4PDMA

Crystal structure of k+ selective nak mutant in rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdmA00
3FB5C 3SPCA 2AHZA 2DYRC 3FB6C 2HG5C 4PA4A 3ABMC 5B3SC 5CBHA 2A9HA 3OR7C 4XDLA 4MVUA 2AHYA 2EIJC 3AG3C 2BOBC 4HYOA 5CBGA 3IFXA 2HVJC 2EINC 3R65A 3E8BA 4P30A 5EC1C 4WFGA 4XDJA 4UUJC 2BOCC 2WLLA 3EFFK 4H37A 2WLNA 4G27B 4ZBMA 3FB8C 2WLHA 4P9OA 3SJQC 1G4YB 4PA9A 4GX0A 3KG2A 3SYOA 4WFEA 4MVOA 4BW5A 1XL4A 2WLIB 4HZ3A 2DYSC 4P2ZA 4X8AA 2WLIA 1R3IC 5EBLC 5CBFA 3E83A 1OCCC 2EIKC 3STZC 3JYCA 5IY5C 4KFMA 2WLMA 3ABKC 4TWKA 4WFHA 2Y69C 1J95A 1QLEC 3OUSA 3ZRSA 1OCOC 3TETA 4J9ZB 4MW8A 5EBWC 3RVYA 3E8GA 4MSWC 3HPLC 3K03A 2ITCC 3SPHA 1S5HC 3STLC 3E8HA 3K06A 2P7TC 4MW3A 3AG1C 4I9WA 2WLLB 4G28B 4JTCB 2X6AA 3SPGA 4EKWA 2X6BA 4H33A 3LUTB 4GX5A 3E86A 3OUFA 2A79B 4LCUC 2ITDC 3T4DA 3LNMB 3ASNC 3K0DA 3SYAA 2A0LA 1M57C 3LDDA 2ZXWC 2JK5C 2QKSA 4PDLA 4R7CA 3PJSK 1ZWIC 4JTDB 4MVMA 4X89A 4R6ZA 3ZJZA 2HJFC 2KB1A 2IH3C 4MTOA 3ASOC 4PDVA 5EK0A 5KUMA 4X88A 4WFFA 5J9PC 3T1CA 3OGCC 2H8PC 4LBEC 3RBZA 2K1EA 1V55C 4CBCA 5KUKA 3E89A 5B1BC 3SYPA 3SPIA 1R3JC 3ABLC 3K0GA 4MS2A 4R50A 2QTOA 3BEHA 4RUFA 3F7VC 3X2QC 1V54C 4XDKA 1M56C 4DXWA 4F4LA 3IGAC 1LNQA 4PA7A 1K4DC 2IH1C 1K4CC 3RW0A 2EILC 2EIMC 4MVZA 3VOUA 1OCRC 2Q69A 3FB7C 3RVZA 5BZBA 4MVRA 2WLKA 3E8FA 2ZD9A 4GX2A 1OCZC 2W0FC 4PA3A 4QE7A 3UKMA 3UM7A 1BL8A 3K08A 3WG7C 4RAIA 5EBMC 4LP8A 3SPJA 2X6CA 4P9PA 3GB7C 3LDEA 2DWDC 4PA6A 3TCUA 2WLJA 3AG4C 3F7YC 5EC2C 4PDMA 2YEVA 2DWEC 2R9RB 2HVKC 4J9YB 2ATKC 4RUEA 4OXSA 4MVSA 4GX1A 5B1AC 4JTAB 2OCCC 3OR6C 1KKDA 3T2MA 4R8CA 1JVMA 4PDRA 3SYQA 4QNHB 1P7BA 1R3LC 4MVQA 1XL6A 2Q68A 3LDCA 4QE9A 5E1AC 4RO2A 4MTFA 3SYCA 3AG2C 2Q67A 4MTGA 2HFEC 3F5WC 1ORQC 2NLJC 3T4ZA 2Q6AA 1R3KC 3K04A
chains in the Genus database with same CATH superfamily
1TVKB 1H2NA 2B9ZA 5HFLA 5B3SC 1XBLA 1OCOB 3NR7A 4DR4B 5JJJB 4CZZA 1XMQO 2VWJA 4XDJA 1N34B 2XTAA 5CN0A 2WLHA 3TK1A 5IE9A 1AI4A 3OW2U 3M8AA 4JI3O 5IY5C 1U97A 1W0KG 2E5LB 4ASUG 3D3IA 1VIBA 1BSMA 2JS5A 3K06A 4DV3O 1ROPA 4GZRB 1JFFB 4NTWA 1J5EB 3RFRA 3OTOO 3DGEA 3J81N 2UXCB 2WA4A 2F66C 2QKCA 1P49A 2UXBO 2LW7A 1L1FA 2UXXA 1XILA 2ZDIC 5A2QN 4TUYA 3TXQA 3ABLC 1Q6UA 2ZKOA 4L8JA 1XMQB 1JOYA 1H2MA 2EIMC 4FZ0A 2EBOA 3UKMA 3ML0A 1PNLA 2FYUH 2MW2B 1HW7A 4U3JB 1M4UA 2Y4UA 3JAKB 5J2TA 2P06A 1E1QG 3JAKA 1WPBA 5KHJA 2HVKC 2QM7A 4JI3B 4J11A 3ETDA 4J7ZA 4LF5O 3OTFA 1B04A 1NH2B 3BHPA 5FPOA 4DV3B 2DYSB 1QQCA 1N4CA 5F2VO 5KHGA 1BMFG 3CCUV 3ZHRA 3ABKB 1SC5B 3U0ZA 3RYHB 3OTOB 3HKBA 4MVUA 3WB2A 3TXSA 1JCHA 3OM3B 1H2GA 4CH3A 5IYCO 1NVPB 5CA1A 2UXBB 3KG2A 2BTQB 4UFZA 1V9PA 3ASNB 4X8AA 4ZOLA 4DR3O 2D3OW 4D6TH 5CBFA 2CTWA 4DW0A 2G38A 2N05A 1QLEC 5C8YA 1NH2D 3H1KH 4MW8A 4DV6O 3L73H 4B08A 1BQ0A 3B4SA 2C2AA 3SPGA 2WLLB 1LUWA 4GX5A 1GM9A 3RYCB 4TQFA 3RYCA 2ZXWC 2QKSA 1QU7A 4O4HA 4X1IA 1K7DA 3C3SA 2BSKA 3P30A 3ASOC 1RPOA 4LF5B 2N04A 4JI7O 1UPGA 1BZKA 2VRZA 3ZRWB 1QCEA 4I55B 5J9PC 4JF3A 4I55A 1QR9A 4TV9B 1V55C 2XASA 3ZHSA 4TV9A 1JQ0A 1UJWB 3CCLV 1HNWO 1L0LH 4JYYA 3SJBC 2Q0OC 1U96A 3NXSA 4DUZO 2IH1C 2Q69A 1Q82W 4CS2A 4MVRA 2Q0AA 2ZD9A 3FFQA 1B6QA 3G80A 4KXRA 5IT9N 3JSNA 3VQXA 1G8MA 4RAIA 3I5DA 2X7RB 2OIEA 3Q4HA 3K5MA 1D2DA 2FL4A 1NS1A 2B5UA 4G2KA 2HR3A 2R9RB 1TUEB 4RUEA 2IU0A 4MVSA 2CTPA 2F4VO 4QJFB 4DV6B 3KZIZ 4MVQA 5JCOC 5IJ9B 3KCXA 4N21A 3AG2C 1BHAA 1VF6C 1OCCB 1YJNV 5ITZA 2Y69B 2QGNA 2ODMA 1Y74B 1VQKV 4ZI7A 3AG3C 4LF4O 2F1MA 4P30A 2WLNA 4GUNA 4UVBA 1QR8A 3AK3A 4X65O 1PL0A 3UCSC 5JJNB 5D5PA 2P4VA 3BVOA 2YIAA 3HKCB 1HNWB 5FNVA 3RYIB 2NR5A 3H01A 3RYIA 4X20A 4DUZB 2ITCC 4JAUA 1K5SA 2NN4A 2ZNJA 5EIBD 3AG1C 4TT3G 4WFBV 4I50B 1D5AA 3K58A 3AK1A 4UCVA 1BHBA 2KSDA 2FTKA 4JI1O 1H2SB 2Y0IA 4Z1VA 4DK1A 4DR6O 3K57A 2F4VB 5EK0A 3K5LA 1KKCA 4GCZA 5H5NA 3T1CA 2V7QG 2H8PC 5LP6C 1N0JA 5B1BC 2ZE7A 3DC6A 4WBNA 1NBMG 5LHIA 4RWUA 2O57A 3F7VC 3VQWA 1L0NH 4AI8A 4LF4B 4FMTA 1A32A 4ZHQB 3RW0A 4ZHQA 5CA3A 1CXZB 1FPOA 2DYRB 5K1PA 2JEUA 4UV8A 4X65B 3ABTA 3SPJA 4D7TA 4I9QA 4PDMA 4JI5O 3EXAA 1PP9H 2OYQA 4GT1A 1JA8A 4O4JB 1JJOA 4WF9V 3JCUZ 1MG1A 4YJ3B 4EB6B 1AP5A 2ZIMA 4EB6A 4O2AA 2L6LA 3D8CA 4B3RO 3ABMC 3JAWB 5KAIZ 2A9HA 3H1JH 3OR7C 1ZAUA 3CCSV 4JI1B 4HYOA 4DR6B 2ZDIA 2EINB 2EZPA 5IJ0B 1KD1W 2FKXA 2Q7EA 3VQVA 5JWPA 1KUQA 4DW1A 1M57B 3OT7A 1AI7A 1KBHA 4X1YB 1Q81W 4KFMA 3OMNB 3K5OA 3UT5B 2YI9A 1RM1B 2WPDG 3CXHF 4AILC 1VARA 1HNZO 3CJHB 5TISZ 3CJHA 3ZMUA 3E86A 5DN6G 1MMMA 1FJGO 3QO8A 4JI5B 1IXMA 2OWOA 3ZJZA 1OCRB 3VQYA 3CRAA 3N2GA 4BW9A 1XNRO 3WB0A 4WFFA 1DK1A 4F6RB 4JYCA 1MZFA 1O9GA 4F6RA 3THOA 5BXZA 4NTXA 1NTKH 4B3RB 2QEXV 1V54C 4XDKA 4DXWA 1BGYH 3IGAC 5KHKA 2QWNB 1AROP 1XNQO 4CC6A 1Z5VA 4UV9A 3F7YC 3RN4A 4J7JA 1PL4A 1H8HG 3QO7A 1WJZA 1YIJV 2E75B 3QF7A 4LF9O 1LUVA 1HNZB 4J42A 1FJGB 3CPWU 1VF7A 2DE0X 4LWSB 4H44B 2AHYA 5LHHA 1WB7A 4Z2WA 1ZSPA 2KKWA 1XNRB 4H37A 3SJQC 1VQ8V 1SESA 1I0HA 1RP3B 4GX0A 4E4EA 4P2ZA 2Y48A 4W4LA 3A8TA 2ZIOA 2HHHO 4TWKA 1R6NA 3MHSC 4DRXA 1F51A 4UCOA 4J9ZB 4JASA 2IBZH 3ZBHA 2CGNA 1XNQB 1GM7A 3SPHA 3K03A 4PHZA 3BA8A 4JTCB 1QNMA 3GWKC 2X6BA 2QSAA 3OUFA 3CXCU 1NR1A 1IBKO 1YDXA 4ZKIA 3RWRD 3JD2A 2LFSA 4FLUA 2AGAA 2Z3YA 1SQBH 4EFBA 1PNMA 3H1LH 2JVDA 2HJDA 3N2KA 4NKGB 5LMNO 5LA6A 1NU1H 3R66A 5DM6V 5JQGB 2PUSA 1R3JC 5JQGA 1Q6HA 2XAFA 5FL7G 4FFBB 3CRCA 5CA0A 4J80A 1IBLO 2Q8VA 5EYPB 2ZCEA 2AZ2A 4PA6A 3IAYA 5EC2C 5KA6A 2HHHB 3EHBB 1M9NA 2LQTA 4GX1A 4JTAB 2YIDA 3MHHC 1CP9A 2XUMA 2CUGA 1MA1A 1H2LA 4QE9A 5E1AC 2A7WA 4FFKA 1R3KC 3K04A 3SYPA 3J7AU 1S0VA 3RYFB 1Q86W 1IBKB 4PA4A 4IHJB 5CBHA 1I7FA 3CCVV 5CB4B 2ZT9B 4LFAO 2UUBO 5CBGA 5CB4A 5LP6A 4KHPO 4I0XA 2BOCC 2M7WA 1AI5A 4OPAA 5KLVH 5LOVA 1S3JA 2WLIB 2WLIA 1CPYA 3LSUA 3D36A 3STZC 2WLMA 4DV4O 4PD4F 4WFAV 1Z5WA 3OUSA 3OEEG 5HFMA 4FM0A 3ZX6A 1N36B 1T5EA 1WLEA 2Z5UA 4HNAA 1URFA 3E8GA 5H6RA 4BIUA 4OX9O 3N27A 4K3AA 4EKWA 1IBLB 3LUTB 2IJIA 2PYLA 3LDDA 1YEWA 1B3QA 3K79A 4R6ZA 3WB1A 4O4LA 2CH7B 1WN7A 2CH7A 1OCZB 3KCYA 4FM1A 3ICXA 3M7MX 2R70A 1WA8A 3M99B 2LP7A 3L74H 2H94A 5LL6Y 1EM1A 3D3QA 4LFAB 2UUBB 2XAQA 2GUZB 2HLDG 4KHPB 3SJCC 2GUZA 5GTIZ 3ZHUA 1BL8A 1XQ8A 1KMIZ 2D2CB 3CCQV 2RJZA 2DWDC 4A5UB 3B8MA 2EIJB 2YS8A 1BCCH 4TUYB 4DV1O 2GBOA 4DV4B 4B3SO 1FXKC 3QO5A 1I5XA 1VQ6V 3L75H 1R3LC 2Q68A 2ZE6A 4OX9B 2HEPA 3ETQA 4U7NA 1FYJA 2IJJA 1KU9A 4DV2O 5KA5A 5DEDA 5L3GA 5J2UA 2F43G 5J2TB 4FLZA 4O2BB 1YJWV 1S72V 3WU2Z 2HVJC 2EINC 1S76D 4O2BA 3JD4A 4WFGA 1MABG 4NXNO 3FB8C 1YITV 1SZTA 1GK9A 4LNUA 3CSXA 2QWQB 4LR3A 1J95A 3ZRSA 2ZINA 3APOA 3HKBB 4H13B 3OMAB 1S5HC 3E8HA 5CA1B 1MOFA 3X2QB 3JSLA 4MT8A 3ZMSA 2UXDB 2NNUA 2R9AA 4NYKA 4PDLA 4ZOLB 1R6KA 4DV1B 2ZQMA 4X89A 2KB1A 4YIOA 4B3SB 2E74B 1GO3F 2DN9A 5C8YB 1SZXA 5D5QA 1MSWD 4JYBA 1HWYA 4DV2B 4BR6A 5IYDO 2DOSA 5K1XA 1N33B 2Y0PA 4FZ1A 2OTJV 1M56B 3MAQA 2QA4V 1Q90D 4O4HB 4X1IB 4IT5A 2EILC 4MVZA 4F6EA 3FB7C 3JASA 2BSKB 2QM8A 3AG7A 4NXNB 4PA3A 4QE7A 1YTFD 1COWG 1RFYA 3JALA 1XDCA 1DGSA 3H1IH 1SETA 1AR4A 3JATA 2PY5A 3CCJV 2P5OA 2EIKB 1R6TA 2LO1A 3SPCA 3TGUH 2Y4TA 3Q4HB 1HP8A 2YICA 1QHTA 4UCSA 3K59A 5EC1C 2KG7A 1NQTA 4IYHA 4P9OA 5B5EZ 5FPRA 3ZMZA 3A0HZ 2FB5A 2FMLA 4DR1O 3K9AA 2JRIA 3CD6V 3WFVA 4CS4A 3JYCA 5ITZB 3B40A 3BABA 2PF4E 4FJCC 1DTOA 5A9GA 1K92A 4ZI7B 1KC8W 4CC5A 5LMUO 1NR7A 3GVMA 2DMXA 2ZE8A 5L3EA 3LNMB 2A0LA 2MK3A 1HNXO 2IH3C 4MTOA 5EZYA 2GV9A 5FNVB 3HKDA 1SERA 1I08A 5KUMA 4E2LA 4DYLA 4X20B 5LXTA 1AILA 5LGNA 4H0LB 3E89A 3W7WA 1PV0A 3K0GA 1Y67A 2UUCO 3CP1A 2JJ1G 3FKSG 4PA7A 1K4CC 3RVZA 4NR1A 4TSFG 1WP7A 3WG7C 5B3SB 4DO2A 4P9PA 5DECA 3AG4C 4DR1B 2QE7G 2GTAA 4WBNB 4L87A 2IM9A 5L3CA 1FFXA 3IC7A 4R8CA 1FXHA 2PI5A 1AR5A 5LMUB 5H9CA 1G1XB 2YSUB 3CC4V 4MTGA 4U3FH 3T4ZA 2Q5ZA 3QVNA 3DSQA 5IY5B 1HNXB 3R65A 1EN5A 3ZRVA 4KL1A 3OD4A 1Y76A 4YY3O 1MSDA 2YDEA 4RQFA 1XL4A 4O2AB 2EX3A 3CE2A 3ZHQA 1G6UA 1NI8A 1IDSA 1YF2A 3L9DA 1AP6A 4PI2A 5KMGB 1OCOC 2F93B 1VQPV 2UUCB 5KMGA 1K34A 4DR2O 3E35A 3G6EV 1S77D 3ABLB 1FXKA 2A79B 3JD0A 2ZR3A 1TGOA 4KP4A 2GSMB 4GKJO 4QIWF 2XHBA 1GAXA 1N32O 2EIMB 1VQ5V 3B8NA 1W0JG 3CX5F 1F23A 5BMVB 2HKOA 4HAMA 5BMVA 1UFIA 3RBZA 1THZA 4AQYB 1EBOA 1XHXA 1R73A 3SPIA 5LGUA 3A0RA 3CYOA 3ZMVA 3CWBH 1RSOA 5GONB 3A0BZ 5GONA 1IURA 2UUAO 4C7UA 2UU9B 4K35A 4CH5A 4W4KA 3N2GB 2WLKA 2YUAA 2KQXA 4YY3B 1VQ7V 4LF7O 2M6YA 3LSSA 3O65A 1SQXH 2YEVA 1NTMH 1GM8A 4J9YB 1YHQV 5IWAB 4B3MO 3T1HO 4NXMO 2IU3A 2GHYA 1XL6A 4DR2B 1BQZA 2XAHA 2B1IA 3F5WC 5JH7B 3FB6C 5JH7A 3L72H 1QLEB 2RCVA 2ARHA 2EJ7A 2JGDB 4GKJB 2JGDA 1TA8A 3CC7V 1N32B 2AZ0A 3E8BA 2QM4A 1SQPH 2E76B 4D7SA 4NB5A 2DYSC 2ZXWB 3I56V 5C93A 3ASOB 3ABKC 2JJ2G 1K97A 2A06H 2L35A 3G6BA 4K8ZA 1IXBA 4IIJB 2UUAB 4IIJA 4MSWC 3STLC 1Y4MA 3PN1A 1V55B 2BCCH 2P22C 2ZR2A 2JIZG 4H33A 3CC2V 1AJNA 2Q7HA 4LF7B 1NT2B 4JPRA 2W6JG 3SJAC 3T4DA 3G71V 3ZN1A 3ASNC 4JZ2A 1EZVH 4I7ZB 1Q3EA 3W7SA 4LH7A 3JD1A 2W0XA 3ZHVA 4DRXB 1VQLV 4B3MB 3T1HB 4NXMB 3K9SA 1EZJA 5LGTA 3QG5A 5KHHA 4EEQA 1AJPA 1XUQA 3ZCCA 4J7KA 3OE7G 4R50A 4RUFA 1RPRA 4YJ2A 1TAEA 1M56C 2B1GA 4F4LA 1LNQA 1K4DC 5JCOA 3AG2B 1VF6A 3OEHG 3N2KB 1JJ2U 5LA6B 3AG3B 4I5SA 1YZBA 4JI4B 2DWEC 4ICGA 3BAAA 1GH6A 2CTRA 1JX9A 5B1AB 1KKDA 3SGIA 1P7BA 4DV5O 1N36O 1OZ0A 1Q7YW 1ORQC 2Q6AA 5CA0B 5L3DA 1IX9A 2BTOA 3IC9A 4ZIBA 1EFRG 1R1BA 1SKVA 1WP8A 1DF4A 4PJ0Z 2DQ0A 3AG1B 2EJRA 2IJKA 2IJHA 2JS3A 4FLTA 5JVDB 2YXLA 1O9HA 4JAAA 5JVDA 3HKEA 5KHIA 3BRCA 5EBLC 1ZL8A 5EIBC 1OCCC 2YI8A 2Y69C 3RT3C 1KYOF 5LYJA 4QPJA 4I4TA 4X64B 3RVYA 2VQFO 5LP6B 1LR1A 1B06A 2JDIG 2YXYA 4I0XB 5B1BB 2VS0A 1H38A 1PKXA 4LCUC 3CEIA 2LGWA 2W6IG 4FK5C 3TJTA 2ITDC 4DUYO 5LOVB 3FYIB 3VBBA 3E22A 3UO3A 1H8EG 2DW4A 2K9PA 3H9VA 2PYJA 4B7EA 4OGQB 3F5TA 1OJHA 1AJQA 1GN4A 4DV5B 4HNAB 2LJ2A 1K5QA 1BT8A 2ADPA 2A3QA 3DXRA 4K8XA 1PM9A 1YJ9V 2QTOA 3CHXA 5BY1A 3C90A 3JARA 4O4LB 3BY6A 4IGGA 1M93A 1TVKA 1XMOO 3G4SV 3ABMB 2Z0AA 3UQ8A 2WSSG 2P4KA 1WA8B 3P3NA 4J10A 4RQEA 2RNBA 3CRQA 1VQOV 3T2MA 2RDCA 2F95B 1FD9A 2Q7GA 2VQFB 5H6QA 1NKDA 3K3WA 2JGUA 2QWRB 3S3WA 2OIGA 2CAZC 2DYRC 2QWOB 3CS5A 4DUYB 1JMKC 2Q9LA 4XDLA 3EVKA 1I94O 2UXDO 1PPJH 1PD3A 4CS3A 1JFFA 1ZUQA 4PA9A 3FD9A 3MDSA 2ZE5A 4MVOA 4BW5A 2WAMA 1SQGA 4Q6GA 1Q5OA 3ZEDA 2CK3G 5KAFZ 4B3TB 1YCIA 5J2UB 3ZHTA 1N33O 1D5NA 1ZX3A 4G28B 5L3FA 2X6AA 3CCRV 1XMOB 1SF9A 1V54B 3K0DA 3SYAA 2WA3A 1M57C 2LFRA 2RQ6A 4JTDB 4LNUB 2HJFC 3KKYA 1KECA 4PDVA 1KQSU 5GTHZ 4UXNA 2XOKG 5BR8O 4FPPA 4U3JA 1RM1C 3ZIAG 3ZRXA 1NJIW 3LSQA 4MS2A 1YTFB 3A2FA 1I94B 1W2BU 2YC0A 2JEXA 2VQEO 3VOUA 1OCRC 2QWPB 3AK2A 5H2FZ 4KUMA 2AW9A 4GX2A 2VWKA 2PTMA 5IYBO 2QKAA 3RYHA 2XNDG 2P67A 3LDEA 1GN3A 4LH6A 1K9MW 4EFEA 1OHHG 4PDRA 4QNHB 2BTQA 1AVMA 3LNNA 3JASB 2HFEC 1JR9A 5EBWC 3CMAV 1E1RG 3FB5C 2HG5C 3JALB 2GTSA 3IFXA 3BPZA 4WCEV 4UUJC 1KP2A 2WLLA 1F4MA 1DLBA 5IDJA 2P90A 3DTUB 1G4YB 2YIBA 5BR8B 3JATB 5GW7A 1YI2V 2CGOA 1R3IC 4UCTA 3E83A 1NVPD 1AB3A 3ZRWA 3TETA 3FX7A 2VQEB 1GRJA 4YIPA 1FFTB 2KG7B 3U10A 2CE4A 4LFCO 3CCEV 1GN6A 4U7OA 3GWOA 3PJSK 1ZWIC 1Q8IA 3C3TA 1AR1B 2YIBD 1SRYA 2PZSA 3W7UA 5CMUA 1L8DA 1MZEA 1F7YA 1VEWA 4DR3B 2RN9A 4CH6A 4TV8B 1PNKA 2R72A 2P6JA 4TV8A 4YXWG 3BEHA 5IJ9A 3OAAG 1ZTEA 5EZYB 3HKDB 3E8FA 4BIZA 4BWAA 1EN4A 1SQVH 2ZM6O 4UB6Z 4LP8A 5EBMC 3S3XA 1M90W 1Y74A 3T1YO 3GB7C 5LXTB 1XHZA 2ETNA 4JI7B 5B1AC 5AG2A 4XBFA 1GN2A 1JVMA 2OCCB 4X66O 2ZNIA 4K0KO 5LHGA 2X0LA 3SYCA 1SA0B 4LFCB 1SA0A 5B66Z 3HKCA 3H1HH 1SS3A 2E3CA 1X4TA 4Z1MG 1N8RW 1GKFA 4LF6O 1XREA 3O9OA 1XEQA 1SQFA 1YSCA 2PGGA 3K5NA 4I50A 1AI6A 1FFXB 3SYOA 1QVFU 3ETGA 2GDSA 4JYAO 1Y66A 4AQYO 1MNGA 3DC5A 2IW5A 3J80N 1XOUA 1X59A 4JGSA 2WWWA 1WPXA 2LW1A 3HPLC 3OMIB 3MD0A 3P32A 5IYZB 3QNEA 1WNSA 4I9WA 4JAVA 4MTXA 5IYZA 2UU9O 1VF5B 2ILMA 2DJVA 2ZM6B 2H3OA 1Y76B 3T1YB 4LF8O 4UVCA 5JJEB 4FLXA 2JK5C 3D36C 4JI0O 2PI4A 2Q4PA 4JI2O 4X66B 5IWAO 4X88A 4K0KB 4LFBO 5B1NA 3OGCC 3L71H 4LBEC 1Q6IA 4PELA 2V1DA 3L70H 1HR0O 2F23A 4O4JA 1FXKB 1GTOA 4YJ3A 1Q43A 1VQ4V 4LF6B 1IBMO 3ABUA 1US6A 1OCZC 2QDOA 2W0FC 2OTLV 2HP8A 3UM7A 3JAWA 4DR5O 1XI1A 1DF5A 2X6CA 2WLJA 1M1KW 4JYAB 3CMEV 4JI8O 3BA9A 3BCCH 4OXSA 1RSOB 5IJ0A 4TQDA 3B2EE 3SYQA 4O4IB 4QPKA 1QLNA 4RO2A 4O4IA 4MTFA 1VQMV 2Q67A 2R9IA 3ZMTA 4PI0A 4X1YA 3JAMN 3SDLA 2AHZA 1VP7A 4FLWA 2V4DA 1BS3A 1P4RA 1JPXA 4FVMA 4LF8B 3UT5A 2EIJC 2BOBC 2YEVB 1QVGU 4JI0B 4X9QA 3B77A 4DV7O 4ZBMA 4G27B 1W59A 4JI2B 4LFBB 1GMGA 4YHHO 4CH4A 3W7TA 2XAJA 3ZS8C 1I5YA 1FKAO 1HR0B 3E2EA 1YVWA 4OPHA 1IZ3A 4NTYA 4WFHA 3BFRA 1K73W 3APQA 1S5JA 1IBMB 1K33A 2P7TC 4MW3A 3IJ4A 2BE3A 3FAVB 4DR5B 3FAVA 3ZN0A 4GLXA 4BIOA 4JI8B 4MVMA 2EILB 1VQ9V 4JI4O 1HDJA 4JV5O 1F4NA 4UVAA 2CDYA 4X1KB 4X1KA 5KUKA 4DK0A 4DV0O 5B1OA 4UCUA 1KP3A 2XAGA 3B09A 3X2QC 5KX5B 5KX5A 2UXNA 5BZBA 4TOIA 1SQQH 4DV7B 3HR0A 4FLVA 4DR7O 1H2KA 3ETEA 3K08A 4YHHB 2QTSA 4QGPA 4LWSA 4GYCB 4ABMA 1M5IA 1VQNV 4LC1A 1BE3H 3OR6C 1P84F 4YJ2B 4B7KA 1OV9A 3LDCA 2CTQA 4X62O 4X64O 4GKKO 3CB2A 3UO2A 2LGQA 3SR2C 2QR4A 2ADQB 2YXHA 1E79G 1EN6A 3OGIB 1N0NA 5E79Z 3EFFK 4FM2A 3AEIA 4FLYA 4JV5B 1K3EA 1TUBB 4WFEA 1TUBA 4HZ3A 1IVSA 4IL6Z 4JI6O 2EZOA 4DV0B 3CRRA 3P3PA 1K8AW 1NZ6A 1FAFA 2EIKC 1KB9F 4UB8Z 1ENVA 4NVPA 4LF9B 1NTZH 3I55V 3CCMV 2XT9A 3CRMA 4FIPC 1QBZA 2OT5A 3JD3A 1VMGA 2AXTZ 2N74A 4DR7B 1YXBA 3G67A 2RMKB 3HKEB 4FFBA 4R7CA 4DR4O 1ZL8B 3U11A 1S5LZ 1N34O 1WAZA 1FXVA 3WG7B 5EYPA 5LYJB 4I4TB 4X62B 4Q20A 3HB3B 2K1EA 4GKKB 3AG4B 1FS0G 4CBCA 4BAYA 3JCZA 3OFNG 2QJ1A 1WB8A 1Y6XA 4HBNA 3E22B 4J41A 2E5LO 2DQ3A 1ZLZA 4AHCA 2EULA 4PV1B 2OCHA 3RGBA 4IYIA 3RYFA 4IHJA 1J5EO 5FLXN 4JI6B 3TCUA 5LBQA 2UXCO 3QTCA 3DXRB 2ATKC 5L3BA 4JZGA 5LMNB 2OCCC 3W7XA 4B3TO 3JARB 1CEZA 1Z2GA 3FYEB 4N23A 4UCRA 2Q73A 2NLJC 1P7GA
chains in the Genus database with same CATH topology
1E1RG 3FB5C 5IY5B 2HG5C 5HFLA 5B3SC 3CPWU 1OCOB 2AHYA 5LHHA 3IFXA 4CZZA 3R65A 4XDJA 4WCEV 4UUJC 3ZRVA 1KP2A 2WLLA 1F4MA 1DLBA 5IDJA 4H37A 2P90A 5CN0A 3SJQC 2WLHA 3DTUB 1VQ8V 1G4YB 1SESA 4GX0A 3TK1A 5GW7A 1YI2V 4RQFA 1XL4A 1AI4A 4P2ZA 2Y48A 1R3IC 3OW2U 3E83A 1NVPD 5IY5C 4TWKA 1R6NA 3MHSC 1F51A 3ZRWA 1VQPV 3TETA 1OCOC 1W0KG 4J9ZB 1K34A 4JASA 4ASUG 1GM7A 3D3IA 3K03A 3SPHA 3E35A 3K06A 1FFTB 4JTCB 1ROPA 2X6BA 3G6EV 1S77D 3ABLB 1FXKA 2A79B 3JD0A 1NR1A 2ZR3A 3OUFA 3CXCU 3CCEV 4U7OA 4ZKIA 4KP4A 3GWOA 2GSMB 3DGEA 4QIWF 3JD2A 3PJSK 1ZWIC 2LFSA 1AR1B 2EIMB 1VQ5V 3B8NA 1W0JG 2Z3YA 1F23A 1PNMA 1SRYA 3W7UA 2HKOA 5CMUA 4HAMA 1L1FA 3RBZA 5DM6V 2UXXA 1THZA 1EBOA 2ZDIC 1R73A 3SPIA 1PNKA 5LGUA 1R3JC 3A0RA 3ABLC 3CYOA 2P6JA 3ZMVA 4YXWG 2XAFA 3BEHA 5FL7G 1JOYA 3OAAG 2EIMC 2EBOA 2WLKA 3E8FA 4BIZA 3UKMA 3ML0A 1PNLA 1VQ7V 5EBMC 4LP8A 1M90W 3LSSA 3GB7C 4PA6A 5EC2C 1E1QG 2YEVA 5KA6A 1GM8A 2HVKC 2QM7A 4J9YB 1YHQV 3ETDA 3EHBB 1M9NA 4GX1A 5B1AC 4JTAB 3MHHC 4XBFA 2IU3A 1CP9A 1JVMA 2OCCB 2GHYA 1NH2B 1XL6A 4QE9A 5E1AC 5LHGA 2XAHA 2X0LA 2B1IA 3SYCA 2DYSB 3F5WC 1R3KC 3K04A 3SYPA 1BMFG 1S0VA 3CCUV 1Q86W 3ABKB 3FB6C 4PA4A 5CBHA 1QLEB 3CCVV 4MVUA 4Z1MG 1N8RW 1GKFA 5CBGA 3CC7V 1JCHA 3E8BA 2BOCC 2M7WA 3OM3B 1YSCA 1AI5A 1H2GA 1AI6A 5IYCO 1NVPB 3KG2A 3SYOA 1QVFU 3ETGA 3ASNB 1S3JA 2WLIB 2DYSC 2ZXWB 4X8AA 3I56V 2WLIA 1CPYA 2D3OW 5C93A 5CBFA 3D36A 1Y66A 3STZC 3ASOB 2IW5A 2WLMA 3ABKC 2JJ2G 4WFAV 5HFMA 1QLEC 1K97A 3OEEG 3OUSA 1NH2D 1WLEA 2Z5UA 4JGSA 2WWWA 4MW8A 1WPXA 3E8GA 4MSWC 3HPLC 3OMIB 1Y4MA 5H6RA 2C2AA 3MD0A 3P32A 3STLC 1V55B 4BIUA 3QNEA 4I9WA 4JAVA 2WLLB 4MTXA 3SPGA 4EKWA 2ZR2A 2JIZG 4H33A 3LUTB 3CC2V 1AJNA 4GX5A 2IJIA 4JPRA 1GM9A 2W6JG 3T4DA 3G71V 3ZN1A 3ASNC 4UVCA 3LDDA 2ZXWC 2JK5C 2QKSA 1K7DA 3K79A 4R6ZA 3P30A 3W7SA 3JD1A 3ASOC 1RPOA 2PI4A 1VQLV 1OCZB 1EZJA 3ZRWB 1QCEA 4X88A 5LGTA 5J9PC 5B1NA 4JF3A 3OGCC 1QR9A 4LBEC 1V55C 3M99B 2XASA 2LP7A 4PELA 2V1DA 1JQ0A 1AJPA 3ZCCA 1UJWB 2H94A 3CCLV 1FXKB 1GTOA 3OE7G 4R50A 4RUFA 1RPRA 1M56C 2B1GA 4F4LA 3NXSA 1LNQA 1VQ4V 2XAQA 1K4DC 2HLDG 2IH1C 3AG2B 2Q69A 3ABUA 1Q82W 4MVRA 2ZD9A 1B6QA 1OCZC 2W0FC 2OTLV 3UM7A 3OEHG 1BL8A 1G8MA 4RAIA 1JJ2U 2X7RB 1DF5A 3CCQV 2X6CA 2DWDC 2B5UA 4G2KA 3B8MA 2EIJB 2HR3A 2WLJA 3AG3B 4I5SA 1M1KW 2DWEC 2R9RB 3CMEV 1TUEB 4RUEA 2IU0A 4OXSA 4MVSA 1FXKC 3QO5A 1JX9A 5B1AB 1KKDA 4QJFB 1I5XA 1VQ6V 3SYQA 1P7BA 1R3LC 4MVQA 2Q68A 4QPKA 1QLNA 4RO2A 4N21A 1OZ0A 4MTFA 3AG2C 2Q67A 2R9IA 3ZMTA 4U7NA 1VQMV 1Q7YW 1ORQC 1BHAA 2Q6AA 1OCCB 2IJJA 1YJNV 2AHZA 5L3DA 5KA5A 2Y69B 1P4RA 1JPXA 5L3GA 2F43G 1VQKV 1EFRG 2EIJC 3AG3C 2BOBC 1YJWV 1S72V 2HVJC 2EINC 2YEVB 1QVGU 1S76D 4P30A 3JD4A 4WFGA 1DF4A 3B77A 2DQ0A 3AG1B 2EJRA 2IJKA 1MABG 2WLNA 4G27B 2IJHA 3FB8C 4UVBA 4ZBMA 1GMGA 1QR8A 1PL0A 3W7TA 2XAJA 5EBLC 1YITV 1SZTA 1GK9A 1I5YA 1OCCC 3E2EA 4WFHA 2Y69C 3H01A 1J95A 1K73W 3ZRSA 4QPJA 3RVYA 3OMAB 2ITCC 2JDIG 1S5HC 3E8HA 4JAUA 1K33A 1K5SA 2P7TC 4MW3A 3AG1C 5B1BB 4TT3G 1H38A 4WFBV 1PKXA 4LCUC 1MOFA 2W6IG 4FK5C 3X2QB 2ITDC 4MT8A 3ZN0A 3FYIB 3ZMSA 1BHBA 3VBBA 2NNUA 2FTKA 4PDLA 1R6KA 4MVMA 2ZQMA 2EILB 4X89A 1VQ9V 1H8EG 2DW4A 2KB1A 5EK0A 1F4NA 4GCZA 1AJQA 1GO3F 4UVAA 3T1CA 2V7QG 2H8PC 1MSWD 1K5QA 4JYBA 5KUKA 1HWYA 5B1BC 5B1OA 1KP3A 1NBMG 5LHIA 2XAGA 5IYDO 1YJ9V 2QTOA 3X2QC 3F7VC 2OTJV 4FMTA 1M56B 2QA4V 3RW0A 2EILC 4MVZA 2UXNA 3FB7C 5BZBA 2QM8A 3BY6A 5CA3A 4PA3A 4QE7A 2DYRB 1YTFD 3G4SV 3ETEA 2JEUA 3K08A 4UV8A 3ABMB 3ABTA 1COWG 3SPJA 2WSSG 4PDMA 4RQEA 4GT1A 1VQNV 4LC1A 4WF9V 1VQOV 3OR6C 1SETA 1MG1A 3T2MA 3LDCA 5H6QA 1NKDA 3K3WA 3CCJV 2EIKB 3SPCA 2DYRC 3ABMC 2A9HA 3OR7C 1E79G 4XDLA 3CCSV 4HYOA 5EC1C 2ZDIA 2EINB 2EZPA 1NQTA 3EFFK 3AEIA 1PD3A 1K3EA 1KD1W 4P9OA 4PA9A 4WFEA 4MVOA 4BW5A 3ZMZA 1M57B 4HZ3A 2WAMA 2EZOA 1AI7A 1K8AW 3K9AA 2CK3G 2EIKC 3CD6V 3WFVA 1Q81W 3JYCA 4KFMA 3OMNB 1ENVA 4FJCC 1DTOA 3I55V 1K92A 3CCMV 1KC8W 1RM1B 2WPDG 4FIPC 1NR7A 1QBZA 4G28B 5L3FA 2X6AA 2OT5A 3CCRV 3JD3A 3ZMUA 3E86A 5DN6G 5L3EA 1V54B 3LNMB 3K0DA 3QO8A 3SYAA 2A0LA 1M57C 2MK3A 1IXMA 4R7CA 2LFRA 4JTDB 3ZJZA 2HJFC 1OCRB 2IH3C 4MTOA 1KECA 4PDVA 1SERA 1KQSU 5KUMA 4E2LA 1FXVA 4UXNA 3WG7B 4WFFA 2XOKG 4FPPA 4JYCA 1RM1C 3ZIAG 4Q20A 3HB3B 3ZRXA 2K1EA 5LGNA 3AG4B 1NJIW 1FS0G 4CBCA 3E89A 3W7WA 4BAYA 3JCZA 3LSQA 3OFNG 3K0GA 4MS2A 2QEXV 1YTFB 1V54C 4XDKA 4DXWA 3IGAC 1W2BU 2DQ3A 1AROP 2JJ1G 3CP1A 3FKSG 2JEXA 4PA7A 1K4CC 3VOUA 1OCRC 3RVZA 4KUMA 4GX2A 4TSFG 5IYBO 3WG7C 5B3SB 4DO2A 4UV9A 4P9PA 2XNDG 2P67A 3LDEA 3TCUA 3AG4C 3F7YC 5LBQA 1H8HG 2ATKC 3QO7A 2QE7G 5L3BA 4L87A 1K9MW 2OCCC 1OHHG 5L3CA 3W7XA 3IC7A 1YIJV 4R8CA 1FXHA 4PDRA 4QNHB 2PI5A 5H9CA 1CEZA 2YSUB 3CC4V 3FYEB 4N23A 4MTGA 2HFEC 3T4ZA 2NLJC 5EBWC 3CMAV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB5 C;  3SPC A;  2AHZ A;  2DYR C;  3FB6 C;  2HG5 C;  4PA4 A;  3ABM C;  5B3S C;  5CBH A;  2A9H A;  3OR7 C;  4XDL A;  4MVU A;  2AHY A;  2EIJ C;  3AG3 C;  2BOB C;  4HYO A;  5CBG A;  3IFX A;  2HVJ C;  2EIN C;  3R65 A;  3E8B A;  4P30 A;  5EC1 C;  4WFG A;  4XDJ A;  4UUJ C;  2BOC C;  2WLL A;  3EFF K;  4H37 A;  2WLN A;  4G27 B;  4ZBM A;  3FB8 C;  2WLH A;  4P9O A;  3SJQ C;  1G4Y B;  4PA9 A;  4GX0 A;  3KG2 A;  3SYO A;  4WFE A;  4MVO A;  4BW5 A;  1XL4 A;  2WLI B;  4HZ3 A;  2DYS C;  4P2Z A;  4X8A A;  2WLI A;  1R3I C;  5EBL C;  5CBF A;  3E83 A;  1OCC C;  2EIK C;  3STZ C;  3JYC A;  5IY5 C;  4KFM A;  2WLM A;  3ABK C;  4TWK A;  4WFH A;  2Y69 C;  1J95 A;  1QLE C;  3OUS A;  3ZRS A;  1OCO C;  3TET A;  4J9Z B;  4MW8 A;  5EBW C;  3RVY A;  3E8G A;  4MSW C;  3HPL C;  3K03 A;  2ITC C;  3SPH A;  1S5H C;  3STL C;  3E8H A;  3K06 A;  2P7T C;  4MW3 A;  3AG1 C;  4I9W A;  2WLL B;  4G28 B;  4JTC B;  2X6A A;  3SPG A;  4EKW A;  2X6B A;  4H33 A;  3LUT B;  4GX5 A;  3E86 A;  3OUF A;  2A79 B;  4LCU C;  2ITD C;  3T4D A;  3LNM B;  3ASN C;  3K0D A;  3SYA A;  2A0L A;  1M57 C;  3LDD A;  2ZXW C;  2JK5 C;  2QKS A;  4PDL A;  4R7C A;  3PJS K;  1ZWI C;  4JTD B;  4MVM A;  4X89 A;  4R6Z A;  3ZJZ A;  2HJF C;  2KB1 A;  2IH3 C;  4MTO A;  3ASO C;  4PDV A;  5EK0 A;  5KUM A;  4X88 A;  4WFF A;  5J9P C;  3T1C A;  3OGC C;  2H8P C;  4LBE C;  3RBZ A;  2K1E A;  1V55 C;  4CBC A;  5KUK A;  3E89 A;  5B1B C;  3SYP A;  3SPI A;  1R3J C;  3ABL C;  3K0G A;  4MS2 A;  4R50 A;  2QTO A;  3BEH A;  4RUF A;  3F7V C;  3X2Q C;  1V54 C;  4XDK A;  1M56 C;  4DXW A;  4F4L A;  3IGA C;  1LNQ A;  4PA7 A;  1K4D C;  2IH1 C;  1K4C C;  3RW0 A;  2EIL C;  2EIM C;  4MVZ A;  3VOU A;  1OCR C;  2Q69 A;  3FB7 C;  3RVZ A;  5BZB A;  4MVR A;  2WLK A;  3E8F A;  2ZD9 A;  4GX2 A;  1OCZ C;  2W0F C;  4PA3 A;  4QE7 A;  3UKM A;  3UM7 A;  1BL8 A;  3K08 A;  3WG7 C;  4RAI A;  5EBM C;  4LP8 A;  3SPJ A;  2X6C A;  4P9P A;  3GB7 C;  3LDE A;  2DWD C;  4PA6 A;  3TCU A;  2WLJ A;  3AG4 C;  3F7Y C;  5EC2 C;  4PDM A;  2YEV A;  2DWE C;  2R9R B;  2HVK C;  4J9Y B;  2ATK C;  4RUE A;  4OXS A;  4MVS A;  4GX1 A;  5B1A C;  4JTA B;  2OCC C;  3OR6 C;  1KKD A;  3T2M A;  4R8C A;  1JVM A;  4PDR A;  3SYQ A;  4QNH B;  1P7B A;  1R3L C;  4MVQ A;  1XL6 A;  2Q68 A;  3LDC A;  4QE9 A;  5E1A C;  4RO2 A;  4MTF A;  3SYC A;  3AG2 C;  2Q67 A;  4MTG A;  2HFE C;  3F5W C;  1ORQ C;  2NLJ C;  3T4Z A;  2Q6A A;  1R3K C;  3K04 A; 
#chains in the Genus database with same CATH topology
 1TVK B;  1H2N A;  2B9Z A;  5HFL A;  5B3S C;  1XBL A;  1OCO B;  3NR7 A;  4DR4 B;  5JJJ B;  4CZZ A;  1XMQ O;  2VWJ A;  4XDJ A;  1N34 B;  2XTA A;  5CN0 A;  2WLH A;  3TK1 A;  5IE9 A;  1AI4 A;  3OW2 U;  3M8A A;  4JI3 O;  5IY5 C;  1U97 A;  1W0K G;  2E5L B;  4ASU G;  3D3I A;  1VIB A;  1BSM A;  2JS5 A;  3K06 A;  4DV3 O;  1ROP A;  4GZR B;  1JFF B;  4NTW A;  1J5E B;  3RFR A;  3OTO O;  3DGE A;  3J81 N;  2UXC B;  2WA4 A;  2F66 C;  2QKC A;  1P49 A;  2UXB O;  2LW7 A;  1L1F A;  2UXX A;  1XIL A;  2ZDI C;  5A2Q N;  4TUY A;  3TXQ A;  3ABL C;  1Q6U A;  2ZKO A;  4L8J A;  1XMQ B;  1JOY A;  1H2M A;  2EIM C;  4FZ0 A;  2EBO A;  3UKM A;  3ML0 A;  1PNL A;  2FYU H;  2MW2 B;  1HW7 A;  4U3J B;  1M4U A;  2Y4U A;  3JAK B;  5J2T A;  2P06 A;  1E1Q G;  3JAK A;  1WPB A;  5KHJ A;  2HVK C;  2QM7 A;  4JI3 B;  4J11 A;  3ETD A;  4J7Z A;  4LF5 O;  3OTF A;  1B04 A;  1NH2 B;  3BHP A;  5FPO A;  4DV3 B;  2DYS B;  1QQC A;  1N4C A;  5F2V O;  5KHG A;  1BMF G;  3CCU V;  3ZHR A;  3ABK B;  1SC5 B;  3U0Z A;  3RYH B;  3OTO B;  3HKB A;  4MVU A;  3WB2 A;  3TXS A;  1JCH A;  3OM3 B;  1H2G A;  4CH3 A;  5IYC O;  1NVP B;  5CA1 A;  2UXB B;  3KG2 A;  2BTQ B;  4UFZ A;  1V9P A;  3ASN B;  4X8A A;  4ZOL A;  4DR3 O;  2D3O W;  4D6T H;  5CBF A;  2CTW A;  4DW0 A;  2G38 A;  2N05 A;  1QLE C;  5C8Y A;  1NH2 D;  3H1K H;  4MW8 A;  4DV6 O;  3L73 H;  4B08 A;  1BQ0 A;  3B4S A;  2C2A A;  3SPG A;  2WLL B;  1LUW A;  4GX5 A;  1GM9 A;  3RYC B;  4TQF A;  3RYC A;  2ZXW C;  2QKS A;  1QU7 A;  4O4H A;  4X1I A;  1K7D A;  3C3S A;  2BSK A;  3P30 A;  3ASO C;  1RPO A;  4LF5 B;  2N04 A;  4JI7 O;  1UPG A;  1BZK A;  2VRZ A;  3ZRW B;  1QCE A;  4I55 B;  5J9P C;  4JF3 A;  4I55 A;  1QR9 A;  4TV9 B;  1V55 C;  2XAS A;  3ZHS A;  4TV9 A;  1JQ0 A;  1UJW B;  3CCL V;  1HNW O;  1L0L H;  4JYY A;  3SJB C;  2Q0O C;  1U96 A;  3NXS A;  4DUZ O;  2IH1 C;  2Q69 A;  1Q82 W;  4CS2 A;  4MVR A;  2Q0A A;  2ZD9 A;  3FFQ A;  1B6Q A;  3G80 A;  4KXR A;  5IT9 N;  3JSN A;  3VQX A;  1G8M A;  4RAI A;  3I5D A;  2X7R B;  2OIE A;  3Q4H A;  3K5M A;  1D2D A;  2FL4 A;  1NS1 A;  2B5U A;  4G2K A;  2HR3 A;  2R9R B;  1TUE B;  4RUE A;  2IU0 A;  4MVS A;  2CTP A;  2F4V O;  4QJF B;  4DV6 B;  3KZI Z;  4MVQ A;  5JCO C;  5IJ9 B;  3KCX A;  4N21 A;  3AG2 C;  1BHA A;  1VF6 C;  1OCC B;  1YJN V;  5ITZ A;  2Y69 B;  2QGN A;  2ODM A;  1Y74 B;  1VQK V;  4ZI7 A;  3AG3 C;  4LF4 O;  2F1M A;  4P30 A;  2WLN A;  4GUN A;  4UVB A;  1QR8 A;  3AK3 A;  4X65 O;  1PL0 A;  3UCS C;  5JJN B;  5D5P A;  2P4V A;  3BVO A;  2YIA A;  3HKC B;  1HNW B;  5FNV A;  3RYI B;  2NR5 A;  3H01 A;  3RYI A;  4X20 A;  4DUZ B;  2ITC C;  4JAU A;  1K5S A;  2NN4 A;  2ZNJ A;  5EIB D;  3AG1 C;  4TT3 G;  4WFB V;  4I50 B;  1D5A A;  3K58 A;  3AK1 A;  4UCV A;  1BHB A;  2KSD A;  2FTK A;  4JI1 O;  1H2S B;  2Y0I A;  4Z1V A;  4DK1 A;  4DR6 O;  3K57 A;  2F4V B;  5EK0 A;  3K5L A;  1KKC A;  4GCZ A;  5H5N A;  3T1C A;  2V7Q G;  2H8P C;  5LP6 C;  1N0J A;  5B1B C;  2ZE7 A;  3DC6 A;  4WBN A;  1NBM G;  5LHI A;  4RWU A;  2O57 A;  3F7V C;  3VQW A;  1L0N H;  4AI8 A;  4LF4 B;  4FMT A;  1A32 A;  4ZHQ B;  3RW0 A;  4ZHQ A;  5CA3 A;  1CXZ B;  1FPO A;  2DYR B;  5K1P A;  2JEU A;  4UV8 A;  4X65 B;  3ABT A;  3SPJ A;  4D7T A;  4I9Q A;  4PDM A;  4JI5 O;  3EXA A;  1PP9 H;  2OYQ A;  4GT1 A;  1JA8 A;  4O4J B;  1JJO A;  4WF9 V;  3JCU Z;  1MG1 A;  4YJ3 B;  4EB6 B;  1AP5 A;  2ZIM A;  4EB6 A;  4O2A A;  2L6L A;  3D8C A;  4B3R O;  3ABM C;  3JAW B;  5KAI Z;  2A9H A;  3H1J H;  3OR7 C;  1ZAU A;  3CCS V;  4JI1 B;  4HYO A;  4DR6 B;  2ZDI A;  2EIN B;  2EZP A;  5IJ0 B;  1KD1 W;  2FKX A;  2Q7E A;  3VQV A;  5JWP A;  1KUQ A;  4DW1 A;  1M57 B;  3OT7 A;  1AI7 A;  1KBH A;  4X1Y B;  1Q81 W;  4KFM A;  3OMN B;  3K5O A;  3UT5 B;  2YI9 A;  1RM1 B;  2WPD G;  3CXH F;  4AIL C;  1VAR A;  1HNZ O;  3CJH B;  5TIS Z;  3CJH A;  3ZMU A;  3E86 A;  5DN6 G;  1MMM A;  1FJG O;  3QO8 A;  4JI5 B;  1IXM A;  2OWO A;  3ZJZ A;  1OCR B;  3VQY A;  3CRA A;  3N2G A;  4BW9 A;  1XNR O;  3WB0 A;  4WFF A;  1DK1 A;  4F6R B;  4JYC A;  1MZF A;  1O9G A;  4F6R A;  3THO A;  5BXZ A;  4NTX A;  1NTK H;  4B3R B;  2QEX V;  1V54 C;  4XDK A;  4DXW A;  1BGY H;  3IGA C;  5KHK A;  2QWN B;  1ARO P;  1XNQ O;  4CC6 A;  1Z5V A;  4UV9 A;  3F7Y C;  3RN4 A;  4J7J A;  1PL4 A;  1H8H G;  3QO7 A;  1WJZ A;  1YIJ V;  2E75 B;  3QF7 A;  4LF9 O;  1LUV A;  1HNZ B;  4J42 A;  1FJG B;  3CPW U;  1VF7 A;  2DE0 X;  4LWS B;  4H44 B;  2AHY A;  5LHH A;  1WB7 A;  4Z2W A;  1ZSP A;  2KKW A;  1XNR B;  4H37 A;  3SJQ C;  1VQ8 V;  1SES A;  1I0H A;  1RP3 B;  4GX0 A;  4E4E A;  4P2Z A;  2Y48 A;  4W4L A;  3A8T A;  2ZIO A;  2HHH O;  4TWK A;  1R6N A;  3MHS C;  4DRX A;  1F51 A;  4UCO A;  4J9Z B;  4JAS A;  2IBZ H;  3ZBH A;  2CGN A;  1XNQ B;  1GM7 A;  3SPH A;  3K03 A;  4PHZ A;  3BA8 A;  4JTC B;  1QNM A;  3GWK C;  2X6B A;  2QSA A;  3OUF A;  3CXC U;  1NR1 A;  1IBK O;  1YDX A;  4ZKI A;  3RWR D;  3JD2 A;  2LFS A;  4FLU A;  2AGA A;  2Z3Y A;  1SQB H;  4EFB A;  1PNM A;  3H1L H;  2JVD A;  2HJD A;  3N2K A;  4NKG B;  5LMN O;  5LA6 A;  1NU1 H;  3R66 A;  5DM6 V;  5JQG B;  2PUS A;  1R3J C;  5JQG A;  1Q6H A;  2XAF A;  5FL7 G;  4FFB B;  3CRC A;  5CA0 A;  4J80 A;  1IBL O;  2Q8V A;  5EYP B;  2ZCE A;  2AZ2 A;  4PA6 A;  3IAY A;  5EC2 C;  5KA6 A;  2HHH B;  3EHB B;  1M9N A;  2LQT A;  4GX1 A;  4JTA B;  2YID A;  3MHH C;  1CP9 A;  2XUM A;  2CUG A;  1MA1 A;  1H2L A;  4QE9 A;  5E1A C;  2A7W A;  4FFK A;  1R3K C;  3K04 A;  3SYP A;  3J7A U;  1S0V A;  3RYF B;  1Q86 W;  1IBK B;  4PA4 A;  4IHJ B;  5CBH A;  1I7F A;  3CCV V;  5CB4 B;  2ZT9 B;  4LFA O;  2UUB O;  5CBG A;  5CB4 A;  5LP6 A;  4KHP O;  4I0X A;  2BOC C;  2M7W A;  1AI5 A;  4OPA A;  5KLV H;  5LOV A;  1S3J A;  2WLI B;  2WLI A;  1CPY A;  3LSU A;  3D36 A;  3STZ C;  2WLM A;  4DV4 O;  4PD4 F;  4WFA V;  1Z5W A;  3OUS A;  3OEE G;  5HFM A;  4FM0 A;  3ZX6 A;  1N36 B;  1T5E A;  1WLE A;  2Z5U A;  4HNA A;  1URF A;  3E8G A;  5H6R A;  4BIU A;  4OX9 O;  3N27 A;  4K3A A;  4EKW A;  1IBL B;  3LUT B;  2IJI A;  2PYL A;  3LDD A;  1YEW A;  1B3Q A;  3K79 A;  4R6Z A;  3WB1 A;  4O4L A;  2CH7 B;  1WN7 A;  2CH7 A;  1OCZ B;  3KCY A;  4FM1 A;  3ICX A;  3M7M X;  2R70 A;  1WA8 A;  3M99 B;  2LP7 A;  3L74 H;  2H94 A;  5LL6 Y;  1EM1 A;  3D3Q A;  4LFA B;  2UUB B;  2XAQ A;  2GUZ B;  2HLD G;  4KHP B;  3SJC C;  2GUZ A;  5GTI Z;  3ZHU A;  1BL8 A;  1XQ8 A;  1KMI Z;  2D2C B;  3CCQ V;  2RJZ A;  2DWD C;  4A5U B;  3B8M A;  2EIJ B;  2YS8 A;  1BCC H;  4TUY B;  4DV1 O;  2GBO A;  4DV4 B;  4B3S O;  1FXK C;  3QO5 A;  1I5X A;  1VQ6 V;  3L75 H;  1R3L C;  2Q68 A;  2ZE6 A;  4OX9 B;  2HEP A;  3ETQ A;  4U7N A;  1FYJ A;  2IJJ A;  1KU9 A;  4DV2 O;  5KA5 A;  5DED A;  5L3G A;  5J2U A;  2F43 G;  5J2T B;  4FLZ A;  4O2B B;  1YJW V;  1S72 V;  3WU2 Z;  2HVJ C;  2EIN C;  1S76 D;  4O2B A;  3JD4 A;  4WFG A;  1MAB G;  4NXN O;  3FB8 C;  1YIT V;  1SZT A;  1GK9 A;  4LNU A;  3CSX A;  2QWQ B;  4LR3 A;  1J95 A;  3ZRS A;  2ZIN A;  3APO A;  3HKB B;  4H13 B;  3OMA B;  1S5H C;  3E8H A;  5CA1 B;  1MOF A;  3X2Q B;  3JSL A;  4MT8 A;  3ZMS A;  2UXD B;  2NNU A;  2R9A A;  4NYK A;  4PDL A;  4ZOL B;  1R6K A;  4DV1 B;  2ZQM A;  4X89 A;  2KB1 A;  4YIO A;  4B3S B;  2E74 B;  1GO3 F;  2DN9 A;  5C8Y B;  1SZX A;  5D5Q A;  1MSW D;  4JYB A;  1HWY A;  4DV2 B;  4BR6 A;  5IYD O;  2DOS A;  5K1X A;  1N33 B;  2Y0P A;  4FZ1 A;  2OTJ V;  1M56 B;  3MAQ A;  2QA4 V;  1Q90 D;  4O4H B;  4X1I B;  4IT5 A;  2EIL C;  4MVZ A;  4F6E A;  3FB7 C;  3JAS A;  2BSK B;  2QM8 A;  3AG7 A;  4NXN B;  4PA3 A;  4QE7 A;  1YTF D;  1COW G;  1RFY A;  3JAL A;  1XDC A;  1DGS A;  3H1I H;  1SET A;  1AR4 A;  3JAT A;  2PY5 A;  3CCJ V;  2P5O A;  2EIK B;  1R6T A;  2LO1 A;  3SPC A;  3TGU H;  2Y4T A;  3Q4H B;  1HP8 A;  2YIC A;  1QHT A;  4UCS A;  3K59 A;  5EC1 C;  2KG7 A;  1NQT A;  4IYH A;  4P9O A;  5B5E Z;  5FPR A;  3ZMZ A;  3A0H Z;  2FB5 A;  2FML A;  4DR1 O;  3K9A A;  2JRI A;  3CD6 V;  3WFV A;  4CS4 A;  3JYC A;  5ITZ B;  3B40 A;  3BAB A;  2PF4 E;  4FJC C;  1DTO A;  5A9G A;  1K92 A;  4ZI7 B;  1KC8 W;  4CC5 A;  5LMU O;  1NR7 A;  3GVM A;  2DMX A;  2ZE8 A;  5L3E A;  3LNM B;  2A0L A;  2MK3 A;  1HNX O;  2IH3 C;  4MTO A;  5EZY A;  2GV9 A;  5FNV B;  3HKD A;  1SER A;  1I08 A;  5KUM A;  4E2L A;  4DYL A;  4X20 B;  5LXT A;  1AIL A;  5LGN A;  4H0L B;  3E89 A;  3W7W A;  1PV0 A;  3K0G A;  1Y67 A;  2UUC O;  3CP1 A;  2JJ1 G;  3FKS G;  4PA7 A;  1K4C C;  3RVZ A;  4NR1 A;  4TSF G;  1WP7 A;  3WG7 C;  5B3S B;  4DO2 A;  4P9P A;  5DEC A;  3AG4 C;  4DR1 B;  2QE7 G;  2GTA A;  4WBN B;  4L87 A;  2IM9 A;  5L3C A;  1FFX A;  3IC7 A;  4R8C A;  1FXH A;  2PI5 A;  1AR5 A;  5LMU B;  5H9C A;  1G1X B;  2YSU B;  3CC4 V;  4MTG A;  4U3F H;  3T4Z A;  2Q5Z A;  3QVN A;  3DSQ A;  5IY5 B;  1HNX B;  3R65 A;  1EN5 A;  3ZRV A;  4KL1 A;  3OD4 A;  1Y76 A;  4YY3 O;  1MSD A;  2YDE A;  4RQF A;  1XL4 A;  4O2A B;  2EX3 A;  3CE2 A;  3ZHQ A;  1G6U A;  1NI8 A;  1IDS A;  1YF2 A;  3L9D A;  1AP6 A;  4PI2 A;  5KMG B;  1OCO C;  2F93 B;  1VQP V;  2UUC B;  5KMG A;  1K34 A;  4DR2 O;  3E35 A;  3G6E V;  1S77 D;  3ABL B;  1FXK A;  2A79 B;  3JD0 A;  2ZR3 A;  1TGO A;  4KP4 A;  2GSM B;  4GKJ O;  4QIW F;  2XHB A;  1GAX A;  1N32 O;  2EIM B;  1VQ5 V;  3B8N A;  1W0J G;  3CX5 F;  1F23 A;  5BMV B;  2HKO A;  4HAM A;  5BMV A;  1UFI A;  3RBZ A;  1THZ A;  4AQY B;  1EBO A;  1XHX A;  1R73 A;  3SPI A;  5LGU A;  3A0R A;  3CYO A;  3ZMV A;  3CWB H;  1RSO A;  5GON B;  3A0B Z;  5GON A;  1IUR A;  2UUA O;  4C7U A;  2UU9 B;  4K35 A;  4CH5 A;  4W4K A;  3N2G B;  2WLK A;  2YUA A;  2KQX A;  4YY3 B;  1VQ7 V;  4LF7 O;  2M6Y A;  3LSS A;  3O65 A;  1SQX H;  2YEV A;  1NTM H;  1GM8 A;  4J9Y B;  1YHQ V;  5IWA B;  4B3M O;  3T1H O;  4NXM O;  2IU3 A;  2GHY A;  1XL6 A;  4DR2 B;  1BQZ A;  2XAH A;  2B1I A;  3F5W C;  5JH7 B;  3FB6 C;  5JH7 A;  3L72 H;  1QLE B;  2RCV A;  2ARH A;  2EJ7 A;  2JGD B;  4GKJ B;  2JGD A;  1TA8 A;  3CC7 V;  1N32 B;  2AZ0 A;  3E8B A;  2QM4 A;  1SQP H;  2E76 B;  4D7S A;  4NB5 A;  2DYS C;  2ZXW B;  3I56 V;  5C93 A;  3ASO B;  3ABK C;  2JJ2 G;  1K97 A;  2A06 H;  2L35 A;  3G6B A;  4K8Z A;  1IXB A;  4IIJ B;  2UUA B;  4IIJ A;  4MSW C;  3STL C;  1Y4M A;  3PN1 A;  1V55 B;  2BCC H;  2P22 C;  2ZR2 A;  2JIZ G;  4H33 A;  3CC2 V;  1AJN A;  2Q7H A;  4LF7 B;  1NT2 B;  4JPR A;  2W6J G;  3SJA C;  3T4D A;  3G71 V;  3ZN1 A;  3ASN C;  4JZ2 A;  1EZV H;  4I7Z B;  1Q3E A;  3W7S A;  4LH7 A;  3JD1 A;  2W0X A;  3ZHV A;  4DRX B;  1VQL V;  4B3M B;  3T1H B;  4NXM B;  3K9S A;  1EZJ A;  5LGT A;  3QG5 A;  5KHH A;  4EEQ A;  1AJP A;  1XUQ A;  3ZCC A;  4J7K A;  3OE7 G;  4R50 A;  4RUF A;  1RPR A;  4YJ2 A;  1TAE A;  1M56 C;  2B1G A;  4F4L A;  1LNQ A;  1K4D C;  5JCO A;  3AG2 B;  1VF6 A;  3OEH G;  3N2K B;  1JJ2 U;  5LA6 B;  3AG3 B;  4I5S A;  1YZB A;  4JI4 B;  2DWE C;  4ICG A;  3BAA A;  1GH6 A;  2CTR A;  1JX9 A;  5B1A B;  1KKD A;  3SGI A;  1P7B A;  4DV5 O;  1N36 O;  1OZ0 A;  1Q7Y W;  1ORQ C;  2Q6A A;  5CA0 B;  5L3D A;  1IX9 A;  2BTO A;  3IC9 A;  4ZIB A;  1EFR G;  1R1B A;  1SKV A;  1WP8 A;  1DF4 A;  4PJ0 Z;  2DQ0 A;  3AG1 B;  2EJR A;  2IJK A;  2IJH A;  2JS3 A;  4FLT A;  5JVD B;  2YXL A;  1O9H A;  4JAA A;  5JVD A;  3HKE A;  5KHI A;  3BRC A;  5EBL C;  1ZL8 A;  5EIB C;  1OCC C;  2YI8 A;  2Y69 C;  3RT3 C;  1KYO F;  5LYJ A;  4QPJ A;  4I4T A;  4X64 B;  3RVY A;  2VQF O;  5LP6 B;  1LR1 A;  1B06 A;  2JDI G;  2YXY A;  4I0X B;  5B1B B;  2VS0 A;  1H38 A;  1PKX A;  4LCU C;  3CEI A;  2LGW A;  2W6I G;  4FK5 C;  3TJT A;  2ITD C;  4DUY O;  5LOV B;  3FYI B;  3VBB A;  3E22 A;  3UO3 A;  1H8E G;  2DW4 A;  2K9P A;  3H9V A;  2PYJ A;  4B7E A;  4OGQ B;  3F5T A;  1OJH A;  1AJQ A;  1GN4 A;  4DV5 B;  4HNA B;  2LJ2 A;  1K5Q A;  1BT8 A;  2ADP A;  2A3Q A;  3DXR A;  4K8X A;  1PM9 A;  1YJ9 V;  2QTO A;  3CHX A;  5BY1 A;  3C90 A;  3JAR A;  4O4L B;  3BY6 A;  4IGG A;  1M93 A;  1TVK A;  1XMO O;  3G4S V;  3ABM B;  2Z0A A;  3UQ8 A;  2WSS G;  2P4K A;  1WA8 B;  3P3N A;  4J10 A;  4RQE A;  2RNB A;  3CRQ A;  1VQO V;  3T2M A;  2RDC A;  2F95 B;  1FD9 A;  2Q7G A;  2VQF B;  5H6Q A;  1NKD A;  3K3W A;  2JGU A;  2QWR B;  3S3W A;  2OIG A;  2CAZ C;  2DYR C;  2QWO B;  3CS5 A;  4DUY B;  1JMK C;  2Q9L A;  4XDL A;  3EVK A;  1I94 O;  2UXD O;  1PPJ H;  1PD3 A;  4CS3 A;  1JFF A;  1ZUQ A;  4PA9 A;  3FD9 A;  3MDS A;  2ZE5 A;  4MVO A;  4BW5 A;  2WAM A;  1SQG A;  4Q6G A;  1Q5O A;  3ZED A;  2CK3 G;  5KAF Z;  4B3T B;  1YCI A;  5J2U B;  3ZHT A;  1N33 O;  1D5N A;  1ZX3 A;  4G28 B;  5L3F A;  2X6A A;  3CCR V;  1XMO B;  1SF9 A;  1V54 B;  3K0D A;  3SYA A;  2WA3 A;  1M57 C;  2LFR A;  2RQ6 A;  4JTD B;  4LNU B;  2HJF C;  3KKY A;  1KEC A;  4PDV A;  1KQS U;  5GTH Z;  4UXN A;  2XOK G;  5BR8 O;  4FPP A;  4U3J A;  1RM1 C;  3ZIA G;  3ZRX A;  1NJI W;  3LSQ A;  4MS2 A;  1YTF B;  3A2F A;  1I94 B;  1W2B U;  2YC0 A;  2JEX A;  2VQE O;  3VOU A;  1OCR C;  2QWP B;  3AK2 A;  5H2F Z;  4KUM A;  2AW9 A;  4GX2 A;  2VWK A;  2PTM A;  5IYB O;  2QKA A;  3RYH A;  2XND G;  2P67 A;  3LDE A;  1GN3 A;  4LH6 A;  1K9M W;  4EFE A;  1OHH G;  4PDR A;  4QNH B;  2BTQ A;  1AVM A;  3LNN A;  3JAS B;  2HFE C;  1JR9 A;  5EBW C;  3CMA V;  1E1R G;  3FB5 C;  2HG5 C;  3JAL B;  2GTS A;  3IFX A;  3BPZ A;  4WCE V;  4UUJ C;  1KP2 A;  2WLL A;  1F4M A;  1DLB A;  5IDJ A;  2P90 A;  3DTU B;  1G4Y B;  2YIB A;  5BR8 B;  3JAT B;  5GW7 A;  1YI2 V;  2CGO A;  1R3I C;  4UCT A;  3E83 A;  1NVP D;  1AB3 A;  3ZRW A;  3TET A;  3FX7 A;  2VQE B;  1GRJ A;  4YIP A;  1FFT B;  2KG7 B;  3U10 A;  2CE4 A;  4LFC O;  3CCE V;  1GN6 A;  4U7O A;  3GWO A;  3PJS K;  1ZWI C;  1Q8I A;  3C3T A;  1AR1 B;  2YIB D;  1SRY A;  2PZS A;  3W7U A;  5CMU A;  1L8D A;  1MZE A;  1F7Y A;  1VEW A;  4DR3 B;  2RN9 A;  4CH6 A;  4TV8 B;  1PNK A;  2R72 A;  2P6J A;  4TV8 A;  4YXW G;  3BEH A;  5IJ9 A;  3OAA G;  1ZTE A;  5EZY B;  3HKD B;  3E8F A;  4BIZ A;  4BWA A;  1EN4 A;  1SQV H;  2ZM6 O;  4UB6 Z;  4LP8 A;  5EBM C;  3S3X A;  1M90 W;  1Y74 A;  3T1Y O;  3GB7 C;  5LXT B;  1XHZ A;  2ETN A;  4JI7 B;  5B1A C;  5AG2 A;  4XBF A;  1GN2 A;  1JVM A;  2OCC B;  4X66 O;  2ZNI A;  4K0K O;  5LHG A;  2X0L A;  3SYC A;  1SA0 B;  4LFC B;  1SA0 A;  5B66 Z;  3HKC A;  3H1H H;  1SS3 A;  2E3C A;  1X4T A;  4Z1M G;  1N8R W;  1GKF A;  4LF6 O;  1XRE A;  3O9O A;  1XEQ A;  1SQF A;  1YSC A;  2PGG A;  3K5N A;  4I50 A;  1AI6 A;  1FFX B;  3SYO A;  1QVF U;  3ETG A;  2GDS A;  4JYA O;  1Y66 A;  4AQY O;  1MNG A;  3DC5 A;  2IW5 A;  3J80 N;  1XOU A;  1X59 A;  4JGS A;  2WWW A;  1WPX A;  2LW1 A;  3HPL C;  3OMI B;  3MD0 A;  3P32 A;  5IYZ B;  3QNE A;  1WNS A;  4I9W A;  4JAV A;  4MTX A;  5IYZ A;  2UU9 O;  1VF5 B;  2ILM A;  2DJV A;  2ZM6 B;  2H3O A;  1Y76 B;  3T1Y B;  4LF8 O;  4UVC A;  5JJE B;  4FLX A;  2JK5 C;  3D36 C;  4JI0 O;  2PI4 A;  2Q4P A;  4JI2 O;  4X66 B;  5IWA O;  4X88 A;  4K0K B;  4LFB O;  5B1N A;  3OGC C;  3L71 H;  4LBE C;  1Q6I A;  4PEL A;  2V1D A;  3L70 H;  1HR0 O;  2F23 A;  4O4J A;  1FXK B;  1GTO A;  4YJ3 A;  1Q43 A;  1VQ4 V;  4LF6 B;  1IBM O;  3ABU A;  1US6 A;  1OCZ C;  2QDO A;  2W0F C;  2OTL V;  2HP8 A;  3UM7 A;  3JAW A;  4DR5 O;  1XI1 A;  1DF5 A;  2X6C A;  2WLJ A;  1M1K W;  4JYA B;  3CME V;  4JI8 O;  3BA9 A;  3BCC H;  4OXS A;  1RSO B;  5IJ0 A;  4TQD A;  3B2E E;  3SYQ A;  4O4I B;  4QPK A;  1QLN A;  4RO2 A;  4O4I A;  4MTF A;  1VQM V;  2Q67 A;  2R9I A;  3ZMT A;  4PI0 A;  4X1Y A;  3JAM N;  3SDL A;  2AHZ A;  1VP7 A;  4FLW A;  2V4D A;  1BS3 A;  1P4R A;  1JPX A;  4FVM A;  4LF8 B;  3UT5 A;  2EIJ C;  2BOB C;  2YEV B;  1QVG U;  4JI0 B;  4X9Q A;  3B77 A;  4DV7 O;  4ZBM A;  4G27 B;  1W59 A;  4JI2 B;  4LFB B;  1GMG A;  4YHH O;  4CH4 A;  3W7T A;  2XAJ A;  3ZS8 C;  1I5Y A;  1FKA O;  1HR0 B;  3E2E A;  1YVW A;  4OPH A;  1IZ3 A;  4NTY A;  4WFH A;  3BFR A;  1K73 W;  3APQ A;  1S5J A;  1IBM B;  1K33 A;  2P7T C;  4MW3 A;  3IJ4 A;  2BE3 A;  3FAV B;  4DR5 B;  3FAV A;  3ZN0 A;  4GLX A;  4BIO A;  4JI8 B;  4MVM A;  2EIL B;  1VQ9 V;  4JI4 O;  1HDJ A;  4JV5 O;  1F4N A;  4UVA A;  2CDY A;  4X1K B;  4X1K A;  5KUK A;  4DK0 A;  4DV0 O;  5B1O A;  4UCU A;  1KP3 A;  2XAG A;  3B09 A;  3X2Q C;  5KX5 B;  5KX5 A;  2UXN A;  5BZB A;  4TOI A;  1SQQ H;  4DV7 B;  3HR0 A;  4FLV A;  4DR7 O;  1H2K A;  3ETE A;  3K08 A;  4YHH B;  2QTS A;  4QGP A;  4LWS A;  4GYC B;  4ABM A;  1M5I A;  1VQN V;  4LC1 A;  1BE3 H;  3OR6 C;  1P84 F;  4YJ2 B;  4B7K A;  1OV9 A;  3LDC A;  2CTQ A;  4X62 O;  4X64 O;  4GKK O;  3CB2 A;  3UO2 A;  2LGQ A;  3SR2 C;  2QR4 A;  2ADQ B;  2YXH A;  1E79 G;  1EN6 A;  3OGI B;  1N0N A;  5E79 Z;  3EFF K;  4FM2 A;  3AEI A;  4FLY A;  4JV5 B;  1K3E A;  1TUB B;  4WFE A;  1TUB A;  4HZ3 A;  1IVS A;  4IL6 Z;  4JI6 O;  2EZO A;  4DV0 B;  3CRR A;  3P3P A;  1K8A W;  1NZ6 A;  1FAF A;  2EIK C;  1KB9 F;  4UB8 Z;  1ENV A;  4NVP A;  4LF9 B;  1NTZ H;  3I55 V;  3CCM V;  2XT9 A;  3CRM A;  4FIP C;  1QBZ A;  2OT5 A;  3JD3 A;  1VMG A;  2AXT Z;  2N74 A;  4DR7 B;  1YXB A;  3G67 A;  2RMK B;  3HKE B;  4FFB A;  4R7C A;  4DR4 O;  1ZL8 B;  3U11 A;  1S5L Z;  1N34 O;  1WAZ A;  1FXV A;  3WG7 B;  5EYP A;  5LYJ B;  4I4T B;  4X62 B;  4Q20 A;  3HB3 B;  2K1E A;  4GKK B;  3AG4 B;  1FS0 G;  4CBC A;  4BAY A;  3JCZ A;  3OFN G;  2QJ1 A;  1WB8 A;  1Y6X A;  4HBN A;  3E22 B;  4J41 A;  2E5L O;  2DQ3 A;  1ZLZ A;  4AHC A;  2EUL A;  4PV1 B;  2OCH A;  3RGB A;  4IYI A;  3RYF A;  4IHJ A;  1J5E O;  5FLX N;  4JI6 B;  3TCU A;  5LBQ A;  2UXC O;  3QTC A;  3DXR B;  2ATK C;  5L3B A;  4JZG A;  5LMN B;  2OCC C;  3W7X A;  4B3T O;  3JAR B;  1CEZ A;  1Z2G A;  3FYE B;  4N23 A;  4UCR A;  2Q73 A;  2NLJ C;  1P7G A; 
#chains in the Genus database with same CATH homology
 1E1R G;  3FB5 C;  5IY5 B;  2HG5 C;  5HFL A;  5B3S C;  3CPW U;  1OCO B;  2AHY A;  5LHH A;  3IFX A;  4CZZ A;  3R65 A;  4XDJ A;  4WCE V;  4UUJ C;  3ZRV A;  1KP2 A;  2WLL A;  1F4M A;  1DLB A;  5IDJ A;  4H37 A;  2P90 A;  5CN0 A;  3SJQ C;  2WLH A;  3DTU B;  1VQ8 V;  1G4Y B;  1SES A;  4GX0 A;  3TK1 A;  5GW7 A;  1YI2 V;  4RQF A;  1XL4 A;  1AI4 A;  4P2Z A;  2Y48 A;  1R3I C;  3OW2 U;  3E83 A;  1NVP D;  5IY5 C;  4TWK A;  1R6N A;  3MHS C;  1F51 A;  3ZRW A;  1VQP V;  3TET A;  1OCO C;  1W0K G;  4J9Z B;  1K34 A;  4JAS A;  4ASU G;  1GM7 A;  3D3I A;  3K03 A;  3SPH A;  3E35 A;  3K06 A;  1FFT B;  4JTC B;  1ROP A;  2X6B A;  3G6E V;  1S77 D;  3ABL B;  1FXK A;  2A79 B;  3JD0 A;  1NR1 A;  2ZR3 A;  3OUF A;  3CXC U;  3CCE V;  4U7O A;  4ZKI A;  4KP4 A;  3GWO A;  2GSM B;  3DGE A;  4QIW F;  3JD2 A;  3PJS K;  1ZWI C;  2LFS A;  1AR1 B;  2EIM B;  1VQ5 V;  3B8N A;  1W0J G;  2Z3Y A;  1F23 A;  1PNM A;  1SRY A;  3W7U A;  2HKO A;  5CMU A;  4HAM A;  1L1F A;  3RBZ A;  5DM6 V;  2UXX A;  1THZ A;  1EBO A;  2ZDI C;  1R73 A;  3SPI A;  1PNK A;  5LGU A;  1R3J C;  3A0R A;  3ABL C;  3CYO A;  2P6J A;  3ZMV A;  4YXW G;  2XAF A;  3BEH A;  5FL7 G;  1JOY A;  3OAA G;  2EIM C;  2EBO A;  2WLK A;  3E8F A;  4BIZ A;  3UKM A;  3ML0 A;  1PNL A;  1VQ7 V;  5EBM C;  4LP8 A;  1M90 W;  3LSS A;  3GB7 C;  4PA6 A;  5EC2 C;  1E1Q G;  2YEV A;  5KA6 A;  1GM8 A;  2HVK C;  2QM7 A;  4J9Y B;  1YHQ V;  3ETD A;  3EHB B;  1M9N A;  4GX1 A;  5B1A C;  4JTA B;  3MHH C;  4XBF A;  2IU3 A;  1CP9 A;  1JVM A;  2OCC B;  2GHY A;  1NH2 B;  1XL6 A;  4QE9 A;  5E1A C;  5LHG A;  2XAH A;  2X0L A;  2B1I A;  3SYC A;  2DYS B;  3F5W C;  1R3K C;  3K04 A;  3SYP A;  1BMF G;  1S0V A;  3CCU V;  1Q86 W;  3ABK B;  3FB6 C;  4PA4 A;  5CBH A;  1QLE B;  3CCV V;  4MVU A;  4Z1M G;  1N8R W;  1GKF A;  5CBG A;  3CC7 V;  1JCH A;  3E8B A;  2BOC C;  2M7W A;  3OM3 B;  1YSC A;  1AI5 A;  1H2G A;  1AI6 A;  5IYC O;  1NVP B;  3KG2 A;  3SYO A;  1QVF U;  3ETG A;  3ASN B;  1S3J A;  2WLI B;  2DYS C;  2ZXW B;  4X8A A;  3I56 V;  2WLI A;  1CPY A;  2D3O W;  5C93 A;  5CBF A;  3D36 A;  1Y66 A;  3STZ C;  3ASO B;  2IW5 A;  2WLM A;  3ABK C;  2JJ2 G;  4WFA V;  5HFM A;  1QLE C;  1K97 A;  3OEE G;  3OUS A;  1NH2 D;  1WLE A;  2Z5U A;  4JGS A;  2WWW A;  4MW8 A;  1WPX A;  3E8G A;  4MSW C;  3HPL C;  3OMI B;  1Y4M A;  5H6R A;  2C2A A;  3MD0 A;  3P32 A;  3STL C;  1V55 B;  4BIU A;  3QNE A;  4I9W A;  4JAV A;  2WLL B;  4MTX A;  3SPG A;  4EKW A;  2ZR2 A;  2JIZ G;  4H33 A;  3LUT B;  3CC2 V;  1AJN A;  4GX5 A;  2IJI A;  4JPR A;  1GM9 A;  2W6J G;  3T4D A;  3G71 V;  3ZN1 A;  3ASN C;  4UVC A;  3LDD A;  2ZXW C;  2JK5 C;  2QKS A;  1K7D A;  3K79 A;  4R6Z A;  3P30 A;  3W7S A;  3JD1 A;  3ASO C;  1RPO A;  2PI4 A;  1VQL V;  1OCZ B;  1EZJ A;  3ZRW B;  1QCE A;  4X88 A;  5LGT A;  5J9P C;  5B1N A;  4JF3 A;  3OGC C;  1QR9 A;  4LBE C;  1V55 C;  3M99 B;  2XAS A;  2LP7 A;  4PEL A;  2V1D A;  1JQ0 A;  1AJP A;  3ZCC A;  1UJW B;  2H94 A;  3CCL V;  1FXK B;  1GTO A;  3OE7 G;  4R50 A;  4RUF A;  1RPR A;  1M56 C;  2B1G A;  4F4L A;  3NXS A;  1LNQ A;  1VQ4 V;  2XAQ A;  1K4D C;  2HLD G;  2IH1 C;  3AG2 B;  2Q69 A;  3ABU A;  1Q82 W;  4MVR A;  2ZD9 A;  1B6Q A;  1OCZ C;  2W0F C;  2OTL V;  3UM7 A;  3OEH G;  1BL8 A;  1G8M A;  4RAI A;  1JJ2 U;  2X7R B;  1DF5 A;  3CCQ V;  2X6C A;  2DWD C;  2B5U A;  4G2K A;  3B8M A;  2EIJ B;  2HR3 A;  2WLJ A;  3AG3 B;  4I5S A;  1M1K W;  2DWE C;  2R9R B;  3CME V;  1TUE B;  4RUE A;  2IU0 A;  4OXS A;  4MVS A;  1FXK C;  3QO5 A;  1JX9 A;  5B1A B;  1KKD A;  4QJF B;  1I5X A;  1VQ6 V;  3SYQ A;  1P7B A;  1R3L C;  4MVQ A;  2Q68 A;  4QPK A;  1QLN A;  4RO2 A;  4N21 A;  1OZ0 A;  4MTF A;  3AG2 C;  2Q67 A;  2R9I A;  3ZMT A;  4U7N A;  1VQM V;  1Q7Y W;  1ORQ C;  1BHA A;  2Q6A A;  1OCC B;  2IJJ A;  1YJN V;  2AHZ A;  5L3D A;  5KA5 A;  2Y69 B;  1P4R A;  1JPX A;  5L3G A;  2F43 G;  1VQK V;  1EFR G;  2EIJ C;  3AG3 C;  2BOB C;  1YJW V;  1S72 V;  2HVJ C;  2EIN C;  2YEV B;  1QVG U;  1S76 D;  4P30 A;  3JD4 A;  4WFG A;  1DF4 A;  3B77 A;  2DQ0 A;  3AG1 B;  2EJR A;  2IJK A;  1MAB G;  2WLN A;  4G27 B;  2IJH A;  3FB8 C;  4UVB A;  4ZBM A;  1GMG A;  1QR8 A;  1PL0 A;  3W7T A;  2XAJ A;  5EBL C;  1YIT V;  1SZT A;  1GK9 A;  1I5Y A;  1OCC C;  3E2E A;  4WFH A;  2Y69 C;  3H01 A;  1J95 A;  1K73 W;  3ZRS A;  4QPJ A;  3RVY A;  3OMA B;  2ITC C;  2JDI G;  1S5H C;  3E8H A;  4JAU A;  1K33 A;  1K5S A;  2P7T C;  4MW3 A;  3AG1 C;  5B1B B;  4TT3 G;  1H38 A;  4WFB V;  1PKX A;  4LCU C;  1MOF A;  2W6I G;  4FK5 C;  3X2Q B;  2ITD C;  4MT8 A;  3ZN0 A;  3FYI B;  3ZMS A;  1BHB A;  3VBB A;  2NNU A;  2FTK A;  4PDL A;  1R6K A;  4MVM A;  2ZQM A;  2EIL B;  4X89 A;  1VQ9 V;  1H8E G;  2DW4 A;  2KB1 A;  5EK0 A;  1F4N A;  4GCZ A;  1AJQ A;  1GO3 F;  4UVA A;  3T1C A;  2V7Q G;  2H8P C;  1MSW D;  1K5Q A;  4JYB A;  5KUK A;  1HWY A;  5B1B C;  5B1O A;  1KP3 A;  1NBM G;  5LHI A;  2XAG A;  5IYD O;  1YJ9 V;  2QTO A;  3X2Q C;  3F7V C;  2OTJ V;  4FMT A;  1M56 B;  2QA4 V;  3RW0 A;  2EIL C;  4MVZ A;  2UXN A;  3FB7 C;  5BZB A;  2QM8 A;  3BY6 A;  5CA3 A;  4PA3 A;  4QE7 A;  2DYR B;  1YTF D;  3G4S V;  3ETE A;  2JEU A;  3K08 A;  4UV8 A;  3ABM B;  3ABT A;  1COW G;  3SPJ A;  2WSS G;  4PDM A;  4RQE A;  4GT1 A;  1VQN V;  4LC1 A;  4WF9 V;  1VQO V;  3OR6 C;  1SET A;  1MG1 A;  3T2M A;  3LDC A;  5H6Q A;  1NKD A;  3K3W A;  3CCJ V;  2EIK B;  3SPC A;  2DYR C;  3ABM C;  2A9H A;  3OR7 C;  1E79 G;  4XDL A;  3CCS V;  4HYO A;  5EC1 C;  2ZDI A;  2EIN B;  2EZP A;  1NQT A;  3EFF K;  3AEI A;  1PD3 A;  1K3E A;  1KD1 W;  4P9O A;  4PA9 A;  4WFE A;  4MVO A;  4BW5 A;  3ZMZ A;  1M57 B;  4HZ3 A;  2WAM A;  2EZO A;  1AI7 A;  1K8A W;  3K9A A;  2CK3 G;  2EIK C;  3CD6 V;  3WFV A;  1Q81 W;  3JYC A;  4KFM A;  3OMN B;  1ENV A;  4FJC C;  1DTO A;  3I55 V;  1K92 A;  3CCM V;  1KC8 W;  1RM1 B;  2WPD G;  4FIP C;  1NR7 A;  1QBZ A;  4G28 B;  5L3F A;  2X6A A;  2OT5 A;  3CCR V;  3JD3 A;  3ZMU A;  3E86 A;  5DN6 G;  5L3E A;  1V54 B;  3LNM B;  3K0D A;  3QO8 A;  3SYA A;  2A0L A;  1M57 C;  2MK3 A;  1IXM A;  4R7C A;  2LFR A;  4JTD B;  3ZJZ A;  2HJF C;  1OCR B;  2IH3 C;  4MTO A;  1KEC A;  4PDV A;  1SER A;  1KQS U;  5KUM A;  4E2L A;  1FXV A;  4UXN A;  3WG7 B;  4WFF A;  2XOK G;  4FPP A;  4JYC A;  1RM1 C;  3ZIA G;  4Q20 A;  3HB3 B;  3ZRX A;  2K1E A;  5LGN A;  3AG4 B;  1NJI W;  1FS0 G;  4CBC A;  3E89 A;  3W7W A;  4BAY A;  3JCZ A;  3LSQ A;  3OFN G;  3K0G A;  4MS2 A;  2QEX V;  1YTF B;  1V54 C;  4XDK A;  4DXW A;  3IGA C;  1W2B U;  2DQ3 A;  1ARO P;  2JJ1 G;  3CP1 A;  3FKS G;  2JEX A;  4PA7 A;  1K4C C;  3VOU A;  1OCR C;  3RVZ A;  4KUM A;  4GX2 A;  4TSF G;  5IYB O;  3WG7 C;  5B3S B;  4DO2 A;  4UV9 A;  4P9P A;  2XND G;  2P67 A;  3LDE A;  3TCU A;  3AG4 C;  3F7Y C;  5LBQ A;  1H8H G;  2ATK C;  3QO7 A;  2QE7 G;  5L3B A;  4L87 A;  1K9M W;  2OCC C;  1OHH G;  5L3C A;  3W7X A;  3IC7 A;  1YIJ V;  4R8C A;  1FXH A;  4PDR A;  4QNH B;  2PI5 A;  5H9C A;  1CEZ A;  2YSU B;  3CC4 V;  3FYE B;  4N23 A;  4MTG A;  2HFE C;  3T4Z A;  2NLJ C;  5EBW C;  3CMA V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...