2A06H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2a06H00
2BCCH 3L75H 1NTMH 3CX5F 3CXHF 4U3FH 1NU1H 1PP9H 1PPJH 1SQVH 3L70H 1BE3H 3CWBH 2FYUH 2A06H 3L73H 1EZVH 3H1IH 3L72H 3H1LH 1L0LH 1BGYH 1SQXH 1BCCH 1SQPH 1L0NH 3H1JH 1KYOF 3L74H 3H1HH 4D6TH 3BCCH 1NTKH 3TGUH 1SQBH 5KLVH 3L71H 4PD4F 1P84F 3H1KH 1SQQH 1KB9F 2IBZH 1NTZH
chains in the Genus database with same CATH superfamily
4J7KA 4JI2B 2AZ0A 2Q68A 1YF2A 1URFA 3OTFA 2Q5ZA 5JH7A 3IAYA 5C8YB 2F4VO 2DE0X 1XL4A 1PM9A 4J9ZB 1COWG 1Q6IA 3SPJA 2M6YA 4Z1MG 2CDYA 3CCLV 1VQ8V 4GCZA 4J7ZA 2OYQA 1KP3A 2XNDG 3RYFA 1GRJA 2Z5UA 3CEIA 2G38A 1E79G 3OR7C 1ZSPA 2X6CA 4O4JA 3X2QB 5B66Z 2WLMA 4F6RB 3A2FA 3BA9A 2GSMB 4LH7A 1BQZA 1N32B 4R7CA 1OHHG 2BOCC 5GONB 4J41A 4B3TO 3UO2A 4FMTA 3AG4B 3OE7G 4OX9O 3ABUA 2Q7HA 4WCEV 2WPDG 2YICA 3E89A 2P7TC 3ZRWA 3JSNA 3ZN0A 2WLLA 4GYCB 2CTPA 5B1NA 3T4ZA 3CS5A 1VF7A 4FLVA 2KQXA 3ETDA 4Q6GA 1D5AA 2YXYA 3P3PA 3AG2B 2LGQA 1NH2B 4JI6B 1KUQA 5CBGA 1BZKA 2QTSA 3ZBHA 5KX5B 4PD4F 1P7GA 1WA8A 4J11A 3DC6A 3OUSA 1OCZB 1IZ3A 1BS3A 4OPHA 4X65O 2ZDIA 2VWKA 4WFFA 3S3XA 1TGOA 4IT5A 5E79Z 2ZQMA 4DUZB 3OUFA 1Q8IA 2YSUB 2ZCEA 3FAVA 2R9IA 3IC7A 4RAIA 4K0KB 1SS3A 1ZUQA 3HKBB 2PI4A 1PD3A 1U96A 4UVAA 1QU7A 4KUMA 3ZMTA 1R73A 4O4LB 1BE3H 3CWBH 1KKDA 1I94B 4DR6O 1EM1A 3QF7A 5IYCO 2DWEC 3T1HO 1HNWB 4H13B 4X66O 3CCRV 1UFIA 4RUFA 2GUZA 5KUMA 2HJFC 3CCVV 4CBCA 4B08A 3AG4C 4LFBB 2ZIOA 2A9HA 3ABMB 4QE7A 1GN6A 3ABTA 4MW3A 1MABG 1GN4A 2BE3A 4X9QA 3FB7C 2JJ1G 5KHKA 1SQPH 4UUJC 4TT3G 3AG2C 4EB6B 4X88A 2IJIA 3DTUB 2GV9A 4X1YA 1VP7A 2FB5A 4RWUA 3EVKA 1V54B 4DV6O 4E2LA 3E22B 1NJIW 1FFTB 4JYAO 1OCZC 3M99B 1WPXA 4UCOA 3MAQA 3P32A 5KA6A 1NR7A 5LHIA 2UXNA 2MW2B 1PL4A 1VQOV 3BRCA 2N74A 4BIZA 1AROP 4CS3A 1YSCA 4DV1B 3A8TA 2X6BA 3QO7A 2JS5A 4K8XA 1Y66A 3ZIAG 4MW8A 3ZMVA 3E35A 4G28B 3Q4HA 3SYCA 3RFRA 1S5HC 1XNRB 1MMMA 1YJNV 1H2LA 2UXCO 2YXHA 3HKCB 4NVPA 3E8BA 1UPGA 3ABMC 4J10A 3RN4A 2VQFB 5BR8B 1K97A 3RBZA 1TAEA 1P4RA 2RN9A 3K3WA 2UUAO 1L8DA 2B1GA 2DJVA 4JI6O 4CC6A 2AHYA 4UVBA 4LF4B 3FD9A 5BMVB 2EX3A 1V54C 4B7KA 1R1BA 3AK2A 1Q82W 1AJPA 1LUVA 2ZT9B 2RCVA 4BIUA 4BAYA 1WLEA 4DUZO 2UXDB 4X1IA 1VQMV 5IY5B 5L3GA 1FFXB 2AXTZ 2IM9A 4ASUG 1I5XA 1EBOA 2QWNB 3AK3A 4O4HB 4U7NA 2FTKA 3JD2A 2A7WA 1I94O 1MSWD 1NT2B 3IJ4A 3SYOA 1P84F 1W2BU 5IYDO 4JI3O 1R6TA 3LSUA 2BTQB 3J80N 3JARB 4ZHQA 4FM1A 4PI2A 1H2GA 4TUYA 3AG7A 1Q7YW 4FK5C 1VQPV 4DR5O 4GLXA 4FLYA 3OGIB 2JK5C 4I55B 3OD4A 2P5OA 1S3JA 4FIPC 4BWAA 3FYEB 4HNAA 1JFFA 1MSDA 4PDMA 2H8PC 4YJ3A 4YJ2A 4IYHA 5D5PA 3D3QA 1YTFD 4KHPB 4FFBA 1HR0O 4WBNA 2R72A 1P7BA 3CJHB 4Q20A 4R50A 3SR2C 1Y74B 2W6JG 2GTSA 3FB6C 3WB2A 1NTKH 4X1KA 1DTOA 4I7ZB 3I5DA 4EKWA 2HR3A 3OW2U 3ZS8C 3OMNB 5IY5C 2UUBO 2CUGA 4FFKA 2KB1A 1L0LH 2Y0IA 5C8YA 5LYJB 3J81N 2RDCA 2PUSA 4DUYB 1K33A 4LF7B 1Q6HA 4OXSA 2ITCC 1E1QG 3T1YO 4QE9A 4DR7B 3N2KB 2OTJV 3OTOB 2JEXA 3SJAC 2QGNA 1PP9H 1XNRO 2XHBA 1MG1A 3ABLB 4IGGA 3K9AA 3E86A 3MHHC 5ITZA 2VQFO 1TVKB 2DQ3A 2ZKOA 1ORQC 3O9OA 4CH3A 4EFEA 3G6BA 5KA5A 5JQGB 1QNMA 4AQYO 3ASOB 1JCHA 3E2EA 1ROPA 5KHGA 1JJOA 2AW9A 2YUAA 3ICXA 2JGUA 2QJ1A 4KP4A 5GW7A 1OCRB 1Q90D 4F6RA 3K58A 2WA3A 1HWYA 3N2GB 4O2BB 2IU0A 2JIZG 1W0JG 1HP8A 3CD6V 4QPJA 2ZM6B 1K5SA 2QDOA 3NXSA 2IJHA 3RYHB 1EN6A 1G8MA 1PKXA 4UCTA 5H9CA 3K08A 3THOA 4NYKA 5KHJA 2CAZC 5EC1C 2QWPB 2OIGA 1XMQB 1AI6A 2XAGA 3D3IA 3LDCA 3T1CA 5KX5A 1RM1B 4UV8A 1XILA 1QR8A 5E1AC 1IX9A 4F6EA 3B8NA 5IYZB 2AZ2A 1Y6XA 1CXZB 4JI7O 1DLBA 3WFVA 4D7TA 1S0VA 2UXXA 1EZJA 3ABLC 1BQ0A 1PL0A 3K03A 3RYCB 1GN2A 1K92A 2IH3C 3HKDA 4AILC 1S76D 1YHQV 2ZD9A 1YITV 2ZR3A 3GWKC 3HKBA 3R66A 4HAMA 3ASOC 3HKEB 1AVMA 2HKOA 4O4LA 2ADQB 5LMNO 1OCRC 3MHSC 3K9SA 2E5LO 1NR1A 4Z2WA 2PY5A 2L35A 3IGAC 3QNEA 3ZHRA 1QHTA 2CE4A 3TJTA 4I0XA 1JX9A 5IJ9B 4LF5B 3GVMA 2EINB 3CXHF 4YY3O 4I50A 2PI5A 1IDSA 2HEPA 1N33B 4WFGA 1R3KC 1TUEB 4JTCB 1DGSA 3RYIB 3H01A 5L3EA 4JZ2A 1O9GA 5GTHZ 1VQ7V 2K9PA 4EB6A 2DOSA 3W7XA 4DUYO 4NTXA 2HP8A 4LF7O 2DYSB 1RM1C 2UXBB 2F95B 2O57A 3E22A 4I9QA 3OTOO 4DV3B 5LHHA 1EZVH 1XEQA 3A0HZ 4DR1B 1WB7A 3OGCC 4JF3A 4ZI7B 2ZE8A 2WSSG 2PYLA 3OMAB 1KECA 2KG7B 4DR2B 1Y76B 3FB5C 4DR3O 1EN4A 4TV8B 3AG3B 1NKDA 2LW7A 4J80A 4JAAA 4UCSA 4JI5O 4FLZA 5EIBD 5JVDB 4JI8B 3FYIB 3B09A 1JPXA 1BGYH 2A0LA 4GX2A 1N0JA 1BHAA 1BT8A 1K7DA 3BHPA 2EIMB 2C2AA 1ZX3A 2Q6AA 1SQQH 3APQA 1YZBA 1ZL8B 3ZRXA 2LO1A 3W7WA 4OGQB 4AHCA 5CBFA 3L9DA 5IWAB 1T5EA 2JEUA 4YIPA 2V4DA 5KAIZ 3LDEA 4FM0A 1R6KA 2OCCB 2EINC 1IBLB 3HKCA 5LMUO 4XDJA 3ABKB 1XNQB 4QJFB 4PA3A 5FLXN 3K06A 1Z2GA 3LSQA 2NN4A 4JTAB 3C3SA 2CH7B 3JAWA 4UCRA 2ADPA 5EZYB 3LUTB 3ZHUA 3DXRB 1XMQO 1VQ5V 2P4KA 1HNZB 1YVWA 2L6LA 5J2UB 2WLIB 2Y4UA 1J5EO 1WPBA 1N34O 4B3MO 4GX0A 3FKSG 5BMVA 2DYSC 3ZN1A 2FMLA 1ZLZA 4DW0A 4BR6A 4MVRA 3K5OA 3UO3A 3JASB 1HNXB 4JYBA 3ZHQA 2HVJC 4CH4A 1LNQA 1RPRA 3ZHSA 4X64O 3CC2V 5HFMA 2Q0AA 3AG3C 3E83A 3SPCA 2W6IG 4PELA 2Q9LA 2YC0A 4Z1VA 2OIEA 3RVZA 1SZTA 2HG5C 1QBZA 1FJGO 2LQTA 4O4HA 1N36O 5B5EZ 4RUEA 2VQEO 1XBLA 3HR0A 4H33A 2JGDA 2EIMC 2P67A 2BCCH 2BTQA 3JARA 3CB2A 1SC5B 2Z3YA 4C7UA 3L70H 1AI4A 4X8AA 3A0BZ 1EN5A 5LXTB 2OCCC 5LGNA 1F51A 1TUBA 3ABKC 5JJEB 4I55A 1GM8A 2YEVB 1U97A 5KHHA 3UCSC 1OJHA 2P90A 3E8HA 2E74B 1GM9A 1AR5A 2N04A 4IIJB 4TSFG 5KUKA 2DMXA 3E8GA 1VF6C 4JI2O 1IBKB 1VMGA 3CJHA 5D5QA 2Q4PA 1DF5A 3H1HH 1Y74A 3ETQA 4W4LA 1IBMB 3JAKB 4JGSA 2LJ2A 1XL6A 4BIOA 4B3SB 4JI4B 5BZBA 3SPIA 4AI8A 1WNSA 4X20B 3H1LH 4JI8O 3SGIA 3JD1A 2IW5A 4EFBA 2PGGA 5JCOC 4GKJB 3CMEV 1Q6UA 3N27A 1KU9A 5B1BB 1H2MA 1FXKB 4EEQA 4FVMA 3N2KA 5C93A 2BOBC 4RQEA 1R3IC 2V7QG 3CMAV 2HJDA 4NXNB 1N32O 3F7VC 4OPAA 4CZZA 2LGWA 1TVKA 3MDSA 2EIJB 4DRXB 1NTZH 4YHHB 5CB4B 1NTMH 2JS3A 1Z5WA 2XOKG 5CN0A 5DM6V 3CRAA 1A32A 1YJWV 4O4IB 1ZAUA 5CA1B 2F66C 3BABA 1QCEA 1QQCA 2E3CA 2F43G 1M93A 1F4NA 4LFAB 1W59A 3TXSA 3K79A 4G27B 3OFNG 4FLUA 3N2GA 2CTRA 2YS8A 3CHXA 4O2BA 4DV2B 1FAFA 3ETGA 1QLEB 3P3NA 1HDJA 4PHZA 4QIWF 3SDLA 3JSLA 3SYPA 3H9VA 1SQVH 5FPOA 5FNVB 3RYHA 4PDLA 3G80A 2HHHB 2F93B 4PV1B 1NVPB 3K59A 2Q69A 4D6TH 2ZNIA 3BCCH 1OZ0A 4DV0B 1XMOB 4DV5B 2H3OA 1FS0G 1H2NA 2YI8A 4ICGA 5EYPB 3JD4A 2LFRA 2Q0OC 3CRRA 1R6NA 3L75H 5B1BC 4K0KO 1FXKC 1NI8A 4YIOA 4DK1A 1IXBA 1QR9A 2AHZA 5IYZA 1N0NA 1OCOB 4U7OA 3UT5B 1ZTEA 3E8FA 1HNWO 1VQKV 1I7FA 2Q73A 3RYCA 2A3QA 4H37A 4TOIA 3SYAA 3CCQV 2EIJC 2WAMA 2Q8VA 4LFBO 2LW1A 3C3TA 2GHYA 1SA0B 4GZRB 2QR4A 4LBEC 4NTWA 4DR4B 3HKEA 4NB5A 3SJQC 2N05A 3ZRSA 3RGBA 1IBKO 1JMKC 2R70A 3JD3A 1MZFA 1B3QA 1BL8A 4JV5B 4DV4B 4L8JA 3D8CA 1IBMO 3VQYA 5L3BA 5IJ9A 2QEXV 3LSSA 4UVCA 3WB0A 1QLEC 3F5TA 4TQDA 3SPHA 1M9NA 3AK1A 2P06A 1S77D 4NTYA 5L3CA 2UUCB 1VEWA 4ZBMA 1JA8A 3RYIA 5BXZA 4RO2A 2PYJA 5HFLA 1RSOA 1NH2D 1G6UA 4WFEA 2EZOA 1NU1H 3CE2A 3CSXA 4UB6Z 3TCUA 4TWKA 4JI0B 3L73H 1SESA 4G2KA 4LNUB 3STLC 2QKAA 3CCMV 3H1JH 4DV1O 2VS0A 4JZGA 2OWOA 4UFZA 2ZNJA 2JDIG 1YCIA 4NXNO 1OCOC 1M57B 5H5NA 4ZI7A 1GMGA 1THZA 2KG7A 1GO3F 1Y67A 2P4VA 2D3OW 2ZDIC 4YHHO 1H2KA 4TV8A 1JVMA 2NR5A 2BTOA 2Y69B 4UB8Z 5JVDA 3L74H 2E75B 2W0FC 5BR8O 3LNMB 1DK1A 1JR9A 3C90A 3TETA 4I4TB 4NKGB 2DQ0A 1X59A 1ZL8A 5GTIZ 3DC5A 2HFEC 1KP2A 2XT9A 1S5LZ 1PPJH 2F4VB 4LF4O 4DV2O 3T2MA 1Q3EA 4LF8B 4DW1A 5LHGA 4HBNA 2HHHO 5H6RA 4JPRA 5GONA 5IJ0B 2LFSA 5LBQA 1AR1B 2CH7A 4DV0O 3DXRA 2QTOA 3G71V 1NZ6A 2OTLV 4MVOA 2UXDO 4DXWA 4CH6A 1K4CC 4H44B 3TXQA 5J2UA 2WLIA 2CGOA 2W0XA 1VF6A 1UJWB 5IYBO 4K8ZA 3K5NA 1SZXA 3GB7C 5CA0B 4DV7B 1H2SB 4UXNA 1S5JA 4B7EA 1AP6A 3ETEA 4WFBV 2NNUA 3JASA 4UV9A 3WG7C 3R65A 2H94A 1M57C 5H2FZ 4B3TB 4KXRA 1B6QA 1JJ2U 2X6AA 1R3LC 2RQ6A 4PA6A 3EHBB 2YIBA 5CBHA 3JD0A 1M1KW 2Y69C 3BY6A 4MVSA 5CA3A 2OT5A 4MVUA 4IL6Z 1M56B 1M5IA 3BPZA 5A9GA 1XDCA 1WP7A 1YIJV 4O2AB 1AILA 2FL4A 3CX5F 3OM3B 1BMFG 4JASA 3BFRA 4DV4O 4BW5A 3ZJZA 3CPWU 4KHPO 1V9PA 3K0DA 3FB8C 2WA4A 3LDDA 1JQ0A 2PZSA 3EXAA 5LXTA 4GUNA 4X65B 1AI7A 3NR7A 3PN1A 5JWPA 2WWWA 2GTAA 3J7AU 1PV0A 4H0LB 4A5UB 4U3JB 3CXCU 4IIJA 2EJRA 1VQLV 1K73W 3U0ZA 2IJJA 1OCCB 2ZR2A 1KMIZ 2V1DA 5FL7G 2ATKC 3DSQA 3STZC 2K1EA 5EBLC 3JAKA 4WFAV 3CC7V 4DR6B 3AEIA 1Q43A 4DR7O 3I56V 3T1HB 4LWSB 2QM7A 4DK0A 4X66B 4PA7A 4UCUA 4MTFA 5KMGB 1GKFA 1JOYA 2EILB 2EULA 4X20A 2ZE7A 4TV9B 3H1KH 2ZE6A 2Y48A 4L87A 4U3FH 3G4SV 1X4TA 5LP6B 1SRYA 1M56C 3U11A 1Q5OA 1SETA 1FXKA 3K5MA 1P49A 1F7YA 1QVFU 2JJ2G 3H1IH 2CK3G 3KG2A 1K3EA 1NQTA 3CCJV 4ZOLB 1M90W 1BHBA 4LF8O 4DV6B 1PNMA 4JYAB 1FXHA 4LFCB 1ZWIC 3OAAG 4MSWC 4JI1B 1OV9A 1B06A 3JATB 5B1AB 3FFQA 4ABMA 4LF6B 4DRXA 1PNKA 5CB4A 1YDXA 5ITZB 2ZM6O 1GM7A 3SJBC 1L1FA 1WN7A 2WLHA 4O4IA 5CA1A 4FM2A 1OCCC 3UQ8A 2IU3A 1K4DC 4DV7O 1YI2V 4GKKB 2E76B 4JAUA 3RT3C 3QO8A 1VARA 3ZCCA 2YIAA 1XHZA 5J2TB 2VWJA 1H8HG 1K5QA 4GX1A 5FNVA 1FKAO 1YTFB 1K34A 3ASNB 3WU2Z 2UXCB 2EILC 1FPOA 3K57A 4IHJB 3UM7A 4P9PA 1SF9A 1FXVA 2MK3A 3ZMUA 5JJNB 2X0LA 5EYPA 1EFRG 3GWOA 4LR3A 2QA4V 1GTOA 5LP6C 3SPGA 1FFXA 4N21A 1I08A 2UUAB 4E4EA 3IC9A 2XTAA 3QG5A 4CS2A 3TK1A 4R6ZA 3UT5A 1N8RW 4JAVA 3S3WA 5LOVB 4GX5A 2P6JA 5B1AC 3G6EV 2R9AA 4LF5O 2XASA 2ZIMA 1PNLA 1SA0A 3HKDB 2DYRB 1N33O 4YXWG 4MVQA 3JALB 1AR4A 3KCXA 1FYJA 3X2QC 4MVMA 3B40A 3T4DA 3VOUA 3FX7A 5K1PA 2HLDG 4HYOA 2UXBO 1SQXH 4JI3B 4MTXA 3BVOA 1CP9A 4I0XB 4X89A 3D36C 4DV3O 3TGUH 1BSMA 4DR1O 5H6QA 3LNNA 4DR5B 2X7RB 5BY1A 3HPLC 4I50B 3ASNC 2AGAA 3UKMA 3W7SA 5LA6B 2IJKA 1G4YB 3EFFK 1KKCA 1GK9A 4DR2O 4DO2A 2XUMA 3KCYA 3B4SA 3K5LA 2BSKB 5L3FA 2ILMA 4LNUA 3ZMSA 2GBOA 1RPOA 3APOA 5J9PC 1HR0B 2PTMA 1VIBA 4CS4A 5EBMC 1KB9F 4UCVA 5LYJA 1GN3A 2HVKC 2WLJA 3RW0A 5JH7B 4LFCO 2FKXA 3DGEA 3PJSK 4JI1O 1HW7A 5K1XA 5LGTA 1IVSA 4LF6O 5IWAO 3JCUZ 2Y0PA 1IBLO 3JYCA 1VQ6V 2DYRC 1XNQO 2RNBA 4WF9V 3ML0A 2UUBB 3RYFB 1YJ9V 2YXLA 2QE7G 5JQGA 4I9WA 1MZEA 3F5WC 3JCZA 4I4TA 1HNZO 1Y4MA 4GKKO 2KSDA 1DF4A 2CGNA 4D7SA 4KL1A 5IDJA 3L72H 5CMUA 2A79B 3VBBA 3T1YB 4O4JB 1MNGA 4NXMB 4RQFA 4XDKA 4FLWA 3O65A 1E1RG 3K04A 3AG1B 5IJ0A 1W0KG 1ENVA 1HNXO 1RFYA 2GDSA 1WP8A 1IURA 2F1MA 3B2EE 1WB8A 2WLNA 1XREA 2FYUH 2A06H 3ZHVA 3JAWB 1L0NH 3QO5A 4AQYB 4CC5A 3ZRWB 5KLVH 2WLLB 2LP7A 4TQFA 2NLJC 4B3RB 5CA0A 4PJ0Z 3OR6C 1LUWA 3OT7A 3BA8A 2YDEA 1S72V 1H38A 4CH5A 4JYYA 5IT9N 4PDVA 4NR1A 2CTWA 2R9RB 2ZE5A 2IH1C 1R3JC 2B9ZA 5EK0A 1WA8B 2XAFA 1RP3B 4K35A 3L71H 1AJQA 5DN6G 4R8CA 2QM4A 4J9YB 3I55V 3CCSV 4MS2A 1D2DA 1D5NA 2XAQA 4LF9B 1Q81W 2P22C 4WFHA 2VRZA 3OMIB 3B8MA 4O2AA 1J95A 4J42A 1SQFA 2EIKB 3ZX6A 3U10A 2M7WA 1V55B 2Q7EA 3FAVB 2QWOB 3ZEDA 5EBWC 4P2ZA 5FPRA 2QWQB 2JGDB 3RVYA 2WLKA 4GT1A 4P30A 2QSAA 1G1XB 4JI7B 3AG1C 4PA9A 1QLNA 2XAJA 4P9OA 1TUBB 4B3SO 1IXMA 2ITDC 4JI4O 4PDRA 2GUZB 4U3JA 1KQSU 1VF5B 2UU9B 5LGUA 2JVDA 4GKJO 3B77A 2JRIA 2Y4TA 5LL6Y 3KKYA 3A0RA 2ZXWB 3F7YC 5LMNB 1B04A 3M7MX 1GH6A 2E5LB 1Z5VA 2RJZA 1F23A 2KKWA 3KZIZ 1SQGA 1AP5A 3CC4V 2ODMA 4LWSA 1GAXA 1AI5A 1MA1A 3W7UA 1KBHA 3BAAA 1US6A 2EJ7A 4X1YB 3W7TA 5KMGA 2YIBD 4YY3B 3WG7B 1CPYA 1VQ9V 3ZMZA 5F2VO 4TV9A 1AB3A 5A2QN 5B3SB 4X62B 4LCUC 1Y76A 5LP6A 2Q67A 4IYIA 2Z0AA 2F23A 4FZ1A 2EIKC 5AG2A 5L3DA 4MTOA 1V55C 3JAMN 1XUQA 2D2CB 4ZOLA 4K3AA 1KC8W 4HZ3A 4F4LA 4FPPA 3CRQA 3SYQA 4NXMO 2DW4A 5EIBC 3M8AA 4LFAO 4XBFA 1TA8A 2QKSA 3JATA 3OEEG 4PA4A 4BW9A 1K9MW 2PF4E 4XDLA 4FLTA 1XOUA 1WJZA 3Q4HB 2EZPA 4LC1A 4DR3B 1F4MA 2ARHA 1SERA 4QPKA 2B5UA 4JI5B 4JYCA 1KD1W 3QVNA 4DYLA 5EZYA 5KHIA 1XMOO 3ZRVA 4DV5O 4MVZA 5JJJB 2ZINA 4B3RO 5DEDA 2OCHA 3OEHG 2RMKB 2ZXWC 3VQXA 4MT8A 1Q86W 3K0GA 3ZHTA 3CCUV 3D36A 5J2TA 3CRCA 1WAZA 4LP8A 5DECA 1H8EG 5EC2C 2XAHA 1YEWA 1CEZA 4IHJA 5LMUB 1I0HA 4LF9O 3CCEV 5B3SC 4ZIBA 4OX9B 1M4UA 1BCCH 1N4CA 4QNHB 2EBOA 5B1OA 3G67A 5JCOA 1XI1A 3WB1A 3VQWA 3RWRD 4X1IB 1NBMG 1J5EB 4PI0A 4N23A 4DR4O 3CRMA 4LH6A 4FJCC 1N34B 4B3MB 1VQNV 1NS1A 3CP1A 4QGPA 4MTGA 4JV5O 1XQ8A 5LOVA 1XHXA 4JTDB 2Q7GA 4ZHQB 3HB3B 2ETNA 5IE9A 2YIDA 2QKCA 4TUYB 4X64B 2DN9A 1K8AW 3QTCA 3JALA 2UU9O 2UUCO 5KAFZ 2YEVA 1LR1A 3BEHA 4KFMA 1AJNA 2DWDC 1FJGB 1O9HA 1N36B 2VQEB 2QWRB 1QVGU 1I5YA 3CYOA 4HNAB 4JI0O 1JFFB 4YJ3B 4YJ2B 4ZKIA 2CTQA 3SJCC 4FZ0A 5TISZ 1NVPD 4FFBB 3VQVA 2IBZH 4WBNB 2QM8A 1SKVA 2YI9A 5LA6A 2B1IA 4FLXA 1VQ4V 4X62O 3MD0A 1YXBA 4X1KB 4W4KA 3IFXA 1KYOF 4J7JA 1RSOB 1SQBH 2BSKA 1MOFA 3P30A 1FD9A 4I5SA
chains in the Genus database with same CATH topology
2BCCH 3L75H 1NTMH 3CX5F 3CXHF 4U3FH 1NU1H 1PP9H 1PPJH 1SQVH 3L70H 1BE3H 3CWBH 2FYUH 2A06H 3L73H 1EZVH 3H1IH 3L72H 3H1LH 1L0LH 1BGYH 1SQXH 1BCCH 1SQPH 1L0NH 3H1JH 1KYOF 3L74H 3H1HH 4D6TH 3BCCH 1NTKH 3TGUH 1SQBH 5KLVH 3L71H 4PD4F 1P84F 3H1KH 1SQQH 1KB9F 2IBZH 1NTZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC H;  3L75 H;  1NTM H;  3CX5 F;  3CXH F;  4U3F H;  1NU1 H;  1PP9 H;  1PPJ H;  1SQV H;  3L70 H;  1BE3 H;  3CWB H;  2FYU H;  2A06 H;  3L73 H;  1EZV H;  3H1I H;  3L72 H;  3H1L H;  1L0L H;  1BGY H;  1SQX H;  1BCC H;  1SQP H;  1L0N H;  3H1J H;  1KYO F;  3L74 H;  3H1H H;  4D6T H;  3BCC H;  1NTK H;  3TGU H;  1SQB H;  5KLV H;  3L71 H;  4PD4 F;  1P84 F;  3H1K H;  1SQQ H;  1KB9 F;  2IBZ H;  1NTZ H; 
#chains in the Genus database with same CATH topology
 4J7K A;  4JI2 B;  2AZ0 A;  2Q68 A;  1YF2 A;  1URF A;  3OTF A;  2Q5Z A;  5JH7 A;  3IAY A;  5C8Y B;  2F4V O;  2DE0 X;  1XL4 A;  1PM9 A;  4J9Z B;  1COW G;  1Q6I A;  3SPJ A;  2M6Y A;  4Z1M G;  2CDY A;  3CCL V;  1VQ8 V;  4GCZ A;  4J7Z A;  2OYQ A;  1KP3 A;  2XND G;  3RYF A;  1GRJ A;  2Z5U A;  3CEI A;  2G38 A;  1E79 G;  3OR7 C;  1ZSP A;  2X6C A;  4O4J A;  3X2Q B;  5B66 Z;  2WLM A;  4F6R B;  3A2F A;  3BA9 A;  2GSM B;  4LH7 A;  1BQZ A;  1N32 B;  4R7C A;  1OHH G;  2BOC C;  5GON B;  4J41 A;  4B3T O;  3UO2 A;  4FMT A;  3AG4 B;  3OE7 G;  4OX9 O;  3ABU A;  2Q7H A;  4WCE V;  2WPD G;  2YIC A;  3E89 A;  2P7T C;  3ZRW A;  3JSN A;  3ZN0 A;  2WLL A;  4GYC B;  2CTP A;  5B1N A;  3T4Z A;  3CS5 A;  1VF7 A;  4FLV A;  2KQX A;  3ETD A;  4Q6G A;  1D5A A;  2YXY A;  3P3P A;  3AG2 B;  2LGQ A;  1NH2 B;  4JI6 B;  1KUQ A;  5CBG A;  1BZK A;  2QTS A;  3ZBH A;  5KX5 B;  4PD4 F;  1P7G A;  1WA8 A;  4J11 A;  3DC6 A;  3OUS A;  1OCZ B;  1IZ3 A;  1BS3 A;  4OPH A;  4X65 O;  2ZDI A;  2VWK A;  4WFF A;  3S3X A;  1TGO A;  4IT5 A;  5E79 Z;  2ZQM A;  4DUZ B;  3OUF A;  1Q8I A;  2YSU B;  2ZCE A;  3FAV A;  2R9I A;  3IC7 A;  4RAI A;  4K0K B;  1SS3 A;  1ZUQ A;  3HKB B;  2PI4 A;  1PD3 A;  1U96 A;  4UVA A;  1QU7 A;  4KUM A;  3ZMT A;  1R73 A;  4O4L B;  1BE3 H;  3CWB H;  1KKD A;  1I94 B;  4DR6 O;  1EM1 A;  3QF7 A;  5IYC O;  2DWE C;  3T1H O;  1HNW B;  4H13 B;  4X66 O;  3CCR V;  1UFI A;  4RUF A;  2GUZ A;  5KUM A;  2HJF C;  3CCV V;  4CBC A;  4B08 A;  3AG4 C;  4LFB B;  2ZIO A;  2A9H A;  3ABM B;  4QE7 A;  1GN6 A;  3ABT A;  4MW3 A;  1MAB G;  1GN4 A;  2BE3 A;  4X9Q A;  3FB7 C;  2JJ1 G;  5KHK A;  1SQP H;  4UUJ C;  4TT3 G;  3AG2 C;  4EB6 B;  4X88 A;  2IJI A;  3DTU B;  2GV9 A;  4X1Y A;  1VP7 A;  2FB5 A;  4RWU A;  3EVK A;  1V54 B;  4DV6 O;  4E2L A;  3E22 B;  1NJI W;  1FFT B;  4JYA O;  1OCZ C;  3M99 B;  1WPX A;  4UCO A;  3MAQ A;  3P32 A;  5KA6 A;  1NR7 A;  5LHI A;  2UXN A;  2MW2 B;  1PL4 A;  1VQO V;  3BRC A;  2N74 A;  4BIZ A;  1ARO P;  4CS3 A;  1YSC A;  4DV1 B;  3A8T A;  2X6B A;  3QO7 A;  2JS5 A;  4K8X A;  1Y66 A;  3ZIA G;  4MW8 A;  3ZMV A;  3E35 A;  4G28 B;  3Q4H A;  3SYC A;  3RFR A;  1S5H C;  1XNR B;  1MMM A;  1YJN V;  1H2L A;  2UXC O;  2YXH A;  3HKC B;  4NVP A;  3E8B A;  1UPG A;  3ABM C;  4J10 A;  3RN4 A;  2VQF B;  5BR8 B;  1K97 A;  3RBZ A;  1TAE A;  1P4R A;  2RN9 A;  3K3W A;  2UUA O;  1L8D A;  2B1G A;  2DJV A;  4JI6 O;  4CC6 A;  2AHY A;  4UVB A;  4LF4 B;  3FD9 A;  5BMV B;  2EX3 A;  1V54 C;  4B7K A;  1R1B A;  3AK2 A;  1Q82 W;  1AJP A;  1LUV A;  2ZT9 B;  2RCV A;  4BIU A;  4BAY A;  1WLE A;  4DUZ O;  2UXD B;  4X1I A;  1VQM V;  5IY5 B;  5L3G A;  1FFX B;  2AXT Z;  2IM9 A;  4ASU G;  1I5X A;  1EBO A;  2QWN B;  3AK3 A;  4O4H B;  4U7N A;  2FTK A;  3JD2 A;  2A7W A;  1I94 O;  1MSW D;  1NT2 B;  3IJ4 A;  3SYO A;  1P84 F;  1W2B U;  5IYD O;  4JI3 O;  1R6T A;  3LSU A;  2BTQ B;  3J80 N;  3JAR B;  4ZHQ A;  4FM1 A;  4PI2 A;  1H2G A;  4TUY A;  3AG7 A;  1Q7Y W;  4FK5 C;  1VQP V;  4DR5 O;  4GLX A;  4FLY A;  3OGI B;  2JK5 C;  4I55 B;  3OD4 A;  2P5O A;  1S3J A;  4FIP C;  4BWA A;  3FYE B;  4HNA A;  1JFF A;  1MSD A;  4PDM A;  2H8P C;  4YJ3 A;  4YJ2 A;  4IYH A;  5D5P A;  3D3Q A;  1YTF D;  4KHP B;  4FFB A;  1HR0 O;  4WBN A;  2R72 A;  1P7B A;  3CJH B;  4Q20 A;  4R50 A;  3SR2 C;  1Y74 B;  2W6J G;  2GTS A;  3FB6 C;  3WB2 A;  1NTK H;  4X1K A;  1DTO A;  4I7Z B;  3I5D A;  4EKW A;  2HR3 A;  3OW2 U;  3ZS8 C;  3OMN B;  5IY5 C;  2UUB O;  2CUG A;  4FFK A;  2KB1 A;  1L0L H;  2Y0I A;  5C8Y A;  5LYJ B;  3J81 N;  2RDC A;  2PUS A;  4DUY B;  1K33 A;  4LF7 B;  1Q6H A;  4OXS A;  2ITC C;  1E1Q G;  3T1Y O;  4QE9 A;  4DR7 B;  3N2K B;  2OTJ V;  3OTO B;  2JEX A;  3SJA C;  2QGN A;  1PP9 H;  1XNR O;  2XHB A;  1MG1 A;  3ABL B;  4IGG A;  3K9A A;  3E86 A;  3MHH C;  5ITZ A;  2VQF O;  1TVK B;  2DQ3 A;  2ZKO A;  1ORQ C;  3O9O A;  4CH3 A;  4EFE A;  3G6B A;  5KA5 A;  5JQG B;  1QNM A;  4AQY O;  3ASO B;  1JCH A;  3E2E A;  1ROP A;  5KHG A;  1JJO A;  2AW9 A;  2YUA A;  3ICX A;  2JGU A;  2QJ1 A;  4KP4 A;  5GW7 A;  1OCR B;  1Q90 D;  4F6R A;  3K58 A;  2WA3 A;  1HWY A;  3N2G B;  4O2B B;  2IU0 A;  2JIZ G;  1W0J G;  1HP8 A;  3CD6 V;  4QPJ A;  2ZM6 B;  1K5S A;  2QDO A;  3NXS A;  2IJH A;  3RYH B;  1EN6 A;  1G8M A;  1PKX A;  4UCT A;  5H9C A;  3K08 A;  3THO A;  4NYK A;  5KHJ A;  2CAZ C;  5EC1 C;  2QWP B;  2OIG A;  1XMQ B;  1AI6 A;  2XAG A;  3D3I A;  3LDC A;  3T1C A;  5KX5 A;  1RM1 B;  4UV8 A;  1XIL A;  1QR8 A;  5E1A C;  1IX9 A;  4F6E A;  3B8N A;  5IYZ B;  2AZ2 A;  1Y6X A;  1CXZ B;  4JI7 O;  1DLB A;  3WFV A;  4D7T A;  1S0V A;  2UXX A;  1EZJ A;  3ABL C;  1BQ0 A;  1PL0 A;  3K03 A;  3RYC B;  1GN2 A;  1K92 A;  2IH3 C;  3HKD A;  4AIL C;  1S76 D;  1YHQ V;  2ZD9 A;  1YIT V;  2ZR3 A;  3GWK C;  3HKB A;  3R66 A;  4HAM A;  3ASO C;  3HKE B;  1AVM A;  2HKO A;  4O4L A;  2ADQ B;  5LMN O;  1OCR C;  3MHS C;  3K9S A;  2E5L O;  1NR1 A;  4Z2W A;  2PY5 A;  2L35 A;  3IGA C;  3QNE A;  3ZHR A;  1QHT A;  2CE4 A;  3TJT A;  4I0X A;  1JX9 A;  5IJ9 B;  4LF5 B;  3GVM A;  2EIN B;  3CXH F;  4YY3 O;  4I50 A;  2PI5 A;  1IDS A;  2HEP A;  1N33 B;  4WFG A;  1R3K C;  1TUE B;  4JTC B;  1DGS A;  3RYI B;  3H01 A;  5L3E A;  4JZ2 A;  1O9G A;  5GTH Z;  1VQ7 V;  2K9P A;  4EB6 A;  2DOS A;  3W7X A;  4DUY O;  4NTX A;  2HP8 A;  4LF7 O;  2DYS B;  1RM1 C;  2UXB B;  2F95 B;  2O57 A;  3E22 A;  4I9Q A;  3OTO O;  4DV3 B;  5LHH A;  1EZV H;  1XEQ A;  3A0H Z;  4DR1 B;  1WB7 A;  3OGC C;  4JF3 A;  4ZI7 B;  2ZE8 A;  2WSS G;  2PYL A;  3OMA B;  1KEC A;  2KG7 B;  4DR2 B;  1Y76 B;  3FB5 C;  4DR3 O;  1EN4 A;  4TV8 B;  3AG3 B;  1NKD A;  2LW7 A;  4J80 A;  4JAA A;  4UCS A;  4JI5 O;  4FLZ A;  5EIB D;  5JVD B;  4JI8 B;  3FYI B;  3B09 A;  1JPX A;  1BGY H;  2A0L A;  4GX2 A;  1N0J A;  1BHA A;  1BT8 A;  1K7D A;  3BHP A;  2EIM B;  2C2A A;  1ZX3 A;  2Q6A A;  1SQQ H;  3APQ A;  1YZB A;  1ZL8 B;  3ZRX A;  2LO1 A;  3W7W A;  4OGQ B;  4AHC A;  5CBF A;  3L9D A;  5IWA B;  1T5E A;  2JEU A;  4YIP A;  2V4D A;  5KAI Z;  3LDE A;  4FM0 A;  1R6K A;  2OCC B;  2EIN C;  1IBL B;  3HKC A;  5LMU O;  4XDJ A;  3ABK B;  1XNQ B;  4QJF B;  4PA3 A;  5FLX N;  3K06 A;  1Z2G A;  3LSQ A;  2NN4 A;  4JTA B;  3C3S A;  2CH7 B;  3JAW A;  4UCR A;  2ADP A;  5EZY B;  3LUT B;  3ZHU A;  3DXR B;  1XMQ O;  1VQ5 V;  2P4K A;  1HNZ B;  1YVW A;  2L6L A;  5J2U B;  2WLI B;  2Y4U A;  1J5E O;  1WPB A;  1N34 O;  4B3M O;  4GX0 A;  3FKS G;  5BMV A;  2DYS C;  3ZN1 A;  2FML A;  1ZLZ A;  4DW0 A;  4BR6 A;  4MVR A;  3K5O A;  3UO3 A;  3JAS B;  1HNX B;  4JYB A;  3ZHQ A;  2HVJ C;  4CH4 A;  1LNQ A;  1RPR A;  3ZHS A;  4X64 O;  3CC2 V;  5HFM A;  2Q0A A;  3AG3 C;  3E83 A;  3SPC A;  2W6I G;  4PEL A;  2Q9L A;  2YC0 A;  4Z1V A;  2OIE A;  3RVZ A;  1SZT A;  2HG5 C;  1QBZ A;  1FJG O;  2LQT A;  4O4H A;  1N36 O;  5B5E Z;  4RUE A;  2VQE O;  1XBL A;  3HR0 A;  4H33 A;  2JGD A;  2EIM C;  2P67 A;  2BCC H;  2BTQ A;  3JAR A;  3CB2 A;  1SC5 B;  2Z3Y A;  4C7U A;  3L70 H;  1AI4 A;  4X8A A;  3A0B Z;  1EN5 A;  5LXT B;  2OCC C;  5LGN A;  1F51 A;  1TUB A;  3ABK C;  5JJE B;  4I55 A;  1GM8 A;  2YEV B;  1U97 A;  5KHH A;  3UCS C;  1OJH A;  2P90 A;  3E8H A;  2E74 B;  1GM9 A;  1AR5 A;  2N04 A;  4IIJ B;  4TSF G;  5KUK A;  2DMX A;  3E8G A;  1VF6 C;  4JI2 O;  1IBK B;  1VMG A;  3CJH A;  5D5Q A;  2Q4P A;  1DF5 A;  3H1H H;  1Y74 A;  3ETQ A;  4W4L A;  1IBM B;  3JAK B;  4JGS A;  2LJ2 A;  1XL6 A;  4BIO A;  4B3S B;  4JI4 B;  5BZB A;  3SPI A;  4AI8 A;  1WNS A;  4X20 B;  3H1L H;  4JI8 O;  3SGI A;  3JD1 A;  2IW5 A;  4EFB A;  2PGG A;  5JCO C;  4GKJ B;  3CME V;  1Q6U A;  3N27 A;  1KU9 A;  5B1B B;  1H2M A;  1FXK B;  4EEQ A;  4FVM A;  3N2K A;  5C93 A;  2BOB C;  4RQE A;  1R3I C;  2V7Q G;  3CMA V;  2HJD A;  4NXN B;  1N32 O;  3F7V C;  4OPA A;  4CZZ A;  2LGW A;  1TVK A;  3MDS A;  2EIJ B;  4DRX B;  1NTZ H;  4YHH B;  5CB4 B;  1NTM H;  2JS3 A;  1Z5W A;  2XOK G;  5CN0 A;  5DM6 V;  3CRA A;  1A32 A;  1YJW V;  4O4I B;  1ZAU A;  5CA1 B;  2F66 C;  3BAB A;  1QCE A;  1QQC A;  2E3C A;  2F43 G;  1M93 A;  1F4N A;  4LFA B;  1W59 A;  3TXS A;  3K79 A;  4G27 B;  3OFN G;  4FLU A;  3N2G A;  2CTR A;  2YS8 A;  3CHX A;  4O2B A;  4DV2 B;  1FAF A;  3ETG A;  1QLE B;  3P3N A;  1HDJ A;  4PHZ A;  4QIW F;  3SDL A;  3JSL A;  3SYP A;  3H9V A;  1SQV H;  5FPO A;  5FNV B;  3RYH A;  4PDL A;  3G80 A;  2HHH B;  2F93 B;  4PV1 B;  1NVP B;  3K59 A;  2Q69 A;  4D6T H;  2ZNI A;  3BCC H;  1OZ0 A;  4DV0 B;  1XMO B;  4DV5 B;  2H3O A;  1FS0 G;  1H2N A;  2YI8 A;  4ICG A;  5EYP B;  3JD4 A;  2LFR A;  2Q0O C;  3CRR A;  1R6N A;  3L75 H;  5B1B C;  4K0K O;  1FXK C;  1NI8 A;  4YIO A;  4DK1 A;  1IXB A;  1QR9 A;  2AHZ A;  5IYZ A;  1N0N A;  1OCO B;  4U7O A;  3UT5 B;  1ZTE A;  3E8F A;  1HNW O;  1VQK V;  1I7F A;  2Q73 A;  3RYC A;  2A3Q A;  4H37 A;  4TOI A;  3SYA A;  3CCQ V;  2EIJ C;  2WAM A;  2Q8V A;  4LFB O;  2LW1 A;  3C3T A;  2GHY A;  1SA0 B;  4GZR B;  2QR4 A;  4LBE C;  4NTW A;  4DR4 B;  3HKE A;  4NB5 A;  3SJQ C;  2N05 A;  3ZRS A;  3RGB A;  1IBK O;  1JMK C;  2R70 A;  3JD3 A;  1MZF A;  1B3Q A;  1BL8 A;  4JV5 B;  4DV4 B;  4L8J A;  3D8C A;  1IBM O;  3VQY A;  5L3B A;  5IJ9 A;  2QEX V;  3LSS A;  4UVC A;  3WB0 A;  1QLE C;  3F5T A;  4TQD A;  3SPH A;  1M9N A;  3AK1 A;  2P06 A;  1S77 D;  4NTY A;  5L3C A;  2UUC B;  1VEW A;  4ZBM A;  1JA8 A;  3RYI A;  5BXZ A;  4RO2 A;  2PYJ A;  5HFL A;  1RSO A;  1NH2 D;  1G6U A;  4WFE A;  2EZO A;  1NU1 H;  3CE2 A;  3CSX A;  4UB6 Z;  3TCU A;  4TWK A;  4JI0 B;  3L73 H;  1SES A;  4G2K A;  4LNU B;  3STL C;  2QKA A;  3CCM V;  3H1J H;  4DV1 O;  2VS0 A;  4JZG A;  2OWO A;  4UFZ A;  2ZNJ A;  2JDI G;  1YCI A;  4NXN O;  1OCO C;  1M57 B;  5H5N A;  4ZI7 A;  1GMG A;  1THZ A;  2KG7 A;  1GO3 F;  1Y67 A;  2P4V A;  2D3O W;  2ZDI C;  4YHH O;  1H2K A;  4TV8 A;  1JVM A;  2NR5 A;  2BTO A;  2Y69 B;  4UB8 Z;  5JVD A;  3L74 H;  2E75 B;  2W0F C;  5BR8 O;  3LNM B;  1DK1 A;  1JR9 A;  3C90 A;  3TET A;  4I4T B;  4NKG B;  2DQ0 A;  1X59 A;  1ZL8 A;  5GTI Z;  3DC5 A;  2HFE C;  1KP2 A;  2XT9 A;  1S5L Z;  1PPJ H;  2F4V B;  4LF4 O;  4DV2 O;  3T2M A;  1Q3E A;  4LF8 B;  4DW1 A;  5LHG A;  4HBN A;  2HHH O;  5H6R A;  4JPR A;  5GON A;  5IJ0 B;  2LFS A;  5LBQ A;  1AR1 B;  2CH7 A;  4DV0 O;  3DXR A;  2QTO A;  3G71 V;  1NZ6 A;  2OTL V;  4MVO A;  2UXD O;  4DXW A;  4CH6 A;  1K4C C;  4H44 B;  3TXQ A;  5J2U A;  2WLI A;  2CGO A;  2W0X A;  1VF6 A;  1UJW B;  5IYB O;  4K8Z A;  3K5N A;  1SZX A;  3GB7 C;  5CA0 B;  4DV7 B;  1H2S B;  4UXN A;  1S5J A;  4B7E A;  1AP6 A;  3ETE A;  4WFB V;  2NNU A;  3JAS A;  4UV9 A;  3WG7 C;  3R65 A;  2H94 A;  1M57 C;  5H2F Z;  4B3T B;  4KXR A;  1B6Q A;  1JJ2 U;  2X6A A;  1R3L C;  2RQ6 A;  4PA6 A;  3EHB B;  2YIB A;  5CBH A;  3JD0 A;  1M1K W;  2Y69 C;  3BY6 A;  4MVS A;  5CA3 A;  2OT5 A;  4MVU A;  4IL6 Z;  1M56 B;  1M5I A;  3BPZ A;  5A9G A;  1XDC A;  1WP7 A;  1YIJ V;  4O2A B;  1AIL A;  2FL4 A;  3CX5 F;  3OM3 B;  1BMF G;  4JAS A;  3BFR A;  4DV4 O;  4BW5 A;  3ZJZ A;  3CPW U;  4KHP O;  1V9P A;  3K0D A;  3FB8 C;  2WA4 A;  3LDD A;  1JQ0 A;  2PZS A;  3EXA A;  5LXT A;  4GUN A;  4X65 B;  1AI7 A;  3NR7 A;  3PN1 A;  5JWP A;  2WWW A;  2GTA A;  3J7A U;  1PV0 A;  4H0L B;  4A5U B;  4U3J B;  3CXC U;  4IIJ A;  2EJR A;  1VQL V;  1K73 W;  3U0Z A;  2IJJ A;  1OCC B;  2ZR2 A;  1KMI Z;  2V1D A;  5FL7 G;  2ATK C;  3DSQ A;  3STZ C;  2K1E A;  5EBL C;  3JAK A;  4WFA V;  3CC7 V;  4DR6 B;  3AEI A;  1Q43 A;  4DR7 O;  3I56 V;  3T1H B;  4LWS B;  2QM7 A;  4DK0 A;  4X66 B;  4PA7 A;  4UCU A;  4MTF A;  5KMG B;  1GKF A;  1JOY A;  2EIL B;  2EUL A;  4X20 A;  2ZE7 A;  4TV9 B;  3H1K H;  2ZE6 A;  2Y48 A;  4L87 A;  4U3F H;  3G4S V;  1X4T A;  5LP6 B;  1SRY A;  1M56 C;  3U11 A;  1Q5O A;  1SET A;  1FXK A;  3K5M A;  1P49 A;  1F7Y A;  1QVF U;  2JJ2 G;  3H1I H;  2CK3 G;  3KG2 A;  1K3E A;  1NQT A;  3CCJ V;  4ZOL B;  1M90 W;  1BHB A;  4LF8 O;  4DV6 B;  1PNM A;  4JYA B;  1FXH A;  4LFC B;  1ZWI C;  3OAA G;  4MSW C;  4JI1 B;  1OV9 A;  1B06 A;  3JAT B;  5B1A B;  3FFQ A;  4ABM A;  4LF6 B;  4DRX A;  1PNK A;  5CB4 A;  1YDX A;  5ITZ B;  2ZM6 O;  1GM7 A;  3SJB C;  1L1F A;  1WN7 A;  2WLH A;  4O4I A;  5CA1 A;  4FM2 A;  1OCC C;  3UQ8 A;  2IU3 A;  1K4D C;  4DV7 O;  1YI2 V;  4GKK B;  2E76 B;  4JAU A;  3RT3 C;  3QO8 A;  1VAR A;  3ZCC A;  2YIA A;  1XHZ A;  5J2T B;  2VWJ A;  1H8H G;  1K5Q A;  4GX1 A;  5FNV A;  1FKA O;  1YTF B;  1K34 A;  3ASN B;  3WU2 Z;  2UXC B;  2EIL C;  1FPO A;  3K57 A;  4IHJ B;  3UM7 A;  4P9P A;  1SF9 A;  1FXV A;  2MK3 A;  3ZMU A;  5JJN B;  2X0L A;  5EYP A;  1EFR G;  3GWO A;  4LR3 A;  2QA4 V;  1GTO A;  5LP6 C;  3SPG A;  1FFX A;  4N21 A;  1I08 A;  2UUA B;  4E4E A;  3IC9 A;  2XTA A;  3QG5 A;  4CS2 A;  3TK1 A;  4R6Z A;  3UT5 A;  1N8R W;  4JAV A;  3S3W A;  5LOV B;  4GX5 A;  2P6J A;  5B1A C;  3G6E V;  2R9A A;  4LF5 O;  2XAS A;  2ZIM A;  1PNL A;  1SA0 A;  3HKD B;  2DYR B;  1N33 O;  4YXW G;  4MVQ A;  3JAL B;  1AR4 A;  3KCX A;  1FYJ A;  3X2Q C;  4MVM A;  3B40 A;  3T4D A;  3VOU A;  3FX7 A;  5K1P A;  2HLD G;  4HYO A;  2UXB O;  1SQX H;  4JI3 B;  4MTX A;  3BVO A;  1CP9 A;  4I0X B;  4X89 A;  3D36 C;  4DV3 O;  3TGU H;  1BSM A;  4DR1 O;  5H6Q A;  3LNN A;  4DR5 B;  2X7R B;  5BY1 A;  3HPL C;  4I50 B;  3ASN C;  2AGA A;  3UKM A;  3W7S A;  5LA6 B;  2IJK A;  1G4Y B;  3EFF K;  1KKC A;  1GK9 A;  4DR2 O;  4DO2 A;  2XUM A;  3KCY A;  3B4S A;  3K5L A;  2BSK B;  5L3F A;  2ILM A;  4LNU A;  3ZMS A;  2GBO A;  1RPO A;  3APO A;  5J9P C;  1HR0 B;  2PTM A;  1VIB A;  4CS4 A;  5EBM C;  1KB9 F;  4UCV A;  5LYJ A;  1GN3 A;  2HVK C;  2WLJ A;  3RW0 A;  5JH7 B;  4LFC O;  2FKX A;  3DGE A;  3PJS K;  4JI1 O;  1HW7 A;  5K1X A;  5LGT A;  1IVS A;  4LF6 O;  5IWA O;  3JCU Z;  2Y0P A;  1IBL O;  3JYC A;  1VQ6 V;  2DYR C;  1XNQ O;  2RNB A;  4WF9 V;  3ML0 A;  2UUB B;  3RYF B;  1YJ9 V;  2YXL A;  2QE7 G;  5JQG A;  4I9W A;  1MZE A;  3F5W C;  3JCZ A;  4I4T A;  1HNZ O;  1Y4M A;  4GKK O;  2KSD A;  1DF4 A;  2CGN A;  4D7S A;  4KL1 A;  5IDJ A;  3L72 H;  5CMU A;  2A79 B;  3VBB A;  3T1Y B;  4O4J B;  1MNG A;  4NXM B;  4RQF A;  4XDK A;  4FLW A;  3O65 A;  1E1R G;  3K04 A;  3AG1 B;  5IJ0 A;  1W0K G;  1ENV A;  1HNX O;  1RFY A;  2GDS A;  1WP8 A;  1IUR A;  2F1M A;  3B2E E;  1WB8 A;  2WLN A;  1XRE A;  2FYU H;  2A06 H;  3ZHV A;  3JAW B;  1L0N H;  3QO5 A;  4AQY B;  4CC5 A;  3ZRW B;  5KLV H;  2WLL B;  2LP7 A;  4TQF A;  2NLJ C;  4B3R B;  5CA0 A;  4PJ0 Z;  3OR6 C;  1LUW A;  3OT7 A;  3BA8 A;  2YDE A;  1S72 V;  1H38 A;  4CH5 A;  4JYY A;  5IT9 N;  4PDV A;  4NR1 A;  2CTW A;  2R9R B;  2ZE5 A;  2IH1 C;  1R3J C;  2B9Z A;  5EK0 A;  1WA8 B;  2XAF A;  1RP3 B;  4K35 A;  3L71 H;  1AJQ A;  5DN6 G;  4R8C A;  2QM4 A;  4J9Y B;  3I55 V;  3CCS V;  4MS2 A;  1D2D A;  1D5N A;  2XAQ A;  4LF9 B;  1Q81 W;  2P22 C;  4WFH A;  2VRZ A;  3OMI B;  3B8M A;  4O2A A;  1J95 A;  4J42 A;  1SQF A;  2EIK B;  3ZX6 A;  3U10 A;  2M7W A;  1V55 B;  2Q7E A;  3FAV B;  2QWO B;  3ZED A;  5EBW C;  4P2Z A;  5FPR A;  2QWQ B;  2JGD B;  3RVY A;  2WLK A;  4GT1 A;  4P30 A;  2QSA A;  1G1X B;  4JI7 B;  3AG1 C;  4PA9 A;  1QLN A;  2XAJ A;  4P9O A;  1TUB B;  4B3S O;  1IXM A;  2ITD C;  4JI4 O;  4PDR A;  2GUZ B;  4U3J A;  1KQS U;  1VF5 B;  2UU9 B;  5LGU A;  2JVD A;  4GKJ O;  3B77 A;  2JRI A;  2Y4T A;  5LL6 Y;  3KKY A;  3A0R A;  2ZXW B;  3F7Y C;  5LMN B;  1B04 A;  3M7M X;  1GH6 A;  2E5L B;  1Z5V A;  2RJZ A;  1F23 A;  2KKW A;  3KZI Z;  1SQG A;  1AP5 A;  3CC4 V;  2ODM A;  4LWS A;  1GAX A;  1AI5 A;  1MA1 A;  3W7U A;  1KBH A;  3BAA A;  1US6 A;  2EJ7 A;  4X1Y B;  3W7T A;  5KMG A;  2YIB D;  4YY3 B;  3WG7 B;  1CPY A;  1VQ9 V;  3ZMZ A;  5F2V O;  4TV9 A;  1AB3 A;  5A2Q N;  5B3S B;  4X62 B;  4LCU C;  1Y76 A;  5LP6 A;  2Q67 A;  4IYI A;  2Z0A A;  2F23 A;  4FZ1 A;  2EIK C;  5AG2 A;  5L3D A;  4MTO A;  1V55 C;  3JAM N;  1XUQ A;  2D2C B;  4ZOL A;  4K3A A;  1KC8 W;  4HZ3 A;  4F4L A;  4FPP A;  3CRQ A;  3SYQ A;  4NXM O;  2DW4 A;  5EIB C;  3M8A A;  4LFA O;  4XBF A;  1TA8 A;  2QKS A;  3JAT A;  3OEE G;  4PA4 A;  4BW9 A;  1K9M W;  2PF4 E;  4XDL A;  4FLT A;  1XOU A;  1WJZ A;  3Q4H B;  2EZP A;  4LC1 A;  4DR3 B;  1F4M A;  2ARH A;  1SER A;  4QPK A;  2B5U A;  4JI5 B;  4JYC A;  1KD1 W;  3QVN A;  4DYL A;  5EZY A;  5KHI A;  1XMO O;  3ZRV A;  4DV5 O;  4MVZ A;  5JJJ B;  2ZIN A;  4B3R O;  5DED A;  2OCH A;  3OEH G;  2RMK B;  2ZXW C;  3VQX A;  4MT8 A;  1Q86 W;  3K0G A;  3ZHT A;  3CCU V;  3D36 A;  5J2T A;  3CRC A;  1WAZ A;  4LP8 A;  5DEC A;  1H8E G;  5EC2 C;  2XAH A;  1YEW A;  1CEZ A;  4IHJ A;  5LMU B;  1I0H A;  4LF9 O;  3CCE V;  5B3S C;  4ZIB A;  4OX9 B;  1M4U A;  1BCC H;  1N4C A;  4QNH B;  2EBO A;  5B1O A;  3G67 A;  5JCO A;  1XI1 A;  3WB1 A;  3VQW A;  3RWR D;  4X1I B;  1NBM G;  1J5E B;  4PI0 A;  4N23 A;  4DR4 O;  3CRM A;  4LH6 A;  4FJC C;  1N34 B;  4B3M B;  1VQN V;  1NS1 A;  3CP1 A;  4QGP A;  4MTG A;  4JV5 O;  1XQ8 A;  5LOV A;  1XHX A;  4JTD B;  2Q7G A;  4ZHQ B;  3HB3 B;  2ETN A;  5IE9 A;  2YID A;  2QKC A;  4TUY B;  4X64 B;  2DN9 A;  1K8A W;  3QTC A;  3JAL A;  2UU9 O;  2UUC O;  5KAF Z;  2YEV A;  1LR1 A;  3BEH A;  4KFM A;  1AJN A;  2DWD C;  1FJG B;  1O9H A;  1N36 B;  2VQE B;  2QWR B;  1QVG U;  1I5Y A;  3CYO A;  4HNA B;  4JI0 O;  1JFF B;  4YJ3 B;  4YJ2 B;  4ZKI A;  2CTQ A;  3SJC C;  4FZ0 A;  5TIS Z;  1NVP D;  4FFB B;  3VQV A;  2IBZ H;  4WBN B;  2QM8 A;  1SKV A;  2YI9 A;  5LA6 A;  2B1I A;  4FLX A;  1VQ4 V;  4X62 O;  3MD0 A;  1YXB A;  4X1K B;  4W4K A;  3IFX A;  1KYO F;  4J7J A;  1RSO B;  1SQB H;  2BSK A;  1MOF A;  3P30 A;  1FD9 A;  4I5S A; 
#chains in the Genus database with same CATH homology
 2BCC H;  3L75 H;  1NTM H;  3CX5 F;  3CXH F;  4U3F H;  1NU1 H;  1PP9 H;  1PPJ H;  1SQV H;  3L70 H;  1BE3 H;  3CWB H;  2FYU H;  2A06 H;  3L73 H;  1EZV H;  3H1I H;  3L72 H;  3H1L H;  1L0L H;  1BGY H;  1SQX H;  1BCC H;  1SQP H;  1L0N H;  3H1J H;  1KYO F;  3L74 H;  3H1H H;  4D6T H;  3BCC H;  1NTK H;  3TGU H;  1SQB H;  5KLV H;  3L71 H;  4PD4 F;  1P84 F;  3H1K H;  1SQQ H;  1KB9 F;  2IBZ H;  1NTZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...