4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
5B1BC 3AG1C 3FB5C 1KKDA 4MTGA 4UUJC 4GX0A 1M56C 2H8PC 2EILC 3KG2A 4X88A 1OCOC 2IH1C 2ZD9A 2IH3C 3VOUA 2BOCC 4JTDB 4OXSA 4R6ZA 2X6BA 5KUMA 3TETA 4MVOA 3AG4C 4MTOA 1XL6A 2X6CA 2ITCC 5EC2C 5CBGA 4RAIA 3LUTB 1V54C 3SPHA 3SYPA 1ZWIC 4R50A 2A0LA 4P9PA 2KB1A 2JK5C 4P30A 4PDVA 2DWDC 3RVZA 3BEHA 3SPGA 4GX5A 2ZXWC 2X6AA 3E8BA 3F7YC 2DWEC 4MVQA 2WLNA 3K0DA 4PDLA 4XDJA 3RBZA 2HVKC 2Q69A 1XL4A 4KFMA 4PDMA 3SYAA 2P7TC 3RVYA 2EINC 3K03A 2WLHA 2R9RB 4QE9A 5B3SC 3SPCA 4PA9A 2WLKA 4R8CA 1V55C 2EIKC 3F5WC 4MW8A 4DXWA 5EK0A 3ASNC 1OCRC 5KUKA 5E1AC 3T4DA 4MVUA 3FB6C 3TCUA 2Q6AA 2A79B 3UM7A 1P7BA 4QNHB 3FB8C 3SYCA 4MVMA 2Y69C 4QE7A 2DYSC 2ITDC 3PJSK 4P9OA 4BW5A 3T4ZA 4I9WA 4PA3A 3STLC 3LDEA 5CBHA 1S5HC 4XDLA 3T1CA 3X2QC 2QTOA 3K04A 4X8AA 2WLLA 4WFGA 3ASOC 1K4DC 2HFEC 4RO2A 3R65A 4MVZA 4PA6A 4X89A 5EBLC 3ZRSA 3GB7C 4LCUC 3ABKC 4MVSA 3OR7C 4PA4A 2YEVA 3EFFK 2HG5C 4PDRA 3K08A 1LNQA 2OCCC 3LDDA 4LBEC 3E89A 4MS2A 2WLIA 3WG7C 3LNMB 1K4CC 4MSWC 3K0GA 4WFHA 3AG2C 4GX2A 3OGCC 4MW3A 4MVRA 2AHZA 5J9PC 3K06A 2Q68A 3LDCA 4H33A 5EBWC 4WFFA 2AHYA 5CBFA 1QLEC 3IGAC 1M57C 4EKWA 4F4LA 4GX1A 2WLLB 4MTFA 1J95A 2HVJC 4CBCA 5B1AC 1R3KC 4PA7A 1R3LC 4ZBMA 3ABMC 3FB7C 3OR6C 4G28B 5EBMC 2EIMC 4G27B 3SPIA 3F7VC 5IY5C 2A9HA 4JTCB 2EIJC 4J9ZB 4RUFA 3T2MA 4WFEA 3UKMA 1OCCC 2Q67A 3E8FA 4HZ3A 2WLIB 1OCZC 3E8GA 3OUSA 5BZBA 3HPLC 3SYQA 2K1EA 4HYOA 4P2ZA 3SPJA 2NLJC 2W0FC 3E86A 3STZC 3ZJZA 1R3JC 2WLJA 3E8HA 4XDKA 1JVMA 1G4YB 4R7CA 2ATKC 3JYCA 3E83A 2DYRC 3OUFA 3AG3C 4H37A 3ABLC 2WLMA 4RUEA 1ORQC 3RW0A 3IFXA 4J9YB 1R3IC 3SYOA 2QKSA 4JTAB 1BL8A 4LP8A 3SJQC 4TWKA 2BOBC 5EC1C 2HJFC
chains in the Genus database with same CATH superfamily
1KKDA 3ZEDA 4GX0A 2Q7HA 3K5LA 4LF5O 2BSKB 3LNNA 1WAZA 5LOVA 1US6A 5FNVA 1I94O 3M99B 4YHHB 2X6CA 3JALB 2F1MA 5GONB 1YITV 4RQEA 2V4DA 2FMLA 2K9PA 4IYHA 1VQ4V 3T1YB 5DEDA 2X6AA 1WPXA 4MVQA 1VF6C 1WPBA 1NI8A 4JYBA 4CH6A 4PA9A 3W7XA 1KMIZ 4A5UB 1B04A 4R8CA 1YXBA 4CS2A 2ZQMA 3RWRD 5C8YB 3R66A 2Q6AA 4BIOA 3W7SA 1QNMA 4JAAA 4DUYO 4TUYB 3HKBB 2XTAA 4DR4O 3PJSK 2QKAA 4O4IB 5LP6A 3ASOC 2XAFA 1RM1B 4B08A 5CA1A 3OEHG 1R6NA 3W7UA 4GLXA 1HNZO 3VQWA 4DR7O 5LYJB 2IJJA 4ZIBA 3K57A 4LBEC 1N8RW 1SZXA 3CRQA 4MS2A 2MK3A 4CC5A 1BGYH 2RCVA 1JR9A 2CAZC 1VMGA 1AVMA 3H1LH 3BHPA 5DN6G 4UVBA 4GKKB 1E79G 2WLLB 1XUQA 1N0JA 1PPJH 4G27B 3DC6A 3F7VC 4OPHA 4DUZB 4J9ZB 3K5OA 2JJ1G 1EN4A 3BA8A 1GN3A 2JVDA 1KQSU 4NTXA 4GT1A 1TUEB 4LF7O 3E86A 1P84F 2UUBO 4TUYA 2UXCB 3RGBA 1VF7A 2HJFC 1IVSA 3LSQA 5LYJA 2XUMA 3B2EE 3TGUH 5IJ0B 2PYJA 4U3FH 1K33A 2P67A 5EC2C 2E3CA 5TISZ 3FYEB 3ZHSA 3OEEG 1FJGO 2XAHA 3F7YC 4JI1B 4PI2A 5EYPA 4NXMB 5LGNA 4TOIA 5LMNO 3P3NA 3OT7A 4DR6B 4MVUA 2FTKA 2KSDA 5BMVA 2XAQA 4BW5A 4YIPA 1JOYA 1N34O 1VQ7V 2KKWA 4PA3A 3STLC 2G38A 4OX9B 4LFAO 2PF4E 4X64B 2VWJA 2LJ2A 4GZRB 5LA6A 2CDYA 1ZLZA 4MVSA 4DV2B 2F93B 1NZ6A 4C7UA 4B3RO 5KAIZ 3UT5A 1CPYA 2UUCB 4UCSA 1TGOA 3SDLA 1BCCH 1K4CC 1YVWA 4J10A 4IGGA 3HKEA 3GWOA 2JS3A 5EBWC 5LP6C 3B77A 1FYJA 3IAYA 1QLEB 2HEPA 3ABUA 4CBCA 1I94B 4WFAV 5JCOA 3SR2C 4G28B 2Y0IA 4TQDA 3SPIA 2PUSA 1OCCC 1QHTA 2R9AA 2CTPA 2EZPA 4DO2A 2QKCA 4LR3A 3ZN1A 1FFTB 3P32A 2PI4A 5D5QA 4B3TO 5CN0A 1NR1A 4X65O 5CA3A 2ETNA 2R72A 1YI2V 4LF8O 1NS1A 1KP2A 5B1BB 4X88A 4DR4B 4GKJB 3OTOO 2BOCC 1URFA 5LXTA 5FLXN 1NKDA 4DR5O 2Z0AA 5AG2A 2ODMA 1HNZB 4PDVA 4DR7B 2YIDA 2LW1A 3BABA 3Q4HB 2YI9A 1XHZA 3UQ8A 2P90A 4JI6O 3SYAA 1RP3B 3VQXA 1SQFA 2EIKC 4I9QA 2Y48A 1XMOO 1V55B 2Y4TA 2UXDO 2A79B 5LBQA 1SQGA 2DOSA 3RYIA 5J2UB 3UO3A 5A9GA 2QSAA 3JAKB 1FXKB 3C3TA 4O2BA 4PA6A 5EBLC 3L73H 3UCSC 2ZE6A 2UUBB 1YZBA 2UXXA 5BR8B 4X1KA 4MSWC 3OGCC 1IBLB 3AG2B 4UB6Z 4NVPA 1Z5WA 1XHXA 1K9MW 4E4EA 3Q4HA 4F4LA 2UU9O 4B3MO 2CH7B 1Y6XA 2HVJC 2GBOA 2YI8A 3BAAA 2V1DA 1MNGA 5DECA 1NVPB 4ASUG 4LNUA 1OCZB 4P2ZA 4AHCA 4G2KA 1AP5A 1SQQH 1SKVA 5J2UA 5LMNB 4W4KA 3RW0A 4NB5A 3JAKA 5JCOC 4QPJA 4CZZA 1D2DA 1FXKA 3U10A 3CWBH 4I4TB 2ADQB 2FYUH 4DV5O 1TVKA 5JWPA 2Q0AA 1JA8A 5H6RA 5L3DA 1M56B 1XDCA 5DM6V 4MTOA 1XL6A 5H6QA 1RPOA 3CRMA 1D5AA 4F6EA 3BY6A 1V54C 1K3EA 4UCRA 5JVDB 5JJEB 2DWDC 1YJ9V 1QBZA 1Q8IA 5J2TB 1YCIA 5ITZA 1KUQA 3FB6C 1S0VA 3K9SA 1GMGA 2A7WA 2DYSC 1GTOA 4JAUA 4FVMA 3T1CA 2EJRA 4ICGA 3CHXA 5KHIA 4I4TA 1VF5B 2ZXWB 2LFRA 3ABKC 4YY3O 4FM0A 2VQEO 2EINB 1I0HA 4BR6A 3RYCA 3ETEA 3B8MA 5J9PC 2IU0A 3QO7A 3LDCA 2ZDIC 4LF8B 1FPOA 5CBFA 3JD4A 3CXCU 2A06H 2QGNA 3OTOB 1GK9A 4YHHO 3O65A 2AZ2A 5J2TA 3FB7C 2ILMA 1NVPD 1E1RG 2Q67A 4GYCB 3BPZA 2XAGA 4I7ZB 2UUAO 5FL7G 4JI7B 1NR7A 1HNXB 3HPLC 1I5XA 4JI6B 1Q6UA 4DRXA 1BT8A 1JVMA 3E83A 3OMNB 1BQ0A 2DE0X 2UXDB 2CTQA 1NT2B 3A8TA 4RQFA 2ZD9A 2EILB 4R6ZA 2X6BA 3K58A 4X1IB 3G6BA 3OE7G 2OIGA 3KCYA 1Q7YW 1U97A 2DWEC 3RBZA 1YHQV 2YXHA 2R70A 3RVYA 5B3SC 3SPCA 3LSUA 2P06A 1EN5A 1Y74B 1MZEA 3CXHF 2UU9B 4B3MB 1TUBB 1W0JG 1OCRB 2Q7EA 1T5EA 1QU7A 1VQ6V 4DUZO 3OMIB 5CBHA 2MW2B 3H1HH 3JD0A 4IHJB 3F5TA 1MSDA 1Z5VA 3OAAG 4WFGA 2HFEC 5BXZA 4RO2A 1NJIW 5H9CA 4K8ZA 4X89A 1SF9A 1XI1A 3GB7C 2DJVA 2Q4PA 3ZS8C 2UXCO 1ZL8A 3ZIAG 3K9AA 2GTAA 2QWPB 4UFZA 4NR1A 3WG7B 4X1IA 1E1QG 2JGDB 2ZKOA 1Y76B 5IE9A 4L8JA 2AZ0A 2QJ1A 4FLUA 5KA6A 5JJJB 1M57C 4JYYA 4CS4A 1QCEA 2GUZA 2YEVB 4WF9V 4WFEA 1AB3A 2XAJA 1OJHA 5GTHZ 3CC2V 3E8HA 2QWOB 4WBNA 3QF7A 4XBFA 4DR1B 4DR6O 5IYCO 2JGUA 2RDCA 3CX5F 4LH6A 5K1XA 3KG2A 2IH1C 5A2QN 2BE3A 5KMGB 1OCOB 4OX9O 2E76B 1PM9A 1SZTA 1F51A 4LWSA 2JGDA 1Y76A 2ZT9B 4QIWF 1SETA 4DV2O 2FL4A 2OWOA 3B40A 2VQEB 3I56V 1WA8A 2ZXWC 4JZ2A 4DV7O 3GWKC 1YJNV 4PDMA 3D36A 2OCHA 2EINC 2IJKA 2DQ3A 3OTFA 3CCEV 4ZOLA 4MTXA 2NR5A 5H5NA 2OTJV 3B8NA 3APOA 2LFSA 4OGQB 1KD1W 2QM8A 1XREA 4IIJB 4H0LB 4LF4B 2ITDC 4FLXA 2UUAB 4F6RA 1O9HA 1K4DC 4LCUC 1U96A 3DGEA 2HR3A 1HWYA 2HG5C 4I5SA 3ZMZA 1GO3F 4X20A 1W0KG 5EIBC 5IWAB 3D3QA 1VIBA 2NN4A 2QM7A 2BTQB 3JD3A 4D7SA 4H33A 5KX5B 4WFFA 1AR1B 4GKJO 1XNQO 4EKWA 1ROPA 3ZHUA 4K0KB 3JASB 1R3LC 1ZX3A 2KG7B 5F2VO 3BA9A 1Q6HA 3CRRA 4NXNB 4FZ1A 1EM1A 1DGSA 3RFRA 1XEQA 2BSKA 1IX9A 1VP7A 1WLEA 1PL4A 3JALA 1K97A 3KKYA 4IIJA 5GONA 4X62O 4PD4F 1H2LA 4H37A 5FPRA 4ZKIA 5B1NA 1BE3H 4BAYA 4YIOA 2BOBC 2ZNIA 1I7FA 1KC8W 1S76D 1HW7A 4BIUA 4EB6B 1N32B 5C8YA 2YSUB 4DR2O 4WFBV 1LUWA 2RQ6A 5KX5A 3HKBA 4JZGA 4O4IA 5BR8O 3K0DA 1BHBA 1XL4A 1IBLO 3U0ZA 2R9RB 3AG1B 1VQNV 3ASNC 5C93A 3L71H 3JARB 3TCUA 4JI4B 3I5DA 4DV0B 1SC5B 1SQBH 4QE7A 3RYHB 1K7DA 3LDEA 1XILA 2WLLA 3D36C 4CH5A 1P49A 3EFFK 2WA4A 1N36B 2N74A 2P6JA 2L6LA 1MABG 3IC9A 1NH2D 5KHJA 1GRJA 1P7GA 2AHYA 3AG7A 3I55V 2CUGA 2EJ7A 2Q8VA 1QVGU 5B1AB 2W6IG 3OR6C 5KAFZ 4EFEA 4NTWA 4JI5O 2EIJC 5IY5B 5IJ0A 3W7WA 1EFRG 1F23A 4HZ3A 3JARA 1PNLA 1K5QA 1WB8A 4JAVA 2K1EA 4DV7B 3CCUV 1VQ8V 2GHYA 1GH6A 1XMQB 2OTLV 1G4YB 3RYHA 1NBMG 4JGSA 3ABLB 3EXAA 3P30A 3ZRXA 2ZINA 3NXSA 4Z1VA 4JF3A 4JI3B 2Y4UA 2EIMB 3VOUA 1L1FA 4OXSA 3OM3B 4DK0A 4HBNA 3ZHTA 1WP8A 2A3QA 3ZMTA 1L0LH 4O4LB 4P30A 2YIBD 3SPGA 2HHHO 4HNAB 2ARHA 3IC7A 3JSLA 1MA1A 2LO1A 2WLKA 2W6JG 3TXQA 4MW8A 5EK0A 1IZ3A 2PYLA 1XNQB 4LFCO 4PHZA 4UCUA 3QO8A 1P7BA 1Y67A 4LF9O 4JI7O 3H1KH 3BFRA 5LGUA 1RM1C 1Q82W 1HNXO 5LGTA 3A0BZ 3N27A 4MVZA 1YSCA 4AQYO 4PDRA 3K08A 4X62B 1S3JA 4JI8B 1LR1A 4JI2B 2XOKG 3TK1A 3VBBA 3ZRWB 2IW5A 3M7MX 4O4LA 1PKXA 5IDJA 3T1HB 3TJTA 4Q20A 1JCHA 3PN1A 1AI6A 2WPDG 3L72H 3HKCB 4DR2B 4J7ZA 3ZMVA 5CA0B 3H01A 3ABMB 4JV5O 3G80A 3HR0A 1M93A 3GVMA 4EEQA 5BZBA 2Q9LA 4KUMA 4UCVA 3M8AA 4PV1B 3K3WA 2H94A 4AILC 2BTOA 4FK5C 2NNUA 2ATKC 1IDSA 3OUFA 5JH7B 1YTFB 4RUEA 1HR0B 4J9YB 2DYRB 4LH7A 3CCQV 3AG1C 4MTGA 1MOFA 1HNWO 2Z3YA 2Y0PA 1CEZA 2H8PC 1Q81W 2VRZA 4TV8B 4FFBB 2YXYA 3VQVA 2CE4A 4FZ0A 3AG4B 1NTZH 2VWKA 3FKSG 3ABTA 1ZWIC 2WAMA 1DLBA 3CPWU 3RVZA 1F7YA 1H2MA 2ZM6B 4XDJA 3HKCA 2P7TC 3K59A 5CA0A 3ZBHA 2LQTA 1IBMO 1MZFA 1R1BA 1SQPH 5L3FA 1QVFU 1Z2GA 4JI5B 3T4ZA 1DK1A 2CH7A 4PJ0Z 2PTMA 3P3PA 1RSOB 2CTWA 3R65A 1JX9A 4TV9B 3CE2A 3WB0A 4W4LA 3EHBB 4ZI7B 3G71V 1LNQA 3QVNA 4FFBA 4DR1O 1YDXA 2OCCB 4L87A 3THOA 2HJDA 4K8XA 1MSWD 1MMMA 3OFNG 1QLEC 1XQ8A 1VQ9V 5KHHA 2QDOA 2PI5A 2UXBO 2EIMC 1L8DA 4QJFB 1H2SB 1AI5A 1HP8A 2YICA 2OYQA 1FAFA 4J41A 1H2GA 2WLIB 3L74H 2HHHB 3A0RA 4CC6A 3L9DA 1AJPA 1N33O 3VQYA 1YTFD 2NLJC 1KKCA 1OHHG 1M1KW 3WB1A 4DV6B 4ZHQB 1X4TA 3CYOA 3QNEA 3W7TA 5JVDA 1GN2A 1QQCA 1AJNA 1AROP 2OT5A 4LFCB 4TWKA 5B1BC 4TQFA 2FKXA 4LF4O 1AI4A 4LF9B 3RYFB 5EZYB 1WNSA 3WFVA 5KHKA 3SYPA 2A0LA 1IXMA 4UV9A 4AQYB 1DTOA 4I50B 3WB2A 1SQVH 5IWAO 2CGNA 3MD0A 1B06A 2YC0A 2HVKC 4DW0A 2OIEA 4KFMA 4GCZA 4FLZA 2P5OA 2WLHA 1VEWA 5IYZB 1V55C 1UJWB 1O9GA 5IJ9B 3D3IA 3CS5A 4K0KO 4ZHQA 1VARA 4NXNO 2FB5A 4OPAA 5KHGA 4GUNA 4JV5B 1GM9A 3CSXA 4X66B 3AK2A 1FXKC 5K1PA 1OV9A 4X8AA 3ASOB 1R6KA 3ICXA 2ZIOA 4PA4A 3S3XA 4DV4O 5JJNB 2F95B 5EZYA 2KQXA 1IBKO 3CEIA 3K0GA 3AG2C 4PELA 1HNWB 4O2AB 3N2GB 1G6UA 2Y69B 4I55B 4D6TH 4I0XB 3A2FA 4K3AA 1N32O 1I5YA 1J95A 1GAXA 2YUAA 4FIPC 4PA7A 3CMEV 1QR8A 4J80A 4J7JA 4B7KA 5IYZA 3T2MA 3E8FA 1OCZC 4J42A 3U11A 3K79A 2XHBA 2LGWA 3H1IH 1AR4A 1EBOA 5BY1A 4R7CA 4B7EA 1PV0A 2VQFB 1IBMB 4NKGB 4YJ2B 3DSQA 5B1OA 4K35A 3ZHVA 4JI4O 3MAQA 3FB5C 4DV0O 4UUJC 1GM8A 1JMKC 1M56C 2QEXV 1Y74A 5KUMA 4LFBO 2B9ZA 4U7NA 1TUBA 2F23A 1W2BU 4LF6O 3C90A 3CB2A 2JK5C 3N2GA 1N36O 4UXNA 3BEHA 1QLNA 4I55A 4I0XA 4IHJA 3E8BA 1ENVA 2WLNA 3AK1A 3JATB 1AP6A 3JCZA 3KCXA 2IM9A 1BSMA 4FMTA 4FLWA 5EIBD 1WB7A 5LOVB 5FNVB 2C2AA 4CH4A 1XNRO 1Q86W 1BS3A 1S5JA 3ETDA 4KHPO 2B1GA 1FXVA 2LGQA 1THZA 3SYCA 2UXBB 4YJ2A 4FM2A 1XOUA 2QTOA 2WSSG 3CC7V 1N33B 3ZRSA 3OGIB 3O9OA 1G8MA 1XMQO 2M6YA 2YEVA 2ZR3A 3SJBC 1GM7A 2ZIMA 1ZSPA 4TSFG 1K34A 3FD9A 1VQOV 4MVRA 1LUVA 4DK1A 3ML0A 4JI3O 3QG5A 3ETQA 4ABMA 4KL1A 5LP6B 1EZJA 1R6TA 2B1IA 1VQPV 3JATA 3CRCA 5CA1B 1B3QA 3X2QB 3MHSC 5B66Z 2R9IA 4U3JB 4RUFA 3ZMSA 2E5LB 5IYBO 1RFYA 4AI8A 1OCCB 5KMGA 1BMFG 3AK3A 1KECA 2HKOA 2GDSA 2GSMB 3STZC 3ZJZA 2WLJA 4BIZA 4LC1A 3J81N 3J80N 5L3CA 3SGIA 1FKAO 1S77D 1BZKA 1Q3EA 1WN7A 3HKDB 2QWRB 3DTUB 1NH2B 1AR5A 4E2LA 1EN6A 2M7WA 4JI0O 5FPOA 2EILC 5L3GA 3G6EV 4FLYA 4H13B 2Z5UA 3CRAA 3TETA 1CXZB 3FX7A 2ITCC 1Y66A 5CMUA 4RAIA 3TXSA 1NU1H 4JYAO 2KB1A 2DN9A 4DV4B 1PL0A 4JI8O 4FFKA 2JIZG 4JI2O 1VQKV 3AG3B 1QR9A 1FFXB 1IBKB 1VQ5V 4U3JA 3T1HO 3K03A 3J7AU 2EX3A 1PP9H 1YIJV 1KU9A 1OCRC 2EIKB 2W0XA 2ZE8A 1J5EO 2ZR2A 2BTQA 2AW9A 1Q6IA 1JJOA 2Y69C 1FXHA 3HKDA 2VS0A 3L75H 3JASA 5EYPB 2KG7A 1JPXA 2RJZA 3CC4V 1H8EG 1FD9A 3CP1A 3JD1A 1HR0O 1H2NA 5KA5A 4YXWG 3WG7C 5BMVB 3CMAV 2H3OA 3ZN0A 4UB8Z 4MT8A 1S5LZ 5D5PA 1SESA 3JAMN 2JJ2G 4X1YB 1V9PA 4LFBB 1FFXA 5LA6B 2F4VO 2A9HA 3UT5B 4LF6B 2D2CB 4EB6A 3E8GA 4J7KA 2ZE5A 2ZM6O 3SYQA 4HYOA 2O57A 3HKEB 2W0FC 4NTYA 4B3SB 5H2FZ 2CTRA 3WU2Z 2WLMA 3L70H 4BWAA 1NQTA 1JQ0A 1XNRB 3CD6V 3ZCCA 4LP8A 2X0LA 2YIBA 4KHPB 5LL6Y 1H8HG 4DYLA 2CK3G 1GN4A 1OCOC 4JTDB 3K5MA 1NTMH 4NYKA 4R50A 3QTCA 3BCCH 1V54B 3H1JH 4DV3B 3DXRB 1SS3A 1AILA 4X1YA 4DV1O 2AGAA 4RWUA 2WWWA 2Q69A 3ZMUA 4JPRA 1SRYA 1MG1A 1WP7A 3CCJV 5L3EA 4Z1MG 2F43G 5LMUO 1B6QA 5LXTB 1HDJA 2YDEA 4FPPA 3FYIB 4P9OA 4LF5B 4UV8A 2DYSB 4TT3G 1S5HC 1GN6A 3B4SA 3X2QC 3CCLV 2E74B 2N05A 1YF2A 1KP3A 4DV6O 4QGPA 3OR7C 2P4KA 3FFQA 3ABKB 3LDDA 1PD3A 2F66C 2CGOA 3LNMB 4WFHA 3CCRV 3N2KB 2ZCEA 4QPKA 2AHZA 3H9VA 2EBOA 4JI0B 3DXRA 3RYIB 2ZE7A 1COWG 1R3KC 3K5NA 4O2BB 3CCMV 1JJ2U 5EBMC 3KZIZ 4DUYB 4JTCB 2PGGA 4JYAB 5E79Z 4FLTA 1K5SA 4X1KB 2QR4A 2DW4A 3SPJA 1OZ0A 1P4RA 4XDKA 3SJAC 3E22B 3JYCA 3AG3C 1KB9F 1Q5OA 2IJHA 3IFXA 4HNAA 1J5EB 1SA0B 4N23A 3A0HZ 1M90W 2UXNA 1WJZA 2IH3C 4X66O 2HLDG 2JRIA 3N2KA 4LNUB 1X59A 5CBGA 3LUTB 4P9PA 3IJ4A 2X7RB 3ZX6A 2ZDIA 3CJHB 5CB4B 4UCTA 2L35A 1W59A 4U7OA 5L3BA 4PDLA 5HFLA 4LF7B 4FLVA 1D5NA 4JYCA 3B09A 1TVKB 5B3SB 4DXWA 5KUKA 5E1AC 3T4DA 3G67A 1SERA 4EFBA 3ZRWA 2B5UA 2P22C 3MHHC 4MVMA 1N4CA 1H2KA 3E22A 2F4VB 4BW9A 2BCCH 4UVAA 4UCOA 2EULA 1SA0A 2YIAA 1VQLV 5KLVH 4KP4A 1N0NA 5LHHA 5ITZB 2VQFO 1FJGB 2EZOA 2QWNB 2Q68A 2JS5A 3G4SV 3CJHA 1R73A 3UO2A 3JAWB 5JH7A 3ZHQA 1EZVH 5CB4A 1AJQA 1M57B 5B1AC 4FJCC 3ETGA 4ZBMA 1A32A 5B5EZ 5IY5C 4O4HB 1KYOF 1N34B 4TV8A 4CS3A 1F4NA 4LFAB 3RYCB 2Q0OC 1CP9A 4DV1B 1F4MA 1SQXH 4B3RB 1KBHA 1IURA 3ABLC 1ORQC 3OMAB 3E2EA 4DR3O 5IT9N 2YS8A 5LMUB 4JASA 2PY5A 1BL8A 1M4UA 3SJQC 1H38A 4Z2WA 5EC1C 2RN9A 2Q73A 2JDIG 1PNKA 1PNMA 2Q5ZA 3SPHA 2GV9A 4DRXB 3MDSA 3JAWA 3RN4A 4GX5A 1S72V 1Q43A 4IL6Z 2DQ0A 1RSOA 4TV9A 5GTIZ 4O4HA 3ZHRA 2Q7GA 4ZI7A 3EVKA 4B3TB 3F5WC 1TAEA 1ZAUA 3ZRVA 1AI7A 4X65B 5LHIA 1G1XB 3OD4A 1UFIA 5GW7A 3UM7A 2QM4A 2E5LO 1NTKH 1I08A 3K04A 4KXRA 4DR5B 1YEWA 1GKFA 3T1YO 1L0NH 4YJ3B 3E89A 5LHGA 2WLIA 2WA3A 4GX2A 2V7QG 1UPGA 4MW3A 3K06A 1XBLA 1DF4A 3BVOA 3DC5A 3S3WA 3IGAC 1JFFB 3JSNA 1FS0G 2IU3A 1XMOB 4GX1A 2QE7G 4MTFA 4FM1A 1Q90D 2RMKB 3FAVB 4H44B 3ABMC 3E35A 1BHAA 1ZL8B 3JCUZ 3UKMA 5IYDO 1VQMV 3RYFA 2HP8A 5JQGB 4J11A 2LP7A 3QO5A 3APQA 4N21A 3SJCC 1BQZA 3AEIA 1R3JC 3CCSV 3C3SA 2DYRC 4I50A 2DMXA 1R3IC 3D8CA 2LW7A 4UVCA 4Q6GA 4IT5A 2GUZB 1VF6A 4CH3A 2P4VA 2QA4V 4GKKO 2IJIA 4YJ3A 4MVOA 3AG4C 5IJ9A 3OW2U 2QTSA 4WBNB 1JFFA 1ZUQA 3FAVA 3LSSA 2ADPA 2AXTZ 1TA8A 3NR7A 2JEXA 4QE9A 2ZNJA 2RNBA 5JQGA 3RT3C 4PI0A 2XASA 3ASNB 4LWSB 2XNDG 4QNHB 3FB8C 1ZTEA 4HAMA 4O4JB 4DV5B 4X9QA 1K92A 4O2AA 4I9WA 3CCVV 3JD2A 1WA8B 2QWQB 4XDLA 2JEUA 3BRCA 4B3SO 1M9NA 2OCCC 2IBZH 4IYIA 4ZOLB 1K8AW 4JI1O 4DR3B 1IXBA 4NXMO 2YXLA 2GTSA 1RPRA 4F6RB 2E75B 1Y4MA 4DV3O 4X20B 2EIJB 4WCEV 4X64O 3OUSA 2PZSA 2N04A 1M5IA 4O4JA 2D3OW 2UUCO 4YY3B 1K73W 1DF5A 5HFMA 1YJWV 4D7TA 4DW1A 3SYOA 2QKSA 3HB3B 4JTAB 2XT9A
chains in the Genus database with same CATH topology
3AG1C 1KKDA 1H8HG 4MTGA 4RQFA 1MOFA 2CK3G 2Z3YA 4GX0A 1CEZA 2H8PC 1Q81W 1OCOC 2ZD9A 2EILB 4JTDB 4R6ZA 2X6BA 3M99B 2X6CA 3AG4B 1YITV 3FKSG 3ABTA 1ZWIC 3OE7G 2WAMA 4R50A 4RQEA 1DLBA 1V54B 3CPWU 3CCQV 1Q7YW 1VQ4V 3RVZA 2X6AA 1WPXA 2DWEC 4MVQA 4XDJA 2WWWA 3RBZA 2Q69A 1YHQV 3ZMUA 2P7TC 4JPRA 3RVYA 1SRYA 1MG1A 3CCJV 4JYBA 5B3SC 5L3EA 3SPCA 4PA9A 3W7XA 4R8CA 4Z1MG 2F43G 2ZQMA 1B6QA 1W0JG 1OCRB 2Q6AA 4FPPA 5L3FA 3W7SA 1QVFU 1VQ6V 3FYIB 3OMIB 4P9OA 3PJSK 4UV8A 3T4ZA 2DYSB 5CBHA 4TT3G 1S5HC 3JD0A 3X2QC 3CCLV 3OAAG 4WFGA 3ASOC 2HFEC 2XAFA 1NJIW 4RO2A 1RM1B 5H9CA 3OEHG 1KP3A 1R6NA 1JX9A 3R65A 4X89A 3W7UA 3GB7C 3EHBB 3OR7C 3G71V 3ABKB 2IJJA 1LNQA 3ZIAG 3LDDA 1PD3A 3K9AA 4LBEC 1N8RW 4MS2A 2MK3A 2OCCB 3LNMB 4WFHA 3CCRV 4L87A 4QPKA 3WG7B 2AHZA 1E1QG 2EBOA 1MSWD 3OFNG 5DN6G 1QLEC 5KA6A 4UVBA 1M57C 1VQ9V 1COWG 1E79G 2WLLB 1QCEA 1R3KC 3CCMV 1JJ2U 2PI5A 5EBMC 2EIMC 4G27B 3F7VC 2YEVB 4JTCB 4WF9V 4QJFB 4J9ZB 1AI5A 4WFEA 2JJ1G 1H2GA 1KQSU 1K5SA 2WLIB 3A0RA 2XAJA 4GT1A 1AJPA 1TUEB 2DW4A 3SPJA 1YTFD 2NLJC 3E86A 1OHHG 1OZ0A 1M1KW 3CC2V 3E8HA 1P4RA 3CYOA 4XDKA 3QNEA 3W7TA 3JYCA 3AG3C 4XBFA 2IJHA 3IFXA 1AJNA 1AROP 5IYCO 2OT5A 4TWKA 2HJFC 5B1BC 4N23A 3LSQA 1M90W 2UXNA 1AI4A 3KG2A 2IH1C 2IH3C 2HLDG 1OCOB 3WFVA 1K33A 1SZTA 2P67A 5EC2C 1F51A 5CBGA 3LUTB 3SYPA 4QIWF 1SETA 3FYEB 2A0LA 4P9PA 1IXMA 2X7RB 2ZDIA 4UV9A 3OEEG 1DTOA 2XAHA 3I56V 2ZXWC 3MD0A 3F7YC 4U7OA 4PDLA 5L3BA 5HFLA 2HVKC 4KFMA 1YJNV 4PDMA 3D36A 5LGNA 4GCZA 4JYCA 2EINC 2IJKA 2WLHA 2DQ3A 1V55C 1UJWB 5B3SB 4DXWA 3CCEV 4MTXA 5KUKA 5E1AC 3T4DA 3D3IA 4MVUA 1SERA 2OTJV 2FTKA 3B8NA 3ZRWA 2LFSA 1KD1W 2QM8A 2B5UA 3MHHC 4MVMA 2ITDC 2XAQA 4BW5A 1JOYA 1VQ7V 1GM9A 4PA3A 3STLC 1FXKC 4X8AA 4UVAA 1K4DC 1VQLV 3ASOB 1R6KA 4LCUC 4MVSA 4PA4A 3DGEA 4KP4A 1CPYA 2HR3A 1HWYA 2HG5C 4I5SA 3ZMZA 5LHHA 1GO3F 2EZOA 1W0KG 1K4CC 3K0GA 3AG2C 2Q68A 2QM7A 3JD3A 3GWOA 4H33A 4PELA 5EBWC 4WFFA 3G4SV 1R73A 3B77A 1AR1B 1AJQA 4EKWA 2Y69B 1ROPA 1QLEB 1M57B 1I5YA 1J95A 3ABUA 4CBCA 5B1AC 4FJCC 4FIPC 4PA7A 4WFAV 3ETGA 1R3LC 4ZBMA 3CMEV 4G28B 3SPIA 1QR8A 5IY5C 3T2MA 1OCCC 3E8FA 2EZPA 1F4NA 1OCZC 4DO2A 1CP9A 1WLEA 1F4MA 3K79A 3ZN1A 1K97A 1FFTB 1EBOA 3P32A 4R7CA 2PI4A 4H37A 3ABLC 1ORQC 3OMAB 5B1OA 4ZKIA 3E2EA 5CN0A 5B1NA 4JASA 1NR1A 1BL8A 5CA3A 3SJQC 4BAYA 1H38A 2BOBC 5EC1C 3FB5C 1YI2V 4UUJC 1KC8W 1KP2A 1GM8A 5B1BB 1M56C 2JDIG 4X88A 2QEXV 1S76D 4BIUA 2BOCC 5KUMA 1PNKA 4U7NA 1PNMA 2YSUB 1NKDA 4WFBV 1W2BU 3SPHA 2JK5C 4PDVA 4UXNA 3BEHA 1QLNA 4GX5A 1S72V 3E8BA 1ENVA 2WLNA 3K0DA 1BHBA 2P90A 1XL4A 2DQ0A 3JCZA 3SYAA 4FMTA 2R9RB 3AG1B 2EIKC 3F5WC 2Y48A 1VQNV 3ASNC 2C2AA 5C93A 1V55B 1Q86W 3ZRVA 1AI7A 3TCUA 5LHIA 3ETDA 2A79B 3UM7A 5GW7A 5LBQA 2B1GA 1FXVA 1THZA 3SYCA 4QE7A 1K7DA 3LDEA 2QTOA 3K04A 2WLLA 2WSSG 3CC7V 1FXKB 4PA6A 5EBLC 3ZRSA 1G8MA 2YEVA 3EFFK 1GKFA 2ZR3A 1GM7A 2UXXA 3E89A 5LHGA 2WLIA 1K34A 4TSFG 4MSWC 1VQOV 4GX2A 3OGCC 2V7QG 4MW3A 4MVRA 3K06A 1DF4A 2P6JA 1MABG 3AG2B 3ML0A 1NH2D 2AHYA 3IGAC 1K9MW 1FS0G 2IU3A 1EZJA 4F4LA 4GX1A 2QE7G 3I55V 2B1IA 4MTFA 2HVJC 1VQPV 1QVGU 3X2QB 5B1AB 2W6IG 3ABMC 3MHSC 3OR6C 2R9IA 3E35A 2EIJC 4RUFA 1BHAA 3ZMSA 3UKMA 5IY5B 2V1DA 5IYDO 5IYBO 3W7WA 1EFRG 1VQMV 1F23A 4HZ3A 1PNLA 1OCCB 2LP7A 3QO5A 1NVPB 1BMFG 1K5QA 4N21A 1KECA 4JAVA 4ASUG 2K1EA 1OCZB 4P2ZA 2HKOA 4G2KA 2GSMB 3AEIA 3STZC 1R3JC 3ZJZA 2WLJA 4BIZA 3CCSV 4LC1A 3CCUV 1VQ8V 2GHYA 2OTLV 5L3CA 1G4YB 1S77D 2DYRC 1NBMG 3RW0A 4JGSA 1R3IC 3ABLB 3P30A 3DTUB 3ZRXA 3NXSA 4QPJA 4CZZA 1FXKA 4UVCA 1NH2B 4JF3A 4E2LA 2M7WA 2EILC 5L3GA 3G6EV 2QA4V 2EIMB 5H6RA 2IJIA 5L3DA 1M56B 3VOUA 1L1FA 2Z5UA 4OXSA 3TETA 4MVOA 3OM3B 3AG4C 5DM6V 4MTOA 1XL6A 5H6QA 1RPOA 2ITCC 1Y66A 5CMUA 3OW2U 4RAIA 3BY6A 1V54C 1K3EA 3ZMTA 2KB1A 4P30A 1PL0A 2DWDC 1YJ9V 3SPGA 2JIZG 1QBZA 1VQKV 3AG3B 1QR9A 3LSSA 3IC7A 1VQ5V 3K03A 2JEXA 4QE9A 2WLKA 2W6JG 1YIJV 4MW8A 5EK0A 1OCRC 2EIKB 2XASA 3ASNB 3FB6C 1S0VA 2XNDG 2ZR2A 3QO8A 1P7BA 4QNHB 3FB8C 1GMGA 4HAMA 2Y69C 1FXHA 2DYSC 1K92A 4I9WA 3CCVV 1GTOA 3JD2A 4XDLA 4JAUA 3T1CA 2EJRA 5LGUA 1RM1C 1Q82W 2JEUA 5LGTA 2ZXWB 4MVZA 1YSCA 2LFRA 3ABKC 1JPXA 3CC4V 1H8EG 1M9NA 4PDRA 3K08A 2EINB 1S3JA 2OCCC 3CP1A 3JD1A 1K8AW 5KA5A 4YXWG 3WG7C 3ETEA 3B8MA 2XOKG 3TK1A 5J9PC 3VBBA 2IU0A 3ZRWB 3QO7A 3LDCA 3CMAV 2IW5A 2ZDIC 5IDJA 1PKXA 3ZN0A 4MT8A 5CBFA 1SESA 3JD4A 3CXCU 1RPRA 4Q20A 2JJ2G 1GK9A 1JCHA 1AI6A 2WPDG 1Y4MA 3FB7C 3ZMVA 2A9HA 3H01A 3ABMB 1NVPD 1E1RG 2Q67A 2XAGA 2EIJB 4WCEV 5FL7G 1NR7A 3E8GA 3OUSA 5BZBA 3HPLC 4KUMA 3SYQA 4HYOA 2W0FC 3K3WA 1I5XA 2H94A 2D3OW 1JVMA 4FK5C 1K73W 2NNUA 1DF5A 2ATKC 3OUFA 3E83A 5HFMA 1YTFB 3OMNB 4RUEA 2WLMA 1YJWV 4J9YB 2DYRB 1NQTA 1JQ0A 2QKSA 3HB3B 3SYOA 4JTAB 3CD6V 3ZCCA 4LP8A 2X0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1B C;  3AG1 C;  3FB5 C;  1KKD A;  4MTG A;  4UUJ C;  4GX0 A;  1M56 C;  2H8P C;  2EIL C;  3KG2 A;  4X88 A;  1OCO C;  2IH1 C;  2ZD9 A;  2IH3 C;  3VOU A;  2BOC C;  4JTD B;  4OXS A;  4R6Z A;  2X6B A;  5KUM A;  3TET A;  4MVO A;  3AG4 C;  4MTO A;  1XL6 A;  2X6C A;  2ITC C;  5EC2 C;  5CBG A;  4RAI A;  3LUT B;  1V54 C;  3SPH A;  3SYP A;  1ZWI C;  4R50 A;  2A0L A;  4P9P A;  2KB1 A;  2JK5 C;  4P30 A;  4PDV A;  2DWD C;  3RVZ A;  3BEH A;  3SPG A;  4GX5 A;  2ZXW C;  2X6A A;  3E8B A;  3F7Y C;  2DWE C;  4MVQ A;  2WLN A;  3K0D A;  4PDL A;  4XDJ A;  3RBZ A;  2HVK C;  2Q69 A;  1XL4 A;  4KFM A;  4PDM A;  3SYA A;  2P7T C;  3RVY A;  2EIN C;  3K03 A;  2WLH A;  2R9R B;  4QE9 A;  5B3S C;  3SPC A;  4PA9 A;  2WLK A;  4R8C A;  1V55 C;  2EIK C;  3F5W C;  4MW8 A;  4DXW A;  5EK0 A;  3ASN C;  1OCR C;  5KUK A;  5E1A C;  3T4D A;  4MVU A;  3FB6 C;  3TCU A;  2Q6A A;  2A79 B;  3UM7 A;  1P7B A;  4QNH B;  3FB8 C;  3SYC A;  4MVM A;  2Y69 C;  4QE7 A;  2DYS C;  2ITD C;  3PJS K;  4P9O A;  4BW5 A;  3T4Z A;  4I9W A;  4PA3 A;  3STL C;  3LDE A;  5CBH A;  1S5H C;  4XDL A;  3T1C A;  3X2Q C;  2QTO A;  3K04 A;  4X8A A;  2WLL A;  4WFG A;  3ASO C;  1K4D C;  2HFE C;  4RO2 A;  3R65 A;  4MVZ A;  4PA6 A;  4X89 A;  5EBL C;  3ZRS A;  3GB7 C;  4LCU C;  3ABK C;  4MVS A;  3OR7 C;  4PA4 A;  2YEV A;  3EFF K;  2HG5 C;  4PDR A;  3K08 A;  1LNQ A;  2OCC C;  3LDD A;  4LBE C;  3E89 A;  4MS2 A;  2WLI A;  3WG7 C;  3LNM B;  1K4C C;  4MSW C;  3K0G A;  4WFH A;  3AG2 C;  4GX2 A;  3OGC C;  4MW3 A;  4MVR A;  2AHZ A;  5J9P C;  3K06 A;  2Q68 A;  3LDC A;  4H33 A;  5EBW C;  4WFF A;  2AHY A;  5CBF A;  1QLE C;  3IGA C;  1M57 C;  4EKW A;  4F4L A;  4GX1 A;  2WLL B;  4MTF A;  1J95 A;  2HVJ C;  4CBC A;  5B1A C;  1R3K C;  4PA7 A;  1R3L C;  4ZBM A;  3ABM C;  3FB7 C;  3OR6 C;  4G28 B;  5EBM C;  2EIM C;  4G27 B;  3SPI A;  3F7V C;  5IY5 C;  2A9H A;  4JTC B;  2EIJ C;  4J9Z B;  4RUF A;  3T2M A;  4WFE A;  3UKM A;  1OCC C;  2Q67 A;  3E8F A;  4HZ3 A;  2WLI B;  1OCZ C;  3E8G A;  3OUS A;  5BZB A;  3HPL C;  3SYQ A;  2K1E A;  4HYO A;  4P2Z A;  3SPJ A;  2NLJ C;  2W0F C;  3E86 A;  3STZ C;  3ZJZ A;  1R3J C;  2WLJ A;  3E8H A;  4XDK A;  1JVM A;  1G4Y B;  4R7C A;  2ATK C;  3JYC A;  3E83 A;  2DYR C;  3OUF A;  3AG3 C;  4H37 A;  3ABL C;  2WLM A;  4RUE A;  1ORQ C;  3RW0 A;  3IFX A;  4J9Y B;  1R3I C;  3SYO A;  2QKS A;  4JTA B;  1BL8 A;  4LP8 A;  3SJQ C;  4TWK A;  2BOB C;  5EC1 C;  2HJF C; 
#chains in the Genus database with same CATH topology
 1KKD A;  3ZED A;  4GX0 A;  2Q7H A;  3K5L A;  4LF5 O;  2BSK B;  3LNN A;  1WAZ A;  5LOV A;  1US6 A;  5FNV A;  1I94 O;  3M99 B;  4YHH B;  2X6C A;  3JAL B;  2F1M A;  5GON B;  1YIT V;  4RQE A;  2V4D A;  2FML A;  2K9P A;  4IYH A;  1VQ4 V;  3T1Y B;  5DED A;  2X6A A;  1WPX A;  4MVQ A;  1VF6 C;  1WPB A;  1NI8 A;  4JYB A;  4CH6 A;  4PA9 A;  3W7X A;  1KMI Z;  4A5U B;  1B04 A;  4R8C A;  1YXB A;  4CS2 A;  2ZQM A;  3RWR D;  5C8Y B;  3R66 A;  2Q6A A;  4BIO A;  3W7S A;  1QNM A;  4JAA A;  4DUY O;  4TUY B;  3HKB B;  2XTA A;  4DR4 O;  3PJS K;  2QKA A;  4O4I B;  5LP6 A;  3ASO C;  2XAF A;  1RM1 B;  4B08 A;  5CA1 A;  3OEH G;  1R6N A;  3W7U A;  4GLX A;  1HNZ O;  3VQW A;  4DR7 O;  5LYJ B;  2IJJ A;  4ZIB A;  3K57 A;  4LBE C;  1N8R W;  1SZX A;  3CRQ A;  4MS2 A;  2MK3 A;  4CC5 A;  1BGY H;  2RCV A;  1JR9 A;  2CAZ C;  1VMG A;  1AVM A;  3H1L H;  3BHP A;  5DN6 G;  4UVB A;  4GKK B;  1E79 G;  2WLL B;  1XUQ A;  1N0J A;  1PPJ H;  4G27 B;  3DC6 A;  3F7V C;  4OPH A;  4DUZ B;  4J9Z B;  3K5O A;  2JJ1 G;  1EN4 A;  3BA8 A;  1GN3 A;  2JVD A;  1KQS U;  4NTX A;  4GT1 A;  1TUE B;  4LF7 O;  3E86 A;  1P84 F;  2UUB O;  4TUY A;  2UXC B;  3RGB A;  1VF7 A;  2HJF C;  1IVS A;  3LSQ A;  5LYJ A;  2XUM A;  3B2E E;  3TGU H;  5IJ0 B;  2PYJ A;  4U3F H;  1K33 A;  2P67 A;  5EC2 C;  2E3C A;  5TIS Z;  3FYE B;  3ZHS A;  3OEE G;  1FJG O;  2XAH A;  3F7Y C;  4JI1 B;  4PI2 A;  5EYP A;  4NXM B;  5LGN A;  4TOI A;  5LMN O;  3P3N A;  3OT7 A;  4DR6 B;  4MVU A;  2FTK A;  2KSD A;  5BMV A;  2XAQ A;  4BW5 A;  4YIP A;  1JOY A;  1N34 O;  1VQ7 V;  2KKW A;  4PA3 A;  3STL C;  2G38 A;  4OX9 B;  4LFA O;  2PF4 E;  4X64 B;  2VWJ A;  2LJ2 A;  4GZR B;  5LA6 A;  2CDY A;  1ZLZ A;  4MVS A;  4DV2 B;  2F93 B;  1NZ6 A;  4C7U A;  4B3R O;  5KAI Z;  3UT5 A;  1CPY A;  2UUC B;  4UCS A;  1TGO A;  3SDL A;  1BCC H;  1K4C C;  1YVW A;  4J10 A;  4IGG A;  3HKE A;  3GWO A;  2JS3 A;  5EBW C;  5LP6 C;  3B77 A;  1FYJ A;  3IAY A;  1QLE B;  2HEP A;  3ABU A;  4CBC A;  1I94 B;  4WFA V;  5JCO A;  3SR2 C;  4G28 B;  2Y0I A;  4TQD A;  3SPI A;  2PUS A;  1OCC C;  1QHT A;  2R9A A;  2CTP A;  2EZP A;  4DO2 A;  2QKC A;  4LR3 A;  3ZN1 A;  1FFT B;  3P32 A;  2PI4 A;  5D5Q A;  4B3T O;  5CN0 A;  1NR1 A;  4X65 O;  5CA3 A;  2ETN A;  2R72 A;  1YI2 V;  4LF8 O;  1NS1 A;  1KP2 A;  5B1B B;  4X88 A;  4DR4 B;  4GKJ B;  3OTO O;  2BOC C;  1URF A;  5LXT A;  5FLX N;  1NKD A;  4DR5 O;  2Z0A A;  5AG2 A;  2ODM A;  1HNZ B;  4PDV A;  4DR7 B;  2YID A;  2LW1 A;  3BAB A;  3Q4H B;  2YI9 A;  1XHZ A;  3UQ8 A;  2P90 A;  4JI6 O;  3SYA A;  1RP3 B;  3VQX A;  1SQF A;  2EIK C;  4I9Q A;  2Y48 A;  1XMO O;  1V55 B;  2Y4T A;  2UXD O;  2A79 B;  5LBQ A;  1SQG A;  2DOS A;  3RYI A;  5J2U B;  3UO3 A;  5A9G A;  2QSA A;  3JAK B;  1FXK B;  3C3T A;  4O2B A;  4PA6 A;  5EBL C;  3L73 H;  3UCS C;  2ZE6 A;  2UUB B;  1YZB A;  2UXX A;  5BR8 B;  4X1K A;  4MSW C;  3OGC C;  1IBL B;  3AG2 B;  4UB6 Z;  4NVP A;  1Z5W A;  1XHX A;  1K9M W;  4E4E A;  3Q4H A;  4F4L A;  2UU9 O;  4B3M O;  2CH7 B;  1Y6X A;  2HVJ C;  2GBO A;  2YI8 A;  3BAA A;  2V1D A;  1MNG A;  5DEC A;  1NVP B;  4ASU G;  4LNU A;  1OCZ B;  4P2Z A;  4AHC A;  4G2K A;  1AP5 A;  1SQQ H;  1SKV A;  5J2U A;  5LMN B;  4W4K A;  3RW0 A;  4NB5 A;  3JAK A;  5JCO C;  4QPJ A;  4CZZ A;  1D2D A;  1FXK A;  3U10 A;  3CWB H;  4I4T B;  2ADQ B;  2FYU H;  4DV5 O;  1TVK A;  5JWP A;  2Q0A A;  1JA8 A;  5H6R A;  5L3D A;  1M56 B;  1XDC A;  5DM6 V;  4MTO A;  1XL6 A;  5H6Q A;  1RPO A;  3CRM A;  1D5A A;  4F6E A;  3BY6 A;  1V54 C;  1K3E A;  4UCR A;  5JVD B;  5JJE B;  2DWD C;  1YJ9 V;  1QBZ A;  1Q8I A;  5J2T B;  1YCI A;  5ITZ A;  1KUQ A;  3FB6 C;  1S0V A;  3K9S A;  1GMG A;  2A7W A;  2DYS C;  1GTO A;  4JAU A;  4FVM A;  3T1C A;  2EJR A;  4ICG A;  3CHX A;  5KHI A;  4I4T A;  1VF5 B;  2ZXW B;  2LFR A;  3ABK C;  4YY3 O;  4FM0 A;  2VQE O;  2EIN B;  1I0H A;  4BR6 A;  3RYC A;  3ETE A;  3B8M A;  5J9P C;  2IU0 A;  3QO7 A;  3LDC A;  2ZDI C;  4LF8 B;  1FPO A;  5CBF A;  3JD4 A;  3CXC U;  2A06 H;  2QGN A;  3OTO B;  1GK9 A;  4YHH O;  3O65 A;  2AZ2 A;  5J2T A;  3FB7 C;  2ILM A;  1NVP D;  1E1R G;  2Q67 A;  4GYC B;  3BPZ A;  2XAG A;  4I7Z B;  2UUA O;  5FL7 G;  4JI7 B;  1NR7 A;  1HNX B;  3HPL C;  1I5X A;  4JI6 B;  1Q6U A;  4DRX A;  1BT8 A;  1JVM A;  3E83 A;  3OMN B;  1BQ0 A;  2DE0 X;  2UXD B;  2CTQ A;  1NT2 B;  3A8T A;  4RQF A;  2ZD9 A;  2EIL B;  4R6Z A;  2X6B A;  3K58 A;  4X1I B;  3G6B A;  3OE7 G;  2OIG A;  3KCY A;  1Q7Y W;  1U97 A;  2DWE C;  3RBZ A;  1YHQ V;  2YXH A;  2R70 A;  3RVY A;  5B3S C;  3SPC A;  3LSU A;  2P06 A;  1EN5 A;  1Y74 B;  1MZE A;  3CXH F;  2UU9 B;  4B3M B;  1TUB B;  1W0J G;  1OCR B;  2Q7E A;  1T5E A;  1QU7 A;  1VQ6 V;  4DUZ O;  3OMI B;  5CBH A;  2MW2 B;  3H1H H;  3JD0 A;  4IHJ B;  3F5T A;  1MSD A;  1Z5V A;  3OAA G;  4WFG A;  2HFE C;  5BXZ A;  4RO2 A;  1NJI W;  5H9C A;  4K8Z A;  4X89 A;  1SF9 A;  1XI1 A;  3GB7 C;  2DJV A;  2Q4P A;  3ZS8 C;  2UXC O;  1ZL8 A;  3ZIA G;  3K9A A;  2GTA A;  2QWP B;  4UFZ A;  4NR1 A;  3WG7 B;  4X1I A;  1E1Q G;  2JGD B;  2ZKO A;  1Y76 B;  5IE9 A;  4L8J A;  2AZ0 A;  2QJ1 A;  4FLU A;  5KA6 A;  5JJJ B;  1M57 C;  4JYY A;  4CS4 A;  1QCE A;  2GUZ A;  2YEV B;  4WF9 V;  4WFE A;  1AB3 A;  2XAJ A;  1OJH A;  5GTH Z;  3CC2 V;  3E8H A;  2QWO B;  4WBN A;  3QF7 A;  4XBF A;  4DR1 B;  4DR6 O;  5IYC O;  2JGU A;  2RDC A;  3CX5 F;  4LH6 A;  5K1X A;  3KG2 A;  2IH1 C;  5A2Q N;  2BE3 A;  5KMG B;  1OCO B;  4OX9 O;  2E76 B;  1PM9 A;  1SZT A;  1F51 A;  4LWS A;  2JGD A;  1Y76 A;  2ZT9 B;  4QIW F;  1SET A;  4DV2 O;  2FL4 A;  2OWO A;  3B40 A;  2VQE B;  3I56 V;  1WA8 A;  2ZXW C;  4JZ2 A;  4DV7 O;  3GWK C;  1YJN V;  4PDM A;  3D36 A;  2OCH A;  2EIN C;  2IJK A;  2DQ3 A;  3OTF A;  3CCE V;  4ZOL A;  4MTX A;  2NR5 A;  5H5N A;  2OTJ V;  3B8N A;  3APO A;  2LFS A;  4OGQ B;  1KD1 W;  2QM8 A;  1XRE A;  4IIJ B;  4H0L B;  4LF4 B;  2ITD C;  4FLX A;  2UUA B;  4F6R A;  1O9H A;  1K4D C;  4LCU C;  1U96 A;  3DGE A;  2HR3 A;  1HWY A;  2HG5 C;  4I5S A;  3ZMZ A;  1GO3 F;  4X20 A;  1W0K G;  5EIB C;  5IWA B;  3D3Q A;  1VIB A;  2NN4 A;  2QM7 A;  2BTQ B;  3JD3 A;  4D7S A;  4H33 A;  5KX5 B;  4WFF A;  1AR1 B;  4GKJ O;  1XNQ O;  4EKW A;  1ROP A;  3ZHU A;  4K0K B;  3JAS B;  1R3L C;  1ZX3 A;  2KG7 B;  5F2V O;  3BA9 A;  1Q6H A;  3CRR A;  4NXN B;  4FZ1 A;  1EM1 A;  1DGS A;  3RFR A;  1XEQ A;  2BSK A;  1IX9 A;  1VP7 A;  1WLE A;  1PL4 A;  3JAL A;  1K97 A;  3KKY A;  4IIJ A;  5GON A;  4X62 O;  4PD4 F;  1H2L A;  4H37 A;  5FPR A;  4ZKI A;  5B1N A;  1BE3 H;  4BAY A;  4YIO A;  2BOB C;  2ZNI A;  1I7F A;  1KC8 W;  1S76 D;  1HW7 A;  4BIU A;  4EB6 B;  1N32 B;  5C8Y A;  2YSU B;  4DR2 O;  4WFB V;  1LUW A;  2RQ6 A;  5KX5 A;  3HKB A;  4JZG A;  4O4I A;  5BR8 O;  3K0D A;  1BHB A;  1XL4 A;  1IBL O;  3U0Z A;  2R9R B;  3AG1 B;  1VQN V;  3ASN C;  5C93 A;  3L71 H;  3JAR B;  3TCU A;  4JI4 B;  3I5D A;  4DV0 B;  1SC5 B;  1SQB H;  4QE7 A;  3RYH B;  1K7D A;  3LDE A;  1XIL A;  2WLL A;  3D36 C;  4CH5 A;  1P49 A;  3EFF K;  2WA4 A;  1N36 B;  2N74 A;  2P6J A;  2L6L A;  1MAB G;  3IC9 A;  1NH2 D;  5KHJ A;  1GRJ A;  1P7G A;  2AHY A;  3AG7 A;  3I55 V;  2CUG A;  2EJ7 A;  2Q8V A;  1QVG U;  5B1A B;  2W6I G;  3OR6 C;  5KAF Z;  4EFE A;  4NTW A;  4JI5 O;  2EIJ C;  5IY5 B;  5IJ0 A;  3W7W A;  1EFR G;  1F23 A;  4HZ3 A;  3JAR A;  1PNL A;  1K5Q A;  1WB8 A;  4JAV A;  2K1E A;  4DV7 B;  3CCU V;  1VQ8 V;  2GHY A;  1GH6 A;  1XMQ B;  2OTL V;  1G4Y B;  3RYH A;  1NBM G;  4JGS A;  3ABL B;  3EXA A;  3P30 A;  3ZRX A;  2ZIN A;  3NXS A;  4Z1V A;  4JF3 A;  4JI3 B;  2Y4U A;  2EIM B;  3VOU A;  1L1F A;  4OXS A;  3OM3 B;  4DK0 A;  4HBN A;  3ZHT A;  1WP8 A;  2A3Q A;  3ZMT A;  1L0L H;  4O4L B;  4P30 A;  2YIB D;  3SPG A;  2HHH O;  4HNA B;  2ARH A;  3IC7 A;  3JSL A;  1MA1 A;  2LO1 A;  2WLK A;  2W6J G;  3TXQ A;  4MW8 A;  5EK0 A;  1IZ3 A;  2PYL A;  1XNQ B;  4LFC O;  4PHZ A;  4UCU A;  3QO8 A;  1P7B A;  1Y67 A;  4LF9 O;  4JI7 O;  3H1K H;  3BFR A;  5LGU A;  1RM1 C;  1Q82 W;  1HNX O;  5LGT A;  3A0B Z;  3N27 A;  4MVZ A;  1YSC A;  4AQY O;  4PDR A;  3K08 A;  4X62 B;  1S3J A;  4JI8 B;  1LR1 A;  4JI2 B;  2XOK G;  3TK1 A;  3VBB A;  3ZRW B;  2IW5 A;  3M7M X;  4O4L A;  1PKX A;  5IDJ A;  3T1H B;  3TJT A;  4Q20 A;  1JCH A;  3PN1 A;  1AI6 A;  2WPD G;  3L72 H;  3HKC B;  4DR2 B;  4J7Z A;  3ZMV A;  5CA0 B;  3H01 A;  3ABM B;  4JV5 O;  3G80 A;  3HR0 A;  1M93 A;  3GVM A;  4EEQ A;  5BZB A;  2Q9L A;  4KUM A;  4UCV A;  3M8A A;  4PV1 B;  3K3W A;  2H94 A;  4AIL C;  2BTO A;  4FK5 C;  2NNU A;  2ATK C;  1IDS A;  3OUF A;  5JH7 B;  1YTF B;  4RUE A;  1HR0 B;  4J9Y B;  2DYR B;  4LH7 A;  3CCQ V;  3AG1 C;  4MTG A;  1MOF A;  1HNW O;  2Z3Y A;  2Y0P A;  1CEZ A;  2H8P C;  1Q81 W;  2VRZ A;  4TV8 B;  4FFB B;  2YXY A;  3VQV A;  2CE4 A;  4FZ0 A;  3AG4 B;  1NTZ H;  2VWK A;  3FKS G;  3ABT A;  1ZWI C;  2WAM A;  1DLB A;  3CPW U;  3RVZ A;  1F7Y A;  1H2M A;  2ZM6 B;  4XDJ A;  3HKC A;  2P7T C;  3K59 A;  5CA0 A;  3ZBH A;  2LQT A;  1IBM O;  1MZF A;  1R1B A;  1SQP H;  5L3F A;  1QVF U;  1Z2G A;  4JI5 B;  3T4Z A;  1DK1 A;  2CH7 A;  4PJ0 Z;  2PTM A;  3P3P A;  1RSO B;  2CTW A;  3R65 A;  1JX9 A;  4TV9 B;  3CE2 A;  3WB0 A;  4W4L A;  3EHB B;  4ZI7 B;  3G71 V;  1LNQ A;  3QVN A;  4FFB A;  4DR1 O;  1YDX A;  2OCC B;  4L87 A;  3THO A;  2HJD A;  4K8X A;  1MSW D;  1MMM A;  3OFN G;  1QLE C;  1XQ8 A;  1VQ9 V;  5KHH A;  2QDO A;  2PI5 A;  2UXB O;  2EIM C;  1L8D A;  4QJF B;  1H2S B;  1AI5 A;  1HP8 A;  2YIC A;  2OYQ A;  1FAF A;  4J41 A;  1H2G A;  2WLI B;  3L74 H;  2HHH B;  3A0R A;  4CC6 A;  3L9D A;  1AJP A;  1N33 O;  3VQY A;  1YTF D;  2NLJ C;  1KKC A;  1OHH G;  1M1K W;  3WB1 A;  4DV6 B;  4ZHQ B;  1X4T A;  3CYO A;  3QNE A;  3W7T A;  5JVD A;  1GN2 A;  1QQC A;  1AJN A;  1ARO P;  2OT5 A;  4LFC B;  4TWK A;  5B1B C;  4TQF A;  2FKX A;  4LF4 O;  1AI4 A;  4LF9 B;  3RYF B;  5EZY B;  1WNS A;  3WFV A;  5KHK A;  3SYP A;  2A0L A;  1IXM A;  4UV9 A;  4AQY B;  1DTO A;  4I50 B;  3WB2 A;  1SQV H;  5IWA O;  2CGN A;  3MD0 A;  1B06 A;  2YC0 A;  2HVK C;  4DW0 A;  2OIE A;  4KFM A;  4GCZ A;  4FLZ A;  2P5O A;  2WLH A;  1VEW A;  5IYZ B;  1V55 C;  1UJW B;  1O9G A;  5IJ9 B;  3D3I A;  3CS5 A;  4K0K O;  4ZHQ A;  1VAR A;  4NXN O;  2FB5 A;  4OPA A;  5KHG A;  4GUN A;  4JV5 B;  1GM9 A;  3CSX A;  4X66 B;  3AK2 A;  1FXK C;  5K1P A;  1OV9 A;  4X8A A;  3ASO B;  1R6K A;  3ICX A;  2ZIO A;  4PA4 A;  3S3X A;  4DV4 O;  5JJN B;  2F95 B;  5EZY A;  2KQX A;  1IBK O;  3CEI A;  3K0G A;  3AG2 C;  4PEL A;  1HNW B;  4O2A B;  3N2G B;  1G6U A;  2Y69 B;  4I55 B;  4D6T H;  4I0X B;  3A2F A;  4K3A A;  1N32 O;  1I5Y A;  1J95 A;  1GAX A;  2YUA A;  4FIP C;  4PA7 A;  3CME V;  1QR8 A;  4J80 A;  4J7J A;  4B7K A;  5IYZ A;  3T2M A;  3E8F A;  1OCZ C;  4J42 A;  3U11 A;  3K79 A;  2XHB A;  2LGW A;  3H1I H;  1AR4 A;  1EBO A;  5BY1 A;  4R7C A;  4B7E A;  1PV0 A;  2VQF B;  1IBM B;  4NKG B;  4YJ2 B;  3DSQ A;  5B1O A;  4K35 A;  3ZHV A;  4JI4 O;  3MAQ A;  3FB5 C;  4DV0 O;  4UUJ C;  1GM8 A;  1JMK C;  1M56 C;  2QEX V;  1Y74 A;  5KUM A;  4LFB O;  2B9Z A;  4U7N A;  1TUB A;  2F23 A;  1W2B U;  4LF6 O;  3C90 A;  3CB2 A;  2JK5 C;  3N2G A;  1N36 O;  4UXN A;  3BEH A;  1QLN A;  4I55 A;  4I0X A;  4IHJ A;  3E8B A;  1ENV A;  2WLN A;  3AK1 A;  3JAT B;  1AP6 A;  3JCZ A;  3KCX A;  2IM9 A;  1BSM A;  4FMT A;  4FLW A;  5EIB D;  1WB7 A;  5LOV B;  5FNV B;  2C2A A;  4CH4 A;  1XNR O;  1Q86 W;  1BS3 A;  1S5J A;  3ETD A;  4KHP O;  2B1G A;  1FXV A;  2LGQ A;  1THZ A;  3SYC A;  2UXB B;  4YJ2 A;  4FM2 A;  1XOU A;  2QTO A;  2WSS G;  3CC7 V;  1N33 B;  3ZRS A;  3OGI B;  3O9O A;  1G8M A;  1XMQ O;  2M6Y A;  2YEV A;  2ZR3 A;  3SJB C;  1GM7 A;  2ZIM A;  1ZSP A;  4TSF G;  1K34 A;  3FD9 A;  1VQO V;  4MVR A;  1LUV A;  4DK1 A;  3ML0 A;  4JI3 O;  3QG5 A;  3ETQ A;  4ABM A;  4KL1 A;  5LP6 B;  1EZJ A;  1R6T A;  2B1I A;  1VQP V;  3JAT A;  3CRC A;  5CA1 B;  1B3Q A;  3X2Q B;  3MHS C;  5B66 Z;  2R9I A;  4U3J B;  4RUF A;  3ZMS A;  2E5L B;  5IYB O;  1RFY A;  4AI8 A;  1OCC B;  5KMG A;  1BMF G;  3AK3 A;  1KEC A;  2HKO A;  2GDS A;  2GSM B;  3STZ C;  3ZJZ A;  2WLJ A;  4BIZ A;  4LC1 A;  3J81 N;  3J80 N;  5L3C A;  3SGI A;  1FKA O;  1S77 D;  1BZK A;  1Q3E A;  1WN7 A;  3HKD B;  2QWR B;  3DTU B;  1NH2 B;  1AR5 A;  4E2L A;  1EN6 A;  2M7W A;  4JI0 O;  5FPO A;  2EIL C;  5L3G A;  3G6E V;  4FLY A;  4H13 B;  2Z5U A;  3CRA A;  3TET A;  1CXZ B;  3FX7 A;  2ITC C;  1Y66 A;  5CMU A;  4RAI A;  3TXS A;  1NU1 H;  4JYA O;  2KB1 A;  2DN9 A;  4DV4 B;  1PL0 A;  4JI8 O;  4FFK A;  2JIZ G;  4JI2 O;  1VQK V;  3AG3 B;  1QR9 A;  1FFX B;  1IBK B;  1VQ5 V;  4U3J A;  3T1H O;  3K03 A;  3J7A U;  2EX3 A;  1PP9 H;  1YIJ V;  1KU9 A;  1OCR C;  2EIK B;  2W0X A;  2ZE8 A;  1J5E O;  2ZR2 A;  2BTQ A;  2AW9 A;  1Q6I A;  1JJO A;  2Y69 C;  1FXH A;  3HKD A;  2VS0 A;  3L75 H;  3JAS A;  5EYP B;  2KG7 A;  1JPX A;  2RJZ A;  3CC4 V;  1H8E G;  1FD9 A;  3CP1 A;  3JD1 A;  1HR0 O;  1H2N A;  5KA5 A;  4YXW G;  3WG7 C;  5BMV B;  3CMA V;  2H3O A;  3ZN0 A;  4UB8 Z;  4MT8 A;  1S5L Z;  5D5P A;  1SES A;  3JAM N;  2JJ2 G;  4X1Y B;  1V9P A;  4LFB B;  1FFX A;  5LA6 B;  2F4V O;  2A9H A;  3UT5 B;  4LF6 B;  2D2C B;  4EB6 A;  3E8G A;  4J7K A;  2ZE5 A;  2ZM6 O;  3SYQ A;  4HYO A;  2O57 A;  3HKE B;  2W0F C;  4NTY A;  4B3S B;  5H2F Z;  2CTR A;  3WU2 Z;  2WLM A;  3L70 H;  4BWA A;  1NQT A;  1JQ0 A;  1XNR B;  3CD6 V;  3ZCC A;  4LP8 A;  2X0L A;  2YIB A;  4KHP B;  5LL6 Y;  1H8H G;  4DYL A;  2CK3 G;  1GN4 A;  1OCO C;  4JTD B;  3K5M A;  1NTM H;  4NYK A;  4R50 A;  3QTC A;  3BCC H;  1V54 B;  3H1J H;  4DV3 B;  3DXR B;  1SS3 A;  1AIL A;  4X1Y A;  4DV1 O;  2AGA A;  4RWU A;  2WWW A;  2Q69 A;  3ZMU A;  4JPR A;  1SRY A;  1MG1 A;  1WP7 A;  3CCJ V;  5L3E A;  4Z1M G;  2F43 G;  5LMU O;  1B6Q A;  5LXT B;  1HDJ A;  2YDE A;  4FPP A;  3FYI B;  4P9O A;  4LF5 B;  4UV8 A;  2DYS B;  4TT3 G;  1S5H C;  1GN6 A;  3B4S A;  3X2Q C;  3CCL V;  2E74 B;  2N05 A;  1YF2 A;  1KP3 A;  4DV6 O;  4QGP A;  3OR7 C;  2P4K A;  3FFQ A;  3ABK B;  3LDD A;  1PD3 A;  2F66 C;  2CGO A;  3LNM B;  4WFH A;  3CCR V;  3N2K B;  2ZCE A;  4QPK A;  2AHZ A;  3H9V A;  2EBO A;  4JI0 B;  3DXR A;  3RYI B;  2ZE7 A;  1COW G;  1R3K C;  3K5N A;  4O2B B;  3CCM V;  1JJ2 U;  5EBM C;  3KZI Z;  4DUY B;  4JTC B;  2PGG A;  4JYA B;  5E79 Z;  4FLT A;  1K5S A;  4X1K B;  2QR4 A;  2DW4 A;  3SPJ A;  1OZ0 A;  1P4R A;  4XDK A;  3SJA C;  3E22 B;  3JYC A;  3AG3 C;  1KB9 F;  1Q5O A;  2IJH A;  3IFX A;  4HNA A;  1J5E B;  1SA0 B;  4N23 A;  3A0H Z;  1M90 W;  2UXN A;  1WJZ A;  2IH3 C;  4X66 O;  2HLD G;  2JRI A;  3N2K A;  4LNU B;  1X59 A;  5CBG A;  3LUT B;  4P9P A;  3IJ4 A;  2X7R B;  3ZX6 A;  2ZDI A;  3CJH B;  5CB4 B;  4UCT A;  2L35 A;  1W59 A;  4U7O A;  5L3B A;  4PDL A;  5HFL A;  4LF7 B;  4FLV A;  1D5N A;  4JYC A;  3B09 A;  1TVK B;  5B3S B;  4DXW A;  5KUK A;  5E1A C;  3T4D A;  3G67 A;  1SER A;  4EFB A;  3ZRW A;  2B5U A;  2P22 C;  3MHH C;  4MVM A;  1N4C A;  1H2K A;  3E22 A;  2F4V B;  4BW9 A;  2BCC H;  4UVA A;  4UCO A;  2EUL A;  1SA0 A;  2YIA A;  1VQL V;  5KLV H;  4KP4 A;  1N0N A;  5LHH A;  5ITZ B;  2VQF O;  1FJG B;  2EZO A;  2QWN B;  2Q68 A;  2JS5 A;  3G4S V;  3CJH A;  1R73 A;  3UO2 A;  3JAW B;  5JH7 A;  3ZHQ A;  1EZV H;  5CB4 A;  1AJQ A;  1M57 B;  5B1A C;  4FJC C;  3ETG A;  4ZBM A;  1A32 A;  5B5E Z;  5IY5 C;  4O4H B;  1KYO F;  1N34 B;  4TV8 A;  4CS3 A;  1F4N A;  4LFA B;  3RYC B;  2Q0O C;  1CP9 A;  4DV1 B;  1F4M A;  1SQX H;  4B3R B;  1KBH A;  1IUR A;  3ABL C;  1ORQ C;  3OMA B;  3E2E A;  4DR3 O;  5IT9 N;  2YS8 A;  5LMU B;  4JAS A;  2PY5 A;  1BL8 A;  1M4U A;  3SJQ C;  1H38 A;  4Z2W A;  5EC1 C;  2RN9 A;  2Q73 A;  2JDI G;  1PNK A;  1PNM A;  2Q5Z A;  3SPH A;  2GV9 A;  4DRX B;  3MDS A;  3JAW A;  3RN4 A;  4GX5 A;  1S72 V;  1Q43 A;  4IL6 Z;  2DQ0 A;  1RSO A;  4TV9 A;  5GTI Z;  4O4H A;  3ZHR A;  2Q7G A;  4ZI7 A;  3EVK A;  4B3T B;  3F5W C;  1TAE A;  1ZAU A;  3ZRV A;  1AI7 A;  4X65 B;  5LHI A;  1G1X B;  3OD4 A;  1UFI A;  5GW7 A;  3UM7 A;  2QM4 A;  2E5L O;  1NTK H;  1I08 A;  3K04 A;  4KXR A;  4DR5 B;  1YEW A;  1GKF A;  3T1Y O;  1L0N H;  4YJ3 B;  3E89 A;  5LHG A;  2WLI A;  2WA3 A;  4GX2 A;  2V7Q G;  1UPG A;  4MW3 A;  3K06 A;  1XBL A;  1DF4 A;  3BVO A;  3DC5 A;  3S3W A;  3IGA C;  1JFF B;  3JSN A;  1FS0 G;  2IU3 A;  1XMO B;  4GX1 A;  2QE7 G;  4MTF A;  4FM1 A;  1Q90 D;  2RMK B;  3FAV B;  4H44 B;  3ABM C;  3E35 A;  1BHA A;  1ZL8 B;  3JCU Z;  3UKM A;  5IYD O;  1VQM V;  3RYF A;  2HP8 A;  5JQG B;  4J11 A;  2LP7 A;  3QO5 A;  3APQ A;  4N21 A;  3SJC C;  1BQZ A;  3AEI A;  1R3J C;  3CCS V;  3C3S A;  2DYR C;  4I50 A;  2DMX A;  1R3I C;  3D8C A;  2LW7 A;  4UVC A;  4Q6G A;  4IT5 A;  2GUZ B;  1VF6 A;  4CH3 A;  2P4V A;  2QA4 V;  4GKK O;  2IJI A;  4YJ3 A;  4MVO A;  3AG4 C;  5IJ9 A;  3OW2 U;  2QTS A;  4WBN B;  1JFF A;  1ZUQ A;  3FAV A;  3LSS A;  2ADP A;  2AXT Z;  1TA8 A;  3NR7 A;  2JEX A;  4QE9 A;  2ZNJ A;  2RNB A;  5JQG A;  3RT3 C;  4PI0 A;  2XAS A;  3ASN B;  4LWS B;  2XND G;  4QNH B;  3FB8 C;  1ZTE A;  4HAM A;  4O4J B;  4DV5 B;  4X9Q A;  1K92 A;  4O2A A;  4I9W A;  3CCV V;  3JD2 A;  1WA8 B;  2QWQ B;  4XDL A;  2JEU A;  3BRC A;  4B3S O;  1M9N A;  2OCC C;  2IBZ H;  4IYI A;  4ZOL B;  1K8A W;  4JI1 O;  4DR3 B;  1IXB A;  4NXM O;  2YXL A;  2GTS A;  1RPR A;  4F6R B;  2E75 B;  1Y4M A;  4DV3 O;  4X20 B;  2EIJ B;  4WCE V;  4X64 O;  3OUS A;  2PZS A;  2N04 A;  1M5I A;  4O4J A;  2D3O W;  2UUC O;  4YY3 B;  1K73 W;  1DF5 A;  5HFM A;  1YJW V;  4D7T A;  4DW1 A;  3SYO A;  2QKS A;  3HB3 B;  4JTA B;  2XT9 A; 
#chains in the Genus database with same CATH homology
 3AG1 C;  1KKD A;  1H8H G;  4MTG A;  4RQF A;  1MOF A;  2CK3 G;  2Z3Y A;  4GX0 A;  1CEZ A;  2H8P C;  1Q81 W;  1OCO C;  2ZD9 A;  2EIL B;  4JTD B;  4R6Z A;  2X6B A;  3M99 B;  2X6C A;  3AG4 B;  1YIT V;  3FKS G;  3ABT A;  1ZWI C;  3OE7 G;  2WAM A;  4R50 A;  4RQE A;  1DLB A;  1V54 B;  3CPW U;  3CCQ V;  1Q7Y W;  1VQ4 V;  3RVZ A;  2X6A A;  1WPX A;  2DWE C;  4MVQ A;  4XDJ A;  2WWW A;  3RBZ A;  2Q69 A;  1YHQ V;  3ZMU A;  2P7T C;  4JPR A;  3RVY A;  1SRY A;  1MG1 A;  3CCJ V;  4JYB A;  5B3S C;  5L3E A;  3SPC A;  4PA9 A;  3W7X A;  4R8C A;  4Z1M G;  2F43 G;  2ZQM A;  1B6Q A;  1W0J G;  1OCR B;  2Q6A A;  4FPP A;  5L3F A;  3W7S A;  1QVF U;  1VQ6 V;  3FYI B;  3OMI B;  4P9O A;  3PJS K;  4UV8 A;  3T4Z A;  2DYS B;  5CBH A;  4TT3 G;  1S5H C;  3JD0 A;  3X2Q C;  3CCL V;  3OAA G;  4WFG A;  3ASO C;  2HFE C;  2XAF A;  1NJI W;  4RO2 A;  1RM1 B;  5H9C A;  3OEH G;  1KP3 A;  1R6N A;  1JX9 A;  3R65 A;  4X89 A;  3W7U A;  3GB7 C;  3EHB B;  3OR7 C;  3G71 V;  3ABK B;  2IJJ A;  1LNQ A;  3ZIA G;  3LDD A;  1PD3 A;  3K9A A;  4LBE C;  1N8R W;  4MS2 A;  2MK3 A;  2OCC B;  3LNM B;  4WFH A;  3CCR V;  4L87 A;  4QPK A;  3WG7 B;  2AHZ A;  1E1Q G;  2EBO A;  1MSW D;  3OFN G;  5DN6 G;  1QLE C;  5KA6 A;  4UVB A;  1M57 C;  1VQ9 V;  1COW G;  1E79 G;  2WLL B;  1QCE A;  1R3K C;  3CCM V;  1JJ2 U;  2PI5 A;  5EBM C;  2EIM C;  4G27 B;  3F7V C;  2YEV B;  4JTC B;  4WF9 V;  4QJF B;  4J9Z B;  1AI5 A;  4WFE A;  2JJ1 G;  1H2G A;  1KQS U;  1K5S A;  2WLI B;  3A0R A;  2XAJ A;  4GT1 A;  1AJP A;  1TUE B;  2DW4 A;  3SPJ A;  1YTF D;  2NLJ C;  3E86 A;  1OHH G;  1OZ0 A;  1M1K W;  3CC2 V;  3E8H A;  1P4R A;  3CYO A;  4XDK A;  3QNE A;  3W7T A;  3JYC A;  3AG3 C;  4XBF A;  2IJH A;  3IFX A;  1AJN A;  1ARO P;  5IYC O;  2OT5 A;  4TWK A;  2HJF C;  5B1B C;  4N23 A;  3LSQ A;  1M90 W;  2UXN A;  1AI4 A;  3KG2 A;  2IH1 C;  2IH3 C;  2HLD G;  1OCO B;  3WFV A;  1K33 A;  1SZT A;  2P67 A;  5EC2 C;  1F51 A;  5CBG A;  3LUT B;  3SYP A;  4QIW F;  1SET A;  3FYE B;  2A0L A;  4P9P A;  1IXM A;  2X7R B;  2ZDI A;  4UV9 A;  3OEE G;  1DTO A;  2XAH A;  3I56 V;  2ZXW C;  3MD0 A;  3F7Y C;  4U7O A;  4PDL A;  5L3B A;  5HFL A;  2HVK C;  4KFM A;  1YJN V;  4PDM A;  3D36 A;  5LGN A;  4GCZ A;  4JYC A;  2EIN C;  2IJK A;  2WLH A;  2DQ3 A;  1V55 C;  1UJW B;  5B3S B;  4DXW A;  3CCE V;  4MTX A;  5KUK A;  5E1A C;  3T4D A;  3D3I A;  4MVU A;  1SER A;  2OTJ V;  2FTK A;  3B8N A;  3ZRW A;  2LFS A;  1KD1 W;  2QM8 A;  2B5U A;  3MHH C;  4MVM A;  2ITD C;  2XAQ A;  4BW5 A;  1JOY A;  1VQ7 V;  1GM9 A;  4PA3 A;  3STL C;  1FXK C;  4X8A A;  4UVA A;  1K4D C;  1VQL V;  3ASO B;  1R6K A;  4LCU C;  4MVS A;  4PA4 A;  3DGE A;  4KP4 A;  1CPY A;  2HR3 A;  1HWY A;  2HG5 C;  4I5S A;  3ZMZ A;  5LHH A;  1GO3 F;  2EZO A;  1W0K G;  1K4C C;  3K0G A;  3AG2 C;  2Q68 A;  2QM7 A;  3JD3 A;  3GWO A;  4H33 A;  4PEL A;  5EBW C;  4WFF A;  3G4S V;  1R73 A;  3B77 A;  1AR1 B;  1AJQ A;  4EKW A;  2Y69 B;  1ROP A;  1QLE B;  1M57 B;  1I5Y A;  1J95 A;  3ABU A;  4CBC A;  5B1A C;  4FJC C;  4FIP C;  4PA7 A;  4WFA V;  3ETG A;  1R3L C;  4ZBM A;  3CME V;  4G28 B;  3SPI A;  1QR8 A;  5IY5 C;  3T2M A;  1OCC C;  3E8F A;  2EZP A;  1F4N A;  1OCZ C;  4DO2 A;  1CP9 A;  1WLE A;  1F4M A;  3K79 A;  3ZN1 A;  1K97 A;  1FFT B;  1EBO A;  3P32 A;  4R7C A;  2PI4 A;  4H37 A;  3ABL C;  1ORQ C;  3OMA B;  5B1O A;  4ZKI A;  3E2E A;  5CN0 A;  5B1N A;  4JAS A;  1NR1 A;  1BL8 A;  5CA3 A;  3SJQ C;  4BAY A;  1H38 A;  2BOB C;  5EC1 C;  3FB5 C;  1YI2 V;  4UUJ C;  1KC8 W;  1KP2 A;  1GM8 A;  5B1B B;  1M56 C;  2JDI G;  4X88 A;  2QEX V;  1S76 D;  4BIU A;  2BOC C;  5KUM A;  1PNK A;  4U7N A;  1PNM A;  2YSU B;  1NKD A;  4WFB V;  1W2B U;  3SPH A;  2JK5 C;  4PDV A;  4UXN A;  3BEH A;  1QLN A;  4GX5 A;  1S72 V;  3E8B A;  1ENV A;  2WLN A;  3K0D A;  1BHB A;  2P90 A;  1XL4 A;  2DQ0 A;  3JCZ A;  3SYA A;  4FMT A;  2R9R B;  3AG1 B;  2EIK C;  3F5W C;  2Y48 A;  1VQN V;  3ASN C;  2C2A A;  5C93 A;  1V55 B;  1Q86 W;  3ZRV A;  1AI7 A;  3TCU A;  5LHI A;  3ETD A;  2A79 B;  3UM7 A;  5GW7 A;  5LBQ A;  2B1G A;  1FXV A;  1THZ A;  3SYC A;  4QE7 A;  1K7D A;  3LDE A;  2QTO A;  3K04 A;  2WLL A;  2WSS G;  3CC7 V;  1FXK B;  4PA6 A;  5EBL C;  3ZRS A;  1G8M A;  2YEV A;  3EFF K;  1GKF A;  2ZR3 A;  1GM7 A;  2UXX A;  3E89 A;  5LHG A;  2WLI A;  1K34 A;  4TSF G;  4MSW C;  1VQO V;  4GX2 A;  3OGC C;  2V7Q G;  4MW3 A;  4MVR A;  3K06 A;  1DF4 A;  2P6J A;  1MAB G;  3AG2 B;  3ML0 A;  1NH2 D;  2AHY A;  3IGA C;  1K9M W;  1FS0 G;  2IU3 A;  1EZJ A;  4F4L A;  4GX1 A;  2QE7 G;  3I55 V;  2B1I A;  4MTF A;  2HVJ C;  1VQP V;  1QVG U;  3X2Q B;  5B1A B;  2W6I G;  3ABM C;  3MHS C;  3OR6 C;  2R9I A;  3E35 A;  2EIJ C;  4RUF A;  1BHA A;  3ZMS A;  3UKM A;  5IY5 B;  2V1D A;  5IYD O;  5IYB O;  3W7W A;  1EFR G;  1VQM V;  1F23 A;  4HZ3 A;  1PNL A;  1OCC B;  2LP7 A;  3QO5 A;  1NVP B;  1BMF G;  1K5Q A;  4N21 A;  1KEC A;  4JAV A;  4ASU G;  2K1E A;  1OCZ B;  4P2Z A;  2HKO A;  4G2K A;  2GSM B;  3AEI A;  3STZ C;  1R3J C;  3ZJZ A;  2WLJ A;  4BIZ A;  3CCS V;  4LC1 A;  3CCU V;  1VQ8 V;  2GHY A;  2OTL V;  5L3C A;  1G4Y B;  1S77 D;  2DYR C;  1NBM G;  3RW0 A;  4JGS A;  1R3I C;  3ABL B;  3P30 A;  3DTU B;  3ZRX A;  3NXS A;  4QPJ A;  4CZZ A;  1FXK A;  4UVC A;  1NH2 B;  4JF3 A;  4E2L A;  2M7W A;  2EIL C;  5L3G A;  3G6E V;  2QA4 V;  2EIM B;  5H6R A;  2IJI A;  5L3D A;  1M56 B;  3VOU A;  1L1F A;  2Z5U A;  4OXS A;  3TET A;  4MVO A;  3OM3 B;  3AG4 C;  5DM6 V;  4MTO A;  1XL6 A;  5H6Q A;  1RPO A;  2ITC C;  1Y66 A;  5CMU A;  3OW2 U;  4RAI A;  3BY6 A;  1V54 C;  1K3E A;  3ZMT A;  2KB1 A;  4P30 A;  1PL0 A;  2DWD C;  1YJ9 V;  3SPG A;  2JIZ G;  1QBZ A;  1VQK V;  3AG3 B;  1QR9 A;  3LSS A;  3IC7 A;  1VQ5 V;  3K03 A;  2JEX A;  4QE9 A;  2WLK A;  2W6J G;  1YIJ V;  4MW8 A;  5EK0 A;  1OCR C;  2EIK B;  2XAS A;  3ASN B;  3FB6 C;  1S0V A;  2XND G;  2ZR2 A;  3QO8 A;  1P7B A;  4QNH B;  3FB8 C;  1GMG A;  4HAM A;  2Y69 C;  1FXH A;  2DYS C;  1K92 A;  4I9W A;  3CCV V;  1GTO A;  3JD2 A;  4XDL A;  4JAU A;  3T1C A;  2EJR A;  5LGU A;  1RM1 C;  1Q82 W;  2JEU A;  5LGT A;  2ZXW B;  4MVZ A;  1YSC A;  2LFR A;  3ABK C;  1JPX A;  3CC4 V;  1H8E G;  1M9N A;  4PDR A;  3K08 A;  2EIN B;  1S3J A;  2OCC C;  3CP1 A;  3JD1 A;  1K8A W;  5KA5 A;  4YXW G;  3WG7 C;  3ETE A;  3B8M A;  2XOK G;  3TK1 A;  5J9P C;  3VBB A;  2IU0 A;  3ZRW B;  3QO7 A;  3LDC A;  3CMA V;  2IW5 A;  2ZDI C;  5IDJ A;  1PKX A;  3ZN0 A;  4MT8 A;  5CBF A;  1SES A;  3JD4 A;  3CXC U;  1RPR A;  4Q20 A;  2JJ2 G;  1GK9 A;  1JCH A;  1AI6 A;  2WPD G;  1Y4M A;  3FB7 C;  3ZMV A;  2A9H A;  3H01 A;  3ABM B;  1NVP D;  1E1R G;  2Q67 A;  2XAG A;  2EIJ B;  4WCE V;  5FL7 G;  1NR7 A;  3E8G A;  3OUS A;  5BZB A;  3HPL C;  4KUM A;  3SYQ A;  4HYO A;  2W0F C;  3K3W A;  1I5X A;  2H94 A;  2D3O W;  1JVM A;  4FK5 C;  1K73 W;  2NNU A;  1DF5 A;  2ATK C;  3OUF A;  3E83 A;  5HFM A;  1YTF B;  3OMN B;  4RUE A;  2WLM A;  1YJW V;  4J9Y B;  2DYR B;  1NQT A;  1JQ0 A;  2QKS A;  3HB3 B;  3SYO A;  4JTA B;  3CD6 V;  3ZCC A;  4LP8 A;  2X0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...