2HJFC

Potassium channel kcsa-fab complex with tetrabutylammonium (tba)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody fragment Heavy chain
publication title Mechanism of Intracellular Block of the KcsA K(+) Channel by Tetrabutylammonium: Insights from X-ray Crystallography, Electrophysiology and Replica-exchange Molecular Dynamics Simulations.
pubmed doi rcsb
molecule tags Metal transport
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hjfC00
2H8PC 4GX2A 3T2MA 4WFEA 5EC1C 2DWEC 2Y69C 1S5HC 1V55C 4LCUC 5B3SC 3E83A 1XL6A 3OUFA 2HJFC 4LBEC 4PA7A 2QTOA 2BOBC 2BOCC 3AG3C 3E8GA 3K06A 4PA4A 3K04A 5EBWC 5EK0A 4HZ3A 4WFGA 2WLNA 5CBGA 2A79B 4GX5A 1R3KC 3UM7A 3K0DA 2ZD9A 3E86A 2WLLA 3LUTB 3RVYA 2K1EA 1KKDA 1OCOC 2EINC 1ZWIC 5EBLC 3ZRSA 1BL8A 3ASOC 5E1AC 4QE7A 4RUFA 4X88A 2YEVA 3SYQA 3OGCC 3T4DA 4H33A 4MVMA 3VOUA 2EIKC 2EIMC 3HPLC 4BW5A 2Q6AA 2WLLB 2AHYA 5KUMA 4PA9A 1K4DC 3AG1C 3ZJZA 1ORQC 5CBHA 4R7CA 3KG2A 3OR7C 3UKMA 4DXWA 5BZBA 1J95A 4MVZA 4WFFA 1V54C 3F5WC 4XDKA 2Q68A 4JTAB 1OCRC 3SYOA 4MS2A 3T4ZA 2DWDC 2WLIA 3LDEA 3ABKC 3SPCA 2X6BA 4J9YB 1R3LC 4KFMA 3FB8C 1M56C 3OR6C 3OUSA 2ITCC 4MVOA 4R6ZA 2EIJC 2IH3C 4LP8A 3T1CA 2DYSC 4MW3A 2DYRC 4MVQA 4PDRA 4R8CA 4CBCA 5IY5C 4PDVA 4MSWC 3SPJA 3K0GA 4J9ZB 4MTGA 3BEHA 4PDLA 4X89A 5EC2C 2HG5C 5CBFA 1M57C 3AG2C 2NLJC 3LDCA 4MVSA 1OCZC 1R3IC 2WLIB 4JTDB 4OXSA 2R9RB 3K08A 3RBZA 3LNMB 2Q69A 4GX0A 4MW8A 3RVZA 3RW0A 3STZC 3TETA 4MTOA 2W0FC 2WLJA 2Q67A 3IFXA 1P7BA 4JTCB 2WLKA 4MVUA 3SPIA 2IH1C 4QE9A 3PJSK 4GX1A 4R50A 1OCCC 2A0LA 3AG4C 3E8BA 3JYCA 4P9PA 4TWKA 4X8AA 3WG7C 2WLMA 2HFEC 2KB1A 4UUJC 2X6AA 2ATKC 4P30A 4PA6A 1QLEC 3F7YC 4G28B 5EBMC 4F4LA 1K4CC 1XL4A 2JK5C 3E8HA 3F7VC 3FB5C 4MTFA 3IGAC 3FB6C 4PDMA 3ASNC 4ZBMA 2P7TC 4P2ZA 4XDLA 3FB7C 5J9PC 3R65A 3ABLC 1LNQA 3TCUA 1G4YB 2AHZA 3SYCA 5KUKA 4PA3A 2EILC 2HVJC 2X6CA 4H37A 5B1AC 3SPHA 2WLHA 2ZXWC 3E89A 3EFFK 4MVRA 3GB7C 2QKSA 4WFHA 5B1BC 4RO2A 3SJQC 3SPGA 3STLC 3E8FA 4P9OA 2HVKC 4HYOA 3K03A 4I9WA 3SYAA 1R3JC 2OCCC 3SYPA 2A9HA 4XDJA 1JVMA 4RAIA 3LDDA 4QNHB 3ABMC 4EKWA 4G27B 4RUEA 3X2QC 2ITDC
chains in the Genus database with same CATH superfamily
2B9ZA 4FLZA 1BS3A 1VQPV 1QLNA 2RN9A 1SQPH 2CH7A 2E76B 2QM8A 3D8CA 1I5XA 1KUQA 3AK2A 3L74H 4X66O 2W6IG 4FM2A 5BR8B 1DF4A 3JARA 4UVBA 5GTIZ 4OPHA 3JAWA 3OGCC 3ZCCA 1GM9A 2L35A 4X66B 2YI8A 4PA9A 4LNUA 5LOVB 1N33O 3M7MX 2EX3A 4W4LA 1MNGA 4HNAA 4X20A 4AILC 4DR4O 4XDKA 4YIOA 4JYYA 3JCUZ 2QA4V 2EIJC 2CH7B 4LP8A 4J11A 1VP7A 2XASA 4DW1A 1PD3A 5GW7A 4MSWC 4DR4B 4NTYA 1A32A 1H2KA 3CC4V 1SQBH 3JARB 4LF4O 1F4NA 1Q81W 4DW0A 3IFXA 3JAWB 3THOA 4H44B 2F4VO 3JYCA 3DGEA 4P9PA 4HAMA 1VQ7V 1Z2GA 4DUZO 3SDLA 5DN6G 1SQXH 4DR5B 3ZHUA 1B04A 4HNAB 4X20B 3G80A 1PKXA 4ZIBA 2JJ1G 3TCUA 2AHZA 4CC6A 4DUZB 3APQA 3RFRA 5A9GA 3H1JH 2AZ0A 1TVKA 4RO2A 4ASUG 3ZMZA 2YS8A 4JZGA 1R6NA 4BAYA 4RWUA 1R3JC 4GUNA 1YTFB 1HNXO 1CP9A 3ABMC 3PN1A 2ZCEA 4GKJO 3SPGA 3E8GA 1HNXB 4HBNA 2WLNA 3CCQV 3UM7A 2PI4A 1Q90D 3QO7A 4B7KA 4NXMB 3ZIAG 1YZBA 3QF7A 1XNQB 1ZAUA 4JAUA 1SC5B 4X88A 4O4HB 3VOUA 1H8EG 2ADPA 4JASA 1KMIZ 1VQ5V 2FKXA 1COWG 4PV1B 4K8ZA 5KHIA 1FXKC 2X0LA 4GYCB 2UUAO 4FFKA 3N27A 4NB5A 1WAZA 2UXCO 2ZE8A 1Q86W 2LQTA 3LDEA 1DF5A 3ABKC 4KUMA 4CS2A 1M56C 4ICGA 5CB4A 1XNRB 4O4JA 5JH7A 5IY5C 4JYCA 3RYIB 3OGIB 1O9GA 1I94B 3NR7A 3EVKA 3FD9A 4GX0A 1IXBA 1RPRA 2Y48A 4JI7O 2EJRA 5KAFZ 2QWNB 3PJSK 2XAHA 1XMOB 5DEDA 1D5NA 4J41A 1R6TA 1Y74A 1QLEC 5C93A 4X65O 2QKCA 5FPRA 3OEHG 1IZ3A 5IJ9B 1VQNV 4O4LA 4JI7B 3CYOA 3D3IA 3SJAC 3ZMVA 3SYCA 2CTQA 1PP9H 2WLHA 5EZYA 5CB4B 3H1LH 2AXTZ 3J81N 3J80N 1VMGA 1JX9A 4PI2A 4JGSA 2A9HA 2JS5A 3ABLB 4RAIA 2KQXA 1MZFA 2ZE6A 3RWRD 5EC1C 2DN9A 4TT3G 5B3SC 3L73H 4FLUA 4FMTA 4PA4A 4E2LA 1Y74B 1FJGB 3QNEA 4WFGA 4BW9A 3IJ4A 2Z5UA 4DV6B 1WLEA 4O4LB 2Y69B 4CH4A 1BL8A 5LGNA 2RMKB 3SYQA 1P4RA 2VS0A 5EZYB 4JYAO 5H5NA 3ZMSA 2R9IA 3OR7C 4YY3O 2ZE5A 4DXWA 2PZSA 2Q68A 1EBOA 3ZS8C 4R6ZA 1KD1W 4MVQA 5GONB 2ETNA 2HG5C 1OCZC 2GDSA 3WB1A 4CH5A 2ZT9B 1M9NA 4LFCB 2LO1A 3D36A 1DGSA 1FYJA 4JI6O 1NVPD 3CJHA 2A7WA 1Q8IA 3E8BA 2JJ2G 4FLWA 1V9PA 1XL4A 2IW5A 2JGDB 3FB7C 3CP1A 1SA0A 4PA3A 2NNUA 3P30A 3JAMN 2HVKC 4J7KA 1UJWB 4LFBO 4UVCA 4KP4A 2OCCC 4DV0O 4UB6Z 1URFA 1VF6C 3K59A 1FFXA 3CJHB 1I0HA 4IYHA 3SPCA 2WPDG 3AG3C 2N04A 5IYZB 4OGQB 2YIBA 2UUCB 3MDSA 1BQZA 3IC9A 4J42A 1TAEA 3LSUA 1BGYH 1HWYA 2AHYA 3QO8A 3ZX6A 3T1HB 3CSXA 1Z5WA 4BR6A 4EFEA 5ITZA 1YI2V 5LHHA 4U7NA 3ASOB 4JTAB 1EN6A 4X62O 2WLIA 2CAZC 1FFXB 2K9PA 4UV9A 4UCUA 3K3WA 4JI1O 4PELA 2N05A 2XT9A 2B1GA 2LW7A 1YF2A 1W59A 2P90A 2Q69A 1FXVA 3HB3B 3ZRVA 3ZMTA 1IBMB 2Q0OC 4N21A 2QR4A 2Y0IA 3B09A 3H01A 3ZHVA 3ETGA 1K5SA 2Z3YA 2IU0A 3ETDA 1B3QA 3FB5C 1SESA 3HKDB 5EIBD 5IYBO 4DR2B 2Q7HA 3TGUH 5DECA 4PJ0Z 2O57A 2EILC 1H2NA 1K73W 3CWBH 4JAAA 4PD4F 4BIUA 3X2QB 1NR1A 4LF8O 4CH3A 3DC5A 5IYCO 4QNHB 4O2BB 5J2TA 3K5LA 4EKWA 4DUYO 3UQ8A 3D3QA 1M90W 4DV5O 4G2KA 1AI7A 1NTKH 3OUFA 4LBEC 2Q9LA 2P6JA 2XOKG 4PA7A 3SJCC 4ZI7B 5LL6Y 4HZ3A 4EEQA 1MZEA 3FX7A 1L1FA 3N2KA 1EZJA 3E86A 1FFTB 5B1OA 1SZTA 1KKDA 2Q5ZA 5CMUA 5EBLC 3S3XA 3UT5A 3JCZA 1K5QA 4H33A 3C3TA 1QNMA 3ML0A 3RYFB 4BW5A 4NYKA 4ZHQA 3GVMA 2Y0PA 2NR5A 5H2FZ 3CRCA 2XAJA 3R66A 1OCRC 4KXRA 3AEIA 3AG2B 1S5JA 2MW2B 2VQEB 1XMQB 2DMXA 2IH3C 2DYSC 4PDRA 5KA6A 3I56V 1JJOA 3SPJA 5LHGA 3N2KB 1Q6UA 4FLVA 3BCCH 4JTDB 4LWSB 1AB3A 5CA1A 3ZRXA 1Y66A 2OIEA 3RVZA 1IBKO 4CS3A 2ODMA 2WLJA 1N36B 1F23A 4JTCB 2QWRB 4MVUA 4JZ2A 1PNLA 3F5TA 2XAFA 4X8AA 1LR1A 1BQ0A 4LF6B 1BE3H 4ZHQB 2X6AA 3C3SA 3JAKA 2YUAA 2RDCA 3O65A 4F4LA 1N32O 2GHYA 3IGAC 4PDMA 3P3PA 4I55B 2QM4A 1EN4A 3AK1A 3CCLV 3L72H 2DE0X 3GWOA 4EB6A 3WG7B 1AI4A 1FXHA 2F43G 2CK3G 4X64B 3ASNB 3K03A 1R1BA 4WFBV 4JI3O 2WWWA 1RSOA 2LFRA 3WB0A 4LFAO 3B4SA 4DR3O 5KMGA 3RN4A 3SGIA 4JF3A 5JCOC 1PL0A 2HJDA 3K57A 1J5EO 3RYCB 4KL1A 5JJJB 1AI6A 3K04A 3UO3A 4UV8A 1L0LH 3JAKB 2ZR3A 4H0LB 2ZD9A 3OD4A 2FMLA 4DR1B 4LF7B 4K3AA 3ZRSA 1CEZA 4EB6B 2PGGA 4QE7A 3MD0A 4Z1MG 1ZL8A 3CCSV 1KP2A 1V54B 3JD0A 5BR8O 4R7CA 5KHHA 3QO5A 4UFZA 4FLTA 1RSOB 1M4UA 3IC7A 1F51A 4FLYA 2ILMA 3OM3B 5KMGB 1M57B 5KLVH 1IVSA 3QG5A 2GUZA 2UXXA 4WCEV 1W0KG 3AG4B 3LNMB 4KHPB 4B3RB 1H38A 1ZL8B 1N8RW 1D2DA 1XBLA 3MHSC 5LA6A 2WLMA 1EN5A 3M8AA 4Z1VA 4YXWG 2OWOA 4K0KO 2IBZH 5LGUA 1QVFU 1G4YB 1QR8A 3JSLA 1XOUA 1PPJH 3HKEA 2M6YA 4DR5O 1XHXA 2YDEA 3E89A 5F2VO 2HKOA 2GUZB 3CRMA 2UXDO 2QKSA 1QR9A 4WFHA 2Q0AA 4K0KB 5EIBC 3BRCA 4HYOA 3FKSG 1K34A 3ZRWA 4DR6B 1JVMA 1ZTEA 2AZ2A 3K0DA 2UXDB 1QBZA 3CEIA 1SQQH 1HNWB 4BWAA 5LA6B 2BOCC 1U97A 4O4HA 4IYIA 2ZE7A 4OX9B 1SQGA 3KCXA 5EYPB 1B6QA 2YIBD 2KG7A 1IXMA 2W6JG 3H1KH 2CTPA 4RUFA 4J80A 3HKEB 5L3BA 2IJHA 4UCSA 2KKWA 2E3CA 2P06A 4NXMO 1N34B 2Q6AA 4U7OA 2HR3A 4JI4B 3KG2A 1XNQO 3UKMA 1SERA 3FAVA 3ZRWB 3HKBA 5L3DA 2EIJB 1L8DA 4X1IA 3RYIA 5LP6A 5KHGA 2EIMB 4MVOA 1R3LC 3CRAA 4D6TH 3BA8A 3I55V 3N2GA 4MW3A 2DYRC 3K0GA 1EFRG 1DLBA 5IWAB 3OMIB 3VQXA 1S76D 2KG7B 1XNRO 1U96A 5E79Z 2Q67A 5IJ9A 5HFLA 1W2BU 1SF9A 1Y67A 4FFBA 3U11A 4B3MB 1I94O 4P30A 2NN4A 3FAVB 3HKBB 3CMEV 2YXHA 1XEQA 3CHXA 4X1IB 3ABLC 3K58A 5LP6B 1XMOO 1HR0B 1H2LA 1KBHA 2G38A 1OCCB 3CC2V 4L8JA 3N2GB 3OAAG 5B1BC 4B3TB 1BHBA 3CCEV 4X1KB 1T5EA 2GTAA 1WB7A 1XILA 4MTXA 3RYHA 2H8PC 3M99B 4FVMA 2ZXWB 2Y69C 3TXQA 2Q7GA 4LCUC 4AI8A 2ZINA 1GTOA 4O4IA 4FFBB 4WFAV 3O9OA 2A79B 2ZNIA 2XTAA 3AG7A 2BTQB 2F95B 1D5AA 1FJGO 3JD1A 4DV7B 1KYOF 3CC7V 4MVMA 1VQMV 3P3NA 4TV8A 4DV6O 2PY5A 2WA3A 2DOSA 1K4DC 2H3OA 3B40A 3SR2C 1WA8A 3ABKB 4UB8Z 5GONA 2ZDIA 4LF9O 4QPJA 3RYHB 1WPBA 2ARHA 4NXNO 2X6BA 3FB8C 1Q43A 4O4IB 4LF9B 1K3EA 5EC2C 1KB9F 1JFFA 4UVAA 3ZEDA 4NTWA 3JATB 3CPWU 1LUVA 4NXNB 5JQGB 4QPKA 5LXTB 2W0FC 1QLEB 2JGDA 2OCHA 3U0ZA 4XBFA 5IJ0A 2Q8VA 2IU3A 2LFSA 4TV8B 2OTJV 2P22C 2UU9B 1H8HG 3ICXA 5LMUB 1L0NH 4LFCO 4F6RA 1NH2B 1WA8B 2JEXA 3W7SA 1ZSPA 4DV2B 1NJIW 2UUBB 4IHJB 2F1MA 3ZMUA 3ABTA 4AQYO 1FPOA 4NTXA 1NU1H 3D36C 1THZA 4MVRA 1RP3B 4NVPA 4FM0A 1XQ8A 3ZHTA 4ABMA 1BT8A 1JFFB 4AQYB 4I4TB 5B1NA 5IYZA 1PNKA 3E22A 3T1YB 4RUEA 1WPXA 3VQVA 1BMFG 2DWEC 5IJ0B 1GN4A 2UXBB 2ZM6B 1XL6A 1Y76A 3B8MA 4FIPC 2M7WA 1RFYA 4F6RB 4X1YA 3OTOB 2PYLA 1I08A 2EZPA 3MAQA 3LUTB 2MK3A 1ZWIC 3DC6A 3ASOC 4FPPA 1MA1A 2BE3A 2EULA 2UUCO 1SKVA 3UCSC 2VWKA 1ORQC 3OTFA 5B66Z 3E22B 3T1HO 1YXBA 2B1IA 4ZKIA 1OCZB 3HKCB 4R8CA 1Y76B 2ITCC 3T1CA 1KC8W 3W7UA 2DW4A 4FM1A 2PUSA 5GTHZ 3L70H 4MTGA 4X1YB 2X7RB 2E74B 4QIWF 1E79G 4FZ0A 3WU2Z 4OXSA 1R3IC 3BHPA 1SQVH 1P49A 2ZQMA 3TETA 3BABA 3HKDA 4PHZA 1N4CA 1TUBB 5D5QA 2IH1C 2A0LA 1GKFA 4DO2A 4I5SA 3FFQA 1IBMO 2JK5C 5IDJA 3H1HH 4OPAA 5IE9A 1G1XB 3G67A 1EM1A 4YIPA 1GN3A 1VQOV 1X4TA 4O2BA 1VF7A 2R9AA 2YICA 2OCCB 1WNSA 2Y4UA 1PL4A 1WB8A 2IJKA 1YTFD 4DR2O 3W7TA 4LH7A 3ABUA 4GZRB 4ZI7A 1KKCA 3KZIZ 3AG3B 1BSMA 4B3SB 4JI2B 4BIOA 3L75H 1V55C 1X59A 3W7WA 3H1IH 5EK0A 1ZX3A 1K7DA 3ZHQA 4GX5A 1R3KC 3VQWA 3RYFA 4DV4B 4LH6A 4UCRA 4JI5B 4DV3B 2QWPB 1QCEA 1N0JA 2PTMA 3OE7G 2E5LB 3ZBHA 5KX5B 1S3JA 4E4EA 2Q4PA 3AG1C 2W0XA 1K33A 2EINB 3E35A 3VQYA 1AROP 2EIKB 1K97A 4LWSA 2D2CB 1KECA 1ZUQA 1Y4MA 2CGOA 1F4MA 5L3FA 2R9RB 2VQEO 1NS1A 1R73A 1XMQO 3G6EV 3JSNA 2OIGA 2GBOA 1AR1B 3CB2A 4I55A 5DM6V 5JVDA 4I9QA 3WG7C 1UFIA 3BFRA 3G6BA 3BAAA 4CC5A 4LF5B 1N36O 1IDSA 3ASNC 1YVWA 5J9PC 1AP6A 3RGBA 1YJNV 1LNQA 4LF6O 4GCZA 3CXCU 1QHTA 3CRQA 3ETEA 4GKKO 3K79A 1VQ6V 1VQ4V 3SYAA 3RYCA 4DYLA 2GV9A 1NQTA 1CXZB 5B1AB 2XAGA 5FL7G 3WFVA 2F66C 4X64O 1AVMA 4GKKB 2JEUA 5JVDB 2HJFC 3A0RA 3CX5F 5L3CA 2RQ6A 2P4KA 2QDOA 2CDYA 2QJ1A 4J10A 2Y4TA 5LHIA 1RM1B 2EZOA 2ZNJA 2WSSG 3ETQA 1MABG 1WP7A 4ZOLB 1K9MW 3CMAV 2YEVA 3ZN0A 4FJCC 1MSWD 3KKYA 4DR1O 1I5YA 2WLLB 4LF7O 3ZJZA 1GRJA 2BCCH 4O2AA 4YJ3A 1OCOB 3CCMV 3F5WC 1SQFA 2F93B 3T4ZA 2DWDC 2QEXV 4JI0B 5FNVA 1GO3F 4K8XA 1AR4A 5LGTA 1G6UA 3BEHA 4PDLA 3LDCA 4MVSA 5K1PA 4U3JA 4TQFA 2YI9A 1IBLO 1E1RG 1H2GA 3RT3C 2WAMA 2YEVB 4QE9A 1JQ0A 1NBMG 4MT8A 5CN0A 2ATKC 4KHPO 1NVPB 5K1XA 1ROPA 2F23A 4G28B 4O2AB 3TXSA 4YJ3B 4B3RO 1Q5OA 1IBLB 2KSDA 3FB6C 1WJZA 4ZBMA 1YJ9V 2PI5A 1NTZH 2GTSA 3B2EE 4A5UB 1GN6A 5FNVB 4H37A 1HP8A 2VQFB 4JI8B 3K5NA 2CTWA 3EFFK 2DQ0A 3GB7C 3JASB 3U10A 3JALA 3STLC 2LP7A 4XDJA 4U3JB 3LDDA 1AJPA 1S72V 1AR5A 4Q20A 5EYPA 2N74A 4QJFB 1NI8A 1S77D 4DR6O 4IIJB 1HDJA 1Q6IA 5CA0A 2V4DA 3CE2A 5IT9N 1HNWO 1N33B 2EJ7A 3J7AU 2IM9A 3BPZA 5E1AC 2Q7EA 3CCUV 4OX9O 1Y6XA 4GT1A 4TSFG 2EIMC 1B06A 1IX9A 3ZHRA 3JALB 2CUGA 2Z0AA 5IYDO 5BZBA 2AW9A 1BCCH 1AJQA 2JRIA 1FAFA 2QWQB 4MS2A 1N34O 4CZZA 4JI4O 4LNUB 4J9YB 4LF4B 3OR6C 2YXYA 5CA0B 2F4VB 2WA4A 3K08A 5JJEB 3RBZA 5KHKA 3STZC 1VEWA 4IL6Z 1GK9A 2QM7A 3LSSA 5LP6C 3L9DA 3P32A 1TA8A 4WBNA 3JD2A 1OCCC 4B08A 5IWAO 2HFEC 2KB1A 4N23A 4RQFA 3H9VA 3F7YC 4DV1O 3G71V 4JAVA 3CD6V 2P7TC 3BVOA 3R65A 4B3MO 4X1KA 2LGQA 1ENVA 4NR1A 3MHHC 2X6CA 2ZXWC 4DV1B 1NZ6A 2FL4A 1OJHA 1GMGA 4Q6GA 3A2FA 2DQ3A 1HR0O 4GKJB 4I0XA 2OYQA 4LC1A 1YIJV 1YSCA 1MG1A 1MOFA 4G27B 2V7QG 3OW2U 3VBBA 2R72A 1VQLV 4B3TO 2Q73A 2LJ2A 1TVKB 1PV0A 2BTQA 4WBNB 2BOBC 1FXKA 2YIDA 1S5LZ 3K5MA 3ABMB 5JJNB 4YHHO 1AI5A 1SS3A 3OEEG 4TUYA 2UUAB 1OV9A 4AHCA 2UXCB 2QE7G 4DRXA 4YHHB 1N0NA 3Q4HA 4I0XB 1WP8A 3SJBC 4J7ZA 4WFFA 4DV7O 1VF5B 2DYRB 3SYOA 3JATA 1NKDA 2L6LA 2QWOB 5JQGA 1AP5A 5LXTA 1XI1A 1FXKB 2QSAA 2FYUH 1GAXA 2JGUA 2QTSA 3K9AA 4X89A 4CS4A 5CBFA 3A0BZ 1RPOA 1PM9A 3LSQA 3E2EA 2XNDG 4MW8A 1YEWA 3RW0A 2ZDIC 4TUYB 4B7EA 4X65B 4O4JB 1M56B 1P7BA 2VWJA 5JH7B 4IHJA 4GLXA 2QGNA 4PI0A 5IY5B 5HFMA 2B5UA 5BXZA 4DRXB 1M1KW 2FB5A 5J2UA 3Q4HB 4FZ1A 1XREA 4D7TA 3E8HA 3UO2A 2P67A 4P2ZA 2PF4E 5B1BB 3CCRV 2UU9O 4I4TA 5LMUO 3CCJV 4DV2O 3EXAA 4U3FH 5KHJA 2UUBO 1VQ9V 1BHAA 3APOA 2FTKA 1R6KA 3CRRA 1P84F 4UCTA 5B5EZ 4GX2A 4WFEA 3OFNG 2R70A 2QTOA 5J2UB 3T1YO 1M5IA 5CBGA 4JYAB 1SZXA 5A2QN 2UXBO 2XUMA 2ZM6O 3RVYA 2K1EA 1SRYA 4YY3B 5B3SB 3JD4A 1KP3A 1HW7A 4TQDA 1HNZO 5AG2A 1DTOA 3OTOO 3HPLC 4TV9A 1GN2A 1NR7A 5KUMA 3W7XA 3HKCA 2BTOA 1AJNA 5JWPA 2IJJA 4MVZA 3ZN1A 1HNZB 1JCHA 3C90A 1EZVH 2HEPA 2ZIMA 2CGNA 1O9HA 3BY6A 3CS5A 3CCVV 5TISZ 1TUBA 4LR3A 1XUQA 2IJIA 3A0HZ 4JI6B 2ZKOA 1DK1A 2CTRA 5H9CA 2NLJC 5L3GA 3B8NA 4DK1A 1FS0G 3TK1A 4H13B 2E75B 4MTOA 2YIAA 4YJ2A 5CA3A 2JDIG 4R50A 1UPGA 4TV9B 1G8MA 1IURA 3F7VC 1VF6A 2YSUB 1SETA 2YC0A 1K8AW 4J7JA 2HHHO 2AGAA 3A8TA 2EBOA 2OTLV 3OMAB 4LFBB 1JJ2U 1GH6A 4DV0B 1YDXA 3K5OA 4I50A 2RJZA 1YJWV 5LBQA 1H2SB 2P4VA 2ADQB 2LGWA 1TGOA 2HHHB 3G4SV 2QKAA 3DTUB 2JIZG 1Q7YW 1OZ0A 1SA0B 4TOIA 5KA5A 4D7SA 3X2QC 2ITDC 5LYJA 3SJQC 5FLXN 1OHHG 2A3QA 1S5HC 4IT5A 5BY1A 4YJ2B 4BIZA 1TUEB 3E83A 1FD9A 1NT2B 5D5PA 3K06A 2XHBA 2LW1A 5H6QA 1MSDA 1KQSU 4B3SO 4JI2O 1QU7A 2RCVA 5KX5A 1YHQV 2EINC 5C8YA 3JD3A 4C7UA 3I5DA 2CE4A 5LMNO 4JV5O 1JOYA 4I50B 2EIKC 1E1QG 4DV4O 4X62B 1BZKA 5CBHA 1GM8A 4JI5O 4DV3O 1M93A 3CXHF 3QVNA 3FYIB 4JI1B 3OT7A 4JPRA 5LMNB 4JV5B 3TJTA 4W4KA 5LYJB 2E5LO 1JA8A 1QQCA 1NTMH 4X9QA 3OUSA 4CBCA 5ITZB 4L87A 1Q6HA 1JPXA 1YCIA 4PDVA 4FLXA 1FKAO 3AG2C 4EFBA 2WLIB 3ZHSA 3EHBB 4WF9V 5C8YB 3SPIA 1VIBA 3FYEB 4TWKA 4UUJC 5FPOA 5BMVA 5EBMC 2OT5A 3B77A 4MTFA 4UCOA 1US6A 1VARA 4XDLA 1P7GA 1W0JG 5L3EA 3HR0A 1QVGU 3DXRA 1MMMA 1AILA 5KUKA 4LF8B 5B1AC 3S3WA 1F7YA 2RNBA 4DUYB 4LF5O 1JMKC 3WB2A 2JS3A 4DV5B 1Z5VA 3E8FA 4P9OA 4I9WA 1V55B 1PNMA 4I7ZB 2UXNA 3DSQA 2ZR2A 2EILB 1RM1C 3T2MA 1WN7A 1LUWA 3GWKC 2GSMB 4UCVA 2XAQA 4FK5C 4ZOLA 5EBWC 2A06H 4JYBA 5BMVB 5J2TB 1XHZA 4IGGA 3NXSA 2WLLA 1H2MA 2V1DA 3DXRB 1OCOC 3QTCA 3AG1B 2DJVA 2HLDG 5H6RA 3T4DA 2P5OA 2ZIOA 1GM7A 1Q82W 3UT5B 1J95A 1V54C 2VRZA 4QGPA 3K9SA 2BSKA 1I7FA 4KFMA 3AK3A 1IBKB 3OMNB 2YXLA 2C2AA 4J9ZB 1Q3EA 1M57C 4JI0O 4DR7O 1OCRB 1YITV 2D3OW 2H94A 1N32B 3IAYA 2WLKA 4RQEA 1JR9A 2DYSB 2HP8A 4Z2WA 4GX1A 1NH2D 3AG4C 4DR7B 3KCYA 4UXNA 3BA9A 5CA1B 4CH6A 4PA6A 1K4CC 4DK0A 1CPYA 3JASA 1S0VA 4F6EA 2JVDA 1XDCA 5KAIZ 4K35A 2HVJC 5JCOA 2BSKB 3SPHA 1KU9A 4JI3B 1K92A 3LNNA 1VQ8V 4LFAB 3L71H 4NKGB 5LOVA 4DR3B 1ZLZA 1J5EB 3SYPA 1VQKV 4IIJA 2VQFO 4JI8O 2PYJA
chains in the Genus database with same CATH topology
1VQLV 1BMFG 2DWEC 4G2KA 1VQPV 1AI7A 1XL6A 3B8MA 3OUFA 1QLNA 4LBEC 4PA7A 2P6JA 2BOBC 2XOKG 1FXKA 4FIPC 2QM8A 2M7WA 4HZ3A 1I5XA 1L1FA 1EZJA 2W6IG 3ABMB 2EZPA 3E86A 1FFTB 5B1OA 1AI5A 3LUTB 1DF4A 2MK3A 1SZTA 4UVBA 1KKDA 1ZWIC 5CMUA 5EBLC 3OEEG 3JCZA 3ASOC 4FPPA 1K5QA 3OGCC 3ZCCA 4H33A 1GM9A 3ML0A 2QE7G 4BW5A 4PA9A 1ORQC 4WFFA 2XAJA 4XDKA 2DYRB 1OCRC 3SYOA 2B1IA 3AEIA 1NKDA 3AG2B 4ZKIA 1OCZB 4R8CA 2ITCC 2QA4V 2EIJC 2IH3C 4LP8A 3T1CA 2DYSC 4PDRA 3W7UA 1KC8W 1FXKB 2DW4A 2XASA 5KA6A 3I56V 1PD3A 5GW7A 4MSWC 3SPJA 5LHGA 3K9AA 4MTGA 4X89A 5CBFA 2X7RB 4QIWF 1RPOA 1E79G 4JTDB 1R3IC 4OXSA 3CC4V 3LSQA 3ZRXA 1Y66A 2XNDG 3E2EA 2ZQMA 1F4NA 4MW8A 3RVZA 3RW0A 2ZDIC 3TETA 1Q81W 2WLJA 1F23A 1M56B 1P7BA 3IFXA 4JTCB 4MVUA 2IH1C 1PNLA 2A0LA 1GKFA 2XAFA 3DGEA 3JYCA 4P9PA 4X8AA 2B5UA 4HAMA 4DO2A 5HFMA 5IY5B 1VQ7V 1M1KW 4I5SA 2X6AA 5DN6G 4F4LA 2JK5C 3E8HA 5IDJA 2GHYA 3IGAC 4PDMA 2P67A 1PKXA 4P2ZA 5B1BB 3CCRV 2JJ1G 3TCUA 3CCLV 2AHZA 3GWOA 1VQOV 3WG7B 1AI4A 1FXHA 2OCCB 3CCJV 2F43G 2IJKA 1YTFD 4RO2A 3W7TA 2CK3G 4ASUG 3ZMZA 1VQ9V 1R6NA 3ASNB 3ABUA 1BHAA 2FTKA 3K03A 1R6KA 4BAYA 1R3JC 1YTFB 4WFBV 1CP9A 3AG3B 3ABMC 2WWWA 2LFRA 4GX2A 4WFEA 1V55C 3W7WA 4JF3A 1PL0A 3OFNG 2QTOA 3SPGA 3E8GA 5EK0A 1AI6A 3K04A 4UV8A 2WLNA 1K7DA 5CBGA 4GX5A 1R3KC 3CCQV 2ZR3A 3UM7A 2PI4A 3QO7A 2ZD9A 3RVYA 3ZIAG 2K1EA 1SRYA 3ZRSA 1CEZA 5B3SB 3JD4A 4JAUA 1KP3A 4QE7A 4X88A 3MD0A 4Z1MG 1QCEA 3VOUA 1H8EG 1DTOA 1KP2A 4JASA 3CCSV 3OE7G 3HPLC 1V54B 1VQ5V 3JD0A 1COWG 1NR7A 5KUMA 1S3JA 3W7XA 3AG1C 4R7CA 1FXKC 2X0LA 1AJNA 1K33A 2EINB 3E35A 2IJJA 4MVZA 3QO5A 3ZN1A 1JCHA 1Q86W 3IC7A 1F51A 3LDEA 1AROP 2EIKB 3OM3B 1K97A 1M57B 1DF5A 3ABKC 4KUMA 1KECA 1M56C 3BY6A 3CCVV 1Y4MA 2UXXA 4WCEV 2IJIA 5IY5C 1W0KG 4JYCA 5H9CA 1F4MA 2NLJC 5L3GA 5L3FA 3B8NA 2R9RB 1M90W 3AG4B 3LNMB 1R73A 3G6EV 4GX0A 1FS0G 3TK1A 4MTOA 1RPRA 1AR1B 2Y48A 2EJRA 5CA3A 2JDIG 5DM6V 1N8RW 1H38A 3PJSK 2XAHA 4R50A 3MHSC 3WG7C 1G8MA 2WLMA 1QLEC 5C93A 4YXWG 3F7VC 2YSUB 1SETA 3OEHG 1K8AW 3ASNC 1VQNV 5J9PC 3CYOA 3D3IA 3ZMVA 2EBOA 2OTLV 5LGUA 3OMAB 1YJNV 1JJ2U 1LNQA 1QVFU 1G4YB 1QR8A 4GCZA 3SYCA 3CXCU 2WLHA 3E89A 1YJWV 2HKOA 5LBQA 2QKSA 3ETEA 1QR9A 4WFHA 3K79A 1JX9A 4HYOA 3G4SV 3DTUB 2JIZG 1VQ6V 1VQ4V 4JGSA 3FKSG 3SYAA 1OZ0A 1Q7YW 1K34A 5KA5A 3ZRWA 2A9HA 3ABLB 1JVMA 4RAIA 1NQTA 3X2QC 2ITDC 3K0DA 5B1AB 3SJQC 2XAGA 1OHHG 5EC1C 1QBZA 5FL7G 1S5HC 3WFVA 4BIZA 1TUEB 4TT3G 2JEUA 3E83A 5B3SC 2HJFC 3A0RA 5L3CA 3K06A 4FMTA 2BOCC 4PA4A 4E2LA 3QNEA 4WFGA 5H6QA 1KQSU 2Z5UA 5LHIA 1B6QA 1WLEA 1RM1B 2EZOA 1YHQV 2WSSG 2EINC 2Y69B 1MABG 1IXMA 1BL8A 3JD3A 2W6JG 5L3BA 5LGNA 4RUFA 3CMAV 1K9MW 1JOYA 2YEVA 3SYQA 2IJHA 1P4RA 3ZN0A 2EIKC 1E1QG 4FJCC 1MSWD 3ZMSA 1I5YA 2Q6AA 2WLLB 4U7OA 2HR3A 3ZJZA 1GM8A 2R9IA 5CBHA 3KG2A 3OR7C 3UKMA 1SERA 4DXWA 3FYIB 1OCOB 3ZRWB 4JPRA 5L3DA 3CCMV 2EIJB 3F5WC 2Q68A 1EBOA 3T4ZA 2DWDC 2QEXV 2EIMB 4MVOA 1R3LC 3OUSA 4R6ZA 3I55V 1KD1W 1GO3F 4MW3A 2DYRC 4MVQA 4CBCA 4L87A 1JPXA 5LGTA 4PDVA 3K0GA 1EFRG 3BEHA 4PDLA 2HG5C 3AG2C 3LDCA 4MVSA 1OCZC 1DLBA 2WLIB 3EHBB 3OMIB 4WF9V 1M9NA 1S76D 1E1RG 1H2GA 3D36A 2Q67A 2WAMA 2YEVB 1NVPD 3SPIA 4QE9A 5HFLA 1W2BU 1JQ0A 3E8BA 3FYEB 4TWKA 1NBMG 4MT8A 4UUJC 5CN0A 2ATKC 2JJ2G 4P30A 1NVPB 1ROPA 4G28B 5EBMC 2OT5A 3B77A 1XL4A 4MTFA 2IW5A 3FB6C 4ZBMA 1YJ9V 4XDLA 1W0JG 3CMEV 3FB7C 5L3EA 2PI5A 1QVGU 3CP1A 3ABLC 5KUKA 4PA3A 3OW2U 1OCCB 4H37A 5B1AC 3CC2V 2NNUA 3OAAG 3P30A 3EFFK 2DQ0A 3GB7C 5B1BC 1BHBA 3CCEV 3STLC 3E8FA 4P9OA 2HVKC 1UJWB 2LP7A 4I9WA 1V55B 1PNMA 4UVCA 4KP4A 2OCCC 2UXNA 4XDJA 3LDDA 1AJPA 2ZR2A 2EILB 4MTXA 1RM1C 4Q20A 1S72V 2H8PC 3M99B 3T2MA 2ZXWB 2Y69C 4LCUC 2GSMB 4QJFB 2XAQA 1GTOA 4FK5C 1S77D 3SPCA 2WPDG 3AG3C 5EBWC 4WFAV 4JYBA 2A79B 3NXSA 2WLLA 2V1DA 1OCOC 3AG1B 2HLDG 5E1AC 3CCUV 5H6RA 3JD1A 3T4DA 4GT1A 3CC7V 4MVMA 4TSFG 1VQMV 2EIMC 3QO8A 1HWYA 2AHYA 1K4DC 1GM7A 1Q82W 5IYDO 3ABKB 5BZBA 1YI2V 1J95A 2ZDIA 1AJQA 1V54C 5LHHA 4U7NA 3ASOB 4JTAB 4QPJA 4MS2A 2WLIA 4CZZA 2X6BA 4J9YB 4KFMA 4UV9A 3FB8C 3OR6C 3OMNB 3K3WA 4PELA 2C2AA 1K3EA 4J9ZB 5EC2C 2B1GA 1M57C 4UVAA 3K08A 1OCRB 3RBZA 3CPWU 1YITV 2P90A 2Q69A 1FXVA 3STZC 3HB3B 3ZRVA 2D3OW 2H94A 4QPKA 3ZMTA 1GK9A 2QM7A 4N21A 3LSSA 2W0FC 1QLEB 4XBFA 2WLKA 4RQEA 2IU3A 2DYSB 2LFSA 3H01A 3P32A 3JD2A 4GX1A 1OCCC 1NH2D 3AG4C 3ETGA 2OTJV 1H8HG 1K5SA 2HFEC 2KB1A 4UXNA 4N23A 2Z3YA 4PA6A 4RQFA 3F7YC 3G71V 2IU0A 1NH2B 1K4CC 4JAVA 3CD6V 3ETDA 3FB5C 1SESA 2JEXA 5IYBO 1CPYA 3W7SA 2P7TC 1S0VA 1NJIW 3ZMUA 3R65A 3ABTA 1ENVA 3MHHC 2EILC 2HVJC 2X6CA 1K73W 3SPHA 2ZXWC 1THZA 4BIUA 4MVRA 1K92A 1GMGA 1VQ8V 3X2QB 2DQ3A 1NR1A 4LC1A 3SYPA 1YIJV 1VQKV 5B1NA 5IYCO 4QNHB 1PNKA 1YSCA 4EKWA 1MG1A 1MOFA 4G27B 2V7QG 4RUEA 1WPXA 3VBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  4GX2 A;  3T2M A;  4WFE A;  5EC1 C;  2DWE C;  2Y69 C;  1S5H C;  1V55 C;  4LCU C;  5B3S C;  3E83 A;  1XL6 A;  3OUF A;  2HJF C;  4LBE C;  4PA7 A;  2QTO A;  2BOB C;  2BOC C;  3AG3 C;  3E8G A;  3K06 A;  4PA4 A;  3K04 A;  5EBW C;  5EK0 A;  4HZ3 A;  4WFG A;  2WLN A;  5CBG A;  2A79 B;  4GX5 A;  1R3K C;  3UM7 A;  3K0D A;  2ZD9 A;  3E86 A;  2WLL A;  3LUT B;  3RVY A;  2K1E A;  1KKD A;  1OCO C;  2EIN C;  1ZWI C;  5EBL C;  3ZRS A;  1BL8 A;  3ASO C;  5E1A C;  4QE7 A;  4RUF A;  4X88 A;  2YEV A;  3SYQ A;  3OGC C;  3T4D A;  4H33 A;  4MVM A;  3VOU A;  2EIK C;  2EIM C;  3HPL C;  4BW5 A;  2Q6A A;  2WLL B;  2AHY A;  5KUM A;  4PA9 A;  1K4D C;  3AG1 C;  3ZJZ A;  1ORQ C;  5CBH A;  4R7C A;  3KG2 A;  3OR7 C;  3UKM A;  4DXW A;  5BZB A;  1J95 A;  4MVZ A;  4WFF A;  1V54 C;  3F5W C;  4XDK A;  2Q68 A;  4JTA B;  1OCR C;  3SYO A;  4MS2 A;  3T4Z A;  2DWD C;  2WLI A;  3LDE A;  3ABK C;  3SPC A;  2X6B A;  4J9Y B;  1R3L C;  4KFM A;  3FB8 C;  1M56 C;  3OR6 C;  3OUS A;  2ITC C;  4MVO A;  4R6Z A;  2EIJ C;  2IH3 C;  4LP8 A;  3T1C A;  2DYS C;  4MW3 A;  2DYR C;  4MVQ A;  4PDR A;  4R8C A;  4CBC A;  5IY5 C;  4PDV A;  4MSW C;  3SPJ A;  3K0G A;  4J9Z B;  4MTG A;  3BEH A;  4PDL A;  4X89 A;  5EC2 C;  2HG5 C;  5CBF A;  1M57 C;  3AG2 C;  2NLJ C;  3LDC A;  4MVS A;  1OCZ C;  1R3I C;  2WLI B;  4JTD B;  4OXS A;  2R9R B;  3K08 A;  3RBZ A;  3LNM B;  2Q69 A;  4GX0 A;  4MW8 A;  3RVZ A;  3RW0 A;  3STZ C;  3TET A;  4MTO A;  2W0F C;  2WLJ A;  2Q67 A;  3IFX A;  1P7B A;  4JTC B;  2WLK A;  4MVU A;  3SPI A;  2IH1 C;  4QE9 A;  3PJS K;  4GX1 A;  4R50 A;  1OCC C;  2A0L A;  3AG4 C;  3E8B A;  3JYC A;  4P9P A;  4TWK A;  4X8A A;  3WG7 C;  2WLM A;  2HFE C;  2KB1 A;  4UUJ C;  2X6A A;  2ATK C;  4P30 A;  4PA6 A;  1QLE C;  3F7Y C;  4G28 B;  5EBM C;  4F4L A;  1K4C C;  1XL4 A;  2JK5 C;  3E8H A;  3F7V C;  3FB5 C;  4MTF A;  3IGA C;  3FB6 C;  4PDM A;  3ASN C;  4ZBM A;  2P7T C;  4P2Z A;  4XDL A;  3FB7 C;  5J9P C;  3R65 A;  3ABL C;  1LNQ A;  3TCU A;  1G4Y B;  2AHZ A;  3SYC A;  5KUK A;  4PA3 A;  2EIL C;  2HVJ C;  2X6C A;  4H37 A;  5B1A C;  3SPH A;  2WLH A;  2ZXW C;  3E89 A;  3EFF K;  4MVR A;  3GB7 C;  2QKS A;  4WFH A;  5B1B C;  4RO2 A;  3SJQ C;  3SPG A;  3STL C;  3E8F A;  4P9O A;  2HVK C;  4HYO A;  3K03 A;  4I9W A;  3SYA A;  1R3J C;  2OCC C;  3SYP A;  2A9H A;  4XDJ A;  1JVM A;  4RAI A;  3LDD A;  4QNH B;  3ABM C;  4EKW A;  4G27 B;  4RUE A;  3X2Q C;  2ITD C; 
#chains in the Genus database with same CATH topology
 2B9Z A;  4FLZ A;  1BS3 A;  1VQP V;  1QLN A;  2RN9 A;  1SQP H;  2CH7 A;  2E76 B;  2QM8 A;  3D8C A;  1I5X A;  1KUQ A;  3AK2 A;  3L74 H;  4X66 O;  2W6I G;  4FM2 A;  5BR8 B;  1DF4 A;  3JAR A;  4UVB A;  5GTI Z;  4OPH A;  3JAW A;  3OGC C;  3ZCC A;  1GM9 A;  2L35 A;  4X66 B;  2YI8 A;  4PA9 A;  4LNU A;  5LOV B;  1N33 O;  3M7M X;  2EX3 A;  4W4L A;  1MNG A;  4HNA A;  4X20 A;  4AIL C;  4DR4 O;  4XDK A;  4YIO A;  4JYY A;  3JCU Z;  2QA4 V;  2EIJ C;  2CH7 B;  4LP8 A;  4J11 A;  1VP7 A;  2XAS A;  4DW1 A;  1PD3 A;  5GW7 A;  4MSW C;  4DR4 B;  4NTY A;  1A32 A;  1H2K A;  3CC4 V;  1SQB H;  3JAR B;  4LF4 O;  1F4N A;  1Q81 W;  4DW0 A;  3IFX A;  3JAW B;  3THO A;  4H44 B;  2F4V O;  3JYC A;  3DGE A;  4P9P A;  4HAM A;  1VQ7 V;  1Z2G A;  4DUZ O;  3SDL A;  5DN6 G;  1SQX H;  4DR5 B;  3ZHU A;  1B04 A;  4HNA B;  4X20 B;  3G80 A;  1PKX A;  4ZIB A;  2JJ1 G;  3TCU A;  2AHZ A;  4CC6 A;  4DUZ B;  3APQ A;  3RFR A;  5A9G A;  3H1J H;  2AZ0 A;  1TVK A;  4RO2 A;  4ASU G;  3ZMZ A;  2YS8 A;  4JZG A;  1R6N A;  4BAY A;  4RWU A;  1R3J C;  4GUN A;  1YTF B;  1HNX O;  1CP9 A;  3ABM C;  3PN1 A;  2ZCE A;  4GKJ O;  3SPG A;  3E8G A;  1HNX B;  4HBN A;  2WLN A;  3CCQ V;  3UM7 A;  2PI4 A;  1Q90 D;  3QO7 A;  4B7K A;  4NXM B;  3ZIA G;  1YZB A;  3QF7 A;  1XNQ B;  1ZAU A;  4JAU A;  1SC5 B;  4X88 A;  4O4H B;  3VOU A;  1H8E G;  2ADP A;  4JAS A;  1KMI Z;  1VQ5 V;  2FKX A;  1COW G;  4PV1 B;  4K8Z A;  5KHI A;  1FXK C;  2X0L A;  4GYC B;  2UUA O;  4FFK A;  3N27 A;  4NB5 A;  1WAZ A;  2UXC O;  2ZE8 A;  1Q86 W;  2LQT A;  3LDE A;  1DF5 A;  3ABK C;  4KUM A;  4CS2 A;  1M56 C;  4ICG A;  5CB4 A;  1XNR B;  4O4J A;  5JH7 A;  5IY5 C;  4JYC A;  3RYI B;  3OGI B;  1O9G A;  1I94 B;  3NR7 A;  3EVK A;  3FD9 A;  4GX0 A;  1IXB A;  1RPR A;  2Y48 A;  4JI7 O;  2EJR A;  5KAF Z;  2QWN B;  3PJS K;  2XAH A;  1XMO B;  5DED A;  1D5N A;  4J41 A;  1R6T A;  1Y74 A;  1QLE C;  5C93 A;  4X65 O;  2QKC A;  5FPR A;  3OEH G;  1IZ3 A;  5IJ9 B;  1VQN V;  4O4L A;  4JI7 B;  3CYO A;  3D3I A;  3SJA C;  3ZMV A;  3SYC A;  2CTQ A;  1PP9 H;  2WLH A;  5EZY A;  5CB4 B;  3H1L H;  2AXT Z;  3J81 N;  3J80 N;  1VMG A;  1JX9 A;  4PI2 A;  4JGS A;  2A9H A;  2JS5 A;  3ABL B;  4RAI A;  2KQX A;  1MZF A;  2ZE6 A;  3RWR D;  5EC1 C;  2DN9 A;  4TT3 G;  5B3S C;  3L73 H;  4FLU A;  4FMT A;  4PA4 A;  4E2L A;  1Y74 B;  1FJG B;  3QNE A;  4WFG A;  4BW9 A;  3IJ4 A;  2Z5U A;  4DV6 B;  1WLE A;  4O4L B;  2Y69 B;  4CH4 A;  1BL8 A;  5LGN A;  2RMK B;  3SYQ A;  1P4R A;  2VS0 A;  5EZY B;  4JYA O;  5H5N A;  3ZMS A;  2R9I A;  3OR7 C;  4YY3 O;  2ZE5 A;  4DXW A;  2PZS A;  2Q68 A;  1EBO A;  3ZS8 C;  4R6Z A;  1KD1 W;  4MVQ A;  5GON B;  2ETN A;  2HG5 C;  1OCZ C;  2GDS A;  3WB1 A;  4CH5 A;  2ZT9 B;  1M9N A;  4LFC B;  2LO1 A;  3D36 A;  1DGS A;  1FYJ A;  4JI6 O;  1NVP D;  3CJH A;  2A7W A;  1Q8I A;  3E8B A;  2JJ2 G;  4FLW A;  1V9P A;  1XL4 A;  2IW5 A;  2JGD B;  3FB7 C;  3CP1 A;  1SA0 A;  4PA3 A;  2NNU A;  3P30 A;  3JAM N;  2HVK C;  4J7K A;  1UJW B;  4LFB O;  4UVC A;  4KP4 A;  2OCC C;  4DV0 O;  4UB6 Z;  1URF A;  1VF6 C;  3K59 A;  1FFX A;  3CJH B;  1I0H A;  4IYH A;  3SPC A;  2WPD G;  3AG3 C;  2N04 A;  5IYZ B;  4OGQ B;  2YIB A;  2UUC B;  3MDS A;  1BQZ A;  3IC9 A;  4J42 A;  1TAE A;  3LSU A;  1BGY H;  1HWY A;  2AHY A;  3QO8 A;  3ZX6 A;  3T1H B;  3CSX A;  1Z5W A;  4BR6 A;  4EFE A;  5ITZ A;  1YI2 V;  5LHH A;  4U7N A;  3ASO B;  4JTA B;  1EN6 A;  4X62 O;  2WLI A;  2CAZ C;  1FFX B;  2K9P A;  4UV9 A;  4UCU A;  3K3W A;  4JI1 O;  4PEL A;  2N05 A;  2XT9 A;  2B1G A;  2LW7 A;  1YF2 A;  1W59 A;  2P90 A;  2Q69 A;  1FXV A;  3HB3 B;  3ZRV A;  3ZMT A;  1IBM B;  2Q0O C;  4N21 A;  2QR4 A;  2Y0I A;  3B09 A;  3H01 A;  3ZHV A;  3ETG A;  1K5S A;  2Z3Y A;  2IU0 A;  3ETD A;  1B3Q A;  3FB5 C;  1SES A;  3HKD B;  5EIB D;  5IYB O;  4DR2 B;  2Q7H A;  3TGU H;  5DEC A;  4PJ0 Z;  2O57 A;  2EIL C;  1H2N A;  1K73 W;  3CWB H;  4JAA A;  4PD4 F;  4BIU A;  3X2Q B;  1NR1 A;  4LF8 O;  4CH3 A;  3DC5 A;  5IYC O;  4QNH B;  4O2B B;  5J2T A;  3K5L A;  4EKW A;  4DUY O;  3UQ8 A;  3D3Q A;  1M90 W;  4DV5 O;  4G2K A;  1AI7 A;  1NTK H;  3OUF A;  4LBE C;  2Q9L A;  2P6J A;  2XOK G;  4PA7 A;  3SJC C;  4ZI7 B;  5LL6 Y;  4HZ3 A;  4EEQ A;  1MZE A;  3FX7 A;  1L1F A;  3N2K A;  1EZJ A;  3E86 A;  1FFT B;  5B1O A;  1SZT A;  1KKD A;  2Q5Z A;  5CMU A;  5EBL C;  3S3X A;  3UT5 A;  3JCZ A;  1K5Q A;  4H33 A;  3C3T A;  1QNM A;  3ML0 A;  3RYF B;  4BW5 A;  4NYK A;  4ZHQ A;  3GVM A;  2Y0P A;  2NR5 A;  5H2F Z;  3CRC A;  2XAJ A;  3R66 A;  1OCR C;  4KXR A;  3AEI A;  3AG2 B;  1S5J A;  2MW2 B;  2VQE B;  1XMQ B;  2DMX A;  2IH3 C;  2DYS C;  4PDR A;  5KA6 A;  3I56 V;  1JJO A;  3SPJ A;  5LHG A;  3N2K B;  1Q6U A;  4FLV A;  3BCC H;  4JTD B;  4LWS B;  1AB3 A;  5CA1 A;  3ZRX A;  1Y66 A;  2OIE A;  3RVZ A;  1IBK O;  4CS3 A;  2ODM A;  2WLJ A;  1N36 B;  1F23 A;  4JTC B;  2QWR B;  4MVU A;  4JZ2 A;  1PNL A;  3F5T A;  2XAF A;  4X8A A;  1LR1 A;  1BQ0 A;  4LF6 B;  1BE3 H;  4ZHQ B;  2X6A A;  3C3S A;  3JAK A;  2YUA A;  2RDC A;  3O65 A;  4F4L A;  1N32 O;  2GHY A;  3IGA C;  4PDM A;  3P3P A;  4I55 B;  2QM4 A;  1EN4 A;  3AK1 A;  3CCL V;  3L72 H;  2DE0 X;  3GWO A;  4EB6 A;  3WG7 B;  1AI4 A;  1FXH A;  2F43 G;  2CK3 G;  4X64 B;  3ASN B;  3K03 A;  1R1B A;  4WFB V;  4JI3 O;  2WWW A;  1RSO A;  2LFR A;  3WB0 A;  4LFA O;  3B4S A;  4DR3 O;  5KMG A;  3RN4 A;  3SGI A;  4JF3 A;  5JCO C;  1PL0 A;  2HJD A;  3K57 A;  1J5E O;  3RYC B;  4KL1 A;  5JJJ B;  1AI6 A;  3K04 A;  3UO3 A;  4UV8 A;  1L0L H;  3JAK B;  2ZR3 A;  4H0L B;  2ZD9 A;  3OD4 A;  2FML A;  4DR1 B;  4LF7 B;  4K3A A;  3ZRS A;  1CEZ A;  4EB6 B;  2PGG A;  4QE7 A;  3MD0 A;  4Z1M G;  1ZL8 A;  3CCS V;  1KP2 A;  1V54 B;  3JD0 A;  5BR8 O;  4R7C A;  5KHH A;  3QO5 A;  4UFZ A;  4FLT A;  1RSO B;  1M4U A;  3IC7 A;  1F51 A;  4FLY A;  2ILM A;  3OM3 B;  5KMG B;  1M57 B;  5KLV H;  1IVS A;  3QG5 A;  2GUZ A;  2UXX A;  4WCE V;  1W0K G;  3AG4 B;  3LNM B;  4KHP B;  4B3R B;  1H38 A;  1ZL8 B;  1N8R W;  1D2D A;  1XBL A;  3MHS C;  5LA6 A;  2WLM A;  1EN5 A;  3M8A A;  4Z1V A;  4YXW G;  2OWO A;  4K0K O;  2IBZ H;  5LGU A;  1QVF U;  1G4Y B;  1QR8 A;  3JSL A;  1XOU A;  1PPJ H;  3HKE A;  2M6Y A;  4DR5 O;  1XHX A;  2YDE A;  3E89 A;  5F2V O;  2HKO A;  2GUZ B;  3CRM A;  2UXD O;  2QKS A;  1QR9 A;  4WFH A;  2Q0A A;  4K0K B;  5EIB C;  3BRC A;  4HYO A;  3FKS G;  1K34 A;  3ZRW A;  4DR6 B;  1JVM A;  1ZTE A;  2AZ2 A;  3K0D A;  2UXD B;  1QBZ A;  3CEI A;  1SQQ H;  1HNW B;  4BWA A;  5LA6 B;  2BOC C;  1U97 A;  4O4H A;  4IYI A;  2ZE7 A;  4OX9 B;  1SQG A;  3KCX A;  5EYP B;  1B6Q A;  2YIB D;  2KG7 A;  1IXM A;  2W6J G;  3H1K H;  2CTP A;  4RUF A;  4J80 A;  3HKE B;  5L3B A;  2IJH A;  4UCS A;  2KKW A;  2E3C A;  2P06 A;  4NXM O;  1N34 B;  2Q6A A;  4U7O A;  2HR3 A;  4JI4 B;  3KG2 A;  1XNQ O;  3UKM A;  1SER A;  3FAV A;  3ZRW B;  3HKB A;  5L3D A;  2EIJ B;  1L8D A;  4X1I A;  3RYI A;  5LP6 A;  5KHG A;  2EIM B;  4MVO A;  1R3L C;  3CRA A;  4D6T H;  3BA8 A;  3I55 V;  3N2G A;  4MW3 A;  2DYR C;  3K0G A;  1EFR G;  1DLB A;  5IWA B;  3OMI B;  3VQX A;  1S76 D;  2KG7 B;  1XNR O;  1U96 A;  5E79 Z;  2Q67 A;  5IJ9 A;  5HFL A;  1W2B U;  1SF9 A;  1Y67 A;  4FFB A;  3U11 A;  4B3M B;  1I94 O;  4P30 A;  2NN4 A;  3FAV B;  3HKB B;  3CME V;  2YXH A;  1XEQ A;  3CHX A;  4X1I B;  3ABL C;  3K58 A;  5LP6 B;  1XMO O;  1HR0 B;  1H2L A;  1KBH A;  2G38 A;  1OCC B;  3CC2 V;  4L8J A;  3N2G B;  3OAA G;  5B1B C;  4B3T B;  1BHB A;  3CCE V;  4X1K B;  1T5E A;  2GTA A;  1WB7 A;  1XIL A;  4MTX A;  3RYH A;  2H8P C;  3M99 B;  4FVM A;  2ZXW B;  2Y69 C;  3TXQ A;  2Q7G A;  4LCU C;  4AI8 A;  2ZIN A;  1GTO A;  4O4I A;  4FFB B;  4WFA V;  3O9O A;  2A79 B;  2ZNI A;  2XTA A;  3AG7 A;  2BTQ B;  2F95 B;  1D5A A;  1FJG O;  3JD1 A;  4DV7 B;  1KYO F;  3CC7 V;  4MVM A;  1VQM V;  3P3N A;  4TV8 A;  4DV6 O;  2PY5 A;  2WA3 A;  2DOS A;  1K4D C;  2H3O A;  3B40 A;  3SR2 C;  1WA8 A;  3ABK B;  4UB8 Z;  5GON A;  2ZDI A;  4LF9 O;  4QPJ A;  3RYH B;  1WPB A;  2ARH A;  4NXN O;  2X6B A;  3FB8 C;  1Q43 A;  4O4I B;  4LF9 B;  1K3E A;  5EC2 C;  1KB9 F;  1JFF A;  4UVA A;  3ZED A;  4NTW A;  3JAT B;  3CPW U;  1LUV A;  4NXN B;  5JQG B;  4QPK A;  5LXT B;  2W0F C;  1QLE B;  2JGD A;  2OCH A;  3U0Z A;  4XBF A;  5IJ0 A;  2Q8V A;  2IU3 A;  2LFS A;  4TV8 B;  2OTJ V;  2P22 C;  2UU9 B;  1H8H G;  3ICX A;  5LMU B;  1L0N H;  4LFC O;  4F6R A;  1NH2 B;  1WA8 B;  2JEX A;  3W7S A;  1ZSP A;  4DV2 B;  1NJI W;  2UUB B;  4IHJ B;  2F1M A;  3ZMU A;  3ABT A;  4AQY O;  1FPO A;  4NTX A;  1NU1 H;  3D36 C;  1THZ A;  4MVR A;  1RP3 B;  4NVP A;  4FM0 A;  1XQ8 A;  3ZHT A;  4ABM A;  1BT8 A;  1JFF B;  4AQY B;  4I4T B;  5B1N A;  5IYZ A;  1PNK A;  3E22 A;  3T1Y B;  4RUE A;  1WPX A;  3VQV A;  1BMF G;  2DWE C;  5IJ0 B;  1GN4 A;  2UXB B;  2ZM6 B;  1XL6 A;  1Y76 A;  3B8M A;  4FIP C;  2M7W A;  1RFY A;  4F6R B;  4X1Y A;  3OTO B;  2PYL A;  1I08 A;  2EZP A;  3MAQ A;  3LUT B;  2MK3 A;  1ZWI C;  3DC6 A;  3ASO C;  4FPP A;  1MA1 A;  2BE3 A;  2EUL A;  2UUC O;  1SKV A;  3UCS C;  2VWK A;  1ORQ C;  3OTF A;  5B66 Z;  3E22 B;  3T1H O;  1YXB A;  2B1I A;  4ZKI A;  1OCZ B;  3HKC B;  4R8C A;  1Y76 B;  2ITC C;  3T1C A;  1KC8 W;  3W7U A;  2DW4 A;  4FM1 A;  2PUS A;  5GTH Z;  3L70 H;  4MTG A;  4X1Y B;  2X7R B;  2E74 B;  4QIW F;  1E79 G;  4FZ0 A;  3WU2 Z;  4OXS A;  1R3I C;  3BHP A;  1SQV H;  1P49 A;  2ZQM A;  3TET A;  3BAB A;  3HKD A;  4PHZ A;  1N4C A;  1TUB B;  5D5Q A;  2IH1 C;  2A0L A;  1GKF A;  4DO2 A;  4I5S A;  3FFQ A;  1IBM O;  2JK5 C;  5IDJ A;  3H1H H;  4OPA A;  5IE9 A;  1G1X B;  3G67 A;  1EM1 A;  4YIP A;  1GN3 A;  1VQO V;  1X4T A;  4O2B A;  1VF7 A;  2R9A A;  2YIC A;  2OCC B;  1WNS A;  2Y4U A;  1PL4 A;  1WB8 A;  2IJK A;  1YTF D;  4DR2 O;  3W7T A;  4LH7 A;  3ABU A;  4GZR B;  4ZI7 A;  1KKC A;  3KZI Z;  3AG3 B;  1BSM A;  4B3S B;  4JI2 B;  4BIO A;  3L75 H;  1V55 C;  1X59 A;  3W7W A;  3H1I H;  5EK0 A;  1ZX3 A;  1K7D A;  3ZHQ A;  4GX5 A;  1R3K C;  3VQW A;  3RYF A;  4DV4 B;  4LH6 A;  4UCR A;  4JI5 B;  4DV3 B;  2QWP B;  1QCE A;  1N0J A;  2PTM A;  3OE7 G;  2E5L B;  3ZBH A;  5KX5 B;  1S3J A;  4E4E A;  2Q4P A;  3AG1 C;  2W0X A;  1K33 A;  2EIN B;  3E35 A;  3VQY A;  1ARO P;  2EIK B;  1K97 A;  4LWS A;  2D2C B;  1KEC A;  1ZUQ A;  1Y4M A;  2CGO A;  1F4M A;  5L3F A;  2R9R B;  2VQE O;  1NS1 A;  1R73 A;  1XMQ O;  3G6E V;  3JSN A;  2OIG A;  2GBO A;  1AR1 B;  3CB2 A;  4I55 A;  5DM6 V;  5JVD A;  4I9Q A;  3WG7 C;  1UFI A;  3BFR A;  3G6B A;  3BAA A;  4CC5 A;  4LF5 B;  1N36 O;  1IDS A;  3ASN C;  1YVW A;  5J9P C;  1AP6 A;  3RGB A;  1YJN V;  1LNQ A;  4LF6 O;  4GCZ A;  3CXC U;  1QHT A;  3CRQ A;  3ETE A;  4GKK O;  3K79 A;  1VQ6 V;  1VQ4 V;  3SYA A;  3RYC A;  4DYL A;  2GV9 A;  1NQT A;  1CXZ B;  5B1A B;  2XAG A;  5FL7 G;  3WFV A;  2F66 C;  4X64 O;  1AVM A;  4GKK B;  2JEU A;  5JVD B;  2HJF C;  3A0R A;  3CX5 F;  5L3C A;  2RQ6 A;  2P4K A;  2QDO A;  2CDY A;  2QJ1 A;  4J10 A;  2Y4T A;  5LHI A;  1RM1 B;  2EZO A;  2ZNJ A;  2WSS G;  3ETQ A;  1MAB G;  1WP7 A;  4ZOL B;  1K9M W;  3CMA V;  2YEV A;  3ZN0 A;  4FJC C;  1MSW D;  3KKY A;  4DR1 O;  1I5Y A;  2WLL B;  4LF7 O;  3ZJZ A;  1GRJ A;  2BCC H;  4O2A A;  4YJ3 A;  1OCO B;  3CCM V;  3F5W C;  1SQF A;  2F93 B;  3T4Z A;  2DWD C;  2QEX V;  4JI0 B;  5FNV A;  1GO3 F;  4K8X A;  1AR4 A;  5LGT A;  1G6U A;  3BEH A;  4PDL A;  3LDC A;  4MVS A;  5K1P A;  4U3J A;  4TQF A;  2YI9 A;  1IBL O;  1E1R G;  1H2G A;  3RT3 C;  2WAM A;  2YEV B;  4QE9 A;  1JQ0 A;  1NBM G;  4MT8 A;  5CN0 A;  2ATK C;  4KHP O;  1NVP B;  5K1X A;  1ROP A;  2F23 A;  4G28 B;  4O2A B;  3TXS A;  4YJ3 B;  4B3R O;  1Q5O A;  1IBL B;  2KSD A;  3FB6 C;  1WJZ A;  4ZBM A;  1YJ9 V;  2PI5 A;  1NTZ H;  2GTS A;  3B2E E;  4A5U B;  1GN6 A;  5FNV B;  4H37 A;  1HP8 A;  2VQF B;  4JI8 B;  3K5N A;  2CTW A;  3EFF K;  2DQ0 A;  3GB7 C;  3JAS B;  3U10 A;  3JAL A;  3STL C;  2LP7 A;  4XDJ A;  4U3J B;  3LDD A;  1AJP A;  1S72 V;  1AR5 A;  4Q20 A;  5EYP A;  2N74 A;  4QJF B;  1NI8 A;  1S77 D;  4DR6 O;  4IIJ B;  1HDJ A;  1Q6I A;  5CA0 A;  2V4D A;  3CE2 A;  5IT9 N;  1HNW O;  1N33 B;  2EJ7 A;  3J7A U;  2IM9 A;  3BPZ A;  5E1A C;  2Q7E A;  3CCU V;  4OX9 O;  1Y6X A;  4GT1 A;  4TSF G;  2EIM C;  1B06 A;  1IX9 A;  3ZHR A;  3JAL B;  2CUG A;  2Z0A A;  5IYD O;  5BZB A;  2AW9 A;  1BCC H;  1AJQ A;  2JRI A;  1FAF A;  2QWQ B;  4MS2 A;  1N34 O;  4CZZ A;  4JI4 O;  4LNU B;  4J9Y B;  4LF4 B;  3OR6 C;  2YXY A;  5CA0 B;  2F4V B;  2WA4 A;  3K08 A;  5JJE B;  3RBZ A;  5KHK A;  3STZ C;  1VEW A;  4IL6 Z;  1GK9 A;  2QM7 A;  3LSS A;  5LP6 C;  3L9D A;  3P32 A;  1TA8 A;  4WBN A;  3JD2 A;  1OCC C;  4B08 A;  5IWA O;  2HFE C;  2KB1 A;  4N23 A;  4RQF A;  3H9V A;  3F7Y C;  4DV1 O;  3G71 V;  4JAV A;  3CD6 V;  2P7T C;  3BVO A;  3R65 A;  4B3M O;  4X1K A;  2LGQ A;  1ENV A;  4NR1 A;  3MHH C;  2X6C A;  2ZXW C;  4DV1 B;  1NZ6 A;  2FL4 A;  1OJH A;  1GMG A;  4Q6G A;  3A2F A;  2DQ3 A;  1HR0 O;  4GKJ B;  4I0X A;  2OYQ A;  4LC1 A;  1YIJ V;  1YSC A;  1MG1 A;  1MOF A;  4G27 B;  2V7Q G;  3OW2 U;  3VBB A;  2R72 A;  1VQL V;  4B3T O;  2Q73 A;  2LJ2 A;  1TVK B;  1PV0 A;  2BTQ A;  4WBN B;  2BOB C;  1FXK A;  2YID A;  1S5L Z;  3K5M A;  3ABM B;  5JJN B;  4YHH O;  1AI5 A;  1SS3 A;  3OEE G;  4TUY A;  2UUA B;  1OV9 A;  4AHC A;  2UXC B;  2QE7 G;  4DRX A;  4YHH B;  1N0N A;  3Q4H A;  4I0X B;  1WP8 A;  3SJB C;  4J7Z A;  4WFF A;  4DV7 O;  1VF5 B;  2DYR B;  3SYO A;  3JAT A;  1NKD A;  2L6L A;  2QWO B;  5JQG A;  1AP5 A;  5LXT A;  1XI1 A;  1FXK B;  2QSA A;  2FYU H;  1GAX A;  2JGU A;  2QTS A;  3K9A A;  4X89 A;  4CS4 A;  5CBF A;  3A0B Z;  1RPO A;  1PM9 A;  3LSQ A;  3E2E A;  2XND G;  4MW8 A;  1YEW A;  3RW0 A;  2ZDI C;  4TUY B;  4B7E A;  4X65 B;  4O4J B;  1M56 B;  1P7B A;  2VWJ A;  5JH7 B;  4IHJ A;  4GLX A;  2QGN A;  4PI0 A;  5IY5 B;  5HFM A;  2B5U A;  5BXZ A;  4DRX B;  1M1K W;  2FB5 A;  5J2U A;  3Q4H B;  4FZ1 A;  1XRE A;  4D7T A;  3E8H A;  3UO2 A;  2P67 A;  4P2Z A;  2PF4 E;  5B1B B;  3CCR V;  2UU9 O;  4I4T A;  5LMU O;  3CCJ V;  4DV2 O;  3EXA A;  4U3F H;  5KHJ A;  2UUB O;  1VQ9 V;  1BHA A;  3APO A;  2FTK A;  1R6K A;  3CRR A;  1P84 F;  4UCT A;  5B5E Z;  4GX2 A;  4WFE A;  3OFN G;  2R70 A;  2QTO A;  5J2U B;  3T1Y O;  1M5I A;  5CBG A;  4JYA B;  1SZX A;  5A2Q N;  2UXB O;  2XUM A;  2ZM6 O;  3RVY A;  2K1E A;  1SRY A;  4YY3 B;  5B3S B;  3JD4 A;  1KP3 A;  1HW7 A;  4TQD A;  1HNZ O;  5AG2 A;  1DTO A;  3OTO O;  3HPL C;  4TV9 A;  1GN2 A;  1NR7 A;  5KUM A;  3W7X A;  3HKC A;  2BTO A;  1AJN A;  5JWP A;  2IJJ A;  4MVZ A;  3ZN1 A;  1HNZ B;  1JCH A;  3C90 A;  1EZV H;  2HEP A;  2ZIM A;  2CGN A;  1O9H A;  3BY6 A;  3CS5 A;  3CCV V;  5TIS Z;  1TUB A;  4LR3 A;  1XUQ A;  2IJI A;  3A0H Z;  4JI6 B;  2ZKO A;  1DK1 A;  2CTR A;  5H9C A;  2NLJ C;  5L3G A;  3B8N A;  4DK1 A;  1FS0 G;  3TK1 A;  4H13 B;  2E75 B;  4MTO A;  2YIA A;  4YJ2 A;  5CA3 A;  2JDI G;  4R50 A;  1UPG A;  4TV9 B;  1G8M A;  1IUR A;  3F7V C;  1VF6 A;  2YSU B;  1SET A;  2YC0 A;  1K8A W;  4J7J A;  2HHH O;  2AGA A;  3A8T A;  2EBO A;  2OTL V;  3OMA B;  4LFB B;  1JJ2 U;  1GH6 A;  4DV0 B;  1YDX A;  3K5O A;  4I50 A;  2RJZ A;  1YJW V;  5LBQ A;  1H2S B;  2P4V A;  2ADQ B;  2LGW A;  1TGO A;  2HHH B;  3G4S V;  2QKA A;  3DTU B;  2JIZ G;  1Q7Y W;  1OZ0 A;  1SA0 B;  4TOI A;  5KA5 A;  4D7S A;  3X2Q C;  2ITD C;  5LYJ A;  3SJQ C;  5FLX N;  1OHH G;  2A3Q A;  1S5H C;  4IT5 A;  5BY1 A;  4YJ2 B;  4BIZ A;  1TUE B;  3E83 A;  1FD9 A;  1NT2 B;  5D5P A;  3K06 A;  2XHB A;  2LW1 A;  5H6Q A;  1MSD A;  1KQS U;  4B3S O;  4JI2 O;  1QU7 A;  2RCV A;  5KX5 A;  1YHQ V;  2EIN C;  5C8Y A;  3JD3 A;  4C7U A;  3I5D A;  2CE4 A;  5LMN O;  4JV5 O;  1JOY A;  4I50 B;  2EIK C;  1E1Q G;  4DV4 O;  4X62 B;  1BZK A;  5CBH A;  1GM8 A;  4JI5 O;  4DV3 O;  1M93 A;  3CXH F;  3QVN A;  3FYI B;  4JI1 B;  3OT7 A;  4JPR A;  5LMN B;  4JV5 B;  3TJT A;  4W4K A;  5LYJ B;  2E5L O;  1JA8 A;  1QQC A;  1NTM H;  4X9Q A;  3OUS A;  4CBC A;  5ITZ B;  4L87 A;  1Q6H A;  1JPX A;  1YCI A;  4PDV A;  4FLX A;  1FKA O;  3AG2 C;  4EFB A;  2WLI B;  3ZHS A;  3EHB B;  4WF9 V;  5C8Y B;  3SPI A;  1VIB A;  3FYE B;  4TWK A;  4UUJ C;  5FPO A;  5BMV A;  5EBM C;  2OT5 A;  3B77 A;  4MTF A;  4UCO A;  1US6 A;  1VAR A;  4XDL A;  1P7G A;  1W0J G;  5L3E A;  3HR0 A;  1QVG U;  3DXR A;  1MMM A;  1AIL A;  5KUK A;  4LF8 B;  5B1A C;  3S3W A;  1F7Y A;  2RNB A;  4DUY B;  4LF5 O;  1JMK C;  3WB2 A;  2JS3 A;  4DV5 B;  1Z5V A;  3E8F A;  4P9O A;  4I9W A;  1V55 B;  1PNM A;  4I7Z B;  2UXN A;  3DSQ A;  2ZR2 A;  2EIL B;  1RM1 C;  3T2M A;  1WN7 A;  1LUW A;  3GWK C;  2GSM B;  4UCV A;  2XAQ A;  4FK5 C;  4ZOL A;  5EBW C;  2A06 H;  4JYB A;  5BMV B;  5J2T B;  1XHZ A;  4IGG A;  3NXS A;  2WLL A;  1H2M A;  2V1D A;  3DXR B;  1OCO C;  3QTC A;  3AG1 B;  2DJV A;  2HLD G;  5H6R A;  3T4D A;  2P5O A;  2ZIO A;  1GM7 A;  1Q82 W;  3UT5 B;  1J95 A;  1V54 C;  2VRZ A;  4QGP A;  3K9S A;  2BSK A;  1I7F A;  4KFM A;  3AK3 A;  1IBK B;  3OMN B;  2YXL A;  2C2A A;  4J9Z B;  1Q3E A;  1M57 C;  4JI0 O;  4DR7 O;  1OCR B;  1YIT V;  2D3O W;  2H94 A;  1N32 B;  3IAY A;  2WLK A;  4RQE A;  1JR9 A;  2DYS B;  2HP8 A;  4Z2W A;  4GX1 A;  1NH2 D;  3AG4 C;  4DR7 B;  3KCY A;  4UXN A;  3BA9 A;  5CA1 B;  4CH6 A;  4PA6 A;  1K4C C;  4DK0 A;  1CPY A;  3JAS A;  1S0V A;  4F6E A;  2JVD A;  1XDC A;  5KAI Z;  4K35 A;  2HVJ C;  5JCO A;  2BSK B;  3SPH A;  1KU9 A;  4JI3 B;  1K92 A;  3LNN A;  1VQ8 V;  4LFA B;  3L71 H;  4NKG B;  5LOV A;  4DR3 B;  1ZLZ A;  1J5E B;  3SYP A;  1VQK V;  4IIJ A;  2VQF O;  4JI8 O;  2PYJ A; 
#chains in the Genus database with same CATH homology
 1VQL V;  1BMF G;  2DWE C;  4G2K A;  1VQP V;  1AI7 A;  1XL6 A;  3B8M A;  3OUF A;  1QLN A;  4LBE C;  4PA7 A;  2P6J A;  2BOB C;  2XOK G;  1FXK A;  4FIP C;  2QM8 A;  2M7W A;  4HZ3 A;  1I5X A;  1L1F A;  1EZJ A;  2W6I G;  3ABM B;  2EZP A;  3E86 A;  1FFT B;  5B1O A;  1AI5 A;  3LUT B;  1DF4 A;  2MK3 A;  1SZT A;  4UVB A;  1KKD A;  1ZWI C;  5CMU A;  5EBL C;  3OEE G;  3JCZ A;  3ASO C;  4FPP A;  1K5Q A;  3OGC C;  3ZCC A;  4H33 A;  1GM9 A;  3ML0 A;  2QE7 G;  4BW5 A;  4PA9 A;  1ORQ C;  4WFF A;  2XAJ A;  4XDK A;  2DYR B;  1OCR C;  3SYO A;  2B1I A;  3AEI A;  1NKD A;  3AG2 B;  4ZKI A;  1OCZ B;  4R8C A;  2ITC C;  2QA4 V;  2EIJ C;  2IH3 C;  4LP8 A;  3T1C A;  2DYS C;  4PDR A;  3W7U A;  1KC8 W;  1FXK B;  2DW4 A;  2XAS A;  5KA6 A;  3I56 V;  1PD3 A;  5GW7 A;  4MSW C;  3SPJ A;  5LHG A;  3K9A A;  4MTG A;  4X89 A;  5CBF A;  2X7R B;  4QIW F;  1RPO A;  1E79 G;  4JTD B;  1R3I C;  4OXS A;  3CC4 V;  3LSQ A;  3ZRX A;  1Y66 A;  2XND G;  3E2E A;  2ZQM A;  1F4N A;  4MW8 A;  3RVZ A;  3RW0 A;  2ZDI C;  3TET A;  1Q81 W;  2WLJ A;  1F23 A;  1M56 B;  1P7B A;  3IFX A;  4JTC B;  4MVU A;  2IH1 C;  1PNL A;  2A0L A;  1GKF A;  2XAF A;  3DGE A;  3JYC A;  4P9P A;  4X8A A;  2B5U A;  4HAM A;  4DO2 A;  5HFM A;  5IY5 B;  1VQ7 V;  1M1K W;  4I5S A;  2X6A A;  5DN6 G;  4F4L A;  2JK5 C;  3E8H A;  5IDJ A;  2GHY A;  3IGA C;  4PDM A;  2P67 A;  1PKX A;  4P2Z A;  5B1B B;  3CCR V;  2JJ1 G;  3TCU A;  3CCL V;  2AHZ A;  3GWO A;  1VQO V;  3WG7 B;  1AI4 A;  1FXH A;  2OCC B;  3CCJ V;  2F43 G;  2IJK A;  1YTF D;  4RO2 A;  3W7T A;  2CK3 G;  4ASU G;  3ZMZ A;  1VQ9 V;  1R6N A;  3ASN B;  3ABU A;  1BHA A;  2FTK A;  3K03 A;  1R6K A;  4BAY A;  1R3J C;  1YTF B;  4WFB V;  1CP9 A;  3AG3 B;  3ABM C;  2WWW A;  2LFR A;  4GX2 A;  4WFE A;  1V55 C;  3W7W A;  4JF3 A;  1PL0 A;  3OFN G;  2QTO A;  3SPG A;  3E8G A;  5EK0 A;  1AI6 A;  3K04 A;  4UV8 A;  2WLN A;  1K7D A;  5CBG A;  4GX5 A;  1R3K C;  3CCQ V;  2ZR3 A;  3UM7 A;  2PI4 A;  3QO7 A;  2ZD9 A;  3RVY A;  3ZIA G;  2K1E A;  1SRY A;  3ZRS A;  1CEZ A;  5B3S B;  3JD4 A;  4JAU A;  1KP3 A;  4QE7 A;  4X88 A;  3MD0 A;  4Z1M G;  1QCE A;  3VOU A;  1H8E G;  1DTO A;  1KP2 A;  4JAS A;  3CCS V;  3OE7 G;  3HPL C;  1V54 B;  1VQ5 V;  3JD0 A;  1COW G;  1NR7 A;  5KUM A;  1S3J A;  3W7X A;  3AG1 C;  4R7C A;  1FXK C;  2X0L A;  1AJN A;  1K33 A;  2EIN B;  3E35 A;  2IJJ A;  4MVZ A;  3QO5 A;  3ZN1 A;  1JCH A;  1Q86 W;  3IC7 A;  1F51 A;  3LDE A;  1ARO P;  2EIK B;  3OM3 B;  1K97 A;  1M57 B;  1DF5 A;  3ABK C;  4KUM A;  1KEC A;  1M56 C;  3BY6 A;  3CCV V;  1Y4M A;  2UXX A;  4WCE V;  2IJI A;  5IY5 C;  1W0K G;  4JYC A;  5H9C A;  1F4M A;  2NLJ C;  5L3G A;  5L3F A;  3B8N A;  2R9R B;  1M90 W;  3AG4 B;  3LNM B;  1R73 A;  3G6E V;  4GX0 A;  1FS0 G;  3TK1 A;  4MTO A;  1RPR A;  1AR1 B;  2Y48 A;  2EJR A;  5CA3 A;  2JDI G;  5DM6 V;  1N8R W;  1H38 A;  3PJS K;  2XAH A;  4R50 A;  3MHS C;  3WG7 C;  1G8M A;  2WLM A;  1QLE C;  5C93 A;  4YXW G;  3F7V C;  2YSU B;  1SET A;  3OEH G;  1K8A W;  3ASN C;  1VQN V;  5J9P C;  3CYO A;  3D3I A;  3ZMV A;  2EBO A;  2OTL V;  5LGU A;  3OMA B;  1YJN V;  1JJ2 U;  1LNQ A;  1QVF U;  1G4Y B;  1QR8 A;  4GCZ A;  3SYC A;  3CXC U;  2WLH A;  3E89 A;  1YJW V;  2HKO A;  5LBQ A;  2QKS A;  3ETE A;  1QR9 A;  4WFH A;  3K79 A;  1JX9 A;  4HYO A;  3G4S V;  3DTU B;  2JIZ G;  1VQ6 V;  1VQ4 V;  4JGS A;  3FKS G;  3SYA A;  1OZ0 A;  1Q7Y W;  1K34 A;  5KA5 A;  3ZRW A;  2A9H A;  3ABL B;  1JVM A;  4RAI A;  1NQT A;  3X2Q C;  2ITD C;  3K0D A;  5B1A B;  3SJQ C;  2XAG A;  1OHH G;  5EC1 C;  1QBZ A;  5FL7 G;  1S5H C;  3WFV A;  4BIZ A;  1TUE B;  4TT3 G;  2JEU A;  3E83 A;  5B3S C;  2HJF C;  3A0R A;  5L3C A;  3K06 A;  4FMT A;  2BOC C;  4PA4 A;  4E2L A;  3QNE A;  4WFG A;  5H6Q A;  1KQS U;  2Z5U A;  5LHI A;  1B6Q A;  1WLE A;  1RM1 B;  2EZO A;  1YHQ V;  2WSS G;  2EIN C;  2Y69 B;  1MAB G;  1IXM A;  1BL8 A;  3JD3 A;  2W6J G;  5L3B A;  5LGN A;  4RUF A;  3CMA V;  1K9M W;  1JOY A;  2YEV A;  3SYQ A;  2IJH A;  1P4R A;  3ZN0 A;  2EIK C;  1E1Q G;  4FJC C;  1MSW D;  3ZMS A;  1I5Y A;  2Q6A A;  2WLL B;  4U7O A;  2HR3 A;  3ZJZ A;  1GM8 A;  2R9I A;  5CBH A;  3KG2 A;  3OR7 C;  3UKM A;  1SER A;  4DXW A;  3FYI B;  1OCO B;  3ZRW B;  4JPR A;  5L3D A;  3CCM V;  2EIJ B;  3F5W C;  2Q68 A;  1EBO A;  3T4Z A;  2DWD C;  2QEX V;  2EIM B;  4MVO A;  1R3L C;  3OUS A;  4R6Z A;  3I55 V;  1KD1 W;  1GO3 F;  4MW3 A;  2DYR C;  4MVQ A;  4CBC A;  4L87 A;  1JPX A;  5LGT A;  4PDV A;  3K0G A;  1EFR G;  3BEH A;  4PDL A;  2HG5 C;  3AG2 C;  3LDC A;  4MVS A;  1OCZ C;  1DLB A;  2WLI B;  3EHB B;  3OMI B;  4WF9 V;  1M9N A;  1S76 D;  1E1R G;  1H2G A;  3D36 A;  2Q67 A;  2WAM A;  2YEV B;  1NVP D;  3SPI A;  4QE9 A;  5HFL A;  1W2B U;  1JQ0 A;  3E8B A;  3FYE B;  4TWK A;  1NBM G;  4MT8 A;  4UUJ C;  5CN0 A;  2ATK C;  2JJ2 G;  4P30 A;  1NVP B;  1ROP A;  4G28 B;  5EBM C;  2OT5 A;  3B77 A;  1XL4 A;  4MTF A;  2IW5 A;  3FB6 C;  4ZBM A;  1YJ9 V;  4XDL A;  1W0J G;  3CME V;  3FB7 C;  5L3E A;  2PI5 A;  1QVG U;  3CP1 A;  3ABL C;  5KUK A;  4PA3 A;  3OW2 U;  1OCC B;  4H37 A;  5B1A C;  3CC2 V;  2NNU A;  3OAA G;  3P30 A;  3EFF K;  2DQ0 A;  3GB7 C;  5B1B C;  1BHB A;  3CCE V;  3STL C;  3E8F A;  4P9O A;  2HVK C;  1UJW B;  2LP7 A;  4I9W A;  1V55 B;  1PNM A;  4UVC A;  4KP4 A;  2OCC C;  2UXN A;  4XDJ A;  3LDD A;  1AJP A;  2ZR2 A;  2EIL B;  4MTX A;  1RM1 C;  4Q20 A;  1S72 V;  2H8P C;  3M99 B;  3T2M A;  2ZXW B;  2Y69 C;  4LCU C;  2GSM B;  4QJF B;  2XAQ A;  1GTO A;  4FK5 C;  1S77 D;  3SPC A;  2WPD G;  3AG3 C;  5EBW C;  4WFA V;  4JYB A;  2A79 B;  3NXS A;  2WLL A;  2V1D A;  1OCO C;  3AG1 B;  2HLD G;  5E1A C;  3CCU V;  5H6R A;  3JD1 A;  3T4D A;  4GT1 A;  3CC7 V;  4MVM A;  4TSF G;  1VQM V;  2EIM C;  3QO8 A;  1HWY A;  2AHY A;  1K4D C;  1GM7 A;  1Q82 W;  5IYD O;  3ABK B;  5BZB A;  1YI2 V;  1J95 A;  2ZDI A;  1AJQ A;  1V54 C;  5LHH A;  4U7N A;  3ASO B;  4JTA B;  4QPJ A;  4MS2 A;  2WLI A;  4CZZ A;  2X6B A;  4J9Y B;  4KFM A;  4UV9 A;  3FB8 C;  3OR6 C;  3OMN B;  3K3W A;  4PEL A;  2C2A A;  1K3E A;  4J9Z B;  5EC2 C;  2B1G A;  1M57 C;  4UVA A;  3K08 A;  1OCR B;  3RBZ A;  3CPW U;  1YIT V;  2P90 A;  2Q69 A;  1FXV A;  3STZ C;  3HB3 B;  3ZRV A;  2D3O W;  2H94 A;  4QPK A;  3ZMT A;  1GK9 A;  2QM7 A;  4N21 A;  3LSS A;  2W0F C;  1QLE B;  4XBF A;  2WLK A;  4RQE A;  2IU3 A;  2DYS B;  2LFS A;  3H01 A;  3P32 A;  3JD2 A;  4GX1 A;  1OCC C;  1NH2 D;  3AG4 C;  3ETG A;  2OTJ V;  1H8H G;  1K5S A;  2HFE C;  2KB1 A;  4UXN A;  4N23 A;  2Z3Y A;  4PA6 A;  4RQF A;  3F7Y C;  3G71 V;  2IU0 A;  1NH2 B;  1K4C C;  4JAV A;  3CD6 V;  3ETD A;  3FB5 C;  1SES A;  2JEX A;  5IYB O;  1CPY A;  3W7S A;  2P7T C;  1S0V A;  1NJI W;  3ZMU A;  3R65 A;  3ABT A;  1ENV A;  3MHH C;  2EIL C;  2HVJ C;  2X6C A;  1K73 W;  3SPH A;  2ZXW C;  1THZ A;  4BIU A;  4MVR A;  1K92 A;  1GMG A;  1VQ8 V;  3X2Q B;  2DQ3 A;  1NR1 A;  4LC1 A;  3SYP A;  1YIJ V;  1VQK V;  5B1N A;  5IYC O;  4QNH B;  1PNK A;  1YSC A;  4EKW A;  1MG1 A;  1MOF A;  4G27 B;  2V7Q G;  4RUE A;  1WPX A;  3VBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...