2HJFC

Potassium channel kcsa-fab complex with tetrabutylammonium (tba)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Antibody fragment Heavy chain
publication title Mechanism of Intracellular Block of the KcsA K(+) Channel by Tetrabutylammonium: Insights from X-ray Crystallography, Electrophysiology and Replica-exchange Molecular Dynamics Simulations.
pubmed doi rcsb
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hjfC00
3LUTB 4I9WA 4R7CA 4G27B 3HPLC 3T4ZA 2ITDC 4MVMA 3STLC 2Q69A 3FB5C 3RVZA 3X2QC 4XDJA 1OCZC 3SYCA 2HJFC 4MVUA 3K0DA 4GX2A 4X89A 3STZC 3AG2C 3ABLC 4MVOA 1R3KC 4MTOA 1R3JC 2A9HA 2HG5C 4F4LA 4JTDB 4MVZA 1R3LC 4R8CA 4X88A 4JTAB 3RVYA 2WLJA 1K4CC 4J9ZB 3T2MA 2Q6AA 3OGCC 5EBLC 5J9PC 4XDLA 1OCCC 3EFFK 1S5HC 3SYOA 2AHYA 3E8HA 4MVSA 2QKSA 2Q67A 2X6CA 3JYCA 3ZRSA 5EBMC 2EIMC 3K04A 4MVRA 2EILC 2DWEC 2WLIA 4KFMA 4LCUC 4MTFA 4PDMA 2K1EA 3SPHA 1V55C 4TWKA 3SPJA 2HFEC 3SYQA 1ZWIC 5EK0A 1ORQC 3T1CA 5BZBA 1R3IC 2DYRC 2WLLB 3KG2A 4LP8A 4MW8A 3SPIA 3TETA 1K4DC 4DXWA 4GX1A 1P7BA 4WFHA 5CBHA 2ITCC 3F7YC 4PA9A 2NLJC 1BL8A 3OUSA 1J95A 2WLMA 3R65A 4MVQA 4RUEA 4BW5A 3PJSK 4QE9A 3K08A 5CBFA 4WFFA 5B1BC 4RAIA 3AG1C 3ZJZA 2EINC 3AG3C 3BEHA 2QTOA 3UM7A 2A0LA 2A79B 3K06A 3VOUA 4LBEC 3SPGA 1OCRC 3SYPA 2EIJC 2ZXWC 2W0FC 4QE7A 4R6ZA 1M57C 3FB8C 5EBWC 1JVMA 4P9PA 3UKMA 1OCOC 3ABMC 3SYAA 4R50A 4MSWC 1QLEC 2WLHA 3F5WC 2KB1A 5KUMA 3LDEA 3GB7C 2OCCC 3LDDA 3OR6C 4P30A 2DWDC 3T4DA 4EKWA 2AHZA 4UUJC 4GX0A 3IGAC 5IY5C 2WLNA 3E8FA 4P2ZA 4PA6A 4P9OA 4J9YB 4JTCB 4X8AA 3TCUA 2P7TC 2X6AA 3K03A 4WFGA 5B3SC 2WLLA 3RW0A 2ATKC 4MS2A 4WFEA 3E86A 4G28B 4RO2A 2HVJC 3SPCA 2IH3C 3E89A 1V54C 1G4YB 3ASOC 3SJQC 2Y69C 2WLKA 4XDKA 4PA3A 3OR7C 2X6BA 2BOCC 1LNQA 3K0GA 5E1AC 4H33A 4PA7A 3E83A 3WG7C 1XL4A 3LDCA 2HVKC 4MTGA 4PDVA 3ABKC 3RBZA 5EC2C 4PDLA 4PDRA 3F7VC 5KUKA 2WLIB 4RUFA 4OXSA 2IH1C 3AG4C 1M56C 2ZD9A 4HZ3A 2H8PC 3ASNC 5EC1C 4PA4A 5CBGA 4CBCA 2YEVA 3OUFA 2DYSC 2Q68A 2R9RB 5B1AC 1XL6A 3IFXA 4QNHB 2EIKC 3E8BA 3E8GA 4ZBMA 4HYOA 2JK5C 4GX5A 4MW3A 3FB7C 2BOBC 3LNMB 4H37A 1KKDA 3FB6C
chains in the Genus database with same CATH superfamily
1VMGA 1K9MW 5EZYA 4EB6B 1N36O 1QU7A 4GCZA 2ILMA 4FMTA 2QKAA 3DXRA 3N27A 1Y6XA 1E1QG 1RFYA 4FLVA 2Q6AA 2UXXA 3JARA 4FFBA 1IVSA 4CC5A 2QKSA 2Q67A 3CP1A 3MHSC 3U10A 2DJVA 2Z5UA 2YIBD 1PV0A 4LCUC 3CCSV 5LBQA 2HP8A 1P84F 1WJZA 1Q81W 3OUSA 2VQEB 3VQVA 4LF5O 4CH5A 2GBOA 4IIJA 3N2GB 2Y0PA 1MSDA 3GWKC 3FYIB 2ZE7A 2WSSG 4KP4A 2YXLA 3RYFA 2OWOA 1OCOC 4DV7B 4O4JA 4N23A 4NKGB 1HNWB 1OHHG 2E74B 3ZMVA 4PA6A 2B5UA 3KZIZ 3K03A 5H5NA 3MHHC 1P4RA 1SQGA 3SJQC 2GV9A 2Y69C 2FTKA 3AK2A 2L6LA 1XI1A 2UUCB 2LFRA 3DC6A 3ZHSA 4U3JA 3ZRWB 3W7WA 3CRRA 4YJ3B 1OZ0A 1BCCH 3JCUZ 1S3JA 1K34A 4RQEA 5CBGA 2MW2B 3CCJV 1CPYA 2DYSC 3K9AA 5CMUA 5B1AC 3ZRXA 3OEHG 2OT5A 1M57B 1JQ0A 5KLVH 3P30A 3HPLC 4B7EA 3LSSA 3STLC 5AG2A 3X2QC 2JGDA 3WB2A 5BMVA 1YJNV 4DV1B 3ZIAG 1FXKB 1VQ7V 4O4IB 1R3LC 1LUWA 3T2MA 2IU0A 1TGOA 1NTKH 4JYAB 1QCEA 3JAWB 4K3AA 2E75B 4B3RO 4YXWG 3SDLA 2ZINA 1Q5OA 3RYCA 2OYQA 5BZBA 5IYDO 4E2LA 1YTFB 4GX1A 5LA6B 4YJ2A 1QR9A 3ML0A 3SJAC 3F7YC 4RUEA 3PJSK 3G67A 5L3FA 1W2BU 2QTOA 4ZHQB 1WA8A 3R66A 1OCRC 1MSWD 4DR1B 1I7FA 3FB8C 1Y4MA 4DV0O 1AI7A 5HFLA 1VQKV 2YIBA 4MSWC 5IJ0A 4L87A 2DWDC 5C93A 2E5LB 3LSQA 2P7TC 2Q0OC 5LOVA 3CRCA 4LFCO 3ZHRA 3ASOC 2QWOB 1PKXA 2UUBO 1SQBH 2QA4V 4TQDA 4JYYA 4F6RA 3RBZA 1AJNA 4LF7O 1XOUA 2QWQB 4DV4B 3AG4C 1M56C 4HZ3A 5EC1C 3K58A 2UU9B 4D7TA 2DMXA 1F4MA 3HKCB 4JZGA 2IJJA 3FAVB 4ZOLB 1BQZA 3JD4A 4JI8O 2QM8A 1YHQV 3CRAA 1N33O 1XHZA 2HG5C 4U7OA 4MVZA 1S77D 1H8EG 1RPOA 4J9ZB 3TXQA 2DQ0A 5LP6C 1H2MA 1PL4A 5FL7G 2Y69B 4X20B 2ZKOA 4MVRA 3SPJA 1Q7YW 4TWKA 1EN5A 1TUBA 3LSUA 2M6YA 3APQA 4CH4A 2CH7A 2LFSA 1YJ9V 5HFMA 5EK0A 4H13B 2WLLB 1K4DC 4K35A 1HNXB 1M9NA 2Y48A 4PA9A 5J2TA 1WPXA 4MVQA 3H1IH 1N32O 1SERA 5JCOC 5JJJB 2P22C 2AGAA 5JWPA 2A79B 3VOUA 1Q6UA 2EILB 1SKVA 3UCSC 1AR4A 2VQEO 5KA5A 4UVBA 4NR1A 1GO3F 4GKJO 3CS5A 2F93B 4WFGA 1KP3A 3RYIA 4DR7B 4DV7O 5CB4B 4DUYB 1NS1A 2XASA 1H38A 2VS0A 1HNWO 5H6RA 4JI2B 5E1AC 3T1HO 1FPOA 2HKOA 4LNUA 2X0LA 2P06A 3ABKC 3SJCC 1AR1B 2A06H 3F7VC 1GM9A 4FJCC 2H8PC 1KC8W 2UUCO 4J7KA 5IWAB 3L9DA 2YIDA 4X1IB 3CB2A 3DC5A 4FVMA 1FFXA 3UT5B 5C8YB 2CTQA 4WFAV 2JK5C 3T4ZA 2Z3YA 2PUSA 3A0BZ 4CS2A 2FYUH 3RFRA 2XNDG 3J80N 1GM8A 2QGNA 5BR8B 4JV5B 3P3PA 3JYCA 3ASOB 3T1YO 5K1PA 1SETA 1VQMV 3SGIA 4PDMA 4WF9V 1K7DA 4DV1O 2P4KA 2Q7EA 1MOFA 4DW0A 4JGSA 4FLZA 4O2BB 4OPAA 1NT2B 1F7YA 4JYAO 5JQGB 1M56B 4DYLA 1BGYH 1QHTA 4YY3B 2P5OA 5D5PA 3F5TA 4LBEC 2VWKA 2W0FC 3N2KA 1WLEA 3UKMA 2X7RB 4LC1A 4DR4B 3OR6C 3IGAC 4DR1O 3ZEDA 2ZCEA 4J9YB 4MT8A 4X8AA 3Q4HB 5KAIZ 2C2AA 3CMAV 3E86A 3CC7V 4I0XA 4WCEV 3L71H 1KYOF 5IJ9B 4U7NA 2E5LO 2YIAA 5KX5A 1P49A 4MTGA 4FM2A 1Y74B 3W7XA 3BVOA 3K57A 1VEWA 3ZHTA 3ASNC 4JI0O 5CA0A 1SQQH 2YEVA 3QO8A 3QTCA 3ETDA 2KG7B 4DV4O 1RPRA 3ZMTA 1TUEB 2UU9O 1L0NH 1R73A 3K0DA 2CTPA 3STZC 2AXTZ 4LWSA 4F4LA 1N34B 5EYPA 4CH6A 4J42A 2W6JG 4EFEA 1XNRB 3ZBHA 4BIUA 1R6KA 2RJZA 4TUYA 1QR8A 1H2KA 2ZT9B 4I5SA 1NI8A 3JAKA 2BTQA 2JVDA 1WPBA 4PI0A 1I94B 3K08A 1JR9A 1XBLA 2NN4A 1TVKB 3HKDB 1HNXO 4HNAB 1UFIA 1G6UA 2OIEA 4R6ZA 5LXTA 4DR3B 5EBWC 4JAAA 1MZFA 1NU1H 3JASB 2RCVA 1PNKA 3WFVA 4JZ2A 1E79G 3RWRD 1XREA 2Q0AA 4DV3B 1N0JA 5EZYB 1XMQB 3G80A 3BA8A 1BHAA 4P9OA 2YC0A 4YIOA 3CWBH 3DXRB 4JI5O 1IXMA 4TV8A 2M7WA 3BRCA 4GKKB 2YI8A 5JH7A 3JARB 5GW7A 3BABA 4TQFA 4CS4A 1W59A 1BE3H 4UVCA 1THZA 3ZS8C 2XTAA 4JI7B 2CAZC 1PM9A 1FFTB 4RUFA 4LF8B 4JI2O 3IAYA 1R1BA 1HNZB 2FKXA 3H1LH 1KKDA 2K9PA 3FB6C 1VP7A 1OJHA 4IIJB 2VWJA 5IWAO 2XAGA 3K5LA 2WAMA 1VQ4V 4JI3B 2WA4A 1FS0G 4WBNA 2DQ3A 3QO7A 4FK5C 1K4CC 1Q82W 1SZTA 2ZE8A 1BSMA 2RDCA 3ZRSA 1YVWA 5CN0A 4FM0A 1I5XA 1CXZB 5CA1A 4DV2B 1IX9A 5KHHA 4DR6B 1MA1A 2DYRC 2EX3A 2JS5A 2CTWA 2YSUB 4KXRA 4DXWA 5BR8O 1SA0A 2R9IA 4JV5O 2ITCC 4X9QA 3K3WA 3ASNB 4BW5A 1AJPA 2R70A 2LW1A 3ZRVA 3D3QA 1PL0A 3K06A 4LF4B 2QE7G 4QE7A 3LNNA 1YIJV 2V7QG 4X66B 1M1KW 3HB3B 4YY3O 5GTIZ 1IBLB 3B8NA 1K5QA 2HJDA 2N05A 2D2CB 3W7UA 3FX7A 1Z5VA 4NXNB 2QM7A 5BMVB 2LGQA 4DR4O 3K0GA 4H33A 1Y67A 1NR7A 1QVFU 2HHHB 4OXSA 2CTRA 3EVKA 4PELA 1VF5B 4KHPB 2KSDA 2Q68A 3H9VA 4FZ1A 4NTYA 1EN6A 5CA3A 4YHHO 4YJ2B 4QNHB 3CCLV 1ZUQA 3ZHUA 1NTMH 3BA9A 4P30A 5JJNB 4J80A 3IJ4A 3WB1A 4MTXA 4MVMA 3BHPA 3L74H 1WA8B 4JPRA 1NH2D 3D36C 4MVOA 2QTSA 2UXCB 2WPDG 1K3EA 4JTAB 3TGUH 1JX9A 3OGCC 3KKYA 2XAHA 4B3SO 3E8HA 1X59A 5EBMC 5IJ0B 2VQFB 2ETNA 2N04A 4MTFA 2EILC 1VQ6V 1N34O 2K1EA 1PNLA 1RM1B 5FLXN 5LOVB 4X1YA 1JA8A 1XNRO 5DEDA 3GWOA 3JD3A 4F6RB 1AR5A 1WAZA 1Z5WA 2ZXWC 2G38A 5J2UA 1QQCA 4NTWA 4FLYA 1I94O 2UXBB 4Q20A 4DO2A 1JVMA 2OTLV 2JS3A 4O4HA 1DF5A 2UXDB 3JALA 4J10A 4EKWA 1WB8A 4GX0A 2ZNJA 3ZHVA 4JI1B 4DR3O 2JJ2G 1JFFA 4UCSA 2ATKC 2QWNB 2LGWA 4LFAB 1CEZA 1G4YB 3OW2U 1BS3A 2BOCC 4DV3O 1MABG 3MD0A 3MAQA 2DYRB 1XMQO 1NH2B 1GH6A 1HR0B 2E3CA 4PDRA 3HKEA 3JAMN 1TUBB 3KCXA 4PA4A 3UO2A 2CH7B 4X65B 4GKKO 4O2AA 1SQFA 2ZM6B 3E35A 2PYLA 2ZR2A 3S3WA 2BSKA 5J2TB 4GUNA 4JI7O 1SRYA 1Q8IA 3OMIB 4ZKIA 4LF8O 4I9WA 4CZZA 1N0NA 3FB5C 1OCZC 3SYCA 4JI4O 4BIOA 4J7JA 4W4KA 4YIPA 1FKAO 3K5MA 2N74A 4CS3A 4X88A 1US6A 1GMGA 3EFFK 1VF6A 1VARA 1XDCA 1EN4A 3K04A 1YJWV 4JI3O 2WLIA 3L73H 3IC7A 1X4TA 4NXMB 3ABUA 4GZRB 4LF6B 3RYIB 3AG2B 3CC4V 3A0RA 3HKBA 1GTOA 1OCCB 1SZXA 4DV2O 3RYHA 1FAFA 4LNUB 1VQ5V 3OFNG 2GTAA 1PPJH 4Z2WA 3J81N 4JASA 5GONA 3OGIB 1XUQA 1QNMA 4IL6Z 4DK0A 3K5OA 1FFXB 5LMUB 5KMGA 1WP7A 4LF4O 4B3TB 5KUMA 1HP8A 1VF7A 1YSCA 3CCRV 2AHZA 1B6QA 5KAFZ 5LYJA 4P2ZA 3A0HZ 4KL1A 3RW0A 1YEWA 2R9AA 2CGNA 1JOYA 1KKCA 1S5LZ 1IBLO 3TJTA 3VBBA 5D5QA 1AI6A 3LDCA 3U11A 3ETGA 3UO3A 2E76B 3KCYA 1GN6A 5LMNB 1JCHA 5A2QN 1D2DA 4XBFA 4J11A 2ZXWB 4ZBMA 1S5JA 2BOBC 3LNMB 3LUTB 2PGGA 2Q7HA 4KHPO 4QPJA 1NBMG 2JEXA 3K79A 1N4CA 3N2KB 2A9HA 2A3QA 4ZOLA 5KHKA 3NXSA 5B66Z 4FLUA 4X64B 3OTFA 1AROP 4UV9A 4TV9A 3CYOA 2KQXA 4HAMA 4PHZA 2UXCO 1ROPA 3H01A 1JJ2U 1M4UA 1FXVA 4I0XB 3NR7A 4UXNA 2V4DA 2NLJC 2VQFO 1FD9A 2QWRB 3K9SA 1SQPH 4WFFA 4UB8Z 5KX5B 3BEHA 1B04A 5KHIA 4FPPA 2HLDG 4I7ZB 1KBHA 3B09A 1H8HG 5CA0B 2YEVB 4Z1MG 4QJFB 1OCZB 3ETEA 3BCCH 3GB7C 1ZX3A 2GSMB 4RWUA 4UFZA 2UXBO 4OGQB 1L8DA 2BTOA 2HVJC 4LWSB 2UXDO 3I55V 3OR7C 4OX9B 2JIZG 3BPZA 1J5EB 4JI1O 5EYPB 1DGSA 2IJIA 4PD4F 1QLEB 4AHCA 3OMAB 4LFAO 3CE2A 4IGGA 5LGNA 2RMKB 1GN2A 2IH1C 2ZD9A 2XAQA 1YDXA 2Z0AA 3C3SA 4J7ZA 4TUYB 1S0VA 1HR0O 3IFXA 1GKFA 5IYZA 2ZDIA 3JAKB 1VIBA 4H37A 2P90A 1GAXA 2XUMA 3JATA 1H2GA 3DTUB 3OT7A 4DRXA 4X65O 1XMOB 1VQOV 3P32A 1WB7A 5IE9A 2ZM6O 3O65A 4MVUA 3UT5A 5C8YA 3P3NA 1AJQA 2F66C 3OMNB 4LF9B 4N21A 3A2FA 4B08A 5LXTB 4EFBA 5EBLC 5J9PC 1MG1A 2F1MA 2Y4TA 3TXSA 2AW9A 3QNEA 1L0LH 3B8MA 4IYIA 3M8AA 1V55C 1BHBA 2WWWA 3D8CA 3I56V 5L3GA 2EJRA 3SPIA 1IBKB 1BZKA 3ABLB 3VQYA 3ABTA 4TV8B 2F4VB 1NZ6A 2BCCH 2R72A 3E2EA 4FM1A 1KU9A 5CBFA 2IBZH 4DR5B 5JH7B 4IHJA 2DE0X 3ZJZA 4DV5B 3AG3C 3MDSA 3AEIA 2EIJC 2GTSA 3ZN0A 3G6BA 2Q4PA 4PI2A 2F23A 1JPXA 5DM6V 2YDEA 5L3DA 3SYAA 5LHGA 2GUZA 4DV6B 2WLHA 3F5WC 2AZ0A 1MZEA 1ZL8A 3THOA 3OEEG 2X6AA 5B5EZ 2LW7A 3SPCA 1VQLV 4WBNB 5LMUO 1IDSA 5A9GA 5IYBO 1K73W 4B3TO 3CCQV 5L3CA 2YXYA 5DN6G 5LP6A 2QKCA 1HDJA 2IJHA 2QR4A 1ZSPA 4JF3A 3W7TA 1Q6IA 4W4LA 1Y76A 5BXZA 4PDLA 4BAYA 1Q86W 5CA1B 2DW4A 3PN1A 5EIBD 4QPKA 3O9OA 3J7AU 1XL6A 1HW7A 1SA0B 3CJHA 2QJ1A 4E4EA 2CUGA 4AQYB 4HYOA 4GX5A 3WG7B 4R7CA 1A32A 2YXHA 3FYEB 5LMNO 3QO5A 2Q69A 3FFQA 1UJWB 4FFBB 2FB5A 1D5AA 3RGBA 5JVDA 1RM1C 4X89A 1Q90D 4DR7O 2OTJV 4DUYO 1VQ9V 4JTDB 4KUMA 4JAVA 4I50A 3B4SA 2OCHA 4DR2B 3W7SA 1AILA 4TSFG 3K59A 4UB6Z 4ZI7A 1W0JG 1IZ3A 2PF4E 1SESA 1LUVA 5LL6Y 2Y0IA 3SYQA 1NKDA 2W6IG 4LP8A 4MW8A 4DUZB 1NR1A 4UVAA 4X64O 1BMFG 1GN4A 4JYBA 1M90W 1J95A 2WLMA 3CCMV 3RYFB 4LFBB 2EINC 1Z2GA 1I08A 1LR1A 2XHBA 1Q43A 4O4JB 4JI6B 4O4LA 4EEQA 2JEUA 2RQ6A 1OV9A 4BIZA 1QLNA 1K97A 4UCOA 5IDJA 1GRJA 3ETQA 5LGUA 2NNUA 5FPOA 1NJIW 2EULA 3CEIA 5ITZA 1YI2V 2OCCC 4GT1A 4I55A 5LGTA 3TCUA 4JTCB 1EZVH 3E22A 4U3JB 2BE3A 1N33B 4WFEA 1W0KG 2IH3C 3OTOB 1V54C 2YI9A 3FD9A 3JD1A 1V55B 4LH7A 2ZE6A 1O9GA 4PA7A 1I0HA 4QGPA 5F2VO 2IJKA 4FFKA 5L3EA 3VQWA 4K8XA 4BR6A 5B3SB 4OX9O 4GLXA 1J5EO 3AG3B 5FNVA 3OUFA 4X1YB 1IBMB 4FZ0A 2JGDB 2EIJB 3E8BA 1N32B 4CH3A 3FB7C 5TISZ 1Q6HA 1GK9A 2B9ZA 3OAAG 1F23A 3RVZA 2CDYA 1S72V 2L35A 2ZNIA 3AG2C 5J2UB 4O4HB 1OCCC 4XDLA 3RYCB 1RSOA 2AZ2A 1XMOO 3GVMA 3JALB 4GKJB 3B40A 3SPHA 4LF9O 3BFRA 4I4TA 1EM1A 4X1KA 5DECA 3UQ8A 3KG2A 1JFFB 3TETA 1FJGB 4Q6GA 1YTFD 2H3OA 1KQSU 3T1HB 4EB6A 1ENVA 4ZIBA 1IBKO 3EHBB 1I5YA 3HKEB 1COWG 1K8AW 1SQVH 2PI5A 2F4VO 4NVPA 4K8ZA 4O2AB 4DR5O 1YF2A 2A7WA 4DV5O 2EZOA 2BSKB 1JJOA 3ZHQA 3AG1B 1K33A 2WLNA 4CC6A 1BT8A 4MS2A 4RO2A 4BW9A 3E89A 4DV6O 3CXHF 2ARHA 3QVNA 2CK3G 3T1YB 1M93A 3N2GA 2HVKC 2EJ7A 2WLIB 1K5SA 3G6EV 4CBCA 2EINB 1XQ8A 4B3MB 2ZR3A 4F6EA 2EIKC 3HKBB 2PZSA 1EFRG 5GTHZ 3JCZA 1KD1W 3RYHB 2UUAB 1XILA 2HJFC 2OCCB 5K1XA 4AQYO 2ZDIC 5IT9N 3RVYA 2XAJA 1XNQB 5GONB 4DK1A 2H94A 1FXHA 3ZRWA 2AHYA 4MVSA 1V54B 5KMGB 4YJ3A 2EIMC 1ZLZA 4GYCB 2NR5A 5B1NA 3L70H 5LYJB 3RN4A 4DR2O 1VQPV 1Q3EA 3ICXA 1HNZO 4IYHA 2DN9A 2PI4A 4PV1B 1IXBA 5B1BC 1VQ8V 1BQ0A 5IYCO 4HBNA 4DUZO 3CCUV 1GN3A 1G8MA 3CD6V 4I9QA 4JI0B 1FXKA 4O4IA 2W0XA 1AB3A 3QG5A 1EBOA 3OD4A 4LFBO 3ABMC 2YS8A 1DF4A 2RN9A 1QLEC 3JD0A 3JAWA 4LR3A 3LDDA 4JI6O 4IT5A 4UV8A 1SF9A 1WNSA 4DR6O 3AK3A 5LA6A 3L72H 2ADQB 4PA3A 2WA3A 2X6BA 1M5IA 1OCOB 2ZIMA 3D3IA 4ABMA 4DW1A 4ZHQA 4TV9B 3OTOO 5LHIA 3S3XA 1YXBA 3JSLA 1IURA 3DSQA 2CGOA 4X66O 2P6JA 3R65A 3G71V 1MNGA 3WB0A 4G27B 2QEXV 4FLXA 1FYJA 3EXAA 3OE7G 2Q9LA 1RP3B 4GX2A 1IBMO 4NXNO 3ABLC 1AI5A 3B77A 1R3JC 2D3OW 3CX5F 2DYSB 5B1AB 1R6TA 1N8RW 3B2EE 1XHXA 1JMKC 1PD3A 2DWEC 2HHHO 3ZX6A 4H0LB 3FKSG 3CRQA 4H44B 3X2QB 3RT3C 1P7GA 1ORQC 4LH6A 3T1CA 4JYCA 4JI5B 3HKCA 2B1GA 5CBHA 1DK1A 3ZMZA 1KUQA 5KHGA 1YCIA 2YUAA 3FAVA 4X62B 2PTMA 2VRZA 2EIKB 4TOIA 3SPGA 4J41A 1FJGO 2ZIOA 2V1DA 1B3QA 4AI8A 3U0ZA 1NTZH 5IYZB 1PNMA 2LQTA 2YICA 3LDEA 4X20A 5IY5C 1SC5B 2JRIA 3JATB 1U97A 3C90A 4DRXB 3WU2Z 1CP9A 2EZPA 3HR0A 1OCRB 2WLLA 2FMLA 3D36A 3SR2C 4G28B 1XEQA 1KB9F 2EIMB 4PJ0Z 1H2NA 4XDKA 4NTXA 2LJ2A 2ADPA 3WG7C 1AP5A 1D5NA 3I5DA 4FLTA 2EBOA 4K0KB 4NYKA 1KMIZ 5B1BB 1QVGU 1N36B 1SS3A 1DLBA 1YZBA 1F51A 1ZAUA 1H2SB 1DTOA 3G4SV 2JDIG 4RAIA 2JJ1G 2QDOA 4IHJB 2B1IA 1ZTEA 2F95B 3ABMB 4XDJA 4B3MO 2Q5ZA 5CB4A 1MMMA 3AG4B 1NQTA 1R3KC 4MTOA 1H2LA 1AP6A 4D7SA 3VQXA 1HWYA 3CPWU 1F4NA 4RQFA 3ZMUA 2DOSA 2ZQMA 2UUAO 3SYOA 3ZCCA 2IM9A 2GUZB 2X6CA 3AG7A 5LHHA 3CCVV 4G2KA 1VQNV 1ZL8B 2BTQB 4KFMA 4LF5B 1O9HA 4C7UA 2HFEC 1XNQO 1ZWIC 1R6NA 4X1IA 3OM3B 2CE4A 2RNBA 1P7BA 4WFHA 5H2FZ 1PP9H 3IC9A 3CC2V 3DGEA 5EIBC 4QE9A 5LP6B 1QBZA 4QIWF 2JGUA 2A0LA 2XAFA 5KHJA 1Y76B 3ZN1A 4FLWA 4YHHB 3M99B 1KECA 3A8TA 2KKWA 4P9PA 2MK3A 3CJHB 4R50A 2XOKG 3QF7A 2FL4A 2P67A 1GM7A 2ZE5A 2Y4UA 2Q8VA 4UCRA 3TK1A 1EZJA 5B3SC 4NXMO 5JVDB 3K5NA 4LF6O 1TA8A 4O2BA 4ASUG 5JQGA 4ICGA 4I50B 1Y66A 4AILC 3E83A 4B3SB 1TAEA 1L1FA 4TT3G 1XL4A 2Q73A 4PDVA 4ZI7B 4UCVA 1YITV 1V9PA 3CSXA 3ZMSA 2PY5A 2GDSA 2R9RB 1UPGA 1WN7A 4B7KA 5KA6A 3CMEV 3CXCU 4UCUA 4MW3A 3H1JH 2XT9A 1B06A 2UXNA 2ITDC 3ABKB 3Q4HA 2HR3A 2HEPA 3AK1A 4O4LB 1K92A 5H9CA 2IW5A 2OIGA 4B3RB 5IY5B 4R8CA 2WLJA 4JAUA 5IJ9A 1S5HC 1URFA 1Y74A 3C3TA 5ITZB 1S76D 5JCOA 4I55B 4Z1VA 1NVPD 3E22B 3M7MX 1R3IC 2ODMA 4A5UB 3BAAA 1AI4A 4BWAA 1AVMA 3H1HH 1BL8A 2QM4A 4DV0B 2KG7A 5B1OA 3AG1C 4L8JA 2P4VA 2Q7GA 3UM7A 5H6QA 3SYPA 3JD2A 4D6TH 5L3BA 3H1KH 1M57C 3APOA 3CHXA 2QWPB 5FPRA 4X62O 5FNVB 2GHYA 3BY6A 5JJEB 4LFCB 2LO1A 3CRMA 2PYJA 1VF6C 2UUBB 2KB1A 2LP7A 4UCTA 2IU3A 3T4DA 4UUJC 2QSAA 1FXKC 4U3FH 3E8FA 4JI4B 2O57A 3L75H 4LF7B 5BY1A 2WLKA 3SJBC 4WFBV 1LNQA 1E1RG 1TVKA 1RSOB 4FIPC 1U96A 3HKDA 1KP2A 5EC2C 5E79Z 4OPHA 4HNAA 5KUKA 4I4TB 1WP8A 4X1KB 2F43G 4JI8B 1SQXH 3JASA 1G1XB 4NB5A 3E8GA 3CCEV 1NVPB 3JSNA 1T5EA 4K0KO
chains in the Genus database with same CATH topology
3JCZA 3LUTB 1K9MW 1RPRA 3ZMTA 1KD1W 1TUEB 4GCZA 4QPJA 2HJFC 1R73A 1NBMG 2JEXA 3K0DA 3K79A 4FMTA 3STZC 2OCCB 4F4LA 2ZDIC 2A9HA 3RVYA 1E1QG 2XAJA 2Q6AA 2UXXA 2H94A 3NXSA 1FXHA 3ZRWA 2AHYA 4MVSA 1AROP 1V54B 2Q67A 2QKSA 3CP1A 2W6JG 4UV9A 3MHSC 2EIMC 2Z5UA 3CYOA 4LCUC 3CCSV 4HAMA 5LBQA 4BIUA 5B1NA 1R6KA 1ROPA 3H01A 1JJ2U 1VQPV 1FXVA 1QR8A 4UXNA 4I5SA 1Q81W 2NLJC 3OUSA 2PI4A 3K08A 4WFFA 5B1BC 3BEHA 1VQ8V 5IYCO 4FPPA 3CCUV 2HLDG 1G8MA 3CD6V 4R6ZA 3FYIB 1FXKA 2WSSG 5EBWC 4KP4A 1H8HG 2YEVB 4Z1MG 4QJFB 1OCZB 1EBOA 1OCOC 3ETEA 3ABMC 1DF4A 4N23A 1PNKA 3WFVA 1QLEC 3JD0A 1OHHG 1E79G 3GB7C 3LDDA 3ZMVA 2GSMB 4UV8A 4PA6A 2B5UA 4P9OA 1BHAA 3K03A 3MHHC 2HVJC 1P4RA 3SJQC 1IXMA 2Y69C 2FTKA 2M7WA 3I55V 4PA3A 3OR7C 2X6BA 2JIZG 2LFRA 1OCOB 5GW7A 2IJIA 3ZRWB 1QLEB 3D3IA 3W7WA 3OMAB 4UVCA 1OZ0A 1THZA 5LGNA 5LHIA 1FFTB 4RUFA 2IH1C 1S3JA 2ZD9A 1K34A 4RQEA 5CBGA 2XAQA 3CCJV 1CPYA 2DYSC 3K9AA 5CMUA 5B1AC 1S0VA 3ZRXA 3OEHG 3IFXA 2OT5A 1GKFA 2P6JA 1M57B 2ZDIA 1JQ0A 1KKDA 3R65A 4H37A 3FB6C 3G71V 2P90A 3P30A 4G27B 2QEXV 3HPLC 3LSSA 1H2GA 3DTUB 3STLC 2XAGA 3X2QC 3P32A 1VQOV 2WAMA 4MVUA 1AJQA 3OE7G 4GX2A 1VQ4V 3OMNB 1FS0G 3ABLC 1AI5A 3B77A 4N21A 1R3JC 1YJNV 3ZIAG 1FXKB 1VQ7V 2D3OW 1R3LC 2DQ3A 3QO7A 4FK5C 3T2MA 1K4CC 2DYSB 5B1AB 5EBLC 1Q82W 5J9PC 2IU0A 1SZTA 1N8RW 1MG1A 3ZRSA 1QCEA 5CN0A 1I5XA 1PD3A 3QNEA 2DWEC 3B8MA 1V55C 4YXWG 3FKSG 1BHBA 3X2QB 2WWWA 3I56V 1ORQC 3T1CA 2EJRA 5BZBA 2DYRC 4JYCA 5L3GA 5IYDO 2YSUB 3SPIA 4E2LA 4DXWA 3ABLB 1YTFB 4GX1A 2B1GA 2R9IA 1QR9A 3ML0A 2ITCC 5CBHA 3F7YC 3ABTA 3ZMZA 3E2EA 4RUEA 3K3WA 3ASNB 4BW5A 3PJSK 1AJPA 5CBFA 3ZRVA 5L3FA 3ZJZA 3AG3C 1W2BU 2QTOA 1PL0A 2EIKB 3K06A 3AEIA 3SPGA 2QE7G 1OCRC 1MSWD 2EIJC 3ZN0A 4QE7A 3FB8C 1Y4MA 1AI7A 2V1DA 1YIJV 1JPXA 5HFLA 5DM6V 2V7QG 1VQKV 1M1KW 5L3DA 3SYAA 3HB3B 5LHGA 4MSWC 1PNMA 2WLHA 3F5WC 3LDEA 4L87A 3B8NA 2DWDC 5C93A 1K5QA 5IY5C 3LSQA 3W7UA 2P7TC 1CP9A 2EZPA 2X6AA 3OEEG 1OCRB 2WLLA 3D36A 2QM7A 4G28B 3SPCA 2EIMB 1VQLV 3ASOC 1PKXA 1K73W 4XDKA 5IYBO 3CCQV 3K0GA 5L3CA 4H33A 5DN6G 3WG7C 2QA4V 1NR7A 2IJHA 3RBZA 4JF3A 1AJNA 3W7TA 1QVFU 4PDLA 2EBOA 4BAYA 1Q86W 2DW4A 4OXSA 3AG4C 1M56C 4HZ3A 5EC1C 5B1BB 1QVGU 1DLBA 4PELA 4QPKA 1F51A 2Q68A 1F4MA 5CA3A 1DTOA 1XL6A 4QNHB 3CCLV 2IJJA 4HYOA 4GX5A 4P30A 3G4SV 2JDIG 3WG7B 4RAIA 2JJ1G 4R7CA 2B1IA 3FYEB 4MTXA 4MVMA 3QO5A 2Q69A 3ABMB 1UJWB 4XDJA 3JD4A 2QM8A 1RM1C 4X89A 4JPRA 1YHQV 1NH2D 3AG4B 2OTJV 1NQTA 4MVOA 1R3KC 4MTOA 2HG5C 1VQ9V 4JTDB 4MVZA 2WPDG 4JAVA 1K3EA 1H8EG 4KUMA 1RPOA 4JTAB 4U7OA 4J9ZB 1JX9A 1HWYA 3OGCC 1F4NA 4RQFA 2DQ0A 3CPWU 2XAHA 3ZMUA 3W7SA 2ZQMA 3SYOA 3ZCCA 3E8HA 4TSFG 2X6CA 5LHHA 5FL7G 1W0JG 2Y69B 5EBMC 3CCVV 1SESA 4G2KA 4MVRA 2EILC 4MTFA 3SPJA 4KFMA 1Q7YW 1VQ6V 1VQNV 2K1EA 4TWKA 2HFEC 3SYQA 1NKDA 1PNLA 2LFSA 1ZWIC 2W6IG 5EK0A 5HFMA 1R6NA 1YJ9V 1RM1B 2WLLB 3OM3B 4LP8A 4MW8A 1K4DC 1M9NA 1NR1A 2Y48A 1P7BA 4UVAA 4WFHA 1BMFG 4PA9A 1WPXA 4JYBA 4MVQA 1M90W 1J95A 2WLMA 3CC2V 1SERA 3DGEA 4QE9A 3CCMV 1QBZA 4QIWF 3GWOA 2EINC 3JD3A 2A0LA 2A79B 3VOUA 2XAFA 2EILB 2JEUA 2ZXWC 4BIZA 1QLNA 1K97A 3ZN1A 5KA5A 4Q20A 3M99B 1KECA 4UVBA 5IDJA 4DO2A 1JVMA 2OTLV 5LGUA 4P9PA 1DF5A 1GO3F 2MK3A 2NNUA 1NJIW 4R50A 2XOKG 1YI2V 2OCCC 4GT1A 4EKWA 4GX0A 2P67A 5LGTA 1GM7A 3TCUA 4JTCB 3TK1A 1EZJA 5B3SC 4WFGA 2JJ2G 1KP3A 2ATKC 4WFEA 1W0KG 2IH3C 1CEZA 1V54C 1G4YB 2XASA 1H38A 3JD1A 1V55B 4ASUG 5H6RA 3OW2U 2BOCC 5E1AC 1Y66A 1MABG 4PA7A 3E83A 3MD0A 2DYRB 1NH2B 2HKOA 1L1FA 4TT3G 2X0LA 1XL4A 4PDVA 3ABKC 2IJKA 1AR1B 4PDRA 5L3EA 3F7VC 1YITV 1GM9A 4FJCC 2H8PC 3ZMSA 5B3SB 4PA4A 1KC8W 3AG3B 3OUFA 2R9RB 3E35A 2EIJB 2ZR2A 3E8BA 5KA6A 3CMEV 3CXCU 4WFAV 2JK5C 4MW3A 3FB7C 3T4ZA 1SRYA 1GK9A 3OMIB 2Z3YA 4ZKIA 4I9WA 2UXNA 4CZZA 3OAAG 1F23A 2ITDC 3ABKB 3RVZA 3FB5C 1S72V 1OCZC 2HR3A 3SYCA 1K92A 3AG2C 5H9CA 2IW5A 5IY5B 2XNDG 4R8CA 4X88A 1GM8A 2WLJA 4JAUA 4XDLA 1OCCC 1GMGA 3EFFK 1S5HC 3JYCA 3ASOB 1SETA 1VQMV 1S76D 3K04A 1YJWV 3SPHA 4PDMA 2WLIA 4WF9V 1K7DA 3IC7A 1NVPD 1MOFA 1R3IC 3KG2A 3ABUA 4JGSA 3TETA 3AG2B 3CC4V 1AI4A 3A0RA 1GTOA 1YTFD 1BL8A 1M56B 1KQSU 1OCCB 5B1OA 3AG1C 1ENVA 3UM7A 1VQ5V 3OFNG 3EHBB 4LBEC 5H6QA 3SYPA 1I5YA 3JD2A 2W0FC 5L3BA 1COWG 1M57C 1K8AW 2PI5A 4JASA 1WLEA 2GHYA 3UKMA 2X7RB 3BY6A 4LC1A 2EZOA 2KB1A 2LP7A 5KUMA 1YSCA 3OR6C 3T4DA 2IU3A 3CCRV 2AHZA 4UUJC 3AG1B 1B6QA 1FXKC 3IGAC 1K33A 2WLNA 3E8FA 4P2ZA 4J9YB 4MT8A 4X8AA 1S77D 3RW0A 2C2AA 4MS2A 3CMAV 3E86A 4RO2A 3CC7V 3E89A 4WCEV 1JOYA 2WLKA 2CK3G 4WFBV 3VBBA 1LNQA 1E1RG 4U7NA 1AI6A 4FIPC 3LDCA 2HVKC 4MTGA 1KP2A 3ETGA 5EC2C 3W7XA 5KUKA 2WLIB 1K5SA 3G6EV 3ASNC 4CBCA 1JCHA 2EINB 2YEVA 2ZR3A 2F43G 4XBFA 2EIKC 2ZXWB 3E8GA 3CCEV 1EFRG 3QO8A 4ZBMA 1NVPB 2BOBC 3LNMB 3ETDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUT B;  4I9W A;  4R7C A;  4G27 B;  3HPL C;  3T4Z A;  2ITD C;  4MVM A;  3STL C;  2Q69 A;  3FB5 C;  3RVZ A;  3X2Q C;  4XDJ A;  1OCZ C;  3SYC A;  2HJF C;  4MVU A;  3K0D A;  4GX2 A;  4X89 A;  3STZ C;  3AG2 C;  3ABL C;  4MVO A;  1R3K C;  4MTO A;  1R3J C;  2A9H A;  2HG5 C;  4F4L A;  4JTD B;  4MVZ A;  1R3L C;  4R8C A;  4X88 A;  4JTA B;  3RVY A;  2WLJ A;  1K4C C;  4J9Z B;  3T2M A;  2Q6A A;  3OGC C;  5EBL C;  5J9P C;  4XDL A;  1OCC C;  3EFF K;  1S5H C;  3SYO A;  2AHY A;  3E8H A;  4MVS A;  2QKS A;  2Q67 A;  2X6C A;  3JYC A;  3ZRS A;  5EBM C;  2EIM C;  3K04 A;  4MVR A;  2EIL C;  2DWE C;  2WLI A;  4KFM A;  4LCU C;  4MTF A;  4PDM A;  2K1E A;  3SPH A;  1V55 C;  4TWK A;  3SPJ A;  2HFE C;  3SYQ A;  1ZWI C;  5EK0 A;  1ORQ C;  3T1C A;  5BZB A;  1R3I C;  2DYR C;  2WLL B;  3KG2 A;  4LP8 A;  4MW8 A;  3SPI A;  3TET A;  1K4D C;  4DXW A;  4GX1 A;  1P7B A;  4WFH A;  5CBH A;  2ITC C;  3F7Y C;  4PA9 A;  2NLJ C;  1BL8 A;  3OUS A;  1J95 A;  2WLM A;  3R65 A;  4MVQ A;  4RUE A;  4BW5 A;  3PJS K;  4QE9 A;  3K08 A;  5CBF A;  4WFF A;  5B1B C;  4RAI A;  3AG1 C;  3ZJZ A;  2EIN C;  3AG3 C;  3BEH A;  2QTO A;  3UM7 A;  2A0L A;  2A79 B;  3K06 A;  3VOU A;  4LBE C;  3SPG A;  1OCR C;  3SYP A;  2EIJ C;  2ZXW C;  2W0F C;  4QE7 A;  4R6Z A;  1M57 C;  3FB8 C;  5EBW C;  1JVM A;  4P9P A;  3UKM A;  1OCO C;  3ABM C;  3SYA A;  4R50 A;  4MSW C;  1QLE C;  2WLH A;  3F5W C;  2KB1 A;  5KUM A;  3LDE A;  3GB7 C;  2OCC C;  3LDD A;  3OR6 C;  4P30 A;  2DWD C;  3T4D A;  4EKW A;  2AHZ A;  4UUJ C;  4GX0 A;  3IGA C;  5IY5 C;  2WLN A;  3E8F A;  4P2Z A;  4PA6 A;  4P9O A;  4J9Y B;  4JTC B;  4X8A A;  3TCU A;  2P7T C;  2X6A A;  3K03 A;  4WFG A;  5B3S C;  2WLL A;  3RW0 A;  2ATK C;  4MS2 A;  4WFE A;  3E86 A;  4G28 B;  4RO2 A;  2HVJ C;  3SPC A;  2IH3 C;  3E89 A;  1V54 C;  1G4Y B;  3ASO C;  3SJQ C;  2Y69 C;  2WLK A;  4XDK A;  4PA3 A;  3OR7 C;  2X6B A;  2BOC C;  1LNQ A;  3K0G A;  5E1A C;  4H33 A;  4PA7 A;  3E83 A;  3WG7 C;  1XL4 A;  3LDC A;  2HVK C;  4MTG A;  4PDV A;  3ABK C;  3RBZ A;  5EC2 C;  4PDL A;  4PDR A;  3F7V C;  5KUK A;  2WLI B;  4RUF A;  4OXS A;  2IH1 C;  3AG4 C;  1M56 C;  2ZD9 A;  4HZ3 A;  2H8P C;  3ASN C;  5EC1 C;  4PA4 A;  5CBG A;  4CBC A;  2YEV A;  3OUF A;  2DYS C;  2Q68 A;  2R9R B;  5B1A C;  1XL6 A;  3IFX A;  4QNH B;  2EIK C;  3E8B A;  3E8G A;  4ZBM A;  4HYO A;  2JK5 C;  4GX5 A;  4MW3 A;  3FB7 C;  2BOB C;  3LNM B;  4H37 A;  1KKD A;  3FB6 C; 
#chains in the Genus database with same CATH topology
 1VMG A;  1K9M W;  5EZY A;  4EB6 B;  1N36 O;  1QU7 A;  4GCZ A;  2ILM A;  4FMT A;  2QKA A;  3DXR A;  3N27 A;  1Y6X A;  1E1Q G;  1RFY A;  4FLV A;  2Q6A A;  2UXX A;  3JAR A;  4FFB A;  1IVS A;  4CC5 A;  2QKS A;  2Q67 A;  3CP1 A;  3MHS C;  3U10 A;  2DJV A;  2Z5U A;  2YIB D;  1PV0 A;  4LCU C;  3CCS V;  5LBQ A;  2HP8 A;  1P84 F;  1WJZ A;  1Q81 W;  3OUS A;  2VQE B;  3VQV A;  4LF5 O;  4CH5 A;  2GBO A;  4IIJ A;  3N2G B;  2Y0P A;  1MSD A;  3GWK C;  3FYI B;  2ZE7 A;  2WSS G;  4KP4 A;  2YXL A;  3RYF A;  2OWO A;  1OCO C;  4DV7 B;  4O4J A;  4N23 A;  4NKG B;  1HNW B;  1OHH G;  2E74 B;  3ZMV A;  4PA6 A;  2B5U A;  3KZI Z;  3K03 A;  5H5N A;  3MHH C;  1P4R A;  1SQG A;  3SJQ C;  2GV9 A;  2Y69 C;  2FTK A;  3AK2 A;  2L6L A;  1XI1 A;  2UUC B;  2LFR A;  3DC6 A;  3ZHS A;  4U3J A;  3ZRW B;  3W7W A;  3CRR A;  4YJ3 B;  1OZ0 A;  1BCC H;  3JCU Z;  1S3J A;  1K34 A;  4RQE A;  5CBG A;  2MW2 B;  3CCJ V;  1CPY A;  2DYS C;  3K9A A;  5CMU A;  5B1A C;  3ZRX A;  3OEH G;  2OT5 A;  1M57 B;  1JQ0 A;  5KLV H;  3P30 A;  3HPL C;  4B7E A;  3LSS A;  3STL C;  5AG2 A;  3X2Q C;  2JGD A;  3WB2 A;  5BMV A;  1YJN V;  4DV1 B;  3ZIA G;  1FXK B;  1VQ7 V;  4O4I B;  1R3L C;  1LUW A;  3T2M A;  2IU0 A;  1TGO A;  1NTK H;  4JYA B;  1QCE A;  3JAW B;  4K3A A;  2E75 B;  4B3R O;  4YXW G;  3SDL A;  2ZIN A;  1Q5O A;  3RYC A;  2OYQ A;  5BZB A;  5IYD O;  4E2L A;  1YTF B;  4GX1 A;  5LA6 B;  4YJ2 A;  1QR9 A;  3ML0 A;  3SJA C;  3F7Y C;  4RUE A;  3PJS K;  3G67 A;  5L3F A;  1W2B U;  2QTO A;  4ZHQ B;  1WA8 A;  3R66 A;  1OCR C;  1MSW D;  4DR1 B;  1I7F A;  3FB8 C;  1Y4M A;  4DV0 O;  1AI7 A;  5HFL A;  1VQK V;  2YIB A;  4MSW C;  5IJ0 A;  4L87 A;  2DWD C;  5C93 A;  2E5L B;  3LSQ A;  2P7T C;  2Q0O C;  5LOV A;  3CRC A;  4LFC O;  3ZHR A;  3ASO C;  2QWO B;  1PKX A;  2UUB O;  1SQB H;  2QA4 V;  4TQD A;  4JYY A;  4F6R A;  3RBZ A;  1AJN A;  4LF7 O;  1XOU A;  2QWQ B;  4DV4 B;  3AG4 C;  1M56 C;  4HZ3 A;  5EC1 C;  3K58 A;  2UU9 B;  4D7T A;  2DMX A;  1F4M A;  3HKC B;  4JZG A;  2IJJ A;  3FAV B;  4ZOL B;  1BQZ A;  3JD4 A;  4JI8 O;  2QM8 A;  1YHQ V;  3CRA A;  1N33 O;  1XHZ A;  2HG5 C;  4U7O A;  4MVZ A;  1S77 D;  1H8E G;  1RPO A;  4J9Z B;  3TXQ A;  2DQ0 A;  5LP6 C;  1H2M A;  1PL4 A;  5FL7 G;  2Y69 B;  4X20 B;  2ZKO A;  4MVR A;  3SPJ A;  1Q7Y W;  4TWK A;  1EN5 A;  1TUB A;  3LSU A;  2M6Y A;  3APQ A;  4CH4 A;  2CH7 A;  2LFS A;  1YJ9 V;  5HFM A;  5EK0 A;  4H13 B;  2WLL B;  1K4D C;  4K35 A;  1HNX B;  1M9N A;  2Y48 A;  4PA9 A;  5J2T A;  1WPX A;  4MVQ A;  3H1I H;  1N32 O;  1SER A;  5JCO C;  5JJJ B;  2P22 C;  2AGA A;  5JWP A;  2A79 B;  3VOU A;  1Q6U A;  2EIL B;  1SKV A;  3UCS C;  1AR4 A;  2VQE O;  5KA5 A;  4UVB A;  4NR1 A;  1GO3 F;  4GKJ O;  3CS5 A;  2F93 B;  4WFG A;  1KP3 A;  3RYI A;  4DR7 B;  4DV7 O;  5CB4 B;  4DUY B;  1NS1 A;  2XAS A;  1H38 A;  2VS0 A;  1HNW O;  5H6R A;  4JI2 B;  5E1A C;  3T1H O;  1FPO A;  2HKO A;  4LNU A;  2X0L A;  2P06 A;  3ABK C;  3SJC C;  1AR1 B;  2A06 H;  3F7V C;  1GM9 A;  4FJC C;  2H8P C;  1KC8 W;  2UUC O;  4J7K A;  5IWA B;  3L9D A;  2YID A;  4X1I B;  3CB2 A;  3DC5 A;  4FVM A;  1FFX A;  3UT5 B;  5C8Y B;  2CTQ A;  4WFA V;  2JK5 C;  3T4Z A;  2Z3Y A;  2PUS A;  3A0B Z;  4CS2 A;  2FYU H;  3RFR A;  2XND G;  3J80 N;  1GM8 A;  2QGN A;  5BR8 B;  4JV5 B;  3P3P A;  3JYC A;  3ASO B;  3T1Y O;  5K1P A;  1SET A;  1VQM V;  3SGI A;  4PDM A;  4WF9 V;  1K7D A;  4DV1 O;  2P4K A;  2Q7E A;  1MOF A;  4DW0 A;  4JGS A;  4FLZ A;  4O2B B;  4OPA A;  1NT2 B;  1F7Y A;  4JYA O;  5JQG B;  1M56 B;  4DYL A;  1BGY H;  1QHT A;  4YY3 B;  2P5O A;  5D5P A;  3F5T A;  4LBE C;  2VWK A;  2W0F C;  3N2K A;  1WLE A;  3UKM A;  2X7R B;  4LC1 A;  4DR4 B;  3OR6 C;  3IGA C;  4DR1 O;  3ZED A;  2ZCE A;  4J9Y B;  4MT8 A;  4X8A A;  3Q4H B;  5KAI Z;  2C2A A;  3CMA V;  3E86 A;  3CC7 V;  4I0X A;  4WCE V;  3L71 H;  1KYO F;  5IJ9 B;  4U7N A;  2E5L O;  2YIA A;  5KX5 A;  1P49 A;  4MTG A;  4FM2 A;  1Y74 B;  3W7X A;  3BVO A;  3K57 A;  1VEW A;  3ZHT A;  3ASN C;  4JI0 O;  5CA0 A;  1SQQ H;  2YEV A;  3QO8 A;  3QTC A;  3ETD A;  2KG7 B;  4DV4 O;  1RPR A;  3ZMT A;  1TUE B;  2UU9 O;  1L0N H;  1R73 A;  3K0D A;  2CTP A;  3STZ C;  2AXT Z;  4LWS A;  4F4L A;  1N34 B;  5EYP A;  4CH6 A;  4J42 A;  2W6J G;  4EFE A;  1XNR B;  3ZBH A;  4BIU A;  1R6K A;  2RJZ A;  4TUY A;  1QR8 A;  1H2K A;  2ZT9 B;  4I5S A;  1NI8 A;  3JAK A;  2BTQ A;  2JVD A;  1WPB A;  4PI0 A;  1I94 B;  3K08 A;  1JR9 A;  1XBL A;  2NN4 A;  1TVK B;  3HKD B;  1HNX O;  4HNA B;  1UFI A;  1G6U A;  2OIE A;  4R6Z A;  5LXT A;  4DR3 B;  5EBW C;  4JAA A;  1MZF A;  1NU1 H;  3JAS B;  2RCV A;  1PNK A;  3WFV A;  4JZ2 A;  1E79 G;  3RWR D;  1XRE A;  2Q0A A;  4DV3 B;  1N0J A;  5EZY B;  1XMQ B;  3G80 A;  3BA8 A;  1BHA A;  4P9O A;  2YC0 A;  4YIO A;  3CWB H;  3DXR B;  4JI5 O;  1IXM A;  4TV8 A;  2M7W A;  3BRC A;  4GKK B;  2YI8 A;  5JH7 A;  3JAR B;  5GW7 A;  3BAB A;  4TQF A;  4CS4 A;  1W59 A;  1BE3 H;  4UVC A;  1THZ A;  3ZS8 C;  2XTA A;  4JI7 B;  2CAZ C;  1PM9 A;  1FFT B;  4RUF A;  4LF8 B;  4JI2 O;  3IAY A;  1R1B A;  1HNZ B;  2FKX A;  3H1L H;  1KKD A;  2K9P A;  3FB6 C;  1VP7 A;  1OJH A;  4IIJ B;  2VWJ A;  5IWA O;  2XAG A;  3K5L A;  2WAM A;  1VQ4 V;  4JI3 B;  2WA4 A;  1FS0 G;  4WBN A;  2DQ3 A;  3QO7 A;  4FK5 C;  1K4C C;  1Q82 W;  1SZT A;  2ZE8 A;  1BSM A;  2RDC A;  3ZRS A;  1YVW A;  5CN0 A;  4FM0 A;  1I5X A;  1CXZ B;  5CA1 A;  4DV2 B;  1IX9 A;  5KHH A;  4DR6 B;  1MA1 A;  2DYR C;  2EX3 A;  2JS5 A;  2CTW A;  2YSU B;  4KXR A;  4DXW A;  5BR8 O;  1SA0 A;  2R9I A;  4JV5 O;  2ITC C;  4X9Q A;  3K3W A;  3ASN B;  4BW5 A;  1AJP A;  2R70 A;  2LW1 A;  3ZRV A;  3D3Q A;  1PL0 A;  3K06 A;  4LF4 B;  2QE7 G;  4QE7 A;  3LNN A;  1YIJ V;  2V7Q G;  4X66 B;  1M1K W;  3HB3 B;  4YY3 O;  5GTI Z;  1IBL B;  3B8N A;  1K5Q A;  2HJD A;  2N05 A;  2D2C B;  3W7U A;  3FX7 A;  1Z5V A;  4NXN B;  2QM7 A;  5BMV B;  2LGQ A;  4DR4 O;  3K0G A;  4H33 A;  1Y67 A;  1NR7 A;  1QVF U;  2HHH B;  4OXS A;  2CTR A;  3EVK A;  4PEL A;  1VF5 B;  4KHP B;  2KSD A;  2Q68 A;  3H9V A;  4FZ1 A;  4NTY A;  1EN6 A;  5CA3 A;  4YHH O;  4YJ2 B;  4QNH B;  3CCL V;  1ZUQ A;  3ZHU A;  1NTM H;  3BA9 A;  4P30 A;  5JJN B;  4J80 A;  3IJ4 A;  3WB1 A;  4MTX A;  4MVM A;  3BHP A;  3L74 H;  1WA8 B;  4JPR A;  1NH2 D;  3D36 C;  4MVO A;  2QTS A;  2UXC B;  2WPD G;  1K3E A;  4JTA B;  3TGU H;  1JX9 A;  3OGC C;  3KKY A;  2XAH A;  4B3S O;  3E8H A;  1X59 A;  5EBM C;  5IJ0 B;  2VQF B;  2ETN A;  2N04 A;  4MTF A;  2EIL C;  1VQ6 V;  1N34 O;  2K1E A;  1PNL A;  1RM1 B;  5FLX N;  5LOV B;  4X1Y A;  1JA8 A;  1XNR O;  5DED A;  3GWO A;  3JD3 A;  4F6R B;  1AR5 A;  1WAZ A;  1Z5W A;  2ZXW C;  2G38 A;  5J2U A;  1QQC A;  4NTW A;  4FLY A;  1I94 O;  2UXB B;  4Q20 A;  4DO2 A;  1JVM A;  2OTL V;  2JS3 A;  4O4H A;  1DF5 A;  2UXD B;  3JAL A;  4J10 A;  4EKW A;  1WB8 A;  4GX0 A;  2ZNJ A;  3ZHV A;  4JI1 B;  4DR3 O;  2JJ2 G;  1JFF A;  4UCS A;  2ATK C;  2QWN B;  2LGW A;  4LFA B;  1CEZ A;  1G4Y B;  3OW2 U;  1BS3 A;  2BOC C;  4DV3 O;  1MAB G;  3MD0 A;  3MAQ A;  2DYR B;  1XMQ O;  1NH2 B;  1GH6 A;  1HR0 B;  2E3C A;  4PDR A;  3HKE A;  3JAM N;  1TUB B;  3KCX A;  4PA4 A;  3UO2 A;  2CH7 B;  4X65 B;  4GKK O;  4O2A A;  1SQF A;  2ZM6 B;  3E35 A;  2PYL A;  2ZR2 A;  3S3W A;  2BSK A;  5J2T B;  4GUN A;  4JI7 O;  1SRY A;  1Q8I A;  3OMI B;  4ZKI A;  4LF8 O;  4I9W A;  4CZZ A;  1N0N A;  3FB5 C;  1OCZ C;  3SYC A;  4JI4 O;  4BIO A;  4J7J A;  4W4K A;  4YIP A;  1FKA O;  3K5M A;  2N74 A;  4CS3 A;  4X88 A;  1US6 A;  1GMG A;  3EFF K;  1VF6 A;  1VAR A;  1XDC A;  1EN4 A;  3K04 A;  1YJW V;  4JI3 O;  2WLI A;  3L73 H;  3IC7 A;  1X4T A;  4NXM B;  3ABU A;  4GZR B;  4LF6 B;  3RYI B;  3AG2 B;  3CC4 V;  3A0R A;  3HKB A;  1GTO A;  1OCC B;  1SZX A;  4DV2 O;  3RYH A;  1FAF A;  4LNU B;  1VQ5 V;  3OFN G;  2GTA A;  1PPJ H;  4Z2W A;  3J81 N;  4JAS A;  5GON A;  3OGI B;  1XUQ A;  1QNM A;  4IL6 Z;  4DK0 A;  3K5O A;  1FFX B;  5LMU B;  5KMG A;  1WP7 A;  4LF4 O;  4B3T B;  5KUM A;  1HP8 A;  1VF7 A;  1YSC A;  3CCR V;  2AHZ A;  1B6Q A;  5KAF Z;  5LYJ A;  4P2Z A;  3A0H Z;  4KL1 A;  3RW0 A;  1YEW A;  2R9A A;  2CGN A;  1JOY A;  1KKC A;  1S5L Z;  1IBL O;  3TJT A;  3VBB A;  5D5Q A;  1AI6 A;  3LDC A;  3U11 A;  3ETG A;  3UO3 A;  2E76 B;  3KCY A;  1GN6 A;  5LMN B;  1JCH A;  5A2Q N;  1D2D A;  4XBF A;  4J11 A;  2ZXW B;  4ZBM A;  1S5J A;  2BOB C;  3LNM B;  3LUT B;  2PGG A;  2Q7H A;  4KHP O;  4QPJ A;  1NBM G;  2JEX A;  3K79 A;  1N4C A;  3N2K B;  2A9H A;  2A3Q A;  4ZOL A;  5KHK A;  3NXS A;  5B66 Z;  4FLU A;  4X64 B;  3OTF A;  1ARO P;  4UV9 A;  4TV9 A;  3CYO A;  2KQX A;  4HAM A;  4PHZ A;  2UXC O;  1ROP A;  3H01 A;  1JJ2 U;  1M4U A;  1FXV A;  4I0X B;  3NR7 A;  4UXN A;  2V4D A;  2NLJ C;  2VQF O;  1FD9 A;  2QWR B;  3K9S A;  1SQP H;  4WFF A;  4UB8 Z;  5KX5 B;  3BEH A;  1B04 A;  5KHI A;  4FPP A;  2HLD G;  4I7Z B;  1KBH A;  3B09 A;  1H8H G;  5CA0 B;  2YEV B;  4Z1M G;  4QJF B;  1OCZ B;  3ETE A;  3BCC H;  3GB7 C;  1ZX3 A;  2GSM B;  4RWU A;  4UFZ A;  2UXB O;  4OGQ B;  1L8D A;  2BTO A;  2HVJ C;  4LWS B;  2UXD O;  3I55 V;  3OR7 C;  4OX9 B;  2JIZ G;  3BPZ A;  1J5E B;  4JI1 O;  5EYP B;  1DGS A;  2IJI A;  4PD4 F;  1QLE B;  4AHC A;  3OMA B;  4LFA O;  3CE2 A;  4IGG A;  5LGN A;  2RMK B;  1GN2 A;  2IH1 C;  2ZD9 A;  2XAQ A;  1YDX A;  2Z0A A;  3C3S A;  4J7Z A;  4TUY B;  1S0V A;  1HR0 O;  3IFX A;  1GKF A;  5IYZ A;  2ZDI A;  3JAK B;  1VIB A;  4H37 A;  2P90 A;  1GAX A;  2XUM A;  3JAT A;  1H2G A;  3DTU B;  3OT7 A;  4DRX A;  4X65 O;  1XMO B;  1VQO V;  3P32 A;  1WB7 A;  5IE9 A;  2ZM6 O;  3O65 A;  4MVU A;  3UT5 A;  5C8Y A;  3P3N A;  1AJQ A;  2F66 C;  3OMN B;  4LF9 B;  4N21 A;  3A2F A;  4B08 A;  5LXT B;  4EFB A;  5EBL C;  5J9P C;  1MG1 A;  2F1M A;  2Y4T A;  3TXS A;  2AW9 A;  3QNE A;  1L0L H;  3B8M A;  4IYI A;  3M8A A;  1V55 C;  1BHB A;  2WWW A;  3D8C A;  3I56 V;  5L3G A;  2EJR A;  3SPI A;  1IBK B;  1BZK A;  3ABL B;  3VQY A;  3ABT A;  4TV8 B;  2F4V B;  1NZ6 A;  2BCC H;  2R72 A;  3E2E A;  4FM1 A;  1KU9 A;  5CBF A;  2IBZ H;  4DR5 B;  5JH7 B;  4IHJ A;  2DE0 X;  3ZJZ A;  4DV5 B;  3AG3 C;  3MDS A;  3AEI A;  2EIJ C;  2GTS A;  3ZN0 A;  3G6B A;  2Q4P A;  4PI2 A;  2F23 A;  1JPX A;  5DM6 V;  2YDE A;  5L3D A;  3SYA A;  5LHG A;  2GUZ A;  4DV6 B;  2WLH A;  3F5W C;  2AZ0 A;  1MZE A;  1ZL8 A;  3THO A;  3OEE G;  2X6A A;  5B5E Z;  2LW7 A;  3SPC A;  1VQL V;  4WBN B;  5LMU O;  1IDS A;  5A9G A;  5IYB O;  1K73 W;  4B3T O;  3CCQ V;  5L3C A;  2YXY A;  5DN6 G;  5LP6 A;  2QKC A;  1HDJ A;  2IJH A;  2QR4 A;  1ZSP A;  4JF3 A;  3W7T A;  1Q6I A;  4W4L A;  1Y76 A;  5BXZ A;  4PDL A;  4BAY A;  1Q86 W;  5CA1 B;  2DW4 A;  3PN1 A;  5EIB D;  4QPK A;  3O9O A;  3J7A U;  1XL6 A;  1HW7 A;  1SA0 B;  3CJH A;  2QJ1 A;  4E4E A;  2CUG A;  4AQY B;  4HYO A;  4GX5 A;  3WG7 B;  4R7C A;  1A32 A;  2YXH A;  3FYE B;  5LMN O;  3QO5 A;  2Q69 A;  3FFQ A;  1UJW B;  4FFB B;  2FB5 A;  1D5A A;  3RGB A;  5JVD A;  1RM1 C;  4X89 A;  1Q90 D;  4DR7 O;  2OTJ V;  4DUY O;  1VQ9 V;  4JTD B;  4KUM A;  4JAV A;  4I50 A;  3B4S A;  2OCH A;  4DR2 B;  3W7S A;  1AIL A;  4TSF G;  3K59 A;  4UB6 Z;  4ZI7 A;  1W0J G;  1IZ3 A;  2PF4 E;  1SES A;  1LUV A;  5LL6 Y;  2Y0I A;  3SYQ A;  1NKD A;  2W6I G;  4LP8 A;  4MW8 A;  4DUZ B;  1NR1 A;  4UVA A;  4X64 O;  1BMF G;  1GN4 A;  4JYB A;  1M90 W;  1J95 A;  2WLM A;  3CCM V;  3RYF B;  4LFB B;  2EIN C;  1Z2G A;  1I08 A;  1LR1 A;  2XHB A;  1Q43 A;  4O4J B;  4JI6 B;  4O4L A;  4EEQ A;  2JEU A;  2RQ6 A;  1OV9 A;  4BIZ A;  1QLN A;  1K97 A;  4UCO A;  5IDJ A;  1GRJ A;  3ETQ A;  5LGU A;  2NNU A;  5FPO A;  1NJI W;  2EUL A;  3CEI A;  5ITZ A;  1YI2 V;  2OCC C;  4GT1 A;  4I55 A;  5LGT A;  3TCU A;  4JTC B;  1EZV H;  3E22 A;  4U3J B;  2BE3 A;  1N33 B;  4WFE A;  1W0K G;  2IH3 C;  3OTO B;  1V54 C;  2YI9 A;  3FD9 A;  3JD1 A;  1V55 B;  4LH7 A;  2ZE6 A;  1O9G A;  4PA7 A;  1I0H A;  4QGP A;  5F2V O;  2IJK A;  4FFK A;  5L3E A;  3VQW A;  4K8X A;  4BR6 A;  5B3S B;  4OX9 O;  4GLX A;  1J5E O;  3AG3 B;  5FNV A;  3OUF A;  4X1Y B;  1IBM B;  4FZ0 A;  2JGD B;  2EIJ B;  3E8B A;  1N32 B;  4CH3 A;  3FB7 C;  5TIS Z;  1Q6H A;  1GK9 A;  2B9Z A;  3OAA G;  1F23 A;  3RVZ A;  2CDY A;  1S72 V;  2L35 A;  2ZNI A;  3AG2 C;  5J2U B;  4O4H B;  1OCC C;  4XDL A;  3RYC B;  1RSO A;  2AZ2 A;  1XMO O;  3GVM A;  3JAL B;  4GKJ B;  3B40 A;  3SPH A;  4LF9 O;  3BFR A;  4I4T A;  1EM1 A;  4X1K A;  5DEC A;  3UQ8 A;  3KG2 A;  1JFF B;  3TET A;  1FJG B;  4Q6G A;  1YTF D;  2H3O A;  1KQS U;  3T1H B;  4EB6 A;  1ENV A;  4ZIB A;  1IBK O;  3EHB B;  1I5Y A;  3HKE B;  1COW G;  1K8A W;  1SQV H;  2PI5 A;  2F4V O;  4NVP A;  4K8Z A;  4O2A B;  4DR5 O;  1YF2 A;  2A7W A;  4DV5 O;  2EZO A;  2BSK B;  1JJO A;  3ZHQ A;  3AG1 B;  1K33 A;  2WLN A;  4CC6 A;  1BT8 A;  4MS2 A;  4RO2 A;  4BW9 A;  3E89 A;  4DV6 O;  3CXH F;  2ARH A;  3QVN A;  2CK3 G;  3T1Y B;  1M93 A;  3N2G A;  2HVK C;  2EJ7 A;  2WLI B;  1K5S A;  3G6E V;  4CBC A;  2EIN B;  1XQ8 A;  4B3M B;  2ZR3 A;  4F6E A;  2EIK C;  3HKB B;  2PZS A;  1EFR G;  5GTH Z;  3JCZ A;  1KD1 W;  3RYH B;  2UUA B;  1XIL A;  2HJF C;  2OCC B;  5K1X A;  4AQY O;  2ZDI C;  5IT9 N;  3RVY A;  2XAJ A;  1XNQ B;  5GON B;  4DK1 A;  2H94 A;  1FXH A;  3ZRW A;  2AHY A;  4MVS A;  1V54 B;  5KMG B;  4YJ3 A;  2EIM C;  1ZLZ A;  4GYC B;  2NR5 A;  5B1N A;  3L70 H;  5LYJ B;  3RN4 A;  4DR2 O;  1VQP V;  1Q3E A;  3ICX A;  1HNZ O;  4IYH A;  2DN9 A;  2PI4 A;  4PV1 B;  1IXB A;  5B1B C;  1VQ8 V;  1BQ0 A;  5IYC O;  4HBN A;  4DUZ O;  3CCU V;  1GN3 A;  1G8M A;  3CD6 V;  4I9Q A;  4JI0 B;  1FXK A;  4O4I A;  2W0X A;  1AB3 A;  3QG5 A;  1EBO A;  3OD4 A;  4LFB O;  3ABM C;  2YS8 A;  1DF4 A;  2RN9 A;  1QLE C;  3JD0 A;  3JAW A;  4LR3 A;  3LDD A;  4JI6 O;  4IT5 A;  4UV8 A;  1SF9 A;  1WNS A;  4DR6 O;  3AK3 A;  5LA6 A;  3L72 H;  2ADQ B;  4PA3 A;  2WA3 A;  2X6B A;  1M5I A;  1OCO B;  2ZIM A;  3D3I A;  4ABM A;  4DW1 A;  4ZHQ A;  4TV9 B;  3OTO O;  5LHI A;  3S3X A;  1YXB A;  3JSL A;  1IUR A;  3DSQ A;  2CGO A;  4X66 O;  2P6J A;  3R65 A;  3G71 V;  1MNG A;  3WB0 A;  4G27 B;  2QEX V;  4FLX A;  1FYJ A;  3EXA A;  3OE7 G;  2Q9L A;  1RP3 B;  4GX2 A;  1IBM O;  4NXN O;  3ABL C;  1AI5 A;  3B77 A;  1R3J C;  2D3O W;  3CX5 F;  2DYS B;  5B1A B;  1R6T A;  1N8R W;  3B2E E;  1XHX A;  1JMK C;  1PD3 A;  2DWE C;  2HHH O;  3ZX6 A;  4H0L B;  3FKS G;  3CRQ A;  4H44 B;  3X2Q B;  3RT3 C;  1P7G A;  1ORQ C;  4LH6 A;  3T1C A;  4JYC A;  4JI5 B;  3HKC A;  2B1G A;  5CBH A;  1DK1 A;  3ZMZ A;  1KUQ A;  5KHG A;  1YCI A;  2YUA A;  3FAV A;  4X62 B;  2PTM A;  2VRZ A;  2EIK B;  4TOI A;  3SPG A;  4J41 A;  1FJG O;  2ZIO A;  2V1D A;  1B3Q A;  4AI8 A;  3U0Z A;  1NTZ H;  5IYZ B;  1PNM A;  2LQT A;  2YIC A;  3LDE A;  4X20 A;  5IY5 C;  1SC5 B;  2JRI A;  3JAT B;  1U97 A;  3C90 A;  4DRX B;  3WU2 Z;  1CP9 A;  2EZP A;  3HR0 A;  1OCR B;  2WLL A;  2FML A;  3D36 A;  3SR2 C;  4G28 B;  1XEQ A;  1KB9 F;  2EIM B;  4PJ0 Z;  1H2N A;  4XDK A;  4NTX A;  2LJ2 A;  2ADP A;  3WG7 C;  1AP5 A;  1D5N A;  3I5D A;  4FLT A;  2EBO A;  4K0K B;  4NYK A;  1KMI Z;  5B1B B;  1QVG U;  1N36 B;  1SS3 A;  1DLB A;  1YZB A;  1F51 A;  1ZAU A;  1H2S B;  1DTO A;  3G4S V;  2JDI G;  4RAI A;  2JJ1 G;  2QDO A;  4IHJ B;  2B1I A;  1ZTE A;  2F95 B;  3ABM B;  4XDJ A;  4B3M O;  2Q5Z A;  5CB4 A;  1MMM A;  3AG4 B;  1NQT A;  1R3K C;  4MTO A;  1H2L A;  1AP6 A;  4D7S A;  3VQX A;  1HWY A;  3CPW U;  1F4N A;  4RQF A;  3ZMU A;  2DOS A;  2ZQM A;  2UUA O;  3SYO A;  3ZCC A;  2IM9 A;  2GUZ B;  2X6C A;  3AG7 A;  5LHH A;  3CCV V;  4G2K A;  1VQN V;  1ZL8 B;  2BTQ B;  4KFM A;  4LF5 B;  1O9H A;  4C7U A;  2HFE C;  1XNQ O;  1ZWI C;  1R6N A;  4X1I A;  3OM3 B;  2CE4 A;  2RNB A;  1P7B A;  4WFH A;  5H2F Z;  1PP9 H;  3IC9 A;  3CC2 V;  3DGE A;  5EIB C;  4QE9 A;  5LP6 B;  1QBZ A;  4QIW F;  2JGU A;  2A0L A;  2XAF A;  5KHJ A;  1Y76 B;  3ZN1 A;  4FLW A;  4YHH B;  3M99 B;  1KEC A;  3A8T A;  2KKW A;  4P9P A;  2MK3 A;  3CJH B;  4R50 A;  2XOK G;  3QF7 A;  2FL4 A;  2P67 A;  1GM7 A;  2ZE5 A;  2Y4U A;  2Q8V A;  4UCR A;  3TK1 A;  1EZJ A;  5B3S C;  4NXM O;  5JVD B;  3K5N A;  4LF6 O;  1TA8 A;  4O2B A;  4ASU G;  5JQG A;  4ICG A;  4I50 B;  1Y66 A;  4AIL C;  3E83 A;  4B3S B;  1TAE A;  1L1F A;  4TT3 G;  1XL4 A;  2Q73 A;  4PDV A;  4ZI7 B;  4UCV A;  1YIT V;  1V9P A;  3CSX A;  3ZMS A;  2PY5 A;  2GDS A;  2R9R B;  1UPG A;  1WN7 A;  4B7K A;  5KA6 A;  3CME V;  3CXC U;  4UCU A;  4MW3 A;  3H1J H;  2XT9 A;  1B06 A;  2UXN A;  2ITD C;  3ABK B;  3Q4H A;  2HR3 A;  2HEP A;  3AK1 A;  4O4L B;  1K92 A;  5H9C A;  2IW5 A;  2OIG A;  4B3R B;  5IY5 B;  4R8C A;  2WLJ A;  4JAU A;  5IJ9 A;  1S5H C;  1URF A;  1Y74 A;  3C3T A;  5ITZ B;  1S76 D;  5JCO A;  4I55 B;  4Z1V A;  1NVP D;  3E22 B;  3M7M X;  1R3I C;  2ODM A;  4A5U B;  3BAA A;  1AI4 A;  4BWA A;  1AVM A;  3H1H H;  1BL8 A;  2QM4 A;  4DV0 B;  2KG7 A;  5B1O A;  3AG1 C;  4L8J A;  2P4V A;  2Q7G A;  3UM7 A;  5H6Q A;  3SYP A;  3JD2 A;  4D6T H;  5L3B A;  3H1K H;  1M57 C;  3APO A;  3CHX A;  2QWP B;  5FPR A;  4X62 O;  5FNV B;  2GHY A;  3BY6 A;  5JJE B;  4LFC B;  2LO1 A;  3CRM A;  2PYJ A;  1VF6 C;  2UUB B;  2KB1 A;  2LP7 A;  4UCT A;  2IU3 A;  3T4D A;  4UUJ C;  2QSA A;  1FXK C;  4U3F H;  3E8F A;  4JI4 B;  2O57 A;  3L75 H;  4LF7 B;  5BY1 A;  2WLK A;  3SJB C;  4WFB V;  1LNQ A;  1E1R G;  1TVK A;  1RSO B;  4FIP C;  1U96 A;  3HKD A;  1KP2 A;  5EC2 C;  5E79 Z;  4OPH A;  4HNA A;  5KUK A;  4I4T B;  1WP8 A;  4X1K B;  2F43 G;  4JI8 B;  1SQX H;  3JAS A;  1G1X B;  4NB5 A;  3E8G A;  3CCE V;  1NVP B;  3JSN A;  1T5E A;  4K0K O; 
#chains in the Genus database with same CATH homology
 3JCZ A;  3LUT B;  1K9M W;  1RPR A;  3ZMT A;  1KD1 W;  1TUE B;  4GCZ A;  4QPJ A;  2HJF C;  1R73 A;  1NBM G;  2JEX A;  3K0D A;  3K79 A;  4FMT A;  3STZ C;  2OCC B;  4F4L A;  2ZDI C;  2A9H A;  3RVY A;  1E1Q G;  2XAJ A;  2Q6A A;  2UXX A;  2H94 A;  3NXS A;  1FXH A;  3ZRW A;  2AHY A;  4MVS A;  1ARO P;  1V54 B;  2Q67 A;  2QKS A;  3CP1 A;  2W6J G;  4UV9 A;  3MHS C;  2EIM C;  2Z5U A;  3CYO A;  4LCU C;  3CCS V;  4HAM A;  5LBQ A;  4BIU A;  5B1N A;  1R6K A;  1ROP A;  3H01 A;  1JJ2 U;  1VQP V;  1FXV A;  1QR8 A;  4UXN A;  4I5S A;  1Q81 W;  2NLJ C;  3OUS A;  2PI4 A;  3K08 A;  4WFF A;  5B1B C;  3BEH A;  1VQ8 V;  5IYC O;  4FPP A;  3CCU V;  2HLD G;  1G8M A;  3CD6 V;  4R6Z A;  3FYI B;  1FXK A;  2WSS G;  5EBW C;  4KP4 A;  1H8H G;  2YEV B;  4Z1M G;  4QJF B;  1OCZ B;  1EBO A;  1OCO C;  3ETE A;  3ABM C;  1DF4 A;  4N23 A;  1PNK A;  3WFV A;  1QLE C;  3JD0 A;  1OHH G;  1E79 G;  3GB7 C;  3LDD A;  3ZMV A;  2GSM B;  4UV8 A;  4PA6 A;  2B5U A;  4P9O A;  1BHA A;  3K03 A;  3MHH C;  2HVJ C;  1P4R A;  3SJQ C;  1IXM A;  2Y69 C;  2FTK A;  2M7W A;  3I55 V;  4PA3 A;  3OR7 C;  2X6B A;  2JIZ G;  2LFR A;  1OCO B;  5GW7 A;  2IJI A;  3ZRW B;  1QLE B;  3D3I A;  3W7W A;  3OMA B;  4UVC A;  1OZ0 A;  1THZ A;  5LGN A;  5LHI A;  1FFT B;  4RUF A;  2IH1 C;  1S3J A;  2ZD9 A;  1K34 A;  4RQE A;  5CBG A;  2XAQ A;  3CCJ V;  1CPY A;  2DYS C;  3K9A A;  5CMU A;  5B1A C;  1S0V A;  3ZRX A;  3OEH G;  3IFX A;  2OT5 A;  1GKF A;  2P6J A;  1M57 B;  2ZDI A;  1JQ0 A;  1KKD A;  3R65 A;  4H37 A;  3FB6 C;  3G71 V;  2P90 A;  3P30 A;  4G27 B;  2QEX V;  3HPL C;  3LSS A;  1H2G A;  3DTU B;  3STL C;  2XAG A;  3X2Q C;  3P32 A;  1VQO V;  2WAM A;  4MVU A;  1AJQ A;  3OE7 G;  4GX2 A;  1VQ4 V;  3OMN B;  1FS0 G;  3ABL C;  1AI5 A;  3B77 A;  4N21 A;  1R3J C;  1YJN V;  3ZIA G;  1FXK B;  1VQ7 V;  2D3O W;  1R3L C;  2DQ3 A;  3QO7 A;  4FK5 C;  3T2M A;  1K4C C;  2DYS B;  5B1A B;  5EBL C;  1Q82 W;  5J9P C;  2IU0 A;  1SZT A;  1N8R W;  1MG1 A;  3ZRS A;  1QCE A;  5CN0 A;  1I5X A;  1PD3 A;  3QNE A;  2DWE C;  3B8M A;  1V55 C;  4YXW G;  3FKS G;  1BHB A;  3X2Q B;  2WWW A;  3I56 V;  1ORQ C;  3T1C A;  2EJR A;  5BZB A;  2DYR C;  4JYC A;  5L3G A;  5IYD O;  2YSU B;  3SPI A;  4E2L A;  4DXW A;  3ABL B;  1YTF B;  4GX1 A;  2B1G A;  2R9I A;  1QR9 A;  3ML0 A;  2ITC C;  5CBH A;  3F7Y C;  3ABT A;  3ZMZ A;  3E2E A;  4RUE A;  3K3W A;  3ASN B;  4BW5 A;  3PJS K;  1AJP A;  5CBF A;  3ZRV A;  5L3F A;  3ZJZ A;  3AG3 C;  1W2B U;  2QTO A;  1PL0 A;  2EIK B;  3K06 A;  3AEI A;  3SPG A;  2QE7 G;  1OCR C;  1MSW D;  2EIJ C;  3ZN0 A;  4QE7 A;  3FB8 C;  1Y4M A;  1AI7 A;  2V1D A;  1YIJ V;  1JPX A;  5HFL A;  5DM6 V;  2V7Q G;  1VQK V;  1M1K W;  5L3D A;  3SYA A;  3HB3 B;  5LHG A;  4MSW C;  1PNM A;  2WLH A;  3F5W C;  3LDE A;  4L87 A;  3B8N A;  2DWD C;  5C93 A;  1K5Q A;  5IY5 C;  3LSQ A;  3W7U A;  2P7T C;  1CP9 A;  2EZP A;  2X6A A;  3OEE G;  1OCR B;  2WLL A;  3D36 A;  2QM7 A;  4G28 B;  3SPC A;  2EIM B;  1VQL V;  3ASO C;  1PKX A;  1K73 W;  4XDK A;  5IYB O;  3CCQ V;  3K0G A;  5L3C A;  4H33 A;  5DN6 G;  3WG7 C;  2QA4 V;  1NR7 A;  2IJH A;  3RBZ A;  4JF3 A;  1AJN A;  3W7T A;  1QVF U;  4PDL A;  2EBO A;  4BAY A;  1Q86 W;  2DW4 A;  4OXS A;  3AG4 C;  1M56 C;  4HZ3 A;  5EC1 C;  5B1B B;  1QVG U;  1DLB A;  4PEL A;  4QPK A;  1F51 A;  2Q68 A;  1F4M A;  5CA3 A;  1DTO A;  1XL6 A;  4QNH B;  3CCL V;  2IJJ A;  4HYO A;  4GX5 A;  4P30 A;  3G4S V;  2JDI G;  3WG7 B;  4RAI A;  2JJ1 G;  4R7C A;  2B1I A;  3FYE B;  4MTX A;  4MVM A;  3QO5 A;  2Q69 A;  3ABM B;  1UJW B;  4XDJ A;  3JD4 A;  2QM8 A;  1RM1 C;  4X89 A;  4JPR A;  1YHQ V;  1NH2 D;  3AG4 B;  2OTJ V;  1NQT A;  4MVO A;  1R3K C;  4MTO A;  2HG5 C;  1VQ9 V;  4JTD B;  4MVZ A;  2WPD G;  4JAV A;  1K3E A;  1H8E G;  4KUM A;  1RPO A;  4JTA B;  4U7O A;  4J9Z B;  1JX9 A;  1HWY A;  3OGC C;  1F4N A;  4RQF A;  2DQ0 A;  3CPW U;  2XAH A;  3ZMU A;  3W7S A;  2ZQM A;  3SYO A;  3ZCC A;  3E8H A;  4TSF G;  2X6C A;  5LHH A;  5FL7 G;  1W0J G;  2Y69 B;  5EBM C;  3CCV V;  1SES A;  4G2K A;  4MVR A;  2EIL C;  4MTF A;  3SPJ A;  4KFM A;  1Q7Y W;  1VQ6 V;  1VQN V;  2K1E A;  4TWK A;  2HFE C;  3SYQ A;  1NKD A;  1PNL A;  2LFS A;  1ZWI C;  2W6I G;  5EK0 A;  5HFM A;  1R6N A;  1YJ9 V;  1RM1 B;  2WLL B;  3OM3 B;  4LP8 A;  4MW8 A;  1K4D C;  1M9N A;  1NR1 A;  2Y48 A;  1P7B A;  4UVA A;  4WFH A;  1BMF G;  4PA9 A;  1WPX A;  4JYB A;  4MVQ A;  1M90 W;  1J95 A;  2WLM A;  3CC2 V;  1SER A;  3DGE A;  4QE9 A;  3CCM V;  1QBZ A;  4QIW F;  3GWO A;  2EIN C;  3JD3 A;  2A0L A;  2A79 B;  3VOU A;  2XAF A;  2EIL B;  2JEU A;  2ZXW C;  4BIZ A;  1QLN A;  1K97 A;  3ZN1 A;  5KA5 A;  4Q20 A;  3M99 B;  1KEC A;  4UVB A;  5IDJ A;  4DO2 A;  1JVM A;  2OTL V;  5LGU A;  4P9P A;  1DF5 A;  1GO3 F;  2MK3 A;  2NNU A;  1NJI W;  4R50 A;  2XOK G;  1YI2 V;  2OCC C;  4GT1 A;  4EKW A;  4GX0 A;  2P67 A;  5LGT A;  1GM7 A;  3TCU A;  4JTC B;  3TK1 A;  1EZJ A;  5B3S C;  4WFG A;  2JJ2 G;  1KP3 A;  2ATK C;  4WFE A;  1W0K G;  2IH3 C;  1CEZ A;  1V54 C;  1G4Y B;  2XAS A;  1H38 A;  3JD1 A;  1V55 B;  4ASU G;  5H6R A;  3OW2 U;  2BOC C;  5E1A C;  1Y66 A;  1MAB G;  4PA7 A;  3E83 A;  3MD0 A;  2DYR B;  1NH2 B;  2HKO A;  1L1F A;  4TT3 G;  2X0L A;  1XL4 A;  4PDV A;  3ABK C;  2IJK A;  1AR1 B;  4PDR A;  5L3E A;  3F7V C;  1YIT V;  1GM9 A;  4FJC C;  2H8P C;  3ZMS A;  5B3S B;  4PA4 A;  1KC8 W;  3AG3 B;  3OUF A;  2R9R B;  3E35 A;  2EIJ B;  2ZR2 A;  3E8B A;  5KA6 A;  3CME V;  3CXC U;  4WFA V;  2JK5 C;  4MW3 A;  3FB7 C;  3T4Z A;  1SRY A;  1GK9 A;  3OMI B;  2Z3Y A;  4ZKI A;  4I9W A;  2UXN A;  4CZZ A;  3OAA G;  1F23 A;  2ITD C;  3ABK B;  3RVZ A;  3FB5 C;  1S72 V;  1OCZ C;  2HR3 A;  3SYC A;  1K92 A;  3AG2 C;  5H9C A;  2IW5 A;  5IY5 B;  2XND G;  4R8C A;  4X88 A;  1GM8 A;  2WLJ A;  4JAU A;  4XDL A;  1OCC C;  1GMG A;  3EFF K;  1S5H C;  3JYC A;  3ASO B;  1SET A;  1VQM V;  1S76 D;  3K04 A;  1YJW V;  3SPH A;  4PDM A;  2WLI A;  4WF9 V;  1K7D A;  3IC7 A;  1NVP D;  1MOF A;  1R3I C;  3KG2 A;  3ABU A;  4JGS A;  3TET A;  3AG2 B;  3CC4 V;  1AI4 A;  3A0R A;  1GTO A;  1YTF D;  1BL8 A;  1M56 B;  1KQS U;  1OCC B;  5B1O A;  3AG1 C;  1ENV A;  3UM7 A;  1VQ5 V;  3OFN G;  3EHB B;  4LBE C;  5H6Q A;  3SYP A;  1I5Y A;  3JD2 A;  2W0F C;  5L3B A;  1COW G;  1M57 C;  1K8A W;  2PI5 A;  4JAS A;  1WLE A;  2GHY A;  3UKM A;  2X7R B;  3BY6 A;  4LC1 A;  2EZO A;  2KB1 A;  2LP7 A;  5KUM A;  1YSC A;  3OR6 C;  3T4D A;  2IU3 A;  3CCR V;  2AHZ A;  4UUJ C;  3AG1 B;  1B6Q A;  1FXK C;  3IGA C;  1K33 A;  2WLN A;  3E8F A;  4P2Z A;  4J9Y B;  4MT8 A;  4X8A A;  1S77 D;  3RW0 A;  2C2A A;  4MS2 A;  3CMA V;  3E86 A;  4RO2 A;  3CC7 V;  3E89 A;  4WCE V;  1JOY A;  2WLK A;  2CK3 G;  4WFB V;  3VBB A;  1LNQ A;  1E1R G;  4U7N A;  1AI6 A;  4FIP C;  3LDC A;  2HVK C;  4MTG A;  1KP2 A;  3ETG A;  5EC2 C;  3W7X A;  5KUK A;  2WLI B;  1K5S A;  3G6E V;  3ASN C;  4CBC A;  1JCH A;  2EIN B;  2YEV A;  2ZR3 A;  2F43 G;  4XBF A;  2EIK C;  2ZXW B;  3E8G A;  3CCE V;  1EFR G;  3QO8 A;  4ZBM A;  1NVP B;  2BOB C;  3LNM B;  3ETD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...