2A06H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2a06H00
1SQXH 3H1IH 3L70H 1PPJH 1SQQH 3H1HH 1BE3H 3TGUH 3L74H 1KB9F 3L75H 4U3FH 1NTKH 1SQVH 3L73H 1SQBH 1NTZH 1P84F 1EZVH 3H1JH 1SQPH 2BCCH 3L72H 3BCCH 1KYOF 3CX5F 2A06H 1L0NH 3CXHF 4D6TH 3CWBH 1L0LH 1BCCH 1NTMH 2IBZH 3H1LH 5KLVH 2FYUH 3L71H 1BGYH 1PP9H 3H1KH 4PD4F 1NU1H
chains in the Genus database with same CATH superfamily
2CDYA 2XHBA 1MSWD 1M9NA 3HKEB 2OTLV 3CCEV 1N36B 4W4KA 1OCRB 4F6EA 4X8AA 1QLNA 5IJ0A 4LF8O 4B3SB 2QJ1A 1N34O 3ZRSA 4IHJB 2GBOA 4GX1A 2DE0X 2P67A 1RSOA 4FFBA 2VQFB 5EZYA 3WU2Z 2UXBO 1H38A 2E76B 5H2FZ 3D3IA 1KC8W 2ZE6A 5B66Z 2Q6AA 3W7XA 4DR4O 3AG2B 1EFRG 2F23A 2QWQB 2GTAA 4DV0O 1S72V 1FFXB 2E3CA 4YJ2A 4ZHQA 5LBQA 2PTMA 4KL1A 2EJ7A 1KD1W 3JARA 4TV8A 2VS0A 1VQLV 5CA0A 1NTZH 1Q6UA 4LF6O 3TXSA 2B1IA 5LOVB 2HLDG 4X64B 1VQ7V 3CPWU 1PL0A 3ABLC 1U97A 4ABMA 4OGQB 1Y6XA 1PNMA 1OCRC 2QDOA 1VQKV 1YI2V 1KB9F 4TUYB 3ETGA 1QVFU 2EBOA 2E5LB 5KHKA 1QCEA 1KYOF 2LO1A 3GB7C 3CCVV 4DR3B 1H2GA 1YZBA 5FPRA 2WLLB 4WF9V 1MABG 1HW7A 1YTFB 5IJ9A 3P30A 4AQYO 2P4KA 2ZM6B 4J9YB 3ZMUA 1XOUA 4NTWA 3JAKA 1V54B 5IT9N 1AROP 2AZ0A 2GDSA 3AG2C 1FJGO 4KFMA 2KG7B 4Q20A 4KXRA 1KKDA 2ZIOA 4PJ0Z 2X0LA 2AW9A 4B7KA 1YEWA 4AHCA 2UUAO 3E86A 4MVQA 1XNRO 1VF6A 3ZMSA 1NH2B 2ZE8A 3TXQA 3TGUH 4GCZA 5IYZA 5JVDA 1IURA 3QO8A 3AG4B 3ZRXA 4JI6O 4Z1MG 4B08A 2YI8A 2Q9LA 4DV7O 1KMIZ 3X2QB 1R3JC 1VQ5V 5EBWC 3HR0A 4O2AA 4TSFG 2CH7A 2NR5A 1VQMV 2OIGA 1VMGA 1SC5B 2WAMA 4IT5A 5KHIA 1EBOA 3JATA 4DR6O 4D7SA 1Q43A 2WLJA 2QM7A 4KHPO 3E8BA 1IBMO 3AK2A 2LFRA 4WFEA 2P90A 4DV4B 4E2LA 4WFAV 4CH5A 2JS5A 4HNAA 1AP6A 1VQOV 2Q5ZA 1JX9A 4FZ0A 1FD9A 4KP4A 3U10A 1R73A 1YJ9V 4IGGA 4JI3B 5J2UB 3T4ZA 4I0XA 4FJCC 2OYQA 3N2KA 1WLEA 5IWAO 1H2KA 4YXWG 1NVPB 5GTIZ 3BAAA 5GW7A 5B1NA 4IYHA 2LFSA 4HBNA 2G38A 4YY3O 4X66B 4NXNB 4ASUG 3SPCA 3AK1A 1HDJA 1ENVA 1MMMA 1Y4MA 3AG4C 3JD0A 3RWRD 2Z0AA 3QF7A 4JZ2A 4J42A 4AI8A 2YS8A 2ITCC 1AP5A 1N32B 3CMEV 3X2QC 1N33O 3ASOB 3P32A 1FFXA 4LFBB 3T1HO 3HKBB 2A0LA 2VWJA 2KKWA 1Q6IA 2OCCB 2IJKA 2P7TC 4FVMA 1KECA 2D2CB 1XL4A 2A3QA 1Y76B 4DR2B 5D5QA 4J41A 3NXSA 2UXCB 3K0GA 5LP6A 5LOVA 4JYBA 2ZQMA 5J9PC 2YIAA 5IDJA 5CB4A 1S3JA 2XAJA 5LL6Y 3FAVB 1CXZB 1VEWA 2X6BA 1SZXA 5DEDA 3E8HA 1HNWB 4TUYA 4JI1B 5BXZA 4X9QA 2RJZA 1VF7A 1R3LC 4H0LB 3SJBC 5A9GA 5BMVB 1CP9A 2QGNA 4CS2A 1B04A 1XILA 5C93A 4LR3A 1RFYA 4FLUA 3GWKC 2JJ1G 3UT5A 4JI7O 1I08A 1YDXA 2F4VB 2YUAA 3P3PA 3S3WA 5EYPB 3KKYA 2GV9A 4DV6B 3RYFB 1GN4A 4LNUA 5FPOA 1XBLA 4GZRB 3LSUA 1F4NA 1PV0A 1AR5A 3CC7V 4NYKA 4LF9B 4GKKO 1YXBA 2OCCC 3OD4A 3Q4HA 2VWKA 2UU9O 3QO5A 4JF3A 4KUMA 1P7BA 4HAMA 1HR0O 4GKJB 1V55B 4P9OA 4LFAO 2GHYA 2P6JA 4LBEC 2HHHO 1AVMA 1AJNA 1H8EG 5IYCO 1L1FA 2H8PC 4K8XA 4PHZA 3OUFA 4X62B 1Q8IA 4U7NA 4LF5B 4LP8A 5CA3A 1EZJA 4TQDA 3UCSC 2CTRA 1YHQV 1CEZA 2HVJC 5H9CA 1PL4A 4JI2B 3ZIAG 2JEXA 1W0JG 1H8HG 5B1BC 5LGUA 1SF9A 2ZNIA 5KX5A 4F6RB 1GN3A 3H1LH 2PUSA 3OGCC 3M7MX 1NJIW 3JD3A 5J2UA 3H1HH 3K5OA 3UO3A 5KHGA 1IBLB 1BZKA 2EIMB 4FLWA 2BOBC 4UVBA 4BW9A 1SQFA 1H2NA 4RUEA 4JAVA 2ADPA 5JJEB 1Q7YW 2KQXA 3F7YC 3T1YO 4CH4A 1WAZA 1S5HC 4UCSA 2F1MA 3WG7C 4LWSB 5IYBO 2QEXV 1WNSA 1GN6A 4DRXA 2V1DA 5C8YB 2JGDB 1OCCB 1YCIA 1Y67A 4DUZB 1KBHA 4OX9B 3HKBA 2YEVB 2CAZC 4ZOLA 5F2VO 2WLKA 2Y0IA 2UUCB 4QE7A 2ETNA 4O4IA 5GONA 2DN9A 5KHJA 3E22A 3OTOO 4ZIBA 4L8JA 1Q82W 4LF4O 3SJAC 3CJHB 3LDDA 2HJFC 3FAVA 2WLHA 1GO3F 1L8DA 1L0NH 4MS2A 2WLNA 1OCOB 3HKDA 4N21A 1AB3A 3ICXA 4B3MB 4NXMO 4J7KA 2Y48A 5CA1B 5BMVA 4DR5O 1XMOB 1EN4A 2EIMC 3ZRWA 1GAXA 2K9PA 3F7VC 1GH6A 3MD0A 3OMAB 4MVRA 4BAYA 4PELA 1NQTA 2F4VO 4X1YB 3IFXA 4MTFA 1JFFA 4E4EA 1GMGA 2AXTZ 1D5NA 4JI8B 2EIKB 1NR7A 4R7CA 1OCCC 3HB3B 1WP7A 2QWPB 1TAEA 3FB5C 4X65O 5LA6B 4PA9A 3EFFK 3JD4A 3ZHUA 1P84F 1I94O 4GX0A 1S0VA 2JK5C 2R9AA 5CBHA 4BIOA 1JPXA 3KCYA 1OV9A 4LFCO 4DV3B 1VF5B 2EZPA 4JZGA 1BHAA 4PA3A 4U3JB 1OCOC 3CX5F 4UB6Z 3CWBH 3RBZA 2LW1A 3K59A 4FM2A 2W6JG 2ZDIC 1AJQA 1FXVA 4LH6A 5ITZB 3L75H 4BR6A 5CN0A 4DR1B 5EK0A 1BMFG 1TUEB 3BVOA 3SPJA 1M90W 5LYJB 1XI1A 3ETDA 2H94A 2FKXA 2JDIG 4OXSA 2YIBD 3ASNB 2ITDC 4DR7O 2EINB 2XAHA 2EIKC 1US6A 1AI4A 1IBLO 3ABLB 3L70H 1IXMA 2VRZA 5L3FA 1KQSU 3EXAA 3O65A 1K4DC 3A2FA 2DOSA 3DGEA 5EIBC 1H2MA 2CTWA 1IVSA 5EC2C 2P5OA 4JYAB 5GTHZ 3B40A 2K1EA 1MOFA 1TUBA 2ZD9A 3C90A 4I9WA 4H33A 1TVKB 3UM7A 5LGTA 4HZ3A 1MZEA 5B3SB 4O2BA 3STLC 4TV9B 1NI8A 2JGDA 2BE3A 2IJIA 2Q67A 2R9RB 2IW5A 4U3FH 2EJRA 2DW4A 4FZ1A 2Y4TA 3ZMZA 4OX9O 2YEVA 3SYQA 4O4JA 3T1CA 3CCSV 4P30A 1FYJA 2FL4A 1G6UA 3SYOA 1B6QA 3H01A 1SA0A 1FXKC 1HNZO 4DV2B 3ABUA 4QPJA 4PD4F 3CJHA 4G27B 1AJPA 4I9QA 1NKDA 4DW1A 3ASNC 2ZKOA 1W59A 2EINC 2N04A 2ZDIA 4DO2A 2DQ0A 5BR8O 1RPOA 3AK3A 3K5MA 4X20B 4NB5A 1T5EA 2CTPA 1BL8A 2ZINA 1KKCA 2KSDA 4RAIA 2R72A 3WFVA 4ZBMA 4I4TB 2LW7A 3N27A 4L87A 5B3SC 3RYCA 5LHGA 5JJJB 3CCQV 5KMGA 3B2EE 1ZUQA 5LA6A 3K0DA 1UJWB 4EB6B 3EHBB 4G28B 2Z3YA 3LDCA 3I55V 4EEQA 1WPXA 1R6NA 2IH1C 4JASA 5FL7G 3K03A 1D2DA 3CCJV 4UV8A 4MTXA 4UVAA 4UFZA 1YITV 2F95B 1PP9H 4K0KO 5JH7B 3RN4A 1YJNV 1YIJV 5EBMC 1MA1A 5JQGA 2YSUB 1N4CA 4YHHB 3PJSK 4X88A 4TT3G 3OFNG 1XNQO 4RWUA 1S77D 4I5SA 2ZCEA 4JI5B 1E79G 2DWDC 4UCVA 2PY5A 1WA8B 3JAMN 1QQCA 2CUGA 2P22C 1S5JA 2RNBA 2YXYA 2QE7G 1DK1A 4DV1B 1Y74B 4BW5A 4QJFB 3MDSA 4X1IB 5A2QN 3RW0A 1PM9A 2ILMA 5H5NA 3K57A 3OAAG 4OPAA 3H1JH 3L9DA 2FTKA 1SESA 1OZ0A 1RP3B 3ZBHA 2IU0A 3O9OA 5FNVB 4DUYB 2HP8A 1GKFA 3HKEA 1LR1A 4EFBA 3D8CA 3UO2A 3J81N 1SQQH 1N36O 3CXCU 2WLIB 1ZSPA 3G71V 2Q7EA 1BQZA 2XNDG 1CPYA 4B3SO 1HWYA 4IHJA 2ZE5A 4MW8A 1TVKA 3ZMVA 2Q7HA 4B7EA 3G4SV 3ZS8C 5LGNA 4TV9A 1M56B 3D36C 1XUQA 4B3TB 2VQFO 3ABKB 3CCLV 4GX2A 4B3RB 1BS3A 2QM4A 1G4YB 1NZ6A 3ZN1A 2R70A 3SYCA 4WFGA 2DQ3A 2JIZG 2Q0AA 3JASB 3JAWB 3HPLC 3BCCH 1JMKC 1L0LH 3BHPA 2IH3C 4XDKA 2YXLA 4K3AA 3ZJZA 3K5LA 4DV5B 4UUJC 4CH6A 4UCUA 3IC7A 4WBNB 1GRJA 2MW2B 3TCUA 4FM1A 1EZVH 4X64O 3DXRB 3I56V 4IYIA 3J80N 4X20A 2A7WA 3OEEG 3K04A 4G2KA 3TJTA 1R6TA 4CS4A 2E5LO 4FM0A 4IIJB 3GVMA 5L3EA 5LXTB 3K79A 3OUSA 4BIUA 1M56C 3K5NA 4K8ZA 4DR3O 2WLLA 5B1BB 1O9HA 3ABKC 4CS3A 2CK3G 1JA8A 3JYCA 4O4LB 4EB6A 1K33A 2ZM6O 1J5EB 1BHBA 1S5LZ 2DJVA 2XASA 3CHXA 1GM9A 3DC5A 1LUVA 3A0BZ 3BEHA 2A79B 2KG7A 1ZX3A 4WCEV 4MVMA 3DTUB 4X1KB 5HFMA 4LF7B 2AGAA 2WSSG 1JR9A 4WFBV 2WLMA 4P2ZA 3CCRV 1GK9A 3G6EV 2E74B 1BCCH 4NVPA 5B5EZ 3A0HZ 2LGWA 4W4LA 3L71H 4JI4B 1W2BU 2QWRB 1O9GA 4MVOA 1J95A 1PNKA 3WG7B 2L35A 3APQA 4PDMA 1HNXB 2Q69A 1F4MA 1ZAUA 3K9AA 5CBGA 4H13B 4JV5B 3E2EA 2F43G 1RPRA 3RYIB 3FX7A 1B06A 4UVCA 3QO7A 3VQWA 3CRAA 5J2TB 4FIPC 1VQ4V 2UUBB 1Y74A 3FB6C 3KG2A 4ZKIA 4JYCA 3LSSA 1GN2A 3T4DA 1BQ0A 2HJDA 2NNUA 2CGOA 3OMIB 1TGOA 1NTMH 2VQEB 4DV4O 2WPDG 4FLTA 3KZIZ 4DXWA 2H3OA 1F23A 4MVSA 4FFKA 4CH3A 2PGGA 4TWKA 2JVDA 4JI3O 2ARHA 5LMNB 1NH2D 5B1OA 3CCUV 1BSMA 5KA6A 1R1BA 1K5SA 4X66O 1IX9A 4NXNO 2YI9A 2Q7GA 4HYOA 2YIDA 4JTDB 4JPRA 4WFHA 2ZXWB 1N32O 3MHSC 4PA4A 1ROPA 5IE9A 1I5YA 1OCZB 4RO2A 4LFBO 4LF8B 5IJ0B 3E8FA 1YVWA 1N34B 3UKMA 1Y76A 1FS0G 4DR2O 3SDLA 1RSOB 4WBNA 2WWWA 4FFBB 3KCXA 2UXCO 5EZYB 2UXBB 2QA4V 4QNHB 4R50A 2CE4A 3DXRA 1AILA 4UCRA 4J10A 3CMAV 3AEIA 3THOA 1XHZA 1HNWO 2RQ6A 3BA8A 4JI1O 1X4TA 4P9PA 4CZZA 2QKAA 4DV0B 2B9ZA 1NVPD 1WB7A 2UXXA 4IIJA 2Q73A 1FAFA 2IM9A 3BRCA 5LXTA 1JJOA 5E1AC 4YJ2B 1WP8A 4ZHQB 3JARB 4LF6B 5KAFZ 3G80A 3BABA 3FB8C 2ZR2A 2DWEC 5EYPA 1SETA 1J5EO 1SKVA 3AG1B 2RDCA 3H1IH 2ZXWC 2ADQB 2R9IA 3K06A 3WB1A 1KP2A 3RYFA 4DV6O 1JCHA 2ODMA 3CS5A 1NTKH 4LF7O 5DM6V 2MK3A 1QNMA 4ICGA 1FPOA 1OCZC 4JTAB 1F7YA 3IC9A 2L6LA 2HR3A 3CC4V 4LF9O 3CB2A 3ETQA 3OW2U 4O4HB 2Y4UA 3ZEDA 5JWPA 1Q81W 2QSAA 5EC1C 1R3IC 3H9VA 3SYPA 2DYSB 4AQYB 4GKJO 2FB5A 5IJ9B 5LHHA 3U11A 3G6BA 1B3QA 1ZTEA 4DK0A 3ZHSA 4JV5O 1XREA 3JAKB 3SPGA 3IJ4A 3RYIA 5B1AB 1FJGB 5L3CA 2JEUA 5J2TA 2HFEC 1Q6HA 3I5DA 4X62O 2UUBO 2UUAB 1K73W 1FXKB 3JALB 4F4LA 4LF5O 3GWOA 3SR2C 3M8AA 4PDRA 4RUFA 1IDSA 4JI2O 3JSLA 3NR7A 2P06A 2B1GA 4UB8Z 3CSXA 2Q4PA 3FB7C 3VQXA 4F6RA 4FLVA 5IYDO 1ZL8B 4DV7B 1ORQC 3ZHTA 1XMQB 3AG1C 1THZA 4XBFA 1OJHA 3OE7G 1I7FA 4XDJA 4JTCB 5TISZ 4DYLA 1TA8A 2OWOA 2AHYA 5K1PA 3FFQA 2ZIMA 1H2SB 2LP7A 4YIPA 4DR6B 1XQ8A 1K4CC 1LNQA 1Q5OA 2A06H 2P4VA 1P7GA 2JRIA 4LWSA 1IBMB 2DYSC 5C8YA 1Q3EA 4JAUA 1S76D 3B4SA 4QGPA 1XL6A 3HKCB 1ZWIC 4HNAB 3IAYA 4DUZO 5KUMA 1SRYA 3B77A 1QU7A 1R6KA 1XHXA 4H44B 2OCHA 5B1AC 1FFTB 1AI6A 2BCCH 2UUCO 1K9MW 4I0XB 2HKOA 2ZR3A 3TETA 4I55B 3CRRA 5IWAB 3N2KB 1Z5VA 3B09A 4RQFA 5KLVH 1KP3A 4YY3B 1VF6C 1BE3H 1P4RA 3JSNA 3STZC 3FKSG 3W7UA 2Y0PA 3SPIA 2C2AA 5FLXN 2YC0A 4FLXA 3T2MA 3D3QA 1N33B 3RYHB 2D3OW 3M99B 2W0XA 2OTJV 2N05A 5D5PA 3T1HB 4B3MO 4RQEA 2W0FC 1IZ3A 2QWOB 5CA1A 3APOA 1XMOO 1GM8A 1E1RG 4MT8A 5CBFA 3IGAC 2N74A 1D5AA 4WFFA 4PI2A 5LP6B 4X1YA 5BZBA 3JCUZ 1K3EA 1M57B 4CC5A 1K5QA 5CB4B 1YJWV 2LJ2A 4JI8O 3DSQA 5E79Z 3OM3B 4C7UA 3LNNA 5H6QA 5KHHA 4GX5A 1AR4A 2X7RB 2GUZB 3R65A 4O4HA 1IXBA 4NTXA 1COWG 3TK1A 2ZNJA 1QHTA 1MNGA 1N8RW 4TQFA 1PNLA 1P49A 1HP8A 3ZCCA 1BGYH 2BOCC 3CRQA 3FYEB 4JI7B 3CYOA 3UT5B 2EZOA 4PDVA 1VQ8V 4DV3O 5K1XA 2IJJA 3RFRA 4LH7A 3W7WA 4U3JA 3BA9A 4DW0A 3JCZA 3ZRVA 3C3TA 4LNUB 5IY5B 1FXKA 3JALA 4YJ3B 3E35A 5L3BA 5ITZA 4GKKB 3K9SA 1I5XA 2QM8A 3Q4HB 2UU9B 4CBCA 4NR1A 2ZE7A 4DR1O 3SYAA 5LYJA 1HR0B 5LP6C 1ZL8A 4LFAB 1JJ2U 1N0NA 2CGNA 1M57C 1DLBA 2Q8VA 5LMUB 2HHHB 1XMQO 4ZI7B 1KUQA 3OTFA 5EIBD 2GTSA 4FK5C 1DTOA 1GTOA 3ZHQA 3VBBA 3RT3C 4PV1B 5AG2A 1QVGU 4PA7A 1XDCA 1R3KC 4JYAO 3CE2A 1SS3A 1V9PA 2BTOA 2XAFA 4GYCB 5HFLA 2HEPA 1MSDA 2W6IG 2EILB 2IBZH 3F5WC 5BY1A 3BPZA 1X59A 4MTGA 3HKCA 5KX5B 1PKXA 3A8TA 3ZX6A 3E8GA 2AHZA 1V54C 4FMTA 2E75B 4I7ZB 4K35A 2X6AA 2EIJB 3DC6A 3F5TA 3C3SA 1K7DA 4I55A 4R8CA 4BWAA 5IY5C 3CXHF 1G8MA 4DV2O 3T1YB 4MW3A 2HVKC 3VQYA 2NLJC 2BTQB 3SJCC 1WB8A 4AILC 1EM1A 1M93A 2Q0OC 4J7JA 4NKGB 1H2LA 2OT5A 1LUWA 3K08A 2DMXA 1EN5A 5KAIZ 1KU9A 4DRXB 3RYHA 2V7QG 2QR4A 1AR1B 4ZOLB 3RGBA 1PD3A 3MAQA 3ML0A 5EBLC 4IL6Z 4MTOA 2NN4A 4H37A 3G67A 4O4IB 5GONB 3EVKA 5KA5A 3OTOB 3E22B 3FYIB 2EX3A 5CMUA 4LF4B 1SQVH 5DECA 2XT9A 1K8AW 4LCUC 4I4TA 3U0ZA 3OEHG 3LDEA 3ZHVA 2JGUA 1IBKB 1E1QG 2EILC 1Q86W 5DN6G 1WJZA 4DK1A 2V4DA 4JAAA 2UXDB 3HKDB 1MG1A 3OR7C 2GUZA 3E83A 4NXMB 2YXHA 2Z5UA 2EIJC 4DR5B 1I0HA 4MSWC 4PI0A 5JCOC 2QTSA 3ZRWB 2GSMB 4R6ZA 4GT1A 3D36A 2PYJA 2LQTA 5L3DA 5JH7A 4JI0B 2QKSA 1JFFB 2PI4A 4A5UB 1MZFA 4MVZA 4YHHO 1GM7A 1VP7A 3ASOC 2PZSA 4X65B 1YF2A 1WN7A 2FMLA 2WA4A 3ZMTA 2QTOA 2F66C 4Z1VA 1SQPH 2LGQA 3LSQA 4YJ3A 4EKWA 1I94B 1WA8A 2YDEA 2PYLA 4JI5O 1JOYA 4X89A 1QLEB 2BSKB 4LC1A 2WA3A 4J7ZA 2QKCA 3BFRA 1K97A 3CRCA 4J11A 3SGIA 3FD9A 3OR6C 2F93B 3LUTB 2DYRB 3MHHC 4DV1O 4X1IA 4LFCB 1YTFD 2PI5A 1DGSA 1Z5WA 1UPGA 4ZI7A 5LMUO 1Y66A 5FNVA 3N2GB 4UV9A 2IJHA 3JD1A 4DUYO 2CTQA 4TOIA 1URFA 1A32A 2WLIA 4UXNA 1JQ0A 4EFEA 2EULA 3OGIB 3CCMV 4OPHA 3ETEA 4I50B 1NT2B 2B5UA 3B8MA 3R66A 1SZTA 1RM1B 4FPPA 3VOUA 1OHHG 5JJNB 4B3TO 1SQGA 1Q90D 4B3RO 4DR7B 3QVNA 1QR9A 1NU1H 1SQXH 3QTCA 2M7WA 5JCOA 1SERA 3JASA 1DF5A 3JAWA 3RVYA 1VIBA 4N23A 3L72H 3AG7A 1QLEC 2UXNA 2BTQA 4J9ZB 1TUBB 3A0RA 3W7SA 1WPBA 4DV5O 4BIZA 4U7OA 3S3XA 1ZLZA 1VARA 2DYRC 3WB2A 4O2BB 1V55C 4NTYA 2IU3A 3ABMB 3K3WA 3OMNB 1N0JA 2X6CA 1UFIA 3QNEA 1VQ6V 1DF4A 3SPHA 3L73H 5L3GA 4O4JB 2QWNB 4QE9A 2XTAA 3B8NA 1VQ9V 4DR4B 2M6YA 5H6RA 1BT8A 1HNZB 1EN6A 1SA0B 4QPKA 4D6TH 2OIEA 3QG5A 3CEIA 2XAGA 4UCTA 4MVUA 3VQVA 1IBKO 1RM1C 3SJQC 1JVMA 4TV8B 2JS3A 1AI5A 4O4LA 3E89A 4J80A 5CA0B 1G1XB 2YICA 2UXDO 4UCOA 1K34A 2XOKG 2XAQA 3CP1A 1M5IA 4Z2WA 5BR8B 2Q68A 3L74H 4GUNA 3ZHRA 3ZN0A 4X1KA 4QIWF 2Y69B 3LNMB 3AG3B 4GLXA 4Q6GA 4JGSA 2ZT9B 4JI0O 2RN9A 1F51A 4JI4O 3J7AU 2RCVA 2XUMA 3CRMA 3RYCB 4D7TA 3WB0A 2YIBA 1PPJH 3ABMC 1HNXO 5KMGB 3BY6A 1FXHA 1YSCA 2AZ2A 3UQ8A 2BSKA 4YIOA 3RVZA 1U96A 1FKAO 5KUKA 1NBMG 5LHIA 3H1KH 2RMKB 3P3NA 4CC6A 1M4UA 4K0KB 1XNRB 4PDLA 1NS1A 2JJ2G 5JVDB 5IYZB 1SQBH 1QR8A 3N2GA 1M1KW 5JQGB 4JI6B 2VQEO 1Z2GA 1VQPV 1XNQB 2A9HA 3K58A 1VQNV 2ATKC 1NR1A 2O57A 1QBZA 4I50A 1AI7A 2KB1A 3W7TA 4O2AB 2HG5C 4XDLA 5LMNO 2CH7B 1W0KG 2Y69C 4FLYA 3JD2A 3AG3C 1XEQA 3CC2V 4FLZA 3JATB 4PA6A 3CD6V 3ABTA 4JYYA 2PF4E 3PN1A 2FYUH 4KHPB 1K92A 3OT7A
chains in the Genus database with same CATH topology
1SQXH 3H1IH 3L70H 1PPJH 1SQQH 3H1HH 1BE3H 3TGUH 3L74H 1KB9F 3L75H 4U3FH 1NTKH 1SQVH 3L73H 1SQBH 1NTZH 1P84F 1EZVH 3H1JH 1SQPH 2BCCH 3L72H 3BCCH 1KYOF 3CX5F 2A06H 1L0NH 3CXHF 4D6TH 3CWBH 1L0LH 1BCCH 1NTMH 2IBZH 3H1LH 5KLVH 2FYUH 3L71H 1BGYH 1PP9H 3H1KH 4PD4F 1NU1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX H;  3H1I H;  3L70 H;  1PPJ H;  1SQQ H;  3H1H H;  1BE3 H;  3TGU H;  3L74 H;  1KB9 F;  3L75 H;  4U3F H;  1NTK H;  1SQV H;  3L73 H;  1SQB H;  1NTZ H;  1P84 F;  1EZV H;  3H1J H;  1SQP H;  2BCC H;  3L72 H;  3BCC H;  1KYO F;  3CX5 F;  2A06 H;  1L0N H;  3CXH F;  4D6T H;  3CWB H;  1L0L H;  1BCC H;  1NTM H;  2IBZ H;  3H1L H;  5KLV H;  2FYU H;  3L71 H;  1BGY H;  1PP9 H;  3H1K H;  4PD4 F;  1NU1 H; 
#chains in the Genus database with same CATH topology
 2CDY A;  2XHB A;  1MSW D;  1M9N A;  3HKE B;  2OTL V;  3CCE V;  1N36 B;  4W4K A;  1OCR B;  4F6E A;  4X8A A;  1QLN A;  5IJ0 A;  4LF8 O;  4B3S B;  2QJ1 A;  1N34 O;  3ZRS A;  4IHJ B;  2GBO A;  4GX1 A;  2DE0 X;  2P67 A;  1RSO A;  4FFB A;  2VQF B;  5EZY A;  3WU2 Z;  2UXB O;  1H38 A;  2E76 B;  5H2F Z;  3D3I A;  1KC8 W;  2ZE6 A;  5B66 Z;  2Q6A A;  3W7X A;  4DR4 O;  3AG2 B;  1EFR G;  2F23 A;  2QWQ B;  2GTA A;  4DV0 O;  1S72 V;  1FFX B;  2E3C A;  4YJ2 A;  4ZHQ A;  5LBQ A;  2PTM A;  4KL1 A;  2EJ7 A;  1KD1 W;  3JAR A;  4TV8 A;  2VS0 A;  1VQL V;  5CA0 A;  1NTZ H;  1Q6U A;  4LF6 O;  3TXS A;  2B1I A;  5LOV B;  2HLD G;  4X64 B;  1VQ7 V;  3CPW U;  1PL0 A;  3ABL C;  1U97 A;  4ABM A;  4OGQ B;  1Y6X A;  1PNM A;  1OCR C;  2QDO A;  1VQK V;  1YI2 V;  1KB9 F;  4TUY B;  3ETG A;  1QVF U;  2EBO A;  2E5L B;  5KHK A;  1QCE A;  1KYO F;  2LO1 A;  3GB7 C;  3CCV V;  4DR3 B;  1H2G A;  1YZB A;  5FPR A;  2WLL B;  4WF9 V;  1MAB G;  1HW7 A;  1YTF B;  5IJ9 A;  3P30 A;  4AQY O;  2P4K A;  2ZM6 B;  4J9Y B;  3ZMU A;  1XOU A;  4NTW A;  3JAK A;  1V54 B;  5IT9 N;  1ARO P;  2AZ0 A;  2GDS A;  3AG2 C;  1FJG O;  4KFM A;  2KG7 B;  4Q20 A;  4KXR A;  1KKD A;  2ZIO A;  4PJ0 Z;  2X0L A;  2AW9 A;  4B7K A;  1YEW A;  4AHC A;  2UUA O;  3E86 A;  4MVQ A;  1XNR O;  1VF6 A;  3ZMS A;  1NH2 B;  2ZE8 A;  3TXQ A;  3TGU H;  4GCZ A;  5IYZ A;  5JVD A;  1IUR A;  3QO8 A;  3AG4 B;  3ZRX A;  4JI6 O;  4Z1M G;  4B08 A;  2YI8 A;  2Q9L A;  4DV7 O;  1KMI Z;  3X2Q B;  1R3J C;  1VQ5 V;  5EBW C;  3HR0 A;  4O2A A;  4TSF G;  2CH7 A;  2NR5 A;  1VQM V;  2OIG A;  1VMG A;  1SC5 B;  2WAM A;  4IT5 A;  5KHI A;  1EBO A;  3JAT A;  4DR6 O;  4D7S A;  1Q43 A;  2WLJ A;  2QM7 A;  4KHP O;  3E8B A;  1IBM O;  3AK2 A;  2LFR A;  4WFE A;  2P90 A;  4DV4 B;  4E2L A;  4WFA V;  4CH5 A;  2JS5 A;  4HNA A;  1AP6 A;  1VQO V;  2Q5Z A;  1JX9 A;  4FZ0 A;  1FD9 A;  4KP4 A;  3U10 A;  1R73 A;  1YJ9 V;  4IGG A;  4JI3 B;  5J2U B;  3T4Z A;  4I0X A;  4FJC C;  2OYQ A;  3N2K A;  1WLE A;  5IWA O;  1H2K A;  4YXW G;  1NVP B;  5GTI Z;  3BAA A;  5GW7 A;  5B1N A;  4IYH A;  2LFS A;  4HBN A;  2G38 A;  4YY3 O;  4X66 B;  4NXN B;  4ASU G;  3SPC A;  3AK1 A;  1HDJ A;  1ENV A;  1MMM A;  1Y4M A;  3AG4 C;  3JD0 A;  3RWR D;  2Z0A A;  3QF7 A;  4JZ2 A;  4J42 A;  4AI8 A;  2YS8 A;  2ITC C;  1AP5 A;  1N32 B;  3CME V;  3X2Q C;  1N33 O;  3ASO B;  3P32 A;  1FFX A;  4LFB B;  3T1H O;  3HKB B;  2A0L A;  2VWJ A;  2KKW A;  1Q6I A;  2OCC B;  2IJK A;  2P7T C;  4FVM A;  1KEC A;  2D2C B;  1XL4 A;  2A3Q A;  1Y76 B;  4DR2 B;  5D5Q A;  4J41 A;  3NXS A;  2UXC B;  3K0G A;  5LP6 A;  5LOV A;  4JYB A;  2ZQM A;  5J9P C;  2YIA A;  5IDJ A;  5CB4 A;  1S3J A;  2XAJ A;  5LL6 Y;  3FAV B;  1CXZ B;  1VEW A;  2X6B A;  1SZX A;  5DED A;  3E8H A;  1HNW B;  4TUY A;  4JI1 B;  5BXZ A;  4X9Q A;  2RJZ A;  1VF7 A;  1R3L C;  4H0L B;  3SJB C;  5A9G A;  5BMV B;  1CP9 A;  2QGN A;  4CS2 A;  1B04 A;  1XIL A;  5C93 A;  4LR3 A;  1RFY A;  4FLU A;  3GWK C;  2JJ1 G;  3UT5 A;  4JI7 O;  1I08 A;  1YDX A;  2F4V B;  2YUA A;  3P3P A;  3S3W A;  5EYP B;  3KKY A;  2GV9 A;  4DV6 B;  3RYF B;  1GN4 A;  4LNU A;  5FPO A;  1XBL A;  4GZR B;  3LSU A;  1F4N A;  1PV0 A;  1AR5 A;  3CC7 V;  4NYK A;  4LF9 B;  4GKK O;  1YXB A;  2OCC C;  3OD4 A;  3Q4H A;  2VWK A;  2UU9 O;  3QO5 A;  4JF3 A;  4KUM A;  1P7B A;  4HAM A;  1HR0 O;  4GKJ B;  1V55 B;  4P9O A;  4LFA O;  2GHY A;  2P6J A;  4LBE C;  2HHH O;  1AVM A;  1AJN A;  1H8E G;  5IYC O;  1L1F A;  2H8P C;  4K8X A;  4PHZ A;  3OUF A;  4X62 B;  1Q8I A;  4U7N A;  4LF5 B;  4LP8 A;  5CA3 A;  1EZJ A;  4TQD A;  3UCS C;  2CTR A;  1YHQ V;  1CEZ A;  2HVJ C;  5H9C A;  1PL4 A;  4JI2 B;  3ZIA G;  2JEX A;  1W0J G;  1H8H G;  5B1B C;  5LGU A;  1SF9 A;  2ZNI A;  5KX5 A;  4F6R B;  1GN3 A;  3H1L H;  2PUS A;  3OGC C;  3M7M X;  1NJI W;  3JD3 A;  5J2U A;  3H1H H;  3K5O A;  3UO3 A;  5KHG A;  1IBL B;  1BZK A;  2EIM B;  4FLW A;  2BOB C;  4UVB A;  4BW9 A;  1SQF A;  1H2N A;  4RUE A;  4JAV A;  2ADP A;  5JJE B;  1Q7Y W;  2KQX A;  3F7Y C;  3T1Y O;  4CH4 A;  1WAZ A;  1S5H C;  4UCS A;  2F1M A;  3WG7 C;  4LWS B;  5IYB O;  2QEX V;  1WNS A;  1GN6 A;  4DRX A;  2V1D A;  5C8Y B;  2JGD B;  1OCC B;  1YCI A;  1Y67 A;  4DUZ B;  1KBH A;  4OX9 B;  3HKB A;  2YEV B;  2CAZ C;  4ZOL A;  5F2V O;  2WLK A;  2Y0I A;  2UUC B;  4QE7 A;  2ETN A;  4O4I A;  5GON A;  2DN9 A;  5KHJ A;  3E22 A;  3OTO O;  4ZIB A;  4L8J A;  1Q82 W;  4LF4 O;  3SJA C;  3CJH B;  3LDD A;  2HJF C;  3FAV A;  2WLH A;  1GO3 F;  1L8D A;  1L0N H;  4MS2 A;  2WLN A;  1OCO B;  3HKD A;  4N21 A;  1AB3 A;  3ICX A;  4B3M B;  4NXM O;  4J7K A;  2Y48 A;  5CA1 B;  5BMV A;  4DR5 O;  1XMO B;  1EN4 A;  2EIM C;  3ZRW A;  1GAX A;  2K9P A;  3F7V C;  1GH6 A;  3MD0 A;  3OMA B;  4MVR A;  4BAY A;  4PEL A;  1NQT A;  2F4V O;  4X1Y B;  3IFX A;  4MTF A;  1JFF A;  4E4E A;  1GMG A;  2AXT Z;  1D5N A;  4JI8 B;  2EIK B;  1NR7 A;  4R7C A;  1OCC C;  3HB3 B;  1WP7 A;  2QWP B;  1TAE A;  3FB5 C;  4X65 O;  5LA6 B;  4PA9 A;  3EFF K;  3JD4 A;  3ZHU A;  1P84 F;  1I94 O;  4GX0 A;  1S0V A;  2JK5 C;  2R9A A;  5CBH A;  4BIO A;  1JPX A;  3KCY A;  1OV9 A;  4LFC O;  4DV3 B;  1VF5 B;  2EZP A;  4JZG A;  1BHA A;  4PA3 A;  4U3J B;  1OCO C;  3CX5 F;  4UB6 Z;  3CWB H;  3RBZ A;  2LW1 A;  3K59 A;  4FM2 A;  2W6J G;  2ZDI C;  1AJQ A;  1FXV A;  4LH6 A;  5ITZ B;  3L75 H;  4BR6 A;  5CN0 A;  4DR1 B;  5EK0 A;  1BMF G;  1TUE B;  3BVO A;  3SPJ A;  1M90 W;  5LYJ B;  1XI1 A;  3ETD A;  2H94 A;  2FKX A;  2JDI G;  4OXS A;  2YIB D;  3ASN B;  2ITD C;  4DR7 O;  2EIN B;  2XAH A;  2EIK C;  1US6 A;  1AI4 A;  1IBL O;  3ABL B;  3L70 H;  1IXM A;  2VRZ A;  5L3F A;  1KQS U;  3EXA A;  3O65 A;  1K4D C;  3A2F A;  2DOS A;  3DGE A;  5EIB C;  1H2M A;  2CTW A;  1IVS A;  5EC2 C;  2P5O A;  4JYA B;  5GTH Z;  3B40 A;  2K1E A;  1MOF A;  1TUB A;  2ZD9 A;  3C90 A;  4I9W A;  4H33 A;  1TVK B;  3UM7 A;  5LGT A;  4HZ3 A;  1MZE A;  5B3S B;  4O2B A;  3STL C;  4TV9 B;  1NI8 A;  2JGD A;  2BE3 A;  2IJI A;  2Q67 A;  2R9R B;  2IW5 A;  4U3F H;  2EJR A;  2DW4 A;  4FZ1 A;  2Y4T A;  3ZMZ A;  4OX9 O;  2YEV A;  3SYQ A;  4O4J A;  3T1C A;  3CCS V;  4P30 A;  1FYJ A;  2FL4 A;  1G6U A;  3SYO A;  1B6Q A;  3H01 A;  1SA0 A;  1FXK C;  1HNZ O;  4DV2 B;  3ABU A;  4QPJ A;  4PD4 F;  3CJH A;  4G27 B;  1AJP A;  4I9Q A;  1NKD A;  4DW1 A;  3ASN C;  2ZKO A;  1W59 A;  2EIN C;  2N04 A;  2ZDI A;  4DO2 A;  2DQ0 A;  5BR8 O;  1RPO A;  3AK3 A;  3K5M A;  4X20 B;  4NB5 A;  1T5E A;  2CTP A;  1BL8 A;  2ZIN A;  1KKC A;  2KSD A;  4RAI A;  2R72 A;  3WFV A;  4ZBM A;  4I4T B;  2LW7 A;  3N27 A;  4L87 A;  5B3S C;  3RYC A;  5LHG A;  5JJJ B;  3CCQ V;  5KMG A;  3B2E E;  1ZUQ A;  5LA6 A;  3K0D A;  1UJW B;  4EB6 B;  3EHB B;  4G28 B;  2Z3Y A;  3LDC A;  3I55 V;  4EEQ A;  1WPX A;  1R6N A;  2IH1 C;  4JAS A;  5FL7 G;  3K03 A;  1D2D A;  3CCJ V;  4UV8 A;  4MTX A;  4UVA A;  4UFZ A;  1YIT V;  2F95 B;  1PP9 H;  4K0K O;  5JH7 B;  3RN4 A;  1YJN V;  1YIJ V;  5EBM C;  1MA1 A;  5JQG A;  2YSU B;  1N4C A;  4YHH B;  3PJS K;  4X88 A;  4TT3 G;  3OFN G;  1XNQ O;  4RWU A;  1S77 D;  4I5S A;  2ZCE A;  4JI5 B;  1E79 G;  2DWD C;  4UCV A;  2PY5 A;  1WA8 B;  3JAM N;  1QQC A;  2CUG A;  2P22 C;  1S5J A;  2RNB A;  2YXY A;  2QE7 G;  1DK1 A;  4DV1 B;  1Y74 B;  4BW5 A;  4QJF B;  3MDS A;  4X1I B;  5A2Q N;  3RW0 A;  1PM9 A;  2ILM A;  5H5N A;  3K57 A;  3OAA G;  4OPA A;  3H1J H;  3L9D A;  2FTK A;  1SES A;  1OZ0 A;  1RP3 B;  3ZBH A;  2IU0 A;  3O9O A;  5FNV B;  4DUY B;  2HP8 A;  1GKF A;  3HKE A;  1LR1 A;  4EFB A;  3D8C A;  3UO2 A;  3J81 N;  1SQQ H;  1N36 O;  3CXC U;  2WLI B;  1ZSP A;  3G71 V;  2Q7E A;  1BQZ A;  2XND G;  1CPY A;  4B3S O;  1HWY A;  4IHJ A;  2ZE5 A;  4MW8 A;  1TVK A;  3ZMV A;  2Q7H A;  4B7E A;  3G4S V;  3ZS8 C;  5LGN A;  4TV9 A;  1M56 B;  3D36 C;  1XUQ A;  4B3T B;  2VQF O;  3ABK B;  3CCL V;  4GX2 A;  4B3R B;  1BS3 A;  2QM4 A;  1G4Y B;  1NZ6 A;  3ZN1 A;  2R70 A;  3SYC A;  4WFG A;  2DQ3 A;  2JIZ G;  2Q0A A;  3JAS B;  3JAW B;  3HPL C;  3BCC H;  1JMK C;  1L0L H;  3BHP A;  2IH3 C;  4XDK A;  2YXL A;  4K3A A;  3ZJZ A;  3K5L A;  4DV5 B;  4UUJ C;  4CH6 A;  4UCU A;  3IC7 A;  4WBN B;  1GRJ A;  2MW2 B;  3TCU A;  4FM1 A;  1EZV H;  4X64 O;  3DXR B;  3I56 V;  4IYI A;  3J80 N;  4X20 A;  2A7W A;  3OEE G;  3K04 A;  4G2K A;  3TJT A;  1R6T A;  4CS4 A;  2E5L O;  4FM0 A;  4IIJ B;  3GVM A;  5L3E A;  5LXT B;  3K79 A;  3OUS A;  4BIU A;  1M56 C;  3K5N A;  4K8Z A;  4DR3 O;  2WLL A;  5B1B B;  1O9H A;  3ABK C;  4CS3 A;  2CK3 G;  1JA8 A;  3JYC A;  4O4L B;  4EB6 A;  1K33 A;  2ZM6 O;  1J5E B;  1BHB A;  1S5L Z;  2DJV A;  2XAS A;  3CHX A;  1GM9 A;  3DC5 A;  1LUV A;  3A0B Z;  3BEH A;  2A79 B;  2KG7 A;  1ZX3 A;  4WCE V;  4MVM A;  3DTU B;  4X1K B;  5HFM A;  4LF7 B;  2AGA A;  2WSS G;  1JR9 A;  4WFB V;  2WLM A;  4P2Z A;  3CCR V;  1GK9 A;  3G6E V;  2E74 B;  1BCC H;  4NVP A;  5B5E Z;  3A0H Z;  2LGW A;  4W4L A;  3L71 H;  4JI4 B;  1W2B U;  2QWR B;  1O9G A;  4MVO A;  1J95 A;  1PNK A;  3WG7 B;  2L35 A;  3APQ A;  4PDM A;  1HNX B;  2Q69 A;  1F4M A;  1ZAU A;  3K9A A;  5CBG A;  4H13 B;  4JV5 B;  3E2E A;  2F43 G;  1RPR A;  3RYI B;  3FX7 A;  1B06 A;  4UVC A;  3QO7 A;  3VQW A;  3CRA A;  5J2T B;  4FIP C;  1VQ4 V;  2UUB B;  1Y74 A;  3FB6 C;  3KG2 A;  4ZKI A;  4JYC A;  3LSS A;  1GN2 A;  3T4D A;  1BQ0 A;  2HJD A;  2NNU A;  2CGO A;  3OMI B;  1TGO A;  1NTM H;  2VQE B;  4DV4 O;  2WPD G;  4FLT A;  3KZI Z;  4DXW A;  2H3O A;  1F23 A;  4MVS A;  4FFK A;  4CH3 A;  2PGG A;  4TWK A;  2JVD A;  4JI3 O;  2ARH A;  5LMN B;  1NH2 D;  5B1O A;  3CCU V;  1BSM A;  5KA6 A;  1R1B A;  1K5S A;  4X66 O;  1IX9 A;  4NXN O;  2YI9 A;  2Q7G A;  4HYO A;  2YID A;  4JTD B;  4JPR A;  4WFH A;  2ZXW B;  1N32 O;  3MHS C;  4PA4 A;  1ROP A;  5IE9 A;  1I5Y A;  1OCZ B;  4RO2 A;  4LFB O;  4LF8 B;  5IJ0 B;  3E8F A;  1YVW A;  1N34 B;  3UKM A;  1Y76 A;  1FS0 G;  4DR2 O;  3SDL A;  1RSO B;  4WBN A;  2WWW A;  4FFB B;  3KCX A;  2UXC O;  5EZY B;  2UXB B;  2QA4 V;  4QNH B;  4R50 A;  2CE4 A;  3DXR A;  1AIL A;  4UCR A;  4J10 A;  3CMA V;  3AEI A;  3THO A;  1XHZ A;  1HNW O;  2RQ6 A;  3BA8 A;  4JI1 O;  1X4T A;  4P9P A;  4CZZ A;  2QKA A;  4DV0 B;  2B9Z A;  1NVP D;  1WB7 A;  2UXX A;  4IIJ A;  2Q73 A;  1FAF A;  2IM9 A;  3BRC A;  5LXT A;  1JJO A;  5E1A C;  4YJ2 B;  1WP8 A;  4ZHQ B;  3JAR B;  4LF6 B;  5KAF Z;  3G80 A;  3BAB A;  3FB8 C;  2ZR2 A;  2DWE C;  5EYP A;  1SET A;  1J5E O;  1SKV A;  3AG1 B;  2RDC A;  3H1I H;  2ZXW C;  2ADQ B;  2R9I A;  3K06 A;  3WB1 A;  1KP2 A;  3RYF A;  4DV6 O;  1JCH A;  2ODM A;  3CS5 A;  1NTK H;  4LF7 O;  5DM6 V;  2MK3 A;  1QNM A;  4ICG A;  1FPO A;  1OCZ C;  4JTA B;  1F7Y A;  3IC9 A;  2L6L A;  2HR3 A;  3CC4 V;  4LF9 O;  3CB2 A;  3ETQ A;  3OW2 U;  4O4H B;  2Y4U A;  3ZED A;  5JWP A;  1Q81 W;  2QSA A;  5EC1 C;  1R3I C;  3H9V A;  3SYP A;  2DYS B;  4AQY B;  4GKJ O;  2FB5 A;  5IJ9 B;  5LHH A;  3U11 A;  3G6B A;  1B3Q A;  1ZTE A;  4DK0 A;  3ZHS A;  4JV5 O;  1XRE A;  3JAK B;  3SPG A;  3IJ4 A;  3RYI A;  5B1A B;  1FJG B;  5L3C A;  2JEU A;  5J2T A;  2HFE C;  1Q6H A;  3I5D A;  4X62 O;  2UUB O;  2UUA B;  1K73 W;  1FXK B;  3JAL B;  4F4L A;  4LF5 O;  3GWO A;  3SR2 C;  3M8A A;  4PDR A;  4RUF A;  1IDS A;  4JI2 O;  3JSL A;  3NR7 A;  2P06 A;  2B1G A;  4UB8 Z;  3CSX A;  2Q4P A;  3FB7 C;  3VQX A;  4F6R A;  4FLV A;  5IYD O;  1ZL8 B;  4DV7 B;  1ORQ C;  3ZHT A;  1XMQ B;  3AG1 C;  1THZ A;  4XBF A;  1OJH A;  3OE7 G;  1I7F A;  4XDJ A;  4JTC B;  5TIS Z;  4DYL A;  1TA8 A;  2OWO A;  2AHY A;  5K1P A;  3FFQ A;  2ZIM A;  1H2S B;  2LP7 A;  4YIP A;  4DR6 B;  1XQ8 A;  1K4C C;  1LNQ A;  1Q5O A;  2A06 H;  2P4V A;  1P7G A;  2JRI A;  4LWS A;  1IBM B;  2DYS C;  5C8Y A;  1Q3E A;  4JAU A;  1S76 D;  3B4S A;  4QGP A;  1XL6 A;  3HKC B;  1ZWI C;  4HNA B;  3IAY A;  4DUZ O;  5KUM A;  1SRY A;  3B77 A;  1QU7 A;  1R6K A;  1XHX A;  4H44 B;  2OCH A;  5B1A C;  1FFT B;  1AI6 A;  2BCC H;  2UUC O;  1K9M W;  4I0X B;  2HKO A;  2ZR3 A;  3TET A;  4I55 B;  3CRR A;  5IWA B;  3N2K B;  1Z5V A;  3B09 A;  4RQF A;  5KLV H;  1KP3 A;  4YY3 B;  1VF6 C;  1BE3 H;  1P4R A;  3JSN A;  3STZ C;  3FKS G;  3W7U A;  2Y0P A;  3SPI A;  2C2A A;  5FLX N;  2YC0 A;  4FLX A;  3T2M A;  3D3Q A;  1N33 B;  3RYH B;  2D3O W;  3M99 B;  2W0X A;  2OTJ V;  2N05 A;  5D5P A;  3T1H B;  4B3M O;  4RQE A;  2W0F C;  1IZ3 A;  2QWO B;  5CA1 A;  3APO A;  1XMO O;  1GM8 A;  1E1R G;  4MT8 A;  5CBF A;  3IGA C;  2N74 A;  1D5A A;  4WFF A;  4PI2 A;  5LP6 B;  4X1Y A;  5BZB A;  3JCU Z;  1K3E A;  1M57 B;  4CC5 A;  1K5Q A;  5CB4 B;  1YJW V;  2LJ2 A;  4JI8 O;  3DSQ A;  5E79 Z;  3OM3 B;  4C7U A;  3LNN A;  5H6Q A;  5KHH A;  4GX5 A;  1AR4 A;  2X7R B;  2GUZ B;  3R65 A;  4O4H A;  1IXB A;  4NTX A;  1COW G;  3TK1 A;  2ZNJ A;  1QHT A;  1MNG A;  1N8R W;  4TQF A;  1PNL A;  1P49 A;  1HP8 A;  3ZCC A;  1BGY H;  2BOC C;  3CRQ A;  3FYE B;  4JI7 B;  3CYO A;  3UT5 B;  2EZO A;  4PDV A;  1VQ8 V;  4DV3 O;  5K1X A;  2IJJ A;  3RFR A;  4LH7 A;  3W7W A;  4U3J A;  3BA9 A;  4DW0 A;  3JCZ A;  3ZRV A;  3C3T A;  4LNU B;  5IY5 B;  1FXK A;  3JAL A;  4YJ3 B;  3E35 A;  5L3B A;  5ITZ A;  4GKK B;  3K9S A;  1I5X A;  2QM8 A;  3Q4H B;  2UU9 B;  4CBC A;  4NR1 A;  2ZE7 A;  4DR1 O;  3SYA A;  5LYJ A;  1HR0 B;  5LP6 C;  1ZL8 A;  4LFA B;  1JJ2 U;  1N0N A;  2CGN A;  1M57 C;  1DLB A;  2Q8V A;  5LMU B;  2HHH B;  1XMQ O;  4ZI7 B;  1KUQ A;  3OTF A;  5EIB D;  2GTS A;  4FK5 C;  1DTO A;  1GTO A;  3ZHQ A;  3VBB A;  3RT3 C;  4PV1 B;  5AG2 A;  1QVG U;  4PA7 A;  1XDC A;  1R3K C;  4JYA O;  3CE2 A;  1SS3 A;  1V9P A;  2BTO A;  2XAF A;  4GYC B;  5HFL A;  2HEP A;  1MSD A;  2W6I G;  2EIL B;  2IBZ H;  3F5W C;  5BY1 A;  3BPZ A;  1X59 A;  4MTG A;  3HKC A;  5KX5 B;  1PKX A;  3A8T A;  3ZX6 A;  3E8G A;  2AHZ A;  1V54 C;  4FMT A;  2E75 B;  4I7Z B;  4K35 A;  2X6A A;  2EIJ B;  3DC6 A;  3F5T A;  3C3S A;  1K7D A;  4I55 A;  4R8C A;  4BWA A;  5IY5 C;  3CXH F;  1G8M A;  4DV2 O;  3T1Y B;  4MW3 A;  2HVK C;  3VQY A;  2NLJ C;  2BTQ B;  3SJC C;  1WB8 A;  4AIL C;  1EM1 A;  1M93 A;  2Q0O C;  4J7J A;  4NKG B;  1H2L A;  2OT5 A;  1LUW A;  3K08 A;  2DMX A;  1EN5 A;  5KAI Z;  1KU9 A;  4DRX B;  3RYH A;  2V7Q G;  2QR4 A;  1AR1 B;  4ZOL B;  3RGB A;  1PD3 A;  3MAQ A;  3ML0 A;  5EBL C;  4IL6 Z;  4MTO A;  2NN4 A;  4H37 A;  3G67 A;  4O4I B;  5GON B;  3EVK A;  5KA5 A;  3OTO B;  3E22 B;  3FYI B;  2EX3 A;  5CMU A;  4LF4 B;  1SQV H;  5DEC A;  2XT9 A;  1K8A W;  4LCU C;  4I4T A;  3U0Z A;  3OEH G;  3LDE A;  3ZHV A;  2JGU A;  1IBK B;  1E1Q G;  2EIL C;  1Q86 W;  5DN6 G;  1WJZ A;  4DK1 A;  2V4D A;  4JAA A;  2UXD B;  3HKD B;  1MG1 A;  3OR7 C;  2GUZ A;  3E83 A;  4NXM B;  2YXH A;  2Z5U A;  2EIJ C;  4DR5 B;  1I0H A;  4MSW C;  4PI0 A;  5JCO C;  2QTS A;  3ZRW B;  2GSM B;  4R6Z A;  4GT1 A;  3D36 A;  2PYJ A;  2LQT A;  5L3D A;  5JH7 A;  4JI0 B;  2QKS A;  1JFF B;  2PI4 A;  4A5U B;  1MZF A;  4MVZ A;  4YHH O;  1GM7 A;  1VP7 A;  3ASO C;  2PZS A;  4X65 B;  1YF2 A;  1WN7 A;  2FML A;  2WA4 A;  3ZMT A;  2QTO A;  2F66 C;  4Z1V A;  1SQP H;  2LGQ A;  3LSQ A;  4YJ3 A;  4EKW A;  1I94 B;  1WA8 A;  2YDE A;  2PYL A;  4JI5 O;  1JOY A;  4X89 A;  1QLE B;  2BSK B;  4LC1 A;  2WA3 A;  4J7Z A;  2QKC A;  3BFR A;  1K97 A;  3CRC A;  4J11 A;  3SGI A;  3FD9 A;  3OR6 C;  2F93 B;  3LUT B;  2DYR B;  3MHH C;  4DV1 O;  4X1I A;  4LFC B;  1YTF D;  2PI5 A;  1DGS A;  1Z5W A;  1UPG A;  4ZI7 A;  5LMU O;  1Y66 A;  5FNV A;  3N2G B;  4UV9 A;  2IJH A;  3JD1 A;  4DUY O;  2CTQ A;  4TOI A;  1URF A;  1A32 A;  2WLI A;  4UXN A;  1JQ0 A;  4EFE A;  2EUL A;  3OGI B;  3CCM V;  4OPH A;  3ETE A;  4I50 B;  1NT2 B;  2B5U A;  3B8M A;  3R66 A;  1SZT A;  1RM1 B;  4FPP A;  3VOU A;  1OHH G;  5JJN B;  4B3T O;  1SQG A;  1Q90 D;  4B3R O;  4DR7 B;  3QVN A;  1QR9 A;  1NU1 H;  1SQX H;  3QTC A;  2M7W A;  5JCO A;  1SER A;  3JAS A;  1DF5 A;  3JAW A;  3RVY A;  1VIB A;  4N23 A;  3L72 H;  3AG7 A;  1QLE C;  2UXN A;  2BTQ A;  4J9Z B;  1TUB B;  3A0R A;  3W7S A;  1WPB A;  4DV5 O;  4BIZ A;  4U7O A;  3S3X A;  1ZLZ A;  1VAR A;  2DYR C;  3WB2 A;  4O2B B;  1V55 C;  4NTY A;  2IU3 A;  3ABM B;  3K3W A;  3OMN B;  1N0J A;  2X6C A;  1UFI A;  3QNE A;  1VQ6 V;  1DF4 A;  3SPH A;  3L73 H;  5L3G A;  4O4J B;  2QWN B;  4QE9 A;  2XTA A;  3B8N A;  1VQ9 V;  4DR4 B;  2M6Y A;  5H6R A;  1BT8 A;  1HNZ B;  1EN6 A;  1SA0 B;  4QPK A;  4D6T H;  2OIE A;  3QG5 A;  3CEI A;  2XAG A;  4UCT A;  4MVU A;  3VQV A;  1IBK O;  1RM1 C;  3SJQ C;  1JVM A;  4TV8 B;  2JS3 A;  1AI5 A;  4O4L A;  3E89 A;  4J80 A;  5CA0 B;  1G1X B;  2YIC A;  2UXD O;  4UCO A;  1K34 A;  2XOK G;  2XAQ A;  3CP1 A;  1M5I A;  4Z2W A;  5BR8 B;  2Q68 A;  3L74 H;  4GUN A;  3ZHR A;  3ZN0 A;  4X1K A;  4QIW F;  2Y69 B;  3LNM B;  3AG3 B;  4GLX A;  4Q6G A;  4JGS A;  2ZT9 B;  4JI0 O;  2RN9 A;  1F51 A;  4JI4 O;  3J7A U;  2RCV A;  2XUM A;  3CRM A;  3RYC B;  4D7T A;  3WB0 A;  2YIB A;  1PPJ H;  3ABM C;  1HNX O;  5KMG B;  3BY6 A;  1FXH A;  1YSC A;  2AZ2 A;  3UQ8 A;  2BSK A;  4YIO A;  3RVZ A;  1U96 A;  1FKA O;  5KUK A;  1NBM G;  5LHI A;  3H1K H;  2RMK B;  3P3N A;  4CC6 A;  1M4U A;  4K0K B;  1XNR B;  4PDL A;  1NS1 A;  2JJ2 G;  5JVD B;  5IYZ B;  1SQB H;  1QR8 A;  3N2G A;  1M1K W;  5JQG B;  4JI6 B;  2VQE O;  1Z2G A;  1VQP V;  1XNQ B;  2A9H A;  3K58 A;  1VQN V;  2ATK C;  1NR1 A;  2O57 A;  1QBZ A;  4I50 A;  1AI7 A;  2KB1 A;  3W7T A;  4O2A B;  2HG5 C;  4XDL A;  5LMN O;  2CH7 B;  1W0K G;  2Y69 C;  4FLY A;  3JD2 A;  3AG3 C;  1XEQ A;  3CC2 V;  4FLZ A;  3JAT B;  4PA6 A;  3CD6 V;  3ABT A;  4JYY A;  2PF4 E;  3PN1 A;  2FYU H;  4KHP B;  1K92 A;  3OT7 A; 
#chains in the Genus database with same CATH homology
 1SQX H;  3H1I H;  3L70 H;  1PPJ H;  1SQQ H;  3H1H H;  1BE3 H;  3TGU H;  3L74 H;  1KB9 F;  3L75 H;  4U3F H;  1NTK H;  1SQV H;  3L73 H;  1SQB H;  1NTZ H;  1P84 F;  1EZV H;  3H1J H;  1SQP H;  2BCC H;  3L72 H;  3BCC H;  1KYO F;  3CX5 F;  2A06 H;  1L0N H;  3CXH F;  4D6T H;  3CWB H;  1L0L H;  1BCC H;  1NTM H;  2IBZ H;  3H1L H;  5KLV H;  2FYU H;  3L71 H;  1BGY H;  1PP9 H;  3H1K H;  4PD4 F;  1NU1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...