3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
3E83A 3LDCA 2WLMA 2AHYA 2KB1A 4QE9A 2QKSA 3K0GA 4R7CA 4CBCA 3UM7A 5EBLC 2IH1C 2Q69A 4MTOA 4WFHA 4X88A 3SYPA 4F4LA 5KUKA 3VSQA 2YEVA 5B1BC 4RUEA 1ORQC 3ZJZA 3TCUA 2DYRC 1R3LC 3ATBA 3JYCA 3SJQC 1R3JC 5EK0A 3RBZA 4PA4A 3SYAA 4J9YB 3ATFA 2EIMC 4UUJC 2NLJC 2H8PC 5CBGA 2HVKC 2K1EA 4R6ZA 1QLEC 1R3KC 4MSWC 4HYOA 2HG5C 1V55C 4H37A 1K4DC 3FB8C 3K04A 3SPIA 1R3IC 3FB7C 3AT8A 2WLJA 2OCCC 1U4EA 3T1CA 3OUSA 4RAIA 4X8AA 3AG1C 4JTCB 4DXWA 3WG7C 3ATEA 5EC1C 3IFXA 2HFEC 1V54C 3EFFK 2EINC 3AG2C 2BOCC 4MW8A 2X6BA 5EC2C 4QNHB 2GIXA 4I9WA 4XDJA 3ABMC 4XDKA 2E4FA 2WLHA 5J9PC 4PDVA 2EIKC 1ZWIC 2EILC 3E89A 4G27B 4HZ3A 3KG2A 4G28B 4PA3A 4PDRA 3AGWA 3SPGA 3E8BA 3AG3C 3GB7C 4JTDB 1KKDA 5BZBA 1LNQA 4GX2A 4GX1A 3X2QC 2ZXWC 5B3SC 2DYSC 4RO2A 5KUMA 2Q68A 3F7VC 3ATAA 3SYQA 2BOBC 2DWEC 3ABKC 1P7BA 2A0LA 3ATDA 3AUWB 2WLKA 4GX5A 4ZBMA 3AT9A 4JTAB 3ASNC 3FB5C 3K03A 3E8FA 2ATKC 2WLLB 1M56C 4RUFA 2HVJC 3ABLC 4MVQA 5B1AC 5CBFA 2ITCC 2JK5C 2P7TC 1S5HC 3E86A 3LDEA 4EKWA 4J9ZB 5IY5C 3SPHA 5EBMC 5E1AC 5EBWC 3ASOC 3RW0A 2R9RB 2WLNA 1G4YB 1JVMA 4MVUA 3SYOA 4R8CA 4PA6A 3RVZA 2A9HA 1OCOC 3T2MA 4MVZA 4PA7A 4MVMA 3STZC 1OCCC 3IGAC 2AHZA 3STLC 2X6AA 2WLLA 3PJSK 1BL8A 4PDMA 3RVYA 1U4FA 3LUTB 4GX0A 3K06A 3K08A 2ITDC 3OUFA 4P9OA 4P2ZA 3K6NA 2ZD9A 4OXSA 3F5WC 4KFMA 3FB6C 4P9PA 3TETA 3LDDA 4X89A 3VOUA 3OGCC 4H33A 2DWDC 3AG4C 4P30A 2HJFC 3LNMB 3R65A 4TWKA 1XL4A 2WLIB 3ZRSA 1K4CC 4QE7A 3BEHA 1XL6A 5CBHA 1J95A 1M57C 4MTGA 3F7YC 3OR6C 3SYCA 3T4ZA 4XDLA 1OCRC 2Q6AA 2QTOA 3OR7C 4MS2A 4MW3A 4WFEA 3UKMA 4LP8A 4MVSA 3SPCA 4PDLA 2Q67A 4MTFA 2X6CA 2EIJC 3HPLC 4BW5A 4MVOA 2A79B 3E8GA 3SPJA 4MVRA 3K0DA 3E8HA 2W0FC 4LCUC 2WLIA 4LBEC 3T4DA 2IH3C 1N9PA 1OCZC 2Y69C 4WFGA 4PA9A 4WFFA 4R50A
chains in the Genus database with same CATH superfamily
2WCGA 4NWTH 3IWUA 2SEBA 2PWEA 4BCYA 5DC4B 1S0VA 4D0BA 5I1LB 1AANA 2HFEB 4K94C 4HOWA 3ESUF 2WP3T 3DIFB 1MCIA 5T1LD 4X4ME 2DYRC 5GIRA 2EVIA 1QHTA 3QXVA 3VSVA 2OWOA 3OKNA 1BGXH 1IEAA 3GM0A 4I3RH 5DF0A 2RAMA 3X2QB 4L5FL 1JPFA 4HFWB 4RAHA 5IYDO 5MENE 4XVTH 4JFUA 5FK9A 1FFOA 2JQMA 2O6EA 3SCMC 4CILA 1R9FA 2WQVA 1IKFL 1INDH 3MU3A 4YHOL 2YXWA 4N8VA 2XX0A 4OF8A 5KHJA 3DBSA 3KLLA 1DZ0A 3SKNB 1A65A 3C08H 3G6JB 1AZZC 1AR5A 2MQCA 2LGWA 5DJ8B 3R7RA 4ZFQA 4EN3A 1TEGA 1XHXA 1HHIA 1IKNC 5DTFA 3P9MB 5KYYB 2WSDA 3LHAA 2E3VA 1XB8A 4MJ6A 5I0DA 4Z7VF 5FPRA 3C6LB 3EZJB 3WGUB 4H13C 4BWUA 4JAVA 2JE8A 2VDLL 3MOAL 4UDUB 2VABA 2Z9TA 1EGJL 2Z7UA 3RI5F 8FABB 2XN9D 3A6OA 3ASNC 1WFUA 3B7YA 3I85A 5AYUL 1IGYA 4HALA 1XV8A 5JLZA 3TNMA 2BVTA 4UV7L 5IVXE 4PRIB 4MHHG 3GXDA 2JCWA 2WBKA 2Y7QB 4R84A 2YR3A 3RW0A 1TJIL 2IMNA 1LWHA 3B7UX 3H9HA 1A7PL 4QHMB 3CE2A 4PYGA 4JI1B 3QZMA 5DQJA 4YHNB 4N90D 1QR1A 1FYTD 2HRPL 4HKJA 3ECWA 1TMQA 4WI2A 4JL1A 2HVJA 1OCZB 2AANA 4KKBD 5D1ZC 5C93A 1IKFH 1NDGA 2ZX9A 5K33A 5D96B 4Z3HA 4YHOH 2A9AA 4K9EC 5BV7C 1AP2A 4UNTA 2HJKA 4FD0A 2Y3NA 4NC2B 4GEJA 1Q0EA 1UHVA 5JQ6L 2CSPA 2CH8A 3CC5B 4TTDD 1JWSB 5D2NB 3UZQB 1ASOA 1BD2E 1N4XL 3SOTA 4NKGB 2ZOKB 3P1VA 2R1WA 5K1XA 4IM8A 5GSVA 4JVPA 1EANA 4D7PA 1S9YB 1JYVA 2X7LB 5F44A 3MOAH 2VDLH 2XAGA 5DZVA 3ZRWB 4J1UB 1MVYA 2EJRA 1DQJB 1P5UB 3HRZC 5AYUH 3RYFA 1MA1A 4UV7H 4RMQA 1UT9A 4LF3A 1XX9C 1VQPV 1VEPA 1XF4A 4BQ9A 1TJIH 2QELA 1S7QB 3D85A 1YPZF 1A7PH 1EDHA 4RGOL 2V9QA 3G5XA 3NJFA 2AK4B 1T21A 2HRPH 3E3QE 1KKCA 4H8WC 1TTBA 1Z2GA 4OAWA 5MENA 4ZOBA 1GJWA 4I55B 3TPUB 2NLJC 1QBLL 2OTUB 1BCCH 3R0NA 3WIIL 3T0AA 5CEZE 3VRIA 4Y2NA 5C86A 2MFNA 4IBUA 5JQ6H 1MUJA 4H8WH 3ABUA 4N0CD 1J8HE 2MNJB 1T1ZB 3NGBB 3C5JA 2BNQE 1XSIA 3QJFB 1NPNA 2Q8VA 4ZDHB 5EZJB 3WG7C 1N4XH 3A5VA 4F37K 4JL2A 2YBRA 2Y6SD 2OQJA 4MW8A 2JQAA 4FQXD 1HR0O 4DVBA 1OE3A 4OIFA 4QDGA 5C0DB 5DA4A 5K9KA 1Y6XA 1P2CB 4B9IA 3E89A 3CCSV 2NPLX 1I1FA 4HS3B 2OL3L 2IAMB 4Y16A 3RWEB 4PTUA 3QCUL 3EGXB 4OF0A 4OGYL 4U7SA 5DHVH 2OMVA 1BFOB 3CPLB 1VCAA 3MRLA 4YHZL 1IBDA 3ETDA 2PW2B 1SYVA 2Y5EA 4XAWL 2IVFC 3EYVB 5IVXA 1HILA 1VFBB 4C57C 3C5SA 4KMQA 1KCVL 3CCJV 1EN6A 1FFPB 3AUWB 4A6YB 2MKLC 3LQAL 1RSOB 2LGQA 1JYXA 1T66D 1LK2B 4CKQA 4RGOH 2BP8B 1UEYA 2GCYB 3VFUB 3NJXA 3C5XA 5FUZL 3NEEA 2VXUL 1QBLH 1CFNB 1MJUL 4JCWA 3WIIH 1WJ3A 4PHZA 5F0JB 3HG5A 4FFYA 4NN7C 1QSFD 2F54E 2DRUA 5C09E 1AAJA 1X4YA 1XB6A 3VFGL 4UYQA 3MFGB 4Q2ZB 5I74C 2A4ZA 5AL0A 3EW3B 3BQUC 4WCEV 4UTAA 2JKNA 4JKNA 3LDDA 2FHFA 1R34A 4U1MA 1JMKC 4ZI7A 4YY3B 2WMPB 1KJVA 4H25B 1KTLA 3NFNB 4TV9A 2DD8L 2VS0A 5BNXD 5E6IC 2AQSA 3TJHC 3KPNB 3LQAC 2OL3H 1CC3A 3D69A 3QFDA 4FXKA 1T1YA 3QCUH 1VFMA 4H8UA 4NCC1 3U9UB 5KW9L 1B4RA 1PNKA 5D93C 4IMKA 1OCWL 3RGVA 3RX7A 5JIKA 1NWOA 1PU0A 5GZNC 4KKCC 1IC4L 5E24E 2NDGA 4PWEA 2FTKA 3UAEA 1FO0L 1BXXA 1KCVH 1WFTA 2VDQL 1I7TA 3LQAH 2G9HB 1AVAA 1AHWA 5TH2B 1F4NA 3DV6A 1LUVA 1UM6L 2V17L 1N34B 2NTSP 4LLDB 5FUZH 5EN2A 2VXUH 1NKDA 1E40A 3CSPA 1MJUH 2CLVA 4L23A 3LRSA 3B6SB 1L9SA 3G80A 1ASQA 5EU6E 5JHDB 1YDXA 3N5AA 5HHOA 1S9VA 1QVOA 1EH9A 4Q89A 1MI5E 4ATWA 32C2B 1JD9A 4QLRA 1RURL 4O5LH 3VFGH 2MOVA 1A6TB 2W9DL 1J8HA 4PJ5D 1FVCA 1WH0A 5F7WC 2BNQA 3DVIA 3JWOL 4U1KB 5A7EA 3E1ZA 5DA0B 4CA4A 1YJDC 3CBJB 1DVFB 3O6FC 1MNNA 1R3HB 4A2HA 4BXVA 2E7DA 1JNJA 2OLDA 4YAQA 1H8LA 2IH9A 3K4ZA 4CMHB 3DXAE 3NCBB 3DVGA 2DD8H 2EEFA 1JA8A 2BIHA 2H26A 2I9TA 2R1XA 4RMTA 5KW9H 2ZT9B 1M7DB 5HYSA 4RRPG 3W11C 4B9YA 1OCWH 2YPLE 2XVKA 5I23A 1I5YA 3Q44A 2PO6D 3C87A 4Q14A 1DVYA 1IC4H 1CGYA 1MVFA 1E8XA 1J86A 3STLB 4DUXA 2VDQH 2IJIA 3QBTB 2OKMA 2XAJA 1TZ8A 2AXTZ 5KVEE 3KXFA 3ERXA 2APFA 1FUNA 1G94A 5DMKB 3RY5A 4Q58C 2B1GA 1UM6H 4Z7UF 2V17H 3ATAA 3DI3B 4GUPB 4RZCB 2HFGL 1P7BA 1GH7A 1XMQB 5KSVB 5DEGA 4QLWA 2UUBB 4H0HB 4X8JB 4JTAB 4PI0A 2CIIB 3JWOC 4XRCA 2ICWA 4G6FD 2ITCC 2EO1A 4I0CC 1OP3H 2O57A 4QYOB 3V0DA 2ZAIA 2F54A 5GGVL 1RURH 3BKCL 3QIBB 5DK0A 2W9DH 4K7PY 1OW0A 4DYLA 5FFGA 3JWOH 4ENEC 2FQFA 1MLBA 1DBKL 4HLZH 3VE0A 4UVBA 2OSYA 4ODBD 2PABA 5ERWA 4JYAO 1WFJA 3D36C 5SWSA 4X98B 1LO5B 3BFWA 2GK0B 2HJFB 5C8YB 4YFLF 2P6JA 1C5CL 4DRXA 2YWYA 3QUHA 4NO3B 43C9A 5JHAA 2EDRA 5AVRB 1G7IA 4XZUA 1RZGA 3AMKA 5AVVB 1W59A 2MSPA 3OJDB 1OT2A 2CUGA 3AS3A 4FKHA 5DGRA 1XF2A 3NRQA 4NNYA 4XHJC 3W9EA 4LFCO 4W9IC 3P02A 3BPCA 2P8PB 1R46A 1UB6A 3KZ8A 4WUUB 4LF4O 3K6FA 1FL3A 2FEDC 2HFGH 2VKXA 1GGUA 2VT0A 4IU2A 4OBRA 4PRBA 2GHYA 5C0BA 3LPWA 4QRPB 4ACPA 1E9PA 3ES6A 1OM9A 2ATPB 3GRBA 5EU6A 2DPKA 2GVYA 4YIOA 2XQYK 3BPNB 3SO5A 1NMCB 4PP1C 5GGVH 4R7LA 2CJTA 4HUUB 1PKXA 3BKCH 1UXLA 2ICES 3QWOB 4BFIB 3O41B 3BI9X 5TE7L 2I7OA 3AXLA 3SJVD 3RA7L 1WWBX 4EXPX 1BG9A 3QHZL 1DBKH 1YJ9V 2DWYA 1TJGL 1J8SA 1AR1D 5C3LD 2UY6A 2XNAA 3GTVA 2OMWA 4IRJB 5EOQL 4HAKA 1FFQA 3DXAA 3AQZA 1VZHA 2YMOA 5LXTA 4OLEA 4TPRL 5G2NA 3WFDH 3HZMA 3ZO0A 2WLJA 1C5CH 4IU3B 4L4VB 4LLVB 4LDEB 1RZ8B 4TUYA 4PVNA 2LU4A 2NLJA 4G72B 1O75A 5DMJB 3WHE0 4HH9A 3JZYA 4ZUSA 1IBLO 3LPGA 2GABA 1EEUA 4N6QA 3M1BA 5CILL 1TOXA 2BSTB 2YUVA 4DR5B 3TVMB 4JFOB 5BVJA 3FJTA 2YSTA 2EVJA 3P73A 3EFDL 5GS2H 5ABDE 2H6PA 4PGEA 1VF6C 5IYBO 3TA3B 2N01B 4JAAA 1QPXA 1U92A 3RQ3A 3S3WA 2L0DA 3O3AA 1ZV9A 4X0KB 4U1SB 5E95B 4DV0O 1X5JA 2Q5BA 4HXBH 4WI0A 4R8WL 2YQGA 3WE6A 3TLRA 3NP3A 3OAYK 4PR5B 3OFNG 5FLVA 3SODB 2FSDA 5EO1A 3ISWA 5F7UA 3GWOA 1JZHA 3WENA 4L3FA 2OULB 4XBFA 4PB9L 2ZWZA 4FAAB 3BZEB 3O4LD 1CLVA 4NRYA 5TE7H 1G0DA 2NTFB 3GZPA 1XB3A 3KPLA 3QHZH 4KFZC 1OAJA 7PAZA 1A0QL 1TJGH 3TH2T 1NLBH 1T83C 3VXOB 2VIRA 4HJGA 5CGTA 5FWQA 3BKJL 3GO1L 5FIEA 1A6WL 3OL2A 4EI0A 5EOQH 4MVZA 2W0FB 4RMBA 5FFOA 1BLIA 2E5LO 4TPRH 3VFSA 1JK9B 2HLAA 3DGEA 2ARWA 1F7YA 4HUWA 2ZE7A 1K2DB 3K06A 1KENL 5C6TL 5T33L 2XAHA 2WO4A 2UXDB 2DV6A 2IU0A 2PMZA 4UWQB 3OSVA 3QUXB 4IJ3B 3H1KH 3VVWA 5CILH 2FLRT 1HHJA 2G60L 5J6HA 3EFDH 1COWG 1QSEA 4Y0GA 4B3SB 5LAPA 4UB0L 4QHPA 2LFSA 5H6QA 2H4EA 1BVOA 1EEYA 3PGCB 5C2BL 3C5ZA 3T4YB 3VWKC 1DUYB 1IC5L 3H6AA 3O9WD 4R8WH 1XFPA 3LZQA 1CICB 1TVBB 2B1HL 4KK8C 4ACTA 1P7KA 5I18H 1HNXO 3MDJA 3BT0A 4LLMA 4LASL 3EKCA 3O3DA 4MAYC 4YFEA 4YPJA 4PB9H 3JARB 3QHTC 5BMVA 3OX8B 4DZBA 3NCJL 5JPNC 4WHDA 1VADB 1DLHA 4Z7VB 1A8JH 5GZNA 2FYYA 1CBVL 1A0QH 5EUOE 2R0ZL 3BKJH 3GO1H 4NKMA 1WPCA 1VQNV 1A6WH 4HSAC 3TWCL 1WTGT 1IILE 2DI9A 3RVTC 4NDMB 5C6TH 4M61A 5T33H 1AD0B 1MDTA 3LD8B 3WAKA 4ANKA 3HB3B 3LZPA 1PYWA 3FTSA 4LLAA 3UMNA 2Q6WB 3FB8B 1NTDA 1ETJA 1KB3A 3JBG7 1BBJB 3K72A 1T1XA 5JIPA 3EGDB 3QJVB 1D5NA 2N04A 2G60H 3GI8L 3KPSE 4C56B 2BWDA 4H0LC 1KT2B 4F6RB 5AOLA 3JUYA 4UB0H 4DV7B 4PPTA 1TA8A 2ADFL 4UBDC 35C8L 5C2BH 4U0RB 3E6HB 3EH1A 1YEJL 1IC5H 3U7YL 3O6FA 3BAAA 3FQ1A 2OPCA 3MJ7A 4B9PA 5AUMB 3FH8A 4AQYB 4LASH 4MAZA 4Y4HD 2H3NA 3WJLC 5JHBA 4O4HA 2CTRA 1G7HA 5BZXA 1YAZA 5B1NA 2CBMA 3NCJH 1O5PA 3SDDD 3WY4A 3EG9A 4CMMB 1B06A 3EJJX 4JQXC 1CBVH 3BDXA 2BWIA 3LKSB 2R0ZH 5E00A 3DRQA 4XNDA 4MYPA 2R1YB 4QPKA 3TWCH 3VDAA 5GS1B 1W80A 2YIHA 1KTRL 3F5WA 4AI8A 1DYZA 2P5WB 4JFTA 4J3XA 1NMBL 3P77A 1Q81W 2UV3A 4L3AA 1J5HA 5LWYL 4LB8A 5HHPA 5T1KA 1WD9A 3NSYA 2TRHA 2ITCA 1BXVA 1YPZB 3E6FA 4F1SA 1V8HA 3MAWA 4ZMNA 1Z3GL 2QVKA 5FM5O 3GI8H 5EU4B 1CFTA 3CN1A 2FEEL 4LPXA 1BAFL 4U2ZA 2ADFH 3KLHC 3TH4T 3JASB 35C8H 3CQFA 3O45A 1BQ0A 4KK9C 5HDRA 1YEJH 2W88A 3OR7B 4JO5A 3U7YH 2LTQC 5CCHE 3O8XB 2Y72A 2J1WA 3P54A 3M17B 5E5RB 4PDLA 3MLVL 3D36A 3ZKNC 5A3IC 2NY0C 2X0VA 2HG5B 1YEDA 4BSVA 4YDVB 3EO9L 1P6AB 2ARJB 4MB3A 4J3SA 5EULV 4MLSA 3DHJA 3HRPA 3MRDA 3S2CA 3S5LB 2DQGL 5EUOA 3S5LG 2AXJA 1VKXB 1E43A 2JIXB 4D9QE 4LAQL 1FFRA 4ETQA 3ULVC 3TJEL 2X2HA 3RNKA 3IPEA 4A7TA 2LV4A 1Y67A 4LFBB 3A4DA 3CXFA 1NMBH 3QULB 5CHNB 4XGZB 5HD8D 1HCZA 1P7GA 2V7NB 3OPZL 2VNCA 4XPTH 4E41B 4CGUB 3B1UA 5LWYH 2CA3A 4GRMB 5JW3L 4HV8A 5D7KD 1Z3GH 3ULVH 3LRKA 1D2DA 5DUJA 3CCHA 3KPSA 3MACL 2CR0A 1WD8A 2YD2A 2P4VA 2UUCO 1NANH 4F57L 2FQGA 4X9YA 4EKJA 4OZFH 1ZL8A 3HS0B 1CDHA 1OSZB 4Q9CA 5ANME 5CP3A 2P7TB 3UZVA 2BH0A 5LKNA 4BKTC 3GSOA 3FCSB 3VDBA 4QRAA 3JAWA 3CFDB 2G5RA 1NBZA 3F83A 5L4MA 1OAXL 3GJEB 3MLVH 2F53B 2D2OA 2PR9A 2WIMA 4DF9A 1SM3L 2H32H 2VQEO 1VFUA 4P3WA 3UTTB 2HJLB 1LL1A 3EO9H 1HKLL 1XZ0B 4JKLA 4ODWB 5GGSY 5F7YC 3H54A 4XOAA 1IBKB 5K1JA 2P47B 4WSJA 2BVQB 4MQ7B 2Z8SA 4BWAA 2Q68A 1U3HB 2DQGH 3BABA 4ISVB 4J4PC 4J3VA 5AVTB 4P5MB 2PF4E 2CBTA 2VDOB 4LAQH 4PREB 1UB5B 4GX5A 1Z1WA 1EHNA 3TJEH 3WU2Z 1EVTC 3BAYA 3OV6A 5H4ZA 4GCZA 2CCWA 2B9BA 3F7YB 2GJ6D 1WP8A 3L72H 2VB5A 3DGGB 3OPZH 2VR3A 5I15L 1B4TA 1BEYL 3W9DA 4IEFB 4AM0Q 5JW3H 1PBYA 4OSUL 4V33A 2WVUA 4HT1L 4L4TD 3OGCA 5HJDA 3CLEL 5CEYB 3MACH 1ZHKA 3WS3B 5IBTL 1N0XL 3RG1C 2AHZA 3MUHL 4GX0A 3BAJA 1EVUA 5J7CC 4HBNA 1J0KA 5JW5A 1Z5LA 1JFHA 3EIFA 1N6QL 1NKRA 2CKBA 4H2CA 3BAWA 1GZHC 3QO0A 4QD2E 2FZ3A 2ZIDA 3IWVA 4QOKD 3UTQB 1J0ZA 1T83A 3GI9L 2XOTA 4X6DA 4AKOA 1MDAA 4XXDA 5J5EA 4WFGE 1FCCA 1KCRH 1OAXH 4RFEB 3G5YA 5E8EA 1TJXA 5DEDA 1SM3H 2Q9LA 4LU5L 4XMZA 2BJML 1FXKC 4GQPH 4N2BA 2R7EB 1HKLH 2TSAA 1OALA 5AB2A 2WNGA 2H6UA 2ZINA 5HYIA 1ETB1 4MVBD 1D5IL 1T5WB 3DYOA 1YZBA 4F37F 4LCUC 1DJGA 2IH3C 1VJSA 4KWUA 5G4OA 1JK8B 2QKIB 1KGWA 3V5HB 5IW6B 2O6PA 3DO7A 2NZIA 2F9BT 1X6LA 1OXYA 3WDIA 2DBLL 4GP4B 2C8NA 5I15H 1DLFL 1MHHA 3DX9A 4Y8DC 3RJOA 3VWKA 4XP6L 1BEYH 4FI7A 3IJHB 3VRJA 4YHHB 4OSUH 5ENWB 4HT1H 2OM5A 3MUGB 2HTKC 4Z7UB 2FB5A 5DJZB 3CLEH 1S7VB 3DC5A 2NY4C 4MAYA 1N0XH 5IBTH 1F4MA 3MRPB 4I1RA 4JZJC 1HS6A 3RWJB 1U8HA 3LXBA 2R0WL 1HINL 4KKAD 5ANMA 4HJIA 4Q9QL 3ZUNC 2YSSB 1SF9A 2ZUUA 3GI9H 3QEUB 1BMZA 4WW1A 5HPMB 2M7WA 2O26U 3OXRA 1KPVB 4P4RA 4RAVA 3MBWA 3VGAB 3ZTJG 2X6VA 3IDNA 3T0ED 4LU5H 1BXUA 2QQLH 2BJMH 3SKMA 4PJCE 3SZ6A 1B88A 1ICTA 3U9WA 5IW3A 1CICD 4KVCL 4APQD 3F7VA 4BIKA 4FXGC 3DETC 1D5IH 3K5RA 4DW0A 4POUB 3OD4A 4HXAL 4YQXL 4FTDA 3GHBL 5KMGB 4WJ5A 5EOTA 4HIJA 2CH7A 5F3HA 3QS3A 4DH2A 4E9YA 5ID0A 2AGAA 4L8BB 4NUMA 1D9KC 1U91B 2DBLH 4YZFE 4OJYA 4P46C 4PBVC 4FHKA 4EI6B 1DLFH 4GKKB 4JRYE 5A9GA 4XP6H 1E5BA 1S7RA 1P6FA 3US0A 4JE0A 2JK5C 1CG9B 1WBZB 3VVVA 1I7ZB 3I2CL 3SJAC 2F5AL 3IJYB 4U3SA 4OGQB 2HRGA 3HB3D 3L3OC 4G7YL 1U8OA 5IEHA 3V10A 2C7UB 4OV5B 3LEVL 1WC7B 4KH9A 3E2HB 5ID1A 1LP9F 2R0WH 1HINH 3MRHB 4MRBA 4Q9QH 5AYQA 1XI1A 2AMUA 3OB0H 1KQSU 2B59B 3ZW3A 5LGKA 3X3GL 4LVOB 5EB9A 2X6AA 4U1JB 2P4KA 4Y19D 1SHXA 4RX4A 3FBKA 4MD5A 5E94A 3LKPA 3BFOA 2P24A 4LDOB 5LYJA 1SY6A 4ZTEA 4IGBC 4H20L 4LF5O 2MNUA 4BSWB 3B9AA 5I0ZA 2C9SA 2ODIA 3NACL 4BDVB 4E5XB 1ORSB 3X1BA 2EH8L 4E5XG 1DDHA 3LSOB 1RV6X 4KVCH 5EZLA 4MTGA 2ZUSA 3OR6C 2IPUG 4LVHB 4XO4A 1BA9A 4XO9A 5INCA 2D0FA 2JJUA 4HXAH 4YQXH 3ULUC 1T6WA 3GHBH 3NRFA 1EZUA 3ZL2A 2DY2A 2I07A 4IS6A 3RWFA 3DPBA 3EOTL 3L3JB 1S7SA 4P5KB 1NOFA 4X5LA 4RA0C 4BFRA 3IMUA 2MQ0A 2Y69C 2GFBB 1FVDB 3IDJA 3MV01 3BN3B 4WFFA 3KH4A 3DXRA 5C71A 3AGVA 2KB1A 4TQPA 4ZO9A 4ZQKB 4J7KA 3OG4B 1MW3A 2Q7EA 1ONQA 2IQAB 2YQ3A 5CB4A 4I4WA 4D0DB 3I2CH 2CWRA 2F5AH 1GCFA 4G7YH 4JFHE 2H2SD 2FT7A 4PV1C 1Y18B 3LEVH 2J20A 3KDMB 1KPUA 1XTMA 4QMEA 1R3JC 2XG4B 2WN2A 3FSAA 1ODUA 5CM1A 5FM5M 3V0WL 4JZ2A 3X3GH 4YUEH 5HGDB 1OF0A 1M7IA 2PXYC 3ELAT 5L3EA 3QNYA 4JAMA 5J12C 3QIUD 4X1YB 2X0WA 4AYGA 4AL8L 2IANE 4H20H 3IMWA 1XCTA 4I7ZB 4PJCA 5DVLA 1IZ3A 2N1TE 3NACH 4O51A 3D50A 3QIWD 5F89B 3JAMN 2EH8H 2R2BA 4EI5C 3O8XD 4KQ4L 1F97A 1MHEA 3FU7B 4X6FB 1KXQE 4I85A 4LC1A 1L4IA 1EAQA 2A74A 2ZXGA 3BPLC 3H9SB 3OJ2C 4JRWA 5AVZB 4C4UA 4TQFA 1WQVT 4FM0A 1M2OA 3QISA 3BJLA 3EJYD 4N26A 3G6AA 3L17A 3EOTH 1BQ5A 3NIGE 4L18A 4Y9FA 3Q05A 2YJLA 1KYUA 1K97A 1KD1W 1A5FH 3AGWA 4A7GF 2K8QA 4PGBA 1LO4L 4TMPA 3L1OL 4O4LA 25C8L 4G1MA 4JRYA 3QUMA 2M6YA 1K9MW 5DR5L 2EDBA 4JN2B 5DO2C 5CO1A 3GSXA 2Q7YA 3CN4A 2A6DB 4JPRA 3K7UA 4Q9RL 3K5LA 4PJDE 2Z92A 5GGTL 5B1AB 2LJ2A 3FT3A 2Z7ZA 3Q2NA 3FTUA 3TASA 5F3FA 3W7WA 4G2KA 4DV4B 3V0WH 1ZPUA 2IPKB 4NQVB 5JDSB 3ZT7A 3U10A 4J4PA 2D7NA 4CC4C 3M86A 4BUQA 1H15B 4ZAKD 3KLAA 2V1DA 1CDUA 1GYUA 3MUY1 2IU3A 4AL8H 1MCPL 1TFHA 5DO8A 1NBCA 2ITDC 3NH7L 4FXTA 1G4RA 1FNLA 1XQ8A 4JDEA 1MQKL 3D3QA 3CVHA 4KQ4H 3IAPA 2B9ZA 1OP5K 2YD9A 4WGWB 1UKSA 1T4KA 2WXKA 2QPDB 4N2CA 3H9ZA 5K1NA 3WTSA 1R19A 3OG6B 4QRSB 2FD6L 3P30A 2E0PA 3MV7D 4MCNA 4OPAA 1MXGA 2F95B 4IBWA 3ZMZA 2V2TB 1BJ1H 5DJ0A 3TEWA 4HUVB 1P9MA 1LO4H 5F8QC 2BC4A 3L1OH 3U7AA 4PVLA 3CHXA 1GZHA 4WTWA 3CFJA 3D2UB 3BRGC 1VACA 5DR5H 3GUTA 1MN4A 2HTLC 2VLRA 4Y5YA 4MFHA 3OXSA 5DS8B 3QHFL 1HP8A 4F5CE 2KH2B 4OI9A 1ZLVK 4Q9RH 1ZT4A 2V5RA 4ODVL 5GGTH 1GOFA 5ABZA 1IC1A 5LLIC 2CTPA 3UM7A 1EPFA 1ZHBA 1UJ3A 2OS7A 4NQCD 5D4HA 3ZK0A 4KAQL 3V6ZA 4TUKL 4GKLA 3E22A 1FKAO 2IH3A 3CMGA 2EYSA 3ATFA 1XF5B 2PYEE 3FUJA 3OLGA 1MCPH 1A2YB 5B1JC 3ZDXE 2OYPA 2F7OA 1R1CA 1N8ZB 1H3PL 3NH7H 4GSXA 4J3BA 1BFSA 4ONHA 3FTGA 1ZHLA 5JXEA 4U6HA 1KXQA 3CX5J 3MBEA 4LSUL 4U4IA 3RGHA 3W7SA 4KROB 3BE1L 4O2AB 3IS1X 1M56B 4RGNE 2HMIC 2FD6H 1ZT7A 3GT6A 2GUYA 5EC1B 3SKOB 3GDBA 4HCRL 2ZXCA 4H5SB 1A25A 4JZJA 3EOBA 1G9ML 2UXBB 3MGTB 1PMYA 4JI2O 3I75A 3P9LB 5ICZA 4NJAL 3NOIA 4ABUA 1M53A 3VFRA 4G27B 4BKLA 1UUSA 4YSUA 2F7RA 1OM3L 5DYOB 4Z76A 3FQUB 1BVLA 2VRZA 3QHFH 4Z3GA 5E5LA 2CG9X 4ODVH 3DX7B 1NGXB 2N7BA 2XTLA 4HK3N 1Q1PA 3Q2WA 4XMXA 4YDNA 3TGXA 3MV11 4G8GD 3SYQA 4K3JL 5EIQA 3WNIA 1CK0H 4JN1L 4NXMO 2VGLM 4FXGA 4KAQH 5KAQF 4TUKH 1K8AW 2DMCA 3QA3A 4XWGL 1IZJA 4UNUA 3U4KA 1AR4A 2AJ3A 3NTCL 4XOCA 3GWJA 1FD9A 2P4AB 1I8UA 3MNZB 1DN0B 3LQMA 4J12A 3VXRD 1R6VA 3KJ4C 2A0LC 1H3PH 4P46A 4F7TA 1QNZL 5DQ9B 4DPBX 5I73C 2C1PA 3VFTA 1S8DB 4IT5A 2D3JA 1N32O 2WIIB 4LSUH 1CD1B 1DANT 2JK5A 4FLXA 1N5AA 5LHHA 1KCUL 3HVNA 3BE1H 2FSEB 1T7ZA 2WINB 4AYDC 4HCRH 5GS0L 2H5UA 1NGPL 1CDJA 1G9MH 1MCRA 4H8QA 4I2XA 5IM7A 1KLFA 4YPGA 1N8OE 1R5VA 4NJAH 4XB3A 4X5XA 2EZ0D 1OM3H 1BMFG 1GH6A 3LV3A 1CGTA 4F5CA 4JPQA 4GRLB 4NLAA 3VXSE 2OZ4A 4QKTA 4EFBA 1Z6JT 4OZHE 3JTTA 2VQ1A 3D18A 2V9TA 1BREA 2ZONA 4K3JH 4AV4A 4R83A 4JN1H 1CIDA 2ZNWA 3JVFC 1NCDL 3BGAA 4M62L 1LE5A 4XWGH 1E7UA 4KKBC 2DQIL 3NTCH 4JQIL 4FYRA 1QO3B 5AG9A 5DD3L 5LGHL 2AGJL 4FG6C 1QNZH 3JYCA 4BUHA 1JN6A 3LSUA 4J9YB 4N0FA 3WO4B 3CRRA 1U41A 4GO8A 4XCNB 4ZXBB 3AW5A 1KCUH 2XYCA 2IH8A 3N9GL 4E9QA 4W9CC 1C12B 4RIRA 1WUZA 5HHQA 5K39B 4G43A 2E86A 5GS0H 1NGPH 3GMNA 3QJZA 1NKGA 1B04A 2DW4A 1MAKA 2A83A 2HB0A 1G7LB 3ILPB 1JPXA 3BHBA 4KRPD 1WEJL 4X65O 3NN8B 3CIAA 3VW3L 1HHHB 4OCRL 3U0TB 2PXYA 3ARRA 4PLKD 5KSBF 1NGQL 4B5ZA 4YEEA 4MHHI 2XVBA 3EJPA 3PQYB 3SKJL 4HNAB 1NJ9A 2DLHA 1HL9A 3HBZA 2X6UA 3O6ML 3MD0A 2XTSA 3KPPA 1SEBB 2GITA 4MCZA 4WENB 4ZTPL 1NCDH 4M62H 3ZT5A 5IIEA 5GRUL 3S96A 3DJRA 2QBWA 2R69A 2X40A 2DQIH 4HK3J 4LCWE 4NPYB 3UIYA 4JQIH 4P2AA 4JHZA 3UTZB 3ORJA 5DD3H 4DP7X 1FC2D 1FRGL 3U0ZA 3UAJD 1KNOA 1Q9KB 2HHHO 2AGJH 3MRFA 2IOIA 1WCQA 5CBFA 1TITA 5LGHH 3T5WA 1WJZA 4Z95L 2Y4UA 3OJMB 3ZTDC 4FQ1L 1RLBA 4N0CC 4HS8H 2VLLB 3H56A 4PRDB 1FPTL 1SN2A 2VDNB 1M05A 3RPIB 1OT4A 1P4IL 2X2UA 4KK5C 4LKXA 3ILQD 2J5WA 3N9GH 4MNGA 4P2OC 2ZE0A 1ITCA 4FQXC 4XE0A 5E4OA 5J2UB 2JTDA 3WJJA 4BM7A 4P5TB 2VAAA 3HKZA 4AYEC 4BZ2L 4X9GA 2CM6A 2AV1A 3QRFM 4EDXB 1FAKT 3IAQA 1QRND 3MC0A 1WEJH 2LFGA 1DQVA 2H3KA 3VW3H 2VERA 2BNRB 4OCRH 4KI5F 3ROLB 3FO2B 1NGQH 1OSEA 2VYRE 1RQ5A 3MROA 3WJMB 1TFPA 5ICUA 3CCQV 4MMZC 1G7PA 3SKJH 3VXSA 5DJ2B 4DGWC 1EO7A 1OF2B 2WTRA 1GS8A 2MK3A 3ARQA 4J3OF 2J8UA 2AMGA 4AG4L 2GBTA 3HG2A 1NUNB 1P0SE 3BX7C 3O6MH 4Y4KA 4CADA 1I3GL 4WHCA 4ZTPH 4WY7L 3MAQA 3QORC 3UX9B 4HEPG 1BZ7A 1OHHG 3DWTA 2W95A 1AXIB 4ELDA 1MWAA 1R5WA 3UPRA 3C8KB 3WNPA 3K9SA 1Q8MA 4N2NA 5TGBA 1T7WA 4I0XB 1FRGH 9PCYA 3NMEA 4MA7L 4U6XA 1AKJD 3RL2A 2E9BA 3PWLA 5F7LB 4Z7AA 1WICA 4Z95H 3IXTA 4Z1PA 2BTOA 4F4LA 2OP4L 1MCDA 1TNNA 4FQ1H 4P48A 1CN4A 4DT2A 5GSRB 5ACZA 1Q94B 3NCCB 1HK6A 1FPTH 3S3DB 2XN9E 4FLSA 1KYDA 1P4IH 1CLCA 1I7FA 3T09A 3JCUZ 4DVRL 4JI5B 2QPFA 4JKMA 1HWYA 4LF9O 4A37A 1N26A 2ETWA 4BZ2H 5AW3B 1SA0A 3RDJA 2K1EA 4XN5A 5LBVA 3DTDA 1FYTE 2DYPD 3V4PB 1OB0A 4WO4B 5H2BA 1GN3A 2NR6A 5AZUA 2V5YA 3BEVA 4B9KC 3BT2H 3NA9L 5TTRA 2YEZA 2F1EA 3FUIA 4EFEA 1U8LB 1Z2KA 3FO9A 3LPPA 3P3UA 4P23B 3NIFE 3ARDB 4NO2A 4RWHA 4D9LL 5LBSL 4JCMA 1HIML 3KVPA 3QZBA 4IRSD 1G6RL 4OLZL 4AG4H 2R29L 1HSAB 1I3GH 4WY7H 4JF3A 1NBQA 4EO5A 3HG3A 4J41A 4NP9A 3WFEL 1K3EA 2XFGB 4LCWA 3JTSA 3HKEA 1ZKAA 2CLZA 2G3MA 2CO6A 1UQSB 2NYKA 3P4LA 3QDGB 3RAJL 4CJ0A 3FKSG 2ZNIA 2X4RA 4MA7H 4D0CA 2NNCA 3LNEA 5D5ME 5B7FA 4R97C 2OP4H 2QVIA 2X4NB 3FRPB 3RDTB 1Y0LB 2GEQA 2Y24A 3NJHA 3UPAA 2X4QA 4K5PA 1EIBA 3KGTA 1A3LL 4Y9BA 1ENVA 4DVRH 3PWJA 1SLXA 1RHHA 1RPKA 2WCPA 4JGMA 4FS0A 3I3DA 1THAA 3OF6D 4HDIB 2R9RB 2Y9RT 2P44B 4DV5B 1DO6A 2ZDIC 1E27B 4F7CB 4F80A 4LFAO 5D55A 3NA9H 5DMGC 1U97A 1KXVC 1ACYL 3BGFB 4NLHA 2VXQL 4Q8BA 1P5VB 3MMEA 4D9LH 2ZPKL 5H37H 5LBSH 4A2EA 5CXPA 5DVMA 1HIMH 2W59A 4JGNA 1G6RH 3CMAV 1JZEA 4OLZH 1OB1B 3QP3A 2R29H 4CN1A 4ZZKA 1E9OA 5SX4H 3LPFA 2UU9B 1Q6UA 4RGMB 5IGXL 1EAPA 3WFEH 1JZ3A 1BE3H 1MSPA 3UABA 4FZ1A 5IK3A 1TZOA 4E68A 1WLHA 1BQKA 3A21A 3S37L 5B38A 3RAJH 5I6NA 4FA8A 3DUUA 4KXZI 4KO6A 4L3EB 2WY3B 1AC6A 1G8MA 1I4FA 2X28A 5MEOA 3ARFB 4WTZG 2YGPA 3KPQB 1YI2V 2XN9A 4OFKA 3TJTA 1A3LH 1I08A 1BM3H 3IDIB 4OT1L 5IHLB 4UV4L 1OSPL 5A2FA 2X2YA 2JJWA 3MV9B 3T77B 2PCPB 4IK6A 3FZUD 3T1FA 3ABMB 5J9PB 3OMIB 3WB0A 2V4LA 3WFVA 2DN9A 4GXFA 4FMTA 1FYTA 5C8JB 1XBDA 4XCEB 3M7FB 4LSQL 4WEMB 2Y06L 1ACYH 4Z8FH 4DETA 1H0DB 1XMWA 2CCLA 3A4AA 1R3KC 3BXNA 2XUWA 2WXMA 4LF6O 5CSZB 1QSFE 3TCLB 1B0GA 4BQBA 4JM0A 1N36B 1K8DB 5T1MB 2D4DA 3MRKA 4Y8AA 1PAMA 5IGXH 3EVKA 1SXAA 2APXA 3SB3A 4ANUA 4L87A 4G6JL 1I3VA 1TQBB 4WUKL 5AFAA 2XIBA 2BK8A 4OZGE 1U36A 5EZOL 3KNBA 3KEHA 3QUZB 3S37H 4PJ8D 2DMBA 5GGVY 3ETGA 1PP9H 2XQYG 1EQWA 5GGRY 4V1DB 1H2LA 5D5MA 1CBJA 3QZWA 4JO3L 4DGYL 1T1WB 1QFWL 4X6CE 2VDRL 5KVEL 2IALB 4HKBB 1E4XL 4LOFA 2IC2A 2Q3ZA 2YXLA 5TDNA 3KVDD 2GBAA 2ZKHL 4OT1H 3GZOA 3B4NA 1OSPH 4QIWF 1AR1C 3NAAL 2Z6FA 4UV4H 4LO9A 3SPVB 4KTGA 3IF1B 2X1OA 2Z7WA 3QGVA 4HKXA 3FO0L 4YIPA 1AQKL 2WLLB 5C08E 4JX0A 2E7LC 4PG9A 2Z1PA 3QFGA 1TCRB 3OHXC 3OZKA 3QJUB 4FOMA 4ZXBD 1JGUL 3T9WA 1JGDB 4QXGL 4O58L 3S3SA 4LSQH 3AWFA 2Y06H 4AKQA 1DBML 1JXKA 1AGBA 4M00A 4G1EB 1YUHA 1GIGL 5BQ7A 3VCLA 2OXHA 1IGFL 2RACA 1IM9B 3PU7A 1N2RA 1A7BA 4XVUD 5IVXF 1YSOA 2MCPL 4PJ5E 4ZSOA 1RERA 1NQTA 2IDQA 3Q43A 3VXPB 4G6JH 4JPIA 4AJVA 4WUKH 1EHKB 4RQFA 5FKAB 4B53A 5EZOH 1AO7B 3ESPA 5EYPB 4FQXA 1WVZA 2IBGA 1XL6A 4Q6GA 5E8OA 5L2JB 4GG6E 3F04A 3UP6A 4JO3H 3RWHA 4DGYH 4KJPD 1QFWH 4XHQA 2V0AA 1NAMB 2VDRH 4LSDA 5KVEH 2BZ7A 3RJQB 1E4XH 1YN7B 4HGWB 3UGUA 4DUYO 4S1DC 3T2QA 1GTNA 3NQKA 4IBZA 2ZKHH 3TBVB 2YXHA 2P43B 3QAZC 4CNIB 5IMLA 1NCJA 2JQZA 3NAAH 3BAXA 4N2KA 4MMXB 3CBKB 4NI6A 3TN0B 3MKGA 3QXAA 4G11A 1UXSB 4MMZA 4AXWB 2EULA 2BVOB 3FO0H 4YSOA 5JWPA 1AQKH 1FG2A 1AIFA 2Y6TE 4ILDA 4P2QB 3PAYA 5KSUB 3OKLA 1KB5A 2K45A 1JGUH 4TLSA 3ZBHA 3ILEA 2ORBL 4QXGH 4HGMA 5I1KH 5HTSA 4O58H 4QHUA 4A7QA 1DBMH 2J4WH 2X53A 2DOSA 1GIGH 1EBAA 1K3IA 3OLEA 4NQXA 3P3PA 4UT9L 1JYNA 2WN3A 2JXMA 1DJSA 2MTAA 2QQKL 1QSFA 1IXMA 2IEPA 1IGFH 3ZLQC 5KAQG 4AI7A 1WWWX 3EXLA 3KCWA 3ZN1A 3QXDB 2MCPH 3NXSA 3TIEB 1K5NB 3SY6A 1QOKA 3MRRB 5IG7A 4FLVA 2DL9A 3OWRA 3OKKA 4FCHA 4WWOA 4ZFGL 3S8GB 5HHXL 1J9RA 5LG1A 2OR7A 3E80A 1U8NA 4JO2L 3G6JE 4GI6A 3CXHK 2AVGA 4O02L 4KGLA 1KZQA 3NSXA 4KO9A 3TFKD 3RBSA 3CMOL 1A64A 2VQFO 1WCBB 5IWAO 2HFFA 5D7JC 2BM3A 4DEPC 3FT9A 4R26L 1KZYA 2ZCKL 3O9OA 1WPXA 2H1XA 4QUOA 3L74H 1T5XB 3D1MC 1A4CA 3MRNB 3AK3A 5FCSH 1E6JL 3CD4A 2KDYA 4IHOA 5IQ7L 1DTUA 4O2CB 5LNEA 3DBXA 1X4XA 2MNWA 4U6VL 1R6KA 4JUTA 5IHUL 3P4MA 3L3IA 2P5EB 2XTJC 2ORBH 3L2NA 3ARSA 2ODMA 4FHJA 3LIUA 2F74B 2XZAL 3LS5H 4PRIE 3N43F 1ACCA 2APBA 3MHHC 4UT9H 3CFEA 4UIMA 3QNFA 4HX1A 4XMKL 2PP8A 4Z23A 3WKYA 7FABL 4YC2B 3THOA 2QQKH 2LFRA 1S7XB 4HC1L 4ZMVA 4NXNO 4WI3A 3DI2B 4FFVD 3NCMA 4PJ5A 3RZCC 5IW1B 2HXAA 5CP7A 1QI4A 4MWFA 5D1XC 5HHXH 4JFFA 4P23D 2NNAA 1AJNA 3T1HO 3MCLL 2YWZA 3OHMB 4JRXB 2D3OW 1S5LZ 1RZFL 5E9DB 3UYOD 1SLVA 1XQ4A 3NPSB 4JO2H 3E9TA 4Z18A 3UBFA 4CRPA 5IQ9B 1OHQA 3UO3A 1N8RW 4O02H 4Y4FB 5TDOB 4DO2A 2FJHA 3OGIB 3CMOH 2WLIB 1IX9A 2ZDIA 3SDDC 3O3UN 2NNXA 3VXTA 3BCDA 5BOJA 2F43G 1MCBA 1IGIL 4Q6YA 2WHVA 4R26H 3QPQD 2ZCKH 2QM7A 2PO6A 1JUFB 4M5ZL 3FFOA 4MVSA 4FQIL 4AIZB 3MODL 5F6HJ 4CVZA 3RIFK 1MEXH 1E6JH 2PTMA 5IQ7H 1CL7I 3LNGA 1PZAA 1P69B 4AENB 1K4DB 4U6VH 4LBEC 1UOWA 5IHUH 5KSBB 3DIFA 4HD5A 2EUXA 5F0PB 5ITZB 1UZ8B 2MQGA 3QG7L 2XZAH 3EH2A 4LSPL 4NJ9L 3LDCA 4U1LA 5AW6B 1KYOJ 1M6UA 3N0AA 2O61A 1F4HA 1K8IA 5I2IA 2XKNB 3KL0A 1FJ1B 1YY9C 4R7VA 4XMKH 5GGSB 4Q52A 3NYKA 2J6WA 3SGJA 1R73A 7FABH 3D25B 2A6IA 3GSQB 3VXMD 4HC1H 4P2RB 4LNUB 1QACA 5E99L 5E6SB 4QI3A 1DP0A 1U30A 1TKWA 1OANA 1S9WA 4L29B 3MCLH 3CZGA 1RZFH 2COQA 3BUBA 4EIUA 2BO0A 2K4WA 4BXSV 4MSWC 4HYOA 1TO5A 3SKNA 3G6JA 3RE0A 5HPOA 1KFAL 2HEPA 3IJ4A 3TESA 3DUSA 1TYRA 1XNQB 2ESVB 4NEHB 5PAZA 4DV1O 3D05A 4D6TH 3W0WD 1IGIH 1HQ4B 3KWVA 4HWZA 1ZDQA 1SEQL 4M5ZH 4YDIL 1FF5A 5EC2B 1HT6A 2ZWKA 4FQIH 4L3ED 3MODH 4LRIC 2ZG2A 3ULAB 4B50A 4EOWH 4Y1AB 3ROOB 2Q87A 4A39A 3QNZB 3ARFD 4WFED 3O4OC 3NIDE 4TVPL 1QVGU 3LDBB 8FABA 4K7FB 4AEIL 5AOMA 5HD8C 4KX7A 2YD5A 3QG7H 1MJJA 2DZEA 4LSPH 4NJ9H 3RB7A 3UQ8A 2GK2A 1C8QA 1MCEA 4J3OG 5C07D 3ML8A 1EDQA 2EC8A 3FQRA 3PG2A 4PJ7A 4YHNA 5FV2A 5KG9A 2W8CA 3FB5C 4NZJA 2ATKC 3CC1A 3OKYA 1AJQA 4A5UB 1OTSD 3P4OA 2P8MB 2Z35A 4PW9A 1C5BL 5DI8A 5E99H 2FMLA 1N3NA 5IY5B 3D8MA 3SJVA 4W4LA 2A9ML 4FFZL 4H8PA 1ZK5A 2DI7A 2DM4A 4LKCA 1DSWA 4B9ZA 1R17A 3PV7A 1KFAH 1IBHA 4MA3A 2E7LA 2VO8A 3UGXA 1F1AA 3CE1A 1UZGA 2E74C 3HCVB 3CDZB 3NJKA 3PL6D 4EPSA 1BV8A 1QKZL 1IM3B 4Z9KB 5I8KL 1F23A 1SEQH 5D71H 1P4UA 3K5OA 4YDIH 5DECA 1Q5OA 4KHPO 4JV5O 4QE7A 3R66A 3WNNA 5I66A 3FHQA 1MLCB 2EZOA 1YMMD 5FYLL 5AVQB 4CN4A 4NRXA 3DTXB 3JATB 3V79C 4J1UA 4FLQA 1IBLB 4TVPH 2SEBB 2YC0A 2QJDA 4AEIH 2DQDL 4D0BB 1AGDA 2XZQL 1LDPL 4PJ9C 4B7LA 2Y7OA 2X1QA 4JFYA 4M7LL 3PE9A 4FLOA 2D31A 3KPOA 3ZKXB 2IDSA 3PLYA 2KQXA 2A9NL 4I9XA 5FUCE 5CD5C 2GTAA 5KA5A 3OKNB 4DV0B 1IEAB 3Q5OA 4ZOCA 1C5BH 1OTTC 4X88A 1JIBA 1JPFB 1NGWA 3O4LA 4FQJL 1QFPA 2ROXA 2RQ6A 1ZLWH 5FK9B 1FFOB 2A9MH 4FFZH 5JHDE 3AK2A 3FUDA 1KC8W 1BGYH 2NY7L 1PEWA 4N8VB 4GUOA 4N8VG 2H8PC 4W6YB 4QY8A 3J7HA 2X4UA 5CGYD 5LA6A 1HOCA 1IAIM 1WITA 4YEFA 1LMIA 3PABA 1ERNA 1QKZH 3WIFB 5AW9B 4BZ1A 4EN3B 4NPKA 1HHIB 3FB7B 5I8KH 5DTFB 3UT5A 1UURA 4MVBC 5I26A 3EBIA 1MW0A 1QBZA 1DQML 5FYLH 3FOMB 4OQTA 4CSPA 5E70A 2P9RA 2VABB 3BVOA 1U3NA 2DQDH 5EOCJ 2F6AA 4ELME 2CTQA 1LDPH 2WZ6A 2XZQH 4NQED 2GIMA 2VC2B 4M7LH 4FM2A 2CO1A 2DWEA 3Q13A 2W0XA 1PZ2A 1IGYB 1VFBA 3O9WA 4FLHA 1FFPA 4GXUM 3TNMB 5IDJA 1CXHA 3UIZA 1A14L 2A9NH 4I5SA 5DJ6A 4M9OA 2C4FT 4P2QD 3V5HA 2YIBD 4G70B 4FYTA 3H9HB 5DQJB 1T6BX 4FQJH 1QR1B 3W57A 5K1VA 4WI5A 1NGZA 3ZYIA 2XNDG 3I9PA 3F5TA 2HVJB 5D7IA 3UERA 2AEOA 4CJ1A 2NY7H 1NDGB 3HNVL 2CK3G 1HDMA 2WBJD 2L7EA 1E3FA 1IL1A 2G0KA 3CFCL 1AP2B 3AABA 3G3LA 4HIXL 4Q2ZA 2HJKB 3V5DA 3QPKA 3WN5B 1MAJA 1L7TL 4OGXL 4R90L 1JVMA 2Q7HA 3W3BA 4X1KA 3VFOA 1HEJC 1TQCC 5I9QC 1B0IA 1AGFA 1SVBA 3IFNL 3N41F 4G8AC 2YMTA 3VQ1C 4PLJD 3CBRA 3ARUA 2R1WB 4TNWK 3MLXH 5GSVB 3CD6V 5D7KE 2X88A 1DQMH 1CB4A 2EEBA 4C83A 4UTBA 4Y7OC 3CHRA 4KRNA 3VI4A 2QSCL 5J11B 5L4JA 5GW7A 2IWFA 3OTFA 2QGEA 5D1XA 2OYLA 3WLBA 3RYFB 1WA0X 4LRNL 1KGYE 4I0PD 5SV4A 1Y07A 5FA4A 1G5GA 1KCBA 2FCBA 3K4DA 4R2GB 4LF3B 3BD5A 2XC8A 2IH1A 4PWIA 4Y4HA 2JJTC 1NPUA 4J6IA 2FL4A 5FW8A 1T21B 3SDDA 5HXMA 3A8TA 4OAWB 2EJ1A 5MENB 4QRPE 3PS6A 3WMQA 2HKFL 5CS7A 3ZTNL 3N1GC 4A67A 5PCYA 3WL9A 3STBA 4RMVA 1YEFL 3HNVH 3SYPA 4W4OA 3VRIB 3VSQA 3CFCH 2H0EA 4B60A 3RU8L 3KBFA 4HIXH 1A6TA 2XWBA 3J8F7 4PLOB 1IC7L 1L7TH 4OGXH 3OT7A 1MUJB 2QDWA 1THCA 4LBEA 4PJIE 4R90H 3P2TA 4Y5VC 4OCLC 3C5JB 3BPZA 1D2OA 3IFNH 1GC1L 3MLTA 1A3QA 1VP7A 1B9KA 2BCKB 2YBRB 2OQJB 3N40P 4L4TE 2ENYA 4YFLI 4DVBB 4LZKA 5F6HI 2QSCH 1I1FB 5EUOF 4Y16B 3VTTA 4PTUB 3EHBB 5E7BA 3ZOAA 2OMVB 4ELMA 3CJHA 3QTCA 2A7WA 3N3EA 4KXAA 3MRLB 3R8BB 1R0AL 4ZNCD 2VM4A 5IVZB 3LPOA 1SYVB 4LRNH 3O0RL 4NAMA 1TZGL 3ZE0F 5IVXB 1HILB 4MSWA 3FTYA 3C5SB 1QBBA 2B9AA 2XT1B 4MCYA 1WT5C 2P22C 4HA1A 4AQ1C 1OOWA 1NEZA 4KU1A 3BZ4A 1ITBB 2V6HA 4PY7A 1N0LB 1JOIA 4YBQC 3B2DC 4HWEL 3V5KA 4X8CA 2VKWA 5D5PA 2HKFH 2WD0A 2APTA 1SQVH 4X7TA 3ZTNH 4BIOA 5I1EL 5DSCA 4FG0A 4LRIA 5DC0A 4P4KC 2CMRL 4P2RD 3QIUC 2F7IA 4P2CG 4XOBA 3RU8H 4HOXA 1HZHL 2DKUA 1WP7A 1IC7H 2K7QA 2YOAA 4EKXA 3JALA 2NZ9C 3KVQA 3ZMEA 2KHAA 4B7IA 2YD8A 5JORA 5GRVK 1I9RL 1SRYA 1ULVA 2NY1D 3MRQA 4H1LH 4DGIL 1GC1H 3QIWC 3UC0L 1K5WA 4U1MB 4ZI7B 1NMAL 1B4JL 2XZCL 2JI3A 4YJ3A 3H4FA 1JQ0A 3CZUB 2VZVA 4K73A 3GZKA 5KJ4A 2BW5A 4BH7A 1KTLB 4MVMA 4TV9B 3FB5A 1Q9WA 3PNRB 3ZXAC 1KGCD 3QUYC 3LX9A 4RCAA 3L16A 3D69B 3GKWL 3QFDB 4FXKB 1T1YB 4G7RB 5IBUB 1G9NL 4OXSA 1GZPA 3ARBD 4M29A 5DD1L 1I3UA 5IBUG 1R0AH 2UUCB 3RGVB 3KBEA 4WHYG 6PAZA 4Y1AD 3PY9A 4WEUD 1O9WA 3O0RH 1TZGH 3WOVA 4ZOAA 2F66C 1I7TB 1AHWB 3DV6B 4L9LB 3V7MA 3T0EE 1N68A 1Z9SB 3F3HA 5SWQA 4HWEH 1UH4A 2OV0A 4G5ZL 4PBXA 1PY9A 2FECI 5EN2B 3TZVC 2A79B 2CLVB 4DKEL 5I1EH 3LRSB 5LB1A 2VQEB 5D2LA 2CMRH 4M7JL 4HIEB 4ZAKC 1A1MA 5HHOB 1S9VB 1QVOB 3JD4A 1HZHH 2R51A 4X6DF 3PWPD 3IDMB 5JHMA 5A6IA 1PL4A 4PJIA 4Z7VE 5EBLC 3FQNA 4OCNC 1J8HB 4ZUWA 4OKDA 1MCWM 2GJ6A 4DGIH 4TOIA 2BNQB 4PN6A 2VAJA 4JY5L 4DUVA 5B7MA 1G9NC 4K3EL 1CQYA 2C9XA 1NMAH 1B4JH 2XZCH 3KYKL 2DYRB 3C9NB 4J2QA 3ZIYA 3M46A 4L4TA 4YAQB 3IBEA 2VZ3A 3DVGB 2GSMB 3CFKA 4O9HL 1W72L 3ZRXA 1P4LA 2H26B 2KI6A 2EXTA 3EJTA 2I9TB 3GKWH 2R1XB 3N43B 4XWOD 2D7OA 5B21A 3CZLA 1G9NH 5F7DB 4FKEA 5HYSB 1YNLL 5HYSG 3B8YA 2JGDA 3F85A 4QOKA 3K74B 3OUSA 5DQDL 3G4SV 5FF6A 2ZM6O 5AD0B 4ZO7A 2VL5A 3KXFB 2H8PA 3MOQA 1HXMA 1WWAX 3C60C 5AAMA 4L1SA 2FQDA 2J56A 3F7KA 2ZTBA 4HAGA 5LGNA 4B95C 4G5ZH 4NZUL 5DEGB 4DKEH 4IBYA 4XRCB 3EJUA 1NIBA 3OEEG 3KYOB 3UMTA 2EXWD 5CJ5A 2LW3A 4M7JH 5E4EB 4GO9A 3AG3C 2WV3A 2N3JA 1KIUB 2P45B 2UXGA 4IK7A 2F54B 3R8QA 1ET8A 5DK0B 1UGKA 1Z7JA 2I9LA 2AVFA 3QZPA 4IBTA 4JY5H 1FLTX 4G7VL 3SDAC 3ASNB 1MLBB 3KL3A 4K3EH 2WVTA 1LTXA 4DFHA 3KYKH 4RUFA 2YXFA 3WAJA 1NBMG 3UEZA 1HCVA 2OYMA 3HI6L 5ERWB 4O9HH 1BFVL 5F7BA 5SWSB 4E2OA 5L4IA 3RY4A 1HDJA 5DD0L 4DRXB 43C9B 2OR9L 5HP5A 4E0RA 1T22A 5AOIA 1G7IB 1UVQA 1YNLH 4XZUB 1RZGB 4FLTA 1UT2A 1YPZE 2JKWA 2WVVA 4AV5A 2G30A 1J9CT 5D1ZB 5AVXB 5JH7A 3ZHTA 5JQGB 1YF2A 3IMVA 5DQDH 1XF2B 2DMHA 5BV7B 3SDCD 1OD9A 3GRWL 3W9EB 3BPCB 3WIAA 4AJYV 3T0EA 2Y4TA 1UB6B 4QPEA 2VW6A 2G2NA 4NZUH 1H5BA 4PRBB 4IU2B 1H6EA 1JPTL 2HR3A 3W38A 1CICA 5C0BB 2QQQA 4APQA 3VJ6A 3GS4A 4GBXC 4OH2A 2D7QA 1EO8L 2DQJL 1E9PB 3ES6B 4GG8A 5T5NF 4OF3A 2XN1A 5EU6B 2W60A 2YFOA 5ESAB 1QRKA 1IGJA 3EF7A 4OZ4A 4RMRA 2R72A 3OKMA 3L9YA 4IGGA 4WU5A 4ANVA 3CXHF 5T3ZD 1BVNT 2ALAA 1OAZL 1S4IA 3AXLB 5L4FA 2JB6A 3HRZB 4G7VH 5KHIA 3WS6A 3ABTA 1HNZO 3FUMA 1I53A 5C3IA 3ZL4L 1BZOA 1BVNP 2OTWA 4ZFOA 5J1SC 2UY6B 2OMWB 3HI6H 1BFVH 3DXAB 4OM0L 1THZA 2AZ2A 5LXTB 4EIGB 3ZQWA 2X1PA 5DD0H 1WG3A 3HZMB 4M1CC 3FT2A 1DDTA 2Y2TA 2OR9H 4JREC 1AKPA 1O7DE 3CLFL 5KSAD 4TUYB 2IWEA 3RKDC 2NLJB 2PI4A 1CVSC 3FT4A 4MNQD 4P3DA 4HH9B 4ZUSB 4EUPH 2UY7A 3LQZA 4Y19A 4L2YA 1M4UA 1BECA 3M1BB 1CI5A 1PD0A 4LPWA 5C7ZA 1JS4A 5BVJB 3GRWH 3K04A 3B2VL 3NQIA 4XXWC 5LAXA 3P73B 1YEKL 4Y5VA 2H6PB 4PGEB 4DW1A 1CMOA 1CE1L 3FHEA 1VZGA 1U92B 2CDFA 3O3AB 1JPTH 1F02I 4N28A 3ZKQD 3B9KC 5DRZA 1CO1A 4R2GD 1EO8H 2DQJH 4WI0B 4Z7QE 5BMFL 3WE6B 1TUEB 3ZVVA 1NBVL 4G8FA 3MV7E 3KPMA 1NCWL 3QRGL 2XX1A 4XI5D 4NRYB 1X5FA 1OAZH 3NZ8B 4HETA 5CLYA 4X7DC 2DQ6A 3LEYL 1A21A 1WE5A 2QEJA 3KPLB 3EDKA 2AZ0A 4UCRA 3ZL4H 2B3RA 4PJCF 5I19L 4HJGB 3ZT6A 1JGLL 5C0RL 1UXMA 3NESA 4OM0H 1WT5A 2WWNA 3KPTA 4X9BA 3GYRA 3OKDA 3VFSB 2HLAB 5FHAL 4HUWB 3RIFF 2ZKYA 5EUKA 3BRCA 3CLFH 4YXWG 4N2HA 4NQCE 1R1BA 2GHZA 2K7PA 3BW9A 4HKZA 3FUFA 1OHZA 4QAMB 4YZFF 1CLOL 1YG9A 2K78A 4P4KA 5HDWA 2NT1A 3UBXI 1HHJB 3IMBA 3T2MA 1XH0A 3BMVA 3QIUA 4LPYA 4NN7B 5J6HB 3B2VH 1MY7A 1QSEB 1YEKH 2XIIA 4X9HA 3T65A 4OCSH 2AKRA 3OUFA 4GS7B 4AIXA 1KTDA 3BQUB 1EEYB 2Q9OA 3HNTL 3QIWA 5J1AB 3C5ZB 5KVGE 4QYAA 1B6UA 5BMFH 4F33A 4JO1L 1NBVH 2EE2A 1P7KB 4PJBE 1JCKA 4LLMB 3K46A 1KELL 3O3DB 4FQHA 1NCWH 3QRGH 4QRTA 1EEQA 3MPCA 4LL4A 1V3KA 1IX2A 3PHOA 4R96A 2O6DA 5BMVB 2Q76A 3ABGA 4DZBB 1HXYA 4XCCL 1OK8A 4B96A 1DLHB 3LEYH 1HHGA 3RVXD 1UPGA 2FYYB 3E8GA 2OXGA 1NBYA 3K80A 2FYVA 3QDHA 4DSYA 4EIZC 5I19H 3L81A 1JGLH 5C0RH 2HZHA 4NKMB 3EYQD 3FTZA 1N9PA 4XGZA 4M61B 5M94B 5EEYA 1CJYA 1UKTA 4AMXA 1PYWB 1PCSA 1IGTA 1ZXQA 5JOPD 4EB6A 4N9GA 5D7HA 2P80D 1BJ8A 3SO3C 4JFWA 1K34A 2YAEA 1CLOH 3K72B 1T1XB 4MJID 5CLZA 5AL8A 3J81N 4HZ1A 4ZAKA 3BIAX 2QFPA 3HS0A 5DHYA 1HL4A 4UB8Z 1YA5A 1NIDA 1OSZA 3S3PA 3AK1A 2KYIA 5A2IH 2V4DA 4XAKE 5EBLA 2VSDA 2XBZA 1II4E 3HNTH 2R9AA 1JTPA 2VXVL 2LFEA 4Z5RA 3O6FB 3DX6A 2JJ2G 3Q1EA 2OCCC 3MJ7B 4D9RE 4RFNC 2WWWA 2X41A 4JO1H 4PGDA 4WJKB 1RJYA 1KELH 3MV7A 3N41B 4HQQL 2H3NB 2HT2D 4CSZA 4O4HB 3D0LA 1G7HB 1BQSA 3UADA 4XCCH 2BVQA 3EG9B 1WPBA 5LCVL 5LXGL 1E8ZA 3ZHRA 5IWLA 3ABZA 4GKOA 1ZWIC 1GSMA 3VYOA 1I1CA 3L3GA 1FNAA 1YNTA 1WBXA 1U95A 2CGRL 2PCFA 5E00B 3S3BB 4CH6A 3DRQB 4NPJA 1IUZA 5BO1L 3GB7C 3A4FA 2K1MA 2XXCB 1XH1A 1UUNA 4N20A 3BPOC 3F5WB 4LVNB 3P77B 1G1CA 2V5TA 4GYBA 4U6YA 2K6ZA 4B3TO 4NQCA 5HHPB 3NIGF 2D2CB 2NW3A 2ITCB 1L6ZA 3E6FB 4CC5A 3APCA 4XX5A 3ZTEA 4JK0D 2KS0A 1CFTB 1US6A 2L7QA 5I6XC 1YTFB 4UTBL 5FFLA 3SCMD 5G4MA 1QVFU 1ESOA 1MCWW 3JD3A 3BVUA 3O45B 5LN4A 4E2LA 1L5GA 5HFLA 2AQ1A 2FH6A 2VXVH 1P1VA 1BZ9A 4OVUA 1EUTA 2J3SA 3GRGA 3KXFD 5D4IA 1H8HG 3SQOL 4PJBA 3AAZA 3ZHUA 3VD0A 3OAUL 4HQQH 3IGUA 1YEDB 3ML0A 4YSRA 4BSVB 3VGEA 4XMPL 2C3WA 1SHWA 5LCVH 5BCAA 5LXGH 4X4XA 1T5WA 1JNLL 3B2UD 3DDFA 1J95A 2GJPA 4MDJA 1I8AA 5KANG 3VYNA 3IPFA 3C09C 3MRDB 2CGRH 5EUOB 4JI2B 2EXSA 5BO1H 4R7NA 4NQDD 4ETQB 1VERA 2UZPA 3RNKB 3D5OF 4KBPA 4G8GA 3ZE0B 2WZPD 3WELA 4OIAA 3IGKA 3PHQA 3WO3B 2NXZC 2ZWNA 3KPSB 3N85L 4HPOL 1ZANH 3VXRA 5B1BC 2Z93A 3PP4L 5LNDA 1ZL8B 3ZJZA 4UTBH 1R6TA 5D1ZD 5FA3A 4OD2B 2D8KA 3UZVB 3HUJB 5K59E 3GSOB 1KPVA 1DBAL 2C34A 4WWID 3JAWB 2HVKC 5KYWA 3SQOH 1LXMA 3OAUH 2FNWA 4MB4A 1J48A 4HF5L 3RWIA 2GJRA 3ULUF 3U48A 3VG9C 5C0BD 4XMPH 1QRNE 1JNLH 2W0LA 3H9SE 2ADIA 3BEWA 1XCQA 1WFMA 4U05A 5KJ7E 1D2PA 3ZDXF 2Q0AA 1EN4A 1I75A 4LFHG 1S7WA 3AG2C 2ROYA 5EU7C 1QEWA 4K55A 4TNWF 3I9IA 1X5ZA 2E4FA 2XT9A 4K0KO 3KHOA 3N42B 3DARA 2DB8A 4YWGH 2X44D 3FZUC 5JTWA 4FLUA 3RPBA 1H3WM 2Y3AA 2OR8A 1CG9A 5KAIZ 2HT3C 4S1RL 3W9DB 3L1FA 3NCYS 4BH8A 3OGCB 4HPOH 3N85H 2ZOWA 1ZHKB 5KYUA 2WVSA 3H6JA 2GDSA 3PP4H 4PJAE 4UDTA 1LEKA 2AJZA 2NY6B 4DGVL 1A47A 5I17B 1PPJH 5KLVH 2BSRA 4HWBH 2H9GA 5JW5B 1JJUA 2CKBB 1WA2X 3QO0B 1PQZA 4YL4A 2FZ3B 1SQQH 3H2PA 5F88A 1DBAH 3AWEA 4X6DB 4LOEA 4XXDB 2WLNA 4WWKD 3IRPX 2L7UA 4FMVA 2AFNA 1DJHA 1KWKA 3S88L 2I69A 3L5HA 3GPSA 4U7NA 5E8EB 3W5NA 3IGAC 2B7DT 1BQZA 1SOQA 4HF5H 5JPMA 3IFLL 2VZOA 1G0YR 4Z7NE 3ILDA 5DHDA 1W0KG 2FDBP 3ZN6A 2MH4A 2CTWA 3DROA 3BGMA 1ZEAL 4ZK8A 3TNNA 1Z5HA 4G3YH 4X65B 5IEKA 4QGYA 5JMOC 3DO7B 1PL0A 2G2RA 2Q6AA 4CAGA 1JZ4A 1FVDA 4MA8L 3PDGA 4LQ1A 3DX9B 1MHHB 3T3MB 3VWKB 3VO0A 5A2CA 3K81A 4HVBA 4J11A 3SPJA 4N85A 4TL5A 3SBWC 3VRJB 4UOW0 1LMKA 2AV7B 3ZUCA 1BMWA 2D3VA 4UCTA 3CH8A 3IN2A 5E23A 2BY3A 4ETYA 3D0AA 3A4EA 4I89A 4MAYB 2ADGA 4UM8A 4KQ3L 1XTLA 4F7EA 3UAJA 2AHYA 2W38A 4ATTA 5C0CD 2OSLA 4XO5A 1U8HB 5JPNB 3U4AA 4XVUC 5ANMB 1V7NH 15C8L 2AJYL 2AXHA 4WW1B 4X1YA 2J8UF 1NCTA 4ZBJA 1Y6KR 4BFNA 3S88H 3IU3A 3OXRB 4P4RB 3L3HA 5DLML 3IN0A 3ML9A 3GTNA 3I02A 1JJOA 3MBWB 1F1DA 3BQUD 3IDNB 4RAVB 3SKMB 3IFLH 5EV7A 1KP3A 2O1AA 1SQFA 1V10A 2KBGA 3EH4B 4KJPC 5EIVA 2ZWYA 3TT1L 1QRNA 1EEZA 3LN4A 4MDRA 4DP9X 4NWUL 4GAFB 3F7VB 5CWSA 4EZMA 3U0PB 4TQHA 5IREA 2H3XC 2CUMA 5E6ID 4WJ5B 1ZEAH 5EOTB 4HIJB 5F3HB 1RK1A 4H0LB 4DV2O 5EZYB 5ID0B 4E9TA 3ZDZE 3FFDA 3HAEA 4MA8H 4DZ8B 2P42B 1RZIA 4KKCD 4ZOLA 4ZW8A 4HAFA 1KEML 1W2KT 1L9RA 2DQUL 1SXCA 3F7QA 4MJ5A 4U2YA 3E8UL 1LJMA 2UXCB 2NY2B 2AQNA 3HN3A 3WKML 4FPPA 4FTVD 3KPRD 2J55A 3Q2CA 4U3SB 4G82A 1TSHA 1U8OB 5B3SC 1JCVA 3EYFA 4KQ3H 1IBBA 2DYSC 1AKJA 1JRHI 4PJAA 3J2PA 2BOBC 5T5NG 1YHQV 1LR1A 1ZWIA 5JNYA 4GZRB 15C8H 2AJYH 1AJPA 4N87A 4KDTC 4MD5B 1KSRA 5E94B 1FN4A 2LU7A 5DLMH 2MJWA 1AGCA 2P24B 5LYJB 1IEBA 2D9CA 2BCMA 3TV3L 1KB9K 4JVUA 3GNML 3MKKA 4Q6IC 4LF9B 4NT6A 2DYPA 4NWUH 1DDHB 4OIIL 5EZLB 5BO0D 4KNSA 1KJ2A 4AZUA 5TF1L 1W0JG 5INCB 4R4NC 3NFSL 2LO1A 3QEQD 4LLUB 4F6EA 3PRZA 5AVSB 1LK3L 4D7TA 3GEWB 3QJQB 3VXUD 2I07B 4IS6B 3RWFB 3DPBB 1DQKA 3Q4HA 2CDEA 1BT8A 3W11D 1REIA 3MZTA 5E7FA 4JBSA 4IRSA 3MGOA 4FXLA 4UAOB 5D1QC 1CDGA 3QZNA 2LW7A 1U58B 4QXVA 1KEMH 2DQUH 3BSGA 3HMWL 4FFWC 3IDJB 1RPQA 2WOYA 1MSWD 1YECL 1JX9A 3DXRB 1OQXA 4L8JA 2YXMA 3E8UH 1X5AA 4NC1C 1ONQB 4IOSA 5CB4B 2IJJA 4I4WB 1SQPH 2NY0B 3BUYA 1QLEB 2KLTA 1SKVA 1KPUB 3ZPDA 4M4RA 3COOA 2EDTA 3SQBA 5D7EA 3CPUA 4APXA 4MNHA 4BBWA 5E1HB 3MRMA 4JAMB 3QNYB 1AD9A 5AOZA 3K6IA 3HKCA 5IQOA 5ESVA 3ARYA 3R1GL 4NVPA 3ZJAA 2BY0A 3TV3H 1XCTB 4ENED 2UXNA 4K8RL 1DR9A 3OF6A 4FK5C 4PJCB 4CW1A 3GNMH 3PFUA 3VD5A 3U83A 4O51B 3WI9A 2VDPB 4FZ0A 2R2BB 2Y7MA 2IV9A 1X5MA 2E4TA 3I56V 1MHEB 2JELL 4N25A 4RBPH 5TF1H 4E9WA 2A74B 3NFSH 4IIQC 5BRPA 4I9WE 5GRZA 1LK3H 3II3A 4H5SA 3G6AB 4UCOA 1JF1A 2VMCA 4GMSL 2F1AA 4LFAB 2ZXEB 2EADA 4YVNA 3V4VA 4J27A 4FNSA 3WHE1 4FNPA 2IJKA 4PGBB 1WF5A 4O4LB 4G1MB 4JRYB 4MTMA 5DYOA 3QUMB 4GIAA 2F5BL 2BIQA 3DSFL 1YECH 2WSPA 1MCQA 3TIDA 2HFEC 3EBGA 1GCYA 1NINA 1NGXA 3GSXB 3PQYE 2Q7YB 2EIDA 2Z92B 3FT3B 1OD7A 4LAJH 3L95A 1FHNA 4M5TA 3DGDA 1FZOA 4EN2A 1KKDA 1XGRA 2W07A 3PIQA 4L1LA 3DKHA 3X2QC 2MMXA 4JFPA 1JD7A 3ZZSA 2JJ1G 5C1MB 2AW2A 3KLAB 3RFZC 5MHSD 2JLPA 3FXIC 1LHZA 3R1GH 4OD3L 1E50A 5KAFZ 2C3HA 3C6EA 3KH3A 5DQ9A 2YPVA 4K8RH 1KN2L 4DP2X 2WPDG 1Q1JH 1S8DA 4HJ1A 3MLSL 4JDEB 5L2KD 3CVHB 4UV9A 4J23A 2JELH 4HWBA 4NBZB 5D5MF 3APFA 2P3YA 2PGGA 4DR7B 4UZUA 1TTAA 4R8CA 2IPTL 2VRQA 4OUUA 5HI5D 5DHMC 3L9RA 5GS2D 4GMSH 3FCUB 1JPST 1DFXA 2F61A 4S1SL 5DJ0B 2CUHA 4XNQA 2BNRE 4PRHD 3RUGE 1HYRC 3UBXA 2F5BH 3HZVA 4GPVA 3CFJB 1ZCRA 3DSFH 1NR7A 1VACB 4M93C 1ROCA 1T3FA 2XCMC 2FTAA 3FCTA 3H9VA 1LO2L 2VLRB 4Y5YB 2BS9A 3GUTB 3OXSB 3FPXA 4PJ8A 3B5TA 4YVUA 4IHBA 3IGAA 1S7UA 1ZT4B 3OMAB 1NPJA 4A2GA 4XMLL 5ITBL 4QRRD 4FDWA 1ZHBB 3R4DA 3T4AC 1UJ3B 4KGJA 1PM9A 4Y88A 5F1SA 5HJ3B 3TK1A 3EO1A 1Q43A 3ZMVA 1ZA3A 4K5OA 3EJSA 3V6ZB 1JZDC 4V2CB 3E22B 2G38A 4AKPA 1CFSA 1RLWA 4RZKA 1XDTT 2IH3B 4WNSA 1OCZC 2GTWB 4K3AA 2EYSB 4WWNA 4OD3H 2DDQL 5CLTA 1WAAA 2JI2A 3CCRV 1KN2H 2QWPB 4NZDA 3MLSH 3PL6C 4QRBA 4ONHB 3FTGB 1MY5A 1ZHLB 3DO3A 3LKOA 3SBWA 2XBDA 3G9AB 4L4JA 4U6HB 4GLXA 3MBEB 1XREA 1FHGA 3ZIMA 5F0LB 1C12A 5D2NC 4D94A 3QVNA 5HHVL 5C6PB 1R47A 2NY4B 1ZT7B 2Y7SA 1FG9C 4HMEA 3G5VA 3FHAA 3QG6A 4N21A 4BHUA 4JZJB 3EOBB 4S1SH 2XV0A 3L6FA 5ICZB 3I75B 1JPEA 2BS8A 5D6DC 3E7JA 1R6NA 3U82B 3ECBA 4BKLB 3VFRB 2GC4C 3ZS8C 5LMUB 3K6OA 1LO2H 1VGEL 4YE0A 5AW0B 1B6DA 2CNYA 1U4EA 4Z76B 4RAIA 1RI8A 5MI0B 1XSJA 3D09A 5BY1A 4XMLH 3QDJD 5ITBH 5KVDL 3AADB 3G67A 1A1OA 3IDGA 2XDHA 1X4ZA 4D8PB 1J5EB 4FXGB 4KK8D 3H1IH 1EBPA 2EO7A 1EXGA 3NP4A 3QA3B 3BAEL 1BMGA 4PJHB 2AJ3B 5GZOD 2YD0A 1DQLL 3QDMD 2DDQH 4A6YL 3DURA 2JCCE 5DFTA 1D9KB 2AITA 5DMYA 5JIIA 3AITA 4P46B 4F7TB 5HYFA 2C1PB 4FADA 1E5ZA 3AT9A 3VFTB 4XH2A 3QR2A 2OT5A 3E2EA 2JK5B 3RIKA 1N5AB 2ZOLA 5HHVH 3QFJD 2G75A 3OAZH 1DUZA 4YGAB 4PRPD 3HIZA 1HU8A 1A4BA 1EV2E 1KGJA 2Q20A 3FU0A 4S0TD 4I2XB 5IM7B 1XEQA 2BOBA 1KLFB 4M8VA 4P57A 4YPGB 1R5VB 3RUGA 4X5XB 2Q7GA 4LF8O 4S0SD 1L0NH 1OQOA 5HDQL 2PYJA 1KBVA 3EOYG 3IFPA 4KDTA 1I5XA 1W6LA 1UJTA 2VXTL 4I8DA 2WXRA 4UF7C 4DV3O 2AI0L 3MJ9L 4UBDD 3TEXA 2F8VA 5KVDH 3J80N 3D18B 3JTTB 4TSFG 3BP6A 4Q6IA 1SQGA 1D5MB 3ENEA 4I77L 3W0WE 3VWJD 3ARPA 5F97E 1LE5B 3BAEH 5TQ0L 2DEXX 5HYQA 4DJMA 2VMEA 3VD7A 2VQFB 5IWAB 4L3EE 4FABL 2JJVA 1DQLH 2WBJC 4UQBA 3BISA 3FFCB 2CE6A 4A6YH 3U6XA 1FDLL 2E56A 2VR4A 3KD4A 4MB5A 4WFEE 3ZDXB 3L4YA 1RJZA 4G9DA 1JN6B 3IK2A 2Y69B 1GGYA 4N0FB 5DGQA 4IKKA 1J05B 1NH2B 3MV9E 3ZQXA 2DWSA 1JXJA 2PPAA 1AS8A 4KKQA 4NFDA 3TXSA 4RIRB 3RVWD 3FD9A 3V9CA 5HHQB 4NKIL 4NQSA 1ZLUK 2FJGA 4G43B 4MJJA 4U6TA 4XBGA 2YKKA 5DJAA 3GMNB 2GY5A 1CTNA 2HKAA 2A83B 4OQ1A 5B1OA 2Z91A 3BHBB 4JI8B 5IROC 5BS0D 4G8IA 4W9HC 1NVPD 5HDQH 1JZGA 4P23A 2PXYB 5DURB 4NXNB 3VFWA 5J12B 5DHEA 1J0IA 4XNUL 1CDIA 2C4FU 2ZAGA 4QJ4B 5I71C 2HN7A 1LWRA 3SPIA 1A7QL 2GTZA 2AI0H 3MJ9H 4M02A 3KCYA 3T1HB 5E0QA 5LUMA 4ZS7L 1NJ9B 4WFFD 1SXBA 5A2AA 3VD3A 3E38A 4I77H 3KPPB 4MCZB 1DJWA 2GITB 1D5ZB 5IIEB 3N27A 3Q8EA 3BPLB 4IIQA 5TQ0H 4JO4H 3S96B 3ZKND 4AVJA 1A6AA 2I5YL 3TYFA 4ADGA 4V1DE 4FABH 1MH5A 5LGYA 1BDYA 5T1DL 1OZTG 2JEXA 1FDLH 1KNOB 2JCCA 3FRPA 3MRFB 4Y1TA 2R0KL 2BOLA 1B6QA 4KKZA 3CSBA 3T71A 4AE1A 1AE6L 1J7VR 2DWXA 3G6JF 1PZSA 1UA3A 1M05B 3HE6D 2OTJV 4B3RB 4A68A 4EZKA 3ULVD 4LKXB 1AZVA 2BIPA 4O2FA 4MNGB 5FYKL 5EEVA 3QF7A 5B7EA 1DVFC 4NKIH 1IFRA 5KWYC 4LGPB 4U1IB 1AI7A 1CI3M 5TE6L 2AJSL 3VXMA 4UZSA 5AOKA 4CMHC 1M57B 2AV1B 1EFXD 2IBZH 1S5HC 1AQ8A 1USQA 3UEQA 4UCSA 5AZ2L 2Z3FA 4XTRC 1X5GA 2VUOA 3RFZA 2EVGA 3MROB 1G7PB 2XYBA 3IB4A 1A7QH 2MHAA 3B77A 3STLC 3MRCA 2WTRB 4XO3A 3SGKC 1MG2C 4ZS7H 3V7AE 2J8UB 5CBEA 3K08A 4NZ8A 4PFEA 1PW3A 5JYLA 4CADB 1U2HA 4Y4KB 3T04D 4PJ7F 1AO7E 2PWFA 2QFRA 5L7XH 3V8CA 3W0WA 1VCBC 5FGSA 1BZ7B 2ZCHL 2I5YH 3T2PA 4DV1B 1MWAB 1R5WB 5GJTL 3UPRB 1I94B 1IAKA 4D2NA 2J5LC 5TGBB 5T1DH 3SIKA 3UACA 1AB3A 4U6XB 3RL2B 2R0KH 3PWLB 4K4KA 3ARFA 4WFEA 4JI6O 1A02N 1WLEA 4TUJA 3IXTB 1AE6H 4KKLD 3BH9A 3SY0A 3VFNA 2BDNL 3PNWA 4WCYL 5ACZB 1VEOA 5JIMA 2XVGA 4NQEE 3D39A 4F91B 2E75C 1IAMA 5GXBB 1D5RA 2ILLA 6FABL 1IJNA 5L3CA 1FNEA 4S11A 5FYKH 5C07A 3HC0A 3GXTA 3RY6C 2WJ7A 1R3LA 4N2DA 4P2QE 3PWUA 5TE6H 4UB6Z 4N23A 4W6XB 2AJSH 2A73A 3BH8A 3JZ7A 3R18A 2CDYA 1IVTA 1SA0B 4G83A 1M9NA 4M9PA 1KYFA 4XCEA 3T4AA 4NOFA 2WA4A 5H2BB 3ARBC 2WWKT 3BEVB 3P40A 2FT6A 4Q74A 1T0NB 3CCUV 4RUEA 5DRWB 1EAJA 5AZ2H 1GA2A 2YEZB 2IGFL 3FO9B 4MT8A 2BSED 4NO2B 1BYNA 2G9KA 4LARL 1E0OB 4JNXA 4JJ5A 3CZNA 3MLZH 1WFOA 1G1XB 2J6EL 3PL6A 4CGTA 3VMNA 1T7VA 4AGPA 3GUFA 1VQ6V 4M1DL 5C0IA 4QHNA 2UWEE 1CGXA 2BOCA 2ZCHH 4UMGA 5C9JA 4YL9A 4LCWB 3JTSB 3HKEB 1JE6A 2CLZB 5GJTH 2CO6B 4PCKA 3GMPA 4NKQB 5A43C 5AENA 5KN5A 1YMMA 2V8LA 2X4RB 4ZX5A 4D0CB 4IOFC 4X9FA 1RUQH 2IALA 3H8NA 4DCQA 5HBBA 1AZCA 2XV3A 3GGWB 1ZLEA 3PV6A 2BDNH 5AVYB 3P2DA 1K92A 1JAEA 4WCYH 4I48A 4S1QL 4OKVA 4WDIA 2X4QB 4M8QA 3GHEL 3BIKA 2BXYA 2P28B 3X17A 1L9NA 6FABH 3W56A 4JM2D 3PWJB 4KX8A 1SBSL 1RHHB 4MA1C 4PGZA 1J5CA 3DTUB 5EF2A 4D9QD 2XFXA 3N1FC 3JT0A 2Y36L 4RO2A 3A22A 4IRJC 4QHKJ 4XWOC 4FJZA 4OY9A 4YGVA 2M83A 3GLDA 4R0LC 4RWYL 1TUBA 2EDXA 2DMGA 5HGBA 5CR8A 2NY4D 3NIDF 3IFOB 2IGFH 1J9TA 2E59A 4RDQF 3E86A 1W2BU 3MMEB 4LT7A 4LARH 4KQ0A 1QLRB 3KJ4B 4F15B 3BIBX 3RWGA 4O2BA 3TVMC 2Z4TA 2QQNL 5I73B 4OI7A 2J6EH 3WKPA 1E9OB 1XIWC 2L04A 2VMFA 4M1DH 1PG7L 4MZRA 1EAPB 4KL1A 4TT3G 2P46B 3CQPA 4YR6A 2QADD 5IK3B 1URLA 5B38B 2EXWC 5B38G 2XIDA 5C7XL