3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
3T2MA 4QE9A 3KG2A 2YEVA 5EC2C 3SYAA 5CBHA 1OCRC 3E8BA 3K08A 4HYOA 3AG4C 2AHZA 2WLMA 2W0FC 4LCUC 3ATBA 3K0GA 2P7TC 2Q6AA 2Q69A 2X6CA 2KB1A 3E8GA 1M56C 4JTCB 3PJSK 4WFFA 3SYCA 5CBGA 5CBFA 2WLNA 2ITCC 3RW0A 4MVUA 3ATEA 3K06A 2A0LA 4MTOA 1G4YB 2DWDC 2IH1C 3OR6C 4BW5A 3TCUA 3TETA 2EIMC 4GX5A 3ATDA 1JVMA 2EIJC 3JYCA 4MW8A 3SPHA 5EBWC 3SYOA 3ZRSA 3ABLC 4PA3A 4X8AA 3UKMA 4XDJA 4GX0A 3K6NA 4MTFA 3FB8C 2X6BA 2E4FA 4XDKA 3ZJZA 2DYSC 3BEHA 2BOBC 5B1BC 3SPIA 3ASNC 4MVRA 1R3LC 3IFXA 1P7BA 2WLLB 3AG3C 1ZWIC 2GIXA 2WLHA 4R7CA 5E1AC 3EFFK 3RBZA 4LP8A 4J9ZB 3SYPA 3VOUA 4P9OA 3UM7A 4WFHA 3SPJA 2HVJC 5EK0A 3T1CA 3HPLC 4RUEA 3T4DA 4RAIA 1XL4A 3IGAC 3OUFA 3VSQA 4R50A 4QE7A 3STLC 4X88A 3AG2C 3F7YC 5EC1C 2AHYA 4R6ZA 3SJQC 2Q67A 4PDMA 2DWEC 4CBCA 1KKDA 1R3JC 4J9YB 1ORQC 2ITDC 4G27B 1M57C 3E86A 4HZ3A 4H37A 1N9PA 1OCOC 3K03A 2DYRC 3STZC 3AT9A 3LDDA 3FB7C 3ATAA 4RO2A 4PA7A 3ABMC 3FB5C 4QNHB 3AT8A 4PA4A 4PA6A 3ATFA 3LDEA 3RVYA 4PA9A 1V54C 3AGWA 1K4CC 4P30A 4WFEA 2WLIB 2ZXWC 3OGCC 4LBEC 1J95A 3SPGA 3OR7C 4GX2A 4MVOA 4PDRA 4OXSA 3ASOC 3FB6C 4R8CA 4MVZA 5EBMC 2BOCC 2X6AA 3LDCA 4MVMA 4H33A 3SPCA 3WG7C 3X2QC 5BZBA 5KUKA 1U4EA 4JTDB 4RUFA 3AUWB 4PDLA 4DXWA 3GB7C 2NLJC 4G28B 4P9PA 2H8PC 5EBLC 3E89A 1BL8A 1OCCC 1QLEC 2A79B 2QTOA 2WLKA 1LNQA 4WFGA 2WLJA 5J9PC 3K04A 4I9WA 3T4ZA 3R65A 3F7VC 4JTAB 5B3SC 1R3IC 3E83A 2WLLA 3E8HA 3F5WC 4KFMA 4X89A 1K4DC 4XDLA 2Q68A 3AG1C 2HVKC 3E8FA 4MS2A 4MW3A 3K0DA 1S5HC 4MVSA 4PDVA 4F4LA 2HFEC 2WLIA 2EINC 2R9RB 1R3KC 4GX1A 4MTGA 2ATKC 2Y69C 2EILC 5B1AC 4MSWC 4EKWA 2K1EA 2OCCC 4UUJC 2HG5C 1U4FA 3LUTB 2IH3C 3RVZA 1OCZC 2JK5C 3SYQA 4ZBMA 2A9HA 2QKSA 5IY5C 4MVQA 2EIKC 1V55C 3OUSA 4TWKA 2HJFC 3ABKC 3LNMB 2ZD9A 1XL6A 5KUMA 4P2ZA
chains in the Genus database with same CATH superfamily
2CR0A 1A3LH 3ES6B 5T3XL 2HKAA 3WJLA 1NR7A 3U1SL 1KBVA 4J11A 4GKZA 2XYCA 5D1XC 1P1ZB 3ZR5A 1OCCB 1IC7L 3TO2B 2D7QA 2GUOB 2DS4A 2ITFA 4X1IB 2KBGA 4KK9D 4KTDH 3DARA 4U7OA 3O6FA 3NQKA 4BINA 3MCLL 2IPUG 4IHOB 4M1CD 2KERA 4QTIH 3WAJA 2EINB 1D5IL 3GBDA 4NJ9L 1JRHH 3FPYA 5T3ZH 1M1XA 1MFAL 1W8NA 4F8NA 4RFEA 2OJZL 3A4AA 2NY2B 1S7RA 3UC0L 1BVKB 2F93B 1XQ8A 3HC3H 4PHXA 4R7CA 5CFAA 2HFGH 4QRQB 4P05A 4Y4HC 4X6FB 3UAJA 5D7LD 5DI8A 5C6PB 4N5EC 5CHNB 4HG4J 5GS0C 3VI4F 3ARBD 1KXQA 1UATA 2CO1A 2N7AA 1P5VB 2FGWH 3OL2A 4ZK8A 2CBMA 3OGIB 4X20B 3ZMUA 3BH8A 4TUUA 1TFPA 2HVKA 3JWDL 4X7FC 4JRXD 3F6JA 2ZE5A 4GCZA 3CN4A 1IB5A 1D5BA 2ZG3A 3BUIA 4IK7A 5F7HA 4N21A 5J3HC 5AKSA 1ZAUA 1QBMH 1RAMA 3JYBA 1L6ZA 1BQUA 4R4BA 5M7QA 2H1LM 2R56L 3HUJF 5ITBH 1BEYL 2X4PB 2ZKHL 3PPSA 4LCWD 2MK3A 4K5LA 2EIJB 3QUYB 2JQAA 4IKIA 3OJDA 4Y5YC 1KXTB 2E75B 1E7UA 1RUKH 4F9PA 5IESH 3EDJA 5LBSL 3QR2A 3MRNA 1AR4A 4DR7B 2PP7A 3J27A 3VWJB 3QQ9D 2VL5A 3AQYA 3D39B 5E4EB 1E5AA 1UT1A 2KKWA 3CWBH 2Q3XA 1EJOL 5IB1A 3ZYIA 1KJ3H 3QZOA 4G28B 4HMDA 2W92A 3UTQB 1RZJC 3H42H 4ZD3L 1MCSA 2Z65C 4MS6A 1GGCH 3B40A 3UADA 1FIGH 4M7LH 4KMTL 4JY6B 5KJ4A 1RHHB 3KYNA 3TONA 4DP5X 2P24B 2OZ4H 1KT2B 2CXKA 1NKOA 3TN0A 1YEGH 4R26L 4DV0B 3KBEA 4F37K 4F8PA 4NC0B 2DWEB 3LZFL 4JPRA 1KB5A 2HT3D 2ITDB 1I7RB 3L3DB 4YDLC 3RB5A 1SLWA 1QI3A 4PLKC 1IAIM 1HKLL 1MCPL 1J5HA 2ODIA 3IS1X 4Z7WA 3P4LA 3QUML 1DVFC 4MFHA 2YD1A 1Q9OB 4LGPB 5ESVB 3GM0A 3W39B 4U7MA 1Q81W 4FMFA 3V4VA 4O00A 2J57A 4QE9A 2XZCH 4HD9A 1TUBB 3HNVL 1RK0A 2YOCA 4LF4B 1JZ2A 3KM2A 6CGTA 1BJ8A 1LLAA 2HN7B 4P9HH 5KYYA 4K94C 4OZHB 5LJYH 1YEFL 2DKUA 2P5EA 3VQLA 1Z2KA 2OCJA 4LDOB 5AYUL 4G83A 1NUFA 3ZL1A 1Z32X 1GA2A 4JRYE 5T3XD 3CJJA 2NNXA 4Z7UA 3TZVD 4C83A 5J6SA 4FFZH 4L4VB 4AYGA 3K4DA 2EDTA 4JFQB 1HK6A 1EM1A 2NY5L 3QUKB 4LVEA 4EIBA 1CDBA 4KI5C 5TJWK 4MD4A 4XMLH 4DGUA 4N8CH 1N8OE 5LWYH 5TDPA 1EHNA 1W0YT 3DHMA 1B3JA 3OXRA 2B1AL 5D2NA 1EZVY 2CHXA 2EYTA 5CA1A 1IL1A 3GXMA 2AS5M 1NDTA 4CBPA 4WHCA 2ENSA 2A4CA 2V9QA 1MFBH 3PABA 5LCVL 2FLBT 3DI3B 3HPLC 4PWJA 4LP4A 3NJHA 3C87A 4R7VA 5IHZA 2XQBL 2AHYA 3CG8A 2JEUA 3QJHA 4TN9A 3O2DA 3TA3D 2VXUL 3F01A 1T7YA 5C8JB 4JFZL 4MCYB 4DR2B 1HHIA 5AWNL 3NCMA 4NI6A 1L7IL 5TQ0H 5I71C 5H6QA 4DTGL 4ZFFA 1ECZA 3DVNB 1EERB 4OCLC 1BZ7B 5SWSA 2AEQH 2OM5A 1U3HA 4LEBA 2R2HB 4EE2A 5IEKB 4HQQH 4ZW7A 2P42B 3PDDA 3PHOA 4DCQB 3IPBA 2BSKB 2QE7G 1A0QL 2E6QA 2VDML 4E9SA 3EYSL 1CD9B 3SPCA 5IHHA 4GXFA 1E5CA 3O8XD 3IC9A 1JF5A 2CGRL 1S9WB 2AV1B 1QBLH 1CICB 4YBLB 4GUOA 1WZ1L 2A79B 5IV2B 2VLKA 2GHWB 3HB3D 5F6HI 5F7LB 2R29L 1AC6A 3TF7C 1Y6XA 4A6YH 1PEWA 2UWEF 3CMOL 1AQKH 4Q7DA 3W2DH 1L0NH 2FHCA 4QGTA 1UOVA 3BDBA 1KV3A 3MLRH 4WEMB 1QYGH 3MRDA 3W0WB 43CAA 2Y6TE 1UJWB 2XN9E 2R51A 3RTQD 2HYMA 3JTBA 4Q9QL 4LVOC 2K78A 4HEME 5KANG 5FR3A 2BZDA 4GKZB 4ZNEE 4LL4A 2AJYL 1DBJH 3W81A 4HJGA 5ICYA 1DQDH 3T4AC 5K39A 1E2ZA 2DQFB 4D2NA 2B1IA 1WJZA 3KL3A 3Q5TA 3O6FB 3EBAA 1PNLA 5LGHL 2ICEA 4TTDD 3QEGL 5DVPA 3PAUA 4QRUA 1FKAO 4U7NA 3N1FC 4PPTA 1NQTA 4LBEB 5GXBB 3IE9A 1NGWB 2G3MA 3EF7A 4LARL 3L74H 1E8YA 4ZPVA 3V7AG 1U8LA 2OXGA 3JAKB 4JI3B 2R9HC 3K06A 2HH0H 1N2RA 1U93A 4NXMB 3GSNH 4BW5A 2WK2A 3IMUA 5JH7A 1JNNH 4JQVC 5D7IA 2Y1ZA 5J57B 3QSKB 3X3FL 4H44C 1NBVL 1Z9SA 2VMCA 2P45B 4X80L 1Q4NX 4UTAL 3OKKB 4FQXA 2TRYA 3BH8B 4UQ2A 3FB8C 2HVKB 2JMRA 4YHKL 3WKML 2HFEB 1XD0A 3AW5A 1D5BB 2AEOA 3MTRA 3FONA 3NCWA 4ACTA 1ZGLA 1GN3A 3EJUA 2ZOOA 1U3JA 3L2MA 4X6CB 2XX0A 1E5BA 3RDTD 3ZKXB 1MRFH 4JZGA 3OJDB 5LHIA 1VGEL 3QS3A 1B4JH 1CUOA 3JSLA 4HXAH 4WK4B 4WUKH 3SQBB 2BNRD 3VTMA 3CPWU 4R5TA 3WFEH 3VW3L 2VL5B 1XH3A 2Y2WA 1ZHNA 4JI4O 1DEEA 2AXGB 2FO4B 2X0UA 5AFAA 5JW3L 3DROA 4ZW3A 2PPCA 4RETB 2UUDK 4Q6YA 4PDMA 4Q0XH 5GISH 5IB1B 3IPFA 2UX6A 2A83B 2AABH 1C1EL 2XY1A 2WBKA 3QO0A 2G5BA 1VEOA 5E51A 2B1OA 4NHCH 4KFZC 4AGNA 3S3BB 2M8XA 2EIMB 5C6WH 4GUCA 2BC4A 3KYNB 3VI4E 4DP8X 1N5AA 2AGJH 3NK4A 4KRPD 2JB5H 1AZNA 3K2UH 4FNRA 3TN0B 2WYIA 5DMKB 3F05A 3S3JA 3KPRD 2C7UA 4RA0C 2ODHA 4OZIF 1KB5B 5B66Z 1YC8A 1I53A 5C07E 1DQVA 4ZX6A 1BQSA 3AXLA 4JFDA 4DR4O 3HUJE 5B21A 3WO4B 1JWSA 1F5WA 4J3WA 1U8HA 2WLZA 4IU2A 3TBYA 2UZIL 2WWMD 2IH1A 3V4VB 4GW1A 2H2SC 2YWZA 4F8QA 3BGMB 4G8IB 1ILSA 4CU8A 4X8GA 1QFWM 4LB8A 1JGUL 3WFDL 5I30H 3T09A 4TVPE 2X9WA 2FYYA 5KYYB 1HL5A 3Q2LA 2UZXB 5CMAA 1ZDQA 1KTDA 4ZTPH 3VFTA 2P5EB 3KEDA 2OQJA 5GSVA 4ODTH 5EOQH 1LEGA 2QGCA 3QUXC 2F1EA 2NY0D 5D5PA 5KSBF 2HG5C 4Z7UB 1MVUA 4C83B 5IVXA 2HFFB 1DBBL 5SX5K 4FI8A 3K5RA 2AV7A 1CDYA 5FOBA 4O4LA 1P9MA 3T65A 5HYQA 4DK3A 1KEML 3DURA 3UACA 1OCRC 5C09B 5TDPB 4WFED 3L3JA 1JPEA 3B2VL 4QHMA 4ZZKA 3S7GA 3T5WA 3PJSA 5D2NB 1HTYA 2EYTB 4DV6B 3BQVA 5CA1B 5B22A 1A02N 3ESOA 1IL1B 2D3NA 4DUYB 2DMKA 2QQNH 2O5ZH 5LQBH 2A0LA 1B9ZA 2Z7UA 4Z9KB 4F15C 4F8TA 3HZMB 2AK4E 3H9SA 1NOFA 2EH8H 3PABB 4G8AC 5J1AA 3FW6A 4QRPA 2EDQA 1Z5LA 2G0KA 4GS7B 1JVMA 1HILA 1DQQA 3GXTA 2JKWA 3O9OA 4JB9L 2NRDA 4ZI7B 3DUUA 3QIWD 1DLBA 5DLMH 1HCVA 2B5UA 2I9TA 3INOA 3K6NA 1XMOB 5IHZB 4BE5A 4YBQC 4N2IA 3RFZC 2DF3A 2PWFA 4MCZA 3QJHB 3VFGL 5KOVC 5D7EA 4QHPA 4YXLL 3BFOA 3I50H 5FUZL 1J11A 2JJVA 4PRNB 5MEOA 5LMUO 2CZNA 3QXVA 4YSSA 3X11A 4Y7OC 5I1KL 1RPUA 4GFXA 1JTTA 1B0WA 4B9KC 4XNQA 3ULVF 4JCLA 1I82A 2IWGA 2Z4TA 1DJWA 4Z5RA 3SDCC 3PHOB 1IC4H 1U8MA 4ETQA 3KW8A 3VI3A 4DKEL 4YLCA 4D8PA 4IDJL 4ZX4A 3S36H 5IROD 2VDOB 4JI2O 3J2PA 4HKZB 3GLZA 4WEBL 4HF5H 2ZTBA 5TTRA 2ZCKH 4CDHA 3BGFC 4DGVH 4Y9BA 4D9LL 2VLKB 4XP9L 4J3TA 4RGND 4ZUVA 2LW3A 4OJFL 1E1RG 1KN2H 1KMIZ 3CRRA 4QNHB 3S3CB 1A6ZA 1TCMA 1QO3A 2EQDA 2N01B 3MRDB 3QG6A 5DT1L 1CDIA 4QWWC 3OAWA 2HJFA 3BDYH 3GMQA 2NXZC 4RDQF 2XU9A 3ZKNC 1BREA 4ZSOE 2A6DA 3MZGB 3MOBH 1WFOA 4HJGB 5ICYB 1LTXA 3G9AB 3DVGB 4ZUWA 3K6OA 1QWNA 4HLEA 1SXCA 5KYWB 4PP1D 2DBLL 2AKRA 2ICEB 3NIFB 2W1NA 1QEWA 1PEZA 3C60A 4QRUB 4XE0A 4NUPA 4EIZC 3CXDH 2LQRA 2XC8A 4JFOA 2MQ3A 4BGDA 5D8JH 4Y1AA 2VQFB 7TAAA 4HJUA 3LXAA 3LIZA 4UV9A 4XT1C 4ZPVB 4KRLB 1U8LB 1TPXB 5E6IC 2WHVA 1N2RB 2NN4A 1SOKA 2O5XL 2W95A 1IGYA 4TOYH 4XAKD 1JZGA 4G80A 4X1YA 2VT0A 3GMNA 4WWOA 1Z9SB 1ZE3C 3VD9A 2YPVL 3WTSA 1A7QH 2Q9OA 3KL0A 4FQXB 3T6VA 1MCIA 4UQ2B 4C58B 1HNFA 5DC2A 1IGFL 2WUBL 4JKNA 4Z1PA 1ZGLB 1HHKA 4XVOA 1UM4H 1XR8B 2XTSA 1FCGA 1ID5I 1N67A 1SHMA 5ADPH 3WG7B 4L18A 1XILA 5D6DC 3W9DB 4CU6A 3UBXI 2ZWKA 3UPAA 1F4AA 2GYSA 2TSAA 1MFCH 3FQTA 5F3HA 4LEOA 1QI5A 2LGWA 1NWPA 2GJZA 1QVGU 2Z31D 4JUSA 5EYPA 4AGOA 1XH3B 5A43C 1P1VA 2VR9A 4QHNA 4QRSB 3FAVA 1MHHB 4MQTB 2IBGA 2IG2H 4NBZB 2ZUTA 1IDSA 2P4AB 1MY7A 4H25A 2IO5A 3RWDA 4M29A 3JD0A 2G5BB 4HD5A 4NQTA 5HHXH 4PSPA 3WMPA 3K57A 3RIKA 5B1AB 2NNCA 5CFHA 1U58A 5CJOL 3UJTL 4DETA 4PH8A 3B9VA 4B0MB 1LNUA 2VJ0A 3ZUCA 2ZUYA 5KW9H 2B08A 2BC4B 3BZ5A 3TNMA 1N5AB 2BS8A 3Q43A 4HH9A 2P67A 4MCMA 1DBAL 4P06A 2P26A 3BWSA 2ODMA 1MREH 1YYLH 5E8EA 2LAGB 3LNIA 5ICZA 1MXDA 4JYYA 4HPOH 4KC3B 1XF2A 2C7UB 4Y5VA 3DXRA 1QFUL 4H0LC 1RZKL 4YHNA 4DUXA 1KPRA 3C5SA 2G60H 5AG2A 1U21A 1UCTA 2QGDA 4DGYL 5FK9A 4S0TD 2VLJE 4JFDB 5DR5L 2WKOA 4NZ8A 4WFGE 3SO3C 5E99H 3W9EA 1I08A 1JWSB 3RL2A 3T0EE 3D0AA 4FG0A 5BUAA 2BY0A 3OMAB 3RB7A 3KPTA 3WFCH 2IH1B 5T5NG 3FT2A 1KENH 3VG0H 5CA3A 4GW1B 4EI6A 1GJUA 1NBQA 1TTUA 2NTFB 3FO9B 3HBQA 4LQFL 5J11C 1ETA1 1MIML 4M1DL 2XXMB 5EV7A 1H3PL 2BSTA 2FYYB 3T77B 3H1HH 2PABA 3MV7E 4I1PA 5CMAB 4BQ9A 2R0ZH 1Q6HA 1KTDB 4H8UA 5BPPA 3VFTB 3CXHJ 4V1DE 5I15H 5GSRA 5GSVB 4YFEA 2OQJB 3VD0A 5FL7G 5LNDA 4WWKC 2J1KA 4LOEA 3WD5H 2ZF8A 3QDME 3FQNA 1MVUB 1J0YA 4H7VA 5DMIH 5IVXB 1TZAA 5IB2A 3ARPA 2WYTA 3M1CA 3VU1A 4KAQH 4AJ0A 2AV7B 4ONOA 5FOBB 2PXYA 2XWEA 3T65B 2C3VA 4B3MO 5FLXN 3DURB 1OT4A 1G9NL 5JA9A 2ESVE 1XHZA 3L3JB 4QHMB 5D1ZC 1KC8W 3PJSB 4P4KD 5DD5L 3IMTA 1TVDA 4K3JL 5ILTH 1ZLDA 2YIDA 5J6HB 2BMKA 3I74A 4OLWL 2H3XC 2B5IC 2QELA 3TV3H 4KUZH 4N0UE 1T5EA 5B8CC 1IJ9A 5BV7C 4PB9L 2FWLB 5D5MF 2HKHH 4QRPB 3SGJC 1Z5LB 1F00I 4BQ8A 5A6LA 5I1JH 1WHOA 3QI9D 1QPKA 4X0KA 3C12A 3QCUL 4AC2A 2I9TB 1KG0A 3ASWA 2IDCA 2EIBA 2O5YL 5LDUA 2PLTA 4MCZB 1G9EA 4OQTH 1PG7W 4HIHA 4PEEA 2EE2A 4ANXA 1UGKA 4JJOA 5MEOB 4PV1C 4Z3IA 1OWWA 5JW4M 1SBSH 4L1BA 2XICA 5KSBE 3M17A 2EXYC 2ZE6A 1AHWB 4AG4H 3MRLA 4WY7L 3V0HA 4ETQB 1NLDL 4P2OD 3VI3B 2FWOB 4D8PB 3GI8H 1EEQA 1M7IA 3DWTA 4LAQH 5E1AA 3OZ9H 3GSWA 1DUYA 4XDKA 5DUBA 5JUEL 1EK3A 1WIPA 5D55A 1QUNA 2XQYG 4H8WC 4N0FA 5CD5D 4QCIA 2QWPB 2Z0AA 1BZEA 3AS0A 4UM8A 3ZJAA 1IGMH 4K9JA 4FDWA 4NJAH 3EYOA 5KBNC 3MBXH 4ISVB 4NM8L 1A6ZB 4QT5A 1QO3B 1PP9H 2ZP9A 3QG6B 4LPCA 3GRWA 2O5NA 1GCFA 4U0QB 1RK7A 3LKPA 4ORZC 1K73W 2BXZA 2HJFB 3GMQB 4OBRA 2B7DT 2E86A 4PJGA 1FJ1B 5ABDE 1BCIA 2F7PA 1OP3K 3TJEL 2A6DB 4ELMF 4XC3L 3NAAH 4ZUWB 1M3JA 5CINH 1JXDA 1ZTMA 2FB5A 4OX9B 3MKKA 2AKRB 2BWDA 4YE0A 3LYRA 5DEFA 2L3BA 2NUPA 3ULVE 5AW4B 2YOAA 3WNIA 1L0QA 2Z6FA 3CNKA 4P48A 2P5WD 3WNLA 2I9LA 1XTMA 1BXVA 4JFOB 3D51A 4N1CA 3E9TA 1IUZA 2YRZA 4MQ7A 2W81C 4EKJA 5AVRB 2R4RH 2Y5EA 4F6RA 2X4SA 4X4YA 5KBKA 1JZ4A 4YH6A 2KQNA 5CEZD 4Q56A 1IGYB 1ZVNA 2Z8RA 1E8ZA 1G1OA 1F2QA 2H9GA 5FYKL 3GMNB 5L2KD 2HT4D 2IQ9H 3CN0A 5F0PB 2BNQE 2WLJA 3KG5A 2QVMA 2OMWB 5GRZA 3A5VA 5A2CA 3CRAA 1FP5A 4DN4H 3UTTA 2R59A 1HHKB 5ICXA 2F0CA 2EXSA 4LCYA 1YMME 4QF1B 4M6AA 2GBTA 5GS1B 3DXAD 4ZPTA 1CDCA 1XBDA 2Y7OA 2X4QB 3HE6A 2YAOA 5AAMC 3FQTB 4MAYD 1J0JA 3ARFC 5TE6H 3C6LD 2L7UA 4LEOB 4NN5B 2Q6WA 5JHDB 1IAOB 2GJZB 4I9WD 1IM3B 5EYPB 3JCZA 2ZCHH 1FE8L 4QHNB 3CZFB 5DECA 3FAVB 3RKDD 3TEXA 3QPKA 3C8KA 4FP8H 1U96A 4GX5A 4UZGA 3QJTB 5D7JD 1L1FA 3A3YB 4X4KA 1MZFA 5DUJA 3TOPA 3E1ZA 1THAA 1AY1L 1JERA 1RZQA 2OYPA 1U58B 3ZE1B 5JOPE 3DJSA 5DUPL 1A1MB 1K8IA 2WXQA 1N18A 3LV3A 1KUMA 3ATEA 4KY1L 1QABA 1G1XB 3TNMB 4HH9B 3P3PA 3AREC 4AVKA 1A6PA 1P4IL 5ICZB 5CGBA 1SF9A 3TETA 4ANKA 2QPFA 3D3VA 4Y5VB 3DXRB 5TK2A 4TNEA 3IU4L 3FB5A 4YHNB 1KPRB 3HTLX 3F5WB 3SE9H 2P47B 4A7VA 4UNVA 1TENA 5FK9B 4HEPG 1HNZB 3VD2A 4G7VH 3JWDC 4NI3A 1RFDL 1MAJA 3CDCA 4LHUA 5I8KL 3W9EB 1GL4B 4HOXA 3SJAC 4FXLA 4EI6B 1TZIA 3FT2B 2Z1PA 1XT5A 2ZG2A 2DOCA 2G4EA 2X89D 1D5NA 4LIQH 1JVLA 5JIHA 4PWKA 4Q9RH 4UNIA 5B7EA 4F93B 1E8WA 2BFGA 2QKIC 4LFHG 5MEPA 3BVOA 4Q6IC 2WKGA 1O0VA 4JYAB 2VW6A 4H1LA 5EMYA 1JMXA 5GSRB 2GUZB 1A5FL 2NQCA 3IGAC 4NSKA 2XHBA 1INDL 1CFSB 3KLDA 4XPHL 1TETH 2H7WA 4R0LA 2F58H 4HUMB 1CPUA 3DC5A 3IAQA 3QAZB 3FQNB 2V5SA 1BQZA 5AALA 1ORQC 5FDYA 4I85A 1K92A 4X66O 4X9IA 1RK1B 5AL0A 2CRMA 3EYQC 3JWNH 2QM7A 3P9MA 4DPAX 3CXCU 3EH4B 2AJXH 2ZD0A 4PY7A 3AUVA 3FO2A 4FTVD 4PA7A 3PWPB 3RX8A 5LGYA 2B1HH 4OPAA 1CS6A 1MW0A 5A2JH 5HHOE 5CU9A 4OI8A 4KZDH 4GSDL 1ZA6A 4BSVA 4NQEB 3FH8A 2CTWA 4YN3A 1LK3L 1AH1A 4X8CA 4P23D 2VC2B 4L0ZA 1GAFL 4EN3B 1R19A 3APMA 3X2QC 3EGXA 3W11C 3DK2A 3N41B 4Z77A 2Q8AL 2EIZB 2NY3C 2GTWA 5JQ6H 4X0KB 1BXUA 1A1OB 3BUYA 4F2ME 1KG0B 3D0LA 4X9YA 3RN4A 2NX5B 3F7VC 1XUQA 3D52A 3B4SA 3C75A 2EVHA 4N28A 4FNLL 3V9EA 4XX1E 1OGAB 1JL8A 1I7UA 1DJSA 1XMEB 3RNKA 5FX3A 3W3BA 5CEZH 3S3XA 4RSYA 4CVZA 3EUUA 1OOAA 4DV2B 4MD0B 1NFAA 3M17B 3BZDA 1U8JB 2WJ7A 5EDSA 4I3RH 2F53D 3LQAL 5BO1L 3CSTA 1A6VL 4LL9A 1AVAA 1GYVA 4BK4A 1AJ7H 1M7IB 3R7RA 1THZA 3GSWB 1DUYB 4JANA 3ZE2B 1QUNB 1RZGA 4N0RA 3LN9A 4JDVA 2F54E 4LMQE 3TV8A 4N0FB 4P46C 4QCIB 1Y66A 5HI3C 4TUKH 1M56C 2IDFA 4UM8B 1PMYA 3EYOB 5D5ME 4S1QH 4QT5B 3BABA 2WXPA 3BUQA 4P3WA 1DQMH 2HTLD 5G4OA 3LKPB 4CL7A 4HT1H 4PJGB 3MJ7A 3H9YA 1J8SA 2VZVA 2LHAA 3AG1B 4GKKB 1R0AL 1E90A 2Z34A 3TJHC 4G6AD 3HKCA 3WKYA 2CBQA 3QARA 2F8VA 3OXSB 5AB0A 5T1LB 2NUPB 4F9LC 3WU1A 3AG3C 4XBGA 3CZSA 3EFFK 3UO1H 2BSSA 3DVFA 3V52H 5I17A 4IOIB 2FRGP 1BEXA 2HVJC 2V3FA 4HUXB 2BVUA 4X4YB 3PXLA 4F6RB 2J72A 2X4SB 5HDOA 2H0EA 4JRYA 1G84A 2Q8BL 3FHAA 3WKQA 4EBQL 4S1RL 3SE3C 1MPAL 1O75A 4KROB 2DTML 2H9GB 4KOCA 4D7BA 1QRNB 3OVUB 4TUOB 2A4ZA 3C5ZB 4IM8A 2G2RA 2G2PA 2X0LA 5LNGA 1KGCE 5A7EA 4LOFA 4M5YH 2JVDA 1MEXH 1SRDA 1LXMA 5E00A 5CA0A 4KHPO 2W60A 4LSRH 5T1DL 3UTTB 2PUSA 5ICXB 4LCYB 4BXSV 8FABA 3DGGA 1CTOA 2ZKOA 4RFNB 3VWKC 4ELME 4ZPTB 1AZUA 1IRAY 2R0LL 1E4HA 2YGVA 4NKIH 4PG2A 2N3JA 4MLIA 4NO2B 2Q6WB 1K4DA 1C08A 4KI5F 5HJGA 5I6LA 2BCMA 4JFED 3DHUA 4CC4A 2J6EA 2HLDG 4L8JA 3Q4HA 2WBJC 2QSCH 4MNGE 4MS8D 3TYFB 4CMMA 2Y1YA 3C8KB 4HBCL 4M93C 4R4NC 5DYFA 4M3KB 5F88A 4RBPK 1HEZB 4HC1H 3D3IA 1K8IB 4JCWA 1NAKL 3BAKA 4OCRH 2R9RB 2UUCB 1CMOA 2F4VO 2EILC 4DVRL 1SRYA 2YGQA 5T8IA 1NCCL 4HAGA 5I0VA 2B9BA 3NA9L 1IT9L 1O6SA 1UM6H 4MDRA 3D3VB 1WO2A 3IVKB 4G7SB 5KAIZ 3PUUA 3S37L 4Z8FL 3FB5B 4OKDA 4H20H 1OP9A 2DW4A 3B8YA 1AFVL 5FV1L 5LN8A 4P2CG 1J8HE 4G3YL 1V54B 3O6LL 2CIKA 2AXWA 3VQXA 2OMYA 3UO8B 1T6VN 3THOA 5CBHA 2AVFA 2AQSA 1A8ZA 4PJ5E 1W72A 5DU7A 1AP2A 1IE4A 3V10A 1TZIB 1NCWH 1EMTH 3TH2T 2XN9A 1HHGA 4TV3A 3QDGE 1KY7A 5KSAD 5IJVB 1QFPA 1R3JA 1T66C 2CUHA 3LEYH 3OB8A 4HEMA 5MHSE 2NR5A 3ZDXB 3QO7A 5MEPB 1DQLL 4Z0BH 1HNYA 2BVPA 4PWIA 1GY2A 4R0LB 1RZ7H 5D70L 2X40A 4PJDF 4BFBD 4LSVL 5I5RA 2XFXA 2ZICA 2WLLB 3WSQH 2DN7A 1RLBA 1DUZA 4J7KA 3FO2B 4K4KA 3E3QE 4WO4C 2IW5A 1HWYA 2OI9C 5I23A 1ZA6B 3LZOA 3WIHL 3E2HB 3GJFK 1TOXA 3PREA 2ZXAA 2H3NA 3BCFA 5GRXG 5EF1A 3RVVC 5DVNA 3FT4B 4L3EB 1VGKA 4I77H 2P5OA 3ALWA 4FZ8L 3U11A 3UTPD 4D7TA 1G9MH 1BBDL 4HSCX 4Z77B 1F23A 2B20A 3IYLW 5IYZA 5FM8A 1TEYA 2GTWB 2ZOLA 1N5YL 2WQWA 5B1OA 3BVNA 3BUYB 4UQAA 1NH2B 3D0LB 3OJVC 3V0JA 1OAJA 2R69H 5HI4D 3FPXA 5JYMA 5CBEB 3N42B 4HOZA 2PW1B 3NACL 4EDXA 5E5MA 2BS9A 3ABLB 5AOLA 1JK8B 5A2KH 4XBFA 2A9NL 3AAZB 5ESAA 2EICA 3DOHA 2BY1A 1OARL 1SVZA 4YDIL 3ZKMC 3I6SA 5EC2A 1EHKB 4F92B 4EEEA 1FDLL 5JIKA 3L54A 4IJ3C 4EVNA 2WTOA 1BBJA 4PJEF 2AW2A 4UT9L 3LXCA 2QR4A 5EBLC 4DK0A 2J2ZB 3E89A 1I7ZB 1E3XA 4U6TA 4BH8A 1N4CA 3HMXL 5SWSD 1BD2B 1ET8A 3CHOA 1U3HD 3OR6A 4GW5A 1T22A 2OKMA 1MWAA 3DMMA 4JANB 3TEWA 1C12A 5CGMA 1L3NA 5DD0L 4JDVB 3F7LA 4M6OH 1VQ6V 4MS2A 1HT6A 1YUKB 1MNGA 5ENWA 1Q0XL 3NIDF 3L08A 3MLTA 1M71A 5ISZE 2VMDA 5CILH 5C07A 3F2LA 1N10A 3P54A 4UYPA 1JN6B 3RGVD 4BZYA 1EZVH 1JCVA 2JJUA 3KCPB 3HUJA 4NAMA 3P30L 2CO3A 4KKQA 1GGCL 5DHMC 2DQEH 1NPUA 2NY4C 2XVLA 3CX5F 5LG1A 2R1XA 4EZLA 3EH2A 1HI6B 2Q69A 3GGWA 4LLYA 2X88A 3X17A 2XG5A 4XBGB 4N6QA 2MTPA 2JV6A 5AENA 2CO7A 3S5LG 4M6MH 4FQCL 2E0PA 1QR9A 2D3VA 4JGJA 1R34A 4BFFA 5KVFL 4AENA 4JRYB 4OF3A 5B1NA 4I50A 3MCYA 3OMNB 4K23H 5DA0B 4NN7C 5E6ZA 4KO5A 1KB5H 1NFIB 3DPBA 4CH4A 4UAOB 5ANHA 4P9HL 1AJQA 1JGDA 5B38A 1FYTA 5F6HJ 1S9XA 1ZTXH 5E00B 5CA0B 1A4AA 2D7MA 2W60B 3CD6V 3CVHB 4N2EA 8FABB 3V4VH 3TBTA 2FD6L 4YL9A 1X9RA 2ZWLT 3BQUA 1KGWA 3DGGB 1F4XL 5AW7B 2AK4A 3NFSH 2OSYA 4FQXD 1CC3A 1SFHA 4LNRB 1QHPA 5EU6A 2QHRH 3ARGC 2DJUA 1LEKA 2ADYA 3GXFA 4FZEH 4H13C 1A66A 4G43B 1OSEA 3BVWA 3T6ZA 1N36B 5EWIH 1C08B 5IHUH 1Z0MA 5FCUL 1E6JH 5DC9B 3T2NL 3Q4HB 3ZEDA 4LLDB 4O2FA 1WWAX 2ADGA 4Z7AA 4PRID 5IBTH 2Y4UA 2XBTA 2PI5A 2QR0A 2R2EA 4UV4H 3DPDA 3MTXA 4G42A 1Z9NA 5F88B 1BXXA 3GB7A 4NKQB 4JG1H 1R73A 3JWNG 4HWZA 1CR9H 5GGTA 1AR1C 2W91A 1SZTA 1O6SB 4LOUD 4Y5XB 1BVLA 3ARDC 1NMBH 4IKJA 5C0IA 4CH5A 1DBML 5BR8O 2EXTA 3OSVA 3SDDA 2LJ2A 3ZS8C 3MLUL 1RUPL 1UG9A 2J1WA 3JD4A 4MSWA 1FAKT 4JDZB 2DV6A 1CGUA 1YEKL 4U3SB 2EVIA 1AP2B 4NDMA 3OAUL 1CDUA 3O0RL 2WQ8A 3O2DH 2IBZH 1DDHA 1HHGB 4KI5E 1R3JB 1X4ZA 4HKXA 3VB8A 1NAMA 5CJXC 2IAMB 4U0RC 3D36C 1E7VA 4IIJA 2F66C 4XCCL 4ZSOA 3RVXD 5DVOA 3H1ZA 3E35A 1EHXA 1KZQA 5DQ9A 1YUHA 2BVPB 2DQCH 5IFHH 1RZFH 2VDLL 5BVPH 4GQQA 1JUFA 1LDPH 1S7XA 5F7WC 3E8BA 1R6TA 4NWUL 5JO5B 4FG6C 2JLPA 2VDOH 4MKTA 5K9QI 1SM3L 2XFXB 4HS8H 3UG5A 1FJGO 1U30A 4DK5A 1HIMH 3B09A 3HC4L 1DUZB 3M07A 3I84A 3TA4D 2NQ3A 1TLKA 4RZKA 5EZPA 4E41E 2LT9A 4XVTH 3VGFA 4Z76B 5I73B 3RHWK 3NJKA 2H3NB 5DHXB 4G8EB 4HGMA 3HNSH 3RZCA 2QDWA 1JOIA 1TU2A 5AKRA 5AZUA 2NY6D 2CDGB 3FT3A 3EJYD 4UT6L 5IYZB 2YIAA 2M6YA 3CCEV 1XV8A 1C5CL 2ZOLB 5D9SA 3BVNB 2Y69B 3GIZH 4P5SA 3D6GA 5ISZA 1RJYB 2A0LD 3KL5A 3H9SD 3HZKB 2OW7A 4NUGL 5B3JF 1Q1JL 5F0LB 2J4WH 1W59A 1DQJA 3KJ4C 4U6VL 3F12A 5E5MB 1G7IA 3MXVL 4LCIL 5FYJU 2JQMA 5C0CD 1Z1WA 3CLFH 5ESAB 1IBDA 2EABA 4WSJA 2ZAHA 3UZQA 1OKEA 4HCGA 4GRLC 2DEYX 2I27N 4PMEA 5EC2B 2ZOKA 4J3OC 4QE7A 2W0FB 5IB5A 4EVNB 2Q9LA 1SJEA 5E6SB 3DSNB 4IT5A 1T6WA 2FH6A 4G70B 4PCKA 2RBLA 3D9AH 3VFOA 4LCCB 3OR6B 1T22B 3C09C 1BFOA 4WNSA 3V5DA 5IT2L 2AJZA 5AAWA 4EXPX 1MAMH 4LSTH 4RNRA 2C9UA 2V2WA 3HHMA 4YHZL 1LK2A 1M6OB 3GWOA 3BKJH 3DOIA 1EDHA 3BJ91 3EGSA 1EAQA 3IFOA 3MBEC 4XXWA 5ENWB 5BRZE 3ASOC 3FB6C 1YEJH 4BGLA 5I19L 3MLTB 3ASNB 1FL6A 3KXFD 4FLRA 5GISL 1M71B 5AAPA 1E5ZA 2CR3A 1MCWW 2FJHB 1AANA 2VLJA 4WFGA 2J8UE 1WG3A 2HVBA 2CRYA 3CZGA 3T0EA 4AH2B 3MV8E 4ODSH 5IOPA 3GTVA 2X4OB 2JKNA 3C2AH 1ACYL 4IIQB 1UB6A 3PUCA 1PQZB 2GJ6E 4N6RA 1QHQA 4FQIL 4XE5B 1IEBA 4EDWH 5BUGA 2E7LA 4PDVA 4IHBA 4LLYB 3PDOA 3H53A 3MJWA 2PW2A 3MV7A 3LPPA 4PJEE 3NRQA 4AYSA 4EI5D 3OKYA 4V1DA 3A67L 1M57B 2CO7B 3EHBD 5IBLD 1EPFA 3PXHA 3CFBA 3NYKA 3C60D 2DRUA 4AENB 3NPZB 1PD0A 1H0DB 3HE7D 4CJ1A 3DIFA 4BUHA 1VQ9V 1SN0A 2NYYC 4I5BA 3HS8A 4L1DA 1XCTA 4CGUB 2AQ3A 4HIXL 4Y1AD 3MV9D 1IC5H 3O2VL 3P9WB 3QUZA 2ZIMA 1FSKC 4O51A 5A6IA 1C5BH 1Q94A 2P7TC 1JGDB 5B38B 2ESVA 1FYTB 3NIDE 3ULUD 3DO3A 1OW0A 2FQFA 4MAZA 1U8KA 3V6BR 2IU3A 3N27A 1S9XB 4U6XA 3REWA 4F57L 1F3JA 5BVJA 1IZ3A 2XZAL 3TBTB 3BQUB 2N7BA 4DESA 1TMCB 3LKSA 3POHA 2AK4B 4N0UA 3A0RA 4AV5A 3SYOA 5EU6B 4QNPE 2NNRA 2EX3A 3QWNA 2P1YA 5GZOC 1LL1A 4NYKA 3B9KD 1BFSA 4K8RL 1I5XA 5ANMB 1KYDA 2XKNA 1FXVA 4PN6A 3PL6A 4YPGA 3DA0A 2B2XL 3SGDH 1X9QA 3QFDA 2YGNA 5HPOA 1QHTA 4KZEH 2E5LO 2ADGB 1P7BA 2CHDA 4O2FB 2VDPB 5JQHC 2CA4A 4E2LA 2DD8L 5GGUB 1EGJL 2QR0B 4JI6B 2R4SL 2W0PA 2EH8L 1UQSB 4MDJA 3LNNA 2MEJB 4HFUH 5CP3A 5CS7A 2DPKA 4YXHL 3AXHA 2Y24A 4ADIA 4DW2H 3U79A 3ZRXA 4AM0B 3OTTA 2Z8SA 1BVLB 4Y16B 3X1FA 3V6OE 2VH5L 4I0XA 1A6UH 2X7RB 1D9KC 4YJ3B 5EU5A 5GS3A 5C0IB 1LMKA 2QTEA 4MRCA 4YSUA 3SR2C 4QUOA 3K03A 1DVYA 3HG0A 5T5FA 3SDDB 1D2DA 1BWWA 1MUJA 1T1WA 1Y18A 2WVTA 1P5UB 4RFOH 3RYCA 1ZKAA 2K0RA 4M9OA 4XNZC 4NDMB 3JSSA 3ZN6A 4ICXA 4Z7QB 4N2FA 4QYAA 2RQEA 4LSSH 4Y8AA 1N70A 4HKXB 3Q48A 4OFIA 2B4CL 4HLJA 4M6NH 1NAMB 5J06A 5F7EL 2D2CB 4DK6A 3CFJA 5FYLL 5KVEE 2C1OA 4ZSOB 2IADA 4UDUA 5EZJA 2D8KA 4EMZA 3BFRA 4QXGH 4ZHQA 3DJRA 3UGUA 3MQIA 3V7MA 4OT1L 4EPSA 2V4DA 3JVGA 4K3GA 3RURA 3SIKA 1KCWA 1SOQA 1S7XB 3B7YA 5FUCC 3L45A 2WUCL 4EO5A 4XC1H 3M1BA 2HTKD 3F7YB 2UU9B 1G5GA 5IMMA 2Q0AA 2AEWA 4I9QA 2XZZA 1FI8C 3K8LA 5HYIA 3BAJA 1OAQL 4O5LH 2NW3A 3SDAA 4BFIA 1CGWA 1O9ZA 5JQIB 2BOBA 4I8DA 5BRQA 4K3DH 2Q7EA 5CJQH 1N34O 2UXBB 4WDIB 4NCC2 4MA1C 5D72H 4AT6A 2PXYD 3MGAA 3RUGF 4JDEB 2KI6A 3SBQA 2H0JA 2IH8A 2BNQA 4OZGF 1NUGA 2RNBA 1EZUA 3FT3B 4Y2DA 3ZZSA 4F7MA 1M9SA 3HMWH 3MODL 3S35X 5D9SB 5I16A 3K08A 1TVKA 5EOCL 3CFIC 4LLWA 3K0GA 4RWYH 1EX0A 4RCAA 2VR7A 3CZEA 1RXLA 3P11H 2CDFA 1YMMA 2QEJA 3TCLA 4POZC 3QNZA 1XB8A 4TXVB 2VM4A 1I8UA 4N26A 1JZ8A 4OLXH 4PJ9A 1G7IB 5H37A 4UBDC 3W7SA 4XOAA 1OK8A 4B60A 4PD4J 5FV2A 2XN1A 3UZQB 4X64B 3CH1A 2YJQA 3BSZA 4U1LA 1BQ0A 1CIUA 1OSPH 2ZOKB 3LIZH 2CA3A 4NO5A 4JHAH 4PJHF 4KL1A 1J5EO 5EOCJ 3B43A 5CGYC 3ZSSA 4YHPA 4EXKA 5C97A 5IT9N 1KCKA 1NC4B 4JFYA 2H2PC 1V7NL 3CHSA 1E6OL 2O57A 3BPLC 4N1HB 1A6TA 5I8EA 5HHQA 2JCWA 3RIAK 1K85A 1BFOB 3V5DB 4RRPA 1R3HA 1ASQA 3VOUA 1XZWA 1IARB 4MJ5A 1MFCL 4OU3A 3QFJA 1CE1H 1OPGH 3UGXA 4KZ0A 3QPQC 2A73B 1NCTA 4DPBX 3RAJL 4Z3HA 5TDNA 4OD3L 4ZOLA 1BMZA 1GZHC 1O7SA 1ROPA 1FL6B 2EO1A 2IG2L 4QTHB 3TNNA 1HL9A 1A3RH 4FHJA 2WLYA 5I5IA 4ZMZA 5GRJL 5TE4L 4K15A 4PJXF 2VLJB 5B3JE 3P0YL 3DX0A 5F1NB 3T0EB 2E3VA 3VM5A 1U91B 5IOPB 3IM1A 4O9HH 2XWCA 3D50A 4B3SO 3GSXA 2R0WL 3ELQA 3RY6C 5DS8A 4DEPC 4DR1B 1NSNL 1AHKA 1XGUA 1MREL 1IEBB 1H2GA 2WA3A 3LPWA 1IBMB 4PRDA 5C86A 1IQDA 3MV7B 4BFGA 2ZJSH 5EEXA 2YR3A 1C8QA 2VQEO 4V1DB 4KKLD 2H4EA 1YY9D 4EZJA 3CC2V 4NENB 1Q43A 1WA8A 3ZCCA 5JTWA 4RWUA 4MTXA 5J13C 4I5BB 1FO0A 3QXWA 1BZ9A 1KENL 1XCTB 5EN2B 1JZDC 4DO6A 4S1DC 4J41A 1PG7H 1GGTA 3AFLA 2OJ1A 4O51B 2DQ0A 1N33B 1Q94B 5HHOA 2R0ZL 5I15L 4GYCB 1U8KB 4U6XB 4WUUE 1F3JB 3ZKSD 5A2FA 1LD9B 4XXCA 2XV6B 4O02A 2J44A 1HXMA 1IGCL 3QXUA 2NY1B 4OCSH 5AB1A 5C0AE 2CKBA 4H5SA 1CBJA 2IH3C 2WNXA 3QNFA 4YSTA 3HR6A 4BWWA 3JD1A 2P49B 3L9BA 3G6AA 3UTTD 1W80A 4TYUA 3LDBB 1FG9C 3TS8A 1IV8A 1NFDF 1A4BA 2XKNB 4G6FD 3WNNA 3R66A 3PL6B 4YPGB 2YPLE 4QJ3B 3H1KH 4JFFE 4LCUC 3QFDB 3HE6D 3ZHSA 2NXYC 2OJEB 1MLBB 5J2UB 2APWA 4LVHB 1TTGA 2BTOA 5EZOH 5C08E 4LPXA 4FLWA 4A7GA 2E76B 4IRJC 4AHCA 2HKHL 3O4OC 3KJ6L 5C0DA 1FL3A 1IBFA 4W93A 3LEVH 2C34A 3X3GL 1N6UA 2C3HA 4E5XA 2FJSA 1PD1A 3KYOA 3FU0A 2LU3A 3AXIA 4KMQA 2MCPL 2C4FT 2UXNA 2VC2H 4HWUA 5IJKA 4I0XB 1PSKL 5EU5B 4FM2A 4WI4A 2F54A 2XVBA 2G75A 2A2QT 2FT8A 3QORD 4PGEA 3T3MF 1SBSL 2F8IA 2GIXA 1Y18B 3LS4H 3TVMC 2NLJA 3NJMA 5I0ZA 1TUPA 1IJNA 3WU2Z 2XZQH 5D5MA 3TCTA 2APFA 2OMUA 3ZX6A 2DQTH 5JW5A 2HEPA 3HC2A 3QJSB 3GI9H 4I48A 1GIGH 2H47C 3GS0A 4E2OA 1ZHBA 4LHUD 4OB5L 4ZS6D 1I1YB 1QPXA 3CFJB 3KH4A 5BS0D 2AMUA 2C1OB 2WQRA 3IWVA 4UDUB 5EZJB 4URKA 5H4ZA 2YN3A 4U3FH 1OAUH 2VRQA 2I7OA 4ZHQB 2ZPKL 3MCG1 5GGRA 3TO4D 3NDZE 5DQJA 2IBZX 1EHLH 2ZSWA 3MCKB 1U8NB 5MP6L 1F3DH 3MRHA 1A14H 1X7QA 3FZUC 3LH2L 2EXWD 2JK5A 1XIWC 4K0KO 1TZGH 4CW1A 3U7WH 3RGBA 1EEZB 1T7XA 1IKNA 1YC7A 5IMMB 1YNTF 2JB6A 4MTMA 4N5UA 3B8SA 4X6DE 3SDAB 4D0BA 4GG6F 2BOBB 1IBLB 4XB7A 4DH2A 1QR1A 2W8CA 3E7JA 5FM5O 5F7DA 3RL1A 4B08A 1CZ8L 4RGMC 2EDDA 4LEEA 3V6ZA 2PWEA 3NSFA 3BXNB 3DC6A 2Y7SA 2ZX9A 4KKCC 3ZQWA 2C9XA 3T4YA 1IXMA 2IALA 5D6CB 1YY8B 2BNQB 3HAEB 1IBGL 4Y2DB 3MLYH 2D3LA 4F7MB 1B0GA 1Z9LA 4TQFA 2VDNH 5I16B 4P2QE 1E0OB 3JT2A 4LLWB 2B16A 4DV4B 1RP3B 5J6GA 2CDFB 5I76A 2UV3A 3P9LB 1KIRB 3TCLB 3WS6C 2ILLA 5IMLA 1JFQL 4Z7OF 3FMGH 3HJ0A 4LDLB 4ELMA 3GSVB 4AEHH 5GRVL 4NXNB 1FC1A 3RYMA 3QNXA 1XAUA 1KQSU 2HHHO 1JOYA 3CH1B 4YHYC 2V1DA 1JI1A 4U1LB 3SQOH 1S8DB 3BAEH 4ZFGL 5ETUA 3ZQ9A 4MNGA 4NO5B 3WTYA 5KA6A 1JXFA 4PJ8A 3QWOA 3TM6A 2X7LB 4HA1A 1AI1L 1SLXA 3ABGA 1MJ8L 1A7OL 1QSEE 4Q2ZA 4OKVA 1E43A 3NCYS 3SKJL 3V4PA 4F3FB 3AK3A 3NCJH 4YK4B 2Z8VC 4K2UH 4CBZA 5HHQB 3WEAA 1W6LA 3K6FA 2WN3A 4XWOD 1F4WL 1R3HB 3PGFL 1I8LC 2H8PB 2Q76B 3VG9C 1WQVT 2OMNA 4MJ5B 4G1EA 2VJ8A 3QFJB 3SKMA 4ADGA 2IFFH 5GGVY 1LP9B 4OM0L 4YXWG 5B3SB 5TDNB 4OZGE 5JJEB 2OXHA 3DSFL 4ZOLB 3D2TA 4IIZA 1AS8A 3VQVA 2J5LC 3V0IA 1MW3A 2DOSA 1ZSDA 1J8HA 2LFGA 3OGCA 3L1FA 5B1BC 3GLDA 2LQTA 2WSPA 1DN2A 4PJ5A 3GSXB 4K0OA 1DANU 4XN4A 1W0JG 2AHIA 5J12B 4YZWA 3QDGA 4HPYL 2MNWA 3PWUA 5EF3A 3A24A 4UU9A 1IQWL 4HCRL 4PRDB 4MNHB 2RALA 5CB4A 4PJHE 3TPKA 3WCYA 2BRRL 4X7DC 3D4CA 4PYGA 3CQPA 2WXRA 4G7VL 5T3XE 1HNWB 4A39A 5FHAH 1WA8B 3WBDA 5JCOA 2WVVB 4LASH 5AG8A 2MPVA 4GRWB 1XHXA 2YKLH 3NCFB 1FO0B 4N2AA 3FRUB 2OTUA 4FD0A 1C8PA 3GEFA 4MQXC 4YJ2A 1ILUA 4N0YH 3P3YA 4JRYD 4PS4H 1O9WA 3CFEB 1NPJA 4H88L 1LUVA 4XAWL 3TWCL 3NPSB 4PD4K 4Q52A 4R90H 2KSDA 1WLEA 2X6AA 3GKWL 1UCBL 2AZAA 3C5XA 5T1MB 3VYNA 1UJ3C 1KTRL 4A7UA 6PAZA 1KTLA 4H5SB 3CIAA 3V0DA 2PR4L 4ZUTA 3FSWA 4FXGC 3E22A 4BSJA 3BEVA 3G6AB 4P5TB 4H8VA 4N9OB 4P2YA 1XGYH 4PVBA 2JH2A 3T4ZA 2YXMA 4H1LH 1HW7A 5I1CL 4WSGA 4FE9A 4JPSA 3OKEA 4A55A 4BH7A 3LNGA 1UFUA 1U92A 3TIDA 3QA3B 5LBGA 3V5HA 1OP5H 3BHBA 3W37A 3KR3H 2FYVA 5T33H 3ZHLA 3CRCA 4QHKI 4AC4A 4WI8A 2DWTA 1P7HL 5C0DB 1FL3B 1WE5A 3G6BA 4LSPL 4Y9CA 2BS71 2FB4H 3ZHKA 5JQ6L 1Q7YW 2OZNA 4AQ1C 4GIAA 4X5PA 4E5XB 3ECQA 1ZK9A 4LRIC 4PY8I 2BHFA 4IRSD 4GT7A 1F3RB 5CCGE 5IJCC 4IYHA 2GB2A 2Q3ZA 1S7SA 1A6AB 2PMZA 5HFMA 4LF9O 4ZT1A 2OYLA 3U30B 1IGIH 4KK8C 1B6DA 3GHBL 3R0MA 3N55A 1G0XA 1GS6X 2DDQL 1OTTC 2G75B 4P9HC 4X9GA 4F7PA 1TDQA 3N3EA 2NLJB 1XGRA 3BT2H 1I7TB 2X28A 4ETYA 4PCTA 3LNHA 4C54A 5K9QG 2OMUB 3UO3A 2X2HA 5JW5B 4JI1O 3I56V 4DZBA 1FORH 1LE5A 4I48B 1I9IL 2BY3A 2AAAA 2OSXA 2VABA 1FPOA 5EBWC 1JWUA 1NFDE 4PS8A 4ABQA 2DQGH 3RBGA 5DQDL 5KA5A 4ABVA 1DJHA 2WXFA 1LWRA 4IOFC 4G6KH 7PCYA 5EIBC 1K5NA 2UY7A 3PE9A 1FA4A 2XN9D 1SQFA 1MCQA 4FLSA 4AQYB 3BKML 1A9VA 3BE1H 2FECI 4GUPA 1JBJA 1JTPA 5DQJB 5IWAB 3B6SA 3QS2A 4KTEL 2ZSWB 5I26A 4NRXB 3AWGA 3MRHB 5E8NA 3P0GB 3O9WD 2JK5B 2VSDA 4KK9C 2M2DA 4CW1B 1IM9A 4JQIL 3IMVA 4JAMA 4U1IB 2JB6B 5FA4A 4D0BB 4HT1L 4X4ZA 3P1VA 1D5XA 3AG2C 1TYEB 4Y4KA 1KJ2L 5F7DB 3RL1B 4K7PY 3RX9A 3T2QA 2BM3A 3U4AA 4D0CA 3V6ZB 1MDTA 3IAPA 3T3ME 2X6VA 5DJCA 2GK0A 2X53A 4LHQB 4UF7C 3T4YB 2IALB 3ZDZF 5CWSB 3SO5A 3A0BZ 3B83A 5DJ2B 4Z95L 3CFMA 3UO1L 3C9NB 4XPBH 4G2KA 3SKOA 2SODB 1VF6A 5JIQA 1QW8A 2UVFA 1EO8H 4NGHH 1F4YL 2CDEA 3A0HZ 2DQDH 2K70A 4JHVA 3CLEH 3DX7A 4JO3L 2J12B 5J6GB 5I76B 2QVKA 3J07A 3MXWH 1VARA 5IMLB 4OGAC 3QG7H 3UPRA 2G3NA 5GGSA 5JQGA 1X5KA 5LYJA 1AGCB 1UACH 4CS4A 2GSGA 3K4ZA 5B1KA 3N43F 3QNXB 1JPST 2ZDIC 3WE6B 5CUSL 4XBEH 4I4WB 1JZ7A 1Y0LB 2MOGA 5ICUA 4R2GB 3MX0B 4IBWA 4DR5B 3MKGA 5ETUB 1XDCA 4PCSA 3QRFM 3MBWB 1FN4A 1J87A 1NCAH 3DC0A 4M5YL 4PJ8B 3SJVD 3X14B 3QWOB 4NQXA 1QSFB 3B5HA 3KM1A 2NYZA 1C7TA 4B3RB 4AGMA 3V4PB 3Q5OA 4U1GC 1GPOH 3DUHA 3E8FA 4M48H 4PJBE 3WY2A 3Q06A 4F4LA 4GG6E 1VLXA 1YEEH 1TCRA 3IFNH 5DDHA 4JM2A 4LF6B 4B5ZA 1Q0YH 4JI5O 1S3RA 4DJMA 1C5DA 3RVWD 2B8OT 2VB5A 5E9DB 3F04A 2Z3YA 3RA7L 4G1EB 1RI8A 3SKMB 2QVIA 2XXCB 4XMKL 3QO1B 1RSFA 3MOQA 3DMMD 3ABMB 2NZIA 2OXHB 2Y07L 1E28A 3FO0L 1SJHB 3Q1EA 2H1PL 4TPRH 3QXAA 3OGCB 4UCVA 3GF8A 5EPMB 3QIUC 4WTWA 3G4SV 4YWGL 4Z7OE 5A2AA 4PJ5B 5EC1A 4A66A 2HPTA 1ZLUK 1FNLA 4ZOEA 2J6EH 4O2CA 1N32O 5E1QA 3DBSA 3EIFA 2YN5A 2ZKXA 5C07D 5HI5C 3F7RA 3SOBL 3PWUB 5A7BA 4PWGA 3F64A 4UU9B 3UCRA 3SGEI 3CCHA 1I94B 1AC0A 3N1PC 4OTXH 5T1KB 2FVNA 1BJ1J 3QQDA 3SBWC 2B0SH 3DJ9A 5HDBB 4I4TB 4LL1A 4GBXC 4TVPD 5BQDA 3CGTA 3TWYA 4W9FC 3CBRA 1KN4H 3EAKA 5ABAA 4O4JB 4GXVH 3IFXA 3U9WA 3LQZA 3PGDA 1EMTL 3Q8AA 4OJAA 1TTFA 2HUEA 2OA9A 3QZLA 2WXLA 1I1AD 1JZIA 2QM8A 1H8NA 4L29A 5HVHC 4OCYL 2IM9A 4WTQA 1TZHA 4EOWL 1W72H 1G6RA 4G5ZH 3HPJA 3EJZD 1CK0H 3OJMB 2D7TL 2AITA 1WZLA 1E3FA 2FE0A 3G7TA 2QFPA 2RN9A 1PG7X 1SQ2N 1UENA 3KBHE 1CU4H 3OC8A 1KTLB 4GG8A 4OLVL 1RIVL 2RH0A 4RLDA 3TEZA 2XUWA 2GJRA 4WCYL 3AGVA 3E22B 2NNFA 5E08H 1JHTB 1A1NA 1RZPA 2WQAA 1Q9WB 3ZT6A 4FAAB 3BQUD 3WXWL 5K1JA 1N0XL 5IQ9A 1XCWA 2AK4D 4QLRA 3FAXA 5KN5A 4YJZL 2G38A 4M4RA 3S35L 1GYAA 5GRVK 4Y19D 3OKEB 5FECA 5I1LA 1U92B 1TVHA 4AZ8B 3TIDB 2JXMA 3A6BH 2P4KA 2GITB 3V5HB 2DI7A 4KJYB 4ZFOA 4LPYA 2QZQA 4LRNH 5IM7A 3FKUS 3O2WL 5SWZB 1R24A 1ML0A 3BD4A 3OX8B 2XIIA 2DQUH 3H3KA 4IRZA 1B2WL 1KF9B 1KWGA 1VIBA 3JUZA 2ADJA 2DQHH 5SX4I 4R4FH 3DX8A 2R69L 4Q6KA 7FABL 3LH8A 5C0BA 3E38A 1S7SB 4HNAB 1T3FA 4J8RB 1F13A 4LESA 4Q4EA 5FM5M 5I74C 3OKLA 3MD0A 4WFFE 4XNUL 3MOAL 2MCG1 3GD1C 4U7KA 1PY9A 3MRPA 2A77H 5C92A 2Q87A 1WFIA 5I1DB 4XMUA 4J3OF 4BZ2A 4XNYH 4XO5A 1YPZF 5BRZA 2GPZA 1ZLVH 4TL5A 2X05A 2FX8H 2YDEA 4XVJH 3T8MA 4DZBB 3AY2A 3IETA 3LRLA 2CMRH 4KKRA 2HSIA 1JWUB 3ALPA 3CFCL 3JWOH 2N7SA 3THML 2XVGA 2G9HB 2J8UA 1SEQH 4BR6A 4K8RC 1QBZA 2Z5UA 1NBZA 3D05A 3MV8A 1K5NB 3TIEB 4CVUA 4POYA 4JQVA 1NDGA 4GUPB 4TNWK 1MVYA 2MHAA 1EXUB 3B6SB 2A1WL 2HWZH 3ERXA 2UXGA 3AS2A 1N3NA 4PGJA 2YMXL 2VZTA 4NP4L 3MACH 4KKBC 4HJSA 5E8NB 3FB8A 3GHEL 5JPNC 1H9VA 1MWAH 4RAUA 3NTCL 1IM9B 3JV4B 1OJHA 4ODWA 5FA4B 1WBYA 2YIBA 3LEXA 2OYKA 1CLZL 3VGGA 4HMEA 2CTQA 1D5XB 1CVRA 4GNKB 4AIZA 8CGTA 4IJTA 3VJ6A 4XAKE 4Y4KB 3IDYC 4D0CB 4IBVA 5EZLA 1HR0B 4L05A 4WBNA 3NG5A 3QJZA 5DJCB 4ZXBA 3U36A 5KBPA 3LB6C 1S78D 5FFOA 1V3KA 1ZEAH 5TF1H 3H9HA 3UJIH 3T2PA 1LJMA 1MJ7H 2YQGA 3RZCD 4M56A 1MJJA 5FA3A 4F8LA 4EN2A 1A7RL 2CDEB 5HSFA 1QNIA 4EQ2A 4LH7A 3DX7B 5IJDC 5C9JA 4O2AB 5K33A 3N50A 3O45A 4RQQA 1UWXH 2O4EA 3UPRB 5GGSB 5JQGB 1JX9A 3CV5A 4WU7B 4WFAV 2TRHA 3N40F 2ITCB 3QRGL 5ES4B 4G6JL 5C2BH 5FO8A 3TFKD 3NRFA 2P5PA 3HG5A 4G1MB 4YMPA 1T20B 5I1HL 3MV11 2ZNWA 4P2AA 1FN4B 3VQMA 5C0JB 1QWHA 1F90L 2LE9A 3N44B 4KY2A 4NQXB 2QADB 1RIUL 3TFBA 1TQUA 3PYCA 3LSUA 1YVLA 3DETC 3NFSL 4U1HA 4NQCE 1K4CC 1TCRB 5DDHB 4JM2B 3NQIA 2VUOA 3BVTA 4M7KL 1FXKA 3RI5K 1GGBH 4MVMA 4WNJA 3Q3GB 1QBBA 5IHUL 4LHUG 4QXTA 1E28B 1GHFL 3V6OA 4WRLA 2IOIA 1KGJA 4JZNB 4OD1L 2VIRA 4ZMVA 1WS8A 3UTZA 1N7MH 2X4UA 3JTTB 3U0PB 1MRDL 3GDCA 1EO7A 2JI3A 2C9QA 1JI2A 4B3TB 3A4EA 4JO2H 3WYRA 5EC1B 2WIMA 4LK4A 1RPOA 3ZYJA 1D6VH 1CG9B 1F8TH 4O2CB 5L88H 4TLTA 3ZHVA 3OM3B 2VDPH 1YRKA 2JJTC 4KNSA 4WFGD 5CJBA 1R3LA 5DJAA 5G4NA 2D0FA 3ZTEA 3CCHB 5MENB 3M8AA 1GKOA 1F02I 1NL0H 4L48A 4FIPC 4OLZL 3L70H 2APVA 5AOIA 1KJVA 4M5TA 3RKPA 5F6IB 4RX4A 4WKZB 1V27A 3FCSA 4YFDB 2YMTA 4KHTL 5GGTH 5ID0A 4MNQD 1BDYA 1OHQA 2CRIA 4M5ZL 2NYKA 1GZPA 3TX4A 1ULVA 3PGDB 5B5EZ 1FH5H 1L0LH 3GM8A 4H2AA 4HMCA 1CURA 3LZNA 1KBGH 2ARJA 2OSLA 5BOZG 3UL4A 3QDMD 3RX7A 1EA9C 2MPAH 4YHMH 3NP4A 4GAGL 1VQLV 4MW8A 3OAAG 1K72A 5C0EB 3U7YH 3QUZD 4XN7A 2DN9A 1KLUA 1HAUA 4M62L 3MFFA 1FNGA 4J27A 2ESVD 4JG0L 1PV0A 3FQXA 2WP3T 4FFYA 4FHBD 1OAYL 5DEGB 1NAMH 3BDXA 3SDCA 2EZ0C 2V8LA 2HZHA 1W2BU 1A1NB 2BFVH 2BVQA 2I5YL 5EBMA 4EZKA 2XY2A 1BJ1H 4BKSC 1T4KA 4ZZFA 4C57C 5IQ9B 3BKYL 1FRGH 5KN5B 2ARJQ 4AMWA 3M7OA 3HG2A 2BCKA 4J3SA 1W0KG 4P9OA 2NNAA 5FECB 5IY5B 1Z5WA 3UQ8A 5DWUL 1BJMA 1TVHB 3D85A 4APQD 3BH4A 3E6FA 2JXMB 2VM9A 1WD8A 2YAHA 2Y22A 4ZFOB 5D1ZI 1U8CA 4QAWA 4PLJC 5IM7B 4Y4FA 5BQ7A 1R24B 2A6KA 2GIYA 1ZPLA 2FCBA 1B04A 4JPVH 4ODHH 2KQMA 2Y9RT 4KKNA 4PFEA 4M8RA 1JR9A 2ADJB 1N0LA 1PCSA 2JLLA 1AXTH 3CUPA 3DX8B 4IDLA 1B88A 4ICWA 4MAUL 4UUJA 1BQKA 2FK9A 5C0BB 3VU2A 1T3FB 2J4WL 5DXWA 4AJWA 5J56B 1UEMA 3OKLB 1NVPB 3E80A 1JZJA 3CU1A 1BM3H 3LRHA 4PA9A 4GQPH 3T0AA 2Z35B 3MRPB 1VZHA 2H5UA 5IP4A 1S7WA 3JD3A 4W4OC 1AR5A 1AI5A 3OR7C 2WINB 3AVEA 3P3NA 4FEMA 3OKMB 1F97A 3ZIAG 2F7RA 1OE2A 1VQ7V 1B4LA 1S7QA 2BERA 3BLKA 3VSTA 3IJ4A 4P9ML 3K4AA 4DR7O 3VFRB 1PZDA 1JPTH 3HBPA 4CKVX 1BL8A 2EDBA 4KPHH 2CKNA 1U3NA 2J8UB 4FPPA 4GQ9H 2B1GA 2NCEA 3MV8B 3G80A 4NN6C 2GCYB 5DJXA 4DV3B 1UB5A 4JO4H 2ZKWA 1NDGB 4FYQA 4BSWA 2X2JA 2MHAB 4K5OA 3SKNA 5C93A 1N3NB 3ZRVA 2P5WE 3NUKA 2JKJA 5IUCA 1JZ5A 4FM1A 1TJIH 4RAUB 4DYLA 1G94A 2BXYA 1JGLL 1AS7A 4DV0O 1WISA 3I9IA 3MNMA 4ODWB 5I5MA 4YEEA 3ULVD 5D6DA 2IEPA 1P6FA 2KDGA 4AIZB 4N0CC 4QRFA 3PWJB 3NBNA 3FH5A 1DHKA 3F85A 4C59B 1JXKA 4BK5A 4WBNB 4ZXBB 2BZCA 2W6IG 3RJQB 1P7QD 3O6ML 1SXBA 1DLHA 3RX5A 3VQYA 3LSOA 3QIBA 5BW7C 1YPZE 2P8PB 4NZRH 2GTSA 1YHPA 3H9HB 4KDWA 1GM7A 1QQCA 4JGMA 4WUUA 3S98A 1MJJB 5FA3B 2XTJC 7PAZA 1T89A 4JHWH 5C9JB 1MHPH 2PPEA 3O45B 4RQQB 2F95B 2BNQD 1DSYA 3FTVA 4Y2DD 5C0AA 4EQ3A 3MRJB 1JPSL 2VO5A 5IDJA 1JK9A 1USQA 3U0TA 4XGZA 5EZIH 4ECNA 3GBNH 1P4LA 1NM4A 4KV5F 1YMMD 4L9DA 3A2FA 1AQDB 3VTTA 1NIBA 3M88A 1M2VB 2YPLA 1RULH 3OBAA 4LKCA 1EEYA 3MRMA 4JFFA 4PJ9D 5ESQA 5HXMA 1MNUH 4D7SA 2V8MA 4QXUL 4HXBH 4YNYA 2EUXA 1YSCA 2OP4L 4PTTA 4YE4L 1UGNA 1NGQH 1PZ5A 3BUPA 5H2FZ 5C08A 2XA8L 4DKFL 5I6XB 3LS5H 5FIEA 4FADA 4M3HA 4AJYV 3QPXH 4OFVA 2CK3G 4YFLF 3MLSH 2EDHA 1H3UA 2LV4A 5B1JC 1FXKB 1WT5C 2N1KA 1HQ4A 3SJQC 5I9QC 1B9KA 4MXWH 3VVWA 4L3FA 1CLOH 4F2EA 2E8ZA 5JOPD 5GGVL 1QLRB 4QXTB 1QP1A 1WCQA 3ZMSA 4KZEL 1UT2A 2OV0A 2GJPA 3AT9A 4I3SH 2VIRB 3UTZB 2X4UB 3GDBA 1NTZH 4RO2A 3IAYA 1CFQA 1CFTA 4O4YL 3EOTH 4WWKA 3OB0H 5DK2A 4AGLA 1HDJA 5HHNA 3EH5B 1OAKH 4ZO8A 4DR2O 12E8H 1FF5A 3BIKB 1KP3A 2NTSP 2O61A 2DLFL 2IJ0C 4DUZB 3MRIB 1AJNA 3L4CA 5JW4Q 3B7RL 5FFLA 5LP6A 5DFVD 5JHLA 4MVZA 1JZHA 1CYGA 2VZSA 3ZL4L 4APXA 5DJAB 1JDDA 1R3LB 1GGIL 3NJVA 4GLRH 2VDQB 2X41A 4PGZA 5E8PA 5K59F 3RHWF 2P3YA 5JHMA 1QLEH 4XO9A 5CP3H 4HJ0C 2H6OA 3RWHA 1AIFA 1UWYA 4X2UA 5B8CA 4XI5D 3EH3B 4AI7A 3SGJA 4WFHD 2AQ2A 2J7LA 1GZPB 5G4MA 3WDJA 2J88L 5CCKH 3OHXC 1R3KC 4N85A 4CNIA 1KLFA 2ARJB 4OLYH 2OSLB 4JN1L 5I6OA 1DVQA 5HVFB 4P8QA 4X6DA 5T5FH 3PDGA 4YZFF 4AQAB 3UPCA 2BH0A 5DFWH 4J28A 1LO4H 3NR7A 2A7BA 3ARBA 4U4IA 1KLUB 4YDNA 3PHSA 1XF4A 4TWKA 1JS4A 2Y3AA 4YX2H 5HHOD 1CFVH 3FQXB 1GH6A 1S5IH 3PAVA 4KHXL 4YAQB 3FCTB 3SCMC 3ZRCC 4KJQD 4FYRA 1ZV5A 5AL8A 1TTRA 2OL3B 5LXGH 5EBMB 2BVQB 1LO0L 3W7UA 1T4KB 4JKLA 1E2WA 4O5LL 4LSQH 3S6CA 4MVUA 5FYKE 2BCKB 3GFUA 1WAAE 3MRKB 1EUTA 2E46A 1WK0A 1OP4A 4K3DL 1A4CA 4A1RA 3ULVH 4JKPH 3E6FB 3L3KA 2RCVA 5KX5B 3SPHA 4FLOA 5LG6A 4U6YB 3VXTA 1ITCA 1M53A 3FCGA 1U8CB 4NXMO 3D34A 3FTUA 1K6QH 4HU2A 4OIAA 4ODXA 4Y4FB 5BQ7B 1EHAA 2A6KB 3RY5A 5BOPA 3KGUA 3TASA 1EJFA 1P2CA 1J05A 4RWYL 4MMXC 4DKTA 1QSEA 3KYKH 3CUPB 5BMVA 3ZRWB 2WVUA 4UUJB 4G71B 4YO0A 4OLXL 1EQWA 3BRCA 4M8QA 4G82A 4J4PD 1FLRH 3P73A 3HAEH 4BV1A 1B0RB 2JJSC 4CSZA 1QI4A 3L95A 4PJAF 4XOEA 3GYRA 4KK5D 2WN2A 5FUCE 3MR9A 3MUZ1 4N8VB 3MMEB 4JHAL 4ZAKC 5BMFH 1D5RA 3H9VA 1XSKA 2F54D 3GMOA 2VDKB 5DUML 2ID5A 4OIBA 2XWTA 5H37H 1MFDH 5EIQA 4DT2A 4IGBD 3STZC 3EZJB 1WF5A 4I1NB 3BSZH 4AQZA 5E8DH 4LNUB 4P5KA 5DJXB 3VGAC 4Y9EA 5IJ9B 5FYKU 4BSWB 3QISA 4W9DC 1S3KH 1FFPA 3EFDH 4JFUA 5IFAL 2CRZA 4J23A 2Q3AA 2ZX7A 2PR9A 2X4RB 3DTXB 3ECUA 5I8CA 1VQ4V 4MASA 3GWJA 3APCA 4QRRB 1H5BB 4YR6A 1M1KW 1LO3L 3OSKA 4DAGH 5ELIA 1OCCC 3WN6A 4ODVL 3MLPA 2DWDA 2DY2A 5IHLB 3IGKA 1UURA 5B38G 4FLVA 3QJVB 4X65B 4XCFL 4ZO6A 5AAMA 2KHAA 1FYHB 4K7PL 4N2HA 2GV9A 3L17A 1UJ3B 2QVFB 1DLHB 5AW3B 5EO9A 5HGHA 3VXPA 2NPLX 3QIBB 4Q58C 1CP9A 2EINC 3HRZA 4HW6A 1ZAGA 2ZJSL 2B9ZA 2MRYA 4RISL 4AEIL 2FWUA 3GMPB 2N74A 4GKOA 4MA7H 3UAAA 1TQVA 3U4KA 4H8PA 2NY2C 3MI6A 5C0AB 4JVUA 1KGCD 3RWIA 1SZNA 4B9GA 4HK3J 1JK9B 5FNVA 4XGZB 1JHLL 3U0TB 4X7SL 2PNDA 1P4LB 3AREA 3MA7A 6PCYA 3IXTA 1WPCA 3TA3A 2YPLB 3R4DA 2ICES 3ZHNA 4LKCB 1EEYB 5KYNA 3MRMB 4JFFB 2D0GA 1OZUA 5ESQB 2IVFC 4YNYB 4A2HA 4GUQA 3CEIA 4GRWH 4H0IA 4PTTB 1FO0H 2GBOA 3MRFA 2HRPL 1AVMA 1PZ5B 1F86A 3BKCH 3HN8A 4KITB 4X42A 3W7WA 3PJLA 1JJUA 3FB7A 2EIJC 3QUYC 3RKDC 1LO2L 4TULL 1L7TH 2E75C 5J2TA 2RA1A 3I9GH 2XNAB 1HQ4B 4OGQB 3VWJC 1A2YB 1QOKA 3HI6L 4UT7H 4YDMA 3RJDA 3UGEA 5E4EC 2DTSA 4PRBA 5AW9B 3Q05A 4O02H 2UUAO 1YQVH 2QKIA 1IAIL 5F1KC 2AQRA 4K9EH 1CQKA 4N2DA 3D1MC 4XNMA 5LBSA 1MRCL 1WEJL 2CKBH 2XACC 3HS0A 1HCZA 3IGAA 4JZOA 4GKJO 5EZOL 4BWAA 5DK2B 2IPKA 4XP5H 5GS0L 1HINL 3BZ4B 3OEEG 1PLGH 4XCEA 5DO8A 2O61B 3UP1A 1XNRB 3KLHD 3KGRA 3UAFA 1GZQB 1SDAB 3LEVL 4MB3A 1FXHA 5LP6B 1J8HD 3QZNA 1AI4A 2Q5ZA 2Z0UA 4XPAH 3MA9H 1K8AW 1RP9A 1NFDA 3QR0A 2ROXA 4APXB 2BIPA 1BYNA 1EJ8A 1UWEL 1AQ8A 2DWEC 2Q0OC 2IXQB 3K1DA 4Z8FH 2ITDC 3LOWA 2KZWA 3VTAA 3RU8H 5GJTL 3FT1A 1NMAH 3QDGD 3SDXF 3W38A 5MHSD 1YF2A 1AIFB 4P99A 4GP4B 3L9EA 2XZQL 3PU7A 5J89A 4KOBA 2Y48A 3EG9A 4DO5A 4JI4B 3JVFC 1LO5A 3SDYH 4P2RD 5DURD 1A6WH 5HDQH 4CNIB 4N2CA 1DFXA 3NGBB 4X6DB 2Q7YB 4HUWB 3HKZA 3UG4A 5D7LB 2UY6A 3ZUNC 1OAUL 3B5GA 1A32A 1WD9A 1Y07A 3ARBB 1UD2A 3U2SA 2P4VA 3UTPE 1I7FA 1A14L 1ND0B 4JRXB 4FQJL 2ZX6A 5IMKB 2DWSA 3MU3A 4BQ6A 2VRKA 5I1GH 2VAAA 1TA8A 1SESA 3IRCA 3F84A 4J6RL 5HHVH 2HX7A 1J5IA 2COQA 2V3DA 4S0SD 1HOCA 3RIAF 4F27A 5K59E 5T5NF 4LCWB 4DR4B 4NNPH 4AW7A 4U3HA 2VQFO 4HDIA 4A6YB 3G71V 3DVIA 5IVNA 3L3KB 1ZWIA 2PCPA 1KNOA 3VXTB 2BNRA 2PO6D 2EEDA 4E0RA 1E4WH 3N2KA 4QPJA 2PTUA 2R1WA 3QFGA 4ODXB 3OUSA 1JXJA 1R3IL 5EOTB 2ZXWB 1ZL8A 3T6QC 2YA0A 1CXKA 1SYVB 3DHPA 4N3TA 5ALBH 3NIGB 1P2CB 1J05B 2PI4A 1PAZA 1YNTA 5LCVA 4O4HA 4PJBA 4E42A 5BMVB 4YZFE 4GO9A 4KRMB 4LGSB 4RSVA 2N0MA 3VXRE 4M8QB 1G4YB 2KS0A 3IJHB 3S97C 2GTAA 4M4PA 4EFBA 2A9ML 3J81N 2QJDA 3IDJA 1Z66A 3A6CH 2OR9L 5D1XD 2F7QA 4JX0A 1VENA 1AOHA 4U05A 1RLWA 2W9EL 3PV6A 2VNCA 1T03L 3GMOB 3R4RA 3GSNB 1H3VA 2XWTB 5G55A 2HVJA 4YHHB 1G1YA 2V7NA 5EDXA 2GY7B 1NANH 4HGKC 1G7LA 1CICC 4I18A 3UXFA 15C8H 4YBLC 5HD8C 5ISZD 2XNDG 1IZJA 5E2UL 1Q9KA 1R4XA 4DV1B 4KJWC 1UUSA 1YECL 2KKQA 4PLNC 4NUMA 4XN1A 5C7XL 3ETQA 3J80N 3MJ9H 3V4PH 4QGYA 1Y6KR 1PZSA 2R29A 2VZ1A 4ZQKA 3G6DL 3WJLC 4N5ED 3RZWA 2FNBA 2VXQL 5JNYB 5I8CB 4KDVA 1UKTA 5LMUB 4L4TE 5CN0A 1G9MC 1MQKH 4YR6B 1ZLWK 1OLZA 3TT1L 5FO9B 3TZVB 3UZVA 1QNZL 5MERA 4XN8A 3ZBMA 3K8MA 2Q2EB 4NEHB 5F9OH 1FFTB 2DWDB 4W9KC 3U9PH 4X9BA 5FO2A 1SXSA 1BZKA 2ZWSA 4AUUA 5E5RB 3O6FC 4ZS7H 5J3HD 2YK1L 4U1MA 3S3SA 1EANA 1I4FA 3EJQA 4RDBA 4HWEH 3VD4A 5EO9B 1G4RA 5D93B 3VXPB 3ZLQC 4WFEA 4LBEC 4JI2B 3HRZB 2FECL 4HJ1A 1MCHA 4G8GE 5BZBA 3WXVH 5D2LF 1CN4A 1F2XK 2IC2A 3IE4A 1UWGH 2AEPH 4XNXL 4DGIL 4YHLL 3ESMA 4ZYKA 1A4JB 1HU8A 4KDTC 1JGEA 3UAJC 3QIWA 5FNVB 3HKEA 4OFKA 2OX5A 2IGFH 1I85A 3U0WL 3WY3A 3WFBL 3MA7B 1R1BA 3IXTB 3TA3B 2HVKC 2CPCA 3N0AA 2HFEC 4BRJA 4C56D 1UOWA 1MCRA 4PRIE 1AD0A 4R90L 1CO1A 4UTAA 4A7TA 4S11A 1RPRA 2XUMA 5ADOL 2DYRB 3U83A 5ACZA 1Q38A 4OCXH 3FB7B 4Z7VF 4JL1A 3ZMTA 5J7CC 5IYBO 5EA0L 3ZKXC 2F15A 1RUMH 4HJJH 3LZLA 2AERT 1OXYA 4PLKD 3U4BL 3HFMH 5DHDA 3BYYA 5IROA 5DD3H 3KWTA 3O8XB 4PRBB 1DVFD 1GM9A 1MZEA 1YJDH 4UINH 2F5AL 2ENQA 1RIHL 2GQHA 4MBOA 4B9JA 4WFFA 2E8YA 3HS0B 2XASA 3NSDA 3HB3B 1WFTA 4RMUA 1P4BH 1TTCA 2IPKB 3AWFA 2DLHA 3APFA 3II2A 3KR3L 1OM3H 4XCEB 4IS6A 4PJIB 3ZXAC 5KZCB 2IWKA 3RWRD 4ZIBA 4ZODA 1A7PH 3O4LD 5B4MC 2EIMC 1F6FB 4JE0A 1A22B 2DIEA 4NWTL 4TVSa 3RTQB 4A2DA 4DP4X 5A2IH 1N6QH 1NMCB 1NANI 4PV8A 4KX9A 3TN0C 4F80A 1A9BA 5JXEA 3VFSA 1XZ0A 4P59H 1XDTT 4WO4A 1H2KA 4NTYA 5LMNB 4R8WL 2ZXGA 1F7YA 5GTHZ 1EN4A 1M90W 4PBWD 1XD1A 2Y4TA 3P0VH 2LTQB 4KI5D 4L8SB 4P3CL 4PS7A 3WO4C 4YDJB 1TJGH 3V0WL 5LHGA 3JTSB 1MA1A 1L4IA 3WAKA 1SJXA 4GMSH 4QAMB 1LO5B 3WIIH 1JV2B 4LF5B 2OMTA 1IKFH 1MABG 1U95A 3S96B 3LZRA 1HZHL 4G6KL 5E8OA 3KCWA 3HAEG 2UY6B 1PIGA 3FCBA 5E94A 1WJ3A 1DTUA 4FNPA 1OOWA 5HJDA 4GPVA 4NUJA 3U2SB 1KCUL 1M7DA 1AGBA 1ZSHA 2JKXA 5KAFZ 2O6CA 5KJRL 1CI3M 4E41D 3D4ZA 3QCTL 4UI2A 3NZ8A 5KVFE 5I5JA 4OX9O 3BT0A 3QULB 2OT5A 3B77A 4OFPA 2DJMA 5H37G 5A3IC 4P30A 2Y2YA 4KH2A 3G6JF 1HOCB 2DYSB 3H7BA 3IS0X 4WV1A 2GHZA 3RDTB 4JO1H 1ETZA 1EXHA 1R5VA 4XP1L 5D2NC 5F9JA 2VW4A 5C0CE 5F2FA 3SDXE 3GSQA 1ZWIB 2PCPB 5DVKA 1KNOB 3CX5J 2BNRB 3WY1A 1MCLA 4E0RB 4KVCH 2AJVH 3N2KB 4JAVA 3K81A 3FSAA 2VCOA 4XTRC 1U2CA 2LU7A 4GS7C 3JV0A 5K9KA 1ZL8B 1G7PA 3F58H 3GMRA 4RRPG 2OTLV 4XDLA 2WWKT 4O4HB 5JW4N 4NZUH 4OBSA 2C9VA 2KZ1B 3B1UA 4PJBB 5IEHA 4FQHB 1I1RA 4MTGA 4WTZA 1A8JH 4XX5A 4UDTB 1KCRH 3RWCA 3I2CL 1O6VA 2V7HB 4KRPB 4BCYA 2I24N 3JV6A 3VRLF 3KPRB 1U3HC 4B3MB 2EDEA 3N5AA 4PVNA 4OFQA 3KXFE 1RZJH 3EADA 4CN1A 5AW1B 3MLWH 2FMLA 4FG2A 3PV6B 1IO4C 2ZD9A 2F7OA 4P2ZA 4NB5A 1GPOL 1KUQA 1BQLH 5BRZD 4NQSB 4ONGH 3TLRA 1TT6A 4S1SL 1KV7A 2VDMB 1G7LB 4I18B 4PW9A 3OAZH 1XH1A 2WNKA 4OJEH 1Q9KB 4R7XA 2A99A 3FQ1A 3CVHL 2R9HD 3JYCA 2E9BA 3B2UC 2JELH 2K8QA 1ZX3A 3R1GL 4PR5A 2X6UA 4BFJA 4ZQKB 4HIJB 2RCSH 1BGXL 1BLNA 3DX6A 4URTB 4TSCL 3K79A 2BIQA 2GJ6D 3QJQB 3OPZH 2NY0B 3UZVB 5MERB 1JYNA 4NX0A 4HIEA 3CDGA 4JPQA 3W82A 3MV9E 1HNZO 4XPGL 3MUY1 3H3PL 3C08H 2WLHA 4K94H 3HI1A 5AZ2L 2H1XA 2ICEC 4JF3A 3RTLA 1AE6H 2YIBD 3ZDYF 4F33B 4W9HC 3TYGH 4GMTH 4H2CA 1T2XA 2J1XA 1I8AA 3CSXA 4RZCA 1G5AA 2B0SL 4WEEA 1NCDH 1RSYA 1QW9A 3IBOA 2QWQB 5F96L 1YDXA 4FNSA 5DZLA 1TPXC 4R96A 1PZCA 4JYAO 2VWKA 1S5LZ 2Y36H 4ZYKB 4PW3A 5IK3A 3P32A 3MNVA 5FYJH 3QI9A 4GXVL 2AAVA 4L87A 2BDNL 3QIWB 4K5MA 3DGEA 1U6AL 3HKEB 1BIIA 1RQ5A 2OX5B 1RZIB 3GZPA 1RH8A 4MZRA 1B3IA 2VQTA 3MRCB 1GN2A 3EKCA 1VEPA 4FQXC 3ARDA 1E50A 1PX8A 4MJIE 2XBDA 3S0PA 1MCDA 3UJJL 1M05B 2JDIG 1P84F 1NIAA 1MFNA 3LKNA 5L9DL 4N3UA 1S76D 1AD0B 2YPVA 4MRBA 2A6IB 1EIBA 4NKDA 4LSUH 4X0NA 3WG7C 5BZXA 4E5XG 2VITA