3L75H

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l75H00
1KYOF 1L0LH 1PP9H 3H1IH 3L72H 1KB9F 3BCCH 3H1LH 1NTMH 2FYUH 3L70H 4PD4F 1L0NH 1BCCH 1SQVH 1BE3H 1SQXH 3L74H 3L73H 1EZVH 1PPJH 1NU1H 3H1JH 3H1KH 1P84F 2A06H 3CWBH 1BGYH 4U3FH 3L71H 1NTZH 3CXHF 2IBZH 1NTKH 3L75H 3H1HH 1SQBH 3CX5F 4D6TH 5KLVH 3TGUH 1SQPH 2BCCH 1SQQH
chains in the Genus database with same CATH superfamily
1Y76B 1XOUA 3QTCA 1SRYA 1S5JA 1H2SB 3GB7C 4U3JA 5EYPA 1GM8A 5EZYB 2OTLV 5TISZ 1M4UA 3JARA 2JEXA 1J95A 2E5LO 5CB4A 3D36C 1WLEA 3G71V 2F1MA 5H9CA 2EILC 3UQ8A 1RSOA 1PNKA 1YVWA 2BCCH 1AI7A 2OCCC 1R3LC 1SQQH 2OTJV 4J42A 3X2QB 1VQ9V 2X6CA 3S3XA 3H1LH 4DR3O 1AI4A 2CDYA 4JI3O 1DF5A 3K04A 3K03A 4I50A 3QNEA 1NS1A 3JALB 4LF8B 5IYCO 2Q69A 1PV0A 1P7BA 3P3PA 1N33O 5B1AC 1OCOB 1FXVA 1K73W 4MVOA 2LQTA 5ITZA 1OCZC 4UVBA 5JJJB 5LA6A 3CJHB 1Y74A 1VQ7V 1K4CC 4O4LB 4P9OA 3H1KH 1THZA 3SPCA 1AILA 5KHKA 4LF6O 4FLVA 4A5UB 5IJ0A 2BSKB 4DR1O 1FD9A 3ZRSA 3OGCC 1KYOF 4ZOLA 5BMVA 2ZD9A 1AJQA 4GX5A 2F43G 2CH7B 5JCOC 1SERA 1SETA 2GBOA 2JDIG 2Q7GA 4GUNA 4FLUA 2AW9A 3E8HA 1LUVA 3T4DA 4PA3A 4UCTA 5H2FZ 2DYRC 3OGIB 2Y48A 3FB5C 4R8CA 1M57B 2FYUH 2UXCO 1IX9A 2QR4A 3IAYA 3STZC 2K1EA 4WBNA 4DR2B 3JD4A 2UXXA 4F6RB 1BGYH 3D3IA 4YJ3A 4I5SA 5IY5B 4DK0A 3H1HH 1FXKB 4J9ZB 2XNDG 4B3TB 1SZTA 5GTIZ 2DWEC 4TUYA 4DW1A 2ODMA 2GSMB 3SPGA 4AI8A 5KAIZ 3CE2A 3WG7C 1WA8B 1ENVA 3OM3B 4IYIA 1B3QA 4G28B 4K0KO 2JJ2G 3FYIB 1J5EB 3F7VC 1BHAA 4B3RO 3CS5A 1F4MA 5KUKA 1NI8A 4FZ1A 3AK2A 1HDJA 2BTOA 1E1RG 4JTDB 2XAGA 2X6AA 1XMOO 4TQDA 3ML0A 4N23A 4UV9A 3ZMSA 3H1JH 3WB1A 3FYEB 2QM8A 3WB2A 2MW2B 3FAVB 4O2BB 5HFMA 1SQBH 1MG1A 3N2KA 4DR4B 3F5TA 1ZUQA 3E8GA 2BE3A 4B3SO 3M7MX 3T1YO 5KA5A 1N32B 3RWRD 2DYSC 4PELA 1VQKV 4OPAA 4LC1A 2YEVA 5KX5B 2OCHA 4D7TA 5LMUB 5IWAO 5KHGA 5LYJA 4DV0O 5LMNO 1SESA 2Q0AA 4DR3B 4UB6Z 1R6NA 4JI3B 1XNQO 2OWOA 2OYQA 1N8RW 4K8ZA 2ZE6A 2YS8A 4QJFB 4ZIBA 3SJBC 3U11A 1GRJA 1NR1A 2DQ0A 1WNSA 5LHIA 2YIBD 5BXZA 1FJGB 1WJZA 1CPYA 2VQFB 3JAWB 3ZHUA 4E4EA 3CCQV 3JATA 1BL8A 2H8PC 3JYCA 1US6A 3BVOA 4X64B 4LF5O 4R50A 4X9QA 5JJNB 3PN1A 2QM7A 3FFQA 2YIBA 3K5LA 1GTOA 1DF4A 1ZL8A 1SS3A 3OEEG 3ASOC 4WFAV 2N05A 3O9OA 1VQ5V 3K0GA 2IM9A 3VQWA 4UB8Z 4RWUA 4UFZA 5JWPA 1VQMV 3ABLC 4DK1A 4LFBB 1AROP 2FKXA 2XOKG 2UUCO 1SQFA 2WLLA 4WFGA 4UVCA 1XREA 1Q90D 3JCUZ 1VF5B 2HLDG 1VQOV 3HKCB 2EIKB 5EIBD 4BWAA 2B9ZA 2WLNA 1GM9A 4I9WA 1Z5WA 2WLIA 3RW0A 2VQEO 1Q86W 1X4TA 2ZCEA 2HKOA 1OCCC 3APQA 2ITCC 5D5QA 1IBMO 4JYAB 4MTOA 3ZEDA 1XBLA 4MTXA 4BAYA 2WLJA 2AXTZ 4DV1B 2LO1A 2ZXWC 3STLC 4P9PA 4QNHB 1KECA 1H2GA 4IGGA 3RYFA 4O4IB 4U7NA 4O4HB 2P5OA 1WPBA 3CRRA 1I0HA 1DGSA 2ZDIC 1JOYA 3ZMUA 3APOA 4I4TA 1KUQA 4XDJA 3RVZA 2R9AA 4PA6A 2JRIA 1YTFB 4K0KB 5DM6V 4JI7B 4NTWA 4LR3A 3B4SA 3LUTB 5C93A 2LFRA 1GN4A 4MW8A 4MS2A 3T2MA 3X2QC 1DLBA 4PJ0Z 4K8XA 2IH3C 3AK3A 3VBBA 1NH2D 1PD3A 2P67A 2LGWA 1X59A 3RFRA 3AG3B 4FZ0A 3ZN0A 5HFLA 3HKBA 4UXNA 2XTAA 3CPWU 3JASA 5IYZB 1MA1A 3DC6A 3UO2A 3E22A 3H9VA 4UCUA 3G80A 4ICGA 3B8NA 1OCOC 3CXHF 4D7SA 3SPIA 5KAFZ 3CC2V 1GKFA 1ORQC 2FB5A 4RQEA 1L8DA 1LR1A 2Q6AA 1BZKA 2XAQA 3M99B 1K34A 4MTGA 5K1PA 1KP2A 2Z5UA 4DV3O 3KKYA 1RPOA 4PA7A 2UUAO 4I0XA 3K0DA 3NR7A 5CA1B 1LUWA 5IT9N 4N21A 3GVMA 1JJOA 5CBHA 3E86A 4LBEC 3L70H 5B5EZ 2WA4A 1R73A 1JVMA 1Y67A 4G2KA 1FFXA 4DV5O 3RYIA 2BTQB 1M5IA 1W59A 3SDLA 4GLXA 1M57C 3RVYA 2IJJA 3SR2C 1QBZA 2K9PA 2WLMA 2WA3A 3MAQA 1HNWO 2UXDO 5IY5C 4JZGA 3B40A 5EBMC 1FXKC 1NT2B 4EFEA 1AR1B 3CC4V 1VF6C 1EN5A 4ZKIA 1B04A 4LF9O 1Q6UA 2ZR3A 1V55B 2JS5A 2QJ1A 1JR9A 3BEHA 1WAZA 4J80A 1YZBA 4CC6A 4KFMA 1P4RA 2C2AA 3JD2A 3CWBH 4X1IB 4X1YA 1XMQB 3FKSG 3ZCCA 2KKWA 3CX5F 3CSXA 3K08A 2RN9A 4BIOA 5LP6B 4TV8B 2IJHA 3EHBB 4X88A 1TUBB 1IXBA 2B1IA 1IVSA 4LF7B 1GN6A 5J2UB 1YHQV 5JH7B 5LBQA 4AQYB 2RQ6A 3L75H 2F95B 3ZS8C 3OD4A 5CBGA 4FMTA 4HAMA 4XDLA 4R7CA 4FFBB 1ZWIC 3N27A 3R65A 3SYAA 3QG5A 3A2FA 4K35A 4CZZA 1OZ0A 1AJPA 1TVKB 1N36B 4KP4A 4DR7O 2DJVA 3CP1A 4GCZA 2X6BA 5CA0A 3VOUA 2F93B 3UO3A 1XNRO 2Q8VA 1CEZA 4ZI7A 1HNZO 1IBLO 2Q5ZA 1H2KA 2AHZA 1QQCA 2KQXA 2O57A 1I5XA 4CS3A 1XHXA 5LOVB 1MNGA 3MHHC 4X1KB 4OXSA 2P22C 5J9PC 4ZHQA 5C8YB 3IFXA 1KKCA 1R3JC 4TOIA 1QCEA 3KCXA 1A32A 4DV4O 1QU7A 4DV3B 5EYPB 1NR7A 3ZIAG 4B7EA 3OMIB 3JARB 4DV6O 3RYHA 5D5PA 3B8MA 5KHHA 2UUAB 2G38A 3ABMB 1RSOB 5JVDA 2UXBO 4X20A 3OR6C 4UV8A 5A2QN 4GKJO 4Z1VA 3CCVV 4DRXA 2QM4A 2PI5A 2EULA 3QVNA 4GX0A 4ASUG 2EIKC 4I50B 1XHZA 1K5QA 2M6YA 1K8AW 3CRMA 3FB8C 1RPRA 4Q20A 4JYCA 4EB6B 1Y76A 4L87A 2Q68A 1SC5B 1PNMA 4HNAA 3ZRWB 5KMGA 4J11A 5GONA 2ARHA 1GMGA 1XEQA 3WU2Z 4P2ZA 4HBNA 2EX3A 3QF7A 1ZTEA 5ITZB 1QNMA 3R66A 4JYYA 2PF4E 1Y74B 4KL1A 1FAFA 2R9IA 5L3GA 1M1KW 2FMLA 2WSSG 4MVQA 4WFEA 1I7FA 1QLEB 2CTQA 3RYCB 1Q7YW 4CC5A 3FD9A 5IYDO 4YIOA 4PHZA 2DN9A 4JI8O 2OIGA 2AZ0A 1AR5A 2YC0A 5BMVB 2RCVA 4R6ZA 4I55A 3F5WC 3OT7A 3SPHA 2Q73A 3H1IH 1VMGA 2V1DA 4MTFA 4LH6A 4DR5B 2YI9A 1TUEB 1SZXA 4PA9A 3G6BA 4X62B 1LNQA 4X65O 1K7DA 3E2EA 2XT9A 3AG3C 2Q9LA 4IHJA 1K3EA 4DYLA 3MD0A 3TCUA 2GTAA 4BIUA 2H94A 4WBNB 4FK5C 4PDMA 3DSQA 4WFBV 4IIJA 4YJ3B 5BY1A 2QWQB 1MABG 4CH4A 1Z2GA 2LFSA 5CMUA 2IH1C 3OTOO 4YIPA 4H13B 2PTMA 4XDKA 4O2AB 4FM1A 4DR7B 4TUYB 1UPGA 1KQSU 4RAIA 1XNRB 4UCSA 4UCOA 2WLKA 4J41A 4JI6O 2ZM6B 3K58A 2Q67A 2B1GA 2QEXV 5J2TB 2IBZH 3VQXA 3W7TA 4F6RA 1SA0B 1NVPD 2CTWA 1JMKC 3HKDA 2ZNJA 2E75B 4H37A 2A0LA 3FB7C 3E8FA 1VF6A 4KXRA 2DQ3A 2ZKOA 1SQVH 1BE3H 3K57A 2XAJA 1PPJH 3N2KB 4H33A 1Q8IA 1S77D 2CGOA 1N34O 2EJ7A 5JQGA 4H0LB 3ZRVA 2QSAA 2UXBB 2YEVB 3HPLC 4LNUA 2E5LB 3ZHQA 4PD4F 5LYJB 1AI5A 1W0JG 3QO7A 4BW5A 1SQGA 3U10A 3QO8A 1XQ8A 2YICA 4WFHA 2JGUA 5EC1C 2PYLA 3E35A 1V55C 3LDCA 2Y69B 4O2BA 1VQLV 5DEDA 1RFYA 1KB9F 4JAVA 2WAMA 1Y4MA 3OW2U 4QE9A 1YITV 4JI2O 4HZ3A 2DMXA 1FKAO 2P6JA 4LH7A 4KHPO 1MMMA 5LP6C 1HNXO 1P84F 2A06H 3K5NA 1N33B 1ZL8B 4JYBA 4BIZA 3U0ZA 2PY5A 2ZR2A 5B66Z 2HR3A 4X8AA 1K5SA 4LFCO 1IXMA 2Z0AA 4LF6B 4B08A 4JI1O 4JI8B 2GUZA 4JI0O 2UUBO 4UVAA 4YY3O 1ROPA 4DR1B 5KA6A 2F23A 5LGNA 2WLLB 1YI2V 1HP8A 1HW7A 4DR6O 2CTPA 1ZSPA 3ICXA 2PI4A 1V9PA 1AI6A 5LHGA 2WLIB 4X65B 2E3CA 2KG7A 4JI4O 1L0NH 4GX2A 3E89A 5B1BB 1EZVH 2F66C 4J7KA 1S76D 4GKKO 1WN7A 1S5LZ 2YIDA 3E8BA 3CMEV 1EFRG 1QHTA 4NXMO 2HHHO 2R72A 2UXCB 2JGDA 1OJHA 1G4YB 1AR4A 1G6UA 2P7TC 4DV2O 3D36A 3B77A 3RYFB 4DUYO 5IJ9B 4FM2A 3WB0A 4B3MO 4J9YB 1E1QG 2Z3YA 3Q4HA 1F23A 4FLZA 4QE7A 1NJIW 2LGQA 3L71H 4IYHA 3I56V 4I4TB 2V7QG 4FFKA 4NYKA 3CCUV 4CBCA 2D2CB 5KLVH 5H6QA 4OGQB 2PYJA 4PV1B 3ABMC 2ZQMA 1PL4A 4O4JA 5L3EA 3OMNB 2NNUA 1KMIZ 4YXWG 3AG1B 4QPKA 1JFFA 1U96A 1VQ4V 1I5YA 3SYOA 1JCHA 3ABTA 3K3WA 3ZMZA 2WPDG 4B3RB 1UFIA 1WP7A 2UU9O 3VQVA 1H2NA 3OAAG 2QKCA 3CEIA 3ABKB 4JGSA 3ZX6A 2HG5C 5FNVA 3THOA 1JQ0A 3JASB 4YJ2B 1XMOB 4O4HA 4JZ2A 5DECA 1Q43A 1NZ6A 3E22B 1GN2A 5KHIA 1NH2B 1N34B 3HKEB 2ZT9B 4IL6Z 2YSUB 1YJWV 4B3SB 3T1YB 2JK5C 2ZIOA 4NKGB 2LJ2A 5JCOA 4BW9A 1QLEC 2QGNA 3L72H 1N4CA 5IWAB 1NTMH 2EBOA 4DV0B 5LMNB 1TA8A 1IZ3A 3G4SV 1XNQB 1AJNA 4GT1A 4I0XB 1EN6A 2FL4A 2P4KA 2RNBA 2A7WA 3J7AU 4PI2A 3UT5A 5IYZA 5EBWC 4TWKA 2OT5A 5K1XA 1HR0O 1L1FA 3AK1A 2GV9A 4JI2B 3G67A 4EEQA 4LWSA 4KHPB 3T1HO 4LFAO 3DTUB 1FFXB 1VARA 1BCCH 3N2GA 2FTKA 4JPRA 4LF5B 1D2DA 3A0RA 4FM0A 1MZEA 3UKMA 1NU1H 2L6LA 2PUSA 1RP3B 1Q3EA 1PM9A 3TXSA 1AP6A 5L3FA 2P06A 1Y6XA 4BR6A 3OTFA 2ZE5A 3BA9A 2HVJC 3BRCA 3SJAC 3CD6V 4MVRA 4J7JA 3EXAA 3WFVA 5H6RA 2EIJB 1S5HC 4DR6B 2PGGA 4F4LA 2CTRA 2UUCB 2M7WA 1DK1A 1XI1A 1JA8A 2GDSA 3OFNG 1NTKH 2QTSA 3BABA 2ADPA 1V54B 2BTQA 4NVPA 4LF8O 3TJTA 1VEWA 5B3SB 2VQEB 4CS4A 4ABMA 5F2VO 3OUFA 4X1YB 4FLYA 1IBMB 5JJEB 3SGIA 4RQFA 3ETGA 3DC5A 3GWKC 4PDLA 3ZHTA 2CGNA 2ATKC 4DUYB 5LXTB 1IURA 1L0LH 1PP9H 2HJFC 4FPPA 4F6EA 4P30A 1JJ2U 2ITDC 4G27B 1XL6A 2IJIA 4MW3A 1XILA 1H2LA 2BOCC 2QDOA 5DN6G 4GX1A 5BR8O 3W7WA 2YXLA 3JAKA 5CA0B 4CH5A 1WPXA 2UU9B 3K5OA 3P30A 4ZI7B 1EZJA 5EBLC 2N04A 3LNNA 4JASA 4W4LA 2Y69C 2JJ1G 4B7KA 4DR2O 2E76B 3IC9A 1WB7A 1VQ8V 3SJCC 3OUSA 4TQFA 3CRQA 1JPXA 2ZE7A 3BAAA 1R3KC 2A79B 1Z5VA 3RN4A 2AZ2A 3SJQC 4B3TO 1TGOA 2W6IG 2VRZA 3RGBA 3RYHB 3T4ZA 2BOBC 1BS3A 3K06A 3AG4B 3DXRA 1NKDA 3ZBHA 5LL6Y 5BZBA 1BT8A 4U3JB 4TV9A 1Q81W 1W2BU 2QKAA 3E83A 5CB4B 1HR0B 4Z1MG 5GTHZ 1EN4A 1CP9A 1QVGU 4DRXB 5IYBO 1N0JA 4U3FH 4LFAB 2DW4A 3J81N 1DTOA 1FFTB 1K33A 5IDJA 1KU9A 1TAEA 3DGEA 5C8YA 2W0FC 1B6QA 2H3OA 3CRCA 5B1BC 4HNAB 5KMGB 5GONB 2EINB 4DV5B 2IW5A 4DV7O 4DR4O 2VWKA 5E1AC 2EIMB 5EIBC 2CUGA 1H38A 1N32O 2AGAA 2ZDIA 5EZYA 5AG2A 2WLHA 1H8HG 1HNWB 4DW0A 2UXDB 5LMUO 1P49A 5LA6B 2HJDA 3JCZA 4NR1A 2V4DA 3I5DA 1ZLZA 4CS2A 2WWWA 1OCRB 4LF4O 1F7YA 3TK1A 4I55B 5IJ0B 1FJGO 1URFA 4LF9B 4EB6A 2VQFO 3P32A 3S3WA 5KHJA 2HP8A 3ZRWA 4ZOLB 3AG1C 1BHBA 3JALA 1M9NA 2Q7HA 4NTXA 1VIBA 4X64O 1OHHG 3OE7G 2GTSA 3F7YC 2Y4TA 3MHSC 1G8MA 1S0VA 3ABKC 4IHJB 5EK0A 4PDRA 3CCEV 1YXBA 3CJHA 2IJKA 3CXCU 3RYCA 2QWOB 1GN3A 2GHYA 4O4LA 2ILMA 4IIJB 3CRAA 1XUQA 3CHXA 3C90A 4LFBO 3FB6C 3RT3C 4PI0A 1AVMA 2BSKA 3CCRV 1S3JA 1R6KA 3SPJA 3MDSA 3ETEA 1QVFU 5BR8B 3C3TA 4JTCB 2Y0PA 1FYJA 2CH7A 4PDVA 2Q4PA 1N0NA 5L3BA 2XHBA 5FPOA 2YI8A 3BHPA 4GYCB 3KCYA 2R9RB 1IBKO 4GZRB 3KG2A 3LNMB 3BY6A 2KSDA 5E79Z 1JX9A 1UJWB 4JYAO 2DE0X 1P7GA 1YSCA 3KZIZ 1IBLB 1HNZB 3ABUA 3CCMV 3AG2B 4TSFG 4DV1O 5LGTA 1KBHA 3HKDB 4FVMA 2JVDA 3L9DA 2QTOA 1BMFG 1FXKA 4O2AA 3VQYA 5FPRA 1VP7A 2IU0A 2LP7A 1NVPB 2EZOA 1PKXA 1G1XB 2QWPB 4DV4B 5JQGB 3T1CA 4JF3A 3ZMVA 4DV6B 4JI7O 4LNUB 4D6TH 2YIAA 3TXQA 3ZN1A 5J2TA 1WA8A 4U7OA 2EIJC 4RO2A 3SYPA 4C7UA 4I7ZB 4QGPA 1SA0A 3BCCH 1BQ0A 1FPOA 3NXSA 4L8JA 3FX7A 2R70A 4GKJB 1GO3F 1K9MW 2CK3G 5EC2C 1AP5A 1GAXA 1GK9A 4MSWC 1YJ9V 1V54C 1GH6A 4NXNO 2A3QA 1RM1B 3LDDA 2W6JG 5B3SC 4DV7B 4UCRA 2Y4UA 4WF9V 2PZSA 1W0KG 3FAVA 2ZIMA 1GM7A 1VF7A 3UM7A 3JATB 1M56B 4OX9O 3UCSC 1Q5OA 2KB1A 2XAFA 4DXWA 3A8TA 2OIEA 3ZMTA 1NTZH 4KUMA 2VS0A 5CBFA 5KX5A 4FLTA 1BQZA 2ZE8A 5FL7G 2GUZB 4JI5O 4LF4B 3CCSV 4JV5O 2P90A 3CC7V 3ZHRA 2Q0OC 2HEPA 1WB8A 4YHHO 4K3AA 4DUZO 1I94O 2JS3A 3LSQA 3AG7A 1D5AA 4RUEA 4FIPC 3JAWA 3GWOA 4JAUA 2L35A 1OV9A 3M8AA 2XUMA 2KG7B 2D3OW 1U97A 3K9AA 1XDCA 1K4DC 1Q82W 2NN4A 2VWJA 1I08A 2DOSA 1EM1A 4Z2WA 4J7ZA 1FXHA 2JGDB 2LW1A 2CE4A 5IE9A 3EFFK 4FJCC 4Q6GA 1EBOA 2EILB 4PA4A 2X0LA 1MSWD 3Q4HB 4X89A 1XL4A 4IT5A 2OCCB 3IJ4A 5LHHA 4FLXA 1KKDA 3CCJV 3OTOB 4MT8A 4EFBA 2ZINA 3AG4C 1IBKB 3HKCA 1QLNA 3PJSK 4O4JB 1AB3A 1R1BA 3TGUH 4CH6A 4EKWA 3B2EE 1JFFB 2JIZG 1D5NA 3BPZA 1XMQO 1S72V 2HVKC 4JI6B 3P3NA 1Y66A 2NR5A 5B1AB 3ASNC 1MZFA 3CYOA 4LF7O 1OCZB 3JSLA 5FNVB 1F4NA 5IJ9A 4J10A 2RDCA 3CCLV 2XASA 1YTFD 2EINC 1O9GA 3HKBB 1F51A 2YXYA 4O4IA 4XBFA 4AQYO 2EIMC 5GW7A 2QWNB 3A0HZ 3JD3A 3O65A 4TT3G 2MK3A 5B1NA 4WFFA 4MVZA 3ZHVA 1COWG 4ZBMA 1N36O 1K97A 3K59A 4W4KA 3ZHSA 3HR0A 2ZNIA 4AILC 5KUMA 3W7XA 1WP8A 4UCVA 4NTYA 2EZPA 1OCRC 4NXNB 2ADQB 4JTAB 2ETNA 3UT5B 4YJ2A 1ZX3A 2UXNA 2DYRB 5L3DA 3C3SA 2XAHA 4LWSB 3H01A 2F4VO 3ZRXA 1YF2A 3BFRA 3HKEA 4X66O 1SF9A 4OX9B 1SKVA 3K5MA 4E2LA 2DWDC 3N2GB 3G6EV 1YEWA 5L3CA 1HNXB 4FLWA 4H44B 3JD1A 2X7RB 5CN0A 2Q7EA 2JEUA 1KP3A 1R3IC 5CA3A 3RYIB 4QIWF 2NLJC 4JI5B 3B09A 4JV5B 3OMAB 4OPHA 4LFCB 1FS0G 4UUJC 4YHHB 1NQTA 2RMKB 3I55V 1YDXA 4DUZB 4JI1B 3WG7B 1I94B 4JI0B 2UUBB 1R6TA 4YY3B 2W0XA 3JD0A 1VQPV 5CA1A 1QR9A 1QR8A 3JSNA 4DO2A 2YUAA 4JAAA 4JI4B 3BA8A 2LW7A 1Q6IA 3JAMN 4MVUA 3AG2C 4GKKB 1ZAUA 2A9HA 1T5EA 3J80N 2QE7G 1KD1W 4LCUC 4NXMB 2HHHB 2DYSB 4QPJA 1YJNV 3QO5A 2QA4V 2EJRA 4HYOA 4DV2B 3W7UA 1B06A 4B3MB 1MOFA 3ZJZA 1IDSA 1VQ6V 3LSSA 4NB5A 1E79G 2E74B 1NBMG 1SQXH 3L74H 5LGUA 4DR5O 4CH3A 3TETA 1PNLA 1YCIA 3JAKB 3CB2A 2N74A 4X62O 4X1IA 2B5UA 5B1OA 3K79A 5LP6A 3EVKA 4TV8A 5LXTA 1TUBA 2RJZA 2AHYA 1RM1C 1BSMA 3ASOB 3D3QA 2YDEA 2YXHA 5J2UA 2CAZC 1H2MA 1Q6HA 5JH7A 1M56C 3ABLB 1H8EG 3IC7A 3K9SA 4MVSA 3LDEA 3IGAC 4ZHQB 4I9QA 4FFBA 1PL0A 3L73H 3SYCA 1HWYA 3ETQA 3DXRB 1TVKA 5FLXN 3A0BZ 1KC8W 4TV9B 5H5NA 3RBZA 1SQPH 2ZM6O 1MSDA 3OEHG 4WCEV 2P4VA 2QKSA 1M90W 3D8CA 1OCCB 2IU3A 3HB3B 1O9HA 5JVDB 4X20B 2F4VB 1J5EO 1K92A 1CXZB 2QWRB 3W7SA 4X66B 1VQNV 3OR7C 4AHCA 4MVMA 3LSUA 2Y0IA 5A9GA 5LOVA 3SYQA 4X1KA 3T1HB 4RUFA 2ZXWB 3ASNB 3AEIA 3CMAV 1YIJV 4LP8A 1M93A 2HFEC 3ETDA
chains in the Genus database with same CATH topology
1KYOF 1L0LH 1PP9H 3H1IH 3L72H 1KB9F 3BCCH 3H1LH 1NTMH 2FYUH 3L70H 4PD4F 1L0NH 1BCCH 1SQVH 1BE3H 1SQXH 3L74H 3L73H 1EZVH 1PPJH 1NU1H 3H1JH 3H1KH 1P84F 2A06H 3CWBH 1BGYH 4U3FH 3L71H 1NTZH 3CXHF 2IBZH 1NTKH 3L75H 3H1HH 1SQBH 3CX5F 4D6TH 5KLVH 3TGUH 1SQPH 2BCCH 1SQQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO F;  1L0L H;  1PP9 H;  3H1I H;  3L72 H;  1KB9 F;  3BCC H;  3H1L H;  1NTM H;  2FYU H;  3L70 H;  4PD4 F;  1L0N H;  1BCC H;  1SQV H;  1BE3 H;  1SQX H;  3L74 H;  3L73 H;  1EZV H;  1PPJ H;  1NU1 H;  3H1J H;  3H1K H;  1P84 F;  2A06 H;  3CWB H;  1BGY H;  4U3F H;  3L71 H;  1NTZ H;  3CXH F;  2IBZ H;  1NTK H;  3L75 H;  3H1H H;  1SQB H;  3CX5 F;  4D6T H;  5KLV H;  3TGU H;  1SQP H;  2BCC H;  1SQQ H; 
#chains in the Genus database with same CATH topology
 1Y76 B;  1XOU A;  3QTC A;  1SRY A;  1S5J A;  1H2S B;  3GB7 C;  4U3J A;  5EYP A;  1GM8 A;  5EZY B;  2OTL V;  5TIS Z;  1M4U A;  3JAR A;  2JEX A;  1J95 A;  2E5L O;  5CB4 A;  3D36 C;  1WLE A;  3G71 V;  2F1M A;  5H9C A;  2EIL C;  3UQ8 A;  1RSO A;  1PNK A;  1YVW A;  2BCC H;  1AI7 A;  2OCC C;  1R3L C;  1SQQ H;  2OTJ V;  4J42 A;  3X2Q B;  1VQ9 V;  2X6C A;  3S3X A;  3H1L H;  4DR3 O;  1AI4 A;  2CDY A;  4JI3 O;  1DF5 A;  3K04 A;  3K03 A;  4I50 A;  3QNE A;  1NS1 A;  3JAL B;  4LF8 B;  5IYC O;  2Q69 A;  1PV0 A;  1P7B A;  3P3P A;  1N33 O;  5B1A C;  1OCO B;  1FXV A;  1K73 W;  4MVO A;  2LQT A;  5ITZ A;  1OCZ C;  4UVB A;  5JJJ B;  5LA6 A;  3CJH B;  1Y74 A;  1VQ7 V;  1K4C C;  4O4L B;  4P9O A;  3H1K H;  1THZ A;  3SPC A;  1AIL A;  5KHK A;  4LF6 O;  4FLV A;  4A5U B;  5IJ0 A;  2BSK B;  4DR1 O;  1FD9 A;  3ZRS A;  3OGC C;  1KYO F;  4ZOL A;  5BMV A;  2ZD9 A;  1AJQ A;  4GX5 A;  2F43 G;  2CH7 B;  5JCO C;  1SER A;  1SET A;  2GBO A;  2JDI G;  2Q7G A;  4GUN A;  4FLU A;  2AW9 A;  3E8H A;  1LUV A;  3T4D A;  4PA3 A;  4UCT A;  5H2F Z;  2DYR C;  3OGI B;  2Y48 A;  3FB5 C;  4R8C A;  1M57 B;  2FYU H;  2UXC O;  1IX9 A;  2QR4 A;  3IAY A;  3STZ C;  2K1E A;  4WBN A;  4DR2 B;  3JD4 A;  2UXX A;  4F6R B;  1BGY H;  3D3I A;  4YJ3 A;  4I5S A;  5IY5 B;  4DK0 A;  3H1H H;  1FXK B;  4J9Z B;  2XND G;  4B3T B;  1SZT A;  5GTI Z;  2DWE C;  4TUY A;  4DW1 A;  2ODM A;  2GSM B;  3SPG A;  4AI8 A;  5KAI Z;  3CE2 A;  3WG7 C;  1WA8 B;  1ENV A;  3OM3 B;  4IYI A;  1B3Q A;  4G28 B;  4K0K O;  2JJ2 G;  3FYI B;  1J5E B;  3F7V C;  1BHA A;  4B3R O;  3CS5 A;  1F4M A;  5KUK A;  1NI8 A;  4FZ1 A;  3AK2 A;  1HDJ A;  2BTO A;  1E1R G;  4JTD B;  2XAG A;  2X6A A;  1XMO O;  4TQD A;  3ML0 A;  4N23 A;  4UV9 A;  3ZMS A;  3H1J H;  3WB1 A;  3FYE B;  2QM8 A;  3WB2 A;  2MW2 B;  3FAV B;  4O2B B;  5HFM A;  1SQB H;  1MG1 A;  3N2K A;  4DR4 B;  3F5T A;  1ZUQ A;  3E8G A;  2BE3 A;  4B3S O;  3M7M X;  3T1Y O;  5KA5 A;  1N32 B;  3RWR D;  2DYS C;  4PEL A;  1VQK V;  4OPA A;  4LC1 A;  2YEV A;  5KX5 B;  2OCH A;  4D7T A;  5LMU B;  5IWA O;  5KHG A;  5LYJ A;  4DV0 O;  5LMN O;  1SES A;  2Q0A A;  4DR3 B;  4UB6 Z;  1R6N A;  4JI3 B;  1XNQ O;  2OWO A;  2OYQ A;  1N8R W;  4K8Z A;  2ZE6 A;  2YS8 A;  4QJF B;  4ZIB A;  3SJB C;  3U11 A;  1GRJ A;  1NR1 A;  2DQ0 A;  1WNS A;  5LHI A;  2YIB D;  5BXZ A;  1FJG B;  1WJZ A;  1CPY A;  2VQF B;  3JAW B;  3ZHU A;  4E4E A;  3CCQ V;  3JAT A;  1BL8 A;  2H8P C;  3JYC A;  1US6 A;  3BVO A;  4X64 B;  4LF5 O;  4R50 A;  4X9Q A;  5JJN B;  3PN1 A;  2QM7 A;  3FFQ A;  2YIB A;  3K5L A;  1GTO A;  1DF4 A;  1ZL8 A;  1SS3 A;  3OEE G;  3ASO C;  4WFA V;  2N05 A;  3O9O A;  1VQ5 V;  3K0G A;  2IM9 A;  3VQW A;  4UB8 Z;  4RWU A;  4UFZ A;  5JWP A;  1VQM V;  3ABL C;  4DK1 A;  4LFB B;  1ARO P;  2FKX A;  2XOK G;  2UUC O;  1SQF A;  2WLL A;  4WFG A;  4UVC A;  1XRE A;  1Q90 D;  3JCU Z;  1VF5 B;  2HLD G;  1VQO V;  3HKC B;  2EIK B;  5EIB D;  4BWA A;  2B9Z A;  2WLN A;  1GM9 A;  4I9W A;  1Z5W A;  2WLI A;  3RW0 A;  2VQE O;  1Q86 W;  1X4T A;  2ZCE A;  2HKO A;  1OCC C;  3APQ A;  2ITC C;  5D5Q A;  1IBM O;  4JYA B;  4MTO A;  3ZED A;  1XBL A;  4MTX A;  4BAY A;  2WLJ A;  2AXT Z;  4DV1 B;  2LO1 A;  2ZXW C;  3STL C;  4P9P A;  4QNH B;  1KEC A;  1H2G A;  4IGG A;  3RYF A;  4O4I B;  4U7N A;  4O4H B;  2P5O A;  1WPB A;  3CRR A;  1I0H A;  1DGS A;  2ZDI C;  1JOY A;  3ZMU A;  3APO A;  4I4T A;  1KUQ A;  4XDJ A;  3RVZ A;  2R9A A;  4PA6 A;  2JRI A;  1YTF B;  4K0K B;  5DM6 V;  4JI7 B;  4NTW A;  4LR3 A;  3B4S A;  3LUT B;  5C93 A;  2LFR A;  1GN4 A;  4MW8 A;  4MS2 A;  3T2M A;  3X2Q C;  1DLB A;  4PJ0 Z;  4K8X A;  2IH3 C;  3AK3 A;  3VBB A;  1NH2 D;  1PD3 A;  2P67 A;  2LGW A;  1X59 A;  3RFR A;  3AG3 B;  4FZ0 A;  3ZN0 A;  5HFL A;  3HKB A;  4UXN A;  2XTA A;  3CPW U;  3JAS A;  5IYZ B;  1MA1 A;  3DC6 A;  3UO2 A;  3E22 A;  3H9V A;  4UCU A;  3G80 A;  4ICG A;  3B8N A;  1OCO C;  3CXH F;  4D7S A;  3SPI A;  5KAF Z;  3CC2 V;  1GKF A;  1ORQ C;  2FB5 A;  4RQE A;  1L8D A;  1LR1 A;  2Q6A A;  1BZK A;  2XAQ A;  3M99 B;  1K34 A;  4MTG A;  5K1P A;  1KP2 A;  2Z5U A;  4DV3 O;  3KKY A;  1RPO A;  4PA7 A;  2UUA O;  4I0X A;  3K0D A;  3NR7 A;  5CA1 B;  1LUW A;  5IT9 N;  4N21 A;  3GVM A;  1JJO A;  5CBH A;  3E86 A;  4LBE C;  3L70 H;  5B5E Z;  2WA4 A;  1R73 A;  1JVM A;  1Y67 A;  4G2K A;  1FFX A;  4DV5 O;  3RYI A;  2BTQ B;  1M5I A;  1W59 A;  3SDL A;  4GLX A;  1M57 C;  3RVY A;  2IJJ A;  3SR2 C;  1QBZ A;  2K9P A;  2WLM A;  2WA3 A;  3MAQ A;  1HNW O;  2UXD O;  5IY5 C;  4JZG A;  3B40 A;  5EBM C;  1FXK C;  1NT2 B;  4EFE A;  1AR1 B;  3CC4 V;  1VF6 C;  1EN5 A;  4ZKI A;  1B04 A;  4LF9 O;  1Q6U A;  2ZR3 A;  1V55 B;  2JS5 A;  2QJ1 A;  1JR9 A;  3BEH A;  1WAZ A;  4J80 A;  1YZB A;  4CC6 A;  4KFM A;  1P4R A;  2C2A A;  3JD2 A;  3CWB H;  4X1I B;  4X1Y A;  1XMQ B;  3FKS G;  3ZCC A;  2KKW A;  3CX5 F;  3CSX A;  3K08 A;  2RN9 A;  4BIO A;  5LP6 B;  4TV8 B;  2IJH A;  3EHB B;  4X88 A;  1TUB B;  1IXB A;  2B1I A;  1IVS A;  4LF7 B;  1GN6 A;  5J2U B;  1YHQ V;  5JH7 B;  5LBQ A;  4AQY B;  2RQ6 A;  3L75 H;  2F95 B;  3ZS8 C;  3OD4 A;  5CBG A;  4FMT A;  4HAM A;  4XDL A;  4R7C A;  4FFB B;  1ZWI C;  3N27 A;  3R65 A;  3SYA A;  3QG5 A;  3A2F A;  4K35 A;  4CZZ A;  1OZ0 A;  1AJP A;  1TVK B;  1N36 B;  4KP4 A;  4DR7 O;  2DJV A;  3CP1 A;  4GCZ A;  2X6B A;  5CA0 A;  3VOU A;  2F93 B;  3UO3 A;  1XNR O;  2Q8V A;  1CEZ A;  4ZI7 A;  1HNZ O;  1IBL O;  2Q5Z A;  1H2K A;  2AHZ A;  1QQC A;  2KQX A;  2O57 A;  1I5X A;  4CS3 A;  1XHX A;  5LOV B;  1MNG A;  3MHH C;  4X1K B;  4OXS A;  2P22 C;  5J9P C;  4ZHQ A;  5C8Y B;  3IFX A;  1KKC A;  1R3J C;  4TOI A;  1QCE A;  3KCX A;  1A32 A;  4DV4 O;  1QU7 A;  4DV3 B;  5EYP B;  1NR7 A;  3ZIA G;  4B7E A;  3OMI B;  3JAR B;  4DV6 O;  3RYH A;  5D5P A;  3B8M A;  5KHH A;  2UUA B;  2G38 A;  3ABM B;  1RSO B;  5JVD A;  2UXB O;  4X20 A;  3OR6 C;  4UV8 A;  5A2Q N;  4GKJ O;  4Z1V A;  3CCV V;  4DRX A;  2QM4 A;  2PI5 A;  2EUL A;  3QVN A;  4GX0 A;  4ASU G;  2EIK C;  4I50 B;  1XHZ A;  1K5Q A;  2M6Y A;  1K8A W;  3CRM A;  3FB8 C;  1RPR A;  4Q20 A;  4JYC A;  4EB6 B;  1Y76 A;  4L87 A;  2Q68 A;  1SC5 B;  1PNM A;  4HNA A;  3ZRW B;  5KMG A;  4J11 A;  5GON A;  2ARH A;  1GMG A;  1XEQ A;  3WU2 Z;  4P2Z A;  4HBN A;  2EX3 A;  3QF7 A;  1ZTE A;  5ITZ B;  1QNM A;  3R66 A;  4JYY A;  2PF4 E;  1Y74 B;  4KL1 A;  1FAF A;  2R9I A;  5L3G A;  1M1K W;  2FML A;  2WSS G;  4MVQ A;  4WFE A;  1I7F A;  1QLE B;  2CTQ A;  3RYC B;  1Q7Y W;  4CC5 A;  3FD9 A;  5IYD O;  4YIO A;  4PHZ A;  2DN9 A;  4JI8 O;  2OIG A;  2AZ0 A;  1AR5 A;  2YC0 A;  5BMV B;  2RCV A;  4R6Z A;  4I55 A;  3F5W C;  3OT7 A;  3SPH A;  2Q73 A;  3H1I H;  1VMG A;  2V1D A;  4MTF A;  4LH6 A;  4DR5 B;  2YI9 A;  1TUE B;  1SZX A;  4PA9 A;  3G6B A;  4X62 B;  1LNQ A;  4X65 O;  1K7D A;  3E2E A;  2XT9 A;  3AG3 C;  2Q9L A;  4IHJ A;  1K3E A;  4DYL A;  3MD0 A;  3TCU A;  2GTA A;  4BIU A;  2H94 A;  4WBN B;  4FK5 C;  4PDM A;  3DSQ A;  4WFB V;  4IIJ A;  4YJ3 B;  5BY1 A;  2QWQ B;  1MAB G;  4CH4 A;  1Z2G A;  2LFS A;  5CMU A;  2IH1 C;  3OTO O;  4YIP A;  4H13 B;  2PTM A;  4XDK A;  4O2A B;  4FM1 A;  4DR7 B;  4TUY B;  1UPG A;  1KQS U;  4RAI A;  1XNR B;  4UCS A;  4UCO A;  2WLK A;  4J41 A;  4JI6 O;  2ZM6 B;  3K58 A;  2Q67 A;  2B1G A;  2QEX V;  5J2T B;  2IBZ H;  3VQX A;  3W7T A;  4F6R A;  1SA0 B;  1NVP D;  2CTW A;  1JMK C;  3HKD A;  2ZNJ A;  2E75 B;  4H37 A;  2A0L A;  3FB7 C;  3E8F A;  1VF6 A;  4KXR A;  2DQ3 A;  2ZKO A;  1SQV H;  1BE3 H;  3K57 A;  2XAJ A;  1PPJ H;  3N2K B;  4H33 A;  1Q8I A;  1S77 D;  2CGO A;  1N34 O;  2EJ7 A;  5JQG A;  4H0L B;  3ZRV A;  2QSA A;  2UXB B;  2YEV B;  3HPL C;  4LNU A;  2E5L B;  3ZHQ A;  4PD4 F;  5LYJ B;  1AI5 A;  1W0J G;  3QO7 A;  4BW5 A;  1SQG A;  3U10 A;  3QO8 A;  1XQ8 A;  2YIC A;  4WFH A;  2JGU A;  5EC1 C;  2PYL A;  3E35 A;  1V55 C;  3LDC A;  2Y69 B;  4O2B A;  1VQL V;  5DED A;  1RFY A;  1KB9 F;  4JAV A;  2WAM A;  1Y4M A;  3OW2 U;  4QE9 A;  1YIT V;  4JI2 O;  4HZ3 A;  2DMX A;  1FKA O;  2P6J A;  4LH7 A;  4KHP O;  1MMM A;  5LP6 C;  1HNX O;  1P84 F;  2A06 H;  3K5N A;  1N33 B;  1ZL8 B;  4JYB A;  4BIZ A;  3U0Z A;  2PY5 A;  2ZR2 A;  5B66 Z;  2HR3 A;  4X8A A;  1K5S A;  4LFC O;  1IXM A;  2Z0A A;  4LF6 B;  4B08 A;  4JI1 O;  4JI8 B;  2GUZ A;  4JI0 O;  2UUB O;  4UVA A;  4YY3 O;  1ROP A;  4DR1 B;  5KA6 A;  2F23 A;  5LGN A;  2WLL B;  1YI2 V;  1HP8 A;  1HW7 A;  4DR6 O;  2CTP A;  1ZSP A;  3ICX A;  2PI4 A;  1V9P A;  1AI6 A;  5LHG A;  2WLI B;  4X65 B;  2E3C A;  2KG7 A;  4JI4 O;  1L0N H;  4GX2 A;  3E89 A;  5B1B B;  1EZV H;  2F66 C;  4J7K A;  1S76 D;  4GKK O;  1WN7 A;  1S5L Z;  2YID A;  3E8B A;  3CME V;  1EFR G;  1QHT A;  4NXM O;  2HHH O;  2R72 A;  2UXC B;  2JGD A;  1OJH A;  1G4Y B;  1AR4 A;  1G6U A;  2P7T C;  4DV2 O;  3D36 A;  3B77 A;  3RYF B;  4DUY O;  5IJ9 B;  4FM2 A;  3WB0 A;  4B3M O;  4J9Y B;  1E1Q G;  2Z3Y A;  3Q4H A;  1F23 A;  4FLZ A;  4QE7 A;  1NJI W;  2LGQ A;  3L71 H;  4IYH A;  3I56 V;  4I4T B;  2V7Q G;  4FFK A;  4NYK A;  3CCU V;  4CBC A;  2D2C B;  5KLV H;  5H6Q A;  4OGQ B;  2PYJ A;  4PV1 B;  3ABM C;  2ZQM A;  1PL4 A;  4O4J A;  5L3E A;  3OMN B;  2NNU A;  1KMI Z;  4YXW G;  3AG1 B;  4QPK A;  1JFF A;  1U96 A;  1VQ4 V;  1I5Y A;  3SYO A;  1JCH A;  3ABT A;  3K3W A;  3ZMZ A;  2WPD G;  4B3R B;  1UFI A;  1WP7 A;  2UU9 O;  3VQV A;  1H2N A;  3OAA G;  2QKC A;  3CEI A;  3ABK B;  4JGS A;  3ZX6 A;  2HG5 C;  5FNV A;  3THO A;  1JQ0 A;  3JAS B;  4YJ2 B;  1XMO B;  4O4H A;  4JZ2 A;  5DEC A;  1Q43 A;  1NZ6 A;  3E22 B;  1GN2 A;  5KHI A;  1NH2 B;  1N34 B;  3HKE B;  2ZT9 B;  4IL6 Z;  2YSU B;  1YJW V;  4B3S B;  3T1Y B;  2JK5 C;  2ZIO A;  4NKG B;  2LJ2 A;  5JCO A;  4BW9 A;  1QLE C;  2QGN A;  3L72 H;  1N4C A;  5IWA B;  1NTM H;  2EBO A;  4DV0 B;  5LMN B;  1TA8 A;  1IZ3 A;  3G4S V;  1XNQ B;  1AJN A;  4GT1 A;  4I0X B;  1EN6 A;  2FL4 A;  2P4K A;  2RNB A;  2A7W A;  3J7A U;  4PI2 A;  3UT5 A;  5IYZ A;  5EBW C;  4TWK A;  2OT5 A;  5K1X A;  1HR0 O;  1L1F A;  3AK1 A;  2GV9 A;  4JI2 B;  3G67 A;  4EEQ A;  4LWS A;  4KHP B;  3T1H O;  4LFA O;  3DTU B;  1FFX B;  1VAR A;  1BCC H;  3N2G A;  2FTK A;  4JPR A;  4LF5 B;  1D2D A;  3A0R A;  4FM0 A;  1MZE A;  3UKM A;  1NU1 H;  2L6L A;  2PUS A;  1RP3 B;  1Q3E A;  1PM9 A;  3TXS A;  1AP6 A;  5L3F A;  2P06 A;  1Y6X A;  4BR6 A;  3OTF A;  2ZE5 A;  3BA9 A;  2HVJ C;  3BRC A;  3SJA C;  3CD6 V;  4MVR A;  4J7J A;  3EXA A;  3WFV A;  5H6R A;  2EIJ B;  1S5H C;  4DR6 B;  2PGG A;  4F4L A;  2CTR A;  2UUC B;  2M7W A;  1DK1 A;  1XI1 A;  1JA8 A;  2GDS A;  3OFN G;  1NTK H;  2QTS A;  3BAB A;  2ADP A;  1V54 B;  2BTQ A;  4NVP A;  4LF8 O;  3TJT A;  1VEW A;  5B3S B;  2VQE B;  4CS4 A;  4ABM A;  5F2V O;  3OUF A;  4X1Y B;  4FLY A;  1IBM B;  5JJE B;  3SGI A;  4RQF A;  3ETG A;  3DC5 A;  3GWK C;  4PDL A;  3ZHT A;  2CGN A;  2ATK C;  4DUY B;  5LXT B;  1IUR A;  1L0L H;  1PP9 H;  2HJF C;  4FPP A;  4F6E A;  4P30 A;  1JJ2 U;  2ITD C;  4G27 B;  1XL6 A;  2IJI A;  4MW3 A;  1XIL A;  1H2L A;  2BOC C;  2QDO A;  5DN6 G;  4GX1 A;  5BR8 O;  3W7W A;  2YXL A;  3JAK A;  5CA0 B;  4CH5 A;  1WPX A;  2UU9 B;  3K5O A;  3P30 A;  4ZI7 B;  1EZJ A;  5EBL C;  2N04 A;  3LNN A;  4JAS A;  4W4L A;  2Y69 C;  2JJ1 G;  4B7K A;  4DR2 O;  2E76 B;  3IC9 A;  1WB7 A;  1VQ8 V;  3SJC C;  3OUS A;  4TQF A;  3CRQ A;  1JPX A;  2ZE7 A;  3BAA A;  1R3K C;  2A79 B;  1Z5V A;  3RN4 A;  2AZ2 A;  3SJQ C;  4B3T O;  1TGO A;  2W6I G;  2VRZ A;  3RGB A;  3RYH B;  3T4Z A;  2BOB C;  1BS3 A;  3K06 A;  3AG4 B;  3DXR A;  1NKD A;  3ZBH A;  5LL6 Y;  5BZB A;  1BT8 A;  4U3J B;  4TV9 A;  1Q81 W;  1W2B U;  2QKA A;  3E83 A;  5CB4 B;  1HR0 B;  4Z1M G;  5GTH Z;  1EN4 A;  1CP9 A;  1QVG U;  4DRX B;  5IYB O;  1N0J A;  4U3F H;  4LFA B;  2DW4 A;  3J81 N;  1DTO A;  1FFT B;  1K33 A;  5IDJ A;  1KU9 A;  1TAE A;  3DGE A;  5C8Y A;  2W0F C;  1B6Q A;  2H3O A;  3CRC A;  5B1B C;  4HNA B;  5KMG B;  5GON B;  2EIN B;  4DV5 B;  2IW5 A;  4DV7 O;  4DR4 O;  2VWK A;  5E1A C;  2EIM B;  5EIB C;  2CUG A;  1H38 A;  1N32 O;  2AGA A;  2ZDI A;  5EZY A;  5AG2 A;  2WLH A;  1H8H G;  1HNW B;  4DW0 A;  2UXD B;  5LMU O;  1P49 A;  5LA6 B;  2HJD A;  3JCZ A;  4NR1 A;  2V4D A;  3I5D A;  1ZLZ A;  4CS2 A;  2WWW A;  1OCR B;  4LF4 O;  1F7Y A;  3TK1 A;  4I55 B;  5IJ0 B;  1FJG O;  1URF A;  4LF9 B;  4EB6 A;  2VQF O;  3P32 A;  3S3W A;  5KHJ A;  2HP8 A;  3ZRW A;  4ZOL B;  3AG1 C;  1BHB A;  3JAL A;  1M9N A;  2Q7H A;  4NTX A;  1VIB A;  4X64 O;  1OHH G;  3OE7 G;  2GTS A;  3F7Y C;  2Y4T A;  3MHS C;  1G8M A;  1S0V A;  3ABK C;  4IHJ B;  5EK0 A;  4PDR A;  3CCE V;  1YXB A;  3CJH A;  2IJK A;  3CXC U;  3RYC A;  2QWO B;  1GN3 A;  2GHY A;  4O4L A;  2ILM A;  4IIJ B;  3CRA A;  1XUQ A;  3CHX A;  3C90 A;  4LFB O;  3FB6 C;  3RT3 C;  4PI0 A;  1AVM A;  2BSK A;  3CCR V;  1S3J A;  1R6K A;  3SPJ A;  3MDS A;  3ETE A;  1QVF U;  5BR8 B;  3C3T A;  4JTC B;  2Y0P A;  1FYJ A;  2CH7 A;  4PDV A;  2Q4P A;  1N0N A;  5L3B A;  2XHB A;  5FPO A;  2YI8 A;  3BHP A;  4GYC B;  3KCY A;  2R9R B;  1IBK O;  4GZR B;  3KG2 A;  3LNM B;  3BY6 A;  2KSD A;  5E79 Z;  1JX9 A;  1UJW B;  4JYA O;  2DE0 X;  1P7G A;  1YSC A;  3KZI Z;  1IBL B;  1HNZ B;  3ABU A;  3CCM V;  3AG2 B;  4TSF G;  4DV1 O;  5LGT A;  1KBH A;  3HKD B;  4FVM A;  2JVD A;  3L9D A;  2QTO A;  1BMF G;  1FXK A;  4O2A A;  3VQY A;  5FPR A;  1VP7 A;  2IU0 A;  2LP7 A;  1NVP B;  2EZO A;  1PKX A;  1G1X B;  2QWP B;  4DV4 B;  5JQG B;  3T1C A;  4JF3 A;  3ZMV A;  4DV6 B;  4JI7 O;  4LNU B;  4D6T H;  2YIA A;  3TXQ A;  3ZN1 A;  5J2T A;  1WA8 A;  4U7O A;  2EIJ C;  4RO2 A;  3SYP A;  4C7U A;  4I7Z B;  4QGP A;  1SA0 A;  3BCC H;  1BQ0 A;  1FPO A;  3NXS A;  4L8J A;  3FX7 A;  2R70 A;  4GKJ B;  1GO3 F;  1K9M W;  2CK3 G;  5EC2 C;  1AP5 A;  1GAX A;  1GK9 A;  4MSW C;  1YJ9 V;  1V54 C;  1GH6 A;  4NXN O;  2A3Q A;  1RM1 B;  3LDD A;  2W6J G;  5B3S C;  4DV7 B;  4UCR A;  2Y4U A;  4WF9 V;  2PZS A;  1W0K G;  3FAV A;  2ZIM A;  1GM7 A;  1VF7 A;  3UM7 A;  3JAT B;  1M56 B;  4OX9 O;  3UCS C;  1Q5O A;  2KB1 A;  2XAF A;  4DXW A;  3A8T A;  2OIE A;  3ZMT A;  1NTZ H;  4KUM A;  2VS0 A;  5CBF A;  5KX5 A;  4FLT A;  1BQZ A;  2ZE8 A;  5FL7 G;  2GUZ B;  4JI5 O;  4LF4 B;  3CCS V;  4JV5 O;  2P90 A;  3CC7 V;  3ZHR A;  2Q0O C;  2HEP A;  1WB8 A;  4YHH O;  4K3A A;  4DUZ O;  1I94 O;  2JS3 A;  3LSQ A;  3AG7 A;  1D5A A;  4RUE A;  4FIP C;  3JAW A;  3GWO A;  4JAU A;  2L35 A;  1OV9 A;  3M8A A;  2XUM A;  2KG7 B;  2D3O W;  1U97 A;  3K9A A;  1XDC A;  1K4D C;  1Q82 W;  2NN4 A;  2VWJ A;  1I08 A;  2DOS A;  1EM1 A;  4Z2W A;  4J7Z A;  1FXH A;  2JGD B;  2LW1 A;  2CE4 A;  5IE9 A;  3EFF K;  4FJC C;  4Q6G A;  1EBO A;  2EIL B;  4PA4 A;  2X0L A;  1MSW D;  3Q4H B;  4X89 A;  1XL4 A;  4IT5 A;  2OCC B;  3IJ4 A;  5LHH A;  4FLX A;  1KKD A;  3CCJ V;  3OTO B;  4MT8 A;  4EFB A;  2ZIN A;  3AG4 C;  1IBK B;  3HKC A;  1QLN A;  3PJS K;  4O4J B;  1AB3 A;  1R1B A;  3TGU H;  4CH6 A;  4EKW A;  3B2E E;  1JFF B;  2JIZ G;  1D5N A;  3BPZ A;  1XMQ O;  1S72 V;  2HVK C;  4JI6 B;  3P3N A;  1Y66 A;  2NR5 A;  5B1A B;  3ASN C;  1MZF A;  3CYO A;  4LF7 O;  1OCZ B;  3JSL A;  5FNV B;  1F4N A;  5IJ9 A;  4J10 A;  2RDC A;  3CCL V;  2XAS A;  1YTF D;  2EIN C;  1O9G A;  3HKB B;  1F51 A;  2YXY A;  4O4I A;  4XBF A;  4AQY O;  2EIM C;  5GW7 A;  2QWN B;  3A0H Z;  3JD3 A;  3O65 A;  4TT3 G;  2MK3 A;  5B1N A;  4WFF A;  4MVZ A;  3ZHV A;  1COW G;  4ZBM A;  1N36 O;  1K97 A;  3K59 A;  4W4K A;  3ZHS A;  3HR0 A;  2ZNI A;  4AIL C;  5KUM A;  3W7X A;  1WP8 A;  4UCV A;  4NTY A;  2EZP A;  1OCR C;  4NXN B;  2ADQ B;  4JTA B;  2ETN A;  3UT5 B;  4YJ2 A;  1ZX3 A;  2UXN A;  2DYR B;  5L3D A;  3C3S A;  2XAH A;  4LWS B;  3H01 A;  2F4V O;  3ZRX A;  1YF2 A;  3BFR A;  3HKE A;  4X66 O;  1SF9 A;  4OX9 B;  1SKV A;  3K5M A;  4E2L A;  2DWD C;  3N2G B;  3G6E V;  1YEW A;  5L3C A;  1HNX B;  4FLW A;  4H44 B;  3JD1 A;  2X7R B;  5CN0 A;  2Q7E A;  2JEU A;  1KP3 A;  1R3I C;  5CA3 A;  3RYI B;  4QIW F;  2NLJ C;  4JI5 B;  3B09 A;  4JV5 B;  3OMA B;  4OPH A;  4LFC B;  1FS0 G;  4UUJ C;  4YHH B;  1NQT A;  2RMK B;  3I55 V;  1YDX A;  4DUZ B;  4JI1 B;  3WG7 B;  1I94 B;  4JI0 B;  2UUB B;  1R6T A;  4YY3 B;  2W0X A;  3JD0 A;  1VQP V;  5CA1 A;  1QR9 A;  1QR8 A;  3JSN A;  4DO2 A;  2YUA A;  4JAA A;  4JI4 B;  3BA8 A;  2LW7 A;  1Q6I A;  3JAM N;  4MVU A;  3AG2 C;  4GKK B;  1ZAU A;  2A9H A;  1T5E A;  3J80 N;  2QE7 G;  1KD1 W;  4LCU C;  4NXM B;  2HHH B;  2DYS B;  4QPJ A;  1YJN V;  3QO5 A;  2QA4 V;  2EJR A;  4HYO A;  4DV2 B;  3W7U A;  1B06 A;  4B3M B;  1MOF A;  3ZJZ A;  1IDS A;  1VQ6 V;  3LSS A;  4NB5 A;  1E79 G;  2E74 B;  1NBM G;  1SQX H;  3L74 H;  5LGU A;  4DR5 O;  4CH3 A;  3TET A;  1PNL A;  1YCI A;  3JAK B;  3CB2 A;  2N74 A;  4X62 O;  4X1I A;  2B5U A;  5B1O A;  3K79 A;  5LP6 A;  3EVK A;  4TV8 A;  5LXT A;  1TUB A;  2RJZ A;  2AHY A;  1RM1 C;  1BSM A;  3ASO B;  3D3Q A;  2YDE A;  2YXH A;  5J2U A;  2CAZ C;  1H2M A;  1Q6H A;  5JH7 A;  1M56 C;  3ABL B;  1H8E G;  3IC7 A;  3K9S A;  4MVS A;  3LDE A;  3IGA C;  4ZHQ B;  4I9Q A;  4FFB A;  1PL0 A;  3L73 H;  3SYC A;  1HWY A;  3ETQ A;  3DXR B;  1TVK A;  5FLX N;  3A0B Z;  1KC8 W;  4TV9 B;  5H5N A;  3RBZ A;  1SQP H;  2ZM6 O;  1MSD A;  3OEH G;  4WCE V;  2P4V A;  2QKS A;  1M90 W;  3D8C A;  1OCC B;  2IU3 A;  3HB3 B;  1O9H A;  5JVD B;  4X20 B;  2F4V B;  1J5E O;  1K92 A;  1CXZ B;  2QWR B;  3W7S A;  4X66 B;  1VQN V;  3OR7 C;  4AHC A;  4MVM A;  3LSU A;  2Y0I A;  5A9G A;  5LOV A;  3SYQ A;  4X1K A;  3T1H B;  4RUF A;  2ZXW B;  3ASN B;  3AEI A;  3CMA V;  1YIJ V;  4LP8 A;  1M93 A;  2HFE C;  3ETD A; 
#chains in the Genus database with same CATH homology
 1KYO F;  1L0L H;  1PP9 H;  3H1I H;  3L72 H;  1KB9 F;  3BCC H;  3H1L H;  1NTM H;  2FYU H;  3L70 H;  4PD4 F;  1L0N H;  1BCC H;  1SQV H;  1BE3 H;  1SQX H;  3L74 H;  3L73 H;  1EZV H;  1PPJ H;  1NU1 H;  3H1J H;  3H1K H;  1P84 F;  2A06 H;  3CWB H;  1BGY H;  4U3F H;  3L71 H;  1NTZ H;  3CXH F;  2IBZ H;  1NTK H;  3L75 H;  3H1H H;  1SQB H;  3CX5 F;  4D6T H;  5KLV H;  3TGU H;  1SQP H;  2BCC H;  1SQQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...