4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
4X8AA 2DWDC 2WLHA 4MTOA 4X89A 3E83A 3IGAC 3K06A 2EIKC 4WFGA 1M56C 2EIJC 3UM7A 4MW3A 1OCOC 4R6ZA 3ZJZA 2W0FC 1XL4A 4QE9A 4RAIA 4R8CA 3VOUA 3ABMC 2QKSA 3IFXA 3R65A 4QE7A 2WLLA 5CBHA 3E89A 2HG5C 4RO2A 2HVKC 3K0DA 3LDCA 4GX0A 4XDLA 4ZBMA 1R3KC 1BL8A 4MVSA 1S5HC 1V55C 2HFEC 5EBMC 5EC1C 5CBFA 3WG7C 1KKDA 4EKWA 4MS2A 2AHZA 1LNQA 2Q69A 3AG2C 4H37A 3TCUA 4WFFA 2IH1C 3F7VC 2P7TC 1XL6A 3SPCA 4P30A 2X6BA 4RUFA 5B1BC 3T4ZA 3UKMA 2ZXWC 2ITDC 4BW5A 3SYAA 3JYCA 3SYOA 1OCZC 3STZC 2JK5C 3EFFK 2HJFC 3SJQC 3RBZA 2A79B 3OGCC 3RVZA 4QNHB 2WLKA 3AG1C 4PA3A 3K08A 4GX2A 4CBCA 4MTGA 3FB6C 3SPGA 3T4DA 1K4DC 3AG4C 3GB7C 2WLLB 4I9WA 1P7BA 3K0GA 1QLEC 3STLC 3ASOC 3E8FA 4F4LA 1ZWIC 4PA9A 3FB5C 3SYCA 3OR7C 2X6AA 2Q67A 4MVUA 5B3SC 5J9PC 2IH3C 3LDEA 4MVZA 4MVMA 1R3JC 4TWKA 3SPHA 2BOCC 4LBEC 5BZBA 3FB8C 4XDKA 4MVOA 4RUEA 4WFEA 4MTFA 4X88A 1J95A 1OCRC 2DWEC 2A9HA 4P2ZA 4MSWC 4XDJA 3F5WC 2Q68A 3X2QC 4P9PA 2A0LA 3BEHA 2YEVA 4UUJC 4GX1A 4R7CA 3OR6C 2ATKC 1K4CC 2R9RB 4PDLA 2Q6AA 1G4YB 3SYQA 2AHYA 1ORQC 2QTOA 2H8PC 3ASNC 1M57C 5KUMA 2WLIA 3OUFA 2DYSC 3PJSK 3E8HA 2Y69C 4JTAB 3HPLC 3K04A 2KB1A 3ABKC 4J9YB 4WFHA 1OCCC 3RVYA 3LDDA 2EINC 4LP8A 2ZD9A 3LUTB 4KFMA 3T2MA 2DYRC 2K1EA 4J9ZB 4MW8A 1JVMA 1R3LC 2BOBC 2EIMC 4DXWA 5KUKA 4HZ3A 3ZRSA 4PDMA 3AG3C 3K03A 4PA7A 5E1AC 5EBLC 3F7YC 4HYOA 4JTCB 4OXSA 2OCCC 4P9OA 4JTDB 3E8GA 3RW0A 5B1AC 4PA4A 3SYPA 4PA6A 4R50A 3FB7C 4PDVA 4G28B 2HVJC 2ITCC 3ABLC 2WLNA 2X6CA 4G27B 4LCUC 4MVRA 4H33A 3KG2A 1V54C 3SPJA 5CBGA 1R3IC 5EK0A 5IY5C 3E8BA 3SPIA 4MVQA 5EBWC 3LNMB 2EILC 2WLJA 3T1CA 2NLJC 3OUSA 3TETA 4PDRA 2WLMA 4GX5A 2WLIB 5EC2C 3E86A
chains in the Genus database with same CATH superfamily
1KKCA 1LUWA 3VQVA 5ITZA 2XAJA 2V4DA 2YICA 4K0KB 2JS5A 1AROP 4NTYA 4WFAV 1JX9A 1HR0B 4QE7A 3G71V 4JI6O 3OFNG 2HG5C 2P90A 2BSKB 4K0KO 1S5HC 2Q4PA 2OTLV 1HP8A 1HR0O 2EIKB 1PL4A 1XL6A 3CXCU 4UV8A 3J7AU 2YXYA 2KG7B 1RSOA 5LXTA 3SJQC 4TV8A 3D36A 3DXRA 2PTMA 1IBLO 1XNQO 4LNUB 4PHZA 3CRRA 1U96A 3WG7B 1QVGU 2Q7GA 1XEQA 3L71H 1SERA 4F4LA 4YY3B 3K9SA 3SPHA 3QNEA 1RPOA 5FPOA 1M4UA 4YY3O 3ZHVA 2NN4A 5H6QA 1PV0A 2Q68A 4GUNA 1BCCH 1OJHA 4LWSB 1Q5OA 4FIPC 1Q7YW 5H5NA 2UXDB 4O2BA 2IJIA 5CA0A 1Y4MA 2HEPA 4J9ZB 1ZUQA 4O4LB 4AQYB 4AILC 4X1IA 1WB8A 4G2KA 5BMVA 4YXWG 1GK9A 4I0XA 4PA6A 2ODMA 1QCEA 1JJOA 4ZKIA 4AQYO 1R3IC 3ABKB 2YEVB 2RDCA 3CC4V 3BVOA 4D7SA 1GM9A 5KMGA 4X89A 2ADQB 3A0RA 4HAMA 2EIJC 4KHPO 4R6ZA 2RMKB 1SS3A 2OCCB 2DQ3A 3CCSV 5B1AB 1SC5B 2RN9A 5L3DA 5L3BA 2WLLA 3E22A 1V54B 2G38A 4XDLA 1MG1A 1BL8A 5IJ0B 4MS2A 3ZMTA 3TCUA 1D5NA 3VBBA 4F6RA 4RUFA 3CCVV 1H8EG 1G8MA 3KCXA 3H9VA 2B9ZA 5LYJA 4LNUA 4PA3A 1SETA 4LFAB 4NXNB 1QLEC 2PF4E 3LSUA 1AJQA 3QTCA 3ABUA 2QJ1A 3APOA 2ZCEA 3OW2U 5J2TA 4DV3B 3U11A 3LSQA 3CB2A 1AILA 1R6KA 1GM8A 1XUQA 3OR6C 3TXQA 3ZHTA 2AHYA 4X1YA 1N34B 5TISZ 5H9CA 2LW7A 1NZ6A 2EINC 1YIJV 1BE3H 4DR5O 1K7DA 1X4TA 5KX5B 1N36B 3GVMA 1R6NA 3JCUZ 1NH2B 4DUZB 1N34O 1SESA 3AG3C 3UO2A 3F7YC 3E8GA 2KSDA 4X66B 3CRMA 4MT8A 4FM1A 2IU3A 2DYSB 3JALA 2GBOA 2GSMB 5B1OA 1R6TA 2GDSA 3HKCB 2R9IA 3OAAG 3CCQV 2WLIB 4LF8B 4I4TA 2WWWA 3L70H 2EIMB 1CXZB 2N04A 3N27A 4FFBA 1P7GA 1SRYA 2UUCB 3FYIB 4DRXB 4LF8O 1K92A 2PI4A 5EZYA 4RO2A 4BW9A 2HVKC 4DV2B 1ZAUA 1L8DA 5CBFA 1PM9A 5EC1C 1KUQA 3RYHA 4H37A 5GTIZ 5KLVH 3D3IA 1SQBH 4P30A 1EN4A 3P30A 1NVPD 3IC7A 2WLKA 3MAQA 1EFRG 1BMFG 3FB6C 2QR4A 4DV7B 1K4DC 4KL1A 5J9PC 2UUAB 5BR8B 4ZI7A 1Z5VA 2DQ0A 5E79Z 4DV7O 2RNBA 2FKXA 4YJ3B 2LFSA 2HJDA 3FAVA 4DR2O 4LR3A 4P2ZA 2Y0IA 2UUAO 4IIJB 5LGUA 1FPOA 5LP6B 4UUJC 4JI0B 4TQDA 4NKGB 4J7JA 1AI7A 1E79G 4DV1B 1WNSA 3E8HA 5JCOC 4C7UA 2IJJA 4FLVA 2ZE7A 5LOVA 2P5OA 3T2MA 4DV1O 1NR7A 1OCRB 1K97A 3ZN1A 2BOBC 1XOUA 5IYZA 2FMLA 4B3SO 4JTDB 1WN7A 2ADPA 1JMKC 3UQ8A 4JYYA 3ABLC 1W0JG 4MVRA 1ZL8A 3B4SA 2QWRB 4H33A 4LH6A 3OTFA 4FLXA 5EBWC 5LHHA 4JI3O 1LR1A 4ASUG 1KMIZ 4YIOA 3ZBHA 2Y48A 4FJCC 3DSQA 4X64B 3ZMVA 1VQNV 1NKDA 4QE9A 1PP9H 3JAWB 2ZNJA 4DRXA 1YDXA 4IHJA 3R65A 3AK1A 3HKBA 1YHQV 3OGIB 3BA9A 2X7RB 2GUZA 4B3MB 4EB6B 4DK1A 1KP2A 2N05A 3OMAB 4UCSA 5L3CA 1H2NA 4QNHB 2JS3A 4O4HB 5GONB 3SPGA 3RWRD 4DR1B 5BY1A 4JZ2A 4B7EA 3JASB 1ROPA 2ZXWB 3K58A 4MVMA 1SQQH 1NBMG 4O4JA 3JARB 2AZ2A 5K1XA 2A9HA 1WPXA 4XDJA 3ZMZA 1F4NA 2A0LA 2OTJV 1I5YA 1QQCA 1WLEA 1YF2A 2BTQB 2Q6AA 4DV0O 4IL6Z 4YJ2A 3CPWU 5KUMA 4B3TO 1KECA 4J9YB 1KD1W 4DO2A 2QE7G 1S5JA 2D2CB 3OTOB 1MA1A 3ML0A 4NYKA 2UXCO 3ZHRA 2YI9A 3ZMSA 4JI7O 4DR4B 4P9OA 2ARHA 4PA4A 4LF5O 2HLDG 3JATB 2HHHO 2HVJC 2ITCC 3FD9A 3QVNA 1TAEA 3OTOO 3G4SV 2X6CA 4UVBA 2R72A 1K33A 4F6EA 4U7OA 2EILC 4DR4O 2OIGA 4MSWC 4KXRA 4MTOA 1COWG 3RYCB 1XHZA 1WAZA 4WFGA 1M56C 4MW3A 2XNDG 4JF3A 5IJ9A 3H1LH 3QF7A 3K5LA 4OPHA 1TA8A 2Y4TA 5IDJA 1UFIA 4UCTA 2HFEC 4DV6B 4K8XA 4NTWA 3K57A 3AG2C 4DUYB 4X20A 1GN2A 5B5EZ 4OGQB 5B1BC 3N2KA 2OCHA 1FFXA 5ITZB 3RN4A 4Q20A 3ABMB 3ZRVA 1XMQO 1JQ0A 5K1PA 1YVWA 1GTOA 1WJZA 1SF9A 3T4DA 5AG2A 5H2FZ 3HR0A 5JH7A 4K8ZA 3B09A 3NXSA 1TVKA 3STLC 4L87A 3CHXA 2B1IA 4MVZA 1FJGO 4K3AA 4LFBO 2KQXA 1OCZB 3W7XA 3H1KH 4E2LA 4EFBA 3AG1B 4WFEA 3T1YB 1CPYA 1RSOB 5LXTB 3ZEDA 1AJPA 1VF7A 3BA8A 4D6TH 2VQEO 3AG4B 4TV8B 2IBZH 4P9PA 5JCOA 4FFKA 3DXRB 5JWPA 1ORQC 2ZE6A 4JASA 4UCUA 4WFHA 3JAKA 1OCCC 2CTWA 3RVYA 3ZHUA 1RM1C 3F5TA 4Z2WA 2QKAA 3RYIA 2XTAA 4BIOA 1F23A 5EIBD 1S77D 5LMUO 4PI2A 3M99B 1Q6HA 1EZJA 4JI8B 3EXAA 4LCUC 1VIBA 5LMNB 1YI2V 3AG7A 4RAIA 3WFVA 4JI8O 3E83A 4L8JA 2K9PA 3THOA 1Y76A 2B5UA 1SQXH 1K5QA 4O2BB 1AVMA 4ICGA 5CA0B 2CTRA 2JIZG 1VQ4V 4X1IB 4NB5A 2QKSA 3IFXA 1YEWA 2JEUA 1Y74A 4FLTA 5BMVB 4I0XB 1BHBA 3BCCH 2VQFB 5EBMC 1VARA 4GCZA 1TUBA 3KZIZ 1IBMB 2JGUA 2HKOA 5KMGB 2VQFO 3SYOA 3I5DA 3CSXA 1X59A 4DR7B 3FYEB 3G6EV 2PY5A 1GMGA 1AI5A 4MTGA 3SDLA 4OX9B 3GB7C 3W7UA 1S3JA 2WLLB 4TOIA 3E22B 1BGYH 1ZSPA 5HFMA 2LW1A 3K59A 1HNWB 2Q67A 2YXHA 3BPZA 4TWKA 2BOCC 4OX9O 2Q8VA 3SGIA 4F6RB 3OM3B 1VQLV 2H94A 3F5WC 1D2DA 3JSNA 1WA8A 1YXBA 1N0NA 1VQ5V 4JAUA 5LYJB 1Q43A 3IJ4A 3H1IH 1BZKA 3CRCA 2MW2B 1HWYA 1E1RG 3ZS8C 2Y69C 2GTAA 3WU2Z 4TV9A 2PZSA 1IVSA 1SZTA 5J2TB 4PDMA 4PA7A 1FXKC 1Z5WA 1QVFU 2VS0A 5LL6Y 5LHGA 1RFYA 3FFQA 1DLBA 2ZR2A 2A06H 4MVQA 5A2QN 3CJHA 1EN5A 4X1YB 4JYBA 5BXZA 2DWDC 2WLHA 3K06A 2QM7A 4PELA 4YIPA 4BAYA 2UXDO 1YTFD 1DGSA 4N21A 4CS2A 3OMNB 1V55C 3JALB 1HNZB 2Q69A 3CEIA 2WSSG 4I7ZB 3PN1A 3RYFA 2DN9A 1DF4A 2ZKOA 1AJNA 3Q4HA 4DK0A 4W4LA 4I4TB 4CH3A 3STZC 5GTHZ 1QR8A 3B2EE 1V9PA 4LC1A 1HNXB 3ZMUA 4FFBB 1IXBA 3APQA 4NTXA 1OV9A 1N8RW 4FM0A 5EZYB 1GN6A 1MABG 1AR1B 1ZWIC 1HNXO 4HBNA 2JDIG 3RYHB 2EJRA 4RUEA 1WB7A 1J95A 1NTKH 3JD1A 1F4MA 2YXLA 3X2QC 3ICXA 3BEHA 1TGOA 1Q6IA 2A3QA 4X62B 1GN4A 3ASNC 4JI5B 2UU9B 2MK3A 5EIBC 4LF7B 3CYOA 4LFAO 4JI2B 1FAFA 3LUTB 4X62O 4NXNO 1JR9A 4QPJA 4ZI7B 5JVDA 4HZ3A 2EZOA 3FAVB 1L1FA 4FLZA 5J2UA 4BIZA 4TSFG 4R50A 4JI2O 1NI8A 3M8AA 1EM1A 2PGGA 1D5AA 4I55A 4DV3O 4EFEA 1BHAA 2RJZA 2JEXA 3QO8A 5CA3A 1VMGA 5DN6G 1CEZA 1OCOC 4TUYA 4A5UB 5LOVB 3DC5A 3RFRA 2LGWA 1XL4A 3BABA 3BRCA 1BQ0A 2IW5A 1VQ9V 5IYZB 2QKCA 3JD4A 1N36O 3IC9A 1XILA 2DW4A 4DUZO 1ZL8B 3C3SA 2AHZA 2IM9A 2AXTZ 2E74B 1P84F 2EIJB 2EX3A 4X66O 1N0JA 3CWBH 2R70A 3ZRWA 3EFFK 1SQGA 2UXBB 4K35A 4IHJB 4LF9B 1XHXA 1NS1A 3OEEG 1I0HA 3ASOC 3HKBB 3NR7A 1E1QG 3ETGA 2IH3C 2UUCO 2VWJA 2GUZB 4XDKA 4LF9O 4B3RB 1AR4A 4X1KA 3ZHQA 4DV2O 2YDEA 4X88A 1NU1H 2E5LB 1MZFA 4H0LB 3L75H 3UT5A 1KC8W 1QLEB 4B3RO 4E4EA 3OUFA 4NVPA 3HPLC 5LA6B 4X9QA 1XI1A 2YC0A 3SJAC 3P3PA 1FXKA 5JJEB 4DV4B 2DYRC 1R3LC 4O4JB 4DXWA 2AZ0A 3A8TA 4HNAA 2OT5A 2Z0AA 1Y67A 5BR8O 5IWAB 1EBOA 5IY5C 2EINB 3U0ZA 2WLJA 3T1CA 1UJWB 3BY6A 4YJ2B 2FL4A 5IWAO 4BIUA 4JI0O 1N33B 4I50A 2W6IG 4CS3A 3AG3B 1QU7A 5DM6V 5CB4A 1YJWV 4ZOLA 5JJJB 3C90A 3CD6V 2E3CA 1N32B 4QJFB 2CGOA 3CXHF 4JAVA 3OT7A 1M93A 2XAGA 3JD3A 4D7TA 2QDOA 1WP8A 1QNMA 1N32O 1B06A 1W59A 5IJ9B 3EVKA 1BT8A 4X64O 1ZX3A 4J42A 3SYCA 5B1NA 1SA0A 1VQKV 4PD4F 4JYCA 1IURA 2NR5A 1Q8IA 1VEWA 2Z3YA 5BZBA 4X20B 4LF4B 1S0VA 2XUMA 4MTFA 1YJNV 3N2KB 4GKKB 2QWQB 3QO7A 2ZQMA 5D5QA 4DR3B 1FFXB 4AHCA 2IJKA 2WA4A 1U97A 4B3MO 3DGEA 4LF4O 1RPRA 2H8PC 5LA6A 5JH7B 4DR3O 2KB1A 1TVKB 2JVDA 3LDDA 3CE2A 4LP8A 1Y66A 2Q9LA 4DR1O 2ZM6B 4NXMB 3E35A 4KUMA 3A2FA 2H3OA 2WLNA 2P4KA 3I55V 4LFCB 3DTUB 4X65B 3K5MA 2ZM6O 1VQ7V 3TETA 2WA3A 4Z1VA 1WP7A 3W7SA 1YTFB 1IX9A 3JAKB 2BTOA 4UCVA 3UM7A 4KP4A 4IT5A 4JV5B 2W0FC 1NTMH 3RYIB 2HP8A 2LGQA 5IYDO 3ABLB 2DMXA 1T5EA 2QEXV 4B7KA 4FLYA 2ZT9B 3CP1A 1GM7A 1PPJH 3CCEV 4O2AA 3VQXA 4JV5O 1R3KC 2W0XA 2ETNA 3F7VC 2P7TC 3JSLA 4UFZA 4BW5A 2QA4V 2ZR3A 2OIEA 3RBZA 2PYLA 4JI4B 2A79B 1Y76B 1DK1A 2ZNIA 2OYQA 4I9QA 2CH7A 3JCZA 2CTQA 1Y74B 3K0GA 2O57A 4DV5B 1HDJA 5B3SC 4GYCB 1O9HA 3LDEA 4WF9V 4JYAB 1R3JC 4TT3G 1TUBB 4W4KA 2CK3G 4FMTA 1KU9A 2ILMA 3J80N 2ZIMA 4DV6O 2E75B 1H2GA 4DUYO 5IYCO 4JYAO 3MDSA 1Z2GA 1K4CC 2HR3A 1GAXA 1M57C 3ABTA 1Q81W 1B3QA 4UVAA 4YHHB 1F7YA 2F95B 5FNVA 4Z1MG 2PYJA 3K03A 3UCSC 3CCUV 4PI0A 4G28B 2QM8A 1XREA 4YHHO 1WA8B 1KBHA 2QWNB 2OWOA 3FX7A 3T1YO 1THZA 2VRZA 2ZE8A 3E86A 4O4IA 5CA1A 1VQ6V 4MTXA 3CCLV 4TV9B 2EIKC 5KHJA 1VF5B 3ZN0A 1P4RA 3W7WA 4ZHQA 1M1KW 1VQMV 3L73H 4DYLA 1I94B 2ZINA 3CS5A 3N2GA 2F66C 1GO3F 5LGNA 1GKFA 2EILB 1SQFA 5KAFZ 2LFRA 3WG7C 4EKWA 3CCJV 5IE9A 1KYOF 1M56B 4PJ0Z 3HKDA 3CJHB 3OMIB 1I94O 2Q0OC 1GRJA 2FTKA 1FYJA 5LMNO 2P6JA 4UB6Z 1XMOB 4GX2A 5F2VO 3MD0A 1BS3A 1NVPB 1WPBA 1SQVH 4ZIBA 3AG2B 3L9DA 1RP3B 2XASA 1IBKB 4MVUA 2M6YA 5B1BB 4QPKA 2YSUB 2FB5A 1YJ9V 3RYFB 1ZLZA 5JJNB 1M90W 1VF6C 3ZHSA 3Q4HB 1JFFA 2RQ6A 2DOSA 1AB3A 1IBMO 2Q7HA 3SJBC 1PNLA 2L35A 4JTAB 4UV9A 5KA5A 3K04A 3ABKC 4DR7O 2ZDIC 2VWKA 3CC7V 4JI6B 4JGSA 1J5EB 3IAYA 3B77A 2AW9A 1DTOA 1JJ2U 5E1AC 1JA8A 2P4VA 1HNWO 2OCCC 3ETDA 1BQZA 3SYPA 5B1AC 2XAHA 1J5EO 1KP3A 1PD3A 5CBGA 1V54C 3RT3C 1OCCB 2GV9A 1AR5A 5JQGA 1RM1B 4PDRA 1HW7A 1XNQB 1IBLB 3QG5A 1ENVA 4RQEA 5JVDB 5LHIA 5J2UB 1P49A 4GX0A 4FK5C 2EULA 2V1DA 4I55B 3HKEA 5GW7A 5C8YB 2IH1C 3SPCA 4DR6B 2CGNA 3W7TA 3CX5F 2QTSA 1B04A 5EYPA 1Q90D 3RVZA 4TUYB 1NR1A 2LJ2A 1YITV 4DR6O 4WBNA 4I5SA 3RGBA 1P7BA 3E8FA 4U7NA 1FXVA 4QIWF 5KHHA 2WPDG 1PNMA 2N74A 4U3JA 4JI1B 1I5XA 1H2LA 4J7KA 1XDCA 1HNZO 3ZRWB 1KQSU 3M7MX 1OZ0A 1R73A 4R7CA 3L74H 2ATKC 4KHPB 4JI1O 1G4YB 1QHTA 1G1XB 2QTOA 4UCOA 2F23A 2DYSC 2RCVA 1GH6A 1AI6A 1IZ3A 4KFMA 4BR6A 4GLXA 1OHHG 2EIMC 4FZ0A 4X1KB 5C93A 3U10A 2M7WA 2BSKA 4CC5A 4G27B 1ZTEA 3UT5B 5IYBO 2Y69B 1AI4A 5EK0A 2NLJC 1B6QA 1M9NA 1H2MA 1JPXA 2KG7A 5DECA 1XBLA 3IGAC 1O9GA 1K73W 1FXKB 3ZJZA 1URFA 2P22C 4JI5O 2UU9O 3VOUA 5IT9N 4HNAB 3MHSC 4H13B 4LF7O 5FL7G 3E89A 3KKYA 3B8NA 4JAAA 4FPPA 5C8YA 2Y4UA 4WFFA 5KHKA 2YI8A 2YIDA 2X6BA 3T4ZA 2LP7A 3UO3A 2QWPB 2DJVA 4I50B 3OGCC 2ZE5A 2XT9A 4LWSA 1R1BA 4FM2A 3K08A 2XAFA 1K8AW 5CB4B 5KA6A 4J80A 4NR1A 4DR5B 1V55B 1DF5A 5LP6C 1BSMA 4ZOLB 4PA9A 1VF6A 2PUSA 5KAIZ 5KHGA 3MHHC 4O4LA 4IGGA 1VP7A 1JOYA 4J11A 4B08A 2UUBB 4MVOA 4FVMA 3GWKC 2JJ1G 1OCRC 1MZEA 5L3FA 4H44B 3C3TA 2YEVA 2ZDIA 2CUGA 4UXNA 3B8MA 2UUBO 4DW1A 2UXXA 3CRAA 3K5NA 2DE0X 5D5PA 1NTZH 4UCRA 2UXBO 2YIBA 1SA0B 4JZGA 2BE3A 2K1EA 4FLUA 3X2QB 1YCIA 4JTCB 4OXSA 1Y6XA 2P06A 3BHPA 1K5SA 5L3EA 3ASNB 5IJ0A 2Y0PA 3KG2A 2Q0AA 2E76B 1NT2B 3H1JH 3G6BA 2E5LO 1VQPV 5EC2C 4XBFA 3CMAV 1FXHA 4JPRA 3A0BZ 1K3EA 3VQYA 4R8CA 4CC6A 4FLWA 4IYHA 5A9GA 2Q7EA 4DV4O 2QWOB 4UB8Z 4ZBMA 4DR2B 5CMUA 1H8HG 3LSSA 1L0NH 2NNUA 2B1GA 2Z5UA 2GHYA 4J41A 2D3OW 3CCRV 5FLXN 1OCOB 4CZZA 1PNKA 3WB2A 1Q6UA 2ZXWC 2CE4A 3FKSG 1W2BU 1IDSA 2UXNA 2XAQA 1N33O 4I9WA 1XQ8A 1SKVA 1Q3EA 2L6LA 4O2AB 4B3SB 5KX5A 1VQOV 1KB9F 3HB3B 1K34A 2IJHA 3ZX6A 4J10A 3SJCC 4JI3B 1LUVA 1MNGA 5H6RA 1H2SB 3ASOB 1MOFA 4PV1B 1CP9A 3HKCA 3J81N 5FPRA 2CH7B 2WLIA 3PJSK 2XOKG 2JGDB 1FS0G 3G80A 2A7WA 3TGUH 4WCEV 3OD4A 1Q86W 3CRQA 3OE7G 2CDYA 4MW8A 5KHIA 1EZVH 5KUKA 1QR9A 1UPGA 4WFBV 4DW0A 5EBLC 3RW0A 4PDVA 5LBQA 1XNRB 3E8BA 2JJ2G 3LNMB 4GKKO 2AGAA 3OUSA 2F4VB 4LH7A 2DYRB 2QM4A 1YSCA 3BFRA 1XNRO 1I08A 3CC2V 2P67A 3ZCCA 4CS4A 2F4VO 5FNVB 3ABMC 4ABMA 3BAAA 5CBHA 2V7QG 2LO1A 5IY5B 4GT1A 1PKXA 3K0DA 3TJTA 2EBOA 4GKJB 1K9MW 1M5IA 4LF6B 2W6JG 4MVSA 1F51A 2YIBD 1LNQA 4NXMO 3K3WA 1YZBA 4YJ3A 3UKMA 5CA1B 1W0KG 2ITDC 2ZIOA 4O4IB 3SYAA 2Q5ZA 4DV0B 1MMMA 1SZXA 4LF6O 4GKJO 4IIJA 1OCZC 3O9OA 2JK5C 4LFCO 2HJFC 4B3TB 2IU0A 4X65O 5LP6A 3AG1C 4ZHQB 3E2EA 3P32A 3JD2A 2CAZC 3AG4C 3G67A 1NJIW 2F93B 3VQWA 3D36C 1H2KA 2UXCB 3N2GB 5CN0A 1A32A 3FB5C 2X6AA 4JI7B 4LF5B 2EZPA 2WAMA 2HHHB 1JCHA 4LBEC 5L3GA 2PI5A 3HKDB 1FD9A 2DWEC 4UVCA 5DEDA 2BCCH 2QSAA 3P3NA 1FFTB 2C2AA 2KKWA 1US6A 3A0HZ 3D3QA 4PDLA 4U3FH 2F1MA 2YIAA 1SQPH 2JGDA 4RQFA 4JI4O 4OPAA 3JAWA 4GZRB 1S5LZ 2F43G 3ZRSA 4DV5O 4HYOA 1JFFB 3T1HB 3SPJA 4BWAA 3SPIA 5LGTA 1XMQB 1NH2D 2LQTA 1MSDA 3EHBB 2WLMA 4GX5A 4EB6A 4X8AA 3TXSA 3LNNA 3T1HO 3GWOA 3I56V 3AK3A 4O4HA 3H1HH 5GONA 1AP6A 4IYIA 4AI8A 1S72V 1FJGB 3JAMN 2CTPA 4LFBB 3JD0A 2FYUH 3JASA 1QBZA 3L72H 3LDCA 1Q82W 1KKDA 4FZ1A 2X0LA 1TUEB 4N23A 2VQEB 3JARA 1GN3A 3S3WA 1S76D 2R9AA 5JQGB 5B66Z 3D8CA 4EEQA 3S3XA 3B40A 2Q73A 3JYCA 1PL0A 3AEIA 3KCYA 2JRIA 3ZRXA 4CH6A 3K79A 1FKAO 2BTQA 4CBCA 3K5OA 4J7ZA 1EN6A 5LMUB 3OR7C 2GTSA 3O65A 1QLNA 4CH4A 3CCMV 3FB8C 3HKEB 3QO5A 3JATA 1AP5A 1L0LH 5EYPB 3SR2C 4QGPA 4GX1A 3R66A 2R9RB 3SYQA 2XHBA 3TK1A 3DC6A 1H38A 4WBNB 5B3SB 1VQ8V 3RYCA 1G6UA 3CMEV 1NQTA 1MSWD 1XMOO 2ZD9A 4RWUA 1N4CA 1I7FA 1JVMA 2YS8A 4TQFA 4U3JB 1IBKO 2YUAA 3OEHG 2EJ7A 3ETEA 5HFLA 4CH5A 3FB7C 1IXMA 4Q6GA 3H01A 1M57B 3WB1A 3ETQA 3ZIAG 3K9AA 3AK2A 2QGNA 3WB0A
chains in the Genus database with same CATH topology
1JPXA 4MTOA 1COWG 3IGAC 4BIUA 4WFGA 1M56C 2XAJA 4MW3A 2W6IG 3AG3B 1K73W 1FXKB 2XNDG 3ZJZA 4JF3A 5DM6V 3VOUA 1AROP 4WFAV 1JX9A 1YJWV 3MHSC 4QE7A 3G71V 5FL7G 3E89A 3OFNG 2HG5C 5IDJA 3B8NA 2P90A 3CD6V 1S5HC 2HFEC 2OTLV 4FPPA 4QJFB 3AG2C 2EIKB 4JAVA 4WFFA 1XL6A 2XAGA 3CXCU 3JD3A 2X6BA 5B1BC 3T4ZA 4UV8A 2LP7A 3SJQC 4Q20A 3ABMB 3ZRVA 3OGCC 3D36A 1JQ0A 1GTOA 3K08A 2XAFA 1K8AW 5KA6A 3T4DA 1V55B 1DF5A 3WG7B 1QVGU 3NXSA 3STLC 4L87A 1SERA 2B1IA 4F4LA 4PA9A 3SYCA 5B1NA 1VQKV 4JYCA 4MVZA 3MHHC 3SPHA 3QNEA 2Z3YA 1RPOA 1JOYA 5BZBA 1OCZB 4MVOA 3W7XA 4E2LA 1S0VA 3AG1B 4WFEA 4MTFA 1YJNV 2JJ1G 1OCRC 3QO7A 1CPYA 5L3FA 2ZQMA 1AJPA 5H6QA 2Q68A 3AG4B 4P9PA 2IJKA 2YEVA 2ZDIA 4UXNA 3B8MA 3DGEA 4FIPC 1RPRA 2UXXA 1ORQC 2H8PC 1Q7YW 4JASA 4WFHA 2KB1A 1OCCC 3RVYA 3LDDA 4LP8A 1RM1C 2IJIA 1Y4MA 1F23A 2K1EA 1Y66A 4J9ZB 3X2QB 4G2KA 1S77D 3E35A 3M99B 4JTCB 4KUMA 4OXSA 1EZJA 4YXWG 1GK9A 4PA6A 1QCEA 4ZKIA 1K5SA 5L3EA 3ASNB 2WLNA 4LCUC 3I55V 3KG2A 1R3IC 3ABKB 2YEVB 3DTUB 3CC4V 1VQ7V 1YI2V 3TETA 4RAIA 1VQPV 3WFVA 3W7SA 1GM9A 5EC2C 4XBFA 1YTFB 4X89A 3CMAV 3E83A 1FXHA 3A0RA 4JPRA 4HAMA 2EIJC 3UM7A 1K3EA 4R6ZA 2B5UA 4KP4A 1K5QA 2W0FC 3CCSV 2OCCB 2DQ3A 5B1AB 4R8CA 2JIZG 1VQ4V 5IYDO 3ABLB 2QKSA 3IFXA 5L3DA 5L3BA 2WLLA 2JEUA 2QEXV 1V54B 3CP1A 1GM7A 3CCEV 1BHBA 4XDLA 4ZBMA 1R3KC 1MG1A 1BL8A 5EBMC 5CMUA 1H8HG 3LSSA 4MS2A 3ZMTA 2NNUA 2B1GA 2Z5UA 4GCZA 3TCUA 2GHYA 3VBBA 2D3OW 3CCRV 3F7VC 2P7TC 1OCOB 4CZZA 1PNKA 4RUFA 2ZXWC 2HKOA 3CCVV 4BW5A 2QA4V 3SYOA 2ZR3A 1H8EG 1G8MA 3RBZA 2A79B 3FKSG 3FYEB 3G6EV 1W2BU 1GMGA 4PA3A 1AI5A 1SETA 4MTGA 2UXNA 3JCZA 2XAQA 3GB7C 3W7UA 1S3JA 2WLLB 4I9WA 3K0GA 1QLEC 5HFMA 2Q67A 1AJQA 5B3SC 4WF9V 3LDEA 3ABUA 1VQOV 1R3JC 4TWKA 2BOCC 3HB3B 1K34A 4TT3G 3OW2U 2CK3G 2IJHA 4FMTA 3LSQA 3OM3B 1H2GA 1VQLV 2H94A 3F5WC 5IYCO 1R6KA 1VQ5V 1GM8A 4JAUA 5H6RA 3OR6C 3ASOB 1K4CC 2HR3A 1MOFA 1CP9A 1HWYA 2AHYA 1E1RG 1M57C 2WLIA 3PJSK 2XOKG 2Y69C 5H9CA 1FS0G 2EINC 4WCEV 1Q86W 1YIJV 3ABTA 1K7DA 3OE7G 1Q81W 1SZTA 4UVAA 1R6NA 4MW8A 5KUKA 1NH2B 4Z1MG 1QR9A 1SESA 4PDMA 3AG3C 3K03A 4PA7A 1FXKC 5EBLC 4WFBV 3F7YC 1QVFU 3E8GA 3RW0A 3CCUV 5LHGA 4PDVA 4MT8A 4G28B 2IU3A 2QM8A 5LBQA 2DYSB 2GSMB 5B1OA 3E8BA 2JJ2G 1DLBA 2ZR2A 4MVQA 3LNMB 1THZA 3OUSA 2R9IA 3OAAG 4JYBA 3CCQV 2WLIB 1VQ6V 3E86A 2DYRB 2DWDC 2WLHA 4MTXA 1YSCA 3CCLV 2WWWA 2EIMB 2EIKC 3K06A 2QM7A 3ZN0A 1P4RA 3W7WA 4PELA 4BAYA 3CC2V 1SRYA 2P67A 3ZCCA 1M1KW 1VQMV 3ABMC 3FYIB 5CBHA 1K92A 2V7QG 2PI4A 5IY5B 4GT1A 4RO2A 1PKXA 1YTFD 2HVKC 3K0DA 1GO3F 2EBOA 5LGNA 1GKFA 4N21A 2EILB 1K9MW 3OMNB 2W6JG 4MVSA 5CBFA 1V55C 5EC1C 2LFRA 1F51A 3WG7C 4EKWA 1LNQA 2Q69A 4H37A 3K3WA 3CCJV 2WSSG 1M56B 1DF4A 3D3IA 3OMIB 1AJNA 4P30A 3UKMA 1W0KG 2ITDC 3SYAA 3P30A 1NVPD 1OCZC 2FTKA 2JK5C 3STZC 2HJFC 3IC7A 1QR8A 2IU0A 4LC1A 3ZMUA 2WLKA 3AG1C 2P6JA 1EFRG 1BMFG 4GX2A 3P32A 3E2EA 3MD0A 3FB6C 3JD2A 1K4DC 3AG4C 1NJIW 1N8RW 1NVPB 3AG2B 1MABG 5CN0A 2XASA 1AR1B 1ZWIC 3FB5C 2X6AA 4MVUA 5J9PC 2JDIG 5B1BB 2EJRA 2EZPA 2DQ0A 2WAMA 4QPKA 1JCHA 2YSUB 4LBEC 5L3GA 1YJ9V 2PI5A 2LFSA 4RUEA 1M90W 1J95A 3JD1A 2DWEC 1F4MA 4P2ZA 4UVCA 5LGUA 3X2QC 3BEHA 1FFTB 4UUJC 2C2AA 1AI7A 1E79G 4PDLA 3ASNC 4RQFA 2MK3A 1PNLA 3E8HA 4JTAB 4UV9A 5KA5A 3K04A 3ABKC 2ZDIC 2IJJA 3CC7V 3CYOA 4JGSA 3LUTB 3T2MA 1NR7A 1OCRB 1K97A 3B77A 4QPJA 3ZN1A 2BOBC 2F43G 1DTOA 1JJ2U 4HZ3A 1B6QA 3ZRSA 2EZOA 5E1AC 4HYOA 1L1FA 2OCCC 3ETDA 4JTDB 4BIZA 3SYPA 5B1AC 2XAHA 4TSFG 4R50A 3ABLC 1KP3A 1W0JG 1PD3A 4MVRA 4H33A 3SPJA 1V54C 5CBGA 1OCCB 3SPIA 1BHAA 5EBWC 5LGTA 1NH2D 5LHHA 1RM1B 3EHBB 4PDRA 2WLMA 4GX5A 4ASUG 4X8AA 2JEXA 2Y48A 4FJCC 3QO8A 5CA3A 3GWOA 5DN6G 3I56V 1OCOC 1CEZA 1ENVA 4RQEA 3ZMVA 1VQNV 1NKDA 1XL4A 4QE9A 2IW5A 1S72V 5LHIA 3R65A 1VQ9V 3JD0A 3JD4A 1YHQV 3LDCA 1QBZA 4GX0A 2X7RB 1Q82W 1KKDA 2X0LA 4FK5C 2DW4A 1TUEB 2V1DA 2AHZA 4N23A 5GW7A 2EIJB 1S76D 2IH1C 3SPCA 3W7TA 3JYCA 1PL0A 1KP2A 3OMAB 3ZRWA 3EFFK 3AEIA 5L3CA 3RVZA 3ZRXA 4QNHB 3K79A 1NR1A 1YITV 4CBCA 3SPGA 4I5SA 1P7BA 3OEEG 3ASOC 3E8FA 4U7NA 1FXVA 3OR7C 1E1QG 3ETGA 2IH3C 1ROPA 2ZXWB 4MVMA 1QLNA 3CCMV 1NBMG 4QIWF 3FB8C 2WPDG 4XDKA 1PNMA 1I5XA 4X88A 3QO5A 2A9HA 1WPXA 4XDJA 3ZMZA 3ZRWB 1KQSU 1F4NA 1KC8W 2A0LA 2OTJV 1OZ0A 1QLEB 1R73A 4GX1A 1I5YA 4R7CA 1WLEA 2ATKC 2R9RB 2Q6AA 1G4YB 3SYQA 3TK1A 2QTOA 1H38A 3CPWU 5B3SB 5KUMA 3OUFA 2DYSC 1VQ8V 3HPLC 1KECA 4J9YB 3CMEV 1KD1W 1NQTA 1MSWD 4DO2A 1FXKA 2QE7G 2ZD9A 1AI6A 4KFMA 2DYRC 1JVMA 3ML0A 1OHHG 1R3LC 2EIMC 4DXWA 2OT5A 5C93A 3ZMSA 3OEHG 4P9OA 5HFLA 3ETEA 4PA4A 2M7WA 2HLDG 3FB7C 1IXMA 2HVJC 2ITCC 3G4SV 3H01A 1M57B 1EBOA 2X6CA 4G27B 4UVBA 5IYBO 2Y69B 5IY5C 1AI4A 1K33A 5EK0A 3ZIAG 2EINB 4U7OA 2EILC 2WLJA 3K9AA 2NLJC 3BY6A 3T1CA 1UJWB 1M9NA 4MSWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8A A;  2DWD C;  2WLH A;  4MTO A;  4X89 A;  3E83 A;  3IGA C;  3K06 A;  2EIK C;  4WFG A;  1M56 C;  2EIJ C;  3UM7 A;  4MW3 A;  1OCO C;  4R6Z A;  3ZJZ A;  2W0F C;  1XL4 A;  4QE9 A;  4RAI A;  4R8C A;  3VOU A;  3ABM C;  2QKS A;  3IFX A;  3R65 A;  4QE7 A;  2WLL A;  5CBH A;  3E89 A;  2HG5 C;  4RO2 A;  2HVK C;  3K0D A;  3LDC A;  4GX0 A;  4XDL A;  4ZBM A;  1R3K C;  1BL8 A;  4MVS A;  1S5H C;  1V55 C;  2HFE C;  5EBM C;  5EC1 C;  5CBF A;  3WG7 C;  1KKD A;  4EKW A;  4MS2 A;  2AHZ A;  1LNQ A;  2Q69 A;  3AG2 C;  4H37 A;  3TCU A;  4WFF A;  2IH1 C;  3F7V C;  2P7T C;  1XL6 A;  3SPC A;  4P30 A;  2X6B A;  4RUF A;  5B1B C;  3T4Z A;  3UKM A;  2ZXW C;  2ITD C;  4BW5 A;  3SYA A;  3JYC A;  3SYO A;  1OCZ C;  3STZ C;  2JK5 C;  3EFF K;  2HJF C;  3SJQ C;  3RBZ A;  2A79 B;  3OGC C;  3RVZ A;  4QNH B;  2WLK A;  3AG1 C;  4PA3 A;  3K08 A;  4GX2 A;  4CBC A;  4MTG A;  3FB6 C;  3SPG A;  3T4D A;  1K4D C;  3AG4 C;  3GB7 C;  2WLL B;  4I9W A;  1P7B A;  3K0G A;  1QLE C;  3STL C;  3ASO C;  3E8F A;  4F4L A;  1ZWI C;  4PA9 A;  3FB5 C;  3SYC A;  3OR7 C;  2X6A A;  2Q67 A;  4MVU A;  5B3S C;  5J9P C;  2IH3 C;  3LDE A;  4MVZ A;  4MVM A;  1R3J C;  4TWK A;  3SPH A;  2BOC C;  4LBE C;  5BZB A;  3FB8 C;  4XDK A;  4MVO A;  4RUE A;  4WFE A;  4MTF A;  4X88 A;  1J95 A;  1OCR C;  2DWE C;  2A9H A;  4P2Z A;  4MSW C;  4XDJ A;  3F5W C;  2Q68 A;  3X2Q C;  4P9P A;  2A0L A;  3BEH A;  2YEV A;  4UUJ C;  4GX1 A;  4R7C A;  3OR6 C;  2ATK C;  1K4C C;  2R9R B;  4PDL A;  2Q6A A;  1G4Y B;  3SYQ A;  2AHY A;  1ORQ C;  2QTO A;  2H8P C;  3ASN C;  1M57 C;  5KUM A;  2WLI A;  3OUF A;  2DYS C;  3PJS K;  3E8H A;  2Y69 C;  4JTA B;  3HPL C;  3K04 A;  2KB1 A;  3ABK C;  4J9Y B;  4WFH A;  1OCC C;  3RVY A;  3LDD A;  2EIN C;  4LP8 A;  2ZD9 A;  3LUT B;  4KFM A;  3T2M A;  2DYR C;  2K1E A;  4J9Z B;  4MW8 A;  1JVM A;  1R3L C;  2BOB C;  2EIM C;  4DXW A;  5KUK A;  4HZ3 A;  3ZRS A;  4PDM A;  3AG3 C;  3K03 A;  4PA7 A;  5E1A C;  5EBL C;  3F7Y C;  4HYO A;  4JTC B;  4OXS A;  2OCC C;  4P9O A;  4JTD B;  3E8G A;  3RW0 A;  5B1A C;  4PA4 A;  3SYP A;  4PA6 A;  4R50 A;  3FB7 C;  4PDV A;  4G28 B;  2HVJ C;  2ITC C;  3ABL C;  2WLN A;  2X6C A;  4G27 B;  4LCU C;  4MVR A;  4H33 A;  3KG2 A;  1V54 C;  3SPJ A;  5CBG A;  1R3I C;  5EK0 A;  5IY5 C;  3E8B A;  3SPI A;  4MVQ A;  5EBW C;  3LNM B;  2EIL C;  2WLJ A;  3T1C A;  2NLJ C;  3OUS A;  3TET A;  4PDR A;  2WLM A;  4GX5 A;  2WLI B;  5EC2 C;  3E86 A; 
#chains in the Genus database with same CATH topology
 1KKC A;  1LUW A;  3VQV A;  5ITZ A;  2XAJ A;  2V4D A;  2YIC A;  4K0K B;  2JS5 A;  1ARO P;  4NTY A;  4WFA V;  1JX9 A;  1HR0 B;  4QE7 A;  3G71 V;  4JI6 O;  3OFN G;  2HG5 C;  2P90 A;  2BSK B;  4K0K O;  1S5H C;  2Q4P A;  2OTL V;  1HP8 A;  1HR0 O;  2EIK B;  1PL4 A;  1XL6 A;  3CXC U;  4UV8 A;  3J7A U;  2YXY A;  2KG7 B;  1RSO A;  5LXT A;  3SJQ C;  4TV8 A;  3D36 A;  3DXR A;  2PTM A;  1IBL O;  1XNQ O;  4LNU B;  4PHZ A;  3CRR A;  1U96 A;  3WG7 B;  1QVG U;  2Q7G A;  1XEQ A;  3L71 H;  1SER A;  4F4L A;  4YY3 B;  3K9S A;  3SPH A;  3QNE A;  1RPO A;  5FPO A;  1M4U A;  4YY3 O;  3ZHV A;  2NN4 A;  5H6Q A;  1PV0 A;  2Q68 A;  4GUN A;  1BCC H;  1OJH A;  4LWS B;  1Q5O A;  4FIP C;  1Q7Y W;  5H5N A;  2UXD B;  4O2B A;  2IJI A;  5CA0 A;  1Y4M A;  2HEP A;  4J9Z B;  1ZUQ A;  4O4L B;  4AQY B;  4AIL C;  4X1I A;  1WB8 A;  4G2K A;  5BMV A;  4YXW G;  1GK9 A;  4I0X A;  4PA6 A;  2ODM A;  1QCE A;  1JJO A;  4ZKI A;  4AQY O;  1R3I C;  3ABK B;  2YEV B;  2RDC A;  3CC4 V;  3BVO A;  4D7S A;  1GM9 A;  5KMG A;  4X89 A;  2ADQ B;  3A0R A;  4HAM A;  2EIJ C;  4KHP O;  4R6Z A;  2RMK B;  1SS3 A;  2OCC B;  2DQ3 A;  3CCS V;  5B1A B;  1SC5 B;  2RN9 A;  5L3D A;  5L3B A;  2WLL A;  3E22 A;  1V54 B;  2G38 A;  4XDL A;  1MG1 A;  1BL8 A;  5IJ0 B;  4MS2 A;  3ZMT A;  3TCU A;  1D5N A;  3VBB A;  4F6R A;  4RUF A;  3CCV V;  1H8E G;  1G8M A;  3KCX A;  3H9V A;  2B9Z A;  5LYJ A;  4LNU A;  4PA3 A;  1SET A;  4LFA B;  4NXN B;  1QLE C;  2PF4 E;  3LSU A;  1AJQ A;  3QTC A;  3ABU A;  2QJ1 A;  3APO A;  2ZCE A;  3OW2 U;  5J2T A;  4DV3 B;  3U11 A;  3LSQ A;  3CB2 A;  1AIL A;  1R6K A;  1GM8 A;  1XUQ A;  3OR6 C;  3TXQ A;  3ZHT A;  2AHY A;  4X1Y A;  1N34 B;  5TIS Z;  5H9C A;  2LW7 A;  1NZ6 A;  2EIN C;  1YIJ V;  1BE3 H;  4DR5 O;  1K7D A;  1X4T A;  5KX5 B;  1N36 B;  3GVM A;  1R6N A;  3JCU Z;  1NH2 B;  4DUZ B;  1N34 O;  1SES A;  3AG3 C;  3UO2 A;  3F7Y C;  3E8G A;  2KSD A;  4X66 B;  3CRM A;  4MT8 A;  4FM1 A;  2IU3 A;  2DYS B;  3JAL A;  2GBO A;  2GSM B;  5B1O A;  1R6T A;  2GDS A;  3HKC B;  2R9I A;  3OAA G;  3CCQ V;  2WLI B;  4LF8 B;  4I4T A;  2WWW A;  3L70 H;  2EIM B;  1CXZ B;  2N04 A;  3N27 A;  4FFB A;  1P7G A;  1SRY A;  2UUC B;  3FYI B;  4DRX B;  4LF8 O;  1K92 A;  2PI4 A;  5EZY A;  4RO2 A;  4BW9 A;  2HVK C;  4DV2 B;  1ZAU A;  1L8D A;  5CBF A;  1PM9 A;  5EC1 C;  1KUQ A;  3RYH A;  4H37 A;  5GTI Z;  5KLV H;  3D3I A;  1SQB H;  4P30 A;  1EN4 A;  3P30 A;  1NVP D;  3IC7 A;  2WLK A;  3MAQ A;  1EFR G;  1BMF G;  3FB6 C;  2QR4 A;  4DV7 B;  1K4D C;  4KL1 A;  5J9P C;  2UUA B;  5BR8 B;  4ZI7 A;  1Z5V A;  2DQ0 A;  5E79 Z;  4DV7 O;  2RNB A;  2FKX A;  4YJ3 B;  2LFS A;  2HJD A;  3FAV A;  4DR2 O;  4LR3 A;  4P2Z A;  2Y0I A;  2UUA O;  4IIJ B;  5LGU A;  1FPO A;  5LP6 B;  4UUJ C;  4JI0 B;  4TQD A;  4NKG B;  4J7J A;  1AI7 A;  1E79 G;  4DV1 B;  1WNS A;  3E8H A;  5JCO C;  4C7U A;  2IJJ A;  4FLV A;  2ZE7 A;  5LOV A;  2P5O A;  3T2M A;  4DV1 O;  1NR7 A;  1OCR B;  1K97 A;  3ZN1 A;  2BOB C;  1XOU A;  5IYZ A;  2FML A;  4B3S O;  4JTD B;  1WN7 A;  2ADP A;  1JMK C;  3UQ8 A;  4JYY A;  3ABL C;  1W0J G;  4MVR A;  1ZL8 A;  3B4S A;  2QWR B;  4H33 A;  4LH6 A;  3OTF A;  4FLX A;  5EBW C;  5LHH A;  4JI3 O;  1LR1 A;  4ASU G;  1KMI Z;  4YIO A;  3ZBH A;  2Y48 A;  4FJC C;  3DSQ A;  4X64 B;  3ZMV A;  1VQN V;  1NKD A;  4QE9 A;  1PP9 H;  3JAW B;  2ZNJ A;  4DRX A;  1YDX A;  4IHJ A;  3R65 A;  3AK1 A;  3HKB A;  1YHQ V;  3OGI B;  3BA9 A;  2X7R B;  2GUZ A;  4B3M B;  4EB6 B;  4DK1 A;  1KP2 A;  2N05 A;  3OMA B;  4UCS A;  5L3C A;  1H2N A;  4QNH B;  2JS3 A;  4O4H B;  5GON B;  3SPG A;  3RWR D;  4DR1 B;  5BY1 A;  4JZ2 A;  4B7E A;  3JAS B;  1ROP A;  2ZXW B;  3K58 A;  4MVM A;  1SQQ H;  1NBM G;  4O4J A;  3JAR B;  2AZ2 A;  5K1X A;  2A9H A;  1WPX A;  4XDJ A;  3ZMZ A;  1F4N A;  2A0L A;  2OTJ V;  1I5Y A;  1QQC A;  1WLE A;  1YF2 A;  2BTQ B;  2Q6A A;  4DV0 O;  4IL6 Z;  4YJ2 A;  3CPW U;  5KUM A;  4B3T O;  1KEC A;  4J9Y B;  1KD1 W;  4DO2 A;  2QE7 G;  1S5J A;  2D2C B;  3OTO B;  1MA1 A;  3ML0 A;  4NYK A;  2UXC O;  3ZHR A;  2YI9 A;  3ZMS A;  4JI7 O;  4DR4 B;  4P9O A;  2ARH A;  4PA4 A;  4LF5 O;  2HLD G;  3JAT B;  2HHH O;  2HVJ C;  2ITC C;  3FD9 A;  3QVN A;  1TAE A;  3OTO O;  3G4S V;  2X6C A;  4UVB A;  2R72 A;  1K33 A;  4F6E A;  4U7O A;  2EIL C;  4DR4 O;  2OIG A;  4MSW C;  4KXR A;  4MTO A;  1COW G;  3RYC B;  1XHZ A;  1WAZ A;  4WFG A;  1M56 C;  4MW3 A;  2XND G;  4JF3 A;  5IJ9 A;  3H1L H;  3QF7 A;  3K5L A;  4OPH A;  1TA8 A;  2Y4T A;  5IDJ A;  1UFI A;  4UCT A;  2HFE C;  4DV6 B;  4K8X A;  4NTW A;  3K57 A;  3AG2 C;  4DUY B;  4X20 A;  1GN2 A;  5B5E Z;  4OGQ B;  5B1B C;  3N2K A;  2OCH A;  1FFX A;  5ITZ B;  3RN4 A;  4Q20 A;  3ABM B;  3ZRV A;  1XMQ O;  1JQ0 A;  5K1P A;  1YVW A;  1GTO A;  1WJZ A;  1SF9 A;  3T4D A;  5AG2 A;  5H2F Z;  3HR0 A;  5JH7 A;  4K8Z A;  3B09 A;  3NXS A;  1TVK A;  3STL C;  4L87 A;  3CHX A;  2B1I A;  4MVZ A;  1FJG O;  4K3A A;  4LFB O;  2KQX A;  1OCZ B;  3W7X A;  3H1K H;  4E2L A;  4EFB A;  3AG1 B;  4WFE A;  3T1Y B;  1CPY A;  1RSO B;  5LXT B;  3ZED A;  1AJP A;  1VF7 A;  3BA8 A;  4D6T H;  2VQE O;  3AG4 B;  4TV8 B;  2IBZ H;  4P9P A;  5JCO A;  4FFK A;  3DXR B;  5JWP A;  1ORQ C;  2ZE6 A;  4JAS A;  4UCU A;  4WFH A;  3JAK A;  1OCC C;  2CTW A;  3RVY A;  3ZHU A;  1RM1 C;  3F5T A;  4Z2W A;  2QKA A;  3RYI A;  2XTA A;  4BIO A;  1F23 A;  5EIB D;  1S77 D;  5LMU O;  4PI2 A;  3M99 B;  1Q6H A;  1EZJ A;  4JI8 B;  3EXA A;  4LCU C;  1VIB A;  5LMN B;  1YI2 V;  3AG7 A;  4RAI A;  3WFV A;  4JI8 O;  3E83 A;  4L8J A;  2K9P A;  3THO A;  1Y76 A;  2B5U A;  1SQX H;  1K5Q A;  4O2B B;  1AVM A;  4ICG A;  5CA0 B;  2CTR A;  2JIZ G;  1VQ4 V;  4X1I B;  4NB5 A;  2QKS A;  3IFX A;  1YEW A;  2JEU A;  1Y74 A;  4FLT A;  5BMV B;  4I0X B;  1BHB A;  3BCC H;  2VQF B;  5EBM C;  1VAR A;  4GCZ A;  1TUB A;  3KZI Z;  1IBM B;  2JGU A;  2HKO A;  5KMG B;  2VQF O;  3SYO A;  3I5D A;  3CSX A;  1X59 A;  4DR7 B;  3FYE B;  3G6E V;  2PY5 A;  1GMG A;  1AI5 A;  4MTG A;  3SDL A;  4OX9 B;  3GB7 C;  3W7U A;  1S3J A;  2WLL B;  4TOI A;  3E22 B;  1BGY H;  1ZSP A;  5HFM A;  2LW1 A;  3K59 A;  1HNW B;  2Q67 A;  2YXH A;  3BPZ A;  4TWK A;  2BOC C;  4OX9 O;  2Q8V A;  3SGI A;  4F6R B;  3OM3 B;  1VQL V;  2H94 A;  3F5W C;  1D2D A;  3JSN A;  1WA8 A;  1YXB A;  1N0N A;  1VQ5 V;  4JAU A;  5LYJ B;  1Q43 A;  3IJ4 A;  3H1I H;  1BZK A;  3CRC A;  2MW2 B;  1HWY A;  1E1R G;  3ZS8 C;  2Y69 C;  2GTA A;  3WU2 Z;  4TV9 A;  2PZS A;  1IVS A;  1SZT A;  5J2T B;  4PDM A;  4PA7 A;  1FXK C;  1Z5W A;  1QVF U;  2VS0 A;  5LL6 Y;  5LHG A;  1RFY A;  3FFQ A;  1DLB A;  2ZR2 A;  2A06 H;  4MVQ A;  5A2Q N;  3CJH A;  1EN5 A;  4X1Y B;  4JYB A;  5BXZ A;  2DWD C;  2WLH A;  3K06 A;  2QM7 A;  4PEL A;  4YIP A;  4BAY A;  2UXD O;  1YTF D;  1DGS A;  4N21 A;  4CS2 A;  3OMN B;  1V55 C;  3JAL B;  1HNZ B;  2Q69 A;  3CEI A;  2WSS G;  4I7Z B;  3PN1 A;  3RYF A;  2DN9 A;  1DF4 A;  2ZKO A;  1AJN A;  3Q4H A;  4DK0 A;  4W4L A;  4I4T B;  4CH3 A;  3STZ C;  5GTH Z;  1QR8 A;  3B2E E;  1V9P A;  4LC1 A;  1HNX B;  3ZMU A;  4FFB B;  1IXB A;  3APQ A;  4NTX A;  1OV9 A;  1N8R W;  4FM0 A;  5EZY B;  1GN6 A;  1MAB G;  1AR1 B;  1ZWI C;  1HNX O;  4HBN A;  2JDI G;  3RYH B;  2EJR A;  4RUE A;  1WB7 A;  1J95 A;  1NTK H;  3JD1 A;  1F4M A;  2YXL A;  3X2Q C;  3ICX A;  3BEH A;  1TGO A;  1Q6I A;  2A3Q A;  4X62 B;  1GN4 A;  3ASN C;  4JI5 B;  2UU9 B;  2MK3 A;  5EIB C;  4LF7 B;  3CYO A;  4LFA O;  4JI2 B;  1FAF A;  3LUT B;  4X62 O;  4NXN O;  1JR9 A;  4QPJ A;  4ZI7 B;  5JVD A;  4HZ3 A;  2EZO A;  3FAV B;  1L1F A;  4FLZ A;  5J2U A;  4BIZ A;  4TSF G;  4R50 A;  4JI2 O;  1NI8 A;  3M8A A;  1EM1 A;  2PGG A;  1D5A A;  4I55 A;  4DV3 O;  4EFE A;  1BHA A;  2RJZ A;  2JEX A;  3QO8 A;  5CA3 A;  1VMG A;  5DN6 G;  1CEZ A;  1OCO C;  4TUY A;  4A5U B;  5LOV B;  3DC5 A;  3RFR A;  2LGW A;  1XL4 A;  3BAB A;  3BRC A;  1BQ0 A;  2IW5 A;  1VQ9 V;  5IYZ B;  2QKC A;  3JD4 A;  1N36 O;  3IC9 A;  1XIL A;  2DW4 A;  4DUZ O;  1ZL8 B;  3C3S A;  2AHZ A;  2IM9 A;  2AXT Z;  2E74 B;  1P84 F;  2EIJ B;  2EX3 A;  4X66 O;  1N0J A;  3CWB H;  2R70 A;  3ZRW A;  3EFF K;  1SQG A;  2UXB B;  4K35 A;  4IHJ B;  4LF9 B;  1XHX A;  1NS1 A;  3OEE G;  1I0H A;  3ASO C;  3HKB B;  3NR7 A;  1E1Q G;  3ETG A;  2IH3 C;  2UUC O;  2VWJ A;  2GUZ B;  4XDK A;  4LF9 O;  4B3R B;  1AR4 A;  4X1K A;  3ZHQ A;  4DV2 O;  2YDE A;  4X88 A;  1NU1 H;  2E5L B;  1MZF A;  4H0L B;  3L75 H;  3UT5 A;  1KC8 W;  1QLE B;  4B3R O;  4E4E A;  3OUF A;  4NVP A;  3HPL C;  5LA6 B;  4X9Q A;  1XI1 A;  2YC0 A;  3SJA C;  3P3P A;  1FXK A;  5JJE B;  4DV4 B;  2DYR C;  1R3L C;  4O4J B;  4DXW A;  2AZ0 A;  3A8T A;  4HNA A;  2OT5 A;  2Z0A A;  1Y67 A;  5BR8 O;  5IWA B;  1EBO A;  5IY5 C;  2EIN B;  3U0Z A;  2WLJ A;  3T1C A;  1UJW B;  3BY6 A;  4YJ2 B;  2FL4 A;  5IWA O;  4BIU A;  4JI0 O;  1N33 B;  4I50 A;  2W6I G;  4CS3 A;  3AG3 B;  1QU7 A;  5DM6 V;  5CB4 A;  1YJW V;  4ZOL A;  5JJJ B;  3C90 A;  3CD6 V;  2E3C A;  1N32 B;  4QJF B;  2CGO A;  3CXH F;  4JAV A;  3OT7 A;  1M93 A;  2XAG A;  3JD3 A;  4D7T A;  2QDO A;  1WP8 A;  1QNM A;  1N32 O;  1B06 A;  1W59 A;  5IJ9 B;  3EVK A;  1BT8 A;  4X64 O;  1ZX3 A;  4J42 A;  3SYC A;  5B1N A;  1SA0 A;  1VQK V;  4PD4 F;  4JYC A;  1IUR A;  2NR5 A;  1Q8I A;  1VEW A;  2Z3Y A;  5BZB A;  4X20 B;  4LF4 B;  1S0V A;  2XUM A;  4MTF A;  1YJN V;  3N2K B;  4GKK B;  2QWQ B;  3QO7 A;  2ZQM A;  5D5Q A;  4DR3 B;  1FFX B;  4AHC A;  2IJK A;  2WA4 A;  1U97 A;  4B3M O;  3DGE A;  4LF4 O;  1RPR A;  2H8P C;  5LA6 A;  5JH7 B;  4DR3 O;  2KB1 A;  1TVK B;  2JVD A;  3LDD A;  3CE2 A;  4LP8 A;  1Y66 A;  2Q9L A;  4DR1 O;  2ZM6 B;  4NXM B;  3E35 A;  4KUM A;  3A2F A;  2H3O A;  2WLN A;  2P4K A;  3I55 V;  4LFC B;  3DTU B;  4X65 B;  3K5M A;  2ZM6 O;  1VQ7 V;  3TET A;  2WA3 A;  4Z1V A;  1WP7 A;  3W7S A;  1YTF B;  1IX9 A;  3JAK B;  2BTO A;  4UCV A;  3UM7 A;  4KP4 A;  4IT5 A;  4JV5 B;  2W0F C;  1NTM H;  3RYI B;  2HP8 A;  2LGQ A;  5IYD O;  3ABL B;  2DMX A;  1T5E A;  2QEX V;  4B7K A;  4FLY A;  2ZT9 B;  3CP1 A;  1GM7 A;  1PPJ H;  3CCE V;  4O2A A;  3VQX A;  4JV5 O;  1R3K C;  2W0X A;  2ETN A;  3F7V C;  2P7T C;  3JSL A;  4UFZ A;  4BW5 A;  2QA4 V;  2ZR3 A;  2OIE A;  3RBZ A;  2PYL A;  4JI4 B;  2A79 B;  1Y76 B;  1DK1 A;  2ZNI A;  2OYQ A;  4I9Q A;  2CH7 A;  3JCZ A;  2CTQ A;  1Y74 B;  3K0G A;  2O57 A;  4DV5 B;  1HDJ A;  5B3S C;  4GYC B;  1O9H A;  3LDE A;  4WF9 V;  4JYA B;  1R3J C;  4TT3 G;  1TUB B;  4W4K A;  2CK3 G;  4FMT A;  1KU9 A;  2ILM A;  3J80 N;  2ZIM A;  4DV6 O;  2E75 B;  1H2G A;  4DUY O;  5IYC O;  4JYA O;  3MDS A;  1Z2G A;  1K4C C;  2HR3 A;  1GAX A;  1M57 C;  3ABT A;  1Q81 W;  1B3Q A;  4UVA A;  4YHH B;  1F7Y A;  2F95 B;  5FNV A;  4Z1M G;  2PYJ A;  3K03 A;  3UCS C;  3CCU V;  4PI0 A;  4G28 B;  2QM8 A;  1XRE A;  4YHH O;  1WA8 B;  1KBH A;  2QWN B;  2OWO A;  3FX7 A;  3T1Y O;  1THZ A;  2VRZ A;  2ZE8 A;  3E86 A;  4O4I A;  5CA1 A;  1VQ6 V;  4MTX A;  3CCL V;  4TV9 B;  2EIK C;  5KHJ A;  1VF5 B;  3ZN0 A;  1P4R A;  3W7W A;  4ZHQ A;  1M1K W;  1VQM V;  3L73 H;  4DYL A;  1I94 B;  2ZIN A;  3CS5 A;  3N2G A;  2F66 C;  1GO3 F;  5LGN A;  1GKF A;  2EIL B;  1SQF A;  5KAF Z;  2LFR A;  3WG7 C;  4EKW A;  3CCJ V;  5IE9 A;  1KYO F;  1M56 B;  4PJ0 Z;  3HKD A;  3CJH B;  3OMI B;  1I94 O;  2Q0O C;  1GRJ A;  2FTK A;  1FYJ A;  5LMN O;  2P6J A;  4UB6 Z;  1XMO B;  4GX2 A;  5F2V O;  3MD0 A;  1BS3 A;  1NVP B;  1WPB A;  1SQV H;  4ZIB A;  3AG2 B;  3L9D A;  1RP3 B;  2XAS A;  1IBK B;  4MVU A;  2M6Y A;  5B1B B;  4QPK A;  2YSU B;  2FB5 A;  1YJ9 V;  3RYF B;  1ZLZ A;  5JJN B;  1M90 W;  1VF6 C;  3ZHS A;  3Q4H B;  1JFF A;  2RQ6 A;  2DOS A;  1AB3 A;  1IBM O;  2Q7H A;  3SJB C;  1PNL A;  2L35 A;  4JTA B;  4UV9 A;  5KA5 A;  3K04 A;  3ABK C;  4DR7 O;  2ZDI C;  2VWK A;  3CC7 V;  4JI6 B;  4JGS A;  1J5E B;  3IAY A;  3B77 A;  2AW9 A;  1DTO A;  1JJ2 U;  5E1A C;  1JA8 A;  2P4V A;  1HNW O;  2OCC C;  3ETD A;  1BQZ A;  3SYP A;  5B1A C;  2XAH A;  1J5E O;  1KP3 A;  1PD3 A;  5CBG A;  1V54 C;  3RT3 C;  1OCC B;  2GV9 A;  1AR5 A;  5JQG A;  1RM1 B;  4PDR A;  1HW7 A;  1XNQ B;  1IBL B;  3QG5 A;  1ENV A;  4RQE A;  5JVD B;  5LHI A;  5J2U B;  1P49 A;  4GX0 A;  4FK5 C;  2EUL A;  2V1D A;  4I55 B;  3HKE A;  5GW7 A;  5C8Y B;  2IH1 C;  3SPC A;  4DR6 B;  2CGN A;  3W7T A;  3CX5 F;  2QTS A;  1B04 A;  5EYP A;  1Q90 D;  3RVZ A;  4TUY B;  1NR1 A;  2LJ2 A;  1YIT V;  4DR6 O;  4WBN A;  4I5S A;  3RGB A;  1P7B A;  3E8F A;  4U7N A;  1FXV A;  4QIW F;  5KHH A;  2WPD G;  1PNM A;  2N74 A;  4U3J A;  4JI1 B;  1I5X A;  1H2L A;  4J7K A;  1XDC A;  1HNZ O;  3ZRW B;  1KQS U;  3M7M X;  1OZ0 A;  1R73 A;  4R7C A;  3L74 H;  2ATK C;  4KHP B;  4JI1 O;  1G4Y B;  1QHT A;  1G1X B;  2QTO A;  4UCO A;  2F23 A;  2DYS C;  2RCV A;  1GH6 A;  1AI6 A;  1IZ3 A;  4KFM A;  4BR6 A;  4GLX A;  1OHH G;  2EIM C;  4FZ0 A;  4X1K B;  5C93 A;  3U10 A;  2M7W A;  2BSK A;  4CC5 A;  4G27 B;  1ZTE A;  3UT5 B;  5IYB O;  2Y69 B;  1AI4 A;  5EK0 A;  2NLJ C;  1B6Q A;  1M9N A;  1H2M A;  1JPX A;  2KG7 A;  5DEC A;  1XBL A;  3IGA C;  1O9G A;  1K73 W;  1FXK B;  3ZJZ A;  1URF A;  2P22 C;  4JI5 O;  2UU9 O;  3VOU A;  5IT9 N;  4HNA B;  3MHS C;  4H13 B;  4LF7 O;  5FL7 G;  3E89 A;  3KKY A;  3B8N A;  4JAA A;  4FPP A;  5C8Y A;  2Y4U A;  4WFF A;  5KHK A;  2YI8 A;  2YID A;  2X6B A;  3T4Z A;  2LP7 A;  3UO3 A;  2QWP B;  2DJV A;  4I50 B;  3OGC C;  2ZE5 A;  2XT9 A;  4LWS A;  1R1B A;  4FM2 A;  3K08 A;  2XAF A;  1K8A W;  5CB4 B;  5KA6 A;  4J80 A;  4NR1 A;  4DR5 B;  1V55 B;  1DF5 A;  5LP6 C;  1BSM A;  4ZOL B;  4PA9 A;  1VF6 A;  2PUS A;  5KAI Z;  5KHG A;  3MHH C;  4O4L A;  4IGG A;  1VP7 A;  1JOY A;  4J11 A;  4B08 A;  2UUB B;  4MVO A;  4FVM A;  3GWK C;  2JJ1 G;  1OCR C;  1MZE A;  5L3F A;  4H44 B;  3C3T A;  2YEV A;  2ZDI A;  2CUG A;  4UXN A;  3B8M A;  2UUB O;  4DW1 A;  2UXX A;  3CRA A;  3K5N A;  2DE0 X;  5D5P A;  1NTZ H;  4UCR A;  2UXB O;  2YIB A;  1SA0 B;  4JZG A;  2BE3 A;  2K1E A;  4FLU A;  3X2Q B;  1YCI A;  4JTC B;  4OXS A;  1Y6X A;  2P06 A;  3BHP A;  1K5S A;  5L3E A;  3ASN B;  5IJ0 A;  2Y0P A;  3KG2 A;  2Q0A A;  2E76 B;  1NT2 B;  3H1J H;  3G6B A;  2E5L O;  1VQP V;  5EC2 C;  4XBF A;  3CMA V;  1FXH A;  4JPR A;  3A0B Z;  1K3E A;  3VQY A;  4R8C A;  4CC6 A;  4FLW A;  4IYH A;  5A9G A;  2Q7E A;  4DV4 O;  2QWO B;  4UB8 Z;  4ZBM A;  4DR2 B;  5CMU A;  1H8H G;  3LSS A;  1L0N H;  2NNU A;  2B1G A;  2Z5U A;  2GHY A;  4J41 A;  2D3O W;  3CCR V;  5FLX N;  1OCO B;  4CZZ A;  1PNK A;  3WB2 A;  1Q6U A;  2ZXW C;  2CE4 A;  3FKS G;  1W2B U;  1IDS A;  2UXN A;  2XAQ A;  1N33 O;  4I9W A;  1XQ8 A;  1SKV A;  1Q3E A;  2L6L A;  4O2A B;  4B3S B;  5KX5 A;  1VQO V;  1KB9 F;  3HB3 B;  1K34 A;  2IJH A;  3ZX6 A;  4J10 A;  3SJC C;  4JI3 B;  1LUV A;  1MNG A;  5H6R A;  1H2S B;  3ASO B;  1MOF A;  4PV1 B;  1CP9 A;  3HKC A;  3J81 N;  5FPR A;  2CH7 B;  2WLI A;  3PJS K;  2XOK G;  2JGD B;  1FS0 G;  3G80 A;  2A7W A;  3TGU H;  4WCE V;  3OD4 A;  1Q86 W;  3CRQ A;  3OE7 G;  2CDY A;  4MW8 A;  5KHI A;  1EZV H;  5KUK A;  1QR9 A;  1UPG A;  4WFB V;  4DW0 A;  5EBL C;  3RW0 A;  4PDV A;  5LBQ A;  1XNR B;  3E8B A;  2JJ2 G;  3LNM B;  4GKK O;  2AGA A;  3OUS A;  2F4V B;  4LH7 A;  2DYR B;  2QM4 A;  1YSC A;  3BFR A;  1XNR O;  1I08 A;  3CC2 V;  2P67 A;  3ZCC A;  4CS4 A;  2F4V O;  5FNV B;  3ABM C;  4ABM A;  3BAA A;  5CBH A;  2V7Q G;  2LO1 A;  5IY5 B;  4GT1 A;  1PKX A;  3K0D A;  3TJT A;  2EBO A;  4GKJ B;  1K9M W;  1M5I A;  4LF6 B;  2W6J G;  4MVS A;  1F51 A;  2YIB D;  1LNQ A;  4NXM O;  3K3W A;  1YZB A;  4YJ3 A;  3UKM A;  5CA1 B;  1W0K G;  2ITD C;  2ZIO A;  4O4I B;  3SYA A;  2Q5Z A;  4DV0 B;  1MMM A;  1SZX A;  4LF6 O;  4GKJ O;  4IIJ A;  1OCZ C;  3O9O A;  2JK5 C;  4LFC O;  2HJF C;  4B3T B;  2IU0 A;  4X65 O;  5LP6 A;  3AG1 C;  4ZHQ B;  3E2E A;  3P32 A;  3JD2 A;  2CAZ C;  3AG4 C;  3G67 A;  1NJI W;  2F93 B;  3VQW A;  3D36 C;  1H2K A;  2UXC B;  3N2G B;  5CN0 A;  1A32 A;  3FB5 C;  2X6A A;  4JI7 B;  4LF5 B;  2EZP A;  2WAM A;  2HHH B;  1JCH A;  4LBE C;  5L3G A;  2PI5 A;  3HKD B;  1FD9 A;  2DWE C;  4UVC A;  5DED A;  2BCC H;  2QSA A;  3P3N A;  1FFT B;  2C2A A;  2KKW A;  1US6 A;  3A0H Z;  3D3Q A;  4PDL A;  4U3F H;  2F1M A;  2YIA A;  1SQP H;  2JGD A;  4RQF A;  4JI4 O;  4OPA A;  3JAW A;  4GZR B;  1S5L Z;  2F43 G;  3ZRS A;  4DV5 O;  4HYO A;  1JFF B;  3T1H B;  3SPJ A;  4BWA A;  3SPI A;  5LGT A;  1XMQ B;  1NH2 D;  2LQT A;  1MSD A;  3EHB B;  2WLM A;  4GX5 A;  4EB6 A;  4X8A A;  3TXS A;  3LNN A;  3T1H O;  3GWO A;  3I56 V;  3AK3 A;  4O4H A;  3H1H H;  5GON A;  1AP6 A;  4IYI A;  4AI8 A;  1S72 V;  1FJG B;  3JAM N;  2CTP A;  4LFB B;  3JD0 A;  2FYU H;  3JAS A;  1QBZ A;  3L72 H;  3LDC A;  1Q82 W;  1KKD A;  4FZ1 A;  2X0L A;  1TUE B;  4N23 A;  2VQE B;  3JAR A;  1GN3 A;  3S3W A;  1S76 D;  2R9A A;  5JQG B;  5B66 Z;  3D8C A;  4EEQ A;  3S3X A;  3B40 A;  2Q73 A;  3JYC A;  1PL0 A;  3AEI A;  3KCY A;  2JRI A;  3ZRX A;  4CH6 A;  3K79 A;  1FKA O;  2BTQ A;  4CBC A;  3K5O A;  4J7Z A;  1EN6 A;  5LMU B;  3OR7 C;  2GTS A;  3O65 A;  1QLN A;  4CH4 A;  3CCM V;  3FB8 C;  3HKE B;  3QO5 A;  3JAT A;  1AP5 A;  1L0L H;  5EYP B;  3SR2 C;  4QGP A;  4GX1 A;  3R66 A;  2R9R B;  3SYQ A;  2XHB A;  3TK1 A;  3DC6 A;  1H38 A;  4WBN B;  5B3S B;  1VQ8 V;  3RYC A;  1G6U A;  3CME V;  1NQT A;  1MSW D;  1XMO O;  2ZD9 A;  4RWU A;  1N4C A;  1I7F A;  1JVM A;  2YS8 A;  4TQF A;  4U3J B;  1IBK O;  2YUA A;  3OEH G;  2EJ7 A;  3ETE A;  5HFL A;  4CH5 A;  3FB7 C;  1IXM A;  4Q6G A;  3H01 A;  1M57 B;  3WB1 A;  3ETQ A;  3ZIA G;  3K9A A;  3AK2 A;  2QGN A;  3WB0 A; 
#chains in the Genus database with same CATH homology
 1JPX A;  4MTO A;  1COW G;  3IGA C;  4BIU A;  4WFG A;  1M56 C;  2XAJ A;  4MW3 A;  2W6I G;  3AG3 B;  1K73 W;  1FXK B;  2XND G;  3ZJZ A;  4JF3 A;  5DM6 V;  3VOU A;  1ARO P;  4WFA V;  1JX9 A;  1YJW V;  3MHS C;  4QE7 A;  3G71 V;  5FL7 G;  3E89 A;  3OFN G;  2HG5 C;  5IDJ A;  3B8N A;  2P90 A;  3CD6 V;  1S5H C;  2HFE C;  2OTL V;  4FPP A;  4QJF B;  3AG2 C;  2EIK B;  4JAV A;  4WFF A;  1XL6 A;  2XAG A;  3CXC U;  3JD3 A;  2X6B A;  5B1B C;  3T4Z A;  4UV8 A;  2LP7 A;  3SJQ C;  4Q20 A;  3ABM B;  3ZRV A;  3OGC C;  3D36 A;  1JQ0 A;  1GTO A;  3K08 A;  2XAF A;  1K8A W;  5KA6 A;  3T4D A;  1V55 B;  1DF5 A;  3WG7 B;  1QVG U;  3NXS A;  3STL C;  4L87 A;  1SER A;  2B1I A;  4F4L A;  4PA9 A;  3SYC A;  5B1N A;  1VQK V;  4JYC A;  4MVZ A;  3MHH C;  3SPH A;  3QNE A;  2Z3Y A;  1RPO A;  1JOY A;  5BZB A;  1OCZ B;  4MVO A;  3W7X A;  4E2L A;  1S0V A;  3AG1 B;  4WFE A;  4MTF A;  1YJN V;  2JJ1 G;  1OCR C;  3QO7 A;  1CPY A;  5L3F A;  2ZQM A;  1AJP A;  5H6Q A;  2Q68 A;  3AG4 B;  4P9P A;  2IJK A;  2YEV A;  2ZDI A;  4UXN A;  3B8M A;  3DGE A;  4FIP C;  1RPR A;  2UXX A;  1ORQ C;  2H8P C;  1Q7Y W;  4JAS A;  4WFH A;  2KB1 A;  1OCC C;  3RVY A;  3LDD A;  4LP8 A;  1RM1 C;  2IJI A;  1Y4M A;  1F23 A;  2K1E A;  1Y66 A;  4J9Z B;  3X2Q B;  4G2K A;  1S77 D;  3E35 A;  3M99 B;  4JTC B;  4KUM A;  4OXS A;  1EZJ A;  4YXW G;  1GK9 A;  4PA6 A;  1QCE A;  4ZKI A;  1K5S A;  5L3E A;  3ASN B;  2WLN A;  4LCU C;  3I55 V;  3KG2 A;  1R3I C;  3ABK B;  2YEV B;  3DTU B;  3CC4 V;  1VQ7 V;  1YI2 V;  3TET A;  4RAI A;  1VQP V;  3WFV A;  3W7S A;  1GM9 A;  5EC2 C;  4XBF A;  1YTF B;  4X89 A;  3CMA V;  3E83 A;  1FXH A;  3A0R A;  4JPR A;  4HAM A;  2EIJ C;  3UM7 A;  1K3E A;  4R6Z A;  2B5U A;  4KP4 A;  1K5Q A;  2W0F C;  3CCS V;  2OCC B;  2DQ3 A;  5B1A B;  4R8C A;  2JIZ G;  1VQ4 V;  5IYD O;  3ABL B;  2QKS A;  3IFX A;  5L3D A;  5L3B A;  2WLL A;  2JEU A;  2QEX V;  1V54 B;  3CP1 A;  1GM7 A;  3CCE V;  1BHB A;  4XDL A;  4ZBM A;  1R3K C;  1MG1 A;  1BL8 A;  5EBM C;  5CMU A;  1H8H G;  3LSS A;  4MS2 A;  3ZMT A;  2NNU A;  2B1G A;  2Z5U A;  4GCZ A;  3TCU A;  2GHY A;  3VBB A;  2D3O W;  3CCR V;  3F7V C;  2P7T C;  1OCO B;  4CZZ A;  1PNK A;  4RUF A;  2ZXW C;  2HKO A;  3CCV V;  4BW5 A;  2QA4 V;  3SYO A;  2ZR3 A;  1H8E G;  1G8M A;  3RBZ A;  2A79 B;  3FKS G;  3FYE B;  3G6E V;  1W2B U;  1GMG A;  4PA3 A;  1AI5 A;  1SET A;  4MTG A;  2UXN A;  3JCZ A;  2XAQ A;  3GB7 C;  3W7U A;  1S3J A;  2WLL B;  4I9W A;  3K0G A;  1QLE C;  5HFM A;  2Q67 A;  1AJQ A;  5B3S C;  4WF9 V;  3LDE A;  3ABU A;  1VQO V;  1R3J C;  4TWK A;  2BOC C;  3HB3 B;  1K34 A;  4TT3 G;  3OW2 U;  2CK3 G;  2IJH A;  4FMT A;  3LSQ A;  3OM3 B;  1H2G A;  1VQL V;  2H94 A;  3F5W C;  5IYC O;  1R6K A;  1VQ5 V;  1GM8 A;  4JAU A;  5H6R A;  3OR6 C;  3ASO B;  1K4C C;  2HR3 A;  1MOF A;  1CP9 A;  1HWY A;  2AHY A;  1E1R G;  1M57 C;  2WLI A;  3PJS K;  2XOK G;  2Y69 C;  5H9C A;  1FS0 G;  2EIN C;  4WCE V;  1Q86 W;  1YIJ V;  3ABT A;  1K7D A;  3OE7 G;  1Q81 W;  1SZT A;  4UVA A;  1R6N A;  4MW8 A;  5KUK A;  1NH2 B;  4Z1M G;  1QR9 A;  1SES A;  4PDM A;  3AG3 C;  3K03 A;  4PA7 A;  1FXK C;  5EBL C;  4WFB V;  3F7Y C;  1QVF U;  3E8G A;  3RW0 A;  3CCU V;  5LHG A;  4PDV A;  4MT8 A;  4G28 B;  2IU3 A;  2QM8 A;  5LBQ A;  2DYS B;  2GSM B;  5B1O A;  3E8B A;  2JJ2 G;  1DLB A;  2ZR2 A;  4MVQ A;  3LNM B;  1THZ A;  3OUS A;  2R9I A;  3OAA G;  4JYB A;  3CCQ V;  2WLI B;  1VQ6 V;  3E86 A;  2DYR B;  2DWD C;  2WLH A;  4MTX A;  1YSC A;  3CCL V;  2WWW A;  2EIM B;  2EIK C;  3K06 A;  2QM7 A;  3ZN0 A;  1P4R A;  3W7W A;  4PEL A;  4BAY A;  3CC2 V;  1SRY A;  2P67 A;  3ZCC A;  1M1K W;  1VQM V;  3ABM C;  3FYI B;  5CBH A;  1K92 A;  2V7Q G;  2PI4 A;  5IY5 B;  4GT1 A;  4RO2 A;  1PKX A;  1YTF D;  2HVK C;  3K0D A;  1GO3 F;  2EBO A;  5LGN A;  1GKF A;  4N21 A;  2EIL B;  1K9M W;  3OMN B;  2W6J G;  4MVS A;  5CBF A;  1V55 C;  5EC1 C;  2LFR A;  1F51 A;  3WG7 C;  4EKW A;  1LNQ A;  2Q69 A;  4H37 A;  3K3W A;  3CCJ V;  2WSS G;  1M56 B;  1DF4 A;  3D3I A;  3OMI B;  1AJN A;  4P30 A;  3UKM A;  1W0K G;  2ITD C;  3SYA A;  3P30 A;  1NVP D;  1OCZ C;  2FTK A;  2JK5 C;  3STZ C;  2HJF C;  3IC7 A;  1QR8 A;  2IU0 A;  4LC1 A;  3ZMU A;  2WLK A;  3AG1 C;  2P6J A;  1EFR G;  1BMF G;  4GX2 A;  3P32 A;  3E2E A;  3MD0 A;  3FB6 C;  3JD2 A;  1K4D C;  3AG4 C;  1NJI W;  1N8R W;  1NVP B;  3AG2 B;  1MAB G;  5CN0 A;  2XAS A;  1AR1 B;  1ZWI C;  3FB5 C;  2X6A A;  4MVU A;  5J9P C;  2JDI G;  5B1B B;  2EJR A;  2EZP A;  2DQ0 A;  2WAM A;  4QPK A;  1JCH A;  2YSU B;  4LBE C;  5L3G A;  1YJ9 V;  2PI5 A;  2LFS A;  4RUE A;  1M90 W;  1J95 A;  3JD1 A;  2DWE C;  1F4M A;  4P2Z A;  4UVC A;  5LGU A;  3X2Q C;  3BEH A;  1FFT B;  4UUJ C;  2C2A A;  1AI7 A;  1E79 G;  4PDL A;  3ASN C;  4RQF A;  2MK3 A;  1PNL A;  3E8H A;  4JTA B;  4UV9 A;  5KA5 A;  3K04 A;  3ABK C;  2ZDI C;  2IJJ A;  3CC7 V;  3CYO A;  4JGS A;  3LUT B;  3T2M A;  1NR7 A;  1OCR B;  1K97 A;  3B77 A;  4QPJ A;  3ZN1 A;  2BOB C;  2F43 G;  1DTO A;  1JJ2 U;  4HZ3 A;  1B6Q A;  3ZRS A;  2EZO A;  5E1A C;  4HYO A;  1L1F A;  2OCC C;  3ETD A;  4JTD B;  4BIZ A;  3SYP A;  5B1A C;  2XAH A;  4TSF G;  4R50 A;  3ABL C;  1KP3 A;  1W0J G;  1PD3 A;  4MVR A;  4H33 A;  3SPJ A;  1V54 C;  5CBG A;  1OCC B;  3SPI A;  1BHA A;  5EBW C;  5LGT A;  1NH2 D;  5LHH A;  1RM1 B;  3EHB B;  4PDR A;  2WLM A;  4GX5 A;  4ASU G;  4X8A A;  2JEX A;  2Y48 A;  4FJC C;  3QO8 A;  5CA3 A;  3GWO A;  5DN6 G;  3I56 V;  1OCO C;  1CEZ A;  1ENV A;  4RQE A;  3ZMV A;  1VQN V;  1NKD A;  1XL4 A;  4QE9 A;  2IW5 A;  1S72 V;  5LHI A;  3R65 A;  1VQ9 V;  3JD0 A;  3JD4 A;  1YHQ V;  3LDC A;  1QBZ A;  4GX0 A;  2X7R B;  1Q82 W;  1KKD A;  2X0L A;  4FK5 C;  2DW4 A;  1TUE B;  2V1D A;  2AHZ A;  4N23 A;  5GW7 A;  2EIJ B;  1S76 D;  2IH1 C;  3SPC A;  3W7T A;  3JYC A;  1PL0 A;  1KP2 A;  3OMA B;  3ZRW A;  3EFF K;  3AEI A;  5L3C A;  3RVZ A;  3ZRX A;  4QNH B;  3K79 A;  1NR1 A;  1YIT V;  4CBC A;  3SPG A;  4I5S A;  1P7B A;  3OEE G;  3ASO C;  3E8F A;  4U7N A;  1FXV A;  3OR7 C;  1E1Q G;  3ETG A;  2IH3 C;  1ROP A;  2ZXW B;  4MVM A;  1QLN A;  3CCM V;  1NBM G;  4QIW F;  3FB8 C;  2WPD G;  4XDK A;  1PNM A;  1I5X A;  4X88 A;  3QO5 A;  2A9H A;  1WPX A;  4XDJ A;  3ZMZ A;  3ZRW B;  1KQS U;  1F4N A;  1KC8 W;  2A0L A;  2OTJ V;  1OZ0 A;  1QLE B;  1R73 A;  4GX1 A;  1I5Y A;  4R7C A;  1WLE A;  2ATK C;  2R9R B;  2Q6A A;  1G4Y B;  3SYQ A;  3TK1 A;  2QTO A;  1H38 A;  3CPW U;  5B3S B;  5KUM A;  3OUF A;  2DYS C;  1VQ8 V;  3HPL C;  1KEC A;  4J9Y B;  3CME V;  1KD1 W;  1NQT A;  1MSW D;  4DO2 A;  1FXK A;  2QE7 G;  2ZD9 A;  1AI6 A;  4KFM A;  2DYR C;  1JVM A;  3ML0 A;  1OHH G;  1R3L C;  2EIM C;  4DXW A;  2OT5 A;  5C93 A;  3ZMS A;  3OEH G;  4P9O A;  5HFL A;  3ETE A;  4PA4 A;  2M7W A;  2HLD G;  3FB7 C;  1IXM A;  2HVJ C;  2ITC C;  3G4S V;  3H01 A;  1M57 B;  1EBO A;  2X6C A;  4G27 B;  4UVB A;  5IYB O;  2Y69 B;  5IY5 C;  1AI4 A;  1K33 A;  5EK0 A;  3ZIA G;  2EIN B;  4U7O A;  2EIL C;  2WLJ A;  3K9A A;  2NLJ C;  3BY6 A;  3T1C A;  1UJW B;  1M9N A;  4MSW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...