3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
2Y69C 4GX1A 4XDJA 3SYAA 3K0DA 3X2QC 4LCUC 4QE9A 2R9RB 3OUFA 4X88A 4QNHB 2YEVA 1R3JC 1G4YB 3ATEA 4CBCA 2DYRC 3AG4C 4PA4A 2E4FA 2EILC 2HJFC 2BOCC 3HPLC 3IFXA 3GB7C 1V55C 3AG2C 2ZXWC 4PDLA 1N9PA 1XL4A 4TWKA 2WLNA 3K04A 3SPCA 2Q68A 3SYQA 4I9WA 3SYOA 4KFMA 2ZD9A 3LDDA 5B1BC 3TETA 2WLHA 4PA6A 2WLKA 2H8PC 2HG5C 2QKSA 2QTOA 3FB7C 4MVZA 4X8AA 4DXWA 4GX5A 3AG1C 4R8CA 3T2MA 4RUEA 1R3IC 3UKMA 3SPIA 3R65A 1K4CC 3SYPA 3T4ZA 4XDKA 2EINC 3STLC 3STZC 3UM7A 3E8FA 5J9PC 1M56C 2EIMC 4BW5A 2A0LA 2EIJC 3FB6C 2WLLA 4R7CA 4MVOA 4MW8A 3RBZA 1J95A 4MSWC 2Q67A 3F7YC 4P30A 1OCOC 2P7TC 3KG2A 5EK0A 1JVMA 1OCRC 1K4DC 3F5WC 3K08A 1QLEC 2ATKC 3ATAA 4PA9A 5KUKA 4MS2A 5KUMA 3T4DA 4LBEC 2HVJC 3FB8C 4MVMA 1S5HC 2Q6AA 4XDLA 4MVUA 4WFFA 3T1CA 3AUWB 3K6NA 2AHYA 1LNQA 1XL6A 3SPHA 3OUSA 4R6ZA 5EBWC 1KKDA 3PJSK 5EC1C 3JYCA 3SPJA 2K1EA 2ITDC 2NLJC 3E83A 4G28B 2W0FC 4HZ3A 4MTGA 2X6AA 1OCZC 2WLJA 1U4FA 4R50A 4PA3A 4P9OA 3LDEA 4X89A 1R3KC 4ZBMA 3SJQC 5CBFA 2WLMA 2WLIB 5IY5C 5BZBA 3IGAC 3ASOC 3AGWA 3WG7C 3FB5C 1M57C 5EC2C 4JTAB 2HVKC 4P9PA 4HYOA 3ATFA 3F7VC 4LP8A 2IH1C 5B1AC 2BOBC 2A9HA 3ABKC 3AG3C 3RVZA 2JK5C 3ATDA 3ABMC 4MW3A 4H37A 4PDMA 4PDVA 3OR7C 5E1AC 4WFHA 3VOUA 2DWDC 4G27B 4J9ZB 4MVRA 2WLIA 3SPGA 1ZWIC 3EFFK 4RUFA 1ORQC 3E8GA 4GX2A 3K0GA 2KB1A 1BL8A 4UUJC 5CBGA 3TCUA 3ZJZA 1R3LC 2AHZA 4JTCB 1P7BA 4MTOA 4OXSA 4RAIA 3RW0A 2A79B 4PA7A 3ATBA 3LDCA 4MVQA 3SYCA 2GIXA 1U4EA 4JTDB 4PDRA 2ITCC 3VSQA 3E89A 5B3SC 5CBHA 4P2ZA 4RO2A 3LUTB 3AT9A 4GX0A 2DWEC 2IH3C 2DYSC 2OCCC 3K06A 1V54C 3RVYA 4MTFA 2WLLB 3OR6C 4WFEA 3K03A 5EBLC 2Q69A 1OCCC 4H33A 3OGCC 4J9YB 3ZRSA 2X6CA 4F4LA 4WFGA 5EBMC 2X6BA 3E8BA 4QE7A 3ABLC 3BEHA 3E8HA 4EKWA 4MVSA 3ASNC 2EIKC 3E86A 2HFEC 3AT8A 3LNMB
chains in the Genus database with same CATH superfamily
1W2BU 4A7GA 4U1GB 4NJ9H 3D69A 5C07B 5I1AA 1ZS8B 4NENA 2Y0IA 4GAFB 1PG7X 2Y7LA 1H8SA 3L1FA 1JXKA 3T3MB 4XWOC 1LUVA 1GOFA 2YRLA 5ID0B 5JW3L 4M8UA 4DGIL 3X14A 4IMLA 4N1HB 1BD2E 3B7RL 2NY6D 1LLAA 2DQFA 5BPPA 4IRJC 1E2WA 2WMPA 1TMCB 2F4VB 1WIPA 4OLVL 1FYTA 1E90A 1PAZA 3E6FA 3FTYA 4X7DC 5DO8A 4ZI8A 4PWEA 1HP8A 2YJLA 4B08A 4LFBO 3AQXA 2O4EA 3B9AA 3FMGL 4HJ1A 4JZGA 2P5PA 4U31A 3ZT5A 4YQXL 2QWNB 2BVYA 5CUSL 3PJNA 4H7VA 4LC1A 2GBAA 2COVD 4JQIA 2DQJL 3KHOA 1BZKA 5D5QA 4OM0H 4RGNC 1VQNV 4Z1MG 1LWJA 1GM8A 4FM1A 2R1WB 3ETTA 2JB6A 4MVBC 2DOSA 4N0UE 5D7KE 3OTOO 1OB1A 4F2FA 1N0JA 5GTHZ 3LRHA 1SZXA 3WIFA 1BYOA 3BUPA 2AJ3B 4IU3B 3QA3B 3KLHD 2C4FT 4G3YL 2GABA 3RNKA 1XMQO 4RAVA 1QLEB 3MRGB 1M4KA 1WRFA 2EE9A 5CFHA 1OCCB 3P30H 3CUPB 5GGQL 1RPRA 1JGUH 1TVHB 1SOSA 4X5XA 2JGDA 4P9PA 1DVTA 4PS7A 2DDQH 1LDPH 4FQIH 2EDNA 3BRDA 4EUPG 4UM9A 1I82A 5FM4A 2FTKA 3RVZA 2X4OB 4U2ZA 4XH2A 4XPGL 4AV4A 4A6YA 2VDLH 5DMGC 4RGMB 2W9EL 3PL6A 2P28B 5C71A 2EE3A 2WYTA 5JIKA 3C5JB 3AT0A 3BRCA 1BV8A 4P2RB 1ZWIC 4MB5A 1QSZA 3CJHA 4Y4KB 5AVVB 3X13A 4BRVA 1YYLL 1N8OE 1T1YA 3THML 4KP4A 3AXHA 1S8DB 2IO5A 3Q01A 2X6VA 5B1KA 5L2JA 2R2BA 1W8OA 1UM5H 3FO9A 3HUJE 3SJBC 3EAKA 3MBEB 1RV6X 2DI8A 1CTOA 3UO1H 5DJ8B 5BS0A 1RJYB 2BCMA 1G43A 4PJ9C 3DV6B 4UB8Z 1BFSA 1CYWA 5D70H 2DYPA 4Y5VC 3D85B 2KYIA 3B4SA 3A24A 5TFSL 1CDJA 1BAFH 1I8UA 2IOIA 4HS8H 4C47A 3B9DA 3QT2A 4AIZA 1QCEA 2G2NA 4RGNB 3UBXG 3HPJB 1HNYA 4YHPB 4WFHE 1L0NH 1LK2B 1N0LB 1CBVL 3II3A 1JFQH 4UQAA 1UJ3A 3A4FA 1OD7A 3CFQA 2IJIA 5JPMB 1CT8B 3MUGB 1QZ1A 3T04D 4MS8D 1N6UA 4EUPH 4DVRL 2VXVH 3C5ZC 3O6MH 4NKDB 1KEML 2QPEB 2Y36L 3QRBA 3CZFA 1EGJH 1R0AH 4TNVK 1XBRA 3M7OA 2OCJA 4WW2F 3NFPA 5IBTH 1TQUA 3BYYA 2W88A 1W72B 3VYPA 1FYTE 3I6LD 3M46A 1WV7T 4HPOL 5GXBB 3N2GA 1YNKH 4HXBH 4NNPH 1UHVA 3OEEG 4YHOL 5HHOD 5D7HA 1R9FA 5E99L 2BDNL 4TS6A 3QIBD 3W3BA 3BVTA 1DDHA 1SN5A 3L3OB 5KS9A 1AC6A 1NOFA 5KBMA 4MVOA 3L5WB 1IGFL 4TV8A 3BT2H 1Y6XA 3F7YC 1INQB 5HY9B 5FKAB 3TBYA 4LOUD 3GJFH 4P9MH 4FN0A 3D0VA 3MNMA 3UTOA 4QPEA 4ZZKA 2WAMA 5C07A 3KPRA 3MBEC 2E7LC 1N6VA 1N67A 1S7SA 3BMVA 1AQKH 2B1AL 4KI1A 2CR3A 4UB6Z 5IM7A 4KY2A 4NUGL 5BMFL 1TUBB 2VLKE 4HZ3A 2X2YA 1WNSA 4O4YH 3UGUA 4A7TA 1EO8L 1I8AA 4PCTA 5DD3H 4PA3A 3FONA 4MNGE 5K9QG 4IL6Z 1ZVSA 2A4ZA 4J3VA 4NI3A 4HLEA 3NEEA 3BE1L 1E40A 1NH6A 2KPWA 3PHQB 2J1KA 3AGWA 5CMUA 1I53A 1O7DE 2OV0A 3MRIA 2DKUA 3BUTA 3TA3A 4HPYL 2D7NA 4W4OC 3L7FB 4RMVA 4AM0A 4GPVA 2PPCA 1JGEA 5EPMA 1JE6A 2RGSA 2XV0A 5CXPA 1G9NL 1QEXA 1FAFA 4DT2A 4KNUA 2UUDH 5FOBB 3GI9L 4WF9V 1B9ZA 2XG4A 1XMQB 3MV7A 1MJJA 3WFHB 3QDJE 1P7HL 1KMIZ 4M5SA 5E8NA 3S3JA 1KPUB 5GGRB 3QCVH 1MWAB 4G9DB 4X8JA 5CLXA 4BINA 1VGEH 5BUAA 4JI7O 4E2LA 2YHGA 3MXVL 2ROXA 3DX2A 1GGCH 3DK0A 2K6ZA 3ZKQD 2FUTA 3ZL2A 1P2CA 3H9HB 4LVNB 3K06A 3BUYA 1UURA 2DQCL 1QHTA 3S34H 3TN0C 5J6GA 3BQUB 3F7YB 2Y1AA 4WWID 5GISL 2X12A 2ZAIA 3DX9B 4PRHB 3VD7A 5CBAB 4GKKO 4X7FC 2RCSH 3JZ7A 4NXKA 4WW2C 2OR9L 1K5NB 1P6FA 1PZAA 5F3HB 2C3VA 2R8SL 5DJYA 1DSYA 3U46B 3VG9C 4XNQB 5A3IC 5CHNA 1AYOA 2AFNA 3N43B 1QSEA 1IVLA 3CFDB 4B3TB 4O4LB 1TT6A 1TJHH 4CH6A 1ZTXE 1I3RA 4NQDD 2MOGA 4YL9A 5AW8B 3V5KB 1THCA 3HN3A 3RZWA 1IMHC 1B0GA 3AREA 2KDGA 3UYPA 4K3EH 1W59A 4PRDA 4O2FA 3WU2Z 1XCQA 5LL6Y 3BUQA 2HLDG 1PLAA 4N2FA 1SHSA 1SUJA 1CE6B 1UM4H 3FQNB 5CHNB 3ABUA 2EIMB 2P3YA 3GSQA 4G9FB 3T0AA 1TCMA 5DVKA 4R4BA 1HE7A 5KVEE 4JO4H 4XPFH 1IILE 4AXWA 3M88A 1MRDH 4XDKA 5IVZB 2G60L 1ZHKA 1C8QA 4U3XA 2JCCE 3TYFA 3WFZA 3DETC 5DECA 3KPSA 3KYKH 2EUZA 4H40A 2Z31A 4YPGB 5HD8D 4ZOCA 2XZAL 3RDTC 5B1BB 3LEXA 4PP1D 3VFWA 3K6IA 4O4JA 5C08D 2UUCO 2P46B 3T4DA 3BZEA 3TVMB 2PO6C 2Y06H 5E5MA 3K6NA 3SE3C 4QEGA 1NIBA 1RXLA 2C7UB 35C8H 2NT0A 2DIAA 4WO4C 2G0KA 2YIBA 2BMKA 3SQOH 4E42A 4LDLB 1PY0A 4HPYH 5HPMB 1SESA 3R19A 3MI6A 2P5OA 1UGNA 4GLRH 1SOQA 3QCUL 4PBVC 4BD4A 3TX4A 2NZ1A 4DUZB 2V0AA 3MGTB 4HIPA 3QUZB 1P0SE 4HWZB 3WMQA 2WYZA 3K5MA 4MA3B 4L29B 4APQB 5E6UB 3AADB 4J6IA 2JKIS 4ADJA 4PLKD 3VG9B 1N4CA 4DESA 3MV8A 3DUUB 1P53A 4CILA 2YXFA 2AF2A 2QTVA 5EU4A 2VLJE 1U3NA 5B1AC 5DMJB 3D39E 3FB8A 1GW6A 4PD4K 4X80H 2OA9A 1PL0A 1I3UA 3X3GH 1CMOA 4HGWA 4RMQA 4A2MA 1JPST 4H88L 4ZUSA 4PRPB 3QC5X 4NCDA 1A1NA 1YEJL 5T1DL 4PJEF 4DUVA 4QJFB 2L6LA 1RIVH 3SGEH 3E35A 4FQLH 4MJIE 4JFYA 2WP3T 3BWUC 5I15H 5CLWA 1P4LB 4YDIL 1U4EA 3VI3A 5HHQB 1MCRA 2MTPA 1B4RA 1D3CA 1U33A 4X5QA 3GXDA 5LBSA 2QL1A 3PF2A 1AGDA 2Q8BH 3SDDC 2G3ZA 4LFCO 1SHWA 3BW9B 3RDTB 1KJMB 3HLAA 1HR0O 5EO1A 2ODHA 3WNKA 1A1NB 4YL4A 1OZUA 3L4ZA 3MBWB 4HBCL 4WDIB 2PYFA 1Y66A 3BEHA 1QI3A 5DEZA 1U96A 3BPLC 5JZ7C 3QDGB 3ZSTA 3CLWA 2N4IA 1VQOV 4XO8A 1OTUC 3D2TA 2BSSB 2Y2TA 2E9BA 3N1PC 1OW0A 1JZ3A 1HH9A 5SX5H 4X5LA 4XN4A 5H37H 5JR1L 1U6AL 4OQTA 1KYFA 1VLXA 2NY5L 3CMOL 2ZXWC 4JKPH 2VGLM 1IEAB 3SKJH 1TLMA 4CN6A 1U8IB 1JNHA 3QXDA 4PTUB 2WIMA 1MCLA 3FO1A 4ZBJA 3CCHA 4JHVA 1YJDC 2LFGA 3RVVC 3CDZB 1JQ0A 5C0AE 4TQDA 1OW0C 3MV8E 4FXTA 1E1QG 3OMIB 1YECH 4TVPL 3MROA 2A74B 3CZJA 3BOVA 4QJ3B 4G8IB 4DEUA 3SGDH 3KVQA 5LXVA 1W0WB 1OHZA 1MCKA 4H26A 2PYEB 3GJEA 4HH9B 4NZUL 3SBQA 1CICA 4MNHA 1TKWB 5F6HJ 2VR5A 2OQJA 4PRHA 3RWGB 2BIQA 2UV3A 5I76B 1F4XL 2EBOA 1JV5A 1MCBA 2FGWH 3F58L 5EH1A 1CLCA 1OTSD 4KZDL 1T1YB 4FK5C 4MCYA 4PMEA 4Z95L 1MNNA 1KELL 1NCIA 3MV9B 4U1MA 3D3VE 2C3WA 3GMPA 3QUMA 4X7EC 3DHPA 4YXHL 4KDTA 2NR6A 2MCPH 4AOFA 4D9RE 4BK4A 2X0UA 4U49A 3NAAH 5IUCA 1BAGA 4O2AA 1H38A 3TZVB 3S8FB 5DJZB 1EN6A 1FFNA 4MA1B 4PUBH 4XMTA 1UH3A 5JOPD 1JHKL 3I6KB 5BCAA 4NQTA 5CEZD 1EJ8A 3CCVV 2HX9A 1E3FA 5IB2B 1JF1B 3P54A 5GGUA 2HN7A 2BOBB 5D1ZA 3IC9A 2QDOA 2GTWB 3NIFE 4XPHH 2BY0A 4URTB 1KB5A 1ID5I 1AE6H 2KL6A 3S5YA 2IADA 5DJDB 4QHLB 3RHWK 3JWOH 4XAKD 5AYTA 4FQXA 2EDLA 4Y8AA 3MO1A 5FYJD 1S2EA 5E1AA 4A67A 1SDAB 1HNFA 2A6KB 1EANA 2AJXL 4ABWA 1X4YA 1QNIA 2EZ0C 1KP3A 5BZDB 4P2QE 1ZHNA 1QTPA 2CR0A 3BP7A 1Q8IA 2GJ6D 3WKML 2YXLA 3EF7A 2SODB 1C08B 3MCYA 3D6GA 1SKVA 1DSWA 3MO1B 3EJZC 1J8SA 1MHCB 4FLVA 4K3JL 5I8EB 1WAPA 5E0FA 2GBOA 1MN4A 2FR4A 5SX5K 3AG7A 4PJFA 2NNUA 1LR1A 1U6AH 1KC5L 1S9YB 5CA1A 3ARFD 5JH7B 3PABB 3U48A 3DYPA 2IGLA 1CLOH 3SBWC 5F7HA 1EAJA 1JSYA 1LTXA 5J4MA 1MCFA 2X4PA 5BOJA 5TE6L 3C6LC 1V8HA 2NNRA 4OIBA 2XC8A 3EXAA 3R0MA 3T0WA 1W91A 1JHTA 3HKCA 3ZN1A 4HWUA 4ZS7L 1X5XA 2VDOH 1DK1A 2ICWA 4DR4B 2W92A 1S9YA 3P1VA 1XT5A 3G5ZA 2CA4A 1G84A 3CYOA 1EAQA 4MJ5B 2HP4A 5GGRY 3DUSB 4P2OB 1FLRH 1QWUA 5GIRA 3RIAF 3CSBA 5DMIL 3S8WA 4LCVA 4QXWA 3OKMA 4EI6B 2HRGA 5IJVB 3ZW3A 2I07A 3W81A 1SY6L 4NFCA 1YEDA 3B7UX 1XNRB 3FBKA 4CH4A 1GZHA 5GRUH 3T2NH 4Q74A 3QJUB 3N41B 4PCSA 5D4HA 3N44B 4NC1C 4ONGH 3VWKD 3GSNB 1JGLL 4R7CA 4OPHA 1CGXA 3QR1A 1ORQB 5EU3B 1JN6A 2AK1L 3ZIAG 3W2DH 2WBJA 4CVWA 3MD0A 3VTTA 2PWEA 4GRLD 3TIDA 3ZL1A 4ORGA 3INUL 1N59A 1GPOL 2L04A 2VNCA 4HLJA 5JHLH 4X5PA 5EEYA 1PG7W 1D5IL 4AIXA 2OZNA 3QW9A 2HVJB 2V3FA 5CP7B 1JJUA 4MXVE 1DBAH 4OLZH 3MAQA 3K3QA 1A6TA 2YD0A 1VKXB 1XB6A 3OLIA 3QXAB 1Q90D 2RFXA 3AABA 4YSSA 1UXWA 2VW7A 3L3GA 4PBXA 2VR7A 1NC4B 3O3BA 5GRJL 2QWRB 5AVZB 4WVRA 3HAEB 5CIPB 3NBNA 2J4WL 2UY6A 3IDGB 3NZUA 2QM8A 1QI5A 4P4KD 4IU3A 1W0WA 4HH9A 1WHPA 4ZFGH 4Q4IA 3QHTC 3LTVA 4W1TA 2AGAA 5TE7L 1ROCA 1LO2H 5E4IA 4NN5C 1MG3C 1KFAL 4OSUL 2P8PB 5M94B 1IBZA 1E8YA 4YDVA 1FO0H 1S46A 4K5LA 3H1HH 1RZKL 3MREA 2BM3A 4P9HL 4EDWL 1EHXA 2Q7NA 1E8ZA 1KNOA 1LYQA 2DQJH 3ATBA 4GEJA 2EXYD 2VQEO 1UC6A 2J5LB 3K72B 2VITB 4IU2A 4NM8H 2E7LA 2WW8A 5J2TA 5DZLA 1HHHA 3B9KD 3H2PA 2DWEC 3ELAT 4D8OA 4U6VL 1PL4A 1FFNB 3K2IA 4NX0A 4TUOA 3EUDA 5IHUL 5JW3H 1A0QH 4UNIA 3UTSA 3FUFA 3IDIB 1NINA 1K8DA 3G6JA 4I7ZB 3T65A 4ZHQB 1RZGB 3U7WL 4ZFOL 1RZIA 3IJSB 2GDSA 2E27H 3ARRA 3RNQA 4PJFF 1X4XA 5HGAB 3JD4A 4OR1A 4FAAB 3O3DA 3A8TA 2F54A 3OPZL 1YNKL 3A67L 4NNPL 4V2CB 3H4HA 4V33A 2CLVB 3S5LA 3CFJB 2AI0H 2CGRL 2Y2WA 1HH6B 4ZOBA 5F0PB 1U8CB 2ADIB 4Y1AD 1TJXA 3KNBB 3AACA 2GEQA 3BZ4A 3HN8A 3C60A 2BIHA 5DZ9A 1XSKA 4HALA 4Y4FD 5CA3A 5GS2D 2XQ0A 2JE8A 3TBVA 3QNXA 2YQ2A 1EEYB 4HP5A 2J1XA 4GKNB 3AG1B 3NH7L 4ODXB 2B4CL 4L5FE 3QFDB 4RMUA 4DPCX 3CX5J 1IGYB 1AKJA 4LMQI 5B39G 4DWHA 4IHJB 2G3NA 3HG2A 2PWDA 1WB7A 1E9PB 4OZIE 1G7PA 3Q6GL 5IJ0A 5BXFA 3V7MA 5DFTA 4P4KB 5A2KH 1R3KB 1WG3A 2D3JA 5INCA 3MNZA 3JSLA 2Z8RA 4GBXB 5I17A 2VABB 4HKJA 3T1CA 4P3WA 1M9NA 3D85D 1A7QH 1F1GA 4P5TB 4V11A 1EAPB 1PNCA 2WV3A 3QH3A 8PAZA 4KV5F 4J3TA 1IGYA 1XF4B 1PZBA 4WK2B 2X1PA 4KI5E 4HS6A 3MLZH 5EORH 3RVUC 2V7QG 4TNWK 1ACXA 1BVZA 3D4CA 3KBFA 5ID0A 2DTML 3I6GA 3MRCA 3P73A 5E9DE 4D9LL 4TYUA 5TDOB 2KZKA 4QPJA 5IDJA 4OFDA 1OGPA 5JIDA 4HX1B 2ESVE 3MDSA 2CDGA 1MVUB 1MFNA 2D4FA 1NLDL 3D05A 3GXMA 4HD9A 1TZHA 1FC1A 1QSFB 4HKZA 4LLWB 4OZGB 1OP5H 3A0OA 2XWXA 5E2UH 1DVFA 1DLBA 4QRUB 5JXED 4LEXH 4X62O 1GY2A 1X5JA 3SY0A 2QV2A 2CTQA 1G4MA 3I6GB 4OY9A 4YSPA 5FNVB 3EDFA 3I3EA 5DQDL 5LXTB 5AKTA 2E5LO 4PFEA 1RZPA 2R0LL 1DBMH 4FFBB 4Y2NA 4MVRA 3GKZA 4ZMPA 4W93A 3Q6FA 5IVXB 4CS4A 1EIBA 3DOSB 4PTUA 3ZSSA 4Q89A 4E41D 2FQDA 6PAZA 5KTEH 2ZSWA 5B3JE 4OLUL 4R83A 5J3HC 1P7BA 1IXMA 3HBZA 3K80A 4IBSA 1IGTA 3CN3A 3AITA 4Y1AB 3GBNL 1A3RH 2I7OA 3QUYB 5C7XL 4LCCB 3I5DA 4YFLF 1I08A 3IBOA 4F8QA 1C16B 1SRDA 1QFWL 4LLMB 5C0DB 5CN3A 4X7SL 3CXHJ 1QBMH 4F58L 4YHLL 4U1NA 3ME0A 3ZRSA 2X3CA 3D4GA 1R33A 3SDYL 4NXMB 2C9UA 2QPSA 3FTXA 1OB0A 1J9QA 2YD5A 4G3YH 2GIMA 4M62H 4PS4H 3AT8A 1DYZA 1KJ2B 1BCCH 3D39D 3FT2A 3GZPA 4NR1A 3KXFD 3QRFM 3ARDC 5BVPH 3QAZB 3RG1C 3V95A 3AJ7A 4JFSA 2PO6B 1QA9A 4PA4A 4UOW1 4WFFE 2AXGB 5IBUB 4PJBB 4PTTA 4HCIA 3AG2C 1HSBB 3HKEB 1RK1B 3L9RB 3ABLB 2ITDB 1NC2A 2VDLL 2H1XA 4U6TA 4E9RA 4R7XA 2JKNA 1NSNL 5D2NB 4LNVA 4AEFA 1MJ7H 4XP5H 2OXHA 1WWCA 3FFCA 2VM3A 1QX1A 3HKFA 3WLWD 1L3WA 2CK0H 3BD4A 3STBA 5JPNB 3SYPA 5IQLA 5EU6B 1WZ1H 1MFDL 4ODVL 1H0DA 4XHJD 1P84J 5J9PC 3V52L 2QSCL 3GNML 5IB5A 1DSFH 2E7BA 3VQWA 3NQKA 2JI2A 2LR4A 4I3RH 1LNUA 1MSWD 1EZJA 2CM6A 2FH6A 1HSAB 2XTJD 4LOEA 4TXVB 5ITFB 5IHLB 1JPTL 4UTBH 4YLCA 2MPAL 3RGVD 1WFOA 3TESA 4G72B 5EU6A 3RY4A 1NGWA 3H56A 2HHHB 4AENA 1CYXA 8CGTA 4LEOB 1OAXL 3SO3C 5JHDD 1AVAA 2UXGA 3WBDA 1UOVA 2XXCB 3LEXB 3CXHF 1P5VA 2VSDA 1D2OA 2X70A 4I85A 3SGDI 4XBEL 3U1SH 2AQNA 3I85A 3KHQA 5DO2C 3UGEA 3VXSE 3ZE2E 4D9QE 2Z3YA 4PVMA 2C3HA 4NHUA 4KY1L 4K8XA 1Y4MA 3QZBA 2V1DA 1ROWA 3WS6C 3ZTJH 3F01A 2NX5D 3FB5C 1A4AA 2NQDA 3HNSL 2XYBA 5CA0A 3AAZB 1RZJL 3SO5A 1UATA 1E30A 4D9QD 4NZTL 2P80A 1ML0A 4ZOLA 4JI0B 4F7PB 2BOLA 3HKCB 3MV9D 3BSZL 4MW3A 3AG2B 1ZD6A 1KXHA 1HINL 4XBEH 5IB4A 4AW7A 4ZFOB 2FSEB 3U30C 5F3FA 1JXFA 3QORA 1MFBL 4GBXC 4HUXB 3NIFF 4X6DB 4F80A 1SHMA 1HYSC 5GGSA 1V5JA 2P45B 3KGSA 15C8H 2C26A 1NFIB 4EIBA 3HC3H 1ZT1A 2IANB 1UM6L 1KYOK 4ASUG 4OXSA 1E4HA 3INOA 4HJTA 4N3TA 1ENVA 3B5HA 4FNRA 3QQ3B 1OLLA 1WC7B 3T8XB 1WS8A 5BO1L 4P2ZA 1DZBA 3L3HB 5KA6A 1K5WA 1IKOP 3P3UA 4X6DA 2K45A 5IHZB 2L4OA 2Q8AH 2WZ0A 4L37B 4LRIA 4HOMA 4K3EL 1B0RB 4PJ5D 1FN4A 1AC0A 3HUJF 3GQFA 2GBTA 4FQPA 1BFOA 2BCCH 1Y76B 3TEWA 3S96B 2FQFA 3QEGL 4PJ8C 4PJDE 5T3XL 4ZNEA 1KUMA 4JDZB 4TM9A 3L72H 2VR3A 1UD4A 3VXPA 1U58A 1S7XB 1L0LH 3D36C 4GX1A 1ZTXL 1J12A 2H5UA 1QO3A 1Q8MA 4Y4HC 2FHBA 1VQ6V 2NYZA 4L37A 1R3JC 2Y4UA 2UUAB 2P5EB 5DR5L 5FF6B 4LIQE 5JDSA 5IROC 1SA0A 3WGVB 3C60C 2CLZA 3US1A 5CZXC 3ZQ9A 2GJ6B 2NQ3A 3WIFB 4G7YH 4G8IA 4YMPA 2KQXA 2VM4A 5CJXA 1UT1A 1X9UA 1IGMH 1MHEB 3KPNB 3MRRA 3PWUA 4F6EA 1LP9B 4WFHD 3S3SA 2UUCB 2DBLH 4DTGH 3GB7A 4JL1A 4R90L 3ZKND 4G11A 3SKOB 3ZMUA 1X9LA 1CPYA 1O6SB 4LCCC 4OUOA 5K39A 5K9JH 4LF8B 4TV9A 2E7CA 4I8DA 1SQQH 4N0RA 4DKEL 4CC0A 5I1LB 4GKSA 4CU8A 3SGIA 3STLC 1JWUB 1Z3RA 3TJTA 3IGAB 4N26A 1RUAH 4QOKA 4UILL 4AGOA 4YZWA 4F92B 5JMRA 5FHBH 2O61B 4XH2B 2X42A 4Q97A 1WFIA 3GDCA 4JPIA 4WWNA 4DTGL 1QNZL 1BMFG 2Q3ZA 4I5BB 4JAUA 4KDWA 1NCAH 1G6RB 3VE0B 3RZCC 2OULB 5DRXB 4M8VA 5LG6A 4ZPVA 3AU0A 2ZDIA 1Y0LB 5DMYA 1AE6L 2WUCL 1IV8A 4F9PC 5FL7G 4ZMWA 5DC2A 4LCYA 3BT0A 1NGQL 1MFAH 4H26B 4Z7QE 3EYOB 4M1DL 3C5SA 1J5OL 5EOCJ 5AOIA 3WDJA 2EIZA 4XTRC 5KHIA 1YN6A 4ZODA 3RGVA 4QJ4B 2DJMA 3VB8A 4QGYA 5IFAH 1XGRA 4LMQE 3V9FA 1D7BA 1UD3A 1L9MA 3LMJH 1LEKB 1MLCB 3ZR5A 3KPRD 4CMMA 5L8KB 2OMVB 5ISZD 2VN7A 2X87A 3VFOA 2CJ3A 2K1MA 3Q48A 5I82A 3LQAL 2NXYD 4LARH 3P77A 4G7SB 4AQ8C 4DV1B 4OVVA 5E94B 4FMVA 4IM8A 2XWJA 1RP3B 2Y36H 1DJIA 5FO2A 2JIXA 2JK5C 1KB3A 4JHAL 4NVPA 3DURB 1FZJA 3JV6B 4N85A 3TVMD 2FT6A 1KQSU 2KUTA 2IU0A 5DJAB 4QRAA 5MEQB 2YGVA 3BC9A 3QUKA 1R6KA 2DAVA 1KCLA 2VLRB 4LSSH 3P3RA 2ZE5A 4IEFB 1D6VH 2PCYA 1US6A 1BPLB 2R2CA 3FOLB 4XWGH 5IG7B 5TF0A 1TZOA 1F4WL 4KUCD 3HZMB 3RX8A 5C2BL 4PVNA 4X6EA 5C0FA 5JIPA 1R5WA 4UQ3B 3K6SA 3H1LH 4ODXA 2Y7QB 1T83A 3GMOB 4HHAB 1RZFH 3VI3E 1ZSHA 5LCVL 2UVEA 4JKPL 3QQ9C 1FRGL 2JGUA 2PW1B 3QR0A 5CCKH 3FB5B 2WXLA 4DNLA 2OYPA 1F3DJ 2C1OB 4YSRA 5G5DA 4DRXA 4KTDL 1AHWB 4JPVH 4QHMB 4BXVA 3QCUH 4L4VB 1AHMA 2XVLA 1I1CA 1PNKA 5EOCH 2BP0B 2EDYA 1DQDH 2BVOA 5ANMA 4OF3A 3VI3F 3IFPB 3QWRD 3BZ5A 3IDXH 1AR2A 4RCAA 2BZDA 3BKML 2WQAA 4EZLA 5DRWB 4EOWH 2GSMB 4ANXA 1YEDB 5EEWA 1ZEAL 1AXSB 3LKNB 2JEUA 3UPRB 1Z7JA 2Q76B 3DRTB 3FRPB 5AYUH 2VN5A 1CWVA 2ADFH 5FHBL 3O6LH 2FNBA 4KI5D 4LSVH 2FJGB 3KPPA 2F15A 5AVWB 2PCFB 2ZKWA 4KJYA 3CK0H 3QRGH 3FW6A 3LS5H 3ARPA 1J1XL 1MFEL 3AG1C 2EYTB 4OFYD 3TS8A 2VUKA 3LXBA 3UKMA 1CG9B 4K2UH 1DVQA 4XMLL 3QJXA 5E5RB 5EO0B 4WGVB 4M7LL 3KL5A 3U2JA 1W8EA 4KUMA 5EUOE 5T33L 5CNHA 3DX0A 3U6XS 3VDBA 5IMOA 2XWTB 4ZNCD 1UB6B 1ND0B 2H3KA 4N0YL 2GUZB 1VEPA 1NQBA 3NZHH 2JCCA 2YQ3A 3MHSC 2G2RA 3QP3A 3S36L 2AEQH 1R3HB 4Y4FA 2XTAA 2AV1A 3MCKA 3E22A 4NFBA 4K9EC 4JDVA 2OMZB 4O2BB 1NBVL 3UMTA 1GKOA 3P9LB 5JVDA 1KKDA 1CQYA 4FYSA 2MNUA 5CIPA 5ENWA 5BNXD 4NWTH 4FQQA 5IMLB 4JG1L 1CVSC 5AVUB 2H26B 2Q9OA 3CCLV 2CUIA 4F6RB 1SOXA 5DUML 4K94L 3HPLA 2R0ZL 2XNAA 1XX9C 4M8QB 2Q6WB 4OFPA 5KHKA 1A1OB 2J88L 5EDXA 2QSTA 5AAMA 5C0ND 2YPVH 3V6FB 2HKOA 3IGAC 4PJ0Z 2Q7EA 2V33A 4PVLA 3T6XA 1Z0NA 4HQQH 5E8PB 3IDUA 2EDRA 4ZFZB 2D0FA 1T3FA 2WYIA 3LNIA 2QEJA 3VFGL 2VDPH 5AZ2L 4MJHA 2VMCA 3K72A 1HZHH 4TVPH 4EKJA 3O4LB 4ZQTA 1CXLA 4PRIB 4AQYO 1MXDA 1H15B 1JGLH 2AEOA 2XAHA 2JB5L 4N86A 1YY9C 4ELME 1YMHA 3V10A 3FUJA 3WY4A 5LGJB 1EDQA 4HQQL 1KMGA 5KSAD 3DX7A 2DQTL 1SLUA 4U7KA 1FVCA 3INUH 3PAYA 3OAZK 3F5TA 4AGNA 4C4UA 5IQ7H 4KMTH 3VD9A 3NEOA 1I9RH 4IHOB 2QADB 5AEAA 4S1DD 1PY4A 1I1AB 2ZOUA 3X17A 2L0DA 3DTUB 2HEPA 2VISA 1BM7A 1CYGA 4F33B 4HUNB 3X12B 4LF6O 4Z7UF 3STZA 3MA9H 2JK5B 1MI5E 1XQ4A 3ABGA 5B3SB 2VUYA 1ZKAA 1J9SA 1TTGA 2WJ5A 3LS5L 4PGEA 2IOOA 2W91A 5SWZB 1QLEL 4H4NA 4DPAX 2IBGA 2WTRA 2YD1A 4LVHC 5BRZA 1GK9A 3TONA 3UTTD 4FG4A 3AG4C 3L5XH 4GZRB 1C1EH 5HHVH 4WHTB 3OKDA 4RFNC 2WVSA 1GYCA 3OXRA 3RT3C 1U8PA 3MGTA 4FQ1H 2ITEA 4PD4J 4EPSA 5MENE 3VD4A 1F02I 2EILB 4DGVL 2RCVA 2OSWA 1U42A 1E8WA 2YICA 4LLVB 2K7PA 3ARUA 2L7QA 2EIJB 4YSAA 3JAWA 1AS8A 2W60A 3CVIH 5JQGA 5H94B 3QHZL 3DGEA 3HHSA 3V0VA 3WJLC 1H2GA 2F7IA 5MEND 4OCNC 5LCVA 3UT5A 1MHCA 1KTLB 4ZOLB 2WNGA 3C6EA 3KBPA 1CFSB 3ETDA 3ZDXE 2ICCA 4BFFA 4S1DC 2F08A 5IROD 5C97A 4N23A 1Y07A 3UTTB 3UZQB 4EZKA 1N6QH 3VACA 3L3KA 1E27B 3NCEB 2F68X 4I18C 4Q2ZB 3WLBB 4I89A 3TBBA 3LHPL 3GD1C 2YAPA 1OY3B 4LCIH 3OC5A 4KKCC 4EI5A 2R0ZH 1KSRA 1LDSA 4X1YA 2P24B 3HHSB 3V0VB 1MVUA 1BBJB 2ZYSA 5H6QA 3QG6B 5KVFL 3RY6C 4KXZH 4YWGL 5AAPA 1AQDB 5J2UB 2D7MA 4HUVA 1RUQH 3BVXA 3VXSB 3ZE2B 1U93A 3OPZH 4XMWA 1J86A 4HS3A 4RZCB 1XIWD 3L5WA 3NVQA 1MFCH 1T20B 3EJQA 2WQWA 3RWIB 5GSRB 3WS6A 5HP5A 3M8OL 5KS9F 4ZBMA 3N9GH 2XBDA 5EF0A 1RFDH 2EYTA 3L3DA 3BWUF 4GFXA 5I0ZA 2VQEB 1XGUB 3I75A 4CKQA 1XF4A 5EO0A 3SBRA 1WE5A 3SE6A 1AQMA 3HR5A 1I1RA 3ZE0E 2WZ6A 5BV7L 4X5WA 3UJIL 4D2NA 4WBNA 3VI4A 3VXRD 3UC0L 5FGCB 1DO6A 5GRUL 3VFNA 1F2XK 5I2IA 5I1DB 1ORQA 4M5YH 1UWEL 4A39A 4IJ3C 1VF5B 4ODTH 4WTXA 1CU4H 1S3RA 1CFMA 3L4VA 1BXXA 3LNNA 1L6PA 4X0KB 1AS6A 4I0PD 2VLME 3IMVA 1DQML 4JHZA 4H0IA 3V4PB 1ECZA 4JAMA 5LP6C 3CMGA 1QEWB 2EDEA 3QVAA 4R4FH 4UQDA 5SWZE 5JW4N 1VFAA 4UMGA 4LP4A 4QPKA 2VQFB 2ENYA 4JFDA 3VXTB 1OKEA 4UU9B 2UZYB 4OZFG 3V0WL 3RYHB 5D8JH 3WO4B 2VM9A 2BY3A 3DJZA 5IKCA 2LAAA 4U2YA 1GGUA 1B4JH 2Z7WA 1ITBB 1JZGA 2ZAHA 4KNTA 3X11A 1K4CA 4IOSA 5F89A 5C0DA 4G83A 4ECNA 1HS6A 2P43B 3ATEA 3CH1A 2MSPA 5D93B 3RWDB 3E1F1 4PJIA 3WAKA 5HJDA 1HILB 1FL3A 2OAAA 4A38A 2AGJL 3LRGA 4ELMB 4KXAA 3B43A 1HDMB 4KJPD 3ZKMD 3HG1D 1KTCA 4E5XA 1T0PB 3BP5A 2YARA 2ZYIA 1JDAA 3MREB 3NDYE 4FADA 4AH2B 4RUEA 5FFLA 1KEMH 4IU2B 4Z3FA 1RPUA 4H13B 5E9DD 1NKDA 3SGEI 3FPXA 1CQKA 2YS8A 1U2HA 4LPYA 4PTTB 5D7LD 2E7DA 3JCZA 2ESVD 2BW5A 4UT9L 4JLRA 4OCRL 1FQ9C 1CK0L 1BFTA 2YQGA 1GJWA 1SJHA 3PFQA 3JAKA 2O26U 4B96A 1I7ZB 4PRNB 4AMKL 5I6PA 2CO7B 2DWDB 3SDCB 4LVHB 4DV2B 4OLXH 5DQJA 5HGAA 4E9YA 3WMPA 2IPKA 3QWRA 3OHXC 1DVUA 1AR4A 2E5LB 2DPKA 1E2ZA 3EFDH 2HJKA 4K8RH 4L9DA 4A2LA 2AXHA 1O6TA 4FZ1A 4DUZO 3MRMB 2OKMA 2FO4B 4N2KA 4RQFA 3G6JE 2ZNJA 1KJ3H 3KWUA 1QVFU 3A0RA 5JO5A 3CFIC 2FEJA 5C0IA 2WBWB 4WWKD 1SF5A 1URLA 4I5SA 1JPGA 1NFDB 1O7VA 4NNYA 4QXGL 5F7UA 2P5WD 1NI8A 3MU3A 1W15A 5AALA 4L05A 4I18B 1T1XA 2VLRE 1ROPA 3CFMA 2Q7GA 1M7XA 2VLJB 4WWKA 4YEEA 1FNGB 1YHPA 3U0WL 3WHXA 3I50L 4JRXE 2EX3A 1A6WH 4PJ7A 5GZOD 3FTUA 1K72A 3P3YA 3J7AU 1FORL 3FH5A 4ADIA 4AEHL 2ZM6O 5ISZB 1IFHH 1XR8B 4H13C 5FHAH 5JOPE 1U3JA 1PVHA 4YBHA 3D18A 3VVVA 1DCEA 1AQKL 2JS5A 3B2PA 4OIFA 1KXTB 4FKKA 1REIA 3AT9A 3BPNB 5KVGE 3U2SA 2XWBB 5E7BA 1AHWC 1TETL 4DCQA 1HH9B 1KN2H 1U3YA 3NPSB 4XN9A 2AJSL 1NCBL 3BLPX 2UXXA 4KPHH 4YZFF 4ZW7A 5ERWA 1KB5H 3BVNA 1NANH 3H9SA 1MKFA 5DZPA 3VXRE 1S9WB 4U1IB 1MUJA 2VQTA 4G6FD 2UXTA 2OYLA 3X3FL 1BVNT 5TFSH 4WCEV 1JNNH 1NJ9A 1GTOA 2VZVA 5CZRA 2YAMA 3OX8B 4X88A 5LB1A 4XC3H 2DL2A 2YEZB 4GUCA 3ARBB 4GKOA 5KANG 2KLSA 3QZPA 3L95B 3HJEA 4WNSA 3ZBHA 5B8CB 3REVA 4NM4H 4WTQA 5FWRA 1LO0L 3Q43A 2ZKXA 2AK4A 2PYLA 1FFPB 4X9GA 3KLDA 1QLRB 2OTUA 3WN6A 3P3SA 1G7LA 3V6FA 1NQTA 1OAQH 4ZXBA 2YR3A 3T2MA 1CCZA 3FTGB 3BDBA 4J4PC 4QXVA 3RGHA 4A7SA 1I8LC 3IJEB 1W6LA 4JYCA 5I1EH 3IDNB 1N12A 2Y07L 5D5PA 5HYJB 4NUQA 3DSQA 1JTOA 4U6XA 2PP8A 4ZTPH 1J0KA 1YEKH 1G7MB 3TNMB 1R1CA 3MZTA 2DQCH 3RTQB 3LNFA 5HGDA 1NDGB 4XPAL 2X09A 3P30L 3C3SA 1UH2A 2BWDA 2RALA 4I4WA 2P5WB 4G1MA 4PMFA 1PBYA 1EZVH 3NJJA 3BI9X 3C8DA 1U8OB 1MDTA 2VXSH 3FT2B 5CJOL 4GKSB 3JATB 2X4TA 5F7MC 3ZO9A 4JI0O 2P8LA 2OJEB 4M62L 1R46A 1HXMB 2P4KA 1I3RB 4I9WE 3MV11 3R1GH 1ETA1 4QGPA 4U3JB 1LO5B 1BSIA 3BAEL 1PM9A 3QIUC 3AREB 2VJ0A 3ELQA 5F8QC 2XWJB 3P4OA 5T1JA 5GRYA 4ONOA 1JZEA 1PS3A 1MIEH 4GUPB 2OLDA 4ZK8A 1E7UA 3LIZL 1EHLH 3FFCB 3U1QA 1HCFX 2AS5M 3A23A 4NRZA 2AQRA 4CBPA 5GGTL 4X6BB 5I0VA 3CLEH 3KAAA 4NIKB 4GIAA 1EZUA 3TGXA 5LBVA 1YEIH 2G60H 2B08A 3MPCA 4GKZA 2PN5A 4RMSA 1SJHB 3K8MA 2DQGH 2DWDC 4PJCF 3SDCC 4HGMA 3VM7A 5HYFA 1H8HG 3NH7H 3G5WA 3PDOB 4XRCA 4YAQB 3G3LA 1K33A 3TCUA 4OX9B 1KD1W 5K1NA 4TNWF 1JFQL 4GI9A 2W9EH 3QIBB 5JA9A 2A79B 4RWUA 3SSGA 2HJLA 3SY6A 5IK3A 4QHLA 4AYGA 5KVGL 5CM1A 1JCKA 1VJSA 1XZ0B 4PG2A 1GHFL 3FB7B 1DUYB 3KDMA 5IT2H 1NBYB 5D7IE 4APXB 2Q3XA 1CDBA 5C93A 1SEBB 5HHNB 1Q1JH 4BK5C 1M7UA 3GSWA 3WEXB 2VLRA 3MRHB 4JM4H 2Z7YA 2YQBA 2F9BT 4QHNB 4QYOB 3VSTA 2OL3B 5DYOA 1OAJA 3BN3B 4WNJA 2NT1A 1Z2GA 1UWXK 5DTFB 4WFFD 4L48A 2ZUQB 5J8OA 1ORSB 2JJSC 5F7NC 2Y6TE 3O6FB 1XH1A 3PQYB 5CSGA 4TRPL 1MRFL 2K9FB 4UZUA 4GRWE 3VGBA 2ZOTA 3BT2L 4Y1TA 1P7KB 4YHKL 2FEEI 5GGVH 3LRLA 1NIFA 1VSCA 5LMUO 4MB4A 4CVUA 1YEHH 4PDLA 3ZRFC 2IXQB 3MFFB 3SE4C 1DVZA 1BGYH 4NUPA 5PCYA 2O5ZH 3OAYH 3T3MF 3AS1A 1KCVL 4EVNA 3SDXA 4MX7B 2F53B 2XPYA 3OAWA 2QWOB 4JDVB 2WSKA 4JJOA 4PSRA 2VXVL 4GW4B 1T1WB 1KXQE 3NOIA 5E2TH 2ERJC 3VW3L 2HKHH 4NAQA 4ZX3A 3FFCD 4P46B 3JVGC 1XMEB 4MDJB 1XOUA 2N74A 2GUOB 4HEMA 5DUMH 5EBWB 4B7KA 2EYRA 2P49B 3EYUH 3K0WA 3L4UA 5EPMB 1XMOO 3RURA 4XNZC 2Z92B 3BD5A 5CEZL 3B6SB 3GXIA 4JO3L 3QDMA 1TTUA 3CSGA 5DDHA 3ZE0B 1S9WA 5FFGA 5IQ9A 5LMNB 4QD2E 3ZY7A 2DRUA 4PA9A 4PD4F 3VD5A 1QBML 1GGIH 3ARBC 3NCJL 2W0FB 3PQYE 3MJWA 2GB2A 1JDDA 3RFRA 4X7CC 1UJWB 5L4FA 1XF2A 2V3DA 5H8DA 2F0CA 4IOSD 5T1KD 3IDXL 4RIRB 1OP4A 4NCC2 4CS3A 1M05B 4P23B 5FKPB 1H2LA 4JQVA 3V4VB 4H20L 3CZNA 1L3NA 3GGWB 3HG5A 1SETA 1VGKB 3MKKA 5LHDA 4A1RA 4KGJA 4QOKE 3MV9E 1JHKH 4HULB 2DJSA 2UXCB 3W7XA 2R2HA 1DQJB 5DD3L 1AZCA 3V4UL 4K94C 4PWIA 2IMMA 2ZUWA 2YUXA 3GZOA 2GHWB 2OR7A 2R27A 2XV2A 3BFWA 1NEZB 2DKMA 4N4YB 3V0FA 1OAUL 2EDTA 4I0PA 4KUZL 4GFTB 4NSKB 3U9WA 5E6IA 1KCKA 3DMMA 4F5CE 5A40E 1UKQA 4GKKB 3MJ9L 3TN0B 4PJXE 5KBKA 4RUFA 4DPRA 5DLLA 4ELMA 5LP6B 2A9BA 1JI1A 3LZPA 3ZMEA 5F71A 1A6VL 3O41A 5CCJA 1XIWC 2NY0D 4PLKC 3QNZA 4QR7A 5DRZB 3S88H 2QA4V 1MF2H 2FEDD 4YHHB 1QBLH 2MCPL 4L4TA 2LW7A 3MLTB 2IDUA 4ZUVB 2H8PA 2WVVA 4NJAL 1UJ3B 4HCGA 4QTFA 3RJOA 1OAKH 2QQNL 3BRGC 4N5EC 2NN4A 4TNFA 4B0MB 3OXRB 1X59A 3ZDXB 3EFOA 5ESAA 2WBKA 1OGAA 3LNMB 1NWOA 5D93C 2VITA 4GMSH 4PJAE 5E00B 3EXJA 4FNLL 3MRQA 1QABA 3VD3A 4DZ8A 3GMLA 2DYPB 1XSIA 1M3IA 1EZSA 3PHOB 4ZG1A 3EW3B 3HRZA 4UANA 1Y18A 3TPUB 2R69A 4N0YH 5JHBA 1E4KC 3R7RA 1HTYA 1QR1A 4OB5L 3N42B 4DIXA 4TQPA 5ESAB 5IVXE 3UO8B 4GXUM 3UZVB 1I9JH 2ZJSH 4IBTA 3GMRB 4WW1A 4DUWA 1XUQA 5IGXH 4B6ZA 3FB7C 4Q2ZA 5CJQL 5I1IH 4K23L 1GM9A 1JZHA 5DSCA 4EFBA 2XN9A 1T22A 4BSWA 3BD3A 3D1MC 1PPJH 4QXUL 1DE4A 1NH2B 4WJG3 1U41A 2HUHA 2W95A 4HKJB 5C0AB 3WIAA 5AKRA 3HE7C 5DHEA 1LHZA 2NY3C 2R23A 3QH3B 1FKAO 4GAYB 3V0HA 2YBRA 1BMWA 5D5MF 3KKYA 1U8PB 5BUGA 1CIDA 4X4MA 1U2CA 2FT8A 1JR9A 1KPVB 4IRJD 1I9JL 2ZJSL 1JK9A 2VW6A 1M9SA 3OZLA 4BIUA 1ZV2A 4FHBD 2DLGA 3VMNA 3WJMA 3IPEA 1CE1L 2BP3A 2Z0BA 1DE4B 5C0AA 3FB8C 4XHJC 1X7SA 5IW1B 4H25A 3OLGA 4ATWA 2PF4E 7PAZA 4KO5A 2X2HA 1TZGH 4KVNH 2K4AA 5E1GA 5IW6A 3ZTDC 1AGDB 3PP3K 4L8BA 1J7VR 3ARFB 3CFBA 4KKRA 1QFHA 3H1JH 3NSDA 1KIPA 9PCYA 3OZ9H 5IIEB 1QYGL 1P9MA 1ZS2A 2NY1B 3TJHD 3D25B 3V7AE 4TUUA 4R2GD 1KXQA 3UJTL 5JYLA 5BZBA 4K35A 2CBPA 5LA6A 1YJDL 5A2JH 1CR9L 2Q8BL 3GO1L 2APFA 2N7BA 2WXIA 2I26N 1C7TA 2PNDA 5EO9B 5ISZE 3IFLL 2RDCA 2PKDA 5C0CD 5ABDE 4YE4L 3UAJA 4P3DB 2F7RA 3NCMA 1E5AA 4JI8B 4G8GA 3W9EB 4V1DE 1TA8A 5HDQL 3QXDB 3NFNB 3CRCA 5TE7H 4KNQA 4G9FE 2W0FA 1CR9H 2VJ8A 4OGQB 2DN7A 5GPRA 4HIHB 4RDQG 2MKLC 2FHFA 2XQYK 3HE7B 4F15B 3NCYP 2TRYA 2BE3A 1L7TH 4O4LA 1K73W 3IB4A 4NZDA 1ZWIB 4NXNB 4YFEA 5MEOB 3DOSA 3FQYA 5I73C 1T80A 1BVKB 4GSQA 3AK1A 1V3JA 3OFNG 4NXMO 1WAAF 4KTYA 4JY5L 2Q5ZA 4HWEH 1JJOA 4I4WB 4M6MH 3J80N 3TJHC 3QORC 2ITFA 3O3AA 4PR5B 5EU5A 4P3CL 5T5NG 3BH8A 4JAMB 3FQTB 4JZNB 2VH5L 2I9TB 4JL2A 1CFQA 2FZ3B 4Y1SA 5CJQH 2E27L 3ZTJG 5GS0C 3O8XB 4IQHA 4AXWB 3FUKA 4OM0L 4WUUB 1BVKA 3RYIA 4MCNA 3ETGA 2YZ8A 5AENA 1ZHKB 4XI5C 2J8UF 3WN5A 5KSAC 1NU1H 4IJTA 2GCYB 2NY1C 1XILA 4KITB 2Q68A 2JELH 1KCWA 4J5VA 4M6ML 1X5GA 4XT1C 2BOCA 3RBSA 5J57B 1RCYA 4P5KA 2HJFB 1KIRA 1PFOA 2XJLA 2CHZA 4J3WA 5GRXG 4F93B 3T6VA 2WWNA 2FWOB 3MX0A 4HOXA 1DQIA 1NIEA 4IIQB 3A2FA 4ZUVA 2AW9A 4W70A 5KMGA 1PY9A 4K7PH 4HBNA 1NKRA 1JOIA 5E6SB 4ZOAA 1AQHA 3BKJL 1I1YA 2IAND 4ACPA 3LH2H 4GH7B 4ZMLA 3OM3B 5AW2B 1MJ8L 2DQHL 5FW7A 5E8EB 2XQYG 1SRYA 2ZX8A 3X12A 3LAFA 1QYGH 4ESKA 5JIIA 2JK5A 5CGYC 4XAKE 3ZMSA 1KCRH 3T4AB 3BP7B 4AL8C 2NYYC 5IQMA 4G28B 4JI3B 1RULL 3RIAK 1QPPA 3BZFB 3CX5F 2DKSA 3UBFA 1U36A 1FNLA 2YPLB 3ULSB 4GXVH 3BWAA 2V5TA 2ZTBA 3FUIA 5D55A 5F0MB 1C12A 1UUNA 3WG7C 1BZ7B 4JFOA 1KLFB 2V3EA 4HFWB 5J6SA 1LUWA 1A64A 1ZT1B 4OU3A 1A7OH 1Z3GL 2NY2B 1Q9OA 2DE0X 2A3QA 2AAAA 2IH1C 4M7ZC 2HFEB 3CK0L 1QSVA 3KYOB 3LKPB 3QRGL 3ZQXA 5KSBB 1HNWB 4OZIF 4AKQA 2UXVA 2FO4A 4XPHL 2HT3C 4IMKA 2G9HB 1U3HA 4JFPB 1DO5A 4Z23A 3E8GA 3TEYA 4XN2A 1N7MH 3E0GA 4C4BA 2VABA 4PG2C 1GOGA 1I4FA 4C59B 4PU2A 2AQSA 5BRPA 2G2PA 4NUJA 4DN4H 5BMVA 2OMTB 3F7VB 4WUUE 4Y2DB 4A68A 4LF5B 1DJGA 1MCWM 2A74C 1DBKL 4LKCA 4PJCE 5DGRA 3S37L 5AB9A 5KVDH 5CBHA 2IBZX 2V2WA 4WU5B 3PN1A 3CXFA 3ZDWA 1HK6A 3ZHFA 3WFEL 3JXAA 3PXHA 1XEUA 1MAMH 1R24A 1VENA 4AJ0A 5CGBA 2GI0A 4NO0A 3T8VA 3RWJB 5ISZA 5KJRH 2J44A 2ZR2A 3NCBB 1I3GH 3P2BA 4D0DA 4WNQA 3D3VB 4O2BA 4GQ9H 3MMEA 4W9JC 1Q0XH 2R9RB 1MCSA 2AJUH 4ZW5A 2JB6B 1HEJC 1IRAY 4F8NA 2FECL 1E65A 1HOCB 5I1DA 1A7BA 4WHYG 4KKZA 1JPFB 4HCFA 5T5FA 4K7FA 1J1PH 3QB7C 4N0FB 5FOBA 2E76B 4NXNO 2VDQB 3ZRXA 3QIUB 1A3LH 1KF9B 2JJUA 2OTWB 3ARQA 3HUJB 2WLKA 4DKAA 4DVRH 2A0LD 4X66O 3ETQA 1PF3A 2XVKA 4QKXB 4ERSH 1BSMA 1NGZA 3FL7A 3SDXF 1NS1A 1G1CA 2GUYA 3DA0A 4DP5X 3T0EB 3QUYA 5GRWA 2IGFL 4A55A 4MCYB 4CJ1A 2VDNH 5GGSY 5E1QA 4FLRA 5DUPL 4RDQF 5GJSL 4J80A 3HR0A 5FYLL 1IE5A 4N0FA 1NLBL 3FQRA 4JFEE 5F7DA 4X6CF 3ZHKA 1DJWA 4GSDL 3RYCA 2A99A 4KX7A 3TBWB 3RUGF 1JZ7A 2BY1A 1U2YA 4B9GA 5TH2B 3F5WC 4I50B 5IBUG 3MYJB 4LASH 2XU9A 5T1LB 5DA0B 2YOCA 4XP1H 4WFFA 4BZ2H 4ZX4A 2VW4A 5TQ0L 1WBZA 3QJFB 4DR3O 2VAAB 2NSMA 3K59A 3MBEA 4NAJA 3MR9A 5EC2A 3JWDH 1JVLA 2AVGA 1BF8A 1G5AA 1OAXH 2FTAA 5HJ3B 3DV6A 2OJZL 5ICUA 5KEZA 1WCBB 2DM2A 5F1NB 3RYFB 3FSZA 4I50A 2ARJB 5FA3A 1X5MA 3MGOB 2B59A 4ISVB 3S5ZA 1GGYA 3ZE1F 1GVIA 4L3AA 1RZIB 4MVBD 5CCGE 4B7LA 2W38A 5TQ0H 1DBAL 1BEYL 4G8FB 1WT5C 3CHOA 4OLZL 3UIZA 2K9UA 3LRKA 3RNQB 2R56L 2BX5A 3KWXA 2PUSA 4M7KH 1RIHH 4Y9BA 3ZE2F 1YEGH 3MAWA 1MW3A 5DJZA 4FQ2H 1AGFA 4X9BA 1YEWA 3N1FC 1IKNA 1RHHA 3FUEA 4LKXB 2YDEA 2RQEA 4ZW8A 1I1YB 3FT1A 1ZLWK 3MGOA 3RVUD 2ZOKA 3FS9A 5EEVA 2ADGA 5ADOL 3FHAA 4P2OC 1Q9LB 4X1IB 4P4RA 1G7HB 4Z0XB 4APQC 1HDJA 5AL0A 4C4KO 3D34A 3CTTA 4FP8H 3JQOB 2YBGA 4YHNA 4BDVB 5A2LH 1OTTC 5FK9B 3JV0A 5DQJB 4LVNC 1A1MA 1AHWA 4QHMA 5J9PA 1U8KA 1UD2A 3GSUA 1Z2KA 4P99A 2CO2A 1EDHA 4XCEB 2N56A 3LKQB 4YY3O 2QHRH 2YOAA 5C09A 4PI0A 4NFDA 3AWEA 4RLDA 1G9EA 1ZCRA 3ETBF 5C0GB 5B66Z 2QLYA 1WLHA 4Q58C 3IMUA 3G4SV 4CJ0A 5FEBA 5I1AB 1WD8A 2HMIC 4NM4L 2QR4A 5KAIZ 1MH5A 4XNYH 4PLOB 4OI8A 3NCYS 2ESVA 2NNCA 3MRBB 4BSVB 3N41F 5DC4B 3WLBA 1XF1A 3LN9A 4MVSA 3CXCU 2C3GA 1CDHA 5EBWC 2HFEC 2J8UB 2FJHA 2F61A 3FRUA 4GS7B 5L6YL 3B9VA 4FFZH 4JUSA 3OKMB 4CKVX 1H3XA 5CB4A 4F27A 3GSRA 2HKHL 3Q2WA 4JFEB 3TIEB 2YUVA 1KN4H 5MHSD 4EXPX 3BPOB 2BHZA 4WEMB 3KJ6H 2Y7NA 1IAOA 1II4E 3VWJB 1E6JH 1NBQA 2DI7A 3MLWH 4WCYL 4Z3TA 5FB8B 2EUWA 4L5FL 5I5MA 1JYVA 5EZLA 1OE3A 1XGQB 1I7UB 3BKYH 3IAQA 2MQCA 3KLAA 5ICYA 1WQVT 3QDMB 3PHQA 1I1FB 4JKNA 5AG8A 3V0EA 2QSQA 4FQCH 4BFIB 3K2UL 3GLZA 1N59B 1A25A 4NKOB 3T4ZA 3ZHRA 4AEHH 1IAOB 2XWBA 1DLFL 3QO8A 3TTSA 1RURL 4R7NB 4IGBC 1EWHA 4P3DA 4Q4EA 1J1OH 3MJGX 4NBYB 4O9HL 4FQQB 1QI4A 4R8WL 4YFLI 4UYPA 2WBJC 1JI2A 3HVDA 4JDZA 3QE5A 4H1LG 1QLEC 1FV1B 5EBGA 1FXHA 3QHFH 4D0CA 4MS2A 3KL3A 3ZDYE 1JPEA 1LD9A 1FGNH 4OGYH 1NCWL 4ANKA 4X66B 4F8OA 4ODUA 5MP6L 2HWZH 3FTWA 3U7YL 2PXYB 5KVEH 1GZHC 3B8NA 1GZPA 3EGSB 4P06A 2NDGA 1I8IB 3A4EA 4ZYKA 3G80A 4R0LB 1F4MA 4KKBC 4F37K 4XP6L 4PRHE 1Q0EA 1FE8L 1R3HA 1UT2A 2BNQB 3GSXB 3PWJB 4Q6IB 3QO5A 2XNDG 1H9VA 2ZG1A 3PGFH 5KLVH 2VUOA 2ZD0A 3VA6A 4PRPD 4HDIA 4Y4KC 4E0RA 4Z18A 4F9LA 2ZPKH 5CSZB 4JFVA 4C54A 5DD6A 5DZAA 3T0EA 4KJWC 3TJPA 1S8DA 2X6UA 2BDNH 3ROLB 3CN0A 4HV8B 1E5YA 4KRPB 3W0WA 1GMGA 5J3HD 1SQFA 1T03L 1IKFL 2ALWA 4Y9FA 2KHAA 4ZAKB 4PHXA 3GSXA 1BHGA 1E5UI 1XD1A 1FE8H 3PWJA 5E4AA 4AE0A 2K9PA 3E80A 2ZR3A 1HXKA 1KY7A 5HYQA 2P5WA 1T21B 2XWRA 4Y5XA 5HYSA 5I18H 3ECBB 5FLUA 3WIIL 1NCAL 4J3OG 5D7SL 2XG5B 5D1XB 3BY6A 3GRBA 5FDYA 4Z7NF 5CJ8A 1YEFL 1BQHG 3HC0A 1AO7B 2V9UA 1NEZA 4O4YL 2VAAA 1ULVA 3SKMB 3EGDB 1MCWW 4OF7A 1IBGH 1FPTL 3RAJH 4Z7VA 12E8H 5E6IB 3ARDB 3GYRA 3TYFB 4G82A 2IQ9H 3LRSA 1LO3H 3O0RH 4JFFB 5HYSB 4EDXB 1QACA 1Y18B 4DR1B 1RQ5A 4PS8A 2C4FU 2JCWA 2EAEA 3IMWA 4PV8B 4XWOD 2ADIA 5GGUB 1IB5A 4LHJB 1KXVA 2F4VO 3SR2C 3FO0H 2KDYA 2FE0A 3M7MX 3IBEA 2VDML 1OXYA 3GI8L 5EOCL 3LDBC 5ECGA 4JPSA 3FXIC 3WLWC 1TYEB 1KELH 2J55A 4E9TA 4NKIH 3KM1A 3QXWA 2BOCC 3FD9A 1SF3A 2HLAA 4LPWA 3OJ2C 1KFGA 3P4MB 4B5EA 3Q1SH 5LMNO 5MEQA 3MRMA 3L3OC 4DO6A 4GAJH 5DHVH 3DNKA 4MJ6B 4R4ND 4AGLA 2VR9A 2X40A 4G6KH 5ITBL 4QUOA 1CFBA 5FFOA 3MXVH 2ODIA 2NY5C 4CU6A 4H8HA 2ED9A 5FS5A 1F4WH 4HFWA 4KRPC 2AEPL 5CA0B 3AAZA 4X1YB 4FTDA 1GZQB 4YDKH 3IF1B 4JM0A 3EGXB 5CINL 3VSVA 3S2AA 1FFOB 3KPQB 3SQRA 4FFVC 4DO2A 2N1TE 3QQXA 4ZW3A 3W7UA 1JUFA 1X5HA 3BZ4B 2NY7H 1ZHBB 2BC4B 4FM0A 2O72A 1ETZB 1XH0A 3FZUC 3G04B 3JWOL 4QWWC 2EXWD 3LZOA 3ARFA 5HVHC 5KUMA 3PGFL 2DQMA 2XXFA 3TZVC 5C9KA 1HINH 2EJ7A 1KTLA 2XN1A 4GEIA 3F6LA 2TAAA 4UDUB 2Y0PA 2IJJA 2E56A 1KGYE 4OF8A 4PLNC 4KTGA 5DJ2A 1TR7A 3CXDL 3HBGA 4DK5A 3HC3L 3D08A 1R3KA 3KPPB 5I9QB 2JKLA 5AW5B 2A06H 2AJZB 3K8LA 3O3EA 2YSSB 2JXMA 2WGXA 2C2AA 3UTSD 1OHHG 5IVXA 3NRPA 3OD4A 5E1HB 4I4TB 3WL9B 4CN4A 4FTVA 1QKZL 5JORA 1KP2A 4JREC 4TTDC 4BZYA 2D4DA 3PWNB 3B7TA 2Y7OA 1X5KA 3C75A 3B5GA 2WPGA 1CFVH 1KBHA 2BNRB 3WOVA 4M6AA 2CLZB 3VI4F 2M6YA 2JJTC 1FBIH 5HYIA 5ILTL 4NP4H 2W6JG 2UZYA 3GHEH 4Y4FB 4PG9B 3DSNA 2AEQL 4D7BA 1XCTA 4DV5O 4FJZA 1DVFB 1QPXA 1CJYA 1UZ6E 4EN3D 1CF1A 4UCSA 3SQBA 2VXQL 3VI4E 4PJ8D 4EZMA 1B2WL 3APDA 3VRLF 4NKMB 5E8OA 5B5EZ 4RO2A 3RIKA 2LOEA 5HVWA 1GW0A 4IGBD 5KYNA 3N1MC 3LJ3A 1UZ6F 4XVOA 1RVFL 1H2SB 4Y5YB 4PJHE 3FQRB 2X9ZA 5CD5D 3VXRB 4NN5B 1EXUA 3QEHB 3R1GL 3AC0A 4P2OD 3NA4A 3Q13A 5FYLE 2EXYC 2WKLA 1DVYA 1AD9A 1N5AB 3PPSA 4OQTL 2P52A 5D7IF 3HE7A 3VG0H 1N3NB 4JRXD 1CE6A 4JE0A 1UZGA 2LT9A 4LQFL 4XBGA 3SQBB 4MNQA 3QUHA 2LVEA 3GRWA 3HBQA 4K5OA 1HXMA 4UM9B 3K5OA 1KJVA 5GQBA 1LO5A 3RYHA 2KS0A 2WGNB 3B77A 1PFCA 2DQUH 2J2ZA 2PETA 1A6UH 2PTUA 3LNEA 4PB9H 1U92A 2RHEA 5IKCB 5IJKA 5PAZA 4E9VA 3WB0A 1H3PL 5IWLA 3J8F7 2F23A 4OAWB 4UV4L 5L3CA 4F37F 4YDJA 2ORBL 2ZUYA 3S35H 5T3ZD 3O8XA 3TPKA 3WFDL 2VYRE 4UNUA 1M2VA 3RYIB 2JIXD 2AXGA 3Q5OA 4KRNA 4AI8A 5AWNL 1ZLSH 3P0YH 3BFQG 5KVDE 1PP9H 5F6IB 5IBLD 1M7IA 4R9HA 3FQWB 2Y6SD 3N5AA 4J2XA 1D5BA 3UJTH 1FYHB 3LXUX 1FJ1A 3ZHSA 4KJPC 2OMNA 2GYSA 3ZDXF 1NC4D 3BIAX 3Q05A 1SVCP 2WQVA 4ZRGA 3FCGA 1M6OA 3U9PL 2BSRA 3QI9B 5I1HL 1Q5OA 2PZSA 5DQ9B 3HS8A 4FNSA 2DMHA 1NBYA 3M99B 4U7MA 4Y2DC 4X8XA 3VXUE 3X1FA 3G5YB 1EHKB 1IBKB 4LHUB 4TQEH 3V8OA 2ZP9A 2A1WL 5TK2A 3WN5C 3C08H 5KAQG 3O9WB 4DR7O 2RB8A 4WFED 4AIEA 2XZCH 5CA1B 1FC2D 3QUMH 2Y23A 1XV8A 5GRJH 1IBLO 1X9QA 1JZ6A 1Q9WB 3DOIA 4DKFH 5AW7B 3US9A 3RVWD 6PCYA 4DEPC 3H0TB 2BTOA 4PJFE 5LGNA 5DK3A 1T4KB 5IFJA 2YPLA 4TQEL 1K3EA 4F57L 4ZFGL 3BEVB 4Y19E 3BAXA 1ZSDA 4HC1A 4MDIB 3TEUA 4JFZH 1SXNA 4K0KO 3DUSA 2VDOL 5FX3A 1UWEH 3TLRA 3DVNA 2RIKA 2DWEB 1IJNA 1MPAL 4B3TO 4JZJA 3S3WA 4PJAA 2VN6A 1WPBA 3ARYA 1TZIA 3MLSL 4F2MB 9CGTA 1RUQL 5LDSA 4WWKB 3LN5A 5DZNA 1CI3M 1FS0G 3G71V 1KCSL 1BCIA 1GH6A 1MHHB 1QD0A 1UACL 5J12C 3VX0A 4JGMA 5GGSB 3P9MB 2EYRB 1PKQB 4K7PY 2BFVL 5DDHB 1LP9A 3LEVL 4NRXB 3BPOC 1GOHA 1KG0B 5I16B 3HUJA 1NBMG 5C09D 2X4RB 1M42A 4ILDA 3FAWA 4L3CA 3KYAA 2RTTA 4CBCA 1Q72H 1N5YL 2ZWKA 3BKJH 5IMLA 3SOBL 4KXCA 3U79A 4MSWA 5AWNH 3Q6FB 4LR3A 1K2DB 2EC9T 2Z8VC 1IX2A 2AZ2A 1HCZA 2AEWA 1RKRA 2QFPA 1BX2B 1IIIA 3D3VA 3BXNA 4PRHD 4QXTB 4AGQA 3WKMH 4X8AA 1PZSA 3UAFA 3WFVA 1N8RW 3V5KA 5FGBA 1KB9J 1YPZE 4B9PA 3FCSB 4OJFL 3PJSA 2BP8A 2VKWA 3LZFH 4FI7A 1AGBA 1W80A 2X3BA 2HFFA 1KC5H 4OUUB 3EBGA 2AK4B 1XMWA 4PJ5A 3ROOA 3O4LA 1HT6A 4DP0X 3OKOA 1N2RA 4JM2F 1VPOH 5L88H 4PELA 1M71B 3ZHNA 1HQ4B 1N3NA 2LLGA 2R56H 4M7KL 5K1XA 4MVUA 1D6EB 2XXGA 4PGBB 3TU6A 5B3JF 4LPVA 4OLUH 1QRNA 1EAOA 2ZIOA 4PJ5B 3ROOB 1NDGA 2O5XH 2F95B 4GMSL 3AB0B 4LRNL 2JVUA 4R50A 4PRID 4G1MB 4UIKL 3THOA 1NC2B 3DURA 3JV6A 4KWUA 3RIFK 4RISH 5I1JH 3IXAB 5EFIB 4XE5B 2L7JA 4FQJH 3BQVA 2EXWC 5IHUH 1OCWH 2DJVA 4G8EB 3NJFA 1S78C 2ID5A 4KX9A 3C6SB 4QTIH 4XBPB 4XMPL 2P5ED 5KVDL 1CLVA 1N26A 3IPFA 3J7HA 4HIQA 4DZ8B 3ILPA 1E4XI 1ZLVK 4FFWD 3SJVA 4EF3A 2Q87A 3OLEA 3FU5A 4UIKH 1H3GA 1MI5D 4X9FA 2WJ7A 4O4JB 3Q44A 4E36A 4LF6B 2C9AA 2Z5UA 4KK5D 2H0FA 4YK4B 4MT8A 1A5FL 2OMYA 4OTXL 2QGDA 1GY1A 2V4DA 5EF3A 1AJNA 1UFUA 3MRDB 3P9WB 1F4NA 4LLUB 3A0HZ 4ZX5A 5AB2A 5B1NA 2HYMA 3VB9A 5J6HA 3KJ6L 5B3SC 1CGWA 1FCCA 1HNZO 3ZN6A 3O6FA 4FQ1L 4HKBB 3S3PA 2ZX9A 4B3MB 3BLBA 4N8VA 5LXGL 3KYNA 4W9GC 4J3BA 5FCUH 1SY6H 4HWZA 3UPRA 1V55B 2Y6SC 2FX9H 2VZTA 3SDCD 5D7IA 2GK2A 3DECA 4Z3JA 3OKEB 4UCVA 3WCYA 4L8CA 3SDYH 1GM7A 1CF8H 4L3EB 1LO4L 3NACH 1RERA 1QVGU 5GS1B 4ODHL 1DLFH 5E79Z 5C0GA 4HZ1A 5J2UA 4HUVB 3CVHL 1VFBA 5ABZA 3UCQA 5I71C 1MH5B 3G5XB 4HHWA 3OKLB 4NWUH 3FB5A 1NLBH 5IW6B 2NX5B 3WTWA 1AKPA 3TNNB 3DHJA 1WB8A 2YIDA 3ZMZA 2IPUK 2GVYA 2MRYA 4X9YA 5SWSB 5LLIC 3DJSA 4ZUSB 4F7KA 1ADQA 4AG4H 3HG1B 3UJJH 3D8MA 4E41A 5KAQF 2WWWA 2TSBA 4X4ME 3QUXA 2H3NA 3KPSD 5FHAL 3EUUA 1Z5YD 3HVNA 2HLFC 3S3DB 3G5ZB 3FU8A 4L1HA 4NQDB 2AANA 2ZIDA 3ZMNA 3VFTA 1E8XA 3U6RA 1GAFH 2A9CA 3VXNB 4LL1A 4BBWA 5DVNA 1KN2L 2TSAA 2YK1H 5FO8A 2J6EA 2NX5E 5C9JA 2P7TC 2XPGA 1MCOL 2VZ1A 4ENEC 5DVOA 3VGGA 1FH2A 4IYKA 4NQDA 4OFVA 3STLB 4M6NL 15C8L 4IBUA 3QQ4B 1DN0A 4FI8A 5EBWA 1J18A 1DN2A 2JS3A 5IY5B 3OKNA 2K4WA 2YK1L 3QEUB 2YGQA 3L9EA 1EZVY 4PJDA 2NY1D 2XQBL 4K8RL 4PPTA 2WCSA 4FP8L 4TSBL 3FU9A 3BXNB 1TGOA 4QXTA 1UKTA 2Y2YA 4X7SH 4NTXA 4N87A 3BH8B 2ZONA 2XG5A 2ZX6A 5T5NF 2AJVH 3N85L 4OCYL 5ACZB 1Q9KB 4Y2OA 4QKTA 2Q2LA 3HKZA 4AYDC 4FLWA 5E9AA 4FQHA 5TPWL 4U3FH 1A4JB 2AK4E 2CKNA 2IGFH 2YWYA 1I94B 3GGWA 3QXAA 4V1DB 2D31B 3ZMVA 4MMZC 4KQ0A 1Z9PA 2GV9A 2FBRA 2VDRH 2RH0A 4FL4C 3V4VH 4MLSA 1EXHA 1BQRA 1UXWB 4UVBA 2M2DA 1WTGT 3RB5A 3WO4C 1PCSA 4K71B 4HAMA 2RN9A 4KDVA 4YHYB 3T65B 2JDIG 1EO8H 2VRKA 2GIXA 3SBPA 4NQSB 2DMKA 3EHBD 3W5MA 2X1XR 1L9SA 1BQ0A 2WY3B 4FXGC 4P59L 3HNTL 5H4YA 5K1JA 3WTYA 3GWKC 5DK2B 4B9JA 4DKEH 5FLVA 4NNXB 5JWPA 2OMVA 4LHQB 3M1BA 4H33A 1MFVA 1WCQA 2WOBA 4G71B 2OT5A 4PRNA 4JDEA 2R0KH 2Z4QB 1T66D 3KPTA 2YN5A 3BH9A 2IDFA 4RVBA 3DXAD 2FJUB 3C60B 4DP6X 4M4RB 3L5JA 4DAGH 4YSQA 1KWKA 4LCUC 1F5WA 3BIBX 4IK7A 5JJJB 1JPTH 4UTBL 1NGPH 2CDFA 2Y1ZA 3T4AA 1UVQB 4APQD 3PV7A 4GUQA 3HE6A 2D7TL 3OWRA 5J11C 5C07D 1RL1A 2DYRC 2YPLD 1E42A 2IALA 4YDIH 1YA5A 4ODWB 4L8DB 2VSKB 4EQ2A 4YSCA 5B38B 2CRMA 2CXKA 5E1AB 3QZLA 4DKDC 5ESVB 4CC4A 1Q94B 3BH9B 1PZ5B 3QDME 2ZWLT 5HY9A 4L0PB 4MD5B 4POZC 1OF2A 1D5MA 3CVCA 4XCEA 2WXHA 3E9TA 4ES9A 4HXBL 4O2CA 4MASA 4H1LA 4G70B 3LQAH 5FPRA 2BNRD 4B0MM 1NFDA 4FFWC 4WHTA 2DQDH 3GIZL 2HFEA 3KYOA 3LKPA 1IBGL 4YHLH 4F58H 2CJUL 5FR3A 5AFAA 2CNYA 1Q1JL 4PJFB 3DPBB 3SDXE 4ZFOA 4RZCA 3TF4A 4KK8D 4LDOB 4Z7UE 4JHAH 3CSTA 1TJHL 4RX4A 1AR1B 1XDCA 1T7YA 3FONB 1EQWA 4LCWB 4AYID 4IBLT 1X5IA 2XQBH 3VU1A 3ARWA 2MH4A 3AMLA 4JFEA 4PJAB 3UTQA 1YZBA 5DRWA 4NENB 1SYVB 3EJJX 4FLXA 4EI5D 2VDMH 3GI8H 2QVMA 3NTCL 1GN4A 1KXTA 5EO9A 1BG1A 1DFXA 1FBIL 2XA8H 3MJ8A 3H55A 4MB1A 3TEXA 3VO0A 1WPCA 3OAZH 4LCWE 4MXQC 4P2OA 5GIRB 3EHBB 3WFCL 5JTWA 3U6XA 4M4PA 3VQ1C 1NAMB 4JFWA 5CBFA 3E7JA 3CX5K 5I0WA 5IJVA 2H1LM 4CSSA 5F8RC 2EYSA 2R4SH 2Z1KA 4WENB 1E5BA 2RBLA 4BFIA 3N6YA 3IGLA 3GJFK 4LCWD 1G9NC 4ZMTA 1FPTH 5J11B 1JZJA 1SHXA 4X0NA 4AYFB 5E2TL 2B4CC 2GUZA 4X4XB 3L95A 1B6DA 1BW8A 4E9WA 4P2CG 1YEIL 1NAKH 5IMMB 2QKCA 3B2VL 2W07A 5DR5H 3WL9A 3VMOA 3BABA 2L7UA 1MIML 3N55A 3WO3B 2RJZA 2XLLA 4XP4L 5GJTL 1A47A 2P26A 3EBIA 3T0BA 2YAHA 4OPAA 1ETJA 2LU4A 2FD6L 1RUKL 2W0KA 2AAVA 4IRZA 3UAEA 3N42F 4MTXA 1OGAD 3DLQR 5MP6H 1JFFA 1IAII 3GWOA 3TGUH 3FT0A 5HYJA 2AKRB 1FSKC 2H2SD 1GRWA 4BFRA 1G7MA 4BGDA 1INDL 1P4IH 2Q69A 3K2MC 4RAVB 5AOKA 1F3DH 3UP1A 5D1QA 1SERA 1NM4A 1RUAL 4UILH 5EBLA 2DWSA 3ABLC 5I1EL 1DTUA 4MZ3A 2CDYA 4OAWA 1AJQA 3NJKA 3DJTA 3KR3H 2G38A 1PLGH 1BF5A 2W94A 3QJFA 2Y1YA 5JPNC 1NUDA 4LCYB 1WJZA 3RL1B 2W5PA 2EIZB 1YF2A 2YA2A 4KZ0A 1SLWA 4YHYC 4I1NB 2D7PA 1UM4L 2WKOA 1UWYA 4QNPF 1GSMA 1F3RB 5SV3A 3QZWB 1IBDA 3P3TA 1FXVA 1HWYA 2N04A 3L9DA 3ZHTA 2MQ3A 3ASWA 1HSAA 5ITFA 3NJVA 1M56B 5KA5A 5I6LA 4ZDHB 2X4UB 4LBEB 4G8FA 3R65A 1ZPUA 3POCA 3KCPB 3BGFC 4OD1L 3O4OB 3N0PB 3MLTA 2JQAA 5CLYA 3CQFA 3LPFA 4A2HA 1V3LA 4W4LA 3QNFA 3UERA 6FABH 2CRIA 1FZJB 3CS5A 5DA4A 1B6UA 3CSYA 2WAHA 3RRQA 2EC8A 2CO3A 4F33A 1JVMA 4WEUD 2F54D 4C58B 1GCYA 2R4RH 4Z5RA 2OMYB 2HFTA 5C0BA 1HHGA 3HPJA 2ZUUA 3K5SA 4JX0A 2XOKG 1W2KT 3FQ4A 4QF1A 4YVNA 4EIZC 1TQBC 1N8ZB 4WK0B 3VNZA 1BZ7A 3LKQA 1H8OA 4IOFC 4RSYA 3DV4A 3MLPA 5INDA 1ZANL 1F18A 4FFZL 7CGTA 2X44D 1MZZA 4X89A 3BE1H 5C0BB 1UENA 3QNYA 4ONGL 4S1SH 2WZPA 1P69B 4ZUWA 5LCVH 3MLVL 3RUGA 5JQGB 1CUOA 2Z8WC 2GSIA 4FULA 1UADC 1BE3H 3AFLA 5BMVB 2OMTA 3BAYA 1WWWX 1L0XA 2BXZA 3C87A 1OANA 4YK4C 4UOJA 4ELDA 2FDBP 5GGTH 3FRPA 4PREA 3U2SB 3AK3A 5KSUB 3CDFA 3S7GA 4P4KA 2BNRE 1S7RA 4L0ZA 2CK3G 1EZVX 2VCOA 3ZO0A 3RUGB 3DK2A 4M3HA 2WQXA 2EH7L 3HMXL 3BCDA 2X9WA 4FMFA 2NXYB 4HVBA 4OD2B 2OK0H 4B7EA 1A7PL 5KSBA 2AQ1A 2FJFB 1F13A 3LZLA 4HS3B 4NQCD 3QXVA 2O5ZL 5DD1H 3WGUB 1MCHA 2VC2B 3H3PH 4MBRA 2KG7B 1E4XH 3QDJD 1RU9L 3CFBB 5K9JL 3TF7C 4PRPA 1FNSH 3BEWB 5FUCC 3A6CH 2BH0A 1ZJBA 3QFJA 4QRSA 3L6FA 1U8IA 4NQCA 4D0CB 4QAWA 4G7QB 4P2YA 3V0GA 2OYKA 3UADA 5IMKA 3U36A 4P3CH 3PWNA 3PU7A 2WANA 3SJVE 3Q9QA 4NQXA 4BQ9A 4RMTA 2F8OA 5FKPA 3MLXH 2JI3A 4FNLH 3KJ4C 5CP7A 5C70A 1BVOA 1Z5VA 2ZKYA 2YGNA 4GG8A 5IMMA 1SVBA 3VWKA 3VWKC 2ZD9A 3DTXB 5HHXH 3EYVB 1NJ9B 4PJEA 4LQ1A 5HHME 5F1SA 4GMTH 3L13A 1BM3H 4ZUUA 2OL3L 2LQRA 1NMCC 2NY4B 1EEZA 2J6EL 2AEIT 2W0LA 2ATPA 2CBTA 3HZYB 4EB6A 2MKWA 4M43L 5DUJA 4LVOB 2GJ6A 3ARBD 1FL5A 4ZJ9A 3T6ZA 3GMPB 4OZIA 1ECYA 1PZDA 4P07A 1BIIB 5CEZE 1MOFA 1JMKC 2LFSA 1PYWA 5CZXD 1D2PA 1J8HA 1V54B 2C7FA 1BHAA 5EBLB 2GFBA 4TUKH 4XGZB 3IMBA 5I6XB 5IYBO 3U10A 3FQTA 1TFPA 4LSQH 1ZL8B 5EFIA 4ZX6A 1IARB 3Q2CA 4KKLC 1YJWV 2V5SA 1DANU 4PJ5E 3L3JB 1OK0A 1XGYL 5A6MA 4W81A 2HG5A 4X64B 2X4SB 1DFBL 2W9DL 1AI5A 1MFUA 3FO0L 4O00A 1QW9A 2H2SC 4NPYB 2WUBH 3BJLA 4NLHA 4ZMZA 1PX4A 1PX8A 3M07A 5TDPA 1G7HA 4Z0XA 1YCIA 2ICEA 4DGWC 3HKBA 4ZDHA 4XXDA 4H20H 2FWOA 5FUCE 5D1QD 2COQA 2QR0A 1FFXB 3ZDZB 2EO9A 3ATFA 5K93A 3TZVA 4GNKB 5SWZA 5KG9B 3T0VA 4IJ3B 4RSVA 1G7JA 1WFJA 4XXWC 1HJBC 1DUYA 3KDMB 4H0LB 4K71C 3UC0H 4AQ1C 5JJEB 3FQWA 4IOIB 5FO9A 1JZDC 2D3VA 3FCUB 4GP4B 1J05A 2NUTA 4X6FB 1HYRC 2UY7A 3C6SA 3FQ1A 5MHSE 2HZHA 4S1QL 3IGKA 4OFYA 2F2HA 4XZUB 4MMYB 5DSCB 2EZPA 2J8UA 1IAIM 5A2AA 4Y9GA 1MREH 5CR8A 1E3XA 4B9KC 4S11A 5L4JA 3CRAA 4R5XA 5DI8A 1JPXA 2KKWA 4XNZB 2O5XL 4LRNH 1F8TL 3L3OA 2ICWB 3MLXL 2GJZB 4DV6O 3RVXD 3KMDA 4JRFA 1AZBA 2ZE6A 4AYEC 4OIIL 4BHUA 2OCCB 4L8SC 5KYWB 2UUDK 1FNAA 5K1PA 5DK0B 3TWCH 5AVRB 2DYRB 1I7UA 1DF5A 1E6OL 4N8CL 2R2EB 4AC4A 3I3DA 1HW7A 1DEDA 1TCRA 4NNYB 2E74B 1TOXA 3FFQA 2ZCLH 3BMWA 3QZWG 4XP9L 2Z35A 5ABAA 1K97A 4LFHD 1W72H 1OWRM 2FSEA 3E6FB 1F0LA 2V37A 3GBNH 4MLIA 2ARJQ 3VXUA 4M6OL 5JH7A 2DJ4A 4JHWH 1S5JA 3SYQA 3VXNA 4NO5A 3S8GB 2VDKL 5FIEA 2IBZY 2WQSA 3RX9A 3B6SA 5FO8B 5IQ7L 5M95B 2CBQA 4RQQB 2ZXWB 1MCNA 2NW2A 2Y25A 2VE6A 1VHPA 3BAWA 2P4AB 4RX4D 1CLZL 1AHKA 1IM3D 4ERSL 2EO1A 3SKUD 1UXSA 5K9OB 2Q73A 4XNAA 1F4HA 2ZXBA 1IO4C 1SZNA 3CWGA 3BGMA 5EF2A 2C9QA 3MJ6A 4DVBB 4GXUN 3HKDA 1FN4B 5ESQA 5FYKE 3CVHB 2EH8H 1DF4A 3QEUA 4S1RH 1YYCA 4FQJL 2FX9L 5KN5A 1AFVH 2ICWI 3CN2A 1WP6A 2F74A 2AJVL 4OCYH 1D7CA 5E8NB 32C2A 3F00A 5C07E 1KY6A 3LRMA 5EC1C 4LL4A 2H3OA 4ZMNA 5ITZB 5K5YA 4ODHH 4TVPE 2K1EA 5A6LA 4OZ4A 3HE6D 5E2VH 3FN3A 3CE1A 2XPGB 1P4BH 3R8QA 3C90A 1RIUL 3L5HA 2VOTA 1RULH 4U1JA 2XBTA 4YC2C 3ASNB 2QSCH 4N0CC 1HKFA 3ZJAA 1IVSA 4CNIA 4UM8A 1ASPA 5DT1L 3D07A 2A73A 4DR2O </