4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
2ITDC 2Q6AA 2R9RB 1XL6A 2X6CA 1G4YB 4JTDB 4MS2A 2Y69C 5EK0A 3UKMA 3TETA 5KUMA 3SPIA 4G28B 3T4ZA 3AG4C 4GX1A 1R3IC 3K03A 3SYPA 5EC1C 3OGCC 4MTGA 4QE9A 3ZRSA 2HFEC 4F4LA 1P7BA 3SPHA 3AG3C 3RW0A 3LDEA 3T2MA 4MVOA 4MW3A 2DYRC 4RUFA 4CBCA 2WLNA 4H33A 3SYQA 2Q68A 4XDLA 3SPCA 3SYCA 2JK5C 3OUFA 2HJFC 4MVMA 4J9YB 4XDKA 2DYSC 3F7YC 4MVSA 5CBFA 5EC2C 2ZXWC 4WFGA 2WLJA 3ZJZA 4MSWC 2WLIA 4PDMA 4QNHB 1K4DC 2A0LA 3STZC 5KUKA 4P9PA 1S5HC 2W0FC 4PDVA 1M57C 3SYOA 4MTFA 4WFFA 2EILC 2QTOA 3E86A 4RUEA 2EIKC 4MVQA 2DWEC 3ASOC 4UUJC 3OR6C 3K06A 5J9PC 2ZD9A 1K4CC 2IH1C 4GX0A 4H37A 3HPLC 2HG5C 4JTCB 4OXSA 4TWKA 1ZWIC 3FB8C 5EBMC 5B1BC 2AHZA 2P7TC 2WLLB 5CBGA 3JYCA 4DXWA 4GX5A 3SPJA 2K1EA 5B3SC 2EINC 2H8PC 2WLIB 4JTAB 2ITCC 2KB1A 4WFEA 4XDJA 4PA3A 3LDCA 4HYOA 3X2QC 3KG2A 3E8GA 4P30A 4R8CA 5IY5C 3LUTB 3R65A 2WLHA 4ZBMA 1M56C 3UM7A 2AHYA 4J9ZB 5EBLC 2EIMC 5BZBA 3SJQC 4LCUC 3OUSA 2NLJC 2HVJC 2YEVA 4G27B 2OCCC 3E8BA 3FB5C 4I9WA 3BEHA 3E83A 3FB6C 3LNMB 4PA7A 3STLC 3F7VC 3SYAA 1OCZC 3PJSK 4PA4A 2X6BA 4R50A 4PDRA 3RVZA 3E8HA 3K08A 2BOCC 3OR7C 4PA9A 2WLLA 2HVKC 3LDDA 4MVZA 3E89A 1R3JC 4LBEC 3SPGA 2ATKC 3T1CA 3ABKC 1R3KC 4GX2A 1ORQC 3K0GA 4X8AA 2QKSA 3WG7C 4MVUA 4X88A 4EKWA 2Q69A 1QLEC 3K04A 3ABLC 3F5WC 2A79B 4RO2A 4BW5A 3VOUA 1LNQA 1OCCC 4P2ZA 3RBZA 3ASNC 2BOBC 4PDLA 3AG1C 1BL8A 2Q67A 4R6ZA 4MTOA 5EBWC 4PA6A 1KKDA 3AG2C 3E8FA 4MVRA 1J95A 3TCUA 3IFXA 4QE7A 4LP8A 2IH3C 1V54C 2A9HA 4P9OA 4KFMA 4X89A 3RVYA 1OCRC 1R3LC 3EFFK 1XL4A 3FB7C 1OCOC 3ABMC 2X6AA 3GB7C 5B1AC 3T4DA 1JVMA 3K0DA 4MW8A 4WFHA 4R7CA 2DWDC 4HZ3A 5CBHA 4RAIA 2WLKA 3IGAC 2EIJC 1V55C 2WLMA 5E1AC
chains in the Genus database with same CATH superfamily
4LF7B 2Q6AA 3CMAV 1VIBA 1I5XA 5D5PA 1HNZO 4X20A 2F4VB 2Q8VA 3SJBC 4LF6B 1P49A 1XMQO 2YSUB 1BZKA 1L1FA 1YCIA 3B77A 3L71H 1M5IA 4J9YB 3UO3A 1CP9A 1SESA 2ZXWC 2OTLV 4GZRB 4QNHB 3KCXA 1H2LA 1H2MA 1G1XB 2XAHA 3E86A 3C3TA 4BWAA 4DRXB 4C7UA 3S3XA 1XILA 4X1IA 2EINB 4J42A 1PNLA 2H8PC 4UB6Z 3FAVA 1BQZA 4NXNB 4LF9O 5KMGA 3C90A 3G6BA 4O2AA 4DV0B 4J11A 3ZHVA 2HHHO 4I9WA 4UB8Z 3ZRWB 4PA7A 3RYFA 3EHBB 1YI2V 4PA4A 2HEPA 1FJGO 1EM1A 4JI6O 3EXAA 1WPXA 3JD2A 4HNAA 3QG5A 5JCOA 4LH7A 3SPGA 1NT2B 3BABA 4X64O 3HKBA 4X8AA 2QKSA 2XAGA 2ZT9B 1ZL8B 4X1KB 1SQGA 4JF3A 3F5TA 3F5WC 3LNNA 1S0VA 3OMIB 3CE2A 2CTRA 4R6ZA 4JI7O 4MTOA 2PYLA 3D36C 2BE3A 4X9QA 1GO3F 1JR9A 1XI1A 4UVAA 2N04A 5B1AC 1OCOC 2LP7A 3O9OA 1I94B 3ZMZA 3IGAC 3JATA 1XNQO 3RYHA 1WB7A 2XOKG 1I7FA 3DXRA 2UXDO 3OGCC 5EZYA 2QWPB 4F4LA 3ETEA 2Q68A 4U3JB 4EB6A 2BSKB 1K33A 2YICA 1UFIA 2XUMA 3OTFA 2Z5UA 2VQFB 1SA0A 2PZSA 2IJIA 3AK1A 1E1RG 3OAAG 1N0JA 1KECA 5GONA 2QGNA 3RYIA 4LF5B 3FB8C 2IJKA 2YIBD 1WAZA 1AI7A 1P7GA 5JH7B 2KB1A 3FYIB 4WFBV 4HYOA 4BR6A 2R70A 3I56V 2D3OW 4DR4B 1LUVA 5BZBA 1QNMA 4X66B 4LCUC 2YEVA 1PD3A 3ZEDA 3IC7A 2XT9A 5EIBD 4WF9V 4QPKA 1HNWO 4PA9A 1Y76A 2HVKC 4FLTA 4UCOA 3L9DA 4JI7B 2MK3A 1M1KW 3H1JH 2GTSA 3APOA 2W0XA 1FYJA 2FTKA 3MHHC 1R6NA 4TUYA 2CGNA 2GTAA 1N36B 5B66Z 4OX9O 2RDCA 2BTQB 4TSFG 3CC2V 3E8FA 2K9PA 4WCEV 1NR7A 2BTQA 5KX5A 1BHAA 3EFFK 1K5QA 1Q5OA 3ZHRA 5LMNO 5CBHA 2Q7GA 4FFBB 2PF4E 4B3TO 1FPOA 5A9GA 4QGPA 5CA0A 3J81N 1MABG 3ETGA 5EK0A 2QE7G 3CXCU 5IY5B 5KUMA 4G28B 1M93A 1VQNV 2P90A 2E74B 2H3OA 1K3EA 1ZX3A 1ZL8A 3I5DA 4AQYB 1US6A 3JASB 4E2LA 3OUFA 1XEQA 1JOYA 1S72V 4X65B 2YS8A 3IC9A 4IYHA 1RPOA 4CH5A 4ABMA 1XREA 3OTOB 3GWOA 1HWYA 2ZQMA 1HNXB 4LFAB 3CC7V 2ADPA 4FK5C 2P4KA 2WAMA 2ZNIA 2UXBO 1IURA 4O4IB 1AI5A 1YHQV 2IH1C 4NR1A 1ZWIC 4ZI7A 2WLLB 2ILMA 2JEXA 3WG7B 4YHHO 4X66O 1NKDA 4NYKA 1VQMV 4LF7O 4TQDA 4KXRA 1XDCA 1Q3EA 3IAYA 4JV5B 1KKCA 1K8AW 3PN1A 4DR2B 3KCYA 3A2FA 1TA8A 4DRXA 3QO8A 4BW9A 4GKJB 4G27B 4GKKO 3WFVA 3SYAA 2VS0A 3FD9A 3U10A 3E8HA 1QCEA 2QM4A 2WLLA 1GM9A 4MVZA 3VQWA 4FLZA 2Y4UA 2QTSA 2IU3A 3CB2A 1GMGA 3O65A 4MVUA 2HKOA 4W4KA 5LHHA 3ABUA 4DR7O 3CEIA 5KA5A 3ZHTA 1MG1A 4DV1B 4FZ0A 4O4HB 1YTFD 4U3FH 3FKSG 3ZHQA 2CE4A 2E76B 2IM9A 1M56B 4BIOA 3ABMC 1VF5B 1W2BU 2Q73A 4FLYA 4DV4B 4H13B 3I55V 4F6EA 3D3QA 3E22A 4NTYA 1KB9F 2IJJA 1VEWA 3A0RA 3K03A 1W0JG 5J2UA 3AG3C 4MW3A 1XUQA 4LF4B 4TT3G 2JK5C 4I4TA 4A5UB 4D7TA 4FFKA 4TV8A 4PDVA 2Q7HA 2ADQB 4JI1O 4ZHQA 5DN6G 5KMGB 1KQSU 3S3WA 2DWEC 3D36A 4PJ0Z 3U0ZA 1JJ2U 1TUBA 4O4IA 3BHPA 4JV5O 1H8HG 2K1EA 2WLIB 4JTAB 4YJ2B 4AQYO 1Y6XA 4O4LB 4PA3A 3CP1A 3E8GA 4FMTA 4R8CA 2CH7A 3ZHUA 1MZEA 1YVWA 2ZR2A 1TAEA 2HP8A 4ASUG 3CRCA 5IYDO 1V9PA 5CA3A 4JPRA 1PNMA 4CH6A 4O4HA 4JAVA 1W0KG 4LF8O 2PY5A 4LWSA 3CCJV 4GX2A 2ODMA 1RM1C 4YJ3B 3OM3B 5IWAO 1HP8A 1R6TA 3W7SA 5ITZA 3CD6V 2ZIOA 1HR0B 4JZGA 1XNQB 4B3SO 3AG2C 4CS4A 2BSKA 1Q86W 2LFSA 3ZHSA 4PI0A 3P3PA 5JWPA 4I9QA 2OTJV 2RCVA 4NXMB 4TQFA 3TJTA 3ZRXA 4WBNB 1N34B 2AZ2A 4UVBA 1MSDA 1G6UA 3SDLA 2RJZA 3AK2A 3SYCA 4JI2O 4XDKA 1LUWA 3B4SA 3CCSV 2F66C 3ZJZA 1JQ0A 2RMKB 4HAMA 4JAUA 5LXTB 3OMAB 1P4RA 4UCRA 4I5SA 2QWRB 3JCUZ 3U11A 4FFBA 4MTFA 2EILC 4CH4A 2QTOA 3BRCA 2HHHB 5B1OA 2P22C 2DMXA 2ZD9A 1Y67A 1OCOB 5CBGA 1XOUA 1AR1B 3K5MA 2F4VO 1VF6A 2GV9A 3M8AA 1VQPV 4WFEA 2NR5A 4J10A 1XMQB 1K5SA 3LDCA 4JYBA 4B3RO 2KG7B 4B3MB 4J9ZB 3N2KA 3JAWA 1I5YA 3BCCH 2PI5A 5L3GA 1QR8A 4B08A 1RPRA 2QSAA 5GTIZ 3ZIAG 1OCZB 3E83A 5B1AB 2EBOA 3WB1A 2DE0X 2UUCO 4UVCA 3ZRVA 1I08A 3APQA 2EJ7A 3K58A 3WG7C 4UCUA 2YI9A 4JI0B 1M90W 3RBZA 2XTAA 1GK9A 4NB5A 3OGIB 4O4LA 2JGUA 1SRYA 1OCRC 4DV0O 2HLDG 2QKAA 1H38A 2Y0PA 3J80N 3DSQA 1SZXA 2ITDC 1AJPA 4JI4B 3ML0A 3SGIA 1JA8A 3TETA 2GSMB 2VWKA 4DR7B 3ZN0A 5B5EZ 5EC1C 2HFEC 1VQKV 1P7BA 4MVOA 4JYYA 2WLNA 5KAFZ 3UCSC 2E75B 1VQLV 1K9MW 3SPCA 1IZ3A 2UXBB 4KL1A 1KMIZ 1RFYA 1EN6A 1UJWB 3B8MA 3CPWU 1S5HC 2ZE5A 4RUEA 2IU0A 2UUCB 1YEWA 3K59A 3OR6C 1E1QG 2C2AA 1EFRG 1NU1H 4FLUA 4DR3O 4DV3B 1EZVH 4JI3O 4K8XA 1WNSA 2DQ0A 3X2QC 3R65A 4X1KA 3KKYA 2UUAB 1A32A 4O4JB 4UV8A 1H2NA 5LP6B 4K0KB 5BMVA 2M7WA 4IHJA 2JGDB 2DYSB 5CB4A 3RVZA 3K08A 1FFTB 3EVKA 3KZIZ 2GBOA 2QDOA 1ZSPA 2HR3A 2Q9LA 4LBEC 1GKFA 3L73H 2ATKC 2UXXA 4CH3A 4DV7B 5CN0A 1N36O 4TV8B 4H44B 1GN2A 1AI6A 2VQEB 1JJOA 2LQTA 2BOBC 1PP9H 2FMLA 3QNEA 4HNAB 5HFMA 4J80A 4LF8B 3K5NA 4J7ZA 1AJNA 2OCCB 2IH3C 1WN7A 2CTPA 3JAKB 1IXBA 1K92A 3FB7C 4U7NA 1I94O 2E3CA 4EB6B 3T2MA 2BCCH 3ZCCA 4JTDB 1MNGA 5EIBC 4EFEA 4GX1A 4K8ZA 2O57A 1S76D 2AXTZ 3CC4V 4RUFA 5IJ9A 5JVDB 1SC5B 4DO2A 3OTOO 4X64B 5IJ9B 3T1YO 2WLIA 4PDMA 3DC5A 2A7WA 1VF6C 4G2KA 4JI5B 3E2EA 5KHIA 1WP8A 1Y74B 2EIKC 4MVQA 5DM6V 4OGQB 5J9PC 1YF2A 3J7AU 4JTCB 4O2AB 1R6KA 1JFFB 4UFZA 4GCZA 4NXNO 2CTQA 3OT7A 3JD4A 1BT8A 1AJQA 1QLEB 1CEZA 3FAVB 5ITZB 1GN6A 4DUYB 1QQCA 4NVPA 4ZBMA 2VWJA 2OCCC 1P84F 3K5LA 3STLC 3F7VC 5LMUB 1OCZC 4PDRA 2R9AA 3QF7A 2CTWA 4DK0A 2N74A 2B1GA 1QHTA 2DQ3A 1TUEB 1XQ8A 3CRRA 3HKCA 3K0GA 2UU9B 5K1XA 3ICXA 3M7MX 3K57A 2AZ0A 3L75H 3D3IA 2LW1A 3SJCC 4LC1A 3QO5A 3JASA 4YXWG 3HR0A 1LR1A 3P30A 1AI4A 3HB3B 1V54C 1L0LH 1G8MA 4R7CA 2JS3A 1V55C 1W59A 1WA8B 5CMUA 2RNBA 5KHJA 4JGSA 2YIDA 4JZ2A 4MTGA 5KX5B 1OJHA 1QLNA 4CBCA 1BQ0A 2LO1A 4WFGA 3CCRV 4LFCO 4RQEA 2XNDG 1AP6A 3IJ4A 5TISZ 2OIGA 3K5OA 4DR2O 1MSWD 3DGEA 3CMEV 4OXSA 2AGAA 3JATB 2F23A 2YXHA 2ITCC 4PHZA 3CXHF 5LGUA 1K97A 1RSOA 4FLVA 1KBHA 4I0XB 2AHYA 1R1BA 1DLBA 2EIMC 2XAFA 3MHSC 1IDSA 2HVJC 2E5LB 5FPOA 2XAQA 3AEIA 3JCZA 3A0HZ 1TVKB 1EZJA 4O2BB 1AB3A 1BMFG 3E89A 4QJFB 4I4TB 5B1BB 3OW2U 3NXSA 4DR1B 4FVMA 4WBNA 1B06A 1FXVA 1B3QA 3AG1C 3BVOA 3LSSA 3E22B 3JARA 1NTMH 2G38A 1VQ8V 1Z5VA 3JAMN 2A9HA 4B3TB 1SQFA 3T4DA 2N05A 3K0DA 4MW8A 1IX9A 1HW7A 4RAIA 1N33O 2PYJA 2B5UA 3RYHB 1Q82W 4GKJO 3CCVV 4DV2O 2XHBA 4DV5B 2D2CB 3ZS8C 4DR4O 2Y69B 4GT1A 3CWBH 4IHJB 4J7KA 5J2TA 1Y66A 2L35A 1XMOB 1COWG 4J7JA 2DYRC 4XBFA 3RYCA 5LXTA 3FFQA 5IYZA 2YXLA 1HNXO 2Q0AA 2ZE7A 2F95B 2Q5ZA 3SJAC 5JJJB 4FZ1A 5J2TB 4H0LB 4JI6B 4UUJC 3W7XA 4TV9B 3CCQV 5JQGA 2F1MA 1FD9A 2AHZA 1Q7YW 1FFXB 1B6QA 2ZDIC 3QO7A 1NTKH 1NBMG 5LA6B 4ZHQB 2EILB 3LUTB 2WLHA 3N2KB 1JFFA 4L8JA 1N8RW 3L74H 2NLJC 5KA6A 2GHYA 3N2GB 3QVNA 1DTOA 4LH6A 2PUSA 4YJ3A 3FYEB 4JASA 3P3NA 5IDJA 1HR0O 2BOCC 4ZKIA 1BGYH 1NQTA 2JJ2G 4Q20A 3A8TA 2OCHA 2EZOA 4FIPC 3OEEG 3FX7A 2ZM6O 2ZNJA 3ABLC 1OHHG 3AG1B 4BW5A 3VOUA 5IE9A 5FL7G 2UXCB 3DTUB 1BL8A 1D5NA 2ZINA 4CZZA 4CC6A 1SQVH 1O9GA 2ZCEA 2LGWA 3CRAA 1OZ0A 3IFXA 2R9IA 4DV5O 3WB0A 1QVGU 2QM8A 5H5NA 1SQXH 2DWDC 4NTWA 3G67A 1G4YB 3UKMA 1MA1A 1M9NA 3RGBA 3P32A 3QTCA 3SYPA 3T1HB 4QE9A 1BE3H 1EBOA 4N23A 1GRJA 4DR3B 1N32O 4JI8O 4FM0A 1D5AA 3C3SA 5IYBO 2YC0A 5KUKA 1NVPB 2W0FC 1M57C 4Q6GA 4X1IB 4DV6B 3ABMB 1F23A 1QR9A 4IT5A 3W7UA 1IBLO 1JCHA 3ZX6A 4GX0A 1WLEA 5EBMC 3BA8A 4TWKA 4UCTA 1N32B 1OCCB 2DJVA 2V1DA 4UCVA 4CS2A 2YIBA 4JAAA 2DN9A 3AG2B 1VF7A 4DUZO 1AR5A 4KHPO 5KHHA 4K3AA 1X59A 3ABKB 3UT5B 4IIJB 1RSOB 1RM1B 5E79Z 4WFAV 3CCMV 2Y0IA 1IBLB 4Z2WA 5KLVH 1H2SB 3OE7G 1PL0A 4B7EA 2ETNA 4QIWF 1IBKO 1MZFA 1ORQC 1KC8W 2JEUA 2Q7EA 2KKWA 1DF4A 1GM7A 5F2VO 5EZYB 1YTFB 4DR6B 5EYPB 1LNQA 1OCCC 4P2ZA 1I0HA 4JI4O 5KHGA 3Q4HA 3W7TA 3TCUA 3JD1A 2E5LO 1M57B 1SA0B 1GN4A 4B3MO 1VQOV 4HBNA 1BHBA 4AHCA 1TVKA 1XL6A 5BR8O 3SPIA 2CDYA 3AG4C 3HKEB 1RP3B 1FXKA 4LFBO 4DR1O 3OEHG 1L8DA 3LDEA 5GW7A 4CS3A 4I0XA 4XDLA 1T5EA 2LGQA 2EIMB 2HJFC 5CBFA 5EC2C 5H2FZ 4ZOLA 5BMVB 5GTHZ 3DC6A 2FL4A 1ENVA 2WA4A 4O4JA 3STZC 2IW5A 4X65O 5L3DA 3ZMTA 3N27A 3CHXA 3ZRWA 1AR4A 2PTMA 2PGGA 1SS3A 1K4CC 3JAWB 2HG5C 4B7KA 1VQ4V 4LFBB 3JYCA 1YSCA 5KAIZ 3RFRA 3RYCB 3H01A 5B1NA 4DV3O 2LW7A 4KUMA 2HJDA 2OT5A 4GYCB 4W4LA 1XMOO 3VQXA 1FFXA 2CUGA 3ASOB 2QKCA 2H94A 3UQ8A 5JQGB 1U96A 3R66A 1NVPD 3E8BA 1N34O 1R73A 4TUYB 4R50A 4IGGA 3BY6A 4ICGA 4OPHA 1OV9A 2DOSA 3JARB 2VQEO 1GM8A 1ZTEA 1ZAUA 3ABKC 3A0BZ 3H9VA 3JD3A 4X62O 3M99B 4X88A 4EKWA 4DK1A 2RQ6A 5IWAB 1PM9A 2JGDA 1Q43A 5IJ0A 4F6RA 1E79G 3CCLV 2VRZA 3G80A 2Q67A 1D2DA 1KKDA 2QWNB 3CS5A 1Q6IA 5H9CA 2EULA 1BCCH 4O2BA 1GH6A 4P9OA 3B09A 3B40A 3ETQA 3L72H 1VQ9V 2EIJB 5IYZB 4YIOA 2WSSG 3HKBB 2Z3YA 3AG7A 1WP7A 5LYJB 1PPJH 1NTZH 3ZRSA 4FPPA 3SPHA 4X62B 3RWRD 4LR3A 1DGSA 4H33A 3GVMA 4NKGB 3H1HH 3ZMSA 3W7WA 3Q4HB 2WLJA 4DV7O 2A3QA 4PELA 4U3JA 3JD0A 3BPZA 2QWOB 2ZDIA 1H2GA 2UUBO 5LGNA 1L0NH 1WPBA 3ZBHA 1VQ6V 1KU9A 2BTOA 3JALB 2YUAA 3RN4A 2WPDG 5J2UB 1H2KA 2LFRA 1ROPA 4LF9B 3KG2A 2F93B 4P30A 5IY5C 1Q90D 1CXZB 2B1IA 2ZE8A 2NN4A 3SJQC 4DV6O 1FXKB 3FB5C 3BEHA 5H6RA 3TXSA 1GTOA 2CGOA 4IYIA 1IBMB 3VQYA 2UXCO 4JI0O 4BIUA 1R3JC 3H1KH 2QJ1A 5FPRA 3BAAA 1QU7A 5BY1A 1V54B 2YXYA 1JX9A 2OYQA 3K04A 2F43G 3BFRA 1K7DA 3HKCB 3ASNC 4I50A 4LNUB 2XASA 3ZMUA 4RQFA 2V7QG 3B2EE 4ZI7B 4X89A 3WU2Z 4DV4O 2X6AA 3K79A 1JVMA 5LOVB 2GUZA 4PD4F 3MD0A 3CX5F 3JSLA 5CB4B 4DR6O 1Q6HA 2DW4A 5BXZA 1MMMA 1UPGA 3E35A 4D7SA 1K73W 4K35A 4IL6Z 3HKDA 3LSQA 4DW0A 2CAZC 3F7YC 4AILC 3ETDA 1FJGB 3HKDB 1Y74A 3JSNA 3ABTA 1XHXA 3SYOA 5K1PA 2CK3G 1SF9A 1DF5A 1IBMO 3ASOC 2Q0OC 3K3WA 1NR1A 2P7TC 1S5JA 3SPJA 4K0KO 2EINC 5LHIA 5H6QA 4X1YB 4DV2B 1H8EG 3LSUA 2X0LA 2FKXA 1XHZA 4KP4A 2ZKOA 2IJHA 1TGOA 1ZLZA 3K9AA 5LHGA 5LA6A 1EN5A 3THOA 3CSXA 2EX3A 4X1YA 3MAQA 4DR5O 1SQBH 4LWSB 4AI8A 3VBBA 5JJEB 1O9HA 1F7YA 5L3BA 4U7OA 1VMGA 2YEVB 1WB8A 5EYPA 3H1LH 4ZIBA 4YY3O 1THZA 3AG3B 2PI4A 1QLEC 5LBQA 2W6IG 3HKEA 4OPAA 1Z2GA 1HNWB 4I55A 5CA0B 2JJ1G 4MVRA 4FM2A 2EIKB 5BR8B 5CA1A 5L3EA 1KP3A 3JAKA 4JYAO 4ZOLB 1NI8A 2UUAO 5IJ0B 4I7ZB 1OCRB 5LMNB 2QEXV 1F4NA 4NXMO 2WLKA 4IIJA 4B3SB 4PA6A 3UT5A 1GAXA 4OX9B 2R9RB 3OMNB 1FS0G 1YJWV 3CYOA 2M6YA 4MS2A 1QVFU 5A2QN 2KSDA 1URFA 2EZPA 1QBZA 3RW0A 4EEQA 1XNRO 1U97A 5DEDA 4MVMA 5FNVA 1Y4MA 1PV0A 1XBLA 1NZ6A 2W6JG 1EN4A 3RT3C 2A0LA 4P9PA 2VQFO 4GLXA 5JJNB 2QWQB 4LFAO 5IYCO 4JI2B 2R72A 3SR2C 1VQ5V 1J5EO 4UXNA 5FNVB 5L3CA 1IVSA 4DXWA 4UV9A 5AG2A 1PKXA 2FB5A 1JPXA 4KHPB 5JH7A 1YXBA 4EFBA 1NH2B 3K9SA 3T1HO 2QA4V 3X2QB 1NS1A 3UM7A 2P4VA 4PI2A 2Q4PA 1BS3A 2CH7B 3G6EV 4Z1MG 2YDEA 3GWKC 1NH2D 4LF5O 4YJ2A 3PJSK 4LFCB 4JYAB 2GUZB 3OR7C 3RYFB 2DYRB 3T1CA 1S5LZ 4LF6O 4DW1A 4E4EA 3ABLB 4CC5A 1F4MA 1HNZB 4PV1B 2ZR3A 3G4SV 3G71V 1Q6UA 3RVYA 3N2GA 4HZ3A 1AILA 4J41A 2WLMA 5E1AC 1GN3A 2V4DA 1R3IC 2IBZH 2Y48A 4B3RB 1Y76B 3DXRB 1YZBA 1FXKC 3ZN1A 2OWOA 1Q8IA 4JI5O 3BA9A 1J5EB 2WWWA 2JRIA 5LP6A 5LMUO 3CRQA 5CA1B 2LJ2A 5D5QA 4JI1B 2NNUA 3OFNG 1SERA 1MOFA 3K06A 3UO2A 4FLXA 4H37A 3AK3A 1NJIW 5B1BC 1IXMA 4FM1A 3B8NA 4DUZB 4RWUA 1WJZA 4UCSA 2ZXWB 3ASNB 1AVMA 2P06A 3RYIB 2YIAA 3TGUH 5B3SB 4YHHB 1PNKA 1K34A 5GONB 4L87A 2YI8A 2P67A 1FKAO 1S77D 2X6BA 1KUQA 1YITV 3CJHB 5C8YA 3ZMVA 4JYCA 3TK1A 4JI8B 2KG7A 2JDIG 1CPYA 2L6LA 2XAJA 2QM7A 5L3FA 2WA3A 2QR4A 2B9ZA 1YJNV 4N21A 4RO2A 4LF4O 1F51A 1SQPH 3L70H 4PDLA 1AP5A 1SETA 5EBWC 3JALA 1N33B 1PL4A 4MTXA 1VARA 3AG4B 5JVDA 1J95A 5LOVA 1FAFA 4QE7A 5LL6Y 1YIJV 4I55B 2UXNA 2A06H 4KFMA 1N4CA 2ARHA 5LP6C 1X4TA 1YDXA 1B04A 4WFHA 3CRMA 4Z1VA 1DK1A 1KD1W 4LP8A 1AROP 5IT9N 3WB2A 2X6CA 3VQVA 4JI3B 2Y69C 2GDSA 1Q81W 4DV1O 2UU9O 1N0NA 3MDSA 1JMKC 2Y4TA 3SYQA 1FXHA 2ZM6B 2DYSC 5LYJA 4MVSA 4YY3B 1SZTA 1IBKB 1TUBB 4MSWC 4FLWA 1K4DC 3T1YB 4GKKB 1M4UA 3CCEV 4WFFA 2ZE6A 5KHKA 4LNUA 1XNRB 4BAYA 2JS5A 3D8CA 3HPLC 5DECA 3CCUV 4BIZA 1YJ9V 1BSMA 4GX5A 4TOIA 4DUYO 4GUNA 5B3SC 4DYLA 4TV9A 4F6RB 2OIEA 1VQ7V 3NR7A 4NTXA 1KP2A 2MW2B 1M56C 5EBLC 2Z0AA 3OUSA 1HDJA 3FB6C 3LNMB 2ZIMA 4MT8A 2EJRA 2JVDA 3CJHA 5C8YB 2P6JA 1SKVA 2UUBB 2RN9A 1SQQH 3LDDA 5HFLA 4D6TH 4X20B 5C93A 2FYUH 3TXQA 4FJCC 2JIZG 1R3KC 2AW9A 1ZUQA 1VP7A 2Q69A 2UXDB 2A79B 1V55B 1Z5WA 3H1IH 5FLXN 1WA8A 2X7RB 4YIPA 1KYOF 3OD4A 3T4ZA 2KQXA 4I50B 3GB7C 1R3LC 4QPJA 1XL4A 4DR5B 5LGTA 2P5OA 1S3JA 5JCOC 2EIJC 4XDJA
chains in the Genus database with same CATH topology
2Q6AA 1Q82W 3MD0A 3CCVV 3CMAV 1I5XA 4UVBA 2DW4A 2Y69B 4GT1A 3E35A 1Y66A 1COWG 2YSUB 1K73W 2DYRC 1L1FA 3B77A 4XBFA 3SYCA 3LSQA 4J9YB 4XDKA 3F7YC 1CP9A 1SESA 2ZXWC 3ETDA 3CCSV 2OTLV 3ZJZA 1JQ0A 4JAUA 4HAMA 3OMAB 4QNHB 1P4RA 4I5SA 3ABTA 3SYOA 2XAHA 4MTFA 2CK3G 2EILC 2QTOA 1DF5A 3E86A 5B1OA 4UUJC 3W7XA 3ASOC 2ZD9A 3CCQV 3K3WA 2AHZA 1OCOB 1NR1A 2P7TC 5CBGA 2EINB 1Q7YW 3SPJA 1AR1B 1B6QA 1PNLA 2EINC 2H8PC 5LHIA 2ZDIC 5H6QA 1VQPV 3QO7A 4WFEA 1H8EG 1NBMG 1K5SA 3LDCA 4JYBA 2X0LA 2EILB 3LUTB 2WLHA 4J9ZB 4KP4A 1N8RW 1I5YA 2IJHA 2PI5A 5L3GA 1QR8A 2NLJC 1RPRA 3K9AA 5LHGA 4I9WA 3ZRWB 5KA6A 2GHYA 3ZIAG 1OCZB 3E83A 4PA7A 1DTOA 5B1AB 2EBOA 3EHBB 1YI2V 3FYEB 4PA4A 4JASA 5IDJA 4UVCA 3ZRVA 2BOCC 4ZKIA 1NQTA 2JJ2G 4Q20A 3VBBA 1WPXA 3JD2A 5L3BA 4U7OA 3SPGA 2YEVB 2EZOA 4FIPC 4X8AA 3WG7C 2QKSA 2XAGA 1THZA 3AG3B 2PI4A 3OEEG 1QLEC 4JF3A 3ABLC 3F5WC 1OHHG 5LBQA 3AG1B 2W6IG 3VOUA 4BW5A 1M90W 5FL7G 3RBZA 3DTUB 1S0VA 3OMIB 1BL8A 4R6ZA 4MTOA 4CZZA 2JJ1G 4MVRA 1GK9A 2EIKB 1OZ0A 3IFXA 2R9IA 1GO3F 5L3EA 1KP3A 4UVAA 1QVGU 2QM8A 1SRYA 1OCRC 5B1AC 1OCOC 2HLDG 2LP7A 1OCRB 1H38A 2QEXV 1F4NA 2DWDC 3ZMZA 2WLKA 3IGAC 4PA6A 2ITDC 1AJPA 2R9RB 1FS0G 2XOKG 3OMNB 3ML0A 1YJWV 1G4YB 3CYOA 2GSMB 4MS2A 3UKMA 3TETA 3ZN0A 1M9NA 1QVFU 3P32A 3SYPA 5EC1C 3OGCC 2EZPA 4QE9A 2HFEC 4F4LA 1VQKV 1P7BA 1QBZA 3RW0A 1EBOA 3ETEA 4MVOA 4N23A 2WLNA 1VQLV 1K9MW 2Q68A 3SPCA 1K33A 4MVMA 1Y4MA 2Z5UA 1UJWB 2W6JG 5IYBO 2IJIA 3B8MA 2A0LA 3CPWU 1E1RG 4P9PA 5KUKA 3OAAG 1S5HC 2W0FC 1NVPB 1M57C 1KECA 3ABMB 4RUEA 2IU0A 1F23A 5IYCO 1QR9A 3W7UA 3OR6C 1VQ5V 1JCHA 4GX0A 1E1QG 1WLEA 5EBMC 4TWKA 4UXNA 3FB8C 2IJKA 5L3CA 1AI7A 2C2AA 1OCCB 4DXWA 1EFRG 2V1DA 4UV9A 1PKXA 1JPXA 2KB1A 3FYIB 3AG2B 2DQ0A 4WFBV 4HYOA 3X2QC 1NH2B 3I56V 3R65A 2D3OW 2QA4V 3X2QB 3UM7A 4UV8A 5BZBA 3ABKB 4LCUC 2YEVA 1PD3A 2M7WA 1RM1B 3IC7A 4WFAV 3G6EV 3CCMV 4Z1MG 1NH2D 2DYSB 4WF9V 3PJSK 4QPKA 3RVZA 3K08A 1FFTB 3OR7C 4PA9A 2HVKC 2HR3A 4LBEC 1GKFA 3OE7G 1PL0A 2ATKC 2DYRB 2UXXA 3T1CA 4QIWF 2MK3A 1M1KW 1ORQC 1KC8W 5CN0A 2JEUA 2FTKA 3MHHC 1R6NA 1DF4A 1GM7A 1YTFB 1AI6A 1LNQA 1OCCC 3ABLB 4P2ZA 2BOBC 3QNEA 1F4MA 4TSFG 5HFMA 3CC2V 3E8FA 3W7TA 3TCUA 3JD1A 1AJNA 4WCEV 2ZR3A 3G4SV 1NR7A 2OCCB 1M57B 3G71V 2IH3C 3RVYA 1BHAA 3EFFK 1K92A 1K5QA 3FB7C 4U7NA 4HZ3A 5CBHA 1VQOV 1BHBA 3T2MA 2WLMA 5E1AC 3ZCCA 1XL6A 1MABG 3ETGA 4JTDB 5EK0A 2QE7G 3CXCU 5IY5B 5KUMA 3SPIA 4G28B 1VQNV 3AG4C 4GX1A 1R3IC 2Y48A 2P90A 1K3EA 1FXKA 1S76D 3OEHG 3LDEA 3CC4V 5GW7A 1FXKC 4RUFA 3ZN1A 4XDLA 4E2LA 3OUFA 2EIMB 2HJFC 5CBFA 1JOYA 5EC2C 1S72V 4DO2A 2WWWA 2WLIA 4PDMA 1ENVA 1RPOA 3STZC 2IW5A 4G2KA 3GWOA 1HWYA 2ZQMA 5L3DA 3E2EA 3ZMTA 3CC7V 4FK5C 2NNUA 2EIKC 4MVQA 3ZRWA 5DM6V 3OFNG 2WAMA 1SERA 1AI5A 1MOFA 3K06A 5J9PC 1YHQV 4H37A 1K4CC 2IH1C 4JTCB 1NJIW 1R6KA 2HG5C 5B1BC 1IXMA 1ZWIC 1VQ4V 3B8NA 2WLLB 3JYCA 4GCZA 2JEXA 1YSCA 3WG7B 2ZXWB 3ASNB 1NKDA 3H01A 3JD4A 1AJQA 1QLEB 5B1NA 1CEZA 5B3SB 4KUMA 1VQMV 1PNKA 2OT5A 1K34A 4L87A 1K8AW 3ASOB 4ZBMA 2H94A 3QO8A 4G27B 1NVPD 2OCCC 3E8BA 1R73A 3WFVA 3STLC 2P67A 3F7VC 3SYAA 1S77D 1OCZC 4R50A 2X6BA 4PDRA 1YITV 3E8HA 1QCEA 3BY6A 4JYCA 3ZMVA 3TK1A 2WLLA 1GM9A 2JDIG 4MVZA 2B1GA 1CPYA 2DQ3A 1GM8A 2IU3A 2XAJA 2QM7A 1TUEB 5L3FA 3ABKC 1GMGA 3JD3A 3M99B 3K0GA 4MVUA 4X88A 4EKWA 2HKOA 1YJNV 4N21A 5LHHA 3ABUA 4RO2A 1F51A 3D3IA 1E79G 5KA5A 4PDLA 3CCLV 1MG1A 1SETA 2Q67A 5EBWC 4MTXA 4LC1A 1KKDA 3AG4B 3QO5A 4YXWG 5H9CA 1J95A 1YTFD 3P30A 3FKSG 1AI4A 4QE7A 1YIJV 3HB3B 1V54C 4P9OA 1M56B 2UXNA 4KFMA 3ABMC 1VQ9V 2EIJB 4WFHA 1G8MA 4R7CA 1W2BU 1KD1W 4LP8A 1V55C 3I55V 1AROP 2WSSG 2X6CA 2Z3YA 5CMUA 2Y69C 2IJJA 3A0RA 3K03A 4JGSA 1W0JG 4MTGA 1Q81W 3ZRSA 4FPPA 3AG3C 3SPHA 4MW3A 1QLNA 4CBCA 4H33A 3SYQA 4TT3G 1FXHA 2JK5C 3ZMSA 3W7WA 2DYSC 4MVSA 1SZTA 4WFGA 2WLJA 4PELA 4MSWC 3CCRV 3JD0A 1K4DC 4RQEA 2ZDIA 2XNDG 4PDVA 3CCEV 5DN6G 4WFFA 1H2GA 1KQSU 5LGNA 2DWEC 3D36A 1JJ2U 4BAYA 1MSWD 3DGEA 3CMEV 3HPLC 4OXSA 1VQ6V 1H8HG 3CCUV 4BIZA 1YJ9V 4GX5A 2K1EA 5B3SC 2WLIB 4JTAB 2ITCC 2WPDG 2LFRA 5LGUA 4PA3A 3CP1A 1ROPA 1K97A 3KG2A 3E8GA 4FMTA 4P30A 4R8CA 5IY5C 1VQ7V 1KP2A 1M56C 2B1IA 2AHYA 5EBLC 1DLBA 2EIMC 3SJQC 2XAFA 3MHSC 3OUSA 2HVJC 1FXKB 2ZR2A 3FB5C 3BEHA 2XAQA 3AEIA 3FB6C 3LNMB 5H6RA 4ASUG 4MT8A 2EJRA 1GTOA 3JCZA 5IYDO 2P6JA 1EZJA 5CA3A 4JPRA 1BMFG 1PNMA 3LDDA 4JAVA 4BIUA 3E89A 1R3JC 1W0KG 5HFLA 4QJFB 5C93A 5B1BB 4FJCC 2JIZG 3CCJV 3OW2U 1R3KC 1V54B 3NXSA 4GX2A 1JX9A 1RM1C 2Q69A 3K04A 2F43G 3OM3B 1K7DA 2A79B 1FXVA 3W7SA 1V55B 3ASNC 3CD6V 3AG1C 3LSSA 2XASA 3ZMUA 4RQFA 3AG2C 2X7RB 1VQ8V 2V7QG 1Q86W 2LFSA 2A9HA 3T4ZA 4X89A 3GB7C 1R3LC 4QPJA 1XL4A 2OTJV 2X6AA 3K79A 3T4DA 5LGTA 1JVMA 3K0DA 4MW8A 3ZRXA 1S3JA 4RAIA 2B5UA 2EIJC 4XDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ITD C;  2Q6A A;  2R9R B;  1XL6 A;  2X6C A;  1G4Y B;  4JTD B;  4MS2 A;  2Y69 C;  5EK0 A;  3UKM A;  3TET A;  5KUM A;  3SPI A;  4G28 B;  3T4Z A;  3AG4 C;  4GX1 A;  1R3I C;  3K03 A;  3SYP A;  5EC1 C;  3OGC C;  4MTG A;  4QE9 A;  3ZRS A;  2HFE C;  4F4L A;  1P7B A;  3SPH A;  3AG3 C;  3RW0 A;  3LDE A;  3T2M A;  4MVO A;  4MW3 A;  2DYR C;  4RUF A;  4CBC A;  2WLN A;  4H33 A;  3SYQ A;  2Q68 A;  4XDL A;  3SPC A;  3SYC A;  2JK5 C;  3OUF A;  2HJF C;  4MVM A;  4J9Y B;  4XDK A;  2DYS C;  3F7Y C;  4MVS A;  5CBF A;  5EC2 C;  2ZXW C;  4WFG A;  2WLJ A;  3ZJZ A;  4MSW C;  2WLI A;  4PDM A;  4QNH B;  1K4D C;  2A0L A;  3STZ C;  5KUK A;  4P9P A;  1S5H C;  2W0F C;  4PDV A;  1M57 C;  3SYO A;  4MTF A;  4WFF A;  2EIL C;  2QTO A;  3E86 A;  4RUE A;  2EIK C;  4MVQ A;  2DWE C;  3ASO C;  4UUJ C;  3OR6 C;  3K06 A;  5J9P C;  2ZD9 A;  1K4C C;  2IH1 C;  4GX0 A;  4H37 A;  3HPL C;  2HG5 C;  4JTC B;  4OXS A;  4TWK A;  1ZWI C;  3FB8 C;  5EBM C;  5B1B C;  2AHZ A;  2P7T C;  2WLL B;  5CBG A;  3JYC A;  4DXW A;  4GX5 A;  3SPJ A;  2K1E A;  5B3S C;  2EIN C;  2H8P C;  2WLI B;  4JTA B;  2ITC C;  2KB1 A;  4WFE A;  4XDJ A;  4PA3 A;  3LDC A;  4HYO A;  3X2Q C;  3KG2 A;  3E8G A;  4P30 A;  4R8C A;  5IY5 C;  3LUT B;  3R65 A;  2WLH A;  4ZBM A;  1M56 C;  3UM7 A;  2AHY A;  4J9Z B;  5EBL C;  2EIM C;  5BZB A;  3SJQ C;  4LCU C;  3OUS A;  2NLJ C;  2HVJ C;  2YEV A;  4G27 B;  2OCC C;  3E8B A;  3FB5 C;  4I9W A;  3BEH A;  3E83 A;  3FB6 C;  3LNM B;  4PA7 A;  3STL C;  3F7V C;  3SYA A;  1OCZ C;  3PJS K;  4PA4 A;  2X6B A;  4R50 A;  4PDR A;  3RVZ A;  3E8H A;  3K08 A;  2BOC C;  3OR7 C;  4PA9 A;  2WLL A;  2HVK C;  3LDD A;  4MVZ A;  3E89 A;  1R3J C;  4LBE C;  3SPG A;  2ATK C;  3T1C A;  3ABK C;  1R3K C;  4GX2 A;  1ORQ C;  3K0G A;  4X8A A;  2QKS A;  3WG7 C;  4MVU A;  4X88 A;  4EKW A;  2Q69 A;  1QLE C;  3K04 A;  3ABL C;  3F5W C;  2A79 B;  4RO2 A;  4BW5 A;  3VOU A;  1LNQ A;  1OCC C;  4P2Z A;  3RBZ A;  3ASN C;  2BOB C;  4PDL A;  3AG1 C;  1BL8 A;  2Q67 A;  4R6Z A;  4MTO A;  5EBW C;  4PA6 A;  1KKD A;  3AG2 C;  3E8F A;  4MVR A;  1J95 A;  3TCU A;  3IFX A;  4QE7 A;  4LP8 A;  2IH3 C;  1V54 C;  2A9H A;  4P9O A;  4KFM A;  4X89 A;  3RVY A;  1OCR C;  1R3L C;  3EFF K;  1XL4 A;  3FB7 C;  1OCO C;  3ABM C;  2X6A A;  3GB7 C;  5B1A C;  3T4D A;  1JVM A;  3K0D A;  4MW8 A;  4WFH A;  4R7C A;  2DWD C;  4HZ3 A;  5CBH A;  4RAI A;  2WLK A;  3IGA C;  2EIJ C;  1V55 C;  2WLM A;  5E1A C; 
#chains in the Genus database with same CATH topology
 4LF7 B;  2Q6A A;  3CMA V;  1VIB A;  1I5X A;  5D5P A;  1HNZ O;  4X20 A;  2F4V B;  2Q8V A;  3SJB C;  4LF6 B;  1P49 A;  1XMQ O;  2YSU B;  1BZK A;  1L1F A;  1YCI A;  3B77 A;  3L71 H;  1M5I A;  4J9Y B;  3UO3 A;  1CP9 A;  1SES A;  2ZXW C;  2OTL V;  4GZR B;  4QNH B;  3KCX A;  1H2L A;  1H2M A;  1G1X B;  2XAH A;  3E86 A;  3C3T A;  4BWA A;  4DRX B;  4C7U A;  3S3X A;  1XIL A;  4X1I A;  2EIN B;  4J42 A;  1PNL A;  2H8P C;  4UB6 Z;  3FAV A;  1BQZ A;  4NXN B;  4LF9 O;  5KMG A;  3C90 A;  3G6B A;  4O2A A;  4DV0 B;  4J11 A;  3ZHV A;  2HHH O;  4I9W A;  4UB8 Z;  3ZRW B;  4PA7 A;  3RYF A;  3EHB B;  1YI2 V;  4PA4 A;  2HEP A;  1FJG O;  1EM1 A;  4JI6 O;  3EXA A;  1WPX A;  3JD2 A;  4HNA A;  3QG5 A;  5JCO A;  4LH7 A;  3SPG A;  1NT2 B;  3BAB A;  4X64 O;  3HKB A;  4X8A A;  2QKS A;  2XAG A;  2ZT9 B;  1ZL8 B;  4X1K B;  1SQG A;  4JF3 A;  3F5T A;  3F5W C;  3LNN A;  1S0V A;  3OMI B;  3CE2 A;  2CTR A;  4R6Z A;  4JI7 O;  4MTO A;  2PYL A;  3D36 C;  2BE3 A;  4X9Q A;  1GO3 F;  1JR9 A;  1XI1 A;  4UVA A;  2N04 A;  5B1A C;  1OCO C;  2LP7 A;  3O9O A;  1I94 B;  3ZMZ A;  3IGA C;  3JAT A;  1XNQ O;  3RYH A;  1WB7 A;  2XOK G;  1I7F A;  3DXR A;  2UXD O;  3OGC C;  5EZY A;  2QWP B;  4F4L A;  3ETE A;  2Q68 A;  4U3J B;  4EB6 A;  2BSK B;  1K33 A;  2YIC A;  1UFI A;  2XUM A;  3OTF A;  2Z5U A;  2VQF B;  1SA0 A;  2PZS A;  2IJI A;  3AK1 A;  1E1R G;  3OAA G;  1N0J A;  1KEC A;  5GON A;  2QGN A;  3RYI A;  4LF5 B;  3FB8 C;  2IJK A;  2YIB D;  1WAZ A;  1AI7 A;  1P7G A;  5JH7 B;  2KB1 A;  3FYI B;  4WFB V;  4HYO A;  4BR6 A;  2R70 A;  3I56 V;  2D3O W;  4DR4 B;  1LUV A;  5BZB A;  1QNM A;  4X66 B;  4LCU C;  2YEV A;  1PD3 A;  3ZED A;  3IC7 A;  2XT9 A;  5EIB D;  4WF9 V;  4QPK A;  1HNW O;  4PA9 A;  1Y76 A;  2HVK C;  4FLT A;  4UCO A;  3L9D A;  4JI7 B;  2MK3 A;  1M1K W;  3H1J H;  2GTS A;  3APO A;  2W0X A;  1FYJ A;  2FTK A;  3MHH C;  1R6N A;  4TUY A;  2CGN A;  2GTA A;  1N36 B;  5B66 Z;  4OX9 O;  2RDC A;  2BTQ B;  4TSF G;  3CC2 V;  3E8F A;  2K9P A;  4WCE V;  1NR7 A;  2BTQ A;  5KX5 A;  1BHA A;  3EFF K;  1K5Q A;  1Q5O A;  3ZHR A;  5LMN O;  5CBH A;  2Q7G A;  4FFB B;  2PF4 E;  4B3T O;  1FPO A;  5A9G A;  4QGP A;  5CA0 A;  3J81 N;  1MAB G;  3ETG A;  5EK0 A;  2QE7 G;  3CXC U;  5IY5 B;  5KUM A;  4G28 B;  1M93 A;  1VQN V;  2P90 A;  2E74 B;  2H3O A;  1K3E A;  1ZX3 A;  1ZL8 A;  3I5D A;  4AQY B;  1US6 A;  3JAS B;  4E2L A;  3OUF A;  1XEQ A;  1JOY A;  1S72 V;  4X65 B;  2YS8 A;  3IC9 A;  4IYH A;  1RPO A;  4CH5 A;  4ABM A;  1XRE A;  3OTO B;  3GWO A;  1HWY A;  2ZQM A;  1HNX B;  4LFA B;  3CC7 V;  2ADP A;  4FK5 C;  2P4K A;  2WAM A;  2ZNI A;  2UXB O;  1IUR A;  4O4I B;  1AI5 A;  1YHQ V;  2IH1 C;  4NR1 A;  1ZWI C;  4ZI7 A;  2WLL B;  2ILM A;  2JEX A;  3WG7 B;  4YHH O;  4X66 O;  1NKD A;  4NYK A;  1VQM V;  4LF7 O;  4TQD A;  4KXR A;  1XDC A;  1Q3E A;  3IAY A;  4JV5 B;  1KKC A;  1K8A W;  3PN1 A;  4DR2 B;  3KCY A;  3A2F A;  1TA8 A;  4DRX A;  3QO8 A;  4BW9 A;  4GKJ B;  4G27 B;  4GKK O;  3WFV A;  3SYA A;  2VS0 A;  3FD9 A;  3U10 A;  3E8H A;  1QCE A;  2QM4 A;  2WLL A;  1GM9 A;  4MVZ A;  3VQW A;  4FLZ A;  2Y4U A;  2QTS A;  2IU3 A;  3CB2 A;  1GMG A;  3O65 A;  4MVU A;  2HKO A;  4W4K A;  5LHH A;  3ABU A;  4DR7 O;  3CEI A;  5KA5 A;  3ZHT A;  1MG1 A;  4DV1 B;  4FZ0 A;  4O4H B;  1YTF D;  4U3F H;  3FKS G;  3ZHQ A;  2CE4 A;  2E76 B;  2IM9 A;  1M56 B;  4BIO A;  3ABM C;  1VF5 B;  1W2B U;  2Q73 A;  4FLY A;  4DV4 B;  4H13 B;  3I55 V;  4F6E A;  3D3Q A;  3E22 A;  4NTY A;  1KB9 F;  2IJJ A;  1VEW A;  3A0R A;  3K03 A;  1W0J G;  5J2U A;  3AG3 C;  4MW3 A;  1XUQ A;  4LF4 B;  4TT3 G;  2JK5 C;  4I4T A;  4A5U B;  4D7T A;  4FFK A;  4TV8 A;  4PDV A;  2Q7H A;  2ADQ B;  4JI1 O;  4ZHQ A;  5DN6 G;  5KMG B;  1KQS U;  3S3W A;  2DWE C;  3D36 A;  4PJ0 Z;  3U0Z A;  1JJ2 U;  1TUB A;  4O4I A;  3BHP A;  4JV5 O;  1H8H G;  2K1E A;  2WLI B;  4JTA B;  4YJ2 B;  4AQY O;  1Y6X A;  4O4L B;  4PA3 A;  3CP1 A;  3E8G A;  4FMT A;  4R8C A;  2CH7 A;  3ZHU A;  1MZE A;  1YVW A;  2ZR2 A;  1TAE A;  2HP8 A;  4ASU G;  3CRC A;  5IYD O;  1V9P A;  5CA3 A;  4JPR A;  1PNM A;  4CH6 A;  4O4H A;  4JAV A;  1W0K G;  4LF8 O;  2PY5 A;  4LWS A;  3CCJ V;  4GX2 A;  2ODM A;  1RM1 C;  4YJ3 B;  3OM3 B;  5IWA O;  1HP8 A;  1R6T A;  3W7S A;  5ITZ A;  3CD6 V;  2ZIO A;  1HR0 B;  4JZG A;  1XNQ B;  4B3S O;  3AG2 C;  4CS4 A;  2BSK A;  1Q86 W;  2LFS A;  3ZHS A;  4PI0 A;  3P3P A;  5JWP A;  4I9Q A;  2OTJ V;  2RCV A;  4NXM B;  4TQF A;  3TJT A;  3ZRX A;  4WBN B;  1N34 B;  2AZ2 A;  4UVB A;  1MSD A;  1G6U A;  3SDL A;  2RJZ A;  3AK2 A;  3SYC A;  4JI2 O;  4XDK A;  1LUW A;  3B4S A;  3CCS V;  2F66 C;  3ZJZ A;  1JQ0 A;  2RMK B;  4HAM A;  4JAU A;  5LXT B;  3OMA B;  1P4R A;  4UCR A;  4I5S A;  2QWR B;  3JCU Z;  3U11 A;  4FFB A;  4MTF A;  2EIL C;  4CH4 A;  2QTO A;  3BRC A;  2HHH B;  5B1O A;  2P22 C;  2DMX A;  2ZD9 A;  1Y67 A;  1OCO B;  5CBG A;  1XOU A;  1AR1 B;  3K5M A;  2F4V O;  1VF6 A;  2GV9 A;  3M8A A;  1VQP V;  4WFE A;  2NR5 A;  4J10 A;  1XMQ B;  1K5S A;  3LDC A;  4JYB A;  4B3R O;  2KG7 B;  4B3M B;  4J9Z B;  3N2K A;  3JAW A;  1I5Y A;  3BCC H;  2PI5 A;  5L3G A;  1QR8 A;  4B08 A;  1RPR A;  2QSA A;  5GTI Z;  3ZIA G;  1OCZ B;  3E83 A;  5B1A B;  2EBO A;  3WB1 A;  2DE0 X;  2UUC O;  4UVC A;  3ZRV A;  1I08 A;  3APQ A;  2EJ7 A;  3K58 A;  3WG7 C;  4UCU A;  2YI9 A;  4JI0 B;  1M90 W;  3RBZ A;  2XTA A;  1GK9 A;  4NB5 A;  3OGI B;  4O4L A;  2JGU A;  1SRY A;  1OCR C;  4DV0 O;  2HLD G;  2QKA A;  1H38 A;  2Y0P A;  3J80 N;  3DSQ A;  1SZX A;  2ITD C;  1AJP A;  4JI4 B;  3ML0 A;  3SGI A;  1JA8 A;  3TET A;  2GSM B;  2VWK A;  4DR7 B;  3ZN0 A;  5B5E Z;  5EC1 C;  2HFE C;  1VQK V;  1P7B A;  4MVO A;  4JYY A;  2WLN A;  5KAF Z;  3UCS C;  2E75 B;  1VQL V;  1K9M W;  3SPC A;  1IZ3 A;  2UXB B;  4KL1 A;  1KMI Z;  1RFY A;  1EN6 A;  1UJW B;  3B8M A;  3CPW U;  1S5H C;  2ZE5 A;  4RUE A;  2IU0 A;  2UUC B;  1YEW A;  3K59 A;  3OR6 C;  1E1Q G;  2C2A A;  1EFR G;  1NU1 H;  4FLU A;  4DR3 O;  4DV3 B;  1EZV H;  4JI3 O;  4K8X A;  1WNS A;  2DQ0 A;  3X2Q C;  3R65 A;  4X1K A;  3KKY A;  2UUA B;  1A32 A;  4O4J B;  4UV8 A;  1H2N A;  5LP6 B;  4K0K B;  5BMV A;  2M7W A;  4IHJ A;  2JGD B;  2DYS B;  5CB4 A;  3RVZ A;  3K08 A;  1FFT B;  3EVK A;  3KZI Z;  2GBO A;  2QDO A;  1ZSP A;  2HR3 A;  2Q9L A;  4LBE C;  1GKF A;  3L73 H;  2ATK C;  2UXX A;  4CH3 A;  4DV7 B;  5CN0 A;  1N36 O;  4TV8 B;  4H44 B;  1GN2 A;  1AI6 A;  2VQE B;  1JJO A;  2LQT A;  2BOB C;  1PP9 H;  2FML A;  3QNE A;  4HNA B;  5HFM A;  4J80 A;  4LF8 B;  3K5N A;  4J7Z A;  1AJN A;  2OCC B;  2IH3 C;  1WN7 A;  2CTP A;  3JAK B;  1IXB A;  1K92 A;  3FB7 C;  4U7N A;  1I94 O;  2E3C A;  4EB6 B;  3T2M A;  2BCC H;  3ZCC A;  4JTD B;  1MNG A;  5EIB C;  4EFE A;  4GX1 A;  4K8Z A;  2O57 A;  1S76 D;  2AXT Z;  3CC4 V;  4RUF A;  5IJ9 A;  5JVD B;  1SC5 B;  4DO2 A;  3OTO O;  4X64 B;  5IJ9 B;  3T1Y O;  2WLI A;  4PDM A;  3DC5 A;  2A7W A;  1VF6 C;  4G2K A;  4JI5 B;  3E2E A;  5KHI A;  1WP8 A;  1Y74 B;  2EIK C;  4MVQ A;  5DM6 V;  4OGQ B;  5J9P C;  1YF2 A;  3J7A U;  4JTC B;  4O2A B;  1R6K A;  1JFF B;  4UFZ A;  4GCZ A;  4NXN O;  2CTQ A;  3OT7 A;  3JD4 A;  1BT8 A;  1AJQ A;  1QLE B;  1CEZ A;  3FAV B;  5ITZ B;  1GN6 A;  4DUY B;  1QQC A;  4NVP A;  4ZBM A;  2VWJ A;  2OCC C;  1P84 F;  3K5L A;  3STL C;  3F7V C;  5LMU B;  1OCZ C;  4PDR A;  2R9A A;  3QF7 A;  2CTW A;  4DK0 A;  2N74 A;  2B1G A;  1QHT A;  2DQ3 A;  1TUE B;  1XQ8 A;  3CRR A;  3HKC A;  3K0G A;  2UU9 B;  5K1X A;  3ICX A;  3M7M X;  3K57 A;  2AZ0 A;  3L75 H;  3D3I A;  2LW1 A;  3SJC C;  4LC1 A;  3QO5 A;  3JAS A;  4YXW G;  3HR0 A;  1LR1 A;  3P30 A;  1AI4 A;  3HB3 B;  1V54 C;  1L0L H;  1G8M A;  4R7C A;  2JS3 A;  1V55 C;  1W59 A;  1WA8 B;  5CMU A;  2RNB A;  5KHJ A;  4JGS A;  2YID A;  4JZ2 A;  4MTG A;  5KX5 B;  1OJH A;  1QLN A;  4CBC A;  1BQ0 A;  2LO1 A;  4WFG A;  3CCR V;  4LFC O;  4RQE A;  2XND G;  1AP6 A;  3IJ4 A;  5TIS Z;  2OIG A;  3K5O A;  4DR2 O;  1MSW D;  3DGE A;  3CME V;  4OXS A;  2AGA A;  3JAT B;  2F23 A;  2YXH A;  2ITC C;  4PHZ A;  3CXH F;  5LGU A;  1K97 A;  1RSO A;  4FLV A;  1KBH A;  4I0X B;  2AHY A;  1R1B A;  1DLB A;  2EIM C;  2XAF A;  3MHS C;  1IDS A;  2HVJ C;  2E5L B;  5FPO A;  2XAQ A;  3AEI A;  3JCZ A;  3A0H Z;  1TVK B;  1EZJ A;  4O2B B;  1AB3 A;  1BMF G;  3E89 A;  4QJF B;  4I4T B;  5B1B B;  3OW2 U;  3NXS A;  4DR1 B;  4FVM A;  4WBN A;  1B06 A;  1FXV A;  1B3Q A;  3AG1 C;  3BVO A;  3LSS A;  3E22 B;  3JAR A;  1NTM H;  2G38 A;  1VQ8 V;  1Z5V A;  3JAM N;  2A9H A;  4B3T B;  1SQF A;  3T4D A;  2N05 A;  3K0D A;  4MW8 A;  1IX9 A;  1HW7 A;  4RAI A;  1N33 O;  2PYJ A;  2B5U A;  3RYH B;  1Q82 W;  4GKJ O;  3CCV V;  4DV2 O;  2XHB A;  4DV5 B;  2D2C B;  3ZS8 C;  4DR4 O;  2Y69 B;  4GT1 A;  3CWB H;  4IHJ B;  4J7K A;  5J2T A;  1Y66 A;  2L35 A;  1XMO B;  1COW G;  4J7J A;  2DYR C;  4XBF A;  3RYC A;  5LXT A;  3FFQ A;  5IYZ A;  2YXL A;  1HNX O;  2Q0A A;  2ZE7 A;  2F95 B;  2Q5Z A;  3SJA C;  5JJJ B;  4FZ1 A;  5J2T B;  4H0L B;  4JI6 B;  4UUJ C;  3W7X A;  4TV9 B;  3CCQ V;  5JQG A;  2F1M A;  1FD9 A;  2AHZ A;  1Q7Y W;  1FFX B;  1B6Q A;  2ZDI C;  3QO7 A;  1NTK H;  1NBM G;  5LA6 B;  4ZHQ B;  2EIL B;  3LUT B;  2WLH A;  3N2K B;  1JFF A;  4L8J A;  1N8R W;  3L74 H;  2NLJ C;  5KA6 A;  2GHY A;  3N2G B;  3QVN A;  1DTO A;  4LH6 A;  2PUS A;  4YJ3 A;  3FYE B;  4JAS A;  3P3N A;  5IDJ A;  1HR0 O;  2BOC C;  4ZKI A;  1BGY H;  1NQT A;  2JJ2 G;  4Q20 A;  3A8T A;  2OCH A;  2EZO A;  4FIP C;  3OEE G;  3FX7 A;  2ZM6 O;  2ZNJ A;  3ABL C;  1OHH G;  3AG1 B;  4BW5 A;  3VOU A;  5IE9 A;  5FL7 G;  2UXC B;  3DTU B;  1BL8 A;  1D5N A;  2ZIN A;  4CZZ A;  4CC6 A;  1SQV H;  1O9G A;  2ZCE A;  2LGW A;  3CRA A;  1OZ0 A;  3IFX A;  2R9I A;  4DV5 O;  3WB0 A;  1QVG U;  2QM8 A;  5H5N A;  1SQX H;  2DWD C;  4NTW A;  3G67 A;  1G4Y B;  3UKM A;  1MA1 A;  1M9N A;  3RGB A;  3P32 A;  3QTC A;  3SYP A;  3T1H B;  4QE9 A;  1BE3 H;  1EBO A;  4N23 A;  1GRJ A;  4DR3 B;  1N32 O;  4JI8 O;  4FM0 A;  1D5A A;  3C3S A;  5IYB O;  2YC0 A;  5KUK A;  1NVP B;  2W0F C;  1M57 C;  4Q6G A;  4X1I B;  4DV6 B;  3ABM B;  1F23 A;  1QR9 A;  4IT5 A;  3W7U A;  1IBL O;  1JCH A;  3ZX6 A;  4GX0 A;  1WLE A;  5EBM C;  3BA8 A;  4TWK A;  4UCT A;  1N32 B;  1OCC B;  2DJV A;  2V1D A;  4UCV A;  4CS2 A;  2YIB A;  4JAA A;  2DN9 A;  3AG2 B;  1VF7 A;  4DUZ O;  1AR5 A;  4KHP O;  5KHH A;  4K3A A;  1X59 A;  3ABK B;  3UT5 B;  4IIJ B;  1RSO B;  1RM1 B;  5E79 Z;  4WFA V;  3CCM V;  2Y0I A;  1IBL B;  4Z2W A;  5KLV H;  1H2S B;  3OE7 G;  1PL0 A;  4B7E A;  2ETN A;  4QIW F;  1IBK O;  1MZF A;  1ORQ C;  1KC8 W;  2JEU A;  2Q7E A;  2KKW A;  1DF4 A;  1GM7 A;  5F2V O;  5EZY B;  1YTF B;  4DR6 B;  5EYP B;  1LNQ A;  1OCC C;  4P2Z A;  1I0H A;  4JI4 O;  5KHG A;  3Q4H A;  3W7T A;  3TCU A;  3JD1 A;  2E5L O;  1M57 B;  1SA0 B;  1GN4 A;  4B3M O;  1VQO V;  4HBN A;  1BHB A;  4AHC A;  1TVK A;  1XL6 A;  5BR8 O;  3SPI A;  2CDY A;  3AG4 C;  3HKE B;  1RP3 B;  1FXK A;  4LFB O;  4DR1 O;  3OEH G;  1L8D A;  3LDE A;  5GW7 A;  4CS3 A;  4I0X A;  4XDL A;  1T5E A;  2LGQ A;  2EIM B;  2HJF C;  5CBF A;  5EC2 C;  5H2F Z;  4ZOL A;  5BMV B;  5GTH Z;  3DC6 A;  2FL4 A;  1ENV A;  2WA4 A;  4O4J A;  3STZ C;  2IW5 A;  4X65 O;  5L3D A;  3ZMT A;  3N27 A;  3CHX A;  3ZRW A;  1AR4 A;  2PTM A;  2PGG A;  1SS3 A;  1K4C C;  3JAW B;  2HG5 C;  4B7K A;  1VQ4 V;  4LFB B;  3JYC A;  1YSC A;  5KAI Z;  3RFR A;  3RYC B;  3H01 A;  5B1N A;  4DV3 O;  2LW7 A;  4KUM A;  2HJD A;  2OT5 A;  4GYC B;  4W4L A;  1XMO O;  3VQX A;  1FFX A;  2CUG A;  3ASO B;  2QKC A;  2H94 A;  3UQ8 A;  5JQG B;  1U96 A;  3R66 A;  1NVP D;  3E8B A;  1N34 O;  1R73 A;  4TUY B;  4R50 A;  4IGG A;  3BY6 A;  4ICG A;  4OPH A;  1OV9 A;  2DOS A;  3JAR B;  2VQE O;  1GM8 A;  1ZTE A;  1ZAU A;  3ABK C;  3A0B Z;  3H9V A;  3JD3 A;  4X62 O;  3M99 B;  4X88 A;  4EKW A;  4DK1 A;  2RQ6 A;  5IWA B;  1PM9 A;  2JGD A;  1Q43 A;  5IJ0 A;  4F6R A;  1E79 G;  3CCL V;  2VRZ A;  3G80 A;  2Q67 A;  1D2D A;  1KKD A;  2QWN B;  3CS5 A;  1Q6I A;  5H9C A;  2EUL A;  1BCC H;  4O2B A;  1GH6 A;  4P9O A;  3B09 A;  3B40 A;  3ETQ A;  3L72 H;  1VQ9 V;  2EIJ B;  5IYZ B;  4YIO A;  2WSS G;  3HKB B;  2Z3Y A;  3AG7 A;  1WP7 A;  5LYJ B;  1PPJ H;  1NTZ H;  3ZRS A;  4FPP A;  3SPH A;  4X62 B;  3RWR D;  4LR3 A;  1DGS A;  4H33 A;  3GVM A;  4NKG B;  3H1H H;  3ZMS A;  3W7W A;  3Q4H B;  2WLJ A;  4DV7 O;  2A3Q A;  4PEL A;  4U3J A;  3JD0 A;  3BPZ A;  2QWO B;  2ZDI A;  1H2G A;  2UUB O;  5LGN A;  1L0N H;  1WPB A;  3ZBH A;  1VQ6 V;  1KU9 A;  2BTO A;  3JAL B;  2YUA A;  3RN4 A;  2WPD G;  5J2U B;  1H2K A;  2LFR A;  1ROP A;  4LF9 B;  3KG2 A;  2F93 B;  4P30 A;  5IY5 C;  1Q90 D;  1CXZ B;  2B1I A;  2ZE8 A;  2NN4 A;  3SJQ C;  4DV6 O;  1FXK B;  3FB5 C;  3BEH A;  5H6R A;  3TXS A;  1GTO A;  2CGO A;  4IYI A;  1IBM B;  3VQY A;  2UXC O;  4JI0 O;  4BIU A;  1R3J C;  3H1K H;  2QJ1 A;  5FPR A;  3BAA A;  1QU7 A;  5BY1 A;  1V54 B;  2YXY A;  1JX9 A;  2OYQ A;  3K04 A;  2F43 G;  3BFR A;  1K7D A;  3HKC B;  3ASN C;  4I50 A;  4LNU B;  2XAS A;  3ZMU A;  4RQF A;  2V7Q G;  3B2E E;  4ZI7 B;  4X89 A;  3WU2 Z;  4DV4 O;  2X6A A;  3K79 A;  1JVM A;  5LOV B;  2GUZ A;  4PD4 F;  3MD0 A;  3CX5 F;  3JSL A;  5CB4 B;  4DR6 O;  1Q6H A;  2DW4 A;  5BXZ A;  1MMM A;  1UPG A;  3E35 A;  4D7S A;  1K73 W;  4K35 A;  4IL6 Z;  3HKD A;  3LSQ A;  4DW0 A;  2CAZ C;  3F7Y C;  4AIL C;  3ETD A;  1FJG B;  3HKD B;  1Y74 A;  3JSN A;  3ABT A;  1XHX A;  3SYO A;  5K1P A;  2CK3 G;  1SF9 A;  1DF5 A;  1IBM O;  3ASO C;  2Q0O C;  3K3W A;  1NR1 A;  2P7T C;  1S5J A;  3SPJ A;  4K0K O;  2EIN C;  5LHI A;  5H6Q A;  4X1Y B;  4DV2 B;  1H8E G;  3LSU A;  2X0L A;  2FKX A;  1XHZ A;  4KP4 A;  2ZKO A;  2IJH A;  1TGO A;  1ZLZ A;  3K9A A;  5LHG A;  5LA6 A;  1EN5 A;  3THO A;  3CSX A;  2EX3 A;  4X1Y A;  3MAQ A;  4DR5 O;  1SQB H;  4LWS B;  4AI8 A;  3VBB A;  5JJE B;  1O9H A;  1F7Y A;  5L3B A;  4U7O A;  1VMG A;  2YEV B;  1WB8 A;  5EYP A;  3H1L H;  4ZIB A;  4YY3 O;  1THZ A;  3AG3 B;  2PI4 A;  1QLE C;  5LBQ A;  2W6I G;  3HKE A;  4OPA A;  1Z2G A;  1HNW B;  4I55 A;  5CA0 B;  2JJ1 G;  4MVR A;  4FM2 A;  2EIK B;  5BR8 B;  5CA1 A;  5L3E A;  1KP3 A;  3JAK A;  4JYA O;  4ZOL B;  1NI8 A;  2UUA O;  5IJ0 B;  4I7Z B;  1OCR B;  5LMN B;  2QEX V;  1F4N A;  4NXM O;  2WLK A;  4IIJ A;  4B3S B;  4PA6 A;  3UT5 A;  1GAX A;  4OX9 B;  2R9R B;  3OMN B;  1FS0 G;  1YJW V;  3CYO A;  2M6Y A;  4MS2 A;  1QVF U;  5A2Q N;  2KSD A;  1URF A;  2EZP A;  1QBZ A;  3RW0 A;  4EEQ A;  1XNR O;  1U97 A;  5DED A;  4MVM A;  5FNV A;  1Y4M A;  1PV0 A;  1XBL A;  1NZ6 A;  2W6J G;  1EN4 A;  3RT3 C;  2A0L A;  4P9P A;  2VQF O;  4GLX A;  5JJN B;  2QWQ B;  4LFA O;  5IYC O;  4JI2 B;  2R72 A;  3SR2 C;  1VQ5 V;  1J5E O;  4UXN A;  5FNV B;  5L3C A;  1IVS A;  4DXW A;  4UV9 A;  5AG2 A;  1PKX A;  2FB5 A;  1JPX A;  4KHP B;  5JH7 A;  1YXB A;  4EFB A;  1NH2 B;  3K9S A;  3T1H O;  2QA4 V;  3X2Q B;  1NS1 A;  3UM7 A;  2P4V A;  4PI2 A;  2Q4P A;  1BS3 A;  2CH7 B;  3G6E V;  4Z1M G;  2YDE A;  3GWK C;  1NH2 D;  4LF5 O;  4YJ2 A;  3PJS K;  4LFC B;  4JYA B;  2GUZ B;  3OR7 C;  3RYF B;  2DYR B;  3T1C A;  1S5L Z;  4LF6 O;  4DW1 A;  4E4E A;  3ABL B;  4CC5 A;  1F4M A;  1HNZ B;  4PV1 B;  2ZR3 A;  3G4S V;  3G71 V;  1Q6U A;  3RVY A;  3N2G A;  4HZ3 A;  1AIL A;  4J41 A;  2WLM A;  5E1A C;  1GN3 A;  2V4D A;  1R3I C;  2IBZ H;  2Y48 A;  4B3R B;  1Y76 B;  3DXR B;  1YZB A;  1FXK C;  3ZN1 A;  2OWO A;  1Q8I A;  4JI5 O;  3BA9 A;  1J5E B;  2WWW A;  2JRI A;  5LP6 A;  5LMU O;  3CRQ A;  5CA1 B;  2LJ2 A;  5D5Q A;  4JI1 B;  2NNU A;  3OFN G;  1SER A;  1MOF A;  3K06 A;  3UO2 A;  4FLX A;  4H37 A;  3AK3 A;  1NJI W;  5B1B C;  1IXM A;  4FM1 A;  3B8N A;  4DUZ B;  4RWU A;  1WJZ A;  4UCS A;  2ZXW B;  3ASN B;  1AVM A;  2P06 A;  3RYI B;  2YIA A;  3TGU H;  5B3S B;  4YHH B;  1PNK A;  1K34 A;  5GON B;  4L87 A;  2YI8 A;  2P67 A;  1FKA O;  1S77 D;  2X6B A;  1KUQ A;  1YIT V;  3CJH B;  5C8Y A;  3ZMV A;  4JYC A;  3TK1 A;  4JI8 B;  2KG7 A;  2JDI G;  1CPY A;  2L6L A;  2XAJ A;  2QM7 A;  5L3F A;  2WA3 A;  2QR4 A;  2B9Z A;  1YJN V;  4N21 A;  4RO2 A;  4LF4 O;  1F51 A;  1SQP H;  3L70 H;  4PDL A;  1AP5 A;  1SET A;  5EBW C;  3JAL A;  1N33 B;  1PL4 A;  4MTX A;  1VAR A;  3AG4 B;  5JVD A;  1J95 A;  5LOV A;  1FAF A;  4QE7 A;  5LL6 Y;  1YIJ V;  4I55 B;  2UXN A;  2A06 H;  4KFM A;  1N4C A;  2ARH A;  5LP6 C;  1X4T A;  1YDX A;  1B04 A;  4WFH A;  3CRM A;  4Z1V A;  1DK1 A;  1KD1 W;  4LP8 A;  1ARO P;  5IT9 N;  3WB2 A;  2X6C A;  3VQV A;  4JI3 B;  2Y69 C;  2GDS A;  1Q81 W;  4DV1 O;  2UU9 O;  1N0N A;  3MDS A;  1JMK C;  2Y4T A;  3SYQ A;  1FXH A;  2ZM6 B;  2DYS C;  5LYJ A;  4MVS A;  4YY3 B;  1SZT A;  1IBK B;  1TUB B;  4MSW C;  4FLW A;  1K4D C;  3T1Y B;  4GKK B;  1M4U A;  3CCE V;  4WFF A;  2ZE6 A;  5KHK A;  4LNU A;  1XNR B;  4BAY A;  2JS5 A;  3D8C A;  3HPL C;  5DEC A;  3CCU V;  4BIZ A;  1YJ9 V;  1BSM A;  4GX5 A;  4TOI A;  4DUY O;  4GUN A;  5B3S C;  4DYL A;  4TV9 A;  4F6R B;  2OIE A;  1VQ7 V;  3NR7 A;  4NTX A;  1KP2 A;  2MW2 B;  1M56 C;  5EBL C;  2Z0A A;  3OUS A;  1HDJ A;  3FB6 C;  3LNM B;  2ZIM A;  4MT8 A;  2EJR A;  2JVD A;  3CJH A;  5C8Y B;  2P6J A;  1SKV A;  2UUB B;  2RN9 A;  1SQQ H;  3LDD A;  5HFL A;  4D6T H;  4X20 B;  5C93 A;  2FYU H;  3TXQ A;  4FJC C;  2JIZ G;  1R3K C;  2AW9 A;  1ZUQ A;  1VP7 A;  2Q69 A;  2UXD B;  2A79 B;  1V55 B;  1Z5W A;  3H1I H;  5FLX N;  1WA8 A;  2X7R B;  4YIP A;  1KYO F;  3OD4 A;  3T4Z A;  2KQX A;  4I50 B;  3GB7 C;  1R3L C;  4QPJ A;  1XL4 A;  4DR5 B;  5LGT A;  2P5O A;  1S3J A;  5JCO C;  2EIJ C;  4XDJ A; 
#chains in the Genus database with same CATH homology
 2Q6A A;  1Q82 W;  3MD0 A;  3CCV V;  3CMA V;  1I5X A;  4UVB A;  2DW4 A;  2Y69 B;  4GT1 A;  3E35 A;  1Y66 A;  1COW G;  2YSU B;  1K73 W;  2DYR C;  1L1F A;  3B77 A;  4XBF A;  3SYC A;  3LSQ A;  4J9Y B;  4XDK A;  3F7Y C;  1CP9 A;  1SES A;  2ZXW C;  3ETD A;  3CCS V;  2OTL V;  3ZJZ A;  1JQ0 A;  4JAU A;  4HAM A;  3OMA B;  4QNH B;  1P4R A;  4I5S A;  3ABT A;  3SYO A;  2XAH A;  4MTF A;  2CK3 G;  2EIL C;  2QTO A;  1DF5 A;  3E86 A;  5B1O A;  4UUJ C;  3W7X A;  3ASO C;  2ZD9 A;  3CCQ V;  3K3W A;  2AHZ A;  1OCO B;  1NR1 A;  2P7T C;  5CBG A;  2EIN B;  1Q7Y W;  3SPJ A;  1AR1 B;  1B6Q A;  1PNL A;  2EIN C;  2H8P C;  5LHI A;  2ZDI C;  5H6Q A;  1VQP V;  3QO7 A;  4WFE A;  1H8E G;  1NBM G;  1K5S A;  3LDC A;  4JYB A;  2X0L A;  2EIL B;  3LUT B;  2WLH A;  4J9Z B;  4KP4 A;  1N8R W;  1I5Y A;  2IJH A;  2PI5 A;  5L3G A;  1QR8 A;  2NLJ C;  1RPR A;  3K9A A;  5LHG A;  4I9W A;  3ZRW B;  5KA6 A;  2GHY A;  3ZIA G;  1OCZ B;  3E83 A;  4PA7 A;  1DTO A;  5B1A B;  2EBO A;  3EHB B;  1YI2 V;  3FYE B;  4PA4 A;  4JAS A;  5IDJ A;  4UVC A;  3ZRV A;  2BOC C;  4ZKI A;  1NQT A;  2JJ2 G;  4Q20 A;  3VBB A;  1WPX A;  3JD2 A;  5L3B A;  4U7O A;  3SPG A;  2YEV B;  2EZO A;  4FIP C;  4X8A A;  3WG7 C;  2QKS A;  2XAG A;  1THZ A;  3AG3 B;  2PI4 A;  3OEE G;  1QLE C;  4JF3 A;  3ABL C;  3F5W C;  1OHH G;  5LBQ A;  3AG1 B;  2W6I G;  3VOU A;  4BW5 A;  1M90 W;  5FL7 G;  3RBZ A;  3DTU B;  1S0V A;  3OMI B;  1BL8 A;  4R6Z A;  4MTO A;  4CZZ A;  2JJ1 G;  4MVR A;  1GK9 A;  2EIK B;  1OZ0 A;  3IFX A;  2R9I A;  1GO3 F;  5L3E A;  1KP3 A;  4UVA A;  1QVG U;  2QM8 A;  1SRY A;  1OCR C;  5B1A C;  1OCO C;  2HLD G;  2LP7 A;  1OCR B;  1H38 A;  2QEX V;  1F4N A;  2DWD C;  3ZMZ A;  2WLK A;  3IGA C;  4PA6 A;  2ITD C;  1AJP A;  2R9R B;  1FS0 G;  2XOK G;  3OMN B;  3ML0 A;  1YJW V;  1G4Y B;  3CYO A;  2GSM B;  4MS2 A;  3UKM A;  3TET A;  3ZN0 A;  1M9N A;  1QVF U;  3P32 A;  3SYP A;  5EC1 C;  3OGC C;  2EZP A;  4QE9 A;  2HFE C;  4F4L A;  1VQK V;  1P7B A;  1QBZ A;  3RW0 A;  1EBO A;  3ETE A;  4MVO A;  4N23 A;  2WLN A;  1VQL V;  1K9M W;  2Q68 A;  3SPC A;  1K33 A;  4MVM A;  1Y4M A;  2Z5U A;  1UJW B;  2W6J G;  5IYB O;  2IJI A;  3B8M A;  2A0L A;  3CPW U;  1E1R G;  4P9P A;  5KUK A;  3OAA G;  1S5H C;  2W0F C;  1NVP B;  1M57 C;  1KEC A;  3ABM B;  4RUE A;  2IU0 A;  1F23 A;  5IYC O;  1QR9 A;  3W7U A;  3OR6 C;  1VQ5 V;  1JCH A;  4GX0 A;  1E1Q G;  1WLE A;  5EBM C;  4TWK A;  4UXN A;  3FB8 C;  2IJK A;  5L3C A;  1AI7 A;  2C2A A;  1OCC B;  4DXW A;  1EFR G;  2V1D A;  4UV9 A;  1PKX A;  1JPX A;  2KB1 A;  3FYI B;  3AG2 B;  2DQ0 A;  4WFB V;  4HYO A;  3X2Q C;  1NH2 B;  3I56 V;  3R65 A;  2D3O W;  2QA4 V;  3X2Q B;  3UM7 A;  4UV8 A;  5BZB A;  3ABK B;  4LCU C;  2YEV A;  1PD3 A;  2M7W A;  1RM1 B;  3IC7 A;  4WFA V;  3G6E V;  3CCM V;  4Z1M G;  1NH2 D;  2DYS B;  4WF9 V;  3PJS K;  4QPK A;  3RVZ A;  3K08 A;  1FFT B;  3OR7 C;  4PA9 A;  2HVK C;  2HR3 A;  4LBE C;  1GKF A;  3OE7 G;  1PL0 A;  2ATK C;  2DYR B;  2UXX A;  3T1C A;  4QIW F;  2MK3 A;  1M1K W;  1ORQ C;  1KC8 W;  5CN0 A;  2JEU A;  2FTK A;  3MHH C;  1R6N A;  1DF4 A;  1GM7 A;  1YTF B;  1AI6 A;  1LNQ A;  1OCC C;  3ABL B;  4P2Z A;  2BOB C;  3QNE A;  1F4M A;  4TSF G;  5HFM A;  3CC2 V;  3E8F A;  3W7T A;  3TCU A;  3JD1 A;  1AJN A;  4WCE V;  2ZR3 A;  3G4S V;  1NR7 A;  2OCC B;  1M57 B;  3G71 V;  2IH3 C;  3RVY A;  1BHA A;  3EFF K;  1K92 A;  1K5Q A;  3FB7 C;  4U7N A;  4HZ3 A;  5CBH A;  1VQO V;  1BHB A;  3T2M A;  2WLM A;  5E1A C;  3ZCC A;  1XL6 A;  1MAB G;  3ETG A;  4JTD B;  5EK0 A;  2QE7 G;  3CXC U;  5IY5 B;  5KUM A;  3SPI A;  4G28 B;  1VQN V;  3AG4 C;  4GX1 A;  1R3I C;  2Y48 A;  2P90 A;  1K3E A;  1FXK A;  1S76 D;  3OEH G;  3LDE A;  3CC4 V;  5GW7 A;  1FXK C;  4RUF A;  3ZN1 A;  4XDL A;  4E2L A;  3OUF A;  2EIM B;  2HJF C;  5CBF A;  1JOY A;  5EC2 C;  1S72 V;  4DO2 A;  2WWW A;  2WLI A;  4PDM A;  1ENV A;  1RPO A;  3STZ C;  2IW5 A;  4G2K A;  3GWO A;  1HWY A;  2ZQM A;  5L3D A;  3E2E A;  3ZMT A;  3CC7 V;  4FK5 C;  2NNU A;  2EIK C;  4MVQ A;  3ZRW A;  5DM6 V;  3OFN G;  2WAM A;  1SER A;  1AI5 A;  1MOF A;  3K06 A;  5J9P C;  1YHQ V;  4H37 A;  1K4C C;  2IH1 C;  4JTC B;  1NJI W;  1R6K A;  2HG5 C;  5B1B C;  1IXM A;  1ZWI C;  1VQ4 V;  3B8N A;  2WLL B;  3JYC A;  4GCZ A;  2JEX A;  1YSC A;  3WG7 B;  2ZXW B;  3ASN B;  1NKD A;  3H01 A;  3JD4 A;  1AJQ A;  1QLE B;  5B1N A;  1CEZ A;  5B3S B;  4KUM A;  1VQM V;  1PNK A;  2OT5 A;  1K34 A;  4L87 A;  1K8A W;  3ASO B;  4ZBM A;  2H94 A;  3QO8 A;  4G27 B;  1NVP D;  2OCC C;  3E8B A;  1R73 A;  3WFV A;  3STL C;  2P67 A;  3F7V C;  3SYA A;  1S77 D;  1OCZ C;  4R50 A;  2X6B A;  4PDR A;  1YIT V;  3E8H A;  1QCE A;  3BY6 A;  4JYC A;  3ZMV A;  3TK1 A;  2WLL A;  1GM9 A;  2JDI G;  4MVZ A;  2B1G A;  1CPY A;  2DQ3 A;  1GM8 A;  2IU3 A;  2XAJ A;  2QM7 A;  1TUE B;  5L3F A;  3ABK C;  1GMG A;  3JD3 A;  3M99 B;  3K0G A;  4MVU A;  4X88 A;  4EKW A;  2HKO A;  1YJN V;  4N21 A;  5LHH A;  3ABU A;  4RO2 A;  1F51 A;  3D3I A;  1E79 G;  5KA5 A;  4PDL A;  3CCL V;  1MG1 A;  1SET A;  2Q67 A;  5EBW C;  4MTX A;  4LC1 A;  1KKD A;  3AG4 B;  3QO5 A;  4YXW G;  5H9C A;  1J95 A;  1YTF D;  3P30 A;  3FKS G;  1AI4 A;  4QE7 A;  1YIJ V;  3HB3 B;  1V54 C;  4P9O A;  1M56 B;  2UXN A;  4KFM A;  3ABM C;  1VQ9 V;  2EIJ B;  4WFH A;  1G8M A;  4R7C A;  1W2B U;  1KD1 W;  4LP8 A;  1V55 C;  3I55 V;  1ARO P;  2WSS G;  2X6C A;  2Z3Y A;  5CMU A;  2Y69 C;  2IJJ A;  3A0R A;  3K03 A;  4JGS A;  1W0J G;  4MTG A;  1Q81 W;  3ZRS A;  4FPP A;  3AG3 C;  3SPH A;  4MW3 A;  1QLN A;  4CBC A;  4H33 A;  3SYQ A;  4TT3 G;  1FXH A;  2JK5 C;  3ZMS A;  3W7W A;  2DYS C;  4MVS A;  1SZT A;  4WFG A;  2WLJ A;  4PEL A;  4MSW C;  3CCR V;  3JD0 A;  1K4D C;  4RQE A;  2ZDI A;  2XND G;  4PDV A;  3CCE V;  5DN6 G;  4WFF A;  1H2G A;  1KQS U;  5LGN A;  2DWE C;  3D36 A;  1JJ2 U;  4BAY A;  1MSW D;  3DGE A;  3CME V;  3HPL C;  4OXS A;  1VQ6 V;  1H8H G;  3CCU V;  4BIZ A;  1YJ9 V;  4GX5 A;  2K1E A;  5B3S C;  2WLI B;  4JTA B;  2ITC C;  2WPD G;  2LFR A;  5LGU A;  4PA3 A;  3CP1 A;  1ROP A;  1K97 A;  3KG2 A;  3E8G A;  4FMT A;  4P30 A;  4R8C A;  5IY5 C;  1VQ7 V;  1KP2 A;  1M56 C;  2B1I A;  2AHY A;  5EBL C;  1DLB A;  2EIM C;  3SJQ C;  2XAF A;  3MHS C;  3OUS A;  2HVJ C;  1FXK B;  2ZR2 A;  3FB5 C;  3BEH A;  2XAQ A;  3AEI A;  3FB6 C;  3LNM B;  5H6R A;  4ASU G;  4MT8 A;  2EJR A;  1GTO A;  3JCZ A;  5IYD O;  2P6J A;  1EZJ A;  5CA3 A;  4JPR A;  1BMF G;  1PNM A;  3LDD A;  4JAV A;  4BIU A;  3E89 A;  1R3J C;  1W0K G;  5HFL A;  4QJF B;  5C93 A;  5B1B B;  4FJC C;  2JIZ G;  3CCJ V;  3OW2 U;  1R3K C;  1V54 B;  3NXS A;  4GX2 A;  1JX9 A;  1RM1 C;  2Q69 A;  3K04 A;  2F43 G;  3OM3 B;  1K7D A;  2A79 B;  1FXV A;  3W7S A;  1V55 B;  3ASN C;  3CD6 V;  3AG1 C;  3LSS A;  2XAS A;  3ZMU A;  4RQF A;  3AG2 C;  2X7R B;  1VQ8 V;  2V7Q G;  1Q86 W;  2LFS A;  2A9H A;  3T4Z A;  4X89 A;  3GB7 C;  1R3L C;  4QPJ A;  1XL4 A;  2OTJ V;  2X6A A;  3K79 A;  3T4D A;  5LGT A;  1JVM A;  3K0D A;  4MW8 A;  3ZRX A;  1S3J A;  4RAI A;  2B5U A;  2EIJ C;  4XDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...