3SPIA

Inward rectifier potassium channel kir2.2 in complex with pip2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
332
structure length
332
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 92
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spiA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spiA01
4JTDB 3E86A 4X8AA 3HPLC 1U4EA 3VSQA 4R7CA 1R3IC 2E4FA 2HG5C 4GX5A 4RO2A 3IGAC 5E1AC 4PDMA 5CBFA 3ATAA 3SPCA 2IH1C 3FB6C 3OR7C 3FB7C 3K6NA 1JVMA 4GX2A 2Q6AA 2WLMA 3K03A 4WFGA 4QNHB 5BZBA 2K1EA 2BOBC 3FB8C 4RUFA 3X2QC 3E83A 1P7BA 5CBHA 2A9HA 4PA9A 3STLC 3SJQC 3JYCA 2Q69A 3LDEA 1QLEC 1OCRC 3SPGA 1R3JC 2WLIA 4WFEA 2DWDC 3T4DA 1V54C 1M57C 3ATEA 2BOCC 2OCCC 4MTFA 4PA3A 1G4YB 2X6CA 4RUEA 2EINC 4EKWA 4R50A 2EIJC 4HZ3A 4P2ZA 4PA4A 4MW3A 3K0GA 1ORQC 1ZWIC 3ZRSA 3ZJZA 3UM7A 4XDLA 1J95A 3F7YC 2W0FC 3F7VC 5IY5C 4H33A 3RBZA 3LDCA 4GX0A 4MVMA 3LDDA 4MS2A 5EC2C 3T1CA 5EBWC 4XDJA 4PDRA 3RW0A 4PDVA 3K0DA 4X89A 5EBLC 4J9ZB 3STZC 3ATBA 1OCCC 3E8FA 4PA7A 2AHYA 3TETA 3ABKC 4KFMA 4J9YB 1KKDA 1U4FA 2GIXA 4F4LA 2DYSC 3FB5C 2WLLB 5KUMA 2DYRC 4TWKA 1N9PA 3ATDA 3EFFK 2YEVA 3OGCC 3GB7C 1R3LC 3AG2C 3K06A 2JK5C 3SYPA 2ATKC 4BW5A 3KG2A 4P9OA 3ASNC 4MVQA 3T2MA 5B1BC 4UUJC 1M56C 2R9RB 5B1AC 3BEHA 1OCOC 3ABLC 2ITDC 4OXSA 4P30A 3E8HA 5EC1C 2WLIB 3LNMB 2EIMC 3SPHA 4MVZA 3AT9A 4WFFA 3E8GA 3OR6C 2WLNA 2P7TC 2A79B 2WLLA 3E89A 2X6BA 4GX1A 2Y69C 4R6ZA 5KUKA 4JTCB 2WLHA 4MVUA 5B3SC 4RAIA 4HYOA 2QTOA 3R65A 2HJFC 4MTOA 1BL8A 3OUFA 2IH3C 4ZBMA 3SYOA 3WG7C 3K04A 4MVRA 4LP8A 2EILC 2Q68A 4H37A 2X6AA 4PA6A 3E8BA 3ASOC 3LUTB 4JTAB 3RVYA 4MTGA 3RVZA 2HFEC 3T4ZA 2WLJA 2NLJC 2ZD9A 3K08A 1K4CC 1K4DC 4QE9A 4LCUC 1LNQA 4LBEC 2DWEC 2KB1A 3OUSA 3UKMA 1S5HC 4G27B 3SYCA 3AG4C 2ITCC 1XL4A 4I9WA 3SYAA 4DXWA 3F5WC 2HVJC 2EIKC 3IFXA 4PDLA 4WFHA 2Q67A 3AGWA 3ATFA 2ZXWC 3AT8A 5CBGA 3AUWB 4MVOA 4X88A 3VOUA 1V55C 2AHZA 3PJSK 3SPJA 3SYQA 2A0LA 4XDKA 4MSWC 3TCUA 4MW8A 1XL6A 5EBMC 4QE7A 2WLKA 3ABMC 4MVSA 3AG1C 4P9PA 2HVKC 2H8PC 5EK0A 4R8CA 5J9PC 3AG3C 3SPIA 1OCZC 4CBCA 1R3KC 2QKSA 4G28B
chains in the Genus database with same CATH superfamily
4CGTA 3OF6D 3WXWH 1J5OH 4D8PB 1GYWA 1KB5H 4OIIL 3N40F 1WPBA 4OUUB 2XG4A 4LDCA 3VXME 1OSPL 2OK0H 4RZCB 2EIDA 1FO0B 3DUSA 4ILDA 4PJDF 1N6QL 2YXWA 4ES8A 2AJUH 4NKMA 4IHOA 4MD0A 1M93A 3AQYA 3QULA 1K5QA 1TZHB 3H9ZA 1FNSH 3RGVA 5AB2A 4LF8B 2ZKWA 3MRPB 4OQ1A 5KG9A 2BIMA 4A2FA 1PEWA 1WICA 3U0TA 3L4CA 4X7SH 2V7HB 5EU6D 5FYJL 5C0GB 4GW5A 5JHBA 4NJ9H 1KXVA 3K0GA 2AZUA 4I77H 5IFAH 4R9HA 2ODMA 2OMVB 3HPJA 2J3SA 1KB5B 4BKSC 3GJFH 4XXWA 2FSDA 4LGSB 3RFZA 1KXTA 1UJWB 3KW8A 5MEPA 4P05A 3QWOB 1E67A 4XVTL 4JPWL 1F41A 1O6VA 4Z7VE 4LSQH 3IAPA 4CVXA 4OPAA 2XWTA 5EBLA 4MNQB 2LU4A 2ERJB 3MRLA 2HG5B 5HI4D 2R0ZH 5C0CE 4M5SA 4PLKC 3DURB 2EVJA 1OCOB 2OSXA 3MBEA 4RESB 4H0GA 5BCAA 4FMTA 1XGTA 2XWBA 1NBMG 3VCLA 1M56C 5FIEA 3BH9B 4NPJA 1E43A 3TYFB 2VJ0A 4XTRC 3BEHA 2FNWA 4NP4H 5HJDA 3N43B 4JR9L 3E8HA 3C87A 4TQEH 3TNMB 4RWUA 1QUNB 3NA9H 4HWZA 4H0LB 3SJAC 2FNBA 3KWWA 3WL9A 1BAFL 4IRSD 1HNXB 4EI0A 4LLDA 1N2RB 3VXTA 3TTSA 2AZAA 3OB8A 1NCTA 4R6ZA 3M6DA 2WKLA 4IBZA 4NHCH 3NFNA 5MHSD 1NIAA 4KO5A 5E1AB 1AI7A 4K2UL 12E8L 4JJHA 1HH6A 5DEFB 5IVZA 3SGEH 1TTGA 2Q68A 2VDNH 3DSNB 5JPMC 4JTAB 2XAHA 3FU8A 2WGNB 1FH2A 1NFDA 4YSAA 5ISZE 2OMYA 5GRWA 1JN6B 2DWDB 5EBMB 3H7BA 1XB6A 4DKTA 1K3ZA 3QIBD 3UKMA 5D8JL 1E90A 4OBSA 5SWZD 2Y2TA 1G9MH 2FWOA 4Y8DC 1XSJA 4F92B 2EAEA 5L3EA 5HHQB 4DR2O 1XGRB 2OCJA 2UUBB 5DJ8A 4KL1A 1CWVA 4AITA 1L9NA 2B1HL 4CSPA 4MAUL 1YJNV 1E5ZA 1CFNA 1M4KA 2DOCA 3S34H 1DVYA 2BK8A 2AS5M 2FJUB 2WNXA 3DSFH 1KD1W 1FL5B 3RUGF 2MW2B 2H8PA 4FCAA 2ZE0A 1C7TA 3OLEA 3QPXH 5L2KB 2VLKE 3BGAA 2B4CL 3FYIB 2KQNA 3C08L 2XTAA 2YHGA 4N2MA 4Y4HD 3PQYE 3BFOA 4KUMA 3FCSB 2B77A 1NTDA 3JATA 1LQSR 4NUMA 5CBAA 3PHAA 4EFEA 1IM3A 1BYNA 1UT1A 2ESVE 1HI6B 5EU6A 2AQ2A 3EYVB 1INQA 3G67A 1J5DA 4Q2ZA 1Q6HA 4ZS7L 1Z3RA 4MS6A 4DV4B 1FA4A 3AABA 4M6MH 5FA3B 2Y24A 1HNYA 3DDGA 1T7XA 4NKIH 3QXDB 3ZE1E 3BRCA 3CG8A 5I73C 1ZT7A 1P4LA 1Y1UA 1C5CL 4HOZA 4TRPH 1VEMA 4YSRA 5JIMA 1BEYH 3EZJB 5E94A 3G6BA 3V52L 3CK0H 2PWFA 4D6TH 2ICES 3KCPA 3QQDB 4IS6B 4I8DA 5ANHA 4X4YA 5LWYH 4LSVL 3LKOA 3QR1A 2ADIB 5BRZA 2VH5H 4QT5A 1NGYA 2G4EA 3BUYB 3QCVH 4ZMPA 1DQDH 3U0PA 2XBZA 4XCNA 3PNWA 1R1BA 1F23A 3F7YB 3MLZL 1UD6A 1I8MB 4IGBD 1TSRA 4CSTA 4L8CB 3CVHB 1WWCA 3QG6B 1KUQA 3K74B 3EUDA 3S8WA 4NQDB 1X5IA 3GB7C 3EAKA 3HNVH 3D07A 2AJYL 2H0EA 2VOTA 3ILQC 3DLQR 3T8XA 1HI6A 3W82A 3TP4A 4BINA 1F7YA 2X44D 1C08B 4K94H 3QWRD 4BHUA 4G7RB 4HZLA 2FQGA 2LW7A 4ZX6A 2B2XH 4M7ZB 3TN0D 3UP1A 4BH8B 4I4TA 4CMMA 2P28B 1YEFL 3MNZA 5DVLA 4Y0GA 2JGDA 1KWGA 2Y4UA 4HBNA 2YKKA 3JWDC 2D73A 3WS3B 4LF7B 5AOIA 2PCPB 2WY3B 3QE5A 4L1TA 3S7GA 5JW5A 2BOBB 3QIBA 2RIKA 3ZT7A 35C8L 5LP6B 2XXCB 3KPSE 4GNKB 2YD9A 1IV8A 4NN6C 3SDYL 2WBKA 4W9EC 2FH8A 1F4XH 4EVNB 4NR1A 1KGUA 1QSFA 3MQIA 4QRRB 3QUXB 4HEMA 2KB1A 1MW3A 5LKNA 1QLFA 2YI9A 4L05A 4PJEE 1G7QB 2ICWA 3G6AB 1MFAL 5SWQA 5T1DH 2Q67A 1AKJA 2ZXWC 3L1EA 4GAFB 3QORA 2ITFA 1DCEA 4KJWD 5HYEA 2AERT 4N9GA 1HHIB 2HT4D 4FOMA 4OD3H 4HPYH 1A4JA 4QXWA 1IGTA 4HJ0D 1PX3A 4MNHA 5JIHA 4O4JA 2K6ZA 3ABMC 3HOGA 4YK4C 4BKLA 4JGUA 4Y4HA 1WIOA 1NPUA 5GSRA 3ZHUA 1WG3A 4ZX3A 2ZONA 5JW4N 2XWRA 3IXTB 3E86A 2HHHB 4ZFGH 4CC6A 1QFWM 2PI4A 4GXVH 4QRUA 1AR1C 3L1FA 4GMSL 2DYRB 4PJ8A 4F58L 5JWPA 3ARZA 4JI3B 4NQVA 4BQBA 3NEXA 1R6NA 2VDQL 4IJTA 1F4YL 4BA8A 5HGAB 2GFBA 3I6KA 1AYOA 2N04A 3HG1D 4EOWH 5EO9B 4LNRA 3DO7A 2Q8AH 1M56B 3QCUH 5HHXL 2DQJL 3ATEA 2I24N 2VXSL 4Z0BH 2PPAA 4JY4B 3SCMC 3PAYA 1J9RA 3ARDB 2ZUYA 1DP0A 1LNUB 3DX6A 1OAQL 4CC0A 1AO7E 1MCSA 2Y6SC 2AXGB 1JZ3A 2EDNA 2ZNJA 2KS0A 4JN2B 1RHFA 3ME0A 2W0FA 3QWOA 3ELAT 3HN3A 3QAZB 4PRHD 3ULAB 2QVIA 4OZGF 5DA0B 5IMMB 3MD0A 2LVCA 4P4KA 5JHLH 1IM9A 5F1NA 1AG6A 4IGBA 5D72H 5IEHA 1QSFE 4PDVA 3GFUA 1LE5A 2X2HA 3LH9A 4OIAA 4YXLL 1MZYA 2ZUSA 2EJRA 2YAQA 4UOJA 1J7VR 1PIGA 4EQ3A 3OZKA 2IM9A 2PP8A 2K3HA 2VITA 1ORQA 3LRMA 1KXQE 2P3YA 4H8VA 1A6PA 1SY6A 5D7SH 5I74C 1UACL 2X0LA 1M53A 1S3RA 3PHQB 4EB6A 3GB7A 1ZLVH 1TJGH 3CNKA 3MRQB 3PF2A 3A0OA 4MQ7B 4IKKA 3JUZA 1AJNA 4TKWA 3T77B 5K9QI 3MNVB 2YUVA 5D7JA 1PZCA 1NGPL 3SHSA 1LP9E 1E4HA 1I7UB 5DQ9A 3QEHA 3MUJA 2MOQA 3U6XS 3BZFB 3UIYA 1RHHB 2D0GA 3KPSA 1I1FB 3I5DA 3NN8A 1A9BA 1IGIH 3KPQB 4AL8C 2AV1B 1QSFD 2Y48A 1I8UA 3NP3A 5FK9A 1ASQA 1Q6UA 1F1AA 1QLRB 1IBZA 2Z1KA 3FPXA 4LLYA 4XPBL 5EC2B 4WI0B 3ML8A 3WFZA 3H01A 5KVGH 2OAAA 2MIZA 4LPWA 4ONHA 3DTDA 4EDWH 1RZFL 1K4CC 3RI5K 3FOMA 1LNQA 4FC3E 2ZAIA 1N34B 4B3SO 1JHKH 3K91A 1QAWA 1CDBA 2G38A 2YD7A 3ZJAA 5HDOA 4FYQA 1WD8A 3ISWA 2ZT9C 2H0JA 4AQZA 2B1AH 3T0EA 1P2CA 2GW5A 3BAJA 4JM2D 2BFVL 1A7QL 2XVKA 3A67L 4H8QA 1JZ5A 2V5YA 3HEIB 3D5OF 1IFGA 4Z7NF 2AQ3A 1HHHA 1AROP 3DPBB 5IROD 1E8XA 1WS7A 1HOCA 4Z1PA 4DKFL 3SQRA 2NZ9C 1RSYA 4YUEH 3DHPA 4OGZA 1T5EA 3RVVC 5BV7L 3FBQA 1PKQE 3FJTA 5HYJA 2D31B 4GAGH 5I19L 4U1KB 2QKCA 4GQ9H 2A83B 2AW2A 2DBLL 3IJYA 1NGWB 2XG5A 4GAYB 2EIZB 1S7QB 3BGFC 3CJJA 4OCWH 4Y16A 1P9MC 3KPOA 5B8CC 4AXWA 4X98B 1GTOA 4UVBA 4M1DL 2Q69A 1D5ZA 1N12A 1C8PA 1FIGL 1CE1H 5IBLD 5DZ9A 4QTHB 3IXTA 1UXLA 3TH4T 5HHVH 2J8OA 4QCIB 3VCLB 2EDLA 2CO7A 5D1XB 3ABUA 4S0TD 5G55A 3VFTA 4NQDE 4QJ4B 4YEFA 4PD4F 3Q6GH 1OF2B 4Z7QF 2EO9A 4J3XA 2Z93B 1O0VA 1XCXA 4N0CC 5CSZB 4RWYL 1OSZB 4QXGL 1JGUH 2Z0UA 4M1CD 4NRXA 3FULA 4PP2A 3WD5L 3BZFA 4I2XB 4JFPB 2XOTA 2IANA 1JHTB 3QG6A 1A66A 3U36A 2ZXBA 5EOCL 4Y16C 3MUGB 4B3SB 4I0PD 4TVPE 2HLAB 4JCLA 4W1TA 2XXFA 3A5VA 5D1ZD 3GKZA 5D7JB 1OZUA 5EORL 3TV8A 3ZYZA 2YWZA 3DOSB 1L5GB 2FECI 4LDOB 3TT3H 4AMKH 5JHDD 1Q94B 4CILA 5I30H 4AT6A 2AJSH 4IU3B 3REVB 3C3SA 2JGDB 2E74C 5I8EA 4HIIB 3TBTA 1VQ8V 4KNUA 2YPLD 1FZJB 1IC4L 5EIQA 5L9DL 1TAEA 3HKBA 3B8NA 3BN9D 3ZE2B 3CYOA 1NFDE 1CFMA 1XZ0B 1SNRA 1D5IL 4ZJ9A 3GHPA 4XMKH 4TV9A 4BA0A 1OCWL 3RVXC 3HN5A 4NBZB 2HAZA 2GC7C 4NO3A 4QKTA 1CCZA 1T4WA 1XGZA 4ICWA 5C09D 5A6IA 3BUYA 3U0PB 1A3LL 4XNQA 3MRIA 1AD9B 3QQ9C 1LP9F 3EYOA 1OV8A 5CA0A 5JXAL 1AZZC 1MWAH 5DC2A 4Z3GA 2ZR2A 4HIXL 4ERSH 1K7DA 1UJ3A 5J9PA 1UENA 1GTFA 1A7NL 4YNYA 4JAMA 1VQ7V 3HC4H 3P30L 2ZUQC 1BT8A 4HXBL 3TOPA 2CTQA 1SJEB 2G2NA 1KOAA 4G9DA 4N20A 4U3FH 5ISZA 5AENA 2FX9L 4MDRA 5CN0A 4OQTH 3AU1B 3HG4A 1GY2A 4RH4A 4QJ3B 1SZTA 5FW7A 5IVXE 4A7TA 4D0DB 1IKNA 4LHUB 3EDDA 3CRMA 2JIXD 3APDA 3CFDB 3EFDH 2CO7B 4OJFL 3K6DA 3HKCA 4XP5L 2DEXX 3UZQB 1KTBA 2ZUTA 3FB6C 1OHQA 3WN5A 1FZOB 1J11A 1HQ4B 1NOAA 5E8OA 4PHZA 1MG3C 3DBXA 4F8LA 5J4MA 1A6WH 5IHWA 4Q6KA 1MJ7H 4U3JB 1DBML 3BCFA 4OZGE 2BWDA 1XMWA 5KBNC 3ZMVA 4NWTH 1ET8A 1NC2B 4G6JH 3OHXC 3TIEB 4FERA 4YJ3B 5TDNA 4FFYL 3DIVA 4E4EA 5J1AB 4PGBA 5MI0C 4JFWA 4JE4B 1XD0A 5SV3A 1MWAB 3E2HB 4E9LA 1DVQA 2ZOOA 3MNZB 1QLNA 3BPNC 4YHIB 4XNMA 3ZE1B 1H3PL 2OX5A 2XZAH 3UTTB 2D7OA 2HPOA 3TA3D 4HP5A 4K5LA 4UMSA 5FKPB 2BINA 5JHDA 3GPEA 1KYDA 5K9OA 3GEWB 1ES0A 2IGFL 3MBEC 3LB6D 2E7MA 2JJ1G 5MP6H 2HA1A 2ENQA 1HE8A 5ICYB 4N2NA 5CJQL 2C9QA 1BQSA 4M7ZC 2Z93A 3EGSA 4UT6A 3W38A 4U6VL 2YPLA 3GSQB 3GBNH 1OGAD 1C5DA 3O81A 2CUHA 4XP6L 4CL7A 1NSNH 2CNZA 4PY8I 1C1EH 3FC8A 4ANKA 3LNMB 4HNAA 2I9LB 5KW9L 1AI4A 4JK0D 5BMFH 1FL6B 2MPAH 4QAWA 5IDJA 1QATA 4J1UB 3VJ6B 3SPVB 4LF9B 4K0KO 3VQ2C 2EXTA 5D93C 1NMCC 2VM4A 1Z0MA 3MREA 5EU3A 4FFYA 2WK2A 4TQPA 1BZ9A 2ZE6A 2IJKA 3QDGD 3U9UB 1KLGA 1XR8B 1IC5H 4C4KT 2HZHA 5EU4A 2VZVA 5AB9A 3CD6V 3WHE1 1OE2A 3CDCA 3VFGH 1AQ8A 2Q7GA 1GW6A 1MJ8L 4WFHD 2B8OT 1CDIA 2HRPL 3POCA 2JTYA 5TQ0H 5L7XL 2A4CA 4ZZFA 2WTOA 4JQIL 1YNTA 4PRPE 5F7EH 2FX7H 5F6IC 4GKJO 1FGNH 3B9AA 1XNQO 1ZT4B 2P49B 4JRYB 3KPNA 2WXKA 1ET7A 2ZCHH 2CH7A 1WFMA 3V4PL 2XETA 3VG0L 1MQKH 4PV8A 1AR1B 4U1JA 4JYAB 3FSVA 4M3HA 1Y76A 4P9PA 4G8AC 5KJ7E 4WW1B 2Q7HA 4XN7A 4LK4A 3V4VH 4NS0A 3GC3A 1CL7H 1S3JA 2CLRA 2J20A 2GK0B 4EAEA 5IJBC 4MHHG 1WA1X 4OM1H 1KECA 2F95B 1FPTL 3N85L 4K7PH 1A5FL 1BD2D 1JFQH 3NACH 3HMXL 4PWIA 5GISH 2IWKA 4Z7WE 3FO9A 3ZX1A 1JUFB 4XCYA 4GT7A 3BLKA 3KPSB 4KTEL 4M62H 4I18B 4K8RD 3C75A 1UWEH 2L04A 4KK6C 1XH3B 3EUUA 4JKPH 3DGGB 3D3VD 3O4OC 3DC5A 2UXDO 4N2IA 3V0WH 1WZMA 2AJXH 3VFUA 2C4FT 2ZF8A 3MV8B 4U1IB 1YJDC 1GCYA 1CURA 5C2UB 3B2PA 1LL1A 2FDBP 2IBZY 4P57B 5M94B 5JORA 5KSBB 1J0YA 2YGQA 3EO1B 4MQ7A 2CGZA 1FV1A 3L4UA 4TV8B 15C8H 2E76C 1HQ4A 5E8OB 1RJCA 4MNGB 4YSTA 4YSPA 4G9FB 1QU7A 2GY5A 1N36B 4N26A 1ZSPA 3B8MA 4XMLL 3EBIA 3CMAV 2VMDA 4NWUL 5E5UB 3S98A 3VFSB 2N59A 5D1QC 2P5ED 4WRLA 2AEPH 2PTUA 1G1XB 4AQ8A 2VDLB 2VDRB 4WY7H 1QFWL 1RJZB 2UUDH 3GSRB 3FB6B 4JQVC 4ONHB 2IXQB 4LOVA 4PJBF 1ULVA 2QR0B 4OT1L 1XMOO 2VUKA 3BOVA 4DN4H 2MK3A 3QRLA 3NSXA 5LBSH 3JARB 4EZMA 1SXZA 2EYSB 5LL6Y 3TYGH 1MCBA 3OHXB 5CZVH 2X12A 3WXWL 1ZL8A 3PQYB 1XEUA 1XEQA 1XR9B 5MI0B 3LKSB 1E5AA 1OWWA 3WNPA 3LVEA 1AZCA 3JD2A 3VG9B 4OCXH 5L2JA 1IBBA 4X5QA 2VDRH 2BOLA 1F4HA 2PPCA 3OKKB 3S35H 2PYEE 2V9QA 5I24A 1BG1A 3EJJX 3S9DB 1TCMA 3ZUCA 2CGRL 4Q6GA 2C7FA 3JAKA 2DJSA 4XVJH 1NDTA 3RVZA 4L23A 5DLMH 2G5UA 2H32B 2HJKB 1I8LA 2VDKB 1KIUB 1JF1A 1KTLB 3QZMA 4M93C 1PPIA 3CZGA 2JIXB 3AK2A 3U82B 4X98A 4FZ8H 2VDPH 3FSZA 2Z92A 3PWNA 3V10A 4WENB 3RZCC 1A4JB 2LAGB 3SGIA 2UXCB 2H6UA 3B2VH 1X5YA 4ODWB 2EH7H 4KK5D 1NFAA 4F2MB 1IEAB 2HVBA 5B1CA 2FD6L 2YUZA 5B38B 3GSNB 2Y36L 5LXGH 2XUWA 3VQMA 4DKEH 2NW3A 1Q0XH 1R3IH 3G6AA 4DESA 3S8GB 5KHKA 3US1A 3I9AA 2HRGA 3X12A 1DVTA 2R0ZL 4D3CH 1JJOA 3UG3A 4JZ2A 3RHWF 1N6UA 1QEWB 2AXJA 3B4NA 4KC3B 2EP6A 5DWUL 1PQZA 1PLGL 4EN2A 2BIQA 2W0XA 2FLRT 2NNAB 1MW0A 3NCBB 5T3XL 4HISA 3GXPA 4NT6B 1AVAA 4TUYA 4LNRB 3S3CB 4AKQA 1MH5B 4LEEA 3CE2A 4LVOC 1VDGA 3ES6A 1UASA 2YK1H 4WUUE 4KJQC 4X66B 1KCSH 1P6FA 2HFFB 4LRIA 2H0PA 3FB6A 1ETB1 2BWIA 2WXLA 1Y0LB 4BWUA 3QG7L 3NJXA 4UANA 1EO5A 4ZQKA 1KCKA 3QUXC 3E38A 5E8NB 1UD5A 4TT3G 3CSGA 3WTXA 2EE6A 1RUAH 1J0IA 4WW2C 1WQVT 3AAZA 5IQMA 4OKVA 4WNSA 1DJWA 3CZEA 1M4UA 4XMXA 3WJLC 4PJ5A 1SQVH 4DR1B 1VCBC 1GN4A 4M61A 1CK0H 3HS0B 1XHXA 4O5LL 4TV3A 1OD9A 3OAUH 1RK1B 4Z76A 3P3PA 4YWGL 5SWSA 4R0LB 2OQJB 3M1BA 1DVSA 2YN5A 3OTFA 3GXTA 3MAQA 3IGAB 1MEXH 3ETGA 3SZ6A 5E4EC 4JLRB 1FAKT 3ZIAG 2YXYA 4K7FA 5EC1A 4KVCH 3ZR5A 1GAFL 1D2PA 4PGEA 1RVFH 3BVDB 1IGFH 3CFUA 3QXUA 4LNVA 1MCCA 1ZSHA 3ZBMA 1RIHH 3VRLF 1J5IA 1RZIA 3MRRB 2Q73A 3RJOA 3B6SA 3SD5A 2OYKA 3ZHNA 3U4EA 1JF1B 4M8UA 5E2JA 2JDIG 1ZGLA 1UC6A 4JO5A 5I1HH 2OJ1A 5AOMA 1X9LA 2F43G 2I85A 3L5WB 3TBSA 3I9GH 1KGCE 1KGCD 1NEUA 4AIOA 2KHAA 2EEBA 3RVWD 5C3LD 4HLEA 2PTMA 4ADGA 3VI3A 1JNLL 4KJPD 4PR5A 2FT7A 4PMEA 4XHJC 3NOIA 5IYZA 1ZIAA 3F7KA 3S88H 3L3JB 1A6AB 5CFAA 3VXRA 3OJDA 3MV8D 3N9GL 5E70A 1EAJA 3V0GA 4F8TA 1IGCH 1YMME 4BELD 4NKIL 1HQRB 2DBJA 5AW1B 3D69B 3MRKA 2ZE5A 4HIPA 1PQZB 2E8ZA 3T0WA 2W65A 4O00A 2IPKB 1UADC 4NZDA 3L3IB 4ZHQB 1OIOA 3GSNL 2Q76B 3MJGX 3AT8A 4UT7L 4YLBA 5ICUA 2ZYHA 1NBZA 1HC1A 1G1OA 2ISDA 4ELMB 1VQMV 4UCFA 5GRUL 4ZMZA 3CFTA 3TEZA 2A38A 3M99B 3SPIA 2X2IA 3I6GB 1FYHB 5FX3A 2YGVA 1SBBA 1TU2B 2H3XC 4YZWA 3QIUA 5K1JA 1BFOB 1RCYA 1XIWA 3QDJB 4HF5L 4Z7UF 5E4IA 1RIUH 1TZAA 4UYPA 4QJFB 1J1OH 1FJGB 2X1XR 4JFEE 5DK2A 3QO5A 1KNOA 2DQEH 2NXYB 4JO8A 1XTLA 2EZ0C 3KL0A 4TTDD 5I17A 4AKOA 4M6NH 5CBEA 2EVFA 2VMJA 3D30A 3P73B 4PS4H 4D0CA 1MCDA 3DO4A 3OMNB 3L2NA 4MXWH 3WTYA 3LN4B 3FUNA 4F7TB 4AMXA 4RQFA 1FGVL 1N4XH 1OQXA 4PA3A 3V5DB 4OFQA 5I1KL 1DYZA 1NS1A 1WA0X 3TXAA 4OM0H 3ZZSA 2NPLX 1ASPA 2WP3O 3GBML 4YHMH 2J1KA 3O2DA 3AB0B 2I32A 3PNRB 2LFEA 2OYMA 4I2XA 4QDGA 3MR9A 4QRAA 4YDIL 3ZDZE 3QIUC 35C8H 1YEHH 3EFFA 5GGTL 1XBDA 5TFSL 4BFEA 3RYMA 1UUNA 3G08B 3D4ZA 4LF3B 3L5WA 5B4MC 5AFAA 3WNMA 3CCRV 4H7VA 2QR0A 3UC0H 1JRHH 1O7VA 2IIJA 3KJ6H 2LFSA 2GJPA 1UEMA 4WQOA 2VDOL 1YIJV 4ANXA 3E35A 5ABZA 5AW2B 2FB4L 4J7JA 1YUHA 4GRLC 4NLHA 2GT9B 1R5VA 2F53A 3PNWB 2Q20A 3P73A 3I75B 5AUMA 3W0WA 3JQOB 5LGTA 4W9ZA 2K9UA 1CFSA 2G9HA 3AREA 2CH7B 2AK1L 3DA0A 2B1GA 4GXVL 4YDNA 2YIBA 1A7OL 2OQJA 3CZNA 3M1BB 5CJXC 4KI5D 4HVBA 4P57A 4WAFA 4NM4L 5CA1B 4MSWA 1C8QA 3I9IA 3PJSB 4FFZA 1FFOA 4CVWA 3NZUA 5BS0B 3T8VA 1G7HA 2GTWB 4EOWL 1BL8A 1B04A 3NSFA 2PW1A 1F97A 3KBFA 1Q43A 2L6LA 1A6TA 3NUKA 5LN8A 4N8CL 2DJMA 4PPTA 1IBKB 4FQ2L 3WS3A 2VXTL 3MOQA 4NENB 3DC6A 3MC0A 4Y1AD 3FQTB 3IN2A 3MA9L 5EUOE 5T3ZD 5JZ7C 2KQMA 3MLTB 4AV5A 4N8PA 4FM2A 4POZC 5EU6E 1AZBA 4ABQA 1XL4A 3K3QA 4F7TA 3GS7A 2NNFA 4UU9A 2JKNA 4POZD 3TN0B 2CR0A 3W0WE 4B50A 1U3HD 3BIKB 1QI3A 4KGLA 3L3JA 3IGKA 4L29B 5GRVL 2CRIA 3QFDB 4G43A 2Z31A 4YXLH 1DN0B 1EN6A 5HGDA 1CJYA 3D18B 4P5TD 3UAEA 4Z7UB 1BBJA 2GTZA 1E5CA 1DBJL 4GO8A 5EDXA 4YHPB 4CS3A 2CO4A 3T4AB 2P8LB 3KNBB 2WYZA 1RLBA 3JBG7 4N0FA 4TLUA 3WN6A 4ELMF 5AW7B 1SXAA 4PDMA 5DUML 2ILLA 1FFOB 1TJGL 2UZXA 2ZKOA 2C9AA 5T1KB 4GG6A 4L4JA 4DOHE 5H35A 3MOAL 4UQ3B 3CDZB 3H7BB 4G8GA 1YHQV 4S0SD 4NQTA 2IOOA 3SN6N 4UM8A 5GS0C 1DK1A 3U83A 1K6QL 3N2KB 2XY1A 4CW1B 2X6CA 5IY5B 4NZJA 5LBSA 4DV6B 3I75A 4CNIA 4JI8O 2BJMH 4M7LL 1W16A 2CIKB 3JD3A 2FBRA 1EQWA 1I1AA 1N0LA 5FECB 4FFZH 1EGJH 3S3JA 3EJCA 5F93C 4M1CC 2NRDA 3X3FH 5CBAB 4U1HA 1OXYA 4IBVA 1MCPH 3IJSA 5KBPA 5MEOA 5KVGL 3CUPB 1H3VA 4AIXA 2HJLB 4EPSA 4R4NC 1INEL 2OZNA 2GJRA 1KIPB 4RQQA 2HXAA 1SOXA 4YSOA 1X5XA 3HCVA 1I9RL 4HV8B 5GRZA 2JWYA 2F5BL 1F11B 4M4RB 1FZKA 5E2UL 1YEWA 2O5XH 2VLRB 2OJEA 5KSAC 1XVSA 4KXZH 1KCUL 3FQRB 4C56B 2ARWA 1N9PA 1QA9A 3VXUB 3W0WD 4AXWB 2BHZA 5ILTH 3EFFK 3HKDB 4YMPA 5F1IA 1OAXH 3MX0A 3Q8CA 5DEGB 1XEDA 5EA0L 1NL0L 1G7HB 1KTCA 3C9NA 4XAKE 2FJHB 3BSZH 4XRCB 5GRJH 3FMGH 2NYZA 5FPOA 1IBFA 4KXCA 4NHUB 5EEWA 3PGDA 2HRLA 5JW3H 5EC1C 5LJYH 1TQTA 1N0JA 4WI4A 1MLCB 3V2AR 5I19H 3CDGB 3GB7B 5F96L 1N33O 4HXAL 2AV7B 3ZDXB 4LWSB 4HJJH 2YSUB 2A9ML 3K5SA 4POYA 1BXAA 4UV7L 1KYAA 3OL2A 1YPZE 2VLRD 1AZVA 4HBCH 5ITZB 4MMXA 3D36A 4LLVA 1CE1L 4FP8L 4Z5RA 1HNGA 3VI3E 3WEBA 2ZIDA 5TISZ 4IBSA 3ZRWB 4DVRH 1NGQH 2P48B 5AW4B 1XB8A 3GZOA 2CDGA 3U48A 4I4TB 1UURA 1UB6A 5D71H 3QVAA 2C3XA 2OCCB 2X4SA 1FN4B 5AVYB 1RULL 2CHXA 3B7TA 4WI0A 5EU4B 3RPIB 3TBVB 3V6OC 4AK2A 3BPOB 4YAQA 3JZYA 5D2LF 4DPCX 1W0JG 4QXGH 5EF3A 4KQ4H 2NDFA 3C3TA 4WK4B 3VD9A 3ZMNA 3BEVB 4J3SA 1DE4B 5DD5H 4FQHA 2CUGA 1KPRB 1ONQB 5JW5B 3FSOA 4WDIA 3V9FA 2YMXH 3TCUA 1UKSA 1XX9C 2WINB 4YLCA 5EUKA 3CDZA 4G8GB 3GMOA 2A77H 1N18A 5EIBC 3N50A 4TSBL 2R4SL 3K7UA 4L3EE 5H94A 4EIGB 1XGUA 3TNNB 4V1DB 3MUGA 3HE7B 4LU5L 3L95B 1QNZH 3US9A 2BIIA 3PHOB 3CFQA 4EXKA 1S5JA 3ZMZA 1HHGA 4JFFA 5IW3A 3VWKB 5IT9N 2WPDG 2V9TA 3CVCA 2ZKHL 3ARTA 3JV4A 3RGVD 1A32A 2R72A 4OU3A 5AW6B 4XBMA 5CBHA 1EZLA 4JN1L 3CSFA 5JQGA 2R0WL 1S5IH 2A9HA 1IVSA 4RMTA 5C08B 4A6YA 2Z31B 2YD3A 1OCRC 1MJUL 4HT1L 1CT8A 4ZBJA 5LDUA 4J11A 3V4VB 1CICA 5IEKA 4DK1A 5D7IF 1F11A 1QQDA 2JE8A 5FUZL 4OZIE 3THOA 1P5VB 2W07B 4EZLA 1VARA 1K9TA 4UT6H 2JCCF 4WEUD 2B08A 1QWHA 4HIHA 2VQEB 5DLLA 4DKAA 2A74A 3HAEA 4OJCA 4X65O 4PV1C 1J8HD 4IQHA 1TLKA 3T3MF 5HGBB 2IH3B 4FI8A 3IRPX 3FT4A 2P4AB 2NYYD 5L8LB 4FFTA 4XMUA 4JY4A 4K9EC 3OAZK 3TPUB 5LXVA 2BVOA 4E2LA 1IUZA 1HTYA 2CQVA 4MJJA 4ZOCA 2DN9A 5A2CA 5FM4A 3RU8L 3BHBB 4KUZH 3RA7H 4EI6B 4XXCA 2IANB 1T5WB 3AM8A 2YWYA 3BPCB 4OD2B 2BSSA 3P30H 4HXBH 3F7QA 4P2RB 1NH2B 2YD6A 3QXWA 3NTCL 1IM3B 1MFEL 2QPDB 3T2MA 2BRQA 5BJTA 2DI7A 4LSPH 1BEXA 5FM5O 3EFDL 4RGMC 5DEJA 3VI4A 4XMTA 5FLVA 4JHAL 4N1CA 1DUZA 3A8TA 3LS4H 3SKMB 3ZMUA 3EH3B 3HZ3A 3WKQA 3WJJC 3CU1A 1Y18A 1UA6L 4NOBA 4P59L 3DJRA 5C0DA 1DBMH 4KRNA 5GTHZ 1WB7A 2EXYC 3JAWA 3CXFA 1XGRA 4FHKA 3EGDA 4XC1H 2DTMH 3D36C 2VRKA 5GS0L 4N0RA 4CMHC 5JZ7D 3H9SE 4EZKA 3KH3A 4L8BA 3OKYA 4PRAA 3LNHA 1KWKA 5BRZB 2Y69B 1FG2B 2IGLA 3NIFE 4FE9A 4N2DA 4PBWD 4QD2E 3NZ8B 5DQDH 1FF5A 4K5OA 3BZDA 1LVEA 1GC1L 1NGZA 5JHDE 4X20A 4JFYB 4OFKA 2YXHA 3BKML 3A6BH 2GITA 3Q8AA 3W5NA 4X1YB 2CH8A 4MQXC 3MNVA 5DD1L 5DD6A 1HJBC 1QOKA 3CFEB 4NQED 5GGTA 2RJMA 1MRCL 3BSZA 1NCCL 3LN9A 3RWCA 3W7UA 4FNUA 4YJ2A 1GIGL 1NCHA 3D06A 4UQ2B 2H2PC 2FB5A 5EZYB 2ZXQA 2XZZA 2MQCA 4IKJA 4PH8A 3MBWA 1CPUA 1OL0A 5I0VA 5IBLC 2YC1B 2J6EH 3P77A 1DN2A 1WYJA 3LQAH 2HKHL 3V4UH 2UUAO 3I6SA 3GBNL 4X62O 2YRBA 2Z8VC 2EE9A 4UV4L 4PLNC 3TO2A 1JWMA 4LCWD 1A0QH 3PAZA 3LEVL 3SJQC 1KT2B 2DLEA 2AW9A 3WEMA 2ID5A 1IGMH 1VADB 2AP2A 4R7LA 4CJ1A 1O9WA 1AGCB 4PW3A 3V5KB 5L3DA 2JNZA 2VE6B 1IAIM 1JHTA 2B59B 2P5EB 4J3VA 3TBBA 3VQVA 5DECA 1J8HA 3D39D 1I7UA 3L13A 1JVOA 3BPOC 2W5PA 4WWOA 5CEZD 5LGJB 2VQFB 1KJ3L 4DR3B 4OIFA 1DBAH 4PREA 4KHPO 1G7IB 2NW2B 4GJTB 3FT1A 4XN2A 4DH2A 3U9UA 4I9WE 3CFEA 2IALA 1UATA 1JGVL 5IGXL 2JLLA 3KHOA 3KPMB 5EF2A 3VQYA 2OL3L 2ALWA 4OW6A 5KS9A 4JI5B 5L88L 3A23A 1KGIA 1FGNL 3VWJD 5AD0B 5HGGS 4NNYB 4PWFA 4PG2C 3V4PH 2CTWA 3KXFA 4ZO6A 3IDIB 3KBHE 3SD2A 2QVFB 3VXSE 2YEVA 3O9WC 7FABH 5KSAA 4DEWA 3MV9D 4KAQL 3MRRA 2VCOA 1AGDB 1ETA1 1HXYA 4ZW7A 5HDBB 5C9JA 5DJZB 5JO5B 5ID0A 1ZHBB 1CL7L 2DH3A 4XMWA 5GGUA 1OCOC 2Z7ZA 3WIHL 4EN3A 2ALAA 3ABMB 4A7GF 3VQ1C 1G6RL 2HLAA 4GUNA 3ZYIA 1AO7B 1ET5A 3HMXH 1VZIA 4JM4L 5D7LA 5I76B 2FYUH 4AYFA 2WA3A 4ADIA 3WMPA 5JPNA 3ZS8C 4WWPA 4PP2B 4U2YA 4XI5D 3E0GA 3FT9A 1H6UA 4Y5XB 3V0WL 1WC7B 4UAHA 2FR4B 3Q8BA 2X4RA 5C0EB 2VDMH 4AVKA 3G7TA 1KF9B 1S7WA 4WTZG 4IMKC 5JH7B 5D6DC 4YHZH 1BVKB 2FHCA 5EIVA 4BH8A 3MNMA 4JM2C 1H3XA 1FZKB 3QHFH 3D48R 4R6UA 1SQMA 4Y2DD 5I1AA 2VQFO 2CK0H 2DLIA 3W9EA 2LU5A 1ZVSB 3FQ1A 4QF1B 3VFNA 5JPMB 2KZWA 5FCSH 4PDLA 3T1FB 4ETYA 1QG3A 3V0EA 1V3KA 1WUZA 3JD1A 3F5WA 5IWAB 3EBAA 1I85A 4PG9B 4ZI7B 3CCMV 1NJ9A 1N8RW 1HL9A 1N0LB 1ODAA 1QFHA 1XGPA 2EO7A 2ZCZA 3HUJE 5FECA 2XKSA 2VABA 4NP9A 1K4CA 1SDYA 1YEKH 1HCYA 3FN0H 4HD9A 1RZGB 2IADA 4L0ZA 2QQLL 1MRFH 4PRHE 4YHNB 3EDFA 3KYMA 1WAAA 3ARVA 2ZDIC 2WNGA 4KHXH 4NKDA 3BPLB 4UIMB 2DDQL 3N41F 3FUJA 1UJ3B 5J9PB 2IH8A 4NHCL 4H13B 1AOZA 1WTGT 3RDJA 2E7LC 1F3JB 1YY8B 3DARA 3D85A 5AOKA 2NY5L 3P0VH 5I15H 1NTMH 2VDRL 3N06B 5I1IL 1FE8H 3H4HA 4FI7A 4N24A 4FXLA 4NUGH 4OZFA 4P4KD 5E5LA 3B40A 4U3SB 5DFAA 2X1OA 2BP0B 3L7EB 3AC0A 1SY6H 4MQTB 1U8OB 2WKOA 3NG5A 2CGRH 1SA0A 2X9YA 3LB6C 1XCTA 2JJWA 3A0HZ 3Q5OA 2YBRA 5B3JE 4WTQA 5KZCB 3BEVA 1MI5A 1IMHC 1NTZH 3P4NB 3FRPB 5GSVB 4R5VA 1BVLA 1P84J 3DYOA 3QQ4B 3H3PH 3BZ5A 3RX7A 2Q10A 2B1HH 5K39A 4D7SA 3MV9A 1FL5A 1GC1C 3OZ9H 5DRNB 3V8CA 2AHYA 4RISL 4TL4A 4XAWL 3DSFL 4LF3A 2WQWA 4TOYH 3ZQXA 2UX7A 1K72A 2FD6H 3ATDA 1RUPL 4LLWA 5I5IA 2GHYA 1FXVA 1I4FA 3ETDA 2B4CH 2QELA 5AW0B 1H3TA 2BY1A 1KXQA 1I8KA 3MGAA 3O6KL 4W4OC 1EVTC 3KPOB 1J9CT 3ILEA 2OMUA 3WIHA 2V17L 3QS3A 4LPTA 5JLZA 2NY6B 2C3VB 1AQDA 5FCUH 3LX9A 1WISA 3CH1B 5LNDA 3LNFA 3OR6C 1OZTG 2M26A 3L8QA 2VDMB 2VERN 3AS3A 4NNXA 1U91A 4GI9A 3BFWA 5EPMA 1N26A 1K4CB 2N7SA 3WKNA 4HIHB 2DQFA 3QUKA 4ODVL 4F7CB 3S0PA 3HUJB 2ADYA 2VLJE 3V4PB 5D5ME 1QSEB 3MTRA 4B7KA 3FT3A 4U6TA 1S7XB 2P7TB 2VXQH 2DL2A 2GUOA 4GZRB 4S1QH 3JAMN 3BMVA 4IIJB 4FNSA 4PRHB 3S5LA 2Z4TA 2IU0A 1V3JA 5B7MA 2VH5L 4JM2A 4PB0L 3L45A 5L2KD 2EC8A 3JAKB 3CX5J 1HHKA 3EGXA 1FFXA 3QCVL 3BQVA 5FGCE 1A8JH 1MVUB 2V37A 4M6OL 4MVOA 5IROA 4MCZB 5DQJA 1P4BH 1DBKH 1RPRA 4YWGH 1LMKA 1OALA 2JKXA 2AJYH 4KMQA 2ZCKL 3C2SA 3JUYA 2JS3A 2XXMB 4Z7NB 1CGUA 3CVIL 1IAII 3IU3A 2Z3YA 3QIWB 4U0QB 4J8RA 4YE0A 3WDIA 3DDFA 4Z3IA 2WD0A 4FIPC 1BF8A 4FYTA 1XWVA 1R47A 4FL4C 3DWTA 3AG1B 1RVFL 1YEFH 2HVKB 4P2RE 2C34A 1S7SA 1SA0B 1P2CB 3JTSB 4F7CA 1XMQB 2XA8L 4LFAO 3FUDA 3PP4L 1K8DA 4PWHA 4P9HH 3QUZD 3EJUA 3SKNB 3OSKA 1FYTA 5EH1A 4FL4B 3SBPA 5KVDE 2ARJA 5I8CA 1MPAL 4GO9A 4IU3A 3REVA 1MI5D 3V79C 1RPUA 3RTLA 1JYNA 1FH5H 1UH2A 5GHWL 4X62B 4JG1H 5JLZB 3EFOA 2EYTB 1CD1A 2QVTA 3MRPA 5KG9B 2YEZA 3VGFA 3ZE0B 3ZGIA 1QPXA 1R24A 2VLKD 4HWBL 4OFYA 1HKFA 5E2WL 3SY6A 3UTQB 2HLFC 1HILA 2KLSA 1S9VA 2IAMA 4YDLC 1IT9H 1X4ZA 1YDPA 1VF7A 2R56L 4H4NA 4L8SA 5DS1A 3K0YA 1Y4MA 3E9UA 2LABA 4UAOB 4B3MB 3TGXA 4I0CC 1RFYA 2IPUG 3QAZC 5C6TL 1WS8A 2ICWJ 4HKBB 1WZ1H 3CXHF 4H5SA 4L8BB 3DGGA 3K2MC 1SPDA 4JRXE 5TE6H 4OLWH 1MI5B 2F7RA 3FQRA 3VFWB 3B9EA 3ZLQC 1FFXB 1UFGA 2HX7A 5F2VO 3RIKA 5JQIB 1CDUA 4AENA 4JI5O 4FJYA 3VU1A 3CLFH 5EU7C 3T71A 3LQZA 4IIJA 1RJZA 4AGOA 5EZIL 1JPSL 2IAMC 3QCUL 1AD0A 3HI5H 5I1EL 4Q6YA 1T1YB 1S7WB 1WB8A 1NCWH 4F8QA 5KUKA 4JTCB 4X8JA 5GSRB 1SDDB 4PRDA 3OUFA 5EZLA 5F44A 5C09A 4MCNA 5KVFH 4LMQI 1A3ZA 4XNMB 1D5XA 2PF4E 1GN6A 4Y1AB 5ACZB 1F4AA 2UX6A 4LBEC 1S9XB 2J4WH 1SKVA 2GEEA 2X9XA 3RWJA 4W9HC 4XCEA 2ESVA 5IKCB 3D8CA 3VXOA 4DXWA 1GGYA 2XHNA 4DP2X 5BRZE 4R4FL 1EXUB 1N0XH 1YMMB 2XWEA 1D3CA 2X4OB 2QQNH 4LAQL 4I0PB 2YSTA 4P5MA 4WEBH 1RAMA 3RILA 3UC0L 4AEHL 4JO4L 4Y89A 4XP1H 2J6EA 5HVGB 1OAYH 1NKDA 3CRAA 3RX5A 5KAFZ 4P5TB 2CXKA 3WIFA 4YN3A 4JPIA 4B3MO 4FABL 3A0BZ 1I7TB 3CFCH 2BW4A 4X6FB 3QIBC 3F58L 5E24E 2OIEA 1KBBA 4PY7A 1BZQK 1UGKA 2EEDA 3TZVA 4K3GA 4Q4IA 4MBRA 4NQDD 2VIRB 5E8EA 4Z2WA 4HKBA 4GIOA 2ZDIA 1SJEA 3MLTA 3NDZE 1A7OH 3D7PA 5DVMA 5FAAA 4NC1E 2EC9T 3V0FA 4AJ0A 4WFEA 3PQYA 4NM4H 4XPBH 4FFBA 3U0ZA 4K4KA 5HFLA 4KO6A 4FNPA 3U7YL 2WBJB 4UVAA 2EZOA 4DERA 1SOKA 2LFGA 4B9IA 4HFUH 5DRWA 3WFEH 3OR6B 1Y74B 5KVFE 3TJEL 5C0CA 5A3IC 3A6CH 1J8HE 5BS0A 4JNXA 1SUJA 2F7OA 1JGLH 3GNML 2MSPA 3SE4C 1GXEA 1AGEA 5FL7G 1VQ6V 3AUVA 2PKDA 3HZMA 3QO1A 4PJDA 3GMQA 1E8YA 1OP5K 4DGUA 1INDL 2XVLA 3WTSA 1G8MA 4WFFE 4GX0A 4FLZA 4R83A 1EPFA 5LGNA 1MI5E 4N0FB 4OZHF 2B1AL 3DMMB 3KBPA 3LYRA 3NJKA 1CTOA 2WZ5A 1LR1A 1X9QA 4YJ3A 3JWNG 3TASA 1YN7B 3A67H 1PEZA 4MS8D 3K57A 3IFNL 4ODTH 2J8UB 2QL1A 3OAYK 5EN3A 3TBWB 4X0NA 3C5SA 2VLMD 4L9DA 1U3NA 5INDA 4DKFH 1WA8A 3TJHC 1OE3A 1ZHKA 4R5TA 3BIKA 5TPWH 5LXTB 2AI0H 1BXVA 2CBOA 3LEYH 1EFRG 5IF0B 4XXWC 5LBVA 3UYRH 4E9QA 2VLJA 3IN0A 4TXVB 1ZVSA 1CDHA 4L4TE 4QF1A 5AALA 5TDOA 1M57B 4K3JL 5I6PA 5ICXB 1IAIL 1C16B 1QPPA 4MVZA 2OFQA 4NUJB 1H5BA 5DHMC 4K9EL 4DETA 3VTAA 1ES0B 3B8SA 1FIGH 3TL5A 4HEME 1ZWIB 4X5PA 3NPSB 3UT5B 2DWEB 5F97E 4A7VA 4MTOA 3KM2A 4YH6A 1UXSA 3C5JA 2DD8H 2FHBA 5KLVH 2AGAA 1U8QB 3L3OB 1JYWA 2Y07H 3Q6GL 2EC9U 1W2BU 2R0KH 1F51A 3EJQA 1Q1JL 4KQ0A 4RWYH 1QA9B 5EO0B 2QSAA 3MZTA 4ENED 4O02H 2G5RA 2Y5TB 2RCVA 1K2DB 1DQQA 3OUSA 4KMTH 5E1GA 1GGTA 1MCPL 4YZFF 5GGVL 2UZIL 2VDLH 3T6QC 4O02A 4YJ2B 1MY5A 2YJQA 4XXDA 2R1WB 3ZN6A 1GJIA 2DQTL 2YR3A 4ZFFA 2FEJA 1JFFB 4LXFA 2FT8A 2AHZA 1QLFB 3IAGC 5IQLA 4GPVA 1HCFX 4KUCF 2F23A 5B22A 1BJMA 1NGXA 1VGEH 1TQUA 5ETUA 2X9WA 1AQDB 1R3KC 5LYJA 3J81N 4GW4B 4JTDB 4GAJH 2CE4A 1OF0A 2OMXB 2A06H 3DMMA 3EO1A 4H8WH 2GFBB 1X5GA 1GMGA 3BSZL 4WI2A 4GG6F 2IH1C 5BR8B 1A3QA 1JVMA 1YCIA 3VBBA 1MCNA 4PRPA 3BEWB 3BFRA 1YC7A 2O72A 1I7RB 4BCYA 4OKDA 5LGJA 4MNQE 2Y7SA 5F96H 4HCRH 3QO7A 1MHHA 1THAA 1ZA3B 1M7IB 2G3MA 4MQXD 2HUHA 4PREB 2CLRB 2BTQA 1Z9SB 2BC4B 4WHCA 1JWMB 2H1PL 4L3CB 4B7LA 4D94A 1M2VA 3VGAC 3TVMC 5K1NA 3QXAB 3FB5A 4FQXA 5DJYB 5KVGE 5T5FA 1W72B 2PYFA 2B59A 2P5EA 4CAGA 4HLZG 5ITBL 3CBJB 1EV2E 5FWRA 4DVRL 2RJZA 1RUML 1OV9A 1NANI 4HH9A 3VSTA 4WV1C 3V6OE 1EX0A 3IDIA 1PPJH 1A7NH 3FU3A 3HC4L 2IU3A 1DQIA 1KY7A 4HHWA 4LESA 1E4XL 4EEQA 1U30A 3HJ0A 3W11D 3TF4A 4NQUA 4KXRA 1QYGH 3F7PC 4JFDD 4AIZB 3F65A 1H8OA 5KUMA 5DD5L 2WVUA 1L0NH 1BREA 3IGFA 1JHLH 4MNGA 1MNGA 3GJEA 3QA3B 4OJFH 4TSBH 4WFFD 5CUSL 4QGPA 4U0RB 2XPGA 1T04A 1OCCB 3TVMA 1AHWB 2FZ3B 3IJEA 3MBEB 4NXNO 4FNLL 2CA4A 4OGAC 3OKLB 3QEQA 4LFCB 3THMH 2A4ZA 2Q2EB 1MJ7L 3LV3A 4NNPL 5KWYC 2P7TC 2CCVA 4ZFOA 2BNQD 3QCTL 5A2BA 2J88L 1BIIA 2ODHA 3FS9A 6TAAA 1CMOA 2C9PA 4AY0A 1BCIA 3OMAB 4EXPX 4QHLB 3WFHB 2F53B 3MLWH 4HWBA 1ZPUA 2Z0AA 4X4XB 3GSUA 3JV6A 4HFWA 3VXUD 3O6FD 2FEEL 4GSRA 4HH9B 3P9MB 4PJ7B 4DCQB 5FUZH 4E36A 1QMUA 2BCMA 3KLAA 4YHLL 1M71B 4Y1AE 2XTSA 4WCYH 5ACLA 5J13C 4UZGA 2AXHA 2APXA 4LFBO 4DK5A 3LH8A 1UA3A 1M6UA 4RNRB 5KS9E 1TQBC 3US0A 5HHOE 3HBPA 1HZHL 4LOUC 5MP6L 5CBGA 2P44B 2PO6C 4FQJL 4GP8B 4C58B 4AIEA 4PJCB 5I8KH 4NO0D 2CLZA 2BSKA 1T20A 5DURB 1KCRL 4HYTB 4CADA 1I7RA 2Z7WA 1JJ2U 3DMMD 3AG1C 4K8RC 3N41B 3ESVF 3T0XA 1FVEA 2CALA 4Z77A 2IJ0C 4RQEA 1SJHA 4WFEE 3WGVB 4AGQA 3LQAC 1B0GA 4B27A 1X5JA 1U8HB 5CEYA 2Y06L 1YECH 2G75A 3VFPA 3MAWA 4WU5B 4PP1D 1AI1H 4PJFF 5BY1A 4F2MA 2P6JA 3AS2A 2AQPA 4XCCL 4LSPL 1XH1A 4PJ5B 1I9JH 1U8PB 4LCWB 3K2UH 2G4GA 3B7SA 5C3IA 3VXQB 3MYJA 4Y2LA 4GKLA 4P48A 3MJ8B 4Y4HC 3SJVB 4G8EA 2X6MA 3MRDA 4NKOA 4WTXA 3C90A 3VXSB 5JJNB 4HS3A 3BD3A 4OBRA 5B38G 1ICTA 2D7MA 1P84K 5KX5B 3BE1H 3BAAA 3QDHA 1MJ8H 4YXHL 3R4RA 1HDMB 1MHCA 5L7XH 4X5RA 2EVIA 4G1EB 5GGSY 5BZWA 5FHAL 1ZHLA 2AJ3B 5GGRA 2QKAA 2KPWA 3KAAA 1F8TH 4FULA 3N1GC 25C8H 4IK6A 2E4TA 1AACA 5JQ6H 1UM6L 3SE4A 2R1XA 3O65A 3N0PB 3RFRA 4NRZA 1MOFA 1U8IB 4JDZA 1BE3H 1U3JA 4BWTA 1TKWA 1AMXA 3DX9A 1P0SE 3LV3B 4KFMA 1YN6B 2XZCH 4NUPA 5IJDC 4LCWE 1DO6A 4GFXA 1QVGU 1WT5C 3KYKH 2A7WA 3BT2H 4OM1L 1NCCH 5CLYA 1WVZA 1FFTB 1ZTMA 2ICEA 4FNRA 5IJCC 1TEGA 5LDSA 2YARA 2RCSL 3HMWL 3RN4A 4Y2OB 4M62L 3RWIB 4ZTPL 1NMBH 2AK4B 4BQ8A 3EJZC 4Z7OF 1TNMA 1PLAA 1XZ0A 1YO4A 2A6KA 2JXMA 2WCPA 3GZPA 4L4VB 1ZK9A 2ENSA 3G6JA 5IR1A 1TJIH 1GGBH 1A1OA 4HK3N 4Z7AA 3GJFA 3IDGA 1E3FA 4Z7OE 3O6FA 4DN3H 1U93A 2Y69C 2P7TA 3EYSL 2DKUA 2F54D 4RGOH 5FC9A 5MHSE 1E42A 3UACA 1AKPA 3TBTB 4F9LC 3G04A 5EC1B 5AZEH 2DKMA 5FGCB 3NABH 4PJHB 4A7SA 1Q9KA 3R66A 1DVFC 2FECL 3DURA 3ULUC 3BKYH 1RERA 2OSYA 2GCYB 1S3KL 4MS8C 4TUJB 4F5CA 5E1HB 1KN2L 4XWOC 3DTUB 1VFOA 1QBAA 3WSQL 4JDZB 3J2PA 4H25B 1E8WA 4LF4B 2ZSWA 3ZY7A 4AC2A 1TZGL 3L95A 4Y7OC 5LUMA 4P5TC 3U46A 2PWDA 4G6AC 3RGHA 2H45A 3WUZA 5ABDE 2BSDA 3OG6B 1R3LB 2V2WA 2CGNA 5HHOB 5HPOA 1JGVH 1JI1A 1YPZB 1KB5A 3P0YH 4IJ3C 1HSAA 4PGZA 2ZNWA 4BKTC 3SPJA 3QDMD 3QQNA 2WNKA 3WFBH 4XDKA 4DPBX 4J3TA 2ITDB 1BS3A 4FVMA 1GA2A 3JVGA 4XWGH 1NDMA 1KZYA 3QJFA 1LYQA 1U95B 2QKSA 4BH7B 4F15C 1FN4A 4PJ7E 2DKSA 2OXHB 3TBVA 2GJZB 1BQUA 3P40A 4S2SA 2ZUVA 1T6VN 5DYOA 3MJWA 4EI5A 3QUXD 4LLYB 1CD9B 2VXUH 5D96C 3FB8A 5GS0D 2CIIA 3MVSA 1Y0LA 2QGNA 3ISRA 4U3JA 4MVBC 4ZAKA 3WI9A 1JZ7A 4PGDA 1F5WA 4MXVE 1QBLL 3WIHH 3HE7C 1EN5A 4PJHE 2R69L 4JGSA 3UZQA 3SPGA 4I5SA 1TZ8A 1X5HA 3JD4A 1UB5A 5FF6B 2C26A 1AP2B 2XACC 1NGYB 4ZNEA 3MROB 2Y5TA 1J0JA 5DDHA 1GCFA 4NAMA 1NC4A 32C2B 4ZG1A 2DM7A 4HH8A 4R2GC 3VA6A 4YHYB 1KJMB 1F4WL 3UADA 5ANMA 5LHGA 1OCRB 2VDPL 1O9VA 1I1RA 1IL1B 4NIKB 4UDUB 4LQFL 2IJIA 1B4JL 1R5VB 5EV7A 4CBZA 3L4XA 4LSRL 5AVVB 3RHWK 4QRPB 2DJVA 2IG2H 4N90D 5HGDB 3JWOC 4AUJA 1SJXA 4S1RL 1M1XA 5IM7A 2YZ1A 4LF4O 4NSKB 5GIRB 3C12A 1TR7A 4WV1A 2IDQA 1YSCA 2DM4A 3KEHA 2KPNA 5C08A 2ADPA 1I1AC 2DAVA 2F4VB 1U8NA 5IW6B 1PLGH 1PD0A 1MRDH 2EABA 4HC1H 1U8LB 4NERA 2DQ0A 1WCBA 3F5WB 4PG9A 3SBWA 1Y6MR 5IMLA 2HFFA 1YQVH 2DQIH 4XBEL 1YEKL 2EKJA 3DC0A 3DIFB 3PGCA 1BQZA 1DJIA 5A2IH 2F5AL 1F3DH 1YPZA 2Y2YA 2QQLH 4V1DA 3IU4L 2VL5A 1JCVA 3BJ91 1M7IA 4KKLD 2H8PB 2HMIC 1PNCA 3QG7H 5G5DB 2H26A 3Q4HB 1FLRH 2TRHA 4PJXB 3WMSA 3ZHFA 3FT4B 3CFJA 3IS1X 4QYOB 3LKOB 2FGWL 3BD5A 2E0PA 3ALXA 3BKCH 4L3EB 4MNQD 3FQNA 2CO6B 2E75C 5C0FB 3UG5A 1K5NA 2OMXA 2BVPA 3QC5X 2N7BA 4I18C 3RBSA 3ABZA 2G9HB 3ISYA 4AMWA 2VWKA 1FE8L 4NUGL 1JNJA 4BSVA 1JPTL 3OWRA 2AEIT 1QQDB 1M1XB 5IM7B 4O5LH 4K5NA 1RZ8B 4F3FB 4GQRA 2NCMA 2NXZB 4JVPA 1AGFA 1H3WM 2HP4A 4LOUD 5CP3A 4DJMA 1UWXH 3QRBA 3VM5A 3EXLA 2FO1A 5DC4B 1QRNB 2DWXA 3RDTB 1LK3H 1SBSL 1OSZA 1CP9A 5GW7A 4ORGB 3X1EA 4QLRA 3ARGC 1JV2B 2CMRH 2LV4A 5AVWB 4LL4A 4JHUA 1NIEA 4J3BA 3VH8G 3N91A 4TULL 1OAZH 4UINH 1V7NL 1PNMA 1CG9A 4HWZB 3GSWB 1TUEB 1JTOA 2H5UA 3DX6B 4R8WL 3HMXA 3OKEA 3VFUB 3ECWA 4O2CA 1XF5A 2A6IA 5HHPA 3FB7C 5MEQA 4MX7B 4O2BA 1HH9B 2XKNB 1SYSB 2CGYA 5CEZH 1T2XA 3MX0B 4OZHE 4Y2DB 1NCDL 3ESMA 4X6EA 3U4BH 2VC2L 4P9HC 5FCUL 2Z9TA 3VI3B 3DO3A 1PFCA 4XNQB 3ZRCC 4AGLA 2QQQA 3STLA 4GKJB 2WLIA 4LLAA 3WEAA 4HZLB 5EF1A 2OLDA 4BH7A 4HV8A 2MNWA 2CM6A 3B77A 4RUEA 1X7TA 1DANU 2H6OA 3T0BA 4V2CB 2LJ2A 3DHMA 4NSKA 3UO1H 3W2DH 5KYYB 1ROPA 4X9QA 2FQFA 4LRNL 2PP7A 3HZKB 5F9OH 2H2PD 4MNHB 5FA4A 2QDVA 3ZIMA 4IJ3B 5KYXB 3F7YC 4LSDA 2W9LA 3A47A 4GSQA 3D4YA 2XN0A 1S7XA 3FDWA 3O9OA 1NBYA 4NEHB 4MS2A 5DJ6B 5C08D 3BVUA 1EXHA 3S3XA 3NFNB 2P42B 1SZXA 2X7LA 3K0DA 2QQKH 1FFPA 4XPFL 2VLME 4PB0H 5C0AA 2GUYA 5A7EA 1US6A 3PWJA 4PLJD 4RX4D 1TU2A 5DDHB 1C5BL 4Z78A 1VFMA 3L2MA 3M88A 4YDKH 3AVEA 2VLLB 1S72V 4XX1G 1IFRA 3JWNE 4MB5A 1DL7L 4P49A 3CFJB 2OWOA 2PTTB 1J1OL 3ZHDA 1I9EA 4LHQB 2H9GB 2PPFA 3MCKB 1PNKA 4X6EB 3UZVB 4CU6A 5D7LE 4AYBA 5KSVB 1AQHA 1H5BC 4ZFZB 4RFEB 5E03A 4PS4L 2Y4TA 2L3BA 2Z64C 1A1NB 4G8IA 2VLRA 4QHMB 5CEZE 3TEUA 1AS7A 4H26B 2MCMA 3NCJH 4P46C 4KI1A 3F12A 4P3DB 1KPUA 3MRGB 1H2MA 1F6AB 1BAWA 2ADFH 2BNUB 4XTRD 1U8LA 1TUBA 1PIFA 3VXMB 1BZKA 4GRWF 4PJAA 4OLVL 2OTUA 3PAUA 4ZW3A 4HETA 1KCLA 2G3ZA 4PJCE 2QM7A 3C60D 5GGTH 3A6OA 5TFSH 5J8OA 3Q0HA 2HR3A 1QBMH 3ZE2F 1RKRA 2X09A 1QNMA 2A9CA 5GHWH 4UF7C 1R73A 4RFNC 4U7NA 5F89A 2IDCA 5D1QE 1JRHL 2CSPA 4XCNB 4J3UA 4ZS6C 3PFQA 4NPYA 1QO3A 2VDOH 4N2LA 3VMPA 3KYMB 1NM9A 3QISA 4GLRH 4CC4C 4NN6B 3WFCL 2PTTA 4GSUA 1JCKA 2R56H 1FFRA 2BVPB 5AWNH 4DQAA 1C7SA 1OTUC 3GMNB 1FZMA 2HVKC 3W7SA 1GN3A 1RMFL 5C6TH 5DK3A 1F4NA 1T1WA 3CN4A 4JANA 4DP5X 1QSED 3OWEA 5DK0A 3WFVA 3RYIA 2PW2A 4LSTH 1TETL 1ACCA 3JTBA 4PRIE 1KGWA 3VSQA 1OGAE 2QADC 1S9WB 1NGXB 5E1AC 1AG0A 1AFVH 3Q2LA 1XF1A 2OTUB 1C5DB 1CICC 4DR6O 1AE6H 1EEZA 1JV5B 2I5YL 5IHLB 5EIBD 4ASUG 1IIIA 5A2LH 3QR0A 5DSCA 2DWDC 3AMKA 1HR0O 5ECGA 4N8CH 4PLOB 4PWJA 3RY5A 5DMIH 3C6LD 5C07D 4JGMA 1MMMA 4YHHO 2VXTH 4B3EA 3OD4A 2H3KA 4MW3A 2ZIMA 1LILA 3MA9H 3V0DA 2MPVA 1FCGA 4XC3L 3VWJC 5E8NA 1BYPA 5ECJE 1MFNA 3MCG1 2BSCA 3GM0A 5F9WC 5C0EA 3EJYD 2M7WA 1E2VA 4X9IA 2I60L 4V11A 2FYYB 4TSCL 3BVWA 1G0XA 1FZMB 4NI3A 1Z5HA 4V33A 3M07A 4IRJB 3CSYA 4Y5VC 2E76B 5BVJB 3FCBA 1Q9KB 3CXCU 3ZKND 3FTXA 1HILB 2ZX7A 2AJZA 1GMIA 5AYQA 2WZ0A 4LEXL 5F8RC 4BZ1H 2BVQB 3QO8A 4TWKA 2D4DA 3NJJA 5KN5B 5BZXA 4POUB 3DX3A 2DYPB 2EULA 2YAPA 4FQIH 3WFDL 3KG2A 2ATPA 1BQHA 3H9HA 2ED6A 3U79A 3T5WA 1QFPA 3VI4F 3F58H 2YD2A 3WAKA 4ZTEA 4MFHA 1UWGH 2FBOJ 3H1HH 5ITFA 1PP9H 3IJEB 4JQVA 3V0IA 3ETEA 1P7KA 3ECBB 4XHQA 2Q7YB 4YSEA 4U7OA 2JQAA 3ME0B 4Y5VA 5H8DA 1EHAA 2RFXB 1EJFA 1KYOJ 3ZSSA 4ZBMA 1FO0L 3DJ9A 4UILH 4XGZB 4PVLA 2ZXAA 3X3FL 1IAKB 4RFEA 1GS8A 4OLUH 2WN2A 1JF5A 3QJHA 3PDOB 1EJOH 4KPHL 2JJ2G 5HGAA 5FO7A 5EOTB 1A6AA 1YY9D 5F6HJ 3VW3L 3SDDA 4H88H 4J4PA 4WWKC 2X1WL 1S78D 2BP5M 2I7SA 4QNPE 5E2UH 3SYAA 4Z23A 3I2CL 1KCUH 3HC3H 4NGHL 4X9FA 1DF4A 1QSVA 5F7MC 4DGYL 1U0QA 1NL0H 4ODTL 2YPLE 1RZPA 3FONA 5BOPA 1PSKH 3WY2A 4HX1B 2XKUA 3QUZC 4G6KH 4LCWA 3GIVA 2CBQA 3EW3B 3GSRA 4M43L 4IGBB 3QFJA 2R59A 3NP4A 5CJ8A 1BWMA 1BV8A 4HXAH 1KULA 1M05B 3WG7B 4MZ3A 3LN5A 4XP9H 5E1AA 1MWAA 5FXCH 4X65B 3HKFA 1QBBA 1VB9A 3MLXH 4K3JH 2XX1A 4WK2B 4QO1B 3HVNA 1TFHA 4ZOEA 2M8XA 3OKMB 4TNGA 3VI4E 2F68X 4JCWA 1IBGH 4JUSA 1M7DA 3S48A 4BGDA 3MGTA 1MABG 4QR7A 1D7CA 2YRLA 2A9NH 1CLZL 4I0KA 1A9EB 1NGQL 5SX4I 3RWHA 4NBYB 2CUAA 3LCYA 2OP4H 4NRYA 2DD8L 5DRZB 1M3JA 1R0AH 2J25A 3TCLA 1T21A 5B1KA 2VXVL 4OCLC 4HS8H 5HHQA 3UH8A 1IXBA 2KBGA 3NCXA 3SDCB 4BK5A 2UY6A 3ML9A 4ZMOA 2XQBH 5BRPA 4R90L 2E6QA 1N5YL 4ZPTA 3JV5A 3O45A 2W0LA 4LASL 1GGCH 1J8HB 4NJAL 4TSAH 3S5LB 4DUXA 2UZIH 2VDLL 1ED3B 5GRXG 4TOIA 3W7TA 2BZDA 2UZYA 1N32B 4TNWK 4XVSH 5E6ID 4BD4A 2ZPKH 2CR3A 2OJZH 4WWKD 1BP3B 3LXBA 3M1CA 1EJ6A 1HS6A 2MH4A 4EN3D 3VD2A 1MLBA 2X4NA 1LEGB 3BXNA 4GO6B 3VI4B 4LCIL 4E42A 3TN0C 1VGEL 4O4HA 1T0MB 4P5KB 4JO2H 5D7LD 2BDNL 4XVOA 3UJIL 1BSMA 4LO9A 5D7KE 1A14H 3UPAA 4BIZA 4KKRA 2YO3A 1ZA6A 4Q9CA 1DQVA 3LJ3A 3BZ4B 3D0VB 3SDCD 3X14A 2V8MA 1LEIA 5EUKB 3RNQA 2HJFA 3JD0A 1QASA 3MUUA 1U41A 5TDOB 2B1IA 1H19A 2V5TA 4B0MM 1HHHB 1U42A 4Z9KB 1SF5A 2XNAB 2VN6A 3BDYH 3M45A 4RGNC 5KBMA 5J6SA 1KC5H 4JRYE 2UXBB 1BVNP 2RALA 1PG7W 4JZJA 1JZ2A 5BQ7B 4NPKA 3O6FB 5EU5A 4DK0A 3T4YA 4J4PD 3PJSA 4U1GC 4DZBA 2G30A 2Q5ZA 3AU0A 3D34A 4K3DH 4CH6A 5SV4A 1MFMA 3CAFA 4JUTA 3RUGA 2NN4A 2R83A 3DRTA 3EYVA 1M9NA 4LSSL 1SETA 1I7ZB 2PO6D 4JVUA 4TUOA 4X8GA 1BZEA 1YJDH 3ARPA 2Q6WA 4BZ2L 4N3UA 1TMCB 2PYFB 3Q2NA 3VQWA 4OF3A 5IEKB 2X4UA 1XHZA 3GI9H 1I08A 3ARFA 4HPOH 4H40A 4A67A 3NEOA 4KHTH 4I4WA 3N1PC 3NCMA 4MA3A 1KLFB 3JSNA 1DHKA 1HAUA 2X42A 2GIMA 5I0XA 3O41B 2VISA 1A1MA 1RUQH 3AS0A 5EBWB 1ZGLP 3AQDA 3BESR 5DI8A 2QFPA 2C1PA 4EI5C 2BTOA 3L5HA 5BPPA 3DIDA 5AZ2L 2NY3C 2R9AA 1KV3A 1N32O 4GX5A 4RIRA 4HJEA 5E6RB 3QULB 6FABL 3LIZA 4F7EA 4YHOH 1NOLA 2EDFA 1G9HA 2QKIC 1J88A 4FEIA 2QV4A 2EH8L 2E56A 1U3YA 5ID1A 1UA6H 3GVMA 4P59H 2XG4B 4OD1L 3KLLA 3B9VA 4JM0A 3ZGHA 3H9SA 4KJQD 2ZJSL 1H8SA 1COWG 1KFGA 2HPTA 3WIIL 4ZS6D 5BZDB 3BHPA 4HZ3A 5C7ZA 3T2NL 3ZTJG 1V10A 4WSJA 5IJKA 5TE7L 5DQDL 4HIEB 1XH2A 3HUJF 3GKWL 1T0NA 4N4YB 4E9YA 1GHFL 5TF1H 3S35X 1CXHA 2WPGA 5IUSA 3BKMH 2Q8VA 4KOCA 2WJ7A 4N8VA 2G75B 4GB9A 4C59B 1M1KW 4PDRA 5L6YL 4G9DB 4JRYD 2AK4D 1M6OA 5K1XA 3NDYE 3GRGA 1T1WB 5TGBB 2QPSA 3SJVE 5I1CL 2P5PA 1XQ4A 5K5YA 5JTWA 4O58L 5BO1L 2PYJA 4X5XB 2G9KA 2F74A 5AW9B 3F7LA 4OZHB 1G7JB 3TWCL 1CLYL 3M1OA 7CGTA 3BGFB 2FKXA 1IAMA 2NSQA 5EN2B 4HIJA 3SDCA 5GZOC 5IUCA 1K34A 1ZV9A 4YIPA 4UIKH 4A2DA 4NPYB 5D93B 4UV4H 5B1AC 4E9RA 5DSCB 3WTWA 4G7YL 3MTXA 1AY1H 5E8DH 1GSMA 3LNEA 4AH2B 3LZOA 5D2NB 3DHUA 1AI1L 4KKAC 1SLXA 1JNHA 4PRIB 5CP3H 2ZAGA 5ESQB 2GUZB 1EAPB 5AG8A 1IAKA 4JQIA 2WLHA 1P6WA 5F0JB 4OVUA 4EDXA 4YBLC 3K5NA 4CS4A 3G5VA 4N2OA 1MFCL 3VX0A 2QWOB 2Y23A 4APQD 1NEZG 3T0AA 2Y6TE 2Z8RA 3V4LA 4CN1A 3X2QB 4XXCC 1OOAA 2ZOTA 4B9ZA 5I8EB 3H2PA 4LNUA 4BV1A 4KP4A 1BECA 3UTSD 5IGXH 3S4SA 4NNXB 3FPYA 5L88H 4PTUA 4JPKL 1XAKA 3UBFA 2ATKB 3BA8A 4OGXH 4OI7A 1AILA 4X88A 2DYPA 4WEMB 3WY1A 3PJSK 1MJJB 1BQ0A 5I75B 4H1LB 5H4ZA 7FABL 3FUHA 4A04A 3DPDA 4KAQH 3VFVA 3P30A 2H41A 3I9PA 1A6UL 3AXIA 4OZIF 5CB4B 3COOA 4OLYH 4LF5B 3K80A 5T3XE 4JJ5B 1HFUA 2L8AA 5FPRA 1DZBA 2CHWA 5T5FL 4KKQA 3IKCB 4U1SA 2ENPA 2J1XA 5JMRA 5CP7A 2LGNA 3QUZA 2ZX9A 2RCSH 3H9SD 1FYTD 3HMWH 2C9VA 2UYLB 1E40A 2NY4C 3ARYA 4LCCB 4OZGA 1GN2A 4XX1E 4CRPA 4OH2A 1GOHA 3GPSA 3P69A 2AEOA 1KYOK 3ZE0F 3HAEH 3IKKA 3OD3A 3ZMRA 3U2JA 2V1DA 3HZVA 2GBTA 1XOUA 1ZVHA 4DN3L 1O9HA 2J6WA 8FABA 4HHAB 3E8UH 4HSQA 2EYRA 2EDJA 2NX5B 3ICXA 4KKAD 1VQNV 3T77A 5B7FA 3K4ZA 4GYCB 3QHFL 4HS6B 5D7IE 4Q58C 3SZKC 3VXOB 1BHBA 5K59E 43CAA 2WXNA 1PZBA 3BKYL 1MDTA 1KBKA 3F7VC 5KAQG 4KTYA 5LNEA 4APQC 2LLNA 3NQIA 4QTIL 5CN1A 5ESVB 1ZLUK 1TZGH 3BW9B 3MLRH 3ZKNC 2N3JA 1KBGL 3DPBA 3CU7A 4AC4A 3QJXA 1BOGA 4GFTB 4O4HB 1T0MA 4XODA 4MWFA 5T1MA 2L0DA 3P0YL 3R18A 5KVMC 1VEOA 3I84A 2OBGA 1UB5B 1MRFL 3HFML 3L3GB 4KHXL 1KJ2B 2J8UF 3K6FA 2CDEB 4NQCA 5E9NA 2XN9D 4ZNCD 3SKUD 3ARBD 3FO1B 1NEZA 5ERWB 3F7VA 2LTQB 4X0KA 2VDNB 1T1ZA 4K7PX 3FZUD 4O51B 3ECUA 4DEUA 4PEEA 3QIBB 3UCSC 3HBQA 4GX1A 5BNXD 3UPCA 5I1IH 1OQOA 2R2EB 2XY2A 5CA3A 3L3DB 3MV7B 3DXAE 5FOJA 1IBLB 3B34A 3X13A 4HAGA 1WTLA 4QIRA 4X6DF 3UTSA 3ZE1F 1FNSL 1A21A 1EA9C 4DAGH 3IKCA 1JDDA 3MRIB 2BNUA 3KD4A 4NC2B 4WUUD 1RSFA 4U1KA 5AVSB 4ZNEE 2BCKA 4X7SL 4I3RL 4G2AA 1UCTA 4MHHI 1FP5A 4U6YA 3E9TA 3ZIYA 2XSKA 1VFAB 3Q6FA 3DECA 3BP6A 2M2DA 2QTSA 3OZ9L 5TK4A 3RWFB 3O41A 4HIQA 2CJ3A 1B2WL 5TF0A 3RLSA 5EYPA 5KHGA 2YPKA 3BP5B 3D1MC 1LEKA 4XNUH 1X7QA 2AQRA 3NAAL 3VOUA 4NN5C 4P07A 1G7MA 4LVNC 3RTQA 4LSQL 5HI3D 4X80H 1E28B 1E9PA 3TZVD 4CGUB 3CCLV 4D9QD 1ZT1B 4RRPA 4WFGD 4CH4A 1MFDL 3P11H 1GKFA 3CQPA 3MLSH 1UZGA 2X4QA 3LPPA 4UQ2A 4ZFQA 2P22C 2DLTA 4LCYA 4Z8FH 1YQVL 4WFED 4K7FB 3H9SB 2B9ZA 3W7XA 1NBZB 5HGHA 1IVLA 1GZHC 3O9WB 3UERA 1UXSB 2YD0A 3C5JB 5JA8B 4JZJB 1A7PL 4R2GB 4TQEL 3I55V 2YA0A 3ZDXE 3HE6C 3E6FA 1E8ZA 3VE0A 4AWJC 2PYED 2VLRE 1BAFH 4D0BB 2VL5B 2W0FB 4GUQA 2OT5A 4BR6A 4S1QL 5JIKA 5EEVA 3L5IA 1XGYH 3DMMC 3F85A 5EO9A 5AW3B 5FHBL 1OGTB 2LFRA 2GTSA 3S3SA 3UZEA 3ZRSA 3UEQA 4G42A 4R7NA 1NMCB 3LKQB 1ILUA 2EACA 4YC2C 1LO0L 5I1DB 2JJVA 2E47A 5E4EB 5DHVB 3VXRB 3T6VA 2OMVA 2BVYA 1GKEA 1BM3H 1PX4A 5C9KA 4HUUA 1WPXA 1OHZA 3BDXA 1OT1A 1UB6B 3P0GB 4PQXA 4XP4L 4DUWA 1RPOA 2VKXA 5C0RL 1CYWA 1SBSH 1RZKC 2ZCKH 2GUOB 3MRJB 2DYRC 5EZOL 1S5HB 1QP1A 6PAZA 3GGWB 4KI5F 1H6EA 1OGSA 4MAUH 3VI3F 4DGVH 3VXMD 4KZDL 3ALPA 3GMQB 5MERB 3TBCA 1IGYB 4TULH 4Y4FB 4QY8A 4FI6A 1R33A 1YPZF 4I55A 1TZIA 5IYDO 2QVMA 3D2TA 5GS2D 3C60B 3LTVA 4J6RL 1UWFA 1NFIA 3PP4H 3V6FA 2XWDA 1ID5I 1BOGB 2HTKD 2D9CA 2D2CB 2X89D 1P6AB 4BFRA 1B0IA 3I6LE 3VFPB 2A79B 1VFAA 3Q6FB 3ECVA 2IWFA 3E89A 4FHBD 3VD3A 4WUUA 4LE8A 4MGXA 3MRMA 1BZOA 1QNIA 2VDQB 3OHMB 2OMTA 4AE0A 1E50A 3TH2T 3CFKB 4F37F 2WBJD 2AC0A 2E9JA 1VKXA 1T7ZA 4DPRA 1XT5A 5CAYB 2HB0A 4XMPH 4JI2O 2PXYA 1XQ8A 4HWBH 4WI6A 1JPFA 3W2DL 1ZV2A 4Y1TA 3G6JB 2NNCA 3H2WA 4Z7UA 5IR1B 1R9FA 2E3CA 2LGQA 4YSQA 1YQ2A 4EZJA 5JHLA 1Z5WA 2DW5A 1KB9K 4MDJB 4DW0A 5D5QA 3IFXA 3ABTA 3R1GH 4LSVH 3CBKB 5DR5L 4Q89A 2WAMA 3QR2A 5HJGA 4MW8A 3H3BC 4LFHG 1D5RA 4WCEV 3ZMEA 2VNCA 4AYMC 1QRNA 4TUJA 1LUVA 4Z3EA 4K73A 4YDKL 4ZXBB 1VAHA 4ELKB 3MGOA 1BVZA 4FJCC 1X44A 2FEDC 2P80D 2IH1A 3B6SB 5LAXA 1HDJA 5HD8D 5A2JH 4D7TA 5ALBH 4KZCA 3GBLA 4ZFOB 2JSFA 5JDJA 3O6LH 3M17B 1HZKA 2XFXA 4QEGA 4W9LC 2E27L 1HKLH 2O5YH 2I9TB 3HPJB 3M46A 1EVUA 1NCWL 1Y67A 1BPVA 5EZLB 4K94L 4BFIA 1KLGB 4M3JA 4WU7A 3AB0C 3DKHA 2VZUA 5KJ4A 5CMAB 1LE9B 2PYEB 5I66B 3GGWA 4YHKH 2V2TA 5FM5M 1NCJA 2UUDK 4JFXB 3T4DA 1JL8A 1I1CA 2WBXA 2JQZA 2WVVB 3B83A 3GS0A 3FTZA 4NO2A 3L4WA 3HG3A 3S4SB 4X42A 2HH0L 2XV3A 3VFRA 2RMNA 3QB7C 1CVSC 2BHFA 3QFDA 4NFBA 4B53A 3EKCA 3V4VA 3ARWA 4NZTL 2IBBA 2G0KA 4IRSB 4K94C 4HCRA 1H0DA 1TCRB 4GI8A 4HJSA 4U6XB 4ZQTA 5F7UA 4MVMA 4HU2A 3WHXA 1TDQA 4D8PA 3N2GB 3AEIA 3RYHB 4WEBL 5I18H 2W94A 2KKQA 4JO4H 2VDOB 5GONB 1Q9OB 3F01A 3N55A 4MT8A 1M2VB 5LQBH 3BAWA 3WYRA 5DJAA 3TVMD 1MUJB 3NCEB 5AWNL 4QGYA 4ES9A 5ANME 3IF1B 5I6XC 1BYOA 1AQMA 3QEQD 3FO9B 1ZL8B 4WW2F 5B3NA 2OYQA 4JL1A 4OJYA 2A6JB 1N10A 3DROA 2YN3A 4RNRA 1PNDA 5DU7A 4I50A 1W8OA 4KOBA 1G5GA 3F04A 3FQUB 4M8RA 4UQEA 4YBLB 1ZEAH 1TETH 2ATKA 5IMKA 2NR6A 4OSUL 5C0ND 1KTKE 1QBZA 4MMYB 1Z2GA 2OJEB 1DVFD 1FSKC 1MXGA 2EEFA 3B8YA 3QNYB 4N2BA 4OFPA 4W9KC 3WMQA 3DJTA 5KVEE 1AFVL 4B3VA 4L8SC 3QIWC 3EG9B 3VAEA 1JA8A 1KIPA 1F4YH 5L3CA 4E41A 1PZDA 1IILE 5HYIA 1N33B 3A6CL 4G6AD 5F6IB 2WXIA 3MRBA 4HULB 5DXWA 1T89A 4M8VA 1TYEB 4F6RB 1OAQH 2VSCA 3MRCB 1F56A 4HC1A 4K8RL 4XXDB 3KWWB 3WL9B 2X6VA 4FA6A 2DM2A 1KJVB 3ARDA 1ASOA 4WF9V 2HFGH 1YN7A 4Z7IA 4WO0A 1NBCA 4KUCD 5JNYB 3BP7B 3H7LA 3LZNA 3LIZL 1TUPA 1DFXA 3IFNH 2I60H 4F91B 5DUPH 3GIZH 1Q72L 1A4KB 1REIA 5D70L 4JI8B 3L4TA 1MREL 1SYSA 3T3PE 2DH2A 3ZDZF 3Q4HA 5D6DA 2DEWX 1HHJB 1QR1B 3GHEL 5MEPB 5DHDA 4RIRB 4TUYB 2DMGA 1SQPH 5AVQB 2EDYA 2FX8L 3FO2B 1CICB 1NEZB 4I4WB 3SDAD 1U4EA 5D7SL 4DV3O 3BDBA 3N2GA 1ZY9A 3PWPD 3UAJC 4HSCX 2VISB 4KKCC 5K1PA 1VP7A 1T22B 4UB0L 1WCBB 2XV2A 2KKWA 5CINH 5C9JB 5I8CB 2NY7H 2X53A 1PLBA 4QRPD 4LEOB 2IXQA 1V3MA 4HDIB 1Z9MA 1MSDA 1GOGA 1ZHKB 4F6EA 2A7BA 4APXA 4NZ8A 4M02A 3QDJA 5D4HA 4OF0A 1ACZA 1MA1A 1NBVH 1HOEA 4EKWA 2BXYA 4YX2H 3I02B 1WFTA 1IGIL 1KIQA 3RYFA 5E8PA 4JVWA 2K7QA 3BWSA 1WAAF 3GLAA 1J87A 3ARGB 5C0FA 3DETD 5FO9A 3HKEA 1TF4A 5AAMA 2Y9RT 2ICEB 4EDWL 4V2BA 1Z5YD 4MXVF 1EJOL 4KPHH 5T3XD 4NB7A 5E7BA 3KPRE 1GZQA 2VQEO 1OO2A 1J1PL 4G80B 4JJOA 1FNHA 3K5OA 1EUTA 4X6BA 3ZEDA 3STZC 4AV4A 1YAZA 3TIDB 3BYTA 1PD1A 2HYMA 1P5VA 3HAEG 1VQLV 3W9DB 4NCC2 3T0DA 5IJ0A 1T5XA 4PS8A 2FYYA 1B6QA 5I5MA 2BFVH 3NCCB 1T22A 3BUTA 4J42A 2JK5C 1E5BA 5CGBA 2D3LA 3T0EB 4EMZA 3PAVA 5C0DB 3DXRA 3PWUB 3ASNC 3T6XA </