2A06H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2a06H00
3TGUH 3L75H 1PP9H 1NTMH 1NTZH 3L73H 1SQXH 2FYUH 1BGYH 3H1KH 1L0LH 1EZVH 1SQPH 2A06H 3CX5F 3L70H 4D6TH 2BCCH 1KYOF 1BCCH 1BE3H 4U3FH 1NU1H 3H1LH 3H1HH 3H1JH 3BCCH 3CXHF 4PD4F 3H1IH 1KB9F 5KLVH 2IBZH 1NTKH 1L0NH 1SQQH 3L71H 3L74H 1SQVH 3CWBH 1P84F 1PPJH 3L72H 1SQBH
chains in the Genus database with same CATH superfamily
3ABLC 3E22B 2ZDIA 2FTKA 1EM1A 1OCRB 1HNZB 2B1GA 3OMIB 4D6TH 2Q68A 1NU1H 5KX5A 1Q43A 3AK2A 4DUZO 3APOA 2PUSA 2Z5UA 1V55B 3JALA 4FK5C 2HFEC 1M5IA 4EEQA 2QA4V 3IJ4A 1SA0A 1WA8B 5CA0B 2DMXA 1NJIW 3K06A 1R3LC 1SS3A 3K58A 2UXBB 2IH3C 1FJGO 1COWG 5E1AC 3CEIA 2OIGA 1EFRG 3LSUA 5IY5C 2R9AA 4EB6A 1VQ7V 4MW8A 4TUYB 4DV2O 3HR0A 5HFLA 2ZDIC 2F4VO 2VQFO 3ZRXA 3K0DA 5JCOA 2ZM6B 1CEZA 3UQ8A 1W0KG 2UXDO 1MSWD 2QWRB 4HBNA 5E79Z 5CN0A 4EFBA 2PY5A 5LA6B 1WPBA 2QWPB 4JI3B 3S3XA 2OIEA 2YI9A 1TVKB 3SPCA 1Q5OA 1WAZA 3L75H 3A0RA 4G28B 5L3BA 1LR1A 4DUYO 3K79A 2LP7A 3PJSK 4NKGB 3AK3A 1YJ9V 3H1JH 1EZJA 4B3MO 3OGIB 3DXRB 1K7DA 3E8BA 2IJJA 3H01A 1S5JA 4G2KA 4X1YA 4MTXA 3JD3A 2EINC 3WFVA 2QWOB 4AHCA 4I50A 2X7RB 5JCOC 1DGSA 2OTLV 2PI4A 2AGAA 3A8TA 4RUFA 2HVJC 5J9PC 2AW9A 4YJ3A 5B1AC 4I7ZB 5KA6A 3N2GB 1KU9A 2BSKB 2ITDC 5KHHA 5IWAO 1YVWA 3K03A 5IYCO 3P32A 3OR7C 1VQ8V 2D2CB 1TUBA 3OUFA 3BPZA 1J5EB 4PDMA 4TV9B 5LOVB 4O2BB 3ZN0A 1JR9A 3ASOC 4FM0A 2YI8A 2UUCO 2CH7A 3I55V 3ZN1A 4PD4F 1AR4A 2XASA 2JGDA 3D8CA 3R65A 4FPPA 3T2MA 4IT5A 2YS8A 4LWSA 1DF4A 3RYFA 3T1HB 4JI5O 4P9PA 4X8AA 4GKJO 1KP3A 2Q4PA 4DR3B 1SQPH 2ZD9A 2EZOA 1K8AW 1UFIA 2ZIMA 4OPAA 4PDLA 3FB6C 2CUGA 3CJHB 2YXLA 5GONB 5AG2A 4X66O 4JTDB 3VQYA 1KD1W 2B9ZA 3QO7A 1NTZH 5F2VO 4JI7O 1U97A 4BW5A 1K4DC 4YIPA 3JD0A 2OCCB 1TGOA 3ICXA 4NXMB 5EIBC 1FXKA 5B5EZ 4JI2O 1YHQV 5JJNB 3BEHA 3BRCA 4O4LA 1N8RW 4MVQA 2XAQA 3RBZA 1QVGU 2BOBC 2R72A 3ZIAG 1YJNV 3U0ZA 3BVOA 4X9QA 4LF8B 2QM7A 3ZX6A 1RFYA 4MVMA 4RQFA 1BE3H 1OJHA 2WLNA 3H1HH 1H8HG 2JEXA 4CH5A 2UUAO 3ZMTA 4GKKB 1YDXA 5IYDO 1HNXB 5LL6Y 4EFEA 4PI0A 4WFEA 1V54C 2Q73A 3JARA 1RPOA 4UVBA 4PA3A 1JCHA 2PI5A 1YCIA 1NQTA 4DO2A 2QGNA 4TQFA 1FXKC 4Z2WA 1XUQA 1Y6XA 1VQ9V 2EBOA 3PN1A 3ABLB 3E8GA 3K59A 4DR5B 3K57A 3CB2A 1FXHA 3CCLV 1VQNV 1QBZA 5HFMA 1WNSA 1FS0G 2GSMB 5JH7B 2JIZG 1KC8W 3W7XA 1XNQO 1HNWO 4LH7A 1K92A 3ABMC 1CP9A 5JJJB 1E1QG 1H2NA 1NKDA 3GVMA 2YICA 2F43G 2Q67A 2VRZA 4WCEV 1KQSU 1Q8IA 3N27A 3R66A 5CA0A 5IYBO 2P22C 2IU0A 2VWKA 5H9CA 2QDOA 4BWAA 1IX9A 2WPDG 1VQ5V 4RWUA 3OT7A 4LFCB 4JI6B 1MNGA 1MG1A 1OV9A 1D5NA 4TUYA 4LF7O 4I55B 1QLEB 5KUMA 3WG7C 2N05A 1AJPA 3STLC 1Y76B 3CXHF 1ZSPA 1OCRC 4N21A 2ZR3A 1ZL8B 3JATB 4FLUA 1GO3F 2ZR2A 2GHYA 5A9GA 1AJQA 4CC5A 4QIWF 5LA6A 1HW7A 5LXTB 3H1KH 1V55C 4PA9A 3GWOA 1YI2V 2CTRA 2M7WA 3CD6V 4PDRA 1TVKA 4HNAB 4DR7O 4TV8A 1Z5WA 2KKWA 3F5WC 3AK1A 2HHHB 3BY6A 3MHSC 4X65B 3DXRA 3HKDB 1K97A 2XUMA 4QPKA 3AG3B 4KUMA 2EINB 1N0JA 1GAXA 1P7BA 5ITZB 2IBZH 2ZCEA 2NN4A 1WLEA 4J11A 5LMNB 3N2GA 4OX9B 2BSKA 2IW5A 4XDLA 4GLXA 3CHXA 1B04A 4MVSA 3JD2A 3OD4A 5K1PA 3EHBB 1H8EG 1IDSA 5BMVA 3D36A 5J2UB 2UXCO 2HR3A 2P4VA 2Q7GA 1GN2A 3DSQA 3JASB 4TV9A 5LOVA 2A7WA 1S76D 3IAYA 4LF4O 2LFRA 1MA1A 1XI1A 4I0XA 5B1BB 4AI8A 4ZIBA 1OCZB 4H13B 2GTAA 4FLXA 3L73H 4WBNB 4DW1A 1OHHG 2WLMA 3HKBB 2ETNA 1N33O 4FJCC 2E5LO 4DV3B 1GN4A 4WFBV 2A3QA 3BA9A 2RMKB 1LUWA 3RVYA 3OTOB 3L74H 1GM8A 3M99B 1HNZO 1GN3A 4P9OA 3QTCA 3CRMA 2QE7G 3CRRA 3CJHA 3DC5A 2KG7B 5GONA 3K04A 1SERA 2DYRB 1ZAUA 5EIBD 5JQGB 3OMNB 4DR6O 1N36B 2PTMA 1MABG 5H6QA 3AG7A 1BT8A 2ZE8A 3D36C 4QJFB 4U3JB 3JAMN 4UCUA 1NTKH 1SF9A 4UUJC 2QR4A 3WB0A 1M4UA 1LNQA 4YHHO 3W7WA 3OW2U 2UXBO 3CC2V 2VQEO 4ICGA 1SZXA 2DWEC 5CBFA 3SPGA 4R7CA 2P4KA 1SQFA 4DR2B 4CH3A 3CCRV 1VQPV 2JK5C 4LF5B 2ZM6O 3F7YC 5FPRA 3B40A 4JI4O 1WP8A 2UUBO 3B4SA 3P3NA 4B3RB 1NVPD 2ADQB 2G38A 4NTYA 4AILC 1XDCA 3VQXA 2ZINA 1I5YA 1SQQH 1QU7A 2OCCC 2QKCA 4LF9B 1M1KW 2DQ3A 3A2FA 4ZHQB 3TXSA 4XBFA 1S0VA 1NVPB 4FLVA 1VQOV 3RYCB 5BR8B 1S3JA 3CPWU 3JAWB 2EX3A 4GCZA 2OYQA 3ABTA 3RVZA 5JH7A 3SGIA 1OZ0A 1Q3EA 1JX9A 2ODMA 1BQZA 5KAIZ 1BZKA 4L87A 2OT5A 3E89A 2EULA 4JI8O 4AQYB 4CS4A 4KP4A 2L35A 2X6AA 1DTOA 3RWRD 2GV9A 4LNUB 4YY3O 1BHAA 4I55A 1EN4A 3W7TA 1W0JG 1R6KA 1R6TA 1Y76A 4A5UB 4PA4A 3EXAA 1ZL8A 2BE3A 1AI5A 3JATA 1CPYA 3I56V 3T1HO 3OE7G 2HJDA 3K9SA 4FLTA 3P3PA 1JFFA 5LXTA 2VS0A 3T1YO 4DR3O 4JI1B 2ZNIA 1I94O 4L8JA 1M90W 3ZRWB 4HNAA 5DN6G 1R1BA 2OWOA 2BTQB 1H2MA 2XT9A 1URFA 4DRXB 1T5EA 3ETEA 5LHHA 2ARHA 2P7TC 3ZRSA 1XBLA 3ZHRA 2H94A 1N0NA 2LQTA 3WU2Z 3KZIZ 1XMOB 1QLEC 2WSSG 3SYCA 2N04A 3HKDA 3JYCA 1VF5B 3VQWA 4FZ1A 2Q7EA 4RQEA 2WLLB 4NXMO 5ITZA 3CCSV 1KBHA 3SJQC 1HR0B 4NTWA 1W59A 3T1CA 2F1MA 5CB4B 1IXMA 1VF7A 2RDCA 4LF8O 2CTWA 3TETA 4DV6B 2HLDG 1GM9A 5J2UA 3TK1A 2E74B 4I9WA 4KHPB 3JASA 2IJHA 4HZ3A 3UKMA 4GKKO 1BQ0A 1I5XA 1I08A 2V7QG 1PL4A 3B8NA 2XTAA 4WBNA 3BA8A 1SC5B 3HKBA 3K5MA 3AG3C 5IDJA 1BL8A 2Z0AA 1IBKB 4X1IB 5KMGB 3MDSA 4X1KA 4KXRA 3SDLA 3FB8C 1DLBA 1PV0A 1N34B 2QKSA 4DR5O 1S77D 1K5SA 1Y4MA 2LGQA 1K5QA 1XMQB 1W2BU 2W6JG 2A79B 1H2KA 2KG7A 5H5NA 1Z5VA 5JQGA 1ENVA 4MSWC 5CBHA 5A2QN 3RFRA 4RUEA 4TOIA 4MVRA 3TGUH 4U3JA 3THOA 1WB7A 4HYOA 5IYZB 4LFAB 3GWKC 3IFXA 2DN9A 5B1BC 5KHJA 3ETDA 1OCZC 3FKSG 5GTIZ 1PD3A 1AP5A 2P06A 1Q82W 1KUQA 3NR7A 4ZOLB 2ZE6A 1VP7A 1JVMA 4JZ2A 3E8HA 1O9HA 5H6RA 2ZIOA 3C90A 1CXZB 5C93A 4WFAV 2WLJA 3UM7A 2K9PA 1YF2A 3ASNB 1KYOF 3FX7A 4FM1A 2K1EA 3RYHB 1BHBA 2CTQA 2DYRC 4JI0B 2WLIB 5BXZA 1K4CC 1VQMV 1QLNA 4W4KA 3Q4HB 5IE9A 1M56B 1SQXH 5EK0A 4PA6A 3FFQA 1VQLV 4X64B 4NTXA 1J95A 2ZXWC 5DM6V 4ZHQA 2HHHO 5C8YB 1BS3A 4NVPA 2LGWA 3RYCA 2Y0PA 1XHXA 3JAWA 3K5OA 1FAFA 2QM8A 1QNMA 3JCZA 1MZEA 2Y69B 2CTPA 2YIBD 4GX1A 1MSDA 2H3OA 2VQFB 2WWWA 1ROPA 3O9OA 3CP1A 5EC1C 3FB7C 4OX9O 4JV5B 4BR6A 2UXDB 1A32A 4B3TO 4ZI7B 3W7UA 1YXBA 1K34A 1P7GA 5L3EA 4GUNA 3UO3A 4DR1B 3OM3B 2RCVA 4LNUA 4DYLA 2YEVB 4JYYA 4P30A 1HWYA 2P6JA 3SPHA 1QQCA 3E22A 1ZX3A 3KKYA 4LC1A 4EKWA 1QCEA 5KHGA 3BAAA 4UCSA 1G1XB 4NR1A 4B3MB 4DV3O 4R50A 5IJ0B 4GT1A 1K9MW 4MVZA 3M8AA 1BGYH 2EJRA 2KSDA 1HDJA 3ZRWA 5IJ9B 1IBMB 4MTFA 2BTQA 1XOUA 1XILA 3L71H 1WA8A 2E3CA 5L3FA 1N36O 2WAMA 4GX0A 4DRXA 5BY1A 1H2LA 1JJ2U 1NTMH 1IXBA 5B3SB 2EIJB 4UB8Z 2FMLA 4K8XA 1WB8A 1BSMA 5DECA 1UJWB 2WLLA 2P67A 4N23A 4O2AB 2UUCB 1N4CA 3KCXA 4UVAA 4I9QA 4DV5B 2MW2B 3HKCB 2ADPA 1RP3B 1YSCA 4K35A 5CB4A 3QF7A 2HJFC 4DR2O 3J7AU 2DQ0A 2FYUH 2IH1C 1RSOB 3CSXA 4LF5O 4JI5B 4DV4O 4X20B 4TQDA 4IGGA 2VWJA 4IIJB 3E8FA 4UB6Z 1L0NH 3DTUB 2GBOA 4B3RO 2F23A 4TWKA 4E4EA 1RM1B 3RYIB 4X66B 2ZT9B 3HPLC 1DK1A 3ZMVA 4QE9A 3JALB 5JVDB 2BCCH 4LF9O 2Q5ZA 4W4LA 4X1IA 2ZE5A 5FNVB 5KMGA 3OTFA 5CMUA 5BR8O 2X6BA 1AI4A 4X89A 4DK0A 3F5TA 2XNDG 4JF3A 3DC6A 1VQ4V 1ORQC 4PI2A 3NXSA 5IYZA 2FL4A 4JAUA 2Q8VA 4O2BA 3X2QB 4PDVA 3B8MA 2LFSA 5LYJB 4AQYO 1P4RA 3QG5A 2CK3G 1KECA 5LMUO 4ZOLA 3HKEB 2R9IA 4BIOA 2ATKC 1F7YA 1EN6A 2JJ1G 3SR2C 3GB7C 1O9GA 4JYAO 1XREA 2EZPA 2XHBA 4BIZA 4B3SO 2CGNA 3SPIA 4FIPC 3TJTA 1Q90D 1QHTA 2X6CA 3UCSC 3QNEA 2Z3YA 4Z1MG 2LW7A 3RYHA 3K08A 1S5LZ 3E83A 4X88A 2WLIA 4R8CA 1FPOA 1EBOA 4QE7A 3CX5F 2AHYA 1R3IC 4JI1O 4ZKIA 4LFBB 3DGEA 3Q4HA 2Q7HA 2C2AA 1HNWB 3ZCCA 1AP6A 2CDYA 4D7TA 2FB5A 3F7VC 1HP8A 4JASA 3U10A 2X0LA 4P2ZA 5B1OA 2PZSA 1SQBH 1GM7A 1SQGA 2RN9A 3J81N 5EBLC 4CZZA 2ZXWB 4Z1VA 5C8YA 2HG5C 1PNKA 1JOYA 1XMOO 3ZMSA 3N2KB 1AVMA 2RNBA 4LBEC 4DR4B 2A0LA 1QR9A 1UPGA 4FFBB 5LGTA 3ASNC 2GDSA 1KMIZ 1Y74B 3CYOA 4CS2A 5D5PA 2BOCC 3L70H 3RYFB 4ZI7A 2LJ2A 4FM2A 4JI3O 1D2DA 1M56C 4GZRB 4CS3A 4DV6O 1YTFD 1K33A 4MVUA 4H37A 5FLXN 3ZS8C 4PJ0Z 4CBCA 3JCUZ 4DXWA 4YJ2B 4KHPO 4UCRA 4H0LB 1TUEB 2YEVA 2A9HA 2YIBA 1Q6HA 3OMAB 4WFHA 3LDEA 1BMFG 1KKCA 4JYBA 3G6EV 1WJZA 3FYEB 4WFFA 1R73A 2JGUA 2NR5A 3ABKB 3CE2A 3RW0A 4LF6B 2GTSA 3QO5A 1YTFB 4JTCB 5IJ0A 3G80A 2Y69C 1MMMA 2OCHA 1IZ3A 3ZHSA 2PYJA 2QWQB 3IC9A 1GMGA 1XMQO 5IJ9A 5GW7A 1F4MA 3LNNA 3AG2B 4MVOA 4O4LB 4UCOA 1H2GA 3H1LH 1R3JC 1U96A 2B1IA 3JD1A 3P30A 1I0HA 3E86A 2EILB 2JDIG 1J5EO 4LFAO 1QVFU 1G8MA 4DK1A 1WN7A 2QTSA 2YXHA 4DV0B 2ILMA 3QO8A 4MT8A 2DJVA 4DV7B 3LSQA 2XAFA 3OR6C 1Q86W 1F23A 4O2AA 4LF4B 4BAYA 1H2SB 5FPOA 2LO1A 4B7KA 4K0KB 1NI8A 2QEXV 2EIKB 3HKCA 4BIUA 3AG4B 1YJWV 2DWDC 1MZFA 2EJ7A 1VIBA 1RSOA 5L3GA 1N33B 1FYJA 3M7MX 3WB2A 3CCJV 2V1DA 3A0BZ 4X20A 4UV8A 3MHHC 4IIJA 4KL1A 2AZ0A 1X4TA 4JI0O 3AG1B 5KUKA 3SJBC 3L9DA 4JAAA 5KHKA 2Q69A 4Q6GA 3G71V 1WPXA 1XL4A 5JWPA 3RYIA 1GKFA 4DV1B 5B3SC 3O65A 2GUZB 2EIJC 4DR6B 3FD9A 1IURA 1MOFA 2ITCC 2YSUB 3D3IA 5JVDA 5KHIA 5JJEB 4X64O 2PGGA 2QTOA 3CC7V 5FNVA 1H38A 1S5HC 4YHHB 3U11A 3VQVA 1DF5A 1M57C 3RGBA 1VF6A 4NXNB 4O4JB 2VQEB 2JVDA 5LGNA 4X62B 4J9YB 4LCUC 4OXSA 3OEHG 3ZRVA 4PHZA 5J2TB 4WF9V 4JTAB 1VARA 3APQA 2W0FC 1ZTEA 2KB1A 3T4DA 2KQXA 4TT3G 3RN4A 4JV5O 1RM1C 3G67A 1EZVH 5KA5A 3B09A 4MS2A 5LYJA 4C7UA 1HNXO 4JI4B 2UU9B 2JS3A 2UUBB 5LP6B 3K5NA 4ABMA 1F4NA 4IHJB 4DR1O 1K73W 1G4YB 5L3DA 1M9NA 4O4IB 3HKEA 2XAHA 2ZKOA 3JSLA 4TV8B 4I5SA 4CH6A 1KP2A 4J41A 1VF6C 1L0LH 2WLKA 2IJKA 4U7NA 1XNRB 2IM9A 1Q81W 1IVSA 2Q6AA 4UVCA 3CS5A 1R6NA 2R70A 4JPRA 2JJ2G 3ZBHA 5CA1B 2E75B 4WFGA 1P84F 1NH2D 5EYPB 2NNUA 3SPJA 5H2FZ 1VQ6V 1IBLB 1QR8A 3ABUA 1XEQA 1PP9H 2FKXA 2JEUA 1IBMO 1NZ6A 2XAGA 4UCVA 3X2QC 2ZNJA 3CCUV 1I7FA 4XDKA 5EZYB 1E1RG 5IT9N 4OPHA 5B66Z 3J80N 3LUTB 4RAIA 1TAEA 4XDJA 5EBMC 3SYQA 4E2LA 1N32B 5CBGA 1KKDA 4JI8B 4LFCO 4JI6O 1M93A 1PM9A 3N2KA 4J9ZB 1NH2B 3TCUA 1ZWIC 4Q20A 5BMVB 5LBQA 3CCMV 3ZHVA 1LUVA 4YY3B 2EIMB 1D5AA 4YIOA 4FFBA 1XHZA 2M6YA 3HB3B 1NS1A 3VBBA 4DV5O 1AB3A 4I0XB 1Y74A 1YZBA 4KFMA 4D7SA 1OCCB 2N74A 2Q9LA 2UXXA 2PF4E 2DYSB 3SJAC 4GX2A 4DUZB 3VOUA 2JS5A 1GH6A 3T1YB 3OFNG 5KAFZ 3EFFK 4YJ2A 1I94B 5D5QA 3G6BA 1ZUQA 2QM4A 1KB9F 5B1NA 2LW1A 2R9RB 4X65O 4MTGA 3CWBH 1FJGB 4ASUG 2F93B 2P5OA 1YIJV 2B5UA 4K8ZA 3CMEV 4DV2B 4F6RB 3W7SA 2Q0OC 2XAJA 2ZE7A 1AI6A 3E2EA 2CGOA 4GYCB 2F4VB 5LMNO 1SESA 1VEWA 4MTOA 3L72H 3IGAC 3UO2A 5BZBA 1OCOB 1FD9A 1AILA 2DOSA 4H33A 1GN6A 1AR5A 1AJNA 1NR7A 1FXVA 3SYPA 1XL6A 4YXWG 1PNLA 2CE4A 3SJCC 1PNMA 4DUYB 3ML0A 4FVMA 4LP8A 3ABKC 3CCQV 5CA3A 4BW9A 3BFRA 1THZA 4ZBMA 3JAKB 3JSNA 3OTOO 4MW3A 5DEDA 4HAMA 1PL0A 4IL6Z 3AG2C 5FL7G 2Y0IA 2AXTZ 1SZTA 2H8PC 4QNHB 4LFBO 2P90A 2EILC 2GUZA 5IWAB 1FFXB 4I4TB 4JAVA 2OTJV 2RJZA 3MD0A 1VMGA 2AZ2A 1ZLZA 3D3QA 2EIKC 3AG4C 1JPXA 4PA7A 3ZMUA 4U7OA 1EN5A 4O4JA 1M57B 1AI7A 2YDEA 5LGUA 3UT5B 4O4HB 4DR4O 2Q0AA 1JA8A 1SRYA 3LNMB 1E79G 4B08A 2HEPA 3FAVB 3CCEV 2XOKG 5IY5B 1XQ8A 5J2TA 3BABA 1Y66A 4J42A 4FLWA 1RPRA 2HKOA 4GKJB 2F95B 2W6IG 2YIDA 3AG1C 1JQ0A 4OGQB 3ZMZA 2NLJC 3CXCU 1V9PA 2QJ1A 5KX5B 1S72V 4J80A 5LP6A 2HP8A 1JFFB 1TA8A 4IHJA 5L3CA 3OGCC 3OAAG 4O4IA 1Q6IA 4RO2A 4U3FH 4JZGA 4TSFG 1P49A 4JI7B 3ZJZA 1SA0B 1Q6UA 3ZHTA 1Z2GA 4NYKA 4CC6A 3BHPA 4JYCA 3G4SV 4JI2B 4LF6O 2QKAA 4EB6B 5CA1A 5EYPA 4F4LA 3STZC 3SYOA 4F6EA 4H44B 4G27B 2Y48A 2YUAA 1PKXA 3ZHUA 5EZYA 5LP6C 2DW4A 2UUAB 3QVNA 4QGPA 3JD4A 4NB5A 5B1AB 3FYIB 1GRJA 2UXNA 3RT3C 4B3TB 1B6QA 2BTOA 3C3TA 1BCCH 2L6LA 1NBMG 3SYAA 4QPJA 4DV0O 3FB5C 4DV7O 5EC2C 3TXQA 1AR1B 4LR3A 1G6UA 3ASOB 4K0KO 4UXNA 2Y4TA 3ZEDA 1Q7YW 4DW0A 1B3QA 2O57A 4CH4A 1F51A 4FMTA 2JRIA 1X59A 4X1YB 2D3OW 3ETGA 3B2EE 4X1KB 3CCVV 1VQKV 1XNQB 3CRQA 4I50B 5KLVH 4FZ0A 2W0XA 3K3WA 1FFTB 4UV9A 5GTHZ 3OEEG 3KG2A 4YJ3B 4DV1O 5LHIA 3LSSA 3B77A 1YEWA 3ZHQA 3CRCA 2YXYA 1TUBB 4J10A 2YC0A 1SKVA 2EIMC 1WP7A 2HVKC 4UFZA 1L8DA 2IU3A 4LF7B 4F6RA 2CH7B 1HR0O 4NXNO 2YIAA 4R6ZA 1OCCC 3S3WA 3IC7A 3AEIA 4X62O 3K0GA 2JGDB 3LDDA 1FKAO 2CAZC 1GK9A 2DYSC 1R3KC 2A06H 4LWSB 3OUSA 5LHGA 1YITV 4FFKA 1K3EA 4DV4B 2WLHA 4J7ZA 1PPJH 2PYLA 2MK3A 1NT2B 1US6A 2F66C 4LH6A 3K5LA 2UU9O 2AHZA 4DR7B 4FLYA 4J7JA 2V4DA 1JMKC 5TISZ 2QWNB 3MAQA 3BCCH 4JGSA 3T4ZA 1IBKO 1JJOA 2DE0X 1SQVH 1V54B 3I5DA 3JAKA 4PV1B 2Y4UA 3A0HZ 2WA3A 3E35A 1N34O 2E76B 3KCYA 4J7KA 1Y67A 5EBWC 1FXKB 1XNRO 1NR1A 2IJIA 3WB1A 3LDCA 4B7EA 3H9VA 1OCOC 2QSAA 4UCTA 5K1XA 4IYIA 1IBLO 3H1IH 1FFXA 3CRAA 4GX5A 4I4TA 3ABMB 4IYHA 3CMAV 2RQ6A 2WA4A 2UXCB 4FLZA 3CC4V 4PELA 1GTOA 1N32O 3C3SA 5LMUB 1AROP 2ZQMA 3UT5A 4O4HA 3ETQA 3JARB 3FAVA 3K9AA 4K3AA 2E5LB 1SETA 3EVKA 4JYAB 4B3SB 1L1FA 1B06A 3WG7B
chains in the Genus database with same CATH topology
3TGUH 3L75H 1PP9H 1NTMH 1NTZH 3L73H 1SQXH 2FYUH 1BGYH 3H1KH 1L0LH 1EZVH 1SQPH 2A06H 3CX5F 3L70H 4D6TH 2BCCH 1KYOF 1BCCH 1BE3H 4U3FH 1NU1H 3H1LH 3H1HH 3H1JH 3BCCH 3CXHF 4PD4F 3H1IH 1KB9F 5KLVH 2IBZH 1NTKH 1L0NH 1SQQH 3L71H 3L74H 1SQVH 3CWBH 1P84F 1PPJH 3L72H 1SQBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU H;  3L75 H;  1PP9 H;  1NTM H;  1NTZ H;  3L73 H;  1SQX H;  2FYU H;  1BGY H;  3H1K H;  1L0L H;  1EZV H;  1SQP H;  2A06 H;  3CX5 F;  3L70 H;  4D6T H;  2BCC H;  1KYO F;  1BCC H;  1BE3 H;  4U3F H;  1NU1 H;  3H1L H;  3H1H H;  3H1J H;  3BCC H;  3CXH F;  4PD4 F;  3H1I H;  1KB9 F;  5KLV H;  2IBZ H;  1NTK H;  1L0N H;  1SQQ H;  3L71 H;  3L74 H;  1SQV H;  3CWB H;  1P84 F;  1PPJ H;  3L72 H;  1SQB H; 
#chains in the Genus database with same CATH topology
 3ABL C;  3E22 B;  2ZDI A;  2FTK A;  1EM1 A;  1OCR B;  1HNZ B;  2B1G A;  3OMI B;  4D6T H;  2Q68 A;  1NU1 H;  5KX5 A;  1Q43 A;  3AK2 A;  4DUZ O;  3APO A;  2PUS A;  2Z5U A;  1V55 B;  3JAL A;  4FK5 C;  2HFE C;  1M5I A;  4EEQ A;  2QA4 V;  3IJ4 A;  1SA0 A;  1WA8 B;  5CA0 B;  2DMX A;  1NJI W;  3K06 A;  1R3L C;  1SS3 A;  3K58 A;  2UXB B;  2IH3 C;  1FJG O;  1COW G;  5E1A C;  3CEI A;  2OIG A;  1EFR G;  3LSU A;  5IY5 C;  2R9A A;  4EB6 A;  1VQ7 V;  4MW8 A;  4TUY B;  4DV2 O;  3HR0 A;  5HFL A;  2ZDI C;  2F4V O;  2VQF O;  3ZRX A;  3K0D A;  5JCO A;  2ZM6 B;  1CEZ A;  3UQ8 A;  1W0K G;  2UXD O;  1MSW D;  2QWR B;  4HBN A;  5E79 Z;  5CN0 A;  4EFB A;  2PY5 A;  5LA6 B;  1WPB A;  2QWP B;  4JI3 B;  3S3X A;  2OIE A;  2YI9 A;  1TVK B;  3SPC A;  1Q5O A;  1WAZ A;  3L75 H;  3A0R A;  4G28 B;  5L3B A;  1LR1 A;  4DUY O;  3K79 A;  2LP7 A;  3PJS K;  4NKG B;  3AK3 A;  1YJ9 V;  3H1J H;  1EZJ A;  4B3M O;  3OGI B;  3DXR B;  1K7D A;  3E8B A;  2IJJ A;  3H01 A;  1S5J A;  4G2K A;  4X1Y A;  4MTX A;  3JD3 A;  2EIN C;  3WFV A;  2QWO B;  4AHC A;  4I50 A;  2X7R B;  5JCO C;  1DGS A;  2OTL V;  2PI4 A;  2AGA A;  3A8T A;  4RUF A;  2HVJ C;  5J9P C;  2AW9 A;  4YJ3 A;  5B1A C;  4I7Z B;  5KA6 A;  3N2G B;  1KU9 A;  2BSK B;  2ITD C;  5KHH A;  5IWA O;  1YVW A;  3K03 A;  5IYC O;  3P32 A;  3OR7 C;  1VQ8 V;  2D2C B;  1TUB A;  3OUF A;  3BPZ A;  1J5E B;  4PDM A;  4TV9 B;  5LOV B;  4O2B B;  3ZN0 A;  1JR9 A;  3ASO C;  4FM0 A;  2YI8 A;  2UUC O;  2CH7 A;  3I55 V;  3ZN1 A;  4PD4 F;  1AR4 A;  2XAS A;  2JGD A;  3D8C A;  3R65 A;  4FPP A;  3T2M A;  4IT5 A;  2YS8 A;  4LWS A;  1DF4 A;  3RYF A;  3T1H B;  4JI5 O;  4P9P A;  4X8A A;  4GKJ O;  1KP3 A;  2Q4P A;  4DR3 B;  1SQP H;  2ZD9 A;  2EZO A;  1K8A W;  1UFI A;  2ZIM A;  4OPA A;  4PDL A;  3FB6 C;  2CUG A;  3CJH B;  2YXL A;  5GON B;  5AG2 A;  4X66 O;  4JTD B;  3VQY A;  1KD1 W;  2B9Z A;  3QO7 A;  1NTZ H;  5F2V O;  4JI7 O;  1U97 A;  4BW5 A;  1K4D C;  4YIP A;  3JD0 A;  2OCC B;  1TGO A;  3ICX A;  4NXM B;  5EIB C;  1FXK A;  5B5E Z;  4JI2 O;  1YHQ V;  5JJN B;  3BEH A;  3BRC A;  4O4L A;  1N8R W;  4MVQ A;  2XAQ A;  3RBZ A;  1QVG U;  2BOB C;  2R72 A;  3ZIA G;  1YJN V;  3U0Z A;  3BVO A;  4X9Q A;  4LF8 B;  2QM7 A;  3ZX6 A;  1RFY A;  4MVM A;  4RQF A;  1BE3 H;  1OJH A;  2WLN A;  3H1H H;  1H8H G;  2JEX A;  4CH5 A;  2UUA O;  3ZMT A;  4GKK B;  1YDX A;  5IYD O;  1HNX B;  5LL6 Y;  4EFE A;  4PI0 A;  4WFE A;  1V54 C;  2Q73 A;  3JAR A;  1RPO A;  4UVB A;  4PA3 A;  1JCH A;  2PI5 A;  1YCI A;  1NQT A;  4DO2 A;  2QGN A;  4TQF A;  1FXK C;  4Z2W A;  1XUQ A;  1Y6X A;  1VQ9 V;  2EBO A;  3PN1 A;  3ABL B;  3E8G A;  3K59 A;  4DR5 B;  3K57 A;  3CB2 A;  1FXH A;  3CCL V;  1VQN V;  1QBZ A;  5HFM A;  1WNS A;  1FS0 G;  2GSM B;  5JH7 B;  2JIZ G;  1KC8 W;  3W7X A;  1XNQ O;  1HNW O;  4LH7 A;  1K92 A;  3ABM C;  1CP9 A;  5JJJ B;  1E1Q G;  1H2N A;  1NKD A;  3GVM A;  2YIC A;  2F43 G;  2Q67 A;  2VRZ A;  4WCE V;  1KQS U;  1Q8I A;  3N27 A;  3R66 A;  5CA0 A;  5IYB O;  2P22 C;  2IU0 A;  2VWK A;  5H9C A;  2QDO A;  4BWA A;  1IX9 A;  2WPD G;  1VQ5 V;  4RWU A;  3OT7 A;  4LFC B;  4JI6 B;  1MNG A;  1MG1 A;  1OV9 A;  1D5N A;  4TUY A;  4LF7 O;  4I55 B;  1QLE B;  5KUM A;  3WG7 C;  2N05 A;  1AJP A;  3STL C;  1Y76 B;  3CXH F;  1ZSP A;  1OCR C;  4N21 A;  2ZR3 A;  1ZL8 B;  3JAT B;  4FLU A;  1GO3 F;  2ZR2 A;  2GHY A;  5A9G A;  1AJQ A;  4CC5 A;  4QIW F;  5LA6 A;  1HW7 A;  5LXT B;  3H1K H;  1V55 C;  4PA9 A;  3GWO A;  1YI2 V;  2CTR A;  2M7W A;  3CD6 V;  4PDR A;  1TVK A;  4HNA B;  4DR7 O;  4TV8 A;  1Z5W A;  2KKW A;  3F5W C;  3AK1 A;  2HHH B;  3BY6 A;  3MHS C;  4X65 B;  3DXR A;  3HKD B;  1K97 A;  2XUM A;  4QPK A;  3AG3 B;  4KUM A;  2EIN B;  1N0J A;  1GAX A;  1P7B A;  5ITZ B;  2IBZ H;  2ZCE A;  2NN4 A;  1WLE A;  4J11 A;  5LMN B;  3N2G A;  4OX9 B;  2BSK A;  2IW5 A;  4XDL A;  4GLX A;  3CHX A;  1B04 A;  4MVS A;  3JD2 A;  3OD4 A;  5K1P A;  3EHB B;  1H8E G;  1IDS A;  5BMV A;  3D36 A;  5J2U B;  2UXC O;  2HR3 A;  2P4V A;  2Q7G A;  1GN2 A;  3DSQ A;  3JAS B;  4TV9 A;  5LOV A;  2A7W A;  1S76 D;  3IAY A;  4LF4 O;  2LFR A;  1MA1 A;  1XI1 A;  4I0X A;  5B1B B;  4AI8 A;  4ZIB A;  1OCZ B;  4H13 B;  2GTA A;  4FLX A;  3L73 H;  4WBN B;  4DW1 A;  1OHH G;  2WLM A;  3HKB B;  2ETN A;  1N33 O;  4FJC C;  2E5L O;  4DV3 B;  1GN4 A;  4WFB V;  2A3Q A;  3BA9 A;  2RMK B;  1LUW A;  3RVY A;  3OTO B;  3L74 H;  1GM8 A;  3M99 B;  1HNZ O;  1GN3 A;  4P9O A;  3QTC A;  3CRM A;  2QE7 G;  3CRR A;  3CJH A;  3DC5 A;  2KG7 B;  5GON A;  3K04 A;  1SER A;  2DYR B;  1ZAU A;  5EIB D;  5JQG B;  3OMN B;  4DR6 O;  1N36 B;  2PTM A;  1MAB G;  5H6Q A;  3AG7 A;  1BT8 A;  2ZE8 A;  3D36 C;  4QJF B;  4U3J B;  3JAM N;  4UCU A;  1NTK H;  1SF9 A;  4UUJ C;  2QR4 A;  3WB0 A;  1M4U A;  1LNQ A;  4YHH O;  3W7W A;  3OW2 U;  2UXB O;  3CC2 V;  2VQE O;  4ICG A;  1SZX A;  2DWE C;  5CBF A;  3SPG A;  4R7C A;  2P4K A;  1SQF A;  4DR2 B;  4CH3 A;  3CCR V;  1VQP V;  2JK5 C;  4LF5 B;  2ZM6 O;  3F7Y C;  5FPR A;  3B40 A;  4JI4 O;  1WP8 A;  2UUB O;  3B4S A;  3P3N A;  4B3R B;  1NVP D;  2ADQ B;  2G38 A;  4NTY A;  4AIL C;  1XDC A;  3VQX A;  2ZIN A;  1I5Y A;  1SQQ H;  1QU7 A;  2OCC C;  2QKC A;  4LF9 B;  1M1K W;  2DQ3 A;  3A2F A;  4ZHQ B;  3TXS A;  4XBF A;  1S0V A;  1NVP B;  4FLV A;  1VQO V;  3RYC B;  5BR8 B;  1S3J A;  3CPW U;  3JAW B;  2EX3 A;  4GCZ A;  2OYQ A;  3ABT A;  3RVZ A;  5JH7 A;  3SGI A;  1OZ0 A;  1Q3E A;  1JX9 A;  2ODM A;  1BQZ A;  5KAI Z;  1BZK A;  4L87 A;  2OT5 A;  3E89 A;  2EUL A;  4JI8 O;  4AQY B;  4CS4 A;  4KP4 A;  2L35 A;  2X6A A;  1DTO A;  3RWR D;  2GV9 A;  4LNU B;  4YY3 O;  1BHA A;  4I55 A;  1EN4 A;  3W7T A;  1W0J G;  1R6K A;  1R6T A;  1Y76 A;  4A5U B;  4PA4 A;  3EXA A;  1ZL8 A;  2BE3 A;  1AI5 A;  3JAT A;  1CPY A;  3I56 V;  3T1H O;  3OE7 G;  2HJD A;  3K9S A;  4FLT A;  3P3P A;  1JFF A;  5LXT A;  2VS0 A;  3T1Y O;  4DR3 O;  4JI1 B;  2ZNI A;  1I94 O;  4L8J A;  1M90 W;  3ZRW B;  4HNA A;  5DN6 G;  1R1B A;  2OWO A;  2BTQ B;  1H2M A;  2XT9 A;  1URF A;  4DRX B;  1T5E A;  3ETE A;  5LHH A;  2ARH A;  2P7T C;  3ZRS A;  1XBL A;  3ZHR A;  2H94 A;  1N0N A;  2LQT A;  3WU2 Z;  3KZI Z;  1XMO B;  1QLE C;  2WSS G;  3SYC A;  2N04 A;  3HKD A;  3JYC A;  1VF5 B;  3VQW A;  4FZ1 A;  2Q7E A;  4RQE A;  2WLL B;  4NXM O;  5ITZ A;  3CCS V;  1KBH A;  3SJQ C;  1HR0 B;  4NTW A;  1W59 A;  3T1C A;  2F1M A;  5CB4 B;  1IXM A;  1VF7 A;  2RDC A;  4LF8 O;  2CTW A;  3TET A;  4DV6 B;  2HLD G;  1GM9 A;  5J2U A;  3TK1 A;  2E74 B;  4I9W A;  4KHP B;  3JAS A;  2IJH A;  4HZ3 A;  3UKM A;  4GKK O;  1BQ0 A;  1I5X A;  1I08 A;  2V7Q G;  1PL4 A;  3B8N A;  2XTA A;  4WBN A;  3BA8 A;  1SC5 B;  3HKB A;  3K5M A;  3AG3 C;  5IDJ A;  1BL8 A;  2Z0A A;  1IBK B;  4X1I B;  5KMG B;  3MDS A;  4X1K A;  4KXR A;  3SDL A;  3FB8 C;  1DLB A;  1PV0 A;  1N34 B;  2QKS A;  4DR5 O;  1S77 D;  1K5S A;  1Y4M A;  2LGQ A;  1K5Q A;  1XMQ B;  1W2B U;  2W6J G;  2A79 B;  1H2K A;  2KG7 A;  5H5N A;  1Z5V A;  5JQG A;  1ENV A;  4MSW C;  5CBH A;  5A2Q N;  3RFR A;  4RUE A;  4TOI A;  4MVR A;  3TGU H;  4U3J A;  3THO A;  1WB7 A;  4HYO A;  5IYZ B;  4LFA B;  3GWK C;  3IFX A;  2DN9 A;  5B1B C;  5KHJ A;  3ETD A;  1OCZ C;  3FKS G;  5GTI Z;  1PD3 A;  1AP5 A;  2P06 A;  1Q82 W;  1KUQ A;  3NR7 A;  4ZOL B;  2ZE6 A;  1VP7 A;  1JVM A;  4JZ2 A;  3E8H A;  1O9H A;  5H6R A;  2ZIO A;  3C90 A;  1CXZ B;  5C93 A;  4WFA V;  2WLJ A;  3UM7 A;  2K9P A;  1YF2 A;  3ASN B;  1KYO F;  3FX7 A;  4FM1 A;  2K1E A;  3RYH B;  1BHB A;  2CTQ A;  2DYR C;  4JI0 B;  2WLI B;  5BXZ A;  1K4C C;  1VQM V;  1QLN A;  4W4K A;  3Q4H B;  5IE9 A;  1M56 B;  1SQX H;  5EK0 A;  4PA6 A;  3FFQ A;  1VQL V;  4X64 B;  4NTX A;  1J95 A;  2ZXW C;  5DM6 V;  4ZHQ A;  2HHH O;  5C8Y B;  1BS3 A;  4NVP A;  2LGW A;  3RYC A;  2Y0P A;  1XHX A;  3JAW A;  3K5O A;  1FAF A;  2QM8 A;  1QNM A;  3JCZ A;  1MZE A;  2Y69 B;  2CTP A;  2YIB D;  4GX1 A;  1MSD A;  2H3O A;  2VQF B;  2WWW A;  1ROP A;  3O9O A;  3CP1 A;  5EC1 C;  3FB7 C;  4OX9 O;  4JV5 B;  4BR6 A;  2UXD B;  1A32 A;  4B3T O;  4ZI7 B;  3W7U A;  1YXB A;  1K34 A;  1P7G A;  5L3E A;  4GUN A;  3UO3 A;  4DR1 B;  3OM3 B;  2RCV A;  4LNU A;  4DYL A;  2YEV B;  4JYY A;  4P30 A;  1HWY A;  2P6J A;  3SPH A;  1QQC A;  3E22 A;  1ZX3 A;  3KKY A;  4LC1 A;  4EKW A;  1QCE A;  5KHG A;  3BAA A;  4UCS A;  1G1X B;  4NR1 A;  4B3M B;  4DV3 O;  4R50 A;  5IJ0 B;  4GT1 A;  1K9M W;  4MVZ A;  3M8A A;  1BGY H;  2EJR A;  2KSD A;  1HDJ A;  3ZRW A;  5IJ9 B;  1IBM B;  4MTF A;  2BTQ A;  1XOU A;  1XIL A;  3L71 H;  1WA8 A;  2E3C A;  5L3F A;  1N36 O;  2WAM A;  4GX0 A;  4DRX A;  5BY1 A;  1H2L A;  1JJ2 U;  1NTM H;  1IXB A;  5B3S B;  2EIJ B;  4UB8 Z;  2FML A;  4K8X A;  1WB8 A;  1BSM A;  5DEC A;  1UJW B;  2WLL A;  2P67 A;  4N23 A;  4O2A B;  2UUC B;  1N4C A;  3KCX A;  4UVA A;  4I9Q A;  4DV5 B;  2MW2 B;  3HKC B;  2ADP A;  1RP3 B;  1YSC A;  4K35 A;  5CB4 A;  3QF7 A;  2HJF C;  4DR2 O;  3J7A U;  2DQ0 A;  2FYU H;  2IH1 C;  1RSO B;  3CSX A;  4LF5 O;  4JI5 B;  4DV4 O;  4X20 B;  4TQD A;  4IGG A;  2VWJ A;  4IIJ B;  3E8F A;  4UB6 Z;  1L0N H;  3DTU B;  2GBO A;  4B3R O;  2F23 A;  4TWK A;  4E4E A;  1RM1 B;  3RYI B;  4X66 B;  2ZT9 B;  3HPL C;  1DK1 A;  3ZMV A;  4QE9 A;  3JAL B;  5JVD B;  2BCC H;  4LF9 O;  2Q5Z A;  4W4L A;  4X1I A;  2ZE5 A;  5FNV B;  5KMG A;  3OTF A;  5CMU A;  5BR8 O;  2X6B A;  1AI4 A;  4X89 A;  4DK0 A;  3F5T A;  2XND G;  4JF3 A;  3DC6 A;  1VQ4 V;  1ORQ C;  4PI2 A;  3NXS A;  5IYZ A;  2FL4 A;  4JAU A;  2Q8V A;  4O2B A;  3X2Q B;  4PDV A;  3B8M A;  2LFS A;  5LYJ B;  4AQY O;  1P4R A;  3QG5 A;  2CK3 G;  1KEC A;  5LMU O;  4ZOL A;  3HKE B;  2R9I A;  4BIO A;  2ATK C;  1F7Y A;  1EN6 A;  2JJ1 G;  3SR2 C;  3GB7 C;  1O9G A;  4JYA O;  1XRE A;  2EZP A;  2XHB A;  4BIZ A;  4B3S O;  2CGN A;  3SPI A;  4FIP C;  3TJT A;  1Q90 D;  1QHT A;  2X6C A;  3UCS C;  3QNE A;  2Z3Y A;  4Z1M G;  2LW7 A;  3RYH A;  3K08 A;  1S5L Z;  3E83 A;  4X88 A;  2WLI A;  4R8C A;  1FPO A;  1EBO A;  4QE7 A;  3CX5 F;  2AHY A;  1R3I C;  4JI1 O;  4ZKI A;  4LFB B;  3DGE A;  3Q4H A;  2Q7H A;  2C2A A;  1HNW B;  3ZCC A;  1AP6 A;  2CDY A;  4D7T A;  2FB5 A;  3F7V C;  1HP8 A;  4JAS A;  3U10 A;  2X0L A;  4P2Z A;  5B1O A;  2PZS A;  1SQB H;  1GM7 A;  1SQG A;  2RN9 A;  3J81 N;  5EBL C;  4CZZ A;  2ZXW B;  4Z1V A;  5C8Y A;  2HG5 C;  1PNK A;  1JOY A;  1XMO O;  3ZMS A;  3N2K B;  1AVM A;  2RNB A;  4LBE C;  4DR4 B;  2A0L A;  1QR9 A;  1UPG A;  4FFB B;  5LGT A;  3ASN C;  2GDS A;  1KMI Z;  1Y74 B;  3CYO A;  4CS2 A;  5D5P A;  2BOC C;  3L70 H;  3RYF B;  4ZI7 A;  2LJ2 A;  4FM2 A;  4JI3 O;  1D2D A;  1M56 C;  4GZR B;  4CS3 A;  4DV6 O;  1YTF D;  1K33 A;  4MVU A;  4H37 A;  5FLX N;  3ZS8 C;  4PJ0 Z;  4CBC A;  3JCU Z;  4DXW A;  4YJ2 B;  4KHP O;  4UCR A;  4H0L B;  1TUE B;  2YEV A;  2A9H A;  2YIB A;  1Q6H A;  3OMA B;  4WFH A;  3LDE A;  1BMF G;  1KKC A;  4JYB A;  3G6E V;  1WJZ A;  3FYE B;  4WFF A;  1R73 A;  2JGU A;  2NR5 A;  3ABK B;  3CE2 A;  3RW0 A;  4LF6 B;  2GTS A;  3QO5 A;  1YTF B;  4JTC B;  5IJ0 A;  3G80 A;  2Y69 C;  1MMM A;  2OCH A;  1IZ3 A;  3ZHS A;  2PYJ A;  2QWQ B;  3IC9 A;  1GMG A;  1XMQ O;  5IJ9 A;  5GW7 A;  1F4M A;  3LNN A;  3AG2 B;  4MVO A;  4O4L B;  4UCO A;  1H2G A;  3H1L H;  1R3J C;  1U96 A;  2B1I A;  3JD1 A;  3P30 A;  1I0H A;  3E86 A;  2EIL B;  2JDI G;  1J5E O;  4LFA O;  1QVF U;  1G8M A;  4DK1 A;  1WN7 A;  2QTS A;  2YXH A;  4DV0 B;  2ILM A;  3QO8 A;  4MT8 A;  2DJV A;  4DV7 B;  3LSQ A;  2XAF A;  3OR6 C;  1Q86 W;  1F23 A;  4O2A A;  4LF4 B;  4BAY A;  1H2S B;  5FPO A;  2LO1 A;  4B7K A;  4K0K B;  1NI8 A;  2QEX V;  2EIK B;  3HKC A;  4BIU A;  3AG4 B;  1YJW V;  2DWD C;  1MZF A;  2EJ7 A;  1VIB A;  1RSO A;  5L3G A;  1N33 B;  1FYJ A;  3M7M X;  3WB2 A;  3CCJ V;  2V1D A;  3A0B Z;  4X20 A;  4UV8 A;  3MHH C;  4IIJ A;  4KL1 A;  2AZ0 A;  1X4T A;  4JI0 O;  3AG1 B;  5KUK A;  3SJB C;  3L9D A;  4JAA A;  5KHK A;  2Q69 A;  4Q6G A;  3G71 V;  1WPX A;  1XL4 A;  5JWP A;  3RYI A;  1GKF A;  4DV1 B;  5B3S C;  3O65 A;  2GUZ B;  2EIJ C;  4DR6 B;  3FD9 A;  1IUR A;  1MOF A;  2ITC C;  2YSU B;  3D3I A;  5JVD A;  5KHI A;  5JJE B;  4X64 O;  2PGG A;  2QTO A;  3CC7 V;  5FNV A;  1H38 A;  1S5H C;  4YHH B;  3U11 A;  3VQV A;  1DF5 A;  1M57 C;  3RGB A;  1VF6 A;  4NXN B;  4O4J B;  2VQE B;  2JVD A;  5LGN A;  4X62 B;  4J9Y B;  4LCU C;  4OXS A;  3OEH G;  3ZRV A;  4PHZ A;  5J2T B;  4WF9 V;  4JTA B;  1VAR A;  3APQ A;  2W0F C;  1ZTE A;  2KB1 A;  3T4D A;  2KQX A;  4TT3 G;  3RN4 A;  4JV5 O;  1RM1 C;  3G67 A;  1EZV H;  5KA5 A;  3B09 A;  4MS2 A;  5LYJ A;  4C7U A;  1HNX O;  4JI4 B;  2UU9 B;  2JS3 A;  2UUB B;  5LP6 B;  3K5N A;  4ABM A;  1F4N A;  4IHJ B;  4DR1 O;  1K73 W;  1G4Y B;  5L3D A;  1M9N A;  4O4I B;  3HKE A;  2XAH A;  2ZKO A;  3JSL A;  4TV8 B;  4I5S A;  4CH6 A;  1KP2 A;  4J41 A;  1VF6 C;  1L0L H;  2WLK A;  2IJK A;  4U7N A;  1XNR B;  2IM9 A;  1Q81 W;  1IVS A;  2Q6A A;  4UVC A;  3CS5 A;  1R6N A;  2R70 A;  4JPR A;  2JJ2 G;  3ZBH A;  5CA1 B;  2E75 B;  4WFG A;  1P84 F;  1NH2 D;  5EYP B;  2NNU A;  3SPJ A;  5H2F Z;  1VQ6 V;  1IBL B;  1QR8 A;  3ABU A;  1XEQ A;  1PP9 H;  2FKX A;  2JEU A;  1IBM O;  1NZ6 A;  2XAG A;  4UCV A;  3X2Q C;  2ZNJ A;  3CCU V;  1I7F A;  4XDK A;  5EZY B;  1E1R G;  5IT9 N;  4OPH A;  5B66 Z;  3J80 N;  3LUT B;  4RAI A;  1TAE A;  4XDJ A;  5EBM C;  3SYQ A;  4E2L A;  1N32 B;  5CBG A;  1KKD A;  4JI8 B;  4LFC O;  4JI6 O;  1M93 A;  1PM9 A;  3N2K A;  4J9Z B;  1NH2 B;  3TCU A;  1ZWI C;  4Q20 A;  5BMV B;  5LBQ A;  3CCM V;  3ZHV A;  1LUV A;  4YY3 B;  2EIM B;  1D5A A;  4YIO A;  4FFB A;  1XHZ A;  2M6Y A;  3HB3 B;  1NS1 A;  3VBB A;  4DV5 O;  1AB3 A;  4I0X B;  1Y74 A;  1YZB A;  4KFM A;  4D7S A;  1OCC B;  2N74 A;  2Q9L A;  2UXX A;  2PF4 E;  2DYS B;  3SJA C;  4GX2 A;  4DUZ B;  3VOU A;  2JS5 A;  1GH6 A;  3T1Y B;  3OFN G;  5KAF Z;  3EFF K;  4YJ2 A;  1I94 B;  5D5Q A;  3G6B A;  1ZUQ A;  2QM4 A;  1KB9 F;  5B1N A;  2LW1 A;  2R9R B;  4X65 O;  4MTG A;  3CWB H;  1FJG B;  4ASU G;  2F93 B;  2P5O A;  1YIJ V;  2B5U A;  4K8Z A;  3CME V;  4DV2 B;  4F6R B;  3W7S A;  2Q0O C;  2XAJ A;  2ZE7 A;  1AI6 A;  3E2E A;  2CGO A;  4GYC B;  2F4V B;  5LMN O;  1SES A;  1VEW A;  4MTO A;  3L72 H;  3IGA C;  3UO2 A;  5BZB A;  1OCO B;  1FD9 A;  1AIL A;  2DOS A;  4H33 A;  1GN6 A;  1AR5 A;  1AJN A;  1NR7 A;  1FXV A;  3SYP A;  1XL6 A;  4YXW G;  1PNL A;  2CE4 A;  3SJC C;  1PNM A;  4DUY B;  3ML0 A;  4FVM A;  4LP8 A;  3ABK C;  3CCQ V;  5CA3 A;  4BW9 A;  3BFR A;  1THZ A;  4ZBM A;  3JAK B;  3JSN A;  3OTO O;  4MW3 A;  5DED A;  4HAM A;  1PL0 A;  4IL6 Z;  3AG2 C;  5FL7 G;  2Y0I A;  2AXT Z;  1SZT A;  2H8P C;  4QNH B;  4LFB O;  2P90 A;  2EIL C;  2GUZ A;  5IWA B;  1FFX B;  4I4T B;  4JAV A;  2OTJ V;  2RJZ A;  3MD0 A;  1VMG A;  2AZ2 A;  1ZLZ A;  3D3Q A;  2EIK C;  3AG4 C;  1JPX A;  4PA7 A;  3ZMU A;  4U7O A;  1EN5 A;  4O4J A;  1M57 B;  1AI7 A;  2YDE A;  5LGU A;  3UT5 B;  4O4H B;  4DR4 O;  2Q0A A;  1JA8 A;  1SRY A;  3LNM B;  1E79 G;  4B08 A;  2HEP A;  3FAV B;  3CCE V;  2XOK G;  5IY5 B;  1XQ8 A;  5J2T A;  3BAB A;  1Y66 A;  4J42 A;  4FLW A;  1RPR A;  2HKO A;  4GKJ B;  2F95 B;  2W6I G;  2YID A;  3AG1 C;  1JQ0 A;  4OGQ B;  3ZMZ A;  2NLJ C;  3CXC U;  1V9P A;  2QJ1 A;  5KX5 B;  1S72 V;  4J80 A;  5LP6 A;  2HP8 A;  1JFF B;  1TA8 A;  4IHJ A;  5L3C A;  3OGC C;  3OAA G;  4O4I A;  1Q6I A;  4RO2 A;  4U3F H;  4JZG A;  4TSF G;  1P49 A;  4JI7 B;  3ZJZ A;  1SA0 B;  1Q6U A;  3ZHT A;  1Z2G A;  4NYK A;  4CC6 A;  3BHP A;  4JYC A;  3G4S V;  4JI2 B;  4LF6 O;  2QKA A;  4EB6 B;  5CA1 A;  5EYP A;  4F4L A;  3STZ C;  3SYO A;  4F6E A;  4H44 B;  4G27 B;  2Y48 A;  2YUA A;  1PKX A;  3ZHU A;  5EZY A;  5LP6 C;  2DW4 A;  2UUA B;  3QVN A;  4QGP A;  3JD4 A;  4NB5 A;  5B1A B;  3FYI B;  1GRJ A;  2UXN A;  3RT3 C;  4B3T B;  1B6Q A;  2BTO A;  3C3T A;  1BCC H;  2L6L A;  1NBM G;  3SYA A;  4QPJ A;  4DV0 O;  3FB5 C;  4DV7 O;  5EC2 C;  3TXQ A;  1AR1 B;  4LR3 A;  1G6U A;  3ASO B;  4K0K O;  4UXN A;  2Y4T A;  3ZED A;  1Q7Y W;  4DW0 A;  1B3Q A;  2O57 A;  4CH4 A;  1F51 A;  4FMT A;  2JRI A;  1X59 A;  4X1Y B;  2D3O W;  3ETG A;  3B2E E;  4X1K B;  3CCV V;  1VQK V;  1XNQ B;  3CRQ A;  4I50 B;  5KLV H;  4FZ0 A;  2W0X A;  3K3W A;  1FFT B;  4UV9 A;  5GTH Z;  3OEE G;  3KG2 A;  4YJ3 B;  4DV1 O;  5LHI A;  3LSS A;  3B77 A;  1YEW A;  3ZHQ A;  3CRC A;  2YXY A;  1TUB B;  4J10 A;  2YC0 A;  1SKV A;  2EIM C;  1WP7 A;  2HVK C;  4UFZ A;  1L8D A;  2IU3 A;  4LF7 B;  4F6R A;  2CH7 B;  1HR0 O;  4NXN O;  2YIA A;  4R6Z A;  1OCC C;  3S3W A;  3IC7 A;  3AEI A;  4X62 O;  3K0G A;  2JGD B;  3LDD A;  1FKA O;  2CAZ C;  1GK9 A;  2DYS C;  1R3K C;  2A06 H;  4LWS B;  3OUS A;  5LHG A;  1YIT V;  4FFK A;  1K3E A;  4DV4 B;  2WLH A;  4J7Z A;  1PPJ H;  2PYL A;  2MK3 A;  1NT2 B;  1US6 A;  2F66 C;  4LH6 A;  3K5L A;  2UU9 O;  2AHZ A;  4DR7 B;  4FLY A;  4J7J A;  2V4D A;  1JMK C;  5TIS Z;  2QWN B;  3MAQ A;  3BCC H;  4JGS A;  3T4Z A;  1IBK O;  1JJO A;  2DE0 X;  1SQV H;  1V54 B;  3I5D A;  3JAK A;  4PV1 B;  2Y4U A;  3A0H Z;  2WA3 A;  3E35 A;  1N34 O;  2E76 B;  3KCY A;  4J7K A;  1Y67 A;  5EBW C;  1FXK B;  1XNR O;  1NR1 A;  2IJI A;  3WB1 A;  3LDC A;  4B7E A;  3H9V A;  1OCO C;  2QSA A;  4UCT A;  5K1X A;  4IYI A;  1IBL O;  3H1I H;  1FFX A;  3CRA A;  4GX5 A;  4I4T A;  3ABM B;  4IYH A;  3CMA V;  2RQ6 A;  2WA4 A;  2UXC B;  4FLZ A;  3CC4 V;  4PEL A;  1GTO A;  1N32 O;  3C3S A;  5LMU B;  1ARO P;  2ZQM A;  3UT5 A;  4O4H A;  3ETQ A;  3JAR B;  3FAV A;  3K9A A;  4K3A A;  2E5L B;  1SET A;  3EVK A;  4JYA B;  4B3S B;  1L1F A;  1B06 A;  3WG7 B; 
#chains in the Genus database with same CATH homology
 3TGU H;  3L75 H;  1PP9 H;  1NTM H;  1NTZ H;  3L73 H;  1SQX H;  2FYU H;  1BGY H;  3H1K H;  1L0L H;  1EZV H;  1SQP H;  2A06 H;  3CX5 F;  3L70 H;  4D6T H;  2BCC H;  1KYO F;  1BCC H;  1BE3 H;  4U3F H;  1NU1 H;  3H1L H;  3H1H H;  3H1J H;  3BCC H;  3CXH F;  4PD4 F;  3H1I H;  1KB9 F;  5KLV H;  2IBZ H;  1NTK H;  1L0N H;  1SQQ H;  3L71 H;  3L74 H;  1SQV H;  3CWB H;  1P84 F;  1PPJ H;  3L72 H;  1SQB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...