4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
3T4ZA 3SYCA 2YEVA 3K03A 2K1EA 2WLLB 4JTDB 2IH3C 1ORQC 1XL6A 2HJFC 2ITCC 3K04A 2Q6AA 4PA4A 2NLJC 1QLEC 4R6ZA 3RW0A 3SJQC 4MW3A 2ATKC 4P9OA 4G27B 4QE7A 3ZJZA 1R3IC 2DWEC 2EIMC 3SYAA 4G28B 3T1CA 4PA9A 4PA7A 4RO2A 4GX0A 3STLC 4CBCA 1JVMA 3E8HA 3F5WC 2WLMA 3FB5C 4BW5A 4XDJA 3GB7C 5B1AC 2ZXWC 2DWDC 4R7CA 4EKWA 5KUMA 3E8GA 3UM7A 5CBHA 4MVOA 2H8PC 3FB6C 4J9YB 2Q68A 3ABLC 1M57C 4H37A 4JTCB 3SPGA 3TCUA 1ZWIC 4QNHB 4J9ZB 1R3KC 3X2QC 3ZRSA 4WFHA 1P7BA 2Y69C 2JK5C 2QTOA 3LDCA 2WLHA 2HFEC 4GX1A 2AHYA 3R65A 1XL4A 1KKDA 3RBZA 5B3SC 3SPJA 1K4CC 5EBWC 2WLJA 2WLLA 2X6AA 4LBEC 4LCUC 3VOUA 3OGCC 3KG2A 2W0FC 1J95A 2AHZA 4MVZA 3SPIA 4MS2A 4WFFA 2WLKA 3AG1C 4R50A 3JYCA 2EIKC 4H33A 3FB7C 3OUSA 4HZ3A 4RUEA 2A0LA 3K06A 4MSWC 4XDKA 5CBFA 2EILC 3E8BA 4QE9A 2Q69A 1K4DC 2HVJC 4MVUA 2DYRC 3WG7C 3LDDA 5J9PC 4P30A 4JTAB 3E89A 4KFMA 3K0GA 4LP8A 3AG4C 3E83A 3SYQA 2ZD9A 3OUFA 1G4YB 3K08A 1M56C 1LNQA 2QKSA 1OCCC 4I9WA 2HVKC 3ABMC 1BL8A 3PJSK 5EC2C 4RAIA 2WLIA 3SPCA 4PA3A 3HPLC 2X6CA 3FB8C 3UKMA 3AG3C 4MVQA 4WFGA 3IGAC 3BEHA 3SYOA 4MVSA 2ITDC 4PDRA 3ABKC 3RVYA 2EINC 4MTOA 2HG5C 4PDVA 2DYSC 5BZBA 4F4LA 4P2ZA 3F7VC 3E8FA 3LNMB 1R3LC 3OR7C 3ASOC 4MTGA 3RVZA 2BOCC 3ASNC 4ZBMA 4DXWA 2OCCC 2EIJC 2BOBC 3F7YC 4P9PA 3T4DA 3SPHA 3EFFK 4PDLA 4MVMA 4RUFA 1OCOC 4GX5A 5KUKA 5EK0A 4OXSA 3LDEA 4XDLA 5E1AC 3AG2C 3STZC 3E86A 4R8CA 4PDMA 4UUJC 5B1BC 2WLNA 4MTFA 1S5HC 2P7TC 4MW8A 3K0DA 2A9HA 4X89A 1V54C 4WFEA 5EC1C 3T2MA 2X6BA 1V55C 2IH1C 2R9RB 1R3JC 2WLIB 4MVRA 4TWKA 4X8AA 3LUTB 4X88A 5EBMC 5IY5C 1OCZC 2A79B 3TETA 3SYPA 5EBLC 5CBGA 3IFXA 4PA6A 2KB1A 4HYOA 2Q67A 3OR6C 1OCRC 4GX2A
chains in the Genus database with same CATH superfamily
3T4ZA 3J7AU 2N74A 4ZI7A 4X20B 2BSKB 3K04A 3RYHB 1NTZH 4K8XA 2VQEB 1NTKH 3ZRWA 4YJ2A 4YIOA 5IJ0B 5LBQA 1THZA 5LGUA 4KHPO 4BW5A 1Q81W 4JAUA 4DR2O 2XAGA 3P32A 4JV5O 3JATA 1ZWIC 1EN4A 3JD1A 1R3KC 2UUCO 3QVNA 4I9QA 2P90A 5IY5B 1NH2D 3RWRD 4IT5A 1CPYA 4X1IB 3VOUA 1X59A 4EFBA 1IDSA 1TVKA 3AG1C 4RWUA 1VQ8V 4TSFG 1BCCH 3HKCA 2BSKA 4GKKO 4WF9V 3LDDA 3JAKB 4O4JB 1G4YB 4UB8Z 1FXKC 5KHGA 3AG3C 5C8YB 3KCYA 3B40A 3O9OA 2H94A 1RSOB 1VQMV 1XUQA 3JATB 4O2BB 1M1KW 3OEHG 1VQPV 4EEQA 2F95B 3DC6A 1SZTA 4P9PA 4DK1A 4X1IA 3ZMTA 1VF6A 1VQNV 4UCVA 2YXHA 2XT9A 3E22B 4PDMA 1VQKV 2ZNIA 4LF8B 2WLNA 2CTRA 2WPDG 3ML0A 4B7KA 2D3OW 1VQOV 4PJ0Z 2FB5A 2E5LO 4FLZA 1MG1A 3OM3B 3ZRXA 4AILC 1QQCA 1TA8A 1R73A 3WG7B 2XUMA 3HB3B 2ITCC 1RSOA 1IBKB 1XNQB 1SQFA 3JCUZ 4G27B 2QWQB 2W0XA 4DYLA 1OHHG 1RPOA 4PA9A 5HFMA 3JAWB 1SERA 1NS1A 2B9ZA 4FM1A 2DWDC 2ZE6A 3W7TA 1I94B 5CMUA 4FIPC 2IJHA 3FX7A 1QVGU 3RT3C 4J9ZB 1HNXB 1BHAA 2JVDA 4WFHA 4B3RO 4WFAV 2Y69C 4A5UB 4GX1A 2AHYA 1BT8A 4DR5B 2R9IA 2UXCO 1D2DA 3RYFA 4I4TA 4B3SO 3RYHA 1J95A 1LR1A 4JAVA 1N32O 3N2GB 4CZZA 1H2GA 5CBFA 2QWRB 1O9HA 2YS8A 1GKFA 1BS3A 1JJOA 4OPAA 3T1YB 4MVUA 3AG2B 3HR0A 4P30A 1Z5VA 3E22A 3SDLA 5IYZB 3P30A 3QF7A 4I9WA 3CJHA 1LNQA 2HVKC 3KCXA 2IU3A 3THOA 2QKAA 5KAFZ 4O4HA 4Z1VA 3EXAA 4O4IB 2N05A 3CC2V 2UUBB 1BZKA 2JRIA 1K3EA 1XBLA 3GWOA 1S5LZ 3LNMB 4NVPA 1B6QA 1URFA 2GUZA 2AZ2A 3ASOC 3RVZA 1MSDA 1E1RG 3EFFK 4CC6A 4NXNB 1VARA 3C90A 5JJJB 1CEZA 3AG2C 3BFRA 3CCRV 3N2GA 1WLEA 1VQ9V 3A2FA 1L0LH 3LSSA 1YHQV 4UV9A 4HNAA 4FZ0A 2E76B 1FJGO 4TV9A 3J80N 3X2QB 2Q67A 2ARHA 2HP8A 1R6TA 2IH3C 2Y69B 5EYPA 5KHKA 4LNUB 1GK9A 3RW0A 2AXTZ 3G6EV 1ZL8B 2FL4A 3FB5C 3HKCB 4IL6Z 5JCOC 2VWKA 1PKXA 2F23A 2LP7A 2V1DA 1TGOA 5KMGA 3AK3A 1R6KA 2C2AA 1P7BA 4LF6O 1W0KG 2V7QG 3LDCA 1XL4A 3DTUB 4O2BA 4O4LB 4KP4A 4DV0B 3CX5F 5LOVB 4DV3O 1FFXB 2HLDG 1J5EO 4WBNA 3DXRB 4H33A 1OCRB 2CH7B 1PP9H 1FPOA 4NXNO 4EB6B 5KAIZ 5LP6C 4Q20A 2QJ1A 3AK1A 4LWSB 1XMOB 3MD0A 3JCZA 4L87A 4DR7B 3L9DA 4J7KA 2H3OA 2HJDA 1Q6IA 4PDVA 4ZHQB 5FNVB 3LSUA 1RFYA 3WB2A 5KX5B 4NB5A 2XTAA 4WFBV 1HR0B 1KP2A 1Q8IA 3OEEG 3G4SV 3BCCH 5GTHZ 4AHCA 4CS4A 1YIJV 5LMNB 3ABTA 4JYYA 1KYOF 3QG5A 2XNDG 3ZHSA 1FKAO 5LGTA 2K1EA 4JTDB 1HNXO 3N27A 4X1KB 4R6ZA 1B3QA 4F6RB 4ICGA 3JAKA 1XMOO 3AK2A 3GVMA 4GKKB 2F1MA 4MVOA 4FLUA 4X64O 1XNRB 2AW9A 3SPGA 1YI2V 1RM1B 2BCCH 4X65B 2AGAA 5L3DA 1GM9A 1YDXA 5B1OA 3OE7G 5JWPA 4O2AA 2P06A 4JI2O 2ZDIA 1HW7A 1MZFA 5H6QA 3K9SA 2YICA 1QBZA 1P7GA 3RYIA 2Q4PA 2QDOA 2WA3A 1M90W 3TK1A 1K4DC 3ZMSA 3HKBB 4J7ZA 5CA1A 1HWYA 4KFMA 3OAAG 1XMQB 4F6RA 2ZD9A 3OUFA 2EJ7A 5EC1C 3PJSK 4DR4B 3ABUA 3SGIA 5IYBO 2A06H 3CXCU 2QWPB 4U3JA 4I50A 2MK3A 4ABMA 3B2EE 2QM4A 4I4TB 4GKJB 4N21A 5GONB 2LGQA 1NH2B 3ASNC 4ZBMA 3RYCA 1H2LA 3T4DA 4LFAB 2UXDO 2ZCEA 2L35A 4GX5A 3CD6V 1Q82W 3LDEA 3STZC 2OCHA 1Y6XA 2ZE7A 2NN4A 3ICXA 4MW8A 2JIZG 3DC5A 4DR6O 4DO2A 5KMGB 4TWKA 2PTMA 1M57B 2DW4A 2PI5A 3S3WA 1KUQA 1HNZB 1IVSA 4J10A 3D3IA 3KZIZ 4PHZA 1FYJA 3L74H 5LHIA 2UXXA 3UQ8A 5IE9A 4QPJA 4FK5C 2ATKC 3HKDB 3JSNA 3CRMA 3STLC 4UCRA 1SA0B 4DR4O 4DV5O 1KBHA 4BWAA 3Q4HA 1XDCA 3AEIA 5J2UB 5C8YA 4JI1B 1J5EB 3CE2A 2NNUA 4JI6O 3JALA 3SR2C 2XOKG 4QNHB 4YHHB 2DQ3A 4PI2A 1KKDA 4YY3B 4FMTA 3L73H 4LFAO 3ZHUA 4LF4O 4ZHQA 4X62O 1EBOA 5DECA 1BGYH 4PELA 4R50A 3JYCA 2RQ6A 3ZHVA 3BA8A 4Z1MG 4LR3A 5CN0A 1E1QG 5DEDA 4X64B 4LF9B 3UT5B 1XNRO 4FPPA 2F4VO 1Y76B 1DGSA 4JGSA 4RQEA 4KL1A 4KUMA 5JH7A 1BL8A 4RAIA 1JFFB 4WFGA 4O2AB 4DR5O 4O4LA 2Q8VA 1N4CA 1OJHA 4K8ZA 1EZJA 2O57A 5IJ9A 4J80A 4LFCB 3E8FA 1I0HA 4DV2O 3FYEB 2BOCC 4LH7A 5IJ0A 5B1BC 1AJPA 1W0JG 3VBBA 2E5LB 1M56B 4YY3O 3A0RA 3WFVA 4LFBB 2QWNB 3JALB 1R3JC 4LF8O 1FFXA 1K7DA 1Y74A 3D3QA 3L70H 5J2TA 1S72V 4LF6B 4GX2A 2UXBB 1CXZB 2YEVA 1SQXH 1XEQA 1H38A 2LFSA 2ZR3A 2Q9LA 1IXMA 2FTKA 1JVMA 3E8HA 2KG7B 3W7WA 4JI3O 4FJCC 5KA6A 5IYZA 1BQZA 2H8PC 4H37A 3U11A 2R9AA 1WP7A 3A8TA 2UU9B 1H2MA 4DRXB 1FXHA 2UXCB 3OGIB 3E2EA 3FYIB 2V4DA 1I7FA 3AG4B 1BMFG 4HNAB 2ZT9B 4LCUC 4DR2B 3CHXA 3VQWA 3SPIA 4DV4O 5A9GA 4AQYB 3MAQA 3K06A 5C93A 3UCSC 4QE9A 4NR1A 2DOSA 2Q7GA 2EULA 3E89A 1D5AA 3ABMC 2FKXA 2WLIA 3HPLC 2UUBO 3UKMA 1WPXA 4KHPB 1FD9A 3G67A 2CUGA 5J2TB 2IBZH 5E79Z 1HNWB 3DSQA 5LP6B 4CC5A 3H01A 2QWOB 3H1IH 3C3SA 1GAXA 4FLXA 4UVBA 5KA5A 5LA6B 1Z2GA 3EHBB 4UUJC 4UVAA 4YXWG 3ETDA 1D5NA 3O65A 3ZHTA 3ZEDA 4JASA 5EBMC 1GM8A 3IFXA 4K3AA 2YC0A 4X65O 1IXBA 3T1YO 4CH4A 1MABG 1MA1A 2EIMB 4FZ1A 3MHSC 4JI2B 2ZM6B 1S3JA 2YIBA 1AI7A 4CS2A 2ZDIC 4JF3A 1N33B 2ADPA 1OCZB 1F23A 3R66A 2CH7A 4PA7A 4U7OA 1HP8A 3F5WC 1HR0O 3UT5A 4UV8A 4H13B 5KUMA 4KXRA 3OTOO 3K59A 3IAYA 3CYOA 4JI5B 2CK3G 2DN9A 3X2QC 4O4HB 4NYKA 2EIJB 1NKDA 4DW0A 5KHHA 4Q6GA 5LMUO 2Y0PA 3FD9A 1COWG 1OCOB 4JYAB 1VEWA 4L8JA 3CS5A 2Z5UA 1S76D 2Y4TA 1R1BA 2P4VA 3JARB 2W0FC 4MS2A 1SQBH 2B1IA 5BY1A 2PGGA 4GUNA 1DLBA 1QHTA 4B3RB 3B8NA 1K33A 4JI6B 1N34O 2IJIA 3E8BA 5L3BA 1H2NA 3DGEA 2ZE8A 2UXDB 3FKSG 2DYRC 1I94O 3CCMV 2M6YA 4IYIA 3AG4C 3E83A 2UUAO 3SPCA 2XASA 4X20A 3ABKB 3CEIA 1PL0A 2LW1A 2DYSC 3FAVA 2XAJA 3F7VC 2XHBA 2ZM6O 2JEUA 1DK1A 4JI7B 2UXBO 3K58A 1MMMA 1OCOC 4E2LA 1IBKO 1XNQO 4FM0A 4DV1O 3D36A 3E35A 2PY5A 3CRCA 1GN4A 1V55C 1O9GA 1KU9A 1NVPB 3RYFB 2P6JA 4HYOA 3JSLA 1K73W 1NI8A 4NXMO 5B1NA 4NTWA 2WLLB 4DW1A 1RP3B 2GUZB 3CRAA 2PZSA 2KKWA 3DXRA 2EIMC 3SYAA 1AP5A 3OTFA 2YXYA 5EIBC 2WLMA 2UU9O 1V54B 5EZYB 2ZXWC 4R7CA 4EB6A 1PNKA 1JPXA 2CE4A 1K34A 4DR6B 4JTCB 1KD1W 4O4IA 3QO7A 2JS5A 4MT8A 3VQYA 4X66O 2P22C 3B77A 4IHJA 3ZN0A 2QTOA 4FFBA 3MDSA 1JOYA 1KQSU 3R65A 4JI7O 4G2KA 3CPWU 2BTQA 2WLJA 2ZR2A 1PV0A 1SRYA 4DV2B 5CB4A 3B09A 1Q90D 1L1FA 3U0ZA 1YEWA 5JQGA 2VS0A 1S0VA 1G8MA 3SYQA 2QSAA 2OYQA 1OCCC 5L3CA 4DRXA 1QCEA 5DM6V 1K92A 1N34B 1F4MA 5EYPB 1NBMG 3G80A 2PI4A 3N2KA 5JJNB 2HG5C 3ZS8C 1ENVA 1QR9A 5B66Z 2QR4A 1JMKC 4P2ZA 4FFBB 4BW9A 4DXWA 3A0BZ 2IJJA 3F7YC 5CA0A 4UCSA 1MOFA 4C7UA 5KUKA 1SESA 1SA0A 5EK0A 1YSCA 5LL6Y 1ZTEA 3AG1B 1HDJA 3CCVV 1US6A 1GH6A 3L71H 1S5HC 5LHHA 5F2VO 1L0NH 5JJEB 2ODMA 3T2MA 2KQXA 4LH6A 2RCVA 2VQFB 3CC7V 2WLIB 5IY5C 1DF4A 3ZRVA 4I5SA 2DYRB 1YCIA 2Q0AA 1Y76A 3CXHF 2OTLV 1AP6A 4JI0B 1MZEA 5JH7B 3P3NA 3C3TA 1Q43A 2GTSA 2OTJV 3IC7A 1TVKB 1MSWD 1K9MW 1N36O 5BR8O 1VF6C 4CBCA 4OX9O 1SETA 3UM7A 4IYHA 1HNWO 1NQTA 2LGWA 4BIOA 5GTIZ 2YI8A 2JGDB 1BHBA 2Y48A 5B1BB 2HFEC 3ZIAG 5D5PA 2AZ0A 3CCSV 5B3SC 4IIJA 4CH6A 1WAZA 4ZIBA 4U7NA 3ZX6A 2HHHO 4XDKA 3K9AA 5IDJA 2HEPA 4QGPA 3WG7C 1S77D 1ZX3A 2Q0OC 1Y74B 5TISZ 2GHYA 2JEXA 1JQ0A 2QKSA 5BMVB 3TJTA 1CP9A 3FB8C 1PM9A 1QLNA 4LNUA 2GSMB 4PDRA 1KB9F 4J42A 2W6JG 5BZBA 2B5UA 1K8AW 2Y0IA 3CP1A 4TUYB 4JI8B 3CCLV 4RUFA 4X1YA 1K97A 1Q3EA 1ZUQA 2PYLA 4R8CA 5ITZA 3APOA 3ABMB 4BIZA 4DV7B 4GKJO 2X6BA 1PL4A 2IH1C 1RPRA 1SQQH 4LF7B 3UO2A 2OT5A 3WB0A 5CBGA 2A3QA 3KKYA 4TOIA 5L3EA 2ZIMA 1UPGA 2DQ0A 1QNMA 5LXTB 1VF7A 4B3MB 1ORQC 1XL6A 1ZAUA 1GM7A 4BR6A 3JD4A 2UUAB 3OFNG 3RYCB 4P9OA 3ZJZA 4TQFA 3T1CA 4GX0A 4MTXA 4O4JA 1NU1H 3WU2Z 2VRZA 2QTSA 1PNMA 2EX3A 1M57C 5LMNO 3TCUA 1GN2A 4ASUG 2YSUB 5FPOA 4I50B 1N0NA 3FAVB 2ZIOA 1XQ8A 3K57A 2UXNA 3CSXA 3CCQV 3G6BA 3SPJA 1K4CC 2ZINA 2JS3A 1YJNV 1BSMA 2CGNA 1IBLB 2R72A 4H44B 3QO5A 1M4UA 1VQ5V 2EIKC 4N23A 3VQVA 5FLXN 1TUBB 4HZ3A 1K5QA 3B4SA 5IT9N 1M93A 1FFTB 2Z0AA 1N32B 5ITZB 1ZL8A 3CB2A 1I5XA 3L72H 3K0GA 2A7WA 4DV7O 1FXVA 3AG7A 5A2QN 1M56C 5FPRA 2P67A 4YJ3B 5BR8B 1KP3A 1NR7A 3IGAC 3QTCA 2EINC 1OZ0A 5FL7G 4YJ2B 4NXMB 1SC5B 1XOUA 4UCOA 4LC1A 5B3SB 2HHHB 2X7RB 5H6RA 1N8RW 4PDLA 3L75H 2VQFO 5E1AC 1GRJA 2KG7A 2P5OA 2EJRA 2IJKA 4IHJB 2YIBD 1RM1C 4UXNA 2QGNA 3TETA 4B7EA 4DR1O 2LO1A 2DE0X 4E4EA 4H0LB 2K9PA 4QIWF 4DK0A 3SYCA 3K03A 3IJ4A 3H1KH 1FJGB 4JZ2A 2YIDA 1T5EA 1IBMB 2Q6AA 3ETQA 2NLJC 4PA4A 3OMNB 4JI1O 3T1HO 4G28B 3UO3A 2XAQA 3NR7A 4X9QA 2ZE5A 3HKEA 1Q5OA 4D7SA 4EKWA 2VQEO 3E8GA 1I5YA 1AR4A 3ZMUA 4J9YB 2Q68A 4ZOLA 2Z3YA 4LF9O 1AROP 2JK5C 4TV9B 3CMAV 1Z5WA 5FNVA 4TT3G 3KG2A 1AJNA 5IWAO 1WA8A 4TQDA 4DV3B 3OUSA 4RUEA 4MSWC 2IM9A 1A32A 3JD3A 3MHHC 2JJ2G 4X1YB 1OCCB 2HVJC 3A0HZ 4FLVA 3RFRA 1K5SA 1I08A 2ZNJA 3ETGA 3QO8A 4UCTA 1FS0G 3TXQA 1WP8A 4D6TH 3SYOA 4GZRB 1AVMA 2RMKB 1Q6UA 1IBLO 4PI0A 2JGUA 4J7JA 1YJ9V 1Y66A 3JAWA 3G71V 3OR7C 4MTGA 4LF5O 2BOBC 1KKCA 3JASA 3BHPA 5J2UA 4MVMA 1SF9A 4XDLA 3W7UA 4OX9B 4MTFA 4X89A 5LYJB 2ZXWB 1V54C 4WFEA 4GT1A 4X8AA 4AI8A 3HKBA 4YJ3A 4IIJB 3BVOA 3RGBA 3JD0A 1VMGA 2CGOA 4NKGB 2EZOA 2QKCA 2L6LA 1L8DA 4IGGA 3OMAB 2F43G 3IC9A 3M99B 2F4VB 5LGNA 4U3JB 1FAFA 3LSQA 1TAEA 4TUYA 2N04A 3JAMN 1TUBA 1V55B 2CTQA 4XDJA 2BTOA 4LF7O 2JJ1G 4JPRA 1ZLZA 4XBFA 1DTOA 3ABLC 4NTYA 1SQGA 3BPZA 1AB3A 3K79A 3ZHQA 1FXKB 3CMEV 1E79G 1Q7YW 1YXBA 4I0XA 4DUYO 5LA6A 1VQ7V 4WFFA 4JYCA 2WA4A 2YXLA 4DV5B 1F51A 3OMIB 4JI8O 3M7MX 3OTOB 4JTAB 3K5LA 1JJ2U 2R70A 5LYJA 4JV5B 3OW2U 1WB7A 2E3CA 4JAAA 4MVQA 3BY6A 5H5NA 2GDSA 2CTWA 3OT7A 3EVKA 4EFEA 1FXKA 2W6IG 1QVFU 1YF2A 3ABLB 2IU0A 4JI4O 2EIJC 3HKDA 2Y4UA 3RYIB 3K5MA 1EFRG 4OXSA 4JYAO 1UFIA 4DR1B 1SKVA 3T1HB 1V9PA 4DUYB 4X88A 5L3FA 1OCZC 5B5EZ 1BE3H 4FLWA 3SYPA 5EBLC 2LQTA 4B08A 3ZMZA 3OR6C 1OCRC 4YIPA 4I0XB 2BTQB 4FFKA 4DV6O 5DN6G 2PF4E 4TV8B 4CH5A 5GW7A 1PNLA 2EILB 3D8CA 3NXSA 1QLEC 4MW3A 3H1HH 2YI9A 4HAMA 3APQA 3ZBHA 1IX9A 5IJ9B 1NZ6A 3CWBH 4F6EA 4DV1B 1Y4MA 1IBMO 2P4KA 4FVMA 4JI5O 5B1AC 1N36B 4LFCO 3OD4A 5KX5A 1XHZA 3CRQA 1EN6A 5BMVA 2VWJA 1G1XB 1H8EG 4LF4B 1W59A 4J11A 1AJQA 5L3GA 3OGCC 4K0KO 4FM2A 5JVDB 4J41A 3D36C 3ZRWB 2YEVB 4TV8A 2F93B 2Q5ZA 2E74B 5EIBD 2RDCA 4UB6Z 4RQFA 2ZQMA 3TGUH 4DV6B 1IZ3A 2LW7A 3BA9A 1JR9A 1VP7A 3CCJV 2LJ2A 1YZBA 3BEHA 1GO3F 2ITDC 1DF5A 2DYSB 3ABKC 3P3PA 4MTOA 3ASOB 2DJVA 4B3SB 2IW5A 5HFLA 1R3LC 3CCUV 3H9VA 4DV4B 4AQYO 2OCCC 5KHIA 5H9CA 3LNNA 3CCEV 4FLTA 4YHHO 3SJAC 3E86A 1AR5A 1KECA 1Q86W 1NT2B 2R9RB 3I56V 4MVRA 4X62B 3LUTB 1JFFA 2A79B 2MW2B 4W4LA 5K1XA 2WAMA 1F7YA 1H2SB 2ADQB 2HJFC 2WWWA 1OV9A 2M7WA 1HNZO 3ZMVA 2LFRA 5GONA 1IURA 1VQ4V 2FMLA 5CBHA 2DMXA 4JI4B 4B3TO 1N0JA 3N2KB 5BXZA 2QE7G 3ZRSA 1WPBA 4HBNA 3WB1A 4CS3A 4OPHA 3K5NA 3H1LH 4QJFB 2KSDA 4PD4F 2GV9A 2X6AA 2HKOA 3BABA 1F4NA 1H8HG 2F66C 1W2BU 2E75B 2A0LA 2EILC 2JDIG 5LHGA 2X0LA 2BE3A 2Q69A 3SJCC 5J9PC 2EIKB 4U3FH 2OWOA 1AR1B 4NTXA 1SS3A 5JCOA 5EC2C 4ZKIA 2QM7A 2XAHA 3ETEA 2ILMA 1GN3A 4MVSA 3W7SA 1YTFD 2EBOA 1JCHA 1AI6A 1XI1A 5IWAB 3TXSA 5JVDA 3HKEB 4PV1B 1WNSA 5EZYA 3GWKC 3JD2A 1JX9A 1YITV 2HR3A 3JARA 3AG3B 1VF5B 1PPJH 4UVCA 2PYJA 1PD3A 1WB8A 1P84F 2P7TC 3K0DA 1B04A 3ZHRA 1VQLV 1S5JA 2CDYA 4LWSA 1NR1A 2OIGA 1QU7A 2EZPA 1SQPH 1KC8W 2QEXV 2XAFA 4I55B 5D5QA 1VIBA 1EN5A 3SJQC 5K1PA 1ZSPA 1YVWA 4DUZB 2YDEA 2Q73A 1LUVA 4JI0O 1XREA 1EM1A 3M8AA 2OIEA 4K0KB 3ASNB 2QA4V 3RN4A 1YTFB 4D7TA 5H2FZ 3JASB 4ZI7B 1BQ0A 1NJIW 3U10A 1M5IA 5LMUB 1UJWB 2Q7HA 2WLKA 1NTMH 2GBOA 2G38A 1H2KA 3FB7C 3W7XA 2CTPA 4I55A 2PUSA 2UUCB 3ZN1A 3B8MA 3VQXA 4X66B 2RNBA 4PA3A 3S3XA 1Q6HA 5LXTA 5KHJA 4GLXA 2RN9A 4QPKA 2Q7EA 1EZVH 3RVYA 4DUZO 2FYUH 1XHXA 4DR3B 4F4LA 3J81N 4JZGA 4WCEV 2YUAA 1M9NA 4WBNB 5LOVA 4UCUA 5CA3A 1U96A 3BRCA 3K5OA 5CB4B 4OGQB 1B06A 4ZOLB 1MNGA 3F5TA 2D2CB 4PA6A 2KB1A 4GCZA 2CAZC 1AILA 1VQ6V 3BAAA 2QM8A 4Z2WA 1GMGA 2WSSG 4QE7A 4JI3B 4GYCB 1GTOA 1R3IC 2DWEC 2OCCB 1XILA 3CC4V 4RO2A 5LP6A 1ROPA 1U97A 4B3TB 3GB7C 4FLYA 5CA0B 3FB6C 3SJBC 1P49A 1R6NA 5AG2A 1GN6A 2WLHA 3RBZA 1AI5A 3QNEA 5EBWC 1G6UA 2WLLA 4LBEC 1JA8A 4JYBA 4DR3O 4MVZA 2AHZA 3FFQA 4BIUA 1KMIZ 1XMQO 5KLVH 3Q4HB 2YIAA 1NVPD 4LP8A 5IYCO 3K08A 3SPHA 4W4KA 2B1GA 3CRRA 1SQVH 2X6CA 4LFBO 3H1JH 3ZCCA 4X1KA 3PN1A 3I55V 4CH3A 2RJZA 5B1AB 4K35A 1P4RA 4B3MO 4I7ZB 1SZXA 5IYDO 1QLEB 1TUEB 4DV0O 5CA1B 1YJWV 5JQGB 2EINB 1Y67A 3K3WA 2A9HA 1N33O 3CJHB 1WN7A 3I5DA 4LF5B 2GTAA 2ETNA 1LUWA 1AI4A 2ZKOA 4DR7O 1X4TA 1QR8A 2JGDA 2NR5A 4BAYA 1WA8B 1WJZA 4UFZA
chains in the Genus database with same CATH topology
3T4ZA 5DN6G 5GW7A 2OTJV 3IC7A 4QPJA 1PNLA 2EILB 3K04A 3NXSA 1QLEC 4MW3A 4FK5C 2ATKC 1MSWD 3ZRWA 4HAMA 1K9MW 3STLC 5LBQA 1THZA 5LGUA 4CBCA 1Y4MA 4BW5A 1Q81W 5B1AC 4JAUA 1SETA 3AEIA 3UM7A 2NNUA 2XAGA 3P32A 1NQTA 1ZWIC 2XOKG 4QNHB 3JD1A 1R3KC 2DQ3A 1BHBA 2Y48A 1H8EG 5B1BB 2HFEC 3ZIAG 2P90A 3CCSV 1KKDA 5B3SC 5IY5B 4FMTA 1NH2D 1CPYA 1AJQA 5L3GA 3VOUA 3OGCC 1EBOA 4U7NA 3AG1C 4PELA 4R50A 3JYCA 3ZRWB 1VQ8V 4TSFG 2YEVB 4XDKA 3K9AA 5IDJA 4Z1MG 5CN0A 1E1QG 4WF9V 3WG7C 1S77D 3LDDA 4FPPA 4RQFA 4JGSA 2ZQMA 2GHYA 2JEXA 1G4YB 1JQ0A 4RQEA 2QKSA 4KUMA 1BL8A 4RAIA 1FXKC 1CP9A 3FB8C 3CCJV 3AG3C 4WFGA 3BEHA 1GO3F 2H94A 1QLNA 2ITDC 1DF5A 2DYSB 1VQMV 2GSMB 4PDRA 3ABKC 1M1KW 3OEHG 4MTOA 1VQPV 3ASOB 1EZJA 2W6JG 5BZBA 2IW5A 2B5UA 3E8FA 5HFLA 1R3LC 3CCUV 3FYEB 1K8AW 2BOCC 1SZTA 2OCCC 3CP1A 4P9PA 5H9CA 3ZMTA 3CCLV 3CCEV 1VQNV 4RUFA 1K97A 3E86A 4R8CA 4PDMA 1KECA 1AJPA 3ABMB 1W0JG 5B1BC 3VBBA 2WLNA 4BIZA 1M56B 2WPDG 3ML0A 3A0RA 3WFVA 1Q86W 2D3OW 2X6BA 2IH1C 2R9RB 1RPRA 1R3JC 4MVRA 3I56V 1VQOV 3LUTB 2A79B 2OT5A 1MG1A 3OM3B 3ZRXA 1K7DA 2WAMA 5CBGA 1S72V 4GX2A 5L3EA 1R73A 2YEVA 3WG7B 2DQ0A 3HB3B 1ORQC 1XL6A 2HJFC 1GM7A 2ITCC 1H38A 2LFSA 3JD4A 2WWWA 2ZR3A 3OFNG 4P9OA 4G27B 3ZJZA 2M7WA 1IXMA 1OHHG 2FTKA 3T1CA 1RPOA 4PA9A 4GX0A 4MTXA 5HFMA 1JVMA 3E8HA 2LFRA 3ZMVA 1SERA 2DWDC 3W7WA 4FJCC 1VQ4V 5KA6A 5CBHA 3W7TA 1PNMA 5CMUA 2H8PC 4H37A 1M57C 4FIPC 2IJHA 3TCUA 4ASUG 2YSUB 1QVGU 2QE7G 1FXHA 4J9ZB 1BHAA 3ZRSA 4WFHA 3E2EA 4WFAV 2Y69C 2UXNA 3FYIB 4GX1A 2AHYA 3CCQV 3AG4B 1BMFG 3SPJA 1K4CC 4QJFB 2R9IA 2X6AA 4LCUC 1YJNV 2HKOA 1J95A 1F4NA 3SPIA 3QO5A 1H8HG 4JAVA 1W2BU 4CZZA 1VQ5V 2EIKC 4N23A 1H2GA 4HZ3A 2A0LA 1K5QA 3K06A 5C93A 5CBFA 1GKFA 2EILC 2JDIG 1FFTB 5LHGA 2X0LA 4QE9A 2Q69A 4MVUA 5J9PC 3AG2B 4P30A 3E89A 2EIKB 1I5XA 3P30A 3K0GA 1FXVA 1AR1B 4I9WA 1LNQA 1M56C 5EC2C 2HVKC 3ABMC 4ZKIA 2P67A 2QM7A 2IU3A 2WLIA 3HPLC 1KP3A 2XAHA 3UKMA 3ETEA 1WPXA 1NR7A 3IGAC 4MVSA 3W7SA 3CC2V 2EINC 1YTFD 1OZ0A 5FL7G 2EBOA 1JCHA 1AI6A 1K3EA 3GWOA 3LNMB 1B6QA 4LC1A 5B3SB 2X7RB 3ASOC 3RVZA 3H01A 5H6RA 3JD2A 1E1RG 1JX9A 1YITV 1N8RW 3EFFK 4UVBA 4PDLA 5KA5A 2HR3A 3AG3B 5E1AC 1CEZA 3AG2C 3CCRV 3EHBB 4UVCA 2EJRA 2IJKA 1PD3A 1WLEA 4UUJC 4UVAA 4YXWG 1VQ9V 2P7TC 3LSSA 3ETDA 3K0DA 1YHQV 1RM1C 4UV9A 1VQLV 4JASA 4UXNA 5EBMC 3TETA 1GM8A 3IFXA 1NR1A 3X2QB 2EZPA 2Q67A 4QIWF 1KC8W 2QEXV 3SYCA 3K03A 2XAFA 1MABG 2IH3C 2EIMB 3MHSC 2Y69B 1S3JA 2Q6AA 1GK9A 2NLJC 4PA4A 3OMNB 3RW0A 3SJQC 3G6EV 1AI7A 2ZDIC 4JF3A 4G28B 1OCZB 1F23A 4U7OA 2XAQA 4PA7A 3F5WC 3FB5C 4UV8A 4EKWA 1PKXA 5KUMA 3E8GA 1I5YA 3ZMUA 4J9YB 2LP7A 2Q68A 2V1DA 3CYOA 1R6KA 2C2AA 2CK3G 2Z3YA 3X2QC 1P7BA 1AROP 2EIJB 2JK5C 3CMAV 1W0KG 2V7QG 3ASNB 3LDCA 2QA4V 1NKDA 1XL4A 1YTFB 3DTUB 1COWG 1OCOB 4KP4A 2Z5UA 1S76D 2HLDG 1NJIW 4TT3G 3KG2A 2W0FC 1AJNA 1UJWB 4MS2A 2B1IA 2WLKA 1DLBA 4H33A 1OCRB 3B8NA 3FB7C 3OUSA 1K33A 4RUEA 4MSWC 3W7XA 2IJIA 3JD3A 3MHHC 2JJ2G 3E8BA 1OCCB 3DGEA 5L3BA 3FKSG 2HVJC 2DYRC 3CCMV 1K5SA 4Q20A 3ETGA 3AG4C 3E83A 3ZN1A 3B8MA 3QO8A 3SPCA 2XASA 1FS0G 4PA3A 3MD0A 3SYOA 3JCZA 4L87A 4QPKA 3RVYA 3ABKB 4PDVA 1PL0A 2DYSC 1VQKV 2XAJA 4F4LA 3F7VC 1YJ9V 1Y66A 3G71V 3OR7C 4WCEV 2JEUA 4MTGA 1M9NA 2BOBC 5CA3A 4MVMA 1OCOC 4XDLA 4E2LA 4WFBV 3W7UA 4MTFA 3D36A 4X89A 2ZXWB 3E35A 1KP2A 1V54C 4WFEA 1V55C 4GT1A 4X8AA 3OEEG 3JD0A 3G4SV 1NVPB 2P6JA 2EZOA 4PA6A 2KB1A 4HYOA 4GCZA 1K73W 1YIJV 3ABTA 3OMAB 5B1NA 2XNDG 1VQ6V 5LGTA 2F43G 2K1EA 2WLLB 4JTDB 3M99B 2QM8A 5LGNA 1GMGA 4R6ZA 2WSSG 3LSQA 4QE7A 1GTOA 1R3IC 2DWEC 2EIMC 2OCCB 3SYAA 3CC4V 4RO2A 1V55B 1ROPA 2WLMA 4XDJA 3GB7C 1V54B 2JJ1G 4JPRA 2ZXWC 4R7CA 1PNKA 1JPXA 4XBFA 1DTOA 1K34A 4MVOA 3FB6C 3ABLC 4JTCB 1KD1W 3QO7A 4MT8A 3SPGA 1YI2V 1RM1B 3K79A 5L3DA 3B77A 1FXKB 1GM9A 3ZN0A 3CMEV 1R6NA 1E79G 2QTOA 5B1OA 1Q7YW 2WLHA 3OE7G 1JOYA 1KQSU 3R65A 4G2KA 1AI5A 3RBZA 3CPWU 3QNEA 5EBWC 2WLJA 2WLLA 4LBEC 2ZR2A 4JYBA 2ZDIA 1VQ7V 4MVZA 2AHZA 1SRYA 4WFFA 5H6QA 4JYCA 4BIUA 1QBZA 1F51A 3OMIB 1M90W 3TK1A 1K4DC 1L1FA 3ZMSA 4JTAB 1HWYA 4KFMA 1NVPD 1JJ2U 3OAAG 1S0VA 4LP8A 5IYCO 1G8MA 3SYQA 2ZD9A 3OUFA 3K08A 3OW2U 5EC1C 3SPHA 1OCCC 2B1GA 3PJSK 5L3CA 3ABUA 1QCEA 2X6CA 5DM6V 5IYBO 4MVQA 1K92A 3BY6A 1F4MA 3ZCCA 3CXCU 3I55V 1NBMG 2PI4A 2MK3A 2HG5C 1ENVA 1QR9A 1FXKA 2W6IG 1QVFU 5B1AB 4P2ZA 1P4RA 4N21A 3ABLB 2IU0A 1NH2B 3ASNC 4ZBMA 4DXWA 2EIJC 2IJJA 3F7YC 1MOFA 3T4DA 5IYDO 1QLEB 1SESA 5KUKA 4GX5A 1EFRG 5EK0A 1YSCA 4OXSA 3LDEA 1Q82W 1TUEB 3AG1B 3CD6V 3STZC 1YJWV 2EINB 3CCVV 1S5HC 3K3WA 4MW8A 2JIZG 2A9HA 5LHHA 4DO2A 3T2MA 3CC7V 4TWKA 2WLIB 5IY5C 4X88A 1DF4A 1M57B 2DYRB 1AI4A 2DW4A 1OCZC 4I5SA 3ZRVA 5L3FA 2PI5A 1QR8A 5EBLC 3SYPA 2OTLV 4BAYA 3ZMZA 3OR6C 3D3IA 1OCRC 5LHIA 2UXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4Z A;  3SYC A;  2YEV A;  3K03 A;  2K1E A;  2WLL B;  4JTD B;  2IH3 C;  1ORQ C;  1XL6 A;  2HJF C;  2ITC C;  3K04 A;  2Q6A A;  4PA4 A;  2NLJ C;  1QLE C;  4R6Z A;  3RW0 A;  3SJQ C;  4MW3 A;  2ATK C;  4P9O A;  4G27 B;  4QE7 A;  3ZJZ A;  1R3I C;  2DWE C;  2EIM C;  3SYA A;  4G28 B;  3T1C A;  4PA9 A;  4PA7 A;  4RO2 A;  4GX0 A;  3STL C;  4CBC A;  1JVM A;  3E8H A;  3F5W C;  2WLM A;  3FB5 C;  4BW5 A;  4XDJ A;  3GB7 C;  5B1A C;  2ZXW C;  2DWD C;  4R7C A;  4EKW A;  5KUM A;  3E8G A;  3UM7 A;  5CBH A;  4MVO A;  2H8P C;  3FB6 C;  4J9Y B;  2Q68 A;  3ABL C;  1M57 C;  4H37 A;  4JTC B;  3SPG A;  3TCU A;  1ZWI C;  4QNH B;  4J9Z B;  1R3K C;  3X2Q C;  3ZRS A;  4WFH A;  1P7B A;  2Y69 C;  2JK5 C;  2QTO A;  3LDC A;  2WLH A;  2HFE C;  4GX1 A;  2AHY A;  3R65 A;  1XL4 A;  1KKD A;  3RBZ A;  5B3S C;  3SPJ A;  1K4C C;  5EBW C;  2WLJ A;  2WLL A;  2X6A A;  4LBE C;  4LCU C;  3VOU A;  3OGC C;  3KG2 A;  2W0F C;  1J95 A;  2AHZ A;  4MVZ A;  3SPI A;  4MS2 A;  4WFF A;  2WLK A;  3AG1 C;  4R50 A;  3JYC A;  2EIK C;  4H33 A;  3FB7 C;  3OUS A;  4HZ3 A;  4RUE A;  2A0L A;  3K06 A;  4MSW C;  4XDK A;  5CBF A;  2EIL C;  3E8B A;  4QE9 A;  2Q69 A;  1K4D C;  2HVJ C;  4MVU A;  2DYR C;  3WG7 C;  3LDD A;  5J9P C;  4P30 A;  4JTA B;  3E89 A;  4KFM A;  3K0G A;  4LP8 A;  3AG4 C;  3E83 A;  3SYQ A;  2ZD9 A;  3OUF A;  1G4Y B;  3K08 A;  1M56 C;  1LNQ A;  2QKS A;  1OCC C;  4I9W A;  2HVK C;  3ABM C;  1BL8 A;  3PJS K;  5EC2 C;  4RAI A;  2WLI A;  3SPC A;  4PA3 A;  3HPL C;  2X6C A;  3FB8 C;  3UKM A;  3AG3 C;  4MVQ A;  4WFG A;  3IGA C;  3BEH A;  3SYO A;  4MVS A;  2ITD C;  4PDR A;  3ABK C;  3RVY A;  2EIN C;  4MTO A;  2HG5 C;  4PDV A;  2DYS C;  5BZB A;  4F4L A;  4P2Z A;  3F7V C;  3E8F A;  3LNM B;  1R3L C;  3OR7 C;  3ASO C;  4MTG A;  3RVZ A;  2BOC C;  3ASN C;  4ZBM A;  4DXW A;  2OCC C;  2EIJ C;  2BOB C;  3F7Y C;  4P9P A;  3T4D A;  3SPH A;  3EFF K;  4PDL A;  4MVM A;  4RUF A;  1OCO C;  4GX5 A;  5KUK A;  5EK0 A;  4OXS A;  3LDE A;  4XDL A;  5E1A C;  3AG2 C;  3STZ C;  3E86 A;  4R8C A;  4PDM A;  4UUJ C;  5B1B C;  2WLN A;  4MTF A;  1S5H C;  2P7T C;  4MW8 A;  3K0D A;  2A9H A;  4X89 A;  1V54 C;  4WFE A;  5EC1 C;  3T2M A;  2X6B A;  1V55 C;  2IH1 C;  2R9R B;  1R3J C;  2WLI B;  4MVR A;  4TWK A;  4X8A A;  3LUT B;  4X88 A;  5EBM C;  5IY5 C;  1OCZ C;  2A79 B;  3TET A;  3SYP A;  5EBL C;  5CBG A;  3IFX A;  4PA6 A;  2KB1 A;  4HYO A;  2Q67 A;  3OR6 C;  1OCR C;  4GX2 A; 
#chains in the Genus database with same CATH topology
 3T4Z A;  3J7A U;  2N74 A;  4ZI7 A;  4X20 B;  2BSK B;  3K04 A;  3RYH B;  1NTZ H;  4K8X A;  2VQE B;  1NTK H;  3ZRW A;  4YJ2 A;  4YIO A;  5IJ0 B;  5LBQ A;  1THZ A;  5LGU A;  4KHP O;  4BW5 A;  1Q81 W;  4JAU A;  4DR2 O;  2XAG A;  3P32 A;  4JV5 O;  3JAT A;  1ZWI C;  1EN4 A;  3JD1 A;  1R3K C;  2UUC O;  3QVN A;  4I9Q A;  2P90 A;  5IY5 B;  1NH2 D;  3RWR D;  4IT5 A;  1CPY A;  4X1I B;  3VOU A;  1X59 A;  4EFB A;  1IDS A;  1TVK A;  3AG1 C;  4RWU A;  1VQ8 V;  4TSF G;  1BCC H;  3HKC A;  2BSK A;  4GKK O;  4WF9 V;  3LDD A;  3JAK B;  4O4J B;  1G4Y B;  4UB8 Z;  1FXK C;  5KHG A;  3AG3 C;  5C8Y B;  3KCY A;  3B40 A;  3O9O A;  2H94 A;  1RSO B;  1VQM V;  1XUQ A;  3JAT B;  4O2B B;  1M1K W;  3OEH G;  1VQP V;  4EEQ A;  2F95 B;  3DC6 A;  1SZT A;  4P9P A;  4DK1 A;  4X1I A;  3ZMT A;  1VF6 A;  1VQN V;  4UCV A;  2YXH A;  2XT9 A;  3E22 B;  4PDM A;  1VQK V;  2ZNI A;  4LF8 B;  2WLN A;  2CTR A;  2WPD G;  3ML0 A;  4B7K A;  2D3O W;  1VQO V;  4PJ0 Z;  2FB5 A;  2E5L O;  4FLZ A;  1MG1 A;  3OM3 B;  3ZRX A;  4AIL C;  1QQC A;  1TA8 A;  1R73 A;  3WG7 B;  2XUM A;  3HB3 B;  2ITC C;  1RSO A;  1IBK B;  1XNQ B;  1SQF A;  3JCU Z;  4G27 B;  2QWQ B;  2W0X A;  4DYL A;  1OHH G;  1RPO A;  4PA9 A;  5HFM A;  3JAW B;  1SER A;  1NS1 A;  2B9Z A;  4FM1 A;  2DWD C;  2ZE6 A;  3W7T A;  1I94 B;  5CMU A;  4FIP C;  2IJH A;  3FX7 A;  1QVG U;  3RT3 C;  4J9Z B;  1HNX B;  1BHA A;  2JVD A;  4WFH A;  4B3R O;  4WFA V;  2Y69 C;  4A5U B;  4GX1 A;  2AHY A;  1BT8 A;  4DR5 B;  2R9I A;  2UXC O;  1D2D A;  3RYF A;  4I4T A;  4B3S O;  3RYH A;  1J95 A;  1LR1 A;  4JAV A;  1N32 O;  3N2G B;  4CZZ A;  1H2G A;  5CBF A;  2QWR B;  1O9H A;  2YS8 A;  1GKF A;  1BS3 A;  1JJO A;  4OPA A;  3T1Y B;  4MVU A;  3AG2 B;  3HR0 A;  4P30 A;  1Z5V A;  3E22 A;  3SDL A;  5IYZ B;  3P30 A;  3QF7 A;  4I9W A;  3CJH A;  1LNQ A;  2HVK C;  3KCX A;  2IU3 A;  3THO A;  2QKA A;  5KAF Z;  4O4H A;  4Z1V A;  3EXA A;  4O4I B;  2N05 A;  3CC2 V;  2UUB B;  1BZK A;  2JRI A;  1K3E A;  1XBL A;  3GWO A;  1S5L Z;  3LNM B;  4NVP A;  1B6Q A;  1URF A;  2GUZ A;  2AZ2 A;  3ASO C;  3RVZ A;  1MSD A;  1E1R G;  3EFF K;  4CC6 A;  4NXN B;  1VAR A;  3C90 A;  5JJJ B;  1CEZ A;  3AG2 C;  3BFR A;  3CCR V;  3N2G A;  1WLE A;  1VQ9 V;  3A2F A;  1L0L H;  3LSS A;  1YHQ V;  4UV9 A;  4HNA A;  4FZ0 A;  2E76 B;  1FJG O;  4TV9 A;  3J80 N;  3X2Q B;  2Q67 A;  2ARH A;  2HP8 A;  1R6T A;  2IH3 C;  2Y69 B;  5EYP A;  5KHK A;  4LNU B;  1GK9 A;  3RW0 A;  2AXT Z;  3G6E V;  1ZL8 B;  2FL4 A;  3FB5 C;  3HKC B;  4IL6 Z;  5JCO C;  2VWK A;  1PKX A;  2F23 A;  2LP7 A;  2V1D A;  1TGO A;  5KMG A;  3AK3 A;  1R6K A;  2C2A A;  1P7B A;  4LF6 O;  1W0K G;  2V7Q G;  3LDC A;  1XL4 A;  3DTU B;  4O2B A;  4O4L B;  4KP4 A;  4DV0 B;  3CX5 F;  5LOV B;  4DV3 O;  1FFX B;  2HLD G;  1J5E O;  4WBN A;  3DXR B;  4H33 A;  1OCR B;  2CH7 B;  1PP9 H;  1FPO A;  4NXN O;  4EB6 B;  5KAI Z;  5LP6 C;  4Q20 A;  2QJ1 A;  3AK1 A;  4LWS B;  1XMO B;  3MD0 A;  3JCZ A;  4L87 A;  4DR7 B;  3L9D A;  4J7K A;  2H3O A;  2HJD A;  1Q6I A;  4PDV A;  4ZHQ B;  5FNV B;  3LSU A;  1RFY A;  3WB2 A;  5KX5 B;  4NB5 A;  2XTA A;  4WFB V;  1HR0 B;  1KP2 A;  1Q8I A;  3OEE G;  3G4S V;  3BCC H;  5GTH Z;  4AHC A;  4CS4 A;  1YIJ V;  5LMN B;  3ABT A;  4JYY A;  1KYO F;  3QG5 A;  2XND G;  3ZHS A;  1FKA O;  5LGT A;  2K1E A;  4JTD B;  1HNX O;  3N27 A;  4X1K B;  4R6Z A;  1B3Q A;  4F6R B;  4ICG A;  3JAK A;  1XMO O;  3AK2 A;  3GVM A;  4GKK B;  2F1M A;  4MVO A;  4FLU A;  4X64 O;  1XNR B;  2AW9 A;  3SPG A;  1YI2 V;  1RM1 B;  2BCC H;  4X65 B;  2AGA A;  5L3D A;  1GM9 A;  1YDX A;  5B1O A;  3OE7 G;  5JWP A;  4O2A A;  2P06 A;  4JI2 O;  2ZDI A;  1HW7 A;  1MZF A;  5H6Q A;  3K9S A;  2YIC A;  1QBZ A;  1P7G A;  3RYI A;  2Q4P A;  2QDO A;  2WA3 A;  1M90 W;  3TK1 A;  1K4D C;  3ZMS A;  3HKB B;  4J7Z A;  5CA1 A;  1HWY A;  4KFM A;  3OAA G;  1XMQ B;  4F6R A;  2ZD9 A;  3OUF A;  2EJ7 A;  5EC1 C;  3PJS K;  4DR4 B;  3ABU A;  3SGI A;  5IYB O;  2A06 H;  3CXC U;  2QWP B;  4U3J A;  4I50 A;  2MK3 A;  4ABM A;  3B2E E;  2QM4 A;  4I4T B;  4GKJ B;  4N21 A;  5GON B;  2LGQ A;  1NH2 B;  3ASN C;  4ZBM A;  3RYC A;  1H2L A;  3T4D A;  4LFA B;  2UXD O;  2ZCE A;  2L35 A;  4GX5 A;  3CD6 V;  1Q82 W;  3LDE A;  3STZ C;  2OCH A;  1Y6X A;  2ZE7 A;  2NN4 A;  3ICX A;  4MW8 A;  2JIZ G;  3DC5 A;  4DR6 O;  4DO2 A;  5KMG B;  4TWK A;  2PTM A;  1M57 B;  2DW4 A;  2PI5 A;  3S3W A;  1KUQ A;  1HNZ B;  1IVS A;  4J10 A;  3D3I A;  3KZI Z;  4PHZ A;  1FYJ A;  3L74 H;  5LHI A;  2UXX A;  3UQ8 A;  5IE9 A;  4QPJ A;  4FK5 C;  2ATK C;  3HKD B;  3JSN A;  3CRM A;  3STL C;  4UCR A;  1SA0 B;  4DR4 O;  4DV5 O;  1KBH A;  4BWA A;  3Q4H A;  1XDC A;  3AEI A;  5J2U B;  5C8Y A;  4JI1 B;  1J5E B;  3CE2 A;  2NNU A;  4JI6 O;  3JAL A;  3SR2 C;  2XOK G;  4QNH B;  4YHH B;  2DQ3 A;  4PI2 A;  1KKD A;  4YY3 B;  4FMT A;  3L73 H;  4LFA O;  3ZHU A;  4LF4 O;  4ZHQ A;  4X62 O;  1EBO A;  5DEC A;  1BGY H;  4PEL A;  4R50 A;  3JYC A;  2RQ6 A;  3ZHV A;  3BA8 A;  4Z1M G;  4LR3 A;  5CN0 A;  1E1Q G;  5DED A;  4X64 B;  4LF9 B;  3UT5 B;  1XNR O;  4FPP A;  2F4V O;  1Y76 B;  1DGS A;  4JGS A;  4RQE A;  4KL1 A;  4KUM A;  5JH7 A;  1BL8 A;  4RAI A;  1JFF B;  4WFG A;  4O2A B;  4DR5 O;  4O4L A;  2Q8V A;  1N4C A;  1OJH A;  4K8Z A;  1EZJ A;  2O57 A;  5IJ9 A;  4J80 A;  4LFC B;  3E8F A;  1I0H A;  4DV2 O;  3FYE B;  2BOC C;  4LH7 A;  5IJ0 A;  5B1B C;  1AJP A;  1W0J G;  3VBB A;  2E5L B;  1M56 B;  4YY3 O;  3A0R A;  3WFV A;  4LFB B;  2QWN B;  3JAL B;  1R3J C;  4LF8 O;  1FFX A;  1K7D A;  1Y74 A;  3D3Q A;  3L70 H;  5J2T A;  1S72 V;  4LF6 B;  4GX2 A;  2UXB B;  1CXZ B;  2YEV A;  1SQX H;  1XEQ A;  1H38 A;  2LFS A;  2ZR3 A;  2Q9L A;  1IXM A;  2FTK A;  1JVM A;  3E8H A;  2KG7 B;  3W7W A;  4JI3 O;  4FJC C;  5KA6 A;  5IYZ A;  1BQZ A;  2H8P C;  4H37 A;  3U11 A;  2R9A A;  1WP7 A;  3A8T A;  2UU9 B;  1H2M A;  4DRX B;  1FXH A;  2UXC B;  3OGI B;  3E2E A;  3FYI B;  2V4D A;  1I7F A;  3AG4 B;  1BMF G;  4HNA B;  2ZT9 B;  4LCU C;  4DR2 B;  3CHX A;  3VQW A;  3SPI A;  4DV4 O;  5A9G A;  4AQY B;  3MAQ A;  3K06 A;  5C93 A;  3UCS C;  4QE9 A;  4NR1 A;  2DOS A;  2Q7G A;  2EUL A;  3E89 A;  1D5A A;  3ABM C;  2FKX A;  2WLI A;  3HPL C;  2UUB O;  3UKM A;  1WPX A;  4KHP B;  1FD9 A;  3G67 A;  2CUG A;  5J2T B;  2IBZ H;  5E79 Z;  1HNW B;  3DSQ A;  5LP6 B;  4CC5 A;  3H01 A;  2QWO B;  3H1I H;  3C3S A;  1GAX A;  4FLX A;  4UVB A;  5KA5 A;  5LA6 B;  1Z2G A;  3EHB B;  4UUJ C;  4UVA A;  4YXW G;  3ETD A;  1D5N A;  3O65 A;  3ZHT A;  3ZED A;  4JAS A;  5EBM C;  1GM8 A;  3IFX A;  4K3A A;  2YC0 A;  4X65 O;  1IXB A;  3T1Y O;  4CH4 A;  1MAB G;  1MA1 A;  2EIM B;  4FZ1 A;  3MHS C;  4JI2 B;  2ZM6 B;  1S3J A;  2YIB A;  1AI7 A;  4CS2 A;  2ZDI C;  4JF3 A;  1N33 B;  2ADP A;  1OCZ B;  1F23 A;  3R66 A;  2CH7 A;  4PA7 A;  4U7O A;  1HP8 A;  3F5W C;  1HR0 O;  3UT5 A;  4UV8 A;  4H13 B;  5KUM A;  4KXR A;  3OTO O;  3K59 A;  3IAY A;  3CYO A;  4JI5 B;  2CK3 G;  2DN9 A;  3X2Q C;  4O4H B;  4NYK A;  2EIJ B;  1NKD A;  4DW0 A;  5KHH A;  4Q6G A;  5LMU O;  2Y0P A;  3FD9 A;  1COW G;  1OCO B;  4JYA B;  1VEW A;  4L8J A;  3CS5 A;  2Z5U A;  1S76 D;  2Y4T A;  1R1B A;  2P4V A;  3JAR B;  2W0F C;  4MS2 A;  1SQB H;  2B1I A;  5BY1 A;  2PGG A;  4GUN A;  1DLB A;  1QHT A;  4B3R B;  3B8N A;  1K33 A;  4JI6 B;  1N34 O;  2IJI A;  3E8B A;  5L3B A;  1H2N A;  3DGE A;  2ZE8 A;  2UXD B;  3FKS G;  2DYR C;  1I94 O;  3CCM V;  2M6Y A;  4IYI A;  3AG4 C;  3E83 A;  2UUA O;  3SPC A;  2XAS A;  4X20 A;  3ABK B;  3CEI A;  1PL0 A;  2LW1 A;  2DYS C;  3FAV A;  2XAJ A;  3F7V C;  2XHB A;  2ZM6 O;  2JEU A;  1DK1 A;  4JI7 B;  2UXB O;  3K58 A;  1MMM A;  1OCO C;  4E2L A;  1IBK O;  1XNQ O;  4FM0 A;  4DV1 O;  3D36 A;  3E35 A;  2PY5 A;  3CRC A;  1GN4 A;  1V55 C;  1O9G A;  1KU9 A;  1NVP B;  3RYF B;  2P6J A;  4HYO A;  3JSL A;  1K73 W;  1NI8 A;  4NXM O;  5B1N A;  4NTW A;  2WLL B;  4DW1 A;  1RP3 B;  2GUZ B;  3CRA A;  2PZS A;  2KKW A;  3DXR A;  2EIM C;  3SYA A;  1AP5 A;  3OTF A;  2YXY A;  5EIB C;  2WLM A;  2UU9 O;  1V54 B;  5EZY B;  2ZXW C;  4R7C A;  4EB6 A;  1PNK A;  1JPX A;  2CE4 A;  1K34 A;  4DR6 B;  4JTC B;  1KD1 W;  4O4I A;  3QO7 A;  2JS5 A;  4MT8 A;  3VQY A;  4X66 O;  2P22 C;  3B77 A;  4IHJ A;  3ZN0 A;  2QTO A;  4FFB A;  3MDS A;  1JOY A;  1KQS U;  3R65 A;  4JI7 O;  4G2K A;  3CPW U;  2BTQ A;  2WLJ A;  2ZR2 A;  1PV0 A;  1SRY A;  4DV2 B;  5CB4 A;  3B09 A;  1Q90 D;  1L1F A;  3U0Z A;  1YEW A;  5JQG A;  2VS0 A;  1S0V A;  1G8M A;  3SYQ A;  2QSA A;  2OYQ A;  1OCC C;  5L3C A;  4DRX A;  1QCE A;  5DM6 V;  1K92 A;  1N34 B;  1F4M A;  5EYP B;  1NBM G;  3G80 A;  2PI4 A;  3N2K A;  5JJN B;  2HG5 C;  3ZS8 C;  1ENV A;  1QR9 A;  5B66 Z;  2QR4 A;  1JMK C;  4P2Z A;  4FFB B;  4BW9 A;  4DXW A;  3A0B Z;  2IJJ A;  3F7Y C;  5CA0 A;  4UCS A;  1MOF A;  4C7U A;  5KUK A;  1SES A;  1SA0 A;  5EK0 A;  1YSC A;  5LL6 Y;  1ZTE A;  3AG1 B;  1HDJ A;  3CCV V;  1US6 A;  1GH6 A;  3L71 H;  1S5H C;  5LHH A;  5F2V O;  1L0N H;  5JJE B;  2ODM A;  3T2M A;  2KQX A;  4LH6 A;  2RCV A;  2VQF B;  3CC7 V;  2WLI B;  5IY5 C;  1DF4 A;  3ZRV A;  4I5S A;  2DYR B;  1YCI A;  2Q0A A;  1Y76 A;  3CXH F;  2OTL V;  1AP6 A;  4JI0 B;  1MZE A;  5JH7 B;  3P3N A;  3C3T A;  1Q43 A;  2GTS A;  2OTJ V;  3IC7 A;  1TVK B;  1MSW D;  1K9M W;  1N36 O;  5BR8 O;  1VF6 C;  4CBC A;  4OX9 O;  1SET A;  3UM7 A;  4IYH A;  1HNW O;  1NQT A;  2LGW A;  4BIO A;  5GTI Z;  2YI8 A;  2JGD B;  1BHB A;  2Y48 A;  5B1B B;  2HFE C;  3ZIA G;  5D5P A;  2AZ0 A;  3CCS V;  5B3S C;  4IIJ A;  4CH6 A;  1WAZ A;  4ZIB A;  4U7N A;  3ZX6 A;  2HHH O;  4XDK A;  3K9A A;  5IDJ A;  2HEP A;  4QGP A;  3WG7 C;  1S77 D;  1ZX3 A;  2Q0O C;  1Y74 B;  5TIS Z;  2GHY A;  2JEX A;  1JQ0 A;  2QKS A;  5BMV B;  3TJT A;  1CP9 A;  3FB8 C;  1PM9 A;  1QLN A;  4LNU A;  2GSM B;  4PDR A;  1KB9 F;  4J42 A;  2W6J G;  5BZB A;  2B5U A;  1K8A W;  2Y0I A;  3CP1 A;  4TUY B;  4JI8 B;  3CCL V;  4RUF A;  4X1Y A;  1K97 A;  1Q3E A;  1ZUQ A;  2PYL A;  4R8C A;  5ITZ A;  3APO A;  3ABM B;  4BIZ A;  4DV7 B;  4GKJ O;  2X6B A;  1PL4 A;  2IH1 C;  1RPR A;  1SQQ H;  4LF7 B;  3UO2 A;  2OT5 A;  3WB0 A;  5CBG A;  2A3Q A;  3KKY A;  4TOI A;  5L3E A;  2ZIM A;  1UPG A;  2DQ0 A;  1QNM A;  5LXT B;  1VF7 A;  4B3M B;  1ORQ C;  1XL6 A;  1ZAU A;  1GM7 A;  4BR6 A;  3JD4 A;  2UUA B;  3OFN G;  3RYC B;  4P9O A;  3ZJZ A;  4TQF A;  3T1C A;  4GX0 A;  4MTX A;  4O4J A;  1NU1 H;  3WU2 Z;  2VRZ A;  2QTS A;  1PNM A;  2EX3 A;  1M57 C;  5LMN O;  3TCU A;  1GN2 A;  4ASU G;  2YSU B;  5FPO A;  4I50 B;  1N0N A;  3FAV B;  2ZIO A;  1XQ8 A;  3K57 A;  2UXN A;  3CSX A;  3CCQ V;  3G6B A;  3SPJ A;  1K4C C;  2ZIN A;  2JS3 A;  1YJN V;  1BSM A;  2CGN A;  1IBL B;  2R72 A;  4H44 B;  3QO5 A;  1M4U A;  1VQ5 V;  2EIK C;  4N23 A;  3VQV A;  5FLX N;  1TUB B;  4HZ3 A;  1K5Q A;  3B4S A;  5IT9 N;  1M93 A;  1FFT B;  2Z0A A;  1N32 B;  5ITZ B;  1ZL8 A;  3CB2 A;  1I5X A;  3L72 H;  3K0G A;  2A7W A;  4DV7 O;  1FXV A;  3AG7 A;  5A2Q N;  1M56 C;  5FPR A;  2P67 A;  4YJ3 B;  5BR8 B;  1KP3 A;  1NR7 A;  3IGA C;  3QTC A;  2EIN C;  1OZ0 A;  5FL7 G;  4YJ2 B;  4NXM B;  1SC5 B;  1XOU A;  4UCO A;  4LC1 A;  5B3S B;  2HHH B;  2X7R B;  5H6R A;  1N8R W;  4PDL A;  3L75 H;  2VQF O;  5E1A C;  1GRJ A;  2KG7 A;  2P5O A;  2EJR A;  2IJK A;  4IHJ B;  2YIB D;  1RM1 C;  4UXN A;  2QGN A;  3TET A;  4B7E A;  4DR1 O;  2LO1 A;  2DE0 X;  4E4E A;  4H0L B;  2K9P A;  4QIW F;  4DK0 A;  3SYC A;  3K03 A;  3IJ4 A;  3H1K H;  1FJG B;  4JZ2 A;  2YID A;  1T5E A;  1IBM B;  2Q6A A;  3ETQ A;  2NLJ C;  4PA4 A;  3OMN B;  4JI1 O;  3T1H O;  4G28 B;  3UO3 A;  2XAQ A;  3NR7 A;  4X9Q A;  2ZE5 A;  3HKE A;  1Q5O A;  4D7S A;  4EKW A;  2VQE O;  3E8G A;  1I5Y A;  1AR4 A;  3ZMU A;  4J9Y B;  2Q68 A;  4ZOL A;  2Z3Y A;  4LF9 O;  1ARO P;  2JK5 C;  4TV9 B;  3CMA V;  1Z5W A;  5FNV A;  4TT3 G;  3KG2 A;  1AJN A;  5IWA O;  1WA8 A;  4TQD A;  4DV3 B;  3OUS A;  4RUE A;  4MSW C;  2IM9 A;  1A32 A;  3JD3 A;  3MHH C;  2JJ2 G;  4X1Y B;  1OCC B;  2HVJ C;  3A0H Z;  4FLV A;  3RFR A;  1K5S A;  1I08 A;  2ZNJ A;  3ETG A;  3QO8 A;  4UCT A;  1FS0 G;  3TXQ A;  1WP8 A;  4D6T H;  3SYO A;  4GZR B;  1AVM A;  2RMK B;  1Q6U A;  1IBL O;  4PI0 A;  2JGU A;  4J7J A;  1YJ9 V;  1Y66 A;  3JAW A;  3G71 V;  3OR7 C;  4MTG A;  4LF5 O;  2BOB C;  1KKC A;  3JAS A;  3BHP A;  5J2U A;  4MVM A;  1SF9 A;  4XDL A;  3W7U A;  4OX9 B;  4MTF A;  4X89 A;  5LYJ B;  2ZXW B;  1V54 C;  4WFE A;  4GT1 A;  4X8A A;  4AI8 A;  3HKB A;  4YJ3 A;  4IIJ B;  3BVO A;  3RGB A;  3JD0 A;  1VMG A;  2CGO A;  4NKG B;  2EZO A;  2QKC A;  2L6L A;  1L8D A;  4IGG A;  3OMA B;  2F43 G;  3IC9 A;  3M99 B;  2F4V B;  5LGN A;  4U3J B;  1FAF A;  3LSQ A;  1TAE A;  4TUY A;  2N04 A;  3JAM N;  1TUB A;  1V55 B;  2CTQ A;  4XDJ A;  2BTO A;  4LF7 O;  2JJ1 G;  4JPR A;  1ZLZ A;  4XBF A;  1DTO A;  3ABL C;  4NTY A;  1SQG A;  3BPZ A;  1AB3 A;  3K79 A;  3ZHQ A;  1FXK B;  3CME V;  1E79 G;  1Q7Y W;  1YXB A;  4I0X A;  4DUY O;  5LA6 A;  1VQ7 V;  4WFF A;  4JYC A;  2WA4 A;  2YXL A;  4DV5 B;  1F51 A;  3OMI B;  4JI8 O;  3M7M X;  3OTO B;  4JTA B;  3K5L A;  1JJ2 U;  2R70 A;  5LYJ A;  4JV5 B;  3OW2 U;  1WB7 A;  2E3C A;  4JAA A;  4MVQ A;  3BY6 A;  5H5N A;  2GDS A;  2CTW A;  3OT7 A;  3EVK A;  4EFE A;  1FXK A;  2W6I G;  1QVF U;  1YF2 A;  3ABL B;  2IU0 A;  4JI4 O;  2EIJ C;  3HKD A;  2Y4U A;  3RYI B;  3K5M A;  1EFR G;  4OXS A;  4JYA O;  1UFI A;  4DR1 B;  1SKV A;  3T1H B;  1V9P A;  4DUY B;  4X88 A;  5L3F A;  1OCZ C;  5B5E Z;  1BE3 H;  4FLW A;  3SYP A;  5EBL C;  2LQT A;  4B08 A;  3ZMZ A;  3OR6 C;  1OCR C;  4YIP A;  4I0X B;  2BTQ B;  4FFK A;  4DV6 O;  5DN6 G;  2PF4 E;  4TV8 B;  4CH5 A;  5GW7 A;  1PNL A;  2EIL B;  3D8C A;  3NXS A;  1QLE C;  4MW3 A;  3H1H H;  2YI9 A;  4HAM A;  3APQ A;  3ZBH A;  1IX9 A;  5IJ9 B;  1NZ6 A;  3CWB H;  4F6E A;  4DV1 B;  1Y4M A;  1IBM O;  2P4K A;  4FVM A;  4JI5 O;  5B1A C;  1N36 B;  4LFC O;  3OD4 A;  5KX5 A;  1XHZ A;  3CRQ A;  1EN6 A;  5BMV A;  2VWJ A;  1G1X B;  1H8E G;  4LF4 B;  1W59 A;  4J11 A;  1AJQ A;  5L3G A;  3OGC C;  4K0K O;  4FM2 A;  5JVD B;  4J41 A;  3D36 C;  3ZRW B;  2YEV B;  4TV8 A;  2F93 B;  2Q5Z A;  2E74 B;  5EIB D;  2RDC A;  4UB6 Z;  4RQF A;  2ZQM A;  3TGU H;  4DV6 B;  1IZ3 A;  2LW7 A;  3BA9 A;  1JR9 A;  1VP7 A;  3CCJ V;  2LJ2 A;  1YZB A;  3BEH A;  1GO3 F;  2ITD C;  1DF5 A;  2DYS B;  3ABK C;  3P3P A;  4MTO A;  3ASO B;  2DJV A;  4B3S B;  2IW5 A;  5HFL A;  1R3L C;  3CCU V;  3H9V A;  4DV4 B;  4AQY O;  2OCC C;  5KHI A;  5H9C A;  3LNN A;  3CCE V;  4FLT A;  4YHH O;  3SJA C;  3E86 A;  1AR5 A;  1KEC A;  1Q86 W;  1NT2 B;  2R9R B;  3I56 V;  4MVR A;  4X62 B;  3LUT B;  1JFF A;  2A79 B;  2MW2 B;  4W4L A;  5K1X A;  2WAM A;  1F7Y A;  1H2S B;  2ADQ B;  2HJF C;  2WWW A;  1OV9 A;  2M7W A;  1HNZ O;  3ZMV A;  2LFR A;  5GON A;  1IUR A;  1VQ4 V;  2FML A;  5CBH A;  2DMX A;  4JI4 B;  4B3T O;  1N0J A;  3N2K B;  5BXZ A;  2QE7 G;  3ZRS A;  1WPB A;  4HBN A;  3WB1 A;  4CS3 A;  4OPH A;  3K5N A;  3H1L H;  4QJF B;  2KSD A;  4PD4 F;  2GV9 A;  2X6A A;  2HKO A;  3BAB A;  1F4N A;  1H8H G;  2F66 C;  1W2B U;  2E75 B;  2A0L A;  2EIL C;  2JDI G;  5LHG A;  2X0L A;  2BE3 A;  2Q69 A;  3SJC C;  5J9P C;  2EIK B;  4U3F H;  2OWO A;  1AR1 B;  4NTX A;  1SS3 A;  5JCO A;  5EC2 C;  4ZKI A;  2QM7 A;  2XAH A;  3ETE A;  2ILM A;  1GN3 A;  4MVS A;  3W7S A;  1YTF D;  2EBO A;  1JCH A;  1AI6 A;  1XI1 A;  5IWA B;  3TXS A;  5JVD A;  3HKE B;  4PV1 B;  1WNS A;  5EZY A;  3GWK C;  3JD2 A;  1JX9 A;  1YIT V;  2HR3 A;  3JAR A;  3AG3 B;  1VF5 B;  1PPJ H;  4UVC A;  2PYJ A;  1PD3 A;  1WB8 A;  1P84 F;  2P7T C;  3K0D A;  1B04 A;  3ZHR A;  1VQL V;  1S5J A;  2CDY A;  4LWS A;  1NR1 A;  2OIG A;  1QU7 A;  2EZP A;  1SQP H;  1KC8 W;  2QEX V;  2XAF A;  4I55 B;  5D5Q A;  1VIB A;  1EN5 A;  3SJQ C;  5K1P A;  1ZSP A;  1YVW A;  4DUZ B;  2YDE A;  2Q73 A;  1LUV A;  4JI0 O;  1XRE A;  1EM1 A;  3M8A A;  2OIE A;  4K0K B;  3ASN B;  2QA4 V;  3RN4 A;  1YTF B;  4D7T A;  5H2F Z;  3JAS B;  4ZI7 B;  1BQ0 A;  1NJI W;  3U10 A;  1M5I A;  5LMU B;  1UJW B;  2Q7H A;  2WLK A;  1NTM H;  2GBO A;  2G38 A;  1H2K A;  3FB7 C;  3W7X A;  2CTP A;  4I55 A;  2PUS A;  2UUC B;  3ZN1 A;  3B8M A;  3VQX A;  4X66 B;  2RNB A;  4PA3 A;  3S3X A;  1Q6H A;  5LXT A;  5KHJ A;  4GLX A;  2RN9 A;  4QPK A;  2Q7E A;  1EZV H;  3RVY A;  4DUZ O;  2FYU H;  1XHX A;  4DR3 B;  4F4L A;  3J81 N;  4JZG A;  4WCE V;  2YUA A;  1M9N A;  4WBN B;  5LOV A;  4UCU A;  5CA3 A;  1U96 A;  3BRC A;  3K5O A;  5CB4 B;  4OGQ B;  1B06 A;  4ZOL B;  1MNG A;  3F5T A;  2D2C B;  4PA6 A;  2KB1 A;  4GCZ A;  2CAZ C;  1AIL A;  1VQ6 V;  3BAA A;  2QM8 A;  4Z2W A;  1GMG A;  2WSS G;  4QE7 A;  4JI3 B;  4GYC B;  1GTO A;  1R3I C;  2DWE C;  2OCC B;  1XIL A;  3CC4 V;  4RO2 A;  5LP6 A;  1ROP A;  1U97 A;  4B3T B;  3GB7 C;  4FLY A;  5CA0 B;  3FB6 C;  3SJB C;  1P49 A;  1R6N A;  5AG2 A;  1GN6 A;  2WLH A;  3RBZ A;  1AI5 A;  3QNE A;  5EBW C;  1G6U A;  2WLL A;  4LBE C;  1JA8 A;  4JYB A;  4DR3 O;  4MVZ A;  2AHZ A;  3FFQ A;  4BIU A;  1KMI Z;  1XMQ O;  5KLV H;  3Q4H B;  2YIA A;  1NVP D;  4LP8 A;  5IYC O;  3K08 A;  3SPH A;  4W4K A;  2B1G A;  3CRR A;  1SQV H;  2X6C A;  4LFB O;  3H1J H;  3ZCC A;  4X1K A;  3PN1 A;  3I55 V;  4CH3 A;  2RJZ A;  5B1A B;  4K35 A;  1P4R A;  4B3M O;  4I7Z B;  1SZX A;  5IYD O;  1QLE B;  1TUE B;  4DV0 O;  5CA1 B;  1YJW V;  5JQG B;  2EIN B;  1Y67 A;  3K3W A;  2A9H A;  1N33 O;  3CJH B;  1WN7 A;  3I5D A;  4LF5 B;  2GTA A;  2ETN A;  1LUW A;  1AI4 A;  2ZKO A;  4DR7 O;  1X4T A;  1QR8 A;  2JGD A;  2NR5 A;  4BAY A;  1WA8 B;  1WJZ A;  4UFZ A; 
#chains in the Genus database with same CATH homology
 3T4Z A;  5DN6 G;  5GW7 A;  2OTJ V;  3IC7 A;  4QPJ A;  1PNL A;  2EIL B;  3K04 A;  3NXS A;  1QLE C;  4MW3 A;  4FK5 C;  2ATK C;  1MSW D;  3ZRW A;  4HAM A;  1K9M W;  3STL C;  5LBQ A;  1THZ A;  5LGU A;  4CBC A;  1Y4M A;  4BW5 A;  1Q81 W;  5B1A C;  4JAU A;  1SET A;  3AEI A;  3UM7 A;  2NNU A;  2XAG A;  3P32 A;  1NQT A;  1ZWI C;  2XOK G;  4QNH B;  3JD1 A;  1R3K C;  2DQ3 A;  1BHB A;  2Y48 A;  1H8E G;  5B1B B;  2HFE C;  3ZIA G;  2P90 A;  3CCS V;  1KKD A;  5B3S C;  5IY5 B;  4FMT A;  1NH2 D;  1CPY A;  1AJQ A;  5L3G A;  3VOU A;  3OGC C;  1EBO A;  4U7N A;  3AG1 C;  4PEL A;  4R50 A;  3JYC A;  3ZRW B;  1VQ8 V;  4TSF G;  2YEV B;  4XDK A;  3K9A A;  5IDJ A;  4Z1M G;  5CN0 A;  1E1Q G;  4WF9 V;  3WG7 C;  1S77 D;  3LDD A;  4FPP A;  4RQF A;  4JGS A;  2ZQM A;  2GHY A;  2JEX A;  1G4Y B;  1JQ0 A;  4RQE A;  2QKS A;  4KUM A;  1BL8 A;  4RAI A;  1FXK C;  1CP9 A;  3FB8 C;  3CCJ V;  3AG3 C;  4WFG A;  3BEH A;  1GO3 F;  2H94 A;  1QLN A;  2ITD C;  1DF5 A;  2DYS B;  1VQM V;  2GSM B;  4PDR A;  3ABK C;  1M1K W;  3OEH G;  4MTO A;  1VQP V;  3ASO B;  1EZJ A;  2W6J G;  5BZB A;  2IW5 A;  2B5U A;  3E8F A;  5HFL A;  1R3L C;  3CCU V;  3FYE B;  1K8A W;  2BOC C;  1SZT A;  2OCC C;  3CP1 A;  4P9P A;  5H9C A;  3ZMT A;  3CCL V;  3CCE V;  1VQN V;  4RUF A;  1K97 A;  3E86 A;  4R8C A;  4PDM A;  1KEC A;  1AJP A;  3ABM B;  1W0J G;  5B1B C;  3VBB A;  2WLN A;  4BIZ A;  1M56 B;  2WPD G;  3ML0 A;  3A0R A;  3WFV A;  1Q86 W;  2D3O W;  2X6B A;  2IH1 C;  2R9R B;  1RPR A;  1R3J C;  4MVR A;  3I56 V;  1VQO V;  3LUT B;  2A79 B;  2OT5 A;  1MG1 A;  3OM3 B;  3ZRX A;  1K7D A;  2WAM A;  5CBG A;  1S72 V;  4GX2 A;  5L3E A;  1R73 A;  2YEV A;  3WG7 B;  2DQ0 A;  3HB3 B;  1ORQ C;  1XL6 A;  2HJF C;  1GM7 A;  2ITC C;  1H38 A;  2LFS A;  3JD4 A;  2WWW A;  2ZR3 A;  3OFN G;  4P9O A;  4G27 B;  3ZJZ A;  2M7W A;  1IXM A;  1OHH G;  2FTK A;  3T1C A;  1RPO A;  4PA9 A;  4GX0 A;  4MTX A;  5HFM A;  1JVM A;  3E8H A;  2LFR A;  3ZMV A;  1SER A;  2DWD C;  3W7W A;  4FJC C;  1VQ4 V;  5KA6 A;  5CBH A;  3W7T A;  1PNM A;  5CMU A;  2H8P C;  4H37 A;  1M57 C;  4FIP C;  2IJH A;  3TCU A;  4ASU G;  2YSU B;  1QVG U;  2QE7 G;  1FXH A;  4J9Z B;  1BHA A;  3ZRS A;  4WFH A;  3E2E A;  4WFA V;  2Y69 C;  2UXN A;  3FYI B;  4GX1 A;  2AHY A;  3CCQ V;  3AG4 B;  1BMF G;  3SPJ A;  1K4C C;  4QJF B;  2R9I A;  2X6A A;  4LCU C;  1YJN V;  2HKO A;  1J95 A;  1F4N A;  3SPI A;  3QO5 A;  1H8H G;  4JAV A;  1W2B U;  4CZZ A;  1VQ5 V;  2EIK C;  4N23 A;  1H2G A;  4HZ3 A;  2A0L A;  1K5Q A;  3K06 A;  5C93 A;  5CBF A;  1GKF A;  2EIL C;  2JDI G;  1FFT B;  5LHG A;  2X0L A;  4QE9 A;  2Q69 A;  4MVU A;  5J9P C;  3AG2 B;  4P30 A;  3E89 A;  2EIK B;  1I5X A;  3P30 A;  3K0G A;  1FXV A;  1AR1 B;  4I9W A;  1LNQ A;  1M56 C;  5EC2 C;  2HVK C;  3ABM C;  4ZKI A;  2P67 A;  2QM7 A;  2IU3 A;  2WLI A;  3HPL C;  1KP3 A;  2XAH A;  3UKM A;  3ETE A;  1WPX A;  1NR7 A;  3IGA C;  4MVS A;  3W7S A;  3CC2 V;  2EIN C;  1YTF D;  1OZ0 A;  5FL7 G;  2EBO A;  1JCH A;  1AI6 A;  1K3E A;  3GWO A;  3LNM B;  1B6Q A;  4LC1 A;  5B3S B;  2X7R B;  3ASO C;  3RVZ A;  3H01 A;  5H6R A;  3JD2 A;  1E1R G;  1JX9 A;  1YIT V;  1N8R W;  3EFF K;  4UVB A;  4PDL A;  5KA5 A;  2HR3 A;  3AG3 B;  5E1A C;  1CEZ A;  3AG2 C;  3CCR V;  3EHB B;  4UVC A;  2EJR A;  2IJK A;  1PD3 A;  1WLE A;  4UUJ C;  4UVA A;  4YXW G;  1VQ9 V;  2P7T C;  3LSS A;  3ETD A;  3K0D A;  1YHQ V;  1RM1 C;  4UV9 A;  1VQL V;  4JAS A;  4UXN A;  5EBM C;  3TET A;  1GM8 A;  3IFX A;  1NR1 A;  3X2Q B;  2EZP A;  2Q67 A;  4QIW F;  1KC8 W;  2QEX V;  3SYC A;  3K03 A;  2XAF A;  1MAB G;  2IH3 C;  2EIM B;  3MHS C;  2Y69 B;  1S3J A;  2Q6A A;  1GK9 A;  2NLJ C;  4PA4 A;  3OMN B;  3RW0 A;  3SJQ C;  3G6E V;  1AI7 A;  2ZDI C;  4JF3 A;  4G28 B;  1OCZ B;  1F23 A;  4U7O A;  2XAQ A;  4PA7 A;  3F5W C;  3FB5 C;  4UV8 A;  4EKW A;  1PKX A;  5KUM A;  3E8G A;  1I5Y A;  3ZMU A;  4J9Y B;  2LP7 A;  2Q68 A;  2V1D A;  3CYO A;  1R6K A;  2C2A A;  2CK3 G;  2Z3Y A;  3X2Q C;  1P7B A;  1ARO P;  2EIJ B;  2JK5 C;  3CMA V;  1W0K G;  2V7Q G;  3ASN B;  3LDC A;  2QA4 V;  1NKD A;  1XL4 A;  1YTF B;  3DTU B;  1COW G;  1OCO B;  4KP4 A;  2Z5U A;  1S76 D;  2HLD G;  1NJI W;  4TT3 G;  3KG2 A;  2W0F C;  1AJN A;  1UJW B;  4MS2 A;  2B1I A;  2WLK A;  1DLB A;  4H33 A;  1OCR B;  3B8N A;  3FB7 C;  3OUS A;  1K33 A;  4RUE A;  4MSW C;  3W7X A;  2IJI A;  3JD3 A;  3MHH C;  2JJ2 G;  3E8B A;  1OCC B;  3DGE A;  5L3B A;  3FKS G;  2HVJ C;  2DYR C;  3CCM V;  1K5S A;  4Q20 A;  3ETG A;  3AG4 C;  3E83 A;  3ZN1 A;  3B8M A;  3QO8 A;  3SPC A;  2XAS A;  1FS0 G;  4PA3 A;  3MD0 A;  3SYO A;  3JCZ A;  4L87 A;  4QPK A;  3RVY A;  3ABK B;  4PDV A;  1PL0 A;  2DYS C;  1VQK V;  2XAJ A;  4F4L A;  3F7V C;  1YJ9 V;  1Y66 A;  3G71 V;  3OR7 C;  4WCE V;  2JEU A;  4MTG A;  1M9N A;  2BOB C;  5CA3 A;  4MVM A;  1OCO C;  4XDL A;  4E2L A;  4WFB V;  3W7U A;  4MTF A;  3D36 A;  4X89 A;  2ZXW B;  3E35 A;  1KP2 A;  1V54 C;  4WFE A;  1V55 C;  4GT1 A;  4X8A A;  3OEE G;  3JD0 A;  3G4S V;  1NVP B;  2P6J A;  2EZO A;  4PA6 A;  2KB1 A;  4HYO A;  4GCZ A;  1K73 W;  1YIJ V;  3ABT A;  3OMA B;  5B1N A;  2XND G;  1VQ6 V;  5LGT A;  2F43 G;  2K1E A;  2WLL B;  4JTD B;  3M99 B;  2QM8 A;  5LGN A;  1GMG A;  4R6Z A;  2WSS G;  3LSQ A;  4QE7 A;  1GTO A;  1R3I C;  2DWE C;  2EIM C;  2OCC B;  3SYA A;  3CC4 V;  4RO2 A;  1V55 B;  1ROP A;  2WLM A;  4XDJ A;  3GB7 C;  1V54 B;  2JJ1 G;  4JPR A;  2ZXW C;  4R7C A;  1PNK A;  1JPX A;  4XBF A;  1DTO A;  1K34 A;  4MVO A;  3FB6 C;  3ABL C;  4JTC B;  1KD1 W;  3QO7 A;  4MT8 A;  3SPG A;  1YI2 V;  1RM1 B;  3K79 A;  5L3D A;  3B77 A;  1FXK B;  1GM9 A;  3ZN0 A;  3CME V;  1R6N A;  1E79 G;  2QTO A;  5B1O A;  1Q7Y W;  2WLH A;  3OE7 G;  1JOY A;  1KQS U;  3R65 A;  4G2K A;  1AI5 A;  3RBZ A;  3CPW U;  3QNE A;  5EBW C;  2WLJ A;  2WLL A;  4LBE C;  2ZR2 A;  4JYB A;  2ZDI A;  1VQ7 V;  4MVZ A;  2AHZ A;  1SRY A;  4WFF A;  5H6Q A;  4JYC A;  4BIU A;  1QBZ A;  1F51 A;  3OMI B;  1M90 W;  3TK1 A;  1K4D C;  1L1F A;  3ZMS A;  4JTA B;  1HWY A;  4KFM A;  1NVP D;  1JJ2 U;  3OAA G;  1S0V A;  4LP8 A;  5IYC O;  1G8M A;  3SYQ A;  2ZD9 A;  3OUF A;  3K08 A;  3OW2 U;  5EC1 C;  3SPH A;  1OCC C;  2B1G A;  3PJS K;  5L3C A;  3ABU A;  1QCE A;  2X6C A;  5DM6 V;  5IYB O;  4MVQ A;  1K92 A;  3BY6 A;  1F4M A;  3ZCC A;  3CXC U;  3I55 V;  1NBM G;  2PI4 A;  2MK3 A;  2HG5 C;  1ENV A;  1QR9 A;  1FXK A;  2W6I G;  1QVF U;  5B1A B;  4P2Z A;  1P4R A;  4N21 A;  3ABL B;  2IU0 A;  1NH2 B;  3ASN C;  4ZBM A;  4DXW A;  2EIJ C;  2IJJ A;  3F7Y C;  1MOF A;  3T4D A;  5IYD O;  1QLE B;  1SES A;  5KUK A;  4GX5 A;  1EFR G;  5EK0 A;  1YSC A;  4OXS A;  3LDE A;  1Q82 W;  1TUE B;  3AG1 B;  3CD6 V;  3STZ C;  1YJW V;  2EIN B;  3CCV V;  1S5H C;  3K3W A;  4MW8 A;  2JIZ G;  2A9H A;  5LHH A;  4DO2 A;  3T2M A;  3CC7 V;  4TWK A;  2WLI B;  5IY5 C;  4X88 A;  1DF4 A;  1M57 B;  2DYR B;  1AI4 A;  2DW4 A;  1OCZ C;  4I5S A;  3ZRV A;  5L3F A;  2PI5 A;  1QR8 A;  5EBL C;  3SYP A;  2OTL V;  4BAY A;  3ZMZ A;  3OR6 C;  3D3I A;  1OCR C;  5LHI A;  2UXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...