3L75H

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l75H00
3L70H 1L0NH 3CWBH 3L74H 4U3FH 1SQBH 3CX5F 1NTKH 1SQPH 1SQQH 1L0LH 1BCCH 1KB9F 1NTZH 3L72H 3H1JH 1BE3H 3L73H 4PD4F 3H1HH 2A06H 1P84F 2IBZH 3L75H 3H1KH 1EZVH 1SQXH 3BCCH 1SQVH 1PP9H 3CXHF 1NU1H 1BGYH 2BCCH 1PPJH 1KYOF 1NTMH 2FYUH 3H1IH 3L71H 4D6TH 3TGUH 3H1LH 5KLVH
chains in the Genus database with same CATH superfamily
1XNRO 4R8CA 4J7JA 3UT5A 2XOKG 4WBNA 1Y67A 2B9ZA 3PN1A 4PI2A 4RO2A 1RM1B 1Y6XA 5B3SC 2YDEA 2OT5A 4CH5A 3EHBB 4MT8A 3WU2Z 5EK0A 1FXVA 4CS2A 2OWOA 5A2QN 2ZXWC 3H9VA 4GKKB 3CE2A 3AK1A 1VQLV 2B1IA 5DN6G 5JJEB 2ZD9A 1X59A 3KG2A 1BQZA 4DR6B 4Q6GA 5JVDA 2P4VA 4I7ZB 3WG7B 5LMUB 3VBBA 4X9QA 1W0KG 3TGUH 4DRXB 4NXNB 4O4JA 1RPRA 4DV7B 5J2UA 3RFRA 4AQYB 1YJ9V 3JALB 1SRYA 3RYIB 2QWNB 3JD1A 1CXZB 5TISZ 2LO1A 2EJRA 4FFKA 3SJBC 5KHHA 1N8RW 1NR7A 5KHJA 1UFIA 2K1EA 1XMQB 5LL6Y 4JZ2A 1S3JA 2EIJC 5IWAO 4G27B 2CDYA 4I55B 1GM8A 4J7ZA 1BCCH 2X7RB 4X62O 3T1HO 5EYPB 1N34B 1HWYA 3ABKC 3ABKB 1K9MW 3JD0A 5C8YA 3ZIAG 5F2VO 1HDJA 2ADQB 1QVFU 1BHAA 4YJ2A 2YIDA 4BIOA 1B6QA 2NNUA 4YJ3B 1I0HA 4UCOA 1MZFA 1SQBH 1PKXA 4MVOA 2AHYA 3E22B 3UKMA 3CCUV 2E3CA 3ASNC 3H1JH 1FJGB 1XNQB 2BOBC 4DK1A 4UB6Z 2Y4TA 2UXNA 2LJ2A 2YEVB 1KKCA 5LA6A 2H3OA 1PV0A 4N21A 2H94A 4LF5B 1H2LA 1FFXA 1CP9A 4IYHA 2ATKC 5LOVA 4NKGB 2JEUA 2JEXA 3S3XA 1SC5B 2HG5C 3ETGA 5LMUO 5IYZA 1WJZA 5L3DA 1TUBB 4PI0A 1XOUA 3QVNA 4NXNO 4DV7O 3CRAA 1S5LZ 4AQYO 3VQWA 1O9GA 3M7MX 3CMEV 3FB8C 1JJ2U 5BMVB 1W2BU 2ZKOA 1R6NA 2PGGA 4X66O 3AEIA 4PA9A 2ZE7A 4NTXA 2EIKC 5J2TA 1HNWB 2KB1A 3SDLA 3DXRB 4QJFB 1K73W 3APQA 1ZSPA 1IBLB 4HZ3A 3L74H 1DGSA 3H1HH 2RCVA 1M90W 1E1QG 2E5LO 3LSUA 3E35A 4WFBV 2ZE6A 5CN0A 1EBOA 3L9DA 1LUWA 1Q90D 3RYCB 2Z3YA 1Z5VA 1FD9A 1OCRB 1FJGO 1XNQO 2B1GA 5KUKA 1FPOA 1H2SB 1OHHG 2MK3A 3AG1B 3FX7A 1XILA 5JQGA 5GONB 2IH3C 3T4DA 3CCQV 1N36B 5KX5A 5LMNB 4K35A 3FD9A 3ZMUA 3U10A 1Q82W 4TOIA 3ASOC 1E79G 3EXAA 3K57A 1JPXA 5KAFZ 3CRCA 3ABMC 2F4VB 3RYFB 2X6CA 4H33A 4P30A 1GN4A 4LFAB 3HPLC 2UXCO 3D36A 4BWAA 3L71H 3D3QA 5K1PA 1ZL8A 4O4JB 5J2UB 2JGUA 1I7FA 2IW5A 4P9PA 1MNGA 5DM6V 1Q8IA 4LC1A 5LYJA 3AG4C 5LGUA 4GT1A 4MVSA 5GW7A 3C3TA 1FKAO 5LXTB 1IBLO 2ODMA 1BSMA 2DQ3A 3ABLC 4DR4B 2YIBD 2ZDIA 4DV4O 3HKEB 2E75B 1GKFA 3CHXA 2ZT9B 1QR9A 3P32A 3CRRA 4RUEA 1D2DA 1M56C 4I4TA 4IHJB 2Q67A 2R70A 3CYOA 1Q6HA 1S72V 2VRZA 3DSQA 4JTAB 4IGGA 2OTLV 4LFCB 3DC6A 1JR9A 1T5EA 2EBOA 1F4MA 2WA3A 2HJFC 2Q68A 4UV9A 4KXRA 5LGTA 3OFNG 1VQMV 1N36O 1YEWA 2YIAA 3G6EV 4X20A 5LA6B 3OTOO 2ZIOA 2ILMA 2W0FC 3OUSA 4K3AA 1R73A 1BL8A 1K33A 2RQ6A 1CEZA 2F4VO 3ML0A 5B1BC 5IY5B 1ZLZA 3LSQA 2AW9A 5IYZB 5JH7B 3K03A 1SESA 4X65B 4TWKA 4K8XA 3UQ8A 3CXCU 1PNLA 4FK5C 2Z0AA 3QO8A 4D6TH 3HR0A 3JYCA 2PTMA 4E4EA 1L0NH 3WB2A 1D5AA 2YUAA 2LGQA 1HR0O 2AGAA 2ZR3A 2ZIMA 5BY1A 3FKSG 1HNXB 3ZHQA 4JI3B 5KHIA 1AB3A 2QSAA 4LR3A 1M57B 1SQVH 2X6AA 4LFBO 1L1FA 1N4CA 3R65A 3CS5A 1KP3A 2E76B 3N27A 4F6RA 4B3SO 3QO7A 1PM9A 1PNKA 2WSSG 2ARHA 3G71V 3TXSA 3OEHG 3L73H 3RVZA 4JV5B 1NJIW 3JALA 4DR5O 4OPAA 4TT3G 3TXQA 1S0VA 3ZRWB 2RMKB 1ROPA 2E74B 2JS3A 4H0LB 4DR2B 4EEQA 4LFCO 3IC7A 3AG2C 4WFEA 2HP8A 4JI8B 4CH4A 2OCCC 4FLVA 2Q7HA 3NR7A 2QTOA 3SPGA 1XREA 3B77A 1ENVA 4DV6O 1WNSA 4I55A 3RW0A 2VWJA 2GHYA 4LH7A 4NYKA 1JJOA 5EYPA 1PPJH 2YIBA 3CSXA 1GN6A 4JI6B 4JI0B 1P49A 1Z5WA 3VQYA 3A0HZ 5LBQA 4YJ3A 4B3TO 1OCZB 2P06A 4J7KA 3HKBA 4TQFA 4HBNA 4UFZA 3P3PA 1K4DC 1PL0A 4BR6A 2QEXV 2EZPA 2ZNJA 3IGAC 4CH3A 4B7KA 2YEVA 3B40A 3A0RA 2QDOA 3ZHRA 1HNXO 3BFRA 2ITCC 1GMGA 4PJ0Z 3ZHSA 4KUMA 3NXSA 4XBFA 3ZHUA 2QM8A 2K9PA 1RPOA 1AP6A 2NR5A 5FNVA 4JYCA 1SERA 1I5YA 1L8DA 2ZDIC 4GX5A 4DYLA 2C2AA 3QNEA 2BSKA 3P3NA 2F66C 4MS2A 1P7GA 3T2MA 4YY3B 3JCUZ 1I08A 4JV5O 4QE7A 4J9ZB 3ETQA 5KA6A 4DV3B 1X4TA 4JYBA 2GV9A 3BPZA 4FVMA 5BMVA 1IVSA 1XBLA 4UCTA 3J81N 4J41A 1P7BA 4JAUA 1JFFB 1QLEB 1QVGU 3QO5A 5K1XA 3DXRA 4O4HB 4A5UB 4MW8A 4TSFG 3F5WC 5IWAB 1AILA 3KCYA 1B04A 1J95A 3K5OA 4JI0O 4X88A 3JCZA 1K7DA 4X62B 5IE9A 3T1HB 4YHHO 2PYJA 1NT2B 1OCCB 1ZX3A 3A2FA 2QKSA 3CPWU 5L3BA 1SQQH 3RYCA 2P4KA 4WFAV 3ABTA 3C90A 4LF6B 1AI4A 1RM1C 4L87A 4ZBMA 2M6YA 2GTAA 3R66A 5GONA 2F43G 2QGNA 3CCSV 1R6TA 3OUFA 1YI2V 1H38A 4CC5A 4GX0A 1EZJA 4MW3A 3LDEA 2LFSA 3WB1A 3RYFA 1WPBA 1MZEA 1AJQA 4ZOLB 3K0GA 4HAMA 1RP3B 3WG7C 2V4DA 4F6RB 2BOCC 2GUZA 2IH1C 4DR1B 2ZE8A 2QM4A 4YY3O 3OMAB 4TV9B 2EX3A 4H13B 4OX9B 2AXTZ 4DV3O 3K3WA 3LDCA 2WLJA 2WLIA 3I56V 1P84F 3E8GA 2IBZH 5B66Z 4PDRA 5J9PC 4R7CA 3M99B 2A9HA 4X66B 4LWSB 1PD3A 3M8AA 4J11A 5LXTA 3ZJZA 5KHKA 5EZYA 4MVQA 2VQFO 4KFMA 2DN9A 4MSWC 2EILB 2HKOA 2UUAB 3OMIB 3RYHB 3HKEA 4FMTA 3LDDA 3CXHF 4GCZA 4MTGA 5KMGB 2JIZG 4NVPA 3APOA 3JAKB 4H37A 4XDJA 5JJJB 2UXDO 2E5LB 5GTIZ 2HEPA 2RJZA 4IHJA 3ZBHA 1AR1B 3HKBB 3ZMVA 2WLLB 4LF6O 1SKVA 3K9SA 1M93A 3CC4V 2WLNA 2YSUB 4MTOA 3SPHA 1WP7A 4U7NA 3IFXA 1V54B 3D3IA 3GWOA 3O9OA 1AR4A 1QU7A 1YDXA 4LNUB 3ABUA 2Y69B 5EBMC 4GX1A 4FLYA 4DV2B 4O4LA 2L35A 1R6KA 1VIBA 2XASA 4PD4F 1I5XA 5FNVB 5JH7A 1MA1A 1QNMA 4DR1O 2QE7G 3K79A 1OJHA 2DYSB 2BSKB 4UV8A 1NVPB 3K04A 2UXCB 4OX9O 4BIUA 1S77D 3RWRD 5C93A 5IYDO 3A0BZ 1BT8A 3CMAV 2JDIG 2HJDA 4DR3B 2ZR2A 2W6IG 5LGNA 5EC2C 1LUVA 4D7TA 3T1YO 1I94B 3OTFA 2IJJA 1JQ0A 2DWEC 3LNNA 2V7QG 2A7WA 3CP1A 5KA5A 3J80N 1BS3A 2LP7A 2UUAO 4IYIA 5L3GA 4DV4B 2O57A 1VEWA 2QA4V 4FLZA 1YZBA 1GM7A 4UVBA 2WAMA 1IXBA 4PA7A 1TGOA 5CMUA 3ZRWA 1KC8W 3ZRVA 4J42A 1RFYA 1YCIA 2CUGA 2QM7A 1IX9A 3F7YC 1OCRC 2BTQB 3OR7C 3AG1C 1EN5A 2KG7B 3CRQA 5H9CA 2AZ2A 4NTWA 1KD1W 4I0XB 3E83A 4DV2O 3HKDB 1XHZA 3TETA 3OTOB 3ZMSA 1J5EO 3QG5A 3W7UA 1VP7A 4QGPA 4CH6A 5IYCO 4HNAB 3OGIB 4AILC 1SETA 2JS5A 3ICXA 3B2EE 1B06A 3I55V 4TQDA 3ZHVA 1VQOV 1S5JA 1ORQC 1IXMA 2GUZB 4GX2A 3E86A 3MDSA 4BW5A 1LNQA 3BEHA 3UO2A 1XL4A 1URFA 4AHCA 2NN4A 2P5OA 1O9HA 4JI5O 4DR3O 2ZE5A 2WLIB 3VQVA 1W59A 1H2KA 1WA8B 4JI4O 3STZC 1I94O 1HR0B 1SS3A 1K5SA 2YI9A 3IJ4A 2P67A 1FS0G 1SQFA 4X89A 2Q5ZA 1MOFA 1U97A 5EZYB 1VF6A 4LFBB 3ZX6A 4QNHB 1VQKV 4RQFA 1Y4MA 3OD4A 4B3SB 3ZMZA 3SJQC 3CEIA 1YJWV 3WB0A 1BZKA 1AJPA 4U7OA 4NR1A 3SJCC 2JJ2G 2DMXA 4DR5B 4RUFA 5FL7G 3RN4A 1N0NA 2CAZC 3F7VC 1JFFA 4IT5A 2Y48A 3BVOA 4CS3A 3SYOA 3JATA 3E8BA 2XAGA 3OW2U 1NI8A 2CH7A 3UO3A 4O4HA 2HFEC 1N33B 2IU0A 1YTFD 2A06H 3JASB 3HKCA 1IBKB 3OGCC 1JX9A 1K8AW 1MSDA 1ZAUA 2DOSA 4DV6B 4DO2A 5IYBO 4DUZO 1COWG 4BW9A 2HHHO 2UUCB 4IIJB 4O4LB 3SJAC 1SA0A 4MTXA 2UXBB 3SPJA 2QJ1A 1VF7A 5B1NA 5IY5C 1NVPD 2XAHA 4DW1A 4B3TB 4ICGA 3Q4HB 3JAMN 2EULA 4ZHQA 2OCHA 4LF4B 4DR7B 1US6A 1WB8A 1E1RG 2M7WA 2AHZA 2IU3A 4K0KB 1DTOA 2A0LA 1SQPH 2QKCA 2KQXA 4CZZA 2YXHA 2PI4A 3VOUA 4E2LA 2PZSA 4EFBA 2XNDG 1M57C 5EIBD 4P9OA 1NTMH 2P22C 2R9IA 2XAQA 3FYIB 1VQ8V 3RVYA 1TA8A 4WFFA 4ZOLA 3FAVA 3SR2C 2N04A 1H8EG 4TV9A 3S3WA 3BABA 3CCEV 4CS4A 3SPCA 1THZA 1F7YA 4JPRA 5EC1C 2UUBO 1N0JA 3ZEDA 2OTJV 4B08A 2HLDG 3OE7G 2PUSA 3ZRXA 4UCUA 2Q7GA 3ZCCA 1U96A 5D5QA 3K5NA 4LWSA 1IBMB 1YXBA 3SYCA 4DV5B 1D5NA 3T1CA 1N33O 5KUMA 1IBKO 4C7UA 4XDLA 5LP6A 1QQCA 2FKXA 1R3KC 3ZMTA 1OZ0A 2UUCO 3CCRV 1QCEA 2YI8A 4KL1A 4NB5A 1EM1A 3RYHA 1K92A 3CCMV 3H1IH 1GM9A 2UXBO 2PF4E 1P4RA 4X1YA 4JI7B 5KMGA 3CCVV 3JAKA 4YHHB 3TCUA 1TVKB 3JSLA 2LW7A 5DECA 4UCRA 1OCZC 4B3MO 4UXNA 4PDMA 4K8ZA 2WLLA 2ZQMA 2CK3G 3D36C 4LF8B 1VQ4V 2AZ0A 4LF4O 4DR7O 3JD4A 3K58A 1WP8A 1H2GA 4UCVA 4W4KA 4ZI7B 5H5NA 4K0KO 4ASUG 3D8CA 3X2QB 2PY5A 3B8MA 4LF9O 4LNUA 2WWWA 2DQ0A 2EINB 1BE3H 1QLNA 5L3CA 1G6UA 3LUTB 2MW2B 4X1KA 1N32O 2WA4A 1VF6C 3JD2A 1AI6A 3G4SV 1DF5A 2IM9A 1ZWIC 4LP8A 3ZN0A 2GTSA 3DTUB 3SPIA 1Y76B 5CBGA 4FJCC 2XAFA 1KBHA 3N2GB 1VARA 2XT9A 2EZOA 4FLUA 1QLEC 1IBMO 2D3OW 1Q7YW 4R50A 4DV5O 3JATB 1LR1A 2EIMC 4I50B 2EIMB 2CH7B 3ZN1A 3CC7V 2Q6AA 1GO3F 3AG3B 4FFBB 4I9WA 4Q20A 4TV8B 1L0LH 3HKCB 2UU9B 4CBCA 1WPXA 2VQFB 4JTCB 4JI7O 4KHPO 1H2MA 1Q3EA 5IJ0B 4U3JB 1SA0B 1YVWA 4DUYB 1ZTEA 1NR1A 4X8AA 1OCCC 1AP5A 2UXDB 3L70H 2QWRB 2W6JG 4LF8O 4JYAB 2ADPA 1HNZB 2GDSA 2WLKA 2BTQA 4ZHQB 2RDCA 2R9AA 2XHBA 1NH2D 4PA4A 4FLTA 2KG7A 4I0XA 2DE0X 5B1OA 1SZXA 1R3LC 3HKDA 1NTKH 3TJTA 3CJHA 5B3SB 2R72A 1EFRG 1IZ3A 3BY6A 4HNAA 1B3QA 1GH6A 1DLBA 4FM0A 3FAVB 4G2KA 3F5TA 1BQ0A 3AK3A 4I5SA 2ZXWB 4X64O 4F4LA 3ETDA 3RBZA 3AK2A 5CA0B 1VQ5V 2WPDG 3K5MA 1MABG 5BR8B 4DV0B 4PDLA 2F1MA 4LH6A 1F51A 2YS8A 4PV1B 2NLJC 2QWPB 2ZM6B 3L75H 2Q69A 4PA6A 3EFFK 1WA8A 4PELA 3H01A 2VQEO 4O2AB 3CRMA 2Y0IA 1K34A 4DV1B 2A3QA 2Y4UA 2BE3A 4N23A 1XQ8A 5LHIA 3T1YB 2ZINA 2N74A 2YC0A 2OIGA 2UU9O 3AG7A 5LP6C 5LP6B 1DF4A 2CTWA 4OGQB 2EILC 2EJ7A 1IURA 4O2BB 3H1KH 3E89A 4X1YB 5HFLA 4DUYO 4B3RO 4FM1A 3J7AU 2ITDC 5CA1B 2ZCEA 4PHZA 2CTPA 1KP2A 2Z5UA 1KUQA 4X1IB 4QIWF 4JYAO 2EIJB 3CWBH 1TAEA 1HNZO 3RGBA 2IJHA 2VWKA 3FB5C 1PNMA 5CB4B 1Y74B 3E2EA 4JZGA 3BHPA 1KECA 4WF9V 1BHBA 1V54C 5EBLC 4R6ZA 4OXSA 5IDJA 3JASA 4ZKIA 1KQSU 1MG1A 1GAXA 2Y69C 5EBWC 5DEDA 2YXLA 5KLVH 1G4YB 3HB3B 1YTFB 2P7TC 2F23A 2DW4A 4IIJA 5FLXN 1F4NA 2FMLA 1EN4A 4UVCA 3ETEA 1K4CC 3ASNB 1CPYA 4X1KB 1J5EB 3UM7A 3N2KB 4QE9A 2RN9A 1M5IA 1PP9H 1Q86W 1QHTA 4GKKO 1Q81W 2DYSC 1K97A 3CC2V 3Q4HA 2HVKC 1RSOB 4FLXA 1HW7A 1GN3A 5BR8O 2Q4PA 3K5LA 4DV0O 1V9PA 3MAQA 2JK5C 1AVMA 1JMKC 3SYAA 2CTQA 2ZM6O 1GTOA 4MVRA 1NTZH 4DR6O 3W7WA 4JI5B 3GVMA 4JAAA 4JI1B 1M9NA 4DV1O 5D5PA 1H2NA 2P90A 1S5HC 1VQ7V 4JI4B 1Q6IA 4EKWA 4O4IA 4J9YB 3JAWB 1W0JG 1SQGA 2QKAA 3FB6C 1KKDA 1XI1A 2XUMA 3JARB 1AI7A 3QF7A 1NKDA 4W4LA 5EIBC 4YXWG 3P30A 3DGEA 3THOA 5FPRA 1NQTA 3U11A 4BAYA 1XMQO 4BIZA 2EIKB 1NU1H 1WLEA 4P2ZA 4EB6A 2JVDA 4YIPA 3G6BA 2GSMB 3K08A 3KKYA 4CC6A 2L6LA 4JAVA 1N34O 2LW1A 2JJ1G 1AR5A 5L3EA 2CGOA 3G67A 4UUJC 4JI2B 1NZ6A 4D7SA 1FXHA 5A9GA 1XMOB 1WN7A 2N05A 3K59A 3OM3B 5HFMA 1Z2GA 3UT5B 2LGWA 4WBNB 2WLMA 4DUZB 2HHHB 3CJHB 3C3SA 1YIJV 3CX5F 1VQ6V 4Z2WA 4G28B 1GN2A 3U0ZA 1TVKA 4ZIBA 1Y66A 2QTSA 3W7TA 1BMFG 1DK1A 1S76D 1R3IC 4LF5O 5H2FZ 3FYEB 4UB8Z 3ASOB 4LF7B 2Q0AA 1QR8A 4ZI7A 5JCOA 5IT9N 4FM2A 3QTCA 3ABMB 4JI1O 3ZRSA 5AG2A 2IJKA 2CTRA 5JVDB 5CBHA 3KZIZ 2DJVA 3BRCA 2FB5A 2QWOB 2Q9LA 2OYQA 3KCXA 4LCUC 4IL6Z 1H8HG 2Q8VA 2Q7EA 4JASA 3OAAG 2F93B 1NS1A 4MVMA 3MHSC 3STLC 5KHGA 3AG4B 1MMMA 2GBOA 1HNWO 3IC9A 1JOYA 1YHQV 3UCSC 3EVKA 4WFGA 4UCSA 1NBMG 1Y76A 2LFRA 2ETNA 4JGSA 3N2GA 1G8MA 3ABLB 2W0XA 4F6EA 4KP4A 3BAAA 2R9RB 2UUBB 2JGDA 1IDSA 2YXYA 5CA3A 1KMIZ 3FFQA 4U3FH 4JI2O 4WCEV 4I50A 1FFTB 1XMOO 4LBEC 4UVAA 4FFBA 1SF9A 4TV8A 5C8YB 4YJ2B 1G1XB 1M56B 2JRIA 4DXWA 2FYUH 4QPKA 3SGIA 2LQTA 2X0LA 2QR4A 2BTOA 4Z1VA 5IJ0A 4MVZA 1Q6UA 4U3JA 3W7SA 3DC5A 5ITZA 5LHHA 4GKJB 1K3EA 4FPPA 4B3MB 5LMNO 4TUYA 1SQXH 1KYOF 4FLWA 1FAFA 5IJ9A 1FXKA 2IJIA 4LF7O 5E79Z 1FFXB 5BZBA 1WB7A 5FPOA 3VQXA 5JWPA 5LOVB 3CCJV 5B1BB 1R1BA 4LF9B 4LFAO 1V55C 4HYOA 1V55B 4RWUA 1NH2B 4PDVA 1GRJA 4O4IB 4WFHA 4MVUA 3CD6V 1JA8A 2KKWA 4GLXA 5E1AC 1JVMA 1VMGA 1M4UA 1N32B 4MTFA 4PA3A 1XL6A 2DYRC 3RT3C 2DYRB 3A8TA 2VS0A 5CA0A 3L72H 1FYJA 1GK9A 3K0DA 5J2TB 1VF5B 4NTYA 3GB7C 3ZS8C 3K06A 3OT7A 3SYPA 1KU9A 4RAIA 4EB6B 3PJSK 1Q5OA 4B7EA 4DR4O 4GYCB 3W7XA 3JSNA 1YF2A 2Q73A 4O2AA 3TK1A 3GWKC 3E8FA 3E8HA 2WLHA 3MHHC 2PYLA 1YITV 4NXMB 4J10A 4L8JA 4AI8A 4DRXA 2CE4A 3BA9A 5LHGA 3FB7C 2RNBA 3RYIA 3G80A 3K9AA 2XTAA 2H8PC 1Q43A 4O2BA 2UXXA 4DK0A 3AG2B 4GKJO 4KHPB 2B5UA 4RQEA 2OCCB 5CA1A 1AJNA 4X1IA 5JQGB 4DW0A 4GZRB 1ZUQA 1XUQA 4EFEA 1EN6A 5JJNB 2OIEA 5KX5B 1A32A 3B8NA 4ABMA 5CB4A 3MD0A 1AROP 1Y74A 5H6QA 5BXZA 5H6RA 3X2QC 4XDKA 5JCOC 1K5QA 1TUEB 4QPJA 3SYQA 1WAZA 2ZNIA 3CB2A 4X65O 4OPHA 1XNRB 2QWQB 2EINC 2KSDA 3E22A 3CCLV 2YICA 2G38A 4I9QA 5GTHZ 1JCHA 1OV9A 1ZL8B 3WFVA 1YSCA 2FTKA 4JTDB 4J80A 1BGYH 2BCCH 2Q0OC 1SZTA 3BA8A 3N2KA 1VQPV 3JD3A 2A79B 3OEEG 3I5DA 2DWDC 2CGNA 2V1DA 3LSSA 5LYJB 1RSOA 4JI3O 1YJNV 1XHXA 4X64B 1KB9F 4GUNA 1UPGA 4YIOA 4H44B 3OR6C 1F23A 3OMNB 1EZVH 4FZ0A 1R3JC 1OCOC 1TUBA 2JGDB 1OCOB 1UJWB 5KAIZ 2PI5A 4NXMO 1VQNV 2HVJC 2VQEB 2X6BA 5B1AC 5L3FA 5B1AB 1PL4A 3JAWA 1QBZA 3IAYA 3AG3C 2P6JA 1XDCA 3B09A 3JARA 4DR2O 4I4TB 4JF3A 3BCCH 2F95B 4FIPC 4JI8O 3O65A 3B4SA 5ITZB 3H1LH 4B3RB 1M1KW 3ZHTA 4JYYA 3T4ZA 4FZ1A 4Z1MG 1HP8A 1VQ9V 4X20B 4TUYB 4JI6O 1FXKC 2HR3A 1FXKB 1AI5A 5IJ9B 2XAJA 5B5EZ 2D2CB 5CBFA 1MSWD 2Y0PA 3LNMB 2FL4A 1XEQA
chains in the Genus database with same CATH topology
3L70H 1L0NH 3CWBH 3L74H 4U3FH 1SQBH 3CX5F 1NTKH 1SQPH 1SQQH 1L0LH 1BCCH 1KB9F 1NTZH 3L72H 3H1JH 1BE3H 3L73H 4PD4F 3H1HH 2A06H 1P84F 2IBZH 3L75H 3H1KH 1EZVH 1SQXH 3BCCH 1SQVH 1PP9H 3CXHF 1NU1H 1BGYH 2BCCH 1PPJH 1KYOF 1NTMH 2FYUH 3H1IH 3L71H 4D6TH 3TGUH 3H1LH 5KLVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  1L0N H;  3CWB H;  3L74 H;  4U3F H;  1SQB H;  3CX5 F;  1NTK H;  1SQP H;  1SQQ H;  1L0L H;  1BCC H;  1KB9 F;  1NTZ H;  3L72 H;  3H1J H;  1BE3 H;  3L73 H;  4PD4 F;  3H1H H;  2A06 H;  1P84 F;  2IBZ H;  3L75 H;  3H1K H;  1EZV H;  1SQX H;  3BCC H;  1SQV H;  1PP9 H;  3CXH F;  1NU1 H;  1BGY H;  2BCC H;  1PPJ H;  1KYO F;  1NTM H;  2FYU H;  3H1I H;  3L71 H;  4D6T H;  3TGU H;  3H1L H;  5KLV H; 
#chains in the Genus database with same CATH topology
 1XNR O;  4R8C A;  4J7J A;  3UT5 A;  2XOK G;  4WBN A;  1Y67 A;  2B9Z A;  3PN1 A;  4PI2 A;  4RO2 A;  1RM1 B;  1Y6X A;  5B3S C;  2YDE A;  2OT5 A;  4CH5 A;  3EHB B;  4MT8 A;  3WU2 Z;  5EK0 A;  1FXV A;  4CS2 A;  2OWO A;  5A2Q N;  2ZXW C;  3H9V A;  4GKK B;  3CE2 A;  3AK1 A;  1VQL V;  2B1I A;  5DN6 G;  5JJE B;  2ZD9 A;  1X59 A;  3KG2 A;  1BQZ A;  4DR6 B;  4Q6G A;  5JVD A;  2P4V A;  4I7Z B;  3WG7 B;  5LMU B;  3VBB A;  4X9Q A;  1W0K G;  3TGU H;  4DRX B;  4NXN B;  4O4J A;  1RPR A;  4DV7 B;  5J2U A;  3RFR A;  4AQY B;  1YJ9 V;  3JAL B;  1SRY A;  3RYI B;  2QWN B;  3JD1 A;  1CXZ B;  5TIS Z;  2LO1 A;  2EJR A;  4FFK A;  3SJB C;  5KHH A;  1N8R W;  1NR7 A;  5KHJ A;  1UFI A;  2K1E A;  1XMQ B;  5LL6 Y;  4JZ2 A;  1S3J A;  2EIJ C;  5IWA O;  4G27 B;  2CDY A;  4I55 B;  1GM8 A;  4J7Z A;  1BCC H;  2X7R B;  4X62 O;  3T1H O;  5EYP B;  1N34 B;  1HWY A;  3ABK C;  3ABK B;  1K9M W;  3JD0 A;  5C8Y A;  3ZIA G;  5F2V O;  1HDJ A;  2ADQ B;  1QVF U;  1BHA A;  4YJ2 A;  2YID A;  4BIO A;  1B6Q A;  2NNU A;  4YJ3 B;  1I0H A;  4UCO A;  1MZF A;  1SQB H;  1PKX A;  4MVO A;  2AHY A;  3E22 B;  3UKM A;  3CCU V;  2E3C A;  3ASN C;  3H1J H;  1FJG B;  1XNQ B;  2BOB C;  4DK1 A;  4UB6 Z;  2Y4T A;  2UXN A;  2LJ2 A;  2YEV B;  1KKC A;  5LA6 A;  2H3O A;  1PV0 A;  4N21 A;  2H94 A;  4LF5 B;  1H2L A;  1FFX A;  1CP9 A;  4IYH A;  2ATK C;  5LOV A;  4NKG B;  2JEU A;  2JEX A;  3S3X A;  1SC5 B;  2HG5 C;  3ETG A;  5LMU O;  5IYZ A;  1WJZ A;  5L3D A;  1TUB B;  4PI0 A;  1XOU A;  3QVN A;  4NXN O;  4DV7 O;  3CRA A;  1S5L Z;  4AQY O;  3VQW A;  1O9G A;  3M7M X;  3CME V;  3FB8 C;  1JJ2 U;  5BMV B;  1W2B U;  2ZKO A;  1R6N A;  2PGG A;  4X66 O;  3AEI A;  4PA9 A;  2ZE7 A;  4NTX A;  2EIK C;  5J2T A;  1HNW B;  2KB1 A;  3SDL A;  3DXR B;  4QJF B;  1K73 W;  3APQ A;  1ZSP A;  1IBL B;  4HZ3 A;  3L74 H;  1DGS A;  3H1H H;  2RCV A;  1M90 W;  1E1Q G;  2E5L O;  3LSU A;  3E35 A;  4WFB V;  2ZE6 A;  5CN0 A;  1EBO A;  3L9D A;  1LUW A;  1Q90 D;  3RYC B;  2Z3Y A;  1Z5V A;  1FD9 A;  1OCR B;  1FJG O;  1XNQ O;  2B1G A;  5KUK A;  1FPO A;  1H2S B;  1OHH G;  2MK3 A;  3AG1 B;  3FX7 A;  1XIL A;  5JQG A;  5GON B;  2IH3 C;  3T4D A;  3CCQ V;  1N36 B;  5KX5 A;  5LMN B;  4K35 A;  3FD9 A;  3ZMU A;  3U10 A;  1Q82 W;  4TOI A;  3ASO C;  1E79 G;  3EXA A;  3K57 A;  1JPX A;  5KAF Z;  3CRC A;  3ABM C;  2F4V B;  3RYF B;  2X6C A;  4H33 A;  4P30 A;  1GN4 A;  4LFA B;  3HPL C;  2UXC O;  3D36 A;  4BWA A;  3L71 H;  3D3Q A;  5K1P A;  1ZL8 A;  4O4J B;  5J2U B;  2JGU A;  1I7F A;  2IW5 A;  4P9P A;  1MNG A;  5DM6 V;  1Q8I A;  4LC1 A;  5LYJ A;  3AG4 C;  5LGU A;  4GT1 A;  4MVS A;  5GW7 A;  3C3T A;  1FKA O;  5LXT B;  1IBL O;  2ODM A;  1BSM A;  2DQ3 A;  3ABL C;  4DR4 B;  2YIB D;  2ZDI A;  4DV4 O;  3HKE B;  2E75 B;  1GKF A;  3CHX A;  2ZT9 B;  1QR9 A;  3P32 A;  3CRR A;  4RUE A;  1D2D A;  1M56 C;  4I4T A;  4IHJ B;  2Q67 A;  2R70 A;  3CYO A;  1Q6H A;  1S72 V;  2VRZ A;  3DSQ A;  4JTA B;  4IGG A;  2OTL V;  4LFC B;  3DC6 A;  1JR9 A;  1T5E A;  2EBO A;  1F4M A;  2WA3 A;  2HJF C;  2Q68 A;  4UV9 A;  4KXR A;  5LGT A;  3OFN G;  1VQM V;  1N36 O;  1YEW A;  2YIA A;  3G6E V;  4X20 A;  5LA6 B;  3OTO O;  2ZIO A;  2ILM A;  2W0F C;  3OUS A;  4K3A A;  1R73 A;  1BL8 A;  1K33 A;  2RQ6 A;  1CEZ A;  2F4V O;  3ML0 A;  5B1B C;  5IY5 B;  1ZLZ A;  3LSQ A;  2AW9 A;  5IYZ B;  5JH7 B;  3K03 A;  1SES A;  4X65 B;  4TWK A;  4K8X A;  3UQ8 A;  3CXC U;  1PNL A;  4FK5 C;  2Z0A A;  3QO8 A;  4D6T H;  3HR0 A;  3JYC A;  2PTM A;  4E4E A;  1L0N H;  3WB2 A;  1D5A A;  2YUA A;  2LGQ A;  1HR0 O;  2AGA A;  2ZR3 A;  2ZIM A;  5BY1 A;  3FKS G;  1HNX B;  3ZHQ A;  4JI3 B;  5KHI A;  1AB3 A;  2QSA A;  4LR3 A;  1M57 B;  1SQV H;  2X6A A;  4LFB O;  1L1F A;  1N4C A;  3R65 A;  3CS5 A;  1KP3 A;  2E76 B;  3N27 A;  4F6R A;  4B3S O;  3QO7 A;  1PM9 A;  1PNK A;  2WSS G;  2ARH A;  3G71 V;  3TXS A;  3OEH G;  3L73 H;  3RVZ A;  4JV5 B;  1NJI W;  3JAL A;  4DR5 O;  4OPA A;  4TT3 G;  3TXQ A;  1S0V A;  3ZRW B;  2RMK B;  1ROP A;  2E74 B;  2JS3 A;  4H0L B;  4DR2 B;  4EEQ A;  4LFC O;  3IC7 A;  3AG2 C;  4WFE A;  2HP8 A;  4JI8 B;  4CH4 A;  2OCC C;  4FLV A;  2Q7H A;  3NR7 A;  2QTO A;  3SPG A;  1XRE A;  3B77 A;  1ENV A;  4DV6 O;  1WNS A;  4I55 A;  3RW0 A;  2VWJ A;  2GHY A;  4LH7 A;  4NYK A;  1JJO A;  5EYP A;  1PPJ H;  2YIB A;  3CSX A;  1GN6 A;  4JI6 B;  4JI0 B;  1P49 A;  1Z5W A;  3VQY A;  3A0H Z;  5LBQ A;  4YJ3 A;  4B3T O;  1OCZ B;  2P06 A;  4J7K A;  3HKB A;  4TQF A;  4HBN A;  4UFZ A;  3P3P A;  1K4D C;  1PL0 A;  4BR6 A;  2QEX V;  2EZP A;  2ZNJ A;  3IGA C;  4CH3 A;  4B7K A;  2YEV A;  3B40 A;  3A0R A;  2QDO A;  3ZHR A;  1HNX O;  3BFR A;  2ITC C;  1GMG A;  4PJ0 Z;  3ZHS A;  4KUM A;  3NXS A;  4XBF A;  3ZHU A;  2QM8 A;  2K9P A;  1RPO A;  1AP6 A;  2NR5 A;  5FNV A;  4JYC A;  1SER A;  1I5Y A;  1L8D A;  2ZDI C;  4GX5 A;  4DYL A;  2C2A A;  3QNE A;  2BSK A;  3P3N A;  2F66 C;  4MS2 A;  1P7G A;  3T2M A;  4YY3 B;  3JCU Z;  1I08 A;  4JV5 O;  4QE7 A;  4J9Z B;  3ETQ A;  5KA6 A;  4DV3 B;  1X4T A;  4JYB A;  2GV9 A;  3BPZ A;  4FVM A;  5BMV A;  1IVS A;  1XBL A;  4UCT A;  3J81 N;  4J41 A;  1P7B A;  4JAU A;  1JFF B;  1QLE B;  1QVG U;  3QO5 A;  5K1X A;  3DXR A;  4O4H B;  4A5U B;  4MW8 A;  4TSF G;  3F5W C;  5IWA B;  1AIL A;  3KCY A;  1B04 A;  1J95 A;  3K5O A;  4JI0 O;  4X88 A;  3JCZ A;  1K7D A;  4X62 B;  5IE9 A;  3T1H B;  4YHH O;  2PYJ A;  1NT2 B;  1OCC B;  1ZX3 A;  3A2F A;  2QKS A;  3CPW U;  5L3B A;  1SQQ H;  3RYC A;  2P4K A;  4WFA V;  3ABT A;  3C90 A;  4LF6 B;  1AI4 A;  1RM1 C;  4L87 A;  4ZBM A;  2M6Y A;  2GTA A;  3R66 A;  5GON A;  2F43 G;  2QGN A;  3CCS V;  1R6T A;  3OUF A;  1YI2 V;  1H38 A;  4CC5 A;  4GX0 A;  1EZJ A;  4MW3 A;  3LDE A;  2LFS A;  3WB1 A;  3RYF A;  1WPB A;  1MZE A;  1AJQ A;  4ZOL B;  3K0G A;  4HAM A;  1RP3 B;  3WG7 C;  2V4D A;  4F6R B;  2BOC C;  2GUZ A;  2IH1 C;  4DR1 B;  2ZE8 A;  2QM4 A;  4YY3 O;  3OMA B;  4TV9 B;  2EX3 A;  4H13 B;  4OX9 B;  2AXT Z;  4DV3 O;  3K3W A;  3LDC A;  2WLJ A;  2WLI A;  3I56 V;  1P84 F;  3E8G A;  2IBZ H;  5B66 Z;  4PDR A;  5J9P C;  4R7C A;  3M99 B;  2A9H A;  4X66 B;  4LWS B;  1PD3 A;  3M8A A;  4J11 A;  5LXT A;  3ZJZ A;  5KHK A;  5EZY A;  4MVQ A;  2VQF O;  4KFM A;  2DN9 A;  4MSW C;  2EIL B;  2HKO A;  2UUA B;  3OMI B;  3RYH B;  3HKE A;  4FMT A;  3LDD A;  3CXH F;  4GCZ A;  4MTG A;  5KMG B;  2JIZ G;  4NVP A;  3APO A;  3JAK B;  4H37 A;  4XDJ A;  5JJJ B;  2UXD O;  2E5L B;  5GTI Z;  2HEP A;  2RJZ A;  4IHJ A;  3ZBH A;  1AR1 B;  3HKB B;  3ZMV A;  2WLL B;  4LF6 O;  1SKV A;  3K9S A;  1M93 A;  3CC4 V;  2WLN A;  2YSU B;  4MTO A;  3SPH A;  1WP7 A;  4U7N A;  3IFX A;  1V54 B;  3D3I A;  3GWO A;  3O9O A;  1AR4 A;  1QU7 A;  1YDX A;  4LNU B;  3ABU A;  2Y69 B;  5EBM C;  4GX1 A;  4FLY A;  4DV2 B;  4O4L A;  2L35 A;  1R6K A;  1VIB A;  2XAS A;  4PD4 F;  1I5X A;  5FNV B;  5JH7 A;  1MA1 A;  1QNM A;  4DR1 O;  2QE7 G;  3K79 A;  1OJH A;  2DYS B;  2BSK B;  4UV8 A;  1NVP B;  3K04 A;  2UXC B;  4OX9 O;  4BIU A;  1S77 D;  3RWR D;  5C93 A;  5IYD O;  3A0B Z;  1BT8 A;  3CMA V;  2JDI G;  2HJD A;  4DR3 B;  2ZR2 A;  2W6I G;  5LGN A;  5EC2 C;  1LUV A;  4D7T A;  3T1Y O;  1I94 B;  3OTF A;  2IJJ A;  1JQ0 A;  2DWE C;  3LNN A;  2V7Q G;  2A7W A;  3CP1 A;  5KA5 A;  3J80 N;  1BS3 A;  2LP7 A;  2UUA O;  4IYI A;  5L3G A;  4DV4 B;  2O57 A;  1VEW A;  2QA4 V;  4FLZ A;  1YZB A;  1GM7 A;  4UVB A;  2WAM A;  1IXB A;  4PA7 A;  1TGO A;  5CMU A;  3ZRW A;  1KC8 W;  3ZRV A;  4J42 A;  1RFY A;  1YCI A;  2CUG A;  2QM7 A;  1IX9 A;  3F7Y C;  1OCR C;  2BTQ B;  3OR7 C;  3AG1 C;  1EN5 A;  2KG7 B;  3CRQ A;  5H9C A;  2AZ2 A;  4NTW A;  1KD1 W;  4I0X B;  3E83 A;  4DV2 O;  3HKD B;  1XHZ A;  3TET A;  3OTO B;  3ZMS A;  1J5E O;  3QG5 A;  3W7U A;  1VP7 A;  4QGP A;  4CH6 A;  5IYC O;  4HNA B;  3OGI B;  4AIL C;  1SET A;  2JS5 A;  3ICX A;  3B2E E;  1B06 A;  3I55 V;  4TQD A;  3ZHV A;  1VQO V;  1S5J A;  1ORQ C;  1IXM A;  2GUZ B;  4GX2 A;  3E86 A;  3MDS A;  4BW5 A;  1LNQ A;  3BEH A;  3UO2 A;  1XL4 A;  1URF A;  4AHC A;  2NN4 A;  2P5O A;  1O9H A;  4JI5 O;  4DR3 O;  2ZE5 A;  2WLI B;  3VQV A;  1W59 A;  1H2K A;  1WA8 B;  4JI4 O;  3STZ C;  1I94 O;  1HR0 B;  1SS3 A;  1K5S A;  2YI9 A;  3IJ4 A;  2P67 A;  1FS0 G;  1SQF A;  4X89 A;  2Q5Z A;  1MOF A;  1U97 A;  5EZY B;  1VF6 A;  4LFB B;  3ZX6 A;  4QNH B;  1VQK V;  4RQF A;  1Y4M A;  3OD4 A;  4B3S B;  3ZMZ A;  3SJQ C;  3CEI A;  1YJW V;  3WB0 A;  1BZK A;  1AJP A;  4U7O A;  4NR1 A;  3SJC C;  2JJ2 G;  2DMX A;  4DR5 B;  4RUF A;  5FL7 G;  3RN4 A;  1N0N A;  2CAZ C;  3F7V C;  1JFF A;  4IT5 A;  2Y48 A;  3BVO A;  4CS3 A;  3SYO A;  3JAT A;  3E8B A;  2XAG A;  3OW2 U;  1NI8 A;  2CH7 A;  3UO3 A;  4O4H A;  2HFE C;  1N33 B;  2IU0 A;  1YTF D;  2A06 H;  3JAS B;  3HKC A;  1IBK B;  3OGC C;  1JX9 A;  1K8A W;  1MSD A;  1ZAU A;  2DOS A;  4DV6 B;  4DO2 A;  5IYB O;  4DUZ O;  1COW G;  4BW9 A;  2HHH O;  2UUC B;  4IIJ B;  4O4L B;  3SJA C;  1SA0 A;  4MTX A;  2UXB B;  3SPJ A;  2QJ1 A;  1VF7 A;  5B1N A;  5IY5 C;  1NVP D;  2XAH A;  4DW1 A;  4B3T B;  4ICG A;  3Q4H B;  3JAM N;  2EUL A;  4ZHQ A;  2OCH A;  4LF4 B;  4DR7 B;  1US6 A;  1WB8 A;  1E1R G;  2M7W A;  2AHZ A;  2IU3 A;  4K0K B;  1DTO A;  2A0L A;  1SQP H;  2QKC A;  2KQX A;  4CZZ A;  2YXH A;  2PI4 A;  3VOU A;  4E2L A;  2PZS A;  4EFB A;  2XND G;  1M57 C;  5EIB D;  4P9O A;  1NTM H;  2P22 C;  2R9I A;  2XAQ A;  3FYI B;  1VQ8 V;  3RVY A;  1TA8 A;  4WFF A;  4ZOL A;  3FAV A;  3SR2 C;  2N04 A;  1H8E G;  4TV9 A;  3S3W A;  3BAB A;  3CCE V;  4CS4 A;  3SPC A;  1THZ A;  1F7Y A;  4JPR A;  5EC1 C;  2UUB O;  1N0J A;  3ZED A;  2OTJ V;  4B08 A;  2HLD G;  3OE7 G;  2PUS A;  3ZRX A;  4UCU A;  2Q7G A;  3ZCC A;  1U96 A;  5D5Q A;  3K5N A;  4LWS A;  1IBM B;  1YXB A;  3SYC A;  4DV5 B;  1D5N A;  3T1C A;  1N33 O;  5KUM A;  1IBK O;  4C7U A;  4XDL A;  5LP6 A;  1QQC A;  2FKX A;  1R3K C;  3ZMT A;  1OZ0 A;  2UUC O;  3CCR V;  1QCE A;  2YI8 A;  4KL1 A;  4NB5 A;  1EM1 A;  3RYH A;  1K92 A;  3CCM V;  3H1I H;  1GM9 A;  2UXB O;  2PF4 E;  1P4R A;  4X1Y A;  4JI7 B;  5KMG A;  3CCV V;  3JAK A;  4YHH B;  3TCU A;  1TVK B;  3JSL A;  2LW7 A;  5DEC A;  4UCR A;  1OCZ C;  4B3M O;  4UXN A;  4PDM A;  4K8Z A;  2WLL A;  2ZQM A;  2CK3 G;  3D36 C;  4LF8 B;  1VQ4 V;  2AZ0 A;  4LF4 O;  4DR7 O;  3JD4 A;  3K58 A;  1WP8 A;  1H2G A;  4UCV A;  4W4K A;  4ZI7 B;  5H5N A;  4K0K O;  4ASU G;  3D8C A;  3X2Q B;  2PY5 A;  3B8M A;  4LF9 O;  4LNU A;  2WWW A;  2DQ0 A;  2EIN B;  1BE3 H;  1QLN A;  5L3C A;  1G6U A;  3LUT B;  2MW2 B;  4X1K A;  1N32 O;  2WA4 A;  1VF6 C;  3JD2 A;  1AI6 A;  3G4S V;  1DF5 A;  2IM9 A;  1ZWI C;  4LP8 A;  3ZN0 A;  2GTS A;  3DTU B;  3SPI A;  1Y76 B;  5CBG A;  4FJC C;  2XAF A;  1KBH A;  3N2G B;  1VAR A;  2XT9 A;  2EZO A;  4FLU A;  1QLE C;  1IBM O;  2D3O W;  1Q7Y W;  4R50 A;  4DV5 O;  3JAT B;  1LR1 A;  2EIM C;  4I50 B;  2EIM B;  2CH7 B;  3ZN1 A;  3CC7 V;  2Q6A A;  1GO3 F;  3AG3 B;  4FFB B;  4I9W A;  4Q20 A;  4TV8 B;  1L0L H;  3HKC B;  2UU9 B;  4CBC A;  1WPX A;  2VQF B;  4JTC B;  4JI7 O;  4KHP O;  1H2M A;  1Q3E A;  5IJ0 B;  4U3J B;  1SA0 B;  1YVW A;  4DUY B;  1ZTE A;  1NR1 A;  4X8A A;  1OCC C;  1AP5 A;  2UXD B;  3L70 H;  2QWR B;  2W6J G;  4LF8 O;  4JYA B;  2ADP A;  1HNZ B;  2GDS A;  2WLK A;  2BTQ A;  4ZHQ B;  2RDC A;  2R9A A;  2XHB A;  1NH2 D;  4PA4 A;  4FLT A;  2KG7 A;  4I0X A;  2DE0 X;  5B1O A;  1SZX A;  1R3L C;  3HKD A;  1NTK H;  3TJT A;  3CJH A;  5B3S B;  2R72 A;  1EFR G;  1IZ3 A;  3BY6 A;  4HNA A;  1B3Q A;  1GH6 A;  1DLB A;  4FM0 A;  3FAV B;  4G2K A;  3F5T A;  1BQ0 A;  3AK3 A;  4I5S A;  2ZXW B;  4X64 O;  4F4L A;  3ETD A;  3RBZ A;  3AK2 A;  5CA0 B;  1VQ5 V;  2WPD G;  3K5M A;  1MAB G;  5BR8 B;  4DV0 B;  4PDL A;  2F1M A;  4LH6 A;  1F51 A;  2YS8 A;  4PV1 B;  2NLJ C;  2QWP B;  2ZM6 B;  3L75 H;  2Q69 A;  4PA6 A;  3EFF K;  1WA8 A;  4PEL A;  3H01 A;  2VQE O;  4O2A B;  3CRM A;  2Y0I A;  1K34 A;  4DV1 B;  2A3Q A;  2Y4U A;  2BE3 A;  4N23 A;  1XQ8 A;  5LHI A;  3T1Y B;  2ZIN A;  2N74 A;  2YC0 A;  2OIG A;  2UU9 O;  3AG7 A;  5LP6 C;  5LP6 B;  1DF4 A;  2CTW A;  4OGQ B;  2EIL C;  2EJ7 A;  1IUR A;  4O2B B;  3H1K H;  3E89 A;  4X1Y B;  5HFL A;  4DUY O;  4B3R O;  4FM1 A;  3J7A U;  2ITD C;  5CA1 B;  2ZCE A;  4PHZ A;  2CTP A;  1KP2 A;  2Z5U A;  1KUQ A;  4X1I B;  4QIW F;  4JYA O;  2EIJ B;  3CWB H;  1TAE A;  1HNZ O;  3RGB A;  2IJH A;  2VWK A;  3FB5 C;  1PNM A;  5CB4 B;  1Y74 B;  3E2E A;  4JZG A;  3BHP A;  1KEC A;  4WF9 V;  1BHB A;  1V54 C;  5EBL C;  4R6Z A;  4OXS A;  5IDJ A;  3JAS A;  4ZKI A;  1KQS U;  1MG1 A;  1GAX A;  2Y69 C;  5EBW C;  5DED A;  2YXL A;  5KLV H;  1G4Y B;  3HB3 B;  1YTF B;  2P7T C;  2F23 A;  2DW4 A;  4IIJ A;  5FLX N;  1F4N A;  2FML A;  1EN4 A;  4UVC A;  3ETE A;  1K4C C;  3ASN B;  1CPY A;  4X1K B;  1J5E B;  3UM7 A;  3N2K B;  4QE9 A;  2RN9 A;  1M5I A;  1PP9 H;  1Q86 W;  1QHT A;  4GKK O;  1Q81 W;  2DYS C;  1K97 A;  3CC2 V;  3Q4H A;  2HVK C;  1RSO B;  4FLX A;  1HW7 A;  1GN3 A;  5BR8 O;  2Q4P A;  3K5L A;  4DV0 O;  1V9P A;  3MAQ A;  2JK5 C;  1AVM A;  1JMK C;  3SYA A;  2CTQ A;  2ZM6 O;  1GTO A;  4MVR A;  1NTZ H;  4DR6 O;  3W7W A;  4JI5 B;  3GVM A;  4JAA A;  4JI1 B;  1M9N A;  4DV1 O;  5D5P A;  1H2N A;  2P90 A;  1S5H C;  1VQ7 V;  4JI4 B;  1Q6I A;  4EKW A;  4O4I A;  4J9Y B;  3JAW B;  1W0J G;  1SQG A;  2QKA A;  3FB6 C;  1KKD A;  1XI1 A;  2XUM A;  3JAR B;  1AI7 A;  3QF7 A;  1NKD A;  4W4L A;  5EIB C;  4YXW G;  3P30 A;  3DGE A;  3THO A;  5FPR A;  1NQT A;  3U11 A;  4BAY A;  1XMQ O;  4BIZ A;  2EIK B;  1NU1 H;  1WLE A;  4P2Z A;  4EB6 A;  2JVD A;  4YIP A;  3G6B A;  2GSM B;  3K08 A;  3KKY A;  4CC6 A;  2L6L A;  4JAV A;  1N34 O;  2LW1 A;  2JJ1 G;  1AR5 A;  5L3E A;  2CGO A;  3G67 A;  4UUJ C;  4JI2 B;  1NZ6 A;  4D7S A;  1FXH A;  5A9G A;  1XMO B;  1WN7 A;  2N05 A;  3K59 A;  3OM3 B;  5HFM A;  1Z2G A;  3UT5 B;  2LGW A;  4WBN B;  2WLM A;  4DUZ B;  2HHH B;  3CJH B;  3C3S A;  1YIJ V;  3CX5 F;  1VQ6 V;  4Z2W A;  4G28 B;  1GN2 A;  3U0Z A;  1TVK A;  4ZIB A;  1Y66 A;  2QTS A;  3W7T A;  1BMF G;  1DK1 A;  1S76 D;  1R3I C;  4LF5 O;  5H2F Z;  3FYE B;  4UB8 Z;  3ASO B;  4LF7 B;  2Q0A A;  1QR8 A;  4ZI7 A;  5JCO A;  5IT9 N;  4FM2 A;  3QTC A;  3ABM B;  4JI1 O;  3ZRS A;  5AG2 A;  2IJK A;  2CTR A;  5JVD B;  5CBH A;  3KZI Z;  2DJV A;  3BRC A;  2FB5 A;  2QWO B;  2Q9L A;  2OYQ A;  3KCX A;  4LCU C;  4IL6 Z;  1H8H G;  2Q8V A;  2Q7E A;  4JAS A;  3OAA G;  2F93 B;  1NS1 A;  4MVM A;  3MHS C;  3STL C;  5KHG A;  3AG4 B;  1MMM A;  2GBO A;  1HNW O;  3IC9 A;  1JOY A;  1YHQ V;  3UCS C;  3EVK A;  4WFG A;  4UCS A;  1NBM G;  1Y76 A;  2LFR A;  2ETN A;  4JGS A;  3N2G A;  1G8M A;  3ABL B;  2W0X A;  4F6E A;  4KP4 A;  3BAA A;  2R9R B;  2UUB B;  2JGD A;  1IDS A;  2YXY A;  5CA3 A;  1KMI Z;  3FFQ A;  4U3F H;  4JI2 O;  4WCE V;  4I50 A;  1FFT B;  1XMO O;  4LBE C;  4UVA A;  4FFB A;  1SF9 A;  4TV8 A;  5C8Y B;  4YJ2 B;  1G1X B;  1M56 B;  2JRI A;  4DXW A;  2FYU H;  4QPK A;  3SGI A;  2LQT A;  2X0L A;  2QR4 A;  2BTO A;  4Z1V A;  5IJ0 A;  4MVZ A;  1Q6U A;  4U3J A;  3W7S A;  3DC5 A;  5ITZ A;  5LHH A;  4GKJ B;  1K3E A;  4FPP A;  4B3M B;  5LMN O;  4TUY A;  1SQX H;  1KYO F;  4FLW A;  1FAF A;  5IJ9 A;  1FXK A;  2IJI A;  4LF7 O;  5E79 Z;  1FFX B;  5BZB A;  1WB7 A;  5FPO A;  3VQX A;  5JWP A;  5LOV B;  3CCJ V;  5B1B B;  1R1B A;  4LF9 B;  4LFA O;  1V55 C;  4HYO A;  1V55 B;  4RWU A;  1NH2 B;  4PDV A;  1GRJ A;  4O4I B;  4WFH A;  4MVU A;  3CD6 V;  1JA8 A;  2KKW A;  4GLX A;  5E1A C;  1JVM A;  1VMG A;  1M4U A;  1N32 B;  4MTF A;  4PA3 A;  1XL6 A;  2DYR C;  3RT3 C;  2DYR B;  3A8T A;  2VS0 A;  5CA0 A;  3L72 H;  1FYJ A;  1GK9 A;  3K0D A;  5J2T B;  1VF5 B;  4NTY A;  3GB7 C;  3ZS8 C;  3K06 A;  3OT7 A;  3SYP A;  1KU9 A;  4RAI A;  4EB6 B;  3PJS K;  1Q5O A;  4B7E A;  4DR4 O;  4GYC B;  3W7X A;  3JSN A;  1YF2 A;  2Q73 A;  4O2A A;  3TK1 A;  3GWK C;  3E8F A;  3E8H A;  2WLH A;  3MHH C;  2PYL A;  1YIT V;  4NXM B;  4J10 A;  4L8J A;  4AI8 A;  4DRX A;  2CE4 A;  3BA9 A;  5LHG A;  3FB7 C;  2RNB A;  3RYI A;  3G80 A;  3K9A A;  2XTA A;  2H8P C;  1Q43 A;  4O2B A;  2UXX A;  4DK0 A;  3AG2 B;  4GKJ O;  4KHP B;  2B5U A;  4RQE A;  2OCC B;  5CA1 A;  1AJN A;  4X1I A;  5JQG B;  4DW0 A;  4GZR B;  1ZUQ A;  1XUQ A;  4EFE A;  1EN6 A;  5JJN B;  2OIE A;  5KX5 B;  1A32 A;  3B8N A;  4ABM A;  5CB4 A;  3MD0 A;  1ARO P;  1Y74 A;  5H6Q A;  5BXZ A;  5H6R A;  3X2Q C;  4XDK A;  5JCO C;  1K5Q A;  1TUE B;  4QPJ A;  3SYQ A;  1WAZ A;  2ZNI A;  3CB2 A;  4X65 O;  4OPH A;  1XNR B;  2QWQ B;  2EIN C;  2KSD A;  3E22 A;  3CCL V;  2YIC A;  2G38 A;  4I9Q A;  5GTH Z;  1JCH A;  1OV9 A;  1ZL8 B;  3WFV A;  1YSC A;  2FTK A;  4JTD B;  4J80 A;  1BGY H;  2BCC H;  2Q0O C;  1SZT A;  3BA8 A;  3N2K A;  1VQP V;  3JD3 A;  2A79 B;  3OEE G;  3I5D A;  2DWD C;  2CGN A;  2V1D A;  3LSS A;  5LYJ B;  1RSO A;  4JI3 O;  1YJN V;  1XHX A;  4X64 B;  1KB9 F;  4GUN A;  1UPG A;  4YIO A;  4H44 B;  3OR6 C;  1F23 A;  3OMN B;  1EZV H;  4FZ0 A;  1R3J C;  1OCO C;  1TUB A;  2JGD B;  1OCO B;  1UJW B;  5KAI Z;  2PI5 A;  4NXM O;  1VQN V;  2HVJ C;  2VQE B;  2X6B A;  5B1A C;  5L3F A;  5B1A B;  1PL4 A;  3JAW A;  1QBZ A;  3IAY A;  3AG3 C;  2P6J A;  1XDC A;  3B09 A;  3JAR A;  4DR2 O;  4I4T B;  4JF3 A;  3BCC H;  2F95 B;  4FIP C;  4JI8 O;  3O65 A;  3B4S A;  5ITZ B;  3H1L H;  4B3R B;  1M1K W;  3ZHT A;  4JYY A;  3T4Z A;  4FZ1 A;  4Z1M G;  1HP8 A;  1VQ9 V;  4X20 B;  4TUY B;  4JI6 O;  1FXK C;  2HR3 A;  1FXK B;  1AI5 A;  5IJ9 B;  2XAJ A;  5B5E Z;  2D2C B;  5CBF A;  1MSW D;  2Y0P A;  3LNM B;  2FL4 A;  1XEQ A; 
#chains in the Genus database with same CATH homology
 3L70 H;  1L0N H;  3CWB H;  3L74 H;  4U3F H;  1SQB H;  3CX5 F;  1NTK H;  1SQP H;  1SQQ H;  1L0L H;  1BCC H;  1KB9 F;  1NTZ H;  3L72 H;  3H1J H;  1BE3 H;  3L73 H;  4PD4 F;  3H1H H;  2A06 H;  1P84 F;  2IBZ H;  3L75 H;  3H1K H;  1EZV H;  1SQX H;  3BCC H;  1SQV H;  1PP9 H;  3CXH F;  1NU1 H;  1BGY H;  2BCC H;  1PPJ H;  1KYO F;  1NTM H;  2FYU H;  3H1I H;  3L71 H;  4D6T H;  3TGU H;  3H1L H;  5KLV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...