4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
2OCCC 4PA6A 4P2ZA 4H37A 2DYRC 4R50A 5EC2C 4F4LA 2WLMA 4PA3A 3SPJA 3F5WC 4MVUA 4LBEC 2P7TC 5EBMC 4XDLA 2ITDC 4LP8A 3ABKC 3ABLC 1K4CC 4HYOA 3T2MA 1XL4A 3BEHA 5EK0A 2BOCC 1J95A 2WLHA 4MS2A 4PDMA 4XDJA 4EKWA 2X6AA 5KUKA 2HFEC 4MVRA 3STLC 1ORQC 1R3JC 3UKMA 4JTCB 4MVOA 4J9YB 2EILC 2H8PC 2BOBC 4QE7A 4LCUC 4RUFA 4WFFA 3STZC 3RBZA 2WLLA 3OUFA 3RVYA 4PDRA 3WG7C 1K4DC 2WLNA 4OXSA 1S5HC 4GX0A 3SYOA 4MVQA 3T1CA 3SYPA 1P7BA 2NLJC 3AG4C 3AG1C 3E83A 2WLIA 4ZBMA 3K03A 4DXWA 4QNHB 1JVMA 3X2QC 3HPLC 2Q68A 2AHZA 3K06A 4JTDB 1OCZC 1OCOC 4PA7A 3SYCA 2AHYA 3PJSK 1ZWIC 5CBFA 1XL6A 3FB6C 1M56C 3LDDA 5EBLC 4G27B 4PA9A 3R65A 1KKDA 2HVKC 2QKSA 4RO2A 3TETA 3GB7C 3ZRSA 2ZXWC 3SPHA 2YEVA 3EFFK 5IY5C 4MTFA 5KUMA 2KB1A 3OR6C 2JK5C 4H33A 1G4YB 2DWEC 5E1AC 1R3KC 2HVJC 2X6BA 2Q6AA 3LNMB 4KFMA 5B1BC 5B3SC 2IH1C 4P9OA 4WFGA 5CBGA 3AG3C 3K04A 2ZD9A 3FB7C 3VOUA 3SJQC 5BZBA 3SPCA 4UUJC 3JYCA 2A0LA 3ASNC 4X88A 2A79B 2ATKC 2Q69A 2EIMC 2DYSC 2EIKC 5EBWC 3OUSA 3SYAA 3UM7A 2QTOA 3LUTB 3LDCA 3ASOC 4R8CA 4X89A 4PDVA 1R3LC 1LNQA 4QE9A 3T4ZA 5EC1C 4GX2A 3SPGA 4XDKA 2HG5C 3E8HA 2Y69C 3E8GA 3FB8C 1V54C 2R9RB 4WFHA 4JTAB 4X8AA 3E86A 2X6CA 3T4DA 4HZ3A 4PA4A 5CBHA 1V55C 3FB5C 3IGAC 4P30A 1OCCC 4I9WA 4WFEA 5B1AC 3RW0A 3ZJZA 2WLIB 4MVZA 4BW5A 2EIJC 1BL8A 2W0FC 5J9PC 3RVZA 3K0GA 3K0DA 1QLEC 3E8BA 4R6ZA 4R7CA 2WLLB 3AG2C 2Q67A 4MVMA 3OGCC 2IH3C 4MSWC 2WLJA 3F7VC 2A9HA 2EINC 3ABMC 4MW8A 4MVSA 4GX5A 4RAIA 3F7YC 4J9ZB 3E89A 1M57C 4MTOA 3LDEA 3OR7C 3KG2A 4MW3A 4MTGA 4PDLA 3K08A 3SYQA 3IFXA 2DWDC 2K1EA 4CBCA 2HJFC 4RUEA 4TWKA 3SPIA 3E8FA 4GX1A 4P9PA 2WLKA 1R3IC 1OCRC 3TCUA 4G28B 2ITCC
chains in the Genus database with same CATH superfamily
3SR2C 2BSKB 4P2ZA 2PI5A 1S3JA 4J7KA 4NYKA 3CEIA 1VQMV 3F5WC 1EBOA 2JEXA 3CRRA 4FFKA 4GKJO 2HHHO 2OWOA 1CEZA 2MK3A 2ZE8A 3D3IA 4DV1B 3STLC 4MVRA 3KCYA 3WB1A 4X1YB 3UQ8A 2XUMA 2ILMA 2QTSA 3K5OA 1NTZH 2ZIOA 3AG4C 3JARB 3FAVA 4QNHB 3VQVA 1AJQA 2YIAA 3P30A 4PA7A 1K5SA 1N33B 3H1KH 1TA8A 1XMQO 3R65A 4CC6A 1JR9A 2LW7A 2UUCB 4LFBO 3QNEA 4ZHQB 3OTOO 4I0XA 4WFGA 2HJDA 3AG3C 4B3RB 5JH7B 3WB2A 1BCCH 3UO3A 3W7WA 1PNKA 5FLXN 3LDCA 5J2TA 3OFNG 1XBLA 2YXLA 5B66Z 4GX2A 4YJ2B 2F4VB 2R9RB 4TOIA 4WCEV 1GN6A 4GCZA 1RM1C 1E1RG 4P30A 2QKCA 4DV6O 4X62B 1GN3A 3MHSC 4ICGA 4LR3A 2JJ2G 1J5EO 2W6IG 1US6A 4PELA 1I94B 2V7QG 2UXNA 3F5TA 3K08A 5H2FZ 2A06H 2Y48A 3K5MA 3TXSA 1FXKB 2ODMA 1G8MA 4K0KB 1AB3A 3L70H 1GAXA 1XOUA 2XOKG 5K1XA 4MVUA 1BQ0A 2D3OW 1S0VA 3OD4A 3OMIB 1ROPA 2X6AA 2AGAA 2HFEC 3ZHVA 1SC5B 2Z0AA 1OCZB 2EJRA 3JAKA 3CP1A 1F7YA 4Z2WA 4JZ2A 1TAEA 4EB6A 2EINB 3E83A 3RYHA 1ZL8B 4JGSA 4NTYA 1MNGA 2UUBB 3G71V 3EFFK 1H2SB 3ETEA 3DC6A 4KFMA 2Y69B 4NTWA 1JMKC 4JYBA 1BS3A 4YJ3A 3QO5A 2UUCO 4DV0O 4LFBB 4DO2A 3C3SA 2Q69A 5H5NA 4UXNA 4TV8B 4B3TO 2YXYA 1R3LC 1LNQA 5KX5A 4JI5O 4YJ2A 1H2GA 5LGUA 4FLXA 2X0LA 1GRJA 3RYIA 4BIZA 2YIBA 2QEXV 4X65B 1V55C 2G38A 4UFZA 1FFTB 1BL8A 4NXNB 5J9PC 4DR6B 3ZMSA 5JQGB 5BR8O 3CD6V 4KP4A 3L74H 1M9NA 2P5OA 2JIZG 3O9OA 2WLJA 3ABLB 3ABMC 1K5QA 2E76B 5B1BB 3E89A 2ZM6O 2B1GA 3KG2A 3A0BZ 1Y4MA 4JYCA 5B1OA 2QSAA 3JD2A 2WLKA 1OCRB 4PA6A 1W2BU 1KU9A 3T1HO 5KAFZ 3SGIA 1BZKA 1FD9A 3N2KB 4X65O 3WU2Z 2EIKB 3BA9A 4GT1A 4LNUB 5LBQA 1VQ6V 1ENVA 4LCUC 1WPBA 3G6EV 4OXSA 4PI0A 3K79A 2V1DA 1V54B 2WLIA 3LSSA 1VQKV 1L0NH 2H94A 4UCTA 5LHGA 4CH6A 3CE2A 3SYCA 1GN2A 1KMIZ 4DK0A 3PN1A 3RYHB 2HVKC 1H8HG 5IYZA 3APQA 4B3SB 4KHPB 1WPXA 4OPAA 5BMVB 2X6BA 3CJHB 3IC7A 4OPHA 5JCOA 2ZXWB 1XI1A 3SPCA 4G2KA 4YJ3B 3CCVV 2F4VO 5LXTA 3T4ZA 1YZBA 1H2NA 3C3TA 1NR1A 2UXCB 4IHJA 1SQQH 4J7ZA 4JAVA 4JI0O 2LGWA 4WFEA 2JGDA 2DYSB 1WA8B 1N4CA 1NU1H 1S76D 1KP2A 1NZ6A 2QWQB 4TUYB 2EINC 1B04A 1DF4A 3F7YC 4CH3A 4BAYA 5LP6B 3APOA 4AI8A 1D2DA 1VQOV 4PDLA 1AI5A 4FK5C 3SPIA 1WLEA 5GW7A 4TV8A 1FS0G 3CHXA 2UXBB 4H37A 1Q81W 4I7ZB 2RCVA 4JV5B 5IJ0A 1SA0B 1Q8IA 1HWYA 1SZXA 1N36O 2FKXA 1EN6A 2XAHA 4E4EA 1XL4A 3I55V 2YDEA 3A0RA 5J2TB 2OT5A 1X4TA 2P4VA 5BMVA 1M4UA 4EEQA 1W0KG 3N2KA 4LF4B 1KKCA 3UKMA 2H8PC 2IJJA 1YVWA 3JALB 3GWKC 1TVKA 3GVMA 4X1IA 5EZYA 4DR3B 2NLJC 3MDSA 5C93A 4LF5B 1R1BA 3JAKB 3CMAV 5LGNA 1NVPD 1QNMA 1GK9A 3SJCC 2ZXWC 5BY1A 5IT9N 2ZD9A 2Q7EA 3SJQC 1AP6A 2RN9A 3CCEV 4JI0B 5LYJB 3OM3B 1JFFB 1NBMG 4LFAB 1AILA 4R8CA 4PDVA 3CB2A 1PD3A 4ZKIA 3HKDB 4NXNO 1BMFG 1WP8A 2Q9LA 2CH7A 4FJCC 1OCCC 3RW0A 2WLIB 4NXMB 1QLEB 2YIDA 3BY6A 1QLEC 1MSDA 2AZ0A 3CXHF 3AG2C 3ZHUA 3AK3A 1IBMO 4B3MB 3P32A 3ZHSA 1XILA 4DV0B 3B4SA 4MT8A 2HJFC 4DV3B 1LUWA 5LL6Y 4FLWA 1Q6UA 4O2BB 2UUBO 4DR5O 2BTQA 1XMOB 5JH7A 1K34A 4PA3A 2XASA 1H2MA 5H9CA 1U97A 3HKEB 3B8NA 4JYAO 2A7WA 3HB3B 1VF6A 1YHQV 3ZN0A 2OTLV 3JAMN 2XHBA 2DE0X 1HNWO 2Y4TA 2IJIA 3H1JH 1D5NA 3OEHG 2R9AA 3RWRD 4OGQB 2QWOB 1BHAA 3K03A 3H1HH 3K5LA 3GWOA 3CSXA 4U3JB 1VF6C 5KHGA 1YCIA 4JI3O 1M56C 3CRQA 1DTOA 5EIBC 1VQ7V 2EZOA 2HP8A 4JZGA 2PUSA 3DSQA 1Y74B 2BSKA 3H1LH 2OIEA 4QPKA 2YSUB 1PNMA 4Q20A 5J2UA 3ZMTA 4QE9A 3CC7V 3L71H 3E8GA 1WN7A 1XHZA 4X1IB 4I5SA 3AG2B 2VQEO 3CX5F 3KZIZ 1O9HA 3BAAA 4R7CA 1NH2D 4MVMA 4X1KB 2IH3C 5IJ0B 1NTMH 1XMOO 2A9HA 2FL4A 3CCQV 1PL0A 3E35A 3RYFB 1SQVH 2DWDC 2K1EA 2DQ3A 2L35A 1R3IC 4YIPA 3E22B 5K1PA 3ZHRA 3ZMVA 1JA8A 5KMGB 4B3TB 4FFBA 4KHPO 3HKBA 1SQBH 4JI6B 2CTRA 4DK1A 2JGUA 3T2MA 1LUVA 2WA3A 2NNUA 3OTOB 1EN5A 3JASA 3JATA 2VQFO 4FIPC 4W4KA 5DEDA 4JTCB 2BOBC 4QE7A 2QDOA 4WFFA 1S5HC 3K9SA 3J80N 2YS8A 4J7JA 4MVQA 4N23A 3T1YO 3JCUZ 1JVMA 1HR0B 2LP7A 4PHZA 1XDCA 1XL6A 5B1AB 5IYDO 3UT5A 2EIJB 3HKEA 4Z1MG 5IYZB 1U96A 5AG2A 1I08A 1YF2A 3O65A 3JAWA 3QO8A 3CCMV 1R3KC 1AI7A 1WP7A 3W7XA 1FPOA 4RQEA 1GMGA 2BCCH 4O2AB 2A0LA 4XBFA 1FXHA 2ZQMA 4GZRB 1BGYH 2Y0PA 4BR6A 3TXQA 5D5QA 2HEPA 1Y74A 1Q5OA 4NR1A 3T4DA 5LMNO 2ZM6B 3IJ4A 4FM1A 4O4JB 2UUAO 1SETA 1EZJA 3CWBH 4JI8B 2EULA 2CH7B 1M57B 4I0XB 1FKAO 5DN6G 4DW1A 1N0NA 2GSMB 4DV4O 3B2EE 4J42A 4MTGA 4CBCA 5GTHZ 4TWKA 1GM8A 1Q43A 4X1YA 1OCRC 1VIBA 3J81N 1FXVA 2ITCC 4WFAV 1AVMA 2OCCC 2Y0IA 1XNQB 1FJGO 1QCEA 3K9AA 4D7SA 3FAVB 2P7TC 2F95B 4HBNA 2LO1A 3OAAG 2XAGA 2QR4A 2L6LA 1PL4A 1P84F 5EK0A 2XAJA 1J95A 2W6JG 1ZSPA 1IBMB 3U10A 5C8YB 5A9GA 4I9QA 1K97A 1YTFD 3WG7C 1XEQA 1HNXB 5LP6C 4DW0A 3Q4HB 4OX9B 3BFRA 3WFVA 2LQTA 2ZCEA 3HPLC 4UCUA 1OCZC 1COWG 4HNAA 4G27B 4PA9A 1FFXB 4B3MO 1XNQO 3UO2A 4Q6GA 2DWEC 3EVKA 1GTOA 5L3DA 5EYPB 1YITV 2V4DA 1I0HA 3K04A 1VQLV 2YICA 1VF7A 1DLBA 5KHJA 2JJ1G 2JRIA 4X89A 3K57A 3HR0A 3K58A 2Y69C 5FNVA 2Q4PA 2Q0OC 3E86A 5C8YA 1SRYA 2ZE5A 3JALA 1AP5A 3K3WA 3CCUV 4K8ZA 2UXCO 2FMLA 3M7MX 4HAMA 1YSCA 3CCJV 2O57A 1N32O 1GO3F 2RQ6A 2RDCA 3ABUA 5LGTA 1SKVA 4DR7B 3OEEG 2P6JA 4WBNB 4I50B 3U11A 1Z5WA 1N36B 4GX1A 3D8CA 1RPRA 4G28B 1NS1A 4R50A 2RMKB 1RP3B 1H8EG 4O4LB 1SF9A 3RYIB 2YXHA 4ASUG 1ORQC 3JSNA 3M99B 1NVPB 4UVCA 4LF7B 1HDJA 4MVOA 1FXKC 3D36C 1Q7YW 1PP9H 4QIWF 1VQ4V 3SYOA 1N34O 3SYPA 1P7GA 2ZE7A 3ABTA 4GLXA 2ZR2A 3VQXA 1JJOA 3X2QC 4CC5A 4JTDB 1IXMA 3CC2V 1VQ9V 3JD0A 4LF6B 4JI6O 5EBLC 1IXBA 2ZR3A 1KKDA 1QU7A 2GTSA 4H13B 2ZNJA 4LF9O 1FXKA 2HLDG 4B7KA 4YY3O 1Q90D 2LFSA 4JYAB 2QJ1A 5JCOC 5ITZB 2UXDO 1NI8A 2DYSC 4LFCB 2YI8A 4U7NA 3K59A 5B3SB 3CRCA 2UXBO 2HG5C 4QGPA 3AG1B 5F2VO 1TGOA 5CBHA 1F4MA 1H38A 1L1FA 2OYQA 4I55B 3B09A 2N74A 1SESA 4QJFB 5L3CA 1S77D 1TUBA 4NTXA 4MVSA 4DUYB 3CC4V 3ZCCA 3RFRA 4AQYO 4MW3A 1XNRB 3S3XA 2ZE6A 4UCVA 5L3EA 3B77A 3DGEA 1T5EA 1IBLO 1MOFA 3RYFA 1KBHA 4I4TB 5L3BA 1L8DA 2WSSG 3I56V 1IDSA 4LP8A 3Q4HA 4HYOA 2YIBD 1AROP 2A3QA 5KUKA 4FLYA 1FAFA 4TUYA 5KLVH 4TV9B 2EBOA 4DR3O 1EM1A 3VQYA 5KA5A 3BRCA 3DXRB 1YI2V 3DTUB 1QBZA 3RVYA 1YJNV 2Q7HA 1HNWB 1R6TA 4CS3A 2P67A 4O4JA 3LSUA 1P7BA 4AQYB 3IAYA 3G4SV 2OCCB 2FTKA 5IWAO 4IL6Z 5CB4A 3FFQA 2E3CA 2GTAA 3ZRWA 4BW9A 2E5LB 4QPJA 3JARA 5LA6A 3CCLV 3E22A 2KB1A 4UV9A 4LF6O 5E1AC 4D6TH 2PI4A 4AHCA 1CXZB 4X66B 4O2AA 4DR4B 5CA0B 4J10A 1R73A 3ASNC 4WFBV 3OGIB 4EFBA 3R66A 3LUTB 3ASNB 2VQFB 4OX9O 5EYPA 3A8TA 5EC1C 1Q6IA 2M6YA 4WFHA 4FMTA 4ZHQA 4HZ3A 3WG7B 3BA8A 4PD4F 4WF9V 2PY5A 3W7UA 1VP7A 1OCCB 5JQGA 5BXZA 1RPOA 4MSWC 2QM8A 4L87A 4DV7O 2Z3YA 5FPRA 3BVOA 4DUYO 1PKXA 4MTXA 2BE3A 2JGDB 2DYRC 4IGGA 1K8AW 2N04A 3ZEDA 3L75H 5CA0A 4DV2B 1YXBA 5EBMC 5CMUA 2ITDC 1OZ0A 3ABKC 4I50A 1K4CC 1HNZO 3BEHA 2GBOA 2QWNB 1ZAUA 3LSQA 3ZN1A 3JCZA 3ZS8C 4PJ0Z 2P06A 1Y6XA 3SDLA 3JD4A 1GM7A 1Z2GA 4RUFA 4FLZA 4FLTA 4ZIBA 1PNLA 1B06A 4CS2A 3DXRA 5IYCO 3H01A 4HNAB 4GKJB 1JOYA 1NT2B 2ADQB 2X7RB 2ZKOA 2OTJV 1E1QG 1S5JA 1VQNV 5CBFA 1N32B 4TQDA 1THZA 1MZEA 2YEVA 5E79Z 5IY5C 3OW2U 2HVJC 2AW9A 4P9OA 1JQ0A 3A2FA 2PYLA 3G67A 2K9PA 5EBWC 3SYAA 2CGNA 2XT9A 1AR4A 4B7EA 1HP8A 1TUBB 3OT7A 2CGOA 1QVGU 2VQEB 1HW7A 4DV5O 4DV4B 3J7AU 4H0LB 4LWSA 3JASB 3JATB 1KQSU 5A2QN 4UCOA 1EN4A 1H2KA 1KB9F 2KQXA 3K0DA 5LMNB 1K9MW 1IVSA 3L72H 1VMGA 1M93A 1KP3A 2RJZA 1CPYA 1FJGB 5HFMA 3N2GA 2VWJA 4JI2O 3CRAA 2ZNIA 3CCSV 2ARHA 5IJ9A 5LP6A 4LWSB 4A5UB 1XQ8A 1RFYA 4X20A 3CXCU 1AI4A 2ZIMA 4FLUA 3SPJA 4JI1B 4XDLA 2B9ZA 4C7UA 2F43G 4DR6O 1QQCA 5KHKA 3B8MA 2UXDB 1PM9A 4LF5O 3C90A 2QWRB 1YDXA 1P49A 2PZSA 1V55B 3QTCA 1URFA 3L9DA 4IT5A 5IYBO 1K4DC 4GX0A 3AG1C 3RGBA 3ZIAG 3QF7A 1BQZA 3W7SA 3JSLA 3VQWA 2GUZB 1TVKB 3FYIB 4B3RO 2ZT9B 1WJZA 1J5EB 1OJHA 4FLVA 3ZRSA 4LFAO 4YHHB 4MTFA 3LNMB 1M56B 3VOUA 4X20B 2DMXA 1I7FA 2EIMB 3QVNA 5CB4B 2CTWA 1QR9A 4L8JA 4CH5A 5LA6B 2F66C 1GH6A 3AG7A 4UVBA 1N8RW 2W0XA 4JTAB 2E75B 1GN4A 3KCXA 5KA6A 1IURA 4DR1O 1AR5A 2UU9B 4BIOA 4JI3B 2HR3A 1WAZA 4K35A 4JYYA 4ZI7A 1BT8A 1AJPA 1NKDA 4RAIA 1WA8A 4ZOLA 2VRZA 1SQXH 5GONB 1WB8A 2BTOA 3D36A 3I5DA 3RT3C 3TCUA 1YIJV 2IJKA 1V9PA 2D2CB 5EC2C 4F4LA 2IM9A 4FM0A 2CE4A 2PGGA 3IC9A 5EZYB 1XMQB 5CA1B 2OCHA 4JI4O 3TK1A 4PDMA 1KUQA 2QA4V 5GONA 4DR2B 2GHYA 1KC8W 1HNXO 1O9GA 4TV9A 1SS3A 1M90W 4X64B 2UU9O 4U3FH 1Y76A 3OUFA 2P4KA 3QG5A 1XREA 2WLNA 3S3WA 1B6QA 2XTAA 4O4IB 2CUGA 5H6RA 2Q68A 3K06A 1OCOC 5LYJA 2Y4UA 2DOSA 1YTFB 2AHYA 2CTPA 2MW2B 3ZRWB 3FB6C 4LFCO 5LHHA 2QKSA 5ITZA 1BSMA 1W0JG 1N33O 1MA1A 1G4YB 2F23A 3H9VA 2FB5A 3ABMB 2N05A 1MSWD 4DR7O 4YXWG 1G6UA 1ZTEA 1IBKB 4EB6B 1VQPV 3OUSA 2XAQA 1S5LZ 2R9IA 4F6RB 4O4LA 4I55A 4B3SO 3VBBA 5BR8B 5FNVB 4XDKA 3E8HA 3FB8C 1K33A 1SERA 2JDIG 3FYEB 4GUNA 4D7TA 3TGUH 2ZINA 5B1AC 1E79G 4MVZA 4BW5A 2EIJC 5H6QA 2IJHA 1UJWB 4UV8A 3AK1A 5TISZ 4I4TA 3E2EA 1QR8A 2Q67A 3CPWU 3BCCH 4DR1B 4TSFG 1M57C 2CDYA 3OR7C 4IIJB 3EHBB 3FD9A 4EFEA 2C2AA 4P9PA 1KECA 1Q6HA 1RSOA 2YEVB 3NR7A 3L73H 3WB0A 2F93B 2WLMA 1F4NA 4DRXA 2E74B 1JX9A 1MMMA 3BHPA 2DN9A 5HFLA 5EIBD 4NXMO 4K0KO 1Y66A 3MHHC 5B5EZ 2LW1A 1LR1A 5CN0A 1TUEB 3SJBC 3P3NA 5IJ9B 1F51A 4JV5O 3KKYA 3MAQA 2Q8VA 2QE7G 3HKDA 5FPOA 5KHHA 3RBZA 4JI8O 1YEWA 2M7WA 3FX7A 4F6RA 4PV1B 4ZI7B 5DECA 5JJEB 4FZ0A 4X64O 3G80A 4ZBMA 3OTFA 2NN4A 2DYRB 2YC0A 3JD1A 4UB6Z 1VQ5V 4FPPA 3GB7C 3HKCB 4FFBB 4Z1VA 4TT3G 1Q82W 4H33A 3W7TA 2Q6AA 3BPZA 5B3SC 4H44B 3UT5B 5CBGA 2R70A 3FB7C 4ABMA 3NXSA 5BZBA 5IDJA 4UUJC 3JYCA 2GUZA 2GDSA 1MABG 4X88A 4X66O 2ATKC 4KUMA 3UM7A 4FZ1A 2UUAB 3ASOC 3EXAA 3ETQA 2QM7A 2HHHB 1Z5VA 2Q0AA 5CA3A 4JI5B 2ZDIC 3ZJZA 4CS4A 4DV7B 1VQ8V 1WB7A 3RVZA 4YHHO 5L3GA 3RYCA 1I94O 2WLLB 2QM4A 4JAUA 5LOVB 2DQ0A 1AI6A 4MW8A 2Z5UA 2FYUH 4PI2A 4MTOA 3IFXA 2OIGA 3ZHQA 4B08A 4JF3A 3ZRVA 5JWPA 1DF5A 4ZOLB 4TQFA 3B40A 1EZVH 2XNDG 3RN4A 2AZ2A 4DR2O 2VS0A 2WPDG 3ABLC 4JI7B 4UVAA 1UFIA 3HKCA 2UXXA 3ICXA 2PYJA 1BHBA 2YI9A 4DRXB 4EKWA 3T1HB 3ETDA 2WAMA 4KXRA 1R3JC 2ETNA 1QHTA 1HNZB 5JVDB 4J9YB 4LH6A 1K92A 4PDRA 1I5XA 4IIJA 5LXTB 5JJJB 1SQPH 3T1CA 5IWAB 3DC5A 4DXWA 4JI2B 4IYHA 5B1NA 5IE9A 3N2GB 3THOA 5JJNB 3PJSK 3M8AA 1ZX3A 2JS3A 2Q73A 2EZPA 2CTQA 1SZTA 1CP9A 2BTQB 2DW4A 5LHIA 2JEUA 2KKWA 2IH1C 4DV3O 4DV5B 1PPJH 4NVPA 2QTOA 3JAWB 4UCRA 5KMGA 3AK2A 4LF7O 2LGQA 3HKBB 1NJIW 1B3QA 5DM6V 1JPXA 1K73W 1S72V 3AG4B 3ML0A 2X6CA 4LH7A 1K3EA 5GTIZ 5FL7G 3CRMA 3IGAC 4I9WA 3ASOB 1R6NA 3CYOA 1IX9A 1P4RA 4JPRA 1OCOB 3P3PA 1VF5B 4R6ZA 2IW5A 3OE7G 4X1KA 3TJTA 3OGCC 4UB8Z 3ABKB 1SQGA 1G1XB 2P90A 1ZL8A 4BIUA 2KG7B 1Y67A 1M1KW 1KD1W 2YUAA 3LDEA 4JI7O 2VWKA 4RUEA 4YY3B 2EILB 3E8FA 4DV2O 5L3FA 4K3AA 1W59A 4WBNA 3G6BA 1AJNA 4JASA 4IHJB 3ZBHA 3OMNB 5CA1A 4FM2A 4F6EA 3H1IH 3BABA 2WA4A 1GM9A 1R6KA 2AXTZ 4FVMA 4MS2A 1IBKO 4XDJA 1XHXA 1YJ9V 3ETGA 4O4IA 2EILC 3FKSG 3ZHTA 3STZC 2WLLA 4O2BA 5LOVA 4LF4O 1NQTA 4X9QA 1NH2B 4LF8B 4IYIA 2PF4E 1OV9A 4GKKO 1JCHA 2WWWA 4DYLA 2HKOA 2AHZA 4E2LA 2JS5A 3U0ZA 4O4HB 1XUQA 5KUMA 1MG1A 2ZDIA 2QGNA 1HR0O 3CS5A 1QLNA 5JVDA 1IZ3A 2EIMC 2EIKC 1NR7A 2E5LO 4AILC 2IBZH 4U3JA 4CZZA 3X2QB 4CH4A 3SPGA 3SJAC 2Q5ZA 1M5IA 3CCRV 2PTMA 4DR5B 1DK1A 1VEWA 1ZUQA 3CJHA 1A32A 3ZX6A 4PA4A 3FB5C 5LMUB 1KYOF 1NTKH 3QO7A 4JAAA 4U7OA 2W0FC 5KX5B 2IU0A 1YJWV 2B5UA 3D3QA 1DGSA 4X62O 2QKAA 1BE3H 2XAFA 5KAIZ 4NB5A 3A0HZ 3MD0A 4DUZO 3T1YB 4YIOA 1QVFU 1WNSA 3LNNA 1UPGA 2KG7A 1FFXA 2QWPB 4RWUA 1H2LA 2P22C 2Q7GA 3N27A 5KHIA 4LBEC 1N0JA 2F1MA 1FYJA 4W4LA 4LF8O 2BOCC 4UCSA 2CAZC 2WLHA 1JJ2U 1VARA 3JD3A 2DJVA 4GKKB 1Q3EA 3CMEV 1F23A 1SQFA 2CK3G 3ZMZA 3AEIA 2JVDA 1PV0A 1EFRG 4KL1A 4LNUA 3ZMUA 1Q86W 4J41A 3RYCB 2RNBA 4DR4O 3OMAB 4J11A 4GYCB 1ZWIC 4JI1O 3LDDA 2GV9A 1L0LH 4RO2A 3TETA 4LC1A 3SPHA 1AR1B 1RM1B 3OR6C 2JK5C 1I5YA 5B1BC 1K7DA 1ZLZA 2B1IA 1X59A 4J80A 2KSDA 2NR5A 5LMUO 2A79B 1SA0A 1XNRO 3AG3B 1N34B 1IBLB 2LJ2A 3UCSC 1V54C 4X8AA 4DV6B 2ADPA 4RQFA 5IY5B 1D5AA 2EX3A 1GKFA 4DUZB 4DV1O 2LFRA 1OHHG 2IU3A 2R72A 4O4HA 1RSOB 3K0GA 1MZFA 1JFFA 4JI4B 4LF9B 3E8BA 1Y76B 2EJ7A 4NKGB 3F7VC 4N21A 2H3OA 4GX5A 5D5PA 4J9ZB 4BWAA 3ZRXA 3SYQA 3K5NA 5J2UB 4K8XA
chains in the Genus database with same CATH topology
4P2ZA 2PI5A 1S3JA 5L3BA 2WLMA 1F4NA 1K34A 1VQMV 1JX9A 2WSSG 4PA3A 2XASA 3F5WC 5H9CA 1EBOA 5HFLA 2JEXA 3I56V 3B8NA 4LP8A 3HB3B 4HYOA 1Y66A 3MHHC 1AROP 1CEZA 1YHQV 2MK3A 3D3IA 5CN0A 5KUKA 3STLC 1TUEB 4MVRA 3ZN0A 2OTLV 1F51A 2EBOA 2QE7G 5KA5A 1YI2V 2IJIA 1QBZA 3DTUB 3RBZA 3RVYA 1YJNV 3OEHG 2M7WA 2P67A 1P7BA 3AG4C 4QNHB 4ZBMA 1AJQA 3K03A 1BHAA 3G4SV 3GWOA 3P30A 2DYRB 4PA7A 1K5SA 2OCCB 3JD1A 2FTKA 1VQ5V 1M56C 3ZRWA 3R65A 4QPJA 4FPPA 3GB7C 3CCLV 1Q82W 4TT3G 2KB1A 4UV9A 4H33A 3W7TA 5E1AC 2PI4A 3QNEA 1DTOA 2Q6AA 5B3SC 1VQ7V 2EZOA 4WFGA 5CBGA 3AG3C 3FB7C 3NXSA 5BZBA 5IDJA 4UUJC 3JYCA 1R73A 3ASNC 1MABG 4X88A 4WFBV 2ATKC 4KUMA 3UM7A 4QPKA 3W7WA 1PNKA 2YSUB 3LUTB 1PNMA 3ASNB 3LDCA 4Q20A 3OFNG 3ASOC 3ZMTA 4QE9A 5EC1C 4GX2A 3CC7V 3E8GA 2R9RB 4WFHA 4FMTA 4WCEV 2QM7A 4GCZA 1RM1C 1E1RG 5CA3A 4HZ3A 4P30A 4I5SA 3AG2B 3WG7B 2ZDIC 3ZJZA 4WF9V 1VQ8V 3RVZA 3MHSC 5L3GA 4R7CA 3W7UA 1NH2D 2JJ2G 2WLLB 1OCCB 4JAUA 2W6IG 4MVMA 2DQ0A 1AI6A 1RPOA 2IH3C 4MSWC 4MW8A 2A9HA 2QM8A 2Z5UA 4L87A 3CCQV 4PELA 1PL0A 3E35A 2V7QG 2UXNA 4MTOA 3K08A 3IFXA 2DWDC 2Z3YA 2K1EA 2Y48A 2DQ3A 1FXKB 1R3IC 1PKXA 4MTXA 1G8MA 4JF3A 3ZRVA 1DF5A 2DYRC 1K8AW 3ZMVA 2XNDG 2XOKG 4MVUA 5EBMC 5CMUA 2ITDC 1OZ0A 2D3OW 2WPDG 3ABKC 3ABLC 1K4CC 4UVAA 2UXXA 3T2MA 3BEHA 1S0VA 3OMIB 3LSQA 1BHBA 3ZN1A 4EKWA 3JCZA 3ETDA 1ROPA 2X6AA 2HFEC 2NNUA 2WAMA 1R3JC 4FIPC 1OCZB 2EJRA 4JTCB 3JD4A 4J9YB 1GM7A 2BOBC 4QE7A 4RUFA 3CP1A 4WFFA 1K92A 1PNLA 4PDRA 1I5XA 5IYCO 1S5HC 3H01A 4MVQA 3T1CA 4N23A 2EINB 3E83A 1JOYA 4DXWA 1JVMA 5B1NA 2X7RB 2OTJV 4JGSA 1E1QG 2LP7A 1VQNV 3PJSK 5CBFA 1XL6A 5B1AB 5IYDO 2EIJB 2EZPA 4Z1MG 3G71V 1SZTA 1THZA 2YEVA 3EFFK 5IY5C 3OW2U 1CP9A 3QO8A 3CCMV 3ETEA 1R3KC 2DW4A 1AI7A 2HVJC 4KFMA 5LHIA 2JEUA 2Y69B 2IH1C 4P9OA 3W7XA 4RQEA 1JQ0A 1GMGA 4JYBA 3QO5A 2A0LA 4DO2A 4XBFA 2Q69A 5EBWC 3SYAA 2QTOA 4UXNA 1FXHA 2ZQMA 1R3LC 1LNQA 1NJIW 5DM6V 1JPXA 1QVGU 1K73W 1S72V 1H2GA 3AG4B 3ML0A 5LGUA 2X0LA 2X6CA 4BIZA 3T4DA 1K3EA 2QEXV 5FL7G 1V55C 3IGAC 1FFTB 4I9WA 3ASOB 1R6NA 1BL8A 1KQSU 5J9PC 3CYOA 1P4RA 4JPRA 1OCOB 3ZMSA 1SETA 3K0DA 4R6ZA 1EZJA 2IW5A 3OE7G 1K9MW 3CD6V 4KP4A 1M9NA 3OGCC 2JIZG 2WLJA 1KP3A 3ABMC 3ABLB 3ABKB 1M57B 1CPYA 1K5QA 2P90A 5DN6G 5B1BB 5HFMA 2GSMB 4BIUA 3E89A 1M1KW 1KD1W 2B1GA 3LDEA 3KG2A 4MTGA 3CCSV 1Y4MA 4CBCA 4JYCA 4RUEA 4TWKA 5B1OA 3E8FA 1GM8A 2EILB 2WLKA 3JD2A 1OCRC 1OCRB 1FXVA 2ITCC 5L3FA 4WFAV 2OCCC 4PA6A 3CXCU 1AI4A 1QCEA 1AJNA 4JASA 3K9AA 3SPJA 1W2BU 2P7TC 3OMNB 3OAAG 4XDLA 2XAGA 2F43G 5EK0A 2XAJA 1J95A 1GM9A 1R6KA 2W6JG 3B8MA 4MS2A 4XDJA 2EIKB 1YJ9V 4GT1A 3ETGA 5LBQA 1VQ6V 1K97A 1ENVA 2EILC 1YTFD 1V55B 4LCUC 3FKSG 3STZC 3WG7C 2WLLA 5IYBO 3G6EV 1K4DC 4OXSA 1NQTA 4GX0A 3K79A 1NH2B 2V1DA 1V54B 3AG1C 2WLIA 3LSSA 1JCHA 3WFVA 2WWWA 1VQKV 3ZIAG 2H94A 5LHGA 3HPLC 3W7SA 2HKOA 2AHZA 4E2LA 1OCZC 1COWG 3FYIB 3SYCA 4G27B 4PA9A 2HVKC 3ZRSA 1H8HG 4MTFA 5KUMA 1WPXA 2DWEC 1MG1A 2X6BA 1GTOA 3LNMB 5L3DA 2ZDIA 3IC7A 1YITV 1M56B 3K04A 2ZXWB 1VQLV 3VOUA 1QLNA 3SPCA 4G2KA 2EIMC 1DLBA 2EIKC 2EIMB 3CCVV 1NR7A 2JJ1G 4X89A 1QR9A 4CZZA 3T4ZA 3X2QB 1NR1A 3SPGA 4UVBA 2Y69C 3CCRV 1N8RW 4JTAB 3E86A 1SRYA 4PA4A 3FB5C 3K3WA 4JAVA 4WFEA 3CCUV 2DYSB 3QO7A 4U7OA 1S76D 2W0FC 1KP2A 2IU0A 5KA6A 4HAMA 1YSCA 1YJWV 3CCJV 2B5UA 2HR3A 1GO3F 3ABUA 2EINC 5LGTA 1AJPA 1DF4A 1NKDA 2XAFA 3F7YC 3OEEG 4RAIA 4BAYA 2P6JA 3MD0A 1VQOV 4PDLA 1QVFU 1AI5A 4FK5C 3SPIA 1WLEA 3D36A 4GX1A 5GW7A 1FS0G 1RPRA 3TCUA 1YIJV 4G28B 2IJKA 4R50A 4H37A 1Q81W 5EC2C 4F4LA 1H8EG 4LBEC 1HWYA 2XAHA 1XL4A 3I55V 2BOCC 3A0RA 1JJ2U 2OT5A 2WLHA 3TK1A 3JD3A 4PDMA 2QA4V 3CMEV 2GHYA 1KC8W 1W0KG 1ORQC 4ASUG 1NVPB 3M99B 1F23A 2CK3G 3UKMA 4UVCA 3ZMZA 3AEIA 1M90W 4MVOA 1FXKC 2H8PC 2IJJA 1Q7YW 3OUFA 2WLNA 4QIWF 1EFRG 1VQ4V 1B6QA 3SYOA 3SYPA 2NLJC 3ZMUA 3ABTA 1Q86W 5H6RA 5C93A 2ZR2A 3X2QC 2Q68A 3OMAB 3K06A 4JTDB 1OCOC 1IXMA 3CC2V 3CMAV 1YTFB 5LGNA 2AHYA 1VQ9V 1ZWIC 3JD0A 3ZRWB 3FB6C 1NVPD 3LDDA 5EBLC 2ZR3A 5LHHA 1KKDA 4RO2A 2QKSA 3TETA 1GK9A 2ZXWC 4LC1A 3SPHA 1AR1B 1W0JG 1RM1B 3OR6C 2JK5C 1G4YB 1FXKA 2HLDG 1I5YA 5B1BC 1K7DA 3ABMB 2LFSA 2B1IA 2ZD9A 1MSWD 3SJQC 4YXWG 3CCEV 2A79B 1VQPV 2DYSC 3OM3B 3OUSA 2XAQA 1NBMG 2R9IA 3AG3B 4U7NA 4R8CA 4PDVA 3VBBA 5B3SB 1PD3A 4ZKIA 4XDKA 2HG5C 3E8HA 3FB8C 1K33A 1SERA 2JDIG 1V54C 3AG1B 3FYEB 4X8AA 1BMFG 4RQFA 5IY5B 5CBHA 1F4MA 1H38A 4FJCC 1GKFA 1L1FA 1OCCC 5B1AC 1E79G 2LFRA 3RW0A 2WLIB 4MVZA 4BW5A 2EIJC 1OHHG 1QLEB 2IU3A 5H6QA 2IJHA 3K0GA 1SESA 4UV8A 3BY6A 1UJWB 1QLEC 3E8BA 4QJFB 3E2EA 3AG2C 1QR8A 2Q67A 5L3CA 3CPWU 1S77D 3F7VC 4N21A 4MVSA 3P32A 4GX5A 4J9ZB 4TSFG 3CC4V 3ZCCA 1M57C 3ZRXA 3OR7C 4MW3A 3SYQA 3EHBB 4MT8A 5L3EA 2HJFC 3DGEA 2C2AA 3B77A 4P9PA 1KECA 2YEVB 1MOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC C;  4PA6 A;  4P2Z A;  4H37 A;  2DYR C;  4R50 A;  5EC2 C;  4F4L A;  2WLM A;  4PA3 A;  3SPJ A;  3F5W C;  4MVU A;  4LBE C;  2P7T C;  5EBM C;  4XDL A;  2ITD C;  4LP8 A;  3ABK C;  3ABL C;  1K4C C;  4HYO A;  3T2M A;  1XL4 A;  3BEH A;  5EK0 A;  2BOC C;  1J95 A;  2WLH A;  4MS2 A;  4PDM A;  4XDJ A;  4EKW A;  2X6A A;  5KUK A;  2HFE C;  4MVR A;  3STL C;  1ORQ C;  1R3J C;  3UKM A;  4JTC B;  4MVO A;  4J9Y B;  2EIL C;  2H8P C;  2BOB C;  4QE7 A;  4LCU C;  4RUF A;  4WFF A;  3STZ C;  3RBZ A;  2WLL A;  3OUF A;  3RVY A;  4PDR A;  3WG7 C;  1K4D C;  2WLN A;  4OXS A;  1S5H C;  4GX0 A;  3SYO A;  4MVQ A;  3T1C A;  3SYP A;  1P7B A;  2NLJ C;  3AG4 C;  3AG1 C;  3E83 A;  2WLI A;  4ZBM A;  3K03 A;  4DXW A;  4QNH B;  1JVM A;  3X2Q C;  3HPL C;  2Q68 A;  2AHZ A;  3K06 A;  4JTD B;  1OCZ C;  1OCO C;  4PA7 A;  3SYC A;  2AHY A;  3PJS K;  1ZWI C;  5CBF A;  1XL6 A;  3FB6 C;  1M56 C;  3LDD A;  5EBL C;  4G27 B;  4PA9 A;  3R65 A;  1KKD A;  2HVK C;  2QKS A;  4RO2 A;  3TET A;  3GB7 C;  3ZRS A;  2ZXW C;  3SPH A;  2YEV A;  3EFF K;  5IY5 C;  4MTF A;  5KUM A;  2KB1 A;  3OR6 C;  2JK5 C;  4H33 A;  1G4Y B;  2DWE C;  5E1A C;  1R3K C;  2HVJ C;  2X6B A;  2Q6A A;  3LNM B;  4KFM A;  5B1B C;  5B3S C;  2IH1 C;  4P9O A;  4WFG A;  5CBG A;  3AG3 C;  3K04 A;  2ZD9 A;  3FB7 C;  3VOU A;  3SJQ C;  5BZB A;  3SPC A;  4UUJ C;  3JYC A;  2A0L A;  3ASN C;  4X88 A;  2A79 B;  2ATK C;  2Q69 A;  2EIM C;  2DYS C;  2EIK C;  5EBW C;  3OUS A;  3SYA A;  3UM7 A;  2QTO A;  3LUT B;  3LDC A;  3ASO C;  4R8C A;  4X89 A;  4PDV A;  1R3L C;  1LNQ A;  4QE9 A;  3T4Z A;  5EC1 C;  4GX2 A;  3SPG A;  4XDK A;  2HG5 C;  3E8H A;  2Y69 C;  3E8G A;  3FB8 C;  1V54 C;  2R9R B;  4WFH A;  4JTA B;  4X8A A;  3E86 A;  2X6C A;  3T4D A;  4HZ3 A;  4PA4 A;  5CBH A;  1V55 C;  3FB5 C;  3IGA C;  4P30 A;  1OCC C;  4I9W A;  4WFE A;  5B1A C;  3RW0 A;  3ZJZ A;  2WLI B;  4MVZ A;  4BW5 A;  2EIJ C;  1BL8 A;  2W0F C;  5J9P C;  3RVZ A;  3K0G A;  3K0D A;  1QLE C;  3E8B A;  4R6Z A;  4R7C A;  2WLL B;  3AG2 C;  2Q67 A;  4MVM A;  3OGC C;  2IH3 C;  4MSW C;  2WLJ A;  3F7V C;  2A9H A;  2EIN C;  3ABM C;  4MW8 A;  4MVS A;  4GX5 A;  4RAI A;  3F7Y C;  4J9Z B;  3E89 A;  1M57 C;  4MTO A;  3LDE A;  3OR7 C;  3KG2 A;  4MW3 A;  4MTG A;  4PDL A;  3K08 A;  3SYQ A;  3IFX A;  2DWD C;  2K1E A;  4CBC A;  2HJF C;  4RUE A;  4TWK A;  3SPI A;  3E8F A;  4GX1 A;  4P9P A;  2WLK A;  1R3I C;  1OCR C;  3TCU A;  4G28 B;  2ITC C; 
#chains in the Genus database with same CATH topology
 3SR2 C;  2BSK B;  4P2Z A;  2PI5 A;  1S3J A;  4J7K A;  4NYK A;  3CEI A;  1VQM V;  3F5W C;  1EBO A;  2JEX A;  3CRR A;  4FFK A;  4GKJ O;  2HHH O;  2OWO A;  1CEZ A;  2MK3 A;  2ZE8 A;  3D3I A;  4DV1 B;  3STL C;  4MVR A;  3KCY A;  3WB1 A;  4X1Y B;  3UQ8 A;  2XUM A;  2ILM A;  2QTS A;  3K5O A;  1NTZ H;  2ZIO A;  3AG4 C;  3JAR B;  3FAV A;  4QNH B;  3VQV A;  1AJQ A;  2YIA A;  3P30 A;  4PA7 A;  1K5S A;  1N33 B;  3H1K H;  1TA8 A;  1XMQ O;  3R65 A;  4CC6 A;  1JR9 A;  2LW7 A;  2UUC B;  4LFB O;  3QNE A;  4ZHQ B;  3OTO O;  4I0X A;  4WFG A;  2HJD A;  3AG3 C;  4B3R B;  5JH7 B;  3WB2 A;  1BCC H;  3UO3 A;  3W7W A;  1PNK A;  5FLX N;  3LDC A;  5J2T A;  3OFN G;  1XBL A;  2YXL A;  5B66 Z;  4GX2 A;  4YJ2 B;  2F4V B;  2R9R B;  4TOI A;  4WCE V;  1GN6 A;  4GCZ A;  1RM1 C;  1E1R G;  4P30 A;  2QKC A;  4DV6 O;  4X62 B;  1GN3 A;  3MHS C;  4ICG A;  4LR3 A;  2JJ2 G;  1J5E O;  2W6I G;  1US6 A;  4PEL A;  1I94 B;  2V7Q G;  2UXN A;  3F5T A;  3K08 A;  5H2F Z;  2A06 H;  2Y48 A;  3K5M A;  3TXS A;  1FXK B;  2ODM A;  1G8M A;  4K0K B;  1AB3 A;  3L70 H;  1GAX A;  1XOU A;  2XOK G;  5K1X A;  4MVU A;  1BQ0 A;  2D3O W;  1S0V A;  3OD4 A;  3OMI B;  1ROP A;  2X6A A;  2AGA A;  2HFE C;  3ZHV A;  1SC5 B;  2Z0A A;  1OCZ B;  2EJR A;  3JAK A;  3CP1 A;  1F7Y A;  4Z2W A;  4JZ2 A;  1TAE A;  4EB6 A;  2EIN B;  3E83 A;  3RYH A;  1ZL8 B;  4JGS A;  4NTY A;  1MNG A;  2UUB B;  3G71 V;  3EFF K;  1H2S B;  3ETE A;  3DC6 A;  4KFM A;  2Y69 B;  4NTW A;  1JMK C;  4JYB A;  1BS3 A;  4YJ3 A;  3QO5 A;  2UUC O;  4DV0 O;  4LFB B;  4DO2 A;  3C3S A;  2Q69 A;  5H5N A;  4UXN A;  4TV8 B;  4B3T O;  2YXY A;  1R3L C;  1LNQ A;  5KX5 A;  4JI5 O;  4YJ2 A;  1H2G A;  5LGU A;  4FLX A;  2X0L A;  1GRJ A;  3RYI A;  4BIZ A;  2YIB A;  2QEX V;  4X65 B;  1V55 C;  2G38 A;  4UFZ A;  1FFT B;  1BL8 A;  4NXN B;  5J9P C;  4DR6 B;  3ZMS A;  5JQG B;  5BR8 O;  3CD6 V;  4KP4 A;  3L74 H;  1M9N A;  2P5O A;  2JIZ G;  3O9O A;  2WLJ A;  3ABL B;  3ABM C;  1K5Q A;  2E76 B;  5B1B B;  3E89 A;  2ZM6 O;  2B1G A;  3KG2 A;  3A0B Z;  1Y4M A;  4JYC A;  5B1O A;  2QSA A;  3JD2 A;  2WLK A;  1OCR B;  4PA6 A;  1W2B U;  1KU9 A;  3T1H O;  5KAF Z;  3SGI A;  1BZK A;  1FD9 A;  3N2K B;  4X65 O;  3WU2 Z;  2EIK B;  3BA9 A;  4GT1 A;  4LNU B;  5LBQ A;  1VQ6 V;  1ENV A;  4LCU C;  1WPB A;  3G6E V;  4OXS A;  4PI0 A;  3K79 A;  2V1D A;  1V54 B;  2WLI A;  3LSS A;  1VQK V;  1L0N H;  2H94 A;  4UCT A;  5LHG A;  4CH6 A;  3CE2 A;  3SYC A;  1GN2 A;  1KMI Z;  4DK0 A;  3PN1 A;  3RYH B;  2HVK C;  1H8H G;  5IYZ A;  3APQ A;  4B3S B;  4KHP B;  1WPX A;  4OPA A;  5BMV B;  2X6B A;  3CJH B;  3IC7 A;  4OPH A;  5JCO A;  2ZXW B;  1XI1 A;  3SPC A;  4G2K A;  4YJ3 B;  3CCV V;  2F4V O;  5LXT A;  3T4Z A;  1YZB A;  1H2N A;  3C3T A;  1NR1 A;  2UXC B;  4IHJ A;  1SQQ H;  4J7Z A;  4JAV A;  4JI0 O;  2LGW A;  4WFE A;  2JGD A;  2DYS B;  1WA8 B;  1N4C A;  1NU1 H;  1S76 D;  1KP2 A;  1NZ6 A;  2QWQ B;  4TUY B;  2EIN C;  1B04 A;  1DF4 A;  3F7Y C;  4CH3 A;  4BAY A;  5LP6 B;  3APO A;  4AI8 A;  1D2D A;  1VQO V;  4PDL A;  1AI5 A;  4FK5 C;  3SPI A;  1WLE A;  5GW7 A;  4TV8 A;  1FS0 G;  3CHX A;  2UXB B;  4H37 A;  1Q81 W;  4I7Z B;  2RCV A;  4JV5 B;  5IJ0 A;  1SA0 B;  1Q8I A;  1HWY A;  1SZX A;  1N36 O;  2FKX A;  1EN6 A;  2XAH A;  4E4E A;  1XL4 A;  3I55 V;  2YDE A;  3A0R A;  5J2T B;  2OT5 A;  1X4T A;  2P4V A;  5BMV A;  1M4U A;  4EEQ A;  1W0K G;  3N2K A;  4LF4 B;  1KKC A;  3UKM A;  2H8P C;  2IJJ A;  1YVW A;  3JAL B;  3GWK C;  1TVK A;  3GVM A;  4X1I A;  5EZY A;  4DR3 B;  2NLJ C;  3MDS A;  5C93 A;  4LF5 B;  1R1B A;  3JAK B;  3CMA V;  5LGN A;  1NVP D;  1QNM A;  1GK9 A;  3SJC C;  2ZXW C;  5BY1 A;  5IT9 N;  2ZD9 A;  2Q7E A;  3SJQ C;  1AP6 A;  2RN9 A;  3CCE V;  4JI0 B;  5LYJ B;  3OM3 B;  1JFF B;  1NBM G;  4LFA B;  1AIL A;  4R8C A;  4PDV A;  3CB2 A;  1PD3 A;  4ZKI A;  3HKD B;  4NXN O;  1BMF G;  1WP8 A;  2Q9L A;  2CH7 A;  4FJC C;  1OCC C;  3RW0 A;  2WLI B;  4NXM B;  1QLE B;  2YID A;  3BY6 A;  1QLE C;  1MSD A;  2AZ0 A;  3CXH F;  3AG2 C;  3ZHU A;  3AK3 A;  1IBM O;  4B3M B;  3P32 A;  3ZHS A;  1XIL A;  4DV0 B;  3B4S A;  4MT8 A;  2HJF C;  4DV3 B;  1LUW A;  5LL6 Y;  4FLW A;  1Q6U A;  4O2B B;  2UUB O;  4DR5 O;  2BTQ A;  1XMO B;  5JH7 A;  1K34 A;  4PA3 A;  2XAS A;  1H2M A;  5H9C A;  1U97 A;  3HKE B;  3B8N A;  4JYA O;  2A7W A;  3HB3 B;  1VF6 A;  1YHQ V;  3ZN0 A;  2OTL V;  3JAM N;  2XHB A;  2DE0 X;  1HNW O;  2Y4T A;  2IJI A;  3H1J H;  1D5N A;  3OEH G;  2R9A A;  3RWR D;  4OGQ B;  2QWO B;  1BHA A;  3K03 A;  3H1H H;  3K5L A;  3GWO A;  3CSX A;  4U3J B;  1VF6 C;  5KHG A;  1YCI A;  4JI3 O;  1M56 C;  3CRQ A;  1DTO A;  5EIB C;  1VQ7 V;  2EZO A;  2HP8 A;  4JZG A;  2PUS A;  3DSQ A;  1Y74 B;  2BSK A;  3H1L H;  2OIE A;  4QPK A;  2YSU B;  1PNM A;  4Q20 A;  5J2U A;  3ZMT A;  4QE9 A;  3CC7 V;  3L71 H;  3E8G A;  1WN7 A;  1XHZ A;  4X1I B;  4I5S A;  3AG2 B;  2VQE O;  3CX5 F;  3KZI Z;  1O9H A;  3BAA A;  4R7C A;  1NH2 D;  4MVM A;  4X1K B;  2IH3 C;  5IJ0 B;  1NTM H;  1XMO O;  2A9H A;  2FL4 A;  3CCQ V;  1PL0 A;  3E35 A;  3RYF B;  1SQV H;  2DWD C;  2K1E A;  2DQ3 A;  2L35 A;  1R3I C;  4YIP A;  3E22 B;  5K1P A;  3ZHR A;  3ZMV A;  1JA8 A;  5KMG B;  4B3T B;  4FFB A;  4KHP O;  3HKB A;  1SQB H;  4JI6 B;  2CTR A;  4DK1 A;  2JGU A;  3T2M A;  1LUV A;  2WA3 A;  2NNU A;  3OTO B;  1EN5 A;  3JAS A;  3JAT A;  2VQF O;  4FIP C;  4W4K A;  5DED A;  4JTC B;  2BOB C;  4QE7 A;  2QDO A;  4WFF A;  1S5H C;  3K9S A;  3J80 N;  2YS8 A;  4J7J A;  4MVQ A;  4N23 A;  3T1Y O;  3JCU Z;  1JVM A;  1HR0 B;  2LP7 A;  4PHZ A;  1XDC A;  1XL6 A;  5B1A B;  5IYD O;  3UT5 A;  2EIJ B;  3HKE A;  4Z1M G;  5IYZ B;  1U96 A;  5AG2 A;  1I08 A;  1YF2 A;  3O65 A;  3JAW A;  3QO8 A;  3CCM V;  1R3K C;  1AI7 A;  1WP7 A;  3W7X A;  1FPO A;  4RQE A;  1GMG A;  2BCC H;  4O2A B;  2A0L A;  4XBF A;  1FXH A;  2ZQM A;  4GZR B;  1BGY H;  2Y0P A;  4BR6 A;  3TXQ A;  5D5Q A;  2HEP A;  1Y74 A;  1Q5O A;  4NR1 A;  3T4D A;  5LMN O;  2ZM6 B;  3IJ4 A;  4FM1 A;  4O4J B;  2UUA O;  1SET A;  1EZJ A;  3CWB H;  4JI8 B;  2EUL A;  2CH7 B;  1M57 B;  4I0X B;  1FKA O;  5DN6 G;  4DW1 A;  1N0N A;  2GSM B;  4DV4 O;  3B2E E;  4J42 A;  4MTG A;  4CBC A;  5GTH Z;  4TWK A;  1GM8 A;  1Q43 A;  4X1Y A;  1OCR C;  1VIB A;  3J81 N;  1FXV A;  2ITC C;  4WFA V;  1AVM A;  2OCC C;  2Y0I A;  1XNQ B;  1FJG O;  1QCE A;  3K9A A;  4D7S A;  3FAV B;  2P7T C;  2F95 B;  4HBN A;  2LO1 A;  3OAA G;  2XAG A;  2QR4 A;  2L6L A;  1PL4 A;  1P84 F;  5EK0 A;  2XAJ A;  1J95 A;  2W6J G;  1ZSP A;  1IBM B;  3U10 A;  5C8Y B;  5A9G A;  4I9Q A;  1K97 A;  1YTF D;  3WG7 C;  1XEQ A;  1HNX B;  5LP6 C;  4DW0 A;  3Q4H B;  4OX9 B;  3BFR A;  3WFV A;  2LQT A;  2ZCE A;  3HPL C;  4UCU A;  1OCZ C;  1COW G;  4HNA A;  4G27 B;  4PA9 A;  1FFX B;  4B3M O;  1XNQ O;  3UO2 A;  4Q6G A;  2DWE C;  3EVK A;  1GTO A;  5L3D A;  5EYP B;  1YIT V;  2V4D A;  1I0H A;  3K04 A;  1VQL V;  2YIC A;  1VF7 A;  1DLB A;  5KHJ A;  2JJ1 G;  2JRI A;  4X89 A;  3K57 A;  3HR0 A;  3K58 A;  2Y69 C;  5FNV A;  2Q4P A;  2Q0O C;  3E86 A;  5C8Y A;  1SRY A;  2ZE5 A;  3JAL A;  1AP5 A;  3K3W A;  3CCU V;  4K8Z A;  2UXC O;  2FML A;  3M7M X;  4HAM A;  1YSC A;  3CCJ V;  2O57 A;  1N32 O;  1GO3 F;  2RQ6 A;  2RDC A;  3ABU A;  5LGT A;  1SKV A;  4DR7 B;  3OEE G;  2P6J A;  4WBN B;  4I50 B;  3U11 A;  1Z5W A;  1N36 B;  4GX1 A;  3D8C A;  1RPR A;  4G28 B;  1NS1 A;  4R50 A;  2RMK B;  1RP3 B;  1H8E G;  4O4L B;  1SF9 A;  3RYI B;  2YXH A;  4ASU G;  1ORQ C;  3JSN A;  3M99 B;  1NVP B;  4UVC A;  4LF7 B;  1HDJ A;  4MVO A;  1FXK C;  3D36 C;  1Q7Y W;  1PP9 H;  4QIW F;  1VQ4 V;  3SYO A;  1N34 O;  3SYP A;  1P7G A;  2ZE7 A;  3ABT A;  4GLX A;  2ZR2 A;  3VQX A;  1JJO A;  3X2Q C;  4CC5 A;  4JTD B;  1IXM A;  3CC2 V;  1VQ9 V;  3JD0 A;  4LF6 B;  4JI6 O;  5EBL C;  1IXB A;  2ZR3 A;  1KKD A;  1QU7 A;  2GTS A;  4H13 B;  2ZNJ A;  4LF9 O;  1FXK A;  2HLD G;  4B7K A;  4YY3 O;  1Q90 D;  2LFS A;  4JYA B;  2QJ1 A;  5JCO C;  5ITZ B;  2UXD O;  1NI8 A;  2DYS C;  4LFC B;  2YI8 A;  4U7N A;  3K59 A;  5B3S B;  3CRC A;  2UXB O;  2HG5 C;  4QGP A;  3AG1 B;  5F2V O;  1TGO A;  5CBH A;  1F4M A;  1H38 A;  1L1F A;  2OYQ A;  4I55 B;  3B09 A;  2N74 A;  1SES A;  4QJF B;  5L3C A;  1S77 D;  1TUB A;  4NTX A;  4MVS A;  4DUY B;  3CC4 V;  3ZCC A;  3RFR A;  4AQY O;  4MW3 A;  1XNR B;  3S3X A;  2ZE6 A;  4UCV A;  5L3E A;  3B77 A;  3DGE A;  1T5E A;  1IBL O;  1MOF A;  3RYF A;  1KBH A;  4I4T B;  5L3B A;  1L8D A;  2WSS G;  3I56 V;  1IDS A;  4LP8 A;  3Q4H A;  4HYO A;  2YIB D;  1ARO P;  2A3Q A;  5KUK A;  4FLY A;  1FAF A;  4TUY A;  5KLV H;  4TV9 B;  2EBO A;  4DR3 O;  1EM1 A;  3VQY A;  5KA5 A;  3BRC A;  3DXR B;  1YI2 V;  3DTU B;  1QBZ A;  3RVY A;  1YJN V;  2Q7H A;  1HNW B;  1R6T A;  4CS3 A;  2P67 A;  4O4J A;  3LSU A;  1P7B A;  4AQY B;  3IAY A;  3G4S V;  2OCC B;  2FTK A;  5IWA O;  4IL6 Z;  5CB4 A;  3FFQ A;  2E3C A;  2GTA A;  3ZRW A;  4BW9 A;  2E5L B;  4QPJ A;  3JAR A;  5LA6 A;  3CCL V;  3E22 A;  2KB1 A;  4UV9 A;  4LF6 O;  5E1A C;  4D6T H;  2PI4 A;  4AHC A;  1CXZ B;  4X66 B;  4O2A A;  4DR4 B;  5CA0 B;  4J10 A;  1R73 A;  3ASN C;  4WFB V;  3OGI B;  4EFB A;  3R66 A;  3LUT B;  3ASN B;  2VQF B;  4OX9 O;  5EYP A;  3A8T A;  5EC1 C;  1Q6I A;  2M6Y A;  4WFH A;  4FMT A;  4ZHQ A;  4HZ3 A;  3WG7 B;  3BA8 A;  4PD4 F;  4WF9 V;  2PY5 A;  3W7U A;  1VP7 A;  1OCC B;  5JQG A;  5BXZ A;  1RPO A;  4MSW C;  2QM8 A;  4L87 A;  4DV7 O;  2Z3Y A;  5FPR A;  3BVO A;  4DUY O;  1PKX A;  4MTX A;  2BE3 A;  2JGD B;  2DYR C;  4IGG A;  1K8A W;  2N04 A;  3ZED A;  3L75 H;  5CA0 A;  4DV2 B;  1YXB A;  5EBM C;  5CMU A;  2ITD C;  1OZ0 A;  3ABK C;  4I50 A;  1K4C C;  1HNZ O;  3BEH A;  2GBO A;  2QWN B;  1ZAU A;  3LSQ A;  3ZN1 A;  3JCZ A;  3ZS8 C;  4PJ0 Z;  2P06 A;  1Y6X A;  3SDL A;  3JD4 A;  1GM7 A;  1Z2G A;  4RUF A;  4FLZ A;  4FLT A;  4ZIB A;  1PNL A;  1B06 A;  4CS2 A;  3DXR A;  5IYC O;  3H01 A;  4HNA B;  4GKJ B;  1JOY A;  1NT2 B;  2ADQ B;  2X7R B;  2ZKO A;  2OTJ V;  1E1Q G;  1S5J A;  1VQN V;  5CBF A;  1N32 B;  4TQD A;  1THZ A;  1MZE A;  2YEV A;  5E79 Z;  5IY5 C;  3OW2 U;  2HVJ C;  2AW9 A;  4P9O A;  1JQ0 A;  3A2F A;  2PYL A;  3G67 A;  2K9P A;  5EBW C;  3SYA A;  2CGN A;  2XT9 A;  1AR4 A;  4B7E A;  1HP8 A;  1TUB B;  3OT7 A;  2CGO A;  1QVG U;  2VQE B;  1HW7 A;  4DV5 O;  4DV4 B;  3J7A U;  4H0L B;  4LWS A;  3JAS B;  3JAT B;  1KQS U;  5A2Q N;  4UCO A;  1EN4 A;  1H2K A;  1KB9 F;  2KQX A;  3K0D A;  5LMN B;  1K9M W;  1IVS A;  3L72 H;  1VMG A;  1M93 A;  1KP3 A;  2RJZ A;  1CPY A;  1FJG B;  5HFM A;  3N2G A;  2VWJ A;  4JI2 O;  3CRA A;  2ZNI A;  3CCS V;  2ARH A;  5IJ9 A;  5LP6 A;  4LWS B;  4A5U B;  1XQ8 A;  1RFY A;  4X20 A;  3CXC U;  1AI4 A;  2ZIM A;  4FLU A;  3SPJ A;  4JI1 B;  4XDL A;  2B9Z A;  4C7U A;  2F43 G;  4DR6 O;  1QQC A;  5KHK A;  3B8M A;  2UXD B;  1PM9 A;  4LF5 O;  3C90 A;  2QWR B;  1YDX A;  1P49 A;  2PZS A;  1V55 B;  3QTC A;  1URF A;  3L9D A;  4IT5 A;  5IYB O;  1K4D C;  4GX0 A;  3AG1 C;  3RGB A;  3ZIA G;  3QF7 A;  1BQZ A;  3W7S A;  3JSL A;  3VQW A;  2GUZ B;  1TVK B;  3FYI B;  4B3R O;  2ZT9 B;  1WJZ A;  1J5E B;  1OJH A;  4FLV A;  3ZRS A;  4LFA O;  4YHH B;  4MTF A;  3LNM B;  1M56 B;  3VOU A;  4X20 B;  2DMX A;  1I7F A;  2EIM B;  3QVN A;  5CB4 B;  2CTW A;  1QR9 A;  4L8J A;  4CH5 A;  5LA6 B;  2F66 C;  1GH6 A;  3AG7 A;  4UVB A;  1N8R W;  2W0X A;  4JTA B;  2E75 B;  1GN4 A;  3KCX A;  5KA6 A;  1IUR A;  4DR1 O;  1AR5 A;  2UU9 B;  4BIO A;  4JI3 B;  2HR3 A;  1WAZ A;  4K35 A;  4JYY A;  4ZI7 A;  1BT8 A;  1AJP A;  1NKD A;  4RAI A;  1WA8 A;  4ZOL A;  2VRZ A;  1SQX H;  5GON B;  1WB8 A;  2BTO A;  3D36 A;  3I5D A;  3RT3 C;  3TCU A;  1YIJ V;  2IJK A;  1V9P A;  2D2C B;  5EC2 C;  4F4L A;  2IM9 A;  4FM0 A;  2CE4 A;  2PGG A;  3IC9 A;  5EZY B;  1XMQ B;  5CA1 B;  2OCH A;  4JI4 O;  3TK1 A;  4PDM A;  1KUQ A;  2QA4 V;  5GON A;  4DR2 B;  2GHY A;  1KC8 W;  1HNX O;  1O9G A;  4TV9 A;  1SS3 A;  1M90 W;  4X64 B;  2UU9 O;  4U3F H;  1Y76 A;  3OUF A;  2P4K A;  3QG5 A;  1XRE A;  2WLN A;  3S3W A;  1B6Q A;  2XTA A;  4O4I B;  2CUG A;  5H6R A;  2Q68 A;  3K06 A;  1OCO C;  5LYJ A;  2Y4U A;  2DOS A;  1YTF B;  2AHY A;  2CTP A;  2MW2 B;  3ZRW B;  3FB6 C;  4LFC O;  5LHH A;  2QKS A;  5ITZ A;  1BSM A;  1W0J G;  1N33 O;  1MA1 A;  1G4Y B;  2F23 A;  3H9V A;  2FB5 A;  3ABM B;  2N05 A;  1MSW D;  4DR7 O;  4YXW G;  1G6U A;  1ZTE A;  1IBK B;  4EB6 B;  1VQP V;  3OUS A;  2XAQ A;  1S5L Z;  2R9I A;  4F6R B;  4O4L A;  4I55 A;  4B3S O;  3VBB A;  5BR8 B;  5FNV B;  4XDK A;  3E8H A;  3FB8 C;  1K33 A;  1SER A;  2JDI G;  3FYE B;  4GUN A;  4D7T A;  3TGU H;  2ZIN A;  5B1A C;  1E79 G;  4MVZ A;  4BW5 A;  2EIJ C;  5H6Q A;  2IJH A;  1UJW B;  4UV8 A;  3AK1 A;  5TIS Z;  4I4T A;  3E2E A;  1QR8 A;  2Q67 A;  3CPW U;  3BCC H;  4DR1 B;  4TSF G;  1M57 C;  2CDY A;  3OR7 C;  4IIJ B;  3EHB B;  3FD9 A;  4EFE A;  2C2A A;  4P9P A;  1KEC A;  1Q6H A;  1RSO A;  2YEV B;  3NR7 A;  3L73 H;  3WB0 A;  2F93 B;  2WLM A;  1F4N A;  4DRX A;  2E74 B;  1JX9 A;  1MMM A;  3BHP A;  2DN9 A;  5HFL A;  5EIB D;  4NXM O;  4K0K O;  1Y66 A;  3MHH C;  5B5E Z;  2LW1 A;  1LR1 A;  5CN0 A;  1TUE B;  3SJB C;  3P3N A;  5IJ9 B;  1F51 A;  4JV5 O;  3KKY A;  3MAQ A;  2Q8V A;  2QE7 G;  3HKD A;  5FPO A;  5KHH A;  3RBZ A;  4JI8 O;  1YEW A;  2M7W A;  3FX7 A;  4F6R A;  4PV1 B;  4ZI7 B;  5DEC A;  5JJE B;  4FZ0 A;  4X64 O;  3G80 A;  4ZBM A;  3OTF A;  2NN4 A;  2DYR B;  2YC0 A;  3JD1 A;  4UB6 Z;  1VQ5 V;  4FPP A;  3GB7 C;  3HKC B;  4FFB B;  4Z1V A;  4TT3 G;  1Q82 W;  4H33 A;  3W7T A;  2Q6A A;  3BPZ A;  5B3S C;  4H44 B;  3UT5 B;  5CBG A;  2R70 A;  3FB7 C;  4ABM A;  3NXS A;  5BZB A;  5IDJ A;  4UUJ C;  3JYC A;  2GUZ A;  2GDS A;  1MAB G;  4X88 A;  4X66 O;  2ATK C;  4KUM A;  3UM7 A;  4FZ1 A;  2UUA B;  3ASO C;  3EXA A;  3ETQ A;  2QM7 A;  2HHH B;  1Z5V A;  2Q0A A;  5CA3 A;  4JI5 B;  2ZDI C;  3ZJZ A;  4CS4 A;  4DV7 B;  1VQ8 V;  1WB7 A;  3RVZ A;  4YHH O;  5L3G A;  3RYC A;  1I94 O;  2WLL B;  2QM4 A;  4JAU A;  5LOV B;  2DQ0 A;  1AI6 A;  4MW8 A;  2Z5U A;  2FYU H;  4PI2 A;  4MTO A;  3IFX A;  2OIG A;  3ZHQ A;  4B08 A;  4JF3 A;  3ZRV A;  5JWP A;  1DF5 A;  4ZOL B;  4TQF A;  3B40 A;  1EZV H;  2XND G;  3RN4 A;  2AZ2 A;  4DR2 O;  2VS0 A;  2WPD G;  3ABL C;  4JI7 B;  4UVA A;  1UFI A;  3HKC A;  2UXX A;  3ICX A;  2PYJ A;  1BHB A;  2YI9 A;  4DRX B;  4EKW A;  3T1H B;  3ETD A;  2WAM A;  4KXR A;  1R3J C;  2ETN A;  1QHT A;  1HNZ B;  5JVD B;  4J9Y B;  4LH6 A;  1K92 A;  4PDR A;  1I5X A;  4IIJ A;  5LXT B;  5JJJ B;  1SQP H;  3T1C A;  5IWA B;  3DC5 A;  4DXW A;  4JI2 B;  4IYH A;  5B1N A;  5IE9 A;  3N2G B;  3THO A;  5JJN B;  3PJS K;  3M8A A;  1ZX3 A;  2JS3 A;  2Q73 A;  2EZP A;  2CTQ A;  1SZT A;  1CP9 A;  2BTQ B;  2DW4 A;  5LHI A;  2JEU A;  2KKW A;  2IH1 C;  4DV3 O;  4DV5 B;  1PPJ H;  4NVP A;  2QTO A;  3JAW B;  4UCR A;  5KMG A;  3AK2 A;  4LF7 O;  2LGQ A;  3HKB B;  1NJI W;  1B3Q A;  5DM6 V;  1JPX A;  1K73 W;  1S72 V;  3AG4 B;  3ML0 A;  2X6C A;  4LH7 A;  1K3E A;  5GTI Z;  5FL7 G;  3CRM A;  3IGA C;  4I9W A;  3ASO B;  1R6N A;  3CYO A;  1IX9 A;  1P4R A;  4JPR A;  1OCO B;  3P3P A;  1VF5 B;  4R6Z A;  2IW5 A;  3OE7 G;  4X1K A;  3TJT A;  3OGC C;  4UB8 Z;  3ABK B;  1SQG A;  1G1X B;  2P90 A;  1ZL8 A;  4BIU A;  2KG7 B;  1Y67 A;  1M1K W;  1KD1 W;  2YUA A;  3LDE A;  4JI7 O;  2VWK A;  4RUE A;  4YY3 B;  2EIL B;  3E8F A;  4DV2 O;  5L3F A;  4K3A A;  1W59 A;  4WBN A;  3G6B A;  1AJN A;  4JAS A;  4IHJ B;  3ZBH A;  3OMN B;  5CA1 A;  4FM2 A;  4F6E A;  3H1I H;  3BAB A;  2WA4 A;  1GM9 A;  1R6K A;  2AXT Z;  4FVM A;  4MS2 A;  1IBK O;  4XDJ A;  1XHX A;  1YJ9 V;  3ETG A;  4O4I A;  2EIL C;  3FKS G;  3ZHT A;  3STZ C;  2WLL A;  4O2B A;  5LOV A;  4LF4 O;  1NQT A;  4X9Q A;  1NH2 B;  4LF8 B;  4IYI A;  2PF4 E;  1OV9 A;  4GKK O;  1JCH A;  2WWW A;  4DYL A;  2HKO A;  2AHZ A;  4E2L A;  2JS5 A;  3U0Z A;  4O4H B;  1XUQ A;  5KUM A;  1MG1 A;  2ZDI A;  2QGN A;  1HR0 O;  3CS5 A;  1QLN A;  5JVD A;  1IZ3 A;  2EIM C;  2EIK C;  1NR7 A;  2E5L O;  4AIL C;  2IBZ H;  4U3J A;  4CZZ A;  3X2Q B;  4CH4 A;  3SPG A;  3SJA C;  2Q5Z A;  1M5I A;  3CCR V;  2PTM A;  4DR5 B;  1DK1 A;  1VEW A;  1ZUQ A;  3CJH A;  1A32 A;  3ZX6 A;  4PA4 A;  3FB5 C;  5LMU B;  1KYO F;  1NTK H;  3QO7 A;  4JAA A;  4U7O A;  2W0F C;  5KX5 B;  2IU0 A;  1YJW V;  2B5U A;  3D3Q A;  1DGS A;  4X62 O;  2QKA A;  1BE3 H;  2XAF A;  5KAI Z;  4NB5 A;  3A0H Z;  3MD0 A;  4DUZ O;  3T1Y B;  4YIO A;  1QVF U;  1WNS A;  3LNN A;  1UPG A;  2KG7 A;  1FFX A;  2QWP B;  4RWU A;  1H2L A;  2P22 C;  2Q7G A;  3N27 A;  5KHI A;  4LBE C;  1N0J A;  2F1M A;  1FYJ A;  4W4L A;  4LF8 O;  2BOC C;  4UCS A;  2CAZ C;  2WLH A;  1JJ2 U;  1VAR A;  3JD3 A;  2DJV A;  4GKK B;  1Q3E A;  3CME V;  1F23 A;  1SQF A;  2CK3 G;  3ZMZ A;  3AEI A;  2JVD A;  1PV0 A;  1EFR G;  4KL1 A;  4LNU A;  3ZMU A;  1Q86 W;  4J41 A;  3RYC B;  2RNB A;  4DR4 O;  3OMA B;  4J11 A;  4GYC B;  1ZWI C;  4JI1 O;  3LDD A;  2GV9 A;  1L0L H;  4RO2 A;  3TET A;  4LC1 A;  3SPH A;  1AR1 B;  1RM1 B;  3OR6 C;  2JK5 C;  1I5Y A;  5B1B C;  1K7D A;  1ZLZ A;  2B1I A;  1X59 A;  4J80 A;  2KSD A;  2NR5 A;  5LMU O;  2A79 B;  1SA0 A;  1XNR O;  3AG3 B;  1N34 B;  1IBL B;  2LJ2 A;  3UCS C;  1V54 C;  4X8A A;  4DV6 B;  2ADP A;  4RQF A;  5IY5 B;  1D5A A;  2EX3 A;  1GKF A;  4DUZ B;  4DV1 O;  2LFR A;  1OHH G;  2IU3 A;  2R72 A;  4O4H A;  1RSO B;  3K0G A;  1MZF A;  1JFF A;  4JI4 B;  4LF9 B;  3E8B A;  1Y76 B;  2EJ7 A;  4NKG B;  3F7V C;  4N21 A;  2H3O A;  4GX5 A;  5D5P A;  4J9Z B;  4BWA A;  3ZRX A;  3SYQ A;  3K5N A;  5J2U B;  4K8X A; 
#chains in the Genus database with same CATH homology
 4P2Z A;  2PI5 A;  1S3J A;  5L3B A;  2WLM A;  1F4N A;  1K34 A;  1VQM V;  1JX9 A;  2WSS G;  4PA3 A;  2XAS A;  3F5W C;  5H9C A;  1EBO A;  5HFL A;  2JEX A;  3I56 V;  3B8N A;  4LP8 A;  3HB3 B;  4HYO A;  1Y66 A;  3MHH C;  1ARO P;  1CEZ A;  1YHQ V;  2MK3 A;  3D3I A;  5CN0 A;  5KUK A;  3STL C;  1TUE B;  4MVR A;  3ZN0 A;  2OTL V;  1F51 A;  2EBO A;  2QE7 G;  5KA5 A;  1YI2 V;  2IJI A;  1QBZ A;  3DTU B;  3RBZ A;  3RVY A;  1YJN V;  3OEH G;  2M7W A;  2P67 A;  1P7B A;  3AG4 C;  4QNH B;  4ZBM A;  1AJQ A;  3K03 A;  1BHA A;  3G4S V;  3GWO A;  3P30 A;  2DYR B;  4PA7 A;  1K5S A;  2OCC B;  3JD1 A;  2FTK A;  1VQ5 V;  1M56 C;  3ZRW A;  3R65 A;  4QPJ A;  4FPP A;  3GB7 C;  3CCL V;  1Q82 W;  4TT3 G;  2KB1 A;  4UV9 A;  4H33 A;  3W7T A;  5E1A C;  2PI4 A;  3QNE A;  1DTO A;  2Q6A A;  5B3S C;  1VQ7 V;  2EZO A;  4WFG A;  5CBG A;  3AG3 C;  3FB7 C;  3NXS A;  5BZB A;  5IDJ A;  4UUJ C;  3JYC A;  1R73 A;  3ASN C;  1MAB G;  4X88 A;  4WFB V;  2ATK C;  4KUM A;  3UM7 A;  4QPK A;  3W7W A;  1PNK A;  2YSU B;  3LUT B;  1PNM A;  3ASN B;  3LDC A;  4Q20 A;  3OFN G;  3ASO C;  3ZMT A;  4QE9 A;  5EC1 C;  4GX2 A;  3CC7 V;  3E8G A;  2R9R B;  4WFH A;  4FMT A;  4WCE V;  2QM7 A;  4GCZ A;  1RM1 C;  1E1R G;  5CA3 A;  4HZ3 A;  4P30 A;  4I5S A;  3AG2 B;  3WG7 B;  2ZDI C;  3ZJZ A;  4WF9 V;  1VQ8 V;  3RVZ A;  3MHS C;  5L3G A;  4R7C A;  3W7U A;  1NH2 D;  2JJ2 G;  2WLL B;  1OCC B;  4JAU A;  2W6I G;  4MVM A;  2DQ0 A;  1AI6 A;  1RPO A;  2IH3 C;  4MSW C;  4MW8 A;  2A9H A;  2QM8 A;  2Z5U A;  4L87 A;  3CCQ V;  4PEL A;  1PL0 A;  3E35 A;  2V7Q G;  2UXN A;  4MTO A;  3K08 A;  3IFX A;  2DWD C;  2Z3Y A;  2K1E A;  2Y48 A;  2DQ3 A;  1FXK B;  1R3I C;  1PKX A;  4MTX A;  1G8M A;  4JF3 A;  3ZRV A;  1DF5 A;  2DYR C;  1K8A W;  3ZMV A;  2XND G;  2XOK G;  4MVU A;  5EBM C;  5CMU A;  2ITD C;  1OZ0 A;  2D3O W;  2WPD G;  3ABK C;  3ABL C;  1K4C C;  4UVA A;  2UXX A;  3T2M A;  3BEH A;  1S0V A;  3OMI B;  3LSQ A;  1BHB A;  3ZN1 A;  4EKW A;  3JCZ A;  3ETD A;  1ROP A;  2X6A A;  2HFE C;  2NNU A;  2WAM A;  1R3J C;  4FIP C;  1OCZ B;  2EJR A;  4JTC B;  3JD4 A;  4J9Y B;  1GM7 A;  2BOB C;  4QE7 A;  4RUF A;  3CP1 A;  4WFF A;  1K92 A;  1PNL A;  4PDR A;  1I5X A;  5IYC O;  1S5H C;  3H01 A;  4MVQ A;  3T1C A;  4N23 A;  2EIN B;  3E83 A;  1JOY A;  4DXW A;  1JVM A;  5B1N A;  2X7R B;  2OTJ V;  4JGS A;  1E1Q G;  2LP7 A;  1VQN V;  3PJS K;  5CBF A;  1XL6 A;  5B1A B;  5IYD O;  2EIJ B;  2EZP A;  4Z1M G;  3G71 V;  1SZT A;  1THZ A;  2YEV A;  3EFF K;  5IY5 C;  3OW2 U;  1CP9 A;  3QO8 A;  3CCM V;  3ETE A;  1R3K C;  2DW4 A;  1AI7 A;  2HVJ C;  4KFM A;  5LHI A;  2JEU A;  2Y69 B;  2IH1 C;  4P9O A;  3W7X A;  4RQE A;  1JQ0 A;  1GMG A;  4JYB A;  3QO5 A;  2A0L A;  4DO2 A;  4XBF A;  2Q69 A;  5EBW C;  3SYA A;  2QTO A;  4UXN A;  1FXH A;  2ZQM A;  1R3L C;  1LNQ A;  1NJI W;  5DM6 V;  1JPX A;  1QVG U;  1K73 W;  1S72 V;  1H2G A;  3AG4 B;  3ML0 A;  5LGU A;  2X0L A;  2X6C A;  4BIZ A;  3T4D A;  1K3E A;  2QEX V;  5FL7 G;  1V55 C;  3IGA C;  1FFT B;  4I9W A;  3ASO B;  1R6N A;  1BL8 A;  1KQS U;  5J9P C;  3CYO A;  1P4R A;  4JPR A;  1OCO B;  3ZMS A;  1SET A;  3K0D A;  4R6Z A;  1EZJ A;  2IW5 A;  3OE7 G;  1K9M W;  3CD6 V;  4KP4 A;  1M9N A;  3OGC C;  2JIZ G;  2WLJ A;  1KP3 A;  3ABM C;  3ABL B;  3ABK B;  1M57 B;  1CPY A;  1K5Q A;  2P90 A;  5DN6 G;  5B1B B;  5HFM A;  2GSM B;  4BIU A;  3E89 A;  1M1K W;  1KD1 W;  2B1G A;  3LDE A;  3KG2 A;  4MTG A;  3CCS V;  1Y4M A;  4CBC A;  4JYC A;  4RUE A;  4TWK A;  5B1O A;  3E8F A;  1GM8 A;  2EIL B;  2WLK A;  3JD2 A;  1OCR C;  1OCR B;  1FXV A;  2ITC C;  5L3F A;  4WFA V;  2OCC C;  4PA6 A;  3CXC U;  1AI4 A;  1QCE A;  1AJN A;  4JAS A;  3K9A A;  3SPJ A;  1W2B U;  2P7T C;  3OMN B;  3OAA G;  4XDL A;  2XAG A;  2F43 G;  5EK0 A;  2XAJ A;  1J95 A;  1GM9 A;  1R6K A;  2W6J G;  3B8M A;  4MS2 A;  4XDJ A;  2EIK B;  1YJ9 V;  4GT1 A;  3ETG A;  5LBQ A;  1VQ6 V;  1K97 A;  1ENV A;  2EIL C;  1YTF D;  1V55 B;  4LCU C;  3FKS G;  3STZ C;  3WG7 C;  2WLL A;  5IYB O;  3G6E V;  1K4D C;  4OXS A;  1NQT A;  4GX0 A;  3K79 A;  1NH2 B;  2V1D A;  1V54 B;  3AG1 C;  2WLI A;  3LSS A;  1JCH A;  3WFV A;  2WWW A;  1VQK V;  3ZIA G;  2H94 A;  5LHG A;  3HPL C;  3W7S A;  2HKO A;  2AHZ A;  4E2L A;  1OCZ C;  1COW G;  3FYI B;  3SYC A;  4G27 B;  4PA9 A;  2HVK C;  3ZRS A;  1H8H G;  4MTF A;  5KUM A;  1WPX A;  2DWE C;  1MG1 A;  2X6B A;  1GTO A;  3LNM B;  5L3D A;  2ZDI A;  3IC7 A;  1YIT V;  1M56 B;  3K04 A;  2ZXW B;  1VQL V;  3VOU A;  1QLN A;  3SPC A;  4G2K A;  2EIM C;  1DLB A;  2EIK C;  2EIM B;  3CCV V;  1NR7 A;  2JJ1 G;  4X89 A;  1QR9 A;  4CZZ A;  3T4Z A;  3X2Q B;  1NR1 A;  3SPG A;  4UVB A;  2Y69 C;  3CCR V;  1N8R W;  4JTA B;  3E86 A;  1SRY A;  4PA4 A;  3FB5 C;  3K3W A;  4JAV A;  4WFE A;  3CCU V;  2DYS B;  3QO7 A;  4U7O A;  1S76 D;  2W0F C;  1KP2 A;  2IU0 A;  5KA6 A;  4HAM A;  1YSC A;  1YJW V;  3CCJ V;  2B5U A;  2HR3 A;  1GO3 F;  3ABU A;  2EIN C;  5LGT A;  1AJP A;  1DF4 A;  1NKD A;  2XAF A;  3F7Y C;  3OEE G;  4RAI A;  4BAY A;  2P6J A;  3MD0 A;  1VQO V;  4PDL A;  1QVF U;  1AI5 A;  4FK5 C;  3SPI A;  1WLE A;  3D36 A;  4GX1 A;  5GW7 A;  1FS0 G;  1RPR A;  3TCU A;  1YIJ V;  4G28 B;  2IJK A;  4R50 A;  4H37 A;  1Q81 W;  5EC2 C;  4F4L A;  1H8E G;  4LBE C;  1HWY A;  2XAH A;  1XL4 A;  3I55 V;  2BOC C;  3A0R A;  1JJ2 U;  2OT5 A;  2WLH A;  3TK1 A;  3JD3 A;  4PDM A;  2QA4 V;  3CME V;  2GHY A;  1KC8 W;  1W0K G;  1ORQ C;  4ASU G;  1NVP B;  3M99 B;  1F23 A;  2CK3 G;  3UKM A;  4UVC A;  3ZMZ A;  3AEI A;  1M90 W;  4MVO A;  1FXK C;  2H8P C;  2IJJ A;  1Q7Y W;  3OUF A;  2WLN A;  4QIW F;  1EFR G;  1VQ4 V;  1B6Q A;  3SYO A;  3SYP A;  2NLJ C;  3ZMU A;  3ABT A;  1Q86 W;  5H6R A;  5C93 A;  2ZR2 A;  3X2Q C;  2Q68 A;  3OMA B;  3K06 A;  4JTD B;  1OCO C;  1IXM A;  3CC2 V;  3CMA V;  1YTF B;  5LGN A;  2AHY A;  1VQ9 V;  1ZWI C;  3JD0 A;  3ZRW B;  3FB6 C;  1NVP D;  3LDD A;  5EBL C;  2ZR3 A;  5LHH A;  1KKD A;  4RO2 A;  2QKS A;  3TET A;  1GK9 A;  2ZXW C;  4LC1 A;  3SPH A;  1AR1 B;  1W0J G;  1RM1 B;  3OR6 C;  2JK5 C;  1G4Y B;  1FXK A;  2HLD G;  1I5Y A;  5B1B C;  1K7D A;  3ABM B;  2LFS A;  2B1I A;  2ZD9 A;  1MSW D;  3SJQ C;  4YXW G;  3CCE V;  2A79 B;  1VQP V;  2DYS C;  3OM3 B;  3OUS A;  2XAQ A;  1NBM G;  2R9I A;  3AG3 B;  4U7N A;  4R8C A;  4PDV A;  3VBB A;  5B3S B;  1PD3 A;  4ZKI A;  4XDK A;  2HG5 C;  3E8H A;  3FB8 C;  1K33 A;  1SER A;  2JDI G;  1V54 C;  3AG1 B;  3FYE B;  4X8A A;  1BMF G;  4RQF A;  5IY5 B;  5CBH A;  1F4M A;  1H38 A;  4FJC C;  1GKF A;  1L1F A;  1OCC C;  5B1A C;  1E79 G;  2LFR A;  3RW0 A;  2WLI B;  4MVZ A;  4BW5 A;  2EIJ C;  1OHH G;  1QLE B;  2IU3 A;  5H6Q A;  2IJH A;  3K0G A;  1SES A;  4UV8 A;  3BY6 A;  1UJW B;  1QLE C;  3E8B A;  4QJF B;  3E2E A;  3AG2 C;  1QR8 A;  2Q67 A;  5L3C A;  3CPW U;  1S77 D;  3F7V C;  4N21 A;  4MVS A;  3P32 A;  4GX5 A;  4J9Z B;  4TSF G;  3CC4 V;  3ZCC A;  1M57 C;  3ZRX A;  3OR7 C;  4MW3 A;  3SYQ A;  3EHB B;  4MT8 A;  5L3E A;  2HJF C;  3DGE A;  2C2A A;  3B77 A;  4P9P A;  1KEC A;  2YEV B;  1MOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...