1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords ROP PROTEIN
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
1F4NA 1ROPA 1GTOA 1GMGA 1F4MA 4DO2A 1RPOA 2GHYA 1NKDA 2IJJA 3K79A 1B6QA 1PD3A 2IJIA 2IJHA 1RPRA 2IJKA
chains in the Genus database with same CATH superfamily
1RP3B 3H1LH 3HB3B 3ZEDA 1MMMA 3DC6A 3AG4B 2L6LA 5KAIZ 4J42A 3STLC 4G28B 4B3MB 3S3WA 3ZMUA 3BVOA 4CS2A 2ZD9A 4KUMA 1NJIW 5IDJA 1I5YA 3AG2B 4DUZO 3O65A 2EILC 1N36B 2EIKB 4JAUA 4J11A 3KCXA 2HEPA 1NZ6A 3JAKB 1URFA 4WF9V 3ZRWB 1AVMA 4JI2B 3G6EV 1MG1A 2E5LO 4X66B 1QVGU 2B5UA 2Q73A 1F4MA 4GUNA 4W4KA 3WB2A 2YXLA 3Q4HA 2P4KA 4JZGA 4O4IA 3AK3A 3N2GA 3E22A 3CJHA 1TVKA 2NLJC 3M99B 1F23A 4B7KA 5KA5A 4X1KA 2OTJV 3MHHC 5IJ9B 4O4HB 1OV9A 4PHZA 1EFRG 3ABMB 1QR8A 4I5SA 1K5SA 3RYHB 1XMQO 4GX1A 2VQEB 1I94B 1PP9H 1OCRC 5J2UA 2IJKA 1Q6HA 2XAHA 4DR6B 5F2VO 2V7QG 1P49A 5KMGB 5L3CA 5EBMC 3FX7A 3W7SA 1AJQA 4I50A 4DV0B 2WSSG 4XBFA 4LF4B 1A32A 2EINC 1P4RA 3OT7A 1V54B 4ZOLA 3G71V 3JAMN 1L1FA 2YSUB 1S3JA 3X2QC 3CCJV 4J41A 3ZIAG 5JH7A 1E79G 1K34A 4I0XA 1VQLV 3WU2Z 4NB5A 3JAKA 5JJEB 4DR7O 4OGQB 4X62B 1OCCB 2BSKB 1XNQO 3CB2A 3T1YB 2RQ6A 3PJSK 3SJAC 2QM8A 3OUSA 4X1IB 4H13B 1M1KW 1TUBB 5LYJB 5DEDA 4UVBA 1TGOA 3F5WC 1YZBA 4P9PA 5KA6A 5LHIA 4J7ZA 2Q7GA 4C7UA 3RYHA 1FXKB 3CRRA 2ZINA 4P2ZA 3UO2A 3CE2A 2YIAA 4KHPB 3ZHTA 1X59A 4B7EA 1YEWA 3RBZA 3RFRA 2QSAA 3KZIZ 1I0HA 4X1YA 4PA3A 1VF6A 4OXSA 2ZNJA 5L3FA 5IYDO 1E1RG 1K4DC 4DUYB 2UUCO 5EYPA 1M56C 1SQGA 4F6RB 3E86A 1EN4A 4G2KA 5KHJA 4XDJA 2MK3A 1IX9A 3JAWA 2V1DA 2Y0IA 3T1HB 2DYSC 2A7WA 1IZ3A 4DV7B 2HHHO 5EC2C 3HKDA 3QF7A 3CHXA 1JMKC 4DK0A 3K57A 4MVMA 4I4TB 1HR0O 2LP7A 5B3SC 3CC2V 3K06A 4CH4A 1HNZO 1WN7A 1TAEA 3K5MA 3U0ZA 1VQ6V 3BY6A 4O4LA 3CCUV 4LWSA 3A0HZ 4HNAB 2CH7A 4FLYA 5FPOA 4K0KB 5GTIZ 1H2KA 3C90A 4ASUG 4WFFA 2CH7B 2BOCC 5H6RA 4IIJB 3CRMA 3DXRB 4ZBMA 1Z5WA 3DC5A 4J80A 3I5DA 4K35A 3FB5C 5EIBD 5IWAB 1KD1W 3TETA 1KU9A 3K0GA 4Q6GA 5BMVA 4UUJC 3TXSA 5LL6Y 2D2CB 2GV9A 3G67A 4Z2WA 4X65B 2Q9LA 1ROPA 1M5IA 2QDOA 4D7SA 5LHHA 4X20B 2CTRA 4RAIA 2DWEC 5EYPB 4FLZA 3CCVV 2UUAB 3AG2C 2EILB 4TV9A 2DWDC 3I56V 1GK9A 3UM7A 4DXWA 1ZLZA 2VQEO 1NTZH 4XDKA 2QGNA 2ITCC 1OCRB 3QTCA 2Q7EA 4FMTA 2UU9O 2EIMB 3LDDA 1S77D 2RMKB 3BA9A 3CXHF 5B1NA 2ZQMA 1NR1A 3HR0A 4R7CA 4CZZA 1H2SB 1K3EA 2CAZC 4FK5C 3CRCA 3BAAA 3JD3A 3UQ8A 1K5QA 2WA4A 2Y48A 3CJHB 4TQDA 5KHGA 1BHAA 3N2KB 1B6QA 4DW1A 3AG1C 1GN2A 2IH3C 2YC0A 2F4VO 2ILMA 3ETQA 3U11A 1Y67A 1CXZB 3CP1A 4PA6A 3D8CA 5FNVA 5DN6G 4I9QA 3SYPA 3IC9A 1HNWO 4QJFB 2OWOA 1KKDA 2AHYA 4LF8O 5FLXN 1FFXB 4AHCA 4IIJA 4MVRA 3T4ZA 5AG2A 2B9ZA 2DYRC 5DM6V 3A0RA 5KMGA 1OCZC 1LUVA 2O57A 3KKYA 4MTOA 3VQYA 2ZM6B 2EIJB 2XT9A 2AHZA 4LF6O 3VQXA 2VWJA 4UXNA 2QEXV 1X4TA 2DYRB 5GTHZ 5CB4A 4UCUA 3SPIA 5BR8B 4PDLA 3EXAA 5JH7B 3E83A 2P67A 2Y4TA 4H33A 2GTAA 3BEHA 1Y4MA 1AJPA 5LXTB 4H37A 1ZUQA 4U3FH 2RJZA 1QBZA 3CD6V 5DECA 2BCCH 4ZOLB 1TVKB 1YJWV 3TGUH 4EB6B 2UXBB 3LDCA 3GVMA 1WP8A 1K92A 4O4HA 5CMUA 1S5HC 3QVNA 3K9AA 1Y76A 4JI6B 3ZMZA 5BXZA 1TUBA 3WG7C 4JI4O 4EKWA 4DK1A 2YIDA 2F95B 4A5UB 4L8JA 1GH6A 4UVCA 3OTOB 4LF5O 3ABKB 3K5NA 3ZMTA 1NS1A 4JTDB 4MT8A 1S0VA 2FL4A 1JA8A 1HNXO 1MNGA 1XL4A 2C2AA 3WG7B 4DV1B 4X88A 1SERA 4JAAA 1DTOA 1M4UA 3WB0A 1IBKB 1VQ4V 1G6UA 1UPGA 2QA4V 2JGUA 3CEIA 4DR4O 4CH6A 5IYCO 4IHJA 1M57C 3RN4A 2ZXWB 1FKAO 4MS2A 3L74H 4N23A 4QE9A 1YCIA 1Q8IA 4I9WA 4FM1A 1K9MW 1Q82W 3K5LA 1NKDA 5LMUB 2Y0PA 3BCCH 4O4JA 2JRIA 2R9IA 1QU7A 1NH2D 3MAQA 3C3SA 1ZSPA 3L72H 3NR7A 3J80N 2WLJA 5B1OA 2Q5ZA 1UJWB 4GT1A 5HFMA 5C93A 1N32B 1XOUA 2FYUH 3SYOA 1J95A 1OJHA 3E8BA 4DUZB 1XL6A 4I7ZB 2L35A 4RUEA 3P3PA 2H3OA 2NN4A 1HWYA 5CA1A 1OCOC 4PDRA 2BTOA 2E76B 3SPHA 1MZEA 5IYZB 2YUAA 2P7TC 1ZAUA 1YI2V 2GTSA 3AG4C 4DR2O 1V55C 4TSFG 1J5EB 4JYYA 3AK1A 2F93B 2PF4E 4MVUA 1OCOB 4JGSA 3IJ4A 1HDJA 4DW0A 3RT3C 2R72A 3ZN0A 4MSWC 4LFBB 1TUEB 2EIKC 1QR9A 2W0XA 4LF8B 3JD1A 1E1QG 2VWKA 3KG2A 2HHHB 4LCUC 3ZHUA 5CA0B 3OEHG 2EIMC 1XREA 3EFFK 2LFSA 1KB9F 2QKCA 1Q6IA 2BTQB 5CA3A 1WAZA 2KKWA 5IY5C 2WLKA 2GDSA 1N36O 4DR1O 4JI1B 4AQYO 3G6BA 2BE3A 2Q8VA 4NXMB 4O4IB 1XMOB 3FB6C 4DV7O 4LF9B 1SQPH 2PY5A 2Q68A 5J2TA 1WB8A 1R6TA 1GO3F 3SJBC 5IY5B 3JATB 2XOKG 1QLEB 3H1HH 2ATKC 1IXBA 4JI5O 4N21A 1FS0G 1D5AA 4DO2A 4MVSA 1QLNA 4NXNB 4QPKA 2VQFB 1VF5B 4IYIA 2X6AA 2MW2B 1VQOV 3RYIA 2XUMA 4AI8A 1JPXA 3TXQA 2Z0AA 1JFFB 2F43G 2Q4PA 4LF5B 3CMAV 5A2QN 2PUSA 2Z3YA 2X6BA 2ODMA 3ABKC 3FFQA 3K9SA 3CRQA 1LNQA 1CEZA 4KP4A 1NVPD 3D36C 2GHYA 2Y69B 4K3AA 1KUQA 3CXCU 5E1AC 1YJ9V 5JQGA 3ABLB 3BFRA 5H5NA 1XILA 3BPZA 3ZCCA 1IBMB 1SF9A 4JI7B 2P06A 1XNQB 2ZT9B 2ZE7A 2JS3A 1QNMA 4JI5B 2W6JG 2X6CA 1BE3H 4DYLA 2GBOA 3N27A 3K58A 2Y69C 1PV0A 4HZ3A 3ZRVA 1NBMG 1XQ8A 5CBGA 1PL0A 4J7KA 1K7DA 4GLXA 3IGAC 2CTQA 3JALB 1VQ5V 1IBKO 3E8GA 1L0NH 1YSCA 4O2AA 1Z5VA 2X7RB 3CC7V 2CTPA 2HP8A 3Q4HB 4CC6A 3WFVA 4LF4O 4FM0A 1BQ0A 3ZJZA 4RWUA 2DYSB 1AR4A 3L71H 2EJRA 3CCEV 3ABUA 4JI8B 1ORQC 1RM1C 1MSWD 2F4VB 5LMUO 4JAVA 3E8FA 3OR6C 1HNZB 2IJJA 4ZHQA 1BHBA 1EM1A 4TV8A 2H94A 2OIEA 3QNEA 3HKCA 2XASA 4D6TH 3L73H 1FAFA 5JQGB 5BR8O 2X0LA 1RM1B 5LMNB 1N33B 5IT9N 3OUFA 2DMXA 2UXCB 1WA8B 1NTMH 1DK1A 4OPHA 2CE4A 3E22B 3GWKC 2DW4A 2CTWA 4IT5A 2JJ2G 1W59A 4MW8A 2R9RB 1R73A 1AB3A 3UCSC 3RWRD 3MHSC 4JI8O 4HNAA 5H2FZ 2ZNIA 3C3TA 2YEVA 5IYBO 4DV3O 4WFEA 2FB5A 4BWAA 3E89A 2JDIG 4X1KB 2WLLB 4E2LA 4D7TA 2QTSA 1WPBA 4I55B 3FAVB 5CBFA 5EZYA 1YDXA 2RCVA 4LNUB 2EULA 2HVJC 2WLIB 3L9DA 5D5QA 5D5PA 5EBLC 3ZRSA 4ZI7B 1MZFA 4LH6A 2QE7G 1O9HA 3T1YO 4R8CA 3DSQA 2OIGA 3ASNB 4TOIA 4BIOA 2Y4UA 4KFMA 3H1JH 3RYCB 2IJIA 4NXMO 1FPOA 1QQCA 1AI4A 2EJ7A 2W0FC 1JX9A 2UXBO 2QM7A 1KMIZ 3LNNA 4UCVA 1I08A 3BRCA 1SESA 2QJ1A 4B3TB 1BSMA 3UT5A 1SQVH 2HJFC 1GM7A 1KYOF 1SA0B 5FL7G 4JPRA 3VOUA 4DR1B 1GAXA 5B1AC 4GKKO 1P7BA 4NVPA 3ASOC 3ZBHA 5EBWC 4DV1O 1IURA 3D3QA 1YITV 1OCZB 5C8YA 1QVFU 5FPRA 1QLEC 2HKOA 1S5JA 4ICGA 4O4LB 4FM2A 1N32O 4JF3A 5ITZB 3APQA 1AP6A 3JCUZ 4GKJB 3ZRXA 4KXRA 2YIBD 3GWOA 1T5EA 3G4SV 2VRZA 4B08A 2ITDC 4K8XA 4J9YB 2P6JA 4RQFA 3ZX6A 5L3EA 3JASB 1H38A 4U3JB 2WAMA 3OAAG 4YXWG 3CMEV 4K8ZA 1PNKA 5CA0A 2DE0X 2G38A 4LF7O 2FKXA 1HW7A 3JASA 2QWRB 2EIJC 4QGPA 1FFTB 2GSMB 4YIPA 2F23A 1MOFA 5CBHA 3ABLC 4I4TA 4X66O 3HKBA 3ZHVA 2ARHA 1B3QA 1RPOA 4RUFA 1M93A 2A9HA 2YS8A 3SJQC 5EK0A 5KAFZ 4OX9O 3H1KH 4DV2O 3MD0A 3OEEG 1R3JC 1BMFG 2WLNA 4DV6B 2UXNA 4O4JB 4Z1VA 2R9AA 1EN6A 1R3IC 4LWSB 2A0LA 4FFBA 4JYCA 4BIZA 5LOVA 5LA6B 2QTOA 1YXBA 3RVZA 5BMVB 2XAFA 4MVQA 3TK1A 2EZPA 4O2AB 4YHHB 1JVMA 2WWWA 3DTUB 4U7NA 3CCQV 2P90A 3H1IH 1Q43A 2UUBB 1MSDA 1VF6C 3CCSV 4Q20A 1JFFA 1KC8W 3B09A 1FFXA 1EZJA 3ICXA 1XHXA 4LH7A 1SS3A 2B1GA 4IL6Z 2JJ1G 3K79A 3FYEB 2ZDIA 4UVAA 3J81N 4RO2A 1Q7YW 4YJ2B 3X2QB 1ZTEA 4XDLA 4TV9B 4LFBO 1SC5B 3ZHRA 1F4NA 4EEQA 2QKAA 4MVZA 1XMOO 1LUWA 3L75H 4IYHA 3UKMA 3M8AA 1XNRO 1EBOA 1F51A 3ETEA 2EZOA 4UCOA 3W7WA 2YXHA 2NR5A 4PV1B 5LXTA 4DRXB 2QKSA 2AW9A 4HBNA 4LFAO 4DR5B 1VARA 1J5EO 4GCZA 1AR1B 1SQXH 2E5LB 3RW0A 1QCEA 1MA1A 5E79Z 1PM9A 1R6NA 2EX3A 1Q81W 1H8EG 4RQEA 5H6QA 1WNSA 2OCCB 4CH3A 3CCRV 1Q5OA 1ZL8A 1VQKV 2YDEA 5LHGA 5K1XA 3R65A 1IVSA 4DR2B 3LSSA 1Z2GA 2LGWA 1V9PA 4CS3A 1V55B 4W4LA 1SKVA 4J9ZB 4ZI7A 2WLLA 5B1BB 1JJ2U 1S5LZ 2Q69A 1XI1A 5IE9A 1NTKH 2KG7A 2PYLA 4MTFA 3QO8A 4LFAB 4TWKA 5LGUA 2Q67A 2DJVA 1R6KA 1PPJH 1BGYH 3ETGA 2CGOA 1JJOA 3F7YC 4LFCB 5LGNA 1WLEA 3RYFB 1JQ0A 1KKCA 4WFBV 3L70H 5LP6B 4JI3O 5BY1A 3RYCA 4JI7O 3OM3B 2LO1A 3RYFA 1V54C 4YJ3A 3CC4V 1SA0A 5LMNO 3JARA 1K33A 4R50A 1IDSA 1NQTA 4DR3B 3JARB 1B06A 2A3QA 3K03A 1BCCH 3OTOO 4LNUA 3H01A 5CA1B 4FVMA 5H9CA 1XUQA 3JALA 4PI0A 1RSOA 1DLBA 4GYCB 2PI4A 3JSNA 4E4EA 4WFHA 1NVPB 1XHZA 5B5EZ 4LFCO 1RSOB 5JJNB 3SYAA 2UXCO 4X9QA 1SETA 2F66C 4YHHO 3CCLV 5KLVH 2EINB 1H2NA 4BIUA 4WFAV 5IYZA 1R1BA 3T1CA 1AI6A 3LUTB 3OW2U 2HG5C 1ZX3A 2QWPB 2GUZB 1TA8A 2YXYA 2CDYA 2ADPA 4X1YB 1WA8A 4CBCA 2PTMA 3FYIB 3IC7A 3UO3A 4JASA 4JV5B 4PA7A 4DV5O 2Z5UA 4F4LA 4KL1A 3K5OA 4DV2B 4HYOA 3VQVA 4X8AA 1FD9A 2AXTZ 2RNBA 1N8RW 5C8YB 2VQFO 2YIBA 4O2BB 1N34B 3I55V 2ZIOA 2WA3A 2ADQB 1W2BU 4FLXA 4B3MO 1YHQV 4BW9A 4X89A 1PL4A 5EZYB 1O9GA 3P30A 1YJNV 5B3SB 1Y74A 2E3CA 5LGTA 3CX5F 1G1XB 3AG7A 2IBZH 3FD9A 2KB1A 2XAGA 4LP8A 4JYBA 4JYAO 3MDSA 3K04A 5J2TB 3E35A 5KHHA 2IH1C 4WBNB 4FFBB 2JEXA 4DV0O 4B3RB 2Q7HA 2XHBA 4JI1O 4AQYB 3K59A 1RFYA 5JVDA 4B3TO 5IWAO 2WLIA 4PA4A 4BW5A 3SPCA 2E74B 1CP9A 2BTQA 2PYJA 2RN9A 3T2MA 5KX5A 2BOBC 2ZE8A 1YVWA 4GX5A 3E2EA 3QO7A 4DV4B 1W0KG 1XNRB 3SPJA 3B77A 1K97A 3ZRWA 1S72V 2JVDA 4I0XB 5L3GA 3A8TA 4PJ0Z 1JR9A 5LA6A 1KBHA 1XEQA 1KP2A 4FLWA 3SYQA 3M7MX 2OCCC 2ZE6A 3S3XA 1Y74B 4PD4F 3CWBH 1KQSU 1FJGO 2XAQA 1VQ7V 1SQFA 2BSKA 4G27B 1IXMA 1U97A 5J2UB 5L3BA 2A79B 1AP5A 4EFBA 1SZTA 5JCOA 2AZ2A 3W7TA 1IBLO 4MTGA 5A9GA 4AILC 2ZXWC 4L87A 4DV4O 1COWG 4DR7B 3BHPA 4GKKB 4FJCC 4TV8B 3JSLA 2OYQA 1HNWB 3OD4A 5B1AB 4BAYA 1FXKA 4PDVA 3K3WA 3SGIA 3ABTA 1JOYA 3H9VA 2HVKC 2ZR3A 3D3IA 1Y6XA 4MW3A 3HPLC 2WLMA 3KCYA 5KUMA 2QWQB 5JWPA 1GN6A 2N74A 3QG5A 2QM4A 2KG7B 1R3KC 4J10A 3CCMV 3B8MA 1EZVH 4TQFA 3HKCB 2KQXA 1SZXA 2N05A 3N2KA 1PNLA 1AROP 4DV6O 4JI2O 1UFIA 2QWOB 5LOVB 4GX0A 4JI0B 1VQ8V 2DQ3A 1IBMO 3JD2A 4FLTA 5LP6A 4EFEA 3CPWU 1ENVA 2YICA 4U7OA 4QE7A 4R6ZA 1BS3A 4I55A 1AR5A 1PD3A 1G4YB 1PKXA 4JI6O 5LBQA 4DR6O 3EVKA 4B3SO 1M90W 1W0JG 5GONA 2W6IG 4J7JA 3BA8A 4JTAB 3ZHQA 2JIZG 4LF7B 1OCCC 4U3JA 2LFRA 3A2FA 3SR2C 1Y66A 3JATA 1N0JA 1WB7A 4JYAB 3AK2A 1S76D 4GKJO 3OMAB 1SQQH 3T4DA 2ETNA 4Z1MG 3HKBB 3D36A 4I50B 3K0DA 1VMGA 2D3OW 3SDLA 2CK3G 1LR1A 4TUYA 3OR7C 4LC1A 3ABMC 3OFNG 3IFXA 3NXSA 4FFKA 4FLUA 1NU1H 4JV5O 1NI8A 1Y76B 5GW7A 3W7XA 5J9PC 4GZRB 4F6EA 2LW1A 1JCHA 3G80A 1WJZA 3R66A 2UU9B 3JD4A 2IM9A 1WPXA 3OTFA 4MTXA 3ZS8C 2Q0AA 4DV3B 2UXXA 3CYOA 3FAVA 3UT5B 3LSUA 2YI9A 4JI3B 2LW7A 4PI2A 3ZMSA 2UUBO 3SJCC 4X1IA 2YI8A 4IGGA 1D2DA 4X64O 3JYCA 1H8HG 2KSDA 2QR4A 3HKEB 1FXHA 1ZWIC 1DF5A 2K9PA 4UCTA 3ETDA 2PGGA 4UFZA 3BABA 4DUYO 1FXKC 1GTOA 1XMQB 3U10A 2M6YA 3LNMB 2K1EA 4FPPA 1GM8A 2DN9A 1F7YA 5JVDB 2HLDG 1EN5A 3FKSG 1SQBH 3T1HO 5JCOC 4FZ1A 1K4CC 3FB8C 2OT5A 2XTAA 5EC1C 1I7FA 1XDCA 3OGCC 1B04A 2P4VA 1AJNA 4JTCB 2HR3A 3ML0A 4P9OA 1NR7A 4ZKIA 1FJGB 1GMGA 3APOA 4TUYB 4NTWA 3AG3C 2Q6AA 2LQTA 3B40A 1NT2B 1Q86W 2JS5A 5ITZA 2CUGA 3OE7G 2A06H 2PI5A 1VQ9V 3CRAA 2IU3A 1BZKA 3JCZA 1YTFD 2YEVB 1MABG 4GX2A 2JGDA 3AG3B 4ZIBA 4X65O 1CPYA 1HP8A 2Q0OC 2ZR2A 4LF9O 2DQ0A 3W7UA 4PA9A 3CSXA 1GKFA 3LSQA 1VP7A 3AEIA 5FNVB 3EHBB 4NYKA 3HKEA 1DGSA 4ZHQB 3P32A 5KUKA 3O9OA 2XAJA 4LR3A 5B1BC 2QWNB 2ZCEA 1H2GA 1IBLB 2HJDA 4UV8A 3JD0A 1OHHG 5K1PA 2JEUA 2IU0A 1N33O 4X20A 4WCEV 2M7WA 1VQNV 3SPGA 4B3RO 4OX9B 1PNMA 4UB6Z 2F1MA 3WB1A 4NKGB 1G8MA 4QIWF 2VS0A 4DR4B 2GUZA 1BT8A 4YJ2A 4FZ0A 1YF2A 5LP6C 3OMIB 4CS4A 5IJ0B 2XNDG 5KHIA 2P5OA 5CB4B 1YIJV 1H2MA 2H8PC 1K73W 1QHTA 2UUCB 3CS5A 2CGNA 4OPAA 4DRXA 2UUAO 3VBBA 4X62O 3PN1A 1VEWA 1FYJA 4CH5A 4NR1A 4WBNA 3AG1B 1N4CA 1Q3EA 3OMNB 3ZHSA 4UB8Z 3B2EE 2NNUA 2R70A 3ASNC 1L0LH 1L8DA 4UCSA 4ABMA 3DXRA 4BR6A 1D5NA 3FB7C 1GN4A 1H2LA 4P30A 4K0KO 4PELA 1KP3A 2IJHA 4FLVA 5BZBA 1THZA 2JK5C 3ZMVA 4UV9A 2WLHA 3J7AU 1Q90D 2OTLV 1GM9A 2E75B 1NH2B 1HNXB 4NTXA 3DGEA 4QNHB 1I94O 1AILA 4F6RA 1N34O 1VIBA 2IW5A 3ZN1A 5LYJA 3JAWB 1VF7A 2RDCA 4O2BA 4YY3B 2ZE5A 2LJ2A 4H0LB 4TT3G 1VQMV 5IJ0A 2B1IA 2ZIMA 1M57B 4EB6A 4DV5B 1HR0B 3TJTA 3B4SA 4YJ3B 3K08A 1SRYA 5HFLA 4DR5O 3A0BZ 4MVOA 4WFGA 3IAYA 1R3LC 3VQWA 2PZSA 4JI0O 3THOA 2EBOA 5JJJB 4CC5A 1P84F 2HFEC 1WP7A 1RPRA 1GN3A 1AI5A 1GRJA 4NTYA 4QPJA 4NXNO 1BQZA 2OCHA 4FIPC 5B66Z 4DR3O 1BL8A 5KX5B 4HAMA 3HKDB 4YY3O 1I5XA 1AI7A 5L3DA 4JZ2A 4PDMA 2ZM6O 4IHJB 1DF4A 1M56B 1K8AW 2UXDO 4KHPO 2AGAA 4H44B 4UCRA 1US6A 3OGIB 2AZ0A 3GB7C 5TISZ 4LBEC 3RVYA 1U96A 1XBLA 3F7VC 3QO5A 3P3NA 3N2GB 3RGBA 1KECA 2WPDG 3LDEA 2DOSA 5EIBC 4YIOA 5KHKA 1VQPV 1P7GA 2P22C 2LGQA 1M9NA 3E8HA 4JI4B 3TCUA 3B8NA 1Q6UA 2N04A 1ZL8B 3SYCA 5GONB 3ASOB 1YTFB 2ZKOA 2FMLA 1FXVA 1OZ0A 3RYIB 1N0NA 5IJ9A 5CN0A 4B3SB 2FTKA 2UXDB 2ZDIC 3STZC 3F5TA 4X64B 2JGDB 2V4DA 4LF6B
chains in the Genus database with same CATH topology
4N23A 3HB3B 2WLNA 4QE9A 2UXNA 3AG4B 1PD3A 1G4YB 1PKXA 5LBQA 3STLC 4G28B 4I9WA 1K9MW 1Q82W 1NKDA 1M90W 1R3IC 1W0JG 2A0LA 2W6IG 3ZMUA 4JYCA 4BIZA 2ZD9A 4JTAB 4KUMA 3RVZA 2QTOA 2JIZG 2R9IA 5IDJA 1I5YA 3AG2B 1NJIW 2XAFA 2EILC 1NH2D 1OCCC 2EIKB 4MVQA 2EZPA 4JAUA 3TK1A 1JVMA 2WWWA 3DTUB 2LFRA 2WLJA 5B1OA 4U7NA 3CCQV 2P90A 1Y66A 4GT1A 1UJWB 5HFMA 4WF9V 5C93A 3ZRWB 3CCSV 4Q20A 3G6EV 1S76D 1MG1A 3OMAB 1KC8W 3T4DA 3SYOA 1J95A 1QVGU 4Z1MG 3E8BA 3D36A 1XL6A 1EZJA 3K0DA 4RUEA 2B5UA 2D3OW 1F4MA 2CK3G 2B1GA 3OR7C 4LC1A 2JJ1G 3K79A 3FYEB 1HWYA 3ABMC 2ZDIA 1OCOC 3OFNG 4PDRA 4UVAA 4RO2A 3IFXA 3NXSA 5GW7A 3W7XA 1Q7YW 3SPHA 3X2QB 5J9PC 4XDLA 2P7TC 1JCHA 1YI2V 2NLJC 3M99B 1F23A 1F4NA 3AG4C 3JD4A 5KA5A 4MVZA 1WPXA 1V55C 4MTXA 2OTJV 3MHHC 4TSFG 3UKMA 2UXXA 1EFRG 3CYOA 3ABMB 1EBOA 1QR8A 1OCOB 1F51A 3ETEA 4I5SA 2EZOA 4JGSA 4MVUA 3W7WA 1K5SA 3ZN0A 4MSWC 1TUEB 3ZMSA 2QKSA 2EIKC 4GX1A 1QR9A 3JD1A 1E1QG 3JYCA 1H8HG 1OCRC 3KG2A 4LCUC 1FXHA 1ZWIC 1DF5A 4GCZA 1AR1B 3OEHG 2EIMC 3ETDA 2IJKA 2XAHA 3RW0A 1QCEA 2V7QG 5L3CA 5EBMC 3EFFK 1R6NA 2LFSA 3W7SA 1FXKC 1AJQA 1H8EG 1Q81W 1GTOA 2WSSG 4RQEA 5H6QA 5CA3A 4XBFA 2OCCB 3LNMB 3CCRV 2K1EA 4FPPA 5IY5C 2WLKA 1VQKV 1GM8A 2EINC 5LHGA 1P4RA 1V54B 2HLDG 3FKSG 3R65A 3G71V 1L1FA 2YSUB 1S3JA 3X2QC 3LSSA 3FB6C 3CCJV 1K4CC 3ZIAG 1E79G 3FB8C 2OT5A 1K34A 2Q68A 1VQLV 1V55B 5EC1C 1GO3F 5IY5B 3OGCC 4J9ZB 1AJNA 2WLLA 2XOKG 4JTCB 2HR3A 5B1BB 1QLEB 1JJ2U 2ATKC 2Q69A 3ML0A 1OCCB 4P9OA 4N21A 1FS0G 1NR7A 4DO2A 3PJSK 4MVSA 4MTFA 3QO8A 1QLNA 2QM8A 4TWKA 4ZKIA 3OUSA 5LGUA 2Q67A 1GMGA 4QPKA 1M1KW 1R6KA 4UVBA 3ETGA 2X6AA 3AG3C 3F5WC 2Q6AA 4P9PA 1VQOV 5KA6A 3F7YC 5LHIA 5LGNA 1JPXA 1WLEA 1Q86W 2F43G 1JQ0A 1FXKB 4WFBV 4P2ZA 3CMAV 3OE7G 2Z3YA 2X6BA 3ABKC 2PI5A 3OM3B 1VQ9V 2IU3A 1LNQA 1CEZA 3JCZA 1V54C 4KP4A 1YTFD 2YEVB 1MABG 4GX2A 1NVPD 3RBZA 3CC4V 2GHYA 3AG3B 2Y69B 1CPYA 2ZR2A 3CXCU 5E1AC 1YJ9V 3ABLB 1K33A 2DQ0A 4PA3A 3W7UA 4R50A 4OXSA 4PA9A 5L3FA 3ZCCA 5IYDO 1GKFA 3LSQA 1E1RG 1K4DC 3AEIA 1NQTA 3EHBB 1M56C 3K03A 3E86A 3P32A 5KUKA 4G2KA 2XAJA 2W6JG 2MK3A 2X6CA 3H01A 4XDJA 5B1BC 1H2GA 5H9CA 2Y69C 2V1DA 4HZ3A 4UV8A 2DYSC 3JD0A 3ZRVA 1DLBA 1OHHG 2PI4A 1NBMG 5CBGA 2JEUA 2IU0A 1PL0A 5EC2C 4WCEV 2M7WA 1VQNV 4WFHA 3SPGA 1NVPB 1K7DA 3IGAC 1VQ5V 1PNMA 4MVMA 3SYAA 3E8GA 1YSCA 1SETA 1G8MA 2X7RB 4QIWF 3CC7V 2LP7A 3CCLV 5B3SC 3CC2V 3K06A 2EINB 3WFVA 4BIUA 4WFAV 3T1CA 3ZJZA 3OMIB 1VQ6V 2DYSB 1AI6A 3LUTB 3OW2U 2HG5C 3BY6A 2XNDG 3CCUV 2EJRA 3CCEV 3ABUA 1YIJV 2H8PC 1K73W 1ORQC 4CBCA 1RM1C 3FYIB 1MSWD 4ASUG 4WFFA 3IC7A 4JAVA 4JASA 3E8FA 2BOCC 3OR6C 4PA7A 5H6RA 2IJJA 4ZBMA 1BHBA 3FB5C 2Z5UA 2H94A 4F4LA 1KD1W 3VBBA 3TETA 3QNEA 4HYOA 3K0GA 4X8AA 4UUJC 2XASA 2X0LA 1RM1B 1N8RW 1ROPA 3AG1B 3OUFA 5LHHA 3I55V 3OMNB 4RAIA 2DWEC 3CCVV 1W2BU 2NNUA 1YHQV 3AG2C 3ASNC 2EILB 2DWDC 3I56V 1GK9A 3UM7A 4X89A 4DXWA 3P30A 1YJNV 2DW4A 5B3SB 3FB7C 2JJ2G 5LGTA 4XDKA 4MW8A 2ITCC 2R9RB 4P30A 1OCRB 1R73A 4PELA 2KB1A 2XAGA 4LP8A 4FMTA 4JYBA 1KP3A 3MHSC 2IJHA 2EIMB 3K04A 1THZA 2JK5C 3ZMVA 5BZBA 3E35A 3LDDA 1S77D 2IH1C 4UV9A 2YEVA 5IYBO 2JEXA 2WLHA 4WFEA 5B1NA 2ZQMA 3E89A 2JDIG 1NR1A 2OTLV 1GM9A 2WLLB 4E2LA 4R7CA 4CZZA 2WLIA 4PA4A 4BW5A 1K3EA 4FK5C 5CBFA 1NH2B 3DGEA 4QNHB 3SPCA 3JD3A 1CP9A 2HVJC 2WLIB 1K5QA 3T2MA 2IW5A 3ZN1A 2Y48A 2BOBC 5EBLC 1BHAA 3ZRSA 1B6QA 3AG1C 2IH3C 4TT3G 2QE7G 1VQMV 4GX5A 3E2EA 4R8CA 2B1IA 3QO7A 3CP1A 4PA6A 1M57B 1W0KG 3ASNB 5DN6G 3SYPA 3SPJA 3B77A 4KFMA 1K97A 3ZRWA 4QJFB 2IJIA 3K08A 1S72V 1AI4A 1KKDA 1SRYA 2AHYA 2W0FC 5HFLA 5L3GA 1JX9A 4MVOA 2QM7A 4WFGA 1R3LC 4MVRA 3T4ZA 1KP2A 2DYRC 3SYQA 5DM6V 3A0RA 2EBOA 1SESA 2OCCC 2HFEC 1OCZC 1RPRA 4MTOA 2HJFC 1GM7A 1AI5A 2EIJB 2AHZA 5FL7G 1KQSU 4QPJA 2XAQA 4JPRA 1VQ7V 4UXNA 3VOUA 2QEXV 4FIPC 5B1AC 1P7BA 4G27B 1IXMA 2DYRB 3ASOC 3SPIA 1BL8A 5EBWC 4HAMA 4PDLA 5L3BA 2A79B 1I5XA 1AI7A 3E83A 5L3DA 2P67A 1SZTA 4PDMA 4H33A 1YITV 1OCZB 3W7TA 3BEHA 4MTGA 1Y4MA 1QVFU 1AJPA 1QLEC 2HKOA 4H37A 1DF4A 1M56B 1K8AW 2ZXWC 4L87A 1QBZA 3CD6V 1COWG 1YJWV 4FJCC 5B1AB 4JF3A 1FXKA 4BAYA 3LDCA 1K92A 4PDVA 5CMUA 3GB7C 3K3WA 1S5HC 3K9AA 4LBEC 3RVYA 3ABTA 1JOYA 3ZRXA 3ZMZA 2HVKC 2ZR3A 3D3IA 3GWOA 3WG7C 3G4SV 3F7VC 3QO5A 4MW3A 3HPLC 2ITDC 2WLMA 4EKWA 4J9YB 2P6JA 4RQFA 1KECA 5KUMA 5L3EA 1H38A 2WAMA 3OAAG 4YXWG 3CMEV 1PNKA 2WPDG 4UVCA 3LDEA 3ABKB 1R3KC 3CCMV 3ZMTA 3B8MA 4JTDB 1VQPV 4MT8A 1S0VA 2EIJC 1M9NA 3E8HA 1FFTB 2GSMB 1XL4A 2C2AA 1PNLA 1MOFA 3TCUA 3WG7B 4X88A 5CBHA 1SERA 3ABLC 1AROP 3B8NA 1DTOA 3SYCA 1RPOA 3ASOB 4RUFA 1YTFB 2A9HA 3SJQC 4GX0A 1FXVA 1OZ0A 5EK0A 1VQ4V 1VQ8V 2DQ3A 2QA4V 3JD2A 5CN0A 3MD0A 2FTKA 3CPWU 1ENVA 5IYCO 3OEEG 1M57C 2ZDIC 4QE7A 1R3JC 4R6ZA 3STZC 2ZXWB 4U7OA 4MS2A 1BMFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4N A;  1ROP A;  1GTO A;  1GMG A;  1F4M A;  4DO2 A;  1RPO A;  2GHY A;  1NKD A;  2IJJ A;  3K79 A;  1B6Q A;  1PD3 A;  2IJI A;  2IJH A;  1RPR A;  2IJK A; 
#chains in the Genus database with same CATH topology
 1RP3 B;  3H1L H;  3HB3 B;  3ZED A;  1MMM A;  3DC6 A;  3AG4 B;  2L6L A;  5KAI Z;  4J42 A;  3STL C;  4G28 B;  4B3M B;  3S3W A;  3ZMU A;  3BVO A;  4CS2 A;  2ZD9 A;  4KUM A;  1NJI W;  5IDJ A;  1I5Y A;  3AG2 B;  4DUZ O;  3O65 A;  2EIL C;  1N36 B;  2EIK B;  4JAU A;  4J11 A;  3KCX A;  2HEP A;  1NZ6 A;  3JAK B;  1URF A;  4WF9 V;  3ZRW B;  1AVM A;  4JI2 B;  3G6E V;  1MG1 A;  2E5L O;  4X66 B;  1QVG U;  2B5U A;  2Q73 A;  1F4M A;  4GUN A;  4W4K A;  3WB2 A;  2YXL A;  3Q4H A;  2P4K A;  4JZG A;  4O4I A;  3AK3 A;  3N2G A;  3E22 A;  3CJH A;  1TVK A;  2NLJ C;  3M99 B;  1F23 A;  4B7K A;  5KA5 A;  4X1K A;  2OTJ V;  3MHH C;  5IJ9 B;  4O4H B;  1OV9 A;  4PHZ A;  1EFR G;  3ABM B;  1QR8 A;  4I5S A;  1K5S A;  3RYH B;  1XMQ O;  4GX1 A;  2VQE B;  1I94 B;  1PP9 H;  1OCR C;  5J2U A;  2IJK A;  1Q6H A;  2XAH A;  4DR6 B;  5F2V O;  2V7Q G;  1P49 A;  5KMG B;  5L3C A;  5EBM C;  3FX7 A;  3W7S A;  1AJQ A;  4I50 A;  4DV0 B;  2WSS G;  4XBF A;  4LF4 B;  1A32 A;  2EIN C;  1P4R A;  3OT7 A;  1V54 B;  4ZOL A;  3G71 V;  3JAM N;  1L1F A;  2YSU B;  1S3J A;  3X2Q C;  3CCJ V;  4J41 A;  3ZIA G;  5JH7 A;  1E79 G;  1K34 A;  4I0X A;  1VQL V;  3WU2 Z;  4NB5 A;  3JAK A;  5JJE B;  4DR7 O;  4OGQ B;  4X62 B;  1OCC B;  2BSK B;  1XNQ O;  3CB2 A;  3T1Y B;  2RQ6 A;  3PJS K;  3SJA C;  2QM8 A;  3OUS A;  4X1I B;  4H13 B;  1M1K W;  1TUB B;  5LYJ B;  5DED A;  4UVB A;  1TGO A;  3F5W C;  1YZB A;  4P9P A;  5KA6 A;  5LHI A;  4J7Z A;  2Q7G A;  4C7U A;  3RYH A;  1FXK B;  3CRR A;  2ZIN A;  4P2Z A;  3UO2 A;  3CE2 A;  2YIA A;  4KHP B;  3ZHT A;  1X59 A;  4B7E A;  1YEW A;  3RBZ A;  3RFR A;  2QSA A;  3KZI Z;  1I0H A;  4X1Y A;  4PA3 A;  1VF6 A;  4OXS A;  2ZNJ A;  5L3F A;  5IYD O;  1E1R G;  1K4D C;  4DUY B;  2UUC O;  5EYP A;  1M56 C;  1SQG A;  4F6R B;  3E86 A;  1EN4 A;  4G2K A;  5KHJ A;  4XDJ A;  2MK3 A;  1IX9 A;  3JAW A;  2V1D A;  2Y0I A;  3T1H B;  2DYS C;  2A7W A;  1IZ3 A;  4DV7 B;  2HHH O;  5EC2 C;  3HKD A;  3QF7 A;  3CHX A;  1JMK C;  4DK0 A;  3K57 A;  4MVM A;  4I4T B;  1HR0 O;  2LP7 A;  5B3S C;  3CC2 V;  3K06 A;  4CH4 A;  1HNZ O;  1WN7 A;  1TAE A;  3K5M A;  3U0Z A;  1VQ6 V;  3BY6 A;  4O4L A;  3CCU V;  4LWS A;  3A0H Z;  4HNA B;  2CH7 A;  4FLY A;  5FPO A;  4K0K B;  5GTI Z;  1H2K A;  3C90 A;  4ASU G;  4WFF A;  2CH7 B;  2BOC C;  5H6R A;  4IIJ B;  3CRM A;  3DXR B;  4ZBM A;  1Z5W A;  3DC5 A;  4J80 A;  3I5D A;  4K35 A;  3FB5 C;  5EIB D;  5IWA B;  1KD1 W;  3TET A;  1KU9 A;  3K0G A;  4Q6G A;  5BMV A;  4UUJ C;  3TXS A;  5LL6 Y;  2D2C B;  2GV9 A;  3G67 A;  4Z2W A;  4X65 B;  2Q9L A;  1ROP A;  1M5I A;  2QDO A;  4D7S A;  5LHH A;  4X20 B;  2CTR A;  4RAI A;  2DWE C;  5EYP B;  4FLZ A;  3CCV V;  2UUA B;  3AG2 C;  2EIL B;  4TV9 A;  2DWD C;  3I56 V;  1GK9 A;  3UM7 A;  4DXW A;  1ZLZ A;  2VQE O;  1NTZ H;  4XDK A;  2QGN A;  2ITC C;  1OCR B;  3QTC A;  2Q7E A;  4FMT A;  2UU9 O;  2EIM B;  3LDD A;  1S77 D;  2RMK B;  3BA9 A;  3CXH F;  5B1N A;  2ZQM A;  1NR1 A;  3HR0 A;  4R7C A;  4CZZ A;  1H2S B;  1K3E A;  2CAZ C;  4FK5 C;  3CRC A;  3BAA A;  3JD3 A;  3UQ8 A;  1K5Q A;  2WA4 A;  2Y48 A;  3CJH B;  4TQD A;  5KHG A;  1BHA A;  3N2K B;  1B6Q A;  4DW1 A;  3AG1 C;  1GN2 A;  2IH3 C;  2YC0 A;  2F4V O;  2ILM A;  3ETQ A;  3U11 A;  1Y67 A;  1CXZ B;  3CP1 A;  4PA6 A;  3D8C A;  5FNV A;  5DN6 G;  4I9Q A;  3SYP A;  3IC9 A;  1HNW O;  4QJF B;  2OWO A;  1KKD A;  2AHY A;  4LF8 O;  5FLX N;  1FFX B;  4AHC A;  4IIJ A;  4MVR A;  3T4Z A;  5AG2 A;  2B9Z A;  2DYR C;  5DM6 V;  3A0R A;  5KMG A;  1OCZ C;  1LUV A;  2O57 A;  3KKY A;  4MTO A;  3VQY A;  2ZM6 B;  2EIJ B;  2XT9 A;  2AHZ A;  4LF6 O;  3VQX A;  2VWJ A;  4UXN A;  2QEX V;  1X4T A;  2DYR B;  5GTH Z;  5CB4 A;  4UCU A;  3SPI A;  5BR8 B;  4PDL A;  3EXA A;  5JH7 B;  3E83 A;  2P67 A;  2Y4T A;  4H33 A;  2GTA A;  3BEH A;  1Y4M A;  1AJP A;  5LXT B;  4H37 A;  1ZUQ A;  4U3F H;  2RJZ A;  1QBZ A;  3CD6 V;  5DEC A;  2BCC H;  4ZOL B;  1TVK B;  1YJW V;  3TGU H;  4EB6 B;  2UXB B;  3LDC A;  3GVM A;  1WP8 A;  1K92 A;  4O4H A;  5CMU A;  1S5H C;  3QVN A;  3K9A A;  1Y76 A;  4JI6 B;  3ZMZ A;  5BXZ A;  1TUB A;  3WG7 C;  4JI4 O;  4EKW A;  4DK1 A;  2YID A;  2F95 B;  4A5U B;  4L8J A;  1GH6 A;  4UVC A;  3OTO B;  4LF5 O;  3ABK B;  3K5N A;  3ZMT A;  1NS1 A;  4JTD B;  4MT8 A;  1S0V A;  2FL4 A;  1JA8 A;  1HNX O;  1MNG A;  1XL4 A;  2C2A A;  3WG7 B;  4DV1 B;  4X88 A;  1SER A;  4JAA A;  1DTO A;  1M4U A;  3WB0 A;  1IBK B;  1VQ4 V;  1G6U A;  1UPG A;  2QA4 V;  2JGU A;  3CEI A;  4DR4 O;  4CH6 A;  5IYC O;  4IHJ A;  1M57 C;  3RN4 A;  2ZXW B;  1FKA O;  4MS2 A;  3L74 H;  4N23 A;  4QE9 A;  1YCI A;  1Q8I A;  4I9W A;  4FM1 A;  1K9M W;  1Q82 W;  3K5L A;  1NKD A;  5LMU B;  2Y0P A;  3BCC H;  4O4J A;  2JRI A;  2R9I A;  1QU7 A;  1NH2 D;  3MAQ A;  3C3S A;  1ZSP A;  3L72 H;  3NR7 A;  3J80 N;  2WLJ A;  5B1O A;  2Q5Z A;  1UJW B;  4GT1 A;  5HFM A;  5C93 A;  1N32 B;  1XOU A;  2FYU H;  3SYO A;  1J95 A;  1OJH A;  3E8B A;  4DUZ B;  1XL6 A;  4I7Z B;  2L35 A;  4RUE A;  3P3P A;  2H3O A;  2NN4 A;  1HWY A;  5CA1 A;  1OCO C;  4PDR A;  2BTO A;  2E76 B;  3SPH A;  1MZE A;  5IYZ B;  2YUA A;  2P7T C;  1ZAU A;  1YI2 V;  2GTS A;  3AG4 C;  4DR2 O;  1V55 C;  4TSF G;  1J5E B;  4JYY A;  3AK1 A;  2F93 B;  2PF4 E;  4MVU A;  1OCO B;  4JGS A;  3IJ4 A;  1HDJ A;  4DW0 A;  3RT3 C;  2R72 A;  3ZN0 A;  4MSW C;  4LFB B;  1TUE B;  2EIK C;  1QR9 A;  2W0X A;  4LF8 B;  3JD1 A;  1E1Q G;  2VWK A;  3KG2 A;  2HHH B;  4LCU C;  3ZHU A;  5CA0 B;  3OEH G;  2EIM C;  1XRE A;  3EFF K;  2LFS A;  1KB9 F;  2QKC A;  1Q6I A;  2BTQ B;  5CA3 A;  1WAZ A;  2KKW A;  5IY5 C;  2WLK A;  2GDS A;  1N36 O;  4DR1 O;  4JI1 B;  4AQY O;  3G6B A;  2BE3 A;  2Q8V A;  4NXM B;  4O4I B;  1XMO B;  3FB6 C;  4DV7 O;  4LF9 B;  1SQP H;  2PY5 A;  2Q68 A;  5J2T A;  1WB8 A;  1R6T A;  1GO3 F;  3SJB C;  5IY5 B;  3JAT B;  2XOK G;  1QLE B;  3H1H H;  2ATK C;  1IXB A;  4JI5 O;  4N21 A;  1FS0 G;  1D5A A;  4DO2 A;  4MVS A;  1QLN A;  4NXN B;  4QPK A;  2VQF B;  1VF5 B;  4IYI A;  2X6A A;  2MW2 B;  1VQO V;  3RYI A;  2XUM A;  4AI8 A;  1JPX A;  3TXQ A;  2Z0A A;  1JFF B;  2F43 G;  2Q4P A;  4LF5 B;  3CMA V;  5A2Q N;  2PUS A;  2Z3Y A;  2X6B A;  2ODM A;  3ABK C;  3FFQ A;  3K9S A;  3CRQ A;  1LNQ A;  1CEZ A;  4KP4 A;  1NVP D;  3D36 C;  2GHY A;  2Y69 B;  4K3A A;  1KUQ A;  3CXC U;  5E1A C;  1YJ9 V;  5JQG A;  3ABL B;  3BFR A;  5H5N A;  1XIL A;  3BPZ A;  3ZCC A;  1IBM B;  1SF9 A;  4JI7 B;  2P06 A;  1XNQ B;  2ZT9 B;  2ZE7 A;  2JS3 A;  1QNM A;  4JI5 B;  2W6J G;  2X6C A;  1BE3 H;  4DYL A;  2GBO A;  3N27 A;  3K58 A;  2Y69 C;  1PV0 A;  4HZ3 A;  3ZRV A;  1NBM G;  1XQ8 A;  5CBG A;  1PL0 A;  4J7K A;  1K7D A;  4GLX A;  3IGA C;  2CTQ A;  3JAL B;  1VQ5 V;  1IBK O;  3E8G A;  1L0N H;  1YSC A;  4O2A A;  1Z5V A;  2X7R B;  3CC7 V;  2CTP A;  2HP8 A;  3Q4H B;  4CC6 A;  3WFV A;  4LF4 O;  4FM0 A;  1BQ0 A;  3ZJZ A;  4RWU A;  2DYS B;  1AR4 A;  3L71 H;  2EJR A;  3CCE V;  3ABU A;  4JI8 B;  1ORQ C;  1RM1 C;  1MSW D;  2F4V B;  5LMU O;  4JAV A;  3E8F A;  3OR6 C;  1HNZ B;  2IJJ A;  4ZHQ A;  1BHB A;  1EM1 A;  4TV8 A;  2H94 A;  2OIE A;  3QNE A;  3HKC A;  2XAS A;  4D6T H;  3L73 H;  1FAF A;  5JQG B;  5BR8 O;  2X0L A;  1RM1 B;  5LMN B;  1N33 B;  5IT9 N;  3OUF A;  2DMX A;  2UXC B;  1WA8 B;  1NTM H;  1DK1 A;  4OPH A;  2CE4 A;  3E22 B;  3GWK C;  2DW4 A;  2CTW A;  4IT5 A;  2JJ2 G;  1W59 A;  4MW8 A;  2R9R B;  1R73 A;  1AB3 A;  3UCS C;  3RWR D;  3MHS C;  4JI8 O;  4HNA A;  5H2F Z;  2ZNI A;  3C3T A;  2YEV A;  5IYB O;  4DV3 O;  4WFE A;  2FB5 A;  4BWA A;  3E89 A;  2JDI G;  4X1K B;  2WLL B;  4E2L A;  4D7T A;  2QTS A;  1WPB A;  4I55 B;  3FAV B;  5CBF A;  5EZY A;  1YDX A;  2RCV A;  4LNU B;  2EUL A;  2HVJ C;  2WLI B;  3L9D A;  5D5Q A;  5D5P A;  5EBL C;  3ZRS A;  4ZI7 B;  1MZF A;  4LH6 A;  2QE7 G;  1O9H A;  3T1Y O;  4R8C A;  3DSQ A;  2OIG A;  3ASN B;  4TOI A;  4BIO A;  2Y4U A;  4KFM A;  3H1J H;  3RYC B;  2IJI A;  4NXM O;  1FPO A;  1QQC A;  1AI4 A;  2EJ7 A;  2W0F C;  1JX9 A;  2UXB O;  2QM7 A;  1KMI Z;  3LNN A;  4UCV A;  1I08 A;  3BRC A;  1SES A;  2QJ1 A;  4B3T B;  1BSM A;  3UT5 A;  1SQV H;  2HJF C;  1GM7 A;  1KYO F;  1SA0 B;  5FL7 G;  4JPR A;  3VOU A;  4DR1 B;  1GAX A;  5B1A C;  4GKK O;  1P7B A;  4NVP A;  3ASO C;  3ZBH A;  5EBW C;  4DV1 O;  1IUR A;  3D3Q A;  1YIT V;  1OCZ B;  5C8Y A;  1QVF U;  5FPR A;  1QLE C;  2HKO A;  1S5J A;  4ICG A;  4O4L B;  4FM2 A;  1N32 O;  4JF3 A;  5ITZ B;  3APQ A;  1AP6 A;  3JCU Z;  4GKJ B;  3ZRX A;  4KXR A;  2YIB D;  3GWO A;  1T5E A;  3G4S V;  2VRZ A;  4B08 A;  2ITD C;  4K8X A;  4J9Y B;  2P6J A;  4RQF A;  3ZX6 A;  5L3E A;  3JAS B;  1H38 A;  4U3J B;  2WAM A;  3OAA G;  4YXW G;  3CME V;  4K8Z A;  1PNK A;  5CA0 A;  2DE0 X;  2G38 A;  4LF7 O;  2FKX A;  1HW7 A;  3JAS A;  2QWR B;  2EIJ C;  4QGP A;  1FFT B;  2GSM B;  4YIP A;  2F23 A;  1MOF A;  5CBH A;  3ABL C;  4I4T A;  4X66 O;  3HKB A;  3ZHV A;  2ARH A;  1B3Q A;  1RPO A;  4RUF A;  1M93 A;  2A9H A;  2YS8 A;  3SJQ C;  5EK0 A;  5KAF Z;  4OX9 O;  3H1K H;  4DV2 O;  3MD0 A;  3OEE G;  1R3J C;  1BMF G;  2WLN A;  4DV6 B;  2UXN A;  4O4J B;  4Z1V A;  2R9A A;  1EN6 A;  1R3I C;  4LWS B;  2A0L A;  4FFB A;  4JYC A;  4BIZ A;  5LOV A;  5LA6 B;  2QTO A;  1YXB A;  3RVZ A;  5BMV B;  2XAF A;  4MVQ A;  3TK1 A;  2EZP A;  4O2A B;  4YHH B;  1JVM A;  2WWW A;  3DTU B;  4U7N A;  3CCQ V;  2P90 A;  3H1I H;  1Q43 A;  2UUB B;  1MSD A;  1VF6 C;  3CCS V;  4Q20 A;  1JFF A;  1KC8 W;  3B09 A;  1FFX A;  1EZJ A;  3ICX A;  1XHX A;  4LH7 A;  1SS3 A;  2B1G A;  4IL6 Z;  2JJ1 G;  3K79 A;  3FYE B;  2ZDI A;  4UVA A;  3J81 N;  4RO2 A;  1Q7Y W;  4YJ2 B;  3X2Q B;  1ZTE A;  4XDL A;  4TV9 B;  4LFB O;  1SC5 B;  3ZHR A;  1F4N A;  4EEQ A;  2QKA A;  4MVZ A;  1XMO O;  1LUW A;  3L75 H;  4IYH A;  3UKM A;  3M8A A;  1XNR O;  1EBO A;  1F51 A;  3ETE A;  2EZO A;  4UCO A;  3W7W A;  2YXH A;  2NR5 A;  4PV1 B;  5LXT A;  4DRX B;  2QKS A;  2AW9 A;  4HBN A;  4LFA O;  4DR5 B;  1VAR A;  1J5E O;  4GCZ A;  1AR1 B;  1SQX H;  2E5L B;  3RW0 A;  1QCE A;  1MA1 A;  5E79 Z;  1PM9 A;  1R6N A;  2EX3 A;  1Q81 W;  1H8E G;  4RQE A;  5H6Q A;  1WNS A;  2OCC B;  4CH3 A;  3CCR V;  1Q5O A;  1ZL8 A;  1VQK V;  2YDE A;  5LHG A;  5K1X A;  3R65 A;  1IVS A;  4DR2 B;  3LSS A;  1Z2G A;  2LGW A;  1V9P A;  4CS3 A;  1V55 B;  4W4L A;  1SKV A;  4J9Z B;  4ZI7 A;  2WLL A;  5B1B B;  1JJ2 U;  1S5L Z;  2Q69 A;  1XI1 A;  5IE9 A;  1NTK H;  2KG7 A;  2PYL A;  4MTF A;  3QO8 A;  4LFA B;  4TWK A;  5LGU A;  2Q67 A;  2DJV A;  1R6K A;  1PPJ H;  1BGY H;  3ETG A;  2CGO A;  1JJO A;  3F7Y C;  4LFC B;  5LGN A;  1WLE A;  3RYF B;  1JQ0 A;  1KKC A;  4WFB V;  3L70 H;  5LP6 B;  4JI3 O;  5BY1 A;  3RYC A;  4JI7 O;  3OM3 B;  2LO1 A;  3RYF A;  1V54 C;  4YJ3 A;  3CC4 V;  1SA0 A;  5LMN O;  3JAR A;  1K33 A;  4R50 A;  1IDS A;  1NQT A;  4DR3 B;  3JAR B;  1B06 A;  2A3Q A;  3K03 A;  1BCC H;  3OTO O;  4LNU A;  3H01 A;  5CA1 B;  4FVM A;  5H9C A;  1XUQ A;  3JAL A;  4PI0 A;  1RSO A;  1DLB A;  4GYC B;  2PI4 A;  3JSN A;  4E4E A;  4WFH A;  1NVP B;  1XHZ A;  5B5E Z;  4LFC O;  1RSO B;  5JJN B;  3SYA A;  2UXC O;  4X9Q A;  1SET A;  2F66 C;  4YHH O;  3CCL V;  5KLV H;  2EIN B;  1H2N A;  4BIU A;  4WFA V;  5IYZ A;  1R1B A;  3T1C A;  1AI6 A;  3LUT B;  3OW2 U;  2HG5 C;  1ZX3 A;  2QWP B;  2GUZ B;  1TA8 A;  2YXY A;  2CDY A;  2ADP A;  4X1Y B;  1WA8 A;  4CBC A;  2PTM A;  3FYI B;  3IC7 A;  3UO3 A;  4JAS A;  4JV5 B;  4PA7 A;  4DV5 O;  2Z5U A;  4F4L A;  4KL1 A;  3K5O A;  4DV2 B;  4HYO A;  3VQV A;  4X8A A;  1FD9 A;  2AXT Z;  2RNB A;  1N8R W;  5C8Y B;  2VQF O;  2YIB A;  4O2B B;  1N34 B;  3I55 V;  2ZIO A;  2WA3 A;  2ADQ B;  1W2B U;  4FLX A;  4B3M O;  1YHQ V;  4BW9 A;  4X89 A;  1PL4 A;  5EZY B;  1O9G A;  3P30 A;  1YJN V;  5B3S B;  1Y74 A;  2E3C A;  5LGT A;  3CX5 F;  1G1X B;  3AG7 A;  2IBZ H;  3FD9 A;  2KB1 A;  2XAG A;  4LP8 A;  4JYB A;  4JYA O;  3MDS A;  3K04 A;  5J2T B;  3E35 A;  5KHH A;  2IH1 C;  4WBN B;  4FFB B;  2JEX A;  4DV0 O;  4B3R B;  2Q7H A;  2XHB A;  4JI1 O;  4AQY B;  3K59 A;  1RFY A;  5JVD A;  4B3T O;  5IWA O;  2WLI A;  4PA4 A;  4BW5 A;  3SPC A;  2E74 B;  1CP9 A;  2BTQ A;  2PYJ A;  2RN9 A;  3T2M A;  5KX5 A;  2BOB C;  2ZE8 A;  1YVW A;  4GX5 A;  3E2E A;  3QO7 A;  4DV4 B;  1W0K G;  1XNR B;  3SPJ A;  3B77 A;  1K97 A;  3ZRW A;  1S72 V;  2JVD A;  4I0X B;  5L3G A;  3A8T A;  4PJ0 Z;  1JR9 A;  5LA6 A;  1KBH A;  1XEQ A;  1KP2 A;  4FLW A;  3SYQ A;  3M7M X;  2OCC C;  2ZE6 A;  3S3X A;  1Y74 B;  4PD4 F;  3CWB H;  1KQS U;  1FJG O;  2XAQ A;  1VQ7 V;  1SQF A;  2BSK A;  4G27 B;  1IXM A;  1U97 A;  5J2U B;  5L3B A;  2A79 B;  1AP5 A;  4EFB A;  1SZT A;  5JCO A;  2AZ2 A;  3W7T A;  1IBL O;  4MTG A;  5A9G A;  4AIL C;  2ZXW C;  4L87 A;  4DV4 O;  1COW G;  4DR7 B;  3BHP A;  4GKK B;  4FJC C;  4TV8 B;  3JSL A;  2OYQ A;  1HNW B;  3OD4 A;  5B1A B;  4BAY A;  1FXK A;  4PDV A;  3K3W A;  3SGI A;  3ABT A;  1JOY A;  3H9V A;  2HVK C;  2ZR3 A;  3D3I A;  1Y6X A;  4MW3 A;  3HPL C;  2WLM A;  3KCY A;  5KUM A;  2QWQ B;  5JWP A;  1GN6 A;  2N74 A;  3QG5 A;  2QM4 A;  2KG7 B;  1R3K C;  4J10 A;  3CCM V;  3B8M A;  1EZV H;  4TQF A;  3HKC B;  2KQX A;  1SZX A;  2N05 A;  3N2K A;  1PNL A;  1ARO P;  4DV6 O;  4JI2 O;  1UFI A;  2QWO B;  5LOV B;  4GX0 A;  4JI0 B;  1VQ8 V;  2DQ3 A;  1IBM O;  3JD2 A;  4FLT A;  5LP6 A;  4EFE A;  3CPW U;  1ENV A;  2YIC A;  4U7O A;  4QE7 A;  4R6Z A;  1BS3 A;  4I55 A;  1AR5 A;  1PD3 A;  1G4Y B;  1PKX A;  4JI6 O;  5LBQ A;  4DR6 O;  3EVK A;  4B3S O;  1M90 W;  1W0J G;  5GON A;  2W6I G;  4J7J A;  3BA8 A;  4JTA B;  3ZHQ A;  2JIZ G;  4LF7 B;  1OCC C;  4U3J A;  2LFR A;  3A2F A;  3SR2 C;  1Y66 A;  3JAT A;  1N0J A;  1WB7 A;  4JYA B;  3AK2 A;  1S76 D;  4GKJ O;  3OMA B;  1SQQ H;  3T4D A;  2ETN A;  4Z1M G;  3HKB B;  3D36 A;  4I50 B;  3K0D A;  1VMG A;  2D3O W;  3SDL A;  2CK3 G;  1LR1 A;  4TUY A;  3OR7 C;  4LC1 A;  3ABM C;  3OFN G;  3IFX A;  3NXS A;  4FFK A;  4FLU A;  1NU1 H;  4JV5 O;  1NI8 A;  1Y76 B;  5GW7 A;  3W7X A;  5J9P C;  4GZR B;  4F6E A;  2LW1 A;  1JCH A;  3G80 A;  1WJZ A;  3R66 A;  2UU9 B;  3JD4 A;  2IM9 A;  1WPX A;  3OTF A;  4MTX A;  3ZS8 C;  2Q0A A;  4DV3 B;  2UXX A;  3CYO A;  3FAV A;  3UT5 B;  3LSU A;  2YI9 A;  4JI3 B;  2LW7 A;  4PI2 A;  3ZMS A;  2UUB O;  3SJC C;  4X1I A;  2YI8 A;  4IGG A;  1D2D A;  4X64 O;  3JYC A;  1H8H G;  2KSD A;  2QR4 A;  3HKE B;  1FXH A;  1ZWI C;  1DF5 A;  2K9P A;  4UCT A;  3ETD A;  2PGG A;  4UFZ A;  3BAB A;  4DUY O;  1FXK C;  1GTO A;  1XMQ B;  3U10 A;  2M6Y A;  3LNM B;  2K1E A;  4FPP A;  1GM8 A;  2DN9 A;  1F7Y A;  5JVD B;  2HLD G;  1EN5 A;  3FKS G;  1SQB H;  3T1H O;  5JCO C;  4FZ1 A;  1K4C C;  3FB8 C;  2OT5 A;  2XTA A;  5EC1 C;  1I7F A;  1XDC A;  3OGC C;  1B04 A;  2P4V A;  1AJN A;  4JTC B;  2HR3 A;  3ML0 A;  4P9O A;  1NR7 A;  4ZKI A;  1FJG B;  1GMG A;  3APO A;  4TUY B;  4NTW A;  3AG3 C;  2Q6A A;  2LQT A;  3B40 A;  1NT2 B;  1Q86 W;  2JS5 A;  5ITZ A;  2CUG A;  3OE7 G;  2A06 H;  2PI5 A;  1VQ9 V;  3CRA A;  2IU3 A;  1BZK A;  3JCZ A;  1YTF D;  2YEV B;  1MAB G;  4GX2 A;  2JGD A;  3AG3 B;  4ZIB A;  4X65 O;  1CPY A;  1HP8 A;  2Q0O C;  2ZR2 A;  4LF9 O;  2DQ0 A;  3W7U A;  4PA9 A;  3CSX A;  1GKF A;  3LSQ A;  1VP7 A;  3AEI A;  5FNV B;  3EHB B;  4NYK A;  3HKE A;  1DGS A;  4ZHQ B;  3P32 A;  5KUK A;  3O9O A;  2XAJ A;  4LR3 A;  5B1B C;  2QWN B;  2ZCE A;  1H2G A;  1IBL B;  2HJD A;  4UV8 A;  3JD0 A;  1OHH G;  5K1P A;  2JEU A;  2IU0 A;  1N33 O;  4X20 A;  4WCE V;  2M7W A;  1VQN V;  3SPG A;  4B3R O;  4OX9 B;  1PNM A;  4UB6 Z;  2F1M A;  3WB1 A;  4NKG B;  1G8M A;  4QIW F;  2VS0 A;  4DR4 B;  2GUZ A;  1BT8 A;  4YJ2 A;  4FZ0 A;  1YF2 A;  5LP6 C;  3OMI B;  4CS4 A;  5IJ0 B;  2XND G;  5KHI A;  2P5O A;  5CB4 B;  1YIJ V;  1H2M A;  2H8P C;  1K73 W;  1QHT A;  2UUC B;  3CS5 A;  2CGN A;  4OPA A;  4DRX A;  2UUA O;  3VBB A;  4X62 O;  3PN1 A;  1VEW A;  1FYJ A;  4CH5 A;  4NR1 A;  4WBN A;  3AG1 B;  1N4C A;  1Q3E A;  3OMN B;  3ZHS A;  4UB8 Z;  3B2E E;  2NNU A;  2R70 A;  3ASN C;  1L0L H;  1L8D A;  4UCS A;  4ABM A;  3DXR A;  4BR6 A;  1D5N A;  3FB7 C;  1GN4 A;  1H2L A;  4P30 A;  4K0K O;  4PEL A;  1KP3 A;  2IJH A;  4FLV A;  5BZB A;  1THZ A;  2JK5 C;  3ZMV A;  4UV9 A;  2WLH A;  3J7A U;  1Q90 D;  2OTL V;  1GM9 A;  2E75 B;  1NH2 B;  1HNX B;  4NTX A;  3DGE A;  4QNH B;  1I94 O;  1AIL A;  4F6R A;  1N34 O;  1VIB A;  2IW5 A;  3ZN1 A;  5LYJ A;  3JAW B;  1VF7 A;  2RDC A;  4O2B A;  4YY3 B;  2ZE5 A;  2LJ2 A;  4H0L B;  4TT3 G;  1VQM V;  5IJ0 A;  2B1I A;  2ZIM A;  1M57 B;  4EB6 A;  4DV5 B;  1HR0 B;  3TJT A;  3B4S A;  4YJ3 B;  3K08 A;  1SRY A;  5HFL A;  4DR5 O;  3A0B Z;  4MVO A;  4WFG A;  3IAY A;  1R3L C;  3VQW A;  2PZS A;  4JI0 O;  3THO A;  2EBO A;  5JJJ B;  4CC5 A;  1P84 F;  2HFE C;  1WP7 A;  1RPR A;  1GN3 A;  1AI5 A;  1GRJ A;  4NTY A;  4QPJ A;  4NXN O;  1BQZ A;  2OCH A;  4FIP C;  5B66 Z;  4DR3 O;  1BL8 A;  5KX5 B;  4HAM A;  3HKD B;  4YY3 O;  1I5X A;  1AI7 A;  5L3D A;  4JZ2 A;  4PDM A;  2ZM6 O;  4IHJ B;  1DF4 A;  1M56 B;  1K8A W;  2UXD O;  4KHP O;  2AGA A;  4H44 B;  4UCR A;  1US6 A;  3OGI B;  2AZ0 A;  3GB7 C;  5TIS Z;  4LBE C;  3RVY A;  1U96 A;  1XBL A;  3F7V C;  3QO5 A;  3P3N A;  3N2G B;  3RGB A;  1KEC A;  2WPD G;  3LDE A;  2DOS A;  5EIB C;  4YIO A;  5KHK A;  1VQP V;  1P7G A;  2P22 C;  2LGQ A;  1M9N A;  3E8H A;  4JI4 B;  3TCU A;  3B8N A;  1Q6U A;  2N04 A;  1ZL8 B;  3SYC A;  5GON B;  3ASO B;  1YTF B;  2ZKO A;  2FML A;  1FXV A;  1OZ0 A;  3RYI B;  1N0N A;  5IJ9 A;  5CN0 A;  4B3S B;  2FTK A;  2UXD B;  2ZDI C;  3STZ C;  3F5T A;  4X64 B;  2JGD B;  2V4D A;  4LF6 B; 
#chains in the Genus database with same CATH homology
 4N23 A;  3HB3 B;  2WLN A;  4QE9 A;  2UXN A;  3AG4 B;  1PD3 A;  1G4Y B;  1PKX A;  5LBQ A;  3STL C;  4G28 B;  4I9W A;  1K9M W;  1Q82 W;  1NKD A;  1M90 W;  1R3I C;  1W0J G;  2A0L A;  2W6I G;  3ZMU A;  4JYC A;  4BIZ A;  2ZD9 A;  4JTA B;  4KUM A;  3RVZ A;  2QTO A;  2JIZ G;  2R9I A;  5IDJ A;  1I5Y A;  3AG2 B;  1NJI W;  2XAF A;  2EIL C;  1NH2 D;  1OCC C;  2EIK B;  4MVQ A;  2EZP A;  4JAU A;  3TK1 A;  1JVM A;  2WWW A;  3DTU B;  2LFR A;  2WLJ A;  5B1O A;  4U7N A;  3CCQ V;  2P90 A;  1Y66 A;  4GT1 A;  1UJW B;  5HFM A;  4WF9 V;  5C93 A;  3ZRW B;  3CCS V;  4Q20 A;  3G6E V;  1S76 D;  1MG1 A;  3OMA B;  1KC8 W;  3T4D A;  3SYO A;  1J95 A;  1QVG U;  4Z1M G;  3E8B A;  3D36 A;  1XL6 A;  1EZJ A;  3K0D A;  4RUE A;  2B5U A;  2D3O W;  1F4M A;  2CK3 G;  2B1G A;  3OR7 C;  4LC1 A;  2JJ1 G;  3K79 A;  3FYE B;  1HWY A;  3ABM C;  2ZDI A;  1OCO C;  3OFN G;  4PDR A;  4UVA A;  4RO2 A;  3IFX A;  3NXS A;  5GW7 A;  3W7X A;  1Q7Y W;  3SPH A;  3X2Q B;  5J9P C;  4XDL A;  2P7T C;  1JCH A;  1YI2 V;  2NLJ C;  3M99 B;  1F23 A;  1F4N A;  3AG4 C;  3JD4 A;  5KA5 A;  4MVZ A;  1WPX A;  1V55 C;  4MTX A;  2OTJ V;  3MHH C;  4TSF G;  3UKM A;  2UXX A;  1EFR G;  3CYO A;  3ABM B;  1EBO A;  1QR8 A;  1OCO B;  1F51 A;  3ETE A;  4I5S A;  2EZO A;  4JGS A;  4MVU A;  3W7W A;  1K5S A;  3ZN0 A;  4MSW C;  1TUE B;  3ZMS A;  2QKS A;  2EIK C;  4GX1 A;  1QR9 A;  3JD1 A;  1E1Q G;  3JYC A;  1H8H G;  1OCR C;  3KG2 A;  4LCU C;  1FXH A;  1ZWI C;  1DF5 A;  4GCZ A;  1AR1 B;  3OEH G;  2EIM C;  3ETD A;  2IJK A;  2XAH A;  3RW0 A;  1QCE A;  2V7Q G;  5L3C A;  5EBM C;  3EFF K;  1R6N A;  2LFS A;  3W7S A;  1FXK C;  1AJQ A;  1H8E G;  1Q81 W;  1GTO A;  2WSS G;  4RQE A;  5H6Q A;  5CA3 A;  4XBF A;  2OCC B;  3LNM B;  3CCR V;  2K1E A;  4FPP A;  5IY5 C;  2WLK A;  1VQK V;  1GM8 A;  2EIN C;  5LHG A;  1P4R A;  1V54 B;  2HLD G;  3FKS G;  3R65 A;  3G71 V;  1L1F A;  2YSU B;  1S3J A;  3X2Q C;  3LSS A;  3FB6 C;  3CCJ V;  1K4C C;  3ZIA G;  1E79 G;  3FB8 C;  2OT5 A;  1K34 A;  2Q68 A;  1VQL V;  1V55 B;  5EC1 C;  1GO3 F;  5IY5 B;  3OGC C;  4J9Z B;  1AJN A;  2WLL A;  2XOK G;  4JTC B;  2HR3 A;  5B1B B;  1QLE B;  1JJ2 U;  2ATK C;  2Q69 A;  3ML0 A;  1OCC B;  4P9O A;  4N21 A;  1FS0 G;  1NR7 A;  4DO2 A;  3PJS K;  4MVS A;  4MTF A;  3QO8 A;  1QLN A;  2QM8 A;  4TWK A;  4ZKI A;  3OUS A;  5LGU A;  2Q67 A;  1GMG A;  4QPK A;  1M1K W;  1R6K A;  4UVB A;  3ETG A;  2X6A A;  3AG3 C;  3F5W C;  2Q6A A;  4P9P A;  1VQO V;  5KA6 A;  3F7Y C;  5LHI A;  5LGN A;  1JPX A;  1WLE A;  1Q86 W;  2F43 G;  1JQ0 A;  1FXK B;  4WFB V;  4P2Z A;  3CMA V;  3OE7 G;  2Z3Y A;  2X6B A;  3ABK C;  2PI5 A;  3OM3 B;  1VQ9 V;  2IU3 A;  1LNQ A;  1CEZ A;  3JCZ A;  1V54 C;  4KP4 A;  1YTF D;  2YEV B;  1MAB G;  4GX2 A;  1NVP D;  3RBZ A;  3CC4 V;  2GHY A;  3AG3 B;  2Y69 B;  1CPY A;  2ZR2 A;  3CXC U;  5E1A C;  1YJ9 V;  3ABL B;  1K33 A;  2DQ0 A;  4PA3 A;  3W7U A;  4R50 A;  4OXS A;  4PA9 A;  5L3F A;  3ZCC A;  5IYD O;  1GKF A;  3LSQ A;  1E1R G;  1K4D C;  3AEI A;  1NQT A;  3EHB B;  1M56 C;  3K03 A;  3E86 A;  3P32 A;  5KUK A;  4G2K A;  2XAJ A;  2W6J G;  2MK3 A;  2X6C A;  3H01 A;  4XDJ A;  5B1B C;  1H2G A;  5H9C A;  2Y69 C;  2V1D A;  4HZ3 A;  4UV8 A;  2DYS C;  3JD0 A;  3ZRV A;  1DLB A;  1OHH G;  2PI4 A;  1NBM G;  5CBG A;  2JEU A;  2IU0 A;  1PL0 A;  5EC2 C;  4WCE V;  2M7W A;  1VQN V;  4WFH A;  3SPG A;  1NVP B;  1K7D A;  3IGA C;  1VQ5 V;  1PNM A;  4MVM A;  3SYA A;  3E8G A;  1YSC A;  1SET A;  1G8M A;  2X7R B;  4QIW F;  3CC7 V;  2LP7 A;  3CCL V;  5B3S C;  3CC2 V;  3K06 A;  2EIN B;  3WFV A;  4BIU A;  4WFA V;  3T1C A;  3ZJZ A;  3OMI B;  1VQ6 V;  2DYS B;  1AI6 A;  3LUT B;  3OW2 U;  2HG5 C;  3BY6 A;  2XND G;  3CCU V;  2EJR A;  3CCE V;  3ABU A;  1YIJ V;  2H8P C;  1K73 W;  1ORQ C;  4CBC A;  1RM1 C;  3FYI B;  1MSW D;  4ASU G;  4WFF A;  3IC7 A;  4JAV A;  4JAS A;  3E8F A;  2BOC C;  3OR6 C;  4PA7 A;  5H6R A;  2IJJ A;  4ZBM A;  1BHB A;  3FB5 C;  2Z5U A;  2H94 A;  4F4L A;  1KD1 W;  3VBB A;  3TET A;  3QNE A;  4HYO A;  3K0G A;  4X8A A;  4UUJ C;  2XAS A;  2X0L A;  1RM1 B;  1N8R W;  1ROP A;  3AG1 B;  3OUF A;  5LHH A;  3I55 V;  3OMN B;  4RAI A;  2DWE C;  3CCV V;  1W2B U;  2NNU A;  1YHQ V;  3AG2 C;  3ASN C;  2EIL B;  2DWD C;  3I56 V;  1GK9 A;  3UM7 A;  4X89 A;  4DXW A;  3P30 A;  1YJN V;  2DW4 A;  5B3S B;  3FB7 C;  2JJ2 G;  5LGT A;  4XDK A;  4MW8 A;  2ITC C;  2R9R B;  4P30 A;  1OCR B;  1R73 A;  4PEL A;  2KB1 A;  2XAG A;  4LP8 A;  4FMT A;  4JYB A;  1KP3 A;  3MHS C;  2IJH A;  2EIM B;  3K04 A;  1THZ A;  2JK5 C;  3ZMV A;  5BZB A;  3E35 A;  3LDD A;  1S77 D;  2IH1 C;  4UV9 A;  2YEV A;  5IYB O;  2JEX A;  2WLH A;  4WFE A;  5B1N A;  2ZQM A;  3E89 A;  2JDI G;  1NR1 A;  2OTL V;  1GM9 A;  2WLL B;  4E2L A;  4R7C A;  4CZZ A;  2WLI A;  4PA4 A;  4BW5 A;  1K3E A;  4FK5 C;  5CBF A;  1NH2 B;  3DGE A;  4QNH B;  3SPC A;  3JD3 A;  1CP9 A;  2HVJ C;  2WLI B;  1K5Q A;  3T2M A;  2IW5 A;  3ZN1 A;  2Y48 A;  2BOB C;  5EBL C;  1BHA A;  3ZRS A;  1B6Q A;  3AG1 C;  2IH3 C;  4TT3 G;  2QE7 G;  1VQM V;  4GX5 A;  3E2E A;  4R8C A;  2B1I A;  3QO7 A;  3CP1 A;  4PA6 A;  1M57 B;  1W0K G;  3ASN B;  5DN6 G;  3SYP A;  3SPJ A;  3B77 A;  4KFM A;  1K97 A;  3ZRW A;  4QJF B;  2IJI A;  3K08 A;  1S72 V;  1AI4 A;  1KKD A;  1SRY A;  2AHY A;  2W0F C;  5HFL A;  5L3G A;  1JX9 A;  4MVO A;  2QM7 A;  4WFG A;  1R3L C;  4MVR A;  3T4Z A;  1KP2 A;  2DYR C;  3SYQ A;  5DM6 V;  3A0R A;  2EBO A;  1SES A;  2OCC C;  2HFE C;  1OCZ C;  1RPR A;  4MTO A;  2HJF C;  1GM7 A;  1AI5 A;  2EIJ B;  2AHZ A;  5FL7 G;  1KQS U;  4QPJ A;  2XAQ A;  4JPR A;  1VQ7 V;  4UXN A;  3VOU A;  2QEX V;  4FIP C;  5B1A C;  1P7B A;  4G27 B;  1IXM A;  2DYR B;  3ASO C;  3SPI A;  1BL8 A;  5EBW C;  4HAM A;  4PDL A;  5L3B A;  2A79 B;  1I5X A;  1AI7 A;  3E83 A;  5L3D A;  2P67 A;  1SZT A;  4PDM A;  4H33 A;  1YIT V;  1OCZ B;  3W7T A;  3BEH A;  4MTG A;  1Y4M A;  1QVF U;  1AJP A;  1QLE C;  2HKO A;  4H37 A;  1DF4 A;  1M56 B;  1K8A W;  2ZXW C;  4L87 A;  1QBZ A;  3CD6 V;  1COW G;  1YJW V;  4FJC C;  5B1A B;  4JF3 A;  1FXK A;  4BAY A;  3LDC A;  1K92 A;  4PDV A;  5CMU A;  3GB7 C;  3K3W A;  1S5H C;  3K9A A;  4LBE C;  3RVY A;  3ABT A;  1JOY A;  3ZRX A;  3ZMZ A;  2HVK C;  2ZR3 A;  3D3I A;  3GWO A;  3WG7 C;  3G4S V;  3F7V C;  3QO5 A;  4MW3 A;  3HPL C;  2ITD C;  2WLM A;  4EKW A;  4J9Y B;  2P6J A;  4RQF A;  1KEC A;  5KUM A;  5L3E A;  1H38 A;  2WAM A;  3OAA G;  4YXW G;  3CME V;  1PNK A;  2WPD G;  4UVC A;  3LDE A;  3ABK B;  1R3K C;  3CCM V;  3ZMT A;  3B8M A;  4JTD B;  1VQP V;  4MT8 A;  1S0V A;  2EIJ C;  1M9N A;  3E8H A;  1FFT B;  2GSM B;  1XL4 A;  2C2A A;  1PNL A;  1MOF A;  3TCU A;  3WG7 B;  4X88 A;  5CBH A;  1SER A;  3ABL C;  1ARO P;  3B8N A;  1DTO A;  3SYC A;  1RPO A;  3ASO B;  4RUF A;  1YTF B;  2A9H A;  3SJQ C;  4GX0 A;  1FXV A;  1OZ0 A;  5EK0 A;  1VQ4 V;  1VQ8 V;  2DQ3 A;  2QA4 V;  3JD2 A;  5CN0 A;  3MD0 A;  2FTK A;  3CPW U;  1ENV A;  5IYC O;  3OEE G;  1M57 C;  2ZDI C;  4QE7 A;  1R3J C;  4R6Z A;  3STZ C;  2ZXW B;  4U7O A;  4MS2 A;  1BMF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...