2A06H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2a06H00
1NTKH 1SQQH 4U3FH 3H1IH 1SQBH 3H1HH 1SQXH 3L73H 1KYOF 3TGUH 1NTMH 1PP9H 2FYUH 3L75H 1SQVH 1EZVH 3H1LH 3L72H 2A06H 1BE3H 1PPJH 3H1JH 5KLVH 1KB9F 3CXHF 1SQPH 3CWBH 1BCCH 3BCCH 1L0NH 1BGYH 3L70H 1L0LH 4PD4F 3L71H 3H1KH 1NTZH 1P84F 1NU1H 4D6TH 2BCCH 3CX5F 2IBZH 3L74H
chains in the Genus database with same CATH superfamily
2GDSA 4O4HA 3BVOA 1EM1A 1Q90D 3OTFA 1XREA 4UCUA 4WFGA 2DJVA 1N36O 5JJEB 4PI0A 4DR4B 2IJHA 1DF4A 1VMGA 3AK2A 1X59A 3OGIB 2F95B 3JARB 4O4IA 1JR9A 3A0HZ 4D6TH 5KA5A 2XT9A 4F6RB 1ZAUA 4RUFA 1VEWA 3FB7C 1F51A 4FJCC 4JASA 1GRJA 2VQFB 4ZHQB 2A79B 4JTCB 3BABA 3TETA 5LOVB 3HKEA 1G4YB 3LNNA 1L1FA 3K0GA 3ABUA 4FZ0A 5BXZA 3ABKC 1IX9A 4YY3O 4Q6GA 1Y4MA 3RN4A 2QM8A 1VQKV 1QR9A 4GZRB 3OMIB 2WSSG 1N34O 4JYBA 5IYDO 3OEHG 2LW7A 3ZMZA 1SQPH 1AP6A 3JARA 4FK5C 4ZI7B 1H8HG 1VQ5V 4U7OA 1FFXB 2ZR3A 4NVPA 4X20B 4F6RA 5FNVA 1NZ6A 2P22C 1IBLO 3T2MA 2Z0AA 5IYZB 1H2NA 5KHKA 2XAGA 4ICGA 4HZ3A 4I50A 4LWSB 5LOVA 1V9PA 1Y66A 4DV4B 4DUZB 4UCSA 1F7YA 2AXTZ 3DTUB 3JATA 1RPOA 1FXVA 2Q5ZA 3ABLC 3OTOO 1I7FA 3DC6A 1M5IA 3E35A 3BEHA 1RSOA 4JI7O 1HNXB 2ZM6O 1NT2B 3ICXA 1ZLZA 5H6RA 2VWKA 3CC2V 1AP5A 2E3CA 3UT5B 3FB6C 1KP3A 3K06A 1SF9A 4I55B 5B3SC 2E75B 1I5XA 1XDCA 4LNUA 5IYZA 4ZBMA 2DOSA 4JI4B 2LGQA 1NH2D 2GSMB 1WAZA 2YDEA 3FKSG 4Q20A 2N74A 1KP2A 4JV5B 5B5EZ 2GV9A 4HNAB 4WFHA 3B4SA 4TWKA 4HYOA 1VQMV 3RYFA 4MW3A 1VQLV 2E76B 3CPWU 1LNQA 4DR3B 3UT5A 3OW2U 5E79Z 4BR6A 3K58A 1R3JC 2KSDA 4IL6Z 2MW2B 2Q67A 4AILC 1XMOB 3L9DA 3APQA 2YS8A 2OCCB 4Z2WA 4X65O 3K5MA 2K9PA 3B8MA 2EINB 2A0LA 2RDCA 2JEUA 1JX9A 4JI2B 1G6UA 1K5QA 3K08A 2VQEB 5JCOA 2OIGA 3CWBH 3J81N 5LP6C 2CTQA 3N27A 3E8GA 4GX1A 1IVSA 1XILA 4CC6A 4RWUA 1JVMA 3CRAA 1KD1W 4DR2B 5GW7A 1S5HC 1WPBA 4ZOLA 4LCUC 1PM9A 3QNEA 2UUCO 2EIJC 2NR5A 1VF7A 1F23A 3SJAC 4DV6O 5LYJB 1JQ0A 2AZ2A 1TVKB 1IBMO 3STZC 3W7SA 1AI5A 3RYIA 5LMUO 2F23A 2ZXWC 1D5NA 1YXBA 4MTOA 1XOUA 5LHIA 2RMKB 1VF6C 2DN9A 1I94B 4UB6Z 3AK3A 1VQNV 4B3RB 4YIPA 5A9GA 2HJDA 2RCVA 5KX5B 4JTAB 1FAFA 3AG3B 3DGEA 2FYUH 3U11A 4JYAB 1Q82W 5KUKA 1JPXA 1B04A 4NXNO 4Z1MG 2X7RB 1VQ9V 2W6IG 1RM1C 5C8YB 2KB1A 1V54B 3K03A 3U10A 1QHTA 3JYCA 2ILMA 5LBQA 4DR1O 3LNMB 2CTPA 4QJFB 3ASOC 2HHHO 4CC5A 5TISZ 3RYCA 2EIMC 4PA3A 5LYJA 3JAKA 4LF4B 4AQYO 2AZ0A 1TVKA 1JJOA 1W0JG 4I0XB 3JASA 3ZHRA 2DYRC 3E22A 1PV0A 1M4UA 2GUZB 3QG5A 4K8XA 4LFAO 4B3MB 1M90W 1COWG 3CCUV 4U7NA 3GWKC 5EC1C 3ETDA 4PDVA 1PL0A 2CAZC 5KX5A 2X6BA 1AI6A 1YHQV 2Y0IA 3FX7A 1VQ6V 1L8DA 5EZYA 1D2DA 1NR7A 5C8YA 4A5UB 1SC5B 3CSXA 2JDIG 2QGNA 5IWAB 1R3IC 1FKAO 1HR0B 4K8ZA 1AJPA 1VP7A 5JVDB 1NVPB 5B1BB 4DV0B 2UXDO 4DV7B 4MSWC 4P9OA 3CX5F 2CTRA 1DF5A 4J7KA 1UPGA 4LR3A 2P6JA 1GN2A 2JK5C 3K5LA 1BL8A 1N32O 3ZCCA 2NN4A 2GUZA 4X89A 3ML0A 2ZE7A 5EBMC 2XTAA 2QWRB 1N0NA 1NTKH 2WLNA 2OWOA 4NXMB 2EZOA 4LFBB 3KCXA 3MDSA 3FB8C 4KXRA 1H2MA 4X66B 1S77D 3QF7A 3VQYA 1SA0B 4GX5A 1TUEB 1XL6A 4ZKIA 3MHSC 3SYQA 4TV9B 3O65A 1SKVA 2HG5C 4DV2O 3WB1A 4IIJB 1KUQA 2OT5A 2Q7HA 3A0BZ 1KMIZ 1YEWA 3I5DA 1SZXA 1MZFA 2B9ZA 3R66A 2GHYA 2DW4A 3OE7G 3C90A 2JVDA 5FPRA 2ZDIC 1LUVA 4WCEV 2EJRA 5CB4B 2UUBO 4BIUA 2PY5A 1E1RG 1EBOA 2BOCC 4I4TB 3D36C 1PNLA 2F66C 4O4JA 2XOKG 2EZPA 5GTIZ 3W7WA 4R7CA 4JI6O 1M57C 2Q4PA 5E1AC 2NNUA 1GKFA 5EIBD 4PA6A 1Q6HA 2X6CA 4LH7A 1FPOA 5J2TA 2QTSA 2QKCA 2R72A 3CCLV 4DV3B 3L70H 5BR8O 2ADQB 4PD4F 3PN1A 4B7KA 2XHBA 2LP7A 4R50A 1IXBA 5BY1A 1B06A 5KHGA 3P3PA 5IJ9A 2P90A 1OCOB 3BAAA 3ASNB 4AHCA 1N8RW 1ROPA 2LGWA 2ZQMA 3ZX6A 2QEXV 4OX9B 5A2QN 3K5NA 3ZMSA 3RWRD 2DYSC 3LSSA 2GTAA 2ARHA 1BQ0A 4TSFG 3T4ZA 2GTSA 4DUYO 1NBMG 3QO7A 5KHIA 4L87A 2FTKA 3FB5C 5IDJA 2CDYA 2Y4TA 3GVMA 1Y6XA 5JJNB 3B77A 4KL1A 3FFQA 3JALB 4PV1B 4CS4A 4P9PA 5LHGA 4NB5A 2Z5UA 3FAVA 5KMGB 1W59A 1R73A 1XUQA 3T1HB 1OCRB 5DN6G 3RVZA 1JJ2U 4MVMA 4J9ZB 2Y69C 5IY5C 2EILC 4TT3G 4GKJO 3G67A 3HB3B 1QR8A 2F93B 2YEVB 1AVMA 4WFEA 2R9AA 4LP8A 1R1BA 4NKGB 1NVPD 1IXMA 2IH3C 3ZHVA 3NXSA 4N21A 3CC7V 5D5PA 2DMXA 4H33A 1OCZC 1WA8A 4YJ3B 4X1YB 4O2BB 1N36B 3IAYA 2CGOA 5JWPA 3LDDA 5GTHZ 3SYAA 4H44B 3JD4A 2YC0A 3L74H 4JPRA 3H9VA 4CS3A 2Q69A 3CCVV 3OUFA 3N2KB 4O4HB 1G8MA 4MVRA 2A06H 1FYJA 1NKDA 3AG2C 2FMLA 1D5AA 2Q8VA 1M56C 3H1KH 3RW0A 3DXRA 2ZDIA 5CA3A 2YEVA 1H2KA 3G80A 1I5YA 2BCCH 3WG7C 5JQGB 3CCQV 1GTOA 4O4IB 5CBGA 4YY3B 4CH5A 2JRIA 3D36A 3ZRWB 2ZE6A 3CCSV 1EN6A 1EZVH 3QO8A 3AK1A 3ZRXA 4YJ3A 5LGTA 3OUSA 1SQGA 1BCCH 1M9NA 4L8JA 5EC2C 5LXTA 3RBZA 3TK1A 4JI1O 5IJ0A 3HKEB 4WBNB 1VQ4V 3N2KA 1TUBB 1HNZO 1IBLB 4OGQB 3L73H 4QGPA 4QPJA 4RUEA 2ZNJA 1MMMA 3ABMB 4ASUG 2B1IA 4JI0O 4NTYA 1XNQO 1SS3A 3AG4C 5JQGA 2C2AA 1YIJV 3S3WA 3F7YC 3ZRWA 1OHHG 4IGGA 3OTOB 1VIBA 2Y4UA 2EIKB 3K04A 3O9OA 4YHHO 4JI7B 1Q3EA 5FNVB 3GWOA 2ZM6B 2E5LO 3L72H 1NI8A 1ZX3A 4FLZA 3A2FA 4UV8A 3JD1A 4I50B 5C93A 4DV5B 3VQXA 4OPAA 4WBNA 4LF7O 1TUBA 1DK1A 3JATB 3CRRA 3LSQA 2ZINA 2QWPB 2UXXA 4LFCO 3HKDA 2IJJA 1RSOB 4EB6A 1Q86W 1OV9A 3JCZA 1FXKC 4DK1A 2QTOA 4F4LA 1Q6UA 1SETA 3CHXA 1BHAA 4LF6O 2HR3A 4GCZA 4B7EA 3K59A 1K4CC 4LNUB 1EN5A 3G6BA 4X88A 4X64O 1H38A 1K9MW 3U0ZA 5KUMA 1MSWD 3ZJZA 1S76D 3D3QA 2CK3G 1BS3A 3EFFK 4X65B 4TUYA 4CH4A 2OCCC 2ZT9B 4MVSA 1VQPV 2IM9A 1WLEA 4OPHA 4EKWA 4RQEA 1KYOF 5H9CA 1PP9H 4JTDB 4ABMA 5L3GA 3RYFB 3AG1C 5CN0A 1VQOV 4R8CA 1AB3A 1ZTEA 2QSAA 4JI5O 4BW9A 1VARA 4FLVA 2ADPA 1Y74A 3K5OA 2HP8A 2PTMA 3E86A 1PNKA 4PJ0Z 1GH6A 4XDJA 2IJKA 4X62O 1AI7A 1CP9A 3SPHA 4CH6A 1YF2A 4GX2A 1PL4A 2UXNA 3D3IA 3F7VC 3UO3A 4XDLA 2QE7G 1J95A 1BZKA 2WLIB 3ABKB 4DV6B 3ZMUA 3CRQA 5HFMA 1GMGA 1IBMB 4UVCA 3OR6C 5LMUB 2QM4A 4FLWA 2LFRA 1Q8IA 3TXSA 3CJHA 2QA4V 2ZIOA 5EIBC 5KAIZ 1EFRG 3NR7A 1R3KC 1Q81W 4DW1A 4ZOLB 1QQCA 2ZNIA 4NTXA 4NXNB 3Q4HB 1K8AW 5H2FZ 5KHJA 1K3EA 2IH1C 2H94A 2DWDC 3BA9A 2OCHA 3CMEV 2ODMA 3C3SA 1OJHA 2KG7A 3RYIB 3SGIA 4DR1B 1V55C 2Q0OC 1U96A 2JJ1G 2HHHB 1GN6A 4UB8Z 1E79G 2WLIA 4LF5O 2BSKA 3M7MX 4CBCA 3ABLB 2BOBC 2Q73A 3KG2A 4MVUA 4AQYB 4TOIA 4LFAB 4W4LA 2PYJA 1FXKA 1YITV 5BMVA 1HNXO 5L3EA 2OTLV 5J9PC 4B3SO 2M7WA 4I9WA 1IZ3A 3Q4HA 1S0VA 3RYCB 3CXHF 4I5SA 3JAKB 3MD0A 1Y76A 2JGDA 3JASB 1P49A 4JAAA 3E22B 4KUMA 1GN3A 4PI2A 2QWNB 2UXDB 2YIAA 1SZTA 5B1BC 4NYKA 3M99B 1Q5OA 4G2KA 1BHBA 1N32B 4E2LA 4KFMA 2QJ1A 3AEIA 3ETQA 5EZYB 2PYLA 1SQFA 1BGYH 1ORQC 4HBNA 2E74B 5B1OA 1J5EO 3ZN0A 5LMNO 1GN4A 4O2AA 4IT5A 3CP1A 2UXCB 3GB7C 2PF4E 3QVNA 1GM9A 1UFIA 3JD0A 1URFA 1A32A 4GLXA 4GKKO 2OTJV 1NTZH 4MVOA 4DV2B 4BWAA 3ZEDA 1LUWA 4B08A 1IBKO 2Q7GA 1HWYA 2YSUB 5LP6B 2JIZG 3JAWA 1WN7A 3IC9A 2JS5A 2ATKC 3CRCA 3I56V 3MAQA 2WLLB 1KKDA 2UUBB 3P3NA 4FVMA 3C3TA 1WNSA 4LF9O 2EIJB 1HNWB 5FLXN 1SQBH 1YTFB 3JSLA 4QIWF 2R9RB 4KHPB 4JI6B 1M1KW 3ABTA 2ZXWB 2BTOA 4BAYA 4CZZA 3X2QC 3BY6A 3HKCA 2VWJA 1KU9A 4H0LB 2N05A 1L0LH 5BR8B 3RT3C 2K1EA 2ZD9A 4O4LA 5LP6A 3APOA 3CEIA 4O4JB 3DC5A 1I08A 4K0KO 1RM1B 2XAHA 3K3WA 1AR4A 3RVYA 2WLLA 5KLVH 1OCOC 3K57A 3ASOB 4JGSA 1EZJA 5J2TB 4DUYB 2D2CB 2EIMB 2YIBD 3P30A 3QO5A 2AW9A 5EK0A 4FFBA 1QU7A 2WWWA 4DV1O 2DYRB 3BHPA 5DECA 1P7BA 1QLEC 1VF6A 2R70A 5IJ9B 1K73W 4JZ2A 3JAMN 2UXBO 4UCVA 1W0KG 3LUTB 5D5QA 4MTFA 1YJWV 1HW7A 1GO3F 1TGOA 4GKJB 1F4MA 5F2VO 4PDMA 1R3LC 2UU9O 4D7SA 1DLBA 5KHHA 1RFYA 5CMUA 4DR7O 2QKAA 4X9QA 4K35A 1KB9F 1N4CA 4GT1A 4PA9A 1XNRO 3CXCU 4PELA 3FAVB 5HFLA 3ZHSA 5BZBA 2WA3A 2AHYA 1NJIW 3CYOA 4B3TO 4YXWG 2FKXA 1S72V 1Z5WA 2CH7A 3H1IH 3H1HH 2X6AA 1WP7A 4MW8A 1SRYA 3W7XA 2W0FC 3CCRV 2ITDC 2AHZA 2MK3A 4QNHB 1R6NA 5J2UA 3E89A 4BW5A 4U3JB 5B1NA 2KQXA 5FPOA 1WA8B 1KC8W 2YICA 3ZRVA 4NXMO 2IBZH 3IC7A 1OCCC 3UM7A 3G4SV 4IYHA 4DR6O 1SQXH 1AJNA 2VS0A 2IW5A 3EHBB 3H1LH 1MG1A 1W2BU 1BE3H 3H1JH 4J41A 4MT8A 5IYBO 2PI5A 1L0NH 3A8TA 2HFEC 3EVKA 3BRCA 1K34A 3SYOA 4PHZA 2F4VO 1AR5A 2AGAA 2XUMA 4JI1B 3DXRB 4JYYA 5B1AC 1HNZB 1QVGU 3CRMA 4U3JA 4JI8O 1XHZA 3SJCC 1XHXA 3RYHA 2LQTA 4JI0B 2DE0X 1H2SB 1M57B 1XNQB 5ITZA 1HDJA 5LXTB 5LL6Y 2N04A 2FB5A 3OMNB 4J7ZA 5IJ0B 4DW0A 4YHHB 2E5LB 1AI4A 3A0RA 1WP8A 3OEEG 1NS1A 2ETNA 3ZS8C 2Y48A 4MS2A 4LF7B 4CS2A 2LO1A 3WB2A 2YI9A 2ZCEA 2QR4A 2DYSB 2R9IA 2WAMA 4NTWA 4LFCB 1QVFU 4FM0A 1DGSA 2QKSA 4R6ZA 1N34B 1AILA 5EBLC 1NH2B 3IJ4A 3CC4V 3B8NA 5JH7A 1P84F 4TQDA 5GONA 4LF6B 1Y67A 3SPIA 2L35A 1Z5VA 3AG7A 1JMKC 2GBOA 2XNDG 1JCHA 1K4DC 2HJFC 4X64B 3E8BA 5AG2A 1ZSPA 2IU3A 2Y69B 1B3QA 3HKDB 2YI8A 5IY5B 2EILB 2RNBA 4EB6B 4X1IA 2ZIMA 3BFRA 3T1CA 1KKCA 3FD9A 2Q7EA 5EBWC 4I9QA 1GM7A 3OMAB 3IGAC 2F43G 1XMQO 4D7TA 1QBZA 4FLXA 2UUAO 1S5LZ 3HKBB 5L3FA 1OCZB 2NLJC 4IHJA 3G71V 1FJGO 2IU0A 1BSMA 4DR5O 1JOYA 3HR0A 1NR1A 3T1YO 4UXNA 4JI5B 4UVBA 3B09A 5CA0A 1YDXA 5K1PA 3IFXA 1FS0G 4UFZA 2O57A 1O9HA 5KAFZ 3AG2B 4CH3A 4TUYB 3SJBC 4X62B 2QDOA 1M56B 4FLUA 1MSDA 1QNMA 3VOUA 4LF8O 1N33O 5K1XA 2JEXA 5L3BA 3KKYA 3WG7B 5LGNA 1WB8A 1NU1H 4UCTA 5LHHA 3HKBA 2JGUA 5JCOC 4F6EA 1SQQH 1Y74B 5DEDA 3CE2A 1FD9A 4DRXB 1Z2GA 1AROP 1PPJH 1R6TA 4J9YB 4MVQA 3BA8A 4JAUA 4JI3O 4WFAV 3JSNA 1CXZB 3CCJV 2WLKA 3E8HA 1TAEA 1YI2V 3THOA 5IYCO 3OT7A 4I7ZB 4DV7O 1T5EA 3M8AA 4UUJC 1R6KA 4ZHQA 3JD2A 5H5NA 2EINC 1SESA 1SQVH 4MTGA 3SJQC 3CJHB 3AG4B 4N23A 4DR4O 4LF5B 1IDSA 2HVJC 5IT9N 3BCCH 4DO2A 4FLYA 2QWQB 4NR1A 2EX3A 1QLNA 4DRXA 5CBHA 1XBLA 4GX0A 4E4EA 1YSCA 5H6QA 4B3SB 2KG7B 2VQFO 2ZR2A 4XBFA 4UCOA 4ZI7A 2B1GA 4JF3A 4DV5O 2EBOA 2WPDG 5CBFA 3K9AA 2Y0PA 1FFXA 2UUCB 1H2LA 4X20A 3ZMTA 3ETEA 1MNGA 3WU2Z 1TA8A 2BSKB 3L71H 3G6EV 3B2EE 1UJWB 5B66Z 4EEQA 4FM1A 4H13B 2RJZA 3CS5A 1S5JA 1WB7A 3FYEB 1FXKB 4LWSA 2PI4A 3ZMVA 3N2GB 4WFFA 5BMVB 4UCRA 3ZHUA 1XQ8A 1GAXA 4FFKA 3AG3C 3JD3A 5FL7G 3UCSC 1SERA 4MVZA 3UO2A 1PNMA 4P30A 2WLJA 1J5EB 5LMNB 1Y76B 2EJ7A 2JGDB 1KBHA 1KQSU 1V54C 3SPCA 3E8FA 3H01A 3R65A 4GUNA 1XEQA 2HLDG 4I55A 3OAAG 4DV4O 4DUZO 3ZHTA 3RGBA 4JZGA 4QE9A 3UKMA 3TXQA 1XI1A 2YXYA 4GKKB 3JCUZ 3N2GA 4FLTA 3LDCA 3AG1B 3LSUA 1U97A 2P06A 1N0JA 1IBKB 2V4DA 1K33A 4O2AB 2PUSA 4HNAA 5B3SB 2XAJA 1H8EG 2WLMA 1K7DA 2LJ2A 1BMFG 2DQ0A 3ZIAG 1NQTA 1DTOA 5DM6V 3WB0A 4JI4O 3KCYA 4J80A 2V1DA 3OGCC 4LF9B 2FL4A 3OFNG 2P7TC 2HVKC 4JV5O 2B5UA 2PZSA 3B40A 4TQFA 5EYPB 3I55V 1WJZA 2KKWA 3JAWB 1CEZA 4TV8B 1K92A 1Q43A 2X0LA 2H8PC 4BIZA 1KECA 2P4VA 4DR3O 1THZA 2D3OW 1F4NA 2YIBA 3CCMV 2LW1A 3E2EA 2L6LA 3OR7C 4K0KB 1XMOO 5JJJB 4MTXA 1JA8A 4RQFA 4WF9V 1V55B 2XAQA 4KP4A 3HKCB 2H3OA 3OD4A 4FIPC 4JI2O 3W7UA 2VQEO 1Q6IA 1NTMH 5EYPA 4O4LB 2RQ6A 4DV1B 1B6QA 1AR1B 3S3XA 4J11A 3TCUA 4TV8A 2YXLA 2F1MA 1O9GA 2UXBB 5L3CA 4J7JA 5LGUA 2OYQA 5CA1B 1ZUQA 2YIDA 4DR2O 1AJQA 2DQ3A 3MHHC 4FM2A 4PDLA 4FFBB 2UU9B 3RFRA 2RN9A 4DR7B 1FFTB 1MOFA 4UV9A 3E83A 1XNRB 1RP3B 2CE4A 4QE7A 2IJIA 1VQ8V 2YUAA 1IURA 1I94O 1I0HA 4B3RO 4DYLA 2JS3A 4PA7A 3CCEV 4B3TB 3VQVA 2BE3A 4JYAO 4I0XA 4XDKA 2ZE5A 2LFSA 1PD3A 4H37A 3ASNC 2ZE8A 1MABG 3VQWA 5CA1A 2G38A 2ZKOA 2ITCC 1EN4A 3SR2C 3K9SA 4DXWA 3P32A 2UXCO 4G27B 3K0DA 4G28B 4U3FH 5IE9A 4FPPA 2Q9LA 4LF4O 3EXAA 1K97A 4DR6B 3F5TA 2CH7B 1ZL8B 2A3QA 3KZIZ 5JVDA 4B3MO 2V7QG 3DSQA 2HEPA 3STLC 2XASA 1MA1A 5J2UB 1S3JA 3SPJA 1OCRC 5KA6A 2F4VB 2CUGA 3ZN1A 4PDRA 2W0XA 2Q0AA 2Q68A 2YXHA 1Q7YW 1X4TA 4EFEA 4JI8B 4PA4A 1VF5B 4BIOA 5IWAO 1HR0O 1JFFB 2CGNA 4DV0O 2QWOB 3QTCA 1G1XB 1HNWO 3D8CA 4K3AA 4KHPO 1MZEA 1ZL8A 1SA0A 3X2QB 4EFBA 2WLHA 1YJNV 4YIOA 4TV9A 3BPZA 2HKOA 2QM7A 4IIJA 1WPXA 1HP8A 3RYHB 2P5OA 4OXSA 3ZRSA 4LFBO 4LH6A 1GK9A 4X66O 5ITZB 3TGUH 3L75H 4J10A 3SYPA 5CB4A 4YJ2B 3SYCA 1LR1A 1PKXA 1JFFA 4I4TA 1XL4A 2CTWA 3ZBHA 1K5SA 4QPKA 2EULA 1P7GA 2XAFA 1FXHA 1E1QG 5L3DA 1QLEB 1RPRA 2OIEA 1YZBA 4LC1A 4FZ1A 2DWEC 3PJSK 1P4RA 4Z1VA 1H2GA 1GM8A 3SDLA 3FYIB 1YTFD 2BTQB 2P4KA 4X8AA 3HPLC 1QCEA 4P2ZA 3TJTA 3OM3B 1ZWIC 4UVAA 3ABMC 4WFBV 3CMAV 2A9HA 2M6YA 5JH7B 3UQ8A 1XMQB 2Q6AA 4YJ2A 5GONB 2UUAB 3W7TA 3CD6V 4GYCB 3SPGA 1FJGB 4FMTA 4DV3O 2VRZA 2EIKC 3J80N 4DR5B 2A7WA 1BT8A 1ENVA 3F5WC 1M93A 3T1YB 4W4KA 4DK0A 4X1IB 3K79A 2JJ2G 3JALA 1BQZA 5KMGA 1VQ7V 4ZIBA 5LA6B 4AI8A 4X1KB 4IYIA 4HAMA 4OX9O 2BTQA 2PGGA 2P67A 3T4DA 2WA4A 4LF8B 3J7AU 4IHJB 1YJ9V 1N33B 1YCIA 3ZHQA 1OCCB 3WFVA 1YVWA 4LBEC 4C7UA 5CA0B 1CPYA 4RO2A 3CB2A 4JAVA 4RAIA 2Z3YA 1OZ0A 4X1YA 4O2BA 3T1HO 4JYCA 3VBBA 4JI3B 4J42A 3LDEA 5B1AB 3ETGA 1US6A 5LA6A 4X1KA 2W6JG
chains in the Genus database with same CATH topology
1NTKH 1SQQH 4U3FH 3H1IH 1SQBH 3H1HH 1SQXH 3L73H 1KYOF 3TGUH 1NTMH 1PP9H 2FYUH 3L75H 1SQVH 1EZVH 3H1LH 3L72H 2A06H 1BE3H 1PPJH 3H1JH 5KLVH 1KB9F 3CXHF 1SQPH 3CWBH 1BCCH 3BCCH 1L0NH 1BGYH 3L70H 1L0LH 4PD4F 3L71H 3H1KH 1NTZH 1P84F 1NU1H 4D6TH 2BCCH 3CX5F 2IBZH 3L74H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK H;  1SQQ H;  4U3F H;  3H1I H;  1SQB H;  3H1H H;  1SQX H;  3L73 H;  1KYO F;  3TGU H;  1NTM H;  1PP9 H;  2FYU H;  3L75 H;  1SQV H;  1EZV H;  3H1L H;  3L72 H;  2A06 H;  1BE3 H;  1PPJ H;  3H1J H;  5KLV H;  1KB9 F;  3CXH F;  1SQP H;  3CWB H;  1BCC H;  3BCC H;  1L0N H;  1BGY H;  3L70 H;  1L0L H;  4PD4 F;  3L71 H;  3H1K H;  1NTZ H;  1P84 F;  1NU1 H;  4D6T H;  2BCC H;  3CX5 F;  2IBZ H;  3L74 H; 
#chains in the Genus database with same CATH topology
 2GDS A;  4O4H A;  3BVO A;  1EM1 A;  1Q90 D;  3OTF A;  1XRE A;  4UCU A;  4WFG A;  2DJV A;  1N36 O;  5JJE B;  4PI0 A;  4DR4 B;  2IJH A;  1DF4 A;  1VMG A;  3AK2 A;  1X59 A;  3OGI B;  2F95 B;  3JAR B;  4O4I A;  1JR9 A;  3A0H Z;  4D6T H;  5KA5 A;  2XT9 A;  4F6R B;  1ZAU A;  4RUF A;  1VEW A;  3FB7 C;  1F51 A;  4FJC C;  4JAS A;  1GRJ A;  2VQF B;  4ZHQ B;  2A79 B;  4JTC B;  3BAB A;  3TET A;  5LOV B;  3HKE A;  1G4Y B;  3LNN A;  1L1F A;  3K0G A;  3ABU A;  4FZ0 A;  5BXZ A;  3ABK C;  1IX9 A;  4YY3 O;  4Q6G A;  1Y4M A;  3RN4 A;  2QM8 A;  1VQK V;  1QR9 A;  4GZR B;  3OMI B;  2WSS G;  1N34 O;  4JYB A;  5IYD O;  3OEH G;  2LW7 A;  3ZMZ A;  1SQP H;  1AP6 A;  3JAR A;  4FK5 C;  4ZI7 B;  1H8H G;  1VQ5 V;  4U7O A;  1FFX B;  2ZR3 A;  4NVP A;  4X20 B;  4F6R A;  5FNV A;  1NZ6 A;  2P22 C;  1IBL O;  3T2M A;  2Z0A A;  5IYZ B;  1H2N A;  5KHK A;  2XAG A;  4ICG A;  4HZ3 A;  4I50 A;  4LWS B;  5LOV A;  1V9P A;  1Y66 A;  4DV4 B;  4DUZ B;  4UCS A;  1F7Y A;  2AXT Z;  3DTU B;  3JAT A;  1RPO A;  1FXV A;  2Q5Z A;  3ABL C;  3OTO O;  1I7F A;  3DC6 A;  1M5I A;  3E35 A;  3BEH A;  1RSO A;  4JI7 O;  1HNX B;  2ZM6 O;  1NT2 B;  3ICX A;  1ZLZ A;  5H6R A;  2VWK A;  3CC2 V;  1AP5 A;  2E3C A;  3UT5 B;  3FB6 C;  1KP3 A;  3K06 A;  1SF9 A;  4I55 B;  5B3S C;  2E75 B;  1I5X A;  1XDC A;  4LNU A;  5IYZ A;  4ZBM A;  2DOS A;  4JI4 B;  2LGQ A;  1NH2 D;  2GSM B;  1WAZ A;  2YDE A;  3FKS G;  4Q20 A;  2N74 A;  1KP2 A;  4JV5 B;  5B5E Z;  2GV9 A;  4HNA B;  4WFH A;  3B4S A;  4TWK A;  4HYO A;  1VQM V;  3RYF A;  4MW3 A;  1VQL V;  2E76 B;  3CPW U;  1LNQ A;  4DR3 B;  3UT5 A;  3OW2 U;  5E79 Z;  4BR6 A;  3K58 A;  1R3J C;  2KSD A;  4IL6 Z;  2MW2 B;  2Q67 A;  4AIL C;  1XMO B;  3L9D A;  3APQ A;  2YS8 A;  2OCC B;  4Z2W A;  4X65 O;  3K5M A;  2K9P A;  3B8M A;  2EIN B;  2A0L A;  2RDC A;  2JEU A;  1JX9 A;  4JI2 B;  1G6U A;  1K5Q A;  3K08 A;  2VQE B;  5JCO A;  2OIG A;  3CWB H;  3J81 N;  5LP6 C;  2CTQ A;  3N27 A;  3E8G A;  4GX1 A;  1IVS A;  1XIL A;  4CC6 A;  4RWU A;  1JVM A;  3CRA A;  1KD1 W;  4DR2 B;  5GW7 A;  1S5H C;  1WPB A;  4ZOL A;  4LCU C;  1PM9 A;  3QNE A;  2UUC O;  2EIJ C;  2NR5 A;  1VF7 A;  1F23 A;  3SJA C;  4DV6 O;  5LYJ B;  1JQ0 A;  2AZ2 A;  1TVK B;  1IBM O;  3STZ C;  3W7S A;  1AI5 A;  3RYI A;  5LMU O;  2F23 A;  2ZXW C;  1D5N A;  1YXB A;  4MTO A;  1XOU A;  5LHI A;  2RMK B;  1VF6 C;  2DN9 A;  1I94 B;  4UB6 Z;  3AK3 A;  1VQN V;  4B3R B;  4YIP A;  5A9G A;  2HJD A;  2RCV A;  5KX5 B;  4JTA B;  1FAF A;  3AG3 B;  3DGE A;  2FYU H;  3U11 A;  4JYA B;  1Q82 W;  5KUK A;  1JPX A;  1B04 A;  4NXN O;  4Z1M G;  2X7R B;  1VQ9 V;  2W6I G;  1RM1 C;  5C8Y B;  2KB1 A;  1V54 B;  3K03 A;  3U10 A;  1QHT A;  3JYC A;  2ILM A;  5LBQ A;  4DR1 O;  3LNM B;  2CTP A;  4QJF B;  3ASO C;  2HHH O;  4CC5 A;  5TIS Z;  3RYC A;  2EIM C;  4PA3 A;  5LYJ A;  3JAK A;  4LF4 B;  4AQY O;  2AZ0 A;  1TVK A;  1JJO A;  1W0J G;  4I0X B;  3JAS A;  3ZHR A;  2DYR C;  3E22 A;  1PV0 A;  1M4U A;  2GUZ B;  3QG5 A;  4K8X A;  4LFA O;  4B3M B;  1M90 W;  1COW G;  3CCU V;  4U7N A;  3GWK C;  5EC1 C;  3ETD A;  4PDV A;  1PL0 A;  2CAZ C;  5KX5 A;  2X6B A;  1AI6 A;  1YHQ V;  2Y0I A;  3FX7 A;  1VQ6 V;  1L8D A;  5EZY A;  1D2D A;  1NR7 A;  5C8Y A;  4A5U B;  1SC5 B;  3CSX A;  2JDI G;  2QGN A;  5IWA B;  1R3I C;  1FKA O;  1HR0 B;  4K8Z A;  1AJP A;  1VP7 A;  5JVD B;  1NVP B;  5B1B B;  4DV0 B;  2UXD O;  4DV7 B;  4MSW C;  4P9O A;  3CX5 F;  2CTR A;  1DF5 A;  4J7K A;  1UPG A;  4LR3 A;  2P6J A;  1GN2 A;  2JK5 C;  3K5L A;  1BL8 A;  1N32 O;  3ZCC A;  2NN4 A;  2GUZ A;  4X89 A;  3ML0 A;  2ZE7 A;  5EBM C;  2XTA A;  2QWR B;  1N0N A;  1NTK H;  2WLN A;  2OWO A;  4NXM B;  2EZO A;  4LFB B;  3KCX A;  3MDS A;  3FB8 C;  4KXR A;  1H2M A;  4X66 B;  1S77 D;  3QF7 A;  3VQY A;  1SA0 B;  4GX5 A;  1TUE B;  1XL6 A;  4ZKI A;  3MHS C;  3SYQ A;  4TV9 B;  3O65 A;  1SKV A;  2HG5 C;  4DV2 O;  3WB1 A;  4IIJ B;  1KUQ A;  2OT5 A;  2Q7H A;  3A0B Z;  1KMI Z;  1YEW A;  3I5D A;  1SZX A;  1MZF A;  2B9Z A;  3R66 A;  2GHY A;  2DW4 A;  3OE7 G;  3C90 A;  2JVD A;  5FPR A;  2ZDI C;  1LUV A;  4WCE V;  2EJR A;  5CB4 B;  2UUB O;  4BIU A;  2PY5 A;  1E1R G;  1EBO A;  2BOC C;  4I4T B;  3D36 C;  1PNL A;  2F66 C;  4O4J A;  2XOK G;  2EZP A;  5GTI Z;  3W7W A;  4R7C A;  4JI6 O;  1M57 C;  2Q4P A;  5E1A C;  2NNU A;  1GKF A;  5EIB D;  4PA6 A;  1Q6H A;  2X6C A;  4LH7 A;  1FPO A;  5J2T A;  2QTS A;  2QKC A;  2R72 A;  3CCL V;  4DV3 B;  3L70 H;  5BR8 O;  2ADQ B;  4PD4 F;  3PN1 A;  4B7K A;  2XHB A;  2LP7 A;  4R50 A;  1IXB A;  5BY1 A;  1B06 A;  5KHG A;  3P3P A;  5IJ9 A;  2P90 A;  1OCO B;  3BAA A;  3ASN B;  4AHC A;  1N8R W;  1ROP A;  2LGW A;  2ZQM A;  3ZX6 A;  2QEX V;  4OX9 B;  5A2Q N;  3K5N A;  3ZMS A;  3RWR D;  2DYS C;  3LSS A;  2GTA A;  2ARH A;  1BQ0 A;  4TSF G;  3T4Z A;  2GTS A;  4DUY O;  1NBM G;  3QO7 A;  5KHI A;  4L87 A;  2FTK A;  3FB5 C;  5IDJ A;  2CDY A;  2Y4T A;  3GVM A;  1Y6X A;  5JJN B;  3B77 A;  4KL1 A;  3FFQ A;  3JAL B;  4PV1 B;  4CS4 A;  4P9P A;  5LHG A;  4NB5 A;  2Z5U A;  3FAV A;  5KMG B;  1W59 A;  1R73 A;  1XUQ A;  3T1H B;  1OCR B;  5DN6 G;  3RVZ A;  1JJ2 U;  4MVM A;  4J9Z B;  2Y69 C;  5IY5 C;  2EIL C;  4TT3 G;  4GKJ O;  3G67 A;  3HB3 B;  1QR8 A;  2F93 B;  2YEV B;  1AVM A;  4WFE A;  2R9A A;  4LP8 A;  1R1B A;  4NKG B;  1NVP D;  1IXM A;  2IH3 C;  3ZHV A;  3NXS A;  4N21 A;  3CC7 V;  5D5P A;  2DMX A;  4H33 A;  1OCZ C;  1WA8 A;  4YJ3 B;  4X1Y B;  4O2B B;  1N36 B;  3IAY A;  2CGO A;  5JWP A;  3LDD A;  5GTH Z;  3SYA A;  4H44 B;  3JD4 A;  2YC0 A;  3L74 H;  4JPR A;  3H9V A;  4CS3 A;  2Q69 A;  3CCV V;  3OUF A;  3N2K B;  4O4H B;  1G8M A;  4MVR A;  2A06 H;  1FYJ A;  1NKD A;  3AG2 C;  2FML A;  1D5A A;  2Q8V A;  1M56 C;  3H1K H;  3RW0 A;  3DXR A;  2ZDI A;  5CA3 A;  2YEV A;  1H2K A;  3G80 A;  1I5Y A;  2BCC H;  3WG7 C;  5JQG B;  3CCQ V;  1GTO A;  4O4I B;  5CBG A;  4YY3 B;  4CH5 A;  2JRI A;  3D36 A;  3ZRW B;  2ZE6 A;  3CCS V;  1EN6 A;  1EZV H;  3QO8 A;  3AK1 A;  3ZRX A;  4YJ3 A;  5LGT A;  3OUS A;  1SQG A;  1BCC H;  1M9N A;  4L8J A;  5EC2 C;  5LXT A;  3RBZ A;  3TK1 A;  4JI1 O;  5IJ0 A;  3HKE B;  4WBN B;  1VQ4 V;  3N2K A;  1TUB B;  1HNZ O;  1IBL B;  4OGQ B;  3L73 H;  4QGP A;  4QPJ A;  4RUE A;  2ZNJ A;  1MMM A;  3ABM B;  4ASU G;  2B1I A;  4JI0 O;  4NTY A;  1XNQ O;  1SS3 A;  3AG4 C;  5JQG A;  2C2A A;  1YIJ V;  3S3W A;  3F7Y C;  3ZRW A;  1OHH G;  4IGG A;  3OTO B;  1VIB A;  2Y4U A;  2EIK B;  3K04 A;  3O9O A;  4YHH O;  4JI7 B;  1Q3E A;  5FNV B;  3GWO A;  2ZM6 B;  2E5L O;  3L72 H;  1NI8 A;  1ZX3 A;  4FLZ A;  3A2F A;  4UV8 A;  3JD1 A;  4I50 B;  5C93 A;  4DV5 B;  3VQX A;  4OPA A;  4WBN A;  4LF7 O;  1TUB A;  1DK1 A;  3JAT B;  3CRR A;  3LSQ A;  2ZIN A;  2QWP B;  2UXX A;  4LFC O;  3HKD A;  2IJJ A;  1RSO B;  4EB6 A;  1Q86 W;  1OV9 A;  3JCZ A;  1FXK C;  4DK1 A;  2QTO A;  4F4L A;  1Q6U A;  1SET A;  3CHX A;  1BHA A;  4LF6 O;  2HR3 A;  4GCZ A;  4B7E A;  3K59 A;  1K4C C;  4LNU B;  1EN5 A;  3G6B A;  4X88 A;  4X64 O;  1H38 A;  1K9M W;  3U0Z A;  5KUM A;  1MSW D;  3ZJZ A;  1S76 D;  3D3Q A;  2CK3 G;  1BS3 A;  3EFF K;  4X65 B;  4TUY A;  4CH4 A;  2OCC C;  2ZT9 B;  4MVS A;  1VQP V;  2IM9 A;  1WLE A;  4OPH A;  4EKW A;  4RQE A;  1KYO F;  5H9C A;  1PP9 H;  4JTD B;  4ABM A;  5L3G A;  3RYF B;  3AG1 C;  5CN0 A;  1VQO V;  4R8C A;  1AB3 A;  1ZTE A;  2QSA A;  4JI5 O;  4BW9 A;  1VAR A;  4FLV A;  2ADP A;  1Y74 A;  3K5O A;  2HP8 A;  2PTM A;  3E86 A;  1PNK A;  4PJ0 Z;  1GH6 A;  4XDJ A;  2IJK A;  4X62 O;  1AI7 A;  1CP9 A;  3SPH A;  4CH6 A;  1YF2 A;  4GX2 A;  1PL4 A;  2UXN A;  3D3I A;  3F7V C;  3UO3 A;  4XDL A;  2QE7 G;  1J95 A;  1BZK A;  2WLI B;  3ABK B;  4DV6 B;  3ZMU A;  3CRQ A;  5HFM A;  1GMG A;  1IBM B;  4UVC A;  3OR6 C;  5LMU B;  2QM4 A;  4FLW A;  2LFR A;  1Q8I A;  3TXS A;  3CJH A;  2QA4 V;  2ZIO A;  5EIB C;  5KAI Z;  1EFR G;  3NR7 A;  1R3K C;  1Q81 W;  4DW1 A;  4ZOL B;  1QQC A;  2ZNI A;  4NTX A;  4NXN B;  3Q4H B;  1K8A W;  5H2F Z;  5KHJ A;  1K3E A;  2IH1 C;  2H94 A;  2DWD C;  3BA9 A;  2OCH A;  3CME V;  2ODM A;  3C3S A;  1OJH A;  2KG7 A;  3RYI B;  3SGI A;  4DR1 B;  1V55 C;  2Q0O C;  1U96 A;  2JJ1 G;  2HHH B;  1GN6 A;  4UB8 Z;  1E79 G;  2WLI A;  4LF5 O;  2BSK A;  3M7M X;  4CBC A;  3ABL B;  2BOB C;  2Q73 A;  3KG2 A;  4MVU A;  4AQY B;  4TOI A;  4LFA B;  4W4L A;  2PYJ A;  1FXK A;  1YIT V;  5BMV A;  1HNX O;  5L3E A;  2OTL V;  5J9P C;  4B3S O;  2M7W A;  4I9W A;  1IZ3 A;  3Q4H A;  1S0V A;  3RYC B;  3CXH F;  4I5S A;  3JAK B;  3MD0 A;  1Y76 A;  2JGD A;  3JAS B;  1P49 A;  4JAA A;  3E22 B;  4KUM A;  1GN3 A;  4PI2 A;  2QWN B;  2UXD B;  2YIA A;  1SZT A;  5B1B C;  4NYK A;  3M99 B;  1Q5O A;  4G2K A;  1BHB A;  1N32 B;  4E2L A;  4KFM A;  2QJ1 A;  3AEI A;  3ETQ A;  5EZY B;  2PYL A;  1SQF A;  1BGY H;  1ORQ C;  4HBN A;  2E74 B;  5B1O A;  1J5E O;  3ZN0 A;  5LMN O;  1GN4 A;  4O2A A;  4IT5 A;  3CP1 A;  2UXC B;  3GB7 C;  2PF4 E;  3QVN A;  1GM9 A;  1UFI A;  3JD0 A;  1URF A;  1A32 A;  4GLX A;  4GKK O;  2OTJ V;  1NTZ H;  4MVO A;  4DV2 B;  4BWA A;  3ZED A;  1LUW A;  4B08 A;  1IBK O;  2Q7G A;  1HWY A;  2YSU B;  5LP6 B;  2JIZ G;  3JAW A;  1WN7 A;  3IC9 A;  2JS5 A;  2ATK C;  3CRC A;  3I56 V;  3MAQ A;  2WLL B;  1KKD A;  2UUB B;  3P3N A;  4FVM A;  3C3T A;  1WNS A;  4LF9 O;  2EIJ B;  1HNW B;  5FLX N;  1SQB H;  1YTF B;  3JSL A;  4QIW F;  2R9R B;  4KHP B;  4JI6 B;  1M1K W;  3ABT A;  2ZXW B;  2BTO A;  4BAY A;  4CZZ A;  3X2Q C;  3BY6 A;  3HKC A;  2VWJ A;  1KU9 A;  4H0L B;  2N05 A;  1L0L H;  5BR8 B;  3RT3 C;  2K1E A;  2ZD9 A;  4O4L A;  5LP6 A;  3APO A;  3CEI A;  4O4J B;  3DC5 A;  1I08 A;  4K0K O;  1RM1 B;  2XAH A;  3K3W A;  1AR4 A;  3RVY A;  2WLL A;  5KLV H;  1OCO C;  3K57 A;  3ASO B;  4JGS A;  1EZJ A;  5J2T B;  4DUY B;  2D2C B;  2EIM B;  2YIB D;  3P30 A;  3QO5 A;  2AW9 A;  5EK0 A;  4FFB A;  1QU7 A;  2WWW A;  4DV1 O;  2DYR B;  3BHP A;  5DEC A;  1P7B A;  1QLE C;  1VF6 A;  2R70 A;  5IJ9 B;  1K73 W;  4JZ2 A;  3JAM N;  2UXB O;  4UCV A;  1W0K G;  3LUT B;  5D5Q A;  4MTF A;  1YJW V;  1HW7 A;  1GO3 F;  1TGO A;  4GKJ B;  1F4M A;  5F2V O;  4PDM A;  1R3L C;  2UU9 O;  4D7S A;  1DLB A;  5KHH A;  1RFY A;  5CMU A;  4DR7 O;  2QKA A;  4X9Q A;  4K35 A;  1KB9 F;  1N4C A;  4GT1 A;  4PA9 A;  1XNR O;  3CXC U;  4PEL A;  3FAV B;  5HFL A;  3ZHS A;  5BZB A;  2WA3 A;  2AHY A;  1NJI W;  3CYO A;  4B3T O;  4YXW G;  2FKX A;  1S72 V;  1Z5W A;  2CH7 A;  3H1I H;  3H1H H;  2X6A A;  1WP7 A;  4MW8 A;  1SRY A;  3W7X A;  2W0F C;  3CCR V;  2ITD C;  2AHZ A;  2MK3 A;  4QNH B;  1R6N A;  5J2U A;  3E89 A;  4BW5 A;  4U3J B;  5B1N A;  2KQX A;  5FPO A;  1WA8 B;  1KC8 W;  2YIC A;  3ZRV A;  4NXM O;  2IBZ H;  3IC7 A;  1OCC C;  3UM7 A;  3G4S V;  4IYH A;  4DR6 O;  1SQX H;  1AJN A;  2VS0 A;  2IW5 A;  3EHB B;  3H1L H;  1MG1 A;  1W2B U;  1BE3 H;  3H1J H;  4J41 A;  4MT8 A;  5IYB O;  2PI5 A;  1L0N H;  3A8T A;  2HFE C;  3EVK A;  3BRC A;  1K34 A;  3SYO A;  4PHZ A;  2F4V O;  1AR5 A;  2AGA A;  2XUM A;  4JI1 B;  3DXR B;  4JYY A;  5B1A C;  1HNZ B;  1QVG U;  3CRM A;  4U3J A;  4JI8 O;  1XHZ A;  3SJC C;  1XHX A;  3RYH A;  2LQT A;  4JI0 B;  2DE0 X;  1H2S B;  1M57 B;  1XNQ B;  5ITZ A;  1HDJ A;  5LXT B;  5LL6 Y;  2N04 A;  2FB5 A;  3OMN B;  4J7Z A;  5IJ0 B;  4DW0 A;  4YHH B;  2E5L B;  1AI4 A;  3A0R A;  1WP8 A;  3OEE G;  1NS1 A;  2ETN A;  3ZS8 C;  2Y48 A;  4MS2 A;  4LF7 B;  4CS2 A;  2LO1 A;  3WB2 A;  2YI9 A;  2ZCE A;  2QR4 A;  2DYS B;  2R9I A;  2WAM A;  4NTW A;  4LFC B;  1QVF U;  4FM0 A;  1DGS A;  2QKS A;  4R6Z A;  1N34 B;  1AIL A;  5EBL C;  1NH2 B;  3IJ4 A;  3CC4 V;  3B8N A;  5JH7 A;  1P84 F;  4TQD A;  5GON A;  4LF6 B;  1Y67 A;  3SPI A;  2L35 A;  1Z5V A;  3AG7 A;  1JMK C;  2GBO A;  2XND G;  1JCH A;  1K4D C;  2HJF C;  4X64 B;  3E8B A;  5AG2 A;  1ZSP A;  2IU3 A;  2Y69 B;  1B3Q A;  3HKD B;  2YI8 A;  5IY5 B;  2EIL B;  2RNB A;  4EB6 B;  4X1I A;  2ZIM A;  3BFR A;  3T1C A;  1KKC A;  3FD9 A;  2Q7E A;  5EBW C;  4I9Q A;  1GM7 A;  3OMA B;  3IGA C;  2F43 G;  1XMQ O;  4D7T A;  1QBZ A;  4FLX A;  2UUA O;  1S5L Z;  3HKB B;  5L3F A;  1OCZ B;  2NLJ C;  4IHJ A;  3G71 V;  1FJG O;  2IU0 A;  1BSM A;  4DR5 O;  1JOY A;  3HR0 A;  1NR1 A;  3T1Y O;  4UXN A;  4JI5 B;  4UVB A;  3B09 A;  5CA0 A;  1YDX A;  5K1P A;  3IFX A;  1FS0 G;  4UFZ A;  2O57 A;  1O9H A;  5KAF Z;  3AG2 B;  4CH3 A;  4TUY B;  3SJB C;  4X62 B;  2QDO A;  1M56 B;  4FLU A;  1MSD A;  1QNM A;  3VOU A;  4LF8 O;  1N33 O;  5K1X A;  2JEX A;  5L3B A;  3KKY A;  3WG7 B;  5LGN A;  1WB8 A;  1NU1 H;  4UCT A;  5LHH A;  3HKB A;  2JGU A;  5JCO C;  4F6E A;  1SQQ H;  1Y74 B;  5DED A;  3CE2 A;  1FD9 A;  4DRX B;  1Z2G A;  1ARO P;  1PPJ H;  1R6T A;  4J9Y B;  4MVQ A;  3BA8 A;  4JAU A;  4JI3 O;  4WFA V;  3JSN A;  1CXZ B;  3CCJ V;  2WLK A;  3E8H A;  1TAE A;  1YI2 V;  3THO A;  5IYC O;  3OT7 A;  4I7Z B;  4DV7 O;  1T5E A;  3M8A A;  4UUJ C;  1R6K A;  4ZHQ A;  3JD2 A;  5H5N A;  2EIN C;  1SES A;  1SQV H;  4MTG A;  3SJQ C;  3CJH B;  3AG4 B;  4N23 A;  4DR4 O;  4LF5 B;  1IDS A;  2HVJ C;  5IT9 N;  3BCC H;  4DO2 A;  4FLY A;  2QWQ B;  4NR1 A;  2EX3 A;  1QLN A;  4DRX A;  5CBH A;  1XBL A;  4GX0 A;  4E4E A;  1YSC A;  5H6Q A;  4B3S B;  2KG7 B;  2VQF O;  2ZR2 A;  4XBF A;  4UCO A;  4ZI7 A;  2B1G A;  4JF3 A;  4DV5 O;  2EBO A;  2WPD G;  5CBF A;  3K9A A;  2Y0P A;  1FFX A;  2UUC B;  1H2L A;  4X20 A;  3ZMT A;  3ETE A;  1MNG A;  3WU2 Z;  1TA8 A;  2BSK B;  3L71 H;  3G6E V;  3B2E E;  1UJW B;  5B66 Z;  4EEQ A;  4FM1 A;  4H13 B;  2RJZ A;  3CS5 A;  1S5J A;  1WB7 A;  3FYE B;  1FXK B;  4LWS A;  2PI4 A;  3ZMV A;  3N2G B;  4WFF A;  5BMV B;  4UCR A;  3ZHU A;  1XQ8 A;  1GAX A;  4FFK A;  3AG3 C;  3JD3 A;  5FL7 G;  3UCS C;  1SER A;  4MVZ A;  3UO2 A;  1PNM A;  4P30 A;  2WLJ A;  1J5E B;  5LMN B;  1Y76 B;  2EJ7 A;  2JGD B;  1KBH A;  1KQS U;  1V54 C;  3SPC A;  3E8F A;  3H01 A;  3R65 A;  4GUN A;  1XEQ A;  2HLD G;  4I55 A;  3OAA G;  4DV4 O;  4DUZ O;  3ZHT A;  3RGB A;  4JZG A;  4QE9 A;  3UKM A;  3TXQ A;  1XI1 A;  2YXY A;  4GKK B;  3JCU Z;  3N2G A;  4FLT A;  3LDC A;  3AG1 B;  3LSU A;  1U97 A;  2P06 A;  1N0J A;  1IBK B;  2V4D A;  1K33 A;  4O2A B;  2PUS A;  4HNA A;  5B3S B;  2XAJ A;  1H8E G;  2WLM A;  1K7D A;  2LJ2 A;  1BMF G;  2DQ0 A;  3ZIA G;  1NQT A;  1DTO A;  5DM6 V;  3WB0 A;  4JI4 O;  3KCY A;  4J80 A;  2V1D A;  3OGC C;  4LF9 B;  2FL4 A;  3OFN G;  2P7T C;  2HVK C;  4JV5 O;  2B5U A;  2PZS A;  3B40 A;  4TQF A;  5EYP B;  3I55 V;  1WJZ A;  2KKW A;  3JAW B;  1CEZ A;  4TV8 B;  1K92 A;  1Q43 A;  2X0L A;  2H8P C;  4BIZ A;  1KEC A;  2P4V A;  4DR3 O;  1THZ A;  2D3O W;  1F4N A;  2YIB A;  3CCM V;  2LW1 A;  3E2E A;  2L6L A;  3OR7 C;  4K0K B;  1XMO O;  5JJJ B;  4MTX A;  1JA8 A;  4RQF A;  4WF9 V;  1V55 B;  2XAQ A;  4KP4 A;  3HKC B;  2H3O A;  3OD4 A;  4FIP C;  4JI2 O;  3W7U A;  2VQE O;  1Q6I A;  1NTM H;  5EYP A;  4O4L B;  2RQ6 A;  4DV1 B;  1B6Q A;  1AR1 B;  3S3X A;  4J11 A;  3TCU A;  4TV8 A;  2YXL A;  2F1M A;  1O9G A;  2UXB B;  5L3C A;  4J7J A;  5LGU A;  2OYQ A;  5CA1 B;  1ZUQ A;  2YID A;  4DR2 O;  1AJQ A;  2DQ3 A;  3MHH C;  4FM2 A;  4PDL A;  4FFB B;  2UU9 B;  3RFR A;  2RN9 A;  4DR7 B;  1FFT B;  1MOF A;  4UV9 A;  3E83 A;  1XNR B;  1RP3 B;  2CE4 A;  4QE7 A;  2IJI A;  1VQ8 V;  2YUA A;  1IUR A;  1I94 O;  1I0H A;  4B3R O;  4DYL A;  2JS3 A;  4PA7 A;  3CCE V;  4B3T B;  3VQV A;  2BE3 A;  4JYA O;  4I0X A;  4XDK A;  2ZE5 A;  2LFS A;  1PD3 A;  4H37 A;  3ASN C;  2ZE8 A;  1MAB G;  3VQW A;  5CA1 A;  2G38 A;  2ZKO A;  2ITC C;  1EN4 A;  3SR2 C;  3K9S A;  4DXW A;  3P32 A;  2UXC O;  4G27 B;  3K0D A;  4G28 B;  4U3F H;  5IE9 A;  4FPP A;  2Q9L A;  4LF4 O;  3EXA A;  1K97 A;  4DR6 B;  3F5T A;  2CH7 B;  1ZL8 B;  2A3Q A;  3KZI Z;  5JVD A;  4B3M O;  2V7Q G;  3DSQ A;  2HEP A;  3STL C;  2XAS A;  1MA1 A;  5J2U B;  1S3J A;  3SPJ A;  1OCR C;  5KA6 A;  2F4V B;  2CUG A;  3ZN1 A;  4PDR A;  2W0X A;  2Q0A A;  2Q68 A;  2YXH A;  1Q7Y W;  1X4T A;  4EFE A;  4JI8 B;  4PA4 A;  1VF5 B;  4BIO A;  5IWA O;  1HR0 O;  1JFF B;  2CGN A;  4DV0 O;  2QWO B;  3QTC A;  1G1X B;  1HNW O;  3D8C A;  4K3A A;  4KHP O;  1MZE A;  1ZL8 A;  1SA0 A;  3X2Q B;  4EFB A;  2WLH A;  1YJN V;  4YIO A;  4TV9 A;  3BPZ A;  2HKO A;  2QM7 A;  4IIJ A;  1WPX A;  1HP8 A;  3RYH B;  2P5O A;  4OXS A;  3ZRS A;  4LFB O;  4LH6 A;  1GK9 A;  4X66 O;  5ITZ B;  3TGU H;  3L75 H;  4J10 A;  3SYP A;  5CB4 A;  4YJ2 B;  3SYC A;  1LR1 A;  1PKX A;  1JFF A;  4I4T A;  1XL4 A;  2CTW A;  3ZBH A;  1K5S A;  4QPK A;  2EUL A;  1P7G A;  2XAF A;  1FXH A;  1E1Q G;  5L3D A;  1QLE B;  1RPR A;  2OIE A;  1YZB A;  4LC1 A;  4FZ1 A;  2DWE C;  3PJS K;  1P4R A;  4Z1V A;  1H2G A;  1GM8 A;  3SDL A;  3FYI B;  1YTF D;  2BTQ B;  2P4K A;  4X8A A;  3HPL C;  1QCE A;  4P2Z A;  3TJT A;  3OM3 B;  1ZWI C;  4UVA A;  3ABM C;  4WFB V;  3CMA V;  2A9H A;  2M6Y A;  5JH7 B;  3UQ8 A;  1XMQ B;  2Q6A A;  4YJ2 A;  5GON B;  2UUA B;  3W7T A;  3CD6 V;  4GYC B;  3SPG A;  1FJG B;  4FMT A;  4DV3 O;  2VRZ A;  2EIK C;  3J80 N;  4DR5 B;  2A7W A;  1BT8 A;  1ENV A;  3F5W C;  1M93 A;  3T1Y B;  4W4K A;  4DK0 A;  4X1I B;  3K79 A;  2JJ2 G;  3JAL A;  1BQZ A;  5KMG A;  1VQ7 V;  4ZIB A;  5LA6 B;  4AI8 A;  4X1K B;  4IYI A;  4HAM A;  4OX9 O;  2BTQ A;  2PGG A;  2P67 A;  3T4D A;  2WA4 A;  4LF8 B;  3J7A U;  4IHJ B;  1YJ9 V;  1N33 B;  1YCI A;  3ZHQ A;  1OCC B;  3WFV A;  1YVW A;  4LBE C;  4C7U A;  5CA0 B;  1CPY A;  4RO2 A;  3CB2 A;  4JAV A;  4RAI A;  2Z3Y A;  1OZ0 A;  4X1Y A;  4O2B A;  3T1H O;  4JYC A;  3VBB A;  4JI3 B;  4J42 A;  3LDE A;  5B1A B;  3ETG A;  1US6 A;  5LA6 A;  4X1K A;  2W6J G; 
#chains in the Genus database with same CATH homology
 1NTK H;  1SQQ H;  4U3F H;  3H1I H;  1SQB H;  3H1H H;  1SQX H;  3L73 H;  1KYO F;  3TGU H;  1NTM H;  1PP9 H;  2FYU H;  3L75 H;  1SQV H;  1EZV H;  3H1L H;  3L72 H;  2A06 H;  1BE3 H;  1PPJ H;  3H1J H;  5KLV H;  1KB9 F;  3CXH F;  1SQP H;  3CWB H;  1BCC H;  3BCC H;  1L0N H;  1BGY H;  3L70 H;  1L0L H;  4PD4 F;  3L71 H;  3H1K H;  1NTZ H;  1P84 F;  1NU1 H;  4D6T H;  2BCC H;  3CX5 F;  2IBZ H;  3L74 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...