  5LYJ A;  3E89 A;  4RQE A;  1KEC A;  3B2E E;  1VMG A;  3ZRS A;  3K08 A;  3CB2 A;  3WB2 A;  4JI7 O;  1TVK B;  3HPL C;  4O4J B;  4EFB A;  3DSQ A;  1YJ9 V;  3ZRW A;  4DUZ B;  1Z5W A;  2Z0A A;  2JEU A;  1RM1 C;  4GT1 A;  1SZX A;  2RDC A;  3O9O A;  4X1K B;  3W7U A;  2EIN C;  1HWY A;  1T5E A;  5BR8 O;  3UO2 A;  1K4D C;  4PDM A;  1YI2 V;  4O2A B;  2QGN A;  2HR3 A;  3ZN0 A;  4F6R A;  3BA8 A;  1SQQ H;  3VOU A;  1Y76 A;  3K0D A;  1GN4 A;  1HNZ B;  4JI3 O;  3K3W A;  1XI1 A;  4MVQ A;  3PJS K;  4LFB B;  4O4L A;  1THZ A;  1WP8 A;  1G1X B;  5EK0 A;  3F5W C;  4HAM A;  1YHQ V;  1P7B A;  3BRC A;  2EX3 A;  1KP2 A;  4UV9 A;  2ZR3 A;  4X1I B;  1NH2 D;  1IBK B;  4YJ3 B;  1E79 G;  1TUB A;  3STZ C;  4GKK O;  2P06 A;  4FZ1 A;  3ETQ A;  4LF9 B;  1QLN A;  3P30 A;  3FFQ A;  1Q90 D;  2YUA A;  1OCR C;  4W4K A;  2UXX A;  2Y69 B;  2G38 A;  2RN9 A;  4TV8 B;  2KG7 A;  3ASN B;  3O65 A;  3JAK B;  5LOV A;  1VQM V;  3RW0 A;  1BT8 A;  3E83 A;  3CCS V;  4WBN A;  1BSM A;  2EIK C;  4MW8 A;  1EZV H;  1FS0 G;  2IJI A;  1R73 A;  4MVU A;  4Z1V A;  5IY5 B;  1AJQ A;  3CRR A;  4B3T O;  3HB3 B;  1K5S A;  2PF4 E;  2VQF B;  3TK1 A;  1W0K G;  1RPO A;  3OGC C;  2L6L A;  2Q8V A;  2B1I A;  2UUA B;  1XRE A;  2YI8 A;  4LF5 O;  5B1B B;  1K5Q A;  3G67 A;  1V9P A;  5EZY A;  1QQC A;  4X62 O;  2UXD O;  3FAV A;  5JH7 A;  4CH3 A;  3CME V;  2QE7 G;  3SDL A;  3K04 A;  5EBW C;  5KHK A;  2R9R B;  1ARO P;  4PA3 A;  4NXN B;  1G6U A;  2FL4 A;  2JIZ G;  1Q3E A;  4ZHQ B;  1AI5 A;  4GUN A;  2JGD B;  3OE7 G;  4IIJ B;  3ZMT A;  2E76 B;  3JCZ A;  4DV5 B;  1YJW V;  2C2A A;  3TXS A;  4I4T B;  3TGU H;  5IJ9 A;  4YHH O;  4A5U B;  1K8A W;  1BL8 A;  4TV9 A;  4MTF A;  4U3J B;  4B3R B;  3B77 A;  5B3S C;  1IUR A;  5LL6 Y;  3CHX A;  1PD3 A;  4EKW A;  1NU1 H;  1FFT B;  1MSW D;  1F4N A;  3QNE A;  4DV1 O;  1H2S B;  1H8E G;  4O2B B;  1NH2 B;  4XBF A;  4PDR A;  1GM9 A;  2BE3 A;  3K5L A;  4QGP A;  3TCU A;  1BQZ A;  5KMG B;  4DR4 O;  3CC4 V;  4YJ2 A;  1JQ0 A;  1BGY H;  3MHS C;  4UCV A;  4DR1 B;  1MSD A;  2ZIN A;  4PJ0 Z;  3ZRV A;  4YY3 B;  2PUS A;  4LNU A;  4LF7 B;  1AP6 A;  4P2Z A;  4JZ2 A;  4H44 B;  1VQ5 V;  4L87 A;  1V54 B;  3LSS A;  4GX5 A;  2JRI A;  2F43 G;  4G27 B;  4NTW A;  5J2T A;  4J9Y B;  4CZZ A;  2QR4 A;  2BTO A;  3ABK C;  1K73 W;  3ICX A;  5E1A C;  3G80 A;  1Q81 W;  2CTQ A;  1H2M A;  2CTP A;  1IX9 A;  4RO2 A;  2WLI A;  1IXM A;  3OUF A;  4BIZ A;  2M7W A;  4RAI A;  4CS4 A;  5CA1 B;  1JJ2 U;  4O4L B;  2LW7 A;  1W0J G;  2OCH A;  3NR7 A;  3IC9 A;  3FD9 A;  4JI0 O;  1ZSP A;  1L1F A;  4LF8 B;  4F6E A;  5LHI A;  3M7M X;  1JFF A;  2ZDI A;  1YCI A;  4O4H A;  3ZMS A;  4JTC B;  1NR7 A;  1R6T A;  3SPJ A;  3RYF A;  2IW5 A;  3CCQ V;  4JTA B;  1S5L Z;  2CH7 A;  2F66 C;  5LMU O;  4R8C A;  1KKC A;  5LOV B;  4N23 A;  3F5T A;  3JD3 A;  3AK1 A;  1SQX H;  4ICG A;  5CBF A;  3H1K H;  4J9Z B;  1WLE A;  4NTY A;  3RYC A;  4TOI A;  2Q68 A;  4AI8 A;  3D36 A;  4WBN B;  1FAF A;  5IYC O;  3LNN A;  4DV0 O;  2DJV A;  2F23 A;  4C7U A;  3ZS8 C;  4GLX A;  1WA8 A;  4OPA A;  4JV5 O;  3CXH F;  4PA4 A;  3SJQ C;  3SPC A;  2L35 A;  1G4Y B;  2JVD A;  4KP4 A;  2ATK C;  2VQE B;  3WU2 Z;  4MTG A;  3SPH A;  4CS2 A;  2Y69 C;  4CC5 A;  1F4M A;  4PEL A;  2VS0 A;  3ASN C;  4UUJ C;  5JQG A;  1PL4 A;  3FAV B;  4D6T H;  3QO8 A;  3N2G B;  2P67 A;  3BA9 A;  2UUB B;  2H8P C;  1Q7Y W;  1L0N H;  3A0R A;  4UCT A;  4I55 A;  5JCO C;  2ZE8 A;  5IY5 C;  3WG7 B;  3M99 B;  4DR7 O;  1M93 A;  1M56 B;  3BCC H;  1JMK C;  5EBL C;  2PZS A;  1Q5O A;  4FLW A;  1AR4 A;  2UXB B;  3TXQ A;  2YIC A;  5B1B C;  4DV7 B;  1YTF B;  1J95 A;  5IJ9 B;  3OD4 A;  3WB0 A;  4PA6 A;  2HJF C;  4PHZ A;  4TUY A;  4MT8 A;  3DC6 A;  2A7W A;  1D5A A;  2QTS A;  1J5E B;  1S77 D;  5LHG A;  1AIL A;  3FB6 C;  2NR5 A;  2YIB A;  1S5J A;  4X65 O;  1GTO A;  3KCY A;  3JAR A;  4TQD A;  4JTD B;  3ZHV A;  3G6B A;  3RVZ A;  4AHC A;  2VWJ A;  2EJR A;  4JPR A;  1YZB A;  1N36 B;  4PV1 B;  3VQV A;  1XHZ A;  3AEI A;  1N0N A;  4ZOL A;  4UVA A;  5CA3 A;  4YJ2 B;  1SQP H;  1SQV H;  4QPJ A;  1AJP A;  3K9S A;  1K7D A;  1WNS A;  1NBM G;  2XAS A;  5L3G A;  2F4V O;  2P7T C;  1B04 A;  4H0L B;  1K92 A;  3AG1 B;  1ZL8 A;  5KUK A;  1P49 A;  3K5M A;  3OGI B;  2RQ6 A;  1Q82 W;  3LSU A;  4O4I B;  4LCU C;  3CCL V;  4LWS A;  3UM7 A;  3GWK C;  5J2T B;  2WA3 A;  1SQG A;  5LMN O;  4KHP O;  3FB7 C;  4PA7 A;  2FKX A;  3TJT A;  4TQF A;  3CRC A;  2QWP B;  2WWW A;  4FZ0 A;  3LNM B;  1FXK A;  2WLI B;  4D7S A;  3ZHU A;  4QJF B;  5EBM C;  4J10 A;  4X20 A;  1R3I C;  3HKB B;  5IWA O;  1V54 C;  1M57 B;  2YIB D;  2QA4 V;  5CBG A;  1F51 A;  2O57 A;  3JD4 A;  4DR3 B;  1NZ6 A;  4MVZ A;  3OEE G;  3SYA A;  2E74 B;  2ZM6 O;  4JI8 B;  3HKE A;  3JD1 A;  4Z1M G;  3APQ A;  2HEP A;  5B3S B;  2ZR2 A;  3K5N A;  4ZKI A;  1FFX A;  4JAV A;  2CGO A;  4R6Z A;  1KD1 W;  3RYC B;  3R65 A;  4NYK A;  3G4S V;  4JYY A;  1XNR O;  5KHH A;  1AI4 A;  2Q7H A;  2IH1 C;  4MTO A;  3VBB A;  2W6I G;  4IGG A;  4JF3 A;  4FLV A;  4P9O A;  3S3W A;  2IU3 A;  1WA8 B;  1YJN V;  3RYH B;  4LFC O;  3UQ8 A;  5KHI A;  1M90 W;  3ZHS A;  4FK5 C;  3G71 V;  4NKG B;  4X88 A;  2DMX A;  5IYZ A;  1NQT A;  2RCV A;  2X6C A;  4GX0 A;  1VQ6 V;  4AQY O;  4K8Z A;  1SS3 A;  3SPG A;  1GH6 A;  1NKD A;  3JD0 A;  2AW9 A;  3RN4 A;  4OPH A;  1F23 A;  3AG3 C;  3ASO B;  4JI5 B;  2ETN A;  4LF4 O;  4B3S O;  3ABT A;  5HFM A;  1NVP D;  1UFI A;  4B3T B;  2FB5 A;  4EB6 A;  1XEQ A;  2V7Q G;  4I55 B;  1OCC B;  3HKD A;  2Y4U A;  2EIL B;  3ZHT A;  1HNX O;  1XMO B;  4UV8 A;  2Q7G A;  4PA9 A;  5CA0 A;  2GTA A;  1NTK H;  1DF4 A;  2AZ0 A;  4IT5 A;  2N74 A;  4H33 A;  3ABU A;  4IYI A;  1DGS A;  2HHH O;  4TUY B;  1XDC A;  2YIA A;  3IAY A;  1XNQ O;  4J80 A;  4FPP A;  4NVP A;  3CC2 V;  5LP6 A;  3A8T A;  1BE3 H;  2ZKO A;  2WLK A;  2Q69 A;  3JAR B;  3WG7 C;  4JYA B;  1GM8 A;  1I94 B;  5D5Q A;  1MMM A;  1M56 C;  1QCE A;  4DV6 B;  1YXB A;  1I5X A;  2IBZ H;  4I9W A;  1YF2 A;  5IJ0 A;  3P3N A;  2MW2 B;  2HJD A;  4QIW F;  5FPO A;  3QF7 A;  3FYI B;  4JI2 O;  2GSM B;  4K35 A;  3ZN1 A;  1LR1 A;  1ZL8 B;  3K9A A;  1Y4M A;  4P30 A;  4LF6 B;  2GUZ B;  3G6E V;  1VQ8 V;  4BWA A;  2Q0A A;  1HR0 B;  1HNW B;  1WJZ A;  4LWS B;  5KLV H;  1EFR G;  1W2B U;  2FML A;  5CN0 A;  4I0X A;  1XOU A;  2KQX A;  4W4L A;  1VQO V;  3SR2 C;  4RWU A;  4WFH A;  4JI1 O;  2FTK A;  5J2U A;  2XT9 A;  2W0X A;  5GW7 A;  5K1X A;  1WPB A;  3DXR B;  1PL0 A;  4CC6 A;  2VWK A;  4L8J A;  2X6B A;  5LBQ A;  2DOS A;  4U7N A;  4G2K A;  2D2C B;  2ILM A;  3BHP A;  4OGQ B;  1AP5 A;  4MVO A;  3AG1 C;  4X20 B;  2A06 H;  4NXM B;  5B66 Z;  3CEI A;  5B1A B;  5KAI Z;  4DR6 B;  3ML0 A;  1KYO F;  3F7Y C;  2W6J G;  1RFY A;  3MAQ A;  1Y74 B;  1DF5 A;  4N21 A;  1N34 O;  1VF6 A;  3CRA A;  2RJZ A;  4OX9 B;  1IBL O;  1Q6H A;  2N04 A;  2JGU A;  3RWR D;  3K06 A;  1SES A;  5L3C A;  1YSC A;  2R72 A;  5H2F Z;  2WSS G;  2NN4 A;  4JAU A;  4JZG A;  3RYI A;  2YEV A;  4X65 B;  4JI6 B;  3E8G A;  2GV9 A;  3A0B Z;  3K58 A;  2AHZ A;  1VP7 A;  3E22 A;  4DO2 A;  4X1Y A;  1AR5 A;  1R6N A;  1RP3 B;  1M57 C;  3OTO O;  1H2L A;  4DUY B;  3HR0 A;  4HNA A;  3JSL A;  3CMA V;  3PN1 A;  1GO3 F;  4KFM A;  1QVG U;  3VQW A;  5BMV B;  3K79 A;  1N32 O;  1SQB H;  4LFA B;  3C3S A;  4FJC C;  3E35 A;  4GCZ A;  1NR1 A;  1RSO B;  4DR5 O;  1N0J A;  3Q4H A;  3SYC A;  2Q0O C;  3LSQ A;  2ZNJ A;  3ZBH A;  4QNH B;  4FFB A;  4U7O A;  2EIM B;  1B6Q A;  4X66 O;  5CB4 B;  1EN6 A;  3FB8 C;  2E5L B;  3B40 A;  1AVM A;  2BTQ B;  1KQS U;  4NB5 A;  4FLX A;  4EB6 B;  3SJB C;  4QE9 A;  1AJN A;  2XAH A;  3HKD B;  3E8B A;  2BSK B;  1FJG O;  2V1D A;  4J7K A;  4K3A A;  4FLU A;  5FNV A;  2BCC H;  3BY6 A;  5CA0 B;  2E3C A;  1TAE A;  1KBH A;  3CE2 A;  3CJH A;  1DTO A;  4FFK A;  3OMI B;  5LYJ B;  1S76 D;  4I50 A;  4BAY A;  4XDL A;  3UO3 A;  5GON A;  3ABL B;  4KL1 A;  4K0K O;  5IYD O;  3ZRW B;  3JSN A;  4QE7 A;  3MHH C;  3T1Y B;  2JJ2 G;  3T1H O;  2ZM6 B;  3ASO C;  3E86 A;  1XL4 A;  5EC1 C;  2IM9 A;  1YVW A;  2UUC O;  4B3M O;  1MAB G;  4CH4 A;  2ZQM A;  3GVM A;  2DWD C;  1OCC C;  4FM1 A;  2EIL C;  3A2F A;  5EC2 C;  4F6R B;  4DV3 B;  3ZHQ A;  1VQN V;  4EEQ A;  1ENV A;  3JAT A;  4JI4 B;  1Y76 B;  4HYO A;  3L75 H;  5EIB D;  4X64 O;  5IJ0 B;  2DQ0 A;  5AG2 A;  4CS3 A;  5KHG A;  4ZBM A;  4LR3 A;  1B06 A;  1N8R W;  1K34 A;  5CMU A;  2B5U A;  4DV4 B;  1IBM B;  4BW9 A;  3TET A;  4GKJ B;  3CRQ A;  3L9D A;  4UCR A;  2ZNI A;  5LGT A;  4DR2 O;  1TUB B;  4ASU G;  5EYP A;  1TUE B;  4NR1 A;  2LW1 A;  1K9M W;  2UXC O;  2UU9 B;  2WLN A;  2WA4 A;  5IE9 A;  5J2U B;  3OW2 U;  1I7F A;  4KUM A;  4B7K A;  2KG7 B;  1TGO A;  4PI0 A;  1GRJ A;  2LFR A;  4DV2 B;  2R9A A;  4E4E A;  2HG5 C;  3AG3 B;  4GX1 A;  4DUZ O;  2HLD G;  2AZ2 A;  1A32 A;  3QVN A;  1Q6U A;  2ZE7 A;  5ITZ A;  4J7J A;  1EM1 A;  1BHB A;  3CCE V;  5DN6 G;  3CS5 A;  1VIB A;  3T1C A;  3E2E A;  2DWE C;  2ZIM A;  3WFV A;  4FM0 A;  2WAM A;  1HNZ O;  4JI7 B;  2F95 B;  1MNG A;  4J11 A;  4F4L A;  2B1G A;  2QM8 A;  2V4D A;  3H1H H;  1Y6X A;  1HW7 A;  3L73 H;  3UCS C;  5EZY B;  2QWR B;  1LNQ A;  2YEV B;  5JVD A;  1I08 A;  5JH7 B;  5BR8 B;  3CD6 V;  3LUT B;  1XMQ O;  1IBK O;  1L8D A;  2ZD9 A;  3JAW A;  1ZAU A;  2XAF A;  5B1A C;  2ITC C;  2RNB A;  4FLT A;  4LF9 O;  3OEH G;  3T2M A;  4JI3 B;  4DK0 A;  1GKF A;  3BPZ A;  2OYQ A;  1QVF U;  4HNA B;  1E1R G;  3CCU V;  1NJI W;  2LGQ A;  1FD9 A;  4YIP A;  4ZI7 A;  2PY5 A;  3OUS A;  4TV9 B;  5JJE B;  1N4C A;  3AK2 A;  3E8H A;  3ZHR A;  3QG5 A;  2Z5U A;  1BCC H;  4DRX A;  1BS3 A;  4GKK B;  4EFE A;  2YXL A;  3RVY A;  2GDS A;  3JAL A;  2Q4P A;  4R7C A;  3J80 N;  2VQF O;  1MZF A;  3J81 N;  1TVK A;  2LGW A;  3AG7 A;  3K03 A;  4O4J A;  2LQT A;  4UVC A;  2IJH A;  1S5H C;  3B8N A;  2QM7 A;  4X8A A;  5FNV B;  2QWO B;  4DYL A;  3OTF A;  5FL7 G;  3KCX A;  3BFR A;  4X1K A;  1YIT V;  1O9H A;  1Y66 A;  4J7Z A;  1ZUQ A;  1O9G A;  1FPO A;  4LNU B;  4WFG A;  2Y0I A;  5BY1 A;  2PTM A;  2EIM C;  2K1E A;  2Q7E A;  5D5P A; 
#chains in the Genus database with same CATH homology
 1OCC B;  5HFL A;  3CC7 V;  1FXV A;  2EIL B;  3ZMV A;  4I5S A;  4MTX A;  2Z3Y A;  4UV8 A;  5B1O A;  4PA9 A;  3CME V;  2UXN A;  2QE7 G;  4JAS A;  3K04 A;  5EBW C;  2LFS A;  2R9R B;  3OR6 C;  1DF4 A;  1S0V A;  2HVK C;  4MVM A;  1ARO P;  4MSW C;  4H33 A;  4PA3 A;  3ABU A;  3ABM B;  1M9N A;  2BOC C;  4FIP C;  1H2G A;  4TSF G;  3AG4 B;  3ETE A;  2JIZ G;  3ZIA G;  1AI5 A;  3I56 V;  5BZB A;  5LGN A;  3OE7 G;  4FPP A;  4TWK A;  3ZMT A;  3CC2 V;  3JCZ A;  2LP7 A;  2NLJ C;  3FKS G;  4BIU A;  1YJW V;  2C2A A;  2EIJ B;  2QKS A;  1SRY A;  2CK3 G;  1K8A W;  1BL8 A;  4LBE C;  2WLK A;  2Q69 A;  4MTF A;  3WG7 C;  1GM8 A;  3EFF K;  3ABL C;  3B77 A;  5B3S C;  1FXK C;  1M56 C;  1QCE A;  1PD3 A;  4EKW A;  3I55 V;  4TT3 G;  5H6R A;  1FFT B;  1I5X A;  4E2L A;  1V55 C;  1MSW D;  1F4N A;  4I9W A;  3QNE A;  4WFE A;  2X0L A;  2QTO A;  1H8E G;  3NXS A;  3OR7 C;  1NH2 B;  1OCO C;  4XBF A;  4RQF A;  2P90 A;  4G28 B;  2QEX V;  4QIW F;  4PDR A;  1XL6 A;  1R3K C;  1GM9 A;  3FYI B;  2GSM B;  1SZT A;  3TCU A;  3ZN1 A;  1MOF A;  1PNL A;  3K9A A;  5C93 A;  1Y4M A;  4P30 A;  3STL C;  3AG2 C;  4XDJ A;  2HFE C;  3CC4 V;  3CCM V;  3G6E V;  1VQ8 V;  1WPX A;  4R50 A;  1JQ0 A;  2WLJ A;  3OM3 B;  1GM7 A;  1ZWI C;  3MHS C;  3DTU B;  1PKX A;  1EFR G;  1W2B U;  5CN0 A;  1RM1 B;  1EBO A;  5J9P C;  3ZRV A;  3OAA G;  2EIN B;  1VQO V;  1K97 A;  3W7S A;  3QO5 A;  4P2Z A;  4WFH A;  2FTK A;  1VQ5 V;  3SPI A;  5GW7 A;  4L87 A;  1V54 B;  3LSS A;  1PL0 A;  2NNU A;  2X6B A;  4GX5 A;  5LBQ A;  1BMF G;  4U7N A;  4G2K A;  1GMG A;  3W7W A;  3GWO A;  2A9H A;  2F43 G;  4G27 B;  3CPW U;  4LC1 A;  4J9Y B;  4CZZ A;  3DGE A;  3ABK C;  1QR8 A;  1K73 W;  4MVO A;  3AG1 C;  1OCZ B;  4MW3 A;  5E1A C;  4UVB A;  2JDI G;  5B1A B;  5L3F A;  1Q81 W;  1S72 V;  2X6A A;  3CCR V;  3ML0 A;  2DYR C;  3B8M A;  3F7Y C;  2W6J G;  3OMA B;  3ETD A;  2OT5 A;  4RO2 A;  3X2Q C;  1DF5 A;  2WLI A;  4N21 A;  1IXM A;  2Q6A A;  3OUF A;  1AR1 B;  4BIZ A;  5L3D A;  2M7W A;  1K3E A;  4RAI A;  1JJ2 U;  3K06 A;  1SES A;  5L3C A;  1YSC A;  4XDK A;  2DQ3 A;  5DM6 V;  2WSS G;  1W0J G;  4UXN A;  1I5Y A;  1QLE B;  3CP1 A;  1OCR B;  5LGU A;  3CYO A;  4JAU A;  2YEV A;  2HKO A;  3W7T A;  1L1F A;  1JPX A;  2WLL B;  3E8G A;  1JOY A;  3CCJ V;  5LHI A;  2P6J A;  2ZXW B;  2ZDI A;  2OTJ V;  2AHZ A;  2XAJ A;  4WFA V;  4DO2 A;  3ZMS A;  4WFF A;  4JTC B;  3CXC U;  2A0L A;  1PNM A;  1R6N A;  2GHY A;  1M57 C;  1OHH G;  1NR7 A;  3SPJ A;  2Y48 A;  2IW5 A;  2XAG A;  2OTL V;  3CCQ V;  2EIK B;  4JTA B;  1COW G;  2OCC C;  3CMA V;  2IH3 C;  3F7V C;  3QO7 A;  4R8C A;  1GO3 F;  5KA6 A;  4KFM A;  1QVG U;  3K79 A;  3ZCC A;  4N23 A;  3JD3 A;  2XAQ A;  5CBF A;  4J9Z B;  1WLE A;  4FJC C;  3E35 A;  4GCZ A;  1NR1 A;  1UJW B;  2Q68 A;  2D3O W;  3D36 A;  3SYC A;  1DLB A;  1PNK A;  3LSQ A;  4QNH B;  1AI7 A;  3EHB B;  2X7R B;  4U7O A;  5IYC O;  2EIM B;  1B6Q A;  1QBZ A;  3FB8 C;  4RUE A;  3SYP A;  4PA4 A;  3SJQ C;  1JCH A;  3SPC A;  3D3I A;  3BEH A;  1KQS U;  1G4Y B;  3FB5 C;  3SYQ A;  3IGA C;  4KP4 A;  2ATK C;  4QE9 A;  1AJN A;  4MTG A;  3SPH A;  3CCV V;  2Y69 C;  2XAH A;  1VQK V;  3E8B A;  1F4M A;  4PEL A;  4RUF A;  2YSU B;  3ASN C;  2V1D A;  3JYC A;  4UUJ C;  2KB1 A;  3UKM A;  3GB7 C;  1VQ9 V;  3BY6 A;  3QO8 A;  2P67 A;  1KKD A;  1DTO A;  1S3J A;  3H01 A;  2EZP A;  3K0G A;  3OMI B;  2H8P C;  3SYO A;  1Q7Y W;  1S76 D;  1QR9 A;  4BAY A;  2AHY A;  3A0R A;  2WLM A;  4JYB A;  4XDL A;  5IY5 C;  3WG7 B;  2PI5 A;  3M99 B;  3ABL B;  3IFX A;  1P4R A;  1FXK B;  1M56 B;  5IYD O;  3ZRW B;  4QE7 A;  3MHH C;  2JJ2 G;  1JVM A;  3ASO C;  3LDD A;  2A79 B;  2R9I A;  5EBL C;  2IJJ A;  4PDL A;  3E86 A;  1XL4 A;  5EC1 C;  1V55 B;  1CEZ A;  4MVR A;  1VQ7 V;  1MAB G;  5B1B C;  3ETG A;  1YTF B;  5L3E A;  1J95 A;  3ZJZ A;  2ZQM A;  4PA6 A;  2H94 A;  2DWD C;  1OCO B;  1OCC C;  2HJF C;  2EIL C;  4MT8 A;  1VQP V;  5EC2 C;  1VQN V;  1NVP B;  1ENV A;  1CP9 A;  4JGS A;  1GK9 A;  4HYO A;  1S77 D;  5LHG A;  3AG2 B;  3FB6 C;  3OFN G;  2DQ0 A;  3LDC A;  4X89 A;  1M1K W;  3ZMU A;  4LP8 A;  1GTO A;  3ABM C;  4OXS A;  4ZBM A;  2W0F C;  3AG4 C;  1N8R W;  3P32 A;  4JTD B;  1YIJ V;  3RVZ A;  1K34 A;  2JEX A;  2B5U A;  5CMU A;  4CBC A;  4HZ3 A;  2EJR A;  3FYE B;  4JPR A;  3TET A;  2IU0 A;  2DW4 A;  1R3L C;  1EZJ A;  2IJK A;  4WFB V;  1Q86 W;  3AEI A;  2EBO A;  1AI6 A;  2EIJ C;  2MK3 A;  5IYB O;  4UVA A;  5CA3 A;  2DYS B;  5LGT A;  4ASU G;  2ITD C;  4QPJ A;  1AJP A;  1FXH A;  1K7D A;  4WF9 V;  1NBM G;  1R3J C;  1TUE B;  2XAS A;  4Q20 A;  1OZ0 A;  3RBZ A;  1KC8 W;  5L3G A;  3IC7 A;  2P7T C;  3ABK B;  4FMT A;  1K9M W;  1K92 A;  2WLN A;  3AG1 B;  4JYC A;  5KUK A;  3OW2 U;  1KP3 A;  4KUM A;  5LHH A;  1Q82 W;  2DYR B;  2LFR A;  2ZDI C;  3X2Q B;  1K33 A;  4LCU C;  3CCL V;  1SER A;  1E1Q G;  3UM7 A;  1H8H G;  1G8M A;  2HG5 C;  5KA5 A;  3AG3 B;  4GX1 A;  3OMN B;  2HLD G;  3E89 A;  4RQE A;  4QPK A;  1KEC A;  4MS2 A;  3FB7 C;  3ZRS A;  1CPY A;  2Q67 A;  2XND G;  3K08 A;  4PA7 A;  3HPL C;  2WWW A;  3LNM B;  1BHB A;  3CCE V;  3E8F A;  1FXK A;  5DN6 G;  1YJ9 V;  3ZRW A;  4P9P A;  4MVS A;  3T1C A;  4DXW A;  1VQ4 V;  3E2E A;  2WLI B;  2DWE C;  3LDE A;  2JEU A;  4QJF B;  1RM1 C;  3WFV A;  4GT1 A;  2WAM A;  3W7U A;  1VQL V;  2WPD G;  2EIN C;  2JJ1 G;  1HWY A;  5EBM C;  1R3I C;  1SET A;  1K4D C;  4PDM A;  1YI2 V;  1H38 A;  4F4L A;  2B1G A;  2QM8 A;  2HR3 A;  3ZN0 A;  1V54 C;  1R6K A;  1M57 B;  2QA4 V;  1JX9 A;  3VOU A;  5CBG A;  1F51 A;  3K0D A;  3JD4 A;  1LNQ A;  2YEV B;  2OCC B;  4MVZ A;  3OEE G;  3MD0 A;  3CD6 V;  3SYA A;  3K3W A;  3LUT B;  4MVQ A;  4WCE V;  2PI4 A;  3PJS K;  5IDJ A;  1OCZ C;  2ZD9 A;  1THZ A;  2XOK G;  4GX2 A;  5EK0 A;  2WLH A;  2XAF A;  5B1A C;  2ITC C;  3JD1 A;  4YXW G;  3F5W C;  4Z1M G;  1RPR A;  2EZO A;  4HAM A;  1YHQ V;  1P7B A;  5KUM A;  3OEH G;  3T2M A;  4H37 A;  1GKF A;  4BW5 A;  5B3S B;  1KP2 A;  1QVF U;  4UV9 A;  2ZR3 A;  1NH2 D;  1E1R G;  1ORQ C;  2ZR2 A;  1BHA A;  2WLL A;  4ZKI A;  1E79 G;  3CCU V;  3STZ C;  1NJI W;  4JAV A;  5H9C A;  3OUS A;  4R6Z A;  1K4C C;  1KD1 W;  3T4Z A;  1QLN A;  2HVJ C;  3P30 A;  3R65 A;  3G4S V;  1QLE C;  3E8H A;  1AI4 A;  1OCR C;  2Z5U A;  2IH1 C;  4MTO A;  3VBB A;  5H6Q A;  2W6I G;  2UXX A;  4PDV A;  4JF3 A;  2Y69 B;  3T4D A;  4P9O A;  2DYS C;  2IU3 A;  2ZXW C;  3ASN B;  1VQM V;  1YJN V;  3RVY A;  3W7X A;  4R7C A;  3RW0 A;  1M90 W;  4FK5 C;  3G71 V;  2JK5 C;  3E83 A;  4X88 A;  3CCS V;  5CBH A;  1NQT A;  2EIK C;  4MW8 A;  1FS0 G;  2X6C A;  4GX0 A;  2IJI A;  1VQ6 V;  1R73 A;  3K03 A;  4MVU A;  4UVC A;  3SPG A;  2IJH A;  1S5H C;  1AJQ A;  5IY5 B;  3B8N A;  1MG1 A;  1NKD A;  2QM7 A;  3JD0 A;  4X8A A;  3ZMZ A;  1YTF D;  3HB3 B;  1K5S A;  1F23 A;  3AG3 C;  3TK1 A;  1W0K G;  5FL7 G;  1RPO A;  5L3B A;  3ASO B;  3OGC C;  1YIT V;  3ZRX A;  3ABT A;  5HFM A;  1Y66 A;  2B1I A;  1NVP D;  5B1N A;  5B1B B;  4WFG A;  2V7Q G;  2BOB C;  3KG2 A;  1ROP A;  1K5Q A;  3JD2 A;  2EIM C;  2K1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...