4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
molecule tags Transport protein
source organism Bacillus cereus
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
2WLMA 1OCZC 1M57C 3SPGA 4P9OA 3T1CA 2Y69C 2EILC 4GX5A 3IFXA 5EC2C 2Q6AA 1OCRC 4WFHA 4PA3A 4X89A 2A79B 2YEVA 4QNHB 2ZD9A 4HZ3A 3SYPA 2WLJA 3LNMB 4MVZA 4MS2A 3STLC 4DXWA 1M56C 2WLLA 4PA9A 4UUJC 1R3LC 1ZWIC 2IH1C 5B1AC 4PDRA 1OCCC 1XL4A 4H37A 4MW3A 1KKDA 4R8CA 4QE9A 1QLEC 1K4DC 2QTOA 3F7VC 1V54C 2WLIB 4GX1A 3RVZA 3AG3C 3SYQA 4MTFA 1R3IC 3OUSA 4X8AA 2Q69A 4PDMA 3SYAA 2ATKC 2ITDC 1J95A 2OCCC 4WFGA 3E86A 4JTCB 4RUFA 2HFEC 1ORQC 4XDLA 3WG7C 2EIJC 3GB7C 4MVOA 3IGAC 3AG4C 2ZXWC 3KG2A 4PDLA 3E8FA 3SPHA 3OUFA 3UM7A 5E1AC 3RVYA 3T4ZA 1XL6A 4LBEC 2H8PC 5KUMA 5EC1C 2Q68A 4RUEA 3E83A 3OGCC 1JVMA 2HVKC 1OCOC 4ZBMA 5J9PC 2WLIA 3AG2C 2IH3C 4WFFA 2DWEC 4LP8A 3RBZA 4CBCA 2A9HA 2DYSC 4R7CA 1V55C 2Q67A 3K06A 4OXSA 5KUKA 4PA6A 2DYRC 3LUTB 4F4LA 3UKMA 3LDEA 3T4DA 2WLNA 3AG1C 4MVQA 3SYOA 1G4YB 4PA7A 5IY5C 4PA4A 3PJSK 4EKWA 4JTAB 3SYCA 5CBHA 3K0DA 3LDCA 3F5WC 2HJFC 4LCUC 3X2QC 3K08A 4X88A 1LNQA 2JK5C 4MTOA 2W0FC 4H33A 3T2MA 2HVJC 3R65A 2EIKC 4R50A 3HPLC 2X6AA 4MVMA 3OR7C 4RAIA 4WFEA 3ZRSA 3FB7C 2WLHA 2WLLB 3FB5C 4JTDB 3TETA 3E8BA 2X6CA 4MTGA 3K04A 3SPIA 4GX0A 4MSWC 2BOBC 4GX2A 2EINC 2EIMC 3VOUA 3E8GA 4MVUA 5B1BC 2P7TC 3BEHA 3K0GA 2QKSA 5EBWC 3E89A 3ASOC 1R3JC 1K4CC 3ASNC 3E8HA 3EFFK 4KFMA 3SPCA 4BW5A 4QE7A 3SJQC 3OR6C 1S5HC 4P30A 2X6BA 4RO2A 2NLJC 3RW0A 5BZBA 3JYCA 3FB6C 4MVRA 3K03A 2A0LA 5B3SC 3STZC 4G28B 3FB8C 5CBGA 4I9WA 4PDVA 4P9PA 3TCUA 5CBFA 3ABMC 2ITCC 4TWKA 2AHZA 4MVSA 4MW8A 2BOCC 4HYOA 5EK0A 2K1EA 3F7YC 2DWDC 4XDJA 2HG5C 4J9ZB 4J9YB 4G27B 3ABLC 3SPJA 5EBMC 5EBLC 4P2ZA 3ABKC 2KB1A 1P7BA 1R3KC 2WLKA 3ZJZA 2AHYA 1BL8A 3LDDA 2R9RB 4XDKA 4R6ZA
chains in the Genus database with same CATH superfamily
2GBOA 3IFXA 2V1DA 2QR4A 1I94O 2CGNA 4FLWA 1XQ8A 2JGDB 2JRIA 2Q7GA 1GM7A 4PA9A 1NTZH 2KQXA 4HNAA 1VF6A 4R8CA 5FL7G 4PHZA 1N4CA 4K0KO 2DOSA 4X8AA 2Q69A 3GVMA 3E86A 4D6TH 4DW1A 2DQ0A 1KP2A 4DR5B 1AP5A 5CA0B 1IBMO 3G71V 1FAFA 1I0HA 1HNXB 1SF9A 4X20B 5J9PC 1KBHA 4FLYA 1PP9H 1SQFA 1Q81W 4R7CA 3R66A 2ZNJA 4O4JA 3VQWA 3IAYA 1FFXB 3N27A 4J42A 1FJGB 4IYIA 3M7MX 4CH6A 4JASA 5HFMA 1DF5A 1X4TA 1B04A 2F4VB 1I94B 1W0KG 3RYFB 3K04A 4K35A 4C7UA 1ROPA 2QKAA 3A0RA 2K9PA 3CCSV 4O2AA 2GUZA 4JAAA 3WU2Z 3MDSA 1VQ6V 3ASNB 2NLJC 1E79G 1LR1A 4X62O 3I56V 1DTOA 2VWJA 2ZE7A 1XMQO 1Y76B 1VQNV 4X1IA 5J2UA 5K1PA 1VQLV 1J5EO 1S0VA 4J7JA 2C2AA 3K58A 5JH7B 4AQYO 3HKCA 1KP3A 4XDKA 3H1KH 3CCLV 4JI7B 3CMEV 1K73W 1WLEA 3FAVB 2DQ3A 3JSNA 2UUBB 5EIBD 3ZN1A 1YTFB 1AI6A 5B1BB 3SR2C 4UVAA 4MVZA 4UUJC 2XTAA 3THOA 2YSUB 2B5UA 2OTJV 2KG7A 1FXHA 3ZRWA 1RP3B 3OMIB 3ZX6A 2CTWA 1F4NA 4RUFA 4KXRA 1Y4MA 2EIJC 3RGBA 3VQXA 1EN5A 1E1RG 3OUFA 4MTXA 1QVFU 4N21A 1EZVH 2Q68A 3JASB 4X62B 1AILA 4CBCA 4LP8A 1Q5OA 2DYSC 1HNZB 1WJZA 3K06A 1AJQA 3LUTB 4RQEA 4JZGA 3LDEA 5LGNA 2PF4E 3T4DA 3ZN0A 4ZOLA 3AG1C 3HKEA 4JPRA 4LFBO 3K5MA 4BIUA 1SC5B 1HW7A 1XI1A 4DR4B 4CH3A 1YITV 1XNRO 2Q7EA 1SZXA 1Q82W 1SESA 3ZRWB 2YI8A 3HPLC 4CS4A 1H8EG 1MMMA 1VF7A 4NTXA 3JD0A 1B06A 4IT5A 3CCMV 4B3MO 3K79A 2QE7G 1FJGO 3FAVA 3SPCA 4LFCO 4DR2O 4GZRB 3L73H 4FM0A 5H9CA 1OCZB 4DV1O 3WB1A 1HNWO 2F93B 3M8AA 2ITCC 4MVSA 1WPBA 3B8MA 4DR5O 3ZHSA 4ZI7B 1F7YA 1K3EA 1R6KA 3MHHC 4X64B 4TV9A 3ABLC 1FXKC 2Y48A 1R3KC 1P49A 1BL8A 1MNGA 1ZUQA 2DYRB 2QM8A 2XAQA 3JD3A 3BFRA 2D2CB 4KHPO 1Y74B 5LBQA 3RYFA 4DV4O 3Q4HB 1M56C 4NYKA 4O4JB 5KAIZ 2IH1C 1NH2D 1WP7A 4DK0A 1FXKA 5LYJB 1SQBH 1ZTEA 3DGEA 1TVKB 4X65O 1VARA 2VQEB 1SERA 1CPYA 1J5EB 5DM6V 1V9PA 1XMQB 3GB7C 3K5OA 4H0LB 4DV3B 3E83A 2EZOA 2WSSG 3GWKC 4GUNA 3OEEG 1FFTB 5JCOA 4HNAB 4OXSA 2DYSB 2WLNA 4TV8B 4JI4B 4FMTA 3SYCA 1PKXA 3S3XA 4LCUC 1WAZA 4O4LB 5B1NA 4K8XA 1S5LZ 4WBNB 4ASUG 2X6AA 3OMNB 5LXTA 1M1KW 5E79Z 2OT5A 3FB7C 4I4TA 3FB5C 1K34A 1K33A 1YF2A 2Y4UA 1PNMA 2RNBA 1M9NA 1YI2V 2EIMC 4X64O 3W7SA 2QA4V 5EBWC 4DRXA 3SJQC 4YHHO 1RM1B 3O65A 1HNXO 5DECA 1KC8W 1IBMB 5FLXN 4NTYA 1HNWB 2RQ6A 1US6A 2UUAO 2R9IA 2W6JG 4DR2B 3RYHA 3B2EE 3DTUB 2XNDG 1URFA 3ZJZA 4WFAV 2GHYA 4K0KB 1XUQA 4BWAA 2MW2B 4UFZA 3SPGA 2W0XA 2Q6AA 4AILC 2YEVA 1AP6A 1VQMV 1VQOV 1R6NA 2AW9A 3RYIA 3KCYA 3STLC 1NI8A 5IJ9A 3QNEA 4I5SA 1K4DC 4LFBB 4TUYB 3BABA 2YIDA 4IIJA 3ZHVA 1HNZO 1J95A 5IYZB 1K5SA 3DSQA 4LNUB 1AJPA 3OEHG 1XNQO 3FFQA 5ITZA 5IYZA 5LMUO 1Z5VA 2H8PC 3CRAA 3ABLB 4J7KA 5LL6Y 1N36B 3WFVA 5L3CA 3CCUV 4JI6B 1G1XB 2BSKB 2IU3A 2UUCB 4KL1A 1EM1A 4DV6B 4FLVA 4FLTA 4DUZO 4B3TO 3BHPA 1K92A 4JF3A 4TOIA 4JI7O 1YXBA 1GMGA 3CCVV 5DEDA 2ZDIC 2H94A 1QU7A 3VQYA 1QQCA 5LA6B 1V55B 4W4LA 4JI0O 3OR6C 3QF7A 5BZBA 1OCCB 4K8ZA 4DRXB 1PL4A 2QTSA 4JI5B 2LGWA 5CBGA 4NXMO 3ZMSA 2ZNIA 1IX9A 5B66Z 1VQ8V 1U97A 2E3CA 5GTHZ 1WB7A 2XAGA 4CC6A 3D3QA 1Y6XA 4JI1B 2AHYA 3TGUH 1OCZC 4N23A 2F4VO 1WP8A 2RDCA 1UFIA 5EYPB 2A3QA 3HKBA 4X89A 4DW0A 1M4UA 5D5PA 3AG4B 5B1AB 4CZZA 4I55B 2BE3A 5KMGA 4YIOA 5TISZ 2F23A 4F6RB 1MSDA 2XAFA 3W7TA 4CS3A 3K9AA 5AG2A 2IBZH 4O4HB 2OTLV 4LC1A 2NR5A 2LFRA 1KKCA 2L35A 2ZT9B 5E1AC 1SRYA 4UVCA 5LOVB 2HVKC 3D8CA 4WFFA 4PELA 5K1XA 3KKYA 1Q86W 5KMGB 2O57A 2Y69B 5GTIZ 2JS5A 5JQGB 3X2QB 4LF8O 1GM8A 1XDCA 3K08A 1H2KA 4I7ZB 3T2MA 3ZRXA 2Q4PA 5HFLA 4UB6Z 4B7EA 1V54B 2EJ7A 1I08A 4DR6O 1ENVA 2LW7A 3SPIA 3ZMVA 2EINC 4TQFA 3VOUA 1M90W 4JI2B 5L3BA 1H2NA 3CCQV 2RCVA 3D36C 4KFMA 4ZKIA 4X1YB 4BIZA 1PPJH 4O2BB 3WB0A 5LHIA 3FB6C 3VBBA 5B3SC 2UXCB 4GLXA 1BQZA 3IC7A 3P3NA 4HYOA 4XDJA 2E74B 1MOFA 1KECA 3NR7A 3KCXA 2PY5A 1XMOO 5LP6B 2E76B 2F66C 2A79B 2UXDO 1A32A 3SDLA 4ABMA 1NJIW 1JQ0A 2DW4A 5BR8O 1R3LC 2P22C 3BVOA 1K97A 1D2DA 5BXZA 4L87A 4PV1B 1YJNV 3UT5B 2XUMA 4QE9A 1QLEC 4Q20A 3QO7A 3C90A 4LF7B 4W4KA 4CC5A 2Q5ZA 4JAVA 1GKFA 4PI0A 4FLUA 5BMVA 3H1HH 2BSKA 4IIJB 2PYLA 1JVMA 1SQXH 1YVWA 4J11A 2ZKOA 2KG7B 5DN6G 1NR7A 2PI5A 2IH3C 2A9HA 2XOKG 1W2BU 3N2GB 4Z1MG 4FZ0A 1H2SB 1FXVA 1AR1B 2JEUA 4LNUA 1BMFG 3CJHA 4Q6GA 1YIJV 3X2QC 3LDCA 2QGNA 2QWRB 4X1KA 2HJDA 4TT3G 5L3FA 4LF9B 3R65A 3H1JH 2WA3A 3CRQA 1IURA 2ILMA 1M5IA 4I0XA 3MAQA 1DF4A 1FD9A 1XOUA 1AR4A 3OTFA 3CXHF 4X1IB 4CS2A 2CH7A 3A0HZ 4B3RO 5B1BC 2QWNB 2CK3G 3BA8A 1YCIA 1GN2A 2XAHA 3JD1A 1N8RW 1NZ6A 2BOCC 2K1EA 3F7YC 2DWDC 1KQSU 1PNLA 1FPOA 5EBMC 4I4TB 2WLKA 1VP7A 4R6ZA 1SA0A 4UCSA 4PJ0Z 1L8DA 2Z0AA 2ZM6B 4WFHA 5IE9A 2FMLA 1N32O 1OCRB 2ZCEA 4HZ3A 4QPJA 2GTSA 3OTOB 5H6RA 3J7AU 2IJJA 2YDEA 1S72V 4MW3A 3SYQA 2Q9LA 3F7VC 1R3IC 4FJCC 2Q73A 3CB2A 1IXBA 1COWG 1S77D 2HFEC 2UXXA 4EEQA 3B40A 2UXNA 4X66O 2ZINA 4RUEA 4G2KA 4ZBMA 1TVKA 1JMKC 4JYCA 5LP6C 1WNSA 4B3SO 3JATB 4DR7B 3Q4HA 5LGUA 2YIBA 3T1HO 4F6EA 2WPDG 4O4IA 2QM4A 4D7TA 3CPWU 3JCUZ 1SA0B 4R50A 2ZIOA 1XREA 2H3OA 2WLLB 4I50B 1Q90D 3OT7A 1Y74A 1LUWA 4UCOA 2E5LB 2BOBC 2ZR3A 3B77A 1Q8IA 1YJWV 1R3JC 1AJNA 2FTKA 2IM9A 4RO2A 3RW0A 3H01A 4IGGA 5L3GA 4J41A 1BGYH 3TCUA 4P9PA 4ZI7A 1R1BA 2CH7B 1JOYA 1YTFD 1Q6IA 1P7BA 3JAWB 4I0XB 3LDDA 4UV9A 2JVDA 3PN1A 2R9RB 2V4DA 1NT2B 4GKJO 3CCRV 4LF5B 3ZHTA 4X1KB 4LWSB 3AG2B 1NQTA 2JJ2G 2LGQA 1H38A 2LP7A 2HHHO 3QG5A 1QCEA 2UXBO 3SYPA 5A2QN 1KU9A 3LSUA 3HKEB 1L1FA 1XL4A 4DV0B 5LMNO 1RFYA 4GX1A 2Q0OC 3RVZA 3CD6V 1BQ0A 1MA1A 4PDMA 2EULA 4FPPA 4YY3O 1G8MA 3MHSC 3QVNA 2GV9A 1VF6C 3ABMB 4FFKA 2P67A 3P32A 4KP4A 4LBEC 5EC1C 4FK5C 1LUVA 4RWUA 4DV5O 1L0LH 4NVPA 1RM1C 4OX9B 3HKDA 3EXAA 4JI8O 4JV5B 1K7DA 3A8TA 4J80A 4UV8A 1U96A 1LNQA 4CH5A 4LH6A 4OPHA 1N34B 2QEXV 2HLDG 3H1IH 4WFEA 4GKKO 4LF4B 2WLHA 1IBKB 2XASA 4DR1O 3RYCB 1SETA 3E8BA 4UXNA 4TQDA 2YXYA 3OMAB 2M7WA 3KZIZ 4MVUA 3K5LA 4P30A 5LP6A 3HKCB 3JAWA 2ZQMA 5JH7A 3QO8A 1VQ9V 1BE3H 5EZYB 2VQFB 2ODMA 4J9ZB 4OGQB 3ZS8C 3B8NA 3DXRB 1VIBA 2EZPA 3ABTA 1NTMH 3LSSA 2VS0A 1SQQH 1S3JA 4YJ3B 4BR6A 5JQGA 4JI3O 4KUMA 1RPOA 2MK3A 1XHXA 4PI2A 4LF6O 4X20A 1OHHG 2XT9A 3FX7A 4JYAB 4IHJB 3TXQA 2Q8VA 1N33O 2ZIMA 3IGAC 3IC9A 3G67A 3JATA 5KHKA 4D7SA 3RVYA 3J80N 2B9ZA 5BY1A 1OCOB 3C3SA 1UPGA 5KUKA 1BCCH 3E35A 3UKMA 3LNNA 4PA4A 2ARHA 2JGDA 4O4HA 4LF6B 4FVMA 4QGPA 3OD4A 2EJRA 4X88A 1HDJA 3ETQA 5IYCO 2WAMA 5IWAO 3ZIAG 2YXHA 2CTQA 4DUYO 3K57A 4GX2A 3HKBB 5FNVA 2P06A 2P7TC 2YICA 3E22A 3K0GA 4NTWA 4A5UB 5LHGA 4QE7A 3SJCC 1OV9A 1MSWD 3ZMUA 1PM9A 1HR0O 1KMIZ 4G27B 3O9OA 2BCCH 1G6UA 2LFSA 2OCCB 1Q43A 1CP9A 4RQFA 5LA6A 4EFEA 4JZ2A 2Y69C 2AZ0A 1OJHA 2JS3A 1YDXA 5EC2C 4DV2B 4LF4O 4QNHB 4LFAB 5KHHA 1MZEA 4WCEV 1QR9A 2ETNA 3U0ZA 1V54C 2WLIB 4JV5O 1CEZA 4EFBA 4UCVA 3SYAA 3T1YO 1GK9A 3CJHB 3AG1B 5L3DA 5IY5B 4U3JA 3TJTA 4DV5B 4ICGA 1Q6HA 2ADQB 3UM7A 3G6EV 2OYQA 1NVPB 2L6LA 3BRCA 1OCOC 4DR3O 1Q6UA 3ASOB 5IYDO 2YC0A 1MG1A 4U3JB 2FKXA 3PJSK 2G38A 4JTAB 3K0DA 1IZ3A 5C8YB 1D5AA 3ZEDA 5IDJA 1H2MA 2JK5C 5KHJA 1TUBA 1JJ2U 3TK1A 1Y67A 4MVMA 2UXBB 3UT5A 3ZMTA 2UU9O 2Y4TA 3B4SA 3SJBC 5IJ9B 3L71H 4LF5O 4NXNO 1BSMA 4OPAA 2AGAA 1NU1H 3SJAC 2P4KA 3F5TA 3EFFK 3ASNC 3L9DA 5A9GA 4NKGB 3BA9A 4HAMA 3ZRVA 3G80A 1FS0G 2JEXA 3K03A 5KHIA 1AR5A 1YJ9V 5B1OA 1GO3F 3CX5F 2YIBD 3L74H 4FM2A 3T1YB 1GN6A 2XAJA 3H1LH 2LQTA 2KSDA 3JARB 3L75H 4DV7B 1IBLB 1EBOA 4B7KA 5LXTB 4O2BA 1Q7YW 2HP8A 2OCCC 4X1YA 2ZE5A 4WBNA 4O4LA 4CH4A 3UQ8A 3E22B 1R73A 4PA3A 1EN6A 4IYHA 4LFAO 1ZL8B 5GONA 4DV2O 2PUSA 3B09A 1Y66A 3LNMB 3BPZA 3HB3B 4ZHQA 5LGTA 5J2TA 3RT3C 3CCJV 3ZMZA 1Z5WA 4JTCB 2Q7HA 2DE0X 2CGOA 4XDLA 1JX9A 4YJ2A 1M56B 3SPHA 3M99B 1L0NH 1O9GA 3N2KA 4U7NA 3K9SA 3RBZA 4PD4F 4PA6A 3C3TA 2GSMB 5LHHA 4MVQA 3SYOA 1NH2B 4FZ1A 5KA5A 3W7UA 4DUYB 2EIMB 1QLEB 4IHJA 4DYLA 5IJ0A 1IBKO 3CHXA 4GT1A 4FLXA 3U11A 4GCZA 4F6RA 2N05A 1HWYA 5JJJB 3OTOO 3CMAV 1GM9A 1FYJA 1JR9A 1JFFB 2HKOA 4H13B 1DK1A 1B6QA 4MSWC 4DV7O 1IBLO 1VQ7V 5EZYA 4QJFB 1Z2GA 5KAFZ 4BW5A 4OX9O 3AK1A 2CAZC 4LH7A 3G6BA 1S5HC 3ETGA 3CC7V 1JA8A 3UCSC 3CWBH 4TV9B 3FB8C 2PGGA 5CBFA 1QBZA 2AHZA 3OFNG 4E2LA 4YXWG 3RYCA 3FD9A 3SPJA 4P2ZA 2CTRA 5KX5B 2NNUA 3P30A 4NXNB 2Q0AA 2UU9B 2EILC 2QWQB 1AI5A 2ZDIA 1SZTA 1N0NA 2WLJA 2HHHB 1NTKH 4MS2A 4DXWA 2D3OW 3CEIA 3HKDB 5B1AC 1VQPV 1TGOA 4GKJB 3RWRD 2AZ2A 1KUQA 3JASA 2P90A 1VF5B 4FFBA 2A06H 1F51A 4DR3B 1MZFA 1CXZB 3OGIB 2BTOA 3CE2A 5IYBO 4UB8Z 4PDLA 3E8FA 2ZE6A 1GH6A 4ZOLB 3BY6A 1EFRG 3ZBHA 1XL6A 4FFBB 1KD1W 3OGCC 2EIKB 1ZX3A 3CC4V 1EZJA 4F4LA 2Z5UA 5ITZB 2EX3A 4FIPC 4JYBA 5IY5C 2WWWA 3FYEB 2X7RB 4EKWA 2N04A 2R9AA 3RN4A 2RN9A 3EHBB 4GKKB 2JJ1G 4LWSA 5D5QA 1WB8A 5C93A 4TUYA 4MTOA 1ZSPA 1W0JG 2PZSA 3OR7C 3ZHQA 3CRRA 2IW5A 3SGIA 3ZRSA 1JPXA 3JALB 4MTGA 3ETEA 4JI8B 2YEVB 3ZHUA 1IXMA 2B1IA 3FKSG 3E89A 1HR0B 3CRCA 5CA1A 2X6BA 4UCTA 1FKAO 3JYCA 3QTCA 4MVRA 3WB2A 1BZKA 3ABMC 5H6QA 2DN9A 2P6JA 5JJEB 1DGSA 5EK0A 5IT9N 2OIGA 4YY3B 2KB1A 3MD0A 4MT8A 2CDYA 5LMNB 3ZCCA 2YIAA 1M57C 2GUZB 4P9OA 3T1CA 5JWPA 3I55V 2JDIG 2CTPA 1RSOA 4DR6B 4U7OA 5IWAB 4O4IB 1PNKA 2P4VA 2V7QG 1QLNA 4U3FH 2WLLA 4I50A 2Y0IA 2X0LA 1JCHA 2WA4A 1KB9F 1JJOA 4X9QA 4LF8B 3OUSA 2DJVA 5CN0A 3UO2A 2ATKC 1DLBA 4WFGA 3JAKB 4MVOA 1I5XA 2Y0PA 3AG4C 2GDSA 2IU0A 4TV8A 1P7GA 3JAKA 2IJKA 2QKCA 3T4ZA 3K59A 2M6YA 1N0JA 1N33B 3AG2C 3AK3A 4L8JA 4I9QA 4JYAO 4JGSA 4ZHQB 2OCHA 2E5LO 3JSLA 1B3QA 1PV0A 2EINB 5CBHA 1XBLA 4JI3B 3EVKA 1TA8A 1FXKB 5LYJA 1QHTA 4WF9V 2X6CA 2RMKB 4B3SB 4HBNA 1RSOB 1R6TA 3ABKB 1K4CC 3HR0A 2VQFO 2OIEA 1XILA 1H2GA 3VQVA 2A0LA 2LO1A 4JI5O 4PDVA 3UO3A 1BT8A 2DMXA 1PD3A 2HR3A 3JALA 3OAAG 4J9YB 4JAUA 3CSXA 1NS1A 2ZR2A 5CB4B 5CA1B 1EN4A 4DR1B 1TAEA 1TUBB 1N34O 3WG7B 1PL0A 4QPKA 3H9VA 4LR3A 3CC2V 4E4EA 4H44B 4Z2WA 5KLVH 1YSCA 4PDRA 1NR1A 4H37A 5H2FZ 3N2GA 1KKDA 3DC6A 3APOA 4MTFA 4DV6O 2UUCO 3I5DA 1IVSA 2A7WA 2JIZG 1WPXA 2ZXWB 1ORQC 1T5EA 4DO2A 2R72A 3KG2A 3NXSA 1GAXA 3OW2U 2UXCO 1N36O 1QR8A 3A0BZ 4NB5A 1BS3A 1NKDA 5KUMA 3JD2A 2NN4A 1I5YA 5KA6A 1S5JA 2ZE8A 3ML0A 2DYRC 5BMVB 3L70H 2QWPB 1X59A 4DV0O 3K3WA 4FLZA 2EBOA 1ZAUA 3LSQA 1SQVH 1GN4A 2W0FC 4H33A 2OWOA 2RJZA 2EIKC 1SQPH 3S3WA 5KX5A 3TXSA 1SKVA 1HP8A 2XHBA 2QSAA 1WA8A 1YZBA 4UCRA 3OE7G 1UJWB 5L3EA 3BEHA 1AVMA 5KHGA 3CRMA 2FYUH 5B3SB 3APQA 2YI9A 4AI8A 2UUAB 5FNVB 5J2UB 4Z1VA 2LW1A 1Y76A 2P5OA 1AB3A 1JFFA 4YHHB 4AHCA 1BHAA 5EIBC 3E2EA 3GWOA 2FL4A 2WLMA 3OM3B 3L72H 1SQGA 5BR8B 5FPRA 2IJIA 4O2AB 3QO5A 5IJ0B 4BW9A 4UVBA 1WN7A 2PYJA 2F1MA 3CS5A 2YUAA 1GN3A 2QJ1A 1ZWIC 1H2LA 2FB5A 1S76D 3AG3B 3T1HB 1F23A 2BTQB 4DR7O 1M57B 4JI4O 2CE4A 2ITDC 1VQ5V 3P3PA 4JI1O 1BHBA 4YJ2B 1FFXA 2QM7A 2ZXWC 2YXLA 4X66B 4YIPA 4NXMB 3CYOA 3RFRA 3JD4A 2PTMA 2R70A 3ICXA 5LOVA 3N2KB 2VWKA 2DWEC 4J10A 4JI2O 1V55C 2Q67A 5CA0A 4PA7A 2VQEO 1ZL8A 5GONB 1AI7A 1TUEB 5GW7A 4YJ3A 5EYPA 1QNMA 1AROP 2HJFC 2GTAA 1M93A 5J2TB 1QVGU 2YS8A 2HVJC 1N32B 2E75B 4DV4B 2BTQA 2ZM6O 4RAIA 1Q3EA 4KHPB 3DXRA 3JARA 1P4RA 1NVPD 1H8HG 4B3TB 4I55A 3TETA 2W6IG 4JTDB 1KYOF 4J7ZA 1VMGA 3CXCU 4GX0A 4IL6Z 4XBFA 3A2FA 1XEQA 1K5QA 3E8GA 2QKSA 1NBMG 3ASOC 2KKWA 1VQ4V 1E1QG 2B1GA 5JCOC 4ZIBA 5JVDA 3STZC 3K5NA 4G28B 4I9WA 3U10A 1P84F 1W59A 1WA8B 4MW8A 4DV1B 1K9MW 4B3RB 4LFCB 3ABKC 5CMUA 1VQKV 5H5NA 4B3MB 5C8YA 2AXTZ 3DC5A 4GX5A 1OCRC 4GYCB 4BAYA 4LF9O 2ZD9A 2ADPA 5F2VO 5FPOA 2HEPA 1AI4A 2VRZA 3J81N 1OCCC 3BAAA 1XHZA 2QTOA 4EB6B 1XNRB 2Z3YA 3AG3C 4DR4O 1YEWA 3ZHRA 5B5EZ 4FM1A 1K8AW 4B08A 1OZ0A 1D5NA 1MABG 3AEIA 3D36A 3WG7C 1ZLZA 4DK1A 3ETDA 2IJHA 4TSFG 3JCZA 5JJNB 4JI0B 1I7FA 3W7WA 2N74A 2WLIA 2F43G 3AK2A 2JGUA 1RPRA 4LF7O 1G4YB 1THZA 1O9HA 2LJ2A 3BCCH 2F95B 1VEWA 3F5WC 1IDSA 4UCUA 5CA3A 2QDOA 4JYYA 2UXDB 4EB6A 4DUZB 2EILB 4WFBV 3AG7A 2UUBO 1XMOB 2PI4A 1SS3A 3RYIB 4NR1A 3D3IA 3FYIB 3JAMN 4QIWF 3IJ4A 4JI6O 1F4MA 4K3AA 3E8HA 4AQYB 4BIOA 5CB4A 5LMUB 3CP1A 4DV3O 2EIJB 3RYHB 3CCEV 1XNQB 4TWKA 2HG5C 2QWOB 3W7XA 1YHQV 5EBLC 2CUGA 5JVDB 3ABUA 3G4SV 1GRJA 4X65B 1GTOA
chains in the Genus database with same CATH topology
3ABTA 1OCZC 4N23A 3ZCCA 1M57C 3LSSA 4P9OA 3T1CA 3I55V 2JDIG 3IFXA 2V1DA 4U7OA 4X89A 1PNKA 1S3JA 3AG4B 2V7QG 4KUMA 5B1AB 4CZZA 1QLNA 1RPOA 2WLLA 1GM7A 4PA9A 2X0LA 2MK3A 1JCHA 4R8CA 5FL7G 2XAFA 3W7TA 3OUSA 4X8AA 2Q69A 5CN0A 1OHHG 2ATKC 1DLBA 3K9AA 4WFGA 3E86A 4MVOA 2DQ0A 3IGAC 2OTLV 1I5XA 3AG4C 4LC1A 1KP2A 2IU0A 2LFRA 2IJKA 5E1AC 3RVYA 3T4ZA 1SRYA 4UVCA 3G71V 1OCOB 2HVKC 5J9PC 3AG2C 4WFFA 4PELA 1Q81W 4R7CA 4JGSA 5KUKA 3E35A 3UKMA 1Q86W 2Y69B 4PA4A 3X2QB 2EINB 1GM8A 5CBHA 3K08A 2EJRA 4X88A 3T2MA 3ZRXA 4JASA 5HFLA 5IYCO 2WAMA 5HFMA 1FXKB 3ZIAG 1DF5A 1V54B 4WF9V 1W0KG 2X6CA 3K04A 1ENVA 3SPIA 1ROPA 3ZMVA 3A0RA 4GX2A 2EINC 3VOUA 3CCSV 1M90W 5L3BA 2P7TC 3K0GA 3CCQV 3ABKB 4KFMA 1K4CC 5LHGA 4ZKIA 4QE7A 1VQ6V 4BIZA 3ASNB 2NLJC 1E79G 1H2GA 5LHIA 3FB6C 3VBBA 3I56V 2A0LA 5B3SC 1DTOA 1MSWD 3ZMUA 4PDVA 1VQNV 3IC7A 4HYOA 1PD3A 2HR3A 3OAAG 4XDJA 4J9YB 4G27B 1VQLV 1S0VA 2C2AA 4JAUA 2LFSA 1MOFA 2OCCB 2ZR2A 1KECA 1KP3A 4XDKA 4RQFA 1CP9A 3CCLV 3CMEV 1K73W 2Y69C 1WLEA 2DQ3A 5EC2C 2A79B 3ZN1A 4QNHB 1YTFB 1AI6A 5B1BB 3WG7B 1PL0A 4QPKA 4UVAA 3CC2V 1NJIW 4WCEV 4MVZA 1JQ0A 2DW4A 1QR9A 4UUJC 1R3LC 1YSCA 4PDRA 1NR1A 1K97A 4H37A 1KKDA 2YSUB 4L87A 1YJNV 4QE9A 1QLEC 2B5UA 2OTJV 1V54C 2WLIB 4Q20A 4MTFA 3QO7A 1FXHA 3ZRWA 1CEZA 3OMIB 3SYAA 1GK9A 4JAVA 1F4NA 1GKFA 3AG1B 4RUFA 5L3DA 2JIZG 1WPXA 2ZXWB 1ORQC 5IY5B 1Y4MA 2EIJC 4DO2A 3KG2A 3NXSA 1E1RG 3OW2U 3UM7A 3OUFA 4MTXA 3G6EV 1QVFU 1QR8A 1NKDA 4N21A 5KUMA 3JD2A 1NVPB 2Q68A 1JVMA 1I5YA 1OCOC 5KA6A 5DN6G 1NR7A 2PI5A 2IH3C 3ASOB 4CBCA 4LP8A 2A9HA 2DYSC 2XOKG 5IYDO 1W2BU 3K06A 1AJQA 3ML0A 2DYRC 3LUTB 4RQEA 3LDEA 4Z1MG 3T4DA 3ZN0A 5LGNA 3AG1C 4JPRA 4BIUA 1FXVA 1MG1A 1AR1B 2JEUA 3PJSK 1BMFG 4JTAB 1YITV 3K3WA 1YIJV 3K0DA 3LDCA 2EBOA 3X2QC 1Q82W 3LSQA 1SESA 5IDJA 2JK5C 3ZRWB 2W0FC 4H33A 4TT3G 1JJ2U 5L3FA 3TK1A 3R65A 2EIKC 3HPLC 4MVMA 1H8EG 3ZMTA 1DF4A 3CCMV 3JD0A 3K79A 2QE7G 3OE7G 1UJWB 5B1BC 5L3EA 3BEHA 2CK3G 3EFFK 3ASNC 3SPCA 3ZRVA 4HAMA 1FS0G 1OCZB 5H9CA 5B3SB 2JEXA 3K03A 1YJ9V 5B1OA 1GO3F 2XAHA 2ITCC 3JD1A 1N8RW 4MVSA 2BOCC 3B8MA 2K1EA 3F7YC 2DWDC 1KQSU 1K3EA 1R6KA 3MHHC 1PNLA 3ABLC 2XAJA 5EBMC 1FXKC 2Y48A 1R3KC 3E2EA 1BHAA 1EBOA 2WLKA 3GWOA 1BL8A 1Q7YW 2OCCC 4R6ZA 2WLMA 3OM3B 2DYRB 2QM8A 1R73A 2IJIA 2XAQA 3JD3A 3QO5A 4WFHA 4PA3A 4UVBA 1OCRB 4HZ3A 5LBQA 4QPJA 1Y66A 3LNMB 5H6RA 1M56C 3HB3B 2IJJA 1ZWIC 2IH1C 1S72V 1NH2D 4MW3A 1S76D 3AG3B 1FXKA 3SYQA 1F23A 3F7VC 3DGEA 1R3IC 5LGTA 4FJCC 1M57B 1SERA 3CCJV 1CPYA 2ITDC 5DM6V 1VQ5V 3ZMZA 1COWG 4JTCB 1S77D 2HFEC 2UXXA 4XDLA 1BHBA 3GB7C 1JX9A 2QM7A 2ZXWC 2UXNA 1M56B 3SPHA 3M99B 3CYOA 4RUEA 3E83A 4G2KA 2EZOA 3JD4A 4U7NA 4ZBMA 2WSSG 3RBZA 2DWEC 3OEEG 4JYCA 1FFTB 1V55C 2Q67A 4OXSA 4PA6A 2DYSB 2GSMB 5LHHA 2WLNA 4MVQA 3SYOA 5LGUA 4PA7A 1NH2B 5KA5A 3W7UA 1AI7A 1TUEB 2WPDG 4FMTA 2EIMB 5GW7A 3SYCA 1QLEB 1PKXA 1AROP 2HJFC 4LCUC 1QVGU 4GT1A 5B1NA 2HVJC 3CPWU 4GCZA 4R50A 4ASUG 1HWYA 2X6AA 3OMNB 3CMAV 1GM9A 1M1KW 4RAIA 2OT5A 1P4RA 3FB7C 1H8HG 1NVPD 2WLLB 3FB5C 1K34A 2W6IG 1K33A 4JTDB 3TETA 1PNMA 2HKOA 3CXCU 4GX0A 1B6QA 1M9NA 4MSWC 4XBFA 1YI2V 2BOBC 1VQ7V 2EIMC 1K5QA 4QJFB 2ZR3A 3B77A 3E8GA 3W7SA 2QA4V 2QKSA 5EBWC 1NBMG 1YJWV 3ASOC 1R3JC 4BW5A 1AJNA 1VQ4V 2FTKA 1E1QG 3SJQC 1RM1B 1S5HC 2B1GA 4RO2A 3RW0A 3ETGA 1KC8W 3H01A 5L3GA 3CC7V 3STZC 4G28B 3FB8C 4I9WA 3TCUA 4P9PA 5CBFA 1QBZA 2R9IA 2W6JG 2AHZA 1JOYA 4MW8A 1K9MW 3OFNG 4E2LA 3DTUB 4YXWG 1YTFD 3SPJA 2XNDG 4P2ZA 3ABKC 1P7BA 3ZJZA 2NNUA 2GHYA 4WFAV 3LDDA 3P30A 4UV9A 5CMUA 2R9RB 1VQKV 3CCRV 3SPGA 2EILC 4GX5A 3AG2B 1NQTA 1OCRC 2JJ2G 2Q6AA 1H38A 1AI5A 2YEVA 2ZDIA 4BAYA 1SZTA 2ZD9A 1R6NA 1VQMV 1VQOV 2LP7A 1QCEA 3SYPA 2WLJA 4MS2A 1AI4A 3STLC 4DXWA 2D3OW 1L1FA 5B1AC 1VQPV 1OCCC 1XL4A 3QNEA 4I5SA 1K4DC 2QTOA 4GX1A 2Z3YA 3RVZA 3AG3C 3CD6V 4PDMA 2P90A 4FPPA 1K8AW 1J95A 1G8MA 3MHSC 1OZ0A 1F51A 1K5SA 1MABG 3AEIA 3D36A 5IYBO 1AJPA 3OEHG 3WG7C 3ABMB 4PDLA 3ETDA 3E8FA 2IJHA 3BY6A 4TSFG 1EFRG 2P67A 3P32A 4KP4A 1XL6A 4LBEC 2H8PC 3ABLB 5EC1C 1KD1W 3OGCC 3JCZA 2EIKB 4FK5C 3W7WA 3WFVA 2WLIA 5L3CA 3CCUV 2F43G 1RM1C 3CC4V 1EZJA 4F4LA 2IU3A 2Z5UA 1RPRA 4FIPC 1G4YB 4JYBA 5IY5C 1THZA 2WWWA 3FYEB 2X7RB 4EKWA 1K7DA 3EHBB 3F5WC 2JJ1G 5C93A 4UV8A 1LNQA 4MTOA 5CA3A 1K92A 1W0JG 2QEXV 2HLDG 2EILB 3OR7C 4JF3A 4WFEA 4WFBV 2IW5A 3ZRSA 2WLHA 2XASA 1JPXA 1SETA 3E8BA 4MTGA 4UXNA 2PI4A 3ETEA 1GMGA 3CCVV 3OMAB 3D3IA 2YEVB 2M7WA 2ZDIC 3FYIB 1IXMA 2B1IA 2H94A 4MVUA 4QIWF 1F4MA 3FKSG 3E89A 3E8HA 1V55B 3OR6C 4P30A 2X6BA 5BZBA 1OCCB 3JYCA 3CP1A 4MVRA 2ZQMA 3QO8A 5CBGA 2EIJB 1VQ9V 3ZMSA 3ABMC 3CCEV 5H6QA 1VQ8V 4TWKA 2P6JA 2XAGA 5EK0A 2HG5C 4J9ZB 3W7XA 1YHQV 5EBLC 3B8NA 2KB1A 3MD0A 4MT8A 2AHYA 3ABUA 3G4SV 1GTOA 2EZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLM A;  1OCZ C;  1M57 C;  3SPG A;  4P9O A;  3T1C A;  2Y69 C;  2EIL C;  4GX5 A;  3IFX A;  5EC2 C;  2Q6A A;  1OCR C;  4WFH A;  4PA3 A;  4X89 A;  2A79 B;  2YEV A;  4QNH B;  2ZD9 A;  4HZ3 A;  3SYP A;  2WLJ A;  3LNM B;  4MVZ A;  4MS2 A;  3STL C;  4DXW A;  1M56 C;  2WLL A;  4PA9 A;  4UUJ C;  1R3L C;  1ZWI C;  2IH1 C;  5B1A C;  4PDR A;  1OCC C;  1XL4 A;  4H37 A;  4MW3 A;  1KKD A;  4R8C A;  4QE9 A;  1QLE C;  1K4D C;  2QTO A;  3F7V C;  1V54 C;  2WLI B;  4GX1 A;  3RVZ A;  3AG3 C;  3SYQ A;  4MTF A;  1R3I C;  3OUS A;  4X8A A;  2Q69 A;  4PDM A;  3SYA A;  2ATK C;  2ITD C;  1J95 A;  2OCC C;  4WFG A;  3E86 A;  4JTC B;  4RUF A;  2HFE C;  1ORQ C;  4XDL A;  3WG7 C;  2EIJ C;  3GB7 C;  4MVO A;  3IGA C;  3AG4 C;  2ZXW C;  3KG2 A;  4PDL A;  3E8F A;  3SPH A;  3OUF A;  3UM7 A;  5E1A C;  3RVY A;  3T4Z A;  1XL6 A;  4LBE C;  2H8P C;  5KUM A;  5EC1 C;  2Q68 A;  4RUE A;  3E83 A;  3OGC C;  1JVM A;  2HVK C;  1OCO C;  4ZBM A;  5J9P C;  2WLI A;  3AG2 C;  2IH3 C;  4WFF A;  2DWE C;  4LP8 A;  3RBZ A;  4CBC A;  2A9H A;  2DYS C;  4R7C A;  1V55 C;  2Q67 A;  3K06 A;  4OXS A;  5KUK A;  4PA6 A;  2DYR C;  3LUT B;  4F4L A;  3UKM A;  3LDE A;  3T4D A;  2WLN A;  3AG1 C;  4MVQ A;  3SYO A;  1G4Y B;  4PA7 A;  5IY5 C;  4PA4 A;  3PJS K;  4EKW A;  4JTA B;  3SYC A;  5CBH A;  3K0D A;  3LDC A;  3F5W C;  2HJF C;  4LCU C;  3X2Q C;  3K08 A;  4X88 A;  1LNQ A;  2JK5 C;  4MTO A;  2W0F C;  4H33 A;  3T2M A;  2HVJ C;  3R65 A;  2EIK C;  4R50 A;  3HPL C;  2X6A A;  4MVM A;  3OR7 C;  4RAI A;  4WFE A;  3ZRS A;  3FB7 C;  2WLH A;  2WLL B;  3FB5 C;  4JTD B;  3TET A;  3E8B A;  2X6C A;  4MTG A;  3K04 A;  3SPI A;  4GX0 A;  4MSW C;  2BOB C;  4GX2 A;  2EIN C;  2EIM C;  3VOU A;  3E8G A;  4MVU A;  5B1B C;  2P7T C;  3BEH A;  3K0G A;  2QKS A;  5EBW C;  3E89 A;  3ASO C;  1R3J C;  1K4C C;  3ASN C;  3E8H A;  3EFF K;  4KFM A;  3SPC A;  4BW5 A;  4QE7 A;  3SJQ C;  3OR6 C;  1S5H C;  4P30 A;  2X6B A;  4RO2 A;  2NLJ C;  3RW0 A;  5BZB A;  3JYC A;  3FB6 C;  4MVR A;  3K03 A;  2A0L A;  5B3S C;  3STZ C;  4G28 B;  3FB8 C;  5CBG A;  4I9W A;  4PDV A;  4P9P A;  3TCU A;  5CBF A;  3ABM C;  2ITC C;  4TWK A;  2AHZ A;  4MVS A;  4MW8 A;  2BOC C;  4HYO A;  5EK0 A;  2K1E A;  3F7Y C;  2DWD C;  4XDJ A;  2HG5 C;  4J9Z B;  4J9Y B;  4G27 B;  3ABL C;  3SPJ A;  5EBM C;  5EBL C;  4P2Z A;  3ABK C;  2KB1 A;  1P7B A;  1R3K C;  2WLK A;  3ZJZ A;  2AHY A;  1BL8 A;  3LDD A;  2R9R B;  4XDK A;  4R6Z A; 
#chains in the Genus database with same CATH topology
 2GBO A;  3IFX A;  2V1D A;  2QR4 A;  1I94 O;  2CGN A;  4FLW A;  1XQ8 A;  2JGD B;  2JRI A;  2Q7G A;  1GM7 A;  4PA9 A;  1NTZ H;  2KQX A;  4HNA A;  1VF6 A;  4R8C A;  5FL7 G;  4PHZ A;  1N4C A;  4K0K O;  2DOS A;  4X8A A;  2Q69 A;  3GVM A;  3E86 A;  4D6T H;  4DW1 A;  2DQ0 A;  1KP2 A;  4DR5 B;  1AP5 A;  5CA0 B;  1IBM O;  3G71 V;  1FAF A;  1I0H A;  1HNX B;  1SF9 A;  4X20 B;  5J9P C;  1KBH A;  4FLY A;  1PP9 H;  1SQF A;  1Q81 W;  4R7C A;  3R66 A;  2ZNJ A;  4O4J A;  3VQW A;  3IAY A;  1FFX B;  3N27 A;  4J42 A;  1FJG B;  4IYI A;  3M7M X;  4CH6 A;  4JAS A;  5HFM A;  1DF5 A;  1X4T A;  1B04 A;  2F4V B;  1I94 B;  1W0K G;  3RYF B;  3K04 A;  4K35 A;  4C7U A;  1ROP A;  2QKA A;  3A0R A;  2K9P A;  3CCS V;  4O2A A;  2GUZ A;  4JAA A;  3WU2 Z;  3MDS A;  1VQ6 V;  3ASN B;  2NLJ C;  1E79 G;  1LR1 A;  4X62 O;  3I56 V;  1DTO A;  2VWJ A;  2ZE7 A;  1XMQ O;  1Y76 B;  1VQN V;  4X1I A;  5J2U A;  5K1P A;  1VQL V;  1J5E O;  1S0V A;  4J7J A;  2C2A A;  3K58 A;  5JH7 B;  4AQY O;  3HKC A;  1KP3 A;  4XDK A;  3H1K H;  3CCL V;  4JI7 B;  3CME V;  1K73 W;  1WLE A;  3FAV B;  2DQ3 A;  3JSN A;  2UUB B;  5EIB D;  3ZN1 A;  1YTF B;  1AI6 A;  5B1B B;  3SR2 C;  4UVA A;  4MVZ A;  4UUJ C;  2XTA A;  3THO A;  2YSU B;  2B5U A;  2OTJ V;  2KG7 A;  1FXH A;  3ZRW A;  1RP3 B;  3OMI B;  3ZX6 A;  2CTW A;  1F4N A;  4RUF A;  4KXR A;  1Y4M A;  2EIJ C;  3RGB A;  3VQX A;  1EN5 A;  1E1R G;  3OUF A;  4MTX A;  1QVF U;  4N21 A;  1EZV H;  2Q68 A;  3JAS B;  4X62 B;  1AIL A;  4CBC A;  4LP8 A;  1Q5O A;  2DYS C;  1HNZ B;  1WJZ A;  3K06 A;  1AJQ A;  3LUT B;  4RQE A;  4JZG A;  3LDE A;  5LGN A;  2PF4 E;  3T4D A;  3ZN0 A;  4ZOL A;  3AG1 C;  3HKE A;  4JPR A;  4LFB O;  3K5M A;  4BIU A;  1SC5 B;  1HW7 A;  1XI1 A;  4DR4 B;  4CH3 A;  1YIT V;  1XNR O;  2Q7E A;  1SZX A;  1Q82 W;  1SES A;  3ZRW B;  2YI8 A;  3HPL C;  4CS4 A;  1H8E G;  1MMM A;  1VF7 A;  4NTX A;  3JD0 A;  1B06 A;  4IT5 A;  3CCM V;  4B3M O;  3K79 A;  2QE7 G;  1FJG O;  3FAV A;  3SPC A;  4LFC O;  4DR2 O;  4GZR B;  3L73 H;  4FM0 A;  5H9C A;  1OCZ B;  4DV1 O;  3WB1 A;  1HNW O;  2F93 B;  3M8A A;  2ITC C;  4MVS A;  1WPB A;  3B8M A;  4DR5 O;  3ZHS A;  4ZI7 B;  1F7Y A;  1K3E A;  1R6K A;  3MHH C;  4X64 B;  4TV9 A;  3ABL C;  1FXK C;  2Y48 A;  1R3K C;  1P49 A;  1BL8 A;  1MNG A;  1ZUQ A;  2DYR B;  2QM8 A;  2XAQ A;  3JD3 A;  3BFR A;  2D2C B;  4KHP O;  1Y74 B;  5LBQ A;  3RYF A;  4DV4 O;  3Q4H B;  1M56 C;  4NYK A;  4O4J B;  5KAI Z;  2IH1 C;  1NH2 D;  1WP7 A;  4DK0 A;  1FXK A;  5LYJ B;  1SQB H;  1ZTE A;  3DGE A;  1TVK B;  4X65 O;  1VAR A;  2VQE B;  1SER A;  1CPY A;  1J5E B;  5DM6 V;  1V9P A;  1XMQ B;  3GB7 C;  3K5O A;  4H0L B;  4DV3 B;  3E83 A;  2EZO A;  2WSS G;  3GWK C;  4GUN A;  3OEE G;  1FFT B;  5JCO A;  4HNA B;  4OXS A;  2DYS B;  2WLN A;  4TV8 B;  4JI4 B;  4FMT A;  3SYC A;  1PKX A;  3S3X A;  4LCU C;  1WAZ A;  4O4L B;  5B1N A;  4K8X A;  1S5L Z;  4WBN B;  4ASU G;  2X6A A;  3OMN B;  5LXT A;  1M1K W;  5E79 Z;  2OT5 A;  3FB7 C;  4I4T A;  3FB5 C;  1K34 A;  1K33 A;  1YF2 A;  2Y4U A;  1PNM A;  2RNB A;  1M9N A;  1YI2 V;  2EIM C;  4X64 O;  3W7S A;  2QA4 V;  5EBW C;  4DRX A;  3SJQ C;  4YHH O;  1RM1 B;  3O65 A;  1HNX O;  5DEC A;  1KC8 W;  1IBM B;  5FLX N;  4NTY A;  1HNW B;  2RQ6 A;  1US6 A;  2UUA O;  2R9I A;  2W6J G;  4DR2 B;  3RYH A;  3B2E E;  3DTU B;  2XND G;  1URF A;  3ZJZ A;  4WFA V;  2GHY A;  4K0K B;  1XUQ A;  4BWA A;  2MW2 B;  4UFZ A;  3SPG A;  2W0X A;  2Q6A A;  4AIL C;  2YEV A;  1AP6 A;  1VQM V;  1VQO V;  1R6N A;  2AW9 A;  3RYI A;  3KCY A;  3STL C;  1NI8 A;  5IJ9 A;  3QNE A;  4I5S A;  1K4D C;  4LFB B;  4TUY B;  3BAB A;  2YID A;  4IIJ A;  3ZHV A;  1HNZ O;  1J95 A;  5IYZ B;  1K5S A;  3DSQ A;  4LNU B;  1AJP A;  3OEH G;  1XNQ O;  3FFQ A;  5ITZ A;  5IYZ A;  5LMU O;  1Z5V A;  2H8P C;  3CRA A;  3ABL B;  4J7K A;  5LL6 Y;  1N36 B;  3WFV A;  5L3C A;  3CCU V;  4JI6 B;  1G1X B;  2BSK B;  2IU3 A;  2UUC B;  4KL1 A;  1EM1 A;  4DV6 B;  4FLV A;  4FLT A;  4DUZ O;  4B3T O;  3BHP A;  1K92 A;  4JF3 A;  4TOI A;  4JI7 O;  1YXB A;  1GMG A;  3CCV V;  5DED A;  2ZDI C;  2H94 A;  1QU7 A;  3VQY A;  1QQC A;  5LA6 B;  1V55 B;  4W4L A;  4JI0 O;  3OR6 C;  3QF7 A;  5BZB A;  1OCC B;  4K8Z A;  4DRX B;  1PL4 A;  2QTS A;  4JI5 B;  2LGW A;  5CBG A;  4NXM O;  3ZMS A;  2ZNI A;  1IX9 A;  5B66 Z;  1VQ8 V;  1U97 A;  2E3C A;  5GTH Z;  1WB7 A;  2XAG A;  4CC6 A;  3D3Q A;  1Y6X A;  4JI1 B;  2AHY A;  3TGU H;  1OCZ C;  4N23 A;  2F4V O;  1WP8 A;  2RDC A;  1UFI A;  5EYP B;  2A3Q A;  3HKB A;  4X89 A;  4DW0 A;  1M4U A;  5D5P A;  3AG4 B;  5B1A B;  4CZZ A;  4I55 B;  2BE3 A;  5KMG A;  4YIO A;  5TIS Z;  2F23 A;  4F6R B;  1MSD A;  2XAF A;  3W7T A;  4CS3 A;  3K9A A;  5AG2 A;  2IBZ H;  4O4H B;  2OTL V;  4LC1 A;  2NR5 A;  2LFR A;  1KKC A;  2L35 A;  2ZT9 B;  5E1A C;  1SRY A;  4UVC A;  5LOV B;  2HVK C;  3D8C A;  4WFF A;  4PEL A;  5K1X A;  3KKY A;  1Q86 W;  5KMG B;  2O57 A;  2Y69 B;  5GTI Z;  2JS5 A;  5JQG B;  3X2Q B;  4LF8 O;  1GM8 A;  1XDC A;  3K08 A;  1H2K A;  4I7Z B;  3T2M A;  3ZRX A;  2Q4P A;  5HFL A;  4UB6 Z;  4B7E A;  1V54 B;  2EJ7 A;  1I08 A;  4DR6 O;  1ENV A;  2LW7 A;  3SPI A;  3ZMV A;  2EIN C;  4TQF A;  3VOU A;  1M90 W;  4JI2 B;  5L3B A;  1H2N A;  3CCQ V;  2RCV A;  3D36 C;  4KFM A;  4ZKI A;  4X1Y B;  4BIZ A;  1PPJ H;  4O2B B;  3WB0 A;  5LHI A;  3FB6 C;  3VBB A;  5B3S C;  2UXC B;  4GLX A;  1BQZ A;  3IC7 A;  3P3N A;  4HYO A;  4XDJ A;  2E74 B;  1MOF A;  1KEC A;  3NR7 A;  3KCX A;  2PY5 A;  1XMO O;  5LP6 B;  2E76 B;  2F66 C;  2A79 B;  2UXD O;  1A32 A;  3SDL A;  4ABM A;  1NJI W;  1JQ0 A;  2DW4 A;  5BR8 O;  1R3L C;  2P22 C;  3BVO A;  1K97 A;  1D2D A;  5BXZ A;  4L87 A;  4PV1 B;  1YJN V;  3UT5 B;  2XUM A;  4QE9 A;  1QLE C;  4Q20 A;  3QO7 A;  3C90 A;  4LF7 B;  4W4K A;  4CC5 A;  2Q5Z A;  4JAV A;  1GKF A;  4PI0 A;  4FLU A;  5BMV A;  3H1H H;  2BSK A;  4IIJ B;  2PYL A;  1JVM A;  1SQX H;  1YVW A;  4J11 A;  2ZKO A;  2KG7 B;  5DN6 G;  1NR7 A;  2PI5 A;  2IH3 C;  2A9H A;  2XOK G;  1W2B U;  3N2G B;  4Z1M G;  4FZ0 A;  1H2S B;  1FXV A;  1AR1 B;  2JEU A;  4LNU A;  1BMF G;  3CJH A;  4Q6G A;  1YIJ V;  3X2Q C;  3LDC A;  2QGN A;  2QWR B;  4X1K A;  2HJD A;  4TT3 G;  5L3F A;  4LF9 B;  3R65 A;  3H1J H;  2WA3 A;  3CRQ A;  1IUR A;  2ILM A;  1M5I A;  4I0X A;  3MAQ A;  1DF4 A;  1FD9 A;  1XOU A;  1AR4 A;  3OTF A;  3CXH F;  4X1I B;  4CS2 A;  2CH7 A;  3A0H Z;  4B3R O;  5B1B C;  2QWN B;  2CK3 G;  3BA8 A;  1YCI A;  1GN2 A;  2XAH A;  3JD1 A;  1N8R W;  1NZ6 A;  2BOC C;  2K1E A;  3F7Y C;  2DWD C;  1KQS U;  1PNL A;  1FPO A;  5EBM C;  4I4T B;  2WLK A;  1VP7 A;  4R6Z A;  1SA0 A;  4UCS A;  4PJ0 Z;  1L8D A;  2Z0A A;  2ZM6 B;  4WFH A;  5IE9 A;  2FML A;  1N32 O;  1OCR B;  2ZCE A;  4HZ3 A;  4QPJ A;  2GTS A;  3OTO B;  5H6R A;  3J7A U;  2IJJ A;  2YDE A;  1S72 V;  4MW3 A;  3SYQ A;  2Q9L A;  3F7V C;  1R3I C;  4FJC C;  2Q73 A;  3CB2 A;  1IXB A;  1COW G;  1S77 D;  2HFE C;  2UXX A;  4EEQ A;  3B40 A;  2UXN A;  4X66 O;  2ZIN A;  4RUE A;  4G2K A;  4ZBM A;  1TVK A;  1JMK C;  4JYC A;  5LP6 C;  1WNS A;  4B3S O;  3JAT B;  4DR7 B;  3Q4H A;  5LGU A;  2YIB A;  3T1H O;  4F6E A;  2WPD G;  4O4I A;  2QM4 A;  4D7T A;  3CPW U;  3JCU Z;  1SA0 B;  4R50 A;  2ZIO A;  1XRE A;  2H3O A;  2WLL B;  4I50 B;  1Q90 D;  3OT7 A;  1Y74 A;  1LUW A;  4UCO A;  2E5L B;  2BOB C;  2ZR3 A;  3B77 A;  1Q8I A;  1YJW V;  1R3J C;  1AJN A;  2FTK A;  2IM9 A;  4RO2 A;  3RW0 A;  3H01 A;  4IGG A;  5L3G A;  4J41 A;  1BGY H;  3TCU A;  4P9P A;  4ZI7 A;  1R1B A;  2CH7 B;  1JOY A;  1YTF D;  1Q6I A;  1P7B A;  3JAW B;  4I0X B;  3LDD A;  4UV9 A;  2JVD A;  3PN1 A;  2R9R B;  2V4D A;  1NT2 B;  4GKJ O;  3CCR V;  4LF5 B;  3ZHT A;  4X1K B;  4LWS B;  3AG2 B;  1NQT A;  2JJ2 G;  2LGQ A;  1H38 A;  2LP7 A;  2HHH O;  3QG5 A;  1QCE A;  2UXB O;  3SYP A;  5A2Q N;  1KU9 A;  3LSU A;  3HKE B;  1L1F A;  1XL4 A;  4DV0 B;  5LMN O;  1RFY A;  4GX1 A;  2Q0O C;  3RVZ A;  3CD6 V;  1BQ0 A;  1MA1 A;  4PDM A;  2EUL A;  4FPP A;  4YY3 O;  1G8M A;  3MHS C;  3QVN A;  2GV9 A;  1VF6 C;  3ABM B;  4FFK A;  2P67 A;  3P32 A;  4KP4 A;  4LBE C;  5EC1 C;  4FK5 C;  1LUV A;  4RWU A;  4DV5 O;  1L0L H;  4NVP A;  1RM1 C;  4OX9 B;  3HKD A;  3EXA A;  4JI8 O;  4JV5 B;  1K7D A;  3A8T A;  4J80 A;  4UV8 A;  1U96 A;  1LNQ A;  4CH5 A;  4LH6 A;  4OPH A;  1N34 B;  2QEX V;  2HLD G;  3H1I H;  4WFE A;  4GKK O;  4LF4 B;  2WLH A;  1IBK B;  2XAS A;  4DR1 O;  3RYC B;  1SET A;  3E8B A;  4UXN A;  4TQD A;  2YXY A;  3OMA B;  2M7W A;  3KZI Z;  4MVU A;  3K5L A;  4P30 A;  5LP6 A;  3HKC B;  3JAW A;  2ZQM A;  5JH7 A;  3QO8 A;  1VQ9 V;  1BE3 H;  5EZY B;  2VQF B;  2ODM A;  4J9Z B;  4OGQ B;  3ZS8 C;  3B8N A;  3DXR B;  1VIB A;  2EZP A;  3ABT A;  1NTM H;  3LSS A;  2VS0 A;  1SQQ H;  1S3J A;  4YJ3 B;  4BR6 A;  5JQG A;  4JI3 O;  4KUM A;  1RPO A;  2MK3 A;  1XHX A;  4PI2 A;  4LF6 O;  4X20 A;  1OHH G;  2XT9 A;  3FX7 A;  4JYA B;  4IHJ B;  3TXQ A;  2Q8V A;  1N33 O;  2ZIM A;  3IGA C;  3IC9 A;  3G67 A;  3JAT A;  5KHK A;  4D7S A;  3RVY A;  3J80 N;  2B9Z A;  5BY1 A;  1OCO B;  3C3S A;  1UPG A;  5KUK A;  1BCC H;  3E35 A;  3UKM A;  3LNN A;  4PA4 A;  2ARH A;  2JGD A;  4O4H A;  4LF6 B;  4FVM A;  4QGP A;  3OD4 A;  2EJR A;  4X88 A;  1HDJ A;  3ETQ A;  5IYC O;  2WAM A;  5IWA O;  3ZIA G;  2YXH A;  2CTQ A;  4DUY O;  3K57 A;  4GX2 A;  3HKB B;  5FNV A;  2P06 A;  2P7T C;  2YIC A;  3E22 A;  3K0G A;  4NTW A;  4A5U B;  5LHG A;  4QE7 A;  3SJC C;  1OV9 A;  1MSW D;  3ZMU A;  1PM9 A;  1HR0 O;  1KMI Z;  4G27 B;  3O9O A;  2BCC H;  1G6U A;  2LFS A;  2OCC B;  1Q43 A;  1CP9 A;  4RQF A;  5LA6 A;  4EFE A;  4JZ2 A;  2Y69 C;  2AZ0 A;  1OJH A;  2JS3 A;  1YDX A;  5EC2 C;  4DV2 B;  4LF4 O;  4QNH B;  4LFA B;  5KHH A;  1MZE A;  4WCE V;  1QR9 A;  2ETN A;  3U0Z A;  1V54 C;  2WLI B;  4JV5 O;  1CEZ A;  4EFB A;  4UCV A;  3SYA A;  3T1Y O;  1GK9 A;  3CJH B;  3AG1 B;  5L3D A;  5IY5 B;  4U3J A;  3TJT A;  4DV5 B;  4ICG A;  1Q6H A;  2ADQ B;  3UM7 A;  3G6E V;  2OYQ A;  1NVP B;  2L6L A;  3BRC A;  1OCO C;  4DR3 O;  1Q6U A;  3ASO B;  5IYD O;  2YC0 A;  1MG1 A;  4U3J B;  2FKX A;  3PJS K;  2G38 A;  4JTA B;  3K0D A;  1IZ3 A;  5C8Y B;  1D5A A;  3ZED A;  5IDJ A;  1H2M A;  2JK5 C;  5KHJ A;  1TUB A;  1JJ2 U;  3TK1 A;  1Y67 A;  4MVM A;  2UXB B;  3UT5 A;  3ZMT A;  2UU9 O;  2Y4T A;  3B4S A;  3SJB C;  5IJ9 B;  3L71 H;  4LF5 O;  4NXN O;  1BSM A;  4OPA A;  2AGA A;  1NU1 H;  3SJA C;  2P4K A;  3F5T A;  3EFF K;  3ASN C;  3L9D A;  5A9G A;  4NKG B;  3BA9 A;  4HAM A;  3ZRV A;  3G80 A;  1FS0 G;  2JEX A;  3K03 A;  5KHI A;  1AR5 A;  1YJ9 V;  5B1O A;  1GO3 F;  3CX5 F;  2YIB D;  3L74 H;  4FM2 A;  3T1Y B;  1GN6 A;  2XAJ A;  3H1L H;  2LQT A;  2KSD A;  3JAR B;  3L75 H;  4DV7 B;  1IBL B;  1EBO A;  4B7K A;  5LXT B;  4O2B A;  1Q7Y W;  2HP8 A;  2OCC C;  4X1Y A;  2ZE5 A;  4WBN A;  4O4L A;  4CH4 A;  3UQ8 A;  3E22 B;  1R73 A;  4PA3 A;  1EN6 A;  4IYH A;  4LFA O;  1ZL8 B;  5GON A;  4DV2 O;  2PUS A;  3B09 A;  1Y66 A;  3LNM B;  3BPZ A;  3HB3 B;  4ZHQ A;  5LGT A;  5J2T A;  3RT3 C;  3CCJ V;  3ZMZ A;  1Z5W A;  4JTC B;  2Q7H A;  2DE0 X;  2CGO A;  4XDL A;  1JX9 A;  4YJ2 A;  1M56 B;  3SPH A;  3M99 B;  1L0N H;  1O9G A;  3N2K A;  4U7N A;  3K9S A;  3RBZ A;  4PD4 F;  4PA6 A;  3C3T A;  2GSM B;  5LHH A;  4MVQ A;  3SYO A;  1NH2 B;  4FZ1 A;  5KA5 A;  3W7U A;  4DUY B;  2EIM B;  1QLE B;  4IHJ A;  4DYL A;  5IJ0 A;  1IBK O;  3CHX A;  4GT1 A;  4FLX A;  3U11 A;  4GCZ A;  4F6R A;  2N05 A;  1HWY A;  5JJJ B;  3OTO O;  3CMA V;  1GM9 A;  1FYJ A;  1JR9 A;  1JFF B;  2HKO A;  4H13 B;  1DK1 A;  1B6Q A;  4MSW C;  4DV7 O;  1IBL O;  1VQ7 V;  5EZY A;  4QJF B;  1Z2G A;  5KAF Z;  4BW5 A;  4OX9 O;  3AK1 A;  2CAZ C;  4LH7 A;  3G6B A;  1S5H C;  3ETG A;  3CC7 V;  1JA8 A;  3UCS C;  3CWB H;  4TV9 B;  3FB8 C;  2PGG A;  5CBF A;  1QBZ A;  2AHZ A;  3OFN G;  4E2L A;  4YXW G;  3RYC A;  3FD9 A;  3SPJ A;  4P2Z A;  2CTR A;  5KX5 B;  2NNU A;  3P30 A;  4NXN B;  2Q0A A;  2UU9 B;  2EIL C;  2QWQ B;  1AI5 A;  2ZDI A;  1SZT A;  1N0N A;  2WLJ A;  2HHH B;  1NTK H;  4MS2 A;  4DXW A;  2D3O W;  3CEI A;  3HKD B;  5B1A C;  1VQP V;  1TGO A;  4GKJ B;  3RWR D;  2AZ2 A;  1KUQ A;  3JAS A;  2P90 A;  1VF5 B;  4FFB A;  2A06 H;  1F51 A;  4DR3 B;  1MZF A;  1CXZ B;  3OGI B;  2BTO A;  3CE2 A;  5IYB O;  4UB8 Z;  4PDL A;  3E8F A;  2ZE6 A;  1GH6 A;  4ZOL B;  3BY6 A;  1EFR G;  3ZBH A;  1XL6 A;  4FFB B;  1KD1 W;  3OGC C;  2EIK B;  1ZX3 A;  3CC4 V;  1EZJ A;  4F4L A;  2Z5U A;  5ITZ B;  2EX3 A;  4FIP C;  4JYB A;  5IY5 C;  2WWW A;  3FYE B;  2X7R B;  4EKW A;  2N04 A;  2R9A A;  3RN4 A;  2RN9 A;  3EHB B;  4GKK B;  2JJ1 G;  4LWS A;  5D5Q A;  1WB8 A;  5C93 A;  4TUY A;  4MTO A;  1ZSP A;  1W0J G;  2PZS A;  3OR7 C;  3ZHQ A;  3CRR A;  2IW5 A;  3SGI A;  3ZRS A;  1JPX A;  3JAL B;  4MTG A;  3ETE A;  4JI8 B;  2YEV B;  3ZHU A;  1IXM A;  2B1I A;  3FKS G;  3E89 A;  1HR0 B;  3CRC A;  5CA1 A;  2X6B A;  4UCT A;  1FKA O;  3JYC A;  3QTC A;  4MVR A;  3WB2 A;  1BZK A;  3ABM C;  5H6Q A;  2DN9 A;  2P6J A;  5JJE B;  1DGS A;  5EK0 A;  5IT9 N;  2OIG A;  4YY3 B;  2KB1 A;  3MD0 A;  4MT8 A;  2CDY A;  5LMN B;  3ZCC A;  2YIA A;  1M57 C;  2GUZ B;  4P9O A;  3T1C A;  5JWP A;  3I55 V;  2JDI G;  2CTP A;  1RSO A;  4DR6 B;  4U7O A;  5IWA B;  4O4I B;  1PNK A;  2P4V A;  2V7Q G;  1QLN A;  4U3F H;  2WLL A;  4I50 A;  2Y0I A;  2X0L A;  1JCH A;  2WA4 A;  1KB9 F;  1JJO A;  4X9Q A;  4LF8 B;  3OUS A;  2DJV A;  5CN0 A;  3UO2 A;  2ATK C;  1DLB A;  4WFG A;  3JAK B;  4MVO A;  1I5X A;  2Y0P A;  3AG4 C;  2GDS A;  2IU0 A;  4TV8 A;  1P7G A;  3JAK A;  2IJK A;  2QKC A;  3T4Z A;  3K59 A;  2M6Y A;  1N0J A;  1N33 B;  3AG2 C;  3AK3 A;  4L8J A;  4I9Q A;  4JYA O;  4JGS A;  4ZHQ B;  2OCH A;  2E5L O;  3JSL A;  1B3Q A;  1PV0 A;  2EIN B;  5CBH A;  1XBL A;  4JI3 B;  3EVK A;  1TA8 A;  1FXK B;  5LYJ A;  1QHT A;  4WF9 V;  2X6C A;  2RMK B;  4B3S B;  4HBN A;  1RSO B;  1R6T A;  3ABK B;  1K4C C;  3HR0 A;  2VQF O;  2OIE A;  1XIL A;  1H2G A;  3VQV A;  2A0L A;  2LO1 A;  4JI5 O;  4PDV A;  3UO3 A;  1BT8 A;  2DMX A;  1PD3 A;  2HR3 A;  3JAL A;  3OAA G;  4J9Y B;  4JAU A;  3CSX A;  1NS1 A;  2ZR2 A;  5CB4 B;  5CA1 B;  1EN4 A;  4DR1 B;  1TAE A;  1TUB B;  1N34 O;  3WG7 B;  1PL0 A;  4QPK A;  3H9V A;  4LR3 A;  3CC2 V;  4E4E A;  4H44 B;  4Z2W A;  5KLV H;  1YSC A;  4PDR A;  1NR1 A;  4H37 A;  5H2F Z;  3N2G A;  1KKD A;  3DC6 A;  3APO A;  4MTF A;  4DV6 O;  2UUC O;  3I5D A;  1IVS A;  2A7W A;  2JIZ G;  1WPX A;  2ZXW B;  1ORQ C;  1T5E A;  4DO2 A;  2R72 A;  3KG2 A;  3NXS A;  1GAX A;  3OW2 U;  2UXC O;  1N36 O;  1QR8 A;  3A0B Z;  4NB5 A;  1BS3 A;  1NKD A;  5KUM A;  3JD2 A;  2NN4 A;  1I5Y A;  5KA6 A;  1S5J A;  2ZE8 A;  3ML0 A;  2DYR C;  5BMV B;  3L70 H;  2QWP B;  1X59 A;  4DV0 O;  3K3W A;  4FLZ A;  2EBO A;  1ZAU A;  3LSQ A;  1SQV H;  1GN4 A;  2W0F C;  4H33 A;  2OWO A;  2RJZ A;  2EIK C;  1SQP H;  3S3W A;  5KX5 A;  3TXS A;  1SKV A;  1HP8 A;  2XHB A;  2QSA A;  1WA8 A;  1YZB A;  4UCR A;  3OE7 G;  1UJW B;  5L3E A;  3BEH A;  1AVM A;  5KHG A;  3CRM A;  2FYU H;  5B3S B;  3APQ A;  2YI9 A;  4AI8 A;  2UUA B;  5FNV B;  5J2U B;  4Z1V A;  2LW1 A;  1Y76 A;  2P5O A;  1AB3 A;  1JFF A;  4YHH B;  4AHC A;  1BHA A;  5EIB C;  3E2E A;  3GWO A;  2FL4 A;  2WLM A;  3OM3 B;  3L72 H;  1SQG A;  5BR8 B;  5FPR A;  2IJI A;  4O2A B;  3QO5 A;  5IJ0 B;  4BW9 A;  4UVB A;  1WN7 A;  2PYJ A;  2F1M A;  3CS5 A;  2YUA A;  1GN3 A;  2QJ1 A;  1ZWI C;  1H2L A;  2FB5 A;  1S76 D;  3AG3 B;  3T1H B;  1F23 A;  2BTQ B;  4DR7 O;  1M57 B;  4JI4 O;  2CE4 A;  2ITD C;  1VQ5 V;  3P3P A;  4JI1 O;  1BHB A;  4YJ2 B;  1FFX A;  2QM7 A;  2ZXW C;  2YXL A;  4X66 B;  4YIP A;  4NXM B;  3CYO A;  3RFR A;  3JD4 A;  2PTM A;  2R70 A;  3ICX A;  5LOV A;  3N2K B;  2VWK A;  2DWE C;  4J10 A;  4JI2 O;  1V55 C;  2Q67 A;  5CA0 A;  4PA7 A;  2VQE O;  1ZL8 A;  5GON B;  1AI7 A;  1TUE B;  5GW7 A;  4YJ3 A;  5EYP A;  1QNM A;  1ARO P;  2HJF C;  2GTA A;  1M93 A;  5J2T B;  1QVG U;  2YS8 A;  2HVJ C;  1N32 B;  2E75 B;  4DV4 B;  2BTQ A;  2ZM6 O;  4RAI A;  1Q3E A;  4KHP B;  3DXR A;  3JAR A;  1P4R A;  1NVP D;  1H8H G;  4B3T B;  4I55 A;  3TET A;  2W6I G;  4JTD B;  1KYO F;  4J7Z A;  1VMG A;  3CXC U;  4GX0 A;  4IL6 Z;  4XBF A;  3A2F A;  1XEQ A;  1K5Q A;  3E8G A;  2QKS A;  1NBM G;  3ASO C;  2KKW A;  1VQ4 V;  1E1Q G;  2B1G A;  5JCO C;  4ZIB A;  5JVD A;  3STZ C;  3K5N A;  4G28 B;  4I9W A;  3U10 A;  1P84 F;  1W59 A;  1WA8 B;  4MW8 A;  4DV1 B;  1K9M W;  4B3R B;  4LFC B;  3ABK C;  5CMU A;  1VQK V;  5H5N A;  4B3M B;  5C8Y A;  2AXT Z;  3DC5 A;  4GX5 A;  1OCR C;  4GYC B;  4BAY A;  4LF9 O;  2ZD9 A;  2ADP A;  5F2V O;  5FPO A;  2HEP A;  1AI4 A;  2VRZ A;  3J81 N;  1OCC C;  3BAA A;  1XHZ A;  2QTO A;  4EB6 B;  1XNR B;  2Z3Y A;  3AG3 C;  4DR4 O;  1YEW A;  3ZHR A;  5B5E Z;  4FM1 A;  1K8A W;  4B08 A;  1OZ0 A;  1D5N A;  1MAB G;  3AEI A;  3D36 A;  3WG7 C;  1ZLZ A;  4DK1 A;  3ETD A;  2IJH A;  4TSF G;  3JCZ A;  5JJN B;  4JI0 B;  1I7F A;  3W7W A;  2N74 A;  2WLI A;  2F43 G;  3AK2 A;  2JGU A;  1RPR A;  4LF7 O;  1G4Y B;  1THZ A;  1O9H A;  2LJ2 A;  3BCC H;  2F95 B;  1VEW A;  3F5W C;  1IDS A;  4UCU A;  5CA3 A;  2QDO A;  4JYY A;  2UXD B;  4EB6 A;  4DUZ B;  2EIL B;  4WFB V;  3AG7 A;  2UUB O;  1XMO B;  2PI4 A;  1SS3 A;  3RYI B;  4NR1 A;  3D3I A;  3FYI B;  3JAM N;  4QIW F;  3IJ4 A;  4JI6 O;  1F4M A;  4K3A A;  3E8H A;  4AQY B;  4BIO A;  5CB4 A;  5LMU B;  3CP1 A;  4DV3 O;  2EIJ B;  3RYH B;  3CCE V;  1XNQ B;  4TWK A;  2HG5 C;  2QWO B;  3W7X A;  1YHQ V;  5EBL C;  2CUG A;  5JVD B;  3ABU A;  3G4S V;  1GRJ A;  4X65 B;  1GTO A; 
#chains in the Genus database with same CATH homology
 3ABT A;  1OCZ C;  4N23 A;  3ZCC A;  1M57 C;  3LSS A;  4P9O A;  3T1C A;  3I55 V;  2JDI G;  3IFX A;  2V1D A;  4U7O A;  4X89 A;  1PNK A;  1S3J A;  3AG4 B;  2V7Q G;  4KUM A;  5B1A B;  4CZZ A;  1QLN A;  1RPO A;  2WLL A;  1GM7 A;  4PA9 A;  2X0L A;  2MK3 A;  1JCH A;  4R8C A;  5FL7 G;  2XAF A;  3W7T A;  3OUS A;  4X8A A;  2Q69 A;  5CN0 A;  1OHH G;  2ATK C;  1DLB A;  3K9A A;  4WFG A;  3E86 A;  4MVO A;  2DQ0 A;  3IGA C;  2OTL V;  1I5X A;  3AG4 C;  4LC1 A;  1KP2 A;  2IU0 A;  2LFR A;  2IJK A;  5E1A C;  3RVY A;  3T4Z A;  1SRY A;  4UVC A;  3G71 V;  1OCO B;  2HVK C;  5J9P C;  3AG2 C;  4WFF A;  4PEL A;  1Q81 W;  4R7C A;  4JGS A;  5KUK A;  3E35 A;  3UKM A;  1Q86 W;  2Y69 B;  4PA4 A;  3X2Q B;  2EIN B;  1GM8 A;  5CBH A;  3K08 A;  2EJR A;  4X88 A;  3T2M A;  3ZRX A;  4JAS A;  5HFL A;  5IYC O;  2WAM A;  5HFM A;  1FXK B;  3ZIA G;  1DF5 A;  1V54 B;  4WF9 V;  1W0K G;  2X6C A;  3K04 A;  1ENV A;  3SPI A;  1ROP A;  3ZMV A;  3A0R A;  4GX2 A;  2EIN C;  3VOU A;  3CCS V;  1M90 W;  5L3B A;  2P7T C;  3K0G A;  3CCQ V;  3ABK B;  4KFM A;  1K4C C;  5LHG A;  4ZKI A;  4QE7 A;  1VQ6 V;  4BIZ A;  3ASN B;  2NLJ C;  1E79 G;  1H2G A;  5LHI A;  3FB6 C;  3VBB A;  3I56 V;  2A0L A;  5B3S C;  1DTO A;  1MSW D;  3ZMU A;  4PDV A;  1VQN V;  3IC7 A;  4HYO A;  1PD3 A;  2HR3 A;  3OAA G;  4XDJ A;  4J9Y B;  4G27 B;  1VQL V;  1S0V A;  2C2A A;  4JAU A;  2LFS A;  1MOF A;  2OCC B;  2ZR2 A;  1KEC A;  1KP3 A;  4XDK A;  4RQF A;  1CP9 A;  3CCL V;  3CME V;  1K73 W;  2Y69 C;  1WLE A;  2DQ3 A;  5EC2 C;  2A79 B;  3ZN1 A;  4QNH B;  1YTF B;  1AI6 A;  5B1B B;  3WG7 B;  1PL0 A;  4QPK A;  4UVA A;  3CC2 V;  1NJI W;  4WCE V;  4MVZ A;  1JQ0 A;  2DW4 A;  1QR9 A;  4UUJ C;  1R3L C;  1YSC A;  4PDR A;  1NR1 A;  1K97 A;  4H37 A;  1KKD A;  2YSU B;  4L87 A;  1YJN V;  4QE9 A;  1QLE C;  2B5U A;  2OTJ V;  1V54 C;  2WLI B;  4Q20 A;  4MTF A;  3QO7 A;  1FXH A;  3ZRW A;  1CEZ A;  3OMI B;  3SYA A;  1GK9 A;  4JAV A;  1F4N A;  1GKF A;  3AG1 B;  4RUF A;  5L3D A;  2JIZ G;  1WPX A;  2ZXW B;  1ORQ C;  5IY5 B;  1Y4M A;  2EIJ C;  4DO2 A;  3KG2 A;  3NXS A;  1E1R G;  3OW2 U;  3UM7 A;  3OUF A;  4MTX A;  3G6E V;  1QVF U;  1QR8 A;  1NKD A;  4N21 A;  5KUM A;  3JD2 A;  1NVP B;  2Q68 A;  1JVM A;  1I5Y A;  1OCO C;  5KA6 A;  5DN6 G;  1NR7 A;  2PI5 A;  2IH3 C;  3ASO B;  4CBC A;  4LP8 A;  2A9H A;  2DYS C;  2XOK G;  5IYD O;  1W2B U;  3K06 A;  1AJQ A;  3ML0 A;  2DYR C;  3LUT B;  4RQE A;  3LDE A;  4Z1M G;  3T4D A;  3ZN0 A;  5LGN A;  3AG1 C;  4JPR A;  4BIU A;  1FXV A;  1MG1 A;  1AR1 B;  2JEU A;  3PJS K;  1BMF G;  4JTA B;  1YIT V;  3K3W A;  1YIJ V;  3K0D A;  3LDC A;  2EBO A;  3X2Q C;  1Q82 W;  3LSQ A;  1SES A;  5IDJ A;  2JK5 C;  3ZRW B;  2W0F C;  4H33 A;  4TT3 G;  1JJ2 U;  5L3F A;  3TK1 A;  3R65 A;  2EIK C;  3HPL C;  4MVM A;  1H8E G;  3ZMT A;  1DF4 A;  3CCM V;  3JD0 A;  3K79 A;  2QE7 G;  3OE7 G;  1UJW B;  5B1B C;  5L3E A;  3BEH A;  2CK3 G;  3EFF K;  3ASN C;  3SPC A;  3ZRV A;  4HAM A;  1FS0 G;  1OCZ B;  5H9C A;  5B3S B;  2JEX A;  3K03 A;  1YJ9 V;  5B1O A;  1GO3 F;  2XAH A;  2ITC C;  3JD1 A;  1N8R W;  4MVS A;  2BOC C;  3B8M A;  2K1E A;  3F7Y C;  2DWD C;  1KQS U;  1K3E A;  1R6K A;  3MHH C;  1PNL A;  3ABL C;  2XAJ A;  5EBM C;  1FXK C;  2Y48 A;  1R3K C;  3E2E A;  1BHA A;  1EBO A;  2WLK A;  3GWO A;  1BL8 A;  1Q7Y W;  2OCC C;  4R6Z A;  2WLM A;  3OM3 B;  2DYR B;  2QM8 A;  1R73 A;  2IJI A;  2XAQ A;  3JD3 A;  3QO5 A;  4WFH A;  4PA3 A;  4UVB A;  1OCR B;  4HZ3 A;  5LBQ A;  4QPJ A;  1Y66 A;  3LNM B;  5H6R A;  1M56 C;  3HB3 B;  2IJJ A;  1ZWI C;  2IH1 C;  1S72 V;  1NH2 D;  4MW3 A;  1S76 D;  3AG3 B;  1FXK A;  3SYQ A;  1F23 A;  3F7V C;  3DGE A;  1R3I C;  5LGT A;  4FJC C;  1M57 B;  1SER A;  3CCJ V;  1CPY A;  2ITD C;  5DM6 V;  1VQ5 V;  3ZMZ A;  1COW G;  4JTC B;  1S77 D;  2HFE C;  2UXX A;  4XDL A;  1BHB A;  3GB7 C;  1JX9 A;  2QM7 A;  2ZXW C;  2UXN A;  1M56 B;  3SPH A;  3M99 B;  3CYO A;  4RUE A;  3E83 A;  4G2K A;  2EZO A;  3JD4 A;  4U7N A;  4ZBM A;  2WSS G;  3RBZ A;  2DWE C;  3OEE G;  4JYC A;  1FFT B;  1V55 C;  2Q67 A;  4OXS A;  4PA6 A;  2DYS B;  2GSM B;  5LHH A;  2WLN A;  4MVQ A;  3SYO A;  5LGU A;  4PA7 A;  1NH2 B;  5KA5 A;  3W7U A;  1AI7 A;  1TUE B;  2WPD G;  4FMT A;  2EIM B;  5GW7 A;  3SYC A;  1QLE B;  1PKX A;  1ARO P;  2HJF C;  4LCU C;  1QVG U;  4GT1 A;  5B1N A;  2HVJ C;  3CPW U;  4GCZ A;  4R50 A;  4ASU G;  1HWY A;  2X6A A;  3OMN B;  3CMA V;  1GM9 A;  1M1K W;  4RAI A;  2OT5 A;  1P4R A;  3FB7 C;  1H8H G;  1NVP D;  2WLL B;  3FB5 C;  1K34 A;  2W6I G;  1K33 A;  4JTD B;  3TET A;  1PNM A;  2HKO A;  3CXC U;  4GX0 A;  1B6Q A;  1M9N A;  4MSW C;  4XBF A;  1YI2 V;  2BOB C;  1VQ7 V;  2EIM C;  1K5Q A;  4QJF B;  2ZR3 A;  3B77 A;  3E8G A;  3W7S A;  2QA4 V;  2QKS A;  5EBW C;  1NBM G;  1YJW V;  3ASO C;  1R3J C;  4BW5 A;  1AJN A;  1VQ4 V;  2FTK A;  1E1Q G;  3SJQ C;  1RM1 B;  1S5H C;  2B1G A;  4RO2 A;  3RW0 A;  3ETG A;  1KC8 W;  3H01 A;  5L3G A;  3CC7 V;  3STZ C;  4G28 B;  3FB8 C;  4I9W A;  3TCU A;  4P9P A;  5CBF A;  1QBZ A;  2R9I A;  2W6J G;  2AHZ A;  1JOY A;  4MW8 A;  1K9M W;  3OFN G;  4E2L A;  3DTU B;  4YXW G;  1YTF D;  3SPJ A;  2XND G;  4P2Z A;  3ABK C;  1P7B A;  3ZJZ A;  2NNU A;  2GHY A;  4WFA V;  3LDD A;  3P30 A;  4UV9 A;  5CMU A;  2R9R B;  1VQK V;  3CCR V;  3SPG A;  2EIL C;  4GX5 A;  3AG2 B;  1NQT A;  1OCR C;  2JJ2 G;  2Q6A A;  1H38 A;  1AI5 A;  2YEV A;  2ZDI A;  4BAY A;  1SZT A;  2ZD9 A;  1R6N A;  1VQM V;  1VQO V;  2LP7 A;  1QCE A;  3SYP A;  2WLJ A;  4MS2 A;  1AI4 A;  3STL C;  4DXW A;  2D3O W;  1L1F A;  5B1A C;  1VQP V;  1OCC C;  1XL4 A;  3QNE A;  4I5S A;  1K4D C;  2QTO A;  4GX1 A;  2Z3Y A;  3RVZ A;  3AG3 C;  3CD6 V;  4PDM A;  2P90 A;  4FPP A;  1K8A W;  1J95 A;  1G8M A;  3MHS C;  1OZ0 A;  1F51 A;  1K5S A;  1MAB G;  3AEI A;  3D36 A;  5IYB O;  1AJP A;  3OEH G;  3WG7 C;  3ABM B;  4PDL A;  3ETD A;  3E8F A;  2IJH A;  3BY6 A;  4TSF G;  1EFR G;  2P67 A;  3P32 A;  4KP4 A;  1XL6 A;  4LBE C;  2H8P C;  3ABL B;  5EC1 C;  1KD1 W;  3OGC C;  3JCZ A;  2EIK B;  4FK5 C;  3W7W A;  3WFV A;  2WLI A;  5L3C A;  3CCU V;  2F43 G;  1RM1 C;  3CC4 V;  1EZJ A;  4F4L A;  2IU3 A;  2Z5U A;  1RPR A;  4FIP C;  1G4Y B;  4JYB A;  5IY5 C;  1THZ A;  2WWW A;  3FYE B;  2X7R B;  4EKW A;  1K7D A;  3EHB B;  3F5W C;  2JJ1 G;  5C93 A;  4UV8 A;  1LNQ A;  4MTO A;  5CA3 A;  1K92 A;  1W0J G;  2QEX V;  2HLD G;  2EIL B;  3OR7 C;  4JF3 A;  4WFE A;  4WFB V;  2IW5 A;  3ZRS A;  2WLH A;  2XAS A;  1JPX A;  1SET A;  3E8B A;  4MTG A;  4UXN A;  2PI4 A;  3ETE A;  1GMG A;  3CCV V;  3OMA B;  3D3I A;  2YEV B;  2M7W A;  2ZDI C;  3FYI B;  1IXM A;  2B1I A;  2H94 A;  4MVU A;  4QIW F;  1F4M A;  3FKS G;  3E89 A;  3E8H A;  1V55 B;  3OR6 C;  4P30 A;  2X6B A;  5BZB A;  1OCC B;  3JYC A;  3CP1 A;  4MVR A;  2ZQM A;  3QO8 A;  5CBG A;  2EIJ B;  1VQ9 V;  3ZMS A;  3ABM C;  3CCE V;  5H6Q A;  1VQ8 V;  4TWK A;  2P6J A;  2XAG A;  5EK0 A;  2HG5 C;  4J9Z B;  3W7X A;  1YHQ V;  5EBL C;  3B8N A;  2KB1 A;  3MD0 A;  4MT8 A;  2AHY A;  3ABU A;  3G4S V;  1GTO A;  2EZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...