4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
3IGAC 2WLKA 2AHYA 4JTDB 4EKWA 4X88A 4DXWA 3IFXA 4LBEC 2EIJC 2ITCC 2BOBC 3ASOC 4WFGA 3UKMA 3ABLC 3SPJA 4XDKA 5KUMA 4P30A 5E1AC 3F5WC 1J95A 4WFFA 4WFEA 4GX2A 3ABMC 3STZC 3LNMB 4J9YB 4P9PA 4QNHB 4MVOA 1QLEC 1V55C 3K0GA 3SPCA 4WFHA 3SPHA 3LDDA 3OUSA 3VOUA 2WLJA 3X2QC 2HFEC 1R3LC 4UUJC 4R8CA 1V54C 3FB6C 3SYQA 4GX1A 3F7YC 2DYRC 5EBMC 3SYPA 2EILC 4QE7A 1BL8A 2Q6AA 4HYOA 3SPGA 2HG5C 2DWDC 2YEVA 1R3KC 4KFMA 3SYAA 3UM7A 2HJFC 4PDLA 4BW5A 1G4YB 4MS2A 3OR7C 3TCUA 5CBFA 3AG1C 3SJQC 3LDCA 2WLNA 1ORQC 3ASNC 1R3IC 4F4LA 2A9HA 2WLLA 2WLMA 5EC2C 2X6AA 2ZXWC 1JVMA 3STLC 2QKSA 1KKDA 3JYCA 2NLJC 1ZWIC 2ATKC 1M57C 2IH3C 4PA3A 5J9PC 3OUFA 4H33A 4RO2A 3SPIA 3ZJZA 3GB7C 3LUTB 4MSWC 2X6CA 4I9WA 4PDRA 2Q68A 4XDJA 2ITDC 4MVRA 4JTCB 4MTOA 3FB5C 1LNQA 4J9ZB 3RW0A 3T1CA 3OGCC 3HPLC 5EK0A 4CBCA 2BOCC 3K08A 4MVSA 3KG2A 1XL4A 3FB8C 3AG4C 1P7BA 4MW8A 2W0FC 3BEHA 2Y69C 4R6ZA 3EFFK 3WG7C 5KUKA 4G27B 2KB1A 5EBLC 1XL6A 2A0LA 4JTAB 2Q67A 2QTOA 4HZ3A 1M56C 4XDLA 3TETA 1OCZC 4LP8A 4LCUC 3SYOA 2DYSC 2K1EA 4R7CA 2EIKC 3ZRSA 5IY5C 3FB7C 4RAIA 4PDVA 4GX0A 4MW3A 3E8BA 4MVMA 2DWEC 3R65A 2WLIA 2A79B 1K4CC 4MVZA 4QE9A 3RBZA 4R50A 2WLLB 5B1AC 1S5HC 3SYCA 4RUFA 3T4ZA 3LDEA 3OR6C 1OCRC 4X89A 4PA9A 4H37A 3E86A 2JK5C 3AG2C 3RVZA 2Q69A 4PDMA 3E8HA 5B3SC 5BZBA 5CBHA 3E89A 1OCCC 3PJSK 2H8PC 3ABKC 4X8AA 3K03A 5CBGA 4OXSA 4MTFA 4PA6A 2EINC 4RUEA 4GX5A 3E8GA 2P7TC 2X6BA 1OCOC 1K4DC 3T4DA 2OCCC 2ZD9A 4MVQA 3T2MA 4P9OA 4PA4A 3E83A 2HVJC 3K06A 5EC1C 1R3JC 4PA7A 3E8FA 4TWKA 4ZBMA 3K0DA 4P2ZA 2WLHA 5EBWC 3RVYA 3AG3C 4G28B 2HVKC 2AHZA 2EIMC 4MTGA 3F7VC 3K04A 5B1BC 4MVUA 2R9RB 2WLIB 2IH1C
chains in the Genus database with same CATH superfamily
4WFBV 2AHYA 4W4LA 4FMTA 5EYPB 1YCIA 4UVBA 1XQ8A 3ABLC 2OIEA 1IDSA 2HJDA 1OCRB 1E1RG 4CS4A 1VARA 2V7QG 3IJ4A 5ITZB 4WFHA 3JATA 3M8AA 4O4HB 1FKAO 2HFEC 1R3LC 1US6A 5DN6G 3F7YC 2Q7EA 4B3RB 2DWDC 4YJ2A 2JGUA 1BHAA 2F43G 1G8MA 1WJZA 5JH7A 2RJZA 1ORQC 5KX5A 5C8YB 3JCUZ 3OMNB 1EN5A 2AW9A 2EIMB 2ATKC 4LF7O 1RP3B 3A0BZ 4LF7B 3DTUB 4TV9B 1EBOA 2R70A 3N2GB 2GTAA 1Q43A 4H13B 1KD1W 4D6TH 1K8AW 3HKEB 2UXCO 2YI9A 3E22B 3TETA 4LCUC 2QGNA 1N0JA 1MZEA 4HAMA 2UUBB 2EILB 4B08A 4CH5A 3S3XA 1YVWA 5LHHA 4HNAB 1FS0G 2X7RB 2JIZG 4TUYA 4O4LB 1QVGU 3RYCA 3U0ZA 1PPJH 5IJ0B 1ZTEA 5GONB 3MD0A 1FXHA 3M99B 4L8JA 1NJIW 4NXMO 1Y76B 1K34A 3L71H 2P7TC 2QM7A 4LF5B 2C2AA 2LP7A 3VQYA 3FX7A 4MT8A 1SS3A 1HNXO 2QR4A 4LF6O 1HNXB 4JI6O 5LGUA 4DV5O 1M4UA 2QEXV 4DV5B 3F7VC 3CJHB 2XNDG 4B3TB 2ZNIA 2EIJC 3BVOA 5LMUO 1K3EA 2CTPA 4X62B 5E1AC 3F5WC 2YICA 3C90A 1R6KA 4FLZA 2CK3G 1L1FA 4F6EA 3B77A 1HNWO 1OCCB 1HNWB 1VF7A 4U7OA 1R3KC 2HJFC 4GZRB 1SQGA 4YJ2B 5EC2C 3BCCH 4LNUB 1XOUA 1KB9F 4X65O 5KX5B 1H2LA 1WB7A 1B06A 4JTCB 1VQ4V 1JOYA 1JCHA 2CGNA 2PTMA 5IE9A 1H2NA 2KQXA 4DUYO 1QLEB 1SQXH 4DUYB 1TVKB 5L3BA 1YI2V 3JASB 5JQGA 1PL4A 3ZBHA 3DXRA 4MW3A 1SERA 2A79B 3SYCA 1SQPH 2HHHO 2Y4UA 2HHHB 3OMIB 2ZXWB 4JI7O 2LFRA 4DV2O 4TUYB 4DV2B 2B1GA 3ABKC 4OXSA 5KMGA 4JI4O 4JI4B 4DR5O 1K4DC 2F1MA 2Y0IA 3EXAA 1AI5A 5TISZ 4TWKA 4YIPA 4UCTA 1BMFG 1FXKC 1TUBB 3K5MA 4BW9A 1ZAUA 3A0HZ 2ITCC 3SPJA 4XDKA 5KUMA 1MNGA 1J95A 4DW1A 2QWPB 1UPGA 1GN2A 3W7SA 3QO5A 2KG7A 2Q0OC 4J7ZA 3CB2A 3CSXA 3THOA 2YEVA 1QBZA 3SYAA 1SQBH 2Q5ZA 4PDLA 3UM7A 4DRXA 3AG1C 2DN9A 3UCSC 2PYJA 1F51A 1NKDA 3AG3B 3ZS8C 2AGAA 2X6AA 4X1IA 1GAXA 3SDLA 1URFA 4PDRA 2OCHA 4JI1B 3RW0A 3OGCC 1EZVH 1NT2B 2BOCC 2QKCA 4X64O 1ZSPA 4X64B 3GWKC 5B1NA 3D36C 4EEQA 1TA8A 1Q90D 3P3NA 1KP3A 4JAVA 5KHJA 1IZ3A 4XDLA 4JYAO 4W4KA 3X2QB 1IBKO 4AI8A 1IBKB 2NNUA 2HR3A 1GM7A 2YXLA 2R9AA 1N4CA 4I50B 3BA9A 5JQGB 1Q6HA 2PI5A 3DXRB 1F7YA 4LF4O 4MTXA 3D3IA 1BQZA 3CCUV 3TXQA 2PGGA 1XMOO 2JGDA 4JYCA 1XMOB 2R72A 5LOVB 2P4KA 2P22C 4DK1A 2HVJC 5KMGB 3E8FA 4QPJA 2BSKB 3ZRXA 4X66O 1HR0B 3MDSA 2N05A 2XAFA 2WLKA 2BTQB 3ZX6A 3ABUA 4JI2B 3G67A 2CTQA 4FZ1A 3L70H 2Z5UA 2CUGA 1Q5OA 1AJNA 2E3CA 4UFZA 4YJ3A 3RYIA 2W6IG 1V55C 4LH6A 4J7KA 1NR1A 4JZ2A 4UUJC 2VWKA 2ZR2A 3J80N 2GSMB 4ZOLA 1VQ7V 3FYEB 1BL8A 3ZHQA 2KG7B 4Q6GA 3UT5B 1VQNV 3OR7C 4B3SO 4NTYA 4YHHB 4B3SB 1L0NH 1TUEB 1P49A 2YEVB 4EFEA 4TSFG 1XDCA 2UUCO 4PHZA 5IT9N 2UUCB 1O9GA 3HKCA 1EFRG 2N04A 1W2BU 4ICGA 4MVSA 1U96A 4UCUA 3AG4C 2E5LB 3Q4HA 3L74H 5FLXN 1EZJA 1X59A 1V54B 4NKGB 3JALA 4IL6Z 1S3JA 4DV1B 2DWEC 2WLIA 2FL4A 3HB3B 2Z0AA 4DR7B 3WB2A 4JASA 1Y6XA 3QG5A 4PDMA 1B6QA 4DUZO 3MHSC 1DK1A 1M57B 5J2UA 2Z3YA 1K7DA 1S5LZ 1V55B 3UQ8A 3RWRD 2DJVA 4B3MB 1H8EG 2V1DA 1ZL8A 2ZD9A 3H1IH 1G6UA 3CS5A 1NTMH 3E83A 5EC1C 4PA7A 2Y69B 2P67A 2DQ0A 2IU3A 4LH7A 4NVPA 1OCZB 5B1BC 4AQYB 4TOIA 3ZMVA 3FFQA 3OM3B 2BE3A 3H9VA 3CEIA 3ETGA 3HR0A 2VWJA 2ZNJA 4U7NA 2YUAA 4DR3B 4GX2A 3CC2V 4HBNA 4CC6A 2LW1A 5CA1B 5B3SB 4LF9B 1S76D 2WLJA 4BAYA 4Z1VA 1XHXA 3ZRVA 1FJGO 2EINB 4YJ3B 3RYIB 2JJ1G 3OEHG 1AR1B 3T1HO 3H1LH 1YZBA 1D2DA 2A9HA 2HLDG 1RFYA 3JYCA 1PNKA 2NLJC 1Q82W 5H6QA 2RNBA 1SQFA 3WB1A 1YSCA 3CRCA 5KAFZ 2P4VA 3WG7C 3VQVA 4DV3B 4I7ZB 3N2KB 1NQTA 3CYOA 4HZ3A 1SETA 3VQXA 4X1KA 1FFTB 1Y74B 5CB4A 1HNZB 1NBMG 1RPOA 4LFBO 3ZRSA 3Q4HB 1RM1B 4LFBB 3E8BA 4K8XA 2IW5A 1GRJA 1K4CC 3ZHUA 3F5TA 2PI4A 4EB6A 4JPRA 3ASNB 4DV7O 1OCRC 2KKWA 1XNRO 2O57A 2QSAA 1LR1A 3DC5A 2RDCA 1SKVA 4K0KB 4KHPO 2GUZA 4DR6O 2AXTZ 4KL1A 5J2UB 2NR5A 1PM9A 2WLHA 1ZL8B 1DLBA 1VF6A 2EIMC 4IHJA 1VQMV 5KA5A 5IWAO 5IWAB 4X1YA 3DSQA 3C3TA 4J42A 1NZ6A 4ABMA 4GKKO 1I08A 3ETQA 4OX9B 2F93B 3VQWA 1EN6A 4E2LA 1JFFA 1KYOF 2ZM6O 3AG2B 2DQ3A 4JI0O 1YDXA 1R73A 4Z2WA 3FB6C 4F6RA 2EILC 3JD4A 3JSLA 4NXNB 4KFMA 1TGOA 2P06A 3LDCA 4PD4F 3CCVV 3W7WA 1MABG 1LUWA 4MSWC 4I9WA 3E2EA 5IYDO 5J2TB 4J9ZB 3ZN1A 4J7JA 1BSMA 1H2MA 3K08A 3ZRWB 4B3RO 2DW4A 1K5SA 1MZFA 3K5NA 2YC0A 5JCOC 2AZ2A 5LA6A 2HKOA 1VQOV 2K1EA 1XNQO 4LC1A 5CN0A 1KQSU 1XNQB 5CB4B 2D2CB 4WF9V 1Q8IA 2WLLB 2ETNA 1VIBA 3CRAA 1MMMA 1AR4A 3LDEA 1SRYA 3FAVA 4H37A 3E86A 4UCVA 1OCCC 1GO3F 2EZOA 4X8AA 3ICXA 4RUEA 2EZPA 4UB8Z 4PJ0Z 1SA0B 5LL6Y 1FFXB 3H1KH 4FLWA 2QDOA 4KUMA 1VF5B 1N0NA 2RCVA 2UUBO 4DV4B 4FLVA 5EIBC 1FPOA 3BY6A 3RVYA 4IIJB 2GUZB 2YSUB 2IJIA 3D8CA 1OJHA 4H0LB 5H9CA 4GKJO 1COWG 4GKJB 2LJ2A 4IHJB 2RQ6A 4DXWA 3CCJV 4FVMA 3SJBC 1AVMA 4X1YB 1NI8A 4DV0O 4LF5O 4DV0B 1VEWA 2Q4PA 2FTKA 1QLEC 4UVCA 2ZIMA 2B5UA 2NN4A 3OMAB 2OIGA 1Z5WA 4R8CA 2W6JG 3ZMSA 3G4SV 1DTOA 1OCOB 3CCEV 4B3TO 1G4YB 2ARHA 4O2BA 2JRIA 5CBFA 4LR3A 4F6RB 2WLNA 3CXCU 4ZKIA 1M90W 5JVDA 4X62O 2ZXWC 1AR5A 1KP2A 2PZSA 4H33A 3K9AA 2CH7A 4CS3A 4WFAV 1YJ9V 1IBMB 4RWUA 1VQPV 1SZXA 4MTOA 3KZIZ 1CEZA 1MOFA 2F23A 2YI8A 2Y0PA 3KCYA 3JATB 1J5EO 3TK1A 1J5EB 4JTAB 2YS8A 3ZMUA 5DECA 1XI1A 1P7GA 1AILA 4U3JA 5LA6B 5JH7B 4MVMA 2UUAO 1PD3A 4R50A 2UUAB 1Y4MA 3KCXA 2QE7G 2UXXA 3G71V 5GTHZ 5JJEB 1VQ6V 1L0LH 3L73H 3PJSK 3K03A 4C7UA 3K3WA 4PA6A 3FAVB 2ADPA 3K5OA 3B8NA 5IYBO 4GLXA 2Y48A 2MK3A 2YXHA 3K06A 4PA4A 1R3JC 1GTOA 3JARA 3K0DA 4DV6B 3AG3C 3K79A 1NTKH 4LWSA 1XMQB 1M5IA 5KHKA 3A2FA 4O2AA 3R66A 3W7UA 2R9RB 3SGIA 1FXKA 1NVPD 4X88A 1QU7A 5BMVA 3ABTA 4J11A 3RYCB 1W0KG 5B1AB 2N74A 2XAHA 3AG7A 4WFEA 1A32A 4J41A 2WAMA 4K35A 2XUMA 3X2QC 3FD9A 1PNLA 3BA8A 1ENVA 4QE7A 2DMXA 4CS2A 2EJRA 3CCSV 2Y4TA 4FLTA 1XILA 2VQEB 1R3IC 2DOSA 3G6BA 4TQFA 1ZWIC 3LUTB 1M9NA 5JVDB 3OGIB 3M7MX 2UXDO 2UXDB 3JAKA 1XL4A 3HKDA 3ZHTA 1K33A 1LUVA 3HKBA 2KSDA 1H2SB 2DYRB 4PDVA 2Q0AA 5IYZA 5IYCO 2Q9LA 2QWRB 4JI1O 4U3JB 2Q7HA 4YXWG 5KHHA 3IAYA 2CE4A 4DO2A 2Q69A 1M93A 3E89A 2H8PC 4FFBA 5CBGA 1PP9H 3JSNA 1DGSA 1BZKA 5A2QN 4PELA 1H8HG 1QQCA 1CP9A 4P2ZA 3BPZA 2WSSG 4TQDA 5EBWC 3JAMN 3QO8A 2AHZA 4MTGA 1Q86W 3IC7A 4WBNA 3B8MA 4IYIA 3JARB 4LWSB 1W59A 1N36B 3EVKA 4LBEC 2UU9O 5BR8B 1QCEA 2UU9B 3JD2A 4YY3O 4P30A 4YY3B 5H2FZ 5BMVB 4P9PA 3J81N 4ASUG 1OZ0A 3LSSA 1HR0O 1V54C 4JI3B 3RN4A 3ML0A 4TV8A 4FIPC 4UCRA 5L3FA 3LNNA 4MS2A 4JI2O 4X20A 4FLXA 4DR4B 1H2KA 1MSDA 4IYHA 4E4EA 1IXBA 4ZHQA 4PA3A 1M57C 1XUQA 2K9PA 2X6CA 5H6RA 4JZGA 3FB5C 1EN4A 2GDSA 5EK0A 2E74B 1WPXA 3FB8C 1Z2GA 2Y69C 2M6YA 2VQFO 1TAEA 3LSQA 1VMGA 2VQFB 4YHHO 2QM8A 2B9ZA 1OCZC 1S72V 2BCCH 1BE3H 3OAAG 2DYSC 3CE2A 4DRXB 3HKBB 2P90A 4I55A 5BY1A 3S3WA 4I4TA 1IURA 4X1IB 3K9SA 3OR6C 3MHHC 5IYZB 2E5LO 1NH2D 5B3SC 1K97A 1QR8A 1H38A 2JEXA 3CHXA 2EINC 2LQTA 2X6BA 5L3DA 4FFBB 4DV1O 2YIDA 3OTOO 2RN9A 4GT1A 2ZE7A 3OTOB 1E1QG 1M56B 4FJCC 4DR7O 3CP1A 4AHCA 2ZDIA 4GUNA 1DF4A 4IT5A 5GW7A 3I56V 2RMKB 3IGAC 2D3OW 3TJTA 4WBNB 3BRCA 1QHTA 4I9QA 2ZKOA 4B3MO 4GCZA 1JJ2U 1HWYA 4KXRA 2JGDB 4LFAB 1PKXA 3STZC 3SPHA 1KKCA 3QNEA 4OPAA 3U10A 3AK2A 2X0LA 4AQYO 1RM1C 4HYOA 4GYCB 1PL0A 3RYFA 3P32A 1GKFA 1AP6A 5C93A 1YHQV 2DYSB 2OCCB 3TCUA 1WNSA 3SR2C 2ZCEA 3ASNC 4TV8B 5DEDA 4DR3O 4PI2A 1XHZA 3B4SA 3ZHRA 5LP6A 4LF9O 1Q81W 1S5JA 4JV5O 4ZHQB 4JV5B 3ASOB 1E79G 3KG2A 1AROP 3QVNA 1NVPB 2HP8A 4ZIBA 1IX9A 2ADQB 1GM8A 1I0HA 4ZOLB 3CCRV 2LFSA 1BQ0A 1N32B 1JX9A 5CMUA 2CAZC 4UVAA 4X9QA 1I5XA 2CDYA 5B5EZ 5LYJA 4CH6A 1WP7A 2FMLA 3B2EE 4JI8B 3AK3A 4I55B 1B04A 3HKCB 4I4TB 4UCOA 4DV3O 3AG2C 4AILC 3CCLV 4LFCB 1T5EA 2ZE8A 3UO3A 1G1XB 4O4HA 1HNZO 1OV9A 1Q6IA 4JYBA 1W0JG 5B66Z 3I5DA 5KHIA 5LHIA 3JALB 3RFRA 4O4JA 1CPYA 2QWNB 1WLEA 2EIKB 5JJNB 2WLIB 5B1OA 2XAJA 1ZUQA 1YEWA 3CC4V 2CGOA 1BGYH 4QGPA 4BIOA 4WFGA 4TV9A 3QTCA 3CC7V 4K0KO 3L72H 1F4NA 1GN4A 5JWPA 1KC8W 1QNMA 2ZE6A 5LBQA 5KAIZ 4JI5B 4PI0A 2LGQA 4KP4A 1R6TA 2F66C 4O4LA 4OX9O 1AI6A 2QKSA 1KKDA 5IJ0A 5CA0A 4XBFA 1YJNV 5D5PA 3SPIA 1AJPA 3H01A 5GTIZ 2FKXA 2Q73A 1D5AA 3OFNG 4UXNA 1GN6A 5KHGA 3RGBA 3O65A 4YIOA 5LP6B 4NXNO 2YXYA 5JJJB 2G38A 5LMNB 1BT8A 1RSOA 1YXBA 2P6JA 5JCOA 5BXZA 4GX0A 1VF6C 1YTFD 4Q20A 1N33B 1VQ8V 5FL7G 2ILMA 2WA3A 1S5HC 3CCQV 3MAQA 2XAQA 1PV0A 2OT5A 5LYJB 4QPKA 2XT9A 3GVMA 2YIAA 3FYIB 2E76B 1OCOC 1ROPA 2HEPA 3CRRA 4X1KB 3CD6V 3CX5F 2HVKC 2JS5A 3K57A 3P3PA 3K04A 2F4VO 2OTLV 4MVUA 5EZYA 2F4VB 4I0XA 4K8ZA 4LNUA 5IY5B 4FZ0A 1ZX3A 4O4JB 4EB6B 5FPRA 2BOBC 2QJ1A 3UKMA 1IXMA 3W7XA 1SQVH 3AK1A 3OE7G 1EM1A 4DV4O 1BS3A 1YITV 3L9DA 2QWOB 4DK0A 1JMKC 2IJJA 2XAGA 1TVKA 3APOA 1HW7A 1UJWB 1I94O 4NTXA 3JASA 1I94B 1NH2B 1OHHG 3VBBA 2UXCB 3G6EV 4JF3A 5KA6A 2WLMA 3E35A 4JGSA 1NTZH 1JVMA 1IVSA 1VQ9V 4FK5C 3OUFA 3ZJZA 4XDJA 1VP7A 5CA0B 3HPLC 1JFFB 3ABLB 1WP8A 1P7BA 2W0FC 4G27B 2KB1A 1N34O 4WCEV 4NXMB 1N34B 1K9MW 3ZMTA 1UFIA 1WA8A 4LP8A 1IBLO 2OTJV 1IBLB 2YIBD 1RSOB 4RAIA 3K5LA 3L75H 1YJWV 1TUBA 3R65A 1IBMO 5H5NA 3ZEDA 4LF6B 1SESA 5B1AC 4JI6B 4CH3A 3NR7A 5E79Z 4RQEA 1HP8A 1F4MA 1BHBA 1GM9A 5BZBA 2IU0A 4H44B 1P4RA 4GX5A 5LMUB 4NTWA 4CH4A 3H1JH 1AP5A 3OTFA 5D5QA 4JTDB 1L8DA 2FB5A 1KU9A 3C3SA 1AI4A 5EZYB 1R1BA 4I0XB 4FM2A 5LGTA 4OPHA 5IJ9A 4X65B 2ZR3A 1H2GA 3AEIA 3OUSA 4DV6O 1GK9A 2DYRC 1XMQO 4OGQB 2LW7A 5IDJA 3P30A 3CCMV 1KBHA 4BW5A 4L87A 4G2KA 1O9HA 3QF7A 2ZT9B 2IBZH 4I50A 3W7TA 1X4TA 1RPRA 2EJ7A 2EIJB 1DF5A 1AB3A 4QIWF 3EFFK 4JI7B 5LOVA 2IJHA 1HDJA 2VQEO 2BSKA 4DR5B 1SZTA 1XBLA 4O2BB 2ZE5A 1WA8B 3CPWU 3N27A 2BTQA 2PYLA 4FPPA 3B09A 2CH7B 4D7TA 2V4DA 2QM4A 3RVZA 3E8HA 3ZHSA 2Q7GA 4PV1B 3D36A 3JD1A 2OYQA 3T2MA 4P9OA 5AG2A 3UT5A 5A9GA 4JYYA 4D7SA 2Q8VA 5LXTA 2CTWA 4N21A 1WAZA 2A06H 1VQ5V 2QTSA 3JAWA 4J80A 1F23A 4J10A 1AJQA 2YIBA 3RYHA 4UB6Z 3ETDA 3IFXA 5CA3A 4ZI7A 3RT3C 1SC5B 1I7FA 2F95B 3LNMB 4J9YB 4MVOA 1YTFB 3JD0A 1N8RW 3BHPA 1NU1H 3VOUA 2OWOA 3ABKB 4CZZA 1NS1A 3SYPA 5IJ9B 2JEUA 2HG5C 3APQA 3ZCCA 1MSWD 1B3QA 1VQLV 2L35A 4FLYA 2P5OA 1P84F 1N36O 3SJQC 4TT3G 5BR8O 4JYAB 4O2AB 1M1KW 1FXKB 3KKYA 5J9PC 2Q68A 4MVRA 4FM0A 4JI3O 4CBCA 2PUSA 2JJ2G 4LF4B 4MW8A 5KUKA 1S77D 3FKSG 1I5YA 4UV8A 5EBLC 2A0LA 2QTOA 1M56C 4DR4O 4FFKA 3SYOA 3OW2U 3K58A 1ZLZA 4I5SA 1FXVA 3FB7C 3K59A 2IM9A 3ZN0A 2W0XA 2M7WA 5K1PA 4QE9A 3RBZA 3IC9A 4DYLA 3AG1B 4X66B 1WN7A 2R9IA 4PA9A 4JAUA 1NR7A 3B40A 2PY5A 5CBHA 4NYKA 5CA1A 4B7KA 4QJFB 3CMAV 3ETEA 3JAKB 3HKDB 5FNVA 3BFRA 2DE0X 1MG1A 2OCCC 4MVQA 5HFLA 4RQFA 4BR6A 1GN3A 1XREA 2JDIG 5LHGA 3ZMZA 2GHYA 2BTOA 4G28B 3SJCC 2ZQMA 3LSUA 4EFBA 2LGWA 3U11A 5LXTB 4EKWA 4DW0A 2E75B 3ASOC 2VRZA 3TGUH 2B1IA 4DR1O 3JAWB 4DR1B 4WFFA 3DGEA 3RYHB 3ABMC 4ZI7B 5L3CA 4QNHB 3K0GA 3SPCA 3LDDA 3N2KA 4NR1A 1PNMA 3SYQA 2JS3A 1K92A 2Q6AA 3SPGA 1Y74A 3I55V 4UCSA 1KUQA 4JAAA 1JPXA 3SJAC 2EX3A 2ODMA 4DR2O 4DR2B 1D5NA 4B7EA 1U97A 4LF8O 4LFAO 4LF8B 2XASA 1R6NA 3G80A 2ITDC 1Q6UA 3T1CA 3JCZA 4F4LA 3J7AU 3BEHA 4R6ZA 4IGGA 4CC5A 4DUZB 1YF2A 2Q67A 2YDEA 2A3QA 5HFMA 4O4IA 3UO2A 3CWBH 4UV9A 3O9OA 1KMIZ 2EIKC 4R7CA 1KECA 4X20B 5LGNA 4FM1A 4FLUA 2ZDIC 4K3AA 5K1XA 2GV9A 3CMEV 4RUFA 3T4ZA 2VS0A 2QWQB 4X89A 2ZIOA 2PF4E 3D3QA 1WB8A 2WA4A 2WPDG 5EIBD 3ABMB 4MTFA 1JJOA 3E8GA 3ZHVA 1V9PA 1N32O 5F2VO 3BAAA 2EULA 3AG4B 1JQ0A 1K5QA 5FNVB 1FJGB 3ZIAG 1QR9A 1Z5VA 1FAFA 5EYPA 2GBOA 4JI8O 2GTSA 1BCCH 1WPBA 4BWAA 2FYUH 3OD4A 5L3GA 4LFCO 3T1HB 5ITZA 2MW2B 2UXBO 5LP6C 5J2TA 2UXBB 1S0VA 1XEQA 1JR9A 3ZRWA 1Q7YW 3GWOA 3WFVA 3T1YO 5FPOA 4GX1A 5EBMC 3T1YB 5L3EA 2EBOA 1VQKV 5C8YA 4Z1MG 4BIUA 2XOKG 2ZINA 1CXZB 2WWWA 2XHBA 1Y66A 1GH6A 2WLLA 3A8TA 3STLC 3WB0A 3H1HH 5B1BB 2IH3C 4RO2A 3GB7C 3OT7A 3N2GA 3OEEG 1FYJA 1LNQA 4A5UB 3HKEA 1SA0A 3E22A 1FFXA 4DV7B 3CXHF 3EHBB 4JI5O 1XL6A 2H3OA 1XNRB 1SF9A 2L6LA 4HNAA 4IIJA 3RYFB 3DC6A 5KLVH 3TXSA 2H94A 4KHPB 4DR6B 5IY5C 1FD9A 2AZ0A 5GONA 4O4IB 4BIZA 4MVZA 4N23A 3A0RA 1Y76A 1MA1A 2JVDA 1QVFU 3JD3A 1Y67A 3QO7A 2JK5C 3CRMA 5LMNO 3CRQA 2XTAA 4GKKB 1YIJV 1SQQH 2QA4V 4U3FH 3NXSA 3PN1A 3WU2Z 1QLNA 1THZA 2LO1A 2UXNA 1Q3EA 1AI7A 3T4DA 5DM6V 2A7WA 3WG7B 2ZM6B 1N33O 3CJHA 4ZBMA 2IJKA 4JI0B 1JA8A 1K73W 2QKAA 4NB5A 1GMGA 3BABA 2CTRA 2IH1C
chains in the Genus database with same CATH topology
4WFBV 2AHYA 4JTDB 3ETGA 4FMTA 4LBEC 4UVBA 1QCEA 1AI4A 3ABLC 3JD2A 4U7NA 4P30A 5LGTA 1OCRB 4GX2A 3CC2V 1E1RG 4P9PA 2V7QG 4ASUG 2ZR3A 1H2GA 4WFHA 3AEIA 5B3SB 1OZ0A 3OUSA 1S76D 2WLJA 3LSSA 1GK9A 4BAYA 2HFEC 1R3LC 3ZRVA 1V54C 5DN6G 2EINB 3F7YC 2DYRC 2JJ1G 3ML0A 5IDJA 2DWDC 1BHAA 4FIPC 3P30A 3CCMV 3OEHG 4BW5A 5L3FA 4MS2A 1AR1B 2F43G 1G8MA 4L87A 4G2KA 1ORQC 2A9HA 3OMNB 2HLDG 2EIMB 3JYCA 1PNKA 2NLJC 2ATKC 4PA3A 1M57C 1Q82W 3W7TA 2X6CA 1RPRA 5H6RA 5H6QA 3DTUB 3FB5C 1YSCA 1EBOA 1DF5A 2EIJB 5EK0A 4QIWF 1WPXA 3FB8C 3WG7C 2Y69C 3EFFK 2IJHA 1NQTA 3LSQA 3CYOA 1KD1W 1K8AW 4HZ3A 1SETA 2QM8A 3TETA 1FFTB 1OCZC 1S72V 4LCUC 3OAAG 1NBMG 1RPOA 1SZTA 2DYSC 4HAMA 3ZRSA 2EILB 1RM1B 2P90A 3E8BA 2IW5A 5LHHA 3CPWU 1K4CC 1FS0G 2X7RB 2JIZG 1QVGU 2PI4A 4JPRA 3ASNB 3OR6C 4FPPA 3MHHC 3MD0A 1FXHA 1OCRC 3M99B 1NH2D 5B3SC 3RVZA 1K97A 1QR8A 3E8HA 1NJIW 2JEXA 1H38A 1K34A 2EINC 3D36A 2P7TC 2X6BA 3JD1A 5L3DA 2QM7A 2C2AA 3T2MA 2LP7A 4P9OA 4MT8A 4GT1A 2WLHA 1E1QG 5LGUA 4N21A 1M56B 1DLBA 2EIMC 4FJCC 1VQMV 2QEXV 5KA5A 3F7VC 3CP1A 1VQ5V 2ZDIA 1DF4A 2XNDG 5GW7A 3I56V 3IGAC 1F23A 1AJQA 2D3OW 3ETDA 3IFXA 5CA3A 2EIJC 1K3EA 4GCZA 5E1AC 3F5WC 1JJ2U 1HWYA 4E2LA 1PKXA 1R6KA 3STZC 3LNMB 4J9YB 4MVOA 2CK3G 1YTFB 3JD0A 3SPHA 1N8RW 3AG2B 1L1FA 3B77A 3VOUA 2DQ3A 1OCCB 3QNEA 1R73A 3ABKB 4CZZA 3FB6C 3SYPA 2X0LA 2EILC 2JEUA 4HYOA 1RM1C 1PL0A 3JD4A 2HG5C 3P32A 1GKFA 4U7OA 3ZCCA 1MSWD 1R3KC 4KFMA 1VQLV 5C93A 1YHQV 2DYSB 2HJFC 2OCCB 3TCUA 3SJQC 3LDCA 4TT3G 3ASNC 3CCVV 3W7WA 5EC2C 1M1KW 1FXKB 5J9PC 1MABG 4MSWC 4I9WA 3E2EA 2Q68A 4MVRA 1Q81W 4JTCB 1VQ4V 5IYDO 4J9ZB 3ZN1A 1JOYA 1JCHA 4CBCA 3ASOB 3K08A 1E79G 2JJ2G 3ZRWB 3KG2A 4MW8A 5KUKA 1S77D 1AROP 3FKSG 2DW4A 1I5YA 1K5SA 4UV8A 5EBLC 2A0LA 1NVPB 2QTOA 1M56C 1QLEB 1GM8A 2HKOA 3CCRV 2LFSA 5L3BA 1YI2V 3SYOA 3OW2U 1VQOV 2K1EA 4I5SA 1JX9A 4LC1A 1FXVA 3FB7C 5CMUA 5CN0A 4UVAA 1KQSU 4MW3A 1I5XA 3ZN0A 2M7WA 1SERA 2A79B 4QE9A 3RBZA 4WF9V 2WLLB 3AG1B 3SYCA 3LDEA 2R9IA 1SRYA 3OMIB 4PA9A 4JAUA 2ZXWB 4H37A 1NR7A 3E86A 2LFRA 3AG2C 3CCLV 5CBHA 1OCCC 1GO3F 2EZOA 2B1GA 3ABKC 4X8AA 4OXSA 4RUEA 2EZPA 4QJFB 3CMAV 3ETEA 4KUMA 1MG1A 1K4DC 2OCCC 4MVQA 5HFLA 4RQFA 1AI5A 2JDIG 4JYBA 4TWKA 5LHGA 3ZMZA 3BY6A 2GHYA 3RVYA 1W0JG 4G28B 5LHIA 2YSUB 2IJIA 1BMFG 1FXKC 1CPYA 2ZQMA 1WLEA 2EIKB 2WLIB 5H9CA 5B1OA 2XAJA 1COWG 4EKWA 3CCJV 4DXWA 3CC4V 2ITCC 3ASOC 4WFGA 2B1IA 3SPJA 4XDKA 5KUMA 3CC7V 1J95A 4WFFA 1F4NA 3DGEA 3W7SA 3ABMC 3QO5A 5L3CA 2FTKA 4QNHB 1QLEC 3K0GA 3SPCA 4UVCA 3LDDA 2B5UA 3OMAB 1KC8W 4R8CA 2W6JG 1PNMA 3SYQA 1K92A 3ZMSA 2Q6AA 3SPGA 3G4SV 2YEVA 1DTOA 1QBZA 1OCOB 3SYAA 5LBQA 3UM7A 4PDLA 3I55V 3CCEV 1G4YB 1JPXA 5CBFA 3AG1C 2WLNA 3CXCU 4KP4A 4ZKIA 1M90W 1F51A 1NKDA 3AG3B 2X6AA 2ZXWC 1AI6A 2QKSA 1KKDA 1KP2A 4XBFA 1YJNV 4H33A 1AJPA 3K9AA 3SPIA 4WFAV 1YJ9V 3H01A 2XASA 4PDRA 1VQPV 1R6NA 2ITDC 4MTOA 3OFNG 4UXNA 3RW0A 3T1CA 3OGCC 1CEZA 2BOCC 3JCZA 1MOFA 4F4LA 3BEHA 4R6ZA 5B1NA 3TK1A 4JTAB 2Q67A 3ZMUA 4JAVA 1KP3A 5HFMA 2P6JA 4XDLA 3X2QB 4UV9A 4R7CA 2EIKC 1KECA 4GX0A 2NNUA 1YTFD 2HR3A 1GM7A 4MVMA 5LGNA 4Q20A 2ZDIC 1PD3A 1VQ8V 4R50A 5FL7G 3CMEV 2PI5A 1Y4MA 1S5HC 4RUFA 3T4ZA 2QE7G 2UXXA 3G71V 3CCQV 4X89A 1VQ6V 4MTXA 3D3IA 3CCUV 2XAQA 2OT5A 2WPDG 3PJSK 4JYCA 4QPKA 3K03A 3K3WA 3ABMB 4MTFA 4PA6A 3E8GA 3FYIB 1OCOC 3B8NA 5IYBO 1ROPA 2Y48A 2MK3A 3AG4B 2HVJC 3K06A 4PA4A 1R3JC 1GTOA 3E8FA 1JQ0A 1K5QA 3K0DA 4QPJA 3CD6V 3AG3C 3K79A 2HVKC 3ZRXA 3ZIAG 1QR9A 3K04A 2OTLV 3W7UA 4MVUA 2XAFA 2R9RB 5IY5B 2WLKA 1FXKA 5L3GA 1NVPD 3ABUA 4X88A 3ABTA 2BOBC 3UKMA 1W0KG 2Z5UA 5B1AB 2XAHA 1IXMA 3W7XA 1S0VA 3OE7G 1AJNA 4WFEA 3ZRWA 1Q7YW 1YITV 3GWOA 2W6IG 1V55C 2WAMA 1NR1A 3X2QC 4UUJC 1PNLA 3WFVA 2ZR2A 4GX1A 1ENVA 2GSMB 5EBMC 5L3EA 2IJJA 2XAGA 1VQ7V 3FYEB 2EBOA 1BL8A 4QE7A 1UJWB 1VQKV 4Z1MG 2EJRA 1NH2B 3CCSV 4BIUA 1VQNV 2XOKG 3OR7C 1OHHG 2WWWA 3VBBA 1Y66A 3G6EV 4JF3A 1R3IC 1TUEB 5KA6A 2YEVB 2WLLA 2WLMA 3E35A 4JGSA 4TSFG 1JVMA 1VQ9V 3STLC 5B1BB 1ZWIC 2IH3C 4FK5C 3OUFA 4RO2A 3ZJZA 3GB7C 3LUTB 1EFRG 3OEEG 1M9NA 4XDJA 1LNQA 1W2BU 3HPLC 3ABLB 4MVSA 1XL4A 3AG4C 1P7BA 2W0FC 4G27B 1K33A 2KB1A 4WCEV 3EHBB 1XL6A 1K9MW 1EZJA 3ZMTA 4LP8A 2OTJV 1V54B 2H94A 2DYRB 5IY5C 4RAIA 1YJWV 4PDVA 1S3JA 5IYCO 2DWEC 3R65A 2WLIA 4BIZA 4MVZA 4N23A 3A0RA 1SESA 5B1AC 3HB3B 1QVFU 3JD3A 4YXWG 4JASA 4RQEA 1F4MA 3QO7A 2JK5C 4DO2A 2Q69A 1B6QA 4PDMA 1GM9A 3MHSC 5BZBA 1BHBA 3E89A 1M57B 2H8PC 1YIJV 2IU0A 5CBGA 2QA4V 1P4RA 4GX5A 2Z3YA 1K7DA 1V55B 3NXSA 1QLNA 1THZA 2UXNA 1H8EG 1AI7A 2V1DA 2ZD9A 3T4DA 5DM6V 4PELA 3E83A 5EC1C 3WG7B 4PA7A 2Y69B 1H8HG 2P67A 4ZBMA 1CP9A 4P2ZA 2DQ0A 2WSSG 5EBWC 2IU3A 2IJKA 3QO8A 2AHZA 1K73W 4MTGA 1Q86W 1GMGA 1OCZB 5B1BC 3IC7A 3ZMVA 3B8MA 2IH1C 3OM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IGA C;  2WLK A;  2AHY A;  4JTD B;  4EKW A;  4X88 A;  4DXW A;  3IFX A;  4LBE C;  2EIJ C;  2ITC C;  2BOB C;  3ASO C;  4WFG A;  3UKM A;  3ABL C;  3SPJ A;  4XDK A;  5KUM A;  4P30 A;  5E1A C;  3F5W C;  1J95 A;  4WFF A;  4WFE A;  4GX2 A;  3ABM C;  3STZ C;  3LNM B;  4J9Y B;  4P9P A;  4QNH B;  4MVO A;  1QLE C;  1V55 C;  3K0G A;  3SPC A;  4WFH A;  3SPH A;  3LDD A;  3OUS A;  3VOU A;  2WLJ A;  3X2Q C;  2HFE C;  1R3L C;  4UUJ C;  4R8C A;  1V54 C;  3FB6 C;  3SYQ A;  4GX1 A;  3F7Y C;  2DYR C;  5EBM C;  3SYP A;  2EIL C;  4QE7 A;  1BL8 A;  2Q6A A;  4HYO A;  3SPG A;  2HG5 C;  2DWD C;  2YEV A;  1R3K C;  4KFM A;  3SYA A;  3UM7 A;  2HJF C;  4PDL A;  4BW5 A;  1G4Y B;  4MS2 A;  3OR7 C;  3TCU A;  5CBF A;  3AG1 C;  3SJQ C;  3LDC A;  2WLN A;  1ORQ C;  3ASN C;  1R3I C;  4F4L A;  2A9H A;  2WLL A;  2WLM A;  5EC2 C;  2X6A A;  2ZXW C;  1JVM A;  3STL C;  2QKS A;  1KKD A;  3JYC A;  2NLJ C;  1ZWI C;  2ATK C;  1M57 C;  2IH3 C;  4PA3 A;  5J9P C;  3OUF A;  4H33 A;  4RO2 A;  3SPI A;  3ZJZ A;  3GB7 C;  3LUT B;  4MSW C;  2X6C A;  4I9W A;  4PDR A;  2Q68 A;  4XDJ A;  2ITD C;  4MVR A;  4JTC B;  4MTO A;  3FB5 C;  1LNQ A;  4J9Z B;  3RW0 A;  3T1C A;  3OGC C;  3HPL C;  5EK0 A;  4CBC A;  2BOC C;  3K08 A;  4MVS A;  3KG2 A;  1XL4 A;  3FB8 C;  3AG4 C;  1P7B A;  4MW8 A;  2W0F C;  3BEH A;  2Y69 C;  4R6Z A;  3EFF K;  3WG7 C;  5KUK A;  4G27 B;  2KB1 A;  5EBL C;  1XL6 A;  2A0L A;  4JTA B;  2Q67 A;  2QTO A;  4HZ3 A;  1M56 C;  4XDL A;  3TET A;  1OCZ C;  4LP8 A;  4LCU C;  3SYO A;  2DYS C;  2K1E A;  4R7C A;  2EIK C;  3ZRS A;  5IY5 C;  3FB7 C;  4RAI A;  4PDV A;  4GX0 A;  4MW3 A;  3E8B A;  4MVM A;  2DWE C;  3R65 A;  2WLI A;  2A79 B;  1K4C C;  4MVZ A;  4QE9 A;  3RBZ A;  4R50 A;  2WLL B;  5B1A C;  1S5H C;  3SYC A;  4RUF A;  3T4Z A;  3LDE A;  3OR6 C;  1OCR C;  4X89 A;  4PA9 A;  4H37 A;  3E86 A;  2JK5 C;  3AG2 C;  3RVZ A;  2Q69 A;  4PDM A;  3E8H A;  5B3S C;  5BZB A;  5CBH A;  3E89 A;  1OCC C;  3PJS K;  2H8P C;  3ABK C;  4X8A A;  3K03 A;  5CBG A;  4OXS A;  4MTF A;  4PA6 A;  2EIN C;  4RUE A;  4GX5 A;  3E8G A;  2P7T C;  2X6B A;  1OCO C;  1K4D C;  3T4D A;  2OCC C;  2ZD9 A;  4MVQ A;  3T2M A;  4P9O A;  4PA4 A;  3E83 A;  2HVJ C;  3K06 A;  5EC1 C;  1R3J C;  4PA7 A;  3E8F A;  4TWK A;  4ZBM A;  3K0D A;  4P2Z A;  2WLH A;  5EBW C;  3RVY A;  3AG3 C;  4G28 B;  2HVK C;  2AHZ A;  2EIM C;  4MTG A;  3F7V C;  3K04 A;  5B1B C;  4MVU A;  2R9R B;  2WLI B;  2IH1 C; 
#chains in the Genus database with same CATH topology
 4WFB V;  2AHY A;  4W4L A;  4FMT A;  5EYP B;  1YCI A;  4UVB A;  1XQ8 A;  3ABL C;  2OIE A;  1IDS A;  2HJD A;  1OCR B;  1E1R G;  4CS4 A;  1VAR A;  2V7Q G;  3IJ4 A;  5ITZ B;  4WFH A;  3JAT A;  3M8A A;  4O4H B;  1FKA O;  2HFE C;  1R3L C;  1US6 A;  5DN6 G;  3F7Y C;  2Q7E A;  4B3R B;  2DWD C;  4YJ2 A;  2JGU A;  1BHA A;  2F43 G;  1G8M A;  1WJZ A;  5JH7 A;  2RJZ A;  1ORQ C;  5KX5 A;  5C8Y B;  3JCU Z;  3OMN B;  1EN5 A;  2AW9 A;  2EIM B;  2ATK C;  4LF7 O;  1RP3 B;  3A0B Z;  4LF7 B;  3DTU B;  4TV9 B;  1EBO A;  2R70 A;  3N2G B;  2GTA A;  1Q43 A;  4H13 B;  1KD1 W;  4D6T H;  1K8A W;  3HKE B;  2UXC O;  2YI9 A;  3E22 B;  3TET A;  4LCU C;  2QGN A;  1N0J A;  1MZE A;  4HAM A;  2UUB B;  2EIL B;  4B08 A;  4CH5 A;  3S3X A;  1YVW A;  5LHH A;  4HNA B;  1FS0 G;  2X7R B;  2JIZ G;  4TUY A;  4O4L B;  1QVG U;  3RYC A;  3U0Z A;  1PPJ H;  5IJ0 B;  1ZTE A;  5GON B;  3MD0 A;  1FXH A;  3M99 B;  4L8J A;  1NJI W;  4NXM O;  1Y76 B;  1K34 A;  3L71 H;  2P7T C;  2QM7 A;  4LF5 B;  2C2A A;  2LP7 A;  3VQY A;  3FX7 A;  4MT8 A;  1SS3 A;  1HNX O;  2QR4 A;  4LF6 O;  1HNX B;  4JI6 O;  5LGU A;  4DV5 O;  1M4U A;  2QEX V;  4DV5 B;  3F7V C;  3CJH B;  2XND G;  4B3T B;  2ZNI A;  2EIJ C;  3BVO A;  5LMU O;  1K3E A;  2CTP A;  4X62 B;  5E1A C;  3F5W C;  2YIC A;  3C90 A;  1R6K A;  4FLZ A;  2CK3 G;  1L1F A;  4F6E A;  3B77 A;  1HNW O;  1OCC B;  1HNW B;  1VF7 A;  4U7O A;  1R3K C;  2HJF C;  4GZR B;  1SQG A;  4YJ2 B;  5EC2 C;  3BCC H;  4LNU B;  1XOU A;  1KB9 F;  4X65 O;  5KX5 B;  1H2L A;  1WB7 A;  1B06 A;  4JTC B;  1VQ4 V;  1JOY A;  1JCH A;  2CGN A;  2PTM A;  5IE9 A;  1H2N A;  2KQX A;  4DUY O;  1QLE B;  1SQX H;  4DUY B;  1TVK B;  5L3B A;  1YI2 V;  3JAS B;  5JQG A;  1PL4 A;  3ZBH A;  3DXR A;  4MW3 A;  1SER A;  2A79 B;  3SYC A;  1SQP H;  2HHH O;  2Y4U A;  2HHH B;  3OMI B;  2ZXW B;  4JI7 O;  2LFR A;  4DV2 O;  4TUY B;  4DV2 B;  2B1G A;  3ABK C;  4OXS A;  5KMG A;  4JI4 O;  4JI4 B;  4DR5 O;  1K4D C;  2F1M A;  2Y0I A;  3EXA A;  1AI5 A;  5TIS Z;  4TWK A;  4YIP A;  4UCT A;  1BMF G;  1FXK C;  1TUB B;  3K5M A;  4BW9 A;  1ZAU A;  3A0H Z;  2ITC C;  3SPJ A;  4XDK A;  5KUM A;  1MNG A;  1J95 A;  4DW1 A;  2QWP B;  1UPG A;  1GN2 A;  3W7S A;  3QO5 A;  2KG7 A;  2Q0O C;  4J7Z A;  3CB2 A;  3CSX A;  3THO A;  2YEV A;  1QBZ A;  3SYA A;  1SQB H;  2Q5Z A;  4PDL A;  3UM7 A;  4DRX A;  3AG1 C;  2DN9 A;  3UCS C;  2PYJ A;  1F51 A;  1NKD A;  3AG3 B;  3ZS8 C;  2AGA A;  2X6A A;  4X1I A;  1GAX A;  3SDL A;  1URF A;  4PDR A;  2OCH A;  4JI1 B;  3RW0 A;  3OGC C;  1EZV H;  1NT2 B;  2BOC C;  2QKC A;  4X64 O;  1ZSP A;  4X64 B;  3GWK C;  5B1N A;  3D36 C;  4EEQ A;  1TA8 A;  1Q90 D;  3P3N A;  1KP3 A;  4JAV A;  5KHJ A;  1IZ3 A;  4XDL A;  4JYA O;  4W4K A;  3X2Q B;  1IBK O;  4AI8 A;  1IBK B;  2NNU A;  2HR3 A;  1GM7 A;  2YXL A;  2R9A A;  1N4C A;  4I50 B;  3BA9 A;  5JQG B;  1Q6H A;  2PI5 A;  3DXR B;  1F7Y A;  4LF4 O;  4MTX A;  3D3I A;  1BQZ A;  3CCU V;  3TXQ A;  2PGG A;  1XMO O;  2JGD A;  4JYC A;  1XMO B;  2R72 A;  5LOV B;  2P4K A;  2P22 C;  4DK1 A;  2HVJ C;  5KMG B;  3E8F A;  4QPJ A;  2BSK B;  3ZRX A;  4X66 O;  1HR0 B;  3MDS A;  2N05 A;  2XAF A;  2WLK A;  2BTQ B;  3ZX6 A;  3ABU A;  4JI2 B;  3G67 A;  2CTQ A;  4FZ1 A;  3L70 H;  2Z5U A;  2CUG A;  1Q5O A;  1AJN A;  2E3C A;  4UFZ A;  4YJ3 A;  3RYI A;  2W6I G;  1V55 C;  4LH6 A;  4J7K A;  1NR1 A;  4JZ2 A;  4UUJ C;  2VWK A;  2ZR2 A;  3J80 N;  2GSM B;  4ZOL A;  1VQ7 V;  3FYE B;  1BL8 A;  3ZHQ A;  2KG7 B;  4Q6G A;  3UT5 B;  1VQN V;  3OR7 C;  4B3S O;  4NTY A;  4YHH B;  4B3S B;  1L0N H;  1TUE B;  1P49 A;  2YEV B;  4EFE A;  4TSF G;  1XDC A;  2UUC O;  4PHZ A;  5IT9 N;  2UUC B;  1O9G A;  3HKC A;  1EFR G;  2N04 A;  1W2B U;  4ICG A;  4MVS A;  1U96 A;  4UCU A;  3AG4 C;  2E5L B;  3Q4H A;  3L74 H;  5FLX N;  1EZJ A;  1X59 A;  1V54 B;  4NKG B;  3JAL A;  4IL6 Z;  1S3J A;  4DV1 B;  2DWE C;  2WLI A;  2FL4 A;  3HB3 B;  2Z0A A;  4DR7 B;  3WB2 A;  4JAS A;  1Y6X A;  3QG5 A;  4PDM A;  1B6Q A;  4DUZ O;  3MHS C;  1DK1 A;  1M57 B;  5J2U A;  2Z3Y A;  1K7D A;  1S5L Z;  1V55 B;  3UQ8 A;  3RWR D;  2DJV A;  4B3M B;  1H8E G;  2V1D A;  1ZL8 A;  2ZD9 A;  3H1I H;  1G6U A;  3CS5 A;  1NTM H;  3E83 A;  5EC1 C;  4PA7 A;  2Y69 B;  2P67 A;  2DQ0 A;  2IU3 A;  4LH7 A;  4NVP A;  1OCZ B;  5B1B C;  4AQY B;  4TOI A;  3ZMV A;  3FFQ A;  3OM3 B;  2BE3 A;  3H9V A;  3CEI A;  3ETG A;  3HR0 A;  2VWJ A;  2ZNJ A;  4U7N A;  2YUA A;  4DR3 B;  4GX2 A;  3CC2 V;  4HBN A;  4CC6 A;  2LW1 A;  5CA1 B;  5B3S B;  4LF9 B;  1S76 D;  2WLJ A;  4BAY A;  4Z1V A;  1XHX A;  3ZRV A;  1FJG O;  2EIN B;  4YJ3 B;  3RYI B;  2JJ1 G;  3OEH G;  1AR1 B;  3T1H O;  3H1L H;  1YZB A;  1D2D A;  2A9H A;  2HLD G;  1RFY A;  3JYC A;  1PNK A;  2NLJ C;  1Q82 W;  5H6Q A;  2RNB A;  1SQF A;  3WB1 A;  1YSC A;  3CRC A;  5KAF Z;  2P4V A;  3WG7 C;  3VQV A;  4DV3 B;  4I7Z B;  3N2K B;  1NQT A;  3CYO A;  4HZ3 A;  1SET A;  3VQX A;  4X1K A;  1FFT B;  1Y74 B;  5CB4 A;  1HNZ B;  1NBM G;  1RPO A;  4LFB O;  3ZRS A;  3Q4H B;  1RM1 B;  4LFB B;  3E8B A;  4K8X A;  2IW5 A;  1GRJ A;  1K4C C;  3ZHU A;  3F5T A;  2PI4 A;  4EB6 A;  4JPR A;  3ASN B;  4DV7 O;  1OCR C;  2KKW A;  1XNR O;  2O57 A;  2QSA A;  1LR1 A;  3DC5 A;  2RDC A;  1SKV A;  4K0K B;  4KHP O;  2GUZ A;  4DR6 O;  2AXT Z;  4KL1 A;  5J2U B;  2NR5 A;  1PM9 A;  2WLH A;  1ZL8 B;  1DLB A;  1VF6 A;  2EIM C;  4IHJ A;  1VQM V;  5KA5 A;  5IWA O;  5IWA B;  4X1Y A;  3DSQ A;  3C3T A;  4J42 A;  1NZ6 A;  4ABM A;  4GKK O;  1I08 A;  3ETQ A;  4OX9 B;  2F93 B;  3VQW A;  1EN6 A;  4E2L A;  1JFF A;  1KYO F;  2ZM6 O;  3AG2 B;  2DQ3 A;  4JI0 O;  1YDX A;  1R73 A;  4Z2W A;  3FB6 C;  4F6R A;  2EIL C;  3JD4 A;  3JSL A;  4NXN B;  4KFM A;  1TGO A;  2P06 A;  3LDC A;  4PD4 F;  3CCV V;  3W7W A;  1MAB G;  1LUW A;  4MSW C;  4I9W A;  3E2E A;  5IYD O;  5J2T B;  4J9Z B;  3ZN1 A;  4J7J A;  1BSM A;  1H2M A;  3K08 A;  3ZRW B;  4B3R O;  2DW4 A;  1K5S A;  1MZF A;  3K5N A;  2YC0 A;  5JCO C;  2AZ2 A;  5LA6 A;  2HKO A;  1VQO V;  2K1E A;  1XNQ O;  4LC1 A;  5CN0 A;  1KQS U;  1XNQ B;  5CB4 B;  2D2C B;  4WF9 V;  1Q8I A;  2WLL B;  2ETN A;  1VIB A;  3CRA A;  1MMM A;  1AR4 A;  3LDE A;  1SRY A;  3FAV A;  4H37 A;  3E86 A;  4UCV A;  1OCC C;  1GO3 F;  2EZO A;  4X8A A;  3ICX A;  4RUE A;  2EZP A;  4UB8 Z;  4PJ0 Z;  1SA0 B;  5LL6 Y;  1FFX B;  3H1K H;  4FLW A;  2QDO A;  4KUM A;  1VF5 B;  1N0N A;  2RCV A;  2UUB O;  4DV4 B;  4FLV A;  5EIB C;  1FPO A;  3BY6 A;  3RVY A;  4IIJ B;  2GUZ B;  2YSU B;  2IJI A;  3D8C A;  1OJH A;  4H0L B;  5H9C A;  4GKJ O;  1COW G;  4GKJ B;  2LJ2 A;  4IHJ B;  2RQ6 A;  4DXW A;  3CCJ V;  4FVM A;  3SJB C;  1AVM A;  4X1Y B;  1NI8 A;  4DV0 O;  4LF5 O;  4DV0 B;  1VEW A;  2Q4P A;  2FTK A;  1QLE C;  4UVC A;  2ZIM A;  2B5U A;  2NN4 A;  3OMA B;  2OIG A;  1Z5W A;  4R8C A;  2W6J G;  3ZMS A;  3G4S V;  1DTO A;  1OCO B;  3CCE V;  4B3T O;  1G4Y B;  2ARH A;  4O2B A;  2JRI A;  5CBF A;  4LR3 A;  4F6R B;  2WLN A;  3CXC U;  4ZKI A;  1M90 W;  5JVD A;  4X62 O;  2ZXW C;  1AR5 A;  1KP2 A;  2PZS A;  4H33 A;  3K9A A;  2CH7 A;  4CS3 A;  4WFA V;  1YJ9 V;  1IBM B;  4RWU A;  1VQP V;  1SZX A;  4MTO A;  3KZI Z;  1CEZ A;  1MOF A;  2F23 A;  2YI8 A;  2Y0P A;  3KCY A;  3JAT B;  1J5E O;  3TK1 A;  1J5E B;  4JTA B;  2YS8 A;  3ZMU A;  5DEC A;  1XI1 A;  1P7G A;  1AIL A;  4U3J A;  5LA6 B;  5JH7 B;  4MVM A;  2UUA O;  1PD3 A;  4R50 A;  2UUA B;  1Y4M A;  3KCX A;  2QE7 G;  2UXX A;  3G71 V;  5GTH Z;  5JJE B;  1VQ6 V;  1L0L H;  3L73 H;  3PJS K;  3K03 A;  4C7U A;  3K3W A;  4PA6 A;  3FAV B;  2ADP A;  3K5O A;  3B8N A;  5IYB O;  4GLX A;  2Y48 A;  2MK3 A;  2YXH A;  3K06 A;  4PA4 A;  1R3J C;  1GTO A;  3JAR A;  3K0D A;  4DV6 B;  3AG3 C;  3K79 A;  1NTK H;  4LWS A;  1XMQ B;  1M5I A;  5KHK A;  3A2F A;  4O2A A;  3R66 A;  3W7U A;  2R9R B;  3SGI A;  1FXK A;  1NVP D;  4X88 A;  1QU7 A;  5BMV A;  3ABT A;  4J11 A;  3RYC B;  1W0K G;  5B1A B;  2N74 A;  2XAH A;  3AG7 A;  4WFE A;  1A32 A;  4J41 A;  2WAM A;  4K35 A;  2XUM A;  3X2Q C;  3FD9 A;  1PNL A;  3BA8 A;  1ENV A;  4QE7 A;  2DMX A;  4CS2 A;  2EJR A;  3CCS V;  2Y4T A;  4FLT A;  1XIL A;  2VQE B;  1R3I C;  2DOS A;  3G6B A;  4TQF A;  1ZWI C;  3LUT B;  1M9N A;  5JVD B;  3OGI B;  3M7M X;  2UXD O;  2UXD B;  3JAK A;  1XL4 A;  3HKD A;  3ZHT A;  1K33 A;  1LUV A;  3HKB A;  2KSD A;  1H2S B;  2DYR B;  4PDV A;  2Q0A A;  5IYZ A;  5IYC O;  2Q9L A;  2QWR B;  4JI1 O;  4U3J B;  2Q7H A;  4YXW G;  5KHH A;  3IAY A;  2CE4 A;  4DO2 A;  2Q69 A;  1M93 A;  3E89 A;  2H8P C;  4FFB A;  5CBG A;  1PP9 H;  3JSN A;  1DGS A;  1BZK A;  5A2Q N;  4PEL A;  1H8H G;  1QQC A;  1CP9 A;  4P2Z A;  3BPZ A;  2WSS G;  4TQD A;  5EBW C;  3JAM N;  3QO8 A;  2AHZ A;  4MTG A;  1Q86 W;  3IC7 A;  4WBN A;  3B8M A;  4IYI A;  3JAR B;  4LWS B;  1W59 A;  1N36 B;  3EVK A;  4LBE C;  2UU9 O;  5BR8 B;  1QCE A;  2UU9 B;  3JD2 A;  4YY3 O;  4P30 A;  4YY3 B;  5H2F Z;  5BMV B;  4P9P A;  3J81 N;  4ASU G;  1OZ0 A;  3LSS A;  1HR0 O;  1V54 C;  4JI3 B;  3RN4 A;  3ML0 A;  4TV8 A;  4FIP C;  4UCR A;  5L3F A;  3LNN A;  4MS2 A;  4JI2 O;  4X20 A;  4FLX A;  4DR4 B;  1H2K A;  1MSD A;  4IYH A;  4E4E A;  1IXB A;  4ZHQ A;  4PA3 A;  1M57 C;  1XUQ A;  2K9P A;  2X6C A;  5H6R A;  4JZG A;  3FB5 C;  1EN4 A;  2GDS A;  5EK0 A;  2E74 B;  1WPX A;  3FB8 C;  1Z2G A;  2Y69 C;  2M6Y A;  2VQF O;  1TAE A;  3LSQ A;  1VMG A;  2VQF B;  4YHH O;  2QM8 A;  2B9Z A;  1OCZ C;  1S72 V;  2BCC H;  1BE3 H;  3OAA G;  2DYS C;  3CE2 A;  4DRX B;  3HKB B;  2P90 A;  4I55 A;  5BY1 A;  3S3W A;  4I4T A;  1IUR A;  4X1I B;  3K9S A;  3OR6 C;  3MHH C;  5IYZ B;  2E5L O;  1NH2 D;  5B3S C;  1K97 A;  1QR8 A;  1H38 A;  2JEX A;  3CHX A;  2EIN C;  2LQT A;  2X6B A;  5L3D A;  4FFB B;  4DV1 O;  2YID A;  3OTO O;  2RN9 A;  4GT1 A;  2ZE7 A;  3OTO B;  1E1Q G;  1M56 B;  4FJC C;  4DR7 O;  3CP1 A;  4AHC A;  2ZDI A;  4GUN A;  1DF4 A;  4IT5 A;  5GW7 A;  3I56 V;  2RMK B;  3IGA C;  2D3O W;  3TJT A;  4WBN B;  3BRC A;  1QHT A;  4I9Q A;  2ZKO A;  4B3M O;  4GCZ A;  1JJ2 U;  1HWY A;  4KXR A;  2JGD B;  4LFA B;  1PKX A;  3STZ C;  3SPH A;  1KKC A;  3QNE A;  4OPA A;  3U10 A;  3AK2 A;  2X0L A;  4AQY O;  1RM1 C;  4HYO A;  4GYC B;  1PL0 A;  3RYF A;  3P32 A;  1GKF A;  1AP6 A;  5C93 A;  1YHQ V;  2DYS B;  2OCC B;  3TCU A;  1WNS A;  3SR2 C;  2ZCE A;  3ASN C;  4TV8 B;  5DED A;  4DR3 O;  4PI2 A;  1XHZ A;  3B4S A;  3ZHR A;  5LP6 A;  4LF9 O;  1Q81 W;  1S5J A;  4JV5 O;  4ZHQ B;  4JV5 B;  3ASO B;  1E79 G;  3KG2 A;  1ARO P;  3QVN A;  1NVP B;  2HP8 A;  4ZIB A;  1IX9 A;  2ADQ B;  1GM8 A;  1I0H A;  4ZOL B;  3CCR V;  2LFS A;  1BQ0 A;  1N32 B;  1JX9 A;  5CMU A;  2CAZ C;  4UVA A;  4X9Q A;  1I5X A;  2CDY A;  5B5E Z;  5LYJ A;  4CH6 A;  1WP7 A;  2FML A;  3B2E E;  4JI8 B;  3AK3 A;  4I55 B;  1B04 A;  3HKC B;  4I4T B;  4UCO A;  4DV3 O;  3AG2 C;  4AIL C;  3CCL V;  4LFC B;  1T5E A;  2ZE8 A;  3UO3 A;  1G1X B;  4O4H A;  1HNZ O;  1OV9 A;  1Q6I A;  4JYB A;  1W0J G;  5B66 Z;  3I5D A;  5KHI A;  5LHI A;  3JAL B;  3RFR A;  4O4J A;  1CPY A;  2QWN B;  1WLE A;  2EIK B;  5JJN B;  2WLI B;  5B1O A;  2XAJ A;  1ZUQ A;  1YEW A;  3CC4 V;  2CGO A;  1BGY H;  4QGP A;  4BIO A;  4WFG A;  4TV9 A;  3QTC A;  3CC7 V;  4K0K O;  3L72 H;  1F4N A;  1GN4 A;  5JWP A;  1KC8 W;  1QNM A;  2ZE6 A;  5LBQ A;  5KAI Z;  4JI5 B;  4PI0 A;  2LGQ A;  4KP4 A;  1R6T A;  2F66 C;  4O4L A;  4OX9 O;  1AI6 A;  2QKS A;  1KKD A;  5IJ0 A;  5CA0 A;  4XBF A;  1YJN V;  5D5P A;  3SPI A;  1AJP A;  3H01 A;  5GTI Z;  2FKX A;  2Q73 A;  1D5A A;  3OFN G;  4UXN A;  1GN6 A;  5KHG A;  3RGB A;  3O65 A;  4YIO A;  5LP6 B;  4NXN O;  2YXY A;  5JJJ B;  2G38 A;  5LMN B;  1BT8 A;  1RSO A;  1YXB A;  2P6J A;  5JCO A;  5BXZ A;  4GX0 A;  1VF6 C;  1YTF D;  4Q20 A;  1N33 B;  1VQ8 V;  5FL7 G;  2ILM A;  2WA3 A;  1S5H C;  3CCQ V;  3MAQ A;  2XAQ A;  1PV0 A;  2OT5 A;  5LYJ B;  4QPK A;  2XT9 A;  3GVM A;  2YIA A;  3FYI B;  2E76 B;  1OCO C;  1ROP A;  2HEP A;  3CRR A;  4X1K B;  3CD6 V;  3CX5 F;  2HVK C;  2JS5 A;  3K57 A;  3P3P A;  3K04 A;  2F4V O;  2OTL V;  4MVU A;  5EZY A;  2F4V B;  4I0X A;  4K8Z A;  4LNU A;  5IY5 B;  4FZ0 A;  1ZX3 A;  4O4J B;  4EB6 B;  5FPR A;  2BOB C;  2QJ1 A;  3UKM A;  1IXM A;  3W7X A;  1SQV H;  3AK1 A;  3OE7 G;  1EM1 A;  4DV4 O;  1BS3 A;  1YIT V;  3L9D A;  2QWO B;  4DK0 A;  1JMK C;  2IJJ A;  2XAG A;  1TVK A;  3APO A;  1HW7 A;  1UJW B;  1I94 O;  4NTX A;  3JAS A;  1I94 B;  1NH2 B;  1OHH G;  3VBB A;  2UXC B;  3G6E V;  4JF3 A;  5KA6 A;  2WLM A;  3E35 A;  4JGS A;  1NTZ H;  1JVM A;  1IVS A;  1VQ9 V;  4FK5 C;  3OUF A;  3ZJZ A;  4XDJ A;  1VP7 A;  5CA0 B;  3HPL C;  1JFF B;  3ABL B;  1WP8 A;  1P7B A;  2W0F C;  4G27 B;  2KB1 A;  1N34 O;  4WCE V;  4NXM B;  1N34 B;  1K9M W;  3ZMT A;  1UFI A;  1WA8 A;  4LP8 A;  1IBL O;  2OTJ V;  1IBL B;  2YIB D;  1RSO B;  4RAI A;  3K5L A;  3L75 H;  1YJW V;  1TUB A;  3R65 A;  1IBM O;  5H5N A;  3ZED A;  4LF6 B;  1SES A;  5B1A C;  4JI6 B;  4CH3 A;  3NR7 A;  5E79 Z;  4RQE A;  1HP8 A;  1F4M A;  1BHB A;  1GM9 A;  5BZB A;  2IU0 A;  4H44 B;  1P4R A;  4GX5 A;  5LMU B;  4NTW A;  4CH4 A;  3H1J H;  1AP5 A;  3OTF A;  5D5Q A;  4JTD B;  1L8D A;  2FB5 A;  1KU9 A;  3C3S A;  1AI4 A;  5EZY B;  1R1B A;  4I0X B;  4FM2 A;  5LGT A;  4OPH A;  5IJ9 A;  4X65 B;  2ZR3 A;  1H2G A;  3AEI A;  3OUS A;  4DV6 O;  1GK9 A;  2DYR C;  1XMQ O;  4OGQ B;  2LW7 A;  5IDJ A;  3P30 A;  3CCM V;  1KBH A;  4BW5 A;  4L87 A;  4G2K A;  1O9H A;  3QF7 A;  2ZT9 B;  2IBZ H;  4I50 A;  3W7T A;  1X4T A;  1RPR A;  2EJ7 A;  2EIJ B;  1DF5 A;  1AB3 A;  4QIW F;  3EFF K;  4JI7 B;  5LOV A;  2IJH A;  1HDJ A;  2VQE O;  2BSK A;  4DR5 B;  1SZT A;  1XBL A;  4O2B B;  2ZE5 A;  1WA8 B;  3CPW U;  3N27 A;  2BTQ A;  2PYL A;  4FPP A;  3B09 A;  2CH7 B;  4D7T A;  2V4D A;  2QM4 A;  3RVZ A;  3E8H A;  3ZHS A;  2Q7G A;  4PV1 B;  3D36 A;  3JD1 A;  2OYQ A;  3T2M A;  4P9O A;  5AG2 A;  3UT5 A;  5A9G A;  4JYY A;  4D7S A;  2Q8V A;  5LXT A;  2CTW A;  4N21 A;  1WAZ A;  2A06 H;  1VQ5 V;  2QTS A;  3JAW A;  4J80 A;  1F23 A;  4J10 A;  1AJQ A;  2YIB A;  3RYH A;  4UB6 Z;  3ETD A;  3IFX A;  5CA3 A;  4ZI7 A;  3RT3 C;  1SC5 B;  1I7F A;  2F95 B;  3LNM B;  4J9Y B;  4MVO A;  1YTF B;  3JD0 A;  1N8R W;  3BHP A;  1NU1 H;  3VOU A;  2OWO A;  3ABK B;  4CZZ A;  1NS1 A;  3SYP A;  5IJ9 B;  2JEU A;  2HG5 C;  3APQ A;  3ZCC A;  1MSW D;  1B3Q A;  1VQL V;  2L35 A;  4FLY A;  2P5O A;  1P84 F;  1N36 O;  3SJQ C;  4TT3 G;  5BR8 O;  4JYA B;  4O2A B;  1M1K W;  1FXK B;  3KKY A;  5J9P C;  2Q68 A;  4MVR A;  4FM0 A;  4JI3 O;  4CBC A;  2PUS A;  2JJ2 G;  4LF4 B;  4MW8 A;  5KUK A;  1S77 D;  3FKS G;  1I5Y A;  4UV8 A;  5EBL C;  2A0L A;  2QTO A;  1M56 C;  4DR4 O;  4FFK A;  3SYO A;  3OW2 U;  3K58 A;  1ZLZ A;  4I5S A;  1FXV A;  3FB7 C;  3K59 A;  2IM9 A;  3ZN0 A;  2W0X A;  2M7W A;  5K1P A;  4QE9 A;  3RBZ A;  3IC9 A;  4DYL A;  3AG1 B;  4X66 B;  1WN7 A;  2R9I A;  4PA9 A;  4JAU A;  1NR7 A;  3B40 A;  2PY5 A;  5CBH A;  4NYK A;  5CA1 A;  4B7K A;  4QJF B;  3CMA V;  3ETE A;  3JAK B;  3HKD B;  5FNV A;  3BFR A;  2DE0 X;  1MG1 A;  2OCC C;  4MVQ A;  5HFL A;  4RQF A;  4BR6 A;  1GN3 A;  1XRE A;  2JDI G;  5LHG A;  3ZMZ A;  2GHY A;  2BTO A;  4G28 B;  3SJC C;  2ZQM A;  3LSU A;  4EFB A;  2LGW A;  3U11 A;  5LXT B;  4EKW A;  4DW0 A;  2E75 B;  3ASO C;  2VRZ A;  3TGU H;  2B1I A;  4DR1 O;  3JAW B;  4DR1 B;  4WFF A;  3DGE A;  3RYH B;  3ABM C;  4ZI7 B;  5L3C A;  4QNH B;  3K0G A;  3SPC A;  3LDD A;  3N2K A;  4NR1 A;  1PNM A;  3SYQ A;  2JS3 A;  1K92 A;  2Q6A A;  3SPG A;  1Y74 A;  3I55 V;  4UCS A;  1KUQ A;  4JAA A;  1JPX A;  3SJA C;  2EX3 A;  2ODM A;  4DR2 O;  4DR2 B;  1D5N A;  4B7E A;  1U97 A;  4LF8 O;  4LFA O;  4LF8 B;  2XAS A;  1R6N A;  3G80 A;  2ITD C;  1Q6U A;  3T1C A;  3JCZ A;  4F4L A;  3J7A U;  3BEH A;  4R6Z A;  4IGG A;  4CC5 A;  4DUZ B;  1YF2 A;  2Q67 A;  2YDE A;  2A3Q A;  5HFM A;  4O4I A;  3UO2 A;  3CWB H;  4UV9 A;  3O9O A;  1KMI Z;  2EIK C;  4R7C A;  1KEC A;  4X20 B;  5LGN A;  4FM1 A;  4FLU A;  2ZDI C;  4K3A A;  5K1X A;  2GV9 A;  3CME V;  4RUF A;  3T4Z A;  2VS0 A;  2QWQ B;  4X89 A;  2ZIO A;  2PF4 E;  3D3Q A;  1WB8 A;  2WA4 A;  2WPD G;  5EIB D;  3ABM B;  4MTF A;  1JJO A;  3E8G A;  3ZHV A;  1V9P A;  1N32 O;  5F2V O;  3BAA A;  2EUL A;  3AG4 B;  1JQ0 A;  1K5Q A;  5FNV B;  1FJG B;  3ZIA G;  1QR9 A;  1Z5V A;  1FAF A;  5EYP A;  2GBO A;  4JI8 O;  2GTS A;  1BCC H;  1WPB A;  4BWA A;  2FYU H;  3OD4 A;  5L3G A;  4LFC O;  3T1H B;  5ITZ A;  2MW2 B;  2UXB O;  5LP6 C;  5J2T A;  2UXB B;  1S0V A;  1XEQ A;  1JR9 A;  3ZRW A;  1Q7Y W;  3GWO A;  3WFV A;  3T1Y O;  5FPO A;  4GX1 A;  5EBM C;  3T1Y B;  5L3E A;  2EBO A;  1VQK V;  5C8Y A;  4Z1M G;  4BIU A;  2XOK G;  2ZIN A;  1CXZ B;  2WWW A;  2XHB A;  1Y66 A;  1GH6 A;  2WLL A;  3A8T A;  3STL C;  3WB0 A;  3H1H H;  5B1B B;  2IH3 C;  4RO2 A;  3GB7 C;  3OT7 A;  3N2G A;  3OEE G;  1FYJ A;  1LNQ A;  4A5U B;  3HKE A;  1SA0 A;  3E22 A;  1FFX A;  4DV7 B;  3CXH F;  3EHB B;  4JI5 O;  1XL6 A;  2H3O A;  1XNR B;  1SF9 A;  2L6L A;  4HNA A;  4IIJ A;  3RYF B;  3DC6 A;  5KLV H;  3TXS A;  2H94 A;  4KHP B;  4DR6 B;  5IY5 C;  1FD9 A;  2AZ0 A;  5GON A;  4O4I B;  4BIZ A;  4MVZ A;  4N23 A;  3A0R A;  1Y76 A;  1MA1 A;  2JVD A;  1QVF U;  3JD3 A;  1Y67 A;  3QO7 A;  2JK5 C;  3CRM A;  5LMN O;  3CRQ A;  2XTA A;  4GKK B;  1YIJ V;  1SQQ H;  2QA4 V;  4U3F H;  3NXS A;  3PN1 A;  3WU2 Z;  1QLN A;  1THZ A;  2LO1 A;  2UXN A;  1Q3E A;  1AI7 A;  3T4D A;  5DM6 V;  2A7W A;  3WG7 B;  2ZM6 B;  1N33 O;  3CJH A;  4ZBM A;  2IJK A;  4JI0 B;  1JA8 A;  1K73 W;  2QKA A;  4NB5 A;  1GMG A;  3BAB A;  2CTR A;  2IH1 C; 
#chains in the Genus database with same CATH homology
 4WFB V;  2AHY A;  4JTD B;  3ETG A;  4FMT A;  4LBE C;  4UVB A;  1QCE A;  1AI4 A;  3ABL C;  3JD2 A;  4U7N A;  4P30 A;  5LGT A;  1OCR B;  4GX2 A;  3CC2 V;  1E1R G;  4P9P A;  2V7Q G;  4ASU G;  2ZR3 A;  1H2G A;  4WFH A;  3AEI A;  5B3S B;  1OZ0 A;  3OUS A;  1S76 D;  2WLJ A;  3LSS A;  1GK9 A;  4BAY A;  2HFE C;  1R3L C;  3ZRV A;  1V54 C;  5DN6 G;  2EIN B;  3F7Y C;  2DYR C;  2JJ1 G;  3ML0 A;  5IDJ A;  2DWD C;  1BHA A;  4FIP C;  3P30 A;  3CCM V;  3OEH G;  4BW5 A;  5L3F A;  4MS2 A;  1AR1 B;  2F43 G;  1G8M A;  4L87 A;  4G2K A;  1ORQ C;  2A9H A;  3OMN B;  2HLD G;  2EIM B;  3JYC A;  1PNK A;  2NLJ C;  2ATK C;  4PA3 A;  1M57 C;  1Q82 W;  3W7T A;  2X6C A;  1RPR A;  5H6R A;  5H6Q A;  3DTU B;  3FB5 C;  1YSC A;  1EBO A;  1DF5 A;  2EIJ B;  5EK0 A;  4QIW F;  1WPX A;  3FB8 C;  3WG7 C;  2Y69 C;  3EFF K;  2IJH A;  1NQT A;  3LSQ A;  3CYO A;  1KD1 W;  1K8A W;  4HZ3 A;  1SET A;  2QM8 A;  3TET A;  1FFT B;  1OCZ C;  1S72 V;  4LCU C;  3OAA G;  1NBM G;  1RPO A;  1SZT A;  2DYS C;  4HAM A;  3ZRS A;  2EIL B;  1RM1 B;  2P90 A;  3E8B A;  2IW5 A;  5LHH A;  3CPW U;  1K4C C;  1FS0 G;  2X7R B;  2JIZ G;  1QVG U;  2PI4 A;  4JPR A;  3ASN B;  3OR6 C;  4FPP A;  3MHH C;  3MD0 A;  1FXH A;  1OCR C;  3M99 B;  1NH2 D;  5B3S C;  3RVZ A;  1K97 A;  1QR8 A;  3E8H A;  1NJI W;  2JEX A;  1H38 A;  1K34 A;  2EIN C;  3D36 A;  2P7T C;  2X6B A;  3JD1 A;  5L3D A;  2QM7 A;  2C2A A;  3T2M A;  2LP7 A;  4P9O A;  4MT8 A;  4GT1 A;  2WLH A;  1E1Q G;  5LGU A;  4N21 A;  1M56 B;  1DLB A;  2EIM C;  4FJC C;  1VQM V;  2QEX V;  5KA5 A;  3F7V C;  3CP1 A;  1VQ5 V;  2ZDI A;  1DF4 A;  2XND G;  5GW7 A;  3I56 V;  3IGA C;  1F23 A;  1AJQ A;  2D3O W;  3ETD A;  3IFX A;  5CA3 A;  2EIJ C;  1K3E A;  4GCZ A;  5E1A C;  3F5W C;  1JJ2 U;  1HWY A;  4E2L A;  1PKX A;  1R6K A;  3STZ C;  3LNM B;  4J9Y B;  4MVO A;  2CK3 G;  1YTF B;  3JD0 A;  3SPH A;  1N8R W;  3AG2 B;  1L1F A;  3B77 A;  3VOU A;  2DQ3 A;  1OCC B;  3QNE A;  1R73 A;  3ABK B;  4CZZ A;  3FB6 C;  3SYP A;  2X0L A;  2EIL C;  2JEU A;  4HYO A;  1RM1 C;  1PL0 A;  3JD4 A;  2HG5 C;  3P32 A;  1GKF A;  4U7O A;  3ZCC A;  1MSW D;  1R3K C;  4KFM A;  1VQL V;  5C93 A;  1YHQ V;  2DYS B;  2HJF C;  2OCC B;  3TCU A;  3SJQ C;  3LDC A;  4TT3 G;  3ASN C;  3CCV V;  3W7W A;  5EC2 C;  1M1K W;  1FXK B;  5J9P C;  1MAB G;  4MSW C;  4I9W A;  3E2E A;  2Q68 A;  4MVR A;  1Q81 W;  4JTC B;  1VQ4 V;  5IYD O;  4J9Z B;  3ZN1 A;  1JOY A;  1JCH A;  4CBC A;  3ASO B;  3K08 A;  1E79 G;  2JJ2 G;  3ZRW B;  3KG2 A;  4MW8 A;  5KUK A;  1S77 D;  1ARO P;  3FKS G;  2DW4 A;  1I5Y A;  1K5S A;  4UV8 A;  5EBL C;  2A0L A;  1NVP B;  2QTO A;  1M56 C;  1QLE B;  1GM8 A;  2HKO A;  3CCR V;  2LFS A;  5L3B A;  1YI2 V;  3SYO A;  3OW2 U;  1VQO V;  2K1E A;  4I5S A;  1JX9 A;  4LC1 A;  1FXV A;  3FB7 C;  5CMU A;  5CN0 A;  4UVA A;  1KQS U;  4MW3 A;  1I5X A;  3ZN0 A;  2M7W A;  1SER A;  2A79 B;  4QE9 A;  3RBZ A;  4WF9 V;  2WLL B;  3AG1 B;  3SYC A;  3LDE A;  2R9I A;  1SRY A;  3OMI B;  4PA9 A;  4JAU A;  2ZXW B;  4H37 A;  1NR7 A;  3E86 A;  2LFR A;  3AG2 C;  3CCL V;  5CBH A;  1OCC C;  1GO3 F;  2EZO A;  2B1G A;  3ABK C;  4X8A A;  4OXS A;  4RUE A;  2EZP A;  4QJF B;  3CMA V;  3ETE A;  4KUM A;  1MG1 A;  1K4D C;  2OCC C;  4MVQ A;  5HFL A;  4RQF A;  1AI5 A;  2JDI G;  4JYB A;  4TWK A;  5LHG A;  3ZMZ A;  3BY6 A;  2GHY A;  3RVY A;  1W0J G;  4G28 B;  5LHI A;  2YSU B;  2IJI A;  1BMF G;  1FXK C;  1CPY A;  2ZQM A;  1WLE A;  2EIK B;  2WLI B;  5H9C A;  5B1O A;  2XAJ A;  1COW G;  4EKW A;  3CCJ V;  4DXW A;  3CC4 V;  2ITC C;  3ASO C;  4WFG A;  2B1I A;  3SPJ A;  4XDK A;  5KUM A;  3CC7 V;  1J95 A;  4WFF A;  1F4N A;  3DGE A;  3W7S A;  3ABM C;  3QO5 A;  5L3C A;  2FTK A;  4QNH B;  1QLE C;  3K0G A;  3SPC A;  4UVC A;  3LDD A;  2B5U A;  3OMA B;  1KC8 W;  4R8C A;  2W6J G;  1PNM A;  3SYQ A;  1K92 A;  3ZMS A;  2Q6A A;  3SPG A;  3G4S V;  2YEV A;  1DTO A;  1QBZ A;  1OCO B;  3SYA A;  5LBQ A;  3UM7 A;  4PDL A;  3I55 V;  3CCE V;  1G4Y B;  1JPX A;  5CBF A;  3AG1 C;  2WLN A;  3CXC U;  4KP4 A;  4ZKI A;  1M90 W;  1F51 A;  1NKD A;  3AG3 B;  2X6A A;  2ZXW C;  1AI6 A;  2QKS A;  1KKD A;  1KP2 A;  4XBF A;  1YJN V;  4H33 A;  1AJP A;  3K9A A;  3SPI A;  4WFA V;  1YJ9 V;  3H01 A;  2XAS A;  4PDR A;  1VQP V;  1R6N A;  2ITD C;  4MTO A;  3OFN G;  4UXN A;  3RW0 A;  3T1C A;  3OGC C;  1CEZ A;  2BOC C;  3JCZ A;  1MOF A;  4F4L A;  3BEH A;  4R6Z A;  5B1N A;  3TK1 A;  4JTA B;  2Q67 A;  3ZMU A;  4JAV A;  1KP3 A;  5HFM A;  2P6J A;  4XDL A;  3X2Q B;  4UV9 A;  4R7C A;  2EIK C;  1KEC A;  4GX0 A;  2NNU A;  1YTF D;  2HR3 A;  1GM7 A;  4MVM A;  5LGN A;  4Q20 A;  2ZDI C;  1PD3 A;  1VQ8 V;  4R50 A;  5FL7 G;  3CME V;  2PI5 A;  1Y4M A;  1S5H C;  4RUF A;  3T4Z A;  2QE7 G;  2UXX A;  3G71 V;  3CCQ V;  4X89 A;  1VQ6 V;  4MTX A;  3D3I A;  3CCU V;  2XAQ A;  2OT5 A;  2WPD G;  3PJS K;  4JYC A;  4QPK A;  3K03 A;  3K3W A;  3ABM B;  4MTF A;  4PA6 A;  3E8G A;  3FYI B;  1OCO C;  3B8N A;  5IYB O;  1ROP A;  2Y48 A;  2MK3 A;  3AG4 B;  2HVJ C;  3K06 A;  4PA4 A;  1R3J C;  1GTO A;  3E8F A;  1JQ0 A;  1K5Q A;  3K0D A;  4QPJ A;  3CD6 V;  3AG3 C;  3K79 A;  2HVK C;  3ZRX A;  3ZIA G;  1QR9 A;  3K04 A;  2OTL V;  3W7U A;  4MVU A;  2XAF A;  2R9R B;  5IY5 B;  2WLK A;  1FXK A;  5L3G A;  1NVP D;  3ABU A;  4X88 A;  3ABT A;  2BOB C;  3UKM A;  1W0K G;  2Z5U A;  5B1A B;  2XAH A;  1IXM A;  3W7X A;  1S0V A;  3OE7 G;  1AJN A;  4WFE A;  3ZRW A;  1Q7Y W;  1YIT V;  3GWO A;  2W6I G;  1V55 C;  2WAM A;  1NR1 A;  3X2Q C;  4UUJ C;  1PNL A;  3WFV A;  2ZR2 A;  4GX1 A;  1ENV A;  2GSM B;  5EBM C;  5L3E A;  2IJJ A;  2XAG A;  1VQ7 V;  3FYE B;  2EBO A;  1BL8 A;  4QE7 A;  1UJW B;  1VQK V;  4Z1M G;  2EJR A;  1NH2 B;  3CCS V;  4BIU A;  1VQN V;  2XOK G;  3OR7 C;  1OHH G;  2WWW A;  3VBB A;  1Y66 A;  3G6E V;  4JF3 A;  1R3I C;  1TUE B;  5KA6 A;  2YEV B;  2WLL A;  2WLM A;  3E35 A;  4JGS A;  4TSF G;  1JVM A;  1VQ9 V;  3STL C;  5B1B B;  1ZWI C;  2IH3 C;  4FK5 C;  3OUF A;  4RO2 A;  3ZJZ A;  3GB7 C;  3LUT B;  1EFR G;  3OEE G;  1M9N A;  4XDJ A;  1LNQ A;  1W2B U;  3HPL C;  3ABL B;  4MVS A;  1XL4 A;  3AG4 C;  1P7B A;  2W0F C;  4G27 B;  1K33 A;  2KB1 A;  4WCE V;  3EHB B;  1XL6 A;  1K9M W;  1EZJ A;  3ZMT A;  4LP8 A;  2OTJ V;  1V54 B;  2H94 A;  2DYR B;  5IY5 C;  4RAI A;  1YJW V;  4PDV A;  1S3J A;  5IYC O;  2DWE C;  3R65 A;  2WLI A;  4BIZ A;  4MVZ A;  4N23 A;  3A0R A;  1SES A;  5B1A C;  3HB3 B;  1QVF U;  3JD3 A;  4YXW G;  4JAS A;  4RQE A;  1F4M A;  3QO7 A;  2JK5 C;  4DO2 A;  2Q69 A;  1B6Q A;  4PDM A;  1GM9 A;  3MHS C;  5BZB A;  1BHB A;  3E89 A;  1M57 B;  2H8P C;  1YIJ V;  2IU0 A;  5CBG A;  2QA4 V;  1P4R A;  4GX5 A;  2Z3Y A;  1K7D A;  1V55 B;  3NXS A;  1QLN A;  1THZ A;  2UXN A;  1H8E G;  1AI7 A;  2V1D A;  2ZD9 A;  3T4D A;  5DM6 V;  4PEL A;  3E83 A;  5EC1 C;  3WG7 B;  4PA7 A;  2Y69 B;  1H8H G;  2P67 A;  4ZBM A;  1CP9 A;  4P2Z A;  2DQ0 A;  2WSS G;  5EBW C;  2IU3 A;  2IJK A;  3QO8 A;  2AHZ A;  1K73 W;  4MTG A;  1Q86 W;  1GMG A;  1OCZ B;  5B1B C;  3IC7 A;  3ZMV A;  3B8M A;  2IH1 C;  3OM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...