1ROPA

Structure of the col*e1 rop protein at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
56
structure length
56
Chain Sequence
b'MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the ColE1 rop protein at 1.7 A resolution
pubmed doi rcsb
molecule keywords ROP PROTEIN
source organism Escherichia coli
molecule tags Transcription regulation
total genus 27
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1991-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ropA00
1RPOA 2IJJA 1RPRA 4DO2A 1PD3A 2IJHA 1B6QA 2GHYA 1NKDA 2IJIA 1F4MA 3K79A 1GMGA 1F4NA 1GTOA 2IJKA 1ROPA
chains in the Genus database with same CATH superfamily
4YXWG 1H38A 1AB3A 4LF6B 1SKVA 1K5SA 1OCCC 3WFVA 4O2AA 3RYCA 2DQ3A 4J10A 3KCXA 5A2QN 2GUZA 1H8HG 2GV9A 1YEWA 2WLLA 2F93B 4WFBV 2Q0AA 4B7KA 3CRRA 2YIBD 2YIBA 1GAXA 1Q90D 3CCRV 3BABA 2QM7A 3RBZA 1VQ4V 4CZZA 4JYBA 4CS2A 4LF7B 2BOBC 3T1YO 1QVFU 5EIBC 1Z5WA 3N2KA 1RSOB 2YIDA 4JYAB 4NXNB 1HR0B 4DV0B 1PM9A 3HB3B 2AXTZ 2LW7A 1QCEA 3P30A 1PL0A 2CH7A 4LFCB 3ABLC 3Q4HA 4ABMA 1F7YA 2XAGA 4FZ1A 1NU1H 2PI4A 1FS0G 3RYHA 2NNUA 3ASOC 4FJCC 1BSMA 2F95B 1D5AA 1IBKO 1K92A 1FXKB 3SGIA 5L3DA 4DV2B 1IX9A 5J2UA 4RUEA 2Q0OC 4I9QA 3JSNA 2UXBB 4JTAB 4X20A 2XAFA 1X4TA 2QWPB 2ZE7A 1AI6A 1Y6XA 5TISZ 1FPOA 1KP2A 2QTOA 4UV9A 1RSOA 2OCCC 3DXRB 2QA4V 3ABMC 5J2TB 3CCQV 3CRQA 1PNKA 2HHHB 5LP6B 1YF2A 1LUVA 4CH4A 1QNMA 5L3CA 3HKCA 4K3AA 1U97A 5EBMC 4IIJB 3BCCH 4NXMB 1SQBH 3STLC 1WJZA 4GYCB 4DV6O 3SYQA 3JARB 2CDYA 3CCJV 1K33A 2IM9A 3L74H 4LF4B 1HW7A 4DR1B 1VF6C 1VQ6V 3H1HH 5B1AC 3OTFA 4B3MB 3JD3A 3G6BA 3LSSA 3W7TA 4N21A 1QR8A 5IJ9B 2WLMA 1OCZB 2LJ2A 3BY6A 4F4LA 3CB2A 1I94B 1GMGA 3JAWB 5AG2A 3BRCA 4IHJB 2JS3A 2FKXA 1JA8A 1OCOB 5LMNB 2W6IG 2UUAO 2Q67A 4XDKA 3T1HO 3L72H 3RWRD 2W0XA 4PA3A 2CGNA 4TSFG 3W7XA 1Z2GA 1Q81W 4X1IB 1THZA 2JGDA 4B3SB 2UXCO 2FTKA 5IWAO 3E89A 4QPKA 1KC8W 3BAAA 2A7WA 1N32O 1TUBA 1XNRB 3APQA 1XMOB 3W7UA 5BMVA 2WA3A 3FB8C 2P22C 2WAMA 2QGNA 4PHZA 3UM7A 1BCCH 2P4KA 2QKAA 1L1FA 2JIZG 2DWDC 2EIKB 2VQEO 5EZYB 1S0VA 1JR9A 1CXZB 3QO8A 5FNVB 1N4CA 3CPWU 3F5TA 4KHPO 4CH6A 5KMGA 1NQTA 3JCZA 1PD3A 3ZBHA 1HNWB 4DR7B 5EBWC 3T4DA 4O4LB 1WA8B 4NTWA 2CTPA 3R65A 5IY5B 4KL1A 1N33B 3HR0A 4DUZO 5B1BB 1KECA 1Y4MA 1SESA 4P9OA 4FMTA 4PDLA 4DW1A 2UXDO 1S77D 3QVNA 3ASNC 1VQ9V 1GN2A 1HP8A 3LDDA 4UFZA 3HKDB 1Q6IA 2E3CA 1M56C 4TOIA 3TXQA 3D36C 4TWKA 4LBEC 1L0NH 1M9NA 1GK9A 2ODMA 2C2AA 2D2CB 4EFBA 3RYFB 2N04A 4DV3O 1SF9A 3RVYA 5HFLA 5IE9A 1KKCA 4G2KA 5L3FA 2PYJA 1ENVA 3IC7A 2A79B 3FFQA 3VQXA 1VEWA 4YJ3A 3STZC 3ETDA 4DV0O 4OPHA 4J7KA 1XHXA 3K3WA 1TGOA 4JI8B 4DV4O 4DR4B 4MW3A 4UB6Z 3VQYA 1K4CC 4LFCO 1JVMA 3CP1A 2Y4UA 4MTXA 4ZHQA 1B04A 3A8TA 2ITCC 1R1BA 4J11A 3GWKC 1NT2B 3FAVB 3KG2A 4JI1O 3THOA 4X66B 4BIUA 3HKEA 1ZX3A 2R9AA 4F6RA 2AZ0A 5EC1C 2DW4A 4H0LB 2DYRB 5L3BA 4FLXA 4DV2O 2CTWA 1ROPA 3ZHTA 1EZVH 3KKYA 3ETGA 3K58A 1YCIA 2UXBO 1KQSU 2HLDG 5LL6Y 5ITZA 3RYFA 3RVZA 4YY3B 1FFXA 5LXTB 3R66A 1HNZB 2HVKC 2HR3A 3LNMB 2B9ZA 2Q68A 2FMLA 1B06A 2Y4TA 4WFGA 4DYLA 1KP3A 4UV8A 3DGEA 3SPHA 1LR1A 3N2GA 3QNEA 3RN4A 3G67A 1JPXA 4DR3B 5LGUA 3CC4V 2IJKA 4QE7A 1N36O 4DR6B 2ZIOA 2PUSA 2EINC 3ZN0A 1VQNV 4GKKB 2Q6AA 1IBMO 1GN4A 4DR1O 4PA4A 4X62B 4WFAV 3OGIB 1FKAO 3P3NA 1J95A 4O2BA 3K79A 1PP9H 4BIOA 4DK1A 4YIPA 5F2VO 3OR6C 1UPGA 3F5WC 2W0FC 1FJGB 3JASA 2H8PC 1YITV 5L3GA 1AJPA 4X88A 4E4EA 4B3TO 1VQKV 2EILB 2D3OW 1YTFB 3W7WA 2QEXV 5BXZA 4FFBB 4U7OA 1IURA 5L3EA 1PL4A 1N0JA 4UVAA 1M57B 4IYHA 3P3PA 1XUQA 4IL6Z 4DW0A 3BA8A 1V55B 4B3SO 1AR1B 1OV9A 2Q7EA 4BWAA 1Q82W 2YEVA 3LSUA 1RPRA 3B77A 5EBLC 1G4YB 4LFBB 4RAIA 2Q7GA 1YZBA 3VOUA 4P30A 1BS3A 1W59A 2EZOA 3AG4C 5LMUB 3U10A 4JV5O 4DK0A 4JYYA 4AILC 2ZXWC 3K08A 1M4UA 2YSUB 1R73A 3SYPA 2WSSG 2ZNJA 3H1IH 1F23A 4YIOA 4O4HB 3K9AA 3OMNB 1TVKA 1GTOA 1EN6A 1N33O 4IGGA 3SR2C 3K5OA 3KCYA 2EIJC 2R9RB 1TUEB 2BCCH 1I0HA 3C3TA 3EHBB 2WLHA 1WP7A 5K1PA 3VQVA 4GLXA 2OTLV 4O2AB 3RYCB 1HDJA 2DYSB 1R3KC 4G27B 2WLLB 2OTJV 5H6QA 2OCHA 4UVCA 1UJWB 3AG3B 1URFA 2EJRA 2VQFB 1JMKC 1B3QA 3IAYA 1JJ2U 1QLEC 3CCSV 3CCLV 3WB0A 4LF5B 1R6TA 5GONA 1YSCA 4LC1A 3OEEG 2P5OA 2BE3A 1DTOA 3CEIA 1H2LA 3ZIAG 1G1XB 3N2KB 3QO5A 2HEPA 4JASA 4JAVA 5IYBO 1R6NA 4LF9B 3OTOB 4B7EA 4H33A 1S5LZ 4P2ZA 5DM6V 2ADQB 3B8NA 1OCRB 1NTMH 4H37A 4EB6A 3T1CA 3FB7C 3OMIB 4UCSA 2ZD9A 3Q4HB 2ZM6B 1OHHG 5KHKA 3L9DA 4KUMA 2PI5A 4JI4B 3CRCA 2L6LA 1JOYA 3K06A 3K5MA 2UU9O 3RYHB 1V54B 1FXHA 4FK5C 1K34A 2UUBB 4BAYA 4FLYA 3M7MX 3J81N 1PKXA 3OGCC 1EN5A 3VBBA 4U3FH 5J2UB 1P7GA 1EZJA 5JVDA 2HVJC 1J5EB 4YY3O 5H6RA 4X20B 1U96A 4DR2B 2JS5A 4JI7O 4FM1A 1XNQB 3CCVV 4PI2A 1PNMA 1G8MA 4UXNA 2WA4A 1O9HA 1ZWIC 1VQPV 2E5LO 1VMGA 4C7UA 1NTKH 1K4DC 5KHGA 2WLKA 2XTAA 1K97A 4TT3G 3UKMA 3HKCB 5IYDO 2F66C 3AG7A 3MHSC 1P7BA 5EIBD 2RJZA 2KKWA 3ABMB 1TAEA 3JAKA 2X6AA 2V1DA 4PELA 2BOCC 1MOFA 2YIAA 3E35A 1FFTB 2YC0A 3QG5A 3ZMTA 4Q20A 2HJFC 3NXSA 1IBLO 2JRIA 1Q8IA 3L70H 1SA0A 2IU0A 1DLBA 5E79Z 4R50A 1W2BU 3S3XA 4X64O 4NKGB 3SJAC 2GSMB 3E83A 4DO2A 4EEQA 4D6TH 1GM7A 2F4VO 5IDJA 3LDCA 3ZHSA 4Z2WA 5JCOC 1B6QA 4XDLA 1LNQA 3LDEA 3ZMVA 4K0KB 3S3WA 4UCOA 1I5YA 3VQWA 2JGDB 3B4SA 2VWKA 2CK3G 2YI8A 4O4IA 4DXWA 4UCRA 2QE7G 4GKJO 5CA1A 1Q43A 1ZL8A 3E8BA 4OX9O 1TUBB 4MVMA 4CS4A 4FLWA 2DQ0A 5BMVB 1DK1A 2R72A 2OT5A 3ABKB 2KSDA 3F7YC 1BGYH 1MMMA 5LMUO 3BHPA 3G4SV 1FXKC 3OD4A 3B2EE 2EZPA 2GDSA 4RWUA 1P49A 3X2QB 2M7WA 2Y69B 3ZEDA 1KMIZ 5H5NA 5KMGB 4KFMA 1RM1B 4B3RO 3I5DA 4K35A 1VF6A 4GT1A 4MTFA 3SYAA 4J7ZA 3SDLA 1S76D 3SPCA 1PV0A 3AG2B 4TV9A 4JI6B 2PF4E 2X6BA 5CMUA 1QLNA 1JFFA 1XHZA 4LFAB 2Q7HA 4U3JA 2W6JG 3RGBA 4TQDA 3RYIB 1S72V 4NTXA 1LUWA 2ZCEA 3OFNG 1WAZA 2NLJC 2LQTA 4TUYA 1US6A 1I5XA 2ZDIC 2M6YA 3ABTA 4I0XA 4DV5O 4LF8O 5LYJA 1W0JG 2QDOA 2Y0IA 1MG1A 1AJNA 2JJ2G 3OAAG 5EYPA 1NJIW 2UUCO 1OCZC 4YJ3B 2K1EA 3K5LA 4JI5O 1UFIA 2EIMB 4JI2B 4PDMA 1EN4A 1ZLZA 4UCUA 2N74A 5JWPA 5JJEB 4QNHB 1F4MA 1XMQO 1VIBA 1BE3H 3UT5B 4KXRA 2GTAA 4JI4O 4ZHQB 5B3SB 1GN3A 1H2SB 3ZRWA 1VQMV 1FAFA 1AI4A 1K8AW 4JF3A 4LF6O 3H9VA 2GBOA 3CYOA 2LGQA 3HKEB 4F6RB 2JK5C 3RYIA 1VARA 5LOVA 3EXAA 1N34B 4ICGA 1O9GA 1J5EO 3N27A 2CTRA 3AG1B 4DR2O 5ITZB 1FFXB 2PY5A 2ZQMA 1CP9A 4LF7O 2NR5A 2H3OA 4I7ZB 2A06H 2EIKC 4ZIBA 5IT9N 1M93A 3ZMUA 4H13B 4JYAO 2ATKC 3D36A 3UO3A 1HR0O 4NXNO 1K5QA 2CE4A 1D5NA 1D2DA 4BW9A 1IXMA 3N2GB 1W0KG 1DGSA 3A0HZ 4W4KA 3SYOA 1SQQH 2PYLA 3UT5A 4H44B 3RFRA 1H2GA 4JI0B 2JGUA 4ZBMA 5B1BC 3K9SA 3AK3A 2EX3A 3ZJZA 3BVOA 1R6KA 3FKSG 5LGTA 3JD2A 3CS5A 1H2KA 2DJVA 3QTCA 1L0LH 2RMKB 5KAFZ 3O65A 1YVWA 4O2BB 4AHCA 4D7TA 3A0BZ 3PJSK 4XDJA 1H2MA 4FLZA 3ETQA 5IYZA 3JCUZ 5LBQA 3JASB 3FB5C 5FPOA 2ZIMA 1KUQA 2DE0X 4K8XA 1COWG 3DTUB 2P6JA 4FLUA 2E75B 2UXNA 4LP8A 3H1JH 1FYJA 2HHHO 1F4NA 3JYCA 4QJFB 2N05A 4MVSA 2MW2B 2YICA 1GN6A 3BA9A 1WPBA 5CBHA 3E2EA 3FB6C 4R8CA 4RQEA 4NXMO 2QM8A 2YEVB 4MW8A 4J42A 3T1YB 1QHTA 3I56V 1HNXB 1S5HC 1RP3B 3OT7A 2P06A 1BHBA 4WBNA 4LF4O 1R3LC 1Y74A 2BSKA 2DYRC 4ZI7A 4B3MO 2EBOA 4UVBA 1ZTEA 1V9PA 3SPJA 2BTOA 1BQZA 2CAZC 1XL4A 3OUSA 1KBHA 2KG7A 2EJ7A 1SZTA 3FYEB 5LHIA 3ML0A 5LA6A 1I94O 2JVDA 4HNAA 3E86A 4ASUG 2ZE6A 3SJBC 3K04A 3B8MA 5GTHZ 3AEIA 1ORQC 4GUNA 5LMNO 1TVKB 2LO1A 1XOUA 3QO7A 2IH1C 4WCEV 2ZXWB 2FYUH 1SQVH 1QBZA 1NH2B 4IT5A 2FB5A 4UB8Z 2YXYA 2X7RB 4O4JA 4MSWC 2V4DA 3L73H 4ZKIA 1XNRO 3K03A 4NR1A 1XMOO 1BMFG 3B09A 5LHHA 5GONB 2V7QG 3GB7C 5H9CA 5CB4A 3JD1A 2ZINA 4DR5B 4JGSA 1DF5A 4DV6B 3HKBA 1AI7A 3CMAV 1FXVA 4JTCB 2XASA 4I50A 3E8FA 3G80A 5IYCO 1YI2V 4EB6B 4NB5A 1HNWO 3WG7B 4DR7O 5KHIA 4FZ0A 1FD9A 2Q69A 1NBMG 1Y76A 5KX5A 5KHHA 3IFXA 3ZN1A 3OE7G 1AR4A 1M57C 3CJHA 3A2FA 3LNNA 4D7SA 3ETEA 3EFFK 2XUMA 4JAUA 3IGAC 3UO2A 1V55C 1GKFA 4X1KA 4DV1B 3JD0A 1P84F 1M1KW 4JI3B 2E74B 3BPZA 1YTFD 3JALA 3M99B 4OXSA 3C3SA 5IJ0A 3ZRVA 4WF9V 5B5EZ 4MT8A 2UUAB 5JVDB 4J41A 4Q6GA 1YJWV 2XHBA 3TETA 2RN9A 1NR7A 1XILA 2Z3YA 3T4ZA 1AROP 3RW0A 1OCCB 1RPOA 2DOSA 2X6CA 1K7DA 2H94A 4DUYB 1WNSA 2UXCB 4I4TA 2YDEA 4TQFA 1E1RG 5IWAB 2ZKOA 3M8AA 1ZUQA 1N32B 5B1OA 3MDSA 3ZS8C 4MVOA 4JI8O 4QGPA 4DR4O 3LSQA 3JSLA 1IVSA 2HFEC 1XEQA 1OZ0A 5CN0A 5KUKA 1AILA 4R7CA 1MABG 4P9PA 3E22A 2VQEB 5GTIZ 1KKDA 3JAKB 1VF5B 2LP7A 3ABUA 4X66O 1NVPD 4QPJA 5JQGA 1A32A 1IZ3A 1Q86W 2DYSC 1WPXA 3OEHG 4CH5A 4Z1VA 4HAMA 1T5EA 2AW9A 1TA8A 1EM1A 3ABLB 3AG3C 1SA0B 2DMXA 4DUZB 2YUAA 3I55V 2IJJA 3WB1A 3CRAA 4GX0A 4X8AA 2UXDB 5EK0A 1OJHA 3A0RA 1GM8A 3ASOB 1HNZO 2HP8A 2HG5C 2OIGA 1KU9A 3OUFA 2JEUA 1MSWD 4BIZA 4HYOA 4MVZA 5KLVH 1VQOV 1OCRC 1VQLV 4YJ2A 4LH6A 4DR3O 4DV3B 1XBLA 5C8YA 3E8GA 3O9OA 2XAQA 1IDSA 2A3QA 3E8HA 5D5QA 4O4IB 4DR6O 2P4VA 4L87A 1K3EA 4PDRA 1HNXO 5CA1B 3JD4A 3ZHVA 1ZL8B 4N23A 2OCCB 4GKKO 1EFRG 1SQFA 1V54C 2DN9A 4X62O 3HPLC 1YDXA 1KB9F 3JATB 4HBNA 2B1IA 4DV4B 2JEXA 4ZOLA 2WPDG 2IJHA 4LR3A 4X1YA 4CS3A 3SJCC 3ZCCA 1VQ7V 3OMAB 1MZFA 1FJGO 1R3IC 2WLIA 4J9ZB 1AI5A 5JH7B 4JI1B 1N0NA 5HFMA 1EBOA 1YJ9V 2YXLA 2XOKG 3TGUH 3WB2A 2BTQB 2ZT9B 5JJNB 3C90A 1SETA 5B1AB 2G38A 2ETNA 2QKSA 3P32A 4TV9B 2IBZH 1Y66A 3H1LH 2RQ6A 1JFFB 4GX5A 4NYKA 4PV1B 1MNGA 1PPJH 4U3JB 5CA3A 1HWYA 3SYCA 2P67A 5JCOA 4LFBO 5DEDA 3GWOA 1SERA 2E76B 4TUYB 1MSDA 3MAQA 2R9IA 2JJ1G 3JATA 3OR7C 4I0XB 5LYJB 4X65B 2FL4A 4X9QA 2PTMA 4FLVA 2ITDC 5CBFA 1ZAUA 1S5JA 4DR5O 1N36B 1YIJV 5EYPB 1VF7A 3APOA 5LHGA 2QM4A 5FL7G 3J80N 1R3JC 2XAJA 2YS8A 1QVGU 1E1QG 4CBCA 4YHHB 4K8ZA 1NKDA 2R70A 5JH7A 1JJOA 3DSQA 1IBMB 1QQCA 3CCMV 2QWRB 4R6ZA 3CSXA 1SRYA 2BTQA 1KYOF 1FXKA 5K1XA 3CE2A 3ZRWB 4PA9A 3CWBH 2QWOB 4FVMA 5LP6C 2ZE8A 2KB1A 1QU7A 3IC9A 5B66Z 1BT8A 1Q6UA 4DV1O 2RCVA 1VQ5V 4WFFA 4JI3O 4DRXB 3CCUV 4B3TB 4EFEA 2OYQA 3T2MA 2CUGA 5LOVB 3DXRA 2VQFO 4IYIA 2A9HA 5J2TA 4XBFA 3UCSC 1BL8A 5LP6A 3ZMSA 4LWSB 3FX7A 2O57A 4J80A 4LF5O 3ABKC 1JQ0A 3OW2U 3EVKA 4DUYO 3ASNB 2QSAA 4W4LA 3CC2V 5B1NA 1WP8A 2ZE5A 4IIJA 1M56B 2QWNB 4LF9O 3OTOO 5KA5A 4DV7B 4JPRA 3X2QC 2Y69C 1NTZH 3JARA 2Q4PA 2DWEC 3D8CA 1Q7YW 3TJTA 1RM1C 3CC7V 1I08A 2PGGA 2ZDIA 3CHXA 1OCOC 2ZM6O 1H8EG 2CTQA 3CXCU 1SQGA 3J7AU 4JAAA 3QF7A 2VS0A 3AG2C 4WFEA 4J7JA 5IJ9A 4JV5B 1L8DA 1M5IA 4NVPA 2ZR3A 5CBGA 1SC5B 3CD6V 4GX1A 4PA7A 1XI1A 4UUJC 3OM3B 4I9WA 2IJIA 2UUBO 1VQ8V 4DRXA 1X59A 3JAWA 4PDVA 4IHJA 1Q5OA 3AK1A 5IYZB 1XL6A 2VWJA 4LWSA 1XNQO 1H2NA 4CH3A 1GO3F 2F43G 4X1IA 5BZBA 2OIEA 3MD0A 3CMEV 1YHQV 2B5UA 4AQYB 2YXHA 4TV8B 2AHYA 2EIMC 3W7SA 2F1MA 1XDCA 1WN7A 3TK1A 2P7TC 3JAMN 2Y0PA 4MVUA 4FPPA 1NS1A 3IJ4A 2IU3A 5B3SC 5IY5C 3G6EV 2IW5A 3H01A 2K9PA 3H1KH 5EZYA 1WB7A 5BR8B 3K59A 5J9PC 2AHZA 4Z1MG 1WB8A 5FNVA 4WBNB 1CPYA 5DECA 2Z5UA 3ICXA 4JYCA 1Y74B 3K5NA 3TXSA 1S3JA 2QWQB 2BSKB 4ZI7B 3ZHQA 4LNUB 4O4LA 4BW5A 2ILMA 1WA8A 1G6UA 1K9MW 4PD4F 4J9YB 4PA6A 5LGNA 3SPGA 2KG7B 5JJJB 3AG1C 2EINB 1Q3EA 5LA6B 2B1GA 1Y67A 4HNAB 3PN1A 2GTSA 2UU9B 1Q6HA 3HKDA 4I55B 5KHJA 1MZEA 3GVMA 1P4RA 5CA0B 4E2LA 4JZGA 1SS3A 4JZ2A 4A5UB 4K0KO 1NI8A 4TV8A 2WLJA 1IXBA 2HKOA 2JDIG 1SZXA 4RUFA 5KAIZ 2LW1A 3BFRA 1WLEA 4JI7B 4MVQA 1AP5A 5D5PA 5EC2C 2AGAA 1SQXH 4O4JB 4FIPC 2RDCA 5DN6G 4AI8A 2UXXA 2E5LB 5GW7A 3CCEV 4RQFA 5FPRA 2IH3C 2CGOA 1GRJA 2LFRA 3NR7A 1DF4A 2Q73A 4X65O 3SPIA 1I7FA 3WU2Z 2QR4A 2L35A 3CX5F 1NR1A 4LNUA 2PZSA 5CB4B 2AZ2A 4PJ0Z 2X0LA 4U7NA 1BZKA 3D3IA 4YHHO 3HKBB 3FAVA 2Y48A 3L71H 1PNLA 4I50B 1Z5VA 4OPAA 2VRZA 4NTYA 1NZ6A 4I55A 3AG4B 5CA0A 4BR6A 1Y76B 5KX5B 1IBLB 1IBKB 5H2FZ 4FM2A 4JI6O 3CJHB 3K0GA 4FLTA 4X64B 2HJDA 5E1AC 4L8JA 3ZX6A 4MS2A 4F6EA 4LFAO 3BEHA 4X1KB 5FLXN 3FYIB 2Q8VA 4UCTA 1YXBA 1CEZA 5LXTA 3JALB 4QE9A 1M90W 3K0DA 3L75H 4HZ3A 2F4VB 1YJNV 5IJ0B 4EKWA 1GH6A 1AP6A 2QJ1A 3TCUA 2EIJB 3ZHUA 1VP7A 4CC6A 2XNDG 3ZMZA 4GZRB 2YI9A 1XREA 2ZR2A 4G28B 1AR5A 3CXHF 3UQ8A 4I4TB 3F7VC 4CC5A 4DV7O 2A0LA 3DC6A 4GKJB 2P90A 2RNBA 1JCHA 3ZHRA 4GX2A 4JI2O 4OX9B 1F51A 1QLEB 5BY1A 1ZSPA 4LCUC 3FD9A 2Q9LA 3K57A 2ARHA 2EILC 1N8RW 3G71V 2F23A 3RT3C 3E22B 1MA1A 4KP4A 5C93A 1AVMA 4FM0A 1BQ0A 2QKCA 4QIWF 4WFHA 5JQGB 1NVPB 4B3RB 4X89A 1KD1W 1BHAA 4UCVA 1AJQA 4FFBA 1N34O 2KQXA 2WWWA 4MTOA 2XT9A 3MHHC 1K73W 2QTSA 4MVRA 3ZRXA 4MTGA 3T1HB 3AK2A 2Z0AA 3D3QA 1NH2D 3ZRSA 4LH7A 3U11A 3LUTB 2GUZB 3CRMA 3B40A 4I5SA 4B08A 4AQYO 4OGQB 2ZNIA 1RFYA 2LFSA 2ADPA 1JX9A 2NN4A 1QR9A 2XAHA 4YJ2B 1E79G 3WG7C 5C8YB 4PI0A 2Q5ZA 2LGWA 4JI0O 4DV5B 4LF8B 4GCZA 2GHYA 4JTDB 5BR8O 1SQPH 2EULA 2WLNA 3U0ZA 2UUCB 3DC5A 4JI5B 2OWOA 1XQ8A 5KA6A 4O4HA 4KHPB 2CH7B 4ZOLB 3SJQC 5A9GA 4X1YB 4FFKA 4RO2A 1XMQB 2MK3A 3KZIZ 2WLIB 5KUMA 1GM9A
chains in the Genus database with same CATH topology
1K5QA 1R3JC 2XAJA 4YXWG 1QVGU 1IXMA 1E1QG 1H38A 4CBCA 1NKDA 1W0KG 1K5SA 3SYOA 1OCCC 3WFVA 1V55B 3CCMV 2DQ3A 4R6ZA 1AR1B 1SRYA 1H8HG 2WLLA 1H2GA 1Q82W 4WFBV 4ZBMA 1FXKA 2YEVA 5B1BC 3ZRWB 4PA9A 1RPRA 3B77A 3ZJZA 1R6KA 2KB1A 5EBLC 3FKSG 1G4YB 4RAIA 5LGTA 3CCRV 3JD2A 1VQ5V 3VOUA 4WFFA 2QM7A 3RBZA 4P30A 1VQ4V 2EZOA 4CZZA 4JYBA 3AG4C 3CCUV 3T2MA 2BOBC 1QVFU 3PJSK 4XDJA 2A9HA 2ZXWC 3K08A 5LBQA 2YSUB 4XBFA 1BL8A 3ZMSA 1R73A 3SYPA 2WSSG 3HB3B 3FB5C 1QCEA 3ABKC 3P30A 1PL0A 1JQ0A 1F23A 3K9AA 3OW2U 3OMNB 3ASNB 1COWG 3DTUB 2P6JA 3CC2V 5B1NA 1GTOA 3ABLC 2UXNA 4LP8A 1M56B 5KA5A 1F4NA 4JPRA 3JYCA 3X2QC 2EIJC 2XAGA 2Y69C 4QJFB 4MVSA 2R9RB 1TUEB 2PI4A 2DWEC 1FS0G 3EHBB 1Q7YW 2WLHA 2NNUA 1RM1C 3CC7V 3ASOC 4FJCC 2OTLV 5CBHA 2ZDIA 3E2EA 3FB6C 4R8CA 2DYSB 4RQEA 1OCOC 1R3KC 4G27B 2WLLB 1H8EG 2QM8A 2OTJV 5H6QA 1K92A 1FXKB 2YEVB 4MW8A 3CXCU 4UVCA 5L3DA 1UJWB 3AG3B 3I56V 2EJRA 4WFEA 3AG2C 1S5HC 4RUEA 2ZR3A 1JJ2U 1BHBA 1QLEC 5CBGA 3CD6V 3CCSV 4GX1A 4PA7A 4JTAB 4UUJC 3OM3B 2XAFA 4I9WA 2IJIA 3CCLV 1VQ8V 1AI6A 1R3LC 4PDVA 1YSCA 4LC1A 3OEEG 1DTOA 1KP2A 2DYRC 3ZIAG 2EBOA 2QTOA 4UVBA 4UV9A 3QO5A 4JASA 3SPJA 2OCCC 2QA4V 4JAVA 5IYBO 3ABMC 1R6NA 1XL4A 3OUSA 3CCQV 1XL6A 1PNKA 1SZTA 3FYEB 5LHIA 3ML0A 4H33A 4P2ZA 5L3CA 5DM6V 3E86A 4ASUG 3B8NA 1OCRB 1GO3F 3K04A 4H37A 3B8MA 2F43G 3AEIA 3T1CA 3FB7C 1ORQC 5BZBA 3MD0A 3OMIB 2ZD9A 5EBMC 1OHHG 3QO7A 3STLC 2IH1C 3CMEV 4KUMA 1YHQV 2PI5A 2B5UA 2AHYA 3SYQA 2EIMC 1JOYA 4WCEV 2ZXWB 3K06A 3W7SA 3CCJV 1V54B 1QBZA 1FXHA 1K33A 1NH2B 3TK1A 4FK5C 1K34A 2P7TC 5FL7G 1VQ6V 4MVUA 4FPPA 4BAYA 2X7RB 5B1AC 2IU3A 5B3SC 1PKXA 3JD3A 3LSSA 3OGCC 4MSWC 5IY5C 3G6EV 3W7TA 2IW5A 3H01A 4N21A 1QR8A 3VBBA 1EZJA 2WLMA 1OCZB 5J9PC 2AHZA 4ZKIA 4Z1MG 2HVJC 3K03A 3BY6A 5H6RA 1BMFG 1CPYA 2Z5UA 4F4LA 1GMGA 4JYCA 5LHHA 3CCVV 1S3JA 2V7QG 1PNMA 1G8MA 1OCOB 1M57B 3GB7C 4UXNA 4BW5A 1K9MW 5H9CA 1ZWIC 3JD1A 4J9YB 1VQPV 4PA6A 5LGNA 2W6IG 3SPGA 2Q67A 4XDKA 4JGSA 3AG1C 1DF5A 1K4DC 2EINB 2WLKA 4PA3A 1AI7A 2B1GA 3CMAV 1FXVA 4JTCB 4TSFG 3W7XA 2XASA 1K97A 4TT3G 3UKMA 3E8FA 5IYCO 1YI2V 1Q81W 1THZA 3WG7B 5IYDO 1P4RA 2FTKA 2Q69A 4E2LA 1NBMG 3MHSC 3E89A 1P7BA 4QPKA 3IFXA 3ZN1A 3OE7G 1KC8W 1M57C 3ABMB 2WLJA 3ETEA 3EFFK 2HKOA 2JDIG 4JAUA 2X6AA 2V1DA 3IGAC 4PELA 4RUFA 2BOCC 3W7UA 1V55C 1GKFA 3JD0A 1WLEA 1MOFA 3FB8C 3E35A 1FFTB 4MVQA 5EC2C 3ZMTA 1M1KW 4Q20A 2HJFC 1YTFD 2WAMA 3M99B 3NXSA 4OXSA 3UM7A 4FIPC 1L1FA 2JIZG 5DN6G 2IU0A 2DWDC 2EIKB 1DLBA 2UXXA 4R50A 3ZRVA 1W2BU 1S0VA 5GW7A 4WF9V 3CCEV 4MT8A 3QO8A 2GSMB 3E83A 4RQFA 2IH3C 4DO2A 3TETA 3CPWU 1YJWV 1NR7A 2LFRA 2Z3YA 3T4ZA 1AROP 3RW0A 1DF4A 1OCCB 1RPOA 1NQTA 3JCZA 3SPIA 1GM7A 1PD3A 2X6CA 1K7DA 2H94A 1NR1A 5EBWC 3T4DA 5IDJA 3LDCA 1E1RG 2X0LA 3R65A 1B6QA 4U7NA 5IY5B 4XDLA 1LNQA 3LDEA 1KECA 3D3IA 5B1BB 3ZMVA 1Y4MA 5B1OA 1SESA 4P9OA 4FMTA 2Y48A 4PDLA 4MVOA 1PNLA 1S77D 3LSQA 1I5YA 3ASNC 1VQ9V 3LDDA 2HFEC 2CK3G 3AG4B 1OZ0A 1M56C 4DXWA 5CN0A 2QE7G 5KUKA 4R7CA 1MABG 4TWKA 3E8BA 4P9PA 1KKDA 4LBEC 3K0GA 1M9NA 1GK9A 5E1AC 4MVMA 2C2AA 4MS2A 2LP7A 3ABUA 3BEHA 2DQ0A 1NVPD 4QPJA 3RVYA 2OT5A 3FYIB 3ABKB 3F7YC 1Q86W 2DYSC 1WPXA 3OEHG 1CEZA 5HFLA 4QE9A 4HAMA 1FXKC 3G4SV 1M90W 3K0DA 4G2KA 5L3FA 3AG3C 3ABLB 4HZ3A 1YJNV 4EKWA 2ATKC 2EZPA 1ENVA 3IC7A 2A79B 3TCUA 3STZC 3ETDA 3X2QB 2EIJB 2M7WA 2Y69B 3I55V 2IJJA 2XNDG 3K3WA 4GX0A 3ZMZA 4X8AA 5EK0A 1RM1B 4KFMA 4MW3A 3A0RA 1GM8A 3ASOB 2ZR2A 1K4CC 4G28B 2HG5C 1JVMA 3CP1A 4GT1A 4MTFA 3SYAA 3F7VC 3OUFA 4MTXA 2A0LA 2JEUA 1MSWD 1S76D 2P90A 4BIZA 1JCHA 3SPCA 4HYOA 2ITCC 4MVZA 3AG2B 4GX2A 3KG2A 2X6BA 1VQOV 5CMUA 1F51A 1OCRC 1VQLV 1QLEB 1QLNA 4LCUC 4BIUA 2EILC 3E8GA 5EC1C 2W6JG 2XAQA 2DW4A 3E8HA 1S72V 2DYRB 5L3BA 4L87A 1N8RW 1K3EA 4PDRA 3G71V 3JD4A 3OFNG 1ROPA 4N23A 2OCCB 1EFRG 3ETGA 2NLJC 1KQSU 4KP4A 5C93A 2HLDG 1V54C 4QIWF 4WFHA 3RVZA 3HPLC 1I5XA 2ZDIC 1NVPB 2B1IA 3ABTA 2JEXA 2WPDG 2IJHA 4X89A 1KD1W 1BHAA 1W0JG 3ZCCA 1AJQA 1VQ7V 3OMAB 2HVKC 1MG1A 1AJNA 2HR3A 3LNMB 2JJ2G 3OAAG 1NJIW 2Q68A 1OCZC 2K1EA 1R3IC 2WWWA 2WLIA 4WFGA 4J9ZB 1AI5A 1KP3A 4MTOA 3MHHC 1K73W 2EIMB 4UV8A 3DGEA 3SPHA 4MVRA 4PDMA 3ZRXA 4MTGA 3QNEA 5HFMA 1EBOA 1NH2D 1YJ9V 2XOKG 3ZRSA 4QNHB 1JPXA 3LUTB 1F4MA 5LGUA 3CC4V 2IJKA 4QE7A 1SETA 4I5SA 5B1AB 5B3SB 2QKSA 3P32A 3ZRWA 1VQMV 1AI4A 2EINC 3ZN0A 1K8AW 1VQNV 4JF3A 1Y66A 2LFSA 2Q6AA 1JX9A 1QR9A 2XAHA 4PA4A 4GX5A 3CYOA 1E79G 4WFAV 3WG7C 2JK5C 1J95A 5CA3A 1HWYA 3K79A 4GCZA 3SYCA 2GHYA 4JTDB 2P67A 3OR6C 2WLNA 3F5WC 2W0FC 3AG1B 3GWOA 1SERA 2H8PC 1YITV 2R9IA 2JJ1G 1AJPA 3OR7C 4X88A 5KA6A 5L3GA 2ZQMA 1CP9A 1VQKV 3SJQC 2EILB 2D3OW 1YTFB 4RO2A 3W7WA 2QEXV 2MK3A 2EIKC 4U7OA 2ITDC 5CBFA 5L3EA 3ZMUA 1YIJV 4UVAA 5LHGA 2WLIB 3D36A 5KUMA 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPO A;  2IJJ A;  1RPR A;  4DO2 A;  1PD3 A;  2IJH A;  1B6Q A;  2GHY A;  1NKD A;  2IJI A;  1F4M A;  3K79 A;  1GMG A;  1F4N A;  1GTO A;  2IJK A;  1ROP A; 
#chains in the Genus database with same CATH topology
 4YXW G;  1H38 A;  1AB3 A;  4LF6 B;  1SKV A;  1K5S A;  1OCC C;  3WFV A;  4O2A A;  3RYC A;  2DQ3 A;  4J10 A;  3KCX A;  5A2Q N;  2GUZ A;  1H8H G;  2GV9 A;  1YEW A;  2WLL A;  2F93 B;  4WFB V;  2Q0A A;  4B7K A;  3CRR A;  2YIB D;  2YIB A;  1GAX A;  1Q90 D;  3CCR V;  3BAB A;  2QM7 A;  3RBZ A;  1VQ4 V;  4CZZ A;  4JYB A;  4CS2 A;  4LF7 B;  2BOB C;  3T1Y O;  1QVF U;  5EIB C;  1Z5W A;  3N2K A;  1RSO B;  2YID A;  4JYA B;  4NXN B;  1HR0 B;  4DV0 B;  1PM9 A;  3HB3 B;  2AXT Z;  2LW7 A;  1QCE A;  3P30 A;  1PL0 A;  2CH7 A;  4LFC B;  3ABL C;  3Q4H A;  4ABM A;  1F7Y A;  2XAG A;  4FZ1 A;  1NU1 H;  2PI4 A;  1FS0 G;  3RYH A;  2NNU A;  3ASO C;  4FJC C;  1BSM A;  2F95 B;  1D5A A;  1IBK O;  1K92 A;  1FXK B;  3SGI A;  5L3D A;  4DV2 B;  1IX9 A;  5J2U A;  4RUE A;  2Q0O C;  4I9Q A;  3JSN A;  2UXB B;  4JTA B;  4X20 A;  2XAF A;  1X4T A;  2QWP B;  2ZE7 A;  1AI6 A;  1Y6X A;  5TIS Z;  1FPO A;  1KP2 A;  2QTO A;  4UV9 A;  1RSO A;  2OCC C;  3DXR B;  2QA4 V;  3ABM C;  5J2T B;  3CCQ V;  3CRQ A;  1PNK A;  2HHH B;  5LP6 B;  1YF2 A;  1LUV A;  4CH4 A;  1QNM A;  5L3C A;  3HKC A;  4K3A A;  1U97 A;  5EBM C;  4IIJ B;  3BCC H;  4NXM B;  1SQB H;  3STL C;  1WJZ A;  4GYC B;  4DV6 O;  3SYQ A;  3JAR B;  2CDY A;  3CCJ V;  1K33 A;  2IM9 A;  3L74 H;  4LF4 B;  1HW7 A;  4DR1 B;  1VF6 C;  1VQ6 V;  3H1H H;  5B1A C;  3OTF A;  4B3M B;  3JD3 A;  3G6B A;  3LSS A;  3W7T A;  4N21 A;  1QR8 A;  5IJ9 B;  2WLM A;  1OCZ B;  2LJ2 A;  3BY6 A;  4F4L A;  3CB2 A;  1I94 B;  1GMG A;  3JAW B;  5AG2 A;  3BRC A;  4IHJ B;  2JS3 A;  2FKX A;  1JA8 A;  1OCO B;  5LMN B;  2W6I G;  2UUA O;  2Q67 A;  4XDK A;  3T1H O;  3L72 H;  3RWR D;  2W0X A;  4PA3 A;  2CGN A;  4TSF G;  3W7X A;  1Z2G A;  1Q81 W;  4X1I B;  1THZ A;  2JGD A;  4B3S B;  2UXC O;  2FTK A;  5IWA O;  3E89 A;  4QPK A;  1KC8 W;  3BAA A;  2A7W A;  1N32 O;  1TUB A;  1XNR B;  3APQ A;  1XMO B;  3W7U A;  5BMV A;  2WA3 A;  3FB8 C;  2P22 C;  2WAM A;  2QGN A;  4PHZ A;  3UM7 A;  1BCC H;  2P4K A;  2QKA A;  1L1F A;  2JIZ G;  2DWD C;  2EIK B;  2VQE O;  5EZY B;  1S0V A;  1JR9 A;  1CXZ B;  3QO8 A;  5FNV B;  1N4C A;  3CPW U;  3F5T A;  4KHP O;  4CH6 A;  5KMG A;  1NQT A;  3JCZ A;  1PD3 A;  3ZBH A;  1HNW B;  4DR7 B;  5EBW C;  3T4D A;  4O4L B;  1WA8 B;  4NTW A;  2CTP A;  3R65 A;  5IY5 B;  4KL1 A;  1N33 B;  3HR0 A;  4DUZ O;  5B1B B;  1KEC A;  1Y4M A;  1SES A;  4P9O A;  4FMT A;  4PDL A;  4DW1 A;  2UXD O;  1S77 D;  3QVN A;  3ASN C;  1VQ9 V;  1GN2 A;  1HP8 A;  3LDD A;  4UFZ A;  3HKD B;  1Q6I A;  2E3C A;  1M56 C;  4TOI A;  3TXQ A;  3D36 C;  4TWK A;  4LBE C;  1L0N H;  1M9N A;  1GK9 A;  2ODM A;  2C2A A;  2D2C B;  4EFB A;  3RYF B;  2N04 A;  4DV3 O;  1SF9 A;  3RVY A;  5HFL A;  5IE9 A;  1KKC A;  4G2K A;  5L3F A;  2PYJ A;  1ENV A;  3IC7 A;  2A79 B;  3FFQ A;  3VQX A;  1VEW A;  4YJ3 A;  3STZ C;  3ETD A;  4DV0 O;  4OPH A;  4J7K A;  1XHX A;  3K3W A;  1TGO A;  4JI8 B;  4DV4 O;  4DR4 B;  4MW3 A;  4UB6 Z;  3VQY A;  1K4C C;  4LFC O;  1JVM A;  3CP1 A;  2Y4U A;  4MTX A;  4ZHQ A;  1B04 A;  3A8T A;  2ITC C;  1R1B A;  4J11 A;  3GWK C;  1NT2 B;  3FAV B;  3KG2 A;  4JI1 O;  3THO A;  4X66 B;  4BIU A;  3HKE A;  1ZX3 A;  2R9A A;  4F6R A;  2AZ0 A;  5EC1 C;  2DW4 A;  4H0L B;  2DYR B;  5L3B A;  4FLX A;  4DV2 O;  2CTW A;  1ROP A;  3ZHT A;  1EZV H;  3KKY A;  3ETG A;  3K58 A;  1YCI A;  2UXB O;  1KQS U;  2HLD G;  5LL6 Y;  5ITZ A;  3RYF A;  3RVZ A;  4YY3 B;  1FFX A;  5LXT B;  3R66 A;  1HNZ B;  2HVK C;  2HR3 A;  3LNM B;  2B9Z A;  2Q68 A;  2FML A;  1B06 A;  2Y4T A;  4WFG A;  4DYL A;  1KP3 A;  4UV8 A;  3DGE A;  3SPH A;  1LR1 A;  3N2G A;  3QNE A;  3RN4 A;  3G67 A;  1JPX A;  4DR3 B;  5LGU A;  3CC4 V;  2IJK A;  4QE7 A;  1N36 O;  4DR6 B;  2ZIO A;  2PUS A;  2EIN C;  3ZN0 A;  1VQN V;  4GKK B;  2Q6A A;  1IBM O;  1GN4 A;  4DR1 O;  4PA4 A;  4X62 B;  4WFA V;  3OGI B;  1FKA O;  3P3N A;  1J95 A;  4O2B A;  3K79 A;  1PP9 H;  4BIO A;  4DK1 A;  4YIP A;  5F2V O;  3OR6 C;  1UPG A;  3F5W C;  2W0F C;  1FJG B;  3JAS A;  2H8P C;  1YIT V;  5L3G A;  1AJP A;  4X88 A;  4E4E A;  4B3T O;  1VQK V;  2EIL B;  2D3O W;  1YTF B;  3W7W A;  2QEX V;  5BXZ A;  4FFB B;  4U7O A;  1IUR A;  5L3E A;  1PL4 A;  1N0J A;  4UVA A;  1M57 B;  4IYH A;  3P3P A;  1XUQ A;  4IL6 Z;  4DW0 A;  3BA8 A;  1V55 B;  4B3S O;  1AR1 B;  1OV9 A;  2Q7E A;  4BWA A;  1Q82 W;  2YEV A;  3LSU A;  1RPR A;  3B77 A;  5EBL C;  1G4Y B;  4LFB B;  4RAI A;  2Q7G A;  1YZB A;  3VOU A;  4P30 A;  1BS3 A;  1W59 A;  2EZO A;  3AG4 C;  5LMU B;  3U10 A;  4JV5 O;  4DK0 A;  4JYY A;  4AIL C;  2ZXW C;  3K08 A;  1M4U A;  2YSU B;  1R73 A;  3SYP A;  2WSS G;  2ZNJ A;  3H1I H;  1F23 A;  4YIO A;  4O4H B;  3K9A A;  3OMN B;  1TVK A;  1GTO A;  1EN6 A;  1N33 O;  4IGG A;  3SR2 C;  3K5O A;  3KCY A;  2EIJ C;  2R9R B;  1TUE B;  2BCC H;  1I0H A;  3C3T A;  3EHB B;  2WLH A;  1WP7 A;  5K1P A;  3VQV A;  4GLX A;  2OTL V;  4O2A B;  3RYC B;  1HDJ A;  2DYS B;  1R3K C;  4G27 B;  2WLL B;  2OTJ V;  5H6Q A;  2OCH A;  4UVC A;  1UJW B;  3AG3 B;  1URF A;  2EJR A;  2VQF B;  1JMK C;  1B3Q A;  3IAY A;  1JJ2 U;  1QLE C;  3CCS V;  3CCL V;  3WB0 A;  4LF5 B;  1R6T A;  5GON A;  1YSC A;  4LC1 A;  3OEE G;  2P5O A;  2BE3 A;  1DTO A;  3CEI A;  1H2L A;  3ZIA G;  1G1X B;  3N2K B;  3QO5 A;  2HEP A;  4JAS A;  4JAV A;  5IYB O;  1R6N A;  4LF9 B;  3OTO B;  4B7E A;  4H33 A;  1S5L Z;  4P2Z A;  5DM6 V;  2ADQ B;  3B8N A;  1OCR B;  1NTM H;  4H37 A;  4EB6 A;  3T1C A;  3FB7 C;  3OMI B;  4UCS A;  2ZD9 A;  3Q4H B;  2ZM6 B;  1OHH G;  5KHK A;  3L9D A;  4KUM A;  2PI5 A;  4JI4 B;  3CRC A;  2L6L A;  1JOY A;  3K06 A;  3K5M A;  2UU9 O;  3RYH B;  1V54 B;  1FXH A;  4FK5 C;  1K34 A;  2UUB B;  4BAY A;  4FLY A;  3M7M X;  3J81 N;  1PKX A;  3OGC C;  1EN5 A;  3VBB A;  4U3F H;  5J2U B;  1P7G A;  1EZJ A;  5JVD A;  2HVJ C;  1J5E B;  4YY3 O;  5H6R A;  4X20 B;  1U96 A;  4DR2 B;  2JS5 A;  4JI7 O;  4FM1 A;  1XNQ B;  3CCV V;  4PI2 A;  1PNM A;  1G8M A;  4UXN A;  2WA4 A;  1O9H A;  1ZWI C;  1VQP V;  2E5L O;  1VMG A;  4C7U A;  1NTK H;  1K4D C;  5KHG A;  2WLK A;  2XTA A;  1K97 A;  4TT3 G;  3UKM A;  3HKC B;  5IYD O;  2F66 C;  3AG7 A;  3MHS C;  1P7B A;  5EIB D;  2RJZ A;  2KKW A;  3ABM B;  1TAE A;  3JAK A;  2X6A A;  2V1D A;  4PEL A;  2BOC C;  1MOF A;  2YIA A;  3E35 A;  1FFT B;  2YC0 A;  3QG5 A;  3ZMT A;  4Q20 A;  2HJF C;  3NXS A;  1IBL O;  2JRI A;  1Q8I A;  3L70 H;  1SA0 A;  2IU0 A;  1DLB A;  5E79 Z;  4R50 A;  1W2B U;  3S3X A;  4X64 O;  4NKG B;  3SJA C;  2GSM B;  3E83 A;  4DO2 A;  4EEQ A;  4D6T H;  1GM7 A;  2F4V O;  5IDJ A;  3LDC A;  3ZHS A;  4Z2W A;  5JCO C;  1B6Q A;  4XDL A;  1LNQ A;  3LDE A;  3ZMV A;  4K0K B;  3S3W A;  4UCO A;  1I5Y A;  3VQW A;  2JGD B;  3B4S A;  2VWK A;  2CK3 G;  2YI8 A;  4O4I A;  4DXW A;  4UCR A;  2QE7 G;  4GKJ O;  5CA1 A;  1Q43 A;  1ZL8 A;  3E8B A;  4OX9 O;  1TUB B;  4MVM A;  4CS4 A;  4FLW A;  2DQ0 A;  5BMV B;  1DK1 A;  2R72 A;  2OT5 A;  3ABK B;  2KSD A;  3F7Y C;  1BGY H;  1MMM A;  5LMU O;  3BHP A;  3G4S V;  1FXK C;  3OD4 A;  3B2E E;  2EZP A;  2GDS A;  4RWU A;  1P49 A;  3X2Q B;  2M7W A;  2Y69 B;  3ZED A;  1KMI Z;  5H5N A;  5KMG B;  4KFM A;  1RM1 B;  4B3R O;  3I5D A;  4K35 A;  1VF6 A;  4GT1 A;  4MTF A;  3SYA A;  4J7Z A;  3SDL A;  1S76 D;  3SPC A;  1PV0 A;  3AG2 B;  4TV9 A;  4JI6 B;  2PF4 E;  2X6B A;  5CMU A;  1QLN A;  1JFF A;  1XHZ A;  4LFA B;  2Q7H A;  4U3J A;  2W6J G;  3RGB A;  4TQD A;  3RYI B;  1S72 V;  4NTX A;  1LUW A;  2ZCE A;  3OFN G;  1WAZ A;  2NLJ C;  2LQT A;  4TUY A;  1US6 A;  1I5X A;  2ZDI C;  2M6Y A;  3ABT A;  4I0X A;  4DV5 O;  4LF8 O;  5LYJ A;  1W0J G;  2QDO A;  2Y0I A;  1MG1 A;  1AJN A;  2JJ2 G;  3OAA G;  5EYP A;  1NJI W;  2UUC O;  1OCZ C;  4YJ3 B;  2K1E A;  3K5L A;  4JI5 O;  1UFI A;  2EIM B;  4JI2 B;  4PDM A;  1EN4 A;  1ZLZ A;  4UCU A;  2N74 A;  5JWP A;  5JJE B;  4QNH B;  1F4M A;  1XMQ O;  1VIB A;  1BE3 H;  3UT5 B;  4KXR A;  2GTA A;  4JI4 O;  4ZHQ B;  5B3S B;  1GN3 A;  1H2S B;  3ZRW A;  1VQM V;  1FAF A;  1AI4 A;  1K8A W;  4JF3 A;  4LF6 O;  3H9V A;  2GBO A;  3CYO A;  2LGQ A;  3HKE B;  4F6R B;  2JK5 C;  3RYI A;  1VAR A;  5LOV A;  3EXA A;  1N34 B;  4ICG A;  1O9G A;  1J5E O;  3N27 A;  2CTR A;  3AG1 B;  4DR2 O;  5ITZ B;  1FFX B;  2PY5 A;  2ZQM A;  1CP9 A;  4LF7 O;  2NR5 A;  2H3O A;  4I7Z B;  2A06 H;  2EIK C;  4ZIB A;  5IT9 N;  1M93 A;  3ZMU A;  4H13 B;  4JYA O;  2ATK C;  3D36 A;  3UO3 A;  1HR0 O;  4NXN O;  1K5Q A;  2CE4 A;  1D5N A;  1D2D A;  4BW9 A;  1IXM A;  3N2G B;  1W0K G;  1DGS A;  3A0H Z;  4W4K A;  3SYO A;  1SQQ H;  2PYL A;  3UT5 A;  4H44 B;  3RFR A;  1H2G A;  4JI0 B;  2JGU A;  4ZBM A;  5B1B C;  3K9S A;  3AK3 A;  2EX3 A;  3ZJZ A;  3BVO A;  1R6K A;  3FKS G;  5LGT A;  3JD2 A;  3CS5 A;  1H2K A;  2DJV A;  3QTC A;  1L0L H;  2RMK B;  5KAF Z;  3O65 A;  1YVW A;  4O2B B;  4AHC A;  4D7T A;  3A0B Z;  3PJS K;  4XDJ A;  1H2M A;  4FLZ A;  3ETQ A;  5IYZ A;  3JCU Z;  5LBQ A;  3JAS B;  3FB5 C;  5FPO A;  2ZIM A;  1KUQ A;  2DE0 X;  4K8X A;  1COW G;  3DTU B;  2P6J A;  4FLU A;  2E75 B;  2UXN A;  4LP8 A;  3H1J H;  1FYJ A;  2HHH O;  1F4N A;  3JYC A;  4QJF B;  2N05 A;  4MVS A;  2MW2 B;  2YIC A;  1GN6 A;  3BA9 A;  1WPB A;  5CBH A;  3E2E A;  3FB6 C;  4R8C A;  4RQE A;  4NXM O;  2QM8 A;  2YEV B;  4MW8 A;  4J42 A;  3T1Y B;  1QHT A;  3I56 V;  1HNX B;  1S5H C;  1RP3 B;  3OT7 A;  2P06 A;  1BHB A;  4WBN A;  4LF4 O;  1R3L C;  1Y74 A;  2BSK A;  2DYR C;  4ZI7 A;  4B3M O;  2EBO A;  4UVB A;  1ZTE A;  1V9P A;  3SPJ A;  2BTO A;  1BQZ A;  2CAZ C;  1XL4 A;  3OUS A;  1KBH A;  2KG7 A;  2EJ7 A;  1SZT A;  3FYE B;  5LHI A;  3ML0 A;  5LA6 A;  1I94 O;  2JVD A;  4HNA A;  3E86 A;  4ASU G;  2ZE6 A;  3SJB C;  3K04 A;  3B8M A;  5GTH Z;  3AEI A;  1ORQ C;  4GUN A;  5LMN O;  1TVK B;  2LO1 A;  1XOU A;  3QO7 A;  2IH1 C;  4WCE V;  2ZXW B;  2FYU H;  1SQV H;  1QBZ A;  1NH2 B;  4IT5 A;  2FB5 A;  4UB8 Z;  2YXY A;  2X7R B;  4O4J A;  4MSW C;  2V4D A;  3L73 H;  4ZKI A;  1XNR O;  3K03 A;  4NR1 A;  1XMO O;  1BMF G;  3B09 A;  5LHH A;  5GON B;  2V7Q G;  3GB7 C;  5H9C A;  5CB4 A;  3JD1 A;  2ZIN A;  4DR5 B;  4JGS A;  1DF5 A;  4DV6 B;  3HKB A;  1AI7 A;  3CMA V;  1FXV A;  4JTC B;  2XAS A;  4I50 A;  3E8F A;  3G80 A;  5IYC O;  1YI2 V;  4EB6 B;  4NB5 A;  1HNW O;  3WG7 B;  4DR7 O;  5KHI A;  4FZ0 A;  1FD9 A;  2Q69 A;  1NBM G;  1Y76 A;  5KX5 A;  5KHH A;  3IFX A;  3ZN1 A;  3OE7 G;  1AR4 A;  1M57 C;  3CJH A;  3A2F A;  3LNN A;  4D7S A;  3ETE A;  3EFF K;  2XUM A;  4JAU A;  3IGA C;  3UO2 A;  1V55 C;  1GKF A;  4X1K A;  4DV1 B;  3JD0 A;  1P84 F;  1M1K W;  4JI3 B;  2E74 B;  3BPZ A;  1YTF D;  3JAL A;  3M99 B;  4OXS A;  3C3S A;  5IJ0 A;  3ZRV A;  4WF9 V;  5B5E Z;  4MT8 A;  2UUA B;  5JVD B;  4J41 A;  4Q6G A;  1YJW V;  2XHB A;  3TET A;  2RN9 A;  1NR7 A;  1XIL A;  2Z3Y A;  3T4Z A;  1ARO P;  3RW0 A;  1OCC B;  1RPO A;  2DOS A;  2X6C A;  1K7D A;  2H94 A;  4DUY B;  1WNS A;  2UXC B;  4I4T A;  2YDE A;  4TQF A;  1E1R G;  5IWA B;  2ZKO A;  3M8A A;  1ZUQ A;  1N32 B;  5B1O A;  3MDS A;  3ZS8 C;  4MVO A;  4JI8 O;  4QGP A;  4DR4 O;  3LSQ A;  3JSL A;  1IVS A;  2HFE C;  1XEQ A;  1OZ0 A;  5CN0 A;  5KUK A;  1AIL A;  4R7C A;  1MAB G;  4P9P A;  3E22 A;  2VQE B;  5GTI Z;  1KKD A;  3JAK B;  1VF5 B;  2LP7 A;  3ABU A;  4X66 O;  1NVP D;  4QPJ A;  5JQG A;  1A32 A;  1IZ3 A;  1Q86 W;  2DYS C;  1WPX A;  3OEH G;  4CH5 A;  4Z1V A;  4HAM A;  1T5E A;  2AW9 A;  1TA8 A;  1EM1 A;  3ABL B;  3AG3 C;  1SA0 B;  2DMX A;  4DUZ B;  2YUA A;  3I55 V;  2IJJ A;  3WB1 A;  3CRA A;  4GX0 A;  4X8A A;  2UXD B;  5EK0 A;  1OJH A;  3A0R A;  1GM8 A;  3ASO B;  1HNZ O;  2HP8 A;  2HG5 C;  2OIG A;  1KU9 A;  3OUF A;  2JEU A;  1MSW D;  4BIZ A;  4HYO A;  4MVZ A;  5KLV H;  1VQO V;  1OCR C;  1VQL V;  4YJ2 A;  4LH6 A;  4DR3 O;  4DV3 B;  1XBL A;  5C8Y A;  3E8G A;  3O9O A;  2XAQ A;  1IDS A;  2A3Q A;  3E8H A;  5D5Q A;  4O4I B;  4DR6 O;  2P4V A;  4L87 A;  1K3E A;  4PDR A;  1HNX O;  5CA1 B;  3JD4 A;  3ZHV A;  1ZL8 B;  4N23 A;  2OCC B;  4GKK O;  1EFR G;  1SQF A;  1V54 C;  2DN9 A;  4X62 O;  3HPL C;  1YDX A;  1KB9 F;  3JAT B;  4HBN A;  2B1I A;  4DV4 B;  2JEX A;  4ZOL A;  2WPD G;  2IJH A;  4LR3 A;  4X1Y A;  4CS3 A;  3SJC C;  3ZCC A;  1VQ7 V;  3OMA B;  1MZF A;  1FJG O;  1R3I C;  2WLI A;  4J9Z B;  1AI5 A;  5JH7 B;  4JI1 B;  1N0N A;  5HFM A;  1EBO A;  1YJ9 V;  2YXL A;  2XOK G;  3TGU H;  3WB2 A;  2BTQ B;  2ZT9 B;  5JJN B;  3C90 A;  1SET A;  5B1A B;  2G38 A;  2ETN A;  2QKS A;  3P32 A;  4TV9 B;  2IBZ H;  1Y66 A;  3H1L H;  2RQ6 A;  1JFF B;  4GX5 A;  4NYK A;  4PV1 B;  1MNG A;  1PPJ H;  4U3J B;  5CA3 A;  1HWY A;  3SYC A;  2P67 A;  5JCO A;  4LFB O;  5DED A;  3GWO A;  1SER A;  2E76 B;  4TUY B;  1MSD A;  3MAQ A;  2R9I A;  2JJ1 G;  3JAT A;  3OR7 C;  4I0X B;  5LYJ B;  4X65 B;  2FL4 A;  4X9Q A;  2PTM A;  4FLV A;  2ITD C;  5CBF A;  1ZAU A;  1S5J A;  4DR5 O;  1N36 B;  1YIJ V;  5EYP B;  1VF7 A;  3APO A;  5LHG A;  2QM4 A;  5FL7 G;  3J80 N;  1R3J C;  2XAJ A;  2YS8 A;  1QVG U;  1E1Q G;  4CBC A;  4YHH B;  4K8Z A;  1NKD A;  2R70 A;  5JH7 A;  1JJO A;  3DSQ A;  1IBM B;  1QQC A;  3CCM V;  2QWR B;  4R6Z A;  3CSX A;  1SRY A;  2BTQ A;  1KYO F;  1FXK A;  5K1X A;  3CE2 A;  3ZRW B;  4PA9 A;  3CWB H;  2QWO B;  4FVM A;  5LP6 C;  2ZE8 A;  2KB1 A;  1QU7 A;  3IC9 A;  5B66 Z;  1BT8 A;  1Q6U A;  4DV1 O;  2RCV A;  1VQ5 V;  4WFF A;  4JI3 O;  4DRX B;  3CCU V;  4B3T B;  4EFE A;  2OYQ A;  3T2M A;  2CUG A;  5LOV B;  3DXR A;  2VQF O;  4IYI A;  2A9H A;  5J2T A;  4XBF A;  3UCS C;  1BL8 A;  5LP6 A;  3ZMS A;  4LWS B;  3FX7 A;  2O57 A;  4J80 A;  4LF5 O;  3ABK C;  1JQ0 A;  3OW2 U;  3EVK A;  4DUY O;  3ASN B;  2QSA A;  4W4L A;  3CC2 V;  5B1N A;  1WP8 A;  2ZE5 A;  4IIJ A;  1M56 B;  2QWN B;  4LF9 O;  3OTO O;  5KA5 A;  4DV7 B;  4JPR A;  3X2Q C;  2Y69 C;  1NTZ H;  3JAR A;  2Q4P A;  2DWE C;  3D8C A;  1Q7Y W;  3TJT A;  1RM1 C;  3CC7 V;  1I08 A;  2PGG A;  2ZDI A;  3CHX A;  1OCO C;  2ZM6 O;  1H8E G;  2CTQ A;  3CXC U;  1SQG A;  3J7A U;  4JAA A;  3QF7 A;  2VS0 A;  3AG2 C;  4WFE A;  4J7J A;  5IJ9 A;  4JV5 B;  1L8D A;  1M5I A;  4NVP A;  2ZR3 A;  5CBG A;  1SC5 B;  3CD6 V;  4GX1 A;  4PA7 A;  1XI1 A;  4UUJ C;  3OM3 B;  4I9W A;  2IJI A;  2UUB O;  1VQ8 V;  4DRX A;  1X59 A;  3JAW A;  4PDV A;  4IHJ A;  1Q5O A;  3AK1 A;  5IYZ B;  1XL6 A;  2VWJ A;  4LWS A;  1XNQ O;  1H2N A;  4CH3 A;  1GO3 F;  2F43 G;  4X1I A;  5BZB A;  2OIE A;  3MD0 A;  3CME V;  1YHQ V;  2B5U A;  4AQY B;  2YXH A;  4TV8 B;  2AHY A;  2EIM C;  3W7S A;  2F1M A;  1XDC A;  1WN7 A;  3TK1 A;  2P7T C;  3JAM N;  2Y0P A;  4MVU A;  4FPP A;  1NS1 A;  3IJ4 A;  2IU3 A;  5B3S C;  5IY5 C;  3G6E V;  2IW5 A;  3H01 A;  2K9P A;  3H1K H;  5EZY A;  1WB7 A;  5BR8 B;  3K59 A;  5J9P C;  2AHZ A;  4Z1M G;  1WB8 A;  5FNV A;  4WBN B;  1CPY A;  5DEC A;  2Z5U A;  3ICX A;  4JYC A;  1Y74 B;  3K5N A;  3TXS A;  1S3J A;  2QWQ B;  2BSK B;  4ZI7 B;  3ZHQ A;  4LNU B;  4O4L A;  4BW5 A;  2ILM A;  1WA8 A;  1G6U A;  1K9M W;  4PD4 F;  4J9Y B;  4PA6 A;  5LGN A;  3SPG A;  2KG7 B;  5JJJ B;  3AG1 C;  2EIN B;  1Q3E A;  5LA6 B;  2B1G A;  1Y67 A;  4HNA B;  3PN1 A;  2GTS A;  2UU9 B;  1Q6H A;  3HKD A;  4I55 B;  5KHJ A;  1MZE A;  3GVM A;  1P4R A;  5CA0 B;  4E2L A;  4JZG A;  1SS3 A;  4JZ2 A;  4A5U B;  4K0K O;  1NI8 A;  4TV8 A;  2WLJ A;  1IXB A;  2HKO A;  2JDI G;  1SZX A;  4RUF A;  5KAI Z;  2LW1 A;  3BFR A;  1WLE A;  4JI7 B;  4MVQ A;  1AP5 A;  5D5P A;  5EC2 C;  2AGA A;  1SQX H;  4O4J B;  4FIP C;  2RDC A;  5DN6 G;  4AI8 A;  2UXX A;  2E5L B;  5GW7 A;  3CCE V;  4RQF A;  5FPR A;  2IH3 C;  2CGO A;  1GRJ A;  2LFR A;  3NR7 A;  1DF4 A;  2Q73 A;  4X65 O;  3SPI A;  1I7F A;  3WU2 Z;  2QR4 A;  2L35 A;  3CX5 F;  1NR1 A;  4LNU A;  2PZS A;  5CB4 B;  2AZ2 A;  4PJ0 Z;  2X0L A;  4U7N A;  1BZK A;  3D3I A;  4YHH O;  3HKB B;  3FAV A;  2Y48 A;  3L71 H;  1PNL A;  4I50 B;  1Z5V A;  4OPA A;  2VRZ A;  4NTY A;  1NZ6 A;  4I55 A;  3AG4 B;  5CA0 A;  4BR6 A;  1Y76 B;  5KX5 B;  1IBL B;  1IBK B;  5H2F Z;  4FM2 A;  4JI6 O;  3CJH B;  3K0G A;  4FLT A;  4X64 B;  2HJD A;  5E1A C;  4L8J A;  3ZX6 A;  4MS2 A;  4F6E A;  4LFA O;  3BEH A;  4X1K B;  5FLX N;  3FYI B;  2Q8V A;  4UCT A;  1YXB A;  1CEZ A;  5LXT A;  3JAL B;  4QE9 A;  1M90 W;  3K0D A;  3L75 H;  4HZ3 A;  2F4V B;  1YJN V;  5IJ0 B;  4EKW A;  1GH6 A;  1AP6 A;  2QJ1 A;  3TCU A;  2EIJ B;  3ZHU A;  1VP7 A;  4CC6 A;  2XND G;  3ZMZ A;  4GZR B;  2YI9 A;  1XRE A;  2ZR2 A;  4G28 B;  1AR5 A;  3CXH F;  3UQ8 A;  4I4T B;  3F7V C;  4CC5 A;  4DV7 O;  2A0L A;  3DC6 A;  4GKJ B;  2P90 A;  2RNB A;  1JCH A;  3ZHR A;  4GX2 A;  4JI2 O;  4OX9 B;  1F51 A;  1QLE B;  5BY1 A;  1ZSP A;  4LCU C;  3FD9 A;  2Q9L A;  3K57 A;  2ARH A;  2EIL C;  1N8R W;  3G71 V;  2F23 A;  3RT3 C;  3E22 B;  1MA1 A;  4KP4 A;  5C93 A;  1AVM A;  4FM0 A;  1BQ0 A;  2QKC A;  4QIW F;  4WFH A;  5JQG B;  1NVP B;  4B3R B;  4X89 A;  1KD1 W;  1BHA A;  4UCV A;  1AJQ A;  4FFB A;  1N34 O;  2KQX A;  2WWW A;  4MTO A;  2XT9 A;  3MHH C;  1K73 W;  2QTS A;  4MVR A;  3ZRX A;  4MTG A;  3T1H B;  3AK2 A;  2Z0A A;  3D3Q A;  1NH2 D;  3ZRS A;  4LH7 A;  3U11 A;  3LUT B;  2GUZ B;  3CRM A;  3B40 A;  4I5S A;  4B08 A;  4AQY O;  4OGQ B;  2ZNI A;  1RFY A;  2LFS A;  2ADP A;  1JX9 A;  2NN4 A;  1QR9 A;  2XAH A;  4YJ2 B;  1E79 G;  3WG7 C;  5C8Y B;  4PI0 A;  2Q5Z A;  2LGW A;  4JI0 O;  4DV5 B;  4LF8 B;  4GCZ A;  2GHY A;  4JTD B;  5BR8 O;  1SQP H;  2EUL A;  2WLN A;  3U0Z A;  2UUC B;  3DC5 A;  4JI5 B;  2OWO A;  1XQ8 A;  5KA6 A;  4O4H A;  4KHP B;  2CH7 B;  4ZOL B;  3SJQ C;  5A9G A;  4X1Y B;  4FFK A;  4RO2 A;  1XMQ B;  2MK3 A;  3KZI Z;  2WLI B;  5KUM A;  1GM9 A; 
#chains in the Genus database with same CATH homology
 1K5Q A;  1R3J C;  2XAJ A;  4YXW G;  1QVG U;  1IXM A;  1E1Q G;  1H38 A;  4CBC A;  1NKD A;  1W0K G;  1K5S A;  3SYO A;  1OCC C;  3WFV A;  1V55 B;  3CCM V;  2DQ3 A;  4R6Z A;  1AR1 B;  1SRY A;  1H8H G;  2WLL A;  1H2G A;  1Q82 W;  4WFB V;  4ZBM A;  1FXK A;  2YEV A;  5B1B C;  3ZRW B;  4PA9 A;  1RPR A;  3B77 A;  3ZJZ A;  1R6K A;  2KB1 A;  5EBL C;  3FKS G;  1G4Y B;  4RAI A;  5LGT A;  3CCR V;  3JD2 A;  1VQ5 V;  3VOU A;  4WFF A;  2QM7 A;  3RBZ A;  4P30 A;  1VQ4 V;  2EZO A;  4CZZ A;  4JYB A;  3AG4 C;  3CCU V;  3T2M A;  2BOB C;  1QVF U;  3PJS K;  4XDJ A;  2A9H A;  2ZXW C;  3K08 A;  5LBQ A;  2YSU B;  4XBF A;  1BL8 A;  3ZMS A;  1R73 A;  3SYP A;  2WSS G;  3HB3 B;  3FB5 C;  1QCE A;  3ABK C;  3P30 A;  1PL0 A;  1JQ0 A;  1F23 A;  3K9A A;  3OW2 U;  3OMN B;  3ASN B;  1COW G;  3DTU B;  2P6J A;  3CC2 V;  5B1N A;  1GTO A;  3ABL C;  2UXN A;  4LP8 A;  1M56 B;  5KA5 A;  1F4N A;  4JPR A;  3JYC A;  3X2Q C;  2EIJ C;  2XAG A;  2Y69 C;  4QJF B;  4MVS A;  2R9R B;  1TUE B;  2PI4 A;  2DWE C;  1FS0 G;  3EHB B;  1Q7Y W;  2WLH A;  2NNU A;  1RM1 C;  3CC7 V;  3ASO C;  4FJC C;  2OTL V;  5CBH A;  2ZDI A;  3E2E A;  3FB6 C;  4R8C A;  2DYS B;  4RQE A;  1OCO C;  1R3K C;  4G27 B;  2WLL B;  1H8E G;  2QM8 A;  2OTJ V;  5H6Q A;  1K92 A;  1FXK B;  2YEV B;  4MW8 A;  3CXC U;  4UVC A;  5L3D A;  1UJW B;  3AG3 B;  3I56 V;  2EJR A;  4WFE A;  3AG2 C;  1S5H C;  4RUE A;  2ZR3 A;  1JJ2 U;  1BHB A;  1QLE C;  5CBG A;  3CD6 V;  3CCS V;  4GX1 A;  4PA7 A;  4JTA B;  4UUJ C;  3OM3 B;  2XAF A;  4I9W A;  2IJI A;  3CCL V;  1VQ8 V;  1AI6 A;  1R3L C;  4PDV A;  1YSC A;  4LC1 A;  3OEE G;  1DTO A;  1KP2 A;  2DYR C;  3ZIA G;  2EBO A;  2QTO A;  4UVB A;  4UV9 A;  3QO5 A;  4JAS A;  3SPJ A;  2OCC C;  2QA4 V;  4JAV A;  5IYB O;  3ABM C;  1R6N A;  1XL4 A;  3OUS A;  3CCQ V;  1XL6 A;  1PNK A;  1SZT A;  3FYE B;  5LHI A;  3ML0 A;  4H33 A;  4P2Z A;  5L3C A;  5DM6 V;  3E86 A;  4ASU G;  3B8N A;  1OCR B;  1GO3 F;  3K04 A;  4H37 A;  3B8M A;  2F43 G;  3AEI A;  3T1C A;  3FB7 C;  1ORQ C;  5BZB A;  3MD0 A;  3OMI B;  2ZD9 A;  5EBM C;  1OHH G;  3QO7 A;  3STL C;  2IH1 C;  3CME V;  4KUM A;  1YHQ V;  2PI5 A;  2B5U A;  2AHY A;  3SYQ A;  2EIM C;  1JOY A;  4WCE V;  2ZXW B;  3K06 A;  3W7S A;  3CCJ V;  1V54 B;  1QBZ A;  1FXH A;  1K33 A;  1NH2 B;  3TK1 A;  4FK5 C;  1K34 A;  2P7T C;  5FL7 G;  1VQ6 V;  4MVU A;  4FPP A;  4BAY A;  2X7R B;  5B1A C;  2IU3 A;  5B3S C;  1PKX A;  3JD3 A;  3LSS A;  3OGC C;  4MSW C;  5IY5 C;  3G6E V;  3W7T A;  2IW5 A;  3H01 A;  4N21 A;  1QR8 A;  3VBB A;  1EZJ A;  2WLM A;  1OCZ B;  5J9P C;  2AHZ A;  4ZKI A;  4Z1M G;  2HVJ C;  3K03 A;  3BY6 A;  5H6R A;  1BMF G;  1CPY A;  2Z5U A;  4F4L A;  1GMG A;  4JYC A;  5LHH A;  3CCV V;  1S3J A;  2V7Q G;  1PNM A;  1G8M A;  1OCO B;  1M57 B;  3GB7 C;  4UXN A;  4BW5 A;  1K9M W;  5H9C A;  1ZWI C;  3JD1 A;  4J9Y B;  1VQP V;  4PA6 A;  5LGN A;  2W6I G;  3SPG A;  2Q67 A;  4XDK A;  4JGS A;  3AG1 C;  1DF5 A;  1K4D C;  2EIN B;  2WLK A;  4PA3 A;  1AI7 A;  2B1G A;  3CMA V;  1FXV A;  4JTC B;  4TSF G;  3W7X A;  2XAS A;  1K97 A;  4TT3 G;  3UKM A;  3E8F A;  5IYC O;  1YI2 V;  1Q81 W;  1THZ A;  3WG7 B;  5IYD O;  1P4R A;  2FTK A;  2Q69 A;  4E2L A;  1NBM G;  3MHS C;  3E89 A;  1P7B A;  4QPK A;  3IFX A;  3ZN1 A;  3OE7 G;  1KC8 W;  1M57 C;  3ABM B;  2WLJ A;  3ETE A;  3EFF K;  2HKO A;  2JDI G;  4JAU A;  2X6A A;  2V1D A;  3IGA C;  4PEL A;  4RUF A;  2BOC C;  3W7U A;  1V55 C;  1GKF A;  3JD0 A;  1WLE A;  1MOF A;  3FB8 C;  3E35 A;  1FFT B;  4MVQ A;  5EC2 C;  3ZMT A;  1M1K W;  4Q20 A;  2HJF C;  1YTF D;  2WAM A;  3M99 B;  3NXS A;  4OXS A;  3UM7 A;  4FIP C;  1L1F A;  2JIZ G;  5DN6 G;  2IU0 A;  2DWD C;  2EIK B;  1DLB A;  2UXX A;  4R50 A;  3ZRV A;  1W2B U;  1S0V A;  5GW7 A;  4WF9 V;  3CCE V;  4MT8 A;  3QO8 A;  2GSM B;  3E83 A;  4RQF A;  2IH3 C;  4DO2 A;  3TET A;  3CPW U;  1YJW V;  1NR7 A;  2LFR A;  2Z3Y A;  3T4Z A;  1ARO P;  3RW0 A;  1DF4 A;  1OCC B;  1RPO A;  1NQT A;  3JCZ A;  3SPI A;  1GM7 A;  1PD3 A;  2X6C A;  1K7D A;  2H94 A;  1NR1 A;  5EBW C;  3T4D A;  5IDJ A;  3LDC A;  1E1R G;  2X0L A;  3R65 A;  1B6Q A;  4U7N A;  5IY5 B;  4XDL A;  1LNQ A;  3LDE A;  1KEC A;  3D3I A;  5B1B B;  3ZMV A;  1Y4M A;  5B1O A;  1SES A;  4P9O A;  4FMT A;  2Y48 A;  4PDL A;  4MVO A;  1PNL A;  1S77 D;  3LSQ A;  1I5Y A;  3ASN C;  1VQ9 V;  3LDD A;  2HFE C;  2CK3 G;  3AG4 B;  1OZ0 A;  1M56 C;  4DXW A;  5CN0 A;  2QE7 G;  5KUK A;  4R7C A;  1MAB G;  4TWK A;  3E8B A;  4P9P A;  1KKD A;  4LBE C;  3K0G A;  1M9N A;  1GK9 A;  5E1A C;  4MVM A;  2C2A A;  4MS2 A;  2LP7 A;  3ABU A;  3BEH A;  2DQ0 A;  1NVP D;  4QPJ A;  3RVY A;  2OT5 A;  3FYI B;  3ABK B;  3F7Y C;  1Q86 W;  2DYS C;  1WPX A;  3OEH G;  1CEZ A;  5HFL A;  4QE9 A;  4HAM A;  1FXK C;  3G4S V;  1M90 W;  3K0D A;  4G2K A;  5L3F A;  3AG3 C;  3ABL B;  4HZ3 A;  1YJN V;  4EKW A;  2ATK C;  2EZP A;  1ENV A;  3IC7 A;  2A79 B;  3TCU A;  3STZ C;  3ETD A;  3X2Q B;  2EIJ B;  2M7W A;  2Y69 B;  3I55 V;  2IJJ A;  2XND G;  3K3W A;  4GX0 A;  3ZMZ A;  4X8A A;  5EK0 A;  1RM1 B;  4KFM A;  4MW3 A;  3A0R A;  1GM8 A;  3ASO B;  2ZR2 A;  1K4C C;  4G28 B;  2HG5 C;  1JVM A;  3CP1 A;  4GT1 A;  4MTF A;  3SYA A;  3F7V C;  3OUF A;  4MTX A;  2A0L A;  2JEU A;  1MSW D;  1S76 D;  2P90 A;  4BIZ A;  1JCH A;  3SPC A;  4HYO A;  2ITC C;  4MVZ A;  3AG2 B;  4GX2 A;  3KG2 A;  2X6B A;  1VQO V;  5CMU A;  1F51 A;  1OCR C;  1VQL V;  1QLE B;  1QLN A;  4LCU C;  4BIU A;  2EIL C;  3E8G A;  5EC1 C;  2W6J G;  2XAQ A;  2DW4 A;  3E8H A;  1S72 V;  2DYR B;  5L3B A;  4L87 A;  1N8R W;  1K3E A;  4PDR A;  3G71 V;  3JD4 A;  3OFN G;  1ROP A;  4N23 A;  2OCC B;  1EFR G;  3ETG A;  2NLJ C;  1KQS U;  4KP4 A;  5C93 A;  2HLD G;  1V54 C;  4QIW F;  4WFH A;  3RVZ A;  3HPL C;  1I5X A;  2ZDI C;  1NVP B;  2B1I A;  3ABT A;  2JEX A;  2WPD G;  2IJH A;  4X89 A;  1KD1 W;  1BHA A;  1W0J G;  3ZCC A;  1AJQ A;  1VQ7 V;  3OMA B;  2HVK C;  1MG1 A;  1AJN A;  2HR3 A;  3LNM B;  2JJ2 G;  3OAA G;  1NJI W;  2Q68 A;  1OCZ C;  2K1E A;  1R3I C;  2WWW A;  2WLI A;  4WFG A;  4J9Z B;  1AI5 A;  1KP3 A;  4MTO A;  3MHH C;  1K73 W;  2EIM B;  4UV8 A;  3DGE A;  3SPH A;  4MVR A;  4PDM A;  3ZRX A;  4MTG A;  3QNE A;  5HFM A;  1EBO A;  1NH2 D;  1YJ9 V;  2XOK G;  3ZRS A;  4QNH B;  1JPX A;  3LUT B;  1F4M A;  5LGU A;  3CC4 V;  2IJK A;  4QE7 A;  1SET A;  4I5S A;  5B1A B;  5B3S B;  2QKS A;  3P32 A;  3ZRW A;  1VQM V;  1AI4 A;  2EIN C;  3ZN0 A;  1K8A W;  1VQN V;  4JF3 A;  1Y66 A;  2LFS A;  2Q6A A;  1JX9 A;  1QR9 A;  2XAH A;  4PA4 A;  4GX5 A;  3CYO A;  1E79 G;  4WFA V;  3WG7 C;  2JK5 C;  1J95 A;  5CA3 A;  1HWY A;  3K79 A;  4GCZ A;  3SYC A;  2GHY A;  4JTD B;  2P67 A;  3OR6 C;  2WLN A;  3F5W C;  2W0F C;  3AG1 B;  3GWO A;  1SER A;  2H8P C;  1YIT V;  2R9I A;  2JJ1 G;  1AJP A;  3OR7 C;  4X88 A;  5KA6 A;  5L3G A;  2ZQM A;  1CP9 A;  1VQK V;  3SJQ C;  2EIL B;  2D3O W;  1YTF B;  4RO2 A;  3W7W A;  2QEX V;  2MK3 A;  2EIK C;  4U7O A;  2ITD C;  5CBF A;  5L3E A;  3ZMU A;  1YIJ V;  4UVA A;  5LHG A;  2WLI B;  3D36 A;  5KUM A;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...