4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
4PDVA 3VOUA 3WG7C 2WLIB 2QTOA 3K06A 3FB5C 3ASNC 3GB7C 4R8CA 3AG1C 3E8HA 3OR7C 4LBEC 4WFGA 3K03A 3T4DA 4EKWA 1XL6A 2P7TC 3T2MA 5KUKA 2KB1A 2W0FC 2R9RB 5EBWC 4RUFA 3ABLC 2IH3C 2WLMA 4G28B 1BL8A 4CBCA 2A9HA 1LNQA 2NLJC 3LDDA 3ZRSA 4GX0A 1OCCC 4P9PA 4RAIA 2IH1C 3K04A 3UM7A 4JTCB 3SYCA 4GX2A 4F4LA 4PA9A 2BOBC 5B3SC 2BOCC 3F7YC 3SPGA 4DXWA 1R3IC 3E8BA 3JYCA 5CBGA 2X6CA 4MW8A 2Q67A 4PDMA 5EK0A 3RBZA 4WFFA 5CBHA 2OCCC 4JTAB 4QE9A 4BW5A 4I9WA 4UUJC 3SYPA 4MVOA 3TCUA 4X88A 1G4YB 3AG3C 4PA6A 1V55C 4P2ZA 2ZXWC 2WLLA 2A79B 3ABKC 4OXSA 2X6BA 3OR6C 4X8AA 3SYOA 4PDLA 4WFHA 5EC2C 3TETA 3LNMB 4HZ3A 2DYRC 3T1CA 2ZD9A 3SPJA 3E8FA 4MW3A 4PA3A 4MVZA 4LP8A 1JVMA 1M56C 2DWEC 1J95A 4G27B 3FB7C 1V54C 2WLJA 3PJSK 2WLNA 3SPCA 3F5WC 4MTFA 3SYAA 4TWKA 4LCUC 1R3LC 2EIKC 2H8PC 2Q6AA 3BEHA 4GX5A 1R3KC 1P7BA 2A0LA 4MVUA 2WLHA 4MVMA 2AHYA 3UKMA 3LUTB 2ITDC 2EIMC 2EILC 3OUFA 3OUSA 3FB8C 3IFXA 4H37A 4RO2A 3ABMC 4MVSA 3ASOC 4P30A 2ITCC 2WLLB 3SPIA 2Y69C 5E1AC 3E86A 3SPHA 2YEVA 4H33A 3F7VC 2X6AA 5B1AC 3SJQC 4PDRA 3R65A 4HYOA 2ATKC 4PA4A 5J9PC 2EINC 4XDLA 4GX1A 3E83A 2HVJC 4R6ZA 5CBFA 4X89A 1ORQC 1S5HC 3ZJZA 1QLEC 3IGAC 2K1EA 3SYQA 4J9YB 3OGCC 1ZWIC 1XL4A 3LDEA 5IY5C 1OCOC 3FB6C 3T4ZA 2WLIA 5EBMC 2EIJC 3K08A 3KG2A 3RVYA 2DWDC 5EC1C 1KKDA 3AG4C 3K0GA 2Q68A 2WLKA 4XDKA 2Q69A 2DYSC 4RUEA 2HVKC 5KUMA 3K0DA 3STLC 4QNHB 4MS2A 5BZBA 2JK5C 4MSWC 3HPLC 3AG2C 4J9ZB 3E89A 1M57C 2AHZA 4JTDB 3RW0A 2QKSA 3LDCA 4MVRA 3EFFK 4KFMA 2HFEC 4MTOA 1OCRC 2HJFC 4MTGA 4R7CA 5EBLC 3RVZA 4PA7A 4QE7A 3STZC 4P9OA 3E8GA 2HG5C 4ZBMA 3X2QC 1K4CC 1OCZC 1R3JC 4XDJA 5B1BC 4WFEA 4MVQA 1K4DC 4R50A
chains in the Genus database with same CATH superfamily
1GN6A 2P06A 5H5NA 4JV5O 4K8XA 2LP7A 4WFGA 4RWUA 4J10A 1B6QA 4X65O 1VQMV 3H1IH 2CDYA 4U7NA 1XI1A 2Q0OC 4F4LA 4B3MB 3U0ZA 3JATB 1V54B 2UUAB 2CUGA 3FD9A 2KG7B 3I5DA 4NKGB 2X6CA 4WFFA 1WA8A 4CS2A 1KP2A 3SR2C 2EZPA 1YTFD 4PELA 2L35A 2OCHA 3OR6C 2IJHA 4WFAV 4IL6Z 2ZD9A 1M93A 4UCOA 1WP8A 1JVMA 3W7TA 1GM8A 3B2EE 3ZMSA 2E5LO 1ZL8A 1ZTEA 4PI0A 5IJ0B 4MVMA 1K9MW 3CE2A 3KCYA 1MOFA 1PKXA 4B3RB 3SPHA 5E1AC 1PP9H 2XAHA 4IHJB 2E3CA 3CCUV 2F1MA 4JYYA 1US6A 1ZWIC 1XL4A 1CEZA 2EZOA 2QGNA 3P32A 3RVYA 1K73W 4AILC 4UCVA 3VQYA 4YIPA 2P4KA 3STLC 5IWAO 1RSOB 2A06H 2P90A 3T1HB 1VQPV 4KFMA 4R7CA 3DC5A 2VQEO 1JOYA 3HKDB 1K4DC 1EN6A 5B3SB 3FX7A 1R6TA 4R8CA 3RYHA 3QVNA 2MW2B 5EZYA 3RYCA 2Q7HA 4CH4A 2KSDA 1NT2B 2DN9A 2DQ0A 1VQNV 3ABLB 4CBCA 4HAMA 1F4MA 1K8AW 4CH5A 1Y4MA 1SETA 2GV9A 3QF7A 5TISZ 5GW7A 3JYCA 2XUMA 5EK0A 4O4JB 4GZRB 2DE0X 2BE3A 2JS3A 5LA6B 3ZMUA 1V55C 2Q0AA 1QU7A 3CP1A 3P3NA 5KA6A 2UUBO 5CB4B 5C8YB 3G4SV 3WFVA 4W4KA 1T5EA 4E2LA 2VQFO 4LP8A 3BABA 1OJHA 2WLJA 3SPCA 2BTQB 4NB5A 4BIUA 2HHHB 2YXLA 5L3FA 2ITDC 5D5QA 3CSXA 3RYCB 3KCXA 2JIZG 3ABMB 4KP4A 1W59A 2ODMA 3OW2U 2IU0A 5LGUA 1YDXA 1I94O 2AGAA 1DK1A 1YXBA 4LH7A 2DWDC 2XAFA 4ZOLA 3JAKB 3PN1A 5LXTB 1M1KW 2F66C 2Q69A 2DYSC 4IIJB 4J11A 4J7KA 4H13B 1EBOA 2F4VB 1EZJA 3M8AA 3OTOO 4P9OA 2EX3A 5JCOA 1N32B 1R3JC 3L9DA 4NXNO 4WFEA 1XILA 4LR3A 3A8TA 3FB5C 3MHHC 4JPRA 4DV4B 1FJGB 4UV8A 4JGSA 4EKWA 2CH7A 2BCCH 4CC6A 3BA8A 5GTIZ 1H38A 3W7WA 4YHHO 2QM8A 5LBQA 1K5QA 2AZ0A 4JYCA 4K3AA 3ZN1A 1IBKO 1VQ5V 4JAAA 3R66A 4DV2B 2B1IA 4NYKA 5C93A 4FZ1A 4D7SA 3CB2A 5HFLA 1TVKB 4UV9A 3RFRA 1BSMA 3TXQA 3KKYA 2QWPB 1WB7A 4JI7O 4A5UB 2YICA 1AB3A 3SYOA 2GTAA 2FMLA 2DYRC 1L8DA 3UO2A 3K5NA 1MA1A 2ZR3A 3BFRA 4LCUC 4GX5A 4MVUA 3W7XA 3UKMA 5ITZA 2CH7B 1Y76A 1Q3EA 1GTOA 4CC5A 1ROPA 5JVDA 1JQ0A 2ATKC 4DR4O 4JAVA 4X89A 4FMTA 1MZFA 4RQFA 3C3SA 3WB1A 4J41A 5IY5B 4GUNA 2PTMA 3ML0A 4DV3O 4RQEA 2QM7A 3K79A 2OTLV 1YF2A 3RW0A 1F4NA 1FKAO 1EZVH 3H9VA 5LHIA 2PF4E 4MTGA 2ZT9B 4QE7A 2VWJA 5B1BC 1OHHG 3B77A 3CXHF 2XHBA 3VOUA 1HDJA 1P7GA 3M7MX 1BZKA 1W2BU 1FYJA 3T4DA 3RYIB 3N27A 1XL6A 2W0XA 3BCCH 1Y76B 2PI5A 1YJNV 1UJWB 1V55B 4Z1VA 1VMGA 1BL8A 5JVDB 4GKKO 2Q5ZA 5KAFZ 2Z5UA 4P9PA 2RJZA 2ETNA 1AVMA 4LFBB 3JAWA 3H01A 1FXKA 2ILMA 5DEDA 5DM6V 2M6YA 1GO3F 1MSWD 5LYJB 3MAQA 2UU9O 2WA3A 1R6KA 4WFBV 5LMUB 3OGIB 4KHPO 4B3TB 1XNRO 4DK0A 4FLUA 3OTFA 5B1NA 3D36A 1XNQB 1W0JG 2ZR2A 4O2BA 3K5LA 2WWWA 2ADPA 2Q6AA 4LFCO 1GRJA 4DR2B 1W0KG 2DYSB 1SERA 1VQ9V 1GM7A 5LGTA 4DV5B 2GBOA 2ITCC 4N21A 3CMEV 1H2KA 5J9PC 1XMQO 1QLEC 3H1HH 2JGDA 5KMGB 1QQCA 2NN4A 5EC1C 3JAWB 3AG4C 1RFYA 1FXKB 3APOA 1KKDA 2YXYA 4MS2A 4FM1A 4JI0B 3SJAC 3LDCA 2F23A 4JYAB 4DV1B 1IBLO 2IJJA 1FAFA 4X1YB 1K4CC 1VQLV 1TUBA 4OPHA 1BS3A 3THOA 2YIBD 5E79Z 1KP3A 3JARA 5K1PA 1G1XB 4X20A 3G71V 3OEEG 3FAVA 1DF4A 1F7YA 3K57A 1XOUA 2UXNA 4I0XB 4TV9A 4YJ3A 4QJFB 4OX9B 1AR5A 1SS3A 4FLTA 1MNGA 3JASB 2DYRB 5KHHA 4JI5B 3K04A 1IX9A 1OZ0A 4OGQB 3RBZA 2RDCA 4DR6O 2RMKB 1HW7A 2A79B 4LC1A 5GONB 4WFHA 1IBMB 2UXBO 3C90A 2X7RB 3RN4A 1VQKV 1TUBB 1ZX3A 2RNBA 4J42A 3ZRWB 3SYAA 2ZCEA 2P67A 2PUSA 4FPPA 3DGEA 3BAAA 4DUZO 3UT5B 3FB8C 3IFXA 4IYHA 1SQQH 4O2AA 2QJ1A 5AG2A 1AR1B 4DR5B 1XEQA 3CYOA 3F7VC 4WBNA 2OWOA 1FFXA 2EINC 1S77D 2JRIA 1J5EO 4R6ZA 5B1BB 3D3QA 4UVAA 4FFBB 1YCIA 4L8JA 1VQ7V 2MK3A 1BQ0A 4DR3B 2JJ2G 3JAMN 2ZNJA 1LUWA 3E89A 4W4LA 2FB5A 4X64O 4X1IA 4K0KB 4I4TA 1OCRC 3SDLA 5EBLC 4NTXA 1YEWA 3SGIA 2WLIB 3JATA 3K06A 4CH3A 2Y0IA 2KG7A 1N36O 3GWKC 4DUYO 1HNWO 2ZQMA 4JI2B 1M4UA 3E2EA 2UXBB 4DV6B 2ZINA 1N0JA 3OE7G 4WBNB 4X66B 1FD9A 2Q9LA 1VIBA 4JTCB 1XQ8A 2EBOA 3F7YC 2QR4A 3I55V 5IJ0A 5BR8B 4B7EA 5LGNA 1U97A 1XMOB 3ABKC 4IHJA 4AHCA 4X1IB 3OEHG 3ZBHA 4I4TB 2ARHA 3T1CA 4PA3A 1QLEB 1KB9F 3SJBC 4U3JB 2FKXA 4GKJB 2CGNA 3MD0A 3HR0A 1QBZA 3K9AA 1YSCA 1R3LC 2H8PC 4XDJA 3AG4B 1R3KC 1N34O 2N74A 5JQGB 4LF9B 1RSOA 4RO2A 3QO5A 5LP6C 1BQZA 4P30A 1QR8A 5B1AC 4PDRA 1N33B 3JD0A 4JI8B 3W7SA 1XHXA 1D2DA 3AK3A 3CRQA 3HKDA 3FYIB 3RT3C 3U11A 4FM0A 4XDKA 3CJHB 1PNMA 2UXDB 2ZM6B 1M57C 4JAUA 1WP7A 1YJWV 1K92A 4DK1A 1VQ8V 2AW9A 4JV5B 2BTOA 1OCZC 4YXWG 3RWRD 3CRMA 3IAYA 2WAMA 2IU3A 1YI2V 1SQXH 1O9GA 4WCEV 4O4JA 4X65B 3ZIAG 4JI6O 3JD3A 2O57A 5KUKA 2HEPA 5LA6A 4CH6A 2A3QA 1AI6A 4JI4O 2KQXA 1IZ3A 2QDOA 4MT8A 1XDCA 1KUQA 2CTWA 5DN6G 5CB4A 5C8YA 5CMUA 3ZHUA 1OCCC 3UM7A 3H1KH 2WA4A 3GVMA 2BTQA 3LSSA 1SRYA 4U7OA 4X88A 2DMXA 4LF6O 5KHJA 2E5LB 2CK3G 3GWOA 4CZZA 3E8FA 1AR4A 4MW3A 3T1YO 1J95A 1A32A 3JAKA 4YIOA 5LXTA 4L87A 4FLWA 4IIJA 1JX9A 3LNNA 2VS0A 4MVSA 5J2UA 2Z3YA 1ENVA 4GLXA 1P49A 1Q90D 4BWAA 4GX1A 3E83A 1YJ9V 5EYPB 3OFNG 2HJDA 5JJJB 1WN7A 4J9YB 3LDEA 5IWAB 4F6RB 1JCHA 3T4ZA 5KX5A 2HP8A 1CP9A 2UXXA 1NH2D 3K58A 3CEIA 2HVKC 1XUQA 2LW1A 2VRZA 3B8MA 4JTDB 2VQEB 1NTMH 1NQTA 1F51A 3STZC 3X2QC 3CCQV 2YXHA 2QWRB 4X62O 4XDLA 3H1JH 4JZ2A 5IT9N 3CPWU 3ASNC 3E22B 3CRRA 3P3PA 4LBEC 4JI1O 1TVKA 4LF6B 4LF8O 4JI3O 2P7TC 4O4HA 3E35A 1IURA 4NR1A 5J2UB 3ABKB 2IH3C 4ZI7B 3HKBB 1Z5WA 4F6EA 2M7WA 1PNKA 1YIJV 4DXWA 1B04A 3ICXA 3BVOA 3BY6A 5KX5B 2PYLA 3K9SA 2EJRA 2PYJA 2UUBB 4JTAB 4Q6GA 1B06A 4K8ZA 3IC7A 5LP6B 2ZXWC 3VQWA 5KHKA 2VQFB 3J81N 3F5TA 5B1AB 2CTQA 4DV0O 1JMKC 3G67A 2CTRA 1YTFB 3MDSA 1RPRA 2QE7G 1HNZO 5FNVB 5CA1A 4FIPC 4JF3A 1HR0O 2YUAA 1M57B 4O4HB 5BY1A 1QHTA 3E86A 2UUCO 1I94B 3JSLA 4BIZA 2DQ3A 4H44B 1S5HC 1OCZB 2D2CB 4Z2WA 4LF8B 3ZMVA 4LFAO 2FL4A 4AI8A 4LF7O 5KUMA 3RYIA 2EJ7A 2QKAA 3A0RA 3OTOB 4TUYB 4CS4A 3ZHRA 4NXNB 3ZCCA 4MTOA 3CCRV 1YVWA 4PA7A 1OCCB 3OAAG 2G38A 1K7DA 4YY3O 1BCCH 1N8RW 3GB7C 1IXBA 1TUEB 2IM9A 3ZEDA 3OR7C 4XBFA 5IYDO 4TSFG 4FFKA 4YHHB 5CA1B 2P6JA 1S5LZ 4FK5C 5EBWC 3OT7A 5LYJA 1IBKB 4AQYO 2CTPA 3ZRSA 1EN4A 2WSSG 5CA0B 3AEIA 4GX2A 1K3EA 4PA9A 3CCLV 1HR0B 1COWG 1BMFG 3SPGA 1R1BA 3UCSC 3UQ8A 1SA0A 4JI7B 2E74B 4QE9A 2H94A 4I50B 2DJVA 2YDEA 5DECA 2EULA 2HLDG 5BMVB 2PY5A 5D5PA 1KU9A 1CPYA 1TA8A 5EC2C 2XNDG 4TQDA 2B9ZA 2XAJA 2XAQA 4LH6A 4I55A 4G27B 4LF5O 5KMGA 2IJKA 1XREA 2QWOB 2AZ2A 5CN0A 4UB8Z 1KQSU 4JYBA 2P22C 5A2QN 4DR4B 4Q20A 3JD4A 2Z0AA 1H2NA 2N04A 2HVJC 2OT5A 4LWSA 5IJ9B 4X1YA 1SZXA 1NH2B 1ORQC 3UO3A 3DXRA 4DV3B 4TT3G 1UFIA 1OCOC 2QWNB 1N4CA 4DV7O 3ASNB 3O65A 3APQA 5IYBO 1SA0B 3G6BA 4NTYA 2JK5C 1NKDA 4I0XA 1I0HA 4J9ZB 4FLZA 1K34A 4MVRA 2RN9A 1SZTA 2OIEA 2IJIA 1HNXO 1SQFA 1Q81W 3JASA 2K9PA 3E8GA 4U3FH 3CC7V 4B08A 2Y4UA 4I55B 5H2FZ 1SESA 3W7UA 4PD4F 5JH7B 5IYZB 2QTSA 2LGQA 2R9IA 2W0FC 4GKKB 1ZUQA 3L70H 2ZXWB 3ETDA 3NR7A 2W6IG 5GONA 1H8HG 2NLJC 2YSUB 4LWSB 3P30A 4DR7O 3A2FA 3DXRB 3TK1A 1X4TA 3ZRWA 3E8BA 2LW7A 2GDSA 5LMNO 2YIDA 3MHSC 1SQVH 2UU9B 4UUJC 3UT5A 1Z2GA 4BIOA 4PA6A 4KHPB 1DGSA 1XNRB 4LF4O 4OXSA 3AK1A 2X6BA 4NXMO 5B1OA 3TETA 2ZDIC 4O4IB 2Y4TA 1NJIW 1UPGA 1PM9A 1M9NA 1PL0A 4K35A 4MVZA 2LFSA 2GSMB 4LFCB 4NVPA 1AP5A 3FB7C 1E1QG 1G6UA 2DW4A 4FFBA 3HB3B 1YHQV 5JJNB 4PV1B 4DRXA 1JJ2U 3N2KA 4WF9V 4DYLA 2NR5A 3OUFA 1VF7A 1XMQB 3ASOC 5F2VO 2Y69C 4DR1O 3DSQA 5H6QA 2WLIA 1S5JA 2CE4A 1PNLA 5KHIA 1NR1A 1H2SB 3OM3B 5B5EZ 3M99B 3AG7A 3Q4HB 2QA4V 4X9QA 3ZRXA 1K97A 1IBLB 4I9QA 4B3SO 4D6TH 2QKSA 3ZMZA 2YEVB 4EB6A 1AILA 1AI4A 3ZHSA 5LMNB 1M5IA 2X0LA 3O9OA 2RCVA 4JASA 4DRXB 3C3TA 3ZX6A 2RQ6A 1PV0A 3N2KB 3L74H 2GTSA 1VF5B 1K33A 4UCTA 2R9RB 3FYEB 3AK2A 4RUFA 3OD4A 2YIAA 3ABLC 4C7UA 1PPJH 1I5XA 3CCJV 5KHGA 5LOVA 4U3JA 2YI8A 1VP7A 4DR6B 1IXMA 1IDSA 1JFFB 4B3MO 3HKEB 1NVPD 5JQGA 2UUAO 3TCUA 2H3OA 1XBLA 4DW0A 2ZE5A 3CWBH 1AROP 1NTZH 3LNMB 4EB6B 4HZ3A 1BE3H 1IVSA 1AI7A 2JEUA 2R72A 1VF6C 1OCOB 1KD1W 5LL6Y 4GCZA 4YJ2B 4DUZB 1K5SA 2AXTZ 1OV9A 5A9GA 3CJHA 4H37A 3ABMC 1J5EB 2YIBA 2WLLB 1R73A 1H2MA 5L3DA 3ZS8C 1NS1A 5CBFA 4B3RO 4FJCC 2IBZH 2CGOA 4ZIBA 5LOVB 5EBMC 2GHYA 2PI4A 3K0GA 1FXHA 1L0NH 4X64B 2Q4PA 5BZBA 3K5OA 3AG2C 1Z5VA 4EFEA 2AHZA 1E79G 2ZE6A 3RVZA 2HG5C 4PHZA 3T1HO 1N36B 4BR6A 2Q8VA 5JWPA 4DUYB 1KYOF 1HNWB 1DLBA 4QIWF 3S3WA 3AG1C 4ZHQA 1KBHA 1AJQA 3E8HA 3KZIZ 4UVCA 3VQXA 3D3IA 1NR7A 5L3CA 4J7ZA 5H6RA 5IE9A 2V7QG 1GM9A 1GN4A 1Q86W 2YI9A 1URFA 1GN3A 2BOBC 1RM1C 1JPXA 1WAZA 4PDMA 1WNSA 1JJOA 1QVFU 1S76D 3EXAA 1TAEA 4JZGA 5BXZA 1GK9A 3A0HZ 4P2ZA 3ASOB 3ZHQA 2Y69B 3JD2A 1THZA 4B7KA 2LJ2A 5JCOC 5EYPA 2LGWA 5HFMA 1M56C 1N34B 4F6RA 2JDIG 2EIKC 4ZHQB 1WA8B 2QWQB 2QEXV 2P5OA 2HHHO 2B1GA 1MG1A 1KECA 1YZBA 3WU2Z 2UXCO 2QM4A 4I7ZB 1KC8W 3ZHTA 3J7AU 2EINB 2LQTA 3ZJZA 2FYUH 3OGCC 5IY5C 1VF6A 3D8CA 3WB2A 2R70A 1ZL8B 4H0LB 1KKCA 3E22A 1NU1H 2N05A 3B4SA 2VWKA 3K0DA 4PJ0Z 2Q7GA 1V9PA 1SQGA 1S0VA 1SKVA 2L6LA 2E76B 2HFEC 4ZI7A 2W6JG 1OCRB 2F4VO 4ZBMA 3HKBA 5JJEB 1P4RA 1MSDA 4JI6B 1N32O 1LR1A 2OTJV 4Z1MG 3K03A 4JI4B 1ZSPA 4DV4O 2B5UA 3ZHVA 1FJGO 5LP6A 1R6NA 2ZKOA 3H1LH 2JS5A 5L3EA 2A9HA 1VQ4V 1AJPA 2ZIMA 1RP3B 3RYFA 1NVPB 3SYCA 2OIGA 1QR9A 4X1KA 3QG5A 2BSKA 5CA3A 4MW8A 4QGPA 4UFZA 3RYHB 1BHAA 4ABMA 2UXCB 4DV2O 5CBHA 5FNVA 1LUVA 5EZYB 4FM2A 3SYPA 3CS5A 1WPBA 2GUZA 2R9AA 1Y74A 2E75B 3T1YB 4UXNA 4KXRA 1EM1A 4LNUA 3SPJA 3HKCA 5L3GA 2JEXA 1D5NA 2DWEC 1L1FA 2LFRA 3PJSK 2WLNA 4GT1A 4MTXA 1S3JA 3F5WC 4UCUA 4MTFA 1BHBA 3BEHA 4ZKIA 2EILC 3B40A 4IGGA 3CD6V 5L3BA 3AG2B 2A7WA 4J7JA 4TUYA 3SPIA 3I56V 1U96A 4EEQA 1Q5OA 2X6AA 4O4LA 1EFRG 3SJQC 2P4VA 1FS0G 4HBNA 3RYFB 1MMMA 3FB6C 3KG2A 1D5AA 1FXKC 4X1KB 2BSKB 3AG1B 1I7FA 3VQVA 3L73H 4G2KA 2ZNIA 3HPLC 1YITV 3CRCA 1JA8A 3CCEV 2V1DA 1Q6UA 1FPOA 2GUZB 3FFQA 4TQFA 1Y74B 4X62B 1SQPH 2JGUA 4IYIA 3ETGA 3A0BZ 4LNUB 5CA0A 3HKCB 5LHHA 4JI1B 2Y0PA 3D36C 3WG7C 2QTOA 3G6EV 3BPZA 4JI3B 2Q73A 4ZOLB 1Q82W 1RM1B 3L72H 3CCVV 4KUMA 1AI5A 3DC6A 4BW9A 5IYCO 3ABUA 3CX5F 1Y66A 4I50A 1MABG 2KB1A 3CHXA 5BMVA 3B09A 3JSNA 4G28B 3B8NA 4O4LB 1LNQA 3LDDA 1Q6HA 4QPJA 3N2GA 4BAYA 1M56B 2HR3A 4TV8A 2XT9A 2BOCC 3SJCC 2QSAA 2EIKB 2Q7EA 4LFBO 2OCCC 4BW5A 3OMAB 1Q7YW 1E1RG 1G4YB 3AG3C 3U10A 1JR9A 1VQOV 1WB8A 4DV0B 2C2AA 2KKWA 1GKFA 4N23A 5IJ9A 3BA9A 3JCZA 1HNZB 5LMUO 4B3TO 1QNMA 1XNQO 2EIMC 3OUSA 2UUCB 4FLYA 3NXSA 4DR2O 5FLXN 4ASUG 2V4DA 3R65A 3QTCA 5H9CA 4NTWA 4UVBA 4DV5O 3ZN0A 4EFBA 4LFAB 3SYQA 2Y48A 3N2GB 1L0LH 4LF7B 1BT8A 4QPKA 1ZLZA 2EIJC 4TV8B 2XASA 3L71H 1S72V 2Q68A 2WLKA 1QLNA 1ZAUA 1N0NA 5ITZB 1I5YA 5JH7A 2OYQA 5IYZA 4FLVA 1AJNA 3RGBA 2JVDA 4JI0O 4YY3B 5J2TA 4ICGA 1SC5B 4DO2A 3K59A 2QKCA 1H2LA 3X2QB 4JYAO 4X8AA 4R50A 4DV1O 4PI2A 1NBMG 2LO1A 1M90W 3EVKA 1FXVA 5KA5A 3S3XA 1CXZB 3G80A 4AQYB 3OMNB 1SF9A 1Q43A 3CCSV 2F93B 4O4IA 4GX0A 4RAIA 4OX9O 1DTOA 4D7TA 4JI5O 1R3IC 3K5MA 5CBGA 2Q67A 1X59A 2XOKG 1B3QA 1WJZA 2EILB 5FPRA 4DW1A 3JALA 3TXSA 2DOSA 4PDLA 3CXCU 5FL7G 3K3WA 5GTHZ 2F95B 4LF5B 1Y6XA 1O9HA 5J2TB 3TGUH 2XAGA 3ETQA 1IBMO 3QNEA 1V54C 2XTAA 4IT5A 3CMAV 4TWKA 1HP8A 3TJTA 5EIBD 2AHYA 3Q4HA 3LSQA 1KMIZ 3JD1A 1Q6IA 1Q8IA 1NZ6A 5LHGA 4E4EA 1H2GA 2YEVA 5KAIZ 4HYOA 4HNAA 4PA4A 3CCMV 1FFTB 5EIBC 4DV7B 4DR5O 3IGAC 4UCSA 2F43G 2CAZC 3WG7B 3K08A 3IC9A 4O2BB 3J80N 3FKSG 3DTUB 4RUEA 4QNHB 3CC2V 3BHPA 2HKOA 4MSWC 2WPDG 1HNXB 1F23A 1GH6A 1WPXA 5IDJA 1AP6A 3JALB 2PGGA 1DF5A 3EFFK 5B66Z 4DR3O 2HJFC 1I08A 2PZSA 4UCRA 5KLVH 3BRCA 4FZ0A 4I5SA 4MVQA 4K0KO 4PDVA 2JGDB 2YS8A 1QCEA 3CRAA 1JFFA 3LSUA 2ADQB 3HKEA 1XHZA 2OCCB 4KL1A 2D3OW 3T2MA 2ZE7A 3AG3B 3ABTA 2IW5A 1NTKH 1H8EG 4JI2O 4CS3A 2WLMA 4DR7B 4DV6O 4HNAB 2IH1C 2YC0A 3JARB 3QO7A 4X66O 4X20B 3FAVB 5B3SC 4YJ2A 1EN5A 3CC4V 2NNUA 1NI8A 1HWYA 4UB6Z 4LF4B 3IJ4A 2EIMB 4I9WA 4NXMB 4TV9B 4MVOA 1VEWA 3WB0A 4YJ3B 5BR8O 3JCUZ 1Y67A 2WLLA 3L75H 3ZRVA 3ETEA 1XMOO 1QVGU 4GYCB 1TGOA 4FVMA 4J80A 5FPOA 2EIJB 1MZEA 1P7BA 2A0LA 2WLHA 4GKJO 1GN2A 3LUTB 1PL4A 2ZIOA 4DR1B 1G8MA 2JJ1G 2ZE8A 4LF9O 3EHBB 4FLXA 4H33A 1SQBH 1GAXA 1PD3A 2K1EA 1RPOA 2FTKA 3QO8A 1N33O 1VARA 4JI8O 1WLEA 3VBBA 4B3SB 1P84F 4O2AB 1GMGA 1VQ6V 1BGYH 5K1XA 1FFXB 3ZMTA 2UXDO 2ZM6O 2ZDIA 4OPAA 3OMIB 4TOIA
chains in the Genus database with same CATH topology
1P4RA 1K7DA 3G71V 3OEEG 1N8RW 3GB7C 1DF4A 1TUEB 5IYDO 3OR7C 4XBFA 2LP7A 2OTJV 4WFGA 4Z1MG 3K03A 4TSFG 2UXNA 2P6JA 4QJFB 2B5UA 4FK5C 5EBWC 1R6NA 1B6QA 1VQMV 5L3EA 2A9HA 1VQ4V 3ZRSA 1AJPA 2DYRB 2WSSG 3K04A 4U7NA 1NVPB 3AEIA 3SYCA 4GX2A 4F4LA 1K3EA 4PA9A 3CCLV 1V54B 1OZ0A 1QR9A 1COWG 1BMFG 3SPGA 5CA3A 2X6CA 4MW8A 1BHAA 3RBZA 4WFFA 1KP2A 5CBHA 4QE9A 3SYPA 2H94A 2EZPA 1YTFD 4PELA 2HLDG 2A79B 3OR6C 4LC1A 4WFHA 2IJHA 4UXNA 4WFAV 5EC2C 1CPYA 2XNDG 2ZD9A 3SPJA 2X7RB 2XAJA 2XAQA 1VQKV 5L3GA 2JEXA 1JVMA 2DWEC 4G27B 1L1FA 3W7TA 1GM8A 2LFRA 3PJSK 2WLNA 2IJKA 4GT1A 4MTXA 3ZRWB 1S3JA 3ZMSA 3F5WC 4MTFA 3SYAA 1BHBA 3BEHA 2P67A 4MVMA 4ZKIA 1K9MW 5CN0A 4FPPA 3DGEA 1KQSU 2EILC 1MOFA 1PKXA 4JYBA 3FB8C 3IFXA 5L3BA 3CD6V 3AG2B 4Q20A 3SPIA 3JD4A 1AR1B 3I56V 3SPHA 5E1AC 2XAHA 3CYOA 3CCUV 3F7VC 2X6AA 3SJQC 1EFRG 2EINC 1S77D 2HVJC 2OT5A 4R6ZA 1NH2B 1FS0G 1ORQC 5B1BB 1ZWIC 1XL4A 4TT3G 4UVAA 1CEZA 1OCOC 2EZOA 3FB6C 3P32A 3KG2A 3RVYA 1K73W 1VQ7V 1FXKC 2MK3A 3ASNB 3AG1B 5IYBO 3STLC 4G2KA 2JK5C 1NKDA 3HPLC 1YITV 2JJ2G 3CCEV 2V1DA 2P90A 4J9ZB 3E89A 1K34A 1VQPV 4MVRA 4KFMA 1OCRC 1SZTA 2IJIA 4R7CA 5EBLC 1Q81W 3ETGA 3E8GA 3CC7V 1JOYA 1K4DC 5LHHA 3WG7C 2WLIB 2QTOA 3K06A 5B3SB 3G6EV 1SESA 4R8CA 1RM1B 3W7UA 3CCVV 1Q82W 4KUMA 1AI5A 2ZQMA 5IYCO 3ABUA 3E2EA 1Y66A 1MABG 2KB1A 2R9IA 2W0FC 2ZXWB 3ETDA 3OE7G 2W6IG 2DQ0A 1H8HG 4G28B 1VQNV 3ABLB 3B8NA 4CBCA 2NLJC 1LNQA 2YSUB 3LDDA 4HAMA 1F4MA 4QPJA 1K8AW 4JTCB 3P30A 4BAYA 1Y4MA 1SETA 3TK1A 1M56B 2HR3A 2EBOA 2BOCC 3F7YC 5GW7A 3ZRWA 3E8BA 3JYCA 3I55V 5EK0A 2EIKB 3MHSC 2OCCC 4BW5A 3OMAB 4UUJC 1Q7YW 1E1RG 5LGNA 1G4YB 3AG3C 4PA6A 3ZMUA 1V55C 1VQOV 3CP1A 5KA6A 4OXSA 3ABKC 2X6BA 5B1OA 2C2AA 3OEHG 3WFVA 3TETA 1GKFA 3G4SV 2ZDIC 3T1CA 4N23A 1NJIW 1M9NA 1PL0A 3JCZA 4PA3A 1QLEB 4MVZA 4E2LA 4LP8A 2LFSA 2GSMB 3FB7C 1E1QG 2DW4A 2WLJA 3HB3B 1YHQV 3SPCA 3MD0A 3K9AA 1QBZA 1JJ2U 4BIUA 1YSCA 1R3LC 2H8PC 4XDJA 3AG4B 1R3KC 5L3FA 4WF9V 2ITDC 2EIMC 3OUFA 3OUSA 4RO2A 2JIZG 3QO5A 3ASOC 3NXSA 4P30A 3ABMB 1QR8A 4ASUG 2Y69C 5B1AC 4PDRA 3R65A 5H9CA 4KP4A 4UVBA 3JD0A 5H6QA 3ZN0A 3W7SA 3OW2U 2IU0A 3SYQA 2Y48A 5LGUA 3FYIB 2WLIA 4QPKA 2EIJC 2DWDC 2XASA 2XAFA 1PNLA 1S72V 1NR1A 3OM3B 2Q68A 2WLKA 4XDKA 3M99B 1QLNA 1M1KW 2Q69A 2DYSC 2QA4V 1I5YA 3ZRXA 1PNMA 1K97A 1EBOA 1AJNA 1M57C 4JAUA 2QKSA 1YJWV 3ZMZA 1K92A 2YEVB 1EZJA 1VQ8V 1AI4A 4P9OA 1OCZC 1R3JC 4DO2A 4YXWG 3X2QB 4WFEA 4X8AA 4R50A 2WAMA 2X0LA 1NBMG 2IU3A 1M90W 1YI2V 3FB5C 1FXVA 4JASA 3MHHC 4WCEV 4JPRA 5KA5A 4UV8A 4JGSA 4EKWA 1K33A 3ZIAG 3JD3A 3OMNB 5KUKA 2R9RB 3FYEB 1AI6A 4RUFA 1H38A 4MT8A 3W7WA 3ABLC 5DN6G 2QM8A 5CMUA 5LBQA 3CCSV 1K5QA 4JYCA 4GX0A 1OCCC 3UM7A 4RAIA 1I5XA 3ZN1A 3CCJV 1DTOA 1VQ5V 2B1IA 5C93A 1R3IC 5CBGA 2Q67A 3LSSA 5HFLA 1IXMA 2XOKG 4UV9A 1NVPD 1SRYA 2EILB 3TCUA 4U7OA 4X88A 3SYOA 1AROP 4PDLA 3CXCU 5FL7G 3K3WA 3LNMB 4HZ3A 2DYRC 2CK3G 3GWOA 4CZZA 1AI7A 3E8FA 4MW3A 2JEUA 2XAGA 1J95A 3QNEA 1V54C 1OCOB 1KD1W 4GCZA 3CMAV 1K5SA 2ZR3A 4TWKA 4LCUC 4GX5A 4MVUA 4L87A 3W7XA 2AHYA 3UKMA 1JX9A 3LSQA 3JD1A 4H37A 3ABMC 5LHGA 1GTOA 1H2GA 4MVSA 2WLLB 1ROPA 1R73A 2Z3YA 2YEVA 1ENVA 5L3DA 1JQ0A 2ATKC 4HYOA 4PA4A 4GX1A 3E83A 3CCMV 1FFTB 4JAVA 3OFNG 5CBFA 4FJCC 4X89A 4FMTA 4RQFA 1YJ9V 3IGAC 4J9YB 2F43G 3LDEA 1JCHA 3T4ZA 5EBMC 2GHYA 3WG7B 5IY5B 2PI4A 3K08A 1CP9A 3FKSG 2UXXA 3K0GA 3ML0A 1NH2D 3DTUB 1FXHA 4RQEA 4RUEA 4QNHB 2HVKC 3CC2V 2QM7A 5BZBA 2HKOA 4MSWC 2WPDG 3AG2C 1F23A 3K79A 2OTLV 1WPXA 5IDJA 3B8MA 4JTDB 2AHZA 3RW0A 1E79G 1F4NA 1DF5A 3EFFK 5LHIA 4MTGA 2HJFC 3RVZA 1NQTA 1F51A 4QE7A 3STZC 2HG5C 3X2QC 5B1BC 1OHHG 3CCQV 3B77A 4I5SA 4MVQA 4XDLA 4PDVA 3VOUA 1DLBA 3ASNC 3CPWU 4QIWF 3AG1C 1QCEA 1AJQA 3E8HA 4LBEC 1W2BU 4UVCA 3T4DA 2OCCB 3D3IA 1XL6A 1NR7A 2P7TC 2D3OW 3T2MA 2PI5A 1YJNV 3AG3B 3E35A 3ABTA 1V55B 1UJWB 2IW5A 1H8EG 5L3CA 3ABKB 2IH3C 2WLMA 5H6RA 1BL8A 2V7QG 1GM9A 2Z5UA 4P9PA 2IH1C 1Q86W 2M7WA 1PNKA 3QO7A 2BOBC 5B3SC 1YIJV 4DXWA 1RM1C 3BY6A 1JPXA 1FXKA 3H01A 4PDMA 3CC4V 2NNUA 1HWYA 2EJRA 1QVFU 4JTAB 1S76D 2EIMB 4I9WA 5DM6V 4MVOA 1GO3F 1GK9A 1MSWD 3IC7A 4P2ZA 2ZXWC 3ASOB 2WLLA 2Y69B 3ZRVA 3JD2A 5B1AB 3ETEA 1THZA 1R6KA 4WFBV 1QVGU 5HFMA 1M56C 5B1NA 3D36A 1YTFB 2EIJB 1W0JG 2ZR2A 1RPRA 2JDIG 2WWWA 2EIKC 2Q6AA 1P7BA 2A0LA 2QE7G 2WLHA 1W0KG 2DYSB 3LUTB 2QEXV 4FIPC 4JF3A 1SERA 1VQ9V 1G8MA 1GM7A 2B1GA 1MG1A 5LGTA 1KECA 2JJ1G 2ITCC 1M57B 3EHBB 4N21A 3E86A 4H33A 3CMEV 5J9PC 4BIZA 2DQ3A 1KC8W 2EINB 1S5HC 3ZJZA 1OCZB 1PD3A 1QLEC 2K1EA 1RPOA 3OGCC 5IY5C 2FTKA 3QO8A 5EC1C 3ZMVA 3AG4C 1WLEA 1FXKB 3VBBA 5KUMA 1KKDA 3K0DA 4MS2A 1GMGA 1VQ6V 3A0RA 1S0VA 3LDCA 3ZCCA 4MTOA 3CCRV 2HFEC 3ZMTA 2W6JG 4PA7A 2IJJA 2ZDIA 1OCRB 3OMIB 4ZBMA 1OCCB 1K4CC 3OAAG 1VQLV 1KP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDV A;  3VOU A;  3WG7 C;  2WLI B;  2QTO A;  3K06 A;  3FB5 C;  3ASN C;  3GB7 C;  4R8C A;  3AG1 C;  3E8H A;  3OR7 C;  4LBE C;  4WFG A;  3K03 A;  3T4D A;  4EKW A;  1XL6 A;  2P7T C;  3T2M A;  5KUK A;  2KB1 A;  2W0F C;  2R9R B;  5EBW C;  4RUF A;  3ABL C;  2IH3 C;  2WLM A;  4G28 B;  1BL8 A;  4CBC A;  2A9H A;  1LNQ A;  2NLJ C;  3LDD A;  3ZRS A;  4GX0 A;  1OCC C;  4P9P A;  4RAI A;  2IH1 C;  3K04 A;  3UM7 A;  4JTC B;  3SYC A;  4GX2 A;  4F4L A;  4PA9 A;  2BOB C;  5B3S C;  2BOC C;  3F7Y C;  3SPG A;  4DXW A;  1R3I C;  3E8B A;  3JYC A;  5CBG A;  2X6C A;  4MW8 A;  2Q67 A;  4PDM A;  5EK0 A;  3RBZ A;  4WFF A;  5CBH A;  2OCC C;  4JTA B;  4QE9 A;  4BW5 A;  4I9W A;  4UUJ C;  3SYP A;  4MVO A;  3TCU A;  4X88 A;  1G4Y B;  3AG3 C;  4PA6 A;  1V55 C;  4P2Z A;  2ZXW C;  2WLL A;  2A79 B;  3ABK C;  4OXS A;  2X6B A;  3OR6 C;  4X8A A;  3SYO A;  4PDL A;  4WFH A;  5EC2 C;  3TET A;  3LNM B;  4HZ3 A;  2DYR C;  3T1C A;  2ZD9 A;  3SPJ A;  3E8F A;  4MW3 A;  4PA3 A;  4MVZ A;  4LP8 A;  1JVM A;  1M56 C;  2DWE C;  1J95 A;  4G27 B;  3FB7 C;  1V54 C;  2WLJ A;  3PJS K;  2WLN A;  3SPC A;  3F5W C;  4MTF A;  3SYA A;  4TWK A;  4LCU C;  1R3L C;  2EIK C;  2H8P C;  2Q6A A;  3BEH A;  4GX5 A;  1R3K C;  1P7B A;  2A0L A;  4MVU A;  2WLH A;  4MVM A;  2AHY A;  3UKM A;  3LUT B;  2ITD C;  2EIM C;  2EIL C;  3OUF A;  3OUS A;  3FB8 C;  3IFX A;  4H37 A;  4RO2 A;  3ABM C;  4MVS A;  3ASO C;  4P30 A;  2ITC C;  2WLL B;  3SPI A;  2Y69 C;  5E1A C;  3E86 A;  3SPH A;  2YEV A;  4H33 A;  3F7V C;  2X6A A;  5B1A C;  3SJQ C;  4PDR A;  3R65 A;  4HYO A;  2ATK C;  4PA4 A;  5J9P C;  2EIN C;  4XDL A;  4GX1 A;  3E83 A;  2HVJ C;  4R6Z A;  5CBF A;  4X89 A;  1ORQ C;  1S5H C;  3ZJZ A;  1QLE C;  3IGA C;  2K1E A;  3SYQ A;  4J9Y B;  3OGC C;  1ZWI C;  1XL4 A;  3LDE A;  5IY5 C;  1OCO C;  3FB6 C;  3T4Z A;  2WLI A;  5EBM C;  2EIJ C;  3K08 A;  3KG2 A;  3RVY A;  2DWD C;  5EC1 C;  1KKD A;  3AG4 C;  3K0G A;  2Q68 A;  2WLK A;  4XDK A;  2Q69 A;  2DYS C;  4RUE A;  2HVK C;  5KUM A;  3K0D A;  3STL C;  4QNH B;  4MS2 A;  5BZB A;  2JK5 C;  4MSW C;  3HPL C;  3AG2 C;  4J9Z B;  3E89 A;  1M57 C;  2AHZ A;  4JTD B;  3RW0 A;  2QKS A;  3LDC A;  4MVR A;  3EFF K;  4KFM A;  2HFE C;  4MTO A;  1OCR C;  2HJF C;  4MTG A;  4R7C A;  5EBL C;  3RVZ A;  4PA7 A;  4QE7 A;  3STZ C;  4P9O A;  3E8G A;  2HG5 C;  4ZBM A;  3X2Q C;  1K4C C;  1OCZ C;  1R3J C;  4XDJ A;  5B1B C;  4WFE A;  4MVQ A;  1K4D C;  4R50 A; 
#chains in the Genus database with same CATH topology
 1GN6 A;  2P06 A;  5H5N A;  4JV5 O;  4K8X A;  2LP7 A;  4WFG A;  4RWU A;  4J10 A;  1B6Q A;  4X65 O;  1VQM V;  3H1I H;  2CDY A;  4U7N A;  1XI1 A;  2Q0O C;  4F4L A;  4B3M B;  3U0Z A;  3JAT B;  1V54 B;  2UUA B;  2CUG A;  3FD9 A;  2KG7 B;  3I5D A;  4NKG B;  2X6C A;  4WFF A;  1WA8 A;  4CS2 A;  1KP2 A;  3SR2 C;  2EZP A;  1YTF D;  4PEL A;  2L35 A;  2OCH A;  3OR6 C;  2IJH A;  4WFA V;  4IL6 Z;  2ZD9 A;  1M93 A;  4UCO A;  1WP8 A;  1JVM A;  3W7T A;  1GM8 A;  3B2E E;  3ZMS A;  2E5L O;  1ZL8 A;  1ZTE A;  4PI0 A;  5IJ0 B;  4MVM A;  1K9M W;  3CE2 A;  3KCY A;  1MOF A;  1PKX A;  4B3R B;  3SPH A;  5E1A C;  1PP9 H;  2XAH A;  4IHJ B;  2E3C A;  3CCU V;  2F1M A;  4JYY A;  1US6 A;  1ZWI C;  1XL4 A;  1CEZ A;  2EZO A;  2QGN A;  3P32 A;  3RVY A;  1K73 W;  4AIL C;  4UCV A;  3VQY A;  4YIP A;  2P4K A;  3STL C;  5IWA O;  1RSO B;  2A06 H;  2P90 A;  3T1H B;  1VQP V;  4KFM A;  4R7C A;  3DC5 A;  2VQE O;  1JOY A;  3HKD B;  1K4D C;  1EN6 A;  5B3S B;  3FX7 A;  1R6T A;  4R8C A;  3RYH A;  3QVN A;  2MW2 B;  5EZY A;  3RYC A;  2Q7H A;  4CH4 A;  2KSD A;  1NT2 B;  2DN9 A;  2DQ0 A;  1VQN V;  3ABL B;  4CBC A;  4HAM A;  1F4M A;  1K8A W;  4CH5 A;  1Y4M A;  1SET A;  2GV9 A;  3QF7 A;  5TIS Z;  5GW7 A;  3JYC A;  2XUM A;  5EK0 A;  4O4J B;  4GZR B;  2DE0 X;  2BE3 A;  2JS3 A;  5LA6 B;  3ZMU A;  1V55 C;  2Q0A A;  1QU7 A;  3CP1 A;  3P3N A;  5KA6 A;  2UUB O;  5CB4 B;  5C8Y B;  3G4S V;  3WFV A;  4W4K A;  1T5E A;  4E2L A;  2VQF O;  4LP8 A;  3BAB A;  1OJH A;  2WLJ A;  3SPC A;  2BTQ B;  4NB5 A;  4BIU A;  2HHH B;  2YXL A;  5L3F A;  2ITD C;  5D5Q A;  3CSX A;  3RYC B;  3KCX A;  2JIZ G;  3ABM B;  4KP4 A;  1W59 A;  2ODM A;  3OW2 U;  2IU0 A;  5LGU A;  1YDX A;  1I94 O;  2AGA A;  1DK1 A;  1YXB A;  4LH7 A;  2DWD C;  2XAF A;  4ZOL A;  3JAK B;  3PN1 A;  5LXT B;  1M1K W;  2F66 C;  2Q69 A;  2DYS C;  4IIJ B;  4J11 A;  4J7K A;  4H13 B;  1EBO A;  2F4V B;  1EZJ A;  3M8A A;  3OTO O;  4P9O A;  2EX3 A;  5JCO A;  1N32 B;  1R3J C;  3L9D A;  4NXN O;  4WFE A;  1XIL A;  4LR3 A;  3A8T A;  3FB5 C;  3MHH C;  4JPR A;  4DV4 B;  1FJG B;  4UV8 A;  4JGS A;  4EKW A;  2CH7 A;  2BCC H;  4CC6 A;  3BA8 A;  5GTI Z;  1H38 A;  3W7W A;  4YHH O;  2QM8 A;  5LBQ A;  1K5Q A;  2AZ0 A;  4JYC A;  4K3A A;  3ZN1 A;  1IBK O;  1VQ5 V;  4JAA A;  3R66 A;  4DV2 B;  2B1I A;  4NYK A;  5C93 A;  4FZ1 A;  4D7S A;  3CB2 A;  5HFL A;  1TVK B;  4UV9 A;  3RFR A;  1BSM A;  3TXQ A;  3KKY A;  2QWP B;  1WB7 A;  4JI7 O;  4A5U B;  2YIC A;  1AB3 A;  3SYO A;  2GTA A;  2FML A;  2DYR C;  1L8D A;  3UO2 A;  3K5N A;  1MA1 A;  2ZR3 A;  3BFR A;  4LCU C;  4GX5 A;  4MVU A;  3W7X A;  3UKM A;  5ITZ A;  2CH7 B;  1Y76 A;  1Q3E A;  1GTO A;  4CC5 A;  1ROP A;  5JVD A;  1JQ0 A;  2ATK C;  4DR4 O;  4JAV A;  4X89 A;  4FMT A;  1MZF A;  4RQF A;  3C3S A;  3WB1 A;  4J41 A;  5IY5 B;  4GUN A;  2PTM A;  3ML0 A;  4DV3 O;  4RQE A;  2QM7 A;  3K79 A;  2OTL V;  1YF2 A;  3RW0 A;  1F4N A;  1FKA O;  1EZV H;  3H9V A;  5LHI A;  2PF4 E;  4MTG A;  2ZT9 B;  4QE7 A;  2VWJ A;  5B1B C;  1OHH G;  3B77 A;  3CXH F;  2XHB A;  3VOU A;  1HDJ A;  1P7G A;  3M7M X;  1BZK A;  1W2B U;  1FYJ A;  3T4D A;  3RYI B;  3N27 A;  1XL6 A;  2W0X A;  3BCC H;  1Y76 B;  2PI5 A;  1YJN V;  1UJW B;  1V55 B;  4Z1V A;  1VMG A;  1BL8 A;  5JVD B;  4GKK O;  2Q5Z A;  5KAF Z;  2Z5U A;  4P9P A;  2RJZ A;  2ETN A;  1AVM A;  4LFB B;  3JAW A;  3H01 A;  1FXK A;  2ILM A;  5DED A;  5DM6 V;  2M6Y A;  1GO3 F;  1MSW D;  5LYJ B;  3MAQ A;  2UU9 O;  2WA3 A;  1R6K A;  4WFB V;  5LMU B;  3OGI B;  4KHP O;  4B3T B;  1XNR O;  4DK0 A;  4FLU A;  3OTF A;  5B1N A;  3D36 A;  1XNQ B;  1W0J G;  2ZR2 A;  4O2B A;  3K5L A;  2WWW A;  2ADP A;  2Q6A A;  4LFC O;  1GRJ A;  4DR2 B;  1W0K G;  2DYS B;  1SER A;  1VQ9 V;  1GM7 A;  5LGT A;  4DV5 B;  2GBO A;  2ITC C;  4N21 A;  3CME V;  1H2K A;  5J9P C;  1XMQ O;  1QLE C;  3H1H H;  2JGD A;  5KMG B;  1QQC A;  2NN4 A;  5EC1 C;  3JAW B;  3AG4 C;  1RFY A;  1FXK B;  3APO A;  1KKD A;  2YXY A;  4MS2 A;  4FM1 A;  4JI0 B;  3SJA C;  3LDC A;  2F23 A;  4JYA B;  4DV1 B;  1IBL O;  2IJJ A;  1FAF A;  4X1Y B;  1K4C C;  1VQL V;  1TUB A;  4OPH A;  1BS3 A;  3THO A;  2YIB D;  5E79 Z;  1KP3 A;  3JAR A;  5K1P A;  1G1X B;  4X20 A;  3G71 V;  3OEE G;  3FAV A;  1DF4 A;  1F7Y A;  3K57 A;  1XOU A;  2UXN A;  4I0X B;  4TV9 A;  4YJ3 A;  4QJF B;  4OX9 B;  1AR5 A;  1SS3 A;  4FLT A;  1MNG A;  3JAS B;  2DYR B;  5KHH A;  4JI5 B;  3K04 A;  1IX9 A;  1OZ0 A;  4OGQ B;  3RBZ A;  2RDC A;  4DR6 O;  2RMK B;  1HW7 A;  2A79 B;  4LC1 A;  5GON B;  4WFH A;  1IBM B;  2UXB O;  3C90 A;  2X7R B;  3RN4 A;  1VQK V;  1TUB B;  1ZX3 A;  2RNB A;  4J42 A;  3ZRW B;  3SYA A;  2ZCE A;  2P67 A;  2PUS A;  4FPP A;  3DGE A;  3BAA A;  4DUZ O;  3UT5 B;  3FB8 C;  3IFX A;  4IYH A;  1SQQ H;  4O2A A;  2QJ1 A;  5AG2 A;  1AR1 B;  4DR5 B;  1XEQ A;  3CYO A;  3F7V C;  4WBN A;  2OWO A;  1FFX A;  2EIN C;  1S77 D;  2JRI A;  1J5E O;  4R6Z A;  5B1B B;  3D3Q A;  4UVA A;  4FFB B;  1YCI A;  4L8J A;  1VQ7 V;  2MK3 A;  1BQ0 A;  4DR3 B;  2JJ2 G;  3JAM N;  2ZNJ A;  1LUW A;  3E89 A;  4W4L A;  2FB5 A;  4X64 O;  4X1I A;  4K0K B;  4I4T A;  1OCR C;  3SDL A;  5EBL C;  4NTX A;  1YEW A;  3SGI A;  2WLI B;  3JAT A;  3K06 A;  4CH3 A;  2Y0I A;  2KG7 A;  1N36 O;  3GWK C;  4DUY O;  1HNW O;  2ZQM A;  4JI2 B;  1M4U A;  3E2E A;  2UXB B;  4DV6 B;  2ZIN A;  1N0J A;  3OE7 G;  4WBN B;  4X66 B;  1FD9 A;  2Q9L A;  1VIB A;  4JTC B;  1XQ8 A;  2EBO A;  3F7Y C;  2QR4 A;  3I55 V;  5IJ0 A;  5BR8 B;  4B7E A;  5LGN A;  1U97 A;  1XMO B;  3ABK C;  4IHJ A;  4AHC A;  4X1I B;  3OEH G;  3ZBH A;  4I4T B;  2ARH A;  3T1C A;  4PA3 A;  1QLE B;  1KB9 F;  3SJB C;  4U3J B;  2FKX A;  4GKJ B;  2CGN A;  3MD0 A;  3HR0 A;  1QBZ A;  3K9A A;  1YSC A;  1R3L C;  2H8P C;  4XDJ A;  3AG4 B;  1R3K C;  1N34 O;  2N74 A;  5JQG B;  4LF9 B;  1RSO A;  4RO2 A;  3QO5 A;  5LP6 C;  1BQZ A;  4P30 A;  1QR8 A;  5B1A C;  4PDR A;  1N33 B;  3JD0 A;  4JI8 B;  3W7S A;  1XHX A;  1D2D A;  3AK3 A;  3CRQ A;  3HKD A;  3FYI B;  3RT3 C;  3U11 A;  4FM0 A;  4XDK A;  3CJH B;  1PNM A;  2UXD B;  2ZM6 B;  1M57 C;  4JAU A;  1WP7 A;  1YJW V;  1K92 A;  4DK1 A;  1VQ8 V;  2AW9 A;  4JV5 B;  2BTO A;  1OCZ C;  4YXW G;  3RWR D;  3CRM A;  3IAY A;  2WAM A;  2IU3 A;  1YI2 V;  1SQX H;  1O9G A;  4WCE V;  4O4J A;  4X65 B;  3ZIA G;  4JI6 O;  3JD3 A;  2O57 A;  5KUK A;  2HEP A;  5LA6 A;  4CH6 A;  2A3Q A;  1AI6 A;  4JI4 O;  2KQX A;  1IZ3 A;  2QDO A;  4MT8 A;  1XDC A;  1KUQ A;  2CTW A;  5DN6 G;  5CB4 A;  5C8Y A;  5CMU A;  3ZHU A;  1OCC C;  3UM7 A;  3H1K H;  2WA4 A;  3GVM A;  2BTQ A;  3LSS A;  1SRY A;  4U7O A;  4X88 A;  2DMX A;  4LF6 O;  5KHJ A;  2E5L B;  2CK3 G;  3GWO A;  4CZZ A;  3E8F A;  1AR4 A;  4MW3 A;  3T1Y O;  1J95 A;  1A32 A;  3JAK A;  4YIO A;  5LXT A;  4L87 A;  4FLW A;  4IIJ A;  1JX9 A;  3LNN A;  2VS0 A;  4MVS A;  5J2U A;  2Z3Y A;  1ENV A;  4GLX A;  1P49 A;  1Q90 D;  4BWA A;  4GX1 A;  3E83 A;  1YJ9 V;  5EYP B;  3OFN G;  2HJD A;  5JJJ B;  1WN7 A;  4J9Y B;  3LDE A;  5IWA B;  4F6R B;  1JCH A;  3T4Z A;  5KX5 A;  2HP8 A;  1CP9 A;  2UXX A;  1NH2 D;  3K58 A;  3CEI A;  2HVK C;  1XUQ A;  2LW1 A;  2VRZ A;  3B8M A;  4JTD B;  2VQE B;  1NTM H;  1NQT A;  1F51 A;  3STZ C;  3X2Q C;  3CCQ V;  2YXH A;  2QWR B;  4X62 O;  4XDL A;  3H1J H;  4JZ2 A;  5IT9 N;  3CPW U;  3ASN C;  3E22 B;  3CRR A;  3P3P A;  4LBE C;  4JI1 O;  1TVK A;  4LF6 B;  4LF8 O;  4JI3 O;  2P7T C;  4O4H A;  3E35 A;  1IUR A;  4NR1 A;  5J2U B;  3ABK B;  2IH3 C;  4ZI7 B;  3HKB B;  1Z5W A;  4F6E A;  2M7W A;  1PNK A;  1YIJ V;  4DXW A;  1B04 A;  3ICX A;  3BVO A;  3BY6 A;  5KX5 B;  2PYL A;  3K9S A;  2EJR A;  2PYJ A;  2UUB B;  4JTA B;  4Q6G A;  1B06 A;  4K8Z A;  3IC7 A;  5LP6 B;  2ZXW C;  3VQW A;  5KHK A;  2VQF B;  3J81 N;  3F5T A;  5B1A B;  2CTQ A;  4DV0 O;  1JMK C;  3G67 A;  2CTR A;  1YTF B;  3MDS A;  1RPR A;  2QE7 G;  1HNZ O;  5FNV B;  5CA1 A;  4FIP C;  4JF3 A;  1HR0 O;  2YUA A;  1M57 B;  4O4H B;  5BY1 A;  1QHT A;  3E86 A;  2UUC O;  1I94 B;  3JSL A;  4BIZ A;  2DQ3 A;  4H44 B;  1S5H C;  1OCZ B;  2D2C B;  4Z2W A;  4LF8 B;  3ZMV A;  4LFA O;  2FL4 A;  4AI8 A;  4LF7 O;  5KUM A;  3RYI A;  2EJ7 A;  2QKA A;  3A0R A;  3OTO B;  4TUY B;  4CS4 A;  3ZHR A;  4NXN B;  3ZCC A;  4MTO A;  3CCR V;  1YVW A;  4PA7 A;  1OCC B;  3OAA G;  2G38 A;  1K7D A;  4YY3 O;  1BCC H;  1N8R W;  3GB7 C;  1IXB A;  1TUE B;  2IM9 A;  3ZED A;  3OR7 C;  4XBF A;  5IYD O;  4TSF G;  4FFK A;  4YHH B;  5CA1 B;  2P6J A;  1S5L Z;  4FK5 C;  5EBW C;  3OT7 A;  5LYJ A;  1IBK B;  4AQY O;  2CTP A;  3ZRS A;  1EN4 A;  2WSS G;  5CA0 B;  3AEI A;  4GX2 A;  1K3E A;  4PA9 A;  3CCL V;  1HR0 B;  1COW G;  1BMF G;  3SPG A;  1R1B A;  3UCS C;  3UQ8 A;  1SA0 A;  4JI7 B;  2E74 B;  4QE9 A;  2H94 A;  4I50 B;  2DJV A;  2YDE A;  5DEC A;  2EUL A;  2HLD G;  5BMV B;  2PY5 A;  5D5P A;  1KU9 A;  1CPY A;  1TA8 A;  5EC2 C;  2XND G;  4TQD A;  2B9Z A;  2XAJ A;  2XAQ A;  4LH6 A;  4I55 A;  4G27 B;  4LF5 O;  5KMG A;  2IJK A;  1XRE A;  2QWO B;  2AZ2 A;  5CN0 A;  4UB8 Z;  1KQS U;  4JYB A;  2P22 C;  5A2Q N;  4DR4 B;  4Q20 A;  3JD4 A;  2Z0A A;  1H2N A;  2N04 A;  2HVJ C;  2OT5 A;  4LWS A;  5IJ9 B;  4X1Y A;  1SZX A;  1NH2 B;  1ORQ C;  3UO3 A;  3DXR A;  4DV3 B;  4TT3 G;  1UFI A;  1OCO C;  2QWN B;  1N4C A;  4DV7 O;  3ASN B;  3O65 A;  3APQ A;  5IYB O;  1SA0 B;  3G6B A;  4NTY A;  2JK5 C;  1NKD A;  4I0X A;  1I0H A;  4J9Z B;  4FLZ A;  1K34 A;  4MVR A;  2RN9 A;  1SZT A;  2OIE A;  2IJI A;  1HNX O;  1SQF A;  1Q81 W;  3JAS A;  2K9P A;  3E8G A;  4U3F H;  3CC7 V;  4B08 A;  2Y4U A;  4I55 B;  5H2F Z;  1SES A;  3W7U A;  4PD4 F;  5JH7 B;  5IYZ B;  2QTS A;  2LGQ A;  2R9I A;  2W0F C;  4GKK B;  1ZUQ A;  3L70 H;  2ZXW B;  3ETD A;  3NR7 A;  2W6I G;  5GON A;  1H8H G;  2NLJ C;  2YSU B;  4LWS B;  3P30 A;  4DR7 O;  3A2F A;  3DXR B;  3TK1 A;  1X4T A;  3ZRW A;  3E8B A;  2LW7 A;  2GDS A;  5LMN O;  2YID A;  3MHS C;  1SQV H;  2UU9 B;  4UUJ C;  3UT5 A;  1Z2G A;  4BIO A;  4PA6 A;  4KHP B;  1DGS A;  1XNR B;  4LF4 O;  4OXS A;  3AK1 A;  2X6B A;  4NXM O;  5B1O A;  3TET A;  2ZDI C;  4O4I B;  2Y4T A;  1NJI W;  1UPG A;  1PM9 A;  1M9N A;  1PL0 A;  4K35 A;  4MVZ A;  2LFS A;  2GSM B;  4LFC B;  4NVP A;  1AP5 A;  3FB7 C;  1E1Q G;  1G6U A;  2DW4 A;  4FFB A;  3HB3 B;  1YHQ V;  5JJN B;  4PV1 B;  4DRX A;  1JJ2 U;  3N2K A;  4WF9 V;  4DYL A;  2NR5 A;  3OUF A;  1VF7 A;  1XMQ B;  3ASO C;  5F2V O;  2Y69 C;  4DR1 O;  3DSQ A;  5H6Q A;  2WLI A;  1S5J A;  2CE4 A;  1PNL A;  5KHI A;  1NR1 A;  1H2S B;  3OM3 B;  5B5E Z;  3M99 B;  3AG7 A;  3Q4H B;  2QA4 V;  4X9Q A;  3ZRX A;  1K97 A;  1IBL B;  4I9Q A;  4B3S O;  4D6T H;  2QKS A;  3ZMZ A;  2YEV B;  4EB6 A;  1AIL A;  1AI4 A;  3ZHS A;  5LMN B;  1M5I A;  2X0L A;  3O9O A;  2RCV A;  4JAS A;  4DRX B;  3C3T A;  3ZX6 A;  2RQ6 A;  1PV0 A;  3N2K B;  3L74 H;  2GTS A;  1VF5 B;  1K33 A;  4UCT A;  2R9R B;  3FYE B;  3AK2 A;  4RUF A;  3OD4 A;  2YIA A;  3ABL C;  4C7U A;  1PPJ H;  1I5X A;  3CCJ V;  5KHG A;  5LOV A;  4U3J A;  2YI8 A;  1VP7 A;  4DR6 B;  1IXM A;  1IDS A;  1JFF B;  4B3M O;  3HKE B;  1NVP D;  5JQG A;  2UUA O;  3TCU A;  2H3O A;  1XBL A;  4DW0 A;  2ZE5 A;  3CWB H;  1ARO P;  1NTZ H;  3LNM B;  4EB6 B;  4HZ3 A;  1BE3 H;  1IVS A;  1AI7 A;  2JEU A;  2R72 A;  1VF6 C;  1OCO B;  1KD1 W;  5LL6 Y;  4GCZ A;  4YJ2 B;  4DUZ B;  1K5S A;  2AXT Z;  1OV9 A;  5A9G A;  3CJH A;  4H37 A;  3ABM C;  1J5E B;  2YIB A;  2WLL B;  1R73 A;  1H2M A;  5L3D A;  3ZS8 C;  1NS1 A;  5CBF A;  4B3R O;  4FJC C;  2IBZ H;  2CGO A;  4ZIB A;  5LOV B;  5EBM C;  2GHY A;  2PI4 A;  3K0G A;  1FXH A;  1L0N H;  4X64 B;  2Q4P A;  5BZB A;  3K5O A;  3AG2 C;  1Z5V A;  4EFE A;  2AHZ A;  1E79 G;  2ZE6 A;  3RVZ A;  2HG5 C;  4PHZ A;  3T1H O;  1N36 B;  4BR6 A;  2Q8V A;  5JWP A;  4DUY B;  1KYO F;  1HNW B;  1DLB A;  4QIW F;  3S3W A;  3AG1 C;  4ZHQ A;  1KBH A;  1AJQ A;  3E8H A;  3KZI Z;  4UVC A;  3VQX A;  3D3I A;  1NR7 A;  5L3C A;  4J7Z A;  5H6R A;  5IE9 A;  2V7Q G;  1GM9 A;  1GN4 A;  1Q86 W;  2YI9 A;  1URF A;  1GN3 A;  2BOB C;  1RM1 C;  1JPX A;  1WAZ A;  4PDM A;  1WNS A;  1JJO A;  1QVF U;  1S76 D;  3EXA A;  1TAE A;  4JZG A;  5BXZ A;  1GK9 A;  3A0H Z;  4P2Z A;  3ASO B;  3ZHQ A;  2Y69 B;  3JD2 A;  1THZ A;  4B7K A;  2LJ2 A;  5JCO C;  5EYP A;  2LGW A;  5HFM A;  1M56 C;  1N34 B;  4F6R A;  2JDI G;  2EIK C;  4ZHQ B;  1WA8 B;  2QWQ B;  2QEX V;  2P5O A;  2HHH O;  2B1G A;  1MG1 A;  1KEC A;  1YZB A;  3WU2 Z;  2UXC O;  2QM4 A;  4I7Z B;  1KC8 W;  3ZHT A;  3J7A U;  2EIN B;  2LQT A;  3ZJZ A;  2FYU H;  3OGC C;  5IY5 C;  1VF6 A;  3D8C A;  3WB2 A;  2R70 A;  1ZL8 B;  4H0L B;  1KKC A;  3E22 A;  1NU1 H;  2N05 A;  3B4S A;  2VWK A;  3K0D A;  4PJ0 Z;  2Q7G A;  1V9P A;  1SQG A;  1S0V A;  1SKV A;  2L6L A;  2E76 B;  2HFE C;  4ZI7 A;  2W6J G;  1OCR B;  2F4V O;  4ZBM A;  3HKB A;  5JJE B;  1P4R A;  1MSD A;  4JI6 B;  1N32 O;  1LR1 A;  2OTJ V;  4Z1M G;  3K03 A;  4JI4 B;  1ZSP A;  4DV4 O;  2B5U A;  3ZHV A;  1FJG O;  5LP6 A;  1R6N A;  2ZKO A;  3H1L H;  2JS5 A;  5L3E A;  2A9H A;  1VQ4 V;  1AJP A;  2ZIM A;  1RP3 B;  3RYF A;  1NVP B;  3SYC A;  2OIG A;  1QR9 A;  4X1K A;  3QG5 A;  2BSK A;  5CA3 A;  4MW8 A;  4QGP A;  4UFZ A;  3RYH B;  1BHA A;  4ABM A;  2UXC B;  4DV2 O;  5CBH A;  5FNV A;  1LUV A;  5EZY B;  4FM2 A;  3SYP A;  3CS5 A;  1WPB A;  2GUZ A;  2R9A A;  1Y74 A;  2E75 B;  3T1Y B;  4UXN A;  4KXR A;  1EM1 A;  4LNU A;  3SPJ A;  3HKC A;  5L3G A;  2JEX A;  1D5N A;  2DWE C;  1L1F A;  2LFR A;  3PJS K;  2WLN A;  4GT1 A;  4MTX A;  1S3J A;  3F5W C;  4UCU A;  4MTF A;  1BHB A;  3BEH A;  4ZKI A;  2EIL C;  3B40 A;  4IGG A;  3CD6 V;  5L3B A;  3AG2 B;  2A7W A;  4J7J A;  4TUY A;  3SPI A;  3I56 V;  1U96 A;  4EEQ A;  1Q5O A;  2X6A A;  4O4L A;  1EFR G;  3SJQ C;  2P4V A;  1FS0 G;  4HBN A;  3RYF B;  1MMM A;  3FB6 C;  3KG2 A;  1D5A A;  1FXK C;  4X1K B;  2BSK B;  3AG1 B;  1I7F A;  3VQV A;  3L73 H;  4G2K A;  2ZNI A;  3HPL C;  1YIT V;  3CRC A;  1JA8 A;  3CCE V;  2V1D A;  1Q6U A;  1FPO A;  2GUZ B;  3FFQ A;  4TQF A;  1Y74 B;  4X62 B;  1SQP H;  2JGU A;  4IYI A;  3ETG A;  3A0B Z;  4LNU B;  5CA0 A;  3HKC B;  5LHH A;  4JI1 B;  2Y0P A;  3D36 C;  3WG7 C;  2QTO A;  3G6E V;  3BPZ A;  4JI3 B;  2Q73 A;  4ZOL B;  1Q82 W;  1RM1 B;  3L72 H;  3CCV V;  4KUM A;  1AI5 A;  3DC6 A;  4BW9 A;  5IYC O;  3ABU A;  3CX5 F;  1Y66 A;  4I50 A;  1MAB G;  2KB1 A;  3CHX A;  5BMV A;  3B09 A;  3JSN A;  4G28 B;  3B8N A;  4O4L B;  1LNQ A;  3LDD A;  1Q6H A;  4QPJ A;  3N2G A;  4BAY A;  1M56 B;  2HR3 A;  4TV8 A;  2XT9 A;  2BOC C;  3SJC C;  2QSA A;  2EIK B;  2Q7E A;  4LFB O;  2OCC C;  4BW5 A;  3OMA B;  1Q7Y W;  1E1R G;  1G4Y B;  3AG3 C;  3U10 A;  1JR9 A;  1VQO V;  1WB8 A;  4DV0 B;  2C2A A;  2KKW A;  1GKF A;  4N23 A;  5IJ9 A;  3BA9 A;  3JCZ A;  1HNZ B;  5LMU O;  4B3T O;  1QNM A;  1XNQ O;  2EIM C;  3OUS A;  2UUC B;  4FLY A;  3NXS A;  4DR2 O;  5FLX N;  4ASU G;  2V4D A;  3R65 A;  3QTC A;  5H9C A;  4NTW A;  4UVB A;  4DV5 O;  3ZN0 A;  4EFB A;  4LFA B;  3SYQ A;  2Y48 A;  3N2G B;  1L0L H;  4LF7 B;  1BT8 A;  4QPK A;  1ZLZ A;  2EIJ C;  4TV8 B;  2XAS A;  3L71 H;  1S72 V;  2Q68 A;  2WLK A;  1QLN A;  1ZAU A;  1N0N A;  5ITZ B;  1I5Y A;  5JH7 A;  2OYQ A;  5IYZ A;  4FLV A;  1AJN A;  3RGB A;  2JVD A;  4JI0 O;  4YY3 B;  5J2T A;  4ICG A;  1SC5 B;  4DO2 A;  3K59 A;  2QKC A;  1H2L A;  3X2Q B;  4JYA O;  4X8A A;  4R50 A;  4DV1 O;  4PI2 A;  1NBM G;  2LO1 A;  1M90 W;  3EVK A;  1FXV A;  5KA5 A;  3S3X A;  1CXZ B;  3G80 A;  4AQY B;  3OMN B;  1SF9 A;  1Q43 A;  3CCS V;  2F93 B;  4O4I A;  4GX0 A;  4RAI A;  4OX9 O;  1DTO A;  4D7T A;  4JI5 O;  1R3I C;  3K5M A;  5CBG A;  2Q67 A;  1X59 A;  2XOK G;  1B3Q A;  1WJZ A;  2EIL B;  5FPR A;  4DW1 A;  3JAL A;  3TXS A;  2DOS A;  4PDL A;  3CXC U;  5FL7 G;  3K3W A;  5GTH Z;  2F95 B;  4LF5 B;  1Y6X A;  1O9H A;  5J2T B;  3TGU H;  2XAG A;  3ETQ A;  1IBM O;  3QNE A;  1V54 C;  2XTA A;  4IT5 A;  3CMA V;  4TWK A;  1HP8 A;  3TJT A;  5EIB D;  2AHY A;  3Q4H A;  3LSQ A;  1KMI Z;  3JD1 A;  1Q6I A;  1Q8I A;  1NZ6 A;  5LHG A;  4E4E A;  1H2G A;  2YEV A;  5KAI Z;  4HYO A;  4HNA A;  4PA4 A;  3CCM V;  1FFT B;  5EIB C;  4DV7 B;  4DR5 O;  3IGA C;  4UCS A;  2F43 G;  2CAZ C;  3WG7 B;  3K08 A;  3IC9 A;  4O2B B;  3J80 N;  3FKS G;  3DTU B;  4RUE A;  4QNH B;  3CC2 V;  3BHP A;  2HKO A;  4MSW C;  2WPD G;  1HNX B;  1F23 A;  1GH6 A;  1WPX A;  5IDJ A;  1AP6 A;  3JAL B;  2PGG A;  1DF5 A;  3EFF K;  5B66 Z;  4DR3 O;  2HJF C;  1I08 A;  2PZS A;  4UCR A;  5KLV H;  3BRC A;  4FZ0 A;  4I5S A;  4MVQ A;  4K0K O;  4PDV A;  2JGD B;  2YS8 A;  1QCE A;  3CRA A;  1JFF A;  3LSU A;  2ADQ B;  3HKE A;  1XHZ A;  2OCC B;  4KL1 A;  2D3O W;  3T2M A;  2ZE7 A;  3AG3 B;  3ABT A;  2IW5 A;  1NTK H;  1H8E G;  4JI2 O;  4CS3 A;  2WLM A;  4DR7 B;  4DV6 O;  4HNA B;  2IH1 C;  2YC0 A;  3JAR B;  3QO7 A;  4X66 O;  4X20 B;  3FAV B;  5B3S C;  4YJ2 A;  1EN5 A;  3CC4 V;  2NNU A;  1NI8 A;  1HWY A;  4UB6 Z;  4LF4 B;  3IJ4 A;  2EIM B;  4I9W A;  4NXM B;  4TV9 B;  4MVO A;  1VEW A;  3WB0 A;  4YJ3 B;  5BR8 O;  3JCU Z;  1Y67 A;  2WLL A;  3L75 H;  3ZRV A;  3ETE A;  1XMO O;  1QVG U;  4GYC B;  1TGO A;  4FVM A;  4J80 A;  5FPO A;  2EIJ B;  1MZE A;  1P7B A;  2A0L A;  2WLH A;  4GKJ O;  1GN2 A;  3LUT B;  1PL4 A;  2ZIO A;  4DR1 B;  1G8M A;  2JJ1 G;  2ZE8 A;  4LF9 O;  3EHB B;  4FLX A;  4H33 A;  1SQB H;  1GAX A;  1PD3 A;  2K1E A;  1RPO A;  2FTK A;  3QO8 A;  1N33 O;  1VAR A;  4JI8 O;  1WLE A;  3VBB A;  4B3S B;  1P84 F;  4O2A B;  1GMG A;  1VQ6 V;  1BGY H;  5K1X A;  1FFX B;  3ZMT A;  2UXD O;  2ZM6 O;  2ZDI A;  4OPA A;  3OMI B;  4TOI A; 
#chains in the Genus database with same CATH homology
 1P4R A;  1K7D A;  3G71 V;  3OEE G;  1N8R W;  3GB7 C;  1DF4 A;  1TUE B;  5IYD O;  3OR7 C;  4XBF A;  2LP7 A;  2OTJ V;  4WFG A;  4Z1M G;  3K03 A;  4TSF G;  2UXN A;  2P6J A;  4QJF B;  2B5U A;  4FK5 C;  5EBW C;  1R6N A;  1B6Q A;  1VQM V;  5L3E A;  2A9H A;  1VQ4 V;  3ZRS A;  1AJP A;  2DYR B;  2WSS G;  3K04 A;  4U7N A;  1NVP B;  3AEI A;  3SYC A;  4GX2 A;  4F4L A;  1K3E A;  4PA9 A;  3CCL V;  1V54 B;  1OZ0 A;  1QR9 A;  1COW G;  1BMF G;  3SPG A;  5CA3 A;  2X6C A;  4MW8 A;  1BHA A;  3RBZ A;  4WFF A;  1KP2 A;  5CBH A;  4QE9 A;  3SYP A;  2H94 A;  2EZP A;  1YTF D;  4PEL A;  2HLD G;  2A79 B;  3OR6 C;  4LC1 A;  4WFH A;  2IJH A;  4UXN A;  4WFA V;  5EC2 C;  1CPY A;  2XND G;  2ZD9 A;  3SPJ A;  2X7R B;  2XAJ A;  2XAQ A;  1VQK V;  5L3G A;  2JEX A;  1JVM A;  2DWE C;  4G27 B;  1L1F A;  3W7T A;  1GM8 A;  2LFR A;  3PJS K;  2WLN A;  2IJK A;  4GT1 A;  4MTX A;  3ZRW B;  1S3J A;  3ZMS A;  3F5W C;  4MTF A;  3SYA A;  1BHB A;  3BEH A;  2P67 A;  4MVM A;  4ZKI A;  1K9M W;  5CN0 A;  4FPP A;  3DGE A;  1KQS U;  2EIL C;  1MOF A;  1PKX A;  4JYB A;  3FB8 C;  3IFX A;  5L3B A;  3CD6 V;  3AG2 B;  4Q20 A;  3SPI A;  3JD4 A;  1AR1 B;  3I56 V;  3SPH A;  5E1A C;  2XAH A;  3CYO A;  3CCU V;  3F7V C;  2X6A A;  3SJQ C;  1EFR G;  2EIN C;  1S77 D;  2HVJ C;  2OT5 A;  4R6Z A;  1NH2 B;  1FS0 G;  1ORQ C;  5B1B B;  1ZWI C;  1XL4 A;  4TT3 G;  4UVA A;  1CEZ A;  1OCO C;  2EZO A;  3FB6 C;  3P32 A;  3KG2 A;  3RVY A;  1K73 W;  1VQ7 V;  1FXK C;  2MK3 A;  3ASN B;  3AG1 B;  5IYB O;  3STL C;  4G2K A;  2JK5 C;  1NKD A;  3HPL C;  1YIT V;  2JJ2 G;  3CCE V;  2V1D A;  2P90 A;  4J9Z B;  3E89 A;  1K34 A;  1VQP V;  4MVR A;  4KFM A;  1OCR C;  1SZT A;  2IJI A;  4R7C A;  5EBL C;  1Q81 W;  3ETG A;  3E8G A;  3CC7 V;  1JOY A;  1K4D C;  5LHH A;  3WG7 C;  2WLI B;  2QTO A;  3K06 A;  5B3S B;  3G6E V;  1SES A;  4R8C A;  1RM1 B;  3W7U A;  3CCV V;  1Q82 W;  4KUM A;  1AI5 A;  2ZQM A;  5IYC O;  3ABU A;  3E2E A;  1Y66 A;  1MAB G;  2KB1 A;  2R9I A;  2W0F C;  2ZXW B;  3ETD A;  3OE7 G;  2W6I G;  2DQ0 A;  1H8H G;  4G28 B;  1VQN V;  3ABL B;  3B8N A;  4CBC A;  2NLJ C;  1LNQ A;  2YSU B;  3LDD A;  4HAM A;  1F4M A;  4QPJ A;  1K8A W;  4JTC B;  3P30 A;  4BAY A;  1Y4M A;  1SET A;  3TK1 A;  1M56 B;  2HR3 A;  2EBO A;  2BOC C;  3F7Y C;  5GW7 A;  3ZRW A;  3E8B A;  3JYC A;  3I55 V;  5EK0 A;  2EIK B;  3MHS C;  2OCC C;  4BW5 A;  3OMA B;  4UUJ C;  1Q7Y W;  1E1R G;  5LGN A;  1G4Y B;  3AG3 C;  4PA6 A;  3ZMU A;  1V55 C;  1VQO V;  3CP1 A;  5KA6 A;  4OXS A;  3ABK C;  2X6B A;  5B1O A;  2C2A A;  3OEH G;  3WFV A;  3TET A;  1GKF A;  3G4S V;  2ZDI C;  3T1C A;  4N23 A;  1NJI W;  1M9N A;  1PL0 A;  3JCZ A;  4PA3 A;  1QLE B;  4MVZ A;  4E2L A;  4LP8 A;  2LFS A;  2GSM B;  3FB7 C;  1E1Q G;  2DW4 A;  2WLJ A;  3HB3 B;  1YHQ V;  3SPC A;  3MD0 A;  3K9A A;  1QBZ A;  1JJ2 U;  4BIU A;  1YSC A;  1R3L C;  2H8P C;  4XDJ A;  3AG4 B;  1R3K C;  5L3F A;  4WF9 V;  2ITD C;  2EIM C;  3OUF A;  3OUS A;  4RO2 A;  2JIZ G;  3QO5 A;  3ASO C;  3NXS A;  4P30 A;  3ABM B;  1QR8 A;  4ASU G;  2Y69 C;  5B1A C;  4PDR A;  3R65 A;  5H9C A;  4KP4 A;  4UVB A;  3JD0 A;  5H6Q A;  3ZN0 A;  3W7S A;  3OW2 U;  2IU0 A;  3SYQ A;  2Y48 A;  5LGU A;  3FYI B;  2WLI A;  4QPK A;  2EIJ C;  2DWD C;  2XAS A;  2XAF A;  1PNL A;  1S72 V;  1NR1 A;  3OM3 B;  2Q68 A;  2WLK A;  4XDK A;  3M99 B;  1QLN A;  1M1K W;  2Q69 A;  2DYS C;  2QA4 V;  1I5Y A;  3ZRX A;  1PNM A;  1K97 A;  1EBO A;  1AJN A;  1M57 C;  4JAU A;  2QKS A;  1YJW V;  3ZMZ A;  1K92 A;  2YEV B;  1EZJ A;  1VQ8 V;  1AI4 A;  4P9O A;  1OCZ C;  1R3J C;  4DO2 A;  4YXW G;  3X2Q B;  4WFE A;  4X8A A;  4R50 A;  2WAM A;  2X0L A;  1NBM G;  2IU3 A;  1M90 W;  1YI2 V;  3FB5 C;  1FXV A;  4JAS A;  3MHH C;  4WCE V;  4JPR A;  5KA5 A;  4UV8 A;  4JGS A;  4EKW A;  1K33 A;  3ZIA G;  3JD3 A;  3OMN B;  5KUK A;  2R9R B;  3FYE B;  1AI6 A;  4RUF A;  1H38 A;  4MT8 A;  3W7W A;  3ABL C;  5DN6 G;  2QM8 A;  5CMU A;  5LBQ A;  3CCS V;  1K5Q A;  4JYC A;  4GX0 A;  1OCC C;  3UM7 A;  4RAI A;  1I5X A;  3ZN1 A;  3CCJ V;  1DTO A;  1VQ5 V;  2B1I A;  5C93 A;  1R3I C;  5CBG A;  2Q67 A;  3LSS A;  5HFL A;  1IXM A;  2XOK G;  4UV9 A;  1NVP D;  1SRY A;  2EIL B;  3TCU A;  4U7O A;  4X88 A;  3SYO A;  1ARO P;  4PDL A;  3CXC U;  5FL7 G;  3K3W A;  3LNM B;  4HZ3 A;  2DYR C;  2CK3 G;  3GWO A;  4CZZ A;  1AI7 A;  3E8F A;  4MW3 A;  2JEU A;  2XAG A;  1J95 A;  3QNE A;  1V54 C;  1OCO B;  1KD1 W;  4GCZ A;  3CMA V;  1K5S A;  2ZR3 A;  4TWK A;  4LCU C;  4GX5 A;  4MVU A;  4L87 A;  3W7X A;  2AHY A;  3UKM A;  1JX9 A;  3LSQ A;  3JD1 A;  4H37 A;  3ABM C;  5LHG A;  1GTO A;  1H2G A;  4MVS A;  2WLL B;  1ROP A;  1R73 A;  2Z3Y A;  2YEV A;  1ENV A;  5L3D A;  1JQ0 A;  2ATK C;  4HYO A;  4PA4 A;  4GX1 A;  3E83 A;  3CCM V;  1FFT B;  4JAV A;  3OFN G;  5CBF A;  4FJC C;  4X89 A;  4FMT A;  4RQF A;  1YJ9 V;  3IGA C;  4J9Y B;  2F43 G;  3LDE A;  1JCH A;  3T4Z A;  5EBM C;  2GHY A;  3WG7 B;  5IY5 B;  2PI4 A;  3K08 A;  1CP9 A;  3FKS G;  2UXX A;  3K0G A;  3ML0 A;  1NH2 D;  3DTU B;  1FXH A;  4RQE A;  4RUE A;  4QNH B;  2HVK C;  3CC2 V;  2QM7 A;  5BZB A;  2HKO A;  4MSW C;  2WPD G;  3AG2 C;  1F23 A;  3K79 A;  2OTL V;  1WPX A;  5IDJ A;  3B8M A;  4JTD B;  2AHZ A;  3RW0 A;  1E79 G;  1F4N A;  1DF5 A;  3EFF K;  5LHI A;  4MTG A;  2HJF C;  3RVZ A;  1NQT A;  1F51 A;  4QE7 A;  3STZ C;  2HG5 C;  3X2Q C;  5B1B C;  1OHH G;  3CCQ V;  3B77 A;  4I5S A;  4MVQ A;  4XDL A;  4PDV A;  3VOU A;  1DLB A;  3ASN C;  3CPW U;  4QIW F;  3AG1 C;  1QCE A;  1AJQ A;  3E8H A;  4LBE C;  1W2B U;  4UVC A;  3T4D A;  2OCC B;  3D3I A;  1XL6 A;  1NR7 A;  2P7T C;  2D3O W;  3T2M A;  2PI5 A;  1YJN V;  3AG3 B;  3E35 A;  3ABT A;  1V55 B;  1UJW B;  2IW5 A;  1H8E G;  5L3C A;  3ABK B;  2IH3 C;  2WLM A;  5H6R A;  1BL8 A;  2V7Q G;  1GM9 A;  2Z5U A;  4P9P A;  2IH1 C;  1Q86 W;  2M7W A;  1PNK A;  3QO7 A;  2BOB C;  5B3S C;  1YIJ V;  4DXW A;  1RM1 C;  3BY6 A;  1JPX A;  1FXK A;  3H01 A;  4PDM A;  3CC4 V;  2NNU A;  1HWY A;  2EJR A;  1QVF U;  4JTA B;  1S76 D;  2EIM B;  4I9W A;  5DM6 V;  4MVO A;  1GO3 F;  1GK9 A;  1MSW D;  3IC7 A;  4P2Z A;  2ZXW C;  3ASO B;  2WLL A;  2Y69 B;  3ZRV A;  3JD2 A;  5B1A B;  3ETE A;  1THZ A;  1R6K A;  4WFB V;  1QVG U;  5HFM A;  1M56 C;  5B1N A;  3D36 A;  1YTF B;  2EIJ B;  1W0J G;  2ZR2 A;  1RPR A;  2JDI G;  2WWW A;  2EIK C;  2Q6A A;  1P7B A;  2A0L A;  2QE7 G;  2WLH A;  1W0K G;  2DYS B;  3LUT B;  2QEX V;  4FIP C;  4JF3 A;  1SER A;  1VQ9 V;  1G8M A;  1GM7 A;  2B1G A;  1MG1 A;  5LGT A;  1KEC A;  2JJ1 G;  2ITC C;  1M57 B;  3EHB B;  4N21 A;  3E86 A;  4H33 A;  3CME V;  5J9P C;  4BIZ A;  2DQ3 A;  1KC8 W;  2EIN B;  1S5H C;  3ZJZ A;  1OCZ B;  1PD3 A;  1QLE C;  2K1E A;  1RPO A;  3OGC C;  5IY5 C;  2FTK A;  3QO8 A;  5EC1 C;  3ZMV A;  3AG4 C;  1WLE A;  1FXK B;  3VBB A;  5KUM A;  1KKD A;  3K0D A;  4MS2 A;  1GMG A;  1VQ6 V;  3A0R A;  1S0V A;  3LDC A;  3ZCC A;  4MTO A;  3CCR V;  2HFE C;  3ZMT A;  2W6J G;  4PA7 A;  2IJJ A;  2ZDI A;  1OCR B;  3OMI B;  4ZBM A;  1OCC B;  1K4C C;  3OAA G;  1VQL V;  1KP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...