3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
1R3JC 2QKSA 3RW0A 2GIXA 4EKWA 2EIMC 2H8PC 2W0FC 4MVRA 5KUMA 1M56C 2EILC 3ABMC 3F5WC 3FB6C 1ORQC 3AGWA 2ZD9A 4MVZA 3LNMB 2HFEC 2WLLB 4MS2A 4RUFA 2K1EA 5B1BC 3AG1C 4XDLA 1K4DC 5CBGA 3E8GA 1OCZC 3LDEA 4MTFA 5B3SC 3AG4C 1K4CC 4GX1A 4PDLA 4QNHB 2IH1C 1KKDA 2X6AA 5EBMC 3KG2A 4WFFA 2ITDC 2WLHA 4X88A 3SYCA 4UUJC 3SJQC 3K03A 4ZBMA 3T4ZA 2WLNA 4RAIA 4QE9A 4PA3A 4HZ3A 1J95A 4R6ZA 3SYPA 2IH3C 4MVSA 4RO2A 4MTOA 5EBWC 4PDMA 4HYOA 5EC1C 3LDCA 3SPGA 1R3IC 3ATEA 2Q67A 4I9WA 3ZJZA 3TETA 4MW8A 2EIKC 2NLJC 4PA6A 3IGAC 3SYAA 3LUTB 3UKMA 2HVJC 2WLIB 2HG5C 3E86A 2A0LA 3E8HA 3AG3C 4PDRA 5E1AC 4GX0A 5BZBA 2A9HA 2AHZA 3SYOA 3E89A 2WLJA 2WLMA 4R7CA 3OR6C 3AT9A 2ZXWC 4PA4A 3UM7A 3ATFA 4MVQA 3ASNC 3K0DA 4MVUA 2BOBC 4QE7A 4R50A 4CBCA 1V54C 4X89A 3X2QC 4MTGA 1OCCC 1BL8A 1N9PA 3ATDA 2JK5C 3VSQA 3AT8A 4XDJA 3K0GA 5J9PC 4J9YB 3RVYA 4XDKA 4JTAB 2DYSC 4H37A 3JYCA 4P9OA 4KFMA 2Q69A 2R9RB 1V55C 3BEHA 3GB7C 3HPLC 1QLEC 4RUEA 2OCCC 4PDVA 4TWKA 3SPHA 3AUWB 4OXSA 3K06A 2X6CA 3SPCA 4F4LA 1P7BA 1XL4A 4G27B 2BOCC 4P9PA 3FB8C 4PA7A 4X8AA 3SPJA 2KB1A 4DXWA 2X6BA 3OUSA 1R3KC 3F7VC 4BW5A 2WLKA 3T4DA 4JTDB 2QTOA 4H33A 1G4YB 3EFFK 1JVMA 2DYRC 4MVOA 2Q68A 4LCUC 2WLIA 1R3LC 3E83A 4WFEA 4J9ZB 4GX2A 3SPIA 1ZWIC 3FB5C 4LP8A 2Q6AA 3IFXA 1S5HC 2WLLA 3T1CA 3ABLC 4MSWC 4MW3A 1M57C 3K04A 3RBZA 3ZRSA 2EINC 2P7TC 2EIJC 3E8FA 1U4FA 4R8CA 5CBFA 5EK0A 2YEVA 4MVMA 1XL6A 3ASOC 5KUKA 3FB7C 2AHYA 3TCUA 3AG2C 2HJFC 3E8BA 2A79B 3ATAA 3ATBA 2DWDC 4GX5A 2Y69C 2ITCC 3PJSK 5EC2C 3R65A 4JTCB 1OCRC 3ABKC 4LBEC 4PA9A 3STZC 3WG7C 3K6NA 3LDDA 3RVZA 4WFHA 1U4EA 3VOUA 5IY5C 4P30A 2ATKC 3F7YC 2E4FA 2HVKC 5EBLC 3STLC 3OUFA 1OCOC 4G28B 3OGCC 3OR7C 3K08A 5B1AC 4WFGA 3SYQA 5CBHA 1LNQA 4P2ZA 3T2MA 2DWEC
chains in the Genus database with same CATH superfamily
3V6BR 4YDLC 1CR9H 3ZRVA 1NJIW 4E41B 2QM7A 3BMVA 5E7FA 1DVQA 3I75B 2ICES 4FFTA 4PAZA 2HJDA 3VD3A 3FN0H 2FH6A 4IRJD 5TQ0H 3WN6A 1E40A 2DWEA 2JKSA 1FS0G 1S78D 3DRQB 4XBPB 4RAUA 1NFAA 4JDEB 3SGEI 2RFXB 4P2AA 1F58L 1AR1C 3K03A 1YY8B 4LPUA 2QDOA 1PZ5A 4KX9A 5BPPA 5T3XE 2V2TA 2HT3C 3NYKA 1X9RA 2PO6B 3ULVL 3CJHA 2VQFB 3CZEA 1NKGA 4C56D 3ATEA 3U48A 2K9FB 2X4NB 3JD2A 3MNVA 2WXFA 5CB4B 1AHWB 2K7PA 4K3DH 2ZT9B 4M43H 4PIBA 5DA0B 2WCGA 5LLIC 4KUCF 4HIEB 4QJ3B 4M8QA 2CDEA 4LCWB 4LE8A 3WEXB 5L8JB 4N8UA 3RIAK 1SFHA 3VE0A 3K71B 5DEJA 4PJIA 1L7IH 3PQYD 1EVUA 4G80A 4RIRA 1U8JA 2XWBB 2P5WB 2C4FU 1OHZA 3D4YA 1BZDA 1PBYA 4B0MB 1WWCA 3K4AA 3WFCL 4DZ8A 4PSPA 1J8HA 3EXJA 1F58H 3II3A 3ABMB 5HI4D 3KLLA 2YGPA 3K6SA 1TTGA 4EXKA 1XEDA 3QNFA 2Z91B 3QORB 1S7WB 3LNGA 1JFFB 2GI0A 2K9UA 3I50L 2J8UE 3VD9A 5AG2A 5FNVB 3QUZB 2F9BT 2A74A 4CU6A 3QEQE 3ECVA 4YE4H 3NJIA 1WBZB 2NX5A 1CF8H 1XMWA 1HQRB 3N42F 1FVEB 5FYJH 3OAYK 5DFVD 2WVTA 4I3RH 1K34A 3OTOB 2CM5A 3V6OC 3EJPA 3QB7C 2YAMA 2FH8A 2CHXA 1MZEA 4TOIA 3ZRFC 4UYPA 4E4EA 3IDJB 4K35A 3IGLA 1OGTA 1GSKA 4JDEA 3IXAB 4OKVB 5FOBA 3EH3B 1GM8A 2FTKA 1CJYA 2XPGA 3FB5A 5IJKA 3UTPE 1FO0L 4AQYO 3ZHLA 1E9PA 1KCRH 3WFCH 4X4YB 4OCYH 3LKSB 1QP1A 2HZHA 4QF1B 3HAEH 3G5VA 2BNQD 4L8BA 4X8JA 1ZUQA 4URKA 1K92A 2EE6A 2V9QA 4DEWA 3AXHA 5ID1A 2OMTB 3BN9D 3S3BB 4OZFG 4UQCA 4GLRI 1WHOA 4P59L 5EU5A 5F1NB 2V2XA 3IC9A 4K07A 4ZUVA 4I18A 1S7VA 1HHIB 5C71A 1I5YA 4WIQA 2NUPA 3MRKB 5FLVA 1YZBA 1LNQA 2OMVA 4DJMA 5JDJA 2B3RA 1FAFA 1FRGH 3ARGB 3QQ4A 2O5XL 4LCWA 1A7NL 4P46B 1S3RA 4X6DB 3WEXA 2HJLB 4CC1A 3S88H 2YA1A 4ZPTB 1XFPA 1AQMA 4U6TA 5H37A 1L0LH 2F08A 4U1MB 1N0LB 4PG9B 3IPBA 4KXCA 4PYGA 5TF1L 4JI4B 3O41B 4UM9B 3S4SA 1BPLB 2EC9U 1HYSC 5DR5L 3V6ZA 1JZFA 5IVOA 1QVFU 4R5VA 3MGAA 4N5ED 4YIPA 2WQSA 1X5XA 2ILLA 4IKIA 4F2MB 2FJFB 3DLQR 3GSQB 4B3TO 3ES6A 1BXXA 1RHFA 2QSTA 3DWTA 3LNFA 3L2MA 4YGVA 4DFIA 1HNXB 3HIZA 1M93A 2OZ4H 3CCHB 4MQSB 4HFUL 4AQ1C 1RM1B 3HZMA 1GAFL 3TBYB 1HQRA 1OSEA 1EFQA 5KYWA 1HIML 3DA0A 4KXAA 2J5LB 3MV7B 3OR6C 5IHLB 3K0WA 3PGDA 4YSQA 3CLEH 4OTXL 3STZB 1J8SA 1DBAL 1SYVB 3ATFA 2XWCA 1INEL 3L3KB 1P6AB 2HN7A 3MUJA 3QIBB 4N6QA 3V0GA 5FPIA 5JLZA 3IDJA 2ZXQA 5T1JA 1N9PA 5I8KH 5IOKA 1B04A 3CVHB 1QVOB 5J9PC 1T83C 2IBBA 2IH8A 1JYNA 3EFDH 4Y89A 1MCHA 4UDUB 3UAFA 4DVBB 3RTQD 3F62A 1JPTH 3MNWA 4TV8B 4PBWD 1F6FB 4AMWA 1J88A 3PHQB 1T4WA 3VTMA 4ZMOA 4XCFL 5K9QG 1CD1B 5IB4B 3WS6A 4BZ2H 3DO4A 3U9WA 1NM4A 6PCYA 3GSOA 3FN9A 2BC4B 1CZ8H 1YHQV 4JRXB 5ITFB 1MVUB 2P7TA 4NTYA 3SZ6A 2IPUK 3D39D 3MRKA 1UADC 3CFDA 4HXAL 4KHXL 5CO1A 2X44D 4M29A 1GAFH 3M07A 4WVRA 3V4VL 2HJLA 3T6VA 1ZDQA 3K91A 4IW4C 3OXSB 5D7JC 5KS9E 4F93B 3CZKA 4JHAH 4U1MA 1WBYA 5PCYA 2R70A 4PRIE 3O11A 3WLWC 1DBAH 4JO1L 4U6HB 1KEGH 3UBFA 4R7XA 3O8XD 1CT8B 4WHDA 3TA3A 1CFVH 3BPLB 5KYYB 2OMWB 4YHKL 5C09E 1KPRA 3Q2WA 5A43C 4MQTB 5IB2A 3CN3A 1IEHA 4XOCA 1NCHA 1DUYA 1V54B 1PNDA 4PBVC 4WWOA 3RIFK 2EYTA 2R7EB 1KOAA 4MNQB 1L3NA 1QR4A 2AW2A 2LFEA 3ARBA 1SOKA 1BAGA 1EEZB 4PJGE 3OUFA 2HFFB 2XG5A 1B6QA 3DX7A 1YJDH 1NBZA 1K4DA 3HFFA 2PUSA 2RHEA 5IBUB 4KHXH 4QHPA 3KLKA 3P4LA 4I48A 2K0RA 2OSLA 1IBDA 3U36A 3JASA 1FV1B 3Q4HA 3L3KA 4JO2H 4FYQA 3WHE1 5EPMB 3MJ6A 4JFUA 2D03H 5IB5A 3F5WC 1G7QA 3KYNA 4RQEA 3L3HA 1JPST 1PCXA 1RZJH 5FA4A 2GIYA 2F8VA 1KTCA 3KDPB 4OGAD 1E30A 4P3DA 4PJ7F 4Y4KC 2D7NA 4M02A 4TV8A 3VXSD 3O9WA 1Z2KA 2Z92A 4Y1AE 3ROOA 4ZFOA 3I9IA 4OLXL 5K93A 2KG7B 3CZLA 4YHKH 1CD1A 4YSPA 1RURH 1M5IA 3IN2A 3BXNA 5IB4A 4K3JL 2BRRL 4XP9L 4Z7AA 1NC4D 2R29H 4PA3A 4QKTA 2P26A 5HGAB 2IH3C 2BC4A 3F83A 2BP3A 4V33A 1B0IA 2Y0SA 3QWOA 4ANWA 3QO8A 4DFHA 1R3IC 3RKPA 1NH2B 3DTUB 3BOVA 2AQ2A 2CRMA 2W59A 4XVUD 1G7PA 2IJIA 1TCRB 4PJEE 4RRPA 2C4XA 3R4RA 1ZL8A 1ACXA 1MIML 4JR9H 2ZXWC 8CGTA 2ZCEA 1BVLB 5JHLL 4FEIA 1HSAB 2ETNA 4EFBA 4PGDB 5EOCJ 2RGSA 1M7DB 1TKWA 4JFEB 4D7BA 2NY6D 2X4OA 1TEGA 1NFDF 3P3TA 3AXIA 1WFTA 2DQEL 1A6UL 1CT8A 1L7TL 2FHCA 4GY4A 1S5IL 3TPKA 1CO1A 1R4XA 3EIFA 1MJUH 1PAZA 4JI0B 1WEJH 4LSTH 4YPGA 4YSOA 2F15A 4J3UA 4X8GA 4JGUA 3T6XA 2YLKA 4JUSA 4ONGL 5MEQA 4OZIF 3K5OA 4FNLH 5J2TA 5F9WC 3MGOB 1BT8A 3FQUB 1W8OA 4UAHA 1NIFA 2VMCA 3DIDA 4MNQA 4PGEA 3H85A 3FS9A 1DVFC 5E9DE 1UD3A 1EEZA 1D5ZA 4WO0A 2LT9A 2NXZC 1IGYB 4QOKB 1SM3L 3IFLL 2N05A 3MRJB 2JCWA 4UMSA 4JYAO 3LKPB 1E5AA 4PP2A 3SOBL 4NNPL 3TL5A 2PYLA 2BX5A 3VXMB 5ETUA 4WWKB 4YHOL 2I25N 4AMKH 4JAMB 3BP7B 3MXWH 4D94A 3CAFA 3GMMB 4A67A 3J8F7 1F6LL 2DQEH 2B8OT 4L8SB 3HUJE 5PAZA 3ARDC 2KG7A 2JB6A 5I76A 4OQTH 2JCCE 5AB0A 2HEPA 3ECBB 4M7LL 5SWZD 1SXNA 3N5AA 3GXMA 1RJLB 3O6FC 2HX7A 2OTUA 4YBLC 5EU7E 1DSWA 2CK0H 4OZHE 4WKXA 3HMWL 2O72A 4KHTL 3TV3H 4X66O 1LM8V 3A6BH 3VXTB 2Y4SA 4HLZG 4KWUA 4PRAB 4YDVB 3P77A 1D5BA 1USQA 3L2NA 4Y2DC 1KZQA 2Y2YA 4OV6F 2H5UA 3IFLH 1HL9A 1MFBL 1THCA 1PZDA 4P4KB 1C7TA 4B3EA 2FBJH 1BVLA 3SDXF 3VACA 2WNKA 1HSAA 3EFFB 1MPAL 1AD0A 1ACCA 3N27A 4G72B 3MO1B 1B2YA 1JGLH 2X7LB 2JI2A 3RIAF 2YMTA 5GRVK 4X4MA 1EWHA 2DZEA 2FUTA 3V10A 1SJVA 4L37A 4JKPL 4CC0A 2JGDB 3N1FC 4XN8A 4I88A 5E00B 2VM9A 3MGOA 2ZUVA 5JW4Q 4JGMA 5AOMA 3SDYL 4XCEB 4JFTA 2R0WH 3MA9H 1FHGA 1HHJA 3U9PL 1YEIL 1IGYA 4QOKA 3OW2U 5E8PA 5FB8B 3MRJA 2Z35B 1JI1A 1PW3A 1O75A 3QIWB 3VWKD 2BCKA 1AY1H 5HDQH 5F9JB 3MOAL 1BD2B 1UQSA 4P5TD 2WWKT 4KKNA 4ODXB 5E6ZA 2YICA 4PJDE 3KPRA 1K5WA 4FQJL 5FKPA 4L1LA 4A7VA 1UACL 4JCWA 1MVYA 3FH7A 4DR3B 3LQAH 3O65A 3T4AC 3HKDA 4KK6D 2GITB 3D8CA 1J87A 3GMOB 4NC0B 3ZE0F 1N5YH 1A3QA 4F7EA 5BJTA 3H9HB 1DN0A 3ET9F 1NGXB 1EBPA 2D9QB 5E9AA 5E70A 3GNML 1CD9B 1NEZB 1R3JB 2DKSA 4FIPC 2XWJB 1INQA 1YNLH 3SOTA 3X12A 3I74A 1VFAB 4L9DA 3WUWB 3X1GA 4NQCD 4C4KT 5L3DA 2AJ3A 4UV8A 4Y5XA 2WAMA 1EJ8A 4BZ1H 3Q05A 1GPOH 1WAPA 3BCFA 3CK0H 2ZX7A 4OGQC 3QARA 4WI6A 3MDJA 3BAAA 2ROYA 2QSQA 4D7TA 5C08D 1BFTA 1DBKL 4XGZA 1KSRA 5ESAA 3W11C 1CFSB 3QUYB 1IQDB 2X7LA 4E2OA 35C8L 1OSZA 3NIDB 4FQJH 1Y66A 1S8DB 4IGBD 4ZPVB 1YPZA 1P5UC 4QCIA 2MNJB 3GRGA 4WU7B 2XFGB 3X3GL 4K73A 3DYOA 3FRPG 4HQQL 3GBNH 4ZMXA 3Q7JA 3I3BA 2BINA 2FJSA 1N19A 2R0LH 4R96B 2WK2A 3F64A 2JH2A 3GNMH 5AL8A 5KMGA 4XO4A 3PWLA 4J3OH 2HFEB 1GZPA 3F6JA 4LLYB 3MCKA 3SKUD 5I1AB 2WW8A 1PJWA 4M8RA 4J8RA 1ZOXA 2XFXB 4B41A 3BAXA 5FB8A 3H4FA 4Y16D 1NQTA 3DETC 4HZAA 4KKZA 1WC7A 3QIWA 4EQ2A 1MCWM 4AJ0A 2AMGA 4TVSa 3S5ZA 3JV6B 4FQCL 4B3VA 4NUGL 4XPAH 4OGYL 1QLRA 2YMXH 2CJUL 4JZGA 3EJYC 1RP9A 5D7LD 5H6QA 4LT7A 1PNCA 5DZ9A 1I94B 1LEIA 4XP6L 2VERA 1K5SA 1RZIA 2XIIA 2HT4D 1U58B 4Y0GA 4HCGA 4YHNA 4HQQH 5I16B 3MLSL 1NEZA 2NW2B 2BWDA 4JF3A 2ZF8A 4IOIB 3ZN6A 4HG4J 4WTWA 1J0ZA 3E8UL 1JZ8A 2RQ6A 4N8VA 3T6ZA 1MG2C 1FVDB 1FPOA 1U91B 1Y74B 3RWGB 2Z4TA 4X83A 4YHIA 3FX7A 3OJMB 3QC5X 1KCLA 4YHPA 2H45A 4LSSL 1I7FA 3BUTA 3C8KB 1TJIL 3IFOB 2XIDA 1S3KL 4JKWA 4OGYH 1LK3H 3EYVA 1LDPL 5HHQB 1IQDA 5HD8D 3SYOA 3DI3B 5EMYA 2Z0UA 2WLMA 3MHZA 4HKBB 4ZPVA 3V79C 4JJHA 3KE0A 4MCZB 4FTVD 4L2LA 1X9UA 3V5HA 5D70L 3MV9D 4QIRA 1LO3H 4Q56A 3VQXA 1AGBB 4Y5VB 1W2BU 2WQUA 3GIVB 3JTSB 4RGND 4ZSOA 2CTPA 5B38A 3FBQA 1T66D 4M00A 1S46A 2BSCA 4R2GC 1MWAB 3OGCB 2FSEB 4PY8J 3MLSH 5FM5M 3HNVL 1WO2A 32C2B 5CGYD 3FFDB 4NYKA 4GS7C 4Z7UF 5AQ0A 2B5IB 1CL7L 4PDVA 1BLNA 3G6AB 4JGNA 1RZKC 2VLJD 1ZJBA 4LWSA 2VXUL 4OFIA 4OKDA 1QI3A 3MRIB 5GGVY 4WBNB 2KBGA 3RIFF 3JV6A 1KEML 2H6OA 3CVIH 3L4ZA 4LSDA 2EABA 4LSSH 4E5XG 3RUGF 5B8CA 5IKCB 1T2QH 1TJIH 2L4OA 1XX9C 3IFPB 4PS4L 4WI4A 3WELA 4AC4A 5JJEB 1G7MA 1LTXA 1FGNH 5EBMB 4O4YH 1IAOB 4MX7B 3FT4B 4ISVB 4BFEA 5I8OL 1LDPH 3DGCR 4N90E 3E83A 1IKNC 5EBLB 3LH8A 1RIHL 1G9MH 1DQJB 3E8VA 1VCBC 5IHBA 3ZBHA 1VEPA 5G4OA 2OULB 3IXTA 5D70H 5EC2A 1WCBB 5I16A 1I8UA 2X4QB 3UADA 3V0DA 2NW2A 3IGAB 4TSCH 2GUOA 1VQ4V 2PZSA 4PWJA 1AANA 4PUBL 1A6TA 2ZYRA 4F3FB 1PDKB 5ACZB 5I71B 3TCUA 4H0GA 4I4WA 1ZWIA 2HJFC 4MXWL 3VD4A 3LHAA 5A2KH 4MGXA 1Y74A 1WGOA 4HAFA 3ZGHA 3Q13A 3VG0H 4MA3B 1TZHB 5GGSY 5AB9A 1K2DB 1LP9F 1ZT1B 4FXTA 5E5MA 3UJIH 1MIEH 2VDQL 1NCCL 2IANB 3QNEA 4TTGA 1ZTXL 5T1DH 3ZL4L 2P6JA 1YMMA 1G7JA 3T0EE 4L8CB 1UA7A 4IKNA 4AITA 3DO7B 3HCVA 4MJ5A 5IW6B 3JXAA 1BVNT 2A6DB 2HT2D 1EZUA 4QXVA 1SXSA 2IH1A 3G04A 1QRNB 5B3SC 1A6PA 4TUYA 1XB3A 4KY1H 4Y5VA 1JPFB 2P24B 4XMKH 2CR0A 1MFNA 4ZNEE 3QR0A 4H1LA 1MFCH 1Q0YH 1Y0LA 3MLXH 4GG6F 4JI2O 2D0FA 4DV6O 3FFDA 5HHOA 3NEXA 4FXGA 1AE6L 3V0WH 1MLBA 1YQ2A 4EE2A 5TF0A 1S9XB 1TUBB 4I0PD 1W0KG 4NN5B 1BQLH 3V4UL 4WBNA 3GHEH 5I1GH 1ZXQA 3NCBB 1IC4L 3ZCCA 2CBMA 4JI6B 4HYOA 3BP4A 1AFVH 2IV9A 1IAOA 3GKWL 2HRPH 3W0WB 3H9VA 4GLXA 4PDRA 1O9VA 4OCXL 4P9MH 1YNKL 3A67H 3CC1A 2R56H 1U3HD 1F18A 4NRZB 5JHMA 2Y7QA 1PY9A 4HMEA 3IDXL 1IJNA 4MVQA 3LXCA 4YHHO 4CJ0A 1Z32X 4G6MH 1CE6B 2FBRA 1NFDE 3M1CA 5EN2B 4FFZA 2HB0A 1G1OA 1U36A 4H26A 1KBHA 2ZCZA 3CN4A 3WXWH 2YD3A 1LO4L 2DQDL 1LWRA 3WFZA 1KB9J 1I8AA 1JWMB 5CJ8A 5DC0A 1FF5A 4YX2H 2QLVB 4J6RL 2EIMB 2H8PB 2W9EH 4P99A 4OZIE 4HS3B 1FFPA 5DQ9A 2HRHA 4FQQB 1N7ML 3U9UA 4QXWA 4LARH 2X6BA 2I32A 3WLBA 3DO7A 3ZKMC 4PJCB 1BHAA 1S7RA 4KRLB 4X9YA 2W65B 5ICXA 4NDMA 1EUTA 1QRNA 4JRWA 4G5ZH 3KGSA 4MVOA 2H3NA 5F3BB 2UWEB 4NKDA 5KSAB 2P24A 3O6MH 3JWOL 1S3JA 3ML0A 4FFYA 3CMOL 1UB5B 4GUCA 4UIMA 1G5AA 4FA8A 3KPSE 5KYXA 2WIIB 1WA0X 3IDXH 2WQVA 3WFDH 4FP8H 4TSFG 2CO6A 2VTFA 3MX0B 5EIIA 2C3WA 2M6YA 2UZXA 4LKXB 5LGKA 3JV4B 3GGWB 5GZOA 1B4TA 3PV6B 2A74C 2E6JA 4OAWA 4AY0A 5I73B 1S9XA 1G6RB 3RVTC 4KVCH 3CCLV 2DQDH 1YITV 1UT2A 4JAUA 1OTTC 3Q2LA 2VJ8A 4J6RH 2BNQE 5DD1H 4DV4B 4EDWH 2DQFB 5A2LH 3WG7C 2BHYA 3D6GA 5IJ9A 3GTVA 2BVQA 1D6EA 2E3CA 4UYQA 1GGYA 1N7MH 3W0WA 3O2DA 1EXHA 2VXQH 4JFDD 2DDQL 1VQ9V 2IWFA 4M62L 3L1OL 4JFPA 4HCIA 3OKDA 4AQAB 5DEDA 1FG2B 1HXYA 1IFRA 3O45A 3UP6A 5BV7L 1SN2A 3MBXH 5INCA 3HRZC 2YXWA 3SDXE 1PG7H 2P22C 1AYRA 4HIJB 5JOFB 5F7BA 3LKOB 3BAIA 4HWZB 3CQPA 1FFRA 1OW0C 3KPNB 2OTJV 3L16A 5F7FA 1PG7W 3FT1A 5K9KB 3C87A 3IJSB 3UJJL 1OB1A 3D2UD 2VR6A 2DTML 4JRYD 3VYOA 5J9PB 2F19H 5J6SA 3V0IA 5E8DL 5J12C 4E9QA 5F6IB 3VU2A 3J27A 3VJ6B 3PXHA 3UYOD 3VXNB 2AGJL 2WTRA 4GXUN 3R4DA 1GVIA 3FAWA 4IIJA 3FMGL 1VF6A 5T5FA 2DBJA 4HISA 1F6AA 4ELMA 2UWEA 4GKKB 5KSAA 2YBRB 5GGQH 4OV5A 2ZG3A 5SWSD 2W60A 3QZWG 5ENWB 3LZQA 4G6JH 2BRQA 3LHPL 2WIIA 1KXTB 3HVNA 2Q7HA 2W6JG 2R1WA 1GTFA 3T3PB 1AKJA 4FKKA 4HPOH 4ANKA 4JN1L 4TN9A 4WKZA 1QBML 2W9DL 4WU5B 3ATDA 1L1FA 4XZUA 4JO8A 2YD2A 2ZE8A 1IC5L 4QXGH 1G6RA 2VC2L 1XSIA 4DV0B 5LB1A 3T0AA 3U4BH 4NFDA 4QRAA 1MY5A 4P57A 4YL4A 3K72B 3UYPB 1XR9B 5I0ZA 1M3JA 5DK0B 1KCVL 1AXSA 2EXTA 2X70A 3LN5B 4TPRL 4LSQL 2A38A 4OF5A 2OL3B 1VJSA 3CXCU 2CH7A 3K6DA 4GW4B 4IRJA 2ERJB 5FM4A 4PJ7A 5IW1A 5LMUB 1E2VA 5JPMA 5FDWB 3L74H 1GGIL 4HWBH 1YF2A 1ND0B 4KJPD 4TLUA 3LHPH 4FM2A 1T0PB 1T2JA 4X6BB 5F9DC 3WS6C 1IBKB 3FFOA 3GRWA 3PL6D 5KLVH 4JHWL 3HZ3A 5F9OL 4C56A 1S9VB 3FH5A 4JN1H 2XTJC 3MLYL 1QBMH 2P7TC 4S0SD 1MSPA 1Z9OA 4Y4FB 4G8FA 2C1OA 1U8IA 5IFJA 4YDNA 4G42B 2GUYA 4GIOA 3LZRA 4FQIL 5CLXA 5EULV 2VLLB 3CN2A 4Q0XH 3LRMA 1TNMA 4ES8A 2SEBA 5BS0B 1IGMH 4WO4D 4XVSL 1QHTA 3VQVA 3AQXA 4PVLA 4R5XA 5DLMH 3VJ6A 1SDYA 5D6DA 4KJWC 4UFZA 1DLFH 4JG5A 2ADJA 3LNDA 4YHLL 3RX7A 2APWA 2P1YA 2V8MA 1AAJA 1FC1A 2J1XA 5LMNB 2WVVA 3PQYA 2FQDA 4NWUH 4WJ5B 5KSBF 1W6WA 2FX9H 1F4YL 4UT7L 4HHAB 2IH3B 1KTRL 3BEVA 4FLQA 2O6EA 4K8RD 5KJRL 2HRGA 3CFEA 4MDJA 4XN2A 4FLXA 1GGIH 4XR8C 2PW1B 4XO3A 4XNAA 4IBZA 4L8JA 3CC4V 4LLQA 4OB5H 4KQ3L 2BHZA 2J44A 2OR8A 2ZCLL 4YXHL 5LDUA 43C9B 1T0NB 5F9OH 4IU3B 3QDJB 4Z7VF 2ZINA 2A6IB 4MS2A 3ARBC 1K4DC 1OAQH 4OFPA 5T1LA 1JA8A 4G3YL 2YI8A 1D3CA 3SCMB 3CSYA 3V9CA 1D7DA 4XMVA 4XVSH 4ES9A 3T4ZA 1FC2D 5DJZB 3GF8A 4LCYA 2J4WL 4DRXA 3GXPA 2VXSL 4YHLH 4B95C 4R4FH 4JKKA 3OG4B 4OCMC 1HNWB 4N2AA 2NY5L 3BKML 1G1KA 3DMMB 3O9WC 1XH3A 4KQ4H 3SE3A 4M7ZB 5C0JB 1PS3A 1F4YH 4N2HA 1BZ7B 2WLIB 2QHRH 2WANA 4TSAH 4HX1B 3RGVB 2RDCA 2MPVA 5FO9A 1XBDA 5GSRB 4LF6B 3ZHKA 1IARB 1ZY9A 4W70A 4GINA 3RGHA 4N2IA 2WYHA 5ANME 5G5DB 1C12A 1M1SA 1PPIA 1Z9SB 1CICD 5LBGA 5C0AB 5F2FA 5A2QN 2A99A 1FL6B 3BFOA 4G42A 3AT8A 3KEDA 4AYSA 5KAQF 3EJJX 2EVHA 4FG0A 1SJHA 2KS0A 4DUYB 5LWYH 2PYEB 1QSFA 2WN2A 4G3YH 2OMXB 3MRQB 1KCWA 1JZEA 1N8ZA 5C0CA 2PWGA 4F1ZA 5FUOH 4Z7OB 1Z6JT 4Z7UE 3L6FB 4X5LA 2BVPB 4TUOA 4WJ5A 1AXTL 3BGFC 3VXUB 4I0KA 3OUSA 4KY2A 1H8LA 2J55A 4HHAA 5KSVA 1OCZB 4I77L 5CA1A 3S2CA 4D8PA 2HKHH 1JPGB 3RUGE 4BAYA 3SJVB 1BEYL 3MLVH 1NC2B 1RFDL 3HBZA 3KYKL 4K7FB 2X9YA 1A3LH 4OJDH 4ZUSB 4WFEA 4X2UA 3ARYA 3WKYA 5AEAA 4PWKA 4HAMA 2GVYA 5HHVL 2Y06L 4YXWG 3KCPB 1QLNA 1X5GA 1MQKL 1TIUA 3D0VB 4YQXL 1ORSA 4U1LA 4PD4F 2HVJB 4GUPA 3COOA 2OL3H 3GJFK 3SCMA 1A14H 2NZ9C 3OXRB 1OZ0A 1JCVA 1XGTA 4PRPB 5SWZE 3STLA 2VQTA 1Q72L 2MPAL 2YUAA 1VADB 2IWKA 3HEIB 5DHVA 1I7TA 2QPEB 4ONHA 1R3IL 3T4YB 2ZYIA 3S34L 3FFCD 4Q6YA 3ZYJA 1XV8A 5HPMB 4CJ1A 3DMMA 3RVZA 4M6ML 5C0JA 4M1DL 1MHCA 2E59A 3N44F 2B77A 3RA7H 3B2UD 1V3JA 1PKQE 3RTQA 4JM2B 3RGVA 1ETB1 4HUNB 3CDZB 1YECL 1P84J 3H1JH 2ICWI 3SJAC 3F7KA 5HHMB 1BEYH 2IDQA 3QPQC 1IKFH 4HGWA 1WTGT 3V0HA 2ITDA 2FIKB 1TJXA 2BP8B 1V9PA 5J11C 5DHMC 4DTGH 1A1NA 3BPOB 1DF4A 1P7QD 1SQQH 4UCSA 2HWZL 1RZ7L 1KGYE 3BW9B 3FCBA 5B1BC 1A4BA 2XAGA 5DJ6B 1ZGLB 5K39B 5GGRB 5GS0C 4GG6E 1FH2A 3SHSA 5LOVB 1EAOA 3BLPX 2FATL 3BPNB 4O4HA 1KKDA 3OJDB 4XMLH 3PWVB 2RMKB 1TQUA 4X5PA 4FLUA 4DAGH 1U8MB 1AQDA 1GMIA 1RZQA 2DQJL 2VITB 3ETTA 4GRWH 5TQ2L 1KELL 1TO5A 1TEFA 2BSBA 3HB3C 2ILMA 2BIPA 4ILDA 1JX9A 4TNWK 5AAWA 3NJJA 3W9EA 4PBDA 5AAPA 4FXKB 2AMUA 3TBWB 5HYJD 2BZCA 2UXNA 3FD9A 2Q7NA 3P2BA 1F02I 2X6UA 5L2KD 4M6NL 5BVJA 1OGAB 4O2BA 2XNAA 3L95A 3MJ7A 5IQLA 3WNLA 4KGJA 3H6AA 3RTLA 1XIWB 2Z31D 5IQNA 1QD0A 4ODSH 3FTYA 1AC6A 3MLTA 1DBJH 1WFIA 5L88H 2ZOOA 4A7UA 4MCYB 1DQKA 1ETA1 1FNFA 2AZUA 1O0VA 4NNXA 4YLCA 3EUUA 3PWJB 2G5UA 5C9JA 2R4SL 2X4TA 1U6AL 3AADB 3SPCA 4NQCE 1ORQB 1MJJA 5IF0A 1E6OL 2Q8VA 2HTLC 3Q5TA 3SDCD 1HE8A 1OTSD 1AOHA 2HVBA 3MV8B 3VXSA 3VRJB 1AQHA 3TCLB 5C08E 1A47A 3JVFC 2AJZA 3EHBB 2YUWA 2BP8A 1QOKA 2NR6C 2H1PH 3CZGA 3HHSA 4JEGB 4XBGA 1BIIA 4J7ZA 4EEEA 4L3EB 3RL2A 1MCQA 3ETDA 2XRAL 3LZOA 1H8SA 3BW9A 4JV5B 4CW1A 4G83A 5D1XB 2HMIC 4FFKA 3FW6A 5D2LE 5K39A 5A7BA 3KL3A 4NZRH 3SE6A 3QG6A 5EK0A 1N67A 3FUEA 1C5BL 3FSAA 4NO3B 4S1SL 3VYPA 4AW4A 1UD5A 2XNDG 3B2VL 4EI0A 1UWXH 1I8MB 3KBFA 3ME0B 4UTBA 1E2WA 1G9HA 1JXFA 4FQXA 2R4SH 4LQ1A 4DR4B 1I9JL 4QRUA 1U6AH 2BOBB 1GJIA 3VQYA 1QSED 2EYSA 4LGSB 2P5EA 5ILTH 2W0FA 4YDJB 4KTDL 1E6OH 1UZ6F 1U3NA 4N2OA 4Z3IA 4NXNO 3UDWA 2W07B 4AIXA 4POZD 4X20A 4N0FB 5AD0A 1NCIA 2GTWA 1OSPL 2PWDA 3NJVA 3U83A 5D7LE 1B3JA 3WIHH 3OL2A 1Q6UA 2R9HC 1A66A 4QO1A 3MJWA 5B1OA 4G7YH 5F1IB 2QADD 2Q20A 4IRZA 4GKJB 4WUUB 5CCKH 2ALWA 1KT2B 5KZCD 1QW9A 3AG1C 2MJWA 4GAGL 3NA4A 5CEYA 5GRXG 1F11A 5HGHB 3RYIB 2X6AA 1LEKB 2UUAB 2FD6H 4IKLA 2OW6A 4DN4H 3L9DA 1D5RA 3ZSSA 4DKFL 3OVUB 4UIKH 1NCDL 2VJ0A 5E4EB 3SYPA 1J95A 2Q8BL 2F54B 3ILPB 4DP6X 1A6AB 4KTDH 5KVGL 4YJ2A 1XREA 4HGMA 2IMNA 3FTGA 3JD1A 5C0FA 3MRRB 1GZQB 4I4TB 4KO9A 2H26B 1W72A 1KUQA 5DC9B 1L5GB 3MLRH 1EN4A 5JXAH 4X0NA 2LV4A 3MV9E 4HMDA 4CNIA 5EUKA 1UOLA 3ZRWB 1KF9B 4RGNE 2Q76B 1ULVA 4PV1C 2C7UA 1LP9A 4TMPA 4UU9A 4YAQB 1YYMH 3MCYA 5FUZL 3QCVL 1I8MA 4GAGH 4H37A 5D9SA 1FNEA 1AZNA 3BPCA 1E7UA 3L1EA 1TF4A 2CRZA 3HNSL 3QQ9C 4NQEB 2EDYA 2VLJE 3SPHA 3LXAA 4S0TD 1F90L 3MGTB 4TQDA 1JNLL 1RUPH 1XGZA 2ZUXA 1JPXA 3LVTA 4ODWB 3U2SA 3PDOA 3ZR6A 2H4EA 4GIPD 4F8OA 1R3KC 5B7EA 5AOZA 5E0QA 4GKLA 4YFDB 1RZGA 4HFWA 4P23D 4DR6B 1NCTA 1L0PA 4LCUC 2I7SA 1Q8IA 3D69B 3MRBA 4GEJA 4HIPA 5F1IA 4A63A 2Y23A 4CC5A 3L9RB 2PW2A 3HBGA 1ZV9A 3AS2A 4PJHB 2WKOF 1Y18A 1KT2A 3V7AG 3RVXD 3QT2A 3ULVD 3QEHB 1Q6IA 1BZQK 5B8CC 5B3SB 1N32B 4IIZA 4FN0A 4L1TA 4JPRA 1UKSA 1MY7A 1WPBA 1KTLA 3SGKA 5ISZB 4B96A 2VKXA 4N0YL 4P5TA 1FL5B 5I18L 3BUIA 1D9KB 2Q87A 3UAJD 3IM1A 3ZMTA 4TUJA 4XXCA 3STBA 3EVKA 4DK3A 1DGSA 1OJHA 3NCEB 2VDOB 3QYCA 4Y1SA 5EU3B 1A6AA 5FGSA 5EC2C 2P46B 5FECA 5C0BD 1JNLH 1WFNA 3S98A 1UM6L 4XH2A 2DW4A 1UWEL 1FPTL 3TVMD 4JI7B 2QBWA 3KLAB 4P2QE 5FDYA 3UCRA 4EMZA 3HPJB 3ARQA 3MRRA 2WB1A 1JHKL 2V5RA 3QNYB 5KSBE 5J4MA 1L9PA 5T3ZE 4LLDB 5LCVH 1HNZO 2ZWLT 4FQLL 2GSIA 1UD6A 3DGDA 4ZYKA 1AMYA 2IWGA 1MHHA 3FUNA 3ZRWA 2ZOKA 1G7IA 1OT4A 1T5XA 3CHSA 1HJCA 1EHKB 1ZA3B 4JGSA 2CHWA 4NWTL 1I3UA 4L87A 1YRKA 3LB6C 5ALBL 4MMZB 1YTFB 5IVNA 1VMGA 3GSWB 2WSKA 3J80N 3BAEL 3QJHA 4M9OA 4YDZA 1G87A 2J6EL 5C07D 2AK4A 1CU4H 3QUMB 4NQEA 2IH1C 2QVTA 1RZKL 3DVGA 4HJJH 2ZONA 3MV01 2G5BB 2V6HA 1K73W 4IGBA 4GAJH 3DIFA 5JJJB 2X3CA 2ZCKH 1YY9D 4XXDA 1EX0A 1FPTH 2VISA 4AEIH 4HK0A 3BN3B 2M1KA 4GO8A 1GC1H 4FXGC 4DF9A 4WDIB 5J1SC 5E94B 3UPAA 2EE3A 5FCUH 2WBJB 4DR2O 1A1OA 3BYTA 1S5LZ 1M90W 1HKLL 2VAJA 3QEHA 1ZVHA 4I5SA 1XSJA 2IXQA 3EOYG 4NHCH 4NWTH 4WHYG 5CKAA 3HVDA 1YN6A 2BLFA 3SBQA 1KZYA 3BAEH 4JRFA 4UT9L 4BWAA 5BQ7A 5JA9A 3VFNA 4OLZL 1W16A 1JHLH 3U4EB 4YDKH 5DMYA 3BHBA 1D5XB 2PWHA 5T1MA 4S1RL 4LHUG 2ED9A 2ALAA 1XL4A 2ESVD 2L8AA 1UJWB 3WMSA 2XV6B 4N8CH 4WTZG 4EXPX 4A68A 3Q1EA 2QPDB 3OKOA 5A9GA 4IIQA 4WW2A 2HJKA 2NCEA 1QR9A 3WJLC 4PJAF 3QO5A 4HIHA 5CWSA 4Y9GA 3QUXD 1YMHB 2FWLB 3RWIB 1JERA 4R7DB 1J9SA 3QJUB 3DARA 2Z93A 2X4RA 4NUJB 3CJJA 1CMOA 4URTB 4A6YL 1PGRB 1CVSC 3T77B 2J72A 4ZOLA 3HRZB 2NLJB 3ZKXC 2WA3A 1GIGH 4FMFA 4UT9H 3IS1X 3SSGA 5T8IA 1L6XA 4AEHL 3O3DA 4D9LH 3DX1A 2WXRA 4AEEA 4OT1H 5JJNB 5DUJA 3WD5H 2RCSH 1AHKA 1RU9L 2H7WA 2F6AA 5I17B 3LIUA 4AQYB 2IG2H 2IOMA 3L4YA 5ABDE 5DMIL 4C7UA 5J12B 3RP1A 1EJFA 3E6FB 5IVZB 3CV5A 2WBJA 3FUKA 2B20A 4IT5A 1KCUH 2JIXB 3EKCA 2KPNA 1QLEB 1J0YA 1N33B 2CBTA 2FECI 3LH2L 2BNRA 3GWOA 2JV6A 4JFSA 1KXHA 2F5AL 4H5SB 2YRBA 4NS0A 2NN4A 4NKGB 1JV5A 1IM9D 1NEUA 1DFBH 1WPXA 4AV5A 4RSYA 1H2KA 1G94A 3FFQA 2QKCA 2XV2A 3KXFB 3JATB 1FFOB 3NZ8B 4JREC 4MXVF 3RDTA 4ZS7H 1NMBL 4Q9RL 3B7UX 2AJVH 4AEHH 4X1KA 3INOA 3RPIB 4JKLA 1XGUA 1OD9A 3VW3L 5CD3B 3EO0A 1JDAA 3QXDA 3ZDXF 2GY7B 3HTLX 4FI7A 4LOUC 4BZYA 5AFAA 5K9OA 3ZE1B 4M1CD 1KYFA 2Z65C 1YUHB 1IM3B 5CSGA 3TP4A 3SYAA 2WOBA 4B3TB 2XT9A 1F7YA 1SJEB 4PJ9D 4D9QD 3E8HA 5C3TA 1GW0A 1N0JA 4J6IA 4NUJA 2AP2A 3VQLA 2I24N 3B37A 2DIJA 4OF6A 3QUMH 1U93A 5IB1B 1RIVL 2X4PB 1SS3A 4K2UL 4UCOA 4M6OH 5E79Z 4QE7A 2CO2A 1LO5A 2NY4C 4HS6B 4APQA 1O6SA 2MQCA 1VF6C 4IDJH 3O4LD 1TTUA 3EO9L 4OCLC 3VI4E 3IYLW 3MLWL 1HILB 3C08L 5DT1L 2H0EA 2X0WA 4NERA 4UANA 2UU9O 1EHAA 2Y0IA 1MCFA 4FULA 3AK3A 4H44C 1OWWA 5D93B 3HBQA 4W9HC 4MAYD 4X4XB 1F4HA 3Q3GA 3NIFF 1Z9PA 2QFPA 4QNPF 3T0EC 1RL1A 1LXMA 5FV2A 1HL8A 4A38A 3WB2A 1NAMB 2FYYB 2KKWA 2JXMB 4M7KH 2HRLA 5DSCB 1E8YA 4BFBD 1HXMA 4F20A 4YSEA 2GABA 1Q82W 3GK8H 2E7CA 3BP6A 4N68A 2IPTL 4OZGF 3K6OA 4R7NB 4AOFA 3ULVF 4QPJA 1SC5B 2ZR3A 3DUSB 3CZFB 4W68A 1R34A 1G43A 3HN3A 3MKGA 2OYMA 4IRJC 3KXFA 4MJ2A 4TULL 5HVWA 3OFNG 1FFOA 2Z8SA 3WFVA 3S36H 5CA0B 4CVXB 4NO5B 2HVKA 4AV0A 4JO3L 2VQUA 1C16A 2MTAA 4MZRA 5IMMA 1U3HA 3B7RL 2WP3T 3BVXA 3TURA 1MHEA 5DT1H 1T5WA 2DQUL 1W8NA 1GS6X 4MSWA 3K2KA 2HKFL 4BIKA 1IBMO 3KGTA 2F4VO 1HI6B 5B39B 2VDLB 3O3EB 1ZLSH 5JPNA 5L4JA 1UZ6E 4UM8A 1C8QA 2MCMA 4Z78A 4U1SB 2Z0BA 4EZMA 2AEPL 2GAZB 3I56V 3B5GA 1IBFA 1CDGA 2H6PA 2J8UB 4MMYA 3MDSA 1VENA 2IPTH 4MMXA 5D6DC 1JN6A 2OI9C 3VSUA 4M93C 1MCSA 3QEQB 2TRHA 4FNPA 5DZLA 3FB6C 2G30A 2WQWA 4HUUB 4CILA 3KYOA 2AXTZ 1DDHB 4AT6B 5FLXN 2UXFA 3L72H 3PWPD 2IADA 1GHFL 1TZGH 4JO3H 2TRYA 4PTUB 2HKOA 5FC9A 2WLZA 2X9ZA 4DT2A 3U2JA 2B1IA 2V2WB 3HC4H 4NZUL 3U46B 4B53A 1ADQA 1E0OB 5CZXD 2DQUH 5L3GA 1P9MA 4X4XA 4DIXA 1TZAA 2ZXAA 3Q9PA 4MJIE 4C57C 1Z3GH 5F7HA 3KD4A 3ULSA 2DQTL 3DGEA 2PXYD 2Y07L 2Z3FA 3BP5A 4ZDHA 2BY0A 1KPUB 2QQQA 3HE7B 4X65O 3RJQB 4B7KA 1AO7E 1URIA 3M7FB 4H2CA 3HG1A 1UXLA 2IQ9H 4BA0A 3EBGA 1RJCA 1CG9B 4NKMA 5DFVC 1RZ8B 3RX8A 43CAB 3FQ1A 3FL7A 4RMTA 1JUFB 3K2UH 3RYHB 3LEVL 4B08A 5J3HD 1CB4A 3OHXA 1T4KB 4EUPB 3ESPA 3T71A 4JFDA 3P0YH 3BKYL 3MRLA 1AGFB 5E51A 2BSEA 3MODH 1CE1H 3FT3A 1P7GA 3N9GL 1IV8A 4P8QA 1OOAA 2FEDC 1E2ZA 4N2KA 3GIZL 4H88H 3BZEB 1HI6A 3MRMA 2VDMB 3BN9C 1WLHA 4XNYL 1H5BB 4Y19E 3WFBH 4IGGA 3FOMA 2J2ZB 3UBXB 3BDYH 1ECZA 2Y07H 3QQXA 4XMPL 2WLKA 5IIEA 3FF7A 3EFFK 1NA8A 1JPEA 4JRYA 2ICEA 3BVUA 3QEQA 1UFGA 4PY8I 3B3BA 4G8IB 4MLSA 2CGNA 4HKJA 1AJ7L 4FZ8H 3HE6D 1ZX3A 3U4KA 1T1WA 3ABLC 3G5YA 3D85A 4L29A 4F7KA 3VFMA 3CXHJ 1DVXA 4JAAA 3I9AA 2CLRA 2WB7A 1A4KA 4N5EC 3U46A 1RK7A 3JWDC 3KPQB 5T3XH 5HYQA 2K4AA 3HI1A 3CVHL 3H2QA 3APOA 1NDTA 1R5VB 2JJWA 3NH7L 2WA4A 1D7BA 2ZXBA 4KVNL 2X0UA 3FFCE 3TH2T 2AI0H 4E42A 1NGPL 4XNYH 4P48A 1UZ8A 3IF1B 1TQBC 3V52L 5LXGH 3BQUA 3KPTA 3STLC 3K74B 2PY5A 1HT6A 2ZXGA 3NT0A 1NAKL 2E86A 1MH5B 1RZ8A 3EOAB 4BE5A 3NACL 5TDPA 1XGPB 2APBA 4KO5A 5HY9B 1JUFA 2IALA 2C9QA 3QW9A 2VQ4A 4X99A 4LPTA 3IAYA 3P4NA 3SE9L 1NCAL 1RPKA 3L5WB 2PCPB 3EYFB 1CD0A 2XWRA 5KS9B 1SEBA 3VMPA 1ZHLA 3P9WB 2C3VA 2OK0L 2F61A 3RTQC 3T1HO 4PRIB 3C60D 5HJGA 3DXRB 2IO5A 1FBIL 3NCJH 3S5LG 4RZCA 1RK1B 3SDLA 5HDBE 4CZZA 3HKBA 4J3VA 2ITDC 5KYUA 2G9KA 1CXZB 5I2IB 5ICZB 3RVUD 4TQPA 4S1QH 3NH7H 4C4BA 4QE9A 5DJ2B 5C09B 4PRHA 1A7QH 1NGPH 2O4EA 4ZZKA 3LRSB 1KCSH 2JI1A 5IUSA 1DP0A 4LHUD 4XB8A 3VRLF 3H4HA 1O9GA 3QUHA 5I1DA 3HS8A 2VDKH 4LNUB 1CYGA 2NXYB 2EDLA 3OLEA 5DRXA 5HYJE 5LGJB 2FWOA 3LAFA 2JS3A 4GMSL 5HGGS 4PLNC 1Q43A 4G8IA 3BJLA 3UQ8A 2GT9B 3NACH 4PJGB 3PJSA 2WUCH 3HPLA 1HHGA 3VXRE 6PAZA 1F3JB 4PS7A 3CMAV 4LSRH 1AGCA 2XZQL 4NP9A 4AYDC 1IAKB 1NCAH 4NTWA 5AAWC 4G6FB 3WJMA 1WLEA 3IAQA 3KBEA 5SV3A 3CVBA 3RVYA 1A6ZB 4J10A 2WYIA 4YEEA 4K7PY 2FEJA 3QPXH 3N2JA 1FBIH 2KDGA 4FTDA 1QTSA 2YD1A 4OF8A 3NA9L 4YZFF 5A3ID 4Y1AB 5K1VA 4RMSA 2QWPB 4A66A 3QHZH 4L4TD 4LF7B 4DVRL 1DQIA 3H1IH 1MW0A 2H0PA 1ZA6A 1LO0H 5DK3A 1N0XL 2AJUL 1UOVA 4V2BA 3B4SA 4GUOA 1I3GL 4U3JA 1Z3RA 5IYDO 5L2JB 5D5MA 4EUPH 5I30L 3MYJB 3L7FA 4NQXB 1QO3A 3AU0A 2P5OA 3GI9L 5CP7A 4HEME 1MZZA 4K3HA 4IRSA 3PFUA 3GSRB 4TVPH 5F1SA 3WGUB 4ZMTA 4OGAC 1WBXB 4PJEB 2E5LB 4PHZA 4UTAA 1H15B 1HR0O 4LNVA 1E8ZA 4ACTA 5GS0L 1NS1A 1WZKA 3KH4A 4YIQA 2VDMH 3GSNH 2V0AA 5JQ6H 2NNFA 3QAZC 4N1CA 4FLRA 5JXED 5HHXH 2LR4A 5DHDA 5E8OB 3WEMA 1HWYA 1CFTA 5I2IA 1CXLA 4ZIBA 4XB7A 4NJ9L 4BCYA 3UTSD 3W82A 1ITBB 1QSEE 4K7PL 4KTEL 1KWKA 1CICA 4ZW8A 3G80A 5JH7B 2KLSA 1KDIA 3QXAB 1AGDB 2AJUH 5IY5C 5LGJA 4KK5D 5ERWA 1TJGH 1I3GH 2RALA 5GISL 2YD4A 2LW3A 1I8LA 1RLWA 4GKOA 3U0TA 1J5OL 5E9DB 4PJGA 3R0NA 3QFJE 2X2YA 1A4JA 1F3JA 4NOFA 3OT7A 5B1CA 3GDBA 2FJHA 1A65A 1ZXKA 3FZUD 5FA3A 1WS7A 3SKNB 2OX5A 4EBQL 2W0FC 3QRGL 4U33A 1AVMA 4DV5O 4QXUL 1ZPLA 1P4BL 1JS4A 5EWIH 2CDGB 3UDWC 1E3ZA 3OKYA 4CGTA 2J12B 3B8YA 4LHQB 1MUJA 2F74A 1FI8C 2QWRB 4NHUA 3AG4C 1JGVL 3N2GA 2QVFB 1TUPA 4MXVE 1N2RB 2HG5A 4Z3JA 3HUJB 4KPHH 2CA3A 1T7VA 2JCCB 3UAAA 5FW6A 1BM3L 1YN7B 4KTEH 5ALCH 2EINB 2W95A 4F7MA 5AKRA 4YMPA 5I0YA 3N1PC 1FE8H 3M1BA 1FYTD 3ZDXE 4CN1A 3Q8BA 4MW8A 5IYCO 3CYOA 1CFNB 3CU7A 3OAUL 4GT7A 4OZHB 5GISH 5C92A 2KC0A 4GP5B 4W4LA 3CG8A 3GMQB 1J5OH 4HUVB 5D7SH 3GSRA 5EU6D 1R5IB 1JNHA 1R3KB 1B0RB 3A8TA 1IILE 2H0FA 2OXGA 4OIAA 4R8WL 5C8YA 4XZ4A 4UVAA 3VG9B 3LCYA 4BFOA 5IV2A 1OY3B 3CC2V 1KNOB 1ZHNB 3VFUB 4R50A 2Q5ZA 5CZRA 1DL7H 2DQHH 3C5ZA 5BR8O 3FQ2A 2YEVB 1K3IA 4LCUB 4NI6A 2OYKA 2FJGB 1KGCE 4D9QE 4TNFA 3OKEA 1UYWH 2DMGA 4UDTA 3SPVA 1E1QG 3CZSA 2XAHA 3WFHA 4FJZA 5AYUH 4G8GA 3H3PH 5DK2B 1ZT7B 1I4FB 1JGVH 4ZJ9A 1PZAA 1YEEL 2A5UA 4FNUA 5DRZA 4UWQB 4CGUB 3A22A 5JH7A 3EGSA 2C9AA 3B8NA 1ZVSA 1TTBA 2QQLH 1Q90A 4LLMB 4NB5A 2HA1A 3ZT6A 5E6IB 1U2HA 1D5IH 5E5LA 3BAYA 4G70B 4ZKIA 1P2CA 2ARWA 4U1NB 4QNPE 2MRYA 3OAUH 4HDIB 1BVZA 3AWGA 4CKQA 1I82A 2I5YL 1IBGH 4Z95H 2ADGB 1GM7A 5JO5B 1NDGB 2Z34A 1B06A 1O6VA 4OZGE 3D07A 3BDXA 1SXBA 4UT6H 1BJ1J 4ZOBA 3VA6A 3JAWA 1AJPA 4PV8A 2YD6A 2B15A 3WKNA 2F1MA 3O3AB 3JALB 4OQ1A 3ZU8A 4CS4A 1G7LA 4GQ9H 3FB7C 2FT7A 5FYJE 2X88A 4N86A 1RPOA 5JVDB 1JNNL 3NP4A 3ATAA 2FLBT 4GW1B 4MFHA 5KVFH 4K0KO 4JFOA 4LGPB 1E6JL 4GAYB 3X1BA 2N1TE 1OLLA 4WI5A 2BM3A 1FG9C 3LPWA 3SGKC 2J71A 3UXFA 1HP8A 4P5TC 1HAUA 3V5DB 1BW8A 4ALAC 2LGWA 4O02B 5BMVB 1H3WM 1OAKL 3HC0A 4MZ2A 5IG7A 2NZ1A 4XXCC 2HFGH 2Q7YA 1AJQA 3TFBA 4J9YB 1ZHNA 3MI6A 1Y1UA 1UA3A 3N2KB 3BRCA 3UZVA 3A5VA 2DQMA 4IOFD 2COVD 1I1YB 2WUBH 1HZHH 3ARXA 1E9OA 3N42B 5C07E 2GSGA 5L3FA 3L7EB 1INDH 2YO3A 3I3EA 5E2VL 4WFFE 3HR0A 3RNQB 4CC6A 3ARZA 3I6GB 5CN0A 2OCJA 3LQMA 3BRGC 4DV7O 3LYRA 4M48H 4DOHE 5KWYC 3GXNA 3CPWU 1OAUL 4HD9A 1N5AA 3DOHA 4PRDA 2AXGA 3I6KB 4JFXA 4LPXA 1CLOH 2V9RA 3TT3H 4FM0A 1LE5B 1VGKA 2ZWZA 1NLDH 2ETWA 3SQOH 4TV9A 1NDGA 1A6WL 1VGEL 4I0CC 4PQXA 3VD2A 3L9YA 2DOCA 5ECJE 1SVBA 1FXVA 4OW6A 1DUZB 4IGBC 2CMRL 4GFXA 3VMNA 4NO0D 4JQXC 1WAAE 4PJDA 5KHIA 3CHRA 3W39B 2H1LM 2AK1H 2P52A 3TC9A 3LS4H 5D1ZI 1B6DA 1J0JA 5DJDB 3QXTA 3QIUB 3NCMA 5JVDA 3OKKB 4AGNA 2P8PB 3GBEA 3FCUB 3DV4A 3PXJA 4JFYB 1A5FH 4OFYA 3VO0A 3H1LH 2ESVE 2ZE0A 4Y16C 3RB7A 2DQ6A 4P4RB 5FHBH 2NY2B 1QFWH 2LTQC 3FSZA 1S2EA 3R8BB 2K8QA 3D18B 1KULA 5BMVA 2EIZA 2V3EA 2APXA 2XN9A 3MPCA 1XEQA 2CDFB 2V9TA 1VQNV 1BQUA 3MJ9A 2FB4L 5BCAA 2NY7H 5AOKA 4GH7B 1TYJA 2HT4C 4OIIL 3AQYA 4XCYA 1I1YA 1M2VA 1PMYA 1X5LA 2ZXDA 4IIQC 4WW2C 1ODAA 5HHNB 3IBOA 1RIUL 2ATKA 4DK1A 3PV7A 4UV7H 3CPLA 4LLUA 3W7UA 1HWWA 5IMOA 2PN5A 1LD9A 4R6UA 4O4JB 4Z0XA 3A6CH 3HS0B 4JFHD 1NOAA 4FS0A 5GRWA 3ETEA 1AI1L 1AIZA 1CF1A 3D34A 4XRCA 5A2IH 1IO4C 1UJ3B 1GTNA 5TDNB 1MCLA 3T1YB 3CC5A 4YC2C 2F66C 4AQZA 3FU7B 1LLAA 2QGCA 1AS6A 2AQRA 4GSDL 1E5ZA 2G0LA 2X1XR 1GSMA 2G60H 3QG7L 4OH2A 5CILL 5B1NA 2CO7A 4G7VL 3A47A 5HD8C 5JQHC 5I66B 5JW5A 4DN3L 4P2RA 1DUZA 4EI5A 2GPZA 3MTRA 1IIIA 3JARB 4YR6A 4HEPG 1YEJL 3E22B 1WD9A 4HIXL 4OIIH 3H9SA 1AGEB 4RGNC 2BIQA 1C08B 1DHKA 3WN5A 3IFNL 2QR4A 2EVGA 4LLWA 4JPKL 4EDXB 5IFAH 1N68A 5GIRA 1BOYA 4G9DA 3GMLB 2VWEC 2Y1ZA 1GYUA 3MXVL 1IZJA 4OX9O 4BRJA 1M42A 4KRPD 3ZDYF 5IESH 2EZOA 1KV7A 2YD8A 2ZWKA 2OMYA 3GRBA 2QL1A 2JRIA 4FFZL 1DJIA 1EUUA 5DEFB 1I0HA 4GSDH 3P73A 5CMAA 3RDTC 5TE4L 3RPKA 3VRLE 2F7IA 2O93L 1E4KC 1ZS8A 1ID2A 3ETSA 1H6FA 4NUQA 3K1KC 3NP3A 3T0EB 2YEZA 3TJTA 1OT2A 1YEJH 1BHGA 1IAMA 4HIXH 4KNSA 2H9GA 3S6CA 5ESVB 5HHNA 1CDHA 3WKQA 1OAXL 3IFNH 5K1JA 2VR7A 2XA3A 2DI7A 3K0GA 4OD2B 4Y8AA 3FQTA 4O4JA 3WBDA 1VF5B 2BO0A 2EVIA 3MXVH 4YLQT 2XVGA 1UJ3A 3S96B 3NEEA 1DEDA 4NKQB 4JI5B 3FPXA 3WIAA 5ITZA 2ENJA 2QZ5A 4N20A 5AZEL 3ZQWA 4FFZH 4L2YA 3FT0A 3QRFM 2R59A 3X14B 2RACA 2X3AA 2QT6A 2VZOA 5EO0B 3TOPA 5I66A 4TRPH 4D8OA 2HT2C 5DUBA 3KYMA 3SJCC 5CXPA 2QTOA 4UVBA 2FZ3B 3S35H 4QGPA 1Q9LA 5FYLL 4JFWA 5BUPA 1AGEA 1UWYA 2B9BA 3O2DL 2X0LA 3PWNB 4FNRA 5AB2A 2UZIL 4LCCC 4OZ4A 2OYLA 2XKNA 4G1MA 2VRZA 3GMLA 4PY7A 3MJ8A 4BXSV 3BFRA 3U7WL 3WE1A 1JXKA 3GUFA 4H4NA 5D7JD 3IKCB 2XV0A 4I0PC 3FB6B 3NVQA 3ALXA 4FFYH 5CEXA 3WLWD 3Q44A 3BLKA 1NFDB 4NN6C 4UTCA 3VGBA 4H0LB 4N9GB 4UNUA 4GI8A 3NAAL 4OJFL 4NPYA 3C9NB 5DEFA 3HOGA 4O9HH 2LE9A 3BYYA 3Q9QA 4R3SA 4A7QA 1LMIA 5FPOA 1KPVB 4UQ3B 1Q94A 2NQCA 2W92A 3CGTA 3E3QE 4ZUWA 4TLTA 4OZIB 2HVKC 2P8MB 3O2WL 1Y76B 3N1GC 3CFKB 3PUUA 1HINL 1FGVL 5IYZA 1U3HC 2VAAB 4R7LA 4WJKB 4HVBA 3HZVB 4AYFA 3A4DA 3VQ1C 1N4XL 4ODVL 5JPNC 3CCEV 3HC3L 3ZZ1A 2HLAA 4N28A 3F7VB 3HKFA 1YSCA 4MVZA 2YBGA 4MJHA 3PWPE 3KPSB 4HU2A 1K3EA 1JK8A 1QNIA 4LAQH 4UXNA 5LP6C 1EJ6A 1XBLA 5KW9L 4GPVA 5CF3A 1P4LB 25C8H 4JY6A 5IP4A 4JFFD 4GKNB 2YGNA 5CJXC 2UVEA 1G6RL 2AQSA 2F7RA 3CFIC 5G4MA 2QKIB 1EGJH 5BRZA 1IC1A 5I5IA 1UWXK 2CIKB 3L54A 2BNQB 3IETB 2CG9X 2ENQA 4X5QA 1HDMB 3FKSG 4F15B 1QFWM 5C9KA 1YDPA 5D1QA 4ZXBA 4C55A 2P9RA 1KYDA 1MABG 2V5YA 1HINH 4ZO6A 2BDNL 4DGVH 1P9MC 2ZOLA 1X5HA 5KG9B 1MFEL 5CHNB 1WN7A 1I3RB 5DJXA 5T5FH 1B4RA 2D2CB 2MOQA 3QDME 1J10A 1ZGLP 3V7AE 3SDXB 2XTAA 4U7SA 5E2TL 5I19H 4FJCC 1JG9A 1NUGA 3GRWL 5E8EB 1MF2L 3L4WA 3FSVA 5IQ7L 1KXQA 4CMHC 1EAPA 5FV1L 1EZVY 3LSSA 3MAWA 1JI2A 3QUKB 1CGYA 3OHXC 1R46A 2YPLE 5IEKB 5IJVB 3F58L 3IJYA 3D30A 2H32A 1DE4B 4C47A 4UMGA 2BERA 4XCNB 3VI3E 4NAJA 3TPUA 5T5NG 2BZDA 3SDDD 3BGMA 3P3RA 3UO3A 3ZO9A 1UD8A 2YPVL 4MS6A 3ZIAG 1TQBB 1QMUA 5LGUA 3D3QA 1NSNL 1AJNA 1I1AD 1JK9B 1KBBA 5MENA 3GUTA 1NI8A 1JHTA 3F7VA 3EJSA 3KCWA 3RJDA 2IF7A 3IMSA 1S5HC 2YIBA 1MFEH 2K3HA 2NXZD 3C5SB 1SF5A 3BUBA 4BQ8A 5FF6B 3F84A 2UUBO 3MFFA 4TUKH 2YEQA 5DUPH 1P4LA 5EB9A 3L3IB 2IGTA 2K78A 3K9AA 2ICEC 1GZHA 4HJEA 5JHDA 1MF2H 1PLBA 3HG0A 3TF7C 3NPZB 2B14A 5IQ7H 2ICCA 4FL4B 3W7TA 1M1KW 5JR1H 3ARDD 1MREL 1JGUL 3IETA 2CUMA 4OD3L 1NL0H 2YD0A 1OP4A 3FNKA 3O4LA 1Z7JA 4PJ5E 5DFWH 2FGZA 4H8WL 1NPNA 1BGXH 2PLTA 3N1MC 3L9EA 4KX7A 5DQDH 4KZDL 1PY4A 4DZBB 1PF3A 1U30A 4Z3HA 3IDMB 1GGUA 4WHCA 4AE0A 1EXUB 1NSNH 4L8DB 4X6EA 1I3RA 1A4CA 4A55A 3GS4A 4MAYA 1GY1A 4Y2DD 4IBQA 3GO1H 4MD4A 4RWYH 4WSGA 1HKFA 1RUQH 1VACA 4DUZO 1JJ2U 3IJ4A 1MA1A 3K0YA 4H8QA 1NCJA 1R19A 3O8XB 4Q6IB 1JJOA 4LEEA 4B7EA 4DP9X 5IJVA 2RBLA 4QHLB 4XNQA 4XTRC 4PS8A 5J89A 4RO2A 2H0JA 2R4RL 1DJZA 2HX9A 4YHZH 1EVTC 2XQYA 3O6KL 1YEHL 2HXAA 1U8LB 1ZPUA 4KXDA 4P9HL 3VQ2C 4DEPC 2L35A 5CGBA 1U8HB 4CN6A 5CR1A 4W9FC 4LF9O 2F93B 4KJPC 1JK9A 2DM3A 5DI8A 4DQOH 5IW3A 2EKSB 2E9JA 3B9KD 4OSUH 3WKML 4P2OB 4F24A 1KB5B 1ZLDA 4JFZH 2X4SB 3PL6C 2UUCB 5JHLA 2CKNA 3C5SA 3J7HA 3KLDA 4Z7WA 4BK4A 4LFAB 2RN9A 1MAML 3PHOB 1KYOF 4ERSH 1EV2E 4OVVA 2K70A 4CBCA 4IKKA 1CEZA 4KXRA 4E2LA 5DURB 5ECGA 1BG1A 3JTBA 1US6A 3JWDL 3MBED 4F8TA 4K5NA 1E9QB 4U2YA 2CIIB 4WO4C 2VMFA 1EHLL 2R2EB 5A7EA 1IEBB 4PH8A 2ZG2A 4CC4C 2IQAB 3BH4A 5IQOA 3HPLC 4AL8C 4L4TE 2B4CL 3TJEL 2WN3A 2YC1B 4X64O 2YOAA 3WNKA 3HI5H 2N1KA 3QJVB 5DFTA 2AJSL 4DXWA 2WMPB 4O4LB 2X87A 2XOTA 2YSSB 2EKJA 1WZAA 1LVEA 3GLDA 5H37G 3JZYA 1YEHH 3K5SA 4JTDB 2H3OA 1IURA 4B9JA 4HSQA 1GTOA 1YAZA 2LAAA 4M9PA 3L70H 3TN0D 4R4ND 1YCSA 2YK1H 3TO2A 3S4SG 3WIIL 3ZT5A 4E9TA 5I1LB 1MZFA 2ZG1A 5AVQB 4D0CB 3ZKND 2O6DA 5JWPA 2BTQB 2YAEA 4L3CB 3I6LD 4ZTPL 2IFFL 2QQNL 1SDAB 2Y5QA 4HIIB 4MW3A 3NCXA 4I9QA 4JG0L 1NEPA 2MNWA 3L48A 2XETA 4GSRA 3QTCA 1N59A 2BY2A 2NY6B 1R3LA 1BQHA 5ANMB 3HN5A 1KIUA 4TL5A 4JHVA 2IPKA 3QFDA 3MA7B 4YDIL 4IRSC 5BOPA 4JPWL 1OV8A 1MJ8L 3KAAA 2OQJB 4HNAB 4Z23A 3M8OH 3K6NA 4PGCA 4K8ZA 4NQDD 4PREB 4FI8A 1LK2A 4F9LA 1XH1A 4Z7UB 2TSBA 1T1XB 3ZVVA 4NAMA 1DF5A 4GBXB 4N2FA 4AJVA 5DHVH 2DKMA 3ZHFA 4P2OA 3BVOA 1BBDH 1AVAA 4NC1C 2N74A 3EZ8A 5GS1A 2A83A 2R15A 3RUGB 4J28A 4B3SB 4MD0B 1CICC 3OMAB 1OAZL 3EADA 2FWUA 2NDGA 3LEXA 4WNQA 1G84A 2QQNH 2XQBH 4LQFH 3OX8B 3BSZA 2GUZB 4K7PX 4L4VE 4LVOC 2K1EA 4ONFH 2R2EA 3TFKD 1I8LC 5GGRY 2A6JB 2IQAA 4M4RA 2IAMD 1PZ2A 4GX1A 1NTKH 2FLRT 1QR8A 3CBRA 3H3KA 3TZVA 4F80A 3P3NA 2YC1A 4ODTH 4W9KC 4QRQA 1ED3B 2OJ1A 3ZDYE 3B9EA 5SWZB 3HE6A 3UTQB 3CXFA 5MEPA 1FXHA 3D9AL 3CCVV 2YGOA 3LN4A 4QTIL 5FKAB 4BFJA 4PSRA 3FSOA 2E27H 3MRDB 5SX5H 3QEUB 3ZJZA 5FS5A 1J1PH 3O9OA 2OR9H 4TM9A 1I7UB 4YHYB 5CZVL 4GRWF 4XN7A 2HG5C 3BVNB 5EU6E 2H47C 2XBTA 1XCQB 3RHWK 2Y6TE 4UV4L 1PKQB 2AXWA 5DA4A 3CDFA 5GXBB 4PG2A 1D5MB 4U0RC 9CGTA 1ZTXE 4JVWA 3VFRB 1ZD6A 1P7KA 3GD1C 4LPWA 4LSVL 4ZOCA 1DVTA 3THMH 5DMKA 3UJTL 1QBLH 4OPAA 1QUNA 4K23L 1L9TA 3I9GL 5EZYA 2VDPL 1UWGH 4HNAA 3LNEA 5IOPA 2D31B 5KTEL 4GG6B 4M5ZH 1HL4A 1IFHL 4DW1A 1SEQH 2MSPA 4JS7A 3N04A 4ACPA 2GEQA 3FB7B 3WU1A 3D9AH 4QRPA 4QTIH 1KB5H 3WO3B 1T1XA 3B2UC 4GBXA 1ZHBB 1VQ6V 1F4WL 4UTBL 2CQVA 2EBOA 1IVLA 4X6CA 3BH9A 1PLGH 5B21A 4V1DE 4Y9CA 2VL5B 3VWKB 2JGUA 1FL3B 4PJ8D 1S76D 1RUML 3ETBF 4UV4H 3OKLB 1K7DA 4L4JA 2CJSA 1PQZA 2VABA 1BFOB 1CK0H 2EXYC 1J8RA 1HEZB 2X41A 3FOLB 3MTXA 1XEUA 3TETA 5DS8A 3PNWB 3B8SA 1QPPA 4OF0A 1U8CB 1RULL 2R0KH 2GEEA 2ZAIA 3LTVA 1EO7A 3EOBA 3UC2A 1BJ8A 5DZJA 2D4FA 2R2BB 3IU4L 2VDPH 3MRPA 5D7IA 4Z3EA 3UIZA 3CX5F 2Y2WA 4WEMB 1IFHH 4OLEA 1T7WA 3MN8A 3KPPB 2QTSA 4UAOB 5CP3H 1MI5D 1MSDA 2DLIA 2QQKH 1A2YB 2Z3YA 1XCWA 2Y36L 4U7KA 1CWVA 4NQCB 4OGXL 3MQIA 5FIEA 1EHXA 4UTBH 2HH0H 1ZIBA 2VLRD 3ULUL 2Q6WA 4XMUA 3L08A 3DVFA 3KWWA 4OZFB 3UT5A 3SDAB 4AM0A 1ICTA 4KHPO 2NW3B 2F58L 3BUDA 2BFVH 4EKXA 5C08B 2R23B 1T1YA 1HNZB 3VFRA 3ZQ9A 2Z31C 4KZCA 4AH2B 1X7QA 1VQ8V 3RE0A 3BABA 5EZJB 5A1AA 4H7VA 4QRBA 1CLCA 1W72L 3SJBC 1PX4A 5CBGA 1H6EA 1A7OH 1BG9A 4LKCA 2WZPA 4J1UB 3BUYB 2MNUA 5D2LB 2JNZA 4FLZA 4X88A 2G2RB 1Q1PA 3Q6FB 4IRZH 4HBQA 5DVPA 4ENED 4I0XB 4GRLB 1CLYH 4NPKA 5M7QA 3SDCC 3HR5A 4L9LB 1H8OA 3QRLA 4I55A 4WFGE 4F8NA 4D7SA 1DLHB 2Z64C 3B9VA 3NZHH 3ILQD 5EFIA 2VSDA 3U6RB 3EH4B 3P54A 2LW1A 4OGXH 2CKBB 4Y16B 4YUEH 1Q38A 1FL3A 1NCWH 3CFMA 3E86A 1QTPA 3RI5K 4HBCL 3PGFH 1SN0A 2AHZA 2YFOA 2Y69B 3G5WA 1K6QH 2VB5A 3DSFL 3F12A 1TSRA 1MFVA 2E0PA 3OZ9H 4PA4A 4BGDA 1F4NA 5D7LB 3MRGB 5CJQH 1QQCA 1ML0A 2BPBA 3BZFB 4DR2B 3P3SA 3F7YB 3S3CB 1RUAH 2HHHO 1WA2X 1E50A 1FZKA 3F6LA 2ZUQB 2R2BA 2XZAL 4LVNB 1AI5A 5F7MC 5F7NC 4AGOA 2ZIDA 3V0AC 5D96B 3KPPA 3CSPA 1E4XL 1COWG 4M1GL 3ZKQD 5I6OA 1XGQA 2HUEA 5F0JB 3CBKB 2KB1A 3ESUF 3K9SA 2VSMB 4ALAL 4L48A 1ZSDB 4OLUL 2WWMC 1QRKA 1Q6HA 2COQA 3C5JA 4YC2B 2O57A 5JOEA 2OSXA 1JDDA 4X1IB 2XA8L 3VCLB 4HCFA 3C2AL 3SDAA 2OMBA 3O0RL 2WAQA 2EH8L 5CNHA 4WK4B 2J1WA 1B6UA 1J12A 4J23A 3MR9B 3DSFH 2WCPA 3ZKMD 3IVKA 1F23A 2LGQA 1MCOH 4Z8FL 4MYWB 4FYTA 3SGDH 1FYTA 5LVEA 3TYFA 2Y7NA 3MV9B 4IHJB 1B0GB 1J8HD 1NGYA 1VERA 1G9NC 4PU2A 1DQDL 4DR5O 2QV4A 3BLBA 5IWAO 4J42A 1SLXA 3BUPA 3IBEA 4RGNB 2D7TL 1BVKB 4JFHE 1MCBA 3CRCA 2ATPB 3JQOB 3V6OE 4GRLA 4U6YB 2A0LD 3MMEB 3K5NA 2CXGA 1DO6A 2WAHA 4L9LA 2O61B 1J9TA 2YRPA 3QR2A 4S2SB 1L9RA 4GKSB 4KROC 4OFKA 4ZUTA 3BDBA 3HJEA 2GCYA 3HLAB 4XVJL 4BINA 5BOJA 2VLJB 4JG1H 4E41D 2NX5D 1WA1X 2ATKC 1QATA 3PNRB 2NT1A 4MWFA 1LWHA 2OTWB 4MD5B 1DQQB 2XA8H 4WGWB 3RX5A 1S7UB 2P06A 3N85L 2K45A 4YJ3A 4JPSA 3W57A 4MJ6B 3T3MF 4BW5A 3VFGL 5EUOE 4BFGA 3GXIA 4XNBA 1LGVA 1BS3A 3E2HC 5JORB 3BZFA 3APFA 4UCVA 3UACA 3LMJL 1Q9KB 4ZFGL 3DXAA 4LCIH 4YXLL 2P28B 4U3XA 1YEDB 4BGLA 2VL4A 1DN2A 3BIKB 2H2PD 5L6YL 2H3KA 3CXDH 1NCNA 2X1OA 4ZQKB 2R2CA 3D25A 1EEUA 4LEXL 2DBLH 4ZNCD 4RFOH 4BDVA 7FABH 2Y5TB 3WN5C 3OKMA 2W91A 4EZJA 3MBWA 1DANT 4OZFH 3BVWA 2PETA 3H54A 3GLEA 4Z18A 4ESKA 4ZMNA 1K4CA 5GGSA 2F8XC 4ZTEA 2B3IA 3VCLA 4AVJA 2VDOL 3NTCL 4LCWD 4B3RO 4XHJC 4Z77A 5CBAB 1U92A 4DGUA 5IGXH 1CGWA 4NXKA 5CAYB 1K8IA 4P2QB 3NJFA 3N85H 1VKXB 2EO7A 1WE5A 3ULVC 1FSKC 5GTHZ 2BSTB 4N24A 1H3XA 4TOYL 3RVXC 4NKOB 4LVHC 3ZX1A 4WHTB 4LEOB 1JCKA 4ZBJA 5JOPD 1BQSA 3LMJH 3PAZA 3TESA 4JO4L 1QA9A 4MQ7A 2XWEA 4QUOA 3ABTA 5EO1B 5J6GB 1SQXH 4LCCB 4U6YA 3FO1B 1U41A 5CINL 1Z5LA 1K5NB 4FFBA 3VQWA 1YA5A 3LQZA 1SY6H 1T21A 1V27A 4RX4A 3QUZD 4XB3A 2WINB 3C75A 4PWGA 4AGQA 2A7WA 3V2AR 2DQCH 5FK9B 3BGAA 1T6VN 1DQMH 2UU9B 3AABA 1NOFA 1QSVA 2M7WA 5F7WC 2VJXA 2FX8H 2OTWA 1IXBA 3GS7A 2A6KA 5LBSA 1FN4B 3W5MA 5LGTA 5CIPB 1UZGA 3VXOB 1DEEA 3QDAA 4FE9A 2BSSA 4GUQA 1J1XH 1HCYA 2YXMA 5HJ3A 4XNZC 3IKKA 4F7PB 2QR0A 2GY5A 3NEOA 1SF9A 3V4PA 3O6LL 3T3PE 4N8VG 3HC2A 3C90A 3W2DL 3FAXA 3FTUA 1HOCB 1BQRA 2ZX8A 4U1JB 4Y4HA 1C1EL 5C70A 5I82A 1K85A 1X7SA 1HZLA 4F5CE 3REVA 2QFRA 2WCSA 2EDTA 3OR7A 1DSYA 5J5EA 1UB6A 3N43F 3QS3A 3BZ4B 2VCOA 1YY9C 5ICYA 2Q0OC 2QSAA 1ZK9A 2R1YA 1YYLL 5E03A 5AVZB 4BELD 3FU9A 2DIBA 4JN2B 4LSPL 4ZI7B 1JMZA 2DY2A 1X5KA 4KC3B 2F4VB 1BX2A 4JM0A 2VQ1B 5B38G 1L8DA 2G75B 2VIRB 2YXFA 3VDBA 1XBRA 3H9ZA 4UM9D 5HDLA 3RHWF 4KKQA 4ZMQA 4EKWA 5F3HB 1PZCA 3BKJL 3VFVB 3TA3D 4NYLB 3L81A 3VRIA 1BREA 3W2DH 4LK4A 1S7SA 2EXWC 1XOUA 2PCFB 4LF8B 1S7QA 1GN3A 1HHHB 4AVKA 1ZCRA 2MFNA 5DWUL 3VA2C 2EUVA 1YEFL 3ILEA 1RVFL 4J3WA 3ELQA 1WQVT 2F23A 1A3RL 4PJ6A 4DWHA 4I85A 1SQMA 2LP7A 3T2NH 3MV7D 3MLUH 1EO8H 3CBJB 3QZPA 5F70A 3QUXC 2BZ7A 1MCNA 1TMQA 2RQ8A 4R26L 4XPGL 5T5NF 1A9VA 5EIBD 4F7PA 2YRZA 4FHBD 2JELL 4GRWE 4HUWA 4F58L 4HOMA 1FKAO 1XF3B 1JL8A 3N44B 3I84A 3T0VA 2WWKO 3WTSA 4WCYH 1RJYA 1U8QA 1XGYH 1XR8B 3VSVA 4DHLA 4QRRA 4U1JA 1QLEL 4X0KB 5AVRB 5C0NC 3DOSB 4G1EB 5KVDH 2O5YL 1IAIL 3G6JA 4EN2A 1U8NA 2BTOA 5D1QC 3QWRD 3W37A 3BFWA 3FUIA 4UNVA 3KPMA 1FIGH 1S5HB 4CH3A 3MCLH 4JFQB 3RRQA 5E2UL 2WTPA 1ZLUK 4AE1A 2OCCC 3P30A 2K7QA 3GFUA 3QG5A 3GT6A 2LLLA 3D2UB 3TBVA 5J13B 4PJFA 3QI9A 4E9RA 5GRUL 3TO4B 1AD9A 3P4MB 2OIGA 5FL7G 4C4KO 4H1LG 4MNGE 1Q9WB 4AYEC 4R26H 4XPGH 4RNRB 4PJIF 1I8KB 2VH5L 4BH8B 1A7PH 1T0MA 2KQNA 5F3HA 3EDDA 4N0RA 3UYRL 3FCTA 1MHPL 2ICWA 4NYLA 1CBVH 1AS8A 1UUNA 4Q6GA 2DJVA 1Y6NR 1AP6A 1V3MA 4JMXA 4JZNA 3QQDB 5JW4R 1M9SA 1SVCP 3ASWA 2PCFA 1CXHA 1AH1A 1XMEB 2O5YH 5BVPH 5LJYH 3H7LA 1XVSA 2NY1B 4I5BB 4MNQD 5JNYB 5J6HA 3M17A 3I6SA 4NKIL 4FLYA 2BSRA 1U33A 5E2UH 1PCSA 3FRPB 3VI4B 4U7OA 3JCZA 4H8PA 1CQYA 2AZ0A 1DK1A 2ARJA 2BW5A 4M1CC 4PA9A 4HCRH 1BFSA 4M5YH 3PABA 1UOKA 2XX1A 5LYJA 1YAIA 4RCAA 4CRPA 5H9CA 2WXGA 4QHNB 4EKJA 1GH7A 1ADQL 4DR1B 2IU3A 4L1HA 3PIQA 4DGYH 1GZHC 1NH6A 3RWFB 6TAAA 1X4ZA 1P53A 3CFCH 4LVEA 4R0LB 4F6RB 1E7VA 2V5MA 3GJEB 2ZDIA 1NAML 4X0KA 3RZWA 1M6UA 4DPCX 1LWJA 3BWAA 3DOSA 2BOCB 5MI0B 3QDGE 4D0BB 4PJXA 4AGLA 5AW2B 1MAJA 3PL6B 4OLVH 4X98B 3ROLA 1T3FB 4OD1H 4ZW7A 1IC7H 2PTMA 3ULAB 4WTQA 2RAMA 4JDVB 4JZJA 2XXGA 4NCC2 3T1HB 1EZVX 2WLHA 4U1IB 4ABVA 2XUWA 1B90A 3DRTB 4B50A 4NO2A 4MAYC 4Z5RA 1FVCA 2G9HB 1G7HA 1SNRA 1JSYA 2L04A 2QVIA 1QYGH 2V37A 4O51A 5GS0D 3VFOB 4K9EC 4IJ3C 5EIIG 4NT6A 4JFED 5L0QC 1ADQH 3QJQB 3NZUA 2BVUA 2YRLA 4B9IA 3HB3D 5F89A 1SKVA 4TLKA 3QQDA 1SLVA 1HSBB 1UT9A 3E1ZA 3OG6B 5KSBB 1ACYH 3JSSA 5F72S 5L3EA 7PCYA 1M1XB 3NG5A 2P47B 2HLEB 1HHKA 1HVXA 1KD1W 4I5BA 4TQ8A 3NSYA 3U10A 1XCXA 5DVNA 5JHBA 1EFRG 1OCWL 3UERA 4NGHH 3NFNA 4HGKC 4AWJC 3RFZA 2XLLA 5DTFA 5DJCA 3VI4A 1D6VL 1XMQO 7TAAA 2NNRA 1KLGA 3OKNB 4JY4B 4JBSA 4QOKD 4ZK8A 4TWKA 1PD3A 1UM4H 2F7PA 2OMZA 2DN7A 2BSKA 2GJ6A 1ONQB 2DYPA 4X8AA 3DKHA 3E3QC 5AZ2H 2V7HA 3ARFB 5TFSL 1KN2L 4CN4A 2DD8L 4CADA 3NFPB 4JQIH 3VXMD 3QHFL 3KPRD 3GB7A 4MJIB 3V5KB 4F6RA 3CWBH 1X4TA 5BRQA 2W6IG 4JFFA 5EZOH 4BSVA 1WPCA 2VDNB 1DFXA 5C8JA 5ES4B 5KBDA 4E5XB 2WYTA 1AHMA 3I6LE 5F7KC 3RYMA 5MERA 1A64A 1JVLA 2B1GA 1FFQA 2YAQA 5KVGE 1BAFL 3H1ZA 1T04B 4X98A 4EN3A 3EJZD 5D2NA 3QVAA 3C12A 4G9FA 4PPTA 4NN7B 2ARHA 3GMPB 1WFUA 3QUGA 1REIA 1FJGO 1OCWH 4U1IA 1SMDA 5FO7A 3WJJA 4N21A 1OPGL 5KHHA 4A2DA 4MJ4A 3CFBB 4DCQA 3P4OA 1OQXA 2CBQA 4LRIA 5DEGA 2H3XC 5ICUA 3IK2A 4AILC 2NY3C 3JWNC 3M86A 2P80D 3NN8B 5E8NB 3TBBA 3TIDB 2Z7WA 1I9IL 2R9IA 3VAEA 2I26N 4DKDC 4Y19B 4XPFL 2J21A 1QBBA 2YJQA 1PLAA 3S3DB 3V7MA 5CBHA 3RURA 3QO0A 5C7XH 3OE7G 3RZCB 1NLBH 4X9QA 1F4XH 5DZVA 3FB8B 3OLDA 4L3EE 5F7YC 2EE9A 1F2XK 1FXKB 4EVNB 1BAFH 4DW2L 5KX5A 4F9LC 5E5UB 3SDDA 5A2BA 4OR1A 4N6RB 3WXVL 5TPWH 1AZCA 5DO2D 2FDBP 1PSKH 2OXHA 3LKQB 4XO8A 2GV9A 5AOJA 5GS1C 2CH8A 2PP9A 2PYFA 3SYCA 4XP5H 1SF3A 2X5PA 3QIWD 3QR1A 3EJTA 5AVWB 1BD2D 4X9HA 5BZDB 1DTOA 4OIBA 2AV7B 4HC1A 5JYMA 3PGCA 1LO2L 3FFCB 5ID0A 1JQ0A 3RWDB 4X5WA 3TZVC 2J73A 4HUMB 1IL1B 1XDTT 1QFUH 2DEYX 2YUZA 1WG3A 1AO7A 5BQDA 1T22B 4PCYA 3HE6C 1QAWA 1R0AL 3QBTB 1R47A 3H8NA 4LU5H 5KOMC 2YI9A 2FL4A 2UZYB 1IXMA 4JZOA 2GTZA 4FNQA 1S7XA 1ZT4B 3VX1A 5D8JL 4Q2ZB 4WW1A 3NGBB 4MASA 2JK5C 4JAVA 1J11A 3VVVA 1BQKA 4YFLF 4ZX4A 4CSZA 3HFML 5BR8B 4I2XE 3WXVH 4AL8H 3DJTA 3C8HA 4UTAL 5IM7A 2AKRB 4ZFZA 4JDZB 1HH9B 2OS7A 4UZSA 5E8NA 2W0KA 4H13B 5CU9A 5EH1A 3RWEA 2Q4PA 5HDBB 3T65B 2F54E 4ONOA 4Y19A