3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
4X8AA 3AUWB 1R3LC 3K0DA 4WFGA 1P7BA 2A0LA 3E8GA 4LCUC 3F7VC 4EKWA 2EIKC 1S5HC 3GB7C 4PDVA 2WLHA 3ATFA 2A79B 4MVRA 5EK0A 2BOCC 4MTGA 4PDRA 5CBGA 4MTFA 2ATKC 3TETA 3ATEA 2AHZA 3T4DA 4R7CA 3OGCC 3SPHA 3VOUA 3ZJZA 5CBFA 4JTCB 3OUSA 4OXSA 4XDKA 4RO2A 5BZBA 3SYCA 4MW8A 3LNMB 1ORQC 3K08A 1OCOC 3LDCA 4MTOA 4P2ZA 4X89A 2QTOA 4GX2A 3E83A 4MVQA 5EC2C 5E1AC 5J9PC 2E4FA 3K04A 1QLEC 2GIXA 4MVOA 1OCCC 4JTDB 5EBMC 1XL4A 2HFEC 2X6CA 3LDEA 4PA9A 3E8BA 5B1AC 3R65A 1K4DC 2QKSA 4F4LA 4MW3A 2DYRC 3PJSK 2WLIB 2HVKC 4LP8A 2Y69C 4MSWC 3T1CA 2Q6AA 4X88A 5KUMA 4PA6A 4MS2A 1M57C 3OR6C 4QNHB 3LUTB 3WG7C 2DWDC 3AT9A 5B3SC 2WLLA 4CBCA 4MVZA 3AGWA 5EC1C 3SPGA 2IH1C 4H37A 1R3KC 3FB7C 1U4EA 1J95A 1LNQA 1N9PA 5EBLC 4G28B 3HPLC 3IGAC 4MVUA 3BEHA 3F5WC 4XDLA 2Q68A 2EILC 2X6AA 3ABKC 3UKMA 3SYAA 2YEVA 2WLJA 1V54C 4R6ZA 3STLC 4R50A 3T2MA 3T4ZA 3TCUA 3ABMC 2NLJC 3K06A 3OUFA 4ZBMA 4P30A 4MVMA 1U4FA 3ATAA 2EINC 1M56C 4P9PA 4PDMA 3ASOC 2ZXWC 4KFMA 1OCZC 2EIMC 4RUFA 4XDJA 3E8HA 2KB1A 4WFHA 4QE9A 2IH3C 4GX1A 1ZWIC 2ITCC 4UUJC 4I9WA 3X2QC 2X6BA 3ATBA 2WLMA 5B1BC 1K4CC 1XL6A 2JK5C 3K6NA 4BW5A 2WLKA 3LDDA 3RVZA 3SYQA 1BL8A 4DXWA 2WLLB 3AG1C 4PA7A 2WLNA 1R3IC 3F7YC 4J9ZB 2BOBC 3AG3C 4J9YB 2ITDC 2HG5C 3K03A 4JTAB 3UM7A 3ZRSA 3RBZA 4QE7A 4P9OA 3STZC 4PA3A 2Q67A 4HZ3A 4LBEC 5IY5C 2Q69A 5KUKA 3AG2C 2EIJC 4PA4A 2R9RB 2WLIA 4R8CA 4RUEA 1JVMA 1R3JC 3FB5C 1OCRC 2OCCC 3EFFK 2DWEC 3ASNC 3SPCA 4HYOA 3OR7C 3SJQC 3IFXA 3SPIA 3K0GA 3ABLC 3FB8C 1KKDA 3KG2A 3AT8A 2H8PC 3SPJA 4GX0A 3SYOA 3E8FA 3RVYA 2P7TC 3SYPA 4WFFA 2W0FC 3RW0A 4RAIA 2DYSC 5CBHA 3JYCA 3FB6C 3VSQA 2ZD9A 3E86A 3AG4C 4WFEA 4GX5A 4G27B 2A9HA 2AHYA 4H33A 4PDLA 3ATDA 2HJFC 1G4YB 4TWKA 5EBWC 3E89A 1V55C 2HVJC 4MVSA 2K1EA
chains in the Genus database with same CATH superfamily
3QUKB 3ASOB 1D9KA 2YUXA 1RZKC 4OBRA 5E8OB 1GIGH 5HHQA 3KPRA 1E30A 1SBSL 4KXDA 4C55A 1H8HG 1JGDB 5DTFA 4IK7A 3QJVB 2XJLA 4P57B 4UM8A 4JFED 4ZPVB 2H94A 3E2EA 4LVHC 4DGYH 1SRDA 2AQ2A 2NTFA 4R8WL 1EZSA 2ZUQB 1KYOF 1SESA 4JTCB 2AEPL 4ALAH 2WO3B 2AMGA 1KCSL 3MNZB 4JQIA 1AGDA 3G5ZA 1YNTF 3SE8H 4GYCB 1WPXA 3NSFA 4JFFE 4L4VD 3RWCA 5L0QC 1AXTH 2J8UE 4H8PA 2HVKA 2JI2A 3ZRVA 2UY7A 4MXQC 2CAZC 1UPGA 1PL0A 5EU7C 3RA7L 2AHIA 1KJ3L 1I9JH 4U31A 4K15A 1LO0L 2X4UA 1JDCA 1N8ZA 3L17A 1BFVL 3A24A 5LGKA 4PP2B 1R46A 1HP8A 3APQA 5D71L 2Z64C 5DJYA 5ADPH 3GXPA 4RRPM 2PCFA 5JDSB 5C0CD 4X4YB 5J12C 5JIQA 5FYKL 4XBFA 3HB3C 3U4EB 3NFPB 4PS4H 5I73C 3VAEA 2P26A 1JPFA 3CLEH 4LF3A 4RCAA 3QUZB 1WC7B 4WU7A 1JZGA 2ADGB 3DHMA 4OZFH 3SOBL 1PNCA 5ICYA 5C3IA 3LAFA 3AY2A 4FQLL 1A9BB 4AMKH 1GS8A 3ARED 4BGLA 1RZ8B 5FKPB 2UZYB 5ID1A 5IJCC 3KWUA 4X65B 3G04A 4JCLA 5EU3A 5DZ9A 2Z65C 4LVHB 3ZE0B 2EVGA 4MVMA 1ED3A 3TLRA 5C6PB 4JKKA 4I4TA 3W7UA 4AGOA 5C70A 3O9OA 4OT1L 4D9RD 3IDMA 5DUMH 3BESR 3P73B 4ZZKA 4LSUH 3QQDA 1CE1L 4OB5H 5L0QB 4LR3A 1PX3A 2P24A 3GRBA 2UV3A 4IOIA 3JV4B 3S9DB 2VE6A 5ILTL 1CO1A 4OCSL 4J9YB 4JTAB 3V6ZA 2XWTA 1UT1A 3BKYL 2A77H 1NT2B 1IV8A 4OLEA 2IEPA 3MHZA 3T8XA 1MY5A 5CIPH 5IESL 1TZHA 3OT7A 5DECA 2Y7SA 3AQDA 1KMGA 4ORGB 4BFOA 2PYEB 4YDVB 4KX9A 5I17B 4R8CA 2JJSA 3P02A 4UTAH 4XXCA 1Z7JA 4MTXA 5JQ6L 5J12B 1FG9C 5DA0B 4JFZH 5I73B 3HJ0A 4HLEA 5F8RC 1WA1X 5K39A 1J10A 4PJXE 3VQLA 1J8HD 2QTVA 3QIWC 4L2LA 3SDAD 1EHLL 3C5ZA 2JV6A 1OSEA 2W9DL 4Q7DA 3FTWA 2AI0L 3KW7A 4DK5A 4BZ2L 5KS9B 3CPLB 4I1PA 3HHRB 4Y4HD 4QCIB 1KFAH 5DK0A 3FAVA 2Q7AA 4OGYL 5JZ7D 3M99B 1YQVL 1J1OL 2R69A 4MQTB 3ARZA 3U30C 1IGFH 2FQFA 2O6DA 4X4ZA 2A74A 1P9MA 1NU1H 3CN4A 1KCBA 4CL7A 3HMWL 2NUTA 2NX5A 4I77H 1U0QA 3BIBX 3TA3C 3ZHNA 2FGWL 1L9NA 3MV9D 3H7LA 5JIHA 1A3RH 1NPJA 4ZX6A 4YHHO 1RFDL 4X89A 2ZCHL 5DMYA 1UH3A 3B2VL 4GP4B 1IQDA 3FO9B 4MA7L 3L9DA 4WZ9A 4NHUB 1UM5L 4XOBA 5J7CC 1AB3A 1QSVA 4WDIA 5K9OA 4YIOA 1W8NA 4JYAO 4RGOL 1FAIL 1KGJA 2X0LA 4MB4A 3MCKA 5LNEA 3REWB 4AIXA 2L7JA 2R2CA 3VQ1C 1ROCA 5ANMA 5CD3A 3QIWB 3U0TB 2H26B 5IJ9B 2Y69C 4TV8A 1GZPA 2HFGL 3K7UA 4GUNA 4XP1H 2N0MA 4DAGL 4FK5C 1MUJA 3IDJA 4GUPA 4IGBD 1BAWA 2V2TA 3VFGH 1AR1D 3PJSB 3NA4A 4IU2B 2GJZA 5D1XB 1Q94B 4ZUSA 4MMZC 5J6HA 4YJ3B 4R26L 4YJ2B 3S97C 1EN4A 1LM8V 3PQYE 5I66A 4UQ3B 1HHHB 4PJAE 1MHHB 5JA9A 4FABL 2IQ9H 5JWPA 3BGFC 4JHAH 3J7AU 1OP9A 2VIRB 3RGVB 4NT6B 3KKYA 4FG0A 4MWFA 4W4KA 4NRXA 3TA3B 1K97A 3ZBMA 3H9HA 4RUFA 3MJ6A 3Q5OA 2DI8A 4IDJH 1SYSB 2ZCKH 5CD5C 1XEDA 4AYFB 2G2PA 2IWEA 3O8XD 4QRRE 4POZD 3NH7L 1CD9B 5AD0A 2R0ZL 3TGXA 3MLVL 3G08A 3GLDA 3JUZA 4Y1TA 2X70B 5ICZB 3QG5A 3WIAA 1NQBA 5IROD 1VSCA 1VACB 1JVLA 2PW2A 2Y07L 2EIJC 2Y69B 1EZLA 2ZPKL 3CE2A 1TVHB 2KHAA 3GTNA 4WEBH 5GHWL 4N9GB 1AS7A 5D1QA 3G6DH 3RTLA 2VS0A 1YDXA 2M8XA 3QG7H 4C4KT 1SOQA 3FUJA 1WJ3A 1Y18A 4AVIA 1VQNV 1V7NH 2XRAL 3G5YA 1U91B 2CTQA 2VN5A 1EZUA 4Z7WE 5DR5L 2A0LC 5ESVB 2WZPD 3D1MC 1ZT1B 3UZVB 1PZ2A 3DYMA 3U0PA 3MJ7B 4MMZB 2QQKL 4JPKL 2A9NH 3ORJA 5EEWA 2XBDA 3N1QC 1I9IL 4QT5A 4A1RA 1ZGLP 5BW7C 2CHXA 1KLUB 2Y5QA 3F12A 1NEZB 4J3TA 4DJMA 3BGFB 5F9AC 3H9SE 1FFNA 4NUGL 3CHPA 5BUGA 2ZXBA 1C5DA 4X8AA 1IBDA 4JM0A 4X6CA 3F85A 1A1MB 4HXAL 3BCCH 2BSCA 4PRPD 5T1MA 3WD5H 2EVIA 2UZXB 5F44A 3HE7D 3WFDH 5EU4B 4OFDA 1YXBA 4IRZA 4G9FA 3GEWB 4XPTL 5HSFA 4K8RL 4LFHD 2KT6A 4P5MB 1KWGA 3NEOA 1WD9A 5LXGL 2BVEA 2EDLA 4ZXBC 1KTLA 1AZRA 1I8KB 1OGAE 2B9BA 2J1KA 2EIJB 5I1KH 5JH7B 4PJFA 1UA7A 5DC2A 4BDVA 3E8BA 5IDJA 1S5IH 4BCXA 2BINA 3CFKB 2D7NA 1KGCE 1AXIB 3JSLA 3E22A 5ES4B 4U49A 4FOMA 4OGQC 5DRWB 3VFSB 5AYTA 3LH9A 4K07A 1IGCL 1QYGL 3SJVD 1KC8W 3O2VH 1MG3C 3WIFB 3ARTA 3ULUE 5JVDA 3BCDA 1T1YB 3E6HB 4R97C 4CADA 5CGYD 3P3YA 5IV2A 4DR3O 1BYPA 4TOYL 2H32B 2KC0A 1R24A 2MKLC 3Q2WA 1J9TA 3R18A 2F53E 1D5IH 5TK4A 3GNMH 1BF2A 4G8AC 5D7LE 4Z7NE 1FFQA 1MFAH 1ZCRA 2QFRA 2WGXA 4MAYC 1CL7I 3OAWA 3MNWB 3S2AA 2DM2A 1SUJA 2O5XH 3BZFA 4GLXA 3A0OA 4FTVD 5LBSA 3WNLA 5BPPA 3WHE1 1TQCC 2C9SA 5AWNH 4ZXBB 1IM9A 3T0VA 5BQ7B 4HIEB 2Q5ZA 1FXKA 5L8JB 2JKRM 1ONQB 2H3NA 2UXNA 3CVHL 3EJZC 1OPOA 1J1PH 2APTA 4D9QD 3K91A 1PCSA 1CL7L 2LP7A 5T1DL 2AF2A 4E9YA 2NDFA 4O02H 2EUXA 4NXNB 1E5AA 5JW4R 2BOCB 3NABH 1S5JA 1U8PB 1UWEL 4DTGL 2WP3T 3CCEV 4S0TD 1XCTB 3TTSA 1KB9K 3N55A 4OGQB 5AW4B 3S37L 1RUML 3LYRA 5C7ZA 2RFXB 2V2XB 2OPCA 4B7IA 5IQOA 4AC4A 1I1YA 4EI0A 4HKXB 2QJ1A 1NCAH 4O2CA 2I5YH 4R97B 4N0FA 2EYRA 3GXTA 2Q3ZA 1R33A 4XO5A 4DCQB 1U30A 1LWRA 5DQDH 1N59A 3NJJA 2YPVH 5J1AA 1M7DA 4MAYB 5HDQL 5FCUH 3B2EE 4ZFOA 2ZJSL 3MSPA 1EO7A 4MZ3A 3MRHA 1N12A 2H47C 4PJXA 1TQCB 2G5BB 3KL0A 1BBJA 2EIZB 3FC8A 4MT8A 2CGRL 3SBQA 3AT0A 4OV5A 2KLRA 1ZHKA 4YSQA 5JOEA 1J0HA 2M6YA 4NFDA 3U46B 2XAJA 3KYOB 4RO2A 3MRRA 3VWJB 2JLLA 2VDLH 5LGHH 4N26A 2VMFA 3VFUA 1M2VB 3LN4A 5IBLD 1KIQB 1YEJL 3B37A 4R5VA 4AEHH 4ZFGH 3EYOA 5HHOB 1TJXA 5EOCH 1C7SA 1CXHA 3MLRL 3MNVB 4NWTL 1G6RH 4M62L 8FABB 2UUBO 3ULVD 4X5XB 3CMOL 2IBZH 4AW7A 1WB8A 3QNYB 4E9TA 2NQCA 5H37H 3H3BC 1BEYL 2ED9A 4PA6A 1SA0B 1ICTA 4H40A 4TQFA 1GZQB 1KPVA 3VW3L 4XAWL 1IGJB 2OSLA 1B6DA 2QSVA 2IWKA 3CZGA 2B2XL 1AP5A 4KGJA 4OUUB 4QRAA 1DDHA 3EGXB 3TCLA 1CB4A 3MMEA 5BCAA 3CDCA 3BVNA 4JFPA 3VQ2C 5C08B 1ZUQA 2BP5M 4HGKC 4LARL 4OZHF 5JORA 3VWKC 4MA1C 1JUFA 2IH3A 2N0KA 2AP2A 4BFNA 1AJQA 4KUZL 1JA8A 5LMNO 3UEZA 4FMFA 4JPVL 3VJ6A 2NY2C 2ICWI 4AIZA 3RFZA 3VSVA 3CRCA 4LVNB 1HNWB 3SSGA 1W72B 1E4XI 4BIKA 5DHXB 3CUPA 1SLXA 5IHUL 4Y1AE 3PQYA 3C08H 4PJAA 1J18A 4U05A 4YLCA 4XTRC 2Y7OA 4HLZG 2YAQA 1YEFH 4L29B 1TDQA 4IMKC 4L3EA 4ELKB 4I13B 1DN2A 2UXVA 3EF7A 5JPNA 2EDMA 4FKKA 1JHKL 3M46A 3L5XL 4DV7B 3NQIA 3UG3A 3VFOA 3QH3B 2G5UA 1SBSH 1T3FB 2P4AB 2CDFA 4YHMH 1EERB 1B6QA 1PPIA 1U8IB 4KUMA 4LLDA 4X4MA 3SY0B 3BZEB 1T20B 5EYPB 2Y06H 1THZA 2HG0A 4LDCA 1NC2B 2R23A 2OMUA 5C07D 1CT8B 1MFVA 3MRFA 4KVPA 3U7AA 3VI3B 1GZHC 2IGTA 5I82A 1RK0A 1KCSH 4RWHA 2YC1A 3BE1L 2J1ZA 4RMQA 5EH1A 2BFVH 3O4LA 3Q8EA 3VWKB 4ZO8A 4MA1B 4K9EL 4FXKA 3JD1A 2NY2B 1LO0H 4ILDA 1TEYA 3ARBA 5AAWC 5KSVB 1GSMA 3MTRA 5KG9B 3QWQB 4Z7WA 4PJ9D 1UM4L 2YQ3A 3PV7A 4QRUB 3SY6A 4N2BA 3Q6FB 2OM5A 2A79B 4LRIC 1JGEB 3QIUD 1Q72L 1UB5A 1Z1WA 3GIVA 5E99H 5T33L 4W9IC 1CJYA 2P8PB 4JO1H 5SWQA 3CNKA 5GGRY 3MV7D 4F57L 2VR3A 3H9SA 4JI0B 3ZMRA 1ERNA 2PO6A 2Q3XA 4G7VL 4QJ4B 2NT0A 5FO7B 1XBRA 4HXBH 3FQUB 4F7TA 3CMAV 3NGBC 4F27A 2AJXL 5FF6A 4ICXA 4JN1H 1Y6MR 5DWUL 1EAPA 1QACA 1NCIA 3G6AA 5DEGA 2ZAGA 2XVGA 2ICEC 4FN0A 4M5TA 2GHZA 5LBQA 5DRNA 2XG5A 2M26A 1MREL 3BHPA 1QWHA 3FFCE 4WNQB 4LHUA 5EOQL 2BHFA 4Z1PA 3FL7A 4ABUA 3VFVB 5JPMB 4KDTA 2HPTA 3OKNA 3MO1B 1FUNA 3PHQB 5FK9B 3ME0B 5KUMA 1AACA 3LRKA 4PCYA 1OGAA 1GOFA 3CN1A 3ZDZB 4ZMZA 5DFVC 3ZOAA 1NFKA 3PWLA 1KTRL 3CLFL 1GS7A 2GITB 2ZOKA 3UC2A 4DP8X 1UEYA 5JHDE 2X1PA 1D2OA 5C0JA 5I0YA 1LWHA 1AFVH 3BKYH 4UOZA 2Z4QA 3VGEA 2AV1A 2JKIS 5C93A 1K4DA 1OARH 2JIXD 3GZKA 3NIGB 3NFNA 5DC4B 1HDJA 5IESH 2XA8L 4O5LH 3CCHB 2GIMA 3N04A 5IVXF 4PREB 5DD1L 4R50A 5EOTB 2CMRL 4KHXL 2ADJB 1B0WA 1FPOA 4F6EA 1ZVSB 1QWNA 4OF7A 3NIDF 1I94O 4R2GC 4XC1H 3S5LB 4ZZFA 4NHCH 4O2EB 1H3PL 4YY3B 1I8MB 3NGBB 3VXUD 3QRLA 5JCOC 1JL8A 1U58A 2OCJA 2F53A 2GPZA 5IJKC 2DV6A 2QT6A 2V8LA 4N2NA 3W2DL 4E5XA 1CE6B 1R5VB 2ICEB 4P2RE 4P9ML 5D7LA 5EF2A 4LFBO 2BIPA 3LHPL 4KDWA 5K1NA 5LKNA 3WTTA 4KK8C 3B34A 4JRYD 3BH8B 1YQVH 3WIHL 4I9XA 2BVOB 2QDVA 3O45A 5FO9A 4NRYB 1H5BC 1THAA 5IE9A 1TVBA 2WQSA 4TUOB 3SE4A 3AWEA 3ZHQA 3QPXH 4FQXA 1H2LA 4IEFA 3RAJL 3N1MC 3PP3K 3IRCA 4J11A 1KYAA 1HN1A 4DKEL 1OWRM 2EUVA 1FF5A 1MRDH 3U1SH 3KGRA 1O9GA 1IU1A 4RNRB 2VT0A 5ITBL 1HNXB 2OTJV 3RW0A 1T5XA 1Q9WA 4CC5A 5C0FA 4YXHH 3H0TB 4HV8A 3F7KA 2GSGB 3D4YA 2R7EB 1XF3B 4AJVA 4NWUL 4EDXB 4NXMB 5GRJL 2PPFA 4R2GB 4YE0A 2A3QA 5D72L 1LO4L 1ILSA 4WBNB 5HYQB 2VC2L 4NB5A 1KB9J 1NVPD 4ZUWA 4JDTH 4X7FC 5HPOA 4MX7A 4JJOA 4LSRH 2VDKH 1RZJL 4Z0XB 3S3DB 4MXWL 5FNVB 1Z3GH 3D85B 2HCZX 1AS6A 5E0FA 3ZJZA 3SPHA 5CBFA 4QHPA 3DX7B 1ZLWK 1NCNA 5F3BA 3E8UH 4YHLH 2E9JA 1YJDC 4A37A 5IG7A 3A3YB 4RMVA 3T3ME 6PAZA 4GKJB 2D3VA 2J8UB 3T1YO 2NT1A 1VF6C 3GHPA 3KWWB 4XCCL 1DQDL 4YGVB 1NM4A 1EXHA 1GPOL 3CN3A 1H5BB 4OLXL 3QEQB 4X4KA 3KEDA 5DT1H 1HSAA 5ENWA 2DF3A 3MRPA 1H8EG 1HKLH 2NRDA 2VLRA 3F62A 3OGCA 2D0HA 5EPMA 5KYWB 1W6LA 5CJXA 1G4RA 4UIKL 1SVBA 4W6YB 2XKSA 3X2QB 2XN1A 5E5MB 1J5DA 1NSNH 1QLRA 5HGDB 4FZ0A 1F1GA 4TSCL 2FZ3B 3A4AA 3IPEA 3BRDA 4OI9A 4TNVK 2PPEA 2ZKXA 1TZGL 1UZ8A 1K92A 4WWKC 4HGMA 1YAZA 1DANT 1F3JA 4RAUA 3BP6A 4L48A 3FKSG 5KMGB 4K94H 4ZSOE 3MOAL 3V10A 2Y07H 4S1RH 4HUXB 4NZUL 4ZFZA 1Q1JH 2XZZA 4ZW8A 4AQ1C 1GSKA 4Z7UA 4Z7OB 1CI5A 3ZQXA 4RZCA 2QM4A 3KVQA 4B3MO 1JNHA 2OXHB 2QEXV 3VQVA 2AQ3A 2FWOB 3NRPA 3VRIB 2VUYA 4NN6C 1TCRA 1ZEAL 3RWFA 4PYHA 3P3NA 1RK1B 3D2UD 1BOYA 3G5WA 2QQKH 3JYBA 4PJIE 3ZE1B 1EO8H 4KC3B 2X6BA 4F7KA 1E67A 4WJ5A 1N70A 3CJJA 5KYUA 2FYYA 1GS6X 4Y5XC 2WLLB 2DQMA 2OL3A 1B2WL 1M3IA 3TXAA 3KPPB 1KU9A 4JYBA 4LSPH 1Y6XA 5DMKA 5F0LB 4MNQE 5DHEA 3BISA 2JQZA 4HXAH 3QHTC 4L3CA 1PCXA 3SQOL 2K9FB 3OJDA 1KTKE 3QUXD 5CBAA 2JK5A 5C0GB 2DOCA 4ISVB 4AG4H 1XNQO 3X17A 1TSHA 1QUNB 3IXAA 3S5ZA 4K8RH 5TQ0L 4WWKB 3I74A 3BFQG 2R9AA 1I7RB 3PUCA 3OEEG 2AVFA 4C83B 1ZS8B 1HNFA 2E5EA 1E50A 4AQ1B 3N2KB 3LH2L 1R73A 3P4NB 1FORH 4LCIL 1KIRB 3C8KB 1MVFA 3FRPB 1J05A 1WHPA 25C8H 3DSFL 3KE0A 3BPCB 1P2CB 1M7XA 4ADIA 1ITBB 3WUWB 1ODUA 1LVEA 1KC5L 4HIIB 2YKKA 1MIML 3MR9B 3SZKC 3QR2A 1U3HA 4OJDH 5HGGS 1SBBA 3QJFA 3RVTD 1OB1A 5LXTB 3L95B 3LKSB 3NAAL 4M43L 3E8VA 3PCYA 3WIIL 3KWVA 4I88A 4UB0L 4ESKA 1F41A 1XMWA 3CZFA 2VQTA 4Y5XB 4FHKA 1TJIL 5DYFA 1TUEB 4WJG3 3VCLB 2HUHA 2YD5A 3IAYA 1IGCH 1X5GA 2XT1B 2YBRB 4IOSA 4YJZL 2VZOA 4IHJA 4PTUA 2AXGA 3L2LA 3S3JA 4PJ8A 4OIIH 5EFIA 4X42A 1LK3L 1ADQL 1JN6B 4TVUA 3IJYA 2JKXA 3QQ3B 3IDUA 4JRXA 1F4YH 1KN4L 5EU7E 2G60L 2H6UA 3SD5A 2VLME 2WWNA 3OKLB 2KZ1B 7CGTA 1KJ2A 1UXLA 4AEEA 2NUPA 1UGKA 3AQXA 1D5ZA 4S1DC 2PY5A 3M88A 4RAVB 3PNRB 4FVMA 4NKDB 4UM9B 3ETBJ 2O1AA 5F9OL 3HAEH 3BAEL 1AOHA 5A2FA 2HLAB 3T4YB 5EU6A 3TP4A 4YDMA 3LIZH 3N41B 4G8EB 3OQ3B 2SEBB 7FABL 4CKQA 3K2IA 3DUHA 4NI3A 1HL5A 2R1YA 3CC7V 5T5NF 2HG5B 3CVHH 5C0AB 1R3KC 1W0WA 3JATA 3FFCA 5BZWA 3FFDB 1LNQA 5ICXA 4S2SB 4U6XB 4F58H 2IAND 3FBQA 1VQOV 3K1DA 3K72A 4M02A 1F3DH 5DEFA 3RKDC 3VD3A 1LDPH 4LSQH 3CRAA 5F7UA 3UTSB 4JBSA 5JHDA 3J81N 2XWRA 2H0PA 4LL1A 3TBWA 5SX4I 2Q86B 5B8CA 1S5LZ 3W82A 4YUEL 4AQ8C 1B4JL 2WXQA 4LP4A 1WN7A 3N85H 2EKJA 1DQVA 3EYFA 4RWYL 2OMXA 1AGFB 3A2FA 1SOKA 4Y9BA 3DTDA 1J9QA 3CJHA 1FZKA 4KJQD 4EI6A 4OZFA 1I7ZA 3TFBA 1BG9A 1MOEA 1TENA 2ZJSH 3W38A 5H6RA 4HK0B 3DC6A 1XF5B 3BUIA 5JLZA 4JI2B 1FVEB 3DJ9A 2FBRA 2HR3A 4ABVA 2P5WD 4WK2B 5MEPA 1QSFB 1LO5A 1DVFA 1ZGLA 3RY5A 1F6AA 3LXUX 4HYOA 3OXSB 2C1OA 4QRTB 1OLZA 4P2RA 2F58H 2DJMA 1LMKA 3KG2A 2AABH 2FTAA 1HWYA 1R3KB 2ZXGA 1XIWA 3EYSH 4K71B 3MUUA 4CGUB 1PIGA 2RGSA 2XASA 3TT1L 1I8IA 3O3AB 4FQQA 4LL9A 3DNKA 4UQCA 5GONB 5HPMB 4CVUA 3ZYJA 2BIMA 4JUSA 1R3JA 1YCIA 4B9CA 5JHAA 1LMIA 3NBNA 1NMBL 2QHRL 4OLZL 3E89A 1N36B 3EAKA 5TFSL 5ACZB 5DMGD 5IW1A 2JF1A 3QQXA 2O30A 3BEWA 4G9DA 2F54B 5I6KA 1BEYH 4JI4B 3H7BA 3JVGA 4FFTA 5D5MB 3AVEA 1GYCA 1KIPA 4JY5H 3EIFA 2IALA 3CXDL 2WLYA 3VW3H 3MV8E 3W39A 1NLDL 2NY5C 3WS3A 2ESVD 1FXVA 5I1DB 2HVJA 3MRMA 2XIIA 1ZSDA 1A1NA 3UACA 1CFSB 3GMOB 4LOVA 1BECA 3HG1B 3WLWC 5KVDL 4WTQA 3CRQA 4Y16C 4KTDL 5SWZD 4GUOA 4JFDE 2Q9OA 3VB9A 5KSUB 2B0SH 4JKMA 2Q6WB 4E9XA 1KD1W 4EUPA 1RFYA 4JPVH 4N1CA 3X3GL 5B1AC 4ABQA 4ZUVB 4WO4D 3ZDYE 1PX8A 5AZ2L 3H01A 1L0XA 3CCRV 3D7PA 3FQWA 3FTXA 3G9VA 4L4TB 3V6OC 3WG7C 1JF1A 3QUML 5I16A 2AMUA 4Q0XL 5BXZA 1PW3A 3VG0L 4EI5D 5D1ZA 2E86A 3N27A 3MRQA 3PL6D 3HS9A 3D87B 3W81A 5KOMC 4KXZH 4TXVB 4RGMC 5F89A 3H6JA 3SDXA 3JAWA 2YPLD 3V5HB 1E5YA 3DX3A 5HJDA 4FNLL 2GJJA 3FUHA 4X4XA 4Z7QE 3BH9B 5B7FA 3W56A 3MN8A 1Y6NR 2XPGB 3TBYA 4DVBA 3KPOB 1ZHBB 1S2EA 3QEUA 4ODHL 4E42A 1GRWA 2A5UA 3Q8CA 2DI9A 1P1ZB 2OTUB 5E08L 1JV2B 1RZPA 3VFPA 1D5BB 2HRGA 3WAJA 2QDOA 3US9A 5F1IB 1IC5L 1UACL 5LGTA 3F5TA 3BE1H 5CNHA 4ZSOA 3V4PB 4Y5YA 4LDEB 4NTXA 2ZYIA 1F4WH 2WLKA 1RPQA 3QNXA 3RB7A 3STLA 3JTTB 4ZTPL 5IFJA 4H0HB 1T66C 3NJHA 3SKUD 3IF1B 3KG5A 3L4ZA 4M1CC 5B1AB 2NXZC 4FYRA 4LHJB 1U8LA 2AZ2A 4G59C 4DQAA 2G38A 4OR1A 5A2KH 4I0PD 3DBSA 2BCKB 1DVZA 3C5SB 5DVNA 2R9RB 1JGDA 1X5HA 4Q6GA 4OZ4B 5BO1L 2PKDA 4KPHH 3WG7B 4P57A 3FB5C 2DM7A 4ZPVA 2O26U 4RA3A 2VLJB 4F8NA 5BUAA 3I6KA 1UD6A 3JZ7A 3PWPE 2DQIH 5PAZA 3SBPA 5GSVB 4Z5RB 5BS0D 3T6QC 1FL3A 1AI1H 3MNZA 3EO0B 2GSIB 4GINA 2A6DB 4X6EB 4HOWA 1EEYA 2WUCL 3B2UD 1X5JA 3NIFF 3MRCB 2Z91B 4MNQA 4RGMB 3V0HA 4A2DA 1TSRA 3ZHVA 5L4FA 4J80A 3QIBA 4FFZA 4FFYL 5FFOA 4OZFG 3AG4C 5FM5O 5CLWA 1PEWA 2F18A 4Q8BA 2CJUL 2BNQE 4MAUH 3J27A 4DUWA 2X1WL 5FB8B 1MREH 2Q8BH 4RFEA 5J3HD 1SJHB 2D7QA 4HWEL 5E51A 4U4BA 3CSPA 4ZX5A 1KBGH 2YK1H 2GW5A 3QFDB 3SQBA 3ZY7A 3OAUL 1F4NA 4X5WA 3W11C 2JRIA 3BFWA 2Y2YA 4IKIA 5ISZE 3D30A 1MCDA 2MIZA 2Z93B 4HH9B 3I6SA 2YAFA 4LFCO 5IB2A 4PSPA 5MERA 1G7LB 1WC7A 2ZKOA 1TZIB 2SODB 5GRXG 1MJUL 4LU5L 4TLSA 1RZ8A 5FKPA 5F7KC 4AQZA 2FX9H 3E2HB 3EW3B 4LCCC 2R9IA 5DD1H 2PI5A 1EWHA 4X5QA 5GS1B 2WNXA 5F1OB 2CMRH 4QF1B 3D5OF 1XL4A 1BIHA 3O9WC 1U2CA 2IPKB 4XMVA 2ROYA 1BD2D 4ANVA 3A0RA 3ZPDA 2L04A 4GBXC 4D8PB 3TF4A 4BQ8A 3EJTA 3P73A 5CSZA 4JHUA 3FTYA 1XVSA 4N68A 4EB6A 4I8DA 4UWQB 1GC1C 2EXYC 4XPBL 4YHHB 3AG4B 4JZNB 4ECNA 1CK0H 5I1IH 3HZVB 2ZXDA 4MJIE 4XNYL 1C12A 5FFGA 2A4EA 2QELA 3TPKA 4MNGB 3IJEA 5DJ6B 4JYAB 5D9SB 4G11A 1WD8A 2DL9A 4PGDA 3TX4A 2OZ4A 3EGSA 4YDVA 4NQXA 5I17A 4OCXH 4QWWC 4RSYA 4DUZO 3H2PA 4JG1H 5C0RL 2EDEA 5JR1L 1RL1A 1WFOA 1G9NL 4JKWA 5EF3A 3HN5A 4KQ4H 1ASQA 4A7GA 3ZSSA 2F95B 4DGVH 3CPUA 4FJ6A 4DGUA 2AEQH 3KXFE 3WSQL 2XU9A 4NQEB 4KXAA 2DJUA 2XQYK 4NCC1 5DCCA 4WUUB 4NQCB 4LCCB 4GKOA 3QQ9D 3FQYA 4PJGB 3O9WB 3I84A 2ED8A 5IQMA 1BBDL 2P6JA 4WHTB 1UJWB 2DS4A 1AQKH 3N2JA 4HUVA 4MA8H 4GBXB 3BLBA 1XF2A 4ZFFB 2QKCA 5JW3L 1U33A 2O5ZL 1TTAA 3I3BA 1HT6A 1AHWC 1C5BH 3KYMB 4MXWH 5GISL 3RIFF 4B08A 2VQ4A 4UQDA 5FHBL 5KTEL 3EH5B 5LYJA 2HKHH 4DW2L 4EO5A 4ZBJA 2VZVA 3D3VE 1CD1A 5KSBB 5FYJL 4M8RA 4TQHA 1E27B 4WKZA 3IVKB 1TYJA 5IB5A 4NHUA 4NBZB 2HXAA 4APQC 1YMHB 4HD9A 4P8QA 2AQNA 1WP6A 3GEFA 4XPGL 4L05A 4XCNA 3DO4A 4NO3A 1DCLA 4BH7B 4O02A 1TMCB 3BN3B 3CEIA 3QIWA 3U0TA 3INUL 4UIKH 3ZKNC 4NKQB 1I3GH 3D0LA 1BVNP 1BA9A 1T6BX 1S9XB 3OC8A 4KNUA 3N9GH 1LEKB 5FYLL 1BW8A 1RLBA 3OWRA 3RNKB 3X1GA 4P05A 3NJIA 3ZSTA 4IKKA 4M6OH 3PJSA 1TZGH 3KW8A 3L9YA 3N44B 3IGLA 4PJCB 1WNSA 4A6YB 5J8OA 2C8NA 4Y2NA 3S34H 4YJ3A 3QEGH 1LTXA 2ETNA 1MLCB 5ERWB 4LCWB 4WSGA 4UQ3A 3Q4HA 1JGIA 1MHHA 2ZQKA 1PF3A 4KY1L 2GIXA 3BW9A 5HI3C 1AHWB 3MRLA 2DTSA 2VKWA 3CQPA 3MREB 4D0DB 2VIRA 3MV8A 4NT6A 4ZOCA 4J1UB 4JM2D 4JYYA 2X89D 4GRWB 5KWYC 3OF6D 3VX0A 1ZEAH 3SDCC 2EVHA 4Z2WA 2YRPA 3NSCA 3AC0A 4QNHB 4HISA 3ZKMD 1BPLB 5DHMC 2CWRA 3KM1A 4NFBA 4JFDA 1ZSHA 1LNUA 3US1A 4EQ3A 1M6OA 1SXNA 2BVUA 3U36B 2X70A 5ICZA 3L81A 4N21A 4RMSA 2VXVH 2J43A 3EH2A 4NIYE 2R56H 3SGKA 2GB2A 2HRHA 5FOBB 4BSWB 2PR4L 2YEVA 4P5KB 4PW9A 3N0AA 1MFBL 1N10A 1U91A 1WZAA 2VL5B 2WQWA 4Y7OC 3C6SA 5IFHH 3UZVA 3FT1A 2X1XR 5GRVL 3UJTH 4A66A 5A16A 1DUYA 1UASA 3MJ7A 4MMZA 4NQUA 5H37A 3HC0B 1NFDE 2ZWLT 3KPTA 3CN2A 1P7QB 4NTWA 1K3EA 3QJUB 3R0MA 5C0DA 4D7BA 1G9ML 2VWEC 4HQQL 1KLUA 4DR3B 1MG2C 3LH2H 4OF3A 2FSDA 3DI2B 4JKPL 2BSRA 3ZE2F 3V0VA 3LKNB 1QG3A 4U3CA 1MOFA 2UZXA 2Z7WA 3SDCB 3VGHA 3RRQA 2OR9H 3M8OH 4UAOC 4G6JL 5DRZB 2HMID 3QJQB 1BHGA 1KFGA 2G9HB 1TJIH 3ABLC 2AEWA 4P5MA 4HUCA 4AX3A 1T22B 1DYZA 1O75A 4Z6AT 4YDJB 1I8KA 2C4FT 2YRZA 4HULB 5GZOC 5BRZE 1RCYA 3DMMA 3FSWA 3P0VH 1WS7A 2BM3A 5E23A 1VF7A 3PWPA 4QKTA 3GZQA 3ZMVA 1U8NB 4ODSH 2YA1A 5EDSA 5HDBB 3CFKA 3VXSB 2A0LA 2JVDA 1KV3A 1P5VB 3DRQA 2YAMA 4BCZA 2J2ZA 3LD8C 3N50A 1YDPA 2M83A 1AZUA 7FABH 1IFHH 1VQ9V 2K78A 5BW7A 3B2DC 1VENA 2EO9A 5ELIA 3VFSA 5T8IA 1UZGA 2BTOA 2DQHH 3WIFA 3QO8A 3PWVB 4B9JA 5GJSL 5I0WA 3E6HA 2JJTC 5CP3A 1BVKB 5E6SB 2YXMA 3VFMB 4PGEA 5IGXH 4PGCA 4FERA 1GYWA 1MNUL 1BT8A 3H54A 3B7SA 4IIZA 4KROD 4BFJA 4UAOB 4UV4H 3K74B 2EYTB 3OX8B 3Q1SL 5IHLB 2IAMD 5ISZA 1MFMA 4JVWA 1SJEA 3EH3B 1BMWA 5FHAH 3SDYL 3ABLB 4HU8A 4MW3A 1F18A 5L9DH 2HKAA 3VRLF 4YUEH 4ZXBA 1PJWA 3PU7A 1B4JH 4WEEA 3QARA 1EDQA 1KY6A 5FDWB 2X28A 4LPTA 2Q2EB 4D7SA 3VA6A 5JHLA 1SUHA 4FQ2H 1E6JL 2X6UA 2N7SA 1P6WA 5MHSD 2AAVA 2WZAA 2WQ8A 4MCMA 4JRWA 3IWVA 1UA6H 1X5LA 1P6AB 4H20L 2XVLA 4XNAA 3KYKL 1PY0A 1V27A 5HHME 1HE8A 5K9QI 3DOHA 5F7BA 4YSCA 3LD8B 4WF7A 1U8PA 2UUBB 3HFMH 3ARFC 2YD1A 4KHPO 1XCTA 4I0CC 1IJNA 4OGXL 3PWNB 2BNUB 1X5ZA 5DMJB 1EN6A 2V2XA 3ALXA 4GMSH 1L9RA 4M00A 4PJDE 5IB4B 4M7LL 5EZOH 5K5YA 1FNHA 4MJIA 4NZDA 3I50H 3B40A 4NXKA 2VQEO 4WHDA 6PCYA 3EBGA 3MX0B 4GLRH 4DCQA 2Z1KA 3LZFL 3LXAA 4MLSA 1XL6A 1T4WA 4NLHA 4X6BB 43CAB 3LDDA 4PRHE 5IT2L 3GO1L 2WLNA 1SXAA 3ZQWA 3UM7A 4MAYA 4B9YA 3H2WA 3MCLH 1F58L 1EANA 1NR1A 4DZ8A 2IJKA 1Q82W 1CD8A 5AUMB 5L88H 4ICGA 5LMNB 4GKNB 2FQEA 4DR5B 4LLMA 4QHUB 4B6ZA 1VQ5V 5KEZA 3Q5YA 3ZT6A 2BTQA 5LB1A 3FCTB 2PN5A 3QUYD 1UD5A 2YC0A 3WMQA 3WNIA 5L3GA 4TQEL 5ALCH 5H37G 3CZEA 4X80L 1EX0A 2CRIA 3VQXA 2VDNL 1EAJA 3V4UL 5H6QA 3OKMB 2HRPL 4J3OD 3T09A 3OKOB 3JWDL 1LGVA 3BT2H 1KIQA 1YUKB 1NQTA 4W9GC 5C0BD 4AE0A 5IQ7L 1A6UL 1FZMB 1CS6A 3CFJB 2GJRA 3ZRXA 3CHSA 4AH2A 3VXME 1GN2A 3ARFB 3NCJL 3X13B 2KYIA 4PLJD 5C0EB 5EUOE 5SWSE 4FXGA 3WMSA 1EFXD 5D6DA 2IQAA 3MNVA 4J39A 2NDGA 2KPNA 4F8QA 4MVSA 8FABA 3VI4E 4X5XA 2OWOA 3AUWB 3WTUA 2VDOL 3JV6B 3SJBC 4L23A 4IKJA 2X0VA 3QNYA 5LGJB 4PD4J 1OV9A 3RPBA 4QO1B 1SA0A 2D7MA 1GZQA 1NMCC 4HKBB 3O65A 1RURL 2HJKB 3QUMH 1PAZA 4Q0XH 2D3LA 1IGJA 3B8MA 1GGCL 2K3HA 4HJGA 4J3XA 4YXLH 4OUUA 4DKFH 2XZQH 3AS1A 4HZAA 3ULVH 1SQBH 1IGMH 4GAJL 1SN5A 3HUJB 4WWNA 1CFNA 1QHOA 2WBJC 3TXSA 1VCAA 2WC7A 3GSRA 1J9CT 1LUVA 3UERA 1JPTH 4GXFA 5LUMA 4JTDB 2VRKA 4XVUD 4H25B 3ZVVA 2CLRB 3B8YA 2C9XA 3QXTA 4WI0B 1W72A 3BSZL 4NKOB 5KN5A 3OC5A 1IC5H 3EJRA 2F08A 3LUTB 4Y4KC 3NP3A 1CLOH 1DVSA 4KKCC 4M29A 1S7UA 5AOMA 4AENA 1HWHB 1ZTXL 2EXTA 4JPIB 2QMJA 1WDAA 2YQ2A 5HYJD 4M03A 4IIJB 4P3DB 5CJOL 3B7UX 1FBIH 5FW8A 2KLTA 4ONGL 2EDBA 5FA3B 1XBDA 5F7DB 3QH3A 1T3FA 4DOHE 3FH5A 2VO5A 1NMCB 1U8IA 4QYAA 3ARDC 3SY0A 4DR6O 4MRBA 5EYPA 1YTFB 2WCPA 1NC2A 4GKKB 2VXQL 3W9DB 2WPDG 1CT8A 4OJAA 1EJOH 1RU9L 2AJVL 3QDJD 1BGYH 5DLMH 1W8OA 1QVOA 4AYBA 4ZHQA 1KYOK 2WBJB 2YSTA 2UXBB 2ZUUA 4GI8A 3ZRWA 1SOSA 2CUMA 3VWKA 4AMWA 4KFZC 3KBHE 5CGMA 1KXVC 2EZ0C 1D3CA 4MLIA 1GRJA 5JXAH 4XAKD 3KWXA 3OLIA 5EG6C 4HWEH 4WO0A 5KG9A 4IBUA 2PTMA 5T3ZL 4UQ2B 3SKOA 1LR1A 3P9WB 3Q6FA 4A2MA 2WLIA 1NFDA 4OLVH 1I94B 2VITB 1JGEA 3KCPA 1MCHA 1HDMA 3OAUH 3THOA 3QDHA 4BHUA 1WPCA 3TN0D 5KAFZ 4EZKA 4AYMC 4P2QD 4IMKA 3Q2LA 3QO1B 2PYJA 1KYFA 4WU5A 2APSA 5LGUA 3QQNA 5GS0H 1ZLSL 2KPWA 3TH2T 2BNRB 2NQ3A 4R4NC 4K0KO 1MJUH 4LFBB 1DQMH 1OEZW 2IOIA 2FUTA 3BPLB 2KSDA 3MROB 3QXVA 2JTYA 4JQVA 5E6ZA 2WV3A 2DMHA 4P3WA 3ARDB 3CD6V 1A4AA 3BX7C 2FJUB 3JWOL 4HJUA 2CDEA 1V55C 2H9GB 4HEPA 4WNQA 1PG7H 3DVGA 4G6KL 4U3XA 4IDLA 3CU7A 3FN0L 4RQEA 1CYXA 1GZHA 2NYYC 5MP6H 4E68A 5E56A 2Y7LA 3PHQA 4MGXA 5FK9A 1ITCA 1FV1B 3OR6B 4GW1B 4JFEE 5H5NA 3PNWB 5BRZA 1CDCA 1KBKA 3UCQA 3QNZB 3VOUA 4A04A 3APDA 1IX2A 3PREA 1QATA 1PZCA 2FH6A 5AAWA 2VZ1A 1Y6KR 4L4VE 1CXKA 3P32A 1NBVH 1SNRA 5D7IE 5K9KB 2WY3B 1TFPA 2W0PA 3JUYA 5T5FL 3FFQA 1JXKA 4MD4B 5B66Z 4OJEH 4OFVA 3VXTB 4PREA 2IFGA 3CHRA 1HILB 1TVKB 3L16A 4MVBD 3GBLA 5EOTA 2ADJA 2PUQT 1IM3D 1A5FL 3LDEA 3BUQA 1I1RA 3GPEA 2BVPB 4U1SB 3S5LA 3O6FD 3AEIA 4ODTL 2XTAA 1ZWIB 2FO8A 1A7QH 5IK3B 1I8MA 5KBNC 5C0CE 4BFEA 1LK2B 3ZMZA 5B5EZ 4JJ5B 3ZL2A 1Y76B 3KPSB 3T1YB 1R5VA 1V7ML 1OV8A 1AKJB 2ICEA 3QORC 4Q9BA 5LAXB 4QD2E 3P3SA 2QGBA 3R06B 1BEXA 1NC4B 1V55B 2WNKA 4P46C 3SZ6A 3LZPA 4JFXB 4UTCA 1EO5A 3TWCL 3VGBA 2RN9A 1T89C 1RI8A 4I87A 1L0LH 4UNIA 4TUOA 1I5YA 5TK2A 3CSBA 2J20A 2YLKA 2F66C 1P5UA 1RMFH 3QVNA 2AJSH 3C5JA 1MQKL 5F0JB 1Q9KB 3TZVD 2WINB 4YMPA 1T80A 4A7QA 3WFZA 3HAEA 4RNRA 5EA0L 2BY0A 2ZIDA 3OLGA 5DF0A 4CC1A 1GA2A 1D9KD 1MWAL 5BJTB 3U6XA 1HHKB 3MBEC 2WLMA 3D4GA 1KCRH 4KKQA 3UYRH 3VNYA 3FSVA 2WZ6A 2H2SC 4N0UB 2GSGA 1NIDA 2IJJA 5F97E 4EDXA 3ILPB 1A6PA 3WXVL 4XPGH 3KDMA 4NM8L 2VDPL 4WBNA 4PJ5B 4WUKH 2FJFB 3HS0A 1JCKA 3HZYA 4XMKH 2PWDA 3TC9A 4B3MB 5KS9F 4KJPD 1ACYH 3FAXA 4NBYB 4X7EC 2CUGA 4LGRB 2DLEA 1MZEA 4PRHA 3ZIYA 3QORB 2Q7NA 3DX7A 1J8HE 1UG9A 1I7TA 1GOHA 1T04A 1S7TA 4P46B 1I53A 1ZHLB 4MQXD 2HP8A 4HFWA 1KACB 1INQB 4PJEE 2CDGA 1H5BA 1N64L 1A22B 2EIDA 4NX0A 1HI6A 3QZLA 1XILA 2VWKA 3MTXA 4F2EA 5LHDA 1VQ7V 1YUHA 5KAIZ 3AMLA 1WRFA 3LB6C 4OW6A 5KYWA 3MLYL 3F05A 4DIXA 1T0MA 4HC1L 3ZKQD 2QZ5A 1DJWA 1XNQB 4JO3L 2FQDA 4ZS6C 4G8GB 2VRQA 4NNPL 1LQSR 1F5WA 3G6JF 3MBEB 1DLHB 3BDBA 5EO9A 3ATEA 2FZ3A 5C0IB 2CO7A 1Z32X 3IMSA 5CEXA 1KENH 4XRCB 3ECWA 5SWSA 3FFOA 3MCYA 1N2RA 4EVNA 1OHZA 3U4BH 4AJYV 4DO5A 4OM1L 3VI4A 1QSEB 1OAQL 4KV5E 1FYTB 5KMGA 2AK1H 4JNXA 3HNSL 3KJ6H 4K23H 3MOBL 2ZDIA 3IYLW 5G5DB 4HEPG 5KANI 3ABGA 3DX1A 1KCVH 3DWTA 1F23A 3G5XA 4QNPF 5DQ9B 4Z3EA 4PRAB 1KBBA 4N28A 2BERA 1RXLA 2FWOA 1NGXA 4JZGA 2J57A 2DYRC 3US0A 3EFOA 2A83B 4H88H 1QHTA 1XO8A 4U1KA 2IBGA 1VF6A 3D69A 3VGAC 1L0YA 4RDQG 2OP4H 4IRSC 4K4KA 2O5YL 2YOAA 3HG5A 1E0OB 4HQQH 2WLLA 3P2BA 1H2KA 4BFRA 2YXWA 3KPQA 4HDIB 1X44A 4ENED 3KPPA 2ZKWA 4XNBA 1Q4NX 4U7KA 5TTRA 2GK0B 4I5SA 2NY6C 4B95C 1I3VA 1VIWA 3Q48A 3PE9A 3C5ZD 5DD6B 5LNGA 4IQHA 3S5LG 1G7IB 1R6NA 4CN4A 3FX7A 3AY4C 4HJ1A 3ABMC 4XWGH 3LIUA 1F6LL 4MCNA 2GKIA 4NP4H 2YGOA 3IWUA 3BHBB 1YECH 1EEZA 1U93B 4YO0B 2KB1A 5HHNA 2WKOA 1Q6HA 4C83A 1ZS8A 3ATBA 5EN3A 3MJWA 2AGAA 4GOSA 2B15A 2DEXX 4AQ1A 3N2KA 1BL8A 2OMVA 3AK2A 1KIRA 1JF5A 3FRPA 4JAMB 2BOBC 4FC3E 1B2YA 2P42B 4LRNL 4KMTL 1VGKB 3EJYC 3IFNH 3PAZA 1P2CA 1G9EA 1E5CA 2NX5D 2NSXA 3WUWA 5A40E 2DYRB 1QHQA 4HIIA 3L4CA 4YEFA 4DRXA 1L3NA 2EQDA 3MR9A 1MW3A 2VXUL 3P77B 3T2NH 2X9ZA 1IFRA 3GI8H 4PJBE 3RVWC 4BUGA 3DDFA 2PYFA 2AJ3A 1MVUB 4WFEE 3A5VA 6CGTA 4IRSB 2UUCO 3HC3L 4PV8B 3HAEG 5HI4D 2Y0PA 1SN0A 1JPSL 1JFQH 1FJ1A 2DM3A 4JHVA 3DLQR 4TYUA 4Y5XA 2V5TA 2LVCA 3CFNA 1JDAA 1KYOJ 1SJMA 4JFOB 1U2HA 5JA8B 2EDOA 3DTXB 3GHBH 1A1OB 2NY6B 3L7FB 3U2IA 1PFCA 1PMYA 2XPYA 2OMBA 2AERT 4JFTA 1LO3L 1QA9B 4TVPL 1QNIA 3SGDI 35C8H 3ABMB 1NAML 1WEJH 5CBEB 2VGLM 3NCBB 1C5CH 4RAVA 2FD6L 2B1AH 3JSSA 4O2FA 4PRPE 4WFGA 2J12B 3B3IB 5B22A 5KVGL 3SB3A 1WCQA 1V3LA 1T1XA 4H8WL 1S5HC 3FQRB 2Z9TA 3T4YA 5K33A 3NACL 5CAYB 2B8OT 3B09A 2HH0H 4G8EA 4P5TA 3TU6A 5L2KB 3DK2A 4JQXC 2UXDO 3PFUA 4FP8H 4UZUA 1JNNH 1VESA 4ZMNA 3MU3A 4RMRA 3LMJH 5C0AA 5I8CB 1WA8B 2BOBB 1YEEL 4PIRF 3S3BB 4KZCA 4YSOA 3G3LA 3V0AC 2VR5A 3FFDA 5DUBB 1FRGL 2VRAA 4OTXL 4S2SA 5LHIA 4U6XA 4MCZA 1IC7H 1M05A 3V4LA 4ZIBA 5AKVA 3EOTL 1H2MA 1IEAA 4XP6H 4M7ZC 3R8BB 4O51A 3WFBH 3O2DA 2NNUA 1QEWB 1RZ7H 3N1PC 1UQSB 4AZUA 1OE3A 4UCTA 4JRFA 2OK0L 4H8HA 5CXPA 1HH9B 3FSZA 1J9RA 2Q86A 4YDLC 1XSKA 2DTMH 1MEXL 4FQCL 4L4VA 4DH2A 5C8JA 4GG6E 5FGCE 3MYJA 4B41A 4Z7VF 4FNPA 1BGXH 1AVMA 5I24A 4XCYA 1JAEA 1DZBA 1PNMA 2ADFH 3SJVE 4DGIH 1NCHA 3GO1H 5D1QD 2NSMA 5HDRA 1BYNA 5FM8A 5T1LA 4V2BA 1U4EA 2QPDB 4BXSV 1KQSU 1AGEB 4N0CD 1KELH 4KKZA 1WHOA 1S5HB 3U9WA 3RZWA 1YMME 3K46A 3RX5A 3ZR5A 4ELDA 4NN7C 2R29L 2WLJA 1OE1A 4JDEA 2NY4D 2IBZY 4TMPA 3RPIB 4DQOL 5KYXB 3KLHD 3OXSA 4M48H 1M9SA 4FTVE 1QNZH 3ABZA 1R3KA 1SFHA 2B39A 2VDNH 3V4UH 3ARGD 1JK8B 4BFKA 4HJJL 2JI1A 3WXWH 5E2WH 3JWDH 1AZBA 5A3IC 5JW4Q 1RHHA 1DVQA 4XBGA 2YXYA 5HPMA 5GONA 2YMXL 1YEDA 3APNA 2ENYA 3V4VL 2LABA 5CZVL 4D9QE 4JZJA 1SQFA 1BIIB 1I4FA 4G9FD 5JO5A 1F4AA 3OXRB 3PHAA 4P9OA 1QBLL 4E2OA 4KDVA 3PXJA 4YDLB 4HCFA 4U1IB 1QUPA 3D4CA 4Y4FC 2F54A 1B0RA 5HD8D 2JS5A 3S35X 5AYUL 3T6WA 1ZXQA 4K3HA 4PB0L 4X0KA 3SKMB 5CLYA 4UQ9A 2BJML 4Y8AA 1GGCH 4Y9FA 3M7OA 3K4AA 2DY2A 2C9UA 3PGCB 1M9WA 4YE4L 5I1DA 4OSUL 4QY8B 1M1XB 5DS2A 3RUGF 3GMOA 1TIUA 2JTDA 5IMMB 4A7VA 4JEGB 1INDH 1M2OA 4FG6C 4XXDB 3VQWA 3S3SA 5ACMA 5CA0B 4NN7B 1CMOA 5KSUA 2HN7B 1YN7B 3LQMA 3WUWG 3WNOA 4FLYA 1OTUC 2J8HA 3QXDB 2JQMA 1RJYB 1DFXA 2DQGL 2Z92B 3K58A 4K73A 3TV3H 1VFOA 4L4TA 1YNTB 4PJEA 3T4AA 4G82A 3FN3A 3RL2B 4N5ED 4DP1X 3U79A 4Y4HA 1ASOA 5DN6G 1SHSA 4F37F 3SYCA 4K7FB 2YUZA 3FS9A 1VEOA 4TUKH 1YAIA 1ZHNA 1VQ4V 3PF2A 4Y4FB 2NY0D 4U3HA 1IM9D 3N40P 4QTIH 4EKXA 2FHBA 2XPGA 1T5EA 1F4XH 1YC8A 2DICA 1ZHBA 4MJHA 3ULVE 1K34A 4LMQI 4GI6A 3ZX1A 1P1ZA 3UQ8A 4BKLB 1UT9A 4NPYA 5KVFL 1D5BA 1EZVY 1AVAA 3F2LA 1YEKL 5EU5A 5F1IA 3LKQB 2ZE6A 4H26A 2DDQH 3TASA 3V4PA 3IJHB 4LFCB 4Y16A 1MIEH 2EDYA 4I2XA 5J89A 1ID2A 5F6IC 2DLTA 1SQPH 2XC8A 1BAFH 3CVCA 2ZD0A 3JTTA 3JD2A 3BQUD 2AXTZ 5DMIL 5KJ4A 5EC1C 5KJRL 1OM3H 3BWZA 4TULL 1R6KA 2XOKG 2EDJA 3QZOA 2IOOA 4IJTA 3FOLA 4OCYL 2DMGA 4Q89A 1P4IH 2JCCE 2LFGA 3CVHB 2H1LM 4IM8A 3V6OA 4M1DH 1OY3B 3JVFC 4OZ4A 1K8IB 2F1EA 1JGVH 2VM9A 3W0WB 3B6SA 4AKQA 4Z5RA 1M56C 5I1HH 4NAQA 1YCSA 2A6DA 4X6EA 5DGRA 1CG9B 1HEZB 2Z91A 4U1LB 5MEOB 4RLDA 2FKXA 2DJ4A 2QSAA 4LDOB 4N8PA 1HIMH 4HWBL 3A0BZ 2A6IB 5H94A 3BVWA 4GRLA 1HYRC 1NCDL 5FB8A 1E1QG 4LNUB 3ZX6A 1SJHA 2J56A 1FZOB 2HA1A 3VI3F 4DUZB 4MNHA 3CBRA 3BD3A 3MNDA 3ZS8C 4HPOL 1GAFL 2IDUA 5DJXB 5E2UH 3AAZB 5AL8A 5HVHC 1ZGLM 1BE3H 1XI1A 1VPOL 1QI5A 4JI3O 1E4WL 1N5AA 4JDVB 4I55B 3RVUC 3SGJC 4FJYA 3QISA 4YQXL 3UO3A 3MUHL 4Y19B 4MMYB 1VFBA 4HH9A 5EC1B 1IAOB 3ES6B 2FO1A 3FU7B 2VMDA 3RVYA 1B9KA 1TZIA 2AXJA 4ZQKB 2W0FC 4J2QA 4XR8C 2F5AH 1BAGA 2LU3A 3GB7A 3MHSC 4WFEA 3EF4A 5TDNA 3RJDA 3FB5A 4HFUH 5JYLA 2F6AA 4UZSA 1ETA1 3L45A 3SKNB 1MFEH 3GMLB 5GGVY 3BKCL 1M56B 4HS6B 3ZTCC 5HP5A 3GIZL 3UT5B 1MG1A 1NIAA 4D8PA 2B3IA 5T3XH 1G94A 5B1OA 3LS4H 4Y89A 5F7HA 2GTWB 3C60C 5ADOL 2MSPA 5IBUG 3VRJB 1AGCA 3MV7E 1KBWA 1V7MH 3AITA 1MCBA 3X12B 2IG2L 5F1KC 4DP5X 5IJ0A 2Q73A 1EH9A 2LAAA 2UYLB 3GZOA 3ECQA 1A7NL 2F5BL 4XP9L 3M8AA 5DJ6A 5D9SA 2X6VA 4UNVA 3IJ9A 1A32A 2BXZA 3KZIZ 4U7NA 2A1WL 5CP7B 5HVHB 4PI2A 1GYAA 3V0WH 5BOPA 3LRHA 4FLSA 5IZ7A 1NICA 4AILC 5IJDC 2G3XA 3QUGA 4TLKA 5IREA 5IT9N 4L3ED 3O3BA 2XN9D 4PG9A 4HIHB 1R3IH 3QC5X 4K9EC 2J1WA 4ODUB 3ZBHA 1E90A 4M9OA 2PYLA 5IVOA 2P22C 1WTGT 1TA8A 4M7KH 1KIUA 3WCYA 1PLCA 4NCDA 1PZUB 2KERA 3VMPA 4FZEH 4PHXA 2WQAA 4PJGA 3O9WA 1QZ1A 4V1DE 4KKBC 4XI5C 2XJKA 5B1JC 1K8DB 3FCSA 4PLOB 1PD3A 4ZFFA 1OSZB 3VA2C 1ROWA 3WNKA 3JARA 3PV6B 3DV6B 2R2HA 2I60H 3C60B 2Y48A 4MJ6B 1K6QH 3KYMA 3O4LD 4PMFA 4UT9L 5IB3B 2WPGA 3K06A 3QFJB 3WB1A 2X4TB 3X3FH 4I3SL 4TQ8A 2MW2B 1GJWA 5L2JB 4F8TA 3BP4B 3D34A 5EHFA 5FWQA 3VXUE 5AZEH 4UVCA 1JHLH 4HT1H 4AM0A 5I1GL 1G7JB 2DQFA 2J5WA 1GJIA 1E27A 2Y6SD 1YMMA 3UCSC 2FEEI 3QXAA 1DQQA 4KUCF 3QAZC 2PCPB 4LKXB 5AW3B 1DFBL 5AALA 2V7NA 3I3DA 4JRYE 2OMZB 4PWEA 1NMAH 3DGGB 5J6SA 4LLAA 3O4OC 2LFSA 4WFBV 2PO6D 4I4WA 2ZUTA 4DERA 2BC4A 5ESAB 3Q2CA 5B4MD 4KKLD 4HJTA 3I56V 1S9XA 4B9GA 2QVIA 1I9EA 1DJIA 1KXQA 1LEKA 1OT2A 5E7BA 3NJGA 1HVXA 3Q6GL 2FEEL 3RNKA 4X6FB 1P7KB 1U8OA 3F6LA 3OZKA 2OXGB 2X7RB 4ZYKA 4PJCA 3DRTB 4LHUD 4TSBH 4CN6A 5IKCB 4JFQA 4JQIL 2X87A 4QYOA 5ERWA 4LCWA 3SO3B 2J88H 3ZMSA 1M6UA 1TQUA 2EE0A 2W38A 3HNSH 4XC3L 4ODXB 5KYYA 4LEXH 1PP9H 1OGAD 2IMNA 1AHWA 4PJ6A 3JWNH 4D0DA 2GYSA 1SXZA 2MHAA 4F5CA 5AB0A 1R75A 4J1UA 2APWA 2J8UF 3WFCL 5I0VA 1A3LL 2FLBT 2FHCA 3HBPA 2FR4B 3GXIA 5A6IA 1VADA 3WNJA 4QPEA 1D7CA 5EZIH 2X4NB 2AHZA 4APQA 1E65A 5I8EB 3QAZB 4L5FL 4HSCX 3P9LA 4HUUA 3U36A 3MOQA 1AROP 2CPCA 2J4WL 2WIIA 3H55A 3O4OB 3HE6D 2FB4L 3QS3A 2DQEL 4NN5C 1FPTL 2W91A 5FOBA 5H35B 4XWOD 4BSWA 4OD3H 4YZWA 2F53D 1IAKB 3Q3GB 2A9ML 4F93B 4U1JB 2XAQA 5D7LD 2R2EA 2UZPA 4AE1A 1JD7A 1T1ZA 4DV5O 3UAJC 2R1WB 3ASWA 2VJ0A 1A2YB 3VXQA 1P7QA 4JJHA 1N7ML 3RWIA 4H13B 3TJHC 4WGKA 3KAAA 1E9OB 3R66A 1HXMA 3NK4A 4W1TA 1KGWA 1BJMA 1RZJC 5DC9B 3UAEA 2X42A 3SKJL 3LKNA 2PZSA 3HMXH 4C59B 2W07B 3ZMUA 2OMWB 2YBGA 3N0PB 4Y9CA 4KKAD 2CKBH 2Q68A 2M1KA 2VXUH 4LAQL 4LFHG 3PP4L 4IYKA 3WS6A 5DUPL 3HC3H 4X64O 5E00B 1AO7B 3EDJA 2G9HA 1IARB 4IRJD 3II3A 1FFPA 4DP2X 1RZIA 1T22A 3MV01 4HF5L 3VD2A 1NBMG 2QADD 3FT4A 4YDJA 3EHBC 3VTTA 2JCCA 2F1MA 4NYKA 4GKZB 4NN5B 5H2BA 2EH7L 3X1EA 4P4KC 3P4OB 1Y1DA 2JKJA 3L3DB 3VSQA 4KRPC 4ZTOL 1ZANL 2B7DT 1I1FB 3EOAA 1WZ1H 1OAUL 3HG2A 4KO5A 1NAMH 3BVVA 2Q67A 2FD6H 3U4KA 4KHPB 5KVGH 2X10A 4MDIB 4ABWA 4E41B 2R69L 4ZO7A 2X53A 2WD0A 4JREC 4BRVA 5T1JA 1XZWA 4X7DC 1PEZA 5TDOB 4PWFA 5GS2D 3TH4T 5I1CL 1JV5B 1N67A 1OF2B 3ECBA 5A9GA 2VC2B 3BO8A 2J6EA 3ZK0A 2PABA 3PWVA 1HYSC 1YEEH 1DBML 3OMZA 5ECGA 2VLRD 5LXVA 4TNWK 3VFMA 2FX7L 4UAHA 5F7WC 3QZMA 1A66A 3D0VA 4IGBC 3EOBB 5JJEB 1DQJB 1PD1A 2X05A 3S96A 4PRNA 1KY7A 2BSEA 2FEDD 4XN2A 3OX8A 2CCVA 4CU7A 1TETL 3CRRA 1JWMB 3OHXC 3ZDXE 3W9EB 4GG8A 1E4XH 3UC0H 4AQAA 4F33A 1CFQB 5DHVH 4P59L 3DSQA 3F7VC 3FF7A 3VGGA 3BGMB 3GBMH 5FYKU 4JDZB 5I28A 5IIEB 4KVNL 3T1FA 2XV3A 4N2FA 4S1QH 4L87A 5FDWA 5GZOA 3MV9B 1RIUL 2NY1C 4UQEA 4P4KB 4RRPA 4KRPB 1UWFA 1PNKA 1N4CA 1Q6UA 5BZBA 1FP5A 4KZ0A 1VFUA 2V8MA 5L7XL 3SOTA 2ZWZA 4POZC 3Q9PA 3BZ4B 3FU5A 2Y2TA 3QIUA 4PRIE 1N34O 4JREB 4J7KA 2HSIA 4HEMA 3RWHA 2JJ1G 3PWNA 1HHGB 2CO1A 2BNUA 4KMLB 4KJWD 1AQHA 5KHIA 3QJHA 3ISWA 3EYQC 3AM8C 5CR8A 1UD8A 2IBZX 3MX0A 1H0DB 2Z31D 2FE0A 2FMLA 1ZOXA 5LDSA 4IGBB 1NGZB 3QR1A 4X6BA 4N0YL 43CAA 4B3SO 1U96A 1T03L 1I7UB 2VTFA 5CZVH 3ULSB 2E46A 2LOEA 1SY6A 3OHXB 3FO2B 1QBLH 2IANE 3QDME 2A9BA 5AUMA 1KN2H 5TE7H 1ZIAA 3Q7JA 1E9PA 4C4KO 3TNNB 4GKNA 3F7VB 5I1LB 1PZ5B 1TKWB 4QHUA 4K5NA 2GI7A 5KX5B 4N2AA 4UUJA 5AYUH 3RN4A 3J80N 3FCTA 3D06A 1TZAA 3P2DA 3MC0A 3MRJB 4QRPE 1XGQA 4PMEA 5CB4B 3FHQA 3MAWA 5KAQG 3F58H 4YWGH 2JIXA 4PTTA 4G80A 2PCXA 5FWRA 4RZKA 4V1DA 2O6FA 1D5XA 3O8XB 4P4RA 5B1KA 1EUTA 1CBVH 4FL4C 3W37A 1AQDA 2Y24A 4OCWL 4Y2DA 4NZRL 4X7SL 4K3JL 3CQQA 1U3HD 4QXUL 3ARFA 2BP0B 3AACA 2XKNB 3ARRA 4Z7WF 5C0EA 2IDCA 1U8QA 2K7PA 3X1BA 3ZGHA 2YO3A 3VFWB 1GXEA 2LE9A 4NSKB 1AY1L 3FT0A 4DR6B 1JP5A 3JV6A 4IOSD 3LRSA 1NJ9B 2EDRA 4J3OH 2OSYA 4OFKA 3QZWB 4UI2A 5LGJA 4LWSB 2D7TL 1YYMH 3RNQB 4PJ8D 4QO1A 1AJ7L 3ECVA 4JGSA 2HJKA 2L0DA 4JRXD 3CWGA 2BE3A 4IRZL 2XIDA 5F88A 1XUQA 3FB8C 1NH2D 4MTMA 1E4HA 1Z2GA 3AU1B 4JRYA 3C3TA 1NKGA 1UENA 4KWUA 4ENEC 5BXFB 4J8RB 1FH5L 3BXNB 2I25N 1QFOA 1MHCA 5EU6D 3IMRA 2WUBH 1OO2A 2VQUA 4WI5A 2YGQA 2QJDA 2GJ6B 4H25A 1G7HA 3FD9A 4HIQA 4E2LA 3HE7B 4S1SL 4ANWA 1GH6A 3WN6A 5GRVK 3ZEDA 2FO4B 4NKOA 3L4WA 5I30L 3WTSA 1KCUH 2XXCB 2VDML 4FL4B 1LP9E 1S7XA 2IJ0C 4BQ9A 1XF1A 1VKXB 2MCPH 3H8NA 1EZVX 2Q8AL 2CUHA 4CAGA 5DMIH 4YSDA 2ESVE 4K0KB 3R4DA 3ISYA 4JPIA 3UYOD 3VFRB 2OAAA 3BGAA 4N2KA 1W0KG 3OUSA 4ZI7A 1CLYL 1Z9MA 4Y9GA 4PUBL 2UVEA 1X7QB 3ZKSD 2E59A 5JHDD 4P3DA 4IIJA 1L7TL 4MTOA 3FOMB 3N06B 4YXKL 3IKCB 1TTCA 2QTOA 3D9AH 4UBDD 4LPVA 3HG0A 5F7DA 1U8JB 4LF6O 1PZAA 3QDGE 3ULUF 2PF6A 4R7NB 3PAUA 4FPPA 1C16B 2OT5A 2N3JA 1ET5A 3IEAA 4FGMA 3IU3A 3GTVA 5IQNA 3QQ4A 3S36L 3D09A 1JGUH 3DBXA 3VFNA 1JCVA 2EYSB 3EBIA 2AW9A 4JHWL 4N86A 3W9DA 2FT7A 2IH1A 3A4EA 1CF8L 2V33A 3U1PA 2QZQA 1N33O 5JTWA 1NBZB 5TPWL 4RRPG 4DN4L 3RI5K 4Z7NF 2A3TA 2AQTA 1PFOA 2VDQL 2WBJA 3ARQA 3FHEA 4YH6A 5F7NC 4IL6Z 4F7EB 3CCLV 1DVFD 5IYZA 4BWAA 1CDYA 4ES8A 2AXFB 2YPLE 3A6CH 3NIDB 1XIWD 3T3PE 3VMOA 1FFOA 3ABKC 5CZXD 4ZJ9A 4RWUA 5A2IH 4Y4KA 1VQ6V 2D8KA 3BH4A 4KQ0A 4YQXH 3PGFL 3QRFM 4CS3A 1K5NA 5DFAA 1G7MA 5TDPA 5T1KA 2ZXWC 3EYVA 3A4DA 5GGSB 5IB1B 2DQUL 1MRCL 4PS8A 1BVNT 3LQAH 4I3RL 2BY1A 1DSWA 5C09A 1HL8A 3BN9C 3MROA 4X9GA 1K4CC 3HKZA 3UX9B 4N2HA 2P49B 4AYSA 2KL6A 1PX4A 4CN1A 2TRYA 3ML8A 3ARDA 2R4RH 4NFCA 1DN0B 4NB7A 5INCB 3SCMA 3AGVA 4CVZA 1K73W 1R0AH 3OMAB 3QULB 4OFIA 2Y5TB 1G7PA 1ZT7B 2H9GA 2MTPA 1NGPL 3I9IA 3BJ91 2FJGA 1BVLB 1J8SA 3FT9A 5DRXB 2DD8L 4GO9A 3HRZC 2YA2A 3ILQC 2H5UA 3PNWA 5ADOH 5DJZA 5BS0E 1VJSA 3OMIB 1KXVA 2Q76B 3QNZA 4ETYA 5FIEA 1QLFB 1UB6B 5EZYB 4E36A 5DJ0B 1A7NH 5GRZA 1Z9SB 4XVSH 2ZUVA 2YOCA 4MD4A 3I6GB 1Q9LA 4WLCA 4CMHC 2ZE5A 5DUJA 1WLHA 2C1PB 4K3DL 3OV6A 4GAGH 4PBWD 5ITFB 4F2MB 3GSOA 4L4JA 5D1ZD 5F2FA 4U1SA 2DZEA 2QHLA 5TE4L 3RVVC 5IJBC 1SZNA 4R0LC 2ZINA 4PDVA 2H4EA 5IK3A 3GPSA 3F3HA 3IN2A 1LK2A 3QW9A 1H3GA 3UG4A 2CO3A 4JJ5A 3QGVA 3IJSA 1JFHA 2R9HD 1N0XH 3O6ML 4HCRH 5T3XE 1CGUA 3MGOA 3MLWH 4UVBA 3QUMB 5C2BL 4MJ5B 3E7JA 1KB5L 5SV3A 3C09C 5LAPA 2E4FA 4R96B 1B04A 3U6RB 4ORZC 3U7YL 3U2SA 5IR1B 4U3SB 2Q3AA 3NPZB 4H1LB 3UMTA 3SN6N 1O6SB 2IC2A 3GKZA 3VMNA 1BD2E 4JANB 3NSJA 1XF4B 3WJLA 4Z23A 2WINA 3GSVA 5C8YB 2ZX6A 3JQOB 4AYEC 1VZHA 2WAHA 4PCKA 1HH6A 3T5WA 4AT6B 1I8AA 1JBJA 5CCKL 3RIFK 1PBYA 3LEYL 1G43A 5BUPA 4PRIA 5D4JA 3WEOA 4CMHB 4PI0A 4N0UA 4RDBA 2WXKA 3IXTB 1UD4A 4LLYB 1M1KW 1QRNB 3WFHB 5IOPB 3GWKC 1NFIB 5GS3A 4G28B 3U11A 4NAMA 4R0LB 4XNQB 3WBDA 4XDLA 2OR8A 2Y9RT 1JRHH 1QI4A 3B5HA 3IPBA 4JFSA 4MNQD 4NO5B 3OWEA 3EZJB 4N90D 4R6ZA 5EO0B 5BV7L 2W0KA 3QIBD 3B9EA 1E5BA 4OF8A 2FWSA 1TLKA 2HT3C 1TF4A 2BHZA 2R83A 5I6XC 4GSDL 4MFHA 4R7XA 5GTIZ 3IE4A 3QDMA 1KDJA 3QK0A 2ITCC 1NKDA 1ET8A 3OAYH 3C09B 4JQIH 4F7CA 2WNGA 1T89A 1KCLA 3V52L 3AZUA 3KLAA 3P4LA 4QRPA 1MCIA 4UCSA 4NJAL 2VNCA 1I8LA 4FMKA 1WO2A 5DYOB 4JE4B 4TTDD 5G4MA 3QUZD 2FH8A 3EO1B 3PHOA 3WY4A 4G8GA 3BVTA 1RUAH 3FUEA 4CSTA 5CWSB 3MBEA 5E94B 1OAZL 5C07B 1DLHA 5BY1A 1WYJA 2OCCC 5C0IA 5MENB 4Z95L 4XRCA 3K57A 3WTXA 1QQDB 4YDIH 4L5FH 1Y67A 1QSEA 1FYTA 1XZ0B 3NTCH 4LGSB 4PGBA 1G9NC 1PKOA 4URTB 4U3JB 4X6DA 1FPTH 4M61A 4TQDA 1GGBL 5J6GA 5DQ9A 1OVZA 4KO7A 1K72A 3ATDA 2B08A 2VR8A 3CXFA 2Z35B 1OWWA 1TQBC 5I6XB 5GPRA 2UUCB 1S7WB 2HT2C 3H4FA 1MFDL 2A83A 5FUOL 1ZSPA 5KLVH 4PJ7E 2ITCB 3UBXB 4X7TA 4WAFA 4MTGA 5IHZA 3UYPB 2BS71 2CTWA 4XMLH 1J12A 3L9BA 3UABA 1PLGH 4HDIA 5IWLC 4GKLA 5CN1A 3CVIL 5DVPA 1KGUA 1DTUA 1ZK5A 1PL4A 3HB3D 2F0CA 3PXLA 4QHNA 2O5NA 1XB8A 4W9HC 4JI1O 2C3WA 2W8CA 4ZMVA 4P2ZA 1K33A 2QLVB 3IFPB 2JELL 4QRFA 4HBNA 2ZQMA 5DD6A 1FH2A 4K2UL 4CS2A 4X7CC 1NH6A 4OLYH 3C6LC 3QSKB 4JPQA 2OCCB 2DQTL 5DUPH 4HS8L 4HS3B 1PKXA 1SLVA 2NXYC 3IFLL 2EX3A 3BHBA 4NQDB 3ULUL 2UXDB 2EE6A 4JCMA 2HKOA 1ORSB 1U93A 3I2CL 2DMKA 3ET9F 1R9FA 4BZ1A 1ZLEA 2XQBL 4JAVA 4ZMPA 3ZO9A 5LMUO 3QDGA 4I1NB 4L8BA 1O7DE 3W1ZA 1LWJA 4K7PL 3GSNL 1ZANH 2G9KA 3NJFA 3QHFL 3RURA 4UOW1 1H2GA 1ML0A 1TQBB 4BZ2A 4OM0L 3NZSA 4J6RH 3APMA 4MZIA 3P77A 4DN3L 5FUZH 3FUDA 1MVUA 2V4LA 2WXIA 5KBKA 2V4DA 5F8QC 1JTTA 4B5ZA 4GQ9L 4OKDA 2F2HA 3O41B 4JFOA 4W6XB 1ZPLA 5BRPA 4WGWB 2YPLA 1W80A 2F8IA 1A1OA 3QAQA 1IEBB 4FNSA 3GXNA 3X11B 3L7FA 3QIWD 4XZUB 3SDDC 4F8PA 1S7QB 1QLNA 3AG1C 3C6LB 3D52A 5C6TH 4PAZA 2YPKA 3AY4A 2UUDH 2ZUXA 4IHOA 3LN5B 2NXYB 1Q43A 3QP3A 2X1QA 3ROOB 3GD1C 1GHFH 3FQRA 2MPVA 2E3CA 4QPJA 1DO5A 2QSCH 4RUEA 3R1GH 5D2LE 1R6TA 5EO1A 4I5BB 3TYFB 3NZ8B 3A4FA 2BOBA 1CGTA 2V6HA 5EORH 1OGSA 3MA7A 2CA4A 1JWSB 2D3OW 3PXHA 1QASA 2A6KA 1X9UA 3J2PA 4CS4A 3TA3D 3DYPA 4X8CA 1G9HA 3KLQA 3Q8FA 1HR0O 3E86A 4HIJB 1JPEA 3EUUA 3C9NA 4KI5E 2DQCH 3FTSA 5KHJA 3GT6A 4N2GA 3T3MF 3H3PH 2DIBA 1RULL 1G9MC 3U7WL 4CH5A 3WO3B 3CDFA 5DA4A 5DJDB 5E2TL 1DJZA 3TO4A 3SDDB 5JQHC 2X7LA 1NBYA 4BK4A 2RA1A 2H0EA 3MRKB 3RTQC 3CLWA 3AG1B 3O3UN 4WNSA 3EGDB 1E3FA 4J3VA 1OCOC 1NAKH 2P48B 3FCBA 1MJJB 1S5HA 5HHPB 1HQRB 3OZ9L 4BFBD 4ELME 5BMFH 1TJGL 1L6PA 3T71A 2XT9A 1DBJL 1Z5LA 4HP5A 1OP5H 4MJJA 4JQXA 1OXYA 3K2KA 3HVDA 4Z3GA 5LO7A 2ZYHA 5CEZD 4U1NB 1F2XK 1BJ1J 1MW0A 3WE6B 1ZIBA 4I7ZC 1UH4A 3C6EA 1T7WA 3B4NA 1R1BA 3J8F7 4IOFC 3FU9A 2HP4A 4J7JA 4OCWH 2BY3A 1T7VA 3CIQA 1MRFL 4WNJA 2ZP0T 5CD5D 1IKOP 1W2KT 2DIAA 3GSQA 5HYIA 3I02B 4CH4A 1BIIA 3IS0X 1PYWB 5MHSE 5F7YC 2OL3L 4PJIF 1BD2A 3OXRA 4YDZA 2ED7A 3ZHKA 1V9PA 2GUOB 3CAFA 3GKWH 2CK0L 1NGQL 1VA9A 2JS3A 2MKWA 2AEOA 5A2QN 3BEHA 3LCYA 3TT3L 5A2AA 1IGIL 2AJZB 4DETA 1H6UA 3B4SA 3VXRB 2VZUA 2C7UA 4HIPA 4G6ML 4A63A 4KNSA 3RTQB 1IXMA 3GZPA 3LZRA 3D2UB 2JJUA 5DHDA 3MI6A 4O4HB 1SOXA 4KTEL 3PGCA 4YVNA 3JALB 1XR8B 3PWPD 1A9EB 2JGDB 4QY8A 1M1XA 3OHMB 5CZKA 1LE5B 1OCOB 2ZE0A 1HJCA 3CFBB 1PNDA 4AL8L 2A0LD 4I18C 5LP6C 4QR7A 1FH5H 2UWEE 3K6NA 5CA0A 1GW0A 3DO3A 1UH2A 2XSKA 3K2MC 3K03A 4UTBL 2PNDA 2YS4A 3FONA 4I7ZB 1M71A 3TVMC 2E7LC 1RJYA 3HKCB 4OF5A 4PJHE 3ZU8A 5B38B 1YNTA 3NIFB 1WBXA 1AGBB 1FC2D 2KKWA 3RL2A 2XNAA 4HOZA 5L3FA 1DHKA 4UT7L 4N9OB 4TL5A 1GN3A 2E6PA 1QLEL 4Q9CA 1YEHH 4L37A 4O4LB 1AYRA 5DD0H 5C0BE 5LCVL 3DGEA 1SGKA 4M4PA 3O6LL 1OAXH 4HLZH 2H0JA 3ETSA 5FKAB 3MLSL 4B3RO 3QG6B 4JLRB 1MCPH 4Y4FA 4ZXBD 3GUTB 2ZXQA 2WW8A 4YR6B 4R90L 3FZUC 1VDGA 4KNTA 3O3EB 2V17L 1TZOA 4DP9X 4JHWH 2BLFA 4JI3B 1MNGA 1Q0EA 4BKLA 1MDAA 4L1SA 3HUJF 4BWTA 1EVTC 5LBSH 2WTRB 1GIGL 4DKTA 2CCWA 1J87A 3LNHA 2XICA 4EFEA 5LP6B 4I18B 5IYCO 4XNXH 2QMKA 4DGYL 3T4DA 1XBLA 2Y0IA 1JFFA 3CFIC 1AJPA 1QR4A 5EIIB 4ALAL 2XWJA 3E3QC 1KV7A 5AVSB 4IBZA 4IIQA 4MJID 3SE8L 1U8CB 2OYLA 3LH8A 1XGPA 1BLNA 1AXTL 5L3BA 4R7DA 5IWAO 1QFWL 3RWJB 4XBPA 1HNGA 3D33A 3W0WA 2HRLA 5A6MA 1CCZA 3LZLA 1FGNL 3HTLX 3JWDC 1I9JL 2VAAB 1T83A 5D93C 1TOXA 5HI5C 4MAYD 1BMZA 4QJ5B 3K59A 2DQUH 1CG9A 1HEZA 4X88A 4M56A 3L2MA 4MS2A 1DJYA 2X4RB 3S5YA 1OQXA 5ADPL 4WJKB 1GCYA 1BMGA 2XBTA 2A6IA 2ZWSA 3AS2A 4XE5B 1ACZA 2HT4C 5FEBA 5GSRA 1X6LA 4F7PB 1ANUA 5HYJE 3ARWA 3CLEL 3EJZD 3L1OH 5HDWA 3UGXA 3K71B 2IDFA 3FT3A 4OLWH 5JMRA 1JDDA 4AMKL 4BAYA 3AAZA 2RDCA 2NY7H 1IAIM 1UM6H 1MVYA 4JDVA 4I55A 3TBSB 2QGDA 5HJGA 5ID0A 4XHJC 1TITA 2DMBA 1A14H 4MMYA 4FDWA 1NZ6A 4P9PA 3SGEH 4YX2H 2C3XA 1YEGH 3FU7A 5E7FA 1PZ3A 2AQRA 5DUML 2OR7A 4J42A 4JG0H 3VVVA 3X14A 3FB6B 5TH2A 3L2NA 4LSUL 4OB5L 1XH3B 5J0BA 2LR4A 2EEDA 4IBWA 2IU3A 1PZDA 2VDNB 2P4KA 3ELQA 3KYAA 1I1CA 1YQ2A 4NZTH 4UCUA 2GG1A 4XAKE 1PSKH 2VN3A 4ADGA 1AAJA 1EPFA 3GMLA 1BZ9B 5D93B 3CBJB 2P5WB 3UT5A 4YNYB 3D48R 3KR3H 3S4SA 1WP8A 2KZBA 1PY4A 1RVFL 3QB7C 2OMTB 3TCXA 1T5KA 3ZHFA 1TTRA 4P2QE 5BVPH 4IHBA 2VDOB 3MLUH 2R27A 4S0SD 4M7JH 3BVDB 2YI9A 1ZDQA 3AXLB 5MI0B 2FQGA 3T6XA 4WCYH 3FT2B 4LEEA 2LW1A 1RIVH 3DX8A 3IJ7A 4OZGE 5DVKA 3WJMB 1K5SA 5HY9B 1N5YL 5LVEA 1JI2A 4OZHE 3FSOA 1MCKA 1A6ZA 3UTTB 1VARA 3WJJC 2BVYA 4Q97A 2PP7A 5E4EC 2CBQA 2YDEA 4KK5C 1KFAL 2B14A 1MLBB 1Y07A 4X5PA 3TOPA 4LF8O 1MH5B 5C86A 3J07A 4MMXA 3TPUA 2FECI 2PW1B 2EEFA 3CDGA 2XWCA 1OPGH 2YD3A 2W0FA 1XHXA 3APOA 2GAZB 4WIQA 4MVRA 4C56B 1IGFL 3IMBA 1TCMA 2RH0A 2WVSA 4F8OA 2K45A 2X4SB 2ZOUA 4PYGA 2E7HA 4MA3B 1DBAH 3ZDYF 4BH8B 1HS6A 4I77L 3TF7C 2FJSA 1NC2D 1XD1A 3KHOA 1D2DA 2ISDA 1A3RL 2Y2WA 5SWZB 4PVMA 1OSZA 3PV6A 1V54B 3B3BA 3C60A 4L1DA 4TSAL 4MJ6A 3VWKD 5BV7H 3RGHA 1MJ8L 5KJ7E 1W2BU 2WB1A 2X4TA 3BIKB 3QJSB 3L9RB 5DHVA 3BP4A 2NY2D 1JYXA 2FT6A 1JVOA 4Z7QF 3TESA 2JDIG 2OIEA 1TU2B 1KCWA 4HJ0C 1D5MB 3JWOC 4W9ZA 1G7JA 2ATAA 4FXTA 2RJZA 2VH5H 8PAZA 3MUGB 3VO0A 4PR5B 2PCPA 2OQJB 5E4EB 1ECZA 1ZLUH 4XTRD 3VGFA 3VFGL 1NDGB 3DGGA 1P6FA 4K0OA 4BFIB 2WXRA 4IS6B 3LHAA 5ESAA 5I1AB 1HOEA 4AJ0A 3SYAA 2C26A 4W9CC 2RB8A 4WRLA 5AB1A 1EA9C 2IQ9L 1NUFA 3OKKA 2H1PH 1OGPA 1RLWA 4JHAL 4YHKH 3ZTNH 1P7KA 3FRUA 1MI5B 3KLSA 5E1QA 1T0PB 1J11A 5JOPD 3DRTA 1SZXA 4U1HB 2BIHA 5IKCA 2LU7A 4IDJL 3BAKA 5B1JA 3ZE2B 4GP8B 2VLKB