4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
1OCOC 4R6ZA 4G28B 3TCUA 4MS2A 2HJFC 3OGCC 2QKSA 4GX5A 2IH1C 2Q68A 4X89A 4PA9A 3ZJZA 2ZXWC 3OR6C 4EKWA 4X8AA 3K0GA 3SPHA 2ITCC 4RUFA 4J9YB 2EIKC 2ZD9A 2Y69C 4MW8A 5EBMC 2HFEC 3RW0A 3STLC 2A79B 4KFMA 2W0FC 3RVZA 3VOUA 3E8BA 4P2ZA 3UKMA 3X2QC 4MTOA 1V55C 4P30A 3SYCA 5BZBA 2EIJC 4PA7A 4R8CA 4MVZA 4HZ3A 4QNHB 2WLLB 5EC1C 5J9PC 3K0DA 1K4CC 4H33A 4MVMA 2EIMC 3SYAA 3WG7C 3RVYA 4HYOA 1R3KC 4X88A 3LDDA 2HVKC 3SPGA 3R65A 3T4ZA 4LP8A 4DXWA 4H37A 3F7VC 5CBFA 4TWKA 5EBLC 1ORQC 5IY5C 3E89A 1BL8A 3STZC 1QLEC 3UM7A 3SYPA 2WLIB 4WFHA 2WLNA 5E1AC 2BOBC 4GX1A 1ZWIC 3FB8C 2JK5C 2YEVA 1R3LC 2DWEC 5B1AC 3BEHA 2X6CA 4MVUA 1KKDA 3F5WC 1XL4A 4GX2A 3LDCA 4GX0A 4PA6A 4QE7A 2NLJC 4WFEA 2AHZA 2EINC 3SPCA 2Q69A 2KB1A 3KG2A 3ABMC 1K4DC 2QTOA 3IGAC 3E8GA 4MVSA 2K1EA 3HPLC 2OCCC 4PDVA 3K04A 3OUFA 3TETA 4PA4A 2WLLA 4UUJC 2R9RB 2WLJA 4MVQA 4CBCA 3K06A 5B1BC 4MVOA 4RO2A 4OXSA 1R3IC 3FB6C 4PA3A 4BW5A 2X6BA 3SPJA 2WLHA 4MVRA 2DYRC 4PDLA 1J95A 3EFFK 3AG3C 3FB7C 3PJSK 2HG5C 2WLKA 3ABKC 5KUMA 3E8HA 1OCRC 2DWDC 2AHYA 4XDJA 1G4YB 4P9PA 2ITDC 3GB7C 4RUEA 2DYSC 3JYCA 3LNMB 4MSWC 2P7TC 2ATKC 1M56C 5CBGA 2WLIA 3ASNC 3E83A 4LBEC 2BOCC 2H8PC 3E86A 3LUTB 4QE9A 5EBWC 3F7YC 3IFXA 2Q6AA 3T4DA 2WLMA 4PDMA 2EILC 4MTFA 3AG4C 3SPIA 3OR7C 4I9WA 3ASOC 4JTDB 4XDLA 3AG2C 2HVJC 3FB5C 5EC2C 5B3SC 4R7CA 3OUSA 5CBHA 3K08A 2IH3C 3ABLC 1OCCC 4G27B 4J9ZB 1XL6A 2X6AA 4JTAB 4R50A 4ZBMA 1R3JC 3SJQC 1S5HC 3SYOA 4P9OA 3T2MA 1JVMA 1P7BA 4MTGA 2A9HA 3RBZA 5EK0A 3ZRSA 3T1CA 3K03A 1M57C 2A0LA 1V54C 3LDEA 2Q67A 4WFGA 4LCUC 5KUKA 4F4LA 4JTCB 3AG1C 1LNQA 4PDRA 4XDKA 4MW3A 4WFFA 4RAIA 1OCZC 3E8FA 3SYQA
chains in the Genus database with same CATH superfamily
1HR0O 4LFCO 4PJ0Z 3ZHSA 5LOVB 3FYEB 3ZJZA 3ZEDA 1SQVH 2ZXWC 1NH2B 2KQXA 3JAKB 2EX3A 2Q9LA 3L75H 4JI3B 1Q5OA 4UCTA 1YJ9V 2HFEC 4NXNB 2DQ0A 1BGYH 1PL0A 3TXSA 2UUCB 1X59A 2W0XA 2FYUH 3R66A 3ZMTA 1OCCB 5J2UA 2ZCEA 5LMNO 1F4MA 3OFNG 1JOYA 4J42A 4K35A 1IURA 3UM7A 1GM7A 2UXNA 4U7NA 4YJ2A 3BHPA 2QA4V 2DWEC 1RM1B 4NR1A 4MVUA 3JAMN 4K0KB 4TUYB 1XL4A 5L3DA 3I55V 5IYDO 2UUBO 4N23A 2F4VB 1Z5WA 4UVCA 2Q7HA 1RPRA 2F93B 4RO2A 1H2MA 2WLHA 4X62O 5JWPA 1FKAO 2UU9B 3FB7C 2WLKA 2UXBB 3SR2C 2C2AA 4QPKA 1S0VA 2YC0A 1RFYA 2ZE7A 2RMKB 5A2QN 4X20B 2RDCA 1PPJH 2F1MA 2P4KA 3S3WA 3SPIA 3L73H 5IY5B 4DR5B 3H1HH 4NXNO 5D5QA 4BIZA 3OUSA 3QO5A 1VQOV 4ZI7B 5J2TB 2UUCO 2VQFB 2HEPA 5GONB 1EZJA 1H2GA 5FNVB 4X1IA 1P7GA 5LXTB 3ABMB 3O9OA 2PYLA 4FLUA 5IDJA 2Q73A 3TCUA 1VIBA 2HJFC 3E22B 2Q68A 1EBOA 2Y0PA 4EKWA 4K0KO 4WCEV 2ITCC 4CC5A 1NT2B 1UJWB 4UCUA 2A79B 2F4VO 3QG5A 4P30A 3J7AU 4FK5C 2QWPB 3AG4B 3CS5A 3CMEV 2UU9O 4DO2A 2UXBO 1FFXB 2GBOA 3CXHF 2CTPA 3TGUH 1V54B 3ZBHA 1SESA 5IWAO 3D36C 2GHYA 3TXQA 1PNKA 3QNEA 1Z2GA 4DR5O 2YXHA 4IYIA 2B1IA 4IT5A 1QHTA 4O4LA 2VQFO 3B4SA 3UQ8A 3GVMA 4TV8B 2Q0AA 2MW2B 4I4TA 2R9RB 3HKCB 4GKKB 2ETNA 2JJ1G 3SPJA 2CGNA 5B66Z 3E8HA 1Q3EA 3N2KB 1KQSU 3JYCA 1GN2A 1LUWA 1E1QG 2BOCC 1JA8A 3IAYA 4DYLA 2QTSA 4PDMA 2PI5A 3RYIB 3OR7C 1WA8A 1FXKA 1JPXA 3DXRA 1I5XA 3JD4A 4R50A 2JJ2G 3SJAC 1WPBA 5LA6A 2BTOA 2QE7G 4X64B 3LDEA 1AR5A 4XBFA 2QWRB 2ZE5A 5J2UB 3TK1A 4FLYA 5GW7A 4LF7O 4MW3A 3K5LA 4RAIA 2L6LA 3OGIB 1N0JA 2Q7EA 3G67A 4LF6B 4YJ2B 2RN9A 1KC8W 1VQPV 4FVMA 1NJIW 3SDLA 5L3CA 3OTFA 3RW0A 1IXBA 4U3JA 5FL7G 5JVDB 5BXZA 2EILB 5LHGA 3FAVA 1QR9A 1Y6XA 1US6A 1W0JG 3K0DA 3DSQA 1NS1A 3JARA 5L3BA 4DR3B 4JYYA 3G6EV 2IBZH 3W7SA 4BR6A 1HNXB 1PP9H 4IL6Z 1VQ9V 3AG1B 2BE3A 3BEHA 1P84F 4IHJA 1H2SB 1RPOA 4WFEA 1M1KW 1K4DC 2OCCC 5FLXN 3TETA 4HAMA 4X64O 2Y4UA 4X1IB 5KLVH 2P67A 2Q0OC 3W7TA 4P9PA 2ITDC 1H38A 2P4VA 3APQA 4HBNA 4N21A 4LF6O 3WG7B 4LBEC 2H8PC 2XNDG 4QE9A 3ZHQA 5B3SC 4D6TH 2A7WA 4RQFA 4AHCA 4I55B 1JVMA 5B1AB 4JI6B 2CGOA 3KCYA 5D5PA 3ZRWA 1HNXO 2V4DA 3WB2A 2JVDA 2YIAA 2B9ZA 1OCRB 3SPHA 2PGGA 2GUZA 2ZDIC 1VQKV 3B8NA 4O4LB 1BMFG 3M8AA 1V55C 1QR8A 4I4TB 5J9PC 4OX9O 4X88A 4UB8Z 5ITZB 2DMXA 3HKBA 1I94B 1XMOB 1VF6C 2CTQA 4Z2WA 4LNUA 1Q81W 1BHBA 1AI5A 4GKJB 1KKDA 1OCZB 1SQBH 2HKOA 1H2LA 1OCOB 1TA8A 4KP4A 1FXKB 5CMUA 2CUGA 2EINC 3DXRB 4JYAO 2Q4PA 4JI6O 4YJ3A 4J7KA 4Q6GA 2QWQB 2Y69B 5LA6B 1BZKA 2DYRC 2B5UA 1TAEA 1Q6HA 3AEIA 3OMAB 2EIJB 2DWDC 3ABUA 4QJFB 3JASB 2UXCO 4W4KA 1BS3A 1HNZB 1N33B 4K3AA 3EXAA 4NTXA 4U3FH 3ASOC 1SETA 1KB9F 4EFEA 1AI6A 2AW9A 4U3JB 3OTOB 3CXCU 4KL1A 3A0RA 3RBZA 3FAVB 1AILA 4MTXA 4E4EA 2FMLA 4LF9O 3K03A 4ASUG 1I08A 1PM9A 4DK1A 1AP5A 3ZN0A 1HW7A 3A8TA 4XDKA 2R70A 3EHBB 1XMOO 3SYQA 5EIBD 4MS2A 1NVPD 3OGCC 1G8MA 1KU9A 5JH7A 4GKJO 1GMGA 4JYBA 4X8AA 2ZKOA 5LP6C 4IHJB 5LHHA 4DV3O 1XNQB 1MNGA 2FKXA 3D36A 1XQ8A 4GYCB 1WP7A 2GDSA 2P22C 4O4HA 3UO2A 3Q4HA 1FXVA 3U10A 3SYAA 2DN9A 4ZOLA 4JAUA 1NTMH 5IYCO 3WB0A 3IC7A 3ETQA 4DV6B 2YDEA 3AK3A 1QLEC 1HNZO 1GM8A 1N33O 3K5MA 3LSSA 3THOA 4GX1A 4X9QA 1YXBA 2X6CA 3D8CA 4JI4O 1YCIA 3RN4A 4MT8A 3CCRV 3OTOO 4BWAA 2QTOA 2ZXWB 4PDVA 4LF5B 3K04A 3H1LH 4TV9B 3OMIB 4JAVA 3K06A 1WN7A 3CRAA 4CBCA 2EBOA 1M5IA 1NBMG 4PDLA 3EFFK 4B7EA 2OTLV 2YIBD 1J5EB 1ZTEA 3ZRWB 4UVAA 2DYSC 2ZQMA 2ATKC 5CBGA 1L1FA 1SERA 1K3EA 1E79G 4G2KA 1NVPB 1IVSA 3JSNA 3T4DA 2Q6AA 5AG2A 1MOFA 3WU2Z 1XNQO 2GUZB 1SQGA 3ABLC 1XHZA 5KHIA 1XL6A 2CTWA 2OWOA 3W7UA 4RWUA 1PNMA 1Q86W 5H6QA 2LGWA 5LMNB 1ZX3A 1SC5B 2Q67A 4PDRA 4RQEA 4DV6O 1YSCA 3HKBB 1JFFA 3E8FA 2AZ2A 2EZPA 1B6QA 4B3TO 4LNUB 2R9IA 2BSKA 4TOIA 5F2VO 1YI2V 2W6JG 3K0GA 3CEIA 3LSQA 5GTHZ 3HKDA 2UUBB 2EJ7A 1VQ8V 2PF4E 2QKAA 4UV8A 2W0FC 2OIGA 4LF5O 1WJZA 4YJ3B 2HHHO 4H0LB 2ADQB 1KD1W 1R3KC 2DQ3A 1J5EO 5LGTA 3BRCA 1RSOB 2E76B 4IYHA 2E3CA 4B3SB 4WFHA 2JGUA 2RNBA 4CH6A 1VQ7V 4OGQB 3IJ4A 2OTJV 1L0LH 3QVNA 1OHHG 2HR3A 4PA6A 5KHJA 1XDCA 5EIBC 5K1XA 2VWKA 3N2GA 5BMVA 5IE9A 5LYJA 1SA0B 4ZKIA 2JGDA 3ABTA 2F95B 4MVRA 2HG5C 1ZLZA 2XHBA 5LL6Y 2L35A 2JEXA 4Q20A 4CS2A 3WFVA 1EN5A 1VQNV 3A0BZ 1YVWA 1SF9A 4WF9V 5JH7B 4FIPC 1G1XB 4NTYA 4LWSA 4R7CA 5CA0A 3OE7G 1XMQB 1YJNV 3JD2A 2RCVA 1R3JC 1MG1A 3FX7A 4L87A 3T1CA 1QU7A 3Q4HB 2ZDIA 1M57C 4WFGA 4ZOLB 4ZHQA 1S77D 4PELA 5L3GA 2JIZG 5IWAB 2IJHA 1U96A 2ZT9B 4B3SO 4FJCC 2QKSA 4K8XA 3H1KH 1TUBA 2QJ1A 3CE2A 2FTKA 2ZNIA 1RP3B 3IC9A 1SZTA 1HWYA 1CPYA 1VF6A 2QDOA 3X2QC 4YY3O 3SYCA 3OAAG 3K58A 4MVZA 2WAMA 1SQPH 2E5LO 2UUAB 1CEZA 2F66C 3ETGA 4I5SA 3P3PA 3M99B 1VF7A 2WWWA 3E89A 2WLNA 4PI2A 4FZ1A 2GSMB 1FPOA 2PYJA 3CMAV 1XMQO 1HP8A 4QE7A 5LHIA 3ML0A 4NB5A 3OUFA 3RYCA 4FM1A 3D3IA 4LF7B 1P49A 3AG3C 1D2DA 3K79A 4CC6A 3A0HZ 5IJ9A 3E35A 1JFFB 4MSWC 1THZA 5H9CA 2BSKB 1V9PA 4DR7B 3HKDB 4I9WA 2XUMA 3AG2C 3FB5C 1AB3A 3NXSA 3SJQC 3L9DA 2D3OW 4JTAB 1IBKB 1K33A 1BT8A 3UO3A 5LP6A 2UUAO 3G71V 3W7XA 3ZHUA 1GTOA 1SRYA 4LCUC 4F4LA 2OCCB 3AK1A 2Y0IA 4LC1A 1Q82W 3RT3C 3JATA 2HLDG 2NN4A 4JYCA 1EZVH 4FFKA 4GX5A 2D2CB 4LFAB 1GN4A 1SS3A 3QO8A 2EIKC 4J9YB 4BW9A 3B8MA 2G38A 3CSXA 3RVZA 4NTWA 1KKCA 4JZ2A 5BMVB 3N2GB 5LYJB 1VQ6V 2WSSG 2JGDB 4ZIBA 1K4CC 5B3SB 1ZAUA 4MVMA 2EIMC 1H8EG 3LDDA 2AXTZ 1FJGB 2R9AA 1IBLO 4DR7O 3FB8C 1Y74A 4GZRB 3VQVA 4DV4B 4DRXA 4LWSB 4GX0A 5CA0B 1XILA 1IBKO 1PL4A 2Q69A 3IGAC 2XAHA 3AK2A 3GWOA 2R72A 3GWKC 1QCEA 1R3IC 4PA3A 4TSFG 1N4CA 1WP8A 1V55B 4CS3A 1X4TA 4XDJA 5CB4A 2A3QA 4LF8B 5B5EZ 2WLIA 3DTUB 3LUTB 5EBWC 1MSWD 1TUBB 4F6RA 2WLMA 4LFAO 1JMKC 4YIOA 2HVJC 1K5QA 5IJ0A 1S3JA 4J9ZB 2ZR3A 4G27B 3E2EA 2JS3A 4TQDA 2LGQA 1D5NA 1JCHA 1IX9A 4BIOA 4DUZB 4OX9B 3JD3A 1W2BU 2Z0AA 1NR7A 2Z5UA 3A2FA 2EINB 1FJGO 2ZE6A 1K92A 3EVKA 2LFSA 1XHXA 1CP9A 1N0NA 1ZL8A 2DYRB 1MZFA 2H94A 2ILMA 4PA9A 3G4SV 4DV4O 4DW0A 1IDSA 1JR9A 4JYAB 1S72V 4I0XA 1VQ5V 2OCHA 1EN4A 4KFMA 1GAXA 1U97A 5KHGA 5BZBA 4JI0B 3CCEV 1N8RW 3RYCB 4PHZA 4O2BA 4FLTA 3ASOB 1XI1A 3L70H 3RVYA 3ICXA 5CN0A 4FMTA 2LJ2A 4LF8O 2UXCB 1H2KA 3JALA 3HR0A 5IJ9B 1WPXA 1F23A 1PNLA 3ETDA 3LNNA 5EZYA 1TUEB 4J41A 1KMIZ 3JAWA 3BPZA 3CP1A 2KSDA 4FLZA 4LF9B 4DUZO 5KHKA 1VQ4V 1TVKA 5LP6B 4CZZA 2M6YA 3I56V 5B1BC 4MVOA 4J7ZA 1J95A 1XREA 1AJQA 1GM9A 2EULA 5LGUA 3ABKC 1COWG 1YDXA 1YZBA 5A9GA 4I50A 1QVGU 3JATB 1AR1B 1Y76A 1XNRB 3E83A 3BAAA 2Y48A 1WA8B 2YXYA 3CHXA 1JJ2U 2QM7A 4DV3B 1SZXA 5C8YA 4NVPA 1QLEB 3KKYA 4JI0O 3CWBH 4JZGA 3L72H 4D7SA 3VQYA 2YS8A 1WNSA 3ASNB 1QBZA 3TJTA 1MMMA 3RGBA 2YIBA 5IYBO 3ZS8C 2B1GA 3UT5A 2EJRA 3MHHC 4WFFA 2LP7A 3G80A 3T1HO 3K9AA 4R6ZA 4DR4B 2YSUB 4JI4B 2ZIOA 5BY1A 3FFQA 1Y74B 5H2FZ 2ZD9A 3OEHG 2DYSB 4DRXB 3U0ZA 3STLC 2X7RB 1FS0G 3VOUA 4MTOA 1SQXH 3KCXA 4DV5B 3JARB 4DR2B 4J10A 4O2AA 1VQMV 1K7DA 3ABLB 4HYOA 4W4LA 4U7OA 1NQTA 5CA1A 3C90A 5CB4B 3UCSC 1KP2A 1XNRO 4EEQA 4B3RB 2WLIB 3CRQA 1PD3A 4YIPA 2YI8A 3CJHA 4DK0A 4EFBA 4F6RB 3JCUZ 3B09A 5LGNA 1URFA 3WB1A 3OEEG 3T1YB 2WPDG 4UXNA 4B08A 2WA4A 1B3QA 5IJ0B 1QNMA 2P5OA 4IGGA 4QPJA 1Q90D 1ENVA 2LW7A 2WLJA 3ZHVA 1KYOF 1M93A 4YXWG 3HKEA 1FXHA 3H1JH 4B3TB 4DV2O 1YEWA 5JCOC 3K59A 4DR4O 3ASNC 3E86A 1ZL8B 3F7YC 1W59A 4F6EA 1BQZA 2Y4TA 2HP8A 4FZ0A 4XDLA 4E2LA 4DV7B 1P4RA 1Q6IA 4I0XB 4K8ZA 2HHHB 4JPRA 3ZX6A 3JCZA 4DV5O 1XUQA 4DR2O 1O9HA 5EK0A 4O4IA 2QM4A 4O2BB 2IJIA 2ZM6O 2HJDA 1B06A 5FNVA 1Y66A 3ZHRA 3K5NA 3JALB 3FKSG 4OPHA 3J81N 4GLXA 2BCCH 4B3RO 2ZNJA 5EZYB 4UFZA 3JD0A 2KG7A 4JI8B 1KBHA 4D7TA 3T1YO 3KZIZ 2X0LA 1NTZH 1NH2D 4JI7B 3JAWB 2OT5A 4Z1MG 3HB3B 3C3SA 3UKMA 4UCRA 4TQFA 2XTAA 3MD0A 3P32A 1TVKB 3CCSV 1DTOA 3BFRA 2DJVA 4ABMA 2DW4A 4FM0A 4DXWA 4H37A 5LBQA 4I50B 3STZC 1M57B 1KECA 1IZ3A 4YHHB 1JQ0A 2M7WA 4DV7O 5C8YB 1SQFA 3MDSA 1NU1H 2AHZA 3OMNB 2JDIG 2VS0A 1N34O 4PA4A 3CCMV 2IW5A 2E75B 1GN3A 1IBMB 1YTFD 3DC6A 3X2QB 1LR1A 3UT5B 2AHYA 1MA1A 3GB7C 4FPPA 2YIDA 4OPAA 1M56C 1NR1A 3CC2V 1NI8A 3N2KA 4JI8O 2YUAA 2CH7A 4MTFA 3J80N 3FD9A 1M9NA 4JI7O 5CBHA 4YY3B 1WLEA 4LH6A 4KUMA 4WBNA 1GO3F 1K5SA 1M90W 2CDYA 2ODMA 3RYIA 2CTRA 2XAGA 2E5LB 1EM1A 3ZRSA 2JS5A 5DN6G 2OYQA 4O2AB 3P30A 1K34A 4LFBB 2UXDB 4AI8A 5CA1B 3CCVV 1R1BA 5KHHA 4X89A 1VP7A 3AG3B 4H13B 2PZSA 3CJHB 3M7MX 3OR6C 4DR1B 4YHHO 3AG7A 2QGNA 4O4HB 2XAQA 1AROP 5DECA 4HZ3A 4BIUA 5LMUB 3ZCCA 2BTQA 2YI9A 3AG2B 1IBMO 4H33A 5JVDA 5FPOA 1AI7A 1Q7YW 2AZ0A 5IT9N 2HVKC 1YTFB 5L3FA 2FL4A 2AGAA 1QVFU 3HKEB 4EB6A 4NYKA 1Q43A 3ZMSA 4FLXA 5BR8B 5H6RA 2BOBC 2Q5ZA 1H8HG 2YEVA 4H44B 2IM9A 4GX2A 1K73W 3LDCA 4UB6Z 1DGSA 4FFBA 4JI3O 2K1EA 3FYIB 3HPLC 3OT7A 1W0KG 4UUJC 1ZSPA 2WLLA 4MVQA 2EIKB 4O4IB 4LFBO 1VF5B 2UXDO 3PJSK 2QWOB 1S5JA 5EYPA 2CAZC 1I0HA 4CH5A 2JRIA 2EIMB 4FM2A 2Q7GA 3N27A 3NR7A 4DR1O 1MSDA 2KG7B 1L8DA 2QEXV 4DR6B 1T5EA 2ZR2A 3BA8A 2ARHA 1OCCC 5L3EA 5B1NA 3SYOA 2LQTA 2A9HA 5LMUO 3DGEA 1AVMA 4I55A 1FD9A 1KP3A 3H1IH 5KA6A 1RM1C 1R6KA 5BR8O 1IBLB 3CPWU 5IYZA 5KX5A 2V7QG 1KUQA 2IH1C 1N32B 1FAFA 1S76D 3CRRA 2FB5A 1L0NH 4RUFA 2MK3A 3APOA 4AILC 3JSLA 3K57A 4JF3A 3G6BA 3VQXA 1F7YA 4FLWA 1BCCH 4TT3G 4DV1B 3CYOA 1OJHA 2P06A 3ZIAG 3F7VC 5CBFA 5IY5C 1YIJV 2PY5A 1A32A 3SYPA 5ITZA 4ICGA 4IIJA 3RYFA 3ZMVA 3L74H 2F43G 2CH7B 1AR4A 4DR6O 5JCOA 5DEDA 2N74A 4WBNB 1IXMA 2VQEB 3ABMC 3E8GA 1FYJA 3K5OA 1N36B 1R73A 5DM6V 5JJJB 1XBLA 3B40A 2F23A 2DOSA 3CCQV 1MABG 3BCCH 2JEUA 1G4YB 1QQCA 4L8JA 1WAZA 2P7TC 2WA3A 4WFBV 2PTMA 1DF4A 1N32O 1VMGA 3CB2A 4KHPB 1BQ0A 3JASA 5TISZ 3AG4C 5EC2C 3CCLV 2QKCA 1P7BA 4MTGA 5KA5A 3ZMUA 2IU0A 1YITV 5E79Z 4ZHQB 2XT9A 2BTQB 2A0LA 1V54C 4JASA 4DV1O 5C93A 4CS4A 4GKKO 1QLNA 4EB6B 1AJNA 2YICA 4B7KA 5B1BB 3CD6V 4KXRA 1EFRG 2GV9A 1K9MW 4X65B 3ABKB 3RYHA 2YEVB 5EBMC 2VQEO 2ZE8A 5KAFZ 1WB8A 1N36O 4FFBB 4PA7A 2ZINA 4R8CA 2WLLB 5EC1C 5HFMA 1VARA 1NKDA 4PI0A 3ZN1A 3BA9A 1TGOA 3R65A 3T4ZA 5EYPB 2KKWA 5EBLC 4JI1B 3CCJV 2OIEA 1BL8A 4X1KA 4UV9A 2W6IG 3B2EE 5FPRA 1AJPA 1NTKH 4DV0B 2A06H 2YXLA 4JI2B 4KHPO 1K97A 2N04A 4JI5B 1R3LC 2PUSA 4X66B 3ZMZA 1LUVA 4UVBA 4O4JA 1HNWB 2NLJC 4JGSA 1DK1A 2QWNB 1UPGA 3ZRXA 2P90A 1BHAA 2XOKG 3CC4V 3ZRVA 2DE0X 5B1OA 2X6BA 3I5DA 4LR3A 2Z3YA 4TV9A 3T1HB 2LO1A 4J11A 1GRJA 3CRMA 2RQ6A 2RJZA 3LNMB 4I9QA 4DR3O 4QGPA 1EN6A 5IYZB 4X65O 5KX5B 5JQGA 1YHQV 3LSUA 1R6TA 2EILC 4JTDB 3RFRA 5CA3A 1DLBA 2XAFA 4ZBMA 1FFTB 2X6AA 3OM3B 4I7ZB 1S5HC 4C7UA 1PV0A 1SKVA 1WB7A 1BSMA 4GT1A 3SJBC 4JTCB 3AG1C 3O65A 3F5TA 4JI1O 2K9PA 4DV0O 4G28B 3P3NA 3ZHTA 5KMGA 4JI2O 4IIJB 3RYFB 4JI5O 4X66O 5HFLA 3CX5F 2ZIMA 2IU3A 1HNWO 3H01A 1GK9A 2GTAA 2EZOA 3E8BA 3QF7A 2CK3G 1I7FA 1MZEA 4HNAA 3SGIA 1BE3H 2QSAA 2XASA 4BAYA 3WG7C 4Z1VA 1DF5A 3SPGA 4X1YA 4DV2B 1PKXA 4LP8A 3OD4A 2GTSA 4DUYB 2O57A 1E1RG 5LOVA 1H2NA 1RSOA 1GN6A 4J7JA 2JK5C 1S5LZ 3QO7A 4LF4B 3B77A 3JAKA 5B1AC 4DW1A 3D3QA 1NZ6A 2VWJA 3BY6A 3KG2A 4MVSA 2ZM6B 1JJOA 1AP6A 3L71H 3ETEA 5H5NA 3FB6C 1AI4A 4BW5A 3S3XA 1SA0A 4B3MB 5KUMA 1OCRC 4GCZA 2Q8VA 5K1PA 2NNUA 1I94O 4JV5B 3PN1A 1I5YA 1YF2A 3RYHB 1Y4MA 4TUYA 1G6UA 1VQLV 3K08A 2IH3C 1JX9A 3T2MA 2QM8A 4P9OA 2CE4A 1Q8IA 1XOUA 1D5AA 4UCVA 5GTIZ 4AQYB 1F51A 1LNQA 4PD4F 3MAQA 1OCZC 1GKFA 4DUYO 1OCOC 3VBBA 1SQQH 1M4UA 4X1KB 4A5UB 1FXKC 4X20A 5JJNB 4LF4O 3CC7V 4NXMB 1GH6A 1R6NA 3H9VA 2IJKA 2Y69C 2N05A 3VQWA 4MW8A 1M56B 4O4JB 4ZI7A 1N34B 4GUNA 1VEWA 5J2TA 1Z5VA 3QTCA 4P2ZA 5GONA 2EIJC 2P6JA 4WFAV 2V1DA 4QNHB 2ADPA 1Y67A 3MHSC 5LXTA 4JAAA 4B3MO 3BABA 5JJEB 1ZUQA 4TWKA 1ORQC 3CRCA 1HDJA 4LFCB 2XAJA 1HR0B 4PV1B 4JV5O 3E22A 3RWRD 2H3OA 5E1AC 1B04A 5JQGB 1ZWIC 3JD1A 4QIWF 3F5WC 2LW1A 1OZ0A 3OW2U 3SPCA 2KB1A 2E74B 1ROPA 4J80A 1OV9A 2LFRA 4OXSA 3BVOA 3K9SA 1XEQA 4AQYO 1FFXA 1Y76B 2QR4A 5KAIZ 4RUEA 1YJWV 1K8AW 3W7WA 3C3TA 1CXZB 5KMGB 4NXMO 4CH3A 2VRZA 3IFXA 1O9GA 3SJCC 3U11A 2UXXA 4UCSA 4TV8A 1Q6UA 1UFIA 4FLVA 4HNAB 3HKCA 2IJJA 4NKGB 3CCUV 4UCOA 4CH4A 2NR5A 5KUKA 2PI4A 4X62B 4X1YB 3K3WA 4LH7A 3DC5A 1F4NA
chains in the Genus database with same CATH topology
4MS2A 1NVPD 2DYRB 2V7QG 3FYEB 3OGCC 3ZJZA 2H94A 2IH1C 4PA9A 2ZXWC 3G4SV 1G8MA 1NH2B 1GMGA 4JYBA 4X8AA 1S76D 4RUFA 2MK3A 1S72V 5LHHA 2HFEC 1YJ9V 1VQ5V 2DQ0A 3D36A 4KFMA 5BZBA 1PL0A 4JF3A 3CCEV 1N8RW 3ASOB 1FXVA 3SYAA 3RVYA 4JAUA 5CN0A 3ZMTA 1OCCB 5IYCO 4TT3G 4FMTA 3CYOA 1F4MA 3OFNG 3IC7A 3F7VC 3ZIAG 5CBFA 1JOYA 5IY5C 1YIJV 1WPXA 1F23A 1PNLA 3ETDA 1QLEC 3UM7A 1GM8A 1GM7A 2UXNA 3SYPA 4U7NA 1TUEB 2QA4V 3LSSA 3ZMVA 4GX1A 2DWEC 2F43G 1RM1B 2X6CA 4MVUA 1XL4A 5L3DA 3I55V 5IYDO 1IXMA 4MT8A 3CP1A 3CCRV 4N23A 3ABMC 2QTOA 2ZXWB 3E8GA 4PDVA 3K04A 1VQ4V 4UVCA 1RPRA 4CZZA 1R73A 3OMIB 3K06A 4JAVA 5B1BC 5DM6V 4MVOA 4RO2A 2EBOA 4CBCA 3I56V 1NBMG 2WLHA 3EHBB 4PDLA 1J95A 1AJQA 1GM9A 3EFFK 3CCQV 2OTLV 3FB7C 5LGUA 2WLKA 3ABKC 1COWG 1MABG 2JEUA 3ZRWB 2C2AA 1G4YB 4QPKA 4UVAA 2DYSC 1QVGU 2ZQMA 2P7TC 2ATKC 1S0VA 1AR1B 5CBGA 1L1FA 4WFBV 3E83A 1SERA 1K3EA 1DF4A 1E79G 4G2KA 1NVPB 3T4DA 2Q6AA 2Y48A 1JJ2U 1MOFA 2QM7A 3AG4C 3SPIA 5IY5B 5EC2C 4BIZA 1QLEB 3CCLV 3OUSA 3QO5A 1VQOV 3ABLC 1XL6A 3W7UA 1P7BA 4MTGA 1PNMA 5KA5A 3ZMUA 1Q86W 5H6QA 2IU0A 1YITV 3ASNB 1QBZA 1EZJA 1H2GA 2A0LA 1V54C 4JASA 5IYBO 2Q67A 2B1GA 5C93A 2EJRA 3ABMB 3MHHC 4PDRA 4RQEA 4WFFA 1QLNA 2LP7A 1AJNA 1YSCA 5IDJA 3E8FA 3K9AA 2EZPA 4R6ZA 5B1BB 1B6QA 3CD6V 3TCUA 1EFRG 2HJFC 1K9MW 2YSUB 2Q68A 2R9IA 3ABKB 1YI2V 1EBOA 2W6JG 2YEVB 4EKWA 3K0GA 3LSQA 4WCEV 2ITCC 2ZD9A 3OEHG 1UJWB 2DYSB 1VQ8V 5EBMC 3STLC 2A79B 2X7RB 1FS0G 4UV8A 3VOUA 2W0FC 4MTOA 4P30A 4FK5C 4PA7A 4R8CA 3AG4B 2WLLB 5EC1C 5HFMA 1KD1W 1NKDA 3CMEV 1VQMV 1K7DA 3ZN1A 3ABLB 4HYOA 4DO2A 1R3KC 2DQ3A 4U7OA 1NQTA 3R65A 5LGTA 3T4ZA 5EBLC 1KP2A 3CCJV 1BL8A 4UV9A 1V54B 2W6IG 2WLIB 1AJPA 1PD3A 4WFHA 1SESA 1K97A 1VQ7V 2GHYA 1R3LC 2OTJV 1PNKA 3QNEA 5LGNA 3ZMZA 3OEEG 1OHHG 2HR3A 2WPDG 4UXNA 2B1IA 4UVBA 4PA6A 2NLJC 4JGSA 3ZRXA 2P90A 1BHAA 4QPJA 2XOKG 3CC4V 3ZRVA 1ENVA 4ZKIA 2R9RB 2WLJA 3ABTA 5B1OA 2JJ1G 2X6BA 3SPJA 4MVRA 2Z3YA 2HG5C 4YXWG 3E8HA 1FXHA 2JEXA 4Q20A 1KQSU 3JYCA 3WFVA 3LNMB 1VQNV 3ASNC 1E1QG 2BOCC 3E86A 3F7YC 1YHQV 4WF9V 4PDMA 2PI5A 2EILC 4FIPC 3OR7C 4XDLA 4JTDB 4E2LA 5CA3A 1DLBA 4R7CA 3OE7G 1FXKA 1P4RA 1YJNV 1JPXA 2XAFA 4ZBMA 1FFTB 1I5XA 3JD2A 2X6AA 3JD4A 3OM3B 4JPRA 1R3JC 4R50A 1S5HC 1MG1A 2JJ2G 3JCZA 4L87A 5EK0A 3T1CA 2ZDIA 1M57C 2QE7G 4GT1A 3LDEA 4XBFA 2IJIA 4WFGA 3TK1A 1S77D 4JTCB 3AG1C 4PELA 5L3GA 5GW7A 4MW3A 1Y66A 2JIZG 4RAIA 2IJHA 3FKSG 4G28B 4FJCC 2QKSA 3JD0A 5HFLA 1KC8W 2FTKA 1VQPV 1SZTA 2IU3A 2X0LA 1NJIW 5L3CA 1NH2D 1HWYA 1CPYA 3H01A 1GK9A 3RW0A 2OT5A 4Z1MG 3HB3B 2EZOA 3X2QC 5FL7G 3E8BA 2CK3G 3UKMA 3SYCA 2EILB 3OAAG 5LHGA 3MD0A 4MVZA 3P32A 2WAMA 1QR9A 3CCSV 1DTOA 2XASA 3K0DA 1W0JG 4BAYA 1CEZA 3WG7C 3ETGA 4I5SA 1DF5A 3SPGA 2DW4A 5L3BA 1PKXA 3M99B 4LP8A 4DXWA 4H37A 3G6EV 2WWWA 5LBQA 3W7SA 3E89A 3STZC 1M57B 1E1RG 1KECA 1VQ9V 2WLNA 3AG1B 2JK5C 3QO7A 2GSMB 3B77A 5B1AC 3BEHA 3CMAV 1JQ0A 2M7WA 4QE7A 1RPOA 4WFEA 3BY6A 2AHZA 3KG2A 3OMNB 5LHIA 1M1KW 1K4DC 2JDIG 4MVSA 3ML0A 2OCCC 3OUFA 3TETA 4PA4A 4HAMA 3CCMV 2IW5A 3ETEA 3D3IA 3FB6C 1AI4A 4BW5A 1YTFD 3AG3C 3X2QB 5KUMA 3K79A 1OCRC 2AHYA 2P67A 3W7TA 4P9PA 2ITDC 3GB7C 3E35A 1H38A 4FPPA 4MSWC 4N21A 1THZA 1M56C 1NR1A 3WG7B 4GCZA 4LBEC 2H8PC 2XNDG 3CC2V 2NNUA 4QE9A 5H9CA 1I5YA 4MTFA 1Y4MA 1M9NA 4I9WA 5CBHA 3AG2C 5B3SC 3FB5C 1WLEA 1VQLV 4KUMA 1GO3F 2IH3C 3K08A 3NXSA 1K5SA 1M90W 4RQFA 3SJQC 1JX9A 2D3OW 3T2MA 4JTAB 2QM8A 1K33A 4P9OA 1JVMA 2XAGA 5B1AB 3ZRSA 5DN6G 3G71V 3W7XA 1GTOA 3P30A 1SRYA 4LCUC 1K34A 4F4LA 1F51A 1LNQA 2OCCB 3ZRWA 4LC1A 1OCZC 1GKFA 3CCVV 1Q82W 2HLDG 1OCOC 3VBBA 4JYCA 1FXKC 4GX5A 4X89A 3AG3B 3CC7V 3OR6C 1R6NA 1OCRB 2IJKA 3SPHA 3QO8A 2EIKC 4J9YB 2Y69C 2ZDIC 4MW8A 1M56B 3B8MA 1VQKV 3B8NA 3RVZA 1BMFG 4P2ZA 2XAQA 1V55C 1QR8A 2EIJC 2P6JA 1AROP 1VQ6V 2WSSG 4WFAV 4HZ3A 2V1DA 4BIUA 4QNHB 5J9PC 3ZCCA 3AG2B 5B3SB 1K4CC 4H33A 3MHSC 2EIMC 4MVMA 1AI7A 1H8EG 1Q7YW 4X88A 3LDDA 2HVKC 1YTFB 5L3FA 1QVFU 4TWKA 1ORQC 3ZMSA 2XAJA 5E1AC 5H6RA 1Q81W 2BOBC 1ZWIC 3FB8C 1H8HG 3JD1A 1BHBA 2YEVA 1AI5A 1KKDA 1OCZB 4QIWF 3F5WC 2HKOA 4GX2A 1OCOB 1K73W 3LDCA 4GX0A 1OZ0A 4KP4A 1FXKB 3OW2U 5CMUA 2EINC 3SPCA 2Q69A 2KB1A 3IGAC 1ROPA 2K1EA 3FYIB 3HPLC 2XAHA 1W0KG 3GWOA 2WLLA 4UUJC 4MVQA 2EIKB 2Y69B 1QCEA 2LFRA 1R3IC 4OXSA 4PA3A 4TSFG 2DYRC 2B5UA 3PJSK 1V55B 3AEIA 3OMAB 2EIJB 2DWDC 3ABUA 4XDJA 4RUEA 4QJFB 1YJWV 1K8AW 3W7WA 2EIMB 2WLIA 3DTUB 3LUTB 5EBWC 1MSWD 3IFXA 2WLMA 2UXXA 2QEXV 3ASOC 2HVJC 1K5QA 1SETA 1S3JA 2ZR2A 1AI6A 1OCCC 2ZR3A 4G27B 4J9ZB 5L3EA 3E2EA 5B1NA 3SYOA 3CXCU 1JCHA 2A9HA 3A0RA 3RBZA 4MTXA 3JD3A 3DGEA 2IJJA 1W2BU 3K03A 3CCUV 4ASUG 1KP3A 1NR7A 2Z5UA 5KUKA 2PI4A 2EINB 1K92A 3K3WA 5KA6A 3ZN0A 4XDKA 1RM1C 2LFSA 1R6KA 1F4NA 1CP9A 3CPWU 3SYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO C;  4R6Z A;  4G28 B;  3TCU A;  4MS2 A;  2HJF C;  3OGC C;  2QKS A;  4GX5 A;  2IH1 C;  2Q68 A;  4X89 A;  4PA9 A;  3ZJZ A;  2ZXW C;  3OR6 C;  4EKW A;  4X8A A;  3K0G A;  3SPH A;  2ITC C;  4RUF A;  4J9Y B;  2EIK C;  2ZD9 A;  2Y69 C;  4MW8 A;  5EBM C;  2HFE C;  3RW0 A;  3STL C;  2A79 B;  4KFM A;  2W0F C;  3RVZ A;  3VOU A;  3E8B A;  4P2Z A;  3UKM A;  3X2Q C;  4MTO A;  1V55 C;  4P30 A;  3SYC A;  5BZB A;  2EIJ C;  4PA7 A;  4R8C A;  4MVZ A;  4HZ3 A;  4QNH B;  2WLL B;  5EC1 C;  5J9P C;  3K0D A;  1K4C C;  4H33 A;  4MVM A;  2EIM C;  3SYA A;  3WG7 C;  3RVY A;  4HYO A;  1R3K C;  4X88 A;  3LDD A;  2HVK C;  3SPG A;  3R65 A;  3T4Z A;  4LP8 A;  4DXW A;  4H37 A;  3F7V C;  5CBF A;  4TWK A;  5EBL C;  1ORQ C;  5IY5 C;  3E89 A;  1BL8 A;  3STZ C;  1QLE C;  3UM7 A;  3SYP A;  2WLI B;  4WFH A;  2WLN A;  5E1A C;  2BOB C;  4GX1 A;  1ZWI C;  3FB8 C;  2JK5 C;  2YEV A;  1R3L C;  2DWE C;  5B1A C;  3BEH A;  2X6C A;  4MVU A;  1KKD A;  3F5W C;  1XL4 A;  4GX2 A;  3LDC A;  4GX0 A;  4PA6 A;  4QE7 A;  2NLJ C;  4WFE A;  2AHZ A;  2EIN C;  3SPC A;  2Q69 A;  2KB1 A;  3KG2 A;  3ABM C;  1K4D C;  2QTO A;  3IGA C;  3E8G A;  4MVS A;  2K1E A;  3HPL C;  2OCC C;  4PDV A;  3K04 A;  3OUF A;  3TET A;  4PA4 A;  2WLL A;  4UUJ C;  2R9R B;  2WLJ A;  4MVQ A;  4CBC A;  3K06 A;  5B1B C;  4MVO A;  4RO2 A;  4OXS A;  1R3I C;  3FB6 C;  4PA3 A;  4BW5 A;  2X6B A;  3SPJ A;  2WLH A;  4MVR A;  2DYR C;  4PDL A;  1J95 A;  3EFF K;  3AG3 C;  3FB7 C;  3PJS K;  2HG5 C;  2WLK A;  3ABK C;  5KUM A;  3E8H A;  1OCR C;  2DWD C;  2AHY A;  4XDJ A;  1G4Y B;  4P9P A;  2ITD C;  3GB7 C;  4RUE A;  2DYS C;  3JYC A;  3LNM B;  4MSW C;  2P7T C;  2ATK C;  1M56 C;  5CBG A;  2WLI A;  3ASN C;  3E83 A;  4LBE C;  2BOC C;  2H8P C;  3E86 A;  3LUT B;  4QE9 A;  5EBW C;  3F7Y C;  3IFX A;  2Q6A A;  3T4D A;  2WLM A;  4PDM A;  2EIL C;  4MTF A;  3AG4 C;  3SPI A;  3OR7 C;  4I9W A;  3ASO C;  4JTD B;  4XDL A;  3AG2 C;  2HVJ C;  3FB5 C;  5EC2 C;  5B3S C;  4R7C A;  3OUS A;  5CBH A;  3K08 A;  2IH3 C;  3ABL C;  1OCC C;  4G27 B;  4J9Z B;  1XL6 A;  2X6A A;  4JTA B;  4R50 A;  4ZBM A;  1R3J C;  3SJQ C;  1S5H C;  3SYO A;  4P9O A;  3T2M A;  1JVM A;  1P7B A;  4MTG A;  2A9H A;  3RBZ A;  5EK0 A;  3ZRS A;  3T1C A;  3K03 A;  1M57 C;  2A0L A;  1V54 C;  3LDE A;  2Q67 A;  4WFG A;  4LCU C;  5KUK A;  4F4L A;  4JTC B;  3AG1 C;  1LNQ A;  4PDR A;  4XDK A;  4MW3 A;  4WFF A;  4RAI A;  1OCZ C;  3E8F A;  3SYQ A; 
#chains in the Genus database with same CATH topology
 1HR0 O;  4LFC O;  4PJ0 Z;  3ZHS A;  5LOV B;  3FYE B;  3ZJZ A;  3ZED A;  1SQV H;  2ZXW C;  1NH2 B;  2KQX A;  3JAK B;  2EX3 A;  2Q9L A;  3L75 H;  4JI3 B;  1Q5O A;  4UCT A;  1YJ9 V;  2HFE C;  4NXN B;  2DQ0 A;  1BGY H;  1PL0 A;  3TXS A;  2UUC B;  1X59 A;  2W0X A;  2FYU H;  3R66 A;  3ZMT A;  1OCC B;  5J2U A;  2ZCE A;  5LMN O;  1F4M A;  3OFN G;  1JOY A;  4J42 A;  4K35 A;  1IUR A;  3UM7 A;  1GM7 A;  2UXN A;  4U7N A;  4YJ2 A;  3BHP A;  2QA4 V;  2DWE C;  1RM1 B;  4NR1 A;  4MVU A;  3JAM N;  4K0K B;  4TUY B;  1XL4 A;  5L3D A;  3I55 V;  5IYD O;  2UUB O;  4N23 A;  2F4V B;  1Z5W A;  4UVC A;  2Q7H A;  1RPR A;  2F93 B;  4RO2 A;  1H2M A;  2WLH A;  4X62 O;  5JWP A;  1FKA O;  2UU9 B;  3FB7 C;  2WLK A;  2UXB B;  3SR2 C;  2C2A A;  4QPK A;  1S0V A;  2YC0 A;  1RFY A;  2ZE7 A;  2RMK B;  5A2Q N;  4X20 B;  2RDC A;  1PPJ H;  2F1M A;  2P4K A;  3S3W A;  3SPI A;  3L73 H;  5IY5 B;  4DR5 B;  3H1H H;  4NXN O;  5D5Q A;  4BIZ A;  3OUS A;  3QO5 A;  1VQO V;  4ZI7 B;  5J2T B;  2UUC O;  2VQF B;  2HEP A;  5GON B;  1EZJ A;  1H2G A;  5FNV B;  4X1I A;  1P7G A;  5LXT B;  3ABM B;  3O9O A;  2PYL A;  4FLU A;  5IDJ A;  2Q73 A;  3TCU A;  1VIB A;  2HJF C;  3E22 B;  2Q68 A;  1EBO A;  2Y0P A;  4EKW A;  4K0K O;  4WCE V;  2ITC C;  4CC5 A;  1NT2 B;  1UJW B;  4UCU A;  2A79 B;  2F4V O;  3QG5 A;  4P30 A;  3J7A U;  4FK5 C;  2QWP B;  3AG4 B;  3CS5 A;  3CME V;  2UU9 O;  4DO2 A;  2UXB O;  1FFX B;  2GBO A;  3CXH F;  2CTP A;  3TGU H;  1V54 B;  3ZBH A;  1SES A;  5IWA O;  3D36 C;  2GHY A;  3TXQ A;  1PNK A;  3QNE A;  1Z2G A;  4DR5 O;  2YXH A;  4IYI A;  2B1I A;  4IT5 A;  1QHT A;  4O4L A;  2VQF O;  3B4S A;  3UQ8 A;  3GVM A;  4TV8 B;  2Q0A A;  2MW2 B;  4I4T A;  2R9R B;  3HKC B;  4GKK B;  2ETN A;  2JJ1 G;  3SPJ A;  2CGN A;  5B66 Z;  3E8H A;  1Q3E A;  3N2K B;  1KQS U;  3JYC A;  1GN2 A;  1LUW A;  1E1Q G;  2BOC C;  1JA8 A;  3IAY A;  4DYL A;  2QTS A;  4PDM A;  2PI5 A;  3RYI B;  3OR7 C;  1WA8 A;  1FXK A;  1JPX A;  3DXR A;  1I5X A;  3JD4 A;  4R50 A;  2JJ2 G;  3SJA C;  1WPB A;  5LA6 A;  2BTO A;  2QE7 G;  4X64 B;  3LDE A;  1AR5 A;  4XBF A;  2QWR B;  2ZE5 A;  5J2U B;  3TK1 A;  4FLY A;  5GW7 A;  4LF7 O;  4MW3 A;  3K5L A;  4RAI A;  2L6L A;  3OGI B;  1N0J A;  2Q7E A;  3G67 A;  4LF6 B;  4YJ2 B;  2RN9 A;  1KC8 W;  1VQP V;  4FVM A;  1NJI W;  3SDL A;  5L3C A;  3OTF A;  3RW0 A;  1IXB A;  4U3J A;  5FL7 G;  5JVD B;  5BXZ A;  2EIL B;  5LHG A;  3FAV A;  1QR9 A;  1Y6X A;  1US6 A;  1W0J G;  3K0D A;  3DSQ A;  1NS1 A;  3JAR A;  5L3B A;  4DR3 B;  4JYY A;  3G6E V;  2IBZ H;  3W7S A;  4BR6 A;  1HNX B;  1PP9 H;  4IL6 Z;  1VQ9 V;  3AG1 B;  2BE3 A;  3BEH A;  1P84 F;  4IHJ A;  1H2S B;  1RPO A;  4WFE A;  1M1K W;  1K4D C;  2OCC C;  5FLX N;  3TET A;  4HAM A;  4X64 O;  2Y4U A;  4X1I B;  5KLV H;  2P67 A;  2Q0O C;  3W7T A;  4P9P A;  2ITD C;  1H38 A;  2P4V A;  3APQ A;  4HBN A;  4N21 A;  4LF6 O;  3WG7 B;  4LBE C;  2H8P C;  2XND G;  4QE9 A;  3ZHQ A;  5B3S C;  4D6T H;  2A7W A;  4RQF A;  4AHC A;  4I55 B;  1JVM A;  5B1A B;  4JI6 B;  2CGO A;  3KCY A;  5D5P A;  3ZRW A;  1HNX O;  2V4D A;  3WB2 A;  2JVD A;  2YIA A;  2B9Z A;  1OCR B;  3SPH A;  2PGG A;  2GUZ A;  2ZDI C;  1VQK V;  3B8N A;  4O4L B;  1BMF G;  3M8A A;  1V55 C;  1QR8 A;  4I4T B;  5J9P C;  4OX9 O;  4X88 A;  4UB8 Z;  5ITZ B;  2DMX A;  3HKB A;  1I94 B;  1XMO B;  1VF6 C;  2CTQ A;  4Z2W A;  4LNU A;  1Q81 W;  1BHB A;  1AI5 A;  4GKJ B;  1KKD A;  1OCZ B;  1SQB H;  2HKO A;  1H2L A;  1OCO B;  1TA8 A;  4KP4 A;  1FXK B;  5CMU A;  2CUG A;  2EIN C;  3DXR B;  4JYA O;  2Q4P A;  4JI6 O;  4YJ3 A;  4J7K A;  4Q6G A;  2QWQ B;  2Y69 B;  5LA6 B;  1BZK A;  2DYR C;  2B5U A;  1TAE A;  1Q6H A;  3AEI A;  3OMA B;  2EIJ B;  2DWD C;  3ABU A;  4QJF B;  3JAS B;  2UXC O;  4W4K A;  1BS3 A;  1HNZ B;  1N33 B;  4K3A A;  3EXA A;  4NTX A;  4U3F H;  3ASO C;  1SET A;  1KB9 F;  4EFE A;  1AI6 A;  2AW9 A;  4U3J B;  3OTO B;  3CXC U;  4KL1 A;  3A0R A;  3RBZ A;  3FAV B;  1AIL A;  4MTX A;  4E4E A;  2FML A;  4LF9 O;  3K03 A;  4ASU G;  1I08 A;  1PM9 A;  4DK1 A;  1AP5 A;  3ZN0 A;  1HW7 A;  3A8T A;  4XDK A;  2R70 A;  3EHB B;  1XMO O;  3SYQ A;  5EIB D;  4MS2 A;  1NVP D;  3OGC C;  1G8M A;  1KU9 A;  5JH7 A;  4GKJ O;  1GMG A;  4JYB A;  4X8A A;  2ZKO A;  5LP6 C;  4IHJ B;  5LHH A;  4DV3 O;  1XNQ B;  1MNG A;  2FKX A;  3D36 A;  1XQ8 A;  4GYC B;  1WP7 A;  2GDS A;  2P22 C;  4O4H A;  3UO2 A;  3Q4H A;  1FXV A;  3U10 A;  3SYA A;  2DN9 A;  4ZOL A;  4JAU A;  1NTM H;  5IYC O;  3WB0 A;  3IC7 A;  3ETQ A;  4DV6 B;  2YDE A;  3AK3 A;  1QLE C;  1HNZ O;  1GM8 A;  1N33 O;  3K5M A;  3LSS A;  3THO A;  4GX1 A;  4X9Q A;  1YXB A;  2X6C A;  3D8C A;  4JI4 O;  1YCI A;  3RN4 A;  4MT8 A;  3CCR V;  3OTO O;  4BWA A;  2QTO A;  2ZXW B;  4PDV A;  4LF5 B;  3K04 A;  3H1L H;  4TV9 B;  3OMI B;  4JAV A;  3K06 A;  1WN7 A;  3CRA A;  4CBC A;  2EBO A;  1M5I A;  1NBM G;  4PDL A;  3EFF K;  4B7E A;  2OTL V;  2YIB D;  1J5E B;  1ZTE A;  3ZRW B;  4UVA A;  2DYS C;  2ZQM A;  2ATK C;  5CBG A;  1L1F A;  1SER A;  1K3E A;  1E79 G;  4G2K A;  1NVP B;  1IVS A;  3JSN A;  3T4D A;  2Q6A A;  5AG2 A;  1MOF A;  3WU2 Z;  1XNQ O;  2GUZ B;  1SQG A;  3ABL C;  1XHZ A;  5KHI A;  1XL6 A;  2CTW A;  2OWO A;  3W7U A;  4RWU A;  1PNM A;  1Q86 W;  5H6Q A;  2LGW A;  5LMN B;  1ZX3 A;  1SC5 B;  2Q67 A;  4PDR A;  4RQE A;  4DV6 O;  1YSC A;  3HKB B;  1JFF A;  3E8F A;  2AZ2 A;  2EZP A;  1B6Q A;  4B3T O;  4LNU B;  2R9I A;  2BSK A;  4TOI A;  5F2V O;  1YI2 V;  2W6J G;  3K0G A;  3CEI A;  3LSQ A;  5GTH Z;  3HKD A;  2UUB B;  2EJ7 A;  1VQ8 V;  2PF4 E;  2QKA A;  4UV8 A;  2W0F C;  2OIG A;  4LF5 O;  1WJZ A;  4YJ3 B;  2HHH O;  4H0L B;  2ADQ B;  1KD1 W;  1R3K C;  2DQ3 A;  1J5E O;  5LGT A;  3BRC A;  1RSO B;  2E76 B;  4IYH A;  2E3C A;  4B3S B;  4WFH A;  2JGU A;  2RNB A;  4CH6 A;  1VQ7 V;  4OGQ B;  3IJ4 A;  2OTJ V;  1L0L H;  3QVN A;  1OHH G;  2HR3 A;  4PA6 A;  5KHJ A;  1XDC A;  5EIB C;  5K1X A;  2VWK A;  3N2G A;  5BMV A;  5IE9 A;  5LYJ A;  1SA0 B;  4ZKI A;  2JGD A;  3ABT A;  2F95 B;  4MVR A;  2HG5 C;  1ZLZ A;  2XHB A;  5LL6 Y;  2L35 A;  2JEX A;  4Q20 A;  4CS2 A;  3WFV A;  1EN5 A;  1VQN V;  3A0B Z;  1YVW A;  1SF9 A;  4WF9 V;  5JH7 B;  4FIP C;  1G1X B;  4NTY A;  4LWS A;  4R7C A;  5CA0 A;  3OE7 G;  1XMQ B;  1YJN V;  3JD2 A;  2RCV A;  1R3J C;  1MG1 A;  3FX7 A;  4L87 A;  3T1C A;  1QU7 A;  3Q4H B;  2ZDI A;  1M57 C;  4WFG A;  4ZOL B;  4ZHQ A;  1S77 D;  4PEL A;  5L3G A;  2JIZ G;  5IWA B;  2IJH A;  1U96 A;  2ZT9 B;  4B3S O;  4FJC C;  2QKS A;  4K8X A;  3H1K H;  1TUB A;  2QJ1 A;  3CE2 A;  2FTK A;  2ZNI A;  1RP3 B;  3IC9 A;  1SZT A;  1HWY A;  1CPY A;  1VF6 A;  2QDO A;  3X2Q C;  4YY3 O;  3SYC A;  3OAA G;  3K58 A;  4MVZ A;  2WAM A;  1SQP H;  2E5L O;  2UUA B;  1CEZ A;  2F66 C;  3ETG A;  4I5S A;  3P3P A;  3M99 B;  1VF7 A;  2WWW A;  3E89 A;  2WLN A;  4PI2 A;  4FZ1 A;  2GSM B;  1FPO A;  2PYJ A;  3CMA V;  1XMQ O;  1HP8 A;  4QE7 A;  5LHI A;  3ML0 A;  4NB5 A;  3OUF A;  3RYC A;  4FM1 A;  3D3I A;  4LF7 B;  1P49 A;  3AG3 C;  1D2D A;  3K79 A;  4CC6 A;  3A0H Z;  5IJ9 A;  3E35 A;  1JFF B;  4MSW C;  1THZ A;  5H9C A;  2BSK B;  1V9P A;  4DR7 B;  3HKD B;  4I9W A;  2XUM A;  3AG2 C;  3FB5 C;  1AB3 A;  3NXS A;  3SJQ C;  3L9D A;  2D3O W;  4JTA B;  1IBK B;  1K33 A;  1BT8 A;  3UO3 A;  5LP6 A;  2UUA O;  3G71 V;  3W7X A;  3ZHU A;  1GTO A;  1SRY A;  4LCU C;  4F4L A;  2OCC B;  3AK1 A;  2Y0I A;  4LC1 A;  1Q82 W;  3RT3 C;  3JAT A;  2HLD G;  2NN4 A;  4JYC A;  1EZV H;  4FFK A;  4GX5 A;  2D2C B;  4LFA B;  1GN4 A;  1SS3 A;  3QO8 A;  2EIK C;  4J9Y B;  4BW9 A;  3B8M A;  2G38 A;  3CSX A;  3RVZ A;  4NTW A;  1KKC A;  4JZ2 A;  5BMV B;  3N2G B;  5LYJ B;  1VQ6 V;  2WSS G;  2JGD B;  4ZIB A;  1K4C C;  5B3S B;  1ZAU A;  4MVM A;  2EIM C;  1H8E G;  3LDD A;  2AXT Z;  1FJG B;  2R9A A;  1IBL O;  4DR7 O;  3FB8 C;  1Y74 A;  4GZR B;  3VQV A;  4DV4 B;  4DRX A;  4LWS B;  4GX0 A;  5CA0 B;  1XIL A;  1IBK O;  1PL4 A;  2Q69 A;  3IGA C;  2XAH A;  3AK2 A;  3GWO A;  2R72 A;  3GWK C;  1QCE A;  1R3I C;  4PA3 A;  4TSF G;  1N4C A;  1WP8 A;  1V55 B;  4CS3 A;  1X4T A;  4XDJ A;  5CB4 A;  2A3Q A;  4LF8 B;  5B5E Z;  2WLI A;  3DTU B;  3LUT B;  5EBW C;  1MSW D;  1TUB B;  4F6R A;  2WLM A;  4LFA O;  1JMK C;  4YIO A;  2HVJ C;  1K5Q A;  5IJ0 A;  1S3J A;  4J9Z B;  2ZR3 A;  4G27 B;  3E2E A;  2JS3 A;  4TQD A;  2LGQ A;  1D5N A;  1JCH A;  1IX9 A;  4BIO A;  4DUZ B;  4OX9 B;  3JD3 A;  1W2B U;  2Z0A A;  1NR7 A;  2Z5U A;  3A2F A;  2EIN B;  1FJG O;  2ZE6 A;  1K92 A;  3EVK A;  2LFS A;  1XHX A;  1CP9 A;  1N0N A;  1ZL8 A;  2DYR B;  1MZF A;  2H94 A;  2ILM A;  4PA9 A;  3G4S V;  4DV4 O;  4DW0 A;  1IDS A;  1JR9 A;  4JYA B;  1S72 V;  4I0X A;  1VQ5 V;  2OCH A;  1EN4 A;  4KFM A;  1GAX A;  1U97 A;  5KHG A;  5BZB A;  4JI0 B;  3CCE V;  1N8R W;  3RYC B;  4PHZ A;  4O2B A;  4FLT A;  3ASO B;  1XI1 A;  3L70 H;  3RVY A;  3ICX A;  5CN0 A;  4FMT A;  2LJ2 A;  4LF8 O;  2UXC B;  1H2K A;  3JAL A;  3HR0 A;  5IJ9 B;  1WPX A;  1F23 A;  1PNL A;  3ETD A;  3LNN A;  5EZY A;  1TUE B;  4J41 A;  1KMI Z;  3JAW A;  3BPZ A;  3CP1 A;  2KSD A;  4FLZ A;  4LF9 B;  4DUZ O;  5KHK A;  1VQ4 V;  1TVK A;  5LP6 B;  4CZZ A;  2M6Y A;  3I56 V;  5B1B C;  4MVO A;  4J7Z A;  1J95 A;  1XRE A;  1AJQ A;  1GM9 A;  2EUL A;  5LGU A;  3ABK C;  1COW G;  1YDX A;  1YZB A;  5A9G A;  4I50 A;  1QVG U;  3JAT B;  1AR1 B;  1Y76 A;  1XNR B;  3E83 A;  3BAA A;  2Y48 A;  1WA8 B;  2YXY A;  3CHX A;  1JJ2 U;  2QM7 A;  4DV3 B;  1SZX A;  5C8Y A;  4NVP A;  1QLE B;  3KKY A;  4JI0 O;  3CWB H;  4JZG A;  3L72 H;  4D7S A;  3VQY A;  2YS8 A;  1WNS A;  3ASN B;  1QBZ A;  3TJT A;  1MMM A;  3RGB A;  2YIB A;  5IYB O;  3ZS8 C;  2B1G A;  3UT5 A;  2EJR A;  3MHH C;  4WFF A;  2LP7 A;  3G80 A;  3T1H O;  3K9A A;  4R6Z A;  4DR4 B;  2YSU B;  4JI4 B;  2ZIO A;  5BY1 A;  3FFQ A;  1Y74 B;  5H2F Z;  2ZD9 A;  3OEH G;  2DYS B;  4DRX B;  3U0Z A;  3STL C;  2X7R B;  1FS0 G;  3VOU A;  4MTO A;  1SQX H;  3KCX A;  4DV5 B;  3JAR B;  4DR2 B;  4J10 A;  4O2A A;  1VQM V;  1K7D A;  3ABL B;  4HYO A;  4W4L A;  4U7O A;  1NQT A;  5CA1 A;  3C90 A;  5CB4 B;  3UCS C;  1KP2 A;  1XNR O;  4EEQ A;  4B3R B;  2WLI B;  3CRQ A;  1PD3 A;  4YIP A;  2YI8 A;  3CJH A;  4DK0 A;  4EFB A;  4F6R B;  3JCU Z;  3B09 A;  5LGN A;  1URF A;  3WB1 A;  3OEE G;  3T1Y B;  2WPD G;  4UXN A;  4B08 A;  2WA4 A;  1B3Q A;  5IJ0 B;  1QNM A;  2P5O A;  4IGG A;  4QPJ A;  1Q90 D;  1ENV A;  2LW7 A;  2WLJ A;  3ZHV A;  1KYO F;  1M93 A;  4YXW G;  3HKE A;  1FXH A;  3H1J H;  4B3T B;  4DV2 O;  1YEW A;  5JCO C;  3K59 A;  4DR4 O;  3ASN C;  3E86 A;  1ZL8 B;  3F7Y C;  1W59 A;  4F6E A;  1BQZ A;  2Y4T A;  2HP8 A;  4FZ0 A;  4XDL A;  4E2L A;  4DV7 B;  1P4R A;  1Q6I A;  4I0X B;  4K8Z A;  2HHH B;  4JPR A;  3ZX6 A;  3JCZ A;  4DV5 O;  1XUQ A;  4DR2 O;  1O9H A;  5EK0 A;  4O4I A;  2QM4 A;  4O2B B;  2IJI A;  2ZM6 O;  2HJD A;  1B06 A;  5FNV A;  1Y66 A;  3ZHR A;  3K5N A;  3JAL B;  3FKS G;  4OPH A;  3J81 N;  4GLX A;  2BCC H;  4B3R O;  2ZNJ A;  5EZY B;  4UFZ A;  3JD0 A;  2KG7 A;  4JI8 B;  1KBH A;  4D7T A;  3T1Y O;  3KZI Z;  2X0L A;  1NTZ H;  1NH2 D;  4JI7 B;  3JAW B;  2OT5 A;  4Z1M G;  3HB3 B;  3C3S A;  3UKM A;  4UCR A;  4TQF A;  2XTA A;  3MD0 A;  3P32 A;  1TVK B;  3CCS V;  1DTO A;  3BFR A;  2DJV A;  4ABM A;  2DW4 A;  4FM0 A;  4DXW A;  4H37 A;  5LBQ A;  4I50 B;  3STZ C;  1M57 B;  1KEC A;  1IZ3 A;  4YHH B;  1JQ0 A;  2M7W A;  4DV7 O;  5C8Y B;  1SQF A;  3MDS A;  1NU1 H;  2AHZ A;  3OMN B;  2JDI G;  2VS0 A;  1N34 O;  4PA4 A;  3CCM V;  2IW5 A;  2E75 B;  1GN3 A;  1IBM B;  1YTF D;  3DC6 A;  3X2Q B;  1LR1 A;  3UT5 B;  2AHY A;  1MA1 A;  3GB7 C;  4FPP A;  2YID A;  4OPA A;  1M56 C;  1NR1 A;  3CC2 V;  1NI8 A;  3N2K A;  4JI8 O;  2YUA A;  2CH7 A;  4MTF A;  3J80 N;  3FD9 A;  1M9N A;  4JI7 O;  5CBH A;  4YY3 B;  1WLE A;  4LH6 A;  4KUM A;  4WBN A;  1GO3 F;  1K5S A;  1M90 W;  2CDY A;  2ODM A;  3RYI A;  2CTR A;  2XAG A;  2E5L B;  1EM1 A;  3ZRS A;  2JS5 A;  5DN6 G;  2OYQ A;  4O2A B;  3P30 A;  1K34 A;  4LFB B;  2UXD B;  4AI8 A;  5CA1 B;  3CCV V;  1R1B A;  5KHH A;  4X89 A;  1VP7 A;  3AG3 B;  4H13 B;  2PZS A;  3CJH B;  3M7M X;  3OR6 C;  4DR1 B;  4YHH O;  3AG7 A;  2QGN A;  4O4H B;  2XAQ A;  1ARO P;  5DEC A;  4HZ3 A;  4BIU A;  5LMU B;  3ZCC A;  2BTQ A;  2YI9 A;  3AG2 B;  1IBM O;  4H33 A;  5JVD A;  5FPO A;  1AI7 A;  1Q7Y W;  2AZ0 A;  5IT9 N;  2HVK C;  1YTF B;  5L3F A;  2FL4 A;  2AGA A;  1QVF U;  3HKE B;  4EB6 A;  4NYK A;  1Q43 A;  3ZMS A;  4FLX A;  5BR8 B;  5H6R A;  2BOB C;  2Q5Z A;  1H8H G;  2YEV A;  4H44 B;  2IM9 A;  4GX2 A;  1K73 W;  3LDC A;  4UB6 Z;  1DGS A;  4FFB A;  4JI3 O;  2K1E A;  3FYI B;  3HPL C;  3OT7 A;  1W0K G;  4UUJ C;  1ZSP A;  2WLL A;  4MVQ A;  2EIK B;  4O4I B;  4LFB O;  1VF5 B;  2UXD O;  3PJS K;  2QWO B;  1S5J A;  5EYP A;  2CAZ C;  1I0H A;  4CH5 A;  2JRI A;  2EIM B;  4FM2 A;  2Q7G A;  3N27 A;  3NR7 A;  4DR1 O;  1MSD A;  2KG7 B;  1L8D A;  2QEX V;  4DR6 B;  1T5E A;  2ZR2 A;  3BA8 A;  2ARH A;  1OCC C;  5L3E A;  5B1N A;  3SYO A;  2LQT A;  2A9H A;  5LMU O;  3DGE A;  1AVM A;  4I55 A;  1FD9 A;  1KP3 A;  3H1I H;  5KA6 A;  1RM1 C;  1R6K A;  5BR8 O;  1IBL B;  3CPW U;  5IYZ A;  5KX5 A;  2V7Q G;  1KUQ A;  2IH1 C;  1N32 B;  1FAF A;  1S76 D;  3CRR A;  2FB5 A;  1L0N H;  4RUF A;  2MK3 A;  3APO A;  4AIL C;  3JSL A;  3K57 A;  4JF3 A;  3G6B A;  3VQX A;  1F7Y A;  4FLW A;  1BCC H;  4TT3 G;  4DV1 B;  3CYO A;  1OJH A;  2P06 A;  3ZIA G;  3F7V C;  5CBF A;  5IY5 C;  1YIJ V;  2PY5 A;  1A32 A;  3SYP A;  5ITZ A;  4ICG A;  4IIJ A;  3RYF A;  3ZMV A;  3L74 H;  2F43 G;  2CH7 B;  1AR4 A;  4DR6 O;  5JCO A;  5DED A;  2N74 A;  4WBN B;  1IXM A;  2VQE B;  3ABM C;  3E8G A;  1FYJ A;  3K5O A;  1N36 B;  1R73 A;  5DM6 V;  5JJJ B;  1XBL A;  3B40 A;  2F23 A;  2DOS A;  3CCQ V;  1MAB G;  3BCC H;  2JEU A;  1G4Y B;  1QQC A;  4L8J A;  1WAZ A;  2P7T C;  2WA3 A;  4WFB V;  2PTM A;  1DF4 A;  1N32 O;  1VMG A;  3CB2 A;  4KHP B;  1BQ0 A;  3JAS A;  5TIS Z;  3AG4 C;  5EC2 C;  3CCL V;  2QKC A;  1P7B A;  4MTG A;  5KA5 A;  3ZMU A;  2IU0 A;  1YIT V;  5E79 Z;  4ZHQ B;  2XT9 A;  2BTQ B;  2A0L A;  1V54 C;  4JAS A;  4DV1 O;  5C93 A;  4CS4 A;  4GKK O;  1QLN A;  4EB6 B;  1AJN A;  2YIC A;  4B7K A;  5B1B B;  3CD6 V;  4KXR A;  1EFR G;  2GV9 A;  1K9M W;  4X65 B;  3ABK B;  3RYH A;  2YEV B;  5EBM C;  2VQE O;  2ZE8 A;  5KAF Z;  1WB8 A;  1N36 O;  4FFB B;  4PA7 A;  2ZIN A;  4R8C A;  2WLL B;  5EC1 C;  5HFM A;  1VAR A;  1NKD A;  4PI0 A;  3ZN1 A;  3BA9 A;  1TGO A;  3R65 A;  3T4Z A;  5EYP B;  2KKW A;  5EBL C;  4JI1 B;  3CCJ V;  2OIE A;  1BL8 A;  4X1K A;  4UV9 A;  2W6I G;  3B2E E;  5FPR A;  1AJP A;  1NTK H;  4DV0 B;  2A06 H;  2YXL A;  4JI2 B;  4KHP O;  1K97 A;  2N04 A;  4JI5 B;  1R3L C;  2PUS A;  4X66 B;  3ZMZ A;  1LUV A;  4UVB A;  4O4J A;  1HNW B;  2NLJ C;  4JGS A;  1DK1 A;  2QWN B;  1UPG A;  3ZRX A;  2P90 A;  1BHA A;  2XOK G;  3CC4 V;  3ZRV A;  2DE0 X;  5B1O A;  2X6B A;  3I5D A;  4LR3 A;  2Z3Y A;  4TV9 A;  3T1H B;  2LO1 A;  4J11 A;  1GRJ A;  3CRM A;  2RQ6 A;  2RJZ A;  3LNM B;  4I9Q A;  4DR3 O;  4QGP A;  1EN6 A;  5IYZ B;  4X65 O;  5KX5 B;  5JQG A;  1YHQ V;  3LSU A;  1R6T A;  2EIL C;  4JTD B;  3RFR A;  5CA3 A;  1DLB A;  2XAF A;  4ZBM A;  1FFT B;  2X6A A;  3OM3 B;  4I7Z B;  1S5H C;  4C7U A;  1PV0 A;  1SKV A;  1WB7 A;  1BSM A;  4GT1 A;  3SJB C;  4JTC B;  3AG1 C;  3O65 A;  3F5T A;  4JI1 O;  2K9P A;  4DV0 O;  4G28 B;  3P3N A;  3ZHT A;  5KMG A;  4JI2 O;  4IIJ B;  3RYF B;  4JI5 O;  4X66 O;  5HFL A;  3CX5 F;  2ZIM A;  2IU3 A;  1HNW O;  3H01 A;  1GK9 A;  2GTA A;  2EZO A;  3E8B A;  3QF7 A;  2CK3 G;  1I7F A;  1MZE A;  4HNA A;  3SGI A;  1BE3 H;  2QSA A;  2XAS A;  4BAY A;  3WG7 C;  4Z1V A;  1DF5 A;  3SPG A;  4X1Y A;  4DV2 B;  1PKX A;  4LP8 A;  3OD4 A;  2GTS A;  4DUY B;  2O57 A;  1E1R G;  5LOV A;  1H2N A;  1RSO A;  1GN6 A;  4J7J A;  2JK5 C;  1S5L Z;  3QO7 A;  4LF4 B;  3B77 A;  3JAK A;  5B1A C;  4DW1 A;  3D3Q A;  1NZ6 A;  2VWJ A;  3BY6 A;  3KG2 A;  4MVS A;  2ZM6 B;  1JJO A;  1AP6 A;  3L71 H;  3ETE A;  5H5N A;  3FB6 C;  1AI4 A;  4BW5 A;  3S3X A;  1SA0 A;  4B3M B;  5KUM A;  1OCR C;  4GCZ A;  2Q8V A;  5K1P A;  2NNU A;  1I94 O;  4JV5 B;  3PN1 A;  1I5Y A;  1YF2 A;  3RYH B;  1Y4M A;  4TUY A;  1G6U A;  1VQL V;  3K08 A;  2IH3 C;  1JX9 A;  3T2M A;  2QM8 A;  4P9O A;  2CE4 A;  1Q8I A;  1XOU A;  1D5A A;  4UCV A;  5GTI Z;  4AQY B;  1F51 A;  1LNQ A;  4PD4 F;  3MAQ A;  1OCZ C;  1GKF A;  4DUY O;  1OCO C;  3VBB A;  1SQQ H;  1M4U A;  4X1K B;  4A5U B;  1FXK C;  4X20 A;  5JJN B;  4LF4 O;  3CC7 V;  4NXM B;  1GH6 A;  1R6N A;  3H9V A;  2IJK A;  2Y69 C;  2N05 A;  3VQW A;  4MW8 A;  1M56 B;  4O4J B;  4ZI7 A;  1N34 B;  4GUN A;  1VEW A;  5J2T A;  1Z5V A;  3QTC A;  4P2Z A;  5GON A;  2EIJ C;  2P6J A;  4WFA V;  2V1D A;  4QNH B;  2ADP A;  1Y67 A;  3MHS C;  5LXT A;  4JAA A;  4B3M O;  3BAB A;  5JJE B;  1ZUQ A;  4TWK A;  1ORQ C;  3CRC A;  1HDJ A;  4LFC B;  2XAJ A;  1HR0 B;  4PV1 B;  4JV5 O;  3E22 A;  3RWR D;  2H3O A;  5E1A C;  1B04 A;  5JQG B;  1ZWI C;  3JD1 A;  4QIW F;  3F5W C;  2LW1 A;  1OZ0 A;  3OW2 U;  3SPC A;  2KB1 A;  2E74 B;  1ROP A;  4J80 A;  1OV9 A;  2LFR A;  4OXS A;  3BVO A;  3K9S A;  1XEQ A;  4AQY O;  1FFX A;  1Y76 B;  2QR4 A;  5KAI Z;  4RUE A;  1YJW V;  1K8A W;  3W7W A;  3C3T A;  1CXZ B;  5KMG B;  4NXM O;  4CH3 A;  2VRZ A;  3IFX A;  1O9G A;  3SJC C;  3U11 A;  2UXX A;  4UCS A;  4TV8 A;  1Q6U A;  1UFI A;  4FLV A;  4HNA B;  3HKC A;  2IJJ A;  4NKG B;  3CCU V;  4UCO A;  4CH4 A;  2NR5 A;  5KUK A;  2PI4 A;  4X62 B;  4X1Y B;  3K3W A;  4LH7 A;  3DC5 A;  1F4N A; 
#chains in the Genus database with same CATH homology
 4MS2 A;  1NVP D;  2DYR B;  2V7Q G;  3FYE B;  3OGC C;  3ZJZ A;  2H94 A;  2IH1 C;  4PA9 A;  2ZXW C;  3G4S V;  1G8M A;  1NH2 B;  1GMG A;  4JYB A;  4X8A A;  1S76 D;  4RUF A;  2MK3 A;  1S72 V;  5LHH A;  2HFE C;  1YJ9 V;  1VQ5 V;  2DQ0 A;  3D36 A;  4KFM A;  5BZB A;  1PL0 A;  4JF3 A;  3CCE V;  1N8R W;  3ASO B;  1FXV A;  3SYA A;  3RVY A;  4JAU A;  5CN0 A;  3ZMT A;  1OCC B;  5IYC O;  4TT3 G;  4FMT A;  3CYO A;  1F4M A;  3OFN G;  3IC7 A;  3F7V C;  3ZIA G;  5CBF A;  1JOY A;  5IY5 C;  1YIJ V;  1WPX A;  1F23 A;  1PNL A;  3ETD A;  1QLE C;  3UM7 A;  1GM8 A;  1GM7 A;  2UXN A;  3SYP A;  4U7N A;  1TUE B;  2QA4 V;  3LSS A;  3ZMV A;  4GX1 A;  2DWE C;  2F43 G;  1RM1 B;  2X6C A;  4MVU A;  1XL4 A;  5L3D A;  3I55 V;  5IYD O;  1IXM A;  4MT8 A;  3CP1 A;  3CCR V;  4N23 A;  3ABM C;  2QTO A;  2ZXW B;  3E8G A;  4PDV A;  3K04 A;  1VQ4 V;  4UVC A;  1RPR A;  4CZZ A;  1R73 A;  3OMI B;  3K06 A;  4JAV A;  5B1B C;  5DM6 V;  4MVO A;  4RO2 A;  2EBO A;  4CBC A;  3I56 V;  1NBM G;  2WLH A;  3EHB B;  4PDL A;  1J95 A;  1AJQ A;  1GM9 A;  3EFF K;  3CCQ V;  2OTL V;  3FB7 C;  5LGU A;  2WLK A;  3ABK C;  1COW G;  1MAB G;  2JEU A;  3ZRW B;  2C2A A;  1G4Y B;  4QPK A;  4UVA A;  2DYS C;  1QVG U;  2ZQM A;  2P7T C;  2ATK C;  1S0V A;  1AR1 B;  5CBG A;  1L1F A;  4WFB V;  3E83 A;  1SER A;  1K3E A;  1DF4 A;  1E79 G;  4G2K A;  1NVP B;  3T4D A;  2Q6A A;  2Y48 A;  1JJ2 U;  1MOF A;  2QM7 A;  3AG4 C;  3SPI A;  5IY5 B;  5EC2 C;  4BIZ A;  1QLE B;  3CCL V;  3OUS A;  3QO5 A;  1VQO V;  3ABL C;  1XL6 A;  3W7U A;  1P7B A;  4MTG A;  1PNM A;  5KA5 A;  3ZMU A;  1Q86 W;  5H6Q A;  2IU0 A;  1YIT V;  3ASN B;  1QBZ A;  1EZJ A;  1H2G A;  2A0L A;  1V54 C;  4JAS A;  5IYB O;  2Q67 A;  2B1G A;  5C93 A;  2EJR A;  3ABM B;  3MHH C;  4PDR A;  4RQE A;  4WFF A;  1QLN A;  2LP7 A;  1AJN A;  1YSC A;  5IDJ A;  3E8F A;  3K9A A;  2EZP A;  4R6Z A;  5B1B B;  1B6Q A;  3CD6 V;  3TCU A;  1EFR G;  2HJF C;  1K9M W;  2YSU B;  2Q68 A;  2R9I A;  3ABK B;  1YI2 V;  1EBO A;  2W6J G;  2YEV B;  4EKW A;  3K0G A;  3LSQ A;  4WCE V;  2ITC C;  2ZD9 A;  3OEH G;  1UJW B;  2DYS B;  1VQ8 V;  5EBM C;  3STL C;  2A79 B;  2X7R B;  1FS0 G;  4UV8 A;  3VOU A;  2W0F C;  4MTO A;  4P30 A;  4FK5 C;  4PA7 A;  4R8C A;  3AG4 B;  2WLL B;  5EC1 C;  5HFM A;  1KD1 W;  1NKD A;  3CME V;  1VQM V;  1K7D A;  3ZN1 A;  3ABL B;  4HYO A;  4DO2 A;  1R3K C;  2DQ3 A;  4U7O A;  1NQT A;  3R65 A;  5LGT A;  3T4Z A;  5EBL C;  1KP2 A;  3CCJ V;  1BL8 A;  4UV9 A;  1V54 B;  2W6I G;  2WLI B;  1AJP A;  1PD3 A;  4WFH A;  1SES A;  1K97 A;  1VQ7 V;  2GHY A;  1R3L C;  2OTJ V;  1PNK A;  3QNE A;  5LGN A;  3ZMZ A;  3OEE G;  1OHH G;  2HR3 A;  2WPD G;  4UXN A;  2B1I A;  4UVB A;  4PA6 A;  2NLJ C;  4JGS A;  3ZRX A;  2P90 A;  1BHA A;  4QPJ A;  2XOK G;  3CC4 V;  3ZRV A;  1ENV A;  4ZKI A;  2R9R B;  2WLJ A;  3ABT A;  5B1O A;  2JJ1 G;  2X6B A;  3SPJ A;  4MVR A;  2Z3Y A;  2HG5 C;  4YXW G;  3E8H A;  1FXH A;  2JEX A;  4Q20 A;  1KQS U;  3JYC A;  3WFV A;  3LNM B;  1VQN V;  3ASN C;  1E1Q G;  2BOC C;  3E86 A;  3F7Y C;  1YHQ V;  4WF9 V;  4PDM A;  2PI5 A;  2EIL C;  4FIP C;  3OR7 C;  4XDL A;  4JTD B;  4E2L A;  5CA3 A;  1DLB A;  4R7C A;  3OE7 G;  1FXK A;  1P4R A;  1YJN V;  1JPX A;  2XAF A;  4ZBM A;  1FFT B;  1I5X A;  3JD2 A;  2X6A A;  3JD4 A;  3OM3 B;  4JPR A;  1R3J C;  4R50 A;  1S5H C;  1MG1 A;  2JJ2 G;  3JCZ A;  4L87 A;  5EK0 A;  3T1C A;  2ZDI A;  1M57 C;  2QE7 G;  4GT1 A;  3LDE A;  4XBF A;  2IJI A;  4WFG A;  3TK1 A;  1S77 D;  4JTC B;  3AG1 C;  4PEL A;  5L3G A;  5GW7 A;  4MW3 A;  1Y66 A;  2JIZ G;  4RAI A;  2IJH A;  3FKS G;  4G28 B;  4FJC C;  2QKS A;  3JD0 A;  5HFL A;  1KC8 W;  2FTK A;  1VQP V;  1SZT A;  2IU3 A;  2X0L A;  1NJI W;  5L3C A;  1NH2 D;  1HWY A;  1CPY A;  3H01 A;  1GK9 A;  3RW0 A;  2OT5 A;  4Z1M G;  3HB3 B;  2EZO A;  3X2Q C;  5FL7 G;  3E8B A;  2CK3 G;  3UKM A;  3SYC A;  2EIL B;  3OAA G;  5LHG A;  3MD0 A;  4MVZ A;  3P32 A;  2WAM A;  1QR9 A;  3CCS V;  1DTO A;  2XAS A;  3K0D A;  1W0J G;  4BAY A;  1CEZ A;  3WG7 C;  3ETG A;  4I5S A;  1DF5 A;  3SPG A;  2DW4 A;  5L3B A;  1PKX A;  3M99 B;  4LP8 A;  4DXW A;  4H37 A;  3G6E V;  2WWW A;  5LBQ A;  3W7S A;  3E89 A;  3STZ C;  1M57 B;  1E1R G;  1KEC A;  1VQ9 V;  2WLN A;  3AG1 B;  2JK5 C;  3QO7 A;  2GSM B;  3B77 A;  5B1A C;  3BEH A;  3CMA V;  1JQ0 A;  2M7W A;  4QE7 A;  1RPO A;  4WFE A;  3BY6 A;  2AHZ A;  3KG2 A;  3OMN B;  5LHI A;  1M1K W;  1K4D C;  2JDI G;  4MVS A;  3ML0 A;  2OCC C;  3OUF A;  3TET A;  4PA4 A;  4HAM A;  3CCM V;  2IW5 A;  3ETE A;  3D3I A;  3FB6 C;  1AI4 A;  4BW5 A;  1YTF D;  3AG3 C;  3X2Q B;  5KUM A;  3K79 A;  1OCR C;  2AHY A;  2P67 A;  3W7T A;  4P9P A;  2ITD C;  3GB7 C;  3E35 A;  1H38 A;  4FPP A;  4MSW C;  4N21 A;  1THZ A;  1M56 C;  1NR1 A;  3WG7 B;  4GCZ A;  4LBE C;  2H8P C;  2XND G;  3CC2 V;  2NNU A;  4QE9 A;  5H9C A;  1I5Y A;  4MTF A;  1Y4M A;  1M9N A;  4I9W A;  5CBH A;  3AG2 C;  5B3S C;  3FB5 C;  1WLE A;  1VQL V;  4KUM A;  1GO3 F;  2IH3 C;  3K08 A;  3NXS A;  1K5S A;  1M90 W;  4RQF A;  3SJQ C;  1JX9 A;  2D3O W;  3T2M A;  4JTA B;  2QM8 A;  1K33 A;  4P9O A;  1JVM A;  2XAG A;  5B1A B;  3ZRS A;  5DN6 G;  3G71 V;  3W7X A;  1GTO A;  3P30 A;  1SRY A;  4LCU C;  1K34 A;  4F4L A;  1F51 A;  1LNQ A;  2OCC B;  3ZRW A;  4LC1 A;  1OCZ C;  1GKF A;  3CCV V;  1Q82 W;  2HLD G;  1OCO C;  3VBB A;  4JYC A;  1FXK C;  4GX5 A;  4X89 A;  3AG3 B;  3CC7 V;  3OR6 C;  1R6N A;  1OCR B;  2IJK A;  3SPH A;  3QO8 A;  2EIK C;  4J9Y B;  2Y69 C;  2ZDI C;  4MW8 A;  1M56 B;  3B8M A;  1VQK V;  3B8N A;  3RVZ A;  1BMF G;  4P2Z A;  2XAQ A;  1V55 C;  1QR8 A;  2EIJ C;  2P6J A;  1ARO P;  1VQ6 V;  2WSS G;  4WFA V;  4HZ3 A;  2V1D A;  4BIU A;  4QNH B;  5J9P C;  3ZCC A;  3AG2 B;  5B3S B;  1K4C C;  4H33 A;  3MHS C;  2EIM C;  4MVM A;  1AI7 A;  1H8E G;  1Q7Y W;  4X88 A;  3LDD A;  2HVK C;  1YTF B;  5L3F A;  1QVF U;  4TWK A;  1ORQ C;  3ZMS A;  2XAJ A;  5E1A C;  5H6R A;  1Q81 W;  2BOB C;  1ZWI C;  3FB8 C;  1H8H G;  3JD1 A;  1BHB A;  2YEV A;  1AI5 A;  1KKD A;  1OCZ B;  4QIW F;  3F5W C;  2HKO A;  4GX2 A;  1OCO B;  1K73 W;  3LDC A;  4GX0 A;  1OZ0 A;  4KP4 A;  1FXK B;  3OW2 U;  5CMU A;  2EIN C;  3SPC A;  2Q69 A;  2KB1 A;  3IGA C;  1ROP A;  2K1E A;  3FYI B;  3HPL C;  2XAH A;  1W0K G;  3GWO A;  2WLL A;  4UUJ C;  4MVQ A;  2EIK B;  2Y69 B;  1QCE A;  2LFR A;  1R3I C;  4OXS A;  4PA3 A;  4TSF G;  2DYR C;  2B5U A;  3PJS K;  1V55 B;  3AEI A;  3OMA B;  2EIJ B;  2DWD C;  3ABU A;  4XDJ A;  4RUE A;  4QJF B;  1YJW V;  1K8A W;  3W7W A;  2EIM B;  2WLI A;  3DTU B;  3LUT B;  5EBW C;  1MSW D;  3IFX A;  2WLM A;  2UXX A;  2QEX V;  3ASO C;  2HVJ C;  1K5Q A;  1SET A;  1S3J A;  2ZR2 A;  1AI6 A;  1OCC C;  2ZR3 A;  4G27 B;  4J9Z B;  5L3E A;  3E2E A;  5B1N A;  3SYO A;  3CXC U;  1JCH A;  2A9H A;  3A0R A;  3RBZ A;  4MTX A;  3JD3 A;  3DGE A;  2IJJ A;  1W2B U;  3K03 A;  3CCU V;  4ASU G;  1KP3 A;  1NR7 A;  2Z5U A;  5KUK A;  2PI4 A;  2EIN B;  1K92 A;  3K3W A;  5KA6 A;  3ZN0 A;  4XDK A;  1RM1 C;  2LFS A;  1R6K A;  1F4N A;  1CP9 A;  3CPW U;  3SYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...