1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords ROP PROTEIN
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
4DO2A 1GTOA 2IJIA 1F4NA 1F4MA 1RPRA 2IJHA 3K79A 1GMGA 1ROPA 1NKDA 2GHYA 1RPOA 1PD3A 2IJJA 2IJKA 1B6QA
chains in the Genus database with same CATH superfamily
5CA0B 4LF5B 4GLXA 4KHPO 4X20B 3G67A 5EK0A 2VQFB 3PJSK 4DR4B 2EZPA 1EM1A 4TUYA 4QIWF 1IBMB 1SQQH 2OCCC 4ASUG 5LHHA 1AILA 1WJZA 3ETGA 4QNHB 1Y4MA 2BTQB 5CBFA 1YI2V 5LMUO 4GKJO 4O2AB 1WN7A 4L8JA 4DV5B 3ZIAG 2DYRB 3ABTA 5KHIA 1YJNV 3MHSC 2RCVA 4NR1A 3CMEV 1COWG 4TWKA 2RN9A 2KB1A 4P9PA 1LUWA 1R3IC 1JMKC 3U11A 1Y76A 5DECA 5B1BC 1Z5WA 3ZHUA 4U3JB 2CTPA 5AG2A 2P06A 3GVMA 5IYBO 4X8AA 4N23A 3JYCA 3SJBC 3I5DA 2HVKC 2O57A 4DO2A 4C7UA 1VQ7V 1FFTB 1PNMA 4DV0O 3OEHG 1VQ6V 3R66A 3SJCC 4D6TH 4CZZA 5LP6B 3CWBH 2P4VA 3OMIB 3W7XA 1QCEA 4IYIA 3JAWA 1BSMA 2QA4V 3KG2A 2ETNA 3FFQA 3ZRWA 3SPJA 2AZ0A 4L87A 1BL8A 1MZFA 3ZHRA 2ADPA 3A2FA 3N2KA 4LFBO 1TVKA 1VF6C 1M1KW 3KKYA 3SPGA 4I7ZB 3WG7C 4LWSB 2CUGA 4YIPA 3MHHC 4FLVA 3SJQC 1S72V 4KFMA 3U10A 4O2BA 4XDKA 3JARA 5KAIZ 3AEIA 3CC2V 2UXBB 5C93A 5LHIA 3QVNA 1Q90D 2P90A 4E4EA 5L3GA 5FPRA 3P3NA 4B3TO 2ARHA 4UCUA 4YJ3A 4UCTA 2M7WA 3B77A 1GH6A 3RVYA 1W0KG 1N34B 3N2GB 4DUYB 2YXHA 3CC4V 1YVWA 3CE2A 4UFZA 2IH1C 4Z1MG 2Z5UA 2DJVA 2QWPB 3AG3B 3STLC 4QGPA 3CCSV 3B8NA 3ZHQA 4JI6O 5ITZB 1FFXA 3GWKC 3T1YB 1OCCC 1PL4A 2ILMA 3K04A 2Y0IA 1ZLZA 3LSUA 3DTUB 3FYEB 1HNZO 3CEIA 4IYHA 2ZE6A 2HVJC 2GBOA 1M56B 1ENVA 4CS3A 2Y69C 4O4IA 2JS5A 4JI1B 4DK0A 4FIPC 4I9WA 3Q4HB 1PP9H 3R65A 3O9OA 3ZRXA 2KG7B 2DQ0A 1OCRB 4PA4A 3RWRD 2BE3A 3E8HA 2V7QG 4JYYA 4O4HB 4DK1A 4DRXB 1I7FA 2F4VB 4X9QA 4X66B 5IYZA 1XUQA 5EBMC 4DV6O 3A0HZ 3CCEV 1H2MA 4K0KB 4X65B 1SZTA 4WF9V 1Y6XA 1DK1A 5BMVA 1QVGU 4DV1O 3JATB 3L9DA 3RN4A 3G4SV 5L3BA 5H2FZ 3OE7G 5LGTA 4UV9A 3CD6V 2WLIB 1N0JA 3HKDA 1SERA 4X64O 5LGUA 3ASNB 3T4ZA 1S3JA 4B3RB 3BCCH 4YHHO 1ZX3A 2IBZH 4HZ3A 2Z0AA 3E83A 2R9AA 2YS8A 3ASOB 1BT8A 1GN3A 3X2QC 1NVPD 5JH7A 2NNUA 3M8AA 3QNEA 2ZDIC 3PN1A 3CB2A 5FNVB 4JI2O 2UXDB 2OTLV 3OUFA 1K4CC 4DR1O 2XHBA 4FM1A 3CXHF 4IHJB 1GMGA 3ASNC 2PGGA 3JD1A 4DUYO 2EBOA 2HHHB 2ZKOA 4JI6B 4I55B 1L8DA 5DM6V 2RMKB 2XAFA 3OTOB 5LA6B 4DR7B 1R6TA 4FPPA 3AG1C 1J5EB 1F23A 4UB8Z 4PI0A 2Q5ZA 4YJ2A 1XEQA 1I94B 3CRAA 3WB2A 5K1PA 1KKDA 4DV4O 3J80N 1PV0A 2UXNA 4X64B 2GUZB 1JX9A 1R6KA 3O65A 4BW9A 5IJ0A 2YIBA 2ZR3A 4X1YB 3CCUV 1QNMA 3JD2A 3OM3B 3SR2C 1YDXA 4R7CA 3UO3A 1XNQB 3B09A 3F7VC 2Q67A 4MTFA 2UU9B 4DR6B 1V55C 3MDSA 1GKFA 3AK2A 1QBZA 1THZA 2BCCH 3W7UA 5L3FA 2VWKA 2ZR2A 3EFFK 4UCRA 3JALB 4JTAB 3DXRB 2PI5A 3WFVA 3TXQA 1I94O 1N32O 2Q0AA 2XASA 4O4HA 5LOVA 5LHGA 4U3JA 2LFSA 4O4LA 2ZINA 4JPRA 5KAFZ 2EILC 1QLNA 1XHZA 4J11A 1U96A 3CCMV 2DYSC 3JSNA 4FZ1A 5CA0A 1BQ0A 2QTSA 5JVDA 3H9VA 4JI7O 3JATA 1SF9A 2EIKC 1R3KC 1F51A 4JV5B 4OX9B 5A2QN 2DN9A 3BY6A 2BTOA 4H37A 4LH7A 4GX5A 1KP2A 4LFCO 2XAGA 4ZOLA 3UO2A 1XI1A 2F43G 1PM9A 2L6LA 1AJNA 4PI2A 4Q6GA 4ZHQB 1RFYA 3GWOA 1HDJA 2WSSG 3L73H 4HNAB 2PTMA 4NB5A 4FLZA 1F4NA 4QE9A 4B3SO 2QE7G 4NXMB 4YY3O 1N4CA 5EYPA 2Q6AA 3M7MX 3EHBB 2IJJA 1IVSA 3CRQA 4CH5A 3F5WC 1K73W 5KLVH 3AG3C 4YIOA 3OEEG 2IM9A 2AHYA 3RGBA 1Z5VA 1AP5A 4UUJC 4DR2B 1ZL8B 1JA8A 2IW5A 4JF3A 3WU2Z 4DR5B 2YXLA 3L74H 1E79G 4K8ZA 4UVBA 1WPXA 3CCLV 2ZT9B 1XMQO 3RYIA 2F23A 5EZYA 4UCSA 1H2GA 4EB6A 3OFNG 3K3WA 2WLKA 3JAWB 5B5EZ 4DV2O 4FLYA 4JASA 4I9QA 1Y67A 4H0LB 3H1LH 4JYBA 1N33O 1KUQA 4D7SA 1WP8A 4B3RO 4WCEV 5KHJA 4DV1B 1URFA 1EZVH 1ZUQA 3LSSA 2E74B 1B04A 3A0RA 5JCOA 4LF4O 1KECA 1UJWB 2AGAA 5ITZA 5LBQA 1V54C 1FFXB 2HKOA 2CDYA 1S5HC 1VQMV 5J2TA 4JYCA 1XMOO 5KA6A 1S0VA 5EC1C 4H33A 1RP3B 5C8YA 4F6RB 1NBMG 3CRRA 1O9GA 3CYOA 2LW7A 2FKXA 4JAUA 2WA3A 5BR8B 1K5QA 2B5UA 3MAQA 1MSDA 2KKWA 3ZJZA 1X4TA 3EXAA 2QM4A 1HW7A 1MZEA 2DWEC 4EEQA 2OIGA 3RW0A 2ZD9A 4X1IA 1XNRO 4GKKB 4TT3G 1G1XB 2WAMA 1LUVA 4NXNO 4X88A 3CXCU 4DR3O 1JQ0A 4R6ZA 3QF7A 1K3EA 4RUFA 4CC6A 4LF8O 1H2NA 5IYZB 1K33A 3CJHB 1XMQB 3T1YO 4LBEC 1NTZH 2ITDC 1YSCA 1SKVA 3HB3B 2IJKA 1VQ4V 2PY5A 1M90W 4X20A 1Y66A 4NTYA 1AP6A 1SS3A 2K9PA 3BFRA 1GRJA 4OXSA 1FPOA 2PUSA 2ADQB 2P22C 5EYPB 1DTOA 2XNDG 3HKDB 4PA9A 4O4IB 3WB1A 2H3OA 4WFGA 1GM7A 2CAZC 1IBKB 2UXCO 1VARA 2EX3A 1SESA 4TOIA 3I55V 4DV7O 3ZEDA 1YZBA 1FS0G 1JJOA 1AR1B 4LR3A 4BIZA 2W0XA 3CSXA 1RM1B 4DV0B 1OV9A 3HKCB 1XOUA 4I55A 1QLEC 1PNKA 3ZRWB 4CBCA 1XL4A 2GHYA 5KUKA 2CH7B 3ML0A 5LP6A 1L0NH 5H6RA 3ZHVA 5EBLC 1MOFA 2CGOA 2A7WA 1US6A 2QM8A 5KX5B 2HEPA 4J9YB 3FD9A 5D5PA 1FAFA 3F5TA 1NI8A 1L0LH 2HFEC 2EINB 4BAYA 3AG2C 2JIZG 3STZC 4XDJA 4KUMA 3CMAV 2UU9O 1QQCA 4LFAO 5L3EA 2JGDB 4K0KO 2Q7EA 3KZIZ 5L3DA 3UQ8A 1WP7A 5L3CA 3LUTB 4PDMA 1DF4A 4KP4A 2CTWA 1MABG 3C3SA 3IC7A 5B1OA 3JARB 1K5SA 4BIUA 5LA6A 2P67A 2L35A 4I0XB 4W4LA 5B3SC 2FYUH 4R8CA 1TUBB 1W59A 1U97A 2QJ1A 4GX1A 1IBKO 4B3TB 1Y74A 3UM7A 5JQGA 4JI0O 1P84F 4X1KA 1I5XA 1VF5B 1N36B 2W0FC 3SYAA 4H13B 4OX9O 2HG5C 4NYKA 1MNGA 2MK3A 4TSFG 1NH2B 4NTXA 5B3SB 2A9HA 1M9NA 3SYPA 2NLJC 1AB3A 5FL7G 4MVRA 1QR8A 3QO7A 4PV1B 1M57C 5K1XA 4ZHQA 1MSWD 1PL0A 1Q6IA 1S5LZ 2OCHA 4O4LB 1N32B 4HNAA 2YI8A 4MW3A 1HNWO 1KMIZ 1GN6A 1TUEB 4TV8B 1FJGB 4JI4O 4NXMO 4P30A 5LOVB 4DV4B 1Z2GA 1ORQC 4J7ZA 5LGNA 1MA1A 1FYJA 4F4LA 2ZCEA 4EFEA 1CPYA 4J41A 3H1IH 5CBHA 1VQOV 1LNQA 4Z2WA 3HPLC 1JFFA 4X65O 1XILA 1B06A 5LXTB 1XBLA 3QTCA 1CEZA 5H9CA 3JASA 2HJDA 2UUBO 4MVMA 3Q4HA 3OUSA 2QTOA 3K5MA 4FLUA 1V9PA 4JI3B 3D8CA 4JZ2A 3G80A 3DSQA 4DRXA 3K59A 4DYLA 3CCQV 3DC5A 2CK3G 1K34A 3C90A 1EN4A 4IHJA 2Y48A 3K0DA 1AR5A 1ZL8A 4IL6Z 2NR5A 4F6RA 2JGUA 2FL4A 1OHHG 3FKSG 3QG5A 1RPOA 2IU0A 4J7JA 1Q82W 4X62B 4KXRA 4YJ2B 4R50A 1VMGA 3GB7C 2EIMB 1P7BA 2BOBC 3SPHA 3JAMN 2EIJB 4X1IB 5KA5A 1SA0A 3K79A 1BE3H 2NN4A 2YIAA 4MSWC 1P4RA 2Y4UA 2BSKB 1TVKB 4JZGA 1GN2A 4LWSA 4QJFB 3OGIB 1IBMO 1K4DC 2Q9LA 2EIMC 5CA3A 4JI4B 2ATKC 2VWJA 2EIJC 1QLEB 4WFEA 3MD0A 2QWRB 1K92A 3OTFA 1BCCH 4LH6A 3H1JH 2A06H 2YICA 2AXTZ 3J7AU 2LJ2A 1K9MW 5KMGA 2GDSA 5IYDO 3FAVA 2Q8VA 3K57A 1SQBH 1SETA 1SQGA 5B1BB 1R6NA 1BZKA 5IJ0B 2FMLA 2E5LO 1KB9F 1WA8A 2VS0A 5CMUA 4WFAV 2XT9A 4LC1A 1N36O 4DV7B 3W7SA 4W4KA 3OGCC 1SZXA 4GYCB 2XAHA 3E86A 3RYFB 1R73A 2C2AA 3K5OA 3ZCCA 1H2SB 4FFKA 3LDEA 1NT2B 2R9RB 4ZOLB 3ZMTA 1RSOA 3CS5A 4LF6B 2R72A 1PKXA 3ABUA 2IU3A 3JALA 1NR1A 4WBNA 4ABMA 1AI7A 5B1AC 1EZJA 1CP9A 1NTMH 2ZM6O 1SQXH 1KQSU 1O9HA 2JRIA 4F6EA 2IH3C 2QKSA 3CRCA 4FK5C 3E2EA 1YF2A 1YHQV 4AQYO 5BXZA 4YY3B 4FM2A 3HKBB 3K0GA 3WG7B 2XUMA 4OGQB 1GTOA 4DUZO 2HLDG 1M5IA 3JD3A 2V4DA 3LNNA 2OCCB 2ZQMA 3FB8C 1VQLV 2JEXA 1NZ6A 2X6AA 4G2KA 1JOYA 4MT8A 2X0LA 2AHZA 3K58A 5CBGA 1HNXB 2LGWA 1FXKC 4GT1A 4LF4B 3ZN1A 1Q81W 4YHHB 4U7NA 3RYIB 2RNBA 3APQA 1FXHA 5EZYB 1EBOA 4JI1O 3ZMSA 4XDLA 2PYLA 3VOUA 3CRMA 3H01A 5J9PC 2YXYA 3ZBHA 3KCYA 4EKWA 1VQ9V 1T5EA 4WFBV 5DN6G 4P9OA 1KP3A 1TGOA 1NJIW 1HNWB 5JWPA 1SQVH 4MVZA 1D5NA 5IWAO 3C3TA 3L72H 5EBWC 1YITV 1G4YB 2ZNJA 2WLMA 2Y0PA 1PPJH 3CHXA 4JGSA 3L75H 1KYOF 2JEUA 1K97A 1WPBA 5KHGA 3AG1B 3E89A 3E22A 2PZSA 4PJ0Z 5FLXN 5JJJB 2QR4A 2Q68A 3QO8A 1Q8IA 2KSDA 3ZHTA 2BOCC 2V1DA 5EIBC 1KU9A 3BPZA 4B7EA 3ZN0A 4LF8B 3T1CA 1VIBA 3THOA 1R3LC 2WLLA 4X1KB 3AG7A 1M93A 1ZSPA 3ICXA 4KL1A 4ZKIA 3FYIB 1G6UA 4J80A 5J2UA 4PDLA 5CN0A 3K5NA 1JJ2U 4DUZB 5IDJA 1B3QA 2WA4A 3FX7A 4X1YA 2QSAA 5J2TB 1H2KA 4FLTA 2YUAA 3DGEA 4O2AA 3D3IA 3BAAA 1WB7A 1R3JC 3CJHA 4JI8O 2QWNB 5H6QA 3OAAG 2A3QA 4A5UB 5LXTA 2AZ2A 4GZRB 5BR8O 5LYJB 1XDCA 3JASB 3NR7A 3ZS8C 3VQWA 3I56V 3APOA 4I4TA 3HR0A 2LQTA 1YJWV 2DW4A 3RYCA 4X89A 2VQEO 4E2LA 4H44B 1JFFB 1FD9A 2B1IA 4U7OA 4XBFA 1M57B 3ABLC 4UCOA 2HR3A 3ABKB 2EZOA 4BW5A 3T1HO 4MW8A 1WAZA 2YIDA 2ZE8A 1K7DA 1YJ9V 4MVOA 3VQVA 4DR7O 2G38A 1Q5OA 4CC5A 1NH2D 4LCUC 3QO5A 3D3QA 2P5OA 1AI4A 4I50A 2PYJA 4JV5O 3CCVV 5CB4B 3RYHB 1Q3EA 1GK9A 3B2EE 4UB6Z 3OR7C 2UUAO 3K9SA 1AI5A 4AHCA 1SA0B 4B3MB 2OIEA 2UXXA 3JAKA 2P4KA 5LP6C 1R1BA 5LMNB 1PNLA 4RWUA 5BY1A 3P30A 2Z3YA 2ZXWB 3F7YC 3D36C 2JK5C 4FFBA 4LF7B 2F95B 1IURA 1VF6A 1VQNV 4DR3B 3SYQA 1AJPA 1XL6A 5CA1A 3A8TA 5IJ9B 3W7WA 1YTFB 2CGNA 3B4SA 3CC7V 3L70H 2P6JA 2Q73A 1TUBA 3L71H 3AG4C 1NKDA 2JGDA 4ZI7A 2KQXA 3BVOA 4B7KA 2ZXWC 3RT3C 1ZAUA 3T4DA 4IIJB 1OCZC 3FB7C 1XNQO 3UCSC 2F66C 2R9IA 4LF5O 3S3XA 2X7RB 4ZIBA 3CPWU 4CH3A 4LP8A 2RQ6A 4I0XA 1N8RW 1GAXA 1DLBA 3JD4A 1H8EG 3X2QB 2BSKA 1JPXA 5E1AC 4TV9A 3K03A 1BHBA 4FM0A 3BRCA 4PD4F 4O4JA 3DC6A 2OYQA 4RO2A 3TXSA 1QU7A 4TQFA 4EFBA 2EIKB 4JI5O 1QR9A 4PDVA 4UVAA 3M99B 4HAMA 1N33B 1E1RG 4DR2O 1FJGO 3IFXA 1RSOB 4N21A 2BTQA 2HHHO 4RUEA 2RJZA 5C8YB 3SPIA 2PF4E 3ZX6A 3CX5F 1KD1W 1XMOB 4I4TB 3G6BA 2ZIOA 1I0HA 5KMGB 1OCOC 1S77D 4X62O 1Q6UA 1Y74B 3ZHSA 1H2LA 1FXKB 4TUYB 1HR0O 5TISZ 2UXCB 2AW9A 3CCJV 2M6YA 2QWOB 3NXSA 2LW1A 4I5SA 2F4VO 3H1KH 2RDCA 5DEDA 4LF9O 2JDIG 5JJEB 3SGIA 4DW1A 1BHAA 1VEWA 1SRYA 2N05A 1HP8A 1AR4A 3KCXA 5IY5C 4PDRA 4I50B 4QE7A 3TJTA 1WB8A 1JVMA 4OPHA 1FKAO 1I08A 1Q6HA 2GTAA 3ETDA 2R70A 4K8XA 1GO3F 5IT9N 1HNXO 3FB6C 2JS3A 1BS3A 1XHXA 3TCUA 3OMNB 4QPJA 3ZRSA 1N34O 2CTQA 3AK3A 1RM1C 2FB5A 1D2DA 1OJHA 1NQTA 2LP7A 4J7KA 3BA9A 4JAVA 5KHHA 3ZMUA 5CA1B 3U0ZA 4D7TA 4J9ZB 2WWWA 2D2CB 3W7TA 2K1EA 4LNUA 1TAEA 3UT5A 3LNMB 5HFLA 2Y4TA 2ZE5A 1B6QA 1NTKH 1AI6A 1BQZA 4ZI7B 3HKCA 3D36A 4GKKO 2E5LB 3ASOC 4WFFA 2E3CA 3N2GA 3BEHA 1I5YA 1MMMA 1JR9A 2CH7A 4B3MO 3N2KB 1S76D 1EFRG 3EVKA 5B1NA 2E76B 4BIOA 4JI3O 3VBBA 3BABA 1VP7A 1VQ5V 1XREA 2GV9A 3JCUZ 2EJ7A 4DXWA 4BWAA 3LSQA 3HKEB 3ZMVA 4K35A 3SYCA 3IJ4A 4UV8A 3ABKC 1XNRB 1X59A 3G6EV 4NVPA 1L1FA 4JYAO 2YEVA 3FAVB 2ZNIA 4GUNA 4YJ3B 2OT5A 1HR0B 2IJHA 2YSUB 4AQYB 4DR4O 1CXZB 4RQFA 4JTDB 2WLLB 4JI7B 2X6CA 4MTGA 2YI9A 4NKGB 1V55B 2JJ2G 3T2MA 3P32A 4PA6A 2YIBD 1IXBA 1XQ8A 4IT5A 3FB5C 2LO1A 1ZWIC 1IZ3A 4BR6A 1SC5B 2H94A 2N74A 2UUCO 5A9GA 3OR6C 2XAJA 2W6IG 4JI5B 2EILB 1AROP 3TK1A 3T1HB 2P7TC 5IWAB 3K5LA 2DYSB 1UPGA 2JVDA 1M4UA 4J10A 2D3OW 4DW0A 1E1QG 1EN6A 4LF7O 2N04A 2OWOA 2VQEB 4JI2B 2UXDO 3A0BZ 2B9ZA 4TQDA 1YEWA 5KHKA 5FPOA 3IAYA 2WLIA 2E75B 2EJRA 3JSLA 5CB4A 1NS1A 4DR5O 2QWQB 1A32A 1MG1A 5GONA 1WA8B 1KC8W 1G8MA 1IBLB 2Q7HA 2UUAB 5IE9A 1GN4A 2GSMB 1Q43A 3LDDA 1OCZB 4FLWA 5BMVB 4CH6A 3AK1A 3G71V 1IX9A 2GTSA 4DV3B 2XTAA 3RYFA 1DF5A 3HKBA 2HP8A 3UT5B 4FZ0A 2QDOA 4HYOA 1BGYH 1AJQA 3E8BA 1NU1H 4LFBB 1N0NA 5GTIZ 1WNSA 4JI0B 4EB6B 2WLHA 3SYOA 4Z1VA 3WB0A 2DWDC 1Q7YW 1VQKV 1J95A 5GW7A 4WBNB 3ABLB 4DR6O 4LF6O 3ZRVA 4ICGA 2Q7GA 1HNZB 3JAKB 1DGSA 4CH4A 2VQFO 1SQFA 2LGQA 5JH7B 4RQEA 2ZM6B 1OZ0A 2EULA 1W2BU 1OCOB 2ITCC 5IJ9A 3K06A 2H8PC 3VQXA 4DV5O 1Q86W 4OPAA 4FFBB 3SDLA 1NR7A 4J42A 1GM9A 2X6BA 3OTOO 1K8AW 4NXNB 3BA8A 4MVQA 4LF9B 2LFRA 4GX0A 1M56C 3E22B 4PHZA 1LR1A 3SPCA 1PD3A 1OCCB 2UXBO 1IBLO 4MVSA 1V54B 2XAQA 5E79Z 4PA3A 1D5AA 2QKCA 1YIJV 1WLEA 3B8MA 3CCRV 4AI8A 2ZE7A 2B1GA 2EINC 3AG4B 1BMFG 2Q0OC 4TV9B 4MTXA 4CS2A 5IYCO 4IGGA 2JJ1G 3S3WA 1H8HG 4FVMA 4FLXA 5LMUB 4GKJB 2DE0X 4G28B 4MS2A 1W0JG 1HWYA 1KKCA 2ODMA 4Q20A 3JD0A 3ABMC 4QPKA 5GONB 2QEXV 2KG7A 3TETA 3DXRA 4DV3O 5J2UB 5F2VO 2F93B 1VQPV 1NVPB 5LL6Y 4KHPB 5JVDB 4MTOA 2DMXA 3IGAC 1ROPA 5EC2C 5D5QA 4FMTA 5JCOC 2OTJV 1H38A 4CS4A 4HBNA 3RYCB 2QM7A 1F7YA 1F4MA 1YTFD 3ABMB 1KBHA 4JI8B 2CE4A 3P3PA 4X66O 4LNUB 1RPRA 4K3AA 3JCZA 1GM8A 1VF7A 3OW2U 3IC9A 2Q69A 2QGNA 4MVUA 4WFHA 3K9AA 3SJAC 1QHTA 5LYJA 3H1HH 3RYHA 4UXNA 3J81N 4LFAB 2PI4A 3OD4A 4PELA 4B08A 1FXVA 5KX5A 4JAAA 3RVZA 2FTKA 1Y76B 2UUBB 2F1MA 1ZTEA 4DV6B 4PA7A 5GTHZ 4YXWG 4NTWA 2DQ3A 4JTCB 4U3FH 3RBZA 5EIBD 4DV2B 2QKAA 1S5JA 3E35A 3LDCA 5IY5B 1UFIA 4JYAB 5KUMA 3ETEA 5LMNO 2WLNA 4FJCC 2UUCB 2ZDIA 2IJIA 5JJNB 3E8FA 3OT7A 4IIJA 1EN5A 4LFCB 5HFMA 1YCIA 3BHPA 3RFRA 2Y69B 5JQGB 3AG2B 1IDSA 3N27A 3OMAB 3E8GA 1YXBA 3TGUH 2HJFC 2Q4PA 4ZBMA 1IXMA 1OCRC 1AVMA 5BZBA 5H5NA 3ZMZA 5FNVA 1VQ8V 3ETQA 2MW2B 2XOKG 2YEVB 5B66Z 4AILC 3HKEA 4GCZA 2W6JG 3B40A 4O2BB 2DOSA 2YDEA 4UCVA 2CTRA 2ZIMA 4O4JB 4UVCA 1SQPH 1P49A 1P7GA 4B3SB 3CP1A 2YC0A 5B1AB 1TA8A 1QVFU 2WPDG 4TV8A 4P2ZA 1J5EO 3K08A 1FXKA 2GUZA 1JCHA 4RAIA 3UKMA 2WLJA 2DYRC 2A79B 3VQYA 2VRZA 2A0LA 4G27B 4GX2A 4DR1B
chains in the Genus database with same CATH topology
1AI6A 1H2GA 3OFNG 3K3WA 5EK0A 2WLKA 3D36A 3W7SA 3PJSK 3ASOC 2EZPA 4JASA 3OGCC 2XAHA 4QIWF 3E86A 4WFFA 1R73A 2C2AA 3BEHA 1I5YA 4JYBA 3ZCCA 2OCCC 4ASUG 5LHHA 3LDEA 2R9RB 4WCEV 1S76D 3ETGA 3ZMTA 4QNHB 1Y4MA 1EFRG 5CBFA 1YI2V 3LSSA 5B1NA 1PKXA 2DYRB 3ZIAG 3VBBA 3ABTA 3ABUA 2IU3A 3A0RA 1VQ5V 1KECA 1NR1A 3MHSC 1UJWB 1YJNV 3CMEV 5LBQA 1AI7A 1COWG 1V54C 4TWKA 2HKOA 1EZJA 5B1AC 1CP9A 4DXWA 3LSQA 2KB1A 1S5HC 4P9PA 1VQMV 1KQSU 1R3IC 4JYCA 5KA6A 5B1BC 1S0VA 2IH3C 2QKSA 3ZMVA 5EC1C 4FK5C 4H33A 3E2EA 3SYCA 1YHQV 4UV8A 1NBMG 3CYOA 3ABKC 3K0GA 5IYBO 4X8AA 4N23A 3WG7B 4JAUA 3G6EV 3JYCA 1L1FA 1K5QA 2B5UA 2YEVA 2HVKC 3ZJZA 4DO2A 1GTOA 2HLDG 2OT5A 2DWEC 2IJHA 2YSUB 3RW0A 2ZD9A 1VQ7V 3JD3A 1FFTB 1PNMA 4TT3G 2WAMA 3OEHG 4RQFA 2OCCB 1VQ6V 4JTDB 2ZQMA 4X88A 3CXCU 2WLLB 3FB8C 4CZZA 1VQLV 2JEXA 2X6CA 4MTGA 2X6AA 4G2KA 1V55B 2JJ2G 3OMIB 1JQ0A 3P32A 4PA6A 4R6ZA 3T2MA 3W7XA 1JOYA 1QCEA 4MT8A 2X0LA 2AHZA 5CBGA 3FB5C 1K3EA 4RUFA 1K33A 2QA4V 1ZWIC 3KG2A 1FXKC 4GT1A 3ZRWA 2H94A 4LBEC 3SPJA 3OR6C 3ZN1A 2XAJA 1Q81W 2W6IG 2ITDC 4L87A 1BL8A 4U7NA 1YSCA 2EILB 1AROP 3TK1A 1FXHA 2P7TC 1EBOA 3HB3B 2IJKA 3ZMSA 1VQ4V 1M90W 1M1KW 1Y66A 2DYSB 4XDLA 3SPGA 3VOUA 3H01A 5J9PC 2D3OW 3WG7C 1VQ9V 4EKWA 1E1QG 4WFBV 4OXSA 4P9OA 1KP3A 5DN6G 1NJIW 4MVZA 3MHHC 5EBWC 3SJQC 1YITV 1S72V 1G4YB 2WLMA 4KFMA 2WLIA 1DTOA 2EJRA 4JGSA 2XNDG 2JEUA 1K97A 4PA9A 4XDKA 3AG1B 1MG1A 3AEIA 3E89A 3CC2V 5C93A 4WFGA 1GM7A 5LHIA 2P90A 1G8MA 1KC8W 5L3GA 2Q68A 3QO8A 1SESA 2GSMB 3LDDA 3I55V 1OCZB 1FS0G 4LC1A 2BOCC 2V1DA 3G71V 2M7WA 3B77A 3ZN0A 1AR1B 3T1CA 3RVYA 1R3LC 1W0KG 4BIZA 1DF5A 2WLLA 3CC4V 4HYOA 1RM1B 1AJQA 2IH1C 3E8BA 4Z1MG 2Z5UA 4ZKIA 3FYIB 4PDLA 3AG3B 5CN0A 2WLHA 3STLC 3CCSV 3SYOA 1JJ2U 5IDJA 1QLEC 2DWDC 3B8NA 1Q7YW 1PNKA 3ZRWB 1VQKV 4CBCA 1J95A 5GW7A 3ABLB 1XL4A 2GHYA 3ZRVA 5KUKA 3ML0A 1OCCC 5H6RA 3K04A 5EBLC 3DGEA 1MOFA 3D3IA 1R3JC 4RQEA 3DTUB 3FYEB 1OZ0A 5H6QA 3OAAG 2QM8A 1W2BU 4J9YB 1OCOB 2HVJC 2ITCC 1M56B 1ENVA 2HFEC 3K06A 2EINB 2H8PC 2Y69C 4BAYA 3AG2C 2JIZG 1Q86W 3STZC 4XDJA 4FIPC 4I9WA 3I56V 4KUMA 1NR7A 3R65A 3CMAV 3ZRXA 5L3EA 1YJWV 1GM9A 2DQ0A 2X6BA 1OCRB 4PA4A 5L3DA 2DW4A 5L3CA 4X89A 3E8HA 2V7QG 1K8AW 4E2LA 3LUTB 4PDMA 1DF4A 4KP4A 1MABG 4MVQA 3IC7A 5B1OA 2B1IA 5EBMC 4U7OA 1K5SA 4XBFA 1M57B 2LFRA 3ABLC 4BIUA 3CCEV 2P67A 2HR3A 4GX0A 1M56C 3ABKB 2EZOA 4BW5A 5B3SC 4R8CA 3SPCA 4MW8A 1PD3A 1OCCB 1SZTA 4WF9V 4GX1A 4MVSA 1V54B 2XAQA 1K7DA 1QVGU 4PA3A 3G4SV 1YJ9V 4MVOA 3UM7A 5L3BA 1WLEA 1YIJV 1NH2D 4LCUC 3OE7G 3B8MA 3QO5A 3CCRV 5LGTA 1I5XA 4UV9A 3CD6V 2B1GA 2EINC 1AI4A 2W0FC 3AG4B 3SYAA 2WLIB 1BMFG 2HG5C 3CCVV 1SERA 4MTXA 2MK3A 5LGUA 4TSFG 1NH2B 5B3SB 2A9HA 3ASNB 5IYCO 1GK9A 3OR7C 3T4ZA 1M9NA 1S3JA 1AI5A 2JJ1G 3SYPA 2NLJC 1H8HG 2UXXA 5FL7G 4HZ3A 4MVRA 1QR8A 3E83A 3QO7A 3ASOB 4G28B 4MS2A 1W0JG 3X2QC 1PNLA 1M57C 1NVPD 1HWYA 3P30A 2Z3YA 2ZXWB 3F7YC 4Q20A 1MSWD 2NNUA 1PL0A 3QNEA 3JD0A 3ABMC 4QPKA 2JK5C 2QEXV 2ZDIC 4MW3A 3TETA 2OTLV 3OUFA 1K4CC 1TUEB 1VQNV 3SYQA 1AJPA 1XL6A 1VQPV 1NVPB 1GMGA 3ASNC 3JD1A 2EBOA 3W7WA 4MTOA 4P30A 5DM6V 2XAFA 1ORQC 1YTFB 3CC7V 5LGNA 3IGAC 1ROPA 4FPPA 5EC2C 3AG1C 2P6JA 1F23A 4FMTA 2OTJV 4F4LA 3AG4C 1H38A 1CPYA 1NKDA 5CBHA 1VQOV 2QM7A 2ZXWC 1KKDA 3T4DA 1LNQA 1F4MA 1YTFD 1OCZC 3ABMB 3HPLC 2UXNA 3FB7C 1JX9A 1R6KA 2R9IA 2X7RB 1RPRA 3CPWU 2ZR3A 3JCZA 4LP8A 1GM8A 3OW2U 1N8RW 2Q69A 3CCUV 1DLBA 3JD4A 3JD2A 3OM3B 1H8EG 4MVUA 4R7CA 4WFHA 3X2QB 3K9AA 1CEZA 5H9CA 1JPXA 5E1AC 3K03A 1BHBA 3F7VC 4MVMA 2Q67A 4UXNA 4MTFA 2PI4A 3OUSA 2QTOA 4RO2A 2EIKB 1QR9A 1V55C 4PELA 4PDVA 1FXVA 1GKFA 4UVAA 3M99B 1QBZA 1THZA 4HAMA 3RVZA 2FTKA 1E1RG 3IFXA 4N21A 4PA7A 3CCQV 4RUEA 4YXWG 3SPIA 2CK3G 3W7UA 1K34A 5L3FA 1KD1W 2DQ3A 2ZR2A 3EFFK 4JTCB 4JTAB 3RBZA 1OCOC 2PI5A 1S77D 2Y48A 3WFVA 2XASA 3E35A 3LDCA 5IY5B 5LHGA 1FXKB 3K0DA 2LFSA 5KUMA 3ETEA 1OHHG 2WLNA 3FKSG 4JPRA 1RPOA 2IU0A 4FJCC 3CCJV 2EILC 1Q82W 2ZDIA 2IJIA 3NXSA 1QLNA 4R50A 3CCMV 2DYSC 3GB7C 3E8FA 4I5SA 2EIMB 1P7BA 2BOBC 3SPHA 5HFMA 2JDIG 2EIJB 2EIKC 5KA5A 2Y69B 3AG2B 1BHAA 1SRYA 1R3KC 1F51A 3BY6A 3K79A 4H37A 3OMAB 4MSWC 4GX5A 1P4RA 3E8GA 5IY5C 1KP2A 2XAGA 4PDRA 4QE7A 2HJFC 4ZBMA 1IXMA 1JVMA 1OCRC 2F43G 1AJNA 5BZBA 3GWOA 3ETDA 1GO3F 2WSSG 4QJFB 3ZMZA 1VQ8V 1K4DC 2EIMC 3FB6C 1F4NA 2XOKG 5CA3A 2YEVB 2ATKC 4QE9A 2QE7G 4GCZA 2EIJC 2Q6AA 2W6JG 1QLEB 4WFEA 3TCUA 3MD0A 1K92A 3EHBB 3OMNB 2IJJA 4UVCA 4QPJA 3ZRSA 1RM1C 3F5WC 3CP1A 1K9MW 1K73W 1NQTA 2LP7A 3AG3C 5B1AB 5IYDO 1QVFU 3OEEG 2WPDG 2AHYA 4JAVA 1SETA 3ZMUA 4P2ZA 3K08A 1FXKA 4UUJC 4J9ZB 5B1BB 2WWWA 1R6NA 3W7TA 2K1EA 1JCHA 4RAIA 3UKMA 2IW5A 2WLJA 4JF3A 1E79G 3LNMB 2DYRC 2A79B 5HFLA 4UVBA 1WPXA 5CMUA 4WFAV 3CCLV 2A0LA 4G27B 4GX2A 1B6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO2 A;  1GTO A;  2IJI A;  1F4N A;  1F4M A;  1RPR A;  2IJH A;  3K79 A;  1GMG A;  1ROP A;  1NKD A;  2GHY A;  1RPO A;  1PD3 A;  2IJJ A;  2IJK A;  1B6Q A; 
#chains in the Genus database with same CATH topology
 5CA0 B;  4LF5 B;  4GLX A;  4KHP O;  4X20 B;  3G67 A;  5EK0 A;  2VQF B;  3PJS K;  4DR4 B;  2EZP A;  1EM1 A;  4TUY A;  4QIW F;  1IBM B;  1SQQ H;  2OCC C;  4ASU G;  5LHH A;  1AIL A;  1WJZ A;  3ETG A;  4QNH B;  1Y4M A;  2BTQ B;  5CBF A;  1YI2 V;  5LMU O;  4GKJ O;  4O2A B;  1WN7 A;  4L8J A;  4DV5 B;  3ZIA G;  2DYR B;  3ABT A;  5KHI A;  1YJN V;  3MHS C;  2RCV A;  4NR1 A;  3CME V;  1COW G;  4TWK A;  2RN9 A;  2KB1 A;  4P9P A;  1LUW A;  1R3I C;  1JMK C;  3U11 A;  1Y76 A;  5DEC A;  5B1B C;  1Z5W A;  3ZHU A;  4U3J B;  2CTP A;  5AG2 A;  2P06 A;  3GVM A;  5IYB O;  4X8A A;  4N23 A;  3JYC A;  3SJB C;  3I5D A;  2HVK C;  2O57 A;  4DO2 A;  4C7U A;  1VQ7 V;  1FFT B;  1PNM A;  4DV0 O;  3OEH G;  1VQ6 V;  3R66 A;  3SJC C;  4D6T H;  4CZZ A;  5LP6 B;  3CWB H;  2P4V A;  3OMI B;  3W7X A;  1QCE A;  4IYI A;  3JAW A;  1BSM A;  2QA4 V;  3KG2 A;  2ETN A;  3FFQ A;  3ZRW A;  3SPJ A;  2AZ0 A;  4L87 A;  1BL8 A;  1MZF A;  3ZHR A;  2ADP A;  3A2F A;  3N2K A;  4LFB O;  1TVK A;  1VF6 C;  1M1K W;  3KKY A;  3SPG A;  4I7Z B;  3WG7 C;  4LWS B;  2CUG A;  4YIP A;  3MHH C;  4FLV A;  3SJQ C;  1S72 V;  4KFM A;  3U10 A;  4O2B A;  4XDK A;  3JAR A;  5KAI Z;  3AEI A;  3CC2 V;  2UXB B;  5C93 A;  5LHI A;  3QVN A;  1Q90 D;  2P90 A;  4E4E A;  5L3G A;  5FPR A;  3P3N A;  4B3T O;  2ARH A;  4UCU A;  4YJ3 A;  4UCT A;  2M7W A;  3B77 A;  1GH6 A;  3RVY A;  1W0K G;  1N34 B;  3N2G B;  4DUY B;  2YXH A;  3CC4 V;  1YVW A;  3CE2 A;  4UFZ A;  2IH1 C;  4Z1M G;  2Z5U A;  2DJV A;  2QWP B;  3AG3 B;  3STL C;  4QGP A;  3CCS V;  3B8N A;  3ZHQ A;  4JI6 O;  5ITZ B;  1FFX A;  3GWK C;  3T1Y B;  1OCC C;  1PL4 A;  2ILM A;  3K04 A;  2Y0I A;  1ZLZ A;  3LSU A;  3DTU B;  3FYE B;  1HNZ O;  3CEI A;  4IYH A;  2ZE6 A;  2HVJ C;  2GBO A;  1M56 B;  1ENV A;  4CS3 A;  2Y69 C;  4O4I A;  2JS5 A;  4JI1 B;  4DK0 A;  4FIP C;  4I9W A;  3Q4H B;  1PP9 H;  3R65 A;  3O9O A;  3ZRX A;  2KG7 B;  2DQ0 A;  1OCR B;  4PA4 A;  3RWR D;  2BE3 A;  3E8H A;  2V7Q G;  4JYY A;  4O4H B;  4DK1 A;  4DRX B;  1I7F A;  2F4V B;  4X9Q A;  4X66 B;  5IYZ A;  1XUQ A;  5EBM C;  4DV6 O;  3A0H Z;  3CCE V;  1H2M A;  4K0K B;  4X65 B;  1SZT A;  4WF9 V;  1Y6X A;  1DK1 A;  5BMV A;  1QVG U;  4DV1 O;  3JAT B;  3L9D A;  3RN4 A;  3G4S V;  5L3B A;  5H2F Z;  3OE7 G;  5LGT A;  4UV9 A;  3CD6 V;  2WLI B;  1N0J A;  3HKD A;  1SER A;  4X64 O;  5LGU A;  3ASN B;  3T4Z A;  1S3J A;  4B3R B;  3BCC H;  4YHH O;  1ZX3 A;  2IBZ H;  4HZ3 A;  2Z0A A;  3E83 A;  2R9A A;  2YS8 A;  3ASO B;  1BT8 A;  1GN3 A;  3X2Q C;  1NVP D;  5JH7 A;  2NNU A;  3M8A A;  3QNE A;  2ZDI C;  3PN1 A;  3CB2 A;  5FNV B;  4JI2 O;  2UXD B;  2OTL V;  3OUF A;  1K4C C;  4DR1 O;  2XHB A;  4FM1 A;  3CXH F;  4IHJ B;  1GMG A;  3ASN C;  2PGG A;  3JD1 A;  4DUY O;  2EBO A;  2HHH B;  2ZKO A;  4JI6 B;  4I55 B;  1L8D A;  5DM6 V;  2RMK B;  2XAF A;  3OTO B;  5LA6 B;  4DR7 B;  1R6T A;  4FPP A;  3AG1 C;  1J5E B;  1F23 A;  4UB8 Z;  4PI0 A;  2Q5Z A;  4YJ2 A;  1XEQ A;  1I94 B;  3CRA A;  3WB2 A;  5K1P A;  1KKD A;  4DV4 O;  3J80 N;  1PV0 A;  2UXN A;  4X64 B;  2GUZ B;  1JX9 A;  1R6K A;  3O65 A;  4BW9 A;  5IJ0 A;  2YIB A;  2ZR3 A;  4X1Y B;  3CCU V;  1QNM A;  3JD2 A;  3OM3 B;  3SR2 C;  1YDX A;  4R7C A;  3UO3 A;  1XNQ B;  3B09 A;  3F7V C;  2Q67 A;  4MTF A;  2UU9 B;  4DR6 B;  1V55 C;  3MDS A;  1GKF A;  3AK2 A;  1QBZ A;  1THZ A;  2BCC H;  3W7U A;  5L3F A;  2VWK A;  2ZR2 A;  3EFF K;  4UCR A;  3JAL B;  4JTA B;  3DXR B;  2PI5 A;  3WFV A;  3TXQ A;  1I94 O;  1N32 O;  2Q0A A;  2XAS A;  4O4H A;  5LOV A;  5LHG A;  4U3J A;  2LFS A;  4O4L A;  2ZIN A;  4JPR A;  5KAF Z;  2EIL C;  1QLN A;  1XHZ A;  4J11 A;  1U96 A;  3CCM V;  2DYS C;  3JSN A;  4FZ1 A;  5CA0 A;  1BQ0 A;  2QTS A;  5JVD A;  3H9V A;  4JI7 O;  3JAT A;  1SF9 A;  2EIK C;  1R3K C;  1F51 A;  4JV5 B;  4OX9 B;  5A2Q N;  2DN9 A;  3BY6 A;  2BTO A;  4H37 A;  4LH7 A;  4GX5 A;  1KP2 A;  4LFC O;  2XAG A;  4ZOL A;  3UO2 A;  1XI1 A;  2F43 G;  1PM9 A;  2L6L A;  1AJN A;  4PI2 A;  4Q6G A;  4ZHQ B;  1RFY A;  3GWO A;  1HDJ A;  2WSS G;  3L73 H;  4HNA B;  2PTM A;  4NB5 A;  4FLZ A;  1F4N A;  4QE9 A;  4B3S O;  2QE7 G;  4NXM B;  4YY3 O;  1N4C A;  5EYP A;  2Q6A A;  3M7M X;  3EHB B;  2IJJ A;  1IVS A;  3CRQ A;  4CH5 A;  3F5W C;  1K73 W;  5KLV H;  3AG3 C;  4YIO A;  3OEE G;  2IM9 A;  2AHY A;  3RGB A;  1Z5V A;  1AP5 A;  4UUJ C;  4DR2 B;  1ZL8 B;  1JA8 A;  2IW5 A;  4JF3 A;  3WU2 Z;  4DR5 B;  2YXL A;  3L74 H;  1E79 G;  4K8Z A;  4UVB A;  1WPX A;  3CCL V;  2ZT9 B;  1XMQ O;  3RYI A;  2F23 A;  5EZY A;  4UCS A;  1H2G A;  4EB6 A;  3OFN G;  3K3W A;  2WLK A;  3JAW B;  5B5E Z;  4DV2 O;  4FLY A;  4JAS A;  4I9Q A;  1Y67 A;  4H0L B;  3H1L H;  4JYB A;  1N33 O;  1KUQ A;  4D7S A;  1WP8 A;  4B3R O;  4WCE V;  5KHJ A;  4DV1 B;  1URF A;  1EZV H;  1ZUQ A;  3LSS A;  2E74 B;  1B04 A;  3A0R A;  5JCO A;  4LF4 O;  1KEC A;  1UJW B;  2AGA A;  5ITZ A;  5LBQ A;  1V54 C;  1FFX B;  2HKO A;  2CDY A;  1S5H C;  1VQM V;  5J2T A;  4JYC A;  1XMO O;  5KA6 A;  1S0V A;  5EC1 C;  4H33 A;  1RP3 B;  5C8Y A;  4F6R B;  1NBM G;  3CRR A;  1O9G A;  3CYO A;  2LW7 A;  2FKX A;  4JAU A;  2WA3 A;  5BR8 B;  1K5Q A;  2B5U A;  3MAQ A;  1MSD A;  2KKW A;  3ZJZ A;  1X4T A;  3EXA A;  2QM4 A;  1HW7 A;  1MZE A;  2DWE C;  4EEQ A;  2OIG A;  3RW0 A;  2ZD9 A;  4X1I A;  1XNR O;  4GKK B;  4TT3 G;  1G1X B;  2WAM A;  1LUV A;  4NXN O;  4X88 A;  3CXC U;  4DR3 O;  1JQ0 A;  4R6Z A;  3QF7 A;  1K3E A;  4RUF A;  4CC6 A;  4LF8 O;  1H2N A;  5IYZ B;  1K33 A;  3CJH B;  1XMQ B;  3T1Y O;  4LBE C;  1NTZ H;  2ITD C;  1YSC A;  1SKV A;  3HB3 B;  2IJK A;  1VQ4 V;  2PY5 A;  1M90 W;  4X20 A;  1Y66 A;  4NTY A;  1AP6 A;  1SS3 A;  2K9P A;  3BFR A;  1GRJ A;  4OXS A;  1FPO A;  2PUS A;  2ADQ B;  2P22 C;  5EYP B;  1DTO A;  2XND G;  3HKD B;  4PA9 A;  4O4I B;  3WB1 A;  2H3O A;  4WFG A;  1GM7 A;  2CAZ C;  1IBK B;  2UXC O;  1VAR A;  2EX3 A;  1SES A;  4TOI A;  3I55 V;  4DV7 O;  3ZED A;  1YZB A;  1FS0 G;  1JJO A;  1AR1 B;  4LR3 A;  4BIZ A;  2W0X A;  3CSX A;  1RM1 B;  4DV0 B;  1OV9 A;  3HKC B;  1XOU A;  4I55 A;  1QLE C;  1PNK A;  3ZRW B;  4CBC A;  1XL4 A;  2GHY A;  5KUK A;  2CH7 B;  3ML0 A;  5LP6 A;  1L0N H;  5H6R A;  3ZHV A;  5EBL C;  1MOF A;  2CGO A;  2A7W A;  1US6 A;  2QM8 A;  5KX5 B;  2HEP A;  4J9Y B;  3FD9 A;  5D5P A;  1FAF A;  3F5T A;  1NI8 A;  1L0L H;  2HFE C;  2EIN B;  4BAY A;  3AG2 C;  2JIZ G;  3STZ C;  4XDJ A;  4KUM A;  3CMA V;  2UU9 O;  1QQC A;  4LFA O;  5L3E A;  2JGD B;  4K0K O;  2Q7E A;  3KZI Z;  5L3D A;  3UQ8 A;  1WP7 A;  5L3C A;  3LUT B;  4PDM A;  1DF4 A;  4KP4 A;  2CTW A;  1MAB G;  3C3S A;  3IC7 A;  5B1O A;  3JAR B;  1K5S A;  4BIU A;  5LA6 A;  2P67 A;  2L35 A;  4I0X B;  4W4L A;  5B3S C;  2FYU H;  4R8C A;  1TUB B;  1W59 A;  1U97 A;  2QJ1 A;  4GX1 A;  1IBK O;  4B3T B;  1Y74 A;  3UM7 A;  5JQG A;  4JI0 O;  1P84 F;  4X1K A;  1I5X A;  1VF5 B;  1N36 B;  2W0F C;  3SYA A;  4H13 B;  4OX9 O;  2HG5 C;  4NYK A;  1MNG A;  2MK3 A;  4TSF G;  1NH2 B;  4NTX A;  5B3S B;  2A9H A;  1M9N A;  3SYP A;  2NLJ C;  1AB3 A;  5FL7 G;  4MVR A;  1QR8 A;  3QO7 A;  4PV1 B;  1M57 C;  5K1X A;  4ZHQ A;  1MSW D;  1PL0 A;  1Q6I A;  1S5L Z;  2OCH A;  4O4L B;  1N32 B;  4HNA A;  2YI8 A;  4MW3 A;  1HNW O;  1KMI Z;  1GN6 A;  1TUE B;  4TV8 B;  1FJG B;  4JI4 O;  4NXM O;  4P30 A;  5LOV B;  4DV4 B;  1Z2G A;  1ORQ C;  4J7Z A;  5LGN A;  1MA1 A;  1FYJ A;  4F4L A;  2ZCE A;  4EFE A;  1CPY A;  4J41 A;  3H1I H;  5CBH A;  1VQO V;  1LNQ A;  4Z2W A;  3HPL C;  1JFF A;  4X65 O;  1XIL A;  1B06 A;  5LXT B;  1XBL A;  3QTC A;  1CEZ A;  5H9C A;  3JAS A;  2HJD A;  2UUB O;  4MVM A;  3Q4H A;  3OUS A;  2QTO A;  3K5M A;  4FLU A;  1V9P A;  4JI3 B;  3D8C A;  4JZ2 A;  3G80 A;  3DSQ A;  4DRX A;  3K59 A;  4DYL A;  3CCQ V;  3DC5 A;  2CK3 G;  1K34 A;  3C90 A;  1EN4 A;  4IHJ A;  2Y48 A;  3K0D A;  1AR5 A;  1ZL8 A;  4IL6 Z;  2NR5 A;  4F6R A;  2JGU A;  2FL4 A;  1OHH G;  3FKS G;  3QG5 A;  1RPO A;  2IU0 A;  4J7J A;  1Q82 W;  4X62 B;  4KXR A;  4YJ2 B;  4R50 A;  1VMG A;  3GB7 C;  2EIM B;  1P7B A;  2BOB C;  3SPH A;  3JAM N;  2EIJ B;  4X1I B;  5KA5 A;  1SA0 A;  3K79 A;  1BE3 H;  2NN4 A;  2YIA A;  4MSW C;  1P4R A;  2Y4U A;  2BSK B;  1TVK B;  4JZG A;  1GN2 A;  4LWS A;  4QJF B;  3OGI B;  1IBM O;  1K4D C;  2Q9L A;  2EIM C;  5CA3 A;  4JI4 B;  2ATK C;  2VWJ A;  2EIJ C;  1QLE B;  4WFE A;  3MD0 A;  2QWR B;  1K92 A;  3OTF A;  1BCC H;  4LH6 A;  3H1J H;  2A06 H;  2YIC A;  2AXT Z;  3J7A U;  2LJ2 A;  1K9M W;  5KMG A;  2GDS A;  5IYD O;  3FAV A;  2Q8V A;  3K57 A;  1SQB H;  1SET A;  1SQG A;  5B1B B;  1R6N A;  1BZK A;  5IJ0 B;  2FML A;  2E5L O;  1KB9 F;  1WA8 A;  2VS0 A;  5CMU A;  4WFA V;  2XT9 A;  4LC1 A;  1N36 O;  4DV7 B;  3W7S A;  4W4K A;  3OGC C;  1SZX A;  4GYC B;  2XAH A;  3E86 A;  3RYF B;  1R73 A;  2C2A A;  3K5O A;  3ZCC A;  1H2S B;  4FFK A;  3LDE A;  1NT2 B;  2R9R B;  4ZOL B;  3ZMT A;  1RSO A;  3CS5 A;  4LF6 B;  2R72 A;  1PKX A;  3ABU A;  2IU3 A;  3JAL A;  1NR1 A;  4WBN A;  4ABM A;  1AI7 A;  5B1A C;  1EZJ A;  1CP9 A;  1NTM H;  2ZM6 O;  1SQX H;  1KQS U;  1O9H A;  2JRI A;  4F6E A;  2IH3 C;  2QKS A;  3CRC A;  4FK5 C;  3E2E A;  1YF2 A;  1YHQ V;  4AQY O;  5BXZ A;  4YY3 B;  4FM2 A;  3HKB B;  3K0G A;  3WG7 B;  2XUM A;  4OGQ B;  1GTO A;  4DUZ O;  2HLD G;  1M5I A;  3JD3 A;  2V4D A;  3LNN A;  2OCC B;  2ZQM A;  3FB8 C;  1VQL V;  2JEX A;  1NZ6 A;  2X6A A;  4G2K A;  1JOY A;  4MT8 A;  2X0L A;  2AHZ A;  3K58 A;  5CBG A;  1HNX B;  2LGW A;  1FXK C;  4GT1 A;  4LF4 B;  3ZN1 A;  1Q81 W;  4YHH B;  4U7N A;  3RYI B;  2RNB A;  3APQ A;  1FXH A;  5EZY B;  1EBO A;  4JI1 O;  3ZMS A;  4XDL A;  2PYL A;  3VOU A;  3CRM A;  3H01 A;  5J9P C;  2YXY A;  3ZBH A;  3KCY A;  4EKW A;  1VQ9 V;  1T5E A;  4WFB V;  5DN6 G;  4P9O A;  1KP3 A;  1TGO A;  1NJI W;  1HNW B;  5JWP A;  1SQV H;  4MVZ A;  1D5N A;  5IWA O;  3C3T A;  3L72 H;  5EBW C;  1YIT V;  1G4Y B;  2ZNJ A;  2WLM A;  2Y0P A;  1PPJ H;  3CHX A;  4JGS A;  3L75 H;  1KYO F;  2JEU A;  1K97 A;  1WPB A;  5KHG A;  3AG1 B;  3E89 A;  3E22 A;  2PZS A;  4PJ0 Z;  5FLX N;  5JJJ B;  2QR4 A;  2Q68 A;  3QO8 A;  1Q8I A;  2KSD A;  3ZHT A;  2BOC C;  2V1D A;  5EIB C;  1KU9 A;  3BPZ A;  4B7E A;  3ZN0 A;  4LF8 B;  3T1C A;  1VIB A;  3THO A;  1R3L C;  2WLL A;  4X1K B;  3AG7 A;  1M93 A;  1ZSP A;  3ICX A;  4KL1 A;  4ZKI A;  3FYI B;  1G6U A;  4J80 A;  5J2U A;  4PDL A;  5CN0 A;  3K5N A;  1JJ2 U;  4DUZ B;  5IDJ A;  1B3Q A;  2WA4 A;  3FX7 A;  4X1Y A;  2QSA A;  5J2T B;  1H2K A;  4FLT A;  2YUA A;  3DGE A;  4O2A A;  3D3I A;  3BAA A;  1WB7 A;  1R3J C;  3CJH A;  4JI8 O;  2QWN B;  5H6Q A;  3OAA G;  2A3Q A;  4A5U B;  5LXT A;  2AZ2 A;  4GZR B;  5BR8 O;  5LYJ B;  1XDC A;  3JAS B;  3NR7 A;  3ZS8 C;  3VQW A;  3I56 V;  3APO A;  4I4T A;  3HR0 A;  2LQT A;  1YJW V;  2DW4 A;  3RYC A;  4X89 A;  2VQE O;  4E2L A;  4H44 B;  1JFF B;  1FD9 A;  2B1I A;  4U7O A;  4XBF A;  1M57 B;  3ABL C;  4UCO A;  2HR3 A;  3ABK B;  2EZO A;  4BW5 A;  3T1H O;  4MW8 A;  1WAZ A;  2YID A;  2ZE8 A;  1K7D A;  1YJ9 V;  4MVO A;  3VQV A;  4DR7 O;  2G38 A;  1Q5O A;  4CC5 A;  1NH2 D;  4LCU C;  3QO5 A;  3D3Q A;  2P5O A;  1AI4 A;  4I50 A;  2PYJ A;  4JV5 O;  3CCV V;  5CB4 B;  3RYH B;  1Q3E A;  1GK9 A;  3B2E E;  4UB6 Z;  3OR7 C;  2UUA O;  3K9S A;  1AI5 A;  4AHC A;  1SA0 B;  4B3M B;  2OIE A;  2UXX A;  3JAK A;  2P4K A;  5LP6 C;  1R1B A;  5LMN B;  1PNL A;  4RWU A;  5BY1 A;  3P30 A;  2Z3Y A;  2ZXW B;  3F7Y C;  3D36 C;  2JK5 C;  4FFB A;  4LF7 B;  2F95 B;  1IUR A;  1VF6 A;  1VQN V;  4DR3 B;  3SYQ A;  1AJP A;  1XL6 A;  5CA1 A;  3A8T A;  5IJ9 B;  3W7W A;  1YTF B;  2CGN A;  3B4S A;  3CC7 V;  3L70 H;  2P6J A;  2Q73 A;  1TUB A;  3L71 H;  3AG4 C;  1NKD A;  2JGD A;  4ZI7 A;  2KQX A;  3BVO A;  4B7K A;  2ZXW C;  3RT3 C;  1ZAU A;  3T4D A;  4IIJ B;  1OCZ C;  3FB7 C;  1XNQ O;  3UCS C;  2F66 C;  2R9I A;  4LF5 O;  3S3X A;  2X7R B;  4ZIB A;  3CPW U;  4CH3 A;  4LP8 A;  2RQ6 A;  4I0X A;  1N8R W;  1GAX A;  1DLB A;  3JD4 A;  1H8E G;  3X2Q B;  2BSK A;  1JPX A;  5E1A C;  4TV9 A;  3K03 A;  1BHB A;  4FM0 A;  3BRC A;  4PD4 F;  4O4J A;  3DC6 A;  2OYQ A;  4RO2 A;  3TXS A;  1QU7 A;  4TQF A;  4EFB A;  2EIK B;  4JI5 O;  1QR9 A;  4PDV A;  4UVA A;  3M99 B;  4HAM A;  1N33 B;  1E1R G;  4DR2 O;  1FJG O;  3IFX A;  1RSO B;  4N21 A;  2BTQ A;  2HHH O;  4RUE A;  2RJZ A;  5C8Y B;  3SPI A;  2PF4 E;  3ZX6 A;  3CX5 F;  1KD1 W;  1XMO B;  4I4T B;  3G6B A;  2ZIO A;  1I0H A;  5KMG B;  1OCO C;  1S77 D;  4X62 O;  1Q6U A;  1Y74 B;  3ZHS A;  1H2L A;  1FXK B;  4TUY B;  1HR0 O;  5TIS Z;  2UXC B;  2AW9 A;  3CCJ V;  2M6Y A;  2QWO B;  3NXS A;  2LW1 A;  4I5S A;  2F4V O;  3H1K H;  2RDC A;  5DED A;  4LF9 O;  2JDI G;  5JJE B;  3SGI A;  4DW1 A;  1BHA A;  1VEW A;  1SRY A;  2N05 A;  1HP8 A;  1AR4 A;  3KCX A;  5IY5 C;  4PDR A;  4I50 B;  4QE7 A;  3TJT A;  1WB8 A;  1JVM A;  4OPH A;  1FKA O;  1I08 A;  1Q6H A;  2GTA A;  3ETD A;  2R70 A;  4K8X A;  1GO3 F;  5IT9 N;  1HNX O;  3FB6 C;  2JS3 A;  1BS3 A;  1XHX A;  3TCU A;  3OMN B;  4QPJ A;  3ZRS A;  1N34 O;  2CTQ A;  3AK3 A;  1RM1 C;  2FB5 A;  1D2D A;  1OJH A;  1NQT A;  2LP7 A;  4J7K A;  3BA9 A;  4JAV A;  5KHH A;  3ZMU A;  5CA1 B;  3U0Z A;  4D7T A;  4J9Z B;  2WWW A;  2D2C B;  3W7T A;  2K1E A;  4LNU A;  1TAE A;  3UT5 A;  3LNM B;  5HFL A;  2Y4T A;  2ZE5 A;  1B6Q A;  1NTK H;  1AI6 A;  1BQZ A;  4ZI7 B;  3HKC A;  3D36 A;  4GKK O;  2E5L B;  3ASO C;  4WFF A;  2E3C A;  3N2G A;  3BEH A;  1I5Y A;  1MMM A;  1JR9 A;  2CH7 A;  4B3M O;  3N2K B;  1S76 D;  1EFR G;  3EVK A;  5B1N A;  2E76 B;  4BIO A;  4JI3 O;  3VBB A;  3BAB A;  1VP7 A;  1VQ5 V;  1XRE A;  2GV9 A;  3JCU Z;  2EJ7 A;  4DXW A;  4BWA A;  3LSQ A;  3HKE B;  3ZMV A;  4K35 A;  3SYC A;  3IJ4 A;  4UV8 A;  3ABK C;  1XNR B;  1X59 A;  3G6E V;  4NVP A;  1L1F A;  4JYA O;  2YEV A;  3FAV B;  2ZNI A;  4GUN A;  4YJ3 B;  2OT5 A;  1HR0 B;  2IJH A;  2YSU B;  4AQY B;  4DR4 O;  1CXZ B;  4RQF A;  4JTD B;  2WLL B;  4JI7 B;  2X6C A;  4MTG A;  2YI9 A;  4NKG B;  1V55 B;  2JJ2 G;  3T2M A;  3P32 A;  4PA6 A;  2YIB D;  1IXB A;  1XQ8 A;  4IT5 A;  3FB5 C;  2LO1 A;  1ZWI C;  1IZ3 A;  4BR6 A;  1SC5 B;  2H94 A;  2N74 A;  2UUC O;  5A9G A;  3OR6 C;  2XAJ A;  2W6I G;  4JI5 B;  2EIL B;  1ARO P;  3TK1 A;  3T1H B;  2P7T C;  5IWA B;  3K5L A;  2DYS B;  1UPG A;  2JVD A;  1M4U A;  4J10 A;  2D3O W;  4DW0 A;  1E1Q G;  1EN6 A;  4LF7 O;  2N04 A;  2OWO A;  2VQE B;  4JI2 B;  2UXD O;  3A0B Z;  2B9Z A;  4TQD A;  1YEW A;  5KHK A;  5FPO A;  3IAY A;  2WLI A;  2E75 B;  2EJR A;  3JSL A;  5CB4 A;  1NS1 A;  4DR5 O;  2QWQ B;  1A32 A;  1MG1 A;  5GON A;  1WA8 B;  1KC8 W;  1G8M A;  1IBL B;  2Q7H A;  2UUA B;  5IE9 A;  1GN4 A;  2GSM B;  1Q43 A;  3LDD A;  1OCZ B;  4FLW A;  5BMV B;  4CH6 A;  3AK1 A;  3G71 V;  1IX9 A;  2GTS A;  4DV3 B;  2XTA A;  3RYF A;  1DF5 A;  3HKB A;  2HP8 A;  3UT5 B;  4FZ0 A;  2QDO A;  4HYO A;  1BGY H;  1AJQ A;  3E8B A;  1NU1 H;  4LFB B;  1N0N A;  5GTI Z;  1WNS A;  4JI0 B;  4EB6 B;  2WLH A;  3SYO A;  4Z1V A;  3WB0 A;  2DWD C;  1Q7Y W;  1VQK V;  1J95 A;  5GW7 A;  4WBN B;  3ABL B;  4DR6 O;  4LF6 O;  3ZRV A;  4ICG A;  2Q7G A;  1HNZ B;  3JAK B;  1DGS A;  4CH4 A;  2VQF O;  1SQF A;  2LGQ A;  5JH7 B;  4RQE A;  2ZM6 B;  1OZ0 A;  2EUL A;  1W2B U;  1OCO B;  2ITC C;  5IJ9 A;  3K06 A;  2H8P C;  3VQX A;  4DV5 O;  1Q86 W;  4OPA A;  4FFB B;  3SDL A;  1NR7 A;  4J42 A;  1GM9 A;  2X6B A;  3OTO O;  1K8A W;  4NXN B;  3BA8 A;  4MVQ A;  4LF9 B;  2LFR A;  4GX0 A;  1M56 C;  3E22 B;  4PHZ A;  1LR1 A;  3SPC A;  1PD3 A;  1OCC B;  2UXB O;  1IBL O;  4MVS A;  1V54 B;  2XAQ A;  5E79 Z;  4PA3 A;  1D5A A;  2QKC A;  1YIJ V;  1WLE A;  3B8M A;  3CCR V;  4AI8 A;  2ZE7 A;  2B1G A;  2EIN C;  3AG4 B;  1BMF G;  2Q0O C;  4TV9 B;  4MTX A;  4CS2 A;  5IYC O;  4IGG A;  2JJ1 G;  3S3W A;  1H8H G;  4FVM A;  4FLX A;  5LMU B;  4GKJ B;  2DE0 X;  4G28 B;  4MS2 A;  1W0J G;  1HWY A;  1KKC A;  2ODM A;  4Q20 A;  3JD0 A;  3ABM C;  4QPK A;  5GON B;  2QEX V;  2KG7 A;  3TET A;  3DXR A;  4DV3 O;  5J2U B;  5F2V O;  2F93 B;  1VQP V;  1NVP B;  5LL6 Y;  4KHP B;  5JVD B;  4MTO A;  2DMX A;  3IGA C;  1ROP A;  5EC2 C;  5D5Q A;  4FMT A;  5JCO C;  2OTJ V;  1H38 A;  4CS4 A;  4HBN A;  3RYC B;  2QM7 A;  1F7Y A;  1F4M A;  1YTF D;  3ABM B;  1KBH A;  4JI8 B;  2CE4 A;  3P3P A;  4X66 O;  4LNU B;  1RPR A;  4K3A A;  3JCZ A;  1GM8 A;  1VF7 A;  3OW2 U;  3IC9 A;  2Q69 A;  2QGN A;  4MVU A;  4WFH A;  3K9A A;  3SJA C;  1QHT A;  5LYJ A;  3H1H H;  3RYH A;  4UXN A;  3J81 N;  4LFA B;  2PI4 A;  3OD4 A;  4PEL A;  4B08 A;  1FXV A;  5KX5 A;  4JAA A;  3RVZ A;  2FTK A;  1Y76 B;  2UUB B;  2F1M A;  1ZTE A;  4DV6 B;  4PA7 A;  5GTH Z;  4YXW G;  4NTW A;  2DQ3 A;  4JTC B;  4U3F H;  3RBZ A;  5EIB D;  4DV2 B;  2QKA A;  1S5J A;  3E35 A;  3LDC A;  5IY5 B;  1UFI A;  4JYA B;  5KUM A;  3ETE A;  5LMN O;  2WLN A;  4FJC C;  2UUC B;  2ZDI A;  2IJI A;  5JJN B;  3E8F A;  3OT7 A;  4IIJ A;  1EN5 A;  4LFC B;  5HFM A;  1YCI A;  3BHP A;  3RFR A;  2Y69 B;  5JQG B;  3AG2 B;  1IDS A;  3N27 A;  3OMA B;  3E8G A;  1YXB A;  3TGU H;  2HJF C;  2Q4P A;  4ZBM A;  1IXM A;  1OCR C;  1AVM A;  5BZB A;  5H5N A;  3ZMZ A;  5FNV A;  1VQ8 V;  3ETQ A;  2MW2 B;  2XOK G;  2YEV B;  5B66 Z;  4AIL C;  3HKE A;  4GCZ A;  2W6J G;  3B40 A;  4O2B B;  2DOS A;  2YDE A;  4UCV A;  2CTR A;  2ZIM A;  4O4J B;  4UVC A;  1SQP H;  1P49 A;  1P7G A;  4B3S B;  3CP1 A;  2YC0 A;  5B1A B;  1TA8 A;  1QVF U;  2WPD G;  4TV8 A;  4P2Z A;  1J5E O;  3K08 A;  1FXK A;  2GUZ A;  1JCH A;  4RAI A;  3UKM A;  2WLJ A;  2DYR C;  2A79 B;  3VQY A;  2VRZ A;  2A0L A;  4G27 B;  4GX2 A;  4DR1 B; 
#chains in the Genus database with same CATH homology
 1AI6 A;  1H2G A;  3OFN G;  3K3W A;  5EK0 A;  2WLK A;  3D36 A;  3W7S A;  3PJS K;  3ASO C;  2EZP A;  4JAS A;  3OGC C;  2XAH A;  4QIW F;  3E86 A;  4WFF A;  1R73 A;  2C2A A;  3BEH A;  1I5Y A;  4JYB A;  3ZCC A;  2OCC C;  4ASU G;  5LHH A;  3LDE A;  2R9R B;  4WCE V;  1S76 D;  3ETG A;  3ZMT A;  4QNH B;  1Y4M A;  1EFR G;  5CBF A;  1YI2 V;  3LSS A;  5B1N A;  1PKX A;  2DYR B;  3ZIA G;  3VBB A;  3ABT A;  3ABU A;  2IU3 A;  3A0R A;  1VQ5 V;  1KEC A;  1NR1 A;  3MHS C;  1UJW B;  1YJN V;  3CME V;  5LBQ A;  1AI7 A;  1COW G;  1V54 C;  4TWK A;  2HKO A;  1EZJ A;  5B1A C;  1CP9 A;  4DXW A;  3LSQ A;  2KB1 A;  1S5H C;  4P9P A;  1VQM V;  1KQS U;  1R3I C;  4JYC A;  5KA6 A;  5B1B C;  1S0V A;  2IH3 C;  2QKS A;  3ZMV A;  5EC1 C;  4FK5 C;  4H33 A;  3E2E A;  3SYC A;  1YHQ V;  4UV8 A;  1NBM G;  3CYO A;  3ABK C;  3K0G A;  5IYB O;  4X8A A;  4N23 A;  3WG7 B;  4JAU A;  3G6E V;  3JYC A;  1L1F A;  1K5Q A;  2B5U A;  2YEV A;  2HVK C;  3ZJZ A;  4DO2 A;  1GTO A;  2HLD G;  2OT5 A;  2DWE C;  2IJH A;  2YSU B;  3RW0 A;  2ZD9 A;  1VQ7 V;  3JD3 A;  1FFT B;  1PNM A;  4TT3 G;  2WAM A;  3OEH G;  4RQF A;  2OCC B;  1VQ6 V;  4JTD B;  2ZQM A;  4X88 A;  3CXC U;  2WLL B;  3FB8 C;  4CZZ A;  1VQL V;  2JEX A;  2X6C A;  4MTG A;  2X6A A;  4G2K A;  1V55 B;  2JJ2 G;  3OMI B;  1JQ0 A;  3P32 A;  4PA6 A;  4R6Z A;  3T2M A;  3W7X A;  1JOY A;  1QCE A;  4MT8 A;  2X0L A;  2AHZ A;  5CBG A;  3FB5 C;  1K3E A;  4RUF A;  1K33 A;  2QA4 V;  1ZWI C;  3KG2 A;  1FXK C;  4GT1 A;  3ZRW A;  2H94 A;  4LBE C;  3SPJ A;  3OR6 C;  3ZN1 A;  2XAJ A;  1Q81 W;  2W6I G;  2ITD C;  4L87 A;  1BL8 A;  4U7N A;  1YSC A;  2EIL B;  1ARO P;  3TK1 A;  1FXH A;  2P7T C;  1EBO A;  3HB3 B;  2IJK A;  3ZMS A;  1VQ4 V;  1M90 W;  1M1K W;  1Y66 A;  2DYS B;  4XDL A;  3SPG A;  3VOU A;  3H01 A;  5J9P C;  2D3O W;  3WG7 C;  1VQ9 V;  4EKW A;  1E1Q G;  4WFB V;  4OXS A;  4P9O A;  1KP3 A;  5DN6 G;  1NJI W;  4MVZ A;  3MHH C;  5EBW C;  3SJQ C;  1YIT V;  1S72 V;  1G4Y B;  2WLM A;  4KFM A;  2WLI A;  1DTO A;  2EJR A;  4JGS A;  2XND G;  2JEU A;  1K97 A;  4PA9 A;  4XDK A;  3AG1 B;  1MG1 A;  3AEI A;  3E89 A;  3CC2 V;  5C93 A;  4WFG A;  1GM7 A;  5LHI A;  2P90 A;  1G8M A;  1KC8 W;  5L3G A;  2Q68 A;  3QO8 A;  1SES A;  2GSM B;  3LDD A;  3I55 V;  1OCZ B;  1FS0 G;  4LC1 A;  2BOC C;  2V1D A;  3G71 V;  2M7W A;  3B77 A;  3ZN0 A;  1AR1 B;  3T1C A;  3RVY A;  1R3L C;  1W0K G;  4BIZ A;  1DF5 A;  2WLL A;  3CC4 V;  4HYO A;  1RM1 B;  1AJQ A;  2IH1 C;  3E8B A;  4Z1M G;  2Z5U A;  4ZKI A;  3FYI B;  4PDL A;  3AG3 B;  5CN0 A;  2WLH A;  3STL C;  3CCS V;  3SYO A;  1JJ2 U;  5IDJ A;  1QLE C;  2DWD C;  3B8N A;  1Q7Y W;  1PNK A;  3ZRW B;  1VQK V;  4CBC A;  1J95 A;  5GW7 A;  3ABL B;  1XL4 A;  2GHY A;  3ZRV A;  5KUK A;  3ML0 A;  1OCC C;  5H6R A;  3K04 A;  5EBL C;  3DGE A;  1MOF A;  3D3I A;  1R3J C;  4RQE A;  3DTU B;  3FYE B;  1OZ0 A;  5H6Q A;  3OAA G;  2QM8 A;  1W2B U;  4J9Y B;  1OCO B;  2HVJ C;  2ITC C;  1M56 B;  1ENV A;  2HFE C;  3K06 A;  2EIN B;  2H8P C;  2Y69 C;  4BAY A;  3AG2 C;  2JIZ G;  1Q86 W;  3STZ C;  4XDJ A;  4FIP C;  4I9W A;  3I56 V;  4KUM A;  1NR7 A;  3R65 A;  3CMA V;  3ZRX A;  5L3E A;  1YJW V;  1GM9 A;  2DQ0 A;  2X6B A;  1OCR B;  4PA4 A;  5L3D A;  2DW4 A;  5L3C A;  4X89 A;  3E8H A;  2V7Q G;  1K8A W;  4E2L A;  3LUT B;  4PDM A;  1DF4 A;  4KP4 A;  1MAB G;  4MVQ A;  3IC7 A;  5B1O A;  2B1I A;  5EBM C;  4U7O A;  1K5S A;  4XBF A;  1M57 B;  2LFR A;  3ABL C;  4BIU A;  3CCE V;  2P67 A;  2HR3 A;  4GX0 A;  1M56 C;  3ABK B;  2EZO A;  4BW5 A;  5B3S C;  4R8C A;  3SPC A;  4MW8 A;  1PD3 A;  1OCC B;  1SZT A;  4WF9 V;  4GX1 A;  4MVS A;  1V54 B;  2XAQ A;  1K7D A;  1QVG U;  4PA3 A;  3G4S V;  1YJ9 V;  4MVO A;  3UM7 A;  5L3B A;  1WLE A;  1YIJ V;  1NH2 D;  4LCU C;  3OE7 G;  3B8M A;  3QO5 A;  3CCR V;  5LGT A;  1I5X A;  4UV9 A;  3CD6 V;  2B1G A;  2EIN C;  1AI4 A;  2W0F C;  3AG4 B;  3SYA A;  2WLI B;  1BMF G;  2HG5 C;  3CCV V;  1SER A;  4MTX A;  2MK3 A;  5LGU A;  4TSF G;  1NH2 B;  5B3S B;  2A9H A;  3ASN B;  5IYC O;  1GK9 A;  3OR7 C;  3T4Z A;  1M9N A;  1S3J A;  1AI5 A;  2JJ1 G;  3SYP A;  2NLJ C;  1H8H G;  2UXX A;  5FL7 G;  4HZ3 A;  4MVR A;  1QR8 A;  3E83 A;  3QO7 A;  3ASO B;  4G28 B;  4MS2 A;  1W0J G;  3X2Q C;  1PNL A;  1M57 C;  1NVP D;  1HWY A;  3P30 A;  2Z3Y A;  2ZXW B;  3F7Y C;  4Q20 A;  1MSW D;  2NNU A;  1PL0 A;  3QNE A;  3JD0 A;  3ABM C;  4QPK A;  2JK5 C;  2QEX V;  2ZDI C;  4MW3 A;  3TET A;  2OTL V;  3OUF A;  1K4C C;  1TUE B;  1VQN V;  3SYQ A;  1AJP A;  1XL6 A;  1VQP V;  1NVP B;  1GMG A;  3ASN C;  3JD1 A;  2EBO A;  3W7W A;  4MTO A;  4P30 A;  5DM6 V;  2XAF A;  1ORQ C;  1YTF B;  3CC7 V;  5LGN A;  3IGA C;  1ROP A;  4FPP A;  5EC2 C;  3AG1 C;  2P6J A;  1F23 A;  4FMT A;  2OTJ V;  4F4L A;  3AG4 C;  1H38 A;  1CPY A;  1NKD A;  5CBH A;  1VQO V;  2QM7 A;  2ZXW C;  1KKD A;  3T4D A;  1LNQ A;  1F4M A;  1YTF D;  1OCZ C;  3ABM B;  3HPL C;  2UXN A;  3FB7 C;  1JX9 A;  1R6K A;  2R9I A;  2X7R B;  1RPR A;  3CPW U;  2ZR3 A;  3JCZ A;  4LP8 A;  1GM8 A;  3OW2 U;  1N8R W;  2Q69 A;  3CCU V;  1DLB A;  3JD4 A;  3JD2 A;  3OM3 B;  1H8E G;  4MVU A;  4R7C A;  4WFH A;  3X2Q B;  3K9A A;  1CEZ A;  5H9C A;  1JPX A;  5E1A C;  3K03 A;  1BHB A;  3F7V C;  4MVM A;  2Q67 A;  4UXN A;  4MTF A;  2PI4 A;  3OUS A;  2QTO A;  4RO2 A;  2EIK B;  1QR9 A;  1V55 C;  4PEL A;  4PDV A;  1FXV A;  1GKF A;  4UVA A;  3M99 B;  1QBZ A;  1THZ A;  4HAM A;  3RVZ A;  2FTK A;  1E1R G;  3IFX A;  4N21 A;  4PA7 A;  3CCQ V;  4RUE A;  4YXW G;  3SPI A;  2CK3 G;  3W7U A;  1K34 A;  5L3F A;  1KD1 W;  2DQ3 A;  2ZR2 A;  3EFF K;  4JTC B;  4JTA B;  3RBZ A;  1OCO C;  2PI5 A;  1S77 D;  2Y48 A;  3WFV A;  2XAS A;  3E35 A;  3LDC A;  5IY5 B;  5LHG A;  1FXK B;  3K0D A;  2LFS A;  5KUM A;  3ETE A;  1OHH G;  2WLN A;  3FKS G;  4JPR A;  1RPO A;  2IU0 A;  4FJC C;  3CCJ V;  2EIL C;  1Q82 W;  2ZDI A;  2IJI A;  3NXS A;  1QLN A;  4R50 A;  3CCM V;  2DYS C;  3GB7 C;  3E8F A;  4I5S A;  2EIM B;  1P7B A;  2BOB C;  3SPH A;  5HFM A;  2JDI G;  2EIJ B;  2EIK C;  5KA5 A;  2Y69 B;  3AG2 B;  1BHA A;  1SRY A;  1R3K C;  1F51 A;  3BY6 A;  3K79 A;  4H37 A;  3OMA B;  4MSW C;  4GX5 A;  1P4R A;  3E8G A;  5IY5 C;  1KP2 A;  2XAG A;  4PDR A;  4QE7 A;  2HJF C;  4ZBM A;  1IXM A;  1JVM A;  1OCR C;  2F43 G;  1AJN A;  5BZB A;  3GWO A;  3ETD A;  1GO3 F;  2WSS G;  4QJF B;  3ZMZ A;  1VQ8 V;  1K4D C;  2EIM C;  3FB6 C;  1F4N A;  2XOK G;  5CA3 A;  2YEV B;  2ATK C;  4QE9 A;  2QE7 G;  4GCZ A;  2EIJ C;  2Q6A A;  2W6J G;  1QLE B;  4WFE A;  3TCU A;  3MD0 A;  1K92 A;  3EHB B;  3OMN B;  2IJJ A;  4UVC A;  4QPJ A;  3ZRS A;  1RM1 C;  3F5W C;  3CP1 A;  1K9M W;  1K73 W;  1NQT A;  2LP7 A;  3AG3 C;  5B1A B;  5IYD O;  1QVF U;  3OEE G;  2WPD G;  2AHY A;  4JAV A;  1SET A;  3ZMU A;  4P2Z A;  3K08 A;  1FXK A;  4UUJ C;  4J9Z B;  5B1B B;  2WWW A;  1R6N A;  3W7T A;  2K1E A;  1JCH A;  4RAI A;  3UKM A;  2IW5 A;  2WLJ A;  4JF3 A;  1E79 G;  3LNM B;  2DYR C;  2A79 B;  5HFL A;  4UVB A;  1WPX A;  5CMU A;  4WFA V;  3CCL V;  2A0L A;  4G27 B;  4GX2 A;  1B6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...