3L75H

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l75H00
1PP9H 2IBZH 3BCCH 4U3FH 3CXHF 3H1KH 3CX5F 1NTMH 2A06H 1BCCH 3H1IH 1SQPH 1NU1H 3CWBH 1SQQH 2BCCH 3H1HH 3L71H 3TGUH 1BE3H 1NTKH 1KYOF 1KB9F 1L0NH 1SQXH 1L0LH 3H1LH 3L74H 3L72H 3L70H 4D6TH 1SQVH 3L73H 3H1JH 1BGYH 5KLVH 2FYUH 1NTZH 1PPJH 4PD4F 1SQBH 1EZVH 1P84F 3L75H
chains in the Genus database with same CATH superfamily
4I50B 2PTMA 3K0GA 5CBGA 3M7MX 2A06H 3H1IH 4FLYA 3NXSA 1AR4A 2KB1A 3ABKC 1E79G 4K0KO 5B1OA 2PYLA 3W7XA 2ZIOA 3I56V 4UVBA 5CBFA 4QPJA 4L8JA 1W2BU 4JGSA 4CBCA 2GUZB 2PUSA 1SRYA 1GO3F 1K5QA 1N0JA 2KQXA 3JALB 5IE9A 3ICXA 4J42A 4K8XA 1TVKB 3ASNB 4DV3O 3SDLA 2HVKC 3JCUZ 3S3WA 4X8AA 2KKWA 4X20A 2ATKC 3QNEA 2QTSA 4J7JA 3K9SA 4O4JB 4QIWF 3RYIB 3ZMTA 4JI2B 1AI7A 5FL7G 2NN4A 2GSMB 2CE4A 4TV8B 1Q7YW 4QE9A 2JIZG 1VIBA 2X6BA 4JI0B 4P2ZA 2WLLB 3G71V 1GH6A 4DV6O 1QVFU 2PZSA 2Y48A 2Q0OC 5K1PA 2W6JG 5B1BC 1US6A 2LO1A 3QO7A 2P7TC 4X66O 1NT2B 5EBLC 2JS5A 1F4NA 3H9VA 1HNZB 5B66Z 3ZRXA 5EC2C 4EB6B 5C8YA 3ZJZA 1QCEA 2BTQA 4X1YB 3DC5A 4GKJO 3CCLV 2BSKB 1V9PA 1PNLA 3E22B 4J7ZA 4KUMA 3QVNA 3ZRSA 3APQA 4I0XB 3KCXA 3BCCH 2QSAA 4O4LB 1XOUA 1N36B 1XDCA 3I55V 3BY6A 1Q82W 2Q7GA 2ITDC 2BOBC 2YDEA 5B1AB 4O4IA 3K9AA 4I9QA 5CA0A 1NTZH 3N27A 3ETGA 1B3QA 4PD4F 4CH6A 2EILC 3D36C 3IC7A 1GM8A 1YF2A 5JH7B 1YJ9V 3RFRA 2JGDB 1AI6A 2YIBA 2CAZC 3AK3A 1K7DA 3OUSA 2L35A 5EZYA 4TOIA 2CH7A 2N05A 1ZLZA 1SERA 4PV1B 3SJAC 2A9HA 4RAIA 2DOSA 2R9RB 3M8AA 3OEHG 2W0XA 2GV9A 1Z5WA 4JI2O 3HPLC 3T1HB 1M4UA 4NTWA 3JARA 4DV4B 1FXKC 2E5LB 2MW2B 3FAVB 2JS3A 1Q43A 5E79Z 1NBMG 2E74B 4MVSA 2X0LA 3OUFA 1NH2B 2UXDB 2R9AA 4H13B 1HNZO 4QE7A 4X65B 2IU0A 1NH2D 3JD4A 4EFEA 2CGOA 1ZUQA 2P4VA 3ZS8C 3CEIA 3GB7C 5IYZA 3B8NA 3LNMB 3K04A 5LA6A 4Z2WA 1AB3A 1HNWB 1BT8A 3K79A 2ZNIA 2YUAA 1N36O 3HKDB 4J7KA 3ZMZA 2JEUA 4Z1VA 4K35A 2JJ2G 1GN3A 4FLUA 5KUMA 1M56C 3ZHSA 3QG5A 1Y76B 3ZEDA 3D3IA 2VWJA 1TUEB 4BW5A 5KAFZ 1P4RA 5FNVA 2Q9LA 3ZHQA 4DV0B 3BVOA 1JR9A 4PDMA 4DR1B 3LSQA 4JI1B 4LH7A 2Z5UA 3CC7V 3APOA 2E75B 2HP8A 3FKSG 2PI5A 4I7ZB 4ZBMA 1OCCB 2Q8VA 3CHXA 3TK1A 3DXRA 2LFSA 5IJ9A 2FKXA 3JD1A 2Y0IA 3C3SA 3CJHA 1OV9A 3FB7C 4GLXA 3ASNC 5EYPA 3T1HO 4UVCA 4LF7B 5L3DA 3TJTA 5B5EZ 2EULA 3FYIB 3CCQV 5IY5B 1YJWV 4DV4O 2E5LO 2Y4UA 1PM9A 1HNXO 1Q6HA 5J2UA 1VP7A 4AILC 1Y67A 4UCTA 2YICA 4LWSA 1W59A 4W4LA 3VQYA 2UXDO 2KG7A 3SYPA 2ZINA 3HKEA 4JI5B 1EBOA 4DV5B 4JYYA 1CPYA 4PA6A 2ODMA 2Y0PA 1NTKH 4X65O 2UUCB 1ENVA 4I9WA 4DV7B 1F7YA 2XAFA 5FPOA 4JTDB 1OCOB 1V54B 1XEQA 3E86A 4GCZA 4PA4A 2H3OA 4RUFA 2AZ0A 2ZT9B 4FM0A 2CTQA 1E1QG 3M99B 2EZOA 1NU1H 1HNWO 4FZ0A 5IWAB 5LMUB 4YIOA 4IYHA 3MD0A 4GZRB 4X62O 2OCCB 1XMOB 3AG7A 1SESA 2CGNA 3OE7G 2F4VO 2UXNA 2QR4A 4DV0O 1LNQA 2EJ7A 4F4LA 2FMLA 4DR1O 1NZ6A 5H6RA 4UCVA 4JI1O 1XHZA 4JI7O 3LNNA 2JDIG 5B1AC 3LSUA 5L3BA 1V55B 3CE2A 5B3SB 5GONA 3T1CA 2UUBB 4X1KA 1VF6A 2WSSG 3KKYA 2ZKOA 4I55A 1UJWB 4LC1A 1S76D 4I4TA 4NXMB 2DWEC 2VQEB 3ZCCA 1S3JA 3TGUH 5LP6B 5LYJA 4JAVA 2V1DA 3IC9A 2DQ3A 3U10A 4DUYB 4LF7O 4JZGA 4BIZA 1NS1A 4FLVA 4XDLA 1K34A 2XAJA 1K73W 2IBZH 4DR2O 3HKCA 2VQFB 4FM2A 1RPRA 1SQPH 4ZOLA 4EKWA 3CS5A 1FFTB 3LDEA 5DEDA 4DV5O 4MTOA 3CRQA 1KB9F 2UUCO 1XL4A 1JFFA 4MW8A 3ML0A 4FFKA 4B7EA 5EC1C 5LXTB 3LSSA 5BZBA 4JI4O 4X88A 4PDLA 3CB2A 1R3KC 4F6EA 4P9OA 3JAKB 3BA9A 1WAZA 1ZL8A 4J11A 5IWAO 3B2EE 1MSDA 4OPAA 5LMUO 1H2LA 4TUYB 1KKCA 4PDRA 4DR6O 4CC5A 3MHHC 1XNRB 4K8ZA 2VWKA 5KX5B 1IX9A 4X9QA 3UT5A 3CRRA 4RWUA 2WLIB 2AHZA 4PDVA 1NKDA 2ILMA 1EN4A 2DE0X 1KP2A 4WBNA 2GTSA 1JVMA 3TXSA 4FLWA 1IXBA 1KUQA 3N2GA 1DF5A 2QM7A 2NLJC 2UUBO 4B3TB 1OHHG 3OR6C 4JYAO 3DSQA 4DW0A 2P06A 2XOKG 1N34B 4NXMO 1NVPB 2VQEO 3E8FA 4U7NA 4LH6A 1JOYA 1XQ8A 3VQWA 1YI2V 1WA8B 1OCCC 4MVMA 2QKCA 4BWAA 2DQ0A 1S0VA 1NVPD 4CS3A 1JJ2U 3P3PA 1OCRB 1Q8IA 4WFEA 5IJ0A 1K5SA 1WB7A 1GK9A 3FB8C 1Q3EA 1AJPA 4UXNA 4H0LB 3JD0A 3A8TA 2DWDC 2P90A 1O9HA 5D5QA 3MHSC 1MMMA 5IY5C 1FPOA 1URFA 2AHYA 4YJ3B 3SPCA 1AROP 2UU9B 1VQ6V 1SS3A 2WLMA 1SZXA 2QJ1A 4LFCB 4IGGA 3VOUA 1Q90D 4O2BA 1FFXA 1K33A 1SC5B 2QWRB 2F95B 4O2AB 5GW7A 5LOVB 4PHZA 1NI8A 4DK1A 4ZIBA 5KMGB 1OCOC 1V54C 5CB4B 2YEVA 2CTWA 3J80N 1H2KA 3B40A 3RN4A 4HNAA 1Y74A 3FD9A 1XNRO 2ITCC 3RYCA 2OTJV 1G1XB 4ICGA 3B09A 2K1EA 3ABMB 3WG7B 3JYCA 1SZTA 2OCCC 3SJBC 4ABMA 4BAYA 2QEXV 3FFQA 2P4KA 4B3TO 4W4KA 4LCUC 1BL8A 4GX2A 3AG1B 3K58A 1DF4A 2DYSB 1N34O 4C7UA 1SA0A 4JZ2A 3T4ZA 4LF5B 3D3QA 1R73A 1V55C 4TV9B 4EFBA 5B3SC 3K5MA 1BQ0A 1R3IC 5J9PC 2ZM6B 1VQ5V 2A79B 1SF9A 4TQFA 1G8MA 3RYHA 3FB5C 1K8AW 4LF6B 3CWBH 4CH5A 5LP6C 2E76B 2OCHA 4J9ZB 3CRCA 4H33A 2Q68A 3ZHVA 1S77D 3W7TA 4IHJB 1GM7A 3T1YB 4UB8Z 3L75H 1VQKV 4DO2A 3E8BA 3A0RA 1QVGU 3ZX6A 1XNQB 5L3CA 1Q81W 5J2TB 4FLXA 3SJCC 1AR5A 4LFCO 3ETEA 1NJIW 1VARA 1WPBA 1UFIA 3K06A 4WFHA 3D8CA 4PELA 4OGQB 5JVDA 1YITV 3GVMA 1EZVH 4X1IB 1R6KA 5KA5A 1GTOA 3JASB 3OGCC 4IIJB 1TAEA 1XL6A 4KP4A 4WF9V 1F4MA 2D2CB 1GMGA 4PA3A 4YY3B 3JAWB 1DK1A 1S5JA 3E2EA 4DR3B 4CH3A 4QNHB 3F7YC 4DYLA 5CA1B 2LW7A 3SJQC 4LNUA 4JI3B 3EVKA 2CTRA 3OTFA 1YXBA 1D5NA 1Z2GA 2HHHB 4ZHQB 3F5WC 2LP7A 4K3AA 1PD3A 5JCOC 3K08A 4FFBB 4B7KA 1TA8A 1THZA 3RVZA 2YIDA 2B1GA 4FM1A 2B5UA 3AG3B 4LF5O 2OIEA 3CCMV 2F23A 4JI8B 3WFVA 1PKXA 2Q6AA 5BMVA 3LUTB 1JA8A 4RQFA 2ZM6O 3JSLA 1AI4A 1VEWA 3OT7A 4LF6O 4O4HA 1K92A 3JATA 1WJZA 4OPHA 2AW9A 4JI0O 1R6TA 4G27B 5JQGA 4J10A 1S5LZ 1YEWA 5GTHZ 1OCRC 3FYEB 3AG4B 4F6RA 1Y6XA 3T1YO 3W7SA 3ASOB 3OMIB 4JI6B 3ZHTA 1JMKC 3ZHRA 1IBMB 2Q69A 1P7GA 1XNQO 2QWPB 4NTXA 3ZBHA 1S72V 3GWKC 2F93B 4P30A 3BHPA 5DM6V 2R72A 2Q5ZA 5LGUA 3CMEV 3RT3C 2HJDA 4UCRA 1HR0B 3D36A 4Z1MG 3SPHA 4D7SA 1ZTEA 1VQPV 4DRXB 3HR0A 4GX5A 1J5EB 2LQTA 2WLHA 3ZRWB 1OJHA 3JD2A 1GN6A 3HKBA 3NR7A 3IAYA 1H2MA 4NVPA 4AI8A 4LP8A 5EBWC 2BOCC 4YJ2A 4YY3O 1MZFA 4DR3O 1HW7A 1R6NA 5ITZB 1RSOA 4TWKA 4LF9B 3RYFA 4JI3O 4X89A 4ZI7B 1K9MW 1N33B 2KSDA 2WWWA 5DN6G 2XASA 1FXKA 3QF7A 5FPRA 1L1FA 3CCVV 1JJOA 4JYCA 4L87A 1TUBB 2X6CA 2ADPA 1MOFA 1JPXA 3ABMC 2ZQMA 1IZ3A 3BEHA 3WG7C 4D6TH 4JI8O 4FPPA 1BMFG 1YZBA 4U3FH 4TSFG 4B3SB 2CTPA 1ZAUA 1XHXA 3OTOB 3AG1C 3T4DA 2JGUA 1VQOV 4WFFA 4X64B 3JCZA 2DYSC 3H1HH 2IM9A 1KQSU 4A5UB 1ZWIC 1HP8A 4OX9B 1D2DA 2CUGA 1YVWA 4LFAB 3L70H 3SPIA 2ZDIC 4CZZA 1YJNV 3A0BZ 1PPJH 3LDDA 3CXHF 1EN5A 2XHBA 1G4YB 3E8GA 3K57A 1Y66A 1M9NA 4DV2B 2UUAB 3EXAA 4MTFA 1XREA 1IBMO 3STZC 3N2KA 1I5XA 1KP3A 5K1XA 5KHKA 4NB5A 1AI5A 4XBFA 3UQ8A 1IXMA 1FS0G 3Q4HA 3OEEG 3CCRV 1N8RW 1L0LH 4X20B 3G6BA 2WLNA 1FYJA 4I50A 2F1MA 5LHHA 4JASA 1HR0O 4MS2A 3IJ4A 1IBLB 3CX5F 1VQ9V 1M1KW 5L3EA 1K97A 3J81N 2L6LA 1P49A 4TQDA 3OR7C 1J5EO 1N4CA 3G80A 2LGWA 1YCIA 2GUZA 2DJVA 2UXBB 3VQVA 1K4DC 2ZNJA 1P84F 3ZRVA 3JALA 5HFMA 1CEZA 4LF9O 1TVKA 5IDJA 1QBZA 2W0FC 1N33O 1M5IA 2QM8A 5LBQA 1I94B 4BW9A 2ZIMA 5C8YB 3ZIAG 4O4JA 3K5LA 3RYIA 5AG2A 2BTQB 1KC8W 4E2LA 1BGYH 1H38A 4TV8A 4N21A 3SYOA 1GN4A 1SETA 2XAHA 4JTAB 4Q20A 5H2FZ 2WLLA 3BFRA 3OTOO 3X2QB 2IU3A 2RMKB 4X64O 3AG3C 4UB6Z 1KYOF 1AP5A 3QO5A 3L74H 4O4IB 3F7VC 3OM3B 2UXCB 3AK2A 3K59A 4LFAO 5CA0B 1KU9A 1IVSA 1S5HC 4EB6A 1AP6A 3WU2Z 2GHYA 3SR2C 2H8PC 3BAAA 4X1YA 4JI5O 1PNKA 2BSKA 2UUAO 2M7WA 4IYIA 3E22A 3BPZA 4GUNA 2F43G 1GKFA 4RO2A 3ABLB 4CC6A 4I0XA 5EZYB 4DV7O 1AJQA 2CH7B 1T5EA 4O4LA 2YIBD 4NKGB 3AG4C 3ASOC 5H6QA 3W7UA 1D5AA 2DYRB 2WLKA 1IBLO 2RQ6A 3JSNA 5IT9N 5A9GA 4FLTA 1YIJV 3G67A 1R3JC 3JARB 1GM9A 3RVYA 2YSUB 5KHJA 3JD3A 5JH7A 4QJFB 4HAMA 2OT5A 1VQNV 2JGDA 4MVOA 1N32B 1XMOO 2YI8A 1JQ0A 1FD9A 3OMAB 2AXTZ 1RP3B 5E1AC 4PI2A 1J95A 2BE3A 5HFLA 1I94O 2YS8A 4BIUA 2QKSA 2IJHA 4IT5A 5KHIA 1NR1A 4GKKB 1COWG 4WFBV 2QTOA 5IYZB 4LFBB 1QQCA 3W7WA 1VQ8V 1CP9A 1QR9A 2EINB 3MDSA 5B1NA 2PYJA 3AK1A 5LA6B 1KD1W 2WPDG 2Q4PA 3FAVA 2QWQB 5C93A 1WP8A 5IYBO 4UCSA 3QO8A 2FB5A 2ZE7A 4MTXA 4DUYO 4DW1A 2B1IA 4GT1A 2HR3A 2UXCO 2YXHA 5FNVB 1BQZA 1XILA 5JWPA 1NTMH 2IH1C 3E89A 4UVAA 1U97A 3P3NA 1FAFA 4LBEC 4B3MB 4KXRA 1NR7A 1Q6UA 2VQFO 1RFYA 1AJNA 4XDKA 4PA9A 1AILA 4Q6GA 3PN1A 2PY5A 1M93A 1FXVA 2YC0A 4R7CA 3DXRB 1H2GA 1CXZB 1IBKB 5IJ9B 1ZSPA 3HKDA 2HKOA 2EJRA 4OXSA 3CJHB 3CRAA 5EYPB 1Y76A 2DW4A 3ABUA 3BABA 4MTGA 3H1LH 3R66A 1WLEA 4LF4B 3STLC 1KMIZ 5J2UB 2YXLA 4B08A 2W6IG 5CMUA 2P22C 1FKAO 2QWNB 1Q86W 4WFGA 1N32O 4LWSB 2Z0AA 3B4SA 1WPXA 2KG7B 3OAAG 3HKEB 5LHIA 4HBNA 4ASUG 1RM1B 4PJ0Z 1YDXA 3O65A 5L3FA 1I5YA 3ZMVA 4NTYA 4GKKO 3G4SV 2EIJB 3DTUB 4LFBO 4I5SA 3U11A 4DR7B 2ZCEA 3ABTA 2BTOA 1F23A 3E35A 1U96A 5KUKA 1B6QA 2LW1A 2Q7EA 4J80A 2EIKB 2Y4TA 4CS4A 3L73H 1R1BA 2LGQA 3IFXA 4GX1A 1XBLA 2E3CA 4JYBA 1PP9H 4AQYB 2UXXA 5EBMC 1HDJA 3UO2A 5F2VO 4DR5B 1BS3A 2QE7G 2ZE6A 3OD4A 5H9CA 2VS0A 3X2QC 1KECA 3JAMN 3B77A 4B3MO 1QR8A 5A2QN 5GONB 1P7BA 5L3GA 4WCEV 1B04A 2XAQA 2HEPA 4X1KB 1H8HG 1MABG 1M57B 1K4CC 4I55B 1AR1B 4ZKIA 4I4TB 2UU9O 3BA8A 1MSWD 1IBKO 2C2AA 2PI4A 2JVDA 4JAUA 1EZJA 2EX3A 4DK0A 3U0ZA 3RW0A 2RN9A 1MA1A 4DXWA 3AEIA 5LYJB 1W0JG 4H37A 3ABLC 3H1JH 3CCSV 3HB3B 4R50A 1FJGB 4YHHB 1DLBA 4LF4O 1Y4MA 2H94A 1H2SB 3UM7A 4MW3A 2EIMB 2DYRC 2ZD9A 2EBOA 2WA3A 3HKCB 5KHHA 4ZOLB 3ZN1A 1N0NA 3G6EV 5IYCO 1VMGA 3SYAA 4H44B 4FJCC 5LGTA 1JFFB 3MAQA 2Q7HA 2ZXWB 3SGIA 3K03A 3VQXA 3RWRD 5LP6A 3A2FA 3C90A 4DR7O 5CBHA 4U7OA 1ZL8B 1SQVH 2CK3G 3FB6C 4G2KA 5GTIZ 1G6UA 1UPGA 4FK5C 3OMNB 2EINC 2PGGA 2RJZA 4JF3A 3R65A 3ETQA 3QTCA 4AQYO 3UO3A 4LF8B 3UCSC 3UT5B 1WN7A 4DR5O 3KG2A 2GTAA 2IJIA 2HFEC 1LUWA 2QDOA 2YIAA 1GAXA 3OFNG 4D7TA 3SYQA 4WBNB 2WAMA 5LXTA 3N2GB 1BSMA 5EIBD 1DGSA 1MG1A 1QLEB 3JAKA 4FIPC 5TISZ 1Q6IA 2AGAA 1HWYA 1L8DA 5LGNA 4JTCB 2JEXA 4KHPB 1HNXB 2R70A 4TUYA 1NQTA 2XTAA 1GN2A 2IH3C 2F66C 2FL4A 3B8MA 3VBBA 3TCUA 5KX5A 3SPGA 2P6JA 3A0HZ 2IJKA 2WLIA 1VQLV 1MNGA 5JCOA 5IJ0B 1FJGO 2RCVA 1JX9A 3P32A 4YHHO 4UV9A 2Q73A 3ZN0A 1PL0A 1QLNA 4G28B 2JK5C 2HG5C 5KA6A 3CPWU 3LDCA 4BR6A 4TT3G 3L72H 1GRJA 2N04A 3TXQA 1Q5OA 1JCHA 4MVUA 3K0DA 1I7FA 4NR1A 4HYOA 3WB1A 2ZE8A 3FX7A 2HHHO 3CCEV 4LR3A 1WA8A 2A3QA 4O2BB 1FFXB 4X62B 3CXCU 2O57A 1RM1C 3ZMSA 2F4VB 3IGAC 2HVJC 3CCUV 2YEVB 4KFMA 2EIJC 4P9PA 4U3JB 3C3TA 2AZ2A 2IJJA 1H2NA 2Y69B 4HNAB 2ZR3A 4JI7B 1Y74B 1WP7A 2NNUA 2QM4A 4LF8O 1VF5B 3RYCB 2XNDG 4YJ3A 2EIKC 3CD6V 4PA7A 1XMQB 1VQMV 2G38A 1QNMA 1QU7A 5KLVH 1BHAA 2ETNA 2FTKA 3THOA 4QGPA 1BHBA 1OCZB 3CYOA 3DC6A 4O2AA 1YSCA 3KZIZ 2QGNA 3WB0A 5LOVA 3T2MA 2V4DA 2LFRA 4JI6O 1M90W 5H5NA 2OWOA 3TETA 4IL6Z 5KMGA 1SA0B 2OYQA 5CB4A 4KHPO 4UCOA 2HJFC 4WFAV 2FYUH 3E83A 4UV8A 4DR2B 1VF6C 3ZMUA 1M57C 1EFRG 1LUVA 1F51A 1X4TA 3SPJA 2GBOA 2Q67A 3GWOA 1SQQH 1Z5VA 1VQ4V 4RUEA 3RYHB 1BE3H 3CSXA 4YIPA 4CS2A 4NYKA 3AG2B 2NR5A 4FVMA 4N23A 2P5OA 5EK0A 4CH4A 2Z3YA 1B06A 3SYCA 1EN6A 4JI4B 1LR1A 2LJ2A 5KHGA 5CN0A 2X6AA 2EIMC 1KKDA 3CMAV 2WA4A 2V7QG 3ABKB 5BR8B 4TV9A 1SQGA 2DMXA 2ZDIA 4DR6B 2A7WA 4DR4B 4J41A 4KL1A 3L71H 2VRZA 1VQ7V 1R3LC 5JVDB 2ZXWC 1H8EG 1RPOA 4B3RB 1XUQA 4B3SO 4IHJA 4JV5B 4NXNB 5JJEB 4JYAB 2B9ZA 3H01A 4OX9O 1XMQO 2M6YA 4XDJA 4LNUB 5J2TA 3OGIB 1SQFA 2D3OW 3H1KH 2XT9A 1IDSA 4EEQA 3BRCA 4DV1B 4FMTA 4RQEA 4JAAA 2QWOB 4YXWG 1VF7A 4DUZB 1X59A 5EIBC 2XAGA 2OTLV 4DV2O 2OIGA 4MVZA 1L0NH 1QHTA 4X1IA 2X7RB 3JASA 4HZ3A 4IIJA 5B1BB 1YHQV 4MSWC 2P67A 1SQBH 5KAIZ 1FXHA 1AVMA 3RBZA 3RGBA 4GYCB 5BMVB 1QLEC 3JAWA 4UCUA 3UKMA 1ORQC 1PV0A 5LMNB 1W0KG 3F5TA 5CA1A 3CRMA 1OZ0A 1SQXH 4O4HB 1YTFB 2CDYA 3JATB 5D5PA 4ZHQA 5JQGB 4MVQA 2UXBO 3CC4V 1I08A 2R9IA 4FFBA 1YTFD 1BCCH 4F6RB 3J7AU 4FZ1A 4J9YB 5BR8O 5BXZA 5BY1A 2QKAA 5IYDO 1BZKA 4AHCA 2A0LA 4DR4O 2EILB 4QPKA 3CP1A 3K5OA 3OW2U 1K3EA 1MZEA 4K0KB 2QA4V 1O9GA 4B3RO 2IW5A 1TGOA 3KCYA 3EFFK 3K5NA 3HKBB 3L9DA 1PL4A 2EZPA 4YJ2B 2RDCA 4JV5O 1DTOA 2JJ1G 2MK3A 4NXNO 2HLDG 1RSOB 4MT8A 3DGEA 4DV3B 3RYFB 2RNBA 2Y69C 4GX0A 2ADQB 4R8CA 2K9PA 4DV1O 1SKVA 4UFZA 1FXKB 3WB2A 4DUZO 3K3WA 4PI0A 3EHBB 5CA3A 3ZHUA 5LL6Y 4DRXA 3CCJV 3E8HA 1OCZC 4UUJC 3ZRWA 3S3XA 3ETDA 2YI9A 2ZE5A 2BCCH 5DECA 1KBHA 5LMNO 4DV6B 2Q0AA 2ZR2A 5ITZA 5JJJB 5FLXN 3CC2V 4X66B 1PNMA 4R6ZA 4ZI7A 2ARHA 1A32A 1ROPA 2N74A 3I5DA 3P30A 4FLZA 1I0HA 1TUBA 1IURA 1WNSA 1EM1A 2WLJA 4GKJB 2GDSA 2DN9A 5LHGA 1ZX3A 4E4EA 3AG2C 4MVRA 2JRIA 1M56B 1E1RG 2XUMA 1XI1A 2YXYA 3PJSK 4JPRA 3N2KB 5JJNB 1WB8A 2PF4E 3Q4HB 4U3JA 3O9OA 4BIOA
chains in the Genus database with same CATH topology
1PP9H 2IBZH 3BCCH 4U3FH 3CXHF 3H1KH 3CX5F 1NTMH 2A06H 1BCCH 3H1IH 1SQPH 1NU1H 3CWBH 1SQQH 2BCCH 3H1HH 3L71H 3TGUH 1BE3H 1NTKH 1KYOF 1KB9F 1L0NH 1SQXH 1L0LH 3H1LH 3L74H 3L72H 3L70H 4D6TH 1SQVH 3L73H 3H1JH 1BGYH 5KLVH 2FYUH 1NTZH 1PPJH 4PD4F 1SQBH 1EZVH 1P84F 3L75H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 H;  2IBZ H;  3BCC H;  4U3F H;  3CXH F;  3H1K H;  3CX5 F;  1NTM H;  2A06 H;  1BCC H;  3H1I H;  1SQP H;  1NU1 H;  3CWB H;  1SQQ H;  2BCC H;  3H1H H;  3L71 H;  3TGU H;  1BE3 H;  1NTK H;  1KYO F;  1KB9 F;  1L0N H;  1SQX H;  1L0L H;  3H1L H;  3L74 H;  3L72 H;  3L70 H;  4D6T H;  1SQV H;  3L73 H;  3H1J H;  1BGY H;  5KLV H;  2FYU H;  1NTZ H;  1PPJ H;  4PD4 F;  1SQB H;  1EZV H;  1P84 F;  3L75 H; 
#chains in the Genus database with same CATH topology
 4I50 B;  2PTM A;  3K0G A;  5CBG A;  3M7M X;  2A06 H;  3H1I H;  4FLY A;  3NXS A;  1AR4 A;  2KB1 A;  3ABK C;  1E79 G;  4K0K O;  5B1O A;  2PYL A;  3W7X A;  2ZIO A;  3I56 V;  4UVB A;  5CBF A;  4QPJ A;  4L8J A;  1W2B U;  4JGS A;  4CBC A;  2GUZ B;  2PUS A;  1SRY A;  1GO3 F;  1K5Q A;  1N0J A;  2KQX A;  3JAL B;  5IE9 A;  3ICX A;  4J42 A;  4K8X A;  1TVK B;  3ASN B;  4DV3 O;  3SDL A;  2HVK C;  3JCU Z;  3S3W A;  4X8A A;  2KKW A;  4X20 A;  2ATK C;  3QNE A;  2QTS A;  4J7J A;  3K9S A;  4O4J B;  4QIW F;  3RYI B;  3ZMT A;  4JI2 B;  1AI7 A;  5FL7 G;  2NN4 A;  2GSM B;  2CE4 A;  4TV8 B;  1Q7Y W;  4QE9 A;  2JIZ G;  1VIB A;  2X6B A;  4JI0 B;  4P2Z A;  2WLL B;  3G71 V;  1GH6 A;  4DV6 O;  1QVF U;  2PZS A;  2Y48 A;  2Q0O C;  5K1P A;  2W6J G;  5B1B C;  1US6 A;  2LO1 A;  3QO7 A;  2P7T C;  4X66 O;  1NT2 B;  5EBL C;  2JS5 A;  1F4N A;  3H9V A;  1HNZ B;  5B66 Z;  3ZRX A;  5EC2 C;  4EB6 B;  5C8Y A;  3ZJZ A;  1QCE A;  2BTQ A;  4X1Y B;  3DC5 A;  4GKJ O;  3CCL V;  2BSK B;  1V9P A;  1PNL A;  3E22 B;  4J7Z A;  4KUM A;  3QVN A;  3ZRS A;  3APQ A;  4I0X B;  3KCX A;  3BCC H;  2QSA A;  4O4L B;  1XOU A;  1N36 B;  1XDC A;  3I55 V;  3BY6 A;  1Q82 W;  2Q7G A;  2ITD C;  2BOB C;  2YDE A;  5B1A B;  4O4I A;  3K9A A;  4I9Q A;  5CA0 A;  1NTZ H;  3N27 A;  3ETG A;  1B3Q A;  4PD4 F;  4CH6 A;  2EIL C;  3D36 C;  3IC7 A;  1GM8 A;  1YF2 A;  5JH7 B;  1YJ9 V;  3RFR A;  2JGD B;  1AI6 A;  2YIB A;  2CAZ C;  3AK3 A;  1K7D A;  3OUS A;  2L35 A;  5EZY A;  4TOI A;  2CH7 A;  2N05 A;  1ZLZ A;  1SER A;  4PV1 B;  3SJA C;  2A9H A;  4RAI A;  2DOS A;  2R9R B;  3M8A A;  3OEH G;  2W0X A;  2GV9 A;  1Z5W A;  4JI2 O;  3HPL C;  3T1H B;  1M4U A;  4NTW A;  3JAR A;  4DV4 B;  1FXK C;  2E5L B;  2MW2 B;  3FAV B;  2JS3 A;  1Q43 A;  5E79 Z;  1NBM G;  2E74 B;  4MVS A;  2X0L A;  3OUF A;  1NH2 B;  2UXD B;  2R9A A;  4H13 B;  1HNZ O;  4QE7 A;  4X65 B;  2IU0 A;  1NH2 D;  3JD4 A;  4EFE A;  2CGO A;  1ZUQ A;  2P4V A;  3ZS8 C;  3CEI A;  3GB7 C;  5IYZ A;  3B8N A;  3LNM B;  3K04 A;  5LA6 A;  4Z2W A;  1AB3 A;  1HNW B;  1BT8 A;  3K79 A;  2ZNI A;  2YUA A;  1N36 O;  3HKD B;  4J7K A;  3ZMZ A;  2JEU A;  4Z1V A;  4K35 A;  2JJ2 G;  1GN3 A;  4FLU A;  5KUM A;  1M56 C;  3ZHS A;  3QG5 A;  1Y76 B;  3ZED A;  3D3I A;  2VWJ A;  1TUE B;  4BW5 A;  5KAF Z;  1P4R A;  5FNV A;  2Q9L A;  3ZHQ A;  4DV0 B;  3BVO A;  1JR9 A;  4PDM A;  4DR1 B;  3LSQ A;  4JI1 B;  4LH7 A;  2Z5U A;  3CC7 V;  3APO A;  2E75 B;  2HP8 A;  3FKS G;  2PI5 A;  4I7Z B;  4ZBM A;  1OCC B;  2Q8V A;  3CHX A;  3TK1 A;  3DXR A;  2LFS A;  5IJ9 A;  2FKX A;  3JD1 A;  2Y0I A;  3C3S A;  3CJH A;  1OV9 A;  3FB7 C;  4GLX A;  3ASN C;  5EYP A;  3T1H O;  4UVC A;  4LF7 B;  5L3D A;  3TJT A;  5B5E Z;  2EUL A;  3FYI B;  3CCQ V;  5IY5 B;  1YJW V;  4DV4 O;  2E5L O;  2Y4U A;  1PM9 A;  1HNX O;  1Q6H A;  5J2U A;  1VP7 A;  4AIL C;  1Y67 A;  4UCT A;  2YIC A;  4LWS A;  1W59 A;  4W4L A;  3VQY A;  2UXD O;  2KG7 A;  3SYP A;  2ZIN A;  3HKE A;  4JI5 B;  1EBO A;  4DV5 B;  4JYY A;  1CPY A;  4PA6 A;  2ODM A;  2Y0P A;  1NTK H;  4X65 O;  2UUC B;  1ENV A;  4I9W A;  4DV7 B;  1F7Y A;  2XAF A;  5FPO A;  4JTD B;  1OCO B;  1V54 B;  1XEQ A;  3E86 A;  4GCZ A;  4PA4 A;  2H3O A;  4RUF A;  2AZ0 A;  2ZT9 B;  4FM0 A;  2CTQ A;  1E1Q G;  3M99 B;  2EZO A;  1NU1 H;  1HNW O;  4FZ0 A;  5IWA B;  5LMU B;  4YIO A;  4IYH A;  3MD0 A;  4GZR B;  4X62 O;  2OCC B;  1XMO B;  3AG7 A;  1SES A;  2CGN A;  3OE7 G;  2F4V O;  2UXN A;  2QR4 A;  4DV0 O;  1LNQ A;  2EJ7 A;  4F4L A;  2FML A;  4DR1 O;  1NZ6 A;  5H6R A;  4UCV A;  4JI1 O;  1XHZ A;  4JI7 O;  3LNN A;  2JDI G;  5B1A C;  3LSU A;  5L3B A;  1V55 B;  3CE2 A;  5B3S B;  5GON A;  3T1C A;  2UUB B;  4X1K A;  1VF6 A;  2WSS G;  3KKY A;  2ZKO A;  4I55 A;  1UJW B;  4LC1 A;  1S76 D;  4I4T A;  4NXM B;  2DWE C;  2VQE B;  3ZCC A;  1S3J A;  3TGU H;  5LP6 B;  5LYJ A;  4JAV A;  2V1D A;  3IC9 A;  2DQ3 A;  3U10 A;  4DUY B;  4LF7 O;  4JZG A;  4BIZ A;  1NS1 A;  4FLV A;  4XDL A;  1K34 A;  2XAJ A;  1K73 W;  2IBZ H;  4DR2 O;  3HKC A;  2VQF B;  4FM2 A;  1RPR A;  1SQP H;  4ZOL A;  4EKW A;  3CS5 A;  1FFT B;  3LDE A;  5DED A;  4DV5 O;  4MTO A;  3CRQ A;  1KB9 F;  2UUC O;  1XL4 A;  1JFF A;  4MW8 A;  3ML0 A;  4FFK A;  4B7E A;  5EC1 C;  5LXT B;  3LSS A;  5BZB A;  4JI4 O;  4X88 A;  4PDL A;  3CB2 A;  1R3K C;  4F6E A;  4P9O A;  3JAK B;  3BA9 A;  1WAZ A;  1ZL8 A;  4J11 A;  5IWA O;  3B2E E;  1MSD A;  4OPA A;  5LMU O;  1H2L A;  4TUY B;  1KKC A;  4PDR A;  4DR6 O;  4CC5 A;  3MHH C;  1XNR B;  4K8Z A;  2VWK A;  5KX5 B;  1IX9 A;  4X9Q A;  3UT5 A;  3CRR A;  4RWU A;  2WLI B;  2AHZ A;  4PDV A;  1NKD A;  2ILM A;  1EN4 A;  2DE0 X;  1KP2 A;  4WBN A;  2GTS A;  1JVM A;  3TXS A;  4FLW A;  1IXB A;  1KUQ A;  3N2G A;  1DF5 A;  2QM7 A;  2NLJ C;  2UUB O;  4B3T B;  1OHH G;  3OR6 C;  4JYA O;  3DSQ A;  4DW0 A;  2P06 A;  2XOK G;  1N34 B;  4NXM O;  1NVP B;  2VQE O;  3E8F A;  4U7N A;  4LH6 A;  1JOY A;  1XQ8 A;  3VQW A;  1YI2 V;  1WA8 B;  1OCC C;  4MVM A;  2QKC A;  4BWA A;  2DQ0 A;  1S0V A;  1NVP D;  4CS3 A;  1JJ2 U;  3P3P A;  1OCR B;  1Q8I A;  4WFE A;  5IJ0 A;  1K5S A;  1WB7 A;  1GK9 A;  3FB8 C;  1Q3E A;  1AJP A;  4UXN A;  4H0L B;  3JD0 A;  3A8T A;  2DWD C;  2P90 A;  1O9H A;  5D5Q A;  3MHS C;  1MMM A;  5IY5 C;  1FPO A;  1URF A;  2AHY A;  4YJ3 B;  3SPC A;  1ARO P;  2UU9 B;  1VQ6 V;  1SS3 A;  2WLM A;  1SZX A;  2QJ1 A;  4LFC B;  4IGG A;  3VOU A;  1Q90 D;  4O2B A;  1FFX A;  1K33 A;  1SC5 B;  2QWR B;  2F95 B;  4O2A B;  5GW7 A;  5LOV B;  4PHZ A;  1NI8 A;  4DK1 A;  4ZIB A;  5KMG B;  1OCO C;  1V54 C;  5CB4 B;  2YEV A;  2CTW A;  3J80 N;  1H2K A;  3B40 A;  3RN4 A;  4HNA A;  1Y74 A;  3FD9 A;  1XNR O;  2ITC C;  3RYC A;  2OTJ V;  1G1X B;  4ICG A;  3B09 A;  2K1E A;  3ABM B;  3WG7 B;  3JYC A;  1SZT A;  2OCC C;  3SJB C;  4ABM A;  4BAY A;  2QEX V;  3FFQ A;  2P4K A;  4B3T O;  4W4K A;  4LCU C;  1BL8 A;  4GX2 A;  3AG1 B;  3K58 A;  1DF4 A;  2DYS B;  1N34 O;  4C7U A;  1SA0 A;  4JZ2 A;  3T4Z A;  4LF5 B;  3D3Q A;  1R73 A;  1V55 C;  4TV9 B;  4EFB A;  5B3S C;  3K5M A;  1BQ0 A;  1R3I C;  5J9P C;  2ZM6 B;  1VQ5 V;  2A79 B;  1SF9 A;  4TQF A;  1G8M A;  3RYH A;  3FB5 C;  1K8A W;  4LF6 B;  3CWB H;  4CH5 A;  5LP6 C;  2E76 B;  2OCH A;  4J9Z B;  3CRC A;  4H33 A;  2Q68 A;  3ZHV A;  1S77 D;  3W7T A;  4IHJ B;  1GM7 A;  3T1Y B;  4UB8 Z;  3L75 H;  1VQK V;  4DO2 A;  3E8B A;  3A0R A;  1QVG U;  3ZX6 A;  1XNQ B;  5L3C A;  1Q81 W;  5J2T B;  4FLX A;  3SJC C;  1AR5 A;  4LFC O;  3ETE A;  1NJI W;  1VAR A;  1WPB A;  1UFI A;  3K06 A;  4WFH A;  3D8C A;  4PEL A;  4OGQ B;  5JVD A;  1YIT V;  3GVM A;  1EZV H;  4X1I B;  1R6K A;  5KA5 A;  1GTO A;  3JAS B;  3OGC C;  4IIJ B;  1TAE A;  1XL6 A;  4KP4 A;  4WF9 V;  1F4M A;  2D2C B;  1GMG A;  4PA3 A;  4YY3 B;  3JAW B;  1DK1 A;  1S5J A;  3E2E A;  4DR3 B;  4CH3 A;  4QNH B;  3F7Y C;  4DYL A;  5CA1 B;  2LW7 A;  3SJQ C;  4LNU A;  4JI3 B;  3EVK A;  2CTR A;  3OTF A;  1YXB A;  1D5N A;  1Z2G A;  2HHH B;  4ZHQ B;  3F5W C;  2LP7 A;  4K3A A;  1PD3 A;  5JCO C;  3K08 A;  4FFB B;  4B7K A;  1TA8 A;  1THZ A;  3RVZ A;  2YID A;  2B1G A;  4FM1 A;  2B5U A;  3AG3 B;  4LF5 O;  2OIE A;  3CCM V;  2F23 A;  4JI8 B;  3WFV A;  1PKX A;  2Q6A A;  5BMV A;  3LUT B;  1JA8 A;  4RQF A;  2ZM6 O;  3JSL A;  1AI4 A;  1VEW A;  3OT7 A;  4LF6 O;  4O4H A;  1K92 A;  3JAT A;  1WJZ A;  4OPH A;  2AW9 A;  4JI0 O;  1R6T A;  4G27 B;  5JQG A;  4J10 A;  1S5L Z;  1YEW A;  5GTH Z;  1OCR C;  3FYE B;  3AG4 B;  4F6R A;  1Y6X A;  3T1Y O;  3W7S A;  3ASO B;  3OMI B;  4JI6 B;  3ZHT A;  1JMK C;  3ZHR A;  1IBM B;  2Q69 A;  1P7G A;  1XNQ O;  2QWP B;  4NTX A;  3ZBH A;  1S72 V;  3GWK C;  2F93 B;  4P30 A;  3BHP A;  5DM6 V;  2R72 A;  2Q5Z A;  5LGU A;  3CME V;  3RT3 C;  2HJD A;  4UCR A;  1HR0 B;  3D36 A;  4Z1M G;  3SPH A;  4D7S A;  1ZTE A;  1VQP V;  4DRX B;  3HR0 A;  4GX5 A;  1J5E B;  2LQT A;  2WLH A;  3ZRW B;  1OJH A;  3JD2 A;  1GN6 A;  3HKB A;  3NR7 A;  3IAY A;  1H2M A;  4NVP A;  4AI8 A;  4LP8 A;  5EBW C;  2BOC C;  4YJ2 A;  4YY3 O;  1MZF A;  4DR3 O;  1HW7 A;  1R6N A;  5ITZ B;  1RSO A;  4TWK A;  4LF9 B;  3RYF A;  4JI3 O;  4X89 A;  4ZI7 B;  1K9M W;  1N33 B;  2KSD A;  2WWW A;  5DN6 G;  2XAS A;  1FXK A;  3QF7 A;  5FPR A;  1L1F A;  3CCV V;  1JJO A;  4JYC A;  4L87 A;  1TUB B;  2X6C A;  2ADP A;  1MOF A;  1JPX A;  3ABM C;  2ZQM A;  1IZ3 A;  3BEH A;  3WG7 C;  4D6T H;  4JI8 O;  4FPP A;  1BMF G;  1YZB A;  4U3F H;  4TSF G;  4B3S B;  2CTP A;  1ZAU A;  1XHX A;  3OTO B;  3AG1 C;  3T4D A;  2JGU A;  1VQO V;  4WFF A;  4X64 B;  3JCZ A;  2DYS C;  3H1H H;  2IM9 A;  1KQS U;  4A5U B;  1ZWI C;  1HP8 A;  4OX9 B;  1D2D A;  2CUG A;  1YVW A;  4LFA B;  3L70 H;  3SPI A;  2ZDI C;  4CZZ A;  1YJN V;  3A0B Z;  1PPJ H;  3LDD A;  3CXH F;  1EN5 A;  2XHB A;  1G4Y B;  3E8G A;  3K57 A;  1Y66 A;  1M9N A;  4DV2 B;  2UUA B;  3EXA A;  4MTF A;  1XRE A;  1IBM O;  3STZ C;  3N2K A;  1I5X A;  1KP3 A;  5K1X A;  5KHK A;  4NB5 A;  1AI5 A;  4XBF A;  3UQ8 A;  1IXM A;  1FS0 G;  3Q4H A;  3OEE G;  3CCR V;  1N8R W;  1L0L H;  4X20 B;  3G6B A;  2WLN A;  1FYJ A;  4I50 A;  2F1M A;  5LHH A;  4JAS A;  1HR0 O;  4MS2 A;  3IJ4 A;  1IBL B;  3CX5 F;  1VQ9 V;  1M1K W;  5L3E A;  1K97 A;  3J81 N;  2L6L A;  1P49 A;  4TQD A;  3OR7 C;  1J5E O;  1N4C A;  3G80 A;  2LGW A;  1YCI A;  2GUZ A;  2DJV A;  2UXB B;  3VQV A;  1K4D C;  2ZNJ A;  1P84 F;  3ZRV A;  3JAL A;  5HFM A;  1CEZ A;  4LF9 O;  1TVK A;  5IDJ A;  1QBZ A;  2W0F C;  1N33 O;  1M5I A;  2QM8 A;  5LBQ A;  1I94 B;  4BW9 A;  2ZIM A;  5C8Y B;  3ZIA G;  4O4J A;  3K5L A;  3RYI A;  5AG2 A;  2BTQ B;  1KC8 W;  4E2L A;  1BGY H;  1H38 A;  4TV8 A;  4N21 A;  3SYO A;  1GN4 A;  1SET A;  2XAH A;  4JTA B;  4Q20 A;  5H2F Z;  2WLL A;  3BFR A;  3OTO O;  3X2Q B;  2IU3 A;  2RMK B;  4X64 O;  3AG3 C;  4UB6 Z;  1KYO F;  1AP5 A;  3QO5 A;  3L74 H;  4O4I B;  3F7V C;  3OM3 B;  2UXC B;  3AK2 A;  3K59 A;  4LFA O;  5CA0 B;  1KU9 A;  1IVS A;  1S5H C;  4EB6 A;  1AP6 A;  3WU2 Z;  2GHY A;  3SR2 C;  2H8P C;  3BAA A;  4X1Y A;  4JI5 O;  1PNK A;  2BSK A;  2UUA O;  2M7W A;  4IYI A;  3E22 A;  3BPZ A;  4GUN A;  2F43 G;  1GKF A;  4RO2 A;  3ABL B;  4CC6 A;  4I0X A;  5EZY B;  4DV7 O;  1AJQ A;  2CH7 B;  1T5E A;  4O4L A;  2YIB D;  4NKG B;  3AG4 C;  3ASO C;  5H6Q A;  3W7U A;  1D5A A;  2DYR B;  2WLK A;  1IBL O;  2RQ6 A;  3JSN A;  5IT9 N;  5A9G A;  4FLT A;  1YIJ V;  3G67 A;  1R3J C;  3JAR B;  1GM9 A;  3RVY A;  2YSU B;  5KHJ A;  3JD3 A;  5JH7 A;  4QJF B;  4HAM A;  2OT5 A;  1VQN V;  2JGD A;  4MVO A;  1N32 B;  1XMO O;  2YI8 A;  1JQ0 A;  1FD9 A;  3OMA B;  2AXT Z;  1RP3 B;  5E1A C;  4PI2 A;  1J95 A;  2BE3 A;  5HFL A;  1I94 O;  2YS8 A;  4BIU A;  2QKS A;  2IJH A;  4IT5 A;  5KHI A;  1NR1 A;  4GKK B;  1COW G;  4WFB V;  2QTO A;  5IYZ B;  4LFB B;  1QQC A;  3W7W A;  1VQ8 V;  1CP9 A;  1QR9 A;  2EIN B;  3MDS A;  5B1N A;  2PYJ A;  3AK1 A;  5LA6 B;  1KD1 W;  2WPD G;  2Q4P A;  3FAV A;  2QWQ B;  5C93 A;  1WP8 A;  5IYB O;  4UCS A;  3QO8 A;  2FB5 A;  2ZE7 A;  4MTX A;  4DUY O;  4DW1 A;  2B1I A;  4GT1 A;  2HR3 A;  2UXC O;  2YXH A;  5FNV B;  1BQZ A;  1XIL A;  5JWP A;  1NTM H;  2IH1 C;  3E89 A;  4UVA A;  1U97 A;  3P3N A;  1FAF A;  4LBE C;  4B3M B;  4KXR A;  1NR7 A;  1Q6U A;  2VQF O;  1RFY A;  1AJN A;  4XDK A;  4PA9 A;  1AIL A;  4Q6G A;  3PN1 A;  2PY5 A;  1M93 A;  1FXV A;  2YC0 A;  4R7C A;  3DXR B;  1H2G A;  1CXZ B;  1IBK B;  5IJ9 B;  1ZSP A;  3HKD A;  2HKO A;  2EJR A;  4OXS A;  3CJH B;  3CRA A;  5EYP B;  1Y76 A;  2DW4 A;  3ABU A;  3BAB A;  4MTG A;  3H1L H;  3R66 A;  1WLE A;  4LF4 B;  3STL C;  1KMI Z;  5J2U B;  2YXL A;  4B08 A;  2W6I G;  5CMU A;  2P22 C;  1FKA O;  2QWN B;  1Q86 W;  4WFG A;  1N32 O;  4LWS B;  2Z0A A;  3B4S A;  1WPX A;  2KG7 B;  3OAA G;  3HKE B;  5LHI A;  4HBN A;  4ASU G;  1RM1 B;  4PJ0 Z;  1YDX A;  3O65 A;  5L3F A;  1I5Y A;  3ZMV A;  4NTY A;  4GKK O;  3G4S V;  2EIJ B;  3DTU B;  4LFB O;  4I5S A;  3U11 A;  4DR7 B;  2ZCE A;  3ABT A;  2BTO A;  1F23 A;  3E35 A;  1U96 A;  5KUK A;  1B6Q A;  2LW1 A;  2Q7E A;  4J80 A;  2EIK B;  2Y4T A;  4CS4 A;  3L73 H;  1R1B A;  2LGQ A;  3IFX A;  4GX1 A;  1XBL A;  2E3C A;  4JYB A;  1PP9 H;  4AQY B;  2UXX A;  5EBM C;  1HDJ A;  3UO2 A;  5F2V O;  4DR5 B;  1BS3 A;  2QE7 G;  2ZE6 A;  3OD4 A;  5H9C A;  2VS0 A;  3X2Q C;  1KEC A;  3JAM N;  3B77 A;  4B3M O;  1QR8 A;  5A2Q N;  5GON B;  1P7B A;  5L3G A;  4WCE V;  1B04 A;  2XAQ A;  2HEP A;  4X1K B;  1H8H G;  1MAB G;  1M57 B;  1K4C C;  4I55 B;  1AR1 B;  4ZKI A;  4I4T B;  2UU9 O;  3BA8 A;  1MSW D;  1IBK O;  2C2A A;  2PI4 A;  2JVD A;  4JAU A;  1EZJ A;  2EX3 A;  4DK0 A;  3U0Z A;  3RW0 A;  2RN9 A;  1MA1 A;  4DXW A;  3AEI A;  5LYJ B;  1W0J G;  4H37 A;  3ABL C;  3H1J H;  3CCS V;  3HB3 B;  4R50 A;  1FJG B;  4YHH B;  1DLB A;  4LF4 O;  1Y4M A;  2H94 A;  1H2S B;  3UM7 A;  4MW3 A;  2EIM B;  2DYR C;  2ZD9 A;  2EBO A;  2WA3 A;  3HKC B;  5KHH A;  4ZOL B;  3ZN1 A;  1N0N A;  3G6E V;  5IYC O;  1VMG A;  3SYA A;  4H44 B;  4FJC C;  5LGT A;  1JFF B;  3MAQ A;  2Q7H A;  2ZXW B;  3SGI A;  3K03 A;  3VQX A;  3RWR D;  5LP6 A;  3A2F A;  3C90 A;  4DR7 O;  5CBH A;  4U7O A;  1ZL8 B;  1SQV H;  2CK3 G;  3FB6 C;  4G2K A;  5GTI Z;  1G6U A;  1UPG A;  4FK5 C;  3OMN B;  2EIN C;  2PGG A;  2RJZ A;  4JF3 A;  3R65 A;  3ETQ A;  3QTC A;  4AQY O;  3UO3 A;  4LF8 B;  3UCS C;  3UT5 B;  1WN7 A;  4DR5 O;  3KG2 A;  2GTA A;  2IJI A;  2HFE C;  1LUW A;  2QDO A;  2YIA A;  1GAX A;  3OFN G;  4D7T A;  3SYQ A;  4WBN B;  2WAM A;  5LXT A;  3N2G B;  1BSM A;  5EIB D;  1DGS A;  1MG1 A;  1QLE B;  3JAK A;  4FIP C;  5TIS Z;  1Q6I A;  2AGA A;  1HWY A;  1L8D A;  5LGN A;  4JTC B;  2JEX A;  4KHP B;  1HNX B;  2R70 A;  4TUY A;  1NQT A;  2XTA A;  1GN2 A;  2IH3 C;  2F66 C;  2FL4 A;  3B8M A;  3VBB A;  3TCU A;  5KX5 A;  3SPG A;  2P6J A;  3A0H Z;  2IJK A;  2WLI A;  1VQL V;  1MNG A;  5JCO A;  5IJ0 B;  1FJG O;  2RCV A;  1JX9 A;  3P32 A;  4YHH O;  4UV9 A;  2Q73 A;  3ZN0 A;  1PL0 A;  1QLN A;  4G28 B;  2JK5 C;  2HG5 C;  5KA6 A;  3CPW U;  3LDC A;  4BR6 A;  4TT3 G;  3L72 H;  1GRJ A;  2N04 A;  3TXQ A;  1Q5O A;  1JCH A;  4MVU A;  3K0D A;  1I7F A;  4NR1 A;  4HYO A;  3WB1 A;  2ZE8 A;  3FX7 A;  2HHH O;  3CCE V;  4LR3 A;  1WA8 A;  2A3Q A;  4O2B B;  1FFX B;  4X62 B;  3CXC U;  2O57 A;  1RM1 C;  3ZMS A;  2F4V B;  3IGA C;  2HVJ C;  3CCU V;  2YEV B;  4KFM A;  2EIJ C;  4P9P A;  4U3J B;  3C3T A;  2AZ2 A;  2IJJ A;  1H2N A;  2Y69 B;  4HNA B;  2ZR3 A;  4JI7 B;  1Y74 B;  1WP7 A;  2NNU A;  2QM4 A;  4LF8 O;  1VF5 B;  3RYC B;  2XND G;  4YJ3 A;  2EIK C;  3CD6 V;  4PA7 A;  1XMQ B;  1VQM V;  2G38 A;  1QNM A;  1QU7 A;  5KLV H;  1BHA A;  2ETN A;  2FTK A;  3THO A;  4QGP A;  1BHB A;  1OCZ B;  3CYO A;  3DC6 A;  4O2A A;  1YSC A;  3KZI Z;  2QGN A;  3WB0 A;  5LOV A;  3T2M A;  2V4D A;  2LFR A;  4JI6 O;  1M90 W;  5H5N A;  2OWO A;  3TET A;  4IL6 Z;  5KMG A;  1SA0 B;  2OYQ A;  5CB4 A;  4KHP O;  4UCO A;  2HJF C;  4WFA V;  2FYU H;  3E83 A;  4UV8 A;  4DR2 B;  1VF6 C;  3ZMU A;  1M57 C;  1EFR G;  1LUV A;  1F51 A;  1X4T A;  3SPJ A;  2GBO A;  2Q67 A;  3GWO A;  1SQQ H;  1Z5V A;  1VQ4 V;  4RUE A;  3RYH B;  1BE3 H;  3CSX A;  4YIP A;  4CS2 A;  4NYK A;  3AG2 B;  2NR5 A;  4FVM A;  4N23 A;  2P5O A;  5EK0 A;  4CH4 A;  2Z3Y A;  1B06 A;  3SYC A;  1EN6 A;  4JI4 B;  1LR1 A;  2LJ2 A;  5KHG A;  5CN0 A;  2X6A A;  2EIM C;  1KKD A;  3CMA V;  2WA4 A;  2V7Q G;  3ABK B;  5BR8 B;  4TV9 A;  1SQG A;  2DMX A;  2ZDI A;  4DR6 B;  2A7W A;  4DR4 B;  4J41 A;  4KL1 A;  3L71 H;  2VRZ A;  1VQ7 V;  1R3L C;  5JVD B;  2ZXW C;  1H8E G;  1RPO A;  4B3R B;  1XUQ A;  4B3S O;  4IHJ A;  4JV5 B;  4NXN B;  5JJE B;  4JYA B;  2B9Z A;  3H01 A;  4OX9 O;  1XMQ O;  2M6Y A;  4XDJ A;  4LNU B;  5J2T A;  3OGI B;  1SQF A;  2D3O W;  3H1K H;  2XT9 A;  1IDS A;  4EEQ A;  3BRC A;  4DV1 B;  4FMT A;  4RQE A;  4JAA A;  2QWO B;  4YXW G;  1VF7 A;  4DUZ B;  1X59 A;  5EIB C;  2XAG A;  2OTL V;  4DV2 O;  2OIG A;  4MVZ A;  1L0N H;  1QHT A;  4X1I A;  2X7R B;  3JAS A;  4HZ3 A;  4IIJ A;  5B1B B;  1YHQ V;  4MSW C;  2P67 A;  1SQB H;  5KAI Z;  1FXH A;  1AVM A;  3RBZ A;  3RGB A;  4GYC B;  5BMV B;  1QLE C;  3JAW A;  4UCU A;  3UKM A;  1ORQ C;  1PV0 A;  5LMN B;  1W0K G;  3F5T A;  5CA1 A;  3CRM A;  1OZ0 A;  1SQX H;  4O4H B;  1YTF B;  2CDY A;  3JAT B;  5D5P A;  4ZHQ A;  5JQG B;  4MVQ A;  2UXB O;  3CC4 V;  1I08 A;  2R9I A;  4FFB A;  1YTF D;  1BCC H;  4F6R B;  3J7A U;  4FZ1 A;  4J9Y B;  5BR8 O;  5BXZ A;  5BY1 A;  2QKA A;  5IYD O;  1BZK A;  4AHC A;  2A0L A;  4DR4 O;  2EIL B;  4QPK A;  3CP1 A;  3K5O A;  3OW2 U;  1K3E A;  1MZE A;  4K0K B;  2QA4 V;  1O9G A;  4B3R O;  2IW5 A;  1TGO A;  3KCY A;  3EFF K;  3K5N A;  3HKB B;  3L9D A;  1PL4 A;  2EZP A;  4YJ2 B;  2RDC A;  4JV5 O;  1DTO A;  2JJ1 G;  2MK3 A;  4NXN O;  2HLD G;  1RSO B;  4MT8 A;  3DGE A;  4DV3 B;  3RYF B;  2RNB A;  2Y69 C;  4GX0 A;  2ADQ B;  4R8C A;  2K9P A;  4DV1 O;  1SKV A;  4UFZ A;  1FXK B;  3WB2 A;  4DUZ O;  3K3W A;  4PI0 A;  3EHB B;  5CA3 A;  3ZHU A;  5LL6 Y;  4DRX A;  3CCJ V;  3E8H A;  1OCZ C;  4UUJ C;  3ZRW A;  3S3X A;  3ETD A;  2YI9 A;  2ZE5 A;  2BCC H;  5DEC A;  1KBH A;  5LMN O;  4DV6 B;  2Q0A A;  2ZR2 A;  5ITZ A;  5JJJ B;  5FLX N;  3CC2 V;  4X66 B;  1PNM A;  4R6Z A;  4ZI7 A;  2ARH A;  1A32 A;  1ROP A;  2N74 A;  3I5D A;  3P30 A;  4FLZ A;  1I0H A;  1TUB A;  1IUR A;  1WNS A;  1EM1 A;  2WLJ A;  4GKJ B;  2GDS A;  2DN9 A;  5LHG A;  1ZX3 A;  4E4E A;  3AG2 C;  4MVR A;  2JRI A;  1M56 B;  1E1R G;  2XUM A;  1XI1 A;  2YXY A;  3PJS K;  4JPR A;  3N2K B;  5JJN B;  1WB8 A;  2PF4 E;  3Q4H B;  4U3J A;  3O9O A;  4BIO A; 
#chains in the Genus database with same CATH homology
 1PP9 H;  2IBZ H;  3BCC H;  4U3F H;  3CXH F;  3H1K H;  3CX5 F;  1NTM H;  2A06 H;  1BCC H;  3H1I H;  1SQP H;  1NU1 H;  3CWB H;  1SQQ H;  2BCC H;  3H1H H;  3L71 H;  3TGU H;  1BE3 H;  1NTK H;  1KYO F;  1KB9 F;  1L0N H;  1SQX H;  1L0L H;  3H1L H;  3L74 H;  3L72 H;  3L70 H;  4D6T H;  1SQV H;  3L73 H;  3H1J H;  1BGY H;  5KLV H;  2FYU H;  1NTZ H;  1PPJ H;  4PD4 F;  1SQB H;  1EZV H;  1P84 F;  3L75 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...