4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
4MVMA 2HVJC 3AG1C 2WLJA 2QKSA 4R50A 4QNHB 4J9ZB 1R3JC 5CBFA 4CBCA 2EINC 4MW8A 3SYCA 3JYCA 2WLIB 4LP8A 4RUEA 4RO2A 3KG2A 1OCOC 2X6AA 2ZD9A 4WFGA 1BL8A 4JTAB 2IH3C 2IH1C 1G4YB 2EIJC 2QTOA 2WLHA 2HJFC 3E8GA 3OR7C 4I9WA 4JTCB 2EIKC 4DXWA 3IFXA 2OCCC 2WLMA 3FB6C 3STLC 5KUKA 3K03A 3F7YC 2WLIA 2HFEC 1V54C 4R8CA 4PDRA 3T1CA 5CBGA 4RUFA 3ABKC 4GX1A 4F4LA 1P7BA 4MSWC 3K04A 2WLLA 3T4DA 2AHYA 3E83A 2KB1A 1R3KC 4EKWA 2DWDC 2WLLB 2P7TC 3UKMA 3AG4C 5IY5C 2ZXWC 1M56C 4HYOA 4QE9A 4PA6A 4PA4A 4PDVA 2BOBC 4G28B 4PDMA 1XL4A 3SPCA 3UM7A 2NLJC 2HVKC 3SPGA 3K06A 4PA7A 5EK0A 5CBHA 3PJSK 2JK5C 4BW5A 5BZBA 4P2ZA 3K0DA 5B1AC 3WG7C 3RVYA 3SPIA 3GB7C 2W0FC 3F7VC 4TWKA 3SJQC 3TCUA 3E8BA 1S5HC 4P9OA 4PA9A 3FB5C 2BOCC 2WLNA 3LUTB 1ZWIC 2EIMC 2H8PC 2DYRC 4PA3A 3OUSA 2Q69A 3E86A 4MVOA 4R6ZA 4X8AA 1V55C 3VOUA 3SPHA 1J95A 3F5WC 4X88A 4ZBMA 2Q67A 5EBLC 3ABMC 3OR6C 3E8FA 2Q6AA 2A0LA 3ASNC 3BEHA 4XDJA 3R65A 3RBZA 2EILC 4WFFA 1OCRC 3IGAC 4P30A 3LDDA 3OGCC 4R7CA 5EBWC 2X6BA 3T4ZA 4LBEC 2ATKC 2DWEC 4GX2A 3ABLC 3RVZA 4HZ3A 3X2QC 2R9RB 1JVMA 2ITDC 4WFEA 4MS2A 4G27B 1QLEC 3RW0A 2AHZA 1LNQA 4WFHA 4P9PA 5EC1C 5J9PC 1M57C 2YEVA 4LCUC 2HG5C 3LNMB 3SYAA 4QE7A 2ITCC 3E89A 5EBMC 5E1AC 5KUMA 4MW3A 5B1BC 4MTOA 3LDCA 1ORQC 2A79B 1R3LC 4GX0A 3OUFA 4H33A 4XDLA 3T2MA 3E8HA 4OXSA 1K4CC 2Q68A 2X6CA 2Y69C 4MTGA 4RAIA 4J9YB 3SYQA 4UUJC 3ZRSA 3LDEA 1R3IC 4JTDB 1OCZC 4MVUA 3TETA 3STZC 3FB8C 4XDKA 2K1EA 4GX5A 1K4DC 4H37A 4X89A 3K0GA 1OCCC 3AG3C 4MVRA 5EC2C 5B3SC 2A9HA 1KKDA 4MVSA 4KFMA 4MTFA 4PDLA 3SYPA 3ZJZA 3SPJA 2DYSC 3HPLC 3EFFK 3FB7C 3ASOC 3SYOA 4MVZA 2WLKA 3AG2C 3K08A 4MVQA 1XL6A
chains in the Genus database with same CATH superfamily
3VBBA 1QCEA 2ZE7A 3RYFA 4I55B 5K1XA 4CBCA 1FXKC 5IYZA 3CXCU 4DV1B 4DRXB 2YS8A 1QU7A 2CH7B 4OPHA 2XUMA 1Q7YW 1K9MW 3K9SA 3QTCA 4FFKA 4DK0A 1UJWB 4DK1A 3T1CA 1YJ9V 3L9DA 3FAVB 1R1BA 2GHYA 5L3DA 3UKMA 3RN4A 1AI6A 3HKBA 2BOBC 2H3OA 5LGTA 4EFBA 5IJ9B 3GWKC 4LH7A 1R6TA 3CCUV 4LF5B 3ZN1A 1IXBA 4KL1A 3SPIA 4TWKA 3HKCB 4B3TO 1GAXA 1QHTA 3ZRWB 1K8AW 1RFYA 1VP7A 4FLUA 3JSNA 4X8AA 4WCEV 1V55C 3N2GB 4ZOLB 5J2TA 5E79Z 2LFRA 1KMIZ 1AVMA 3R65A 1VQKV 3IGAC 1FXKB 1OCRB 1PL4A 5IYBO 3L74H 2IBZH 3Q4HA 5J9PC 4X1YB 3DXRB 4WFAV 3E89A 3OMAB 1SF9A 1ORQC 5CA0A 3ZMZA 2X7RB 3CMEV 3T2MA 1WA8B 1Q86W 3TGUH 2QEXV 4YJ3B 5JQGA 3ZHSA 4PJ0Z 2LO1A 5FNVA 1YCIA 4W4KA 1NQTA 3IAYA 2EZOA 4J7KA 3BA8A 2HHHO 2F93B 1SZTA 1THZA 4DUYO 1GN3A 3QO7A 1NTKH 4ZI7A 5JVDA 3HKCA 4NVPA 4QPJA 2P06A 4LFAB 1N34O 2NR5A 2ZM6B 4JTAB 2ADQB 3WFVA 4DXWA 1XREA 1JFFB 3RYCB 3K58A 1N34B 3K5LA 2ZIOA 3D36A 3OGIB 3HR0A 1AR1B 2ZXWC 4PHZA 1VQOV 4G28B 4F6RA 4LF8B 2E5LO 3T1HO 3A2FA 4DRXA 1N36B 4I50B 3FKSG 4X1IB 1NH2B 3AK1A 3QO5A 2Q4PA 4I55A 4DR6O 1W0KG 2Q0AA 2N04A 2PI4A 4FMTA 3ETDA 2UUAB 1YI2V 3RYHA 4NTXA 2IU0A 2RNBA 4FFBB 3ZHQA 3BPZA 3SJBC 3QG5A 1QVFU 1TAEA 4WFFA 2GTAA 2PF4E 1HNZO 4JI0B 1GH6A 4LBEC 1SQGA 1WPBA 1CXZB 1JA8A 4YJ2B 4UV9A 4G27B 1KUQA 3RW0A 5CMUA 5C93A 1IVSA 1I94B 3D3IA 5B1NA 5KUMA 1Q81W 5CB4A 3G6BA 4GX0A 1XMQB 3OMIB 1KP3A 2Q68A 2RDCA 1H2SB 1H8HG 1WN7A 4UVCA 3T1YO 3APOA 3JSLA 2IM9A 4TSFG 5LMUO 2W6JG 3CC4V 4OPAA 1TVKB 5EC2C 2ZE8A 2A9HA 3AG1B 3SYPA 3ZJZA 3OEEG 1RPOA 1CP9A 1YF2A 2ZQMA 4MVQA 1NVPB 2YXHA 1I08A 4LFAO 2FTKA 3SJCC 4PI2A 5HFMA 4LNUA 2WLIB 5CB4B 5IJ0A 1YTFB 4LF5O 2Z5UA 1MZEA 2CAZC 4DR5B 2HFEC 4Q6GA 1V54C 4R8CA 4D7SA 2JGDB 4RUFA 2QDOA 4F4LA 4FPPA 1F51A 1PNMA 3D8CA 5FL7G 4FLZA 2B5UA 3WG7B 2F66C 3CP1A 3L71H 2Q5ZA 5D5QA 4JI7B 2DOSA 5LA6A 2UXXA 2GUZB 4EB6B 3CEIA 3CCMV 3RT3C 4DW1A 3UM7A 5ITZA 2UUAO 3ABMB 4CS3A 2WA3A 2JK5C 1FXVA 2O57A 4DV6O 2W0FC 2GSMB 4DV7O 3EXAA 5IE9A 3CC2V 4F6RB 3ZCCA 4JYAO 4ZBMA 1Y4MA 5EBLC 1WB8A 4XDJA 3A8TA 1DLBA 5KMGB 3I56V 3X2QC 4HAMA 1JVMA 4X66B 5LP6A 4WFEA 4LFCB 1QLEC 2LGQA 2YEVA 5CA1A 2ITCC 3K3WA 3MD0A 4DR1O 3HKEB 3WB1A 4YHHO 2FYUH 1KU9A 4OXSA 3QNEA 1SERA 2QM7A 4IL6Z 4UUJC 4O4LA 5EIBD 1XHZA 3J80N 1S77D 4N23A 3AEIA 3DGEA 4NKGB 5DN6G 4ASUG 1K92A 4KFMA 1PL0A 5KX5A 5L3BA 2DYSC 3HPLC 3ICXA 4D6TH 4DUZO 3SYOA 2PI5A 1JMKC 3AG4B 2UXDB 2JS5A 2FKXA 4CH5A 4DV0O 1ZUQA 3MAQA 4YXWG 3K5MA 4B3SO 4YIPA 4FM2A 3D36C 2E3CA 2ARHA 4BIUA 3G67A 4LP8A 3K5NA 2YICA 5LXTA 2PTMA 2X6AA 1F7YA 2IH3C 1Y66A 4DR3B 1AI5A 2WLMA 4X9QA 5KHKA 2W0XA 2PYLA 1GM9A 3L72H 1AROP 1W0JG 1S76D 2ETNA 1P4RA 2KB1A 1ZL8B 1KBHA 1W2BU 4GLXA 4B3RO 3ZMTA 3H1JH 5J2TB 1FYJA 3N2GA 3HKDA 1M56B 3K59A 4IIJB 3JARA 1J5EB 1H8EG 4K0KO 5LMNB 3AK3A 4X1KA 3E22A 1BHBA 3FB5C 4IIJA 1N33B 1NI8A 4LF6O 4I4TA 5DECA 2QGNA 1HR0O 1I7FA 3U0ZA 2DE0X 3E8FA 2NNUA 1PNLA 3I55V 4FLVA 2XAHA 4WFBV 2ATKC 4GX2A 2YC0A 5K1PA 4O4LB 4UCOA 1I0HA 2QKCA 4CS4A 1VMGA 3SDLA 2QTSA 2HG5C 2JIZG 4TV9B 1ZLZA 3ZRVA 3JAKA 4MTOA 1G8MA 4X1KB 4NXNB 4DR6B 1K4CC 4MTGA 3SYQA 4B7KA 3OE7G 1U97A 1BMFG 5B3SC 4TUYB 4CZZA 2QM4A 2RJZA 4MVMA 5JJEB 1JPXA 1TGOA 4WF9V 4UCTA 4WBNB 1V9PA 3QVNA 1WNSA 1OCOC 4UCVA 2CTQA 1EM1A 5ITZB 4Z2WA 4DR7B 3A0RA 4UCRA 2LW1A 4KUMA 4JPRA 3T4DA 2AHYA 4EKWA 2JGDA 1M56C 2KG7B 3FYIB 3W7TA 4PA4A 2B9ZA 4PDMA 3ZS8C 5EZYA 2HVKC 2Q9LA 2YSUB 4IYHA 3OD4A 4LWSB 4LNUB 5B1AC 3CMAV 5DM6V 3CCQV 2QWPB 1BGYH 1S72V 1HNZB 2P67A 3L70H 3BRCA 2F1MA 2YIAA 4IYIA 4DV5O 1FD9A 1CPYA 1Z2GA 2RQ6A 1N32O 3LSUA 1TVKA 4DV7B 1VQ5V 1L1FA 3UT5B 4K35A 3ASNB 2FL4A 4DV6B 4X1IA 1N32B 1XNRO 2R72A 3RYIA 1K73W 1JCHA 1A32A 1M57C 4I50A 1HR0B 3AG7A 4LF4O 2QA4V 2UUCO 3OTFA 2E5LB 5B1BC 1N33O 4TQFA 2ZR2A 3W7UA 1BHAA 2Y69C 4YJ2A 2KKWA 3ML0A 1IBKB 2DN9A 2F4VO 1J5EO 1VQ4V 4H37A 3K0GA 1K97A 1KKDA 1KKCA 2QR4A 3OM3B 2WLKA 3RYCA 1ZAUA 1ZTEA 2EJRA 3A0BZ 1XQ8A 4JAUA 4B3TB 3SYCA 1VQ6V 4RUEA 1Z5WA 2JVDA 1VQLV 2ZD9A 1FXHA 4DR7O 1SQBH 1O9GA 4Q20A 2R9IA 3OW2U 4ABMA 4DR4B 3CXHF 1F4MA 2Q73A 3W7SA 2DMXA 5LHGA 3JATA 1SQXH 5LGNA 2QSAA 1B6QA 1EZVH 2XAJA 2P7TC 2PUSA 1D2DA 3BA9A 3GVMA 3H1HH 2ZE6A 3QO8A 1VEWA 2UXBB 3NR7A 1Q6HA 2EINB 1Q6UA 4JF3A 2YXYA 1L8DA 5EK0A 3DXRA 4I7ZB 4RWUA 3P3NA 1N0NA 1MZFA 2K9PA 1YHQV 5IYDO 1D5AA 2WLNA 1ZWIC 3ZIAG 2H8PC 1IBLB 4J7JA 5DEDA 5LGUA 3RYIB 1R73A 1S3JA 1IURA 4LFCO 2Z0AA 3ASNC 2NN4A 4U7NA 1JJOA 2QE7G 4GUNA 1B3QA 1N8RW 4JI8B 1YJNV 3N2KB 4AI8A 1SQQH 1FKAO 2A7WA 3T1HB 2XOKG 3FD9A 3JCUZ 3Q4HB 4ZHQA 4JAVA 4J11A 3FX7A 1F4NA 3RWRD 4DV3O 3L73H 2VWKA 1E1RG 3ZHRA 2UUBB 2HKOA 2XASA 1P84F 1YZBA 2KG7A 5IY5B 2D3OW 1V55B 3CSXA 3GWOA 3CYOA 4YJ3A 5JQGB 1XDCA 2BSKB 2VQFO 1OZ0A 2A06H 2VQEB 2UU9O 3KG2A 3JD3A 4DR4O 3JARB 3VQYA 2X0LA 3K9AA 3E8GA 1WB7A 4L8JA 4LF8O 1VQ7V 5KUKA 4J42A 4H0LB 3CE2A 3OT7A 3WU2Z 3LSQA 1URFA 4GX1A 2OTLV 4F6EA 1OCZB 2FB5A 2IJIA 5JJJB 4DV0B 2RCVA 4HYOA 4PA6A 3JAWB 1XL4A 1K3EA 2EJ7A 4AILC 3K06A 2EIMB 3MHSC 4GKJB 5LXTB 4GKKB 4P9OA 4UB8Z 4UV8A 2BOCC 5CA0B 1SC5B 3UT5A 3JAKB 3SJAC 4R6ZA 1AI7A 4C7UA 1NR7A 4X88A 1VF6C 3S3XA 1M9NA 4B3RB 4B7EA 4ICGA 2Q7EA 1H2NA 3IC9A 4X64B 5GW7A 2YDEA 2QWOB 2V7QG 1M5IA 3BVOA 4WFHA 1S0VA 2V1DA 3AK2A 5KHIA 5EBMC 4DR3O 2AZ2A 1NT2B 3ZRWA 5KAIZ 1RM1B 3B09A 5HFLA 5CA1B 3VQWA 5CA3A 2ZNIA 2EIJB 2CGOA 3JALB 4B3SB 1S5JA 3EVKA 1MSDA 2AXTZ 3STZC 5BMVB 1B06A 2BCCH 4MVRA 4PDLA 5TISZ 1NJIW 1YEWA 1SQVH 1PP9H 1XHXA 2B1GA 1VQ8V 4U7OA 1Z5VA 5C8YB 4H44B 3JYCA 1VQPV 4O4JA 4RO2A 4O4IA 1AILA 1SA0B 2HJFC 5IYZB 4JYBA 5LL6Y 1NBMG 4BAYA 4FM1A 3TJTA 3AG3B 5LMUB 4CC6A 4O2BA 1K34A 3JALA 5J2UA 2C2AA 1NVPD 5FPRA 4BR6A 2XT9A 3W7WA 3O65A 2YIBA 4UCUA 4DR1B 4JYAB 1MABG 1BQ0A 1MA1A 4X62O 1NS1A 4MTXA 3PJSK 5JCOA 4O4IB 4P2ZA 4DV2B 4GKKO 3WG7C 3JASA 4GYCB 2ZKOA 4GKJO 2ZR3A 2CDYA 4ZKIA 1NH2D 2DYRC 2E76B 3HB3B 3BAAA 4DV4O 2HR3A 3SPHA 2EIKB 4DV5B 4LC1A 4U3JA 2Q6AA 2LGWA 1Q3EA 1H2MA 4B3MO 1WP8A 1X4TA 3HKDB 1OCOB 3JAWA 3CCEV 4WBNA 2VQEO 1KECA 2ILMA 1B04A 2X6CA 2Q8VA 4I0XA 3LDEA 1IBMO 1R3IC 1ZL8A 4JTDB 1OCZC 3H01A 3P32A 2XAGA 3ABKB 4JI2O 2H94A 2DW4A 3BCCH 5B66Z 2R9AA 2HVJC 3LSSA 1R3JC 2YIBD 1G6UA 3BFRA 2EINC 3CRQA 3LNNA 5L3GA 4JYCA 2IH1C 2XAFA 3CCJV 3UCSC 1WPXA 1L0NH 2WLIA 1HNXO 5CN0A 1I5YA 2BTQB 4PDRA 4EFEA 2HLDG 2BTOA 5A2QN 4KP4A 1EN4A 2D2CB 5IY5C 2ZCEA 4NTYA 1K33A 4UCSA 3IJ4A 1XI1A 4QGPA 3SPGA 1VF6A 1KB9F 2UXCO 5CBHA 5B1OA 5F2VO 3E2EA 5LBQA 3KCYA 1Q8IA 1SETA 3TCUA 5H5NA 1LR1A 3ZHUA 4PD4F 4UVAA 4PA3A 4E4EA 4MVOA 5B1AB 1SRYA 4TQDA 4FK5C 2Q0OC 2A0LA 2WSSG 3J81N 2Y69B 2JEUA 1H2LA 1ZX3A 3RVZA 3MHHC 1M4UA 4DV2O 5FPOA 2P4VA 4AQYB 2B1IA 2ZNJA 4PELA 4JZ2A 3H9VA 5KA5A 2N05A 1YVWA 4TV8B 1AP6A 1KQSU 4KHPO 1FFXB 5LA6B 3CPWU 1KD1W 2KQXA 4QPKA 2PZSA 1U96A 3FB7C 4ZOLA 2Y0PA 3KCXA 1Y74B 2VWJA 1GRJA 1AJNA 2P90A 1IBMB 1SESA 4MW8A 3EHBB 4FIPC 3KZIZ 5BXZA 4PI0A 4DR5O 1JFFA 3WB2A 2Y4TA 2QTOA 2XAQA 4I9WA 5L3CA 4JI4O 1AB3A 2EIKC 1N4CA 2HEPA 3IFXA 2W6IG 3ZMVA 2PGGA 3D3QA 1D5NA 4MSWC 1TUBA 4FLWA 2WLLB 1AP5A 3K57A 3CRAA 1OV9A 1DK1A 2M7WA 5D5PA 1M90W 1MSWD 4PDVA 2VS0A 3TK1A 2CH7A 3G80A 1EN5A 3N27A 4CC5A 3CRCA 5BZBA 1OJHA 5IWAB 2BE3A 1BSMA 4LH6A 2EIMC 1V54B 4JI3B 4YIOA 4LF4B 3N2KA 4AQYO 5B5EZ 3ABMC 5L3EA 3CCRV 1LUVA 2Z3YA 3LDDA 5GONB 1OHHG 1I5XA 3S3WA 5IWAO 1GN4A 4HZ3A 4KHPB 4LWSA 1F23A 2OCHA 3SYAA 1IDSA 3WB0A 5KA6A 2F95B 2QWRB 2DQ0A 5H2FZ 1XNRB 3E8HA 4J9YB 1HNWB 2UXCB 1GKFA 1O9HA 4XDKA 5LHIA 2UXDO 4PV1B 3K5OA 4KXRA 1BZKA 2YI8A 4IT5A 5KLVH 3AG2C 4NXMB 1VF7A 1QLEB 2MW2B 1H38A 4K8XA 2QKSA 2CTPA 3JATB 4J9ZB 5KHHA 1PKXA 5KAFZ 1WLEA 4UFZA 1PM9A 3APQA 4FLXA 2MK3A 2Q7GA 5JWPA 1BL8A 2EIJC 2L35A 3K79A 2F43G 3K03A 3F7YC 1H2GA 2DYRB 2EX3A 4TUYA 4IHJA 3B40A 1P7BA 2EULA 1NKDA 1IXMA 1BT8A 1HW7A 1QVGU 4JI6O 4QE9A 1HNXB 2EBOA 4DO2A 2OCCB 4LR3A 1GN6A 3J7AU 3DTUB 4ZIBA 2LW7A 2ZM6O 2ZXWB 3DC6A 1US6A 3K0DA 1E79G 5BY1A 2LFSA 2WWWA 4OX9O 1UPGA 1S5HC 1P49A 4DUYB 1H2KA 3E86A 4NXMO 1HWYA 1DGSA 3JD0A 1ZSPA 4O2AA 5LYJA 3MDSA 3JD2A 2OTJV 1Q6IA 1SZXA 4JI7O 2R70A 3U11A 2JGUA 4JI5B 3CCLV 4FZ1A 1JR9A 2CTWA 3ZHTA 3A0HZ 1FAFA 1MMMA 2LP7A 1MG1A 4JV5B 4TV9A 4LF6B 2JRIA 1R3LC 2QWNB 1QBZA 4I5SA 2WPDG 1N36O 1PV0A 1QR8A 1RPRA 3ETQA 2ZDIA 3L75H 3VQXA 5EZYB 3ZN0A 4NYKA 1OCCC 4FLYA 2BTQA 4MVSA 1AI4A 2YI9A 3DC5A 5EYPA 4JI3O 3OTOO 3AG1C 4FVMA 1FFXA 3E22B 3PN1A 4TT3G 1DF4A 4TOIA 4H13B 4K0KB 4FLTA 4IGGA 1EZJA 2Q7HA 4L87A 4WFGA 2WLHA 4JTCB 2UUCB 2GBOA 1AJPA 1COWG 2OCCC 4J41A 1VQNV 2XNDG 5CBGA 2ZINA 1KP2A 2OWOA 5LOVB 2DWDC 4HNAB 2HHHB 5B3SB 3ABUA 3M99B 4UVBA 3SPCA 4I4TB 1GK9A 2E75B 4HBNA 4YY3O 3FFQA 5GTHZ 1RP3B 2KSDA 2EZPA 1JJ2U 1Y67A 2LQTA 3GB7C 3X2QB 1PPJH 2ZDIC 1Q82W 2XTAA 4U3JB 3F5WC 2G38A 4HNAA 3THOA 3TXQA 1SKVA 4DV4B 3BEHA 4FJCC 2EILC 5EBWC 2X6BA 2ZE5A 4LFBB 2DWEC 2M6YA 4D7TA 3R66A 1AR4A 4MS2A 4P9PA 1XNQO 3LNMB 4MT8A 3IC7A 1GM7A 4JI6B 3RYFB 5LP6B 5LMNO 1GTOA 2CUGA 4MVUA 3TETA 3UO3A 3ZRXA 1X59A 4CH6A 1K4DC 4X89A 1L0LH 2JEXA 5KX5B 4O2AB 3ASOC 4G2KA 1FFTB 4QNHB 3ABLB 4FZ0A 1K5QA 1BE3H 4A5UB 3OTOB 3RFRA 1QNMA 1G4YB 3H1IH 3H1KH 4OGQB 1DTOA 5H6RA 1S5LZ 3ZBHA 3CB2A 4EEQA 2IJKA 5B1BB 1XMOB 1OCCB 5KHGA 5KMGA 4JI5O 3ZHVA 3E83A 5EYPB 3AG2B 2IJJA 1SS3A 1TA8A 1VARA 2OYQA 4GZRB 1W59A 2JDIG 2QM8A 1EN6A 2NLJC 1BCCH 1WAZA 1K5SA 4Z1VA 3T1YB 3CS5A 5KHJA 5A9GA 3ZEDA 4JI1O 1XMQO 4JGSA 1M1KW 3LUTB 3HKEA 1Y76B 5GONA 3CJHB 3ETEA 2Y48A 3OUSA 3VQVA 3VOUA 4UXNA 2YEVB 1VQMV 5H6QA 1CEZA 1J95A 4FM0A 4X66O 1QR9A 5J2UB 4JI8O 4P30A 3QF7A 3ZMSA 1NR1A 2OIGA 5JH7A 4IHJB 4X65O 5LYJB 2GDSA 3CC7V 2AZ0A 1EBOA 5JJNB 2DYSB 5E1AC 1KC8W 1IBLO 1DF5A 1MNGA 3ZMUA 1YITV 3B77A 4H33A 3O9OA 1YDXA 3F5TA 4X20A 1XILA 1XEQA 2K1EA 3C3TA 4E2LA 1P7GA 2DJVA 4EB6A 1XOUA 3EFFK 4K3AA 2Y0IA 4JI4B 3RYHB 3OMNB 5BMVA 1T5EA 4I9QA 4DV3B 1RSOB 2UU9B 2WLJA 1R6KA 4AHCA 4JASA 1XMOO 5JVDB 4ZI7B 2WAMA 3P3PA 3B2EE 5LP6C 3OR7C 1AJQA 2UXBO 4UB6Z 5IDJA 3G4SV 1MOFA 3CD6V 1FJGO 3CCVV 2WLLA 1R3KC 4ZHQB 2RN9A 4YHHB 1SQFA 1WP7A 2P4KA 4PA7A 4BIZA 1M93A 1NU1H 3ABTA 3SJQC 3C90A 4NB5A 2JS3A 4PA9A 4LF9O 1QQCA 4Z1MG 2UXNA 3E35A 2P6JA 4JI2B 3JD1A 5BR8O 1VF5B 1Y6XA 3RBZA 3OFNG 4JAAA 1FPOA 5IT9N 1TUBB 4JI1B 3ABLC 2WA4A 2Y4UA 3W7XA 4LFBO 4QJFB 1JQ0A 3CHXA 2ITDC 1ENVA 4J10A 3G71V 3M7MX 4CH3A 4B08A 4YY3B 3JD4A 3CJHA 4MW3A 1Y76A 1M57B 1E1QG 3OUFA 4XDLA 4DR2O 2ZT9B 2BSKA 4GCZA 5AG2A 2JJ1G 4QIWF 3FAVA 2E74B 4BIOA 2IW5A 5LHHA 1AR5A 4J7ZA 3SPJA 4BWAA 1EFRG 4U3FH 4MVZA 3K08A 5FNVB 1XL6A 4LF9B 4R50A 5IYCO 1NTZH 2IJHA 5CBFA 1WA8A 4TV8A 2PY5A 2CE4A 1RSOA 4JZGA 2LJ2A 4X62B 4GT1A 2PYJA 1GO3F 1GMGA 1UFIA 1PNKA 3FB6C 1SQPH 4W4LA 1XUQA 1I94O 3ETGA 1JOYA 3K04A 1YSCA 1Q90D 1FXKA 1Y74A 1BS3A 2JJ2G 3OEHG 2RMKB 1TUEB 4JV5O 1GN2A 4LF7B 2YIDA 4BW5A 4B3MB 1HNWO 3RVYA 2VRZA 3F7VC 1VIBA 5IJ9A 3I5DA 3HKBB 4X1YA 2V4DA 2HP8A 3OR6C 3SGIA 2OT5A 1OCRC 4R7CA 1BQZA 3OGCC 2QWQB 1QLNA 4DYLA 1PD3A 4O4HB 3M8AA 3CX5F 4NXNO 4RQFA 1LNQA 2OIEA 4LF7O 4LCUC 4DW0A 2F23A 1Q43A 2A79B 2QKAA 4X65B 5H9CA 4OX9B 4N21A 1NTMH 3KKYA 4JYYA 3OAAG 1XBLA 4O2BB 3FB8C 1FJGB 3C3SA 2QJ1A 3B8NA 4MTFA 2P5OA 3BY6A 3UO2A 3NXSA 2IU3A 2CK3G 1SA0A 2A3QA 1IX9A 4X20B 1YIJV 1YJWV 3CWBH 2F4VB 1Q5OA 2YUAA 4I0XB 4RQEA 4O4JB 2XHBA 3RGBA 1LUWA 3SR2C 1R6NA 4CS2A 3BHPA 3JAMN 3STLC 3ZX6A 3JCZA 3CRRA 4BW9A 2DQ3A 5JH7B 3ABKC 1YTFD 2VQFB 3B4SA 4K8ZA 4JI0O 2AGAA 2EILB 3AG4C 1NZ6A 5BR8B 4DR2B 1K7DA 4DUZB 5L3FA 2CTRA 3CCSV 2N74A 3U10A 5IJ0B 3JASB 4J80A 5JCOC 5GTIZ 1FS0G 2HJDA 2CGNA 1JX9A 3UQ8A 3E8BA 1RM1C 1N0JA 4X64O 1GM8A 2GV9A 1YXBA 2Q69A 3FYEB 3H1LH 3P30A 1XNQB 2Q67A 3TXSA 2GTSA 1WJZA 3DSQA 2ADPA 3B8MA 2UUBO 3T4ZA 2ZIMA 1IBKO 1ROPA 2P22C 2R9RB 3CRMA 2YXLA 2AHZA 5EC1C 4QE7A 5FLXN 1VQ9V 4NTWA 1HDJA 1HP8A 3LDCA 4NR1A 2AW9A 3BABA 2FMLA 4CH4A 5C8YA 1KYOF 4RAIA 2L6LA 2ODMA 3G6EV 3ZRSA 4O4HA 5LOVA 1IZ3A 5EIBC 4GX5A 1G1XB 3AG3C 3ASOB 4XBFA 2GUZA 4FFBA 4DV1O
chains in the Genus database with same CATH topology
4MVMA 2HVJC 1JPXA 3VBBA 4QNHB 1QCEA 3LSSA 1R3JC 4WF9V 3ABLB 4CBCA 2EINC 1K5QA 1FXKC 5L3GA 4JYCA 1OCOC 3CXCU 2IH1C 1G4YB 1Q7YW 2XAFA 1K9MW 1DTOA 5H6RA 3CCJV 1WPXA 3A0RA 2WLIA 1UJWB 2IJKA 5CN0A 5B1BB 1I5YA 4PDRA 3T1CA 2HLDG 1YJ9V 1OCCB 4KUMA 4JPRA 3T4DA 2AHYA 2GHYA 5L3DA 3E83A 4EKWA 4KP4A 3AG2B 2IJJA 3UKMA 5IY5C 1M56C 1AI6A 3FYIB 3W7TA 1K33A 4PA4A 2BOBC 2JDIG 4PDMA 2QM8A 5LGTA 2NLJC 3CCUV 2HVKC 3SPGA 1K5SA 5CBHA 5B1OA 2YSUB 3E2EA 3ZN1A 5LBQA 5B1AC 3SPIA 4TWKA 1SETA 5DM6V 3CMAV 3TCUA 4JGSA 3CCQV 1M1KW 3LUTB 3ZRWB 1S72V 1K8AW 2P67A 3ETEA 2Y48A 4PA3A 3OUSA 4UVAA 4MVOA 5B1AB 4X8AA 4WCEV 1SRYA 1V55C 3VOUA 4UXNA 2YEVB 1VQMV 5H6QA 1CEZA 1J95A 4FK5C 1CPYA 2LFRA 2A0LA 1QR9A 2WSSG 3R65A 1VQKV 3IGAC 4P30A 2Y69B 1FXKB 1VQ5V 1L1FA 1OCRB 2JEUA 3ASNB 1NR1A 3ZMSA 3RVZA 3MHHC 5IYBO 5J9PC 1K73W 1JCHA 3CC7V 1M57C 1EBOA 2DYSB 2B1IA 2QA4V 4WFAV 4PELA 3E89A 5E1AC 1KC8W 3OMAB 5B1BC 1ORQC 1DF5A 3ZMZA 2ZR2A 2X7RB 3ZMUA 5KA5A 3CMEV 1YITV 3B77A 4H33A 3T2MA 3W7UA 1KQSU 2Y69C 1BHAA 1Q86W 3CPWU 1KD1W 3ML0A 2QEXV 4QPKA 2K1EA 1VQ4V 4H37A 4E2LA 3K0GA 1K97A 1KKDA 1NQTA 2EZOA 3FB7C 3EFFK 3OM3B 1SZTA 2WLKA 3OMNB 1THZA 1AJNA 2EJRA 3QO7A 2P90A 2WLJA 1R6KA 4JAUA 1SESA 4JASA 4MW8A 4QPJA 3SYCA 3EHBB 4FIPC 1VQ6V 2WAMA 4RUEA 1VQLV 2ZD9A 1FXHA 4JTAB 3OR7C 2QTOA 2XAQA 4I9WA 1AJQA 4Q20A 2R9IA 3WFVA 2EIKC 4DXWA 5L3CA 3OW2U 3IFXA 2W6IG 3ZMVA 5IDJA 1F4MA 3W7SA 1MOFA 3G4SV 5LHGA 3CD6V 3CCVV 4MSWC 3D36A 2WLLA 5LGNA 1R3KC 1B6QA 2XAJA 2WLLB 2P7TC 1AR1B 2ZXWC 2M7WA 1M90W 1MSWD 1VQOV 4PDVA 4G28B 3QO8A 2EINB 3TK1A 4JF3A 4PA7A 5EK0A 4BIZA 5BZBA 1YHQV 3FKSG 5IYDO 1NH2B 3QO5A 3ABTA 3SJQC 1W0KG 4PA9A 2WLNA 2PI4A 1ZWIC 3ZIAG 2EIMC 1V54B 4FMTA 2H8PC 4Z1MG 2UXNA 3ETDA 1YI2V 2IU0A 3E35A 5LGUA 2P6JA 1R73A 1S3JA 3ABMC 3JD1A 5L3EA 3CCRV 3ASNC 1QVFU 2Z3YA 3RBZA 4WFFA 3OFNG 3LDDA 4U7NA 4LBEC 1OHHG 3ABLC 2QE7G 1I5XA 3W7XA 4QJFB 4HZ3A 1N8RW 1JQ0A 2ITDC 4UV9A 1ENVA 1F23A 4G27B 3RW0A 3G71V 5CMUA 5C93A 1YJNV 3D3IA 3SYAA 5B1NA 3JD4A 5KUMA 4MW3A 5KA6A 1M57B 1E1QG 2DQ0A 1Q81W 4GX0A 3OUFA 3OMIB 4XDLA 1KP3A 3E8HA 2XOKG 2Q68A 4J9YB 1H8HG 4JAVA 4UVCA 1F4NA 4GCZA 2JJ1G 4QIWF 1GKFA 4TSFG 4XDKA 1E1RG 2W6JG 3CC4V 2HKOA 5LHIA 2IW5A 5EC2C 5LHHA 2A9HA 3AG1B 3SYPA 2XASA 3ZJZA 3OEEG 3SPJA 1EFRG 1RPOA 5IY5B 2D3OW 1CP9A 1V55B 4MVZA 3GWOA 3AG2C 3CYOA 2ZQMA 3K08A 4MVQA 1NVPB 1QLEB 1H38A 1XL6A 4R50A 2QKSA 5IYCO 4J9ZB 2FTKA 2IJHA 1PKXA 5CBFA 1WLEA 5HFMA 2WLIB 1OZ0A 2MK3A 3KG2A 1YTFB 2Z5UA 3JD3A 1BL8A 4GT1A 2EIJC 2X0LA 3K9AA 1GO3F 3E8GA 3K79A 1GMGA 1VQ7V 1PNKA 3FB6C 5KUKA 2F43G 3K03A 3F7YC 1H2GA 2HFEC 3LSQA 1V54C 2DYRB 4R8CA 4RUFA 4GX1A 3ETGA 1P7BA 4FPPA 1F51A 1PNMA 3K04A 4F4LA 2OTLV 1JOYA 1YSCA 5FL7G 1FXKA 2B5UA 3WG7B 1NKDA 3CP1A 1OCZB 1IXMA 2JJ2G 2IJIA 2UXXA 1QVGU 4HYOA 4QE9A 2EBOA 3OEHG 4PA6A 4DO2A 3CCMV 1TUEB 2OCCB 1XL4A 3UM7A 1K3EA 3DTUB 3ABMB 2ZXWB 3K06A 2EIMB 3MHSC 2JK5C 4BW5A 1FXVA 3K0DA 1E79G 2LFSA 3RVYA 2WWWA 2W0FC 3F7VC 1S5HC 4P9OA 4UV8A 2BOCC 2GSMB 3E86A 4R6ZA 1AI7A 1NR7A 3CC2V 3ZCCA 1HWYA 3JD0A 4X88A 4ZBMA 1Y4MA 3JD2A 5EBLC 1M9NA 2OTJV 3OR6C 4XDJA 2OT5A 1OCRC 4R7CA 3OGCC 1DLBA 5GW7A 1QLNA 1PD3A 3I56V 3X2QC 4HAMA 2V7QG 1JVMA 3CCLV 4WFEA 1QLEC 4RQFA 1LNQA 4WFHA 2YEVA 1S0VA 4LCUC 2LP7A 1MG1A 2ITCC 2V1DA 3K3WA 5EBMC 3MD0A 3ZRWA 1RM1B 5HFLA 2A79B 1R3LC 5CA3A 4OXSA 2EIJB 3QNEA 4N21A 2QM7A 5H9CA 1SERA 4UUJC 1QBZA 3OAAG 4I5SA 2WPDG 1S77D 4N23A 3AEIA 3STZC 1QR8A 1RPRA 3FB8C 3DGEA 2ZDIA 3ZN0A 5DN6G 1OCCC 4MVRA 1K92A 4MVSA 4KFMA 3B8NA 1PL0A 4MTFA 4PDLA 4ASUG 2DYSC 3HPLC 5L3BA 2PI5A 3SYOA 1NJIW 3BY6A 3AG4B 1AI4A 3NXSA 2IU3A 2CK3G 1YIJV 2B1GA 1YJWV 3AG1C 4YXWG 4RQEA 1VQ8V 4U7OA 4TT3G 1DF4A 4BIUA 3JYCA 1VQPV 4LP8A 4RO2A 1R6NA 1EZJA 2X6AA 4L87A 4WFGA 2IH3C 1Y66A 2WLHA 4JTCB 1AI5A 2HJFC 1AJPA 1COWG 2OCCC 2WLMA 3STLC 4JYBA 3JCZA 1NBMG 4BAYA 1VQNV 2XNDG 2DQ3A 5CBGA 3ABKC 3AG3B 1YTFD 1GM9A 1AROP 1W0JG 1S76D 1KP2A 2KB1A 1P4RA 2DWDC 1K34A 1W2BU 2EILB 2C2AA 3AG4C 1K7DA 3ZMTA 1NVPD 5B3SB 3ABUA 3M99B 5L3FA 4UVBA 3W7WA 3SPCA 1MABG 1GK9A 1M56B 4MTXA 3CCSV 3PJSK 1H8EG 4P2ZA 2EZPA 1JJ2U 1FS0G 3WG7C 3GB7C 1JX9A 3E8BA 1BHBA 3X2QB 1RM1C 3FB5C 2ZR3A 1GM8A 4ZKIA 1NH2D 2DYRC 2Q69A 3HB3B 2ZDIC 1Q82W 3FYEB 2HR3A 3SPHA 3P30A 2EIKB 3F5WC 2Q67A 4LC1A 3E8FA 2NNUA 1PNLA 2Q6AA 3BEHA 4FJCC 3I55V 2EILC 3B8MA 2XAHA 5EBWC 4WFBV 2X6BA 3T4ZA 2ATKC 2DWEC 4GX2A 1ROPA 2R9RB 4MS2A 2AHZA 5EC1C 4P9PA 2HG5C 3LNMB 4QE7A 1VQ9V 2JIZG 3ZRVA 4MTOA 3LDCA 4MT8A 1OCOB 3IC7A 3CCEV 1G8MA 1GM7A 1KECA 1K4CC 2X6CA 4MTGA 4RAIA 3SYQA 3G6EV 3ZRSA 1GTOA 3LDEA 3OE7G 1R3IC 4JTDB 1OCZC 3H01A 4MVUA 3TETA 3ZRXA 3P32A 2XAGA 4GX5A 1K4DC 1BMFG 4X89A 5B3SC 3ABKB 3AG3C 2JEXA 3ASOB 4XBFA 4CZZA 2H94A 3ASOC 2DW4A 4G2KA 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVM A;  2HVJ C;  3AG1 C;  2WLJ A;  2QKS A;  4R50 A;  4QNH B;  4J9Z B;  1R3J C;  5CBF A;  4CBC A;  2EIN C;  4MW8 A;  3SYC A;  3JYC A;  2WLI B;  4LP8 A;  4RUE A;  4RO2 A;  3KG2 A;  1OCO C;  2X6A A;  2ZD9 A;  4WFG A;  1BL8 A;  4JTA B;  2IH3 C;  2IH1 C;  1G4Y B;  2EIJ C;  2QTO A;  2WLH A;  2HJF C;  3E8G A;  3OR7 C;  4I9W A;  4JTC B;  2EIK C;  4DXW A;  3IFX A;  2OCC C;  2WLM A;  3FB6 C;  3STL C;  5KUK A;  3K03 A;  3F7Y C;  2WLI A;  2HFE C;  1V54 C;  4R8C A;  4PDR A;  3T1C A;  5CBG A;  4RUF A;  3ABK C;  4GX1 A;  4F4L A;  1P7B A;  4MSW C;  3K04 A;  2WLL A;  3T4D A;  2AHY A;  3E83 A;  2KB1 A;  1R3K C;  4EKW A;  2DWD C;  2WLL B;  2P7T C;  3UKM A;  3AG4 C;  5IY5 C;  2ZXW C;  1M56 C;  4HYO A;  4QE9 A;  4PA6 A;  4PA4 A;  4PDV A;  2BOB C;  4G28 B;  4PDM A;  1XL4 A;  3SPC A;  3UM7 A;  2NLJ C;  2HVK C;  3SPG A;  3K06 A;  4PA7 A;  5EK0 A;  5CBH A;  3PJS K;  2JK5 C;  4BW5 A;  5BZB A;  4P2Z A;  3K0D A;  5B1A C;  3WG7 C;  3RVY A;  3SPI A;  3GB7 C;  2W0F C;  3F7V C;  4TWK A;  3SJQ C;  3TCU A;  3E8B A;  1S5H C;  4P9O A;  4PA9 A;  3FB5 C;  2BOC C;  2WLN A;  3LUT B;  1ZWI C;  2EIM C;  2H8P C;  2DYR C;  4PA3 A;  3OUS A;  2Q69 A;  3E86 A;  4MVO A;  4R6Z A;  4X8A A;  1V55 C;  3VOU A;  3SPH A;  1J95 A;  3F5W C;  4X88 A;  4ZBM A;  2Q67 A;  5EBL C;  3ABM C;  3OR6 C;  3E8F A;  2Q6A A;  2A0L A;  3ASN C;  3BEH A;  4XDJ A;  3R65 A;  3RBZ A;  2EIL C;  4WFF A;  1OCR C;  3IGA C;  4P30 A;  3LDD A;  3OGC C;  4R7C A;  5EBW C;  2X6B A;  3T4Z A;  4LBE C;  2ATK C;  2DWE C;  4GX2 A;  3ABL C;  3RVZ A;  4HZ3 A;  3X2Q C;  2R9R B;  1JVM A;  2ITD C;  4WFE A;  4MS2 A;  4G27 B;  1QLE C;  3RW0 A;  2AHZ A;  1LNQ A;  4WFH A;  4P9P A;  5EC1 C;  5J9P C;  1M57 C;  2YEV A;  4LCU C;  2HG5 C;  3LNM B;  3SYA A;  4QE7 A;  2ITC C;  3E89 A;  5EBM C;  5E1A C;  5KUM A;  4MW3 A;  5B1B C;  4MTO A;  3LDC A;  1ORQ C;  2A79 B;  1R3L C;  4GX0 A;  3OUF A;  4H33 A;  4XDL A;  3T2M A;  3E8H A;  4OXS A;  1K4C C;  2Q68 A;  2X6C A;  2Y69 C;  4MTG A;  4RAI A;  4J9Y B;  3SYQ A;  4UUJ C;  3ZRS A;  3LDE A;  1R3I C;  4JTD B;  1OCZ C;  4MVU A;  3TET A;  3STZ C;  3FB8 C;  4XDK A;  2K1E A;  4GX5 A;  1K4D C;  4H37 A;  4X89 A;  3K0G A;  1OCC C;  3AG3 C;  4MVR A;  5EC2 C;  5B3S C;  2A9H A;  1KKD A;  4MVS A;  4KFM A;  4MTF A;  4PDL A;  3SYP A;  3ZJZ A;  3SPJ A;  2DYS C;  3HPL C;  3EFF K;  3FB7 C;  3ASO C;  3SYO A;  4MVZ A;  2WLK A;  3AG2 C;  3K08 A;  4MVQ A;  1XL6 A; 
#chains in the Genus database with same CATH topology
 3VBB A;  1QCE A;  2ZE7 A;  3RYF A;  4I55 B;  5K1X A;  4CBC A;  1FXK C;  5IYZ A;  3CXC U;  4DV1 B;  4DRX B;  2YS8 A;  1QU7 A;  2CH7 B;  4OPH A;  2XUM A;  1Q7Y W;  1K9M W;  3K9S A;  3QTC A;  4FFK A;  4DK0 A;  1UJW B;  4DK1 A;  3T1C A;  1YJ9 V;  3L9D A;  3FAV B;  1R1B A;  2GHY A;  5L3D A;  3UKM A;  3RN4 A;  1AI6 A;  3HKB A;  2BOB C;  2H3O A;  5LGT A;  4EFB A;  5IJ9 B;  3GWK C;  4LH7 A;  1R6T A;  3CCU V;  4LF5 B;  3ZN1 A;  1IXB A;  4KL1 A;  3SPI A;  4TWK A;  3HKC B;  4B3T O;  1GAX A;  1QHT A;  3ZRW B;  1K8A W;  1RFY A;  1VP7 A;  4FLU A;  3JSN A;  4X8A A;  4WCE V;  1V55 C;  3N2G B;  4ZOL B;  5J2T A;  5E79 Z;  2LFR A;  1KMI Z;  1AVM A;  3R65 A;  1VQK V;  3IGA C;  1FXK B;  1OCR B;  1PL4 A;  5IYB O;  3L74 H;  2IBZ H;  3Q4H A;  5J9P C;  4X1Y B;  3DXR B;  4WFA V;  3E89 A;  3OMA B;  1SF9 A;  1ORQ C;  5CA0 A;  3ZMZ A;  2X7R B;  3CME V;  3T2M A;  1WA8 B;  1Q86 W;  3TGU H;  2QEX V;  4YJ3 B;  5JQG A;  3ZHS A;  4PJ0 Z;  2LO1 A;  5FNV A;  1YCI A;  4W4K A;  1NQT A;  3IAY A;  2EZO A;  4J7K A;  3BA8 A;  2HHH O;  2F93 B;  1SZT A;  1THZ A;  4DUY O;  1GN3 A;  3QO7 A;  1NTK H;  4ZI7 A;  5JVD A;  3HKC A;  4NVP A;  4QPJ A;  2P06 A;  4LFA B;  1N34 O;  2NR5 A;  2ZM6 B;  4JTA B;  2ADQ B;  3WFV A;  4DXW A;  1XRE A;  1JFF B;  3RYC B;  3K58 A;  1N34 B;  3K5L A;  2ZIO A;  3D36 A;  3OGI B;  3HR0 A;  1AR1 B;  2ZXW C;  4PHZ A;  1VQO V;  4G28 B;  4F6R A;  4LF8 B;  2E5L O;  3T1H O;  3A2F A;  4DRX A;  1N36 B;  4I50 B;  3FKS G;  4X1I B;  1NH2 B;  3AK1 A;  3QO5 A;  2Q4P A;  4I55 A;  4DR6 O;  1W0K G;  2Q0A A;  2N04 A;  2PI4 A;  4FMT A;  3ETD A;  2UUA B;  1YI2 V;  3RYH A;  4NTX A;  2IU0 A;  2RNB A;  4FFB B;  3ZHQ A;  3BPZ A;  3SJB C;  3QG5 A;  1QVF U;  1TAE A;  4WFF A;  2GTA A;  2PF4 E;  1HNZ O;  4JI0 B;  1GH6 A;  4LBE C;  1SQG A;  1WPB A;  1CXZ B;  1JA8 A;  4YJ2 B;  4UV9 A;  4G27 B;  1KUQ A;  3RW0 A;  5CMU A;  5C93 A;  1IVS A;  1I94 B;  3D3I A;  5B1N A;  5KUM A;  1Q81 W;  5CB4 A;  3G6B A;  4GX0 A;  1XMQ B;  3OMI B;  1KP3 A;  2Q68 A;  2RDC A;  1H2S B;  1H8H G;  1WN7 A;  4UVC A;  3T1Y O;  3APO A;  3JSL A;  2IM9 A;  4TSF G;  5LMU O;  2W6J G;  3CC4 V;  4OPA A;  1TVK B;  5EC2 C;  2ZE8 A;  2A9H A;  3AG1 B;  3SYP A;  3ZJZ A;  3OEE G;  1RPO A;  1CP9 A;  1YF2 A;  2ZQM A;  4MVQ A;  1NVP B;  2YXH A;  1I08 A;  4LFA O;  2FTK A;  3SJC C;  4PI2 A;  5HFM A;  4LNU A;  2WLI B;  5CB4 B;  5IJ0 A;  1YTF B;  4LF5 O;  2Z5U A;  1MZE A;  2CAZ C;  4DR5 B;  2HFE C;  4Q6G A;  1V54 C;  4R8C A;  4D7S A;  2JGD B;  4RUF A;  2QDO A;  4F4L A;  4FPP A;  1F51 A;  1PNM A;  3D8C A;  5FL7 G;  4FLZ A;  2B5U A;  3WG7 B;  2F66 C;  3CP1 A;  3L71 H;  2Q5Z A;  5D5Q A;  4JI7 B;  2DOS A;  5LA6 A;  2UXX A;  2GUZ B;  4EB6 B;  3CEI A;  3CCM V;  3RT3 C;  4DW1 A;  3UM7 A;  5ITZ A;  2UUA O;  3ABM B;  4CS3 A;  2WA3 A;  2JK5 C;  1FXV A;  2O57 A;  4DV6 O;  2W0F C;  2GSM B;  4DV7 O;  3EXA A;  5IE9 A;  3CC2 V;  4F6R B;  3ZCC A;  4JYA O;  4ZBM A;  1Y4M A;  5EBL C;  1WB8 A;  4XDJ A;  3A8T A;  1DLB A;  5KMG B;  3I56 V;  3X2Q C;  4HAM A;  1JVM A;  4X66 B;  5LP6 A;  4WFE A;  4LFC B;  1QLE C;  2LGQ A;  2YEV A;  5CA1 A;  2ITC C;  3K3W A;  3MD0 A;  4DR1 O;  3HKE B;  3WB1 A;  4YHH O;  2FYU H;  1KU9 A;  4OXS A;  3QNE A;  1SER A;  2QM7 A;  4IL6 Z;  4UUJ C;  4O4L A;  5EIB D;  1XHZ A;  3J80 N;  1S77 D;  4N23 A;  3AEI A;  3DGE A;  4NKG B;  5DN6 G;  4ASU G;  1K92 A;  4KFM A;  1PL0 A;  5KX5 A;  5L3B A;  2DYS C;  3HPL C;  3ICX A;  4D6T H;  4DUZ O;  3SYO A;  2PI5 A;  1JMK C;  3AG4 B;  2UXD B;  2JS5 A;  2FKX A;  4CH5 A;  4DV0 O;  1ZUQ A;  3MAQ A;  4YXW G;  3K5M A;  4B3S O;  4YIP A;  4FM2 A;  3D36 C;  2E3C A;  2ARH A;  4BIU A;  3G67 A;  4LP8 A;  3K5N A;  2YIC A;  5LXT A;  2PTM A;  2X6A A;  1F7Y A;  2IH3 C;  1Y66 A;  4DR3 B;  1AI5 A;  2WLM A;  4X9Q A;  5KHK A;  2W0X A;  2PYL A;  1GM9 A;  3L72 H;  1ARO P;  1W0J G;  1S76 D;  2ETN A;  1P4R A;  2KB1 A;  1ZL8 B;  1KBH A;  1W2B U;  4GLX A;  4B3R O;  3ZMT A;  3H1J H;  5J2T B;  1FYJ A;  3N2G A;  3HKD A;  1M56 B;  3K59 A;  4IIJ B;  3JAR A;  1J5E B;  1H8E G;  4K0K O;  5LMN B;  3AK3 A;  4X1K A;  3E22 A;  1BHB A;  3FB5 C;  4IIJ A;  1N33 B;  1NI8 A;  4LF6 O;  4I4T A;  5DEC A;  2QGN A;  1HR0 O;  1I7F A;  3U0Z A;  2DE0 X;  3E8F A;  2NNU A;  1PNL A;  3I55 V;  4FLV A;  2XAH A;  4WFB V;  2ATK C;  4GX2 A;  2YC0 A;  5K1P A;  4O4L B;  4UCO A;  1I0H A;  2QKC A;  4CS4 A;  1VMG A;  3SDL A;  2QTS A;  2HG5 C;  2JIZ G;  4TV9 B;  1ZLZ A;  3ZRV A;  3JAK A;  4MTO A;  1G8M A;  4X1K B;  4NXN B;  4DR6 B;  1K4C C;  4MTG A;  3SYQ A;  4B7K A;  3OE7 G;  1U97 A;  1BMF G;  5B3S C;  4TUY B;  4CZZ A;  2QM4 A;  2RJZ A;  4MVM A;  5JJE B;  1JPX A;  1TGO A;  4WF9 V;  4UCT A;  4WBN B;  1V9P A;  3QVN A;  1WNS A;  1OCO C;  4UCV A;  2CTQ A;  1EM1 A;  5ITZ B;  4Z2W A;  4DR7 B;  3A0R A;  4UCR A;  2LW1 A;  4KUM A;  4JPR A;  3T4D A;  2AHY A;  4EKW A;  2JGD A;  1M56 C;  2KG7 B;  3FYI B;  3W7T A;  4PA4 A;  2B9Z A;  4PDM A;  3ZS8 C;  5EZY A;  2HVK C;  2Q9L A;  2YSU B;  4IYH A;  3OD4 A;  4LWS B;  4LNU B;  5B1A C;  3CMA V;  5DM6 V;  3CCQ V;  2QWP B;  1BGY H;  1S72 V;  1HNZ B;  2P67 A;  3L70 H;  3BRC A;  2F1M A;  2YIA A;  4IYI A;  4DV5 O;  1FD9 A;  1CPY A;  1Z2G A;  2RQ6 A;  1N32 O;  3LSU A;  1TVK A;  4DV7 B;  1VQ5 V;  1L1F A;  3UT5 B;  4K35 A;  3ASN B;  2FL4 A;  4DV6 B;  4X1I A;  1N32 B;  1XNR O;  2R72 A;  3RYI A;  1K73 W;  1JCH A;  1A32 A;  1M57 C;  4I50 A;  1HR0 B;  3AG7 A;  4LF4 O;  2QA4 V;  2UUC O;  3OTF A;  2E5L B;  5B1B C;  1N33 O;  4TQF A;  2ZR2 A;  3W7U A;  1BHA A;  2Y69 C;  4YJ2 A;  2KKW A;  3ML0 A;  1IBK B;  2DN9 A;  2F4V O;  1J5E O;  1VQ4 V;  4H37 A;  3K0G A;  1K97 A;  1KKD A;  1KKC A;  2QR4 A;  3OM3 B;  2WLK A;  3RYC A;  1ZAU A;  1ZTE A;  2EJR A;  3A0B Z;  1XQ8 A;  4JAU A;  4B3T B;  3SYC A;  1VQ6 V;  4RUE A;  1Z5W A;  2JVD A;  1VQL V;  2ZD9 A;  1FXH A;  4DR7 O;  1SQB H;  1O9G A;  4Q20 A;  2R9I A;  3OW2 U;  4ABM A;  4DR4 B;  3CXH F;  1F4M A;  2Q73 A;  3W7S A;  2DMX A;  5LHG A;  3JAT A;  1SQX H;  5LGN A;  2QSA A;  1B6Q A;  1EZV H;  2XAJ A;  2P7T C;  2PUS A;  1D2D A;  3BA9 A;  3GVM A;  3H1H H;  2ZE6 A;  3QO8 A;  1VEW A;  2UXB B;  3NR7 A;  1Q6H A;  2EIN B;  1Q6U A;  4JF3 A;  2YXY A;  1L8D A;  5EK0 A;  3DXR A;  4I7Z B;  4RWU A;  3P3N A;  1N0N A;  1MZF A;  2K9P A;  1YHQ V;  5IYD O;  1D5A A;  2WLN A;  1ZWI C;  3ZIA G;  2H8P C;  1IBL B;  4J7J A;  5DED A;  5LGU A;  3RYI B;  1R73 A;  1S3J A;  1IUR A;  4LFC O;  2Z0A A;  3ASN C;  2NN4 A;  4U7N A;  1JJO A;  2QE7 G;  4GUN A;  1B3Q A;  1N8R W;  4JI8 B;  1YJN V;  3N2K B;  4AI8 A;  1SQQ H;  1FKA O;  2A7W A;  3T1H B;  2XOK G;  3FD9 A;  3JCU Z;  3Q4H B;  4ZHQ A;  4JAV A;  4J11 A;  3FX7 A;  1F4N A;  3RWR D;  4DV3 O;  3L73 H;  2VWK A;  1E1R G;  3ZHR A;  2UUB B;  2HKO A;  2XAS A;  1P84 F;  1YZB A;  2KG7 A;  5IY5 B;  2D3O W;  1V55 B;  3CSX A;  3GWO A;  3CYO A;  4YJ3 A;  5JQG B;  1XDC A;  2BSK B;  2VQF O;  1OZ0 A;  2A06 H;  2VQE B;  2UU9 O;  3KG2 A;  3JD3 A;  4DR4 O;  3JAR B;  3VQY A;  2X0L A;  3K9A A;  3E8G A;  1WB7 A;  4L8J A;  4LF8 O;  1VQ7 V;  5KUK A;  4J42 A;  4H0L B;  3CE2 A;  3OT7 A;  3WU2 Z;  3LSQ A;  1URF A;  4GX1 A;  2OTL V;  4F6E A;  1OCZ B;  2FB5 A;  2IJI A;  5JJJ B;  4DV0 B;  2RCV A;  4HYO A;  4PA6 A;  3JAW B;  1XL4 A;  1K3E A;  2EJ7 A;  4AIL C;  3K06 A;  2EIM B;  3MHS C;  4GKJ B;  5LXT B;  4GKK B;  4P9O A;  4UB8 Z;  4UV8 A;  2BOC C;  5CA0 B;  1SC5 B;  3UT5 A;  3JAK B;  3SJA C;  4R6Z A;  1AI7 A;  4C7U A;  1NR7 A;  4X88 A;  1VF6 C;  3S3X A;  1M9N A;  4B3R B;  4B7E A;  4ICG A;  2Q7E A;  1H2N A;  3IC9 A;  4X64 B;  5GW7 A;  2YDE A;  2QWO B;  2V7Q G;  1M5I A;  3BVO A;  4WFH A;  1S0V A;  2V1D A;  3AK2 A;  5KHI A;  5EBM C;  4DR3 O;  2AZ2 A;  1NT2 B;  3ZRW A;  5KAI Z;  1RM1 B;  3B09 A;  5HFL A;  5CA1 B;  3VQW A;  5CA3 A;  2ZNI A;  2EIJ B;  2CGO A;  3JAL B;  4B3S B;  1S5J A;  3EVK A;  1MSD A;  2AXT Z;  3STZ C;  5BMV B;  1B06 A;  2BCC H;  4MVR A;  4PDL A;  5TIS Z;  1NJI W;  1YEW A;  1SQV H;  1PP9 H;  1XHX A;  2B1G A;  1VQ8 V;  4U7O A;  1Z5V A;  5C8Y B;  4H44 B;  3JYC A;  1VQP V;  4O4J A;  4RO2 A;  4O4I A;  1AIL A;  1SA0 B;  2HJF C;  5IYZ B;  4JYB A;  5LL6 Y;  1NBM G;  4BAY A;  4FM1 A;  3TJT A;  3AG3 B;  5LMU B;  4CC6 A;  4O2B A;  1K34 A;  3JAL A;  5J2U A;  2C2A A;  1NVP D;  5FPR A;  4BR6 A;  2XT9 A;  3W7W A;  3O65 A;  2YIB A;  4UCU A;  4DR1 B;  4JYA B;  1MAB G;  1BQ0 A;  1MA1 A;  4X62 O;  1NS1 A;  4MTX A;  3PJS K;  5JCO A;  4O4I B;  4P2Z A;  4DV2 B;  4GKK O;  3WG7 C;  3JAS A;  4GYC B;  2ZKO A;  4GKJ O;  2ZR3 A;  2CDY A;  4ZKI A;  1NH2 D;  2DYR C;  2E76 B;  3HB3 B;  3BAA A;  4DV4 O;  2HR3 A;  3SPH A;  2EIK B;  4DV5 B;  4LC1 A;  4U3J A;  2Q6A A;  2LGW A;  1Q3E A;  1H2M A;  4B3M O;  1WP8 A;  1X4T A;  3HKD B;  1OCO B;  3JAW A;  3CCE V;  4WBN A;  2VQE O;  1KEC A;  2ILM A;  1B04 A;  2X6C A;  2Q8V A;  4I0X A;  3LDE A;  1IBM O;  1R3I C;  1ZL8 A;  4JTD B;  1OCZ C;  3H01 A;  3P32 A;  2XAG A;  3ABK B;  4JI2 O;  2H94 A;  2DW4 A;  3BCC H;  5B66 Z;  2R9A A;  2HVJ C;  3LSS A;  1R3J C;  2YIB D;  1G6U A;  3BFR A;  2EIN C;  3CRQ A;  3LNN A;  5L3G A;  4JYC A;  2IH1 C;  2XAF A;  3CCJ V;  3UCS C;  1WPX A;  1L0N H;  2WLI A;  1HNX O;  5CN0 A;  1I5Y A;  2BTQ B;  4PDR A;  4EFE A;  2HLD G;  2BTO A;  5A2Q N;  4KP4 A;  1EN4 A;  2D2C B;  5IY5 C;  2ZCE A;  4NTY A;  1K33 A;  4UCS A;  3IJ4 A;  1XI1 A;  4QGP A;  3SPG A;  1VF6 A;  1KB9 F;  2UXC O;  5CBH A;  5B1O A;  5F2V O;  3E2E A;  5LBQ A;  3KCY A;  1Q8I A;  1SET A;  3TCU A;  5H5N A;  1LR1 A;  3ZHU A;  4PD4 F;  4UVA A;  4PA3 A;  4E4E A;  4MVO A;  5B1A B;  1SRY A;  4TQD A;  4FK5 C;  2Q0O C;  2A0L A;  2WSS G;  3J81 N;  2Y69 B;  2JEU A;  1H2L A;  1ZX3 A;  3RVZ A;  3MHH C;  1M4U A;  4DV2 O;  5FPO A;  2P4V A;  4AQY B;  2B1I A;  2ZNJ A;  4PEL A;  4JZ2 A;  3H9V A;  5KA5 A;  2N05 A;  1YVW A;  4TV8 B;  1AP6 A;  1KQS U;  4KHP O;  1FFX B;  5LA6 B;  3CPW U;  1KD1 W;  2KQX A;  4QPK A;  2PZS A;  1U96 A;  3FB7 C;  4ZOL A;  2Y0P A;  3KCX A;  1Y74 B;  2VWJ A;  1GRJ A;  1AJN A;  2P90 A;  1IBM B;  1SES A;  4MW8 A;  3EHB B;  4FIP C;  3KZI Z;  5BXZ A;  4PI0 A;  4DR5 O;  1JFF A;  3WB2 A;  2Y4T A;  2QTO A;  2XAQ A;  4I9W A;  5L3C A;  4JI4 O;  1AB3 A;  2EIK C;  1N4C A;  2HEP A;  3IFX A;  2W6I G;  3ZMV A;  2PGG A;  3D3Q A;  1D5N A;  4MSW C;  1TUB A;  4FLW A;  2WLL B;  1AP5 A;  3K57 A;  3CRA A;  1OV9 A;  1DK1 A;  2M7W A;  5D5P A;  1M90 W;  1MSW D;  4PDV A;  2VS0 A;  3TK1 A;  2CH7 A;  3G80 A;  1EN5 A;  3N27 A;  4CC5 A;  3CRC A;  5BZB A;  1OJH A;  5IWA B;  2BE3 A;  1BSM A;  4LH6 A;  2EIM C;  1V54 B;  4JI3 B;  4YIO A;  4LF4 B;  3N2K A;  4AQY O;  5B5E Z;  3ABM C;  5L3E A;  3CCR V;  1LUV A;  2Z3Y A;  3LDD A;  5GON B;  1OHH G;  1I5X A;  3S3W A;  5IWA O;  1GN4 A;  4HZ3 A;  4KHP B;  4LWS A;  1F23 A;  2OCH A;  3SYA A;  1IDS A;  3WB0 A;  5KA6 A;  2F95 B;  2QWR B;  2DQ0 A;  5H2F Z;  1XNR B;  3E8H A;  4J9Y B;  1HNW B;  2UXC B;  1GKF A;  1O9H A;  4XDK A;  5LHI A;  2UXD O;  4PV1 B;  3K5O A;  4KXR A;  1BZK A;  2YI8 A;  4IT5 A;  5KLV H;  3AG2 C;  4NXM B;  1VF7 A;  1QLE B;  2MW2 B;  1H38 A;  4K8X A;  2QKS A;  2CTP A;  3JAT B;  4J9Z B;  5KHH A;  1PKX A;  5KAF Z;  1WLE A;  4UFZ A;  1PM9 A;  3APQ A;  4FLX A;  2MK3 A;  2Q7G A;  5JWP A;  1BL8 A;  2EIJ C;  2L35 A;  3K79 A;  2F43 G;  3K03 A;  3F7Y C;  1H2G A;  2DYR B;  2EX3 A;  4TUY A;  4IHJ A;  3B40 A;  1P7B A;  2EUL A;  1NKD A;  1IXM A;  1BT8 A;  1HW7 A;  1QVG U;  4JI6 O;  4QE9 A;  1HNX B;  2EBO A;  4DO2 A;  2OCC B;  4LR3 A;  1GN6 A;  3J7A U;  3DTU B;  4ZIB A;  2LW7 A;  2ZM6 O;  2ZXW B;  3DC6 A;  1US6 A;  3K0D A;  1E79 G;  5BY1 A;  2LFS A;  2WWW A;  4OX9 O;  1UPG A;  1S5H C;  1P49 A;  4DUY B;  1H2K A;  3E86 A;  4NXM O;  1HWY A;  1DGS A;  3JD0 A;  1ZSP A;  4O2A A;  5LYJ A;  3MDS A;  3JD2 A;  2OTJ V;  1Q6I A;  1SZX A;  4JI7 O;  2R70 A;  3U11 A;  2JGU A;  4JI5 B;  3CCL V;  4FZ1 A;  1JR9 A;  2CTW A;  3ZHT A;  3A0H Z;  1FAF A;  1MMM A;  2LP7 A;  1MG1 A;  4JV5 B;  4TV9 A;  4LF6 B;  2JRI A;  1R3L C;  2QWN B;  1QBZ A;  4I5S A;  2WPD G;  1N36 O;  1PV0 A;  1QR8 A;  1RPR A;  3ETQ A;  2ZDI A;  3L75 H;  3VQX A;  5EZY B;  3ZN0 A;  4NYK A;  1OCC C;  4FLY A;  2BTQ A;  4MVS A;  1AI4 A;  2YI9 A;  3DC5 A;  5EYP A;  4JI3 O;  3OTO O;  3AG1 C;  4FVM A;  1FFX A;  3E22 B;  3PN1 A;  4TT3 G;  1DF4 A;  4TOI A;  4H13 B;  4K0K B;  4FLT A;  4IGG A;  1EZJ A;  2Q7H A;  4L87 A;  4WFG A;  2WLH A;  4JTC B;  2UUC B;  2GBO A;  1AJP A;  1COW G;  2OCC C;  4J41 A;  1VQN V;  2XND G;  5CBG A;  2ZIN A;  1KP2 A;  2OWO A;  5LOV B;  2DWD C;  4HNA B;  2HHH B;  5B3S B;  3ABU A;  3M99 B;  4UVB A;  3SPC A;  4I4T B;  1GK9 A;  2E75 B;  4HBN A;  4YY3 O;  3FFQ A;  5GTH Z;  1RP3 B;  2KSD A;  2EZP A;  1JJ2 U;  1Y67 A;  2LQT A;  3GB7 C;  3X2Q B;  1PPJ H;  2ZDI C;  1Q82 W;  2XTA A;  4U3J B;  3F5W C;  2G38 A;  4HNA A;  3THO A;  3TXQ A;  1SKV A;  4DV4 B;  3BEH A;  4FJC C;  2EIL C;  5EBW C;  2X6B A;  2ZE5 A;  4LFB B;  2DWE C;  2M6Y A;  4D7T A;  3R66 A;  1AR4 A;  4MS2 A;  4P9P A;  1XNQ O;  3LNM B;  4MT8 A;  3IC7 A;  1GM7 A;  4JI6 B;  3RYF B;  5LP6 B;  5LMN O;  1GTO A;  2CUG A;  4MVU A;  3TET A;  3UO3 A;  3ZRX A;  1X59 A;  4CH6 A;  1K4D C;  4X89 A;  1L0L H;  2JEX A;  5KX5 B;  4O2A B;  3ASO C;  4G2K A;  1FFT B;  4QNH B;  3ABL B;  4FZ0 A;  1K5Q A;  1BE3 H;  4A5U B;  3OTO B;  3RFR A;  1QNM A;  1G4Y B;  3H1I H;  3H1K H;  4OGQ B;  1DTO A;  5H6R A;  1S5L Z;  3ZBH A;  3CB2 A;  4EEQ A;  2IJK A;  5B1B B;  1XMO B;  1OCC B;  5KHG A;  5KMG A;  4JI5 O;  3ZHV A;  3E83 A;  5EYP B;  3AG2 B;  2IJJ A;  1SS3 A;  1TA8 A;  1VAR A;  2OYQ A;  4GZR B;  1W59 A;  2JDI G;  2QM8 A;  1EN6 A;  2NLJ C;  1BCC H;  1WAZ A;  1K5S A;  4Z1V A;  3T1Y B;  3CS5 A;  5KHJ A;  5A9G A;  3ZED A;  4JI1 O;  1XMQ O;  4JGS A;  1M1K W;  3LUT B;  3HKE A;  1Y76 B;  5GON A;  3CJH B;  3ETE A;  2Y48 A;  3OUS A;  3VQV A;  3VOU A;  4UXN A;  2YEV B;  1VQM V;  5H6Q A;  1CEZ A;  1J95 A;  4FM0 A;  4X66 O;  1QR9 A;  5J2U B;  4JI8 O;  4P30 A;  3QF7 A;  3ZMS A;  1NR1 A;  2OIG A;  5JH7 A;  4IHJ B;  4X65 O;  5LYJ B;  2GDS A;  3CC7 V;  2AZ0 A;  1EBO A;  5JJN B;  2DYS B;  5E1A C;  1KC8 W;  1IBL O;  1DF5 A;  1MNG A;  3ZMU A;  1YIT V;  3B77 A;  4H33 A;  3O9O A;  1YDX A;  3F5T A;  4X20 A;  1XIL A;  1XEQ A;  2K1E A;  3C3T A;  4E2L A;  1P7G A;  2DJV A;  4EB6 A;  1XOU A;  3EFF K;  4K3A A;  2Y0I A;  4JI4 B;  3RYH B;  3OMN B;  5BMV A;  1T5E A;  4I9Q A;  4DV3 B;  1RSO B;  2UU9 B;  2WLJ A;  1R6K A;  4AHC A;  4JAS A;  1XMO O;  5JVD B;  4ZI7 B;  2WAM A;  3P3P A;  3B2E E;  5LP6 C;  3OR7 C;  1AJQ A;  2UXB O;  4UB6 Z;  5IDJ A;  3G4S V;  1MOF A;  3CD6 V;  1FJG O;  3CCV V;  2WLL A;  1R3K C;  4ZHQ B;  2RN9 A;  4YHH B;  1SQF A;  1WP7 A;  2P4K A;  4PA7 A;  4BIZ A;  1M93 A;  1NU1 H;  3ABT A;  3SJQ C;  3C90 A;  4NB5 A;  2JS3 A;  4PA9 A;  4LF9 O;  1QQC A;  4Z1M G;  2UXN A;  3E35 A;  2P6J A;  4JI2 B;  3JD1 A;  5BR8 O;  1VF5 B;  1Y6X A;  3RBZ A;  3OFN G;  4JAA A;  1FPO A;  5IT9 N;  1TUB B;  4JI1 B;  3ABL C;  2WA4 A;  2Y4U A;  3W7X A;  4LFB O;  4QJF B;  1JQ0 A;  3CHX A;  2ITD C;  1ENV A;  4J10 A;  3G71 V;  3M7M X;  4CH3 A;  4B08 A;  4YY3 B;  3JD4 A;  3CJH A;  4MW3 A;  1Y76 A;  1M57 B;  1E1Q G;  3OUF A;  4XDL A;  4DR2 O;  2ZT9 B;  2BSK A;  4GCZ A;  5AG2 A;  2JJ1 G;  4QIW F;  3FAV A;  2E74 B;  4BIO A;  2IW5 A;  5LHH A;  1AR5 A;  4J7Z A;  3SPJ A;  4BWA A;  1EFR G;  4U3F H;  4MVZ A;  3K08 A;  5FNV B;  1XL6 A;  4LF9 B;  4R50 A;  5IYC O;  1NTZ H;  2IJH A;  5CBF A;  1WA8 A;  4TV8 A;  2PY5 A;  2CE4 A;  1RSO A;  4JZG A;  2LJ2 A;  4X62 B;  4GT1 A;  2PYJ A;  1GO3 F;  1GMG A;  1UFI A;  1PNK A;  3FB6 C;  1SQP H;  4W4L A;  1XUQ A;  1I94 O;  3ETG A;  1JOY A;  3K04 A;  1YSC A;  1Q90 D;  1FXK A;  1Y74 A;  1BS3 A;  2JJ2 G;  3OEH G;  2RMK B;  1TUE B;  4JV5 O;  1GN2 A;  4LF7 B;  2YID A;  4BW5 A;  4B3M B;  1HNW O;  3RVY A;  2VRZ A;  3F7V C;  1VIB A;  5IJ9 A;  3I5D A;  3HKB B;  4X1Y A;  2V4D A;  2HP8 A;  3OR6 C;  3SGI A;  2OT5 A;  1OCR C;  4R7C A;  1BQZ A;  3OGC C;  2QWQ B;  1QLN A;  4DYL A;  1PD3 A;  4O4H B;  3M8A A;  3CX5 F;  4NXN O;  4RQF A;  1LNQ A;  2OIE A;  4LF7 O;  4LCU C;  4DW0 A;  2F23 A;  1Q43 A;  2A79 B;  2QKA A;  4X65 B;  5H9C A;  4OX9 B;  4N21 A;  1NTM H;  3KKY A;  4JYY A;  3OAA G;  1XBL A;  4O2B B;  3FB8 C;  1FJG B;  3C3S A;  2QJ1 A;  3B8N A;  4MTF A;  2P5O A;  3BY6 A;  3UO2 A;  3NXS A;  2IU3 A;  2CK3 G;  1SA0 A;  2A3Q A;  1IX9 A;  4X20 B;  1YIJ V;  1YJW V;  3CWB H;  2F4V B;  1Q5O A;  2YUA A;  4I0X B;  4RQE A;  4O4J B;  2XHB A;  3RGB A;  1LUW A;  3SR2 C;  1R6N A;  4CS2 A;  3BHP A;  3JAM N;  3STL C;  3ZX6 A;  3JCZ A;  3CRR A;  4BW9 A;  2DQ3 A;  5JH7 B;  3ABK C;  1YTF D;  2VQF B;  3B4S A;  4K8Z A;  4JI0 O;  2AGA A;  2EIL B;  3AG4 C;  1NZ6 A;  5BR8 B;  4DR2 B;  1K7D A;  4DUZ B;  5L3F A;  2CTR A;  3CCS V;  2N74 A;  3U10 A;  5IJ0 B;  3JAS B;  4J80 A;  5JCO C;  5GTI Z;  1FS0 G;  2HJD A;  2CGN A;  1JX9 A;  3UQ8 A;  3E8B A;  1RM1 C;  1N0J A;  4X64 O;  1GM8 A;  2GV9 A;  1YXB A;  2Q69 A;  3FYE B;  3H1L H;  3P30 A;  1XNQ B;  2Q67 A;  3TXS A;  2GTS A;  1WJZ A;  3DSQ A;  2ADP A;  3B8M A;  2UUB O;  3T4Z A;  2ZIM A;  1IBK O;  1ROP A;  2P22 C;  2R9R B;  3CRM A;  2YXL A;  2AHZ A;  5EC1 C;  4QE7 A;  5FLX N;  1VQ9 V;  4NTW A;  1HDJ A;  1HP8 A;  3LDC A;  4NR1 A;  2AW9 A;  3BAB A;  2FML A;  4CH4 A;  5C8Y A;  1KYO F;  4RAI A;  2L6L A;  2ODM A;  3G6E V;  3ZRS A;  4O4H A;  5LOV A;  1IZ3 A;  5EIB C;  4GX5 A;  1G1X B;  3AG3 C;  3ASO B;  4XBF A;  2GUZ A;  4FFB A;  4DV1 O; 
#chains in the Genus database with same CATH homology
 4MVM A;  2HVJ C;  1JPX A;  3VBB A;  4QNH B;  1QCE A;  3LSS A;  1R3J C;  4WF9 V;  3ABL B;  4CBC A;  2EIN C;  1K5Q A;  1FXK C;  5L3G A;  4JYC A;  1OCO C;  3CXC U;  2IH1 C;  1G4Y B;  1Q7Y W;  2XAF A;  1K9M W;  1DTO A;  5H6R A;  3CCJ V;  1WPX A;  3A0R A;  2WLI A;  1UJW B;  2IJK A;  5CN0 A;  5B1B B;  1I5Y A;  4PDR A;  3T1C A;  2HLD G;  1YJ9 V;  1OCC B;  4KUM A;  4JPR A;  3T4D A;  2AHY A;  2GHY A;  5L3D A;  3E83 A;  4EKW A;  4KP4 A;  3AG2 B;  2IJJ A;  3UKM A;  5IY5 C;  1M56 C;  1AI6 A;  3FYI B;  3W7T A;  1K33 A;  4PA4 A;  2BOB C;  2JDI G;  4PDM A;  2QM8 A;  5LGT A;  2NLJ C;  3CCU V;  2HVK C;  3SPG A;  1K5S A;  5CBH A;  5B1O A;  2YSU B;  3E2E A;  3ZN1 A;  5LBQ A;  5B1A C;  3SPI A;  4TWK A;  1SET A;  5DM6 V;  3CMA V;  3TCU A;  4JGS A;  3CCQ V;  1M1K W;  3LUT B;  3ZRW B;  1S72 V;  1K8A W;  2P67 A;  3ETE A;  2Y48 A;  4PA3 A;  3OUS A;  4UVA A;  4MVO A;  5B1A B;  4X8A A;  4WCE V;  1SRY A;  1V55 C;  3VOU A;  4UXN A;  2YEV B;  1VQM V;  5H6Q A;  1CEZ A;  1J95 A;  4FK5 C;  1CPY A;  2LFR A;  2A0L A;  1QR9 A;  2WSS G;  3R65 A;  1VQK V;  3IGA C;  4P30 A;  2Y69 B;  1FXK B;  1VQ5 V;  1L1F A;  1OCR B;  2JEU A;  3ASN B;  1NR1 A;  3ZMS A;  3RVZ A;  3MHH C;  5IYB O;  5J9P C;  1K73 W;  1JCH A;  3CC7 V;  1M57 C;  1EBO A;  2DYS B;  2B1I A;  2QA4 V;  4WFA V;  4PEL A;  3E89 A;  5E1A C;  1KC8 W;  3OMA B;  5B1B C;  1ORQ C;  1DF5 A;  3ZMZ A;  2ZR2 A;  2X7R B;  3ZMU A;  5KA5 A;  3CME V;  1YIT V;  3B77 A;  4H33 A;  3T2M A;  3W7U A;  1KQS U;  2Y69 C;  1BHA A;  1Q86 W;  3CPW U;  1KD1 W;  3ML0 A;  2QEX V;  4QPK A;  2K1E A;  1VQ4 V;  4H37 A;  4E2L A;  3K0G A;  1K97 A;  1KKD A;  1NQT A;  2EZO A;  3FB7 C;  3EFF K;  3OM3 B;  1SZT A;  2WLK A;  3OMN B;  1THZ A;  1AJN A;  2EJR A;  3QO7 A;  2P90 A;  2WLJ A;  1R6K A;  4JAU A;  1SES A;  4JAS A;  4MW8 A;  4QPJ A;  3SYC A;  3EHB B;  4FIP C;  1VQ6 V;  2WAM A;  4RUE A;  1VQL V;  2ZD9 A;  1FXH A;  4JTA B;  3OR7 C;  2QTO A;  2XAQ A;  4I9W A;  1AJQ A;  4Q20 A;  2R9I A;  3WFV A;  2EIK C;  4DXW A;  5L3C A;  3OW2 U;  3IFX A;  2W6I G;  3ZMV A;  5IDJ A;  1F4M A;  3W7S A;  1MOF A;  3G4S V;  5LHG A;  3CD6 V;  3CCV V;  4MSW C;  3D36 A;  2WLL A;  5LGN A;  1R3K C;  1B6Q A;  2XAJ A;  2WLL B;  2P7T C;  1AR1 B;  2ZXW C;  2M7W A;  1M90 W;  1MSW D;  1VQO V;  4PDV A;  4G28 B;  3QO8 A;  2EIN B;  3TK1 A;  4JF3 A;  4PA7 A;  5EK0 A;  4BIZ A;  5BZB A;  1YHQ V;  3FKS G;  5IYD O;  1NH2 B;  3QO5 A;  3ABT A;  3SJQ C;  1W0K G;  4PA9 A;  2WLN A;  2PI4 A;  1ZWI C;  3ZIA G;  2EIM C;  1V54 B;  4FMT A;  2H8P C;  4Z1M G;  2UXN A;  3ETD A;  1YI2 V;  2IU0 A;  3E35 A;  5LGU A;  2P6J A;  1R73 A;  1S3J A;  3ABM C;  3JD1 A;  5L3E A;  3CCR V;  3ASN C;  1QVF U;  2Z3Y A;  3RBZ A;  4WFF A;  3OFN G;  3LDD A;  4U7N A;  4LBE C;  1OHH G;  3ABL C;  2QE7 G;  1I5X A;  3W7X A;  4QJF B;  4HZ3 A;  1N8R W;  1JQ0 A;  2ITD C;  4UV9 A;  1ENV A;  1F23 A;  4G27 B;  3RW0 A;  3G71 V;  5CMU A;  5C93 A;  1YJN V;  3D3I A;  3SYA A;  5B1N A;  3JD4 A;  5KUM A;  4MW3 A;  5KA6 A;  1M57 B;  1E1Q G;  2DQ0 A;  1Q81 W;  4GX0 A;  3OUF A;  3OMI B;  4XDL A;  1KP3 A;  3E8H A;  2XOK G;  2Q68 A;  4J9Y B;  1H8H G;  4JAV A;  4UVC A;  1F4N A;  4GCZ A;  2JJ1 G;  4QIW F;  1GKF A;  4TSF G;  4XDK A;  1E1R G;  2W6J G;  3CC4 V;  2HKO A;  5LHI A;  2IW5 A;  5EC2 C;  5LHH A;  2A9H A;  3AG1 B;  3SYP A;  2XAS A;  3ZJZ A;  3OEE G;  3SPJ A;  1EFR G;  1RPO A;  5IY5 B;  2D3O W;  1CP9 A;  1V55 B;  4MVZ A;  3GWO A;  3AG2 C;  3CYO A;  2ZQM A;  3K08 A;  4MVQ A;  1NVP B;  1QLE B;  1H38 A;  1XL6 A;  4R50 A;  2QKS A;  5IYC O;  4J9Z B;  2FTK A;  2IJH A;  1PKX A;  5CBF A;  1WLE A;  5HFM A;  2WLI B;  1OZ0 A;  2MK3 A;  3KG2 A;  1YTF B;  2Z5U A;  3JD3 A;  1BL8 A;  4GT1 A;  2EIJ C;  2X0L A;  3K9A A;  1GO3 F;  3E8G A;  3K79 A;  1GMG A;  1VQ7 V;  1PNK A;  3FB6 C;  5KUK A;  2F43 G;  3K03 A;  3F7Y C;  1H2G A;  2HFE C;  3LSQ A;  1V54 C;  2DYR B;  4R8C A;  4RUF A;  4GX1 A;  3ETG A;  1P7B A;  4FPP A;  1F51 A;  1PNM A;  3K04 A;  4F4L A;  2OTL V;  1JOY A;  1YSC A;  5FL7 G;  1FXK A;  2B5U A;  3WG7 B;  1NKD A;  3CP1 A;  1OCZ B;  1IXM A;  2JJ2 G;  2IJI A;  2UXX A;  1QVG U;  4HYO A;  4QE9 A;  2EBO A;  3OEH G;  4PA6 A;  4DO2 A;  3CCM V;  1TUE B;  2OCC B;  1XL4 A;  3UM7 A;  1K3E A;  3DTU B;  3ABM B;  2ZXW B;  3K06 A;  2EIM B;  3MHS C;  2JK5 C;  4BW5 A;  1FXV A;  3K0D A;  1E79 G;  2LFS A;  3RVY A;  2WWW A;  2W0F C;  3F7V C;  1S5H C;  4P9O A;  4UV8 A;  2BOC C;  2GSM B;  3E86 A;  4R6Z A;  1AI7 A;  1NR7 A;  3CC2 V;  3ZCC A;  1HWY A;  3JD0 A;  4X88 A;  4ZBM A;  1Y4M A;  3JD2 A;  5EBL C;  1M9N A;  2OTJ V;  3OR6 C;  4XDJ A;  2OT5 A;  1OCR C;  4R7C A;  3OGC C;  1DLB A;  5GW7 A;  1QLN A;  1PD3 A;  3I56 V;  3X2Q C;  4HAM A;  2V7Q G;  1JVM A;  3CCL V;  4WFE A;  1QLE C;  4RQF A;  1LNQ A;  4WFH A;  2YEV A;  1S0V A;  4LCU C;  2LP7 A;  1MG1 A;  2ITC C;  2V1D A;  3K3W A;  5EBM C;  3MD0 A;  3ZRW A;  1RM1 B;  5HFL A;  2A79 B;  1R3L C;  5CA3 A;  4OXS A;  2EIJ B;  3QNE A;  4N21 A;  2QM7 A;  5H9C A;  1SER A;  4UUJ C;  1QBZ A;  3OAA G;  4I5S A;  2WPD G;  1S77 D;  4N23 A;  3AEI A;  3STZ C;  1QR8 A;  1RPR A;  3FB8 C;  3DGE A;  2ZDI A;  3ZN0 A;  5DN6 G;  1OCC C;  4MVR A;  1K92 A;  4MVS A;  4KFM A;  3B8N A;  1PL0 A;  4MTF A;  4PDL A;  4ASU G;  2DYS C;  3HPL C;  5L3B A;  2PI5 A;  3SYO A;  1NJI W;  3BY6 A;  3AG4 B;  1AI4 A;  3NXS A;  2IU3 A;  2CK3 G;  1YIJ V;  2B1G A;  1YJW V;  3AG1 C;  4YXW G;  4RQE A;  1VQ8 V;  4U7O A;  4TT3 G;  1DF4 A;  4BIU A;  3JYC A;  1VQP V;  4LP8 A;  4RO2 A;  1R6N A;  1EZJ A;  2X6A A;  4L87 A;  4WFG A;  2IH3 C;  1Y66 A;  2WLH A;  4JTC B;  1AI5 A;  2HJF C;  1AJP A;  1COW G;  2OCC C;  2WLM A;  3STL C;  4JYB A;  3JCZ A;  1NBM G;  4BAY A;  1VQN V;  2XND G;  2DQ3 A;  5CBG A;  3ABK C;  3AG3 B;  1YTF D;  1GM9 A;  1ARO P;  1W0J G;  1S76 D;  1KP2 A;  2KB1 A;  1P4R A;  2DWD C;  1K34 A;  1W2B U;  2EIL B;  2C2A A;  3AG4 C;  1K7D A;  3ZMT A;  1NVP D;  5B3S B;  3ABU A;  3M99 B;  5L3F A;  4UVB A;  3W7W A;  3SPC A;  1MAB G;  1GK9 A;  1M56 B;  4MTX A;  3CCS V;  3PJS K;  1H8E G;  4P2Z A;  2EZP A;  1JJ2 U;  1FS0 G;  3WG7 C;  3GB7 C;  1JX9 A;  3E8B A;  1BHB A;  3X2Q B;  1RM1 C;  3FB5 C;  2ZR3 A;  1GM8 A;  4ZKI A;  1NH2 D;  2DYR C;  2Q69 A;  3HB3 B;  2ZDI C;  1Q82 W;  3FYE B;  2HR3 A;  3SPH A;  3P30 A;  2EIK B;  3F5W C;  2Q67 A;  4LC1 A;  3E8F A;  2NNU A;  1PNL A;  2Q6A A;  3BEH A;  4FJC C;  3I55 V;  2EIL C;  3B8M A;  2XAH A;  5EBW C;  4WFB V;  2X6B A;  3T4Z A;  2ATK C;  2DWE C;  4GX2 A;  1ROP A;  2R9R B;  4MS2 A;  2AHZ A;  5EC1 C;  4P9P A;  2HG5 C;  3LNM B;  4QE7 A;  1VQ9 V;  2JIZ G;  3ZRV A;  4MTO A;  3LDC A;  4MT8 A;  1OCO B;  3IC7 A;  3CCE V;  1G8M A;  1GM7 A;  1KEC A;  1K4C C;  2X6C A;  4MTG A;  4RAI A;  3SYQ A;  3G6E V;  3ZRS A;  1GTO A;  3LDE A;  3OE7 G;  1R3I C;  4JTD B;  1OCZ C;  3H01 A;  4MVU A;  3TET A;  3ZRX A;  3P32 A;  2XAG A;  4GX5 A;  1K4D C;  1BMF G;  4X89 A;  5B3S C;  3ABK B;  3AG3 C;  2JEX A;  3ASO B;  4XBF A;  4CZZ A;  2H94 A;  3ASO C;  2DW4 A;  4G2K A;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...