3L75H

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l75H00
2IBZH 1BE3H 3L72H 1KYOF 1NU1H 1BCCH 3H1LH 2A06H 4D6TH 1SQXH 3CXHF 3TGUH 3H1KH 1SQQH 1EZVH 1NTMH 1SQPH 3L74H 3CWBH 3L70H 3H1IH 3L75H 1L0LH 1PP9H 1BGYH 3CX5F 1SQBH 3L73H 1P84F 2BCCH 1KB9F 3H1JH 1NTZH 3L71H 3H1HH 4PD4F 3BCCH 5KLVH 1PPJH 1SQVH 2FYUH 4U3FH 1NTKH 1L0NH
chains in the Genus database with same CATH superfamily
5IJ9B 1OCCB 3K9SA 5KAFZ 4X1KA 4ZBMA 1HR0O 4Q20A 3TXSA 4DR5B 4KL1A 2QA4V 1IZ3A 4YJ2B 4JV5B 3M8AA 4HNAA 3JAKA 4LFBB 4XDLA 2Q9LA 1FYJA 5B3SC 4LFCB 2F95B 1XI1A 3ABKB 5IY5C 1Q6IA 4QJFB 4G27B 1NR1A 4FM1A 3ZN0A 5JJJB 5JH7A 1AI4A 1J95A 3E83A 3T4DA 1K92A 5L3EA 1V55C 4PA3A 4MW3A 3LSQA 3ASNC 4KFMA 4LF6B 1TUEB 1WB8A 1VQ4V 2W0XA 2D2CB 4A5UB 1BQZA 2HVKC 1OZ0A 4DO2A 2QE7G 1IURA 4DR1O 5KMGB 3BY6A 2YEVB 4O4IB 4RQEA 4UCRA 1XNRB 4AI8A 1S77D 2HHHB 1MOFA 4TQDA 1YDXA 1YTFB 1M4UA 3JAWB 4MTGA 5HFLA 3ABLC 5CBHA 2Q7EA 1VQ6V 1N36B 1TUBA 1K73W 4YJ3B 3IFXA 2IJHA 2KG7B 2AZ2A 4NKGB 4ICGA 1QCEA 2YEVA 5JVDA 1H2MA 2QKCA 3CRMA 1K4DC 2R9IA 3H9VA 1L0NH 5LYJB 2EILC 3RBZA 1B3QA 1DLBA 5GW7A 1VP7A 3RFRA 3ZN1A 3CC4V 2AW9A 5LL6Y 3ZRWB 4ZOLB 2F4VB 3JAWA 5KUMA 2OTJV 1FJGO 5TISZ 1JQ0A 1R3IC 5KA6A 3CRRA 1N32B 4YJ3A 2WLHA 4X66B 3HKBB 1XDCA 2N05A 2DE0X 2KG7A 3T4ZA 5L3CA 2DYRB 4GLXA 2LFSA 5H5NA 2PYJA 4Z1MG 2KSDA 3ZMSA 4U7NA 1NVPB 3K5MA 3ZHSA 4PHZA 5LXTB 4O4HB 5BMVA 1P7GA 3ZHTA 4ZOLA 1X4TA 4CH4A 4FK5C 1BE3H 4KXRA 2BTOA 3HKBA 2JGDB 4F6RA 2YUAA 5FNVB 4D7TA 1EBOA 4QPJA 5F2VO 1Z5WA 1LR1A 2V1DA 4FFBB 1ZL8B 4W4KA 3MAQA 4GKKO 4K0KO 5LHHA 1VIBA 1Y6XA 1YZBA 3UT5B 2DWDC 1S5HC 3OMNB 5KAIZ 1QR9A 1VQLV 1ZSPA 1N4CA 5JCOC 1GK9A 3ML0A 1W59A 1V9PA 1K34A 1WJZA 1K97A 2JGDA 1MZFA 3AG3C 4CBCA 2ZE7A 1YCIA 4UV9A 2QM8A 5H6QA 4DV1B 5BXZA 4JI5O 2Y69C 2IU0A 3LDEA 2HKOA 2WLLA 3KCXA 1BSMA 3FFQA 4R7CA 1Q6UA 4FIPC 1ZL8A 2B1IA 4J7JA 4LF7B 4HBNA 1KP2A 4DV4B 5AG2A 2LW1A 1S3JA 3LNNA 4K8ZA 3OD4A 3IC9A 3S3WA 3T1YB 5KHKA 1GN6A 3R66A 2ATKC 4NXMB 2VWKA 3F5WC 2ZM6B 3SJAC 2Y0IA 4JI6B 1HNXO 2V4DA 4DW1A 2OT5A 4MVSA 1KMIZ 4DV0B 2E3CA 1W0JG 3WB1A 1IVSA 5H9CA 1N8RW 1SESA 3SYCA 4UXNA 4JI1O 4D7SA 1THZA 2ZDIC 1AP5A 1Q5OA 4GT1A 2QSAA 5IYZB 4X8AA 1FS0G 1TVKB 4UV8A 3OE7G 1J5EB 1DF5A 1BQ0A 1A32A 3VOUA 2W6JG 2IJKA 2UXNA 3OFNG 3J81N 3JD4A 2E75B 2F1MA 4DR2O 2EBOA 1WA8B 3GWKC 4JTDB 4PA6A 2UU9O 1K33A 3WB2A 1OV9A 1SA0B 4CC6A 5L3BA 4RUFA 4OX9O 2CUGA 2H8PC 3F5TA 5IYZA 2MK3A 2QKAA 3ZHQA 1SF9A 1SQQH 4LNUB 3J80N 3OM3B 2Q6AA 3OAAG 2R70A 3DSQA 3L73H 3OEHG 2JJ2G 3ZRSA 4GKJB 1BL8A 2GHYA 5LA6B 2EIKB 2XTAA 1WA8A 3CS5A 2PYLA 2UXDO 4JZGA 1H8EG 1FFTB 1HP8A 2Q69A 1SA0A 1OCRB 2NNUA 1ZWIC 4X64B 2EIJB 2F43G 4OPHA 4LFAO 1QLNA 2DOSA 4DXWA 2WWWA 1JA8A 4NXNO 4DRXA 1GN3A 3CSXA 3JD2A 4X88A 5LMNB 2ZXWC 1IBKB 4PI0A 1PV0A 1S5LZ 2Q4PA 1RSOB 3SGIA 2WLIA 1IXMA 5LA6A 2UXBO 1AROP 4FLVA 3J7AU 1D2DA 4R50A 4B7KA 4WFGA 1OCOB 3HKDB 2Y0PA 3I56V 5LHGA 3STLC 3L71H 2HP8A 1WNSA 2X6CA 2JEXA 2UUAO 3ZMUA 5CB4B 3IGAC 1M57B 3RN4A 1PNMA 4O4LB 5B1AC 4J7ZA 1XMOO 3CCEV 1E1RG 2Z5UA 2YS8A 4DR4O 3P3NA 5EBLC 4JI3O 2KQXA 3UKMA 1RSOA 2LGWA 4JZ2A 4DUYO 1MNGA 1HW7A 2YI9A 5KHHA 2WLKA 1KQSU 1YJ9V 2CDYA 1EM1A 2O57A 4MVQA 5FLXN 1P7BA 3FD9A 1Y74B 4WFFA 4PDMA 4TV9B 1YJWV 1N0NA 3RYCA 4O4LA 1VMGA 3E89A 5B1BB 2P22C 4I4TA 2YIBD 2A9HA 3BEHA 1JOYA 1B04A 1OCZB 5GONB 4F6EA 1XUQA 2ODMA 2RMKB 1H8HG 4RQFA 2Q0OC 1UJWB 4NR1A 3F7VC 4U3JB 4LF4O 4BAYA 4BIOA 2UXXA 4LWSB 1HWYA 4BW9A 3G4SV 4DV5B 4TV9A 1GM8A 2LFRA 1KD1W 5B3SB 4CH6A 1FKAO 2UUBB 2H3OA 5IY5B 2WLJA 1QHTA 2XUMA 3ZMVA 1D5AA 3WU2Z 2QEXV 5GONA 1GM9A 1N34O 1JPXA 2PF4E 3ZX6A 1QLEC 5LP6C 4QPKA 4DR3O 1MSWD 4PA7A 3ASNB 1G8MA 4U3JA 2RN9A 4IGGA 2L6LA 3ZS8C 1ZUQA 2ZIMA 3I5DA 2BTQB 4LWSA 2OIGA 2VRZA 3RGBA 2C2AA 3L9DA 2P6JA 4TV8B 2W6IG 3HR0A 4GUNA 2HG5C 3OTOB 3UCSC 3W7SA 1K5QA 3T1HB 2ZE5A 4YHHO 3CC7V 1TGOA 3WG7B 3ABLB 2JGUA 3CB2A 2AHZA 2BTQA 4LH6A 3B40A 1IBLB 1PP9H 4RWUA 1M56C 3PN1A 3AK2A 4WFEA 3CX5F 1GN4A 1KBHA 4BIZA 4TV8A 3K03A 1BS3A 3B8MA 4IIJB 1IBMO 1F7YA 5DECA 1ZAUA 3DC6A 4G28B 4X1YB 3CCJV 1FFXA 4YIPA 1H38A 3JYCA 1GRJA 2DJVA 4J80A 4FLWA 2YICA 3L74H 3LNMB 3H1IH 4GX5A 1FPOA 3APOA 3JD1A 1F51A 4BWAA 4H33A 4LF9B 4FFKA 4RAIA 3DC5A 3VQYA 4JYCA 4DYLA 4YY3O 1JCHA 3OR7C 2CTQA 4IIJA 3AG1B 3K5OA 3LUTB 2XAHA 4H0LB 2VQFB 4X1YA 4RUEA 4LFBO 4PDLA 5CA0B 4YXWG 3W7WA 5DN6G 1AB3A 2L35A 3STZC 1Q6HA 1M1KW 1ORQC 4LFCO 2XNDG 3E8FA 4DR6B 4B3RB 3SPCA 2Z3YA 3AEIA 1HR0B 2JJ1G 3GVMA 1OJHA 3K9AA 2OIEA 3A8TA 5LGUA 4LF6O 1NH2B 1CP9A 1Q81W 1XHZA 2X6AA 3SDLA 2AZ0A 3HPLC 1V54C 4J9YB 3JCZA 4MTOA 4RO2A 1FXVA 5CA0A 1TUBB 1EN4A 3X2QB 3UM7A 1PL0A 3QG5A 4F4LA 1SQXH 1YTFD 3QVNA 1Q90D 3SYAA 5JVDB 3W7XA 2HHHO 1G4YB 2IJIA 4LF8O 4QNHB 2IH1C 3B09A 5FPRA 3AG3B 4JI7B 4YIOA 3H1JH 1EN6A 1XMQB 1VF6C 1E79G 1AI5A 1QNMA 2P7TC 1EN5A 3R65A 4MVZA 4BR6A 1NJIW 1JX9A 4UUJC 4P9PA 1N36O 4JGSA 3W7TA 1O9HA 3M99B 3G6EV 1ROPA 3RVYA 3KG2A 2ZCEA 5KX5A 5IWAB 1VQMV 5EK0A 1VQ8V 1BGYH 1D5NA 4UB6Z 1I5XA 4JAVA 2ZKOA 3E22B 2CTRA 1I7FA 2ZE6A 4EKWA 3W7UA 1R3LC 1ZTEA 2GBOA 5CN0A 5CA1A 2YIDA 3LSSA 2ARHA 5BMVB 1DTOA 2F4VO 3ASOB 3K79A 2QWRB 1DK1A 3B8NA 5C93A 2QM7A 3KCYA 4DV3B 1CXZB 4QE9A 1VQ7V 1N32O 3CCRV 5J2UB 4X66O 4UCSA 2E5LB 3P30A 1U96A 4G2KA 4NTWA 3H01A 2RDCA 2Q67A 1CPYA 1FXKC 1AI7A 4MSWC 4P2ZA 4F6RB 4ZHQA 2B9ZA 3SR2C 2EIMB 3E22A 2XAQA 4JI2O 1YHQV 1R6KA 4B3SB 2HR3A 1NZ6A 3K04A 1MMMA 2OYQA 3RYHA 1IDSA 4NTYA 4K8XA 3E2EA 4WFHA 3A0BZ 1VQKV 3ABMC 1PNLA 4TOIA 4WBNA 4I50A 3IJ4A 1I94B 2JS3A 5J2UA 4K3AA 3RVZA 2R9AA 4DV7B 1HNZO 2RQ6A 5B5EZ 1PL4A 1NT2B 4KHPB 2GV9A 2YDEA 5B1OA 3NR7A 1F4MA 4HAMA 4XDKA 4B3TB 1AILA 2WLLB 3T2MA 1SQGA 3CRQA 2FYUH 1NTKH 2QR4A 4FMTA 5BR8B 1NU1H 3CE2A 4I5SA 4MVUA 3U10A 4X89A 5BZBA 1ZLZA 4X20B 1NTMH 2ZNJA 4BIUA 2UUCB 1P49A 1XNQO 2QWQB 4JI0O 5FPOA 4GX2A 1LUVA 4JTCB 4U3FH 5LHIA 4DR7B 2QGNA 4QGPA 3AG2B 3JASB 2R9RB 4DV4O 3ZIAG 1H2LA 5A2QN 1KECA 1S76D 2KB1A 2EULA 2WLNA 3ABTA 4PELA 4NXMO 2ZM6O 3TJTA 4X20A 2CE4A 2K1EA 3VQWA 3QO8A 1WN7A 4DV0O 3N2GB 3MD0A 4CS4A 3K3WA 2YI8A 2GTAA 4JI5B 1QVFU 3LSUA 4D6TH 4PJ0Z 2AGAA 3CC2V 3OT7A 5GTIZ 4LF5O 1W0KG 2LGQA 2NN4A 1N33O 3F7YC 3HKCA 3JASA 1XBLA 2XAFA 5KHGA 1YI2V 3E8BA 3D8CA 2P67A 4IYIA 4B3MO 4CZZA 4JPRA 1AJQA 1TA8A 4FLTA 2A06H 3MHSC 2EJRA 1IX9A 3N2GA 1O9GA 3I55V 4DV6O 2UXCB 2PGGA 2DYSB 1FXHA 3TETA 1U97A 3CHXA 1M90W 2Q7GA 4WFAV 1F4NA 1N0JA 4OXSA 2XASA 5E1AC 1I0HA 2N74A 1PKXA 3SJBC 3JAMN 4H37A 3K0DA 4UCTA 3WB0A 4DRXB 3JARA 3ETQA 2M6YA 1F23A 3T1CA 4DUZO 2YXYA 4I55B 4GKJO 1RPRA 3RT3C 3JATA 3D36C 4GX0A 2Q68A 3ABUA 1NKDA 2WLIB 4MVOA 3ZRXA 1H2GA 3EXAA 1Q86W 1Q7YW 4OX9B 2OWOA 2XHBA 1KU9A 4X64O 1QLEB 2BOBC 5D5PA 4AHCA 3L70H 1NQTA 3SPGA 4P9OA 5LMNO 1Y67A 2QWNB 4IYHA 5KHJA 3ETEA 1IBKO 3K08A 3SPJA 3CJHA 3ZMTA 1M5IA 4QIWF 2KKWA 3N2KA 1KYOF 4JASA 4I55A 1KP3A 3GWOA 1ZX3A 4PA4A 1R6TA 3BA9A 3G67A 1PM9A 5IYBO 4LC1A 3AK1A 3ZEDA 4Q6GA 3K06A 1HNWB 3B4SA 4CC5A 4JI8O 5LP6A 1WB7A 5ITZB 2QWPB 4MVRA 4NXNB 3QNEA 1SQVH 5LMUB 3BCCH 4PDVA 1Z2GA 4WF9V 1GMGA 3BHPA 5H6RA 3RYCB 1AR4A 3U11A 3MDSA 4IT5A 3C3TA 4I4TB 2K9PA 2WLMA 1SERA 4NYKA 4NVPA 4JI4B 1WLEA 2M7WA 3DGEA 5BY1A 2P5OA 3A2FA 1SRYA 1Q8IA 5ITZA 4JAUA 2F23A 3EHBB 1CEZA 5K1XA 2JK5C 4X65O 3SYPA 2JIZG 3ZCCA 2DN9A 1SQBH 5DEDA 3CCUV 4FM2A 3C90A 3Q4HB 4DUYB 3TCUA 2RJZA 2ILMA 3K57A 4JYAB 1SETA 2VQEB 5E79Z 1BCCH 1P4RA 4NB5A 4BW5A 3AG4C 1KC8W 1PNKA 4DV5O 5JWPA 5IT9N 3QF7A 2UUBO 4O2AB 5EBMC 3SPIA 1H2NA 4FLZA 3ICXA 3ETDA 4L8JA 5EIBD 1KUQA 1Y4MA 3Q4HA 3QO7A 4FZ0A 4J10A 4AQYB 2WA3A 1AR5A 3QO5A 1L8DA 2H94A 3ETGA 2XAGA 4P30A 4X1IB 2EZOA 3FAVB 1V55B 2XT9A 1V54B 2PI5A 2HJFC 4CS2A 5GTHZ 4TUYB 2Q8VA 2QTOA 2EIKC 4O2AA 4GYCB 4IHJB 1JR9A 3CRAA 4FPPA 4PA9A 4DK1A 1QQCA 3OTOO 1EFRG 2Y4UA 3E35A 4UVBA 3JD0A 4K35A 3T1HO 3IC7A 2EIJC 3D3QA 4DR3B 5KA5A 4XBFA 1X59A 2VS0A 1XL6A 4PI2A 1FFXB 1FD9A 4X1IA 3BRCA 4TQFA 3UQ8A 2JDIG 3FAVA 3BABA 1BT8A 3CYOA 5FL7G 4TUYA 4UCVA 2YSUB 2E76B 3B77A 4KP4A 1IBLO 1XILA 5EC1C 4Z1VA 3K0GA 4DV2B 4IHJA 2X7RB 1OCOC 3O65A 4EB6A 3LDDA 4IL6Z 2EILB 1I08A 1M93A 4O4JA 4E4EA 4EEQA 5A9GA 1M57C 5IDJA 2ZR3A 2AXTZ 3HB3B 4GCZA 1MSDA 2FKXA 4X62B 4CH5A 4LF9O 1KB9F 4I9WA 5K1PA 4I7ZB 1K4CC 1FXKB 3C3SA 1VF7A 1IBMB 3CCSV 5L3GA 4J42A 2ZIOA 4DR5O 2P4VA 2GUZA 3H1KH 1QU7A 2YC0A 4JV5O 3SPHA 4R8CA 1L0LH 1VEWA 2CH7A 2CAZC 3CXCU 2ITDC 2Q0AA 3ABMB 5B1BC 4PD4F 3PJSK 4B3RO 2IM9A 1NH2D 1OCZC 1ENVA 4LBEC 4JYBA 2CGNA 2IBZH 3SJCC 1GKFA 2B5UA 4OGQB 4YY3B 4NTXA 1FXKA 1Q43A 5EZYB 1WP7A 4TWKA 3S3XA 3P3PA 2CTWA 3FYIB 4J9ZB 5CA3A 2OCHA 1K9MW 2DW4A 1NTZH 4EFBA 2HFEC 2IH3C 3ZBHA 5CBFA 2ZQMA 1RM1C 3L72H 3LDCA 5KX5B 2QDOA 1SS3A 1I5YA 3RYFB 3NXSA 2NR5A 2ETNA 5IJ9A 1XNRO 4JI7O 1XOUA 4B08A 2OCCC 1BHAA 1XMQO 4MTXA 2W0FC 1K8AW 2LP7A 5EZYA 3ZMZA 5CA1B 5EIBC 4YJ2A 2LJ2A 1VQNV 1S0VA 2Y69B 2JEUA 1QBZA 2HLDG 2DQ0A 3U0ZA 3CPWU 5IWAO 3EFFK 1NBMG 1JVMA 1QR8A 4DR1B 4PDRA 1Y66A 1L1FA 3RYFA 3OUSA 4ZHQB 4LF8B 3JSLA 2Z0AA 5JCOA 4UCUA 2PY5A 1OHHG 2G38A 3WG7C 5IJ0B 3AG7A 2Q5ZA 2E74B 3A0RA 3RYHB 1YITV 5DM6V 4FLXA 1XL4A 4DV3O 2IW5A 4WBNB 4I50B 2E5LO 5KMGA 4O4IA 1NVPD 2BE3A 1RFYA 4Z2WA 2DWEC 1B6QA 1VF5B 3APQA 3EVKA 3TXQA 1K3EA 5EBWC 4B3SO 5LGTA 1XREA 1EZVH 1NS1A 2A7WA 4ZKIA 4HZ3A 2V7QG 3D3IA 5IJ0A 1T5EA 3BVOA 2ZR2A 4J11A 2ZNIA 2YXLA 2BCCH 4QE7A 1FJGB 2ZDIA 5JJEB 4I9QA 1I94O 2R72A 4DV7O 2EINC 1LNQA 1VQPV 1OCCC 3CRCA 4KHPO 5LYJA 2AHYA 2ZD9A 3N27A 4JTAB 3K58A 4JI2B 1LUWA 3AG1C 3MHHC 4FVMA 4N23A 5IYDO 4B3TO 2ZINA 1XHXA 2WA4A 5J9PC 2QM4A 3ZRWA 3E8GA 2EX3A 4R6ZA 3DXRB 5BR8O 1YJNV 2MW2B 3OEEG 4UVCA 3ABKC 1HNZB 2UUCO 5HFMA 1GAXA 2F93B 3M7MX 4LR3A 3E8HA 2ZXWB 5JJNB 4DV1O 3RYIB 4DR7O 5LXTA 1PPJH 4O4HA 2HJDA 5JQGB 2WSSG 4N21A 5KHIA 4GKKB 3D36A 4K0KB 3X2QC 1UPGA 4LF7O 1AP6A 2XOKG 3DXRA 3HKCB 5C8YB 1S72V 3JCUZ 1VQ5V 1MZEA 3T1YO 4J7KA 2ADQB 2GDSA 4JI6O 2PTMA 5FNVA 1XNQB 4MT8A 2X6BA 4JYYA 2QWOB 3FB5C 4JI0B 1WPBA 2VWJA 3OGIB 1URFA 5B1AB 4W4LA 1NR7A 1WP8A 4FFBA 3UO2A 5H2FZ 3RYIA 3ZHRA 4HYOA 5JQGA 2D3OW 3TK1A 3UT5A 2YXHA 5C8YA 1MA1A 1VQ9V 2BSKB 1J5EO 4MTFA 2CTPA 2IU3A 4DK0A 1HNXB 2Y48A 3JARB 4ASUG 4I0XB 1G1XB 4TT3G 2GSMB 3OGCC 3TGUH 4ZI7B 3ASOC 4L87A 2ZE8A 3UO3A 2P06A 1AVMA 3ZJZA 1XEQA 3P32A 2UXCO 1RP3B 3JATB 3IAYA 3SYOA 5LBQA 4LF5B 4JI1B 3E86A 3ZHVA 2LW7A 5LOVB 1N33B 1WPXA 4XDJA 3BPZA 4WCEV 4B3MB 3AG4B 4UVAA 1UFIA 2PUSA 4E2LA 2EIMC 5CBGA 2BSKA 4FM0A 2DYRC 3OMAB 3K59A 3RW0A 3VBBA 1G6UA 1BHBA 3CJHB 4I0XA 4ABMA 2ZT9B 3G71V 2P90A 4ZI7A 3N2KB 4DV6B 2EZPA 3JALB 3K5NA 1COWG 4U7OA 4DR2B 4H13B 3DTUB 2UU9B 2Y4TA 5LOVA 2A79B 1H2SB 1GH6A 3CCLV 4JF3A 1TVKA 1SZXA 4MW8A 4TSFG 5L3DA 5LP6B 2GTSA 1SQFA 3CMAV 4DUZB 1Y76B 3THOA 2FTKA 2P4KA 1Q82W 1JJ2U 1SKVA 4MVMA 3JALA 5LGNA 2JRIA 2QKSA 1YXBA 1YVWA 1BMFG 2UXDB 2WAMA 1R73A 4O2BB 1DF4A 4B7EA 1HNWO 3O9OA 2EJ7A 1US6A 4LP8A 5LMUO 4LFAB 1M9NA 4AILC 2OTLV 1YF2A 5KLVH 4LNUA 3OUFA 3BFRA 4GZRB 5EYPB 3AG2C 1Y76A 3FKSG 2LQTA 2A3QA 1K7DA 4FLYA 3ZHUA 1R3JC 1M56B 4FLUA 1MABG 2UXBB 4C7UA 3OTFA 4JI4O 1Q3EA 2HEPA 3WFVA 4O2BA 1W2BU 4JI8B 1Z5VA 1AR1B 1GN2A 4GX1A 3SJQC 3FB7C 3QTCA 2UUAB 1MG1A 3CP1A 3CCQV 1R6NA 1XMOB 2JS5A 2NLJC 5EYPA 2RNBA 3CWBH 3JSNA 4DR4B 4JI3B 4LH7A 1KKDA 4JYAO 2VQEO 5IE9A 1H2KA 3CCMV 3HKDA 3KKYA 5L3FA 3A0HZ 1FAFA 3GB7C 2ITCC 4DW0A 1HDJA 1JFFB 1AI6A 1RPOA 5CB4A 2CGOA 1GO3F 3CEIA 4X65B 2Q73A 2FMLA 2QTSA 3BA8A 2DMXA 2YIAA 1SZTA 3VQXA 2DYSC 4CH3A 5B66Z 4LCUC 4AQYO 4FJCC 4UB8Z 1WAZA 2FL4A 5J2TB 2A0LA 2Q7HA 2WPDG 2FB5A 1SQPH 1NI8A 4LF4B 1Y74A 3CD6V 2JVDA 2BOCC 1JFFA 1YSCA 1RM1B 3AK3A 3G6BA 1IXBA 3FX7A 1YEWA 4PV1B 5IYCO 4UFZA 4X9QA 4H44B 5CMUA 2DQ3A 1EZJA 2OCCB 1GTOA 1OCRC 4EB6B 1S5JA 3ZRVA 5D5QA 1N34B 1AJPA 4FZ1A 5B1NA 5J2TA 2XAJA 4ZIBA 4O4JB 2N04A 3BAAA 1E1QG 2X0LA 2YIBA 1B06A 2LO1A 2PI4A 1R1BA 3JD3A 2PZSA 3FB6C 3H1LH 3FB8C 3HKEB 1YIJV 1JMKC 4UCOA 4DV2O 2B1GA 3VQVA 1VQOV 4J41A 4JAAA 2ADPA 1GM7A 3H1HH 1XQ8A 3CMEV 3OMIB 2GUZB 4YHHB 1PD3A 1KKCA 1JJOA 1VF6A 4WFBV 2CH7B 2CK3G 2QJ1A 3CXHF 2IJJA 4X62O 4EFEA 1AJNA 1K5SA 1VARA 3L75H 3KZIZ 3HKEA 3FYEB 3G80A 3B2EE 1P84F 1QVGU 1DGSA 2RCVA 4X1KB 1R3KC 3RWRD 4MS2A 4KUMA 3SYQA 4HNAB 3JAKB 5EC2C 4CS3A 1BZKA 3OW2U 2VQFO 3K5LA 5KUKA 2HVJC 3OR6C 3CCVV 2F66C 4OPAA 1SC5B 2EINB 4DR6O 1TAEA 5JH7B
chains in the Genus database with same CATH topology
2IBZH 1BE3H 3L72H 1KYOF 1NU1H 1BCCH 3H1LH 2A06H 4D6TH 1SQXH 3CXHF 3TGUH 3H1KH 1SQQH 1EZVH 1NTMH 1SQPH 3L74H 3CWBH 3L70H 3H1IH 3L75H 1L0LH 1PP9H 1BGYH 3CX5F 1SQBH 3L73H 1P84F 2BCCH 1KB9F 3H1JH 1NTZH 3L71H 3H1HH 4PD4F 3BCCH 5KLVH 1PPJH 1SQVH 2FYUH 4U3FH 1NTKH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ H;  1BE3 H;  3L72 H;  1KYO F;  1NU1 H;  1BCC H;  3H1L H;  2A06 H;  4D6T H;  1SQX H;  3CXH F;  3TGU H;  3H1K H;  1SQQ H;  1EZV H;  1NTM H;  1SQP H;  3L74 H;  3CWB H;  3L70 H;  3H1I H;  3L75 H;  1L0L H;  1PP9 H;  1BGY H;  3CX5 F;  1SQB H;  3L73 H;  1P84 F;  2BCC H;  1KB9 F;  3H1J H;  1NTZ H;  3L71 H;  3H1H H;  4PD4 F;  3BCC H;  5KLV H;  1PPJ H;  1SQV H;  2FYU H;  4U3F H;  1NTK H;  1L0N H; 
#chains in the Genus database with same CATH topology
 5IJ9 B;  1OCC B;  3K9S A;  5KAF Z;  4X1K A;  4ZBM A;  1HR0 O;  4Q20 A;  3TXS A;  4DR5 B;  4KL1 A;  2QA4 V;  1IZ3 A;  4YJ2 B;  4JV5 B;  3M8A A;  4HNA A;  3JAK A;  4LFB B;  4XDL A;  2Q9L A;  1FYJ A;  5B3S C;  4LFC B;  2F95 B;  1XI1 A;  3ABK B;  5IY5 C;  1Q6I A;  4QJF B;  4G27 B;  1NR1 A;  4FM1 A;  3ZN0 A;  5JJJ B;  5JH7 A;  1AI4 A;  1J95 A;  3E83 A;  3T4D A;  1K92 A;  5L3E A;  1V55 C;  4PA3 A;  4MW3 A;  3LSQ A;  3ASN C;  4KFM A;  4LF6 B;  1TUE B;  1WB8 A;  1VQ4 V;  2W0X A;  2D2C B;  4A5U B;  1BQZ A;  2HVK C;  1OZ0 A;  4DO2 A;  2QE7 G;  1IUR A;  4DR1 O;  5KMG B;  3BY6 A;  2YEV B;  4O4I B;  4RQE A;  4UCR A;  1XNR B;  4AI8 A;  1S77 D;  2HHH B;  1MOF A;  4TQD A;  1YDX A;  1YTF B;  1M4U A;  3JAW B;  4MTG A;  5HFL A;  3ABL C;  5CBH A;  2Q7E A;  1VQ6 V;  1N36 B;  1TUB A;  1K73 W;  4YJ3 B;  3IFX A;  2IJH A;  2KG7 B;  2AZ2 A;  4NKG B;  4ICG A;  1QCE A;  2YEV A;  5JVD A;  1H2M A;  2QKC A;  3CRM A;  1K4D C;  2R9I A;  3H9V A;  1L0N H;  5LYJ B;  2EIL C;  3RBZ A;  1B3Q A;  1DLB A;  5GW7 A;  1VP7 A;  3RFR A;  3ZN1 A;  3CC4 V;  2AW9 A;  5LL6 Y;  3ZRW B;  4ZOL B;  2F4V B;  3JAW A;  5KUM A;  2OTJ V;  1FJG O;  5TIS Z;  1JQ0 A;  1R3I C;  5KA6 A;  3CRR A;  1N32 B;  4YJ3 A;  2WLH A;  4X66 B;  3HKB B;  1XDC A;  2N05 A;  2DE0 X;  2KG7 A;  3T4Z A;  5L3C A;  2DYR B;  4GLX A;  2LFS A;  5H5N A;  2PYJ A;  4Z1M G;  2KSD A;  3ZMS A;  4U7N A;  1NVP B;  3K5M A;  3ZHS A;  4PHZ A;  5LXT B;  4O4H B;  5BMV A;  1P7G A;  3ZHT A;  4ZOL A;  1X4T A;  4CH4 A;  4FK5 C;  1BE3 H;  4KXR A;  2BTO A;  3HKB A;  2JGD B;  4F6R A;  2YUA A;  5FNV B;  4D7T A;  1EBO A;  4QPJ A;  5F2V O;  1Z5W A;  1LR1 A;  2V1D A;  4FFB B;  1ZL8 B;  4W4K A;  3MAQ A;  4GKK O;  4K0K O;  5LHH A;  1VIB A;  1Y6X A;  1YZB A;  3UT5 B;  2DWD C;  1S5H C;  3OMN B;  5KAI Z;  1QR9 A;  1VQL V;  1ZSP A;  1N4C A;  5JCO C;  1GK9 A;  3ML0 A;  1W59 A;  1V9P A;  1K34 A;  1WJZ A;  1K97 A;  2JGD A;  1MZF A;  3AG3 C;  4CBC A;  2ZE7 A;  1YCI A;  4UV9 A;  2QM8 A;  5H6Q A;  4DV1 B;  5BXZ A;  4JI5 O;  2Y69 C;  2IU0 A;  3LDE A;  2HKO A;  2WLL A;  3KCX A;  1BSM A;  3FFQ A;  4R7C A;  1Q6U A;  4FIP C;  1ZL8 A;  2B1I A;  4J7J A;  4LF7 B;  4HBN A;  1KP2 A;  4DV4 B;  5AG2 A;  2LW1 A;  1S3J A;  3LNN A;  4K8Z A;  3OD4 A;  3IC9 A;  3S3W A;  3T1Y B;  5KHK A;  1GN6 A;  3R66 A;  2ATK C;  4NXM B;  2VWK A;  3F5W C;  2ZM6 B;  3SJA C;  2Y0I A;  4JI6 B;  1HNX O;  2V4D A;  4DW1 A;  2OT5 A;  4MVS A;  1KMI Z;  4DV0 B;  2E3C A;  1W0J G;  3WB1 A;  1IVS A;  5H9C A;  1N8R W;  1SES A;  3SYC A;  4UXN A;  4JI1 O;  4D7S A;  1THZ A;  2ZDI C;  1AP5 A;  1Q5O A;  4GT1 A;  2QSA A;  5IYZ B;  4X8A A;  1FS0 G;  1TVK B;  4UV8 A;  3OE7 G;  1J5E B;  1DF5 A;  1BQ0 A;  1A32 A;  3VOU A;  2W6J G;  2IJK A;  2UXN A;  3OFN G;  3J81 N;  3JD4 A;  2E75 B;  2F1M A;  4DR2 O;  2EBO A;  1WA8 B;  3GWK C;  4JTD B;  4PA6 A;  2UU9 O;  1K33 A;  3WB2 A;  1OV9 A;  1SA0 B;  4CC6 A;  5L3B A;  4RUF A;  4OX9 O;  2CUG A;  2H8P C;  3F5T A;  5IYZ A;  2MK3 A;  2QKA A;  3ZHQ A;  1SF9 A;  1SQQ H;  4LNU B;  3J80 N;  3OM3 B;  2Q6A A;  3OAA G;  2R70 A;  3DSQ A;  3L73 H;  3OEH G;  2JJ2 G;  3ZRS A;  4GKJ B;  1BL8 A;  2GHY A;  5LA6 B;  2EIK B;  2XTA A;  1WA8 A;  3CS5 A;  2PYL A;  2UXD O;  4JZG A;  1H8E G;  1FFT B;  1HP8 A;  2Q69 A;  1SA0 A;  1OCR B;  2NNU A;  1ZWI C;  4X64 B;  2EIJ B;  2F43 G;  4OPH A;  4LFA O;  1QLN A;  2DOS A;  4DXW A;  2WWW A;  1JA8 A;  4NXN O;  4DRX A;  1GN3 A;  3CSX A;  3JD2 A;  4X88 A;  5LMN B;  2ZXW C;  1IBK B;  4PI0 A;  1PV0 A;  1S5L Z;  2Q4P A;  1RSO B;  3SGI A;  2WLI A;  1IXM A;  5LA6 A;  2UXB O;  1ARO P;  4FLV A;  3J7A U;  1D2D A;  4R50 A;  4B7K A;  4WFG A;  1OCO B;  3HKD B;  2Y0P A;  3I56 V;  5LHG A;  3STL C;  3L71 H;  2HP8 A;  1WNS A;  2X6C A;  2JEX A;  2UUA O;  3ZMU A;  5CB4 B;  3IGA C;  1M57 B;  3RN4 A;  1PNM A;  4O4L B;  5B1A C;  4J7Z A;  1XMO O;  3CCE V;  1E1R G;  2Z5U A;  2YS8 A;  4DR4 O;  3P3N A;  5EBL C;  4JI3 O;  2KQX A;  3UKM A;  1RSO A;  2LGW A;  4JZ2 A;  4DUY O;  1MNG A;  1HW7 A;  2YI9 A;  5KHH A;  2WLK A;  1KQS U;  1YJ9 V;  2CDY A;  1EM1 A;  2O57 A;  4MVQ A;  5FLX N;  1P7B A;  3FD9 A;  1Y74 B;  4WFF A;  4PDM A;  4TV9 B;  1YJW V;  1N0N A;  3RYC A;  4O4L A;  1VMG A;  3E89 A;  5B1B B;  2P22 C;  4I4T A;  2YIB D;  2A9H A;  3BEH A;  1JOY A;  1B04 A;  1OCZ B;  5GON B;  4F6E A;  1XUQ A;  2ODM A;  2RMK B;  1H8H G;  4RQF A;  2Q0O C;  1UJW B;  4NR1 A;  3F7V C;  4U3J B;  4LF4 O;  4BAY A;  4BIO A;  2UXX A;  4LWS B;  1HWY A;  4BW9 A;  3G4S V;  4DV5 B;  4TV9 A;  1GM8 A;  2LFR A;  1KD1 W;  5B3S B;  4CH6 A;  1FKA O;  2UUB B;  2H3O A;  5IY5 B;  2WLJ A;  1QHT A;  2XUM A;  3ZMV A;  1D5A A;  3WU2 Z;  2QEX V;  5GON A;  1GM9 A;  1N34 O;  1JPX A;  2PF4 E;  3ZX6 A;  1QLE C;  5LP6 C;  4QPK A;  4DR3 O;  1MSW D;  4PA7 A;  3ASN B;  1G8M A;  4U3J A;  2RN9 A;  4IGG A;  2L6L A;  3ZS8 C;  1ZUQ A;  2ZIM A;  3I5D A;  2BTQ B;  4LWS A;  2OIG A;  2VRZ A;  3RGB A;  2C2A A;  3L9D A;  2P6J A;  4TV8 B;  2W6I G;  3HR0 A;  4GUN A;  2HG5 C;  3OTO B;  3UCS C;  3W7S A;  1K5Q A;  3T1H B;  2ZE5 A;  4YHH O;  3CC7 V;  1TGO A;  3WG7 B;  3ABL B;  2JGU A;  3CB2 A;  2AHZ A;  2BTQ A;  4LH6 A;  3B40 A;  1IBL B;  1PP9 H;  4RWU A;  1M56 C;  3PN1 A;  3AK2 A;  4WFE A;  3CX5 F;  1GN4 A;  1KBH A;  4BIZ A;  4TV8 A;  3K03 A;  1BS3 A;  3B8M A;  4IIJ B;  1IBM O;  1F7Y A;  5DEC A;  1ZAU A;  3DC6 A;  4G28 B;  4X1Y B;  3CCJ V;  1FFX A;  4YIP A;  1H38 A;  3JYC A;  1GRJ A;  2DJV A;  4J80 A;  4FLW A;  2YIC A;  3L74 H;  3LNM B;  3H1I H;  4GX5 A;  1FPO A;  3APO A;  3JD1 A;  1F51 A;  4BWA A;  4H33 A;  4LF9 B;  4FFK A;  4RAI A;  3DC5 A;  3VQY A;  4JYC A;  4DYL A;  4YY3 O;  1JCH A;  3OR7 C;  2CTQ A;  4IIJ A;  3AG1 B;  3K5O A;  3LUT B;  2XAH A;  4H0L B;  2VQF B;  4X1Y A;  4RUE A;  4LFB O;  4PDL A;  5CA0 B;  4YXW G;  3W7W A;  5DN6 G;  1AB3 A;  2L35 A;  3STZ C;  1Q6H A;  1M1K W;  1ORQ C;  4LFC O;  2XND G;  3E8F A;  4DR6 B;  4B3R B;  3SPC A;  2Z3Y A;  3AEI A;  1HR0 B;  2JJ1 G;  3GVM A;  1OJH A;  3K9A A;  2OIE A;  3A8T A;  5LGU A;  4LF6 O;  1NH2 B;  1CP9 A;  1Q81 W;  1XHZ A;  2X6A A;  3SDL A;  2AZ0 A;  3HPL C;  1V54 C;  4J9Y B;  3JCZ A;  4MTO A;  4RO2 A;  1FXV A;  5CA0 A;  1TUB B;  1EN4 A;  3X2Q B;  3UM7 A;  1PL0 A;  3QG5 A;  4F4L A;  1SQX H;  1YTF D;  3QVN A;  1Q90 D;  3SYA A;  5JVD B;  3W7X A;  2HHH O;  1G4Y B;  2IJI A;  4LF8 O;  4QNH B;  2IH1 C;  3B09 A;  5FPR A;  3AG3 B;  4JI7 B;  4YIO A;  3H1J H;  1EN6 A;  1XMQ B;  1VF6 C;  1E79 G;  1AI5 A;  1QNM A;  2P7T C;  1EN5 A;  3R65 A;  4MVZ A;  4BR6 A;  1NJI W;  1JX9 A;  4UUJ C;  4P9P A;  1N36 O;  4JGS A;  3W7T A;  1O9H A;  3M99 B;  3G6E V;  1ROP A;  3RVY A;  3KG2 A;  2ZCE A;  5KX5 A;  5IWA B;  1VQM V;  5EK0 A;  1VQ8 V;  1BGY H;  1D5N A;  4UB6 Z;  1I5X A;  4JAV A;  2ZKO A;  3E22 B;  2CTR A;  1I7F A;  2ZE6 A;  4EKW A;  3W7U A;  1R3L C;  1ZTE A;  2GBO A;  5CN0 A;  5CA1 A;  2YID A;  3LSS A;  2ARH A;  5BMV B;  1DTO A;  2F4V O;  3ASO B;  3K79 A;  2QWR B;  1DK1 A;  3B8N A;  5C93 A;  2QM7 A;  3KCY A;  4DV3 B;  1CXZ B;  4QE9 A;  1VQ7 V;  1N32 O;  3CCR V;  5J2U B;  4X66 O;  4UCS A;  2E5L B;  3P30 A;  1U96 A;  4G2K A;  4NTW A;  3H01 A;  2RDC A;  2Q67 A;  1CPY A;  1FXK C;  1AI7 A;  4MSW C;  4P2Z A;  4F6R B;  4ZHQ A;  2B9Z A;  3SR2 C;  2EIM B;  3E22 A;  2XAQ A;  4JI2 O;  1YHQ V;  1R6K A;  4B3S B;  2HR3 A;  1NZ6 A;  3K04 A;  1MMM A;  2OYQ A;  3RYH A;  1IDS A;  4NTY A;  4K8X A;  3E2E A;  4WFH A;  3A0B Z;  1VQK V;  3ABM C;  1PNL A;  4TOI A;  4WBN A;  4I50 A;  3IJ4 A;  1I94 B;  2JS3 A;  5J2U A;  4K3A A;  3RVZ A;  2R9A A;  4DV7 B;  1HNZ O;  2RQ6 A;  5B5E Z;  1PL4 A;  1NT2 B;  4KHP B;  2GV9 A;  2YDE A;  5B1O A;  3NR7 A;  1F4M A;  4HAM A;  4XDK A;  4B3T B;  1AIL A;  2WLL B;  3T2M A;  1SQG A;  3CRQ A;  2FYU H;  1NTK H;  2QR4 A;  4FMT A;  5BR8 B;  1NU1 H;  3CE2 A;  4I5S A;  4MVU A;  3U10 A;  4X89 A;  5BZB A;  1ZLZ A;  4X20 B;  1NTM H;  2ZNJ A;  4BIU A;  2UUC B;  1P49 A;  1XNQ O;  2QWQ B;  4JI0 O;  5FPO A;  4GX2 A;  1LUV A;  4JTC B;  4U3F H;  5LHI A;  4DR7 B;  2QGN A;  4QGP A;  3AG2 B;  3JAS B;  2R9R B;  4DV4 O;  3ZIA G;  1H2L A;  5A2Q N;  1KEC A;  1S76 D;  2KB1 A;  2EUL A;  2WLN A;  3ABT A;  4PEL A;  4NXM O;  2ZM6 O;  3TJT A;  4X20 A;  2CE4 A;  2K1E A;  3VQW A;  3QO8 A;  1WN7 A;  4DV0 O;  3N2G B;  3MD0 A;  4CS4 A;  3K3W A;  2YI8 A;  2GTA A;  4JI5 B;  1QVF U;  3LSU A;  4D6T H;  4PJ0 Z;  2AGA A;  3CC2 V;  3OT7 A;  5GTI Z;  4LF5 O;  1W0K G;  2LGQ A;  2NN4 A;  1N33 O;  3F7Y C;  3HKC A;  3JAS A;  1XBL A;  2XAF A;  5KHG A;  1YI2 V;  3E8B A;  3D8C A;  2P67 A;  4IYI A;  4B3M O;  4CZZ A;  4JPR A;  1AJQ A;  1TA8 A;  4FLT A;  2A06 H;  3MHS C;  2EJR A;  1IX9 A;  3N2G A;  1O9G A;  3I55 V;  4DV6 O;  2UXC B;  2PGG A;  2DYS B;  1FXH A;  3TET A;  1U97 A;  3CHX A;  1M90 W;  2Q7G A;  4WFA V;  1F4N A;  1N0J A;  4OXS A;  2XAS A;  5E1A C;  1I0H A;  2N74 A;  1PKX A;  3SJB C;  3JAM N;  4H37 A;  3K0D A;  4UCT A;  3WB0 A;  4DRX B;  3JAR A;  3ETQ A;  2M6Y A;  1F23 A;  3T1C A;  4DUZ O;  2YXY A;  4I55 B;  4GKJ O;  1RPR A;  3RT3 C;  3JAT A;  3D36 C;  4GX0 A;  2Q68 A;  3ABU A;  1NKD A;  2WLI B;  4MVO A;  3ZRX A;  1H2G A;  3EXA A;  1Q86 W;  1Q7Y W;  4OX9 B;  2OWO A;  2XHB A;  1KU9 A;  4X64 O;  1QLE B;  2BOB C;  5D5P A;  4AHC A;  3L70 H;  1NQT A;  3SPG A;  4P9O A;  5LMN O;  1Y67 A;  2QWN B;  4IYH A;  5KHJ A;  3ETE A;  1IBK O;  3K08 A;  3SPJ A;  3CJH A;  3ZMT A;  1M5I A;  4QIW F;  2KKW A;  3N2K A;  1KYO F;  4JAS A;  4I55 A;  1KP3 A;  3GWO A;  1ZX3 A;  4PA4 A;  1R6T A;  3BA9 A;  3G67 A;  1PM9 A;  5IYB O;  4LC1 A;  3AK1 A;  3ZED A;  4Q6G A;  3K06 A;  1HNW B;  3B4S A;  4CC5 A;  4JI8 O;  5LP6 A;  1WB7 A;  5ITZ B;  2QWP B;  4MVR A;  4NXN B;  3QNE A;  1SQV H;  5LMU B;  3BCC H;  4PDV A;  1Z2G A;  4WF9 V;  1GMG A;  3BHP A;  5H6R A;  3RYC B;  1AR4 A;  3U11 A;  3MDS A;  4IT5 A;  3C3T A;  4I4T B;  2K9P A;  2WLM A;  1SER A;  4NYK A;  4NVP A;  4JI4 B;  1WLE A;  2M7W A;  3DGE A;  5BY1 A;  2P5O A;  3A2F A;  1SRY A;  1Q8I A;  5ITZ A;  4JAU A;  2F23 A;  3EHB B;  1CEZ A;  5K1X A;  2JK5 C;  4X65 O;  3SYP A;  2JIZ G;  3ZCC A;  2DN9 A;  1SQB H;  5DED A;  3CCU V;  4FM2 A;  3C90 A;  3Q4H B;  4DUY B;  3TCU A;  2RJZ A;  2ILM A;  3K57 A;  4JYA B;  1SET A;  2VQE B;  5E79 Z;  1BCC H;  1P4R A;  4NB5 A;  4BW5 A;  3AG4 C;  1KC8 W;  1PNK A;  4DV5 O;  5JWP A;  5IT9 N;  3QF7 A;  2UUB O;  4O2A B;  5EBM C;  3SPI A;  1H2N A;  4FLZ A;  3ICX A;  3ETD A;  4L8J A;  5EIB D;  1KUQ A;  1Y4M A;  3Q4H A;  3QO7 A;  4FZ0 A;  4J10 A;  4AQY B;  2WA3 A;  1AR5 A;  3QO5 A;  1L8D A;  2H94 A;  3ETG A;  2XAG A;  4P30 A;  4X1I B;  2EZO A;  3FAV B;  1V55 B;  2XT9 A;  1V54 B;  2PI5 A;  2HJF C;  4CS2 A;  5GTH Z;  4TUY B;  2Q8V A;  2QTO A;  2EIK C;  4O2A A;  4GYC B;  4IHJ B;  1JR9 A;  3CRA A;  4FPP A;  4PA9 A;  4DK1 A;  1QQC A;  3OTO O;  1EFR G;  2Y4U A;  3E35 A;  4UVB A;  3JD0 A;  4K35 A;  3T1H O;  3IC7 A;  2EIJ C;  3D3Q A;  4DR3 B;  5KA5 A;  4XBF A;  1X59 A;  2VS0 A;  1XL6 A;  4PI2 A;  1FFX B;  1FD9 A;  4X1I A;  3BRC A;  4TQF A;  3UQ8 A;  2JDI G;  3FAV A;  3BAB A;  1BT8 A;  3CYO A;  5FL7 G;  4TUY A;  4UCV A;  2YSU B;  2E76 B;  3B77 A;  4KP4 A;  1IBL O;  1XIL A;  5EC1 C;  4Z1V A;  3K0G A;  4DV2 B;  4IHJ A;  2X7R B;  1OCO C;  3O65 A;  4EB6 A;  3LDD A;  4IL6 Z;  2EIL B;  1I08 A;  1M93 A;  4O4J A;  4E4E A;  4EEQ A;  5A9G A;  1M57 C;  5IDJ A;  2ZR3 A;  2AXT Z;  3HB3 B;  4GCZ A;  1MSD A;  2FKX A;  4X62 B;  4CH5 A;  4LF9 O;  1KB9 F;  4I9W A;  5K1P A;  4I7Z B;  1K4C C;  1FXK B;  3C3S A;  1VF7 A;  1IBM B;  3CCS V;  5L3G A;  4J42 A;  2ZIO A;  4DR5 O;  2P4V A;  2GUZ A;  3H1K H;  1QU7 A;  2YC0 A;  4JV5 O;  3SPH A;  4R8C A;  1L0L H;  1VEW A;  2CH7 A;  2CAZ C;  3CXC U;  2ITD C;  2Q0A A;  3ABM B;  5B1B C;  4PD4 F;  3PJS K;  4B3R O;  2IM9 A;  1NH2 D;  1OCZ C;  1ENV A;  4LBE C;  4JYB A;  2CGN A;  2IBZ H;  3SJC C;  1GKF A;  2B5U A;  4OGQ B;  4YY3 B;  4NTX A;  1FXK A;  1Q43 A;  5EZY B;  1WP7 A;  4TWK A;  3S3X A;  3P3P A;  2CTW A;  3FYI B;  4J9Z B;  5CA3 A;  2OCH A;  1K9M W;  2DW4 A;  1NTZ H;  4EFB A;  2HFE C;  2IH3 C;  3ZBH A;  5CBF A;  2ZQM A;  1RM1 C;  3L72 H;  3LDC A;  5KX5 B;  2QDO A;  1SS3 A;  1I5Y A;  3RYF B;  3NXS A;  2NR5 A;  2ETN A;  5IJ9 A;  1XNR O;  4JI7 O;  1XOU A;  4B08 A;  2OCC C;  1BHA A;  1XMQ O;  4MTX A;  2W0F C;  1K8A W;  2LP7 A;  5EZY A;  3ZMZ A;  5CA1 B;  5EIB C;  4YJ2 A;  2LJ2 A;  1VQN V;  1S0V A;  2Y69 B;  2JEU A;  1QBZ A;  2HLD G;  2DQ0 A;  3U0Z A;  3CPW U;  5IWA O;  3EFF K;  1NBM G;  1JVM A;  1QR8 A;  4DR1 B;  4PDR A;  1Y66 A;  1L1F A;  3RYF A;  3OUS A;  4ZHQ B;  4LF8 B;  3JSL A;  2Z0A A;  5JCO A;  4UCU A;  2PY5 A;  1OHH G;  2G38 A;  3WG7 C;  5IJ0 B;  3AG7 A;  2Q5Z A;  2E74 B;  3A0R A;  3RYH B;  1YIT V;  5DM6 V;  4FLX A;  1XL4 A;  4DV3 O;  2IW5 A;  4WBN B;  4I50 B;  2E5L O;  5KMG A;  4O4I A;  1NVP D;  2BE3 A;  1RFY A;  4Z2W A;  2DWE C;  1B6Q A;  1VF5 B;  3APQ A;  3EVK A;  3TXQ A;  1K3E A;  5EBW C;  4B3S O;  5LGT A;  1XRE A;  1EZV H;  1NS1 A;  2A7W A;  4ZKI A;  4HZ3 A;  2V7Q G;  3D3I A;  5IJ0 A;  1T5E A;  3BVO A;  2ZR2 A;  4J11 A;  2ZNI A;  2YXL A;  2BCC H;  4QE7 A;  1FJG B;  2ZDI A;  5JJE B;  4I9Q A;  1I94 O;  2R72 A;  4DV7 O;  2EIN C;  1LNQ A;  1VQP V;  1OCC C;  3CRC A;  4KHP O;  5LYJ A;  2AHY A;  2ZD9 A;  3N27 A;  4JTA B;  3K58 A;  4JI2 B;  1LUW A;  3AG1 C;  3MHH C;  4FVM A;  4N23 A;  5IYD O;  4B3T O;  2ZIN A;  1XHX A;  2WA4 A;  5J9P C;  2QM4 A;  3ZRW A;  3E8G A;  2EX3 A;  4R6Z A;  3DXR B;  5BR8 O;  1YJN V;  2MW2 B;  3OEE G;  4UVC A;  3ABK C;  1HNZ B;  2UUC O;  5HFM A;  1GAX A;  2F93 B;  3M7M X;  4LR3 A;  3E8H A;  2ZXW B;  5JJN B;  4DV1 O;  3RYI B;  4DR7 O;  5LXT A;  1PPJ H;  4O4H A;  2HJD A;  5JQG B;  2WSS G;  4N21 A;  5KHI A;  4GKK B;  3D36 A;  4K0K B;  3X2Q C;  1UPG A;  4LF7 O;  1AP6 A;  2XOK G;  3DXR A;  3HKC B;  5C8Y B;  1S72 V;  3JCU Z;  1VQ5 V;  1MZE A;  3T1Y O;  4J7K A;  2ADQ B;  2GDS A;  4JI6 O;  2PTM A;  5FNV A;  1XNQ B;  4MT8 A;  2X6B A;  4JYY A;  2QWO B;  3FB5 C;  4JI0 B;  1WPB A;  2VWJ A;  3OGI B;  1URF A;  5B1A B;  4W4L A;  1NR7 A;  1WP8 A;  4FFB A;  3UO2 A;  5H2F Z;  3RYI A;  3ZHR A;  4HYO A;  5JQG A;  2D3O W;  3TK1 A;  3UT5 A;  2YXH A;  5C8Y A;  1MA1 A;  1VQ9 V;  2BSK B;  1J5E O;  4MTF A;  2CTP A;  2IU3 A;  4DK0 A;  1HNX B;  2Y48 A;  3JAR B;  4ASU G;  4I0X B;  1G1X B;  4TT3 G;  2GSM B;  3OGC C;  3TGU H;  4ZI7 B;  3ASO C;  4L87 A;  2ZE8 A;  3UO3 A;  2P06 A;  1AVM A;  3ZJZ A;  1XEQ A;  3P32 A;  2UXC O;  1RP3 B;  3JAT B;  3IAY A;  3SYO A;  5LBQ A;  4LF5 B;  4JI1 B;  3E86 A;  3ZHV A;  2LW7 A;  5LOV B;  1N33 B;  1WPX A;  4XDJ A;  3BPZ A;  4WCE V;  4B3M B;  3AG4 B;  4UVA A;  1UFI A;  2PUS A;  4E2L A;  2EIM C;  5CBG A;  2BSK A;  4FM0 A;  2DYR C;  3OMA B;  3K59 A;  3RW0 A;  3VBB A;  1G6U A;  1BHB A;  3CJH B;  4I0X A;  4ABM A;  2ZT9 B;  3G71 V;  2P90 A;  4ZI7 A;  3N2K B;  4DV6 B;  2EZP A;  3JAL B;  3K5N A;  1COW G;  4U7O A;  4DR2 B;  4H13 B;  3DTU B;  2UU9 B;  2Y4T A;  5LOV A;  2A79 B;  1H2S B;  1GH6 A;  3CCL V;  4JF3 A;  1TVK A;  1SZX A;  4MW8 A;  4TSF G;  5L3D A;  5LP6 B;  2GTS A;  1SQF A;  3CMA V;  4DUZ B;  1Y76 B;  3THO A;  2FTK A;  2P4K A;  1Q82 W;  1JJ2 U;  1SKV A;  4MVM A;  3JAL A;  5LGN A;  2JRI A;  2QKS A;  1YXB A;  1YVW A;  1BMF G;  2UXD B;  2WAM A;  1R73 A;  4O2B B;  1DF4 A;  4B7E A;  1HNW O;  3O9O A;  2EJ7 A;  1US6 A;  4LP8 A;  5LMU O;  4LFA B;  1M9N A;  4AIL C;  2OTL V;  1YF2 A;  5KLV H;  4LNU A;  3OUF A;  3BFR A;  4GZR B;  5EYP B;  3AG2 C;  1Y76 A;  3FKS G;  2LQT A;  2A3Q A;  1K7D A;  4FLY A;  3ZHU A;  1R3J C;  1M56 B;  4FLU A;  1MAB G;  2UXB B;  4C7U A;  3OTF A;  4JI4 O;  1Q3E A;  2HEP A;  3WFV A;  4O2B A;  1W2B U;  4JI8 B;  1Z5V A;  1AR1 B;  1GN2 A;  4GX1 A;  3SJQ C;  3FB7 C;  3QTC A;  2UUA B;  1MG1 A;  3CP1 A;  3CCQ V;  1R6N A;  1XMO B;  2JS5 A;  2NLJ C;  5EYP A;  2RNB A;  3CWB H;  3JSN A;  4DR4 B;  4JI3 B;  4LH7 A;  1KKD A;  4JYA O;  2VQE O;  5IE9 A;  1H2K A;  3CCM V;  3HKD A;  3KKY A;  5L3F A;  3A0H Z;  1FAF A;  3GB7 C;  2ITC C;  4DW0 A;  1HDJ A;  1JFF B;  1AI6 A;  1RPO A;  5CB4 A;  2CGO A;  1GO3 F;  3CEI A;  4X65 B;  2Q73 A;  2FML A;  2QTS A;  3BA8 A;  2DMX A;  2YIA A;  1SZT A;  3VQX A;  2DYS C;  4CH3 A;  5B66 Z;  4LCU C;  4AQY O;  4FJC C;  4UB8 Z;  1WAZ A;  2FL4 A;  5J2T B;  2A0L A;  2Q7H A;  2WPD G;  2FB5 A;  1SQP H;  1NI8 A;  4LF4 B;  1Y74 A;  3CD6 V;  2JVD A;  2BOC C;  1JFF A;  1YSC A;  1RM1 B;  3AK3 A;  3G6B A;  1IXB A;  3FX7 A;  1YEW A;  4PV1 B;  5IYC O;  4UFZ A;  4X9Q A;  4H44 B;  5CMU A;  2DQ3 A;  1EZJ A;  2OCC B;  1GTO A;  1OCR C;  4EB6 B;  1S5J A;  3ZRV A;  5D5Q A;  1N34 B;  1AJP A;  4FZ1 A;  5B1N A;  5J2T A;  2XAJ A;  4ZIB A;  4O4J B;  2N04 A;  3BAA A;  1E1Q G;  2X0L A;  2YIB A;  1B06 A;  2LO1 A;  2PI4 A;  1R1B A;  3JD3 A;  2PZS A;  3FB6 C;  3H1L H;  3FB8 C;  3HKE B;  1YIJ V;  1JMK C;  4UCO A;  4DV2 O;  2B1G A;  3VQV A;  1VQO V;  4J41 A;  4JAA A;  2ADP A;  1GM7 A;  3H1H H;  1XQ8 A;  3CME V;  3OMI B;  2GUZ B;  4YHH B;  1PD3 A;  1KKC A;  1JJO A;  1VF6 A;  4WFB V;  2CH7 B;  2CK3 G;  2QJ1 A;  3CXH F;  2IJJ A;  4X62 O;  4EFE A;  1AJN A;  1K5S A;  1VAR A;  3L75 H;  3KZI Z;  3HKE A;  3FYE B;  3G80 A;  3B2E E;  1P84 F;  1QVG U;  1DGS A;  2RCV A;  4X1K B;  1R3K C;  3RWR D;  4MS2 A;  4KUM A;  3SYQ A;  4HNA B;  3JAK B;  5EC2 C;  4CS3 A;  1BZK A;  3OW2 U;  2VQF O;  3K5L A;  5KUK A;  2HVJ C;  3OR6 C;  3CCV V;  2F66 C;  4OPA A;  1SC5 B;  2EIN B;  4DR6 O;  1TAE A;  5JH7 B; 
#chains in the Genus database with same CATH homology
 2IBZ H;  1BE3 H;  3L72 H;  1KYO F;  1NU1 H;  1BCC H;  3H1L H;  2A06 H;  4D6T H;  1SQX H;  3CXH F;  3TGU H;  3H1K H;  1SQQ H;  1EZV H;  1NTM H;  1SQP H;  3L74 H;  3CWB H;  3L70 H;  3H1I H;  3L75 H;  1L0L H;  1PP9 H;  1BGY H;  3CX5 F;  1SQB H;  3L73 H;  1P84 F;  2BCC H;  1KB9 F;  3H1J H;  1NTZ H;  3L71 H;  3H1H H;  4PD4 F;  3BCC H;  5KLV H;  1PPJ H;  1SQV H;  2FYU H;  4U3F H;  1NTK H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...