4OXSA

Structure of navms in complex with channel blocking compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
molecule tags Transport protein
source organism Magnetococcus sp.
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
total genus 37
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4oxsA00
4P9PA 4QE7A 1R3IC 1OCZC 2Q68A 4JTAB 3SJQC 3FB5C 3F5WC 4P2ZA 4R7CA 5BZBA 4WFFA 5EBWC 2WLNA 2K1EA 2H8PC 3VOUA 3ABKC 4MVOA 2ZXWC 4X89A 2X6CA 3UKMA 3SYQA 1ORQC 2WLMA 3K08A 4BW5A 3AG3C 2AHYA 2WLIB 3K03A 4MSWC 4PDVA 3AG1C 4PA3A 2W0FC 2EINC 2X6BA 3K0DA 3RVZA 3ZJZA 4J9ZB 2JK5C 3E83A 3T4DA 2Q69A 3EFFK 3K06A 2QKSA 3IGAC 3F7VC 4MVRA 1V54C 5EC1C 3T1CA 2ZD9A 3GB7C 3R65A 4PDMA 1M57C 2NLJC 4PA6A 4HZ3A 4QE9A 2P7TC 1OCRC 2Q67A 3OR7C 3ABLC 4P30A 4R8CA 2A79B 2WLIA 2WLLB 2IH3C 4RAIA 4UUJC 4G27B 3LUTB 2ATKC 4CBCA 1KKDA 2KB1A 4MW8A 3T4ZA 1R3LC 3K04A 5KUKA 1P7BA 4PA4A 1BL8A 3AG2C 3E8GA 2EILC 2YEVA 1QLEC 5CBHA 5B1BC 4HYOA 4MTFA 3X2QC 2DWDC 1V55C 2BOBC 3TCUA 4P9OA 3UM7A 4MVUA 5B1AC 3RVYA 4LBEC 4LP8A 3BEHA 4PA7A 4R50A 3FB7C 2X6AA 3T2MA 1S5HC 5EBLC 3SPJA 3SPIA 4QNHB 2IH1C 4MTOA 4EKWA 4LCUC 3TETA 4X8AA 4GX1A 1OCOC 4PDLA 3FB8C 4F4LA 2R9RB 2HG5C 4I9WA 1LNQA 3E86A 3SYOA 1OCCC 2EIMC 3OUFA 5EK0A 2Q6AA 3E8HA 3FB6C 2HVJC 1ZWIC 2HVKC 1XL4A 1R3KC 5E1AC 2ITCC 3E8BA 4RO2A 4XDKA 2EIJC 2ITDC 3SYCA 3AG4C 4MW3A 2WLHA 3LDDA 3LDCA 3KG2A 4MVMA 3OR6C 3SPGA 4GX5A 4R6ZA 4WFGA 3ABMC 4MVSA 4MVZA 3STZC 4JTDB 4DXWA 3OUSA 4WFEA 2AHZA 4PA9A 4OXSA 2WLLA 4MS2A 2BOCC 2WLKA 3LDEA 2HJFC 3F7YC 4RUEA 4RUFA 2EIKC 2DYRC 2WLJA 4ZBMA 4WFHA 4JTCB 2DYSC 3RW0A 3E8FA 2HFEC 2A0LA 1R3JC 3E89A 3SPCA 3OGCC 2Y69C 3PJSK 4XDJA 4XDLA 5B3SC 3ASOC 4J9YB 2A9HA 4G28B 4H33A 4MVQA 5EBMC 2QTOA 3JYCA 1G4YB 2OCCC 3K0GA 3LNMB 4MTGA 3RBZA 5CBFA 4H37A 4GX2A 2DWEC 3IFXA 5CBGA 1K4DC 1XL6A 5KUMA 4PDRA 3STLC 3SPHA 3ASNC 3SYAA 5J9PC 4GX0A 1J95A 1K4CC 5IY5C 3WG7C 1M56C 4X88A 3SYPA 4TWKA 4KFMA 5EC2C 1JVMA 3ZRSA 3HPLC
chains in the Genus database with same CATH superfamily
4YJ3A 4JAUA 4B7KA 1M57B 4J41A 3PN1A 5K1XA 4ZKIA 2H8PC 1ZSPA 1IDSA 4LFBB 1JJOA 4DR1B 5KHIA 5LGNA 3O9OA 1K3EA 4LH6A 1JX9A 1RP3B 3EFFK 4JV5B 4DUYB 4BR6A 1VQ6V 2NLJC 4FK5C 5EIBC 2CDYA 1GTOA 3EHBB 2HLDG 1N33B 4IHJA 1YVWA 2HEPA 3W7XA 2VQFO 4B3RB 2JEUA 2HKOA 3D8CA 5KAFZ 5LXTA 4JI3B 1K5SA 3RT3C 4X1IB 2N05A 4WFBV 1NTMH 4JI5O 2JIZG 4JI2O 1QR8A 5FL7G 5IYZB 1Y4MA 5JJNB 4LCUC 3CRCA 1OZ0A 2Q73A 5LMUO 2ZE7A 5KHGA 4LR3A 2Y4TA 2HR3A 2EULA 1XI1A 1PNKA 5H9CA 1RPOA 4OX9O 3OUSA 3OEHG 4OXSA 1S5LZ 1Q90D 5IJ0B 1R3JC 3E2EA 3D3IA 1BE3H 2LGWA 2Q8VA 2QWOB 3CC4V 3JYCA 3LNMB 4JI0B 1HDJA 4JASA 2EINB 1VQ5V 4O4IB 4DRXA 5IE9A 4CS4A 5BY1A 4PDRA 5J9PC 2A7WA 3CE2A 4DO2A 5A2QN 3SYPA 2PYJA 3ZRSA 3JASB 4BIUA 4FLXA 4DR5O 4KHPO 4X62O 3CJHA 1XBLA 1IZ3A 5IYBO 2QTSA 2XT9A 3JATB 1K8AW 2F43G 1P4RA 1H2LA 4O2AA 3AG1C 4DV2B 2B9ZA 3E22B 3ZJZA 3J81N 4J9ZB 1VQ9V 2QEXV 2PY5A 4X65B 2EJ7A 1URFA 4IT5A 1SQQH 5JJJB 2JEXA 2DYSB 2DN9A 4YJ2B 3BA9A 3K58A 2XAJA 4GUNA 1VQ4V 1Q7YW 3JASA 4LFCB 3M8AA 2Y0PA 1KKCA 3OD4A 3RVYA 1ZTEA 4JI4O 4HNAA 3ZEDA 1H2KA 2X6AA 1IBLB 4PD4F 3BAAA 4FLYA 1S3JA 4GX1A 1Q6HA 2JS3A 1MNGA 1E1QG 3E22A 1YI2V 3LSSA 4EB6A 3CEIA 3CXHF 3BABA 2ZM6O 4PA9A 2P67A 3GVMA 1KB9F 3H1JH 3F7YC 4WFHA 3K57A 3S3WA 1ZAUA 1HR0O 2M7WA 5LHHA 4X1YA 5JVDA 3W7TA 2AXTZ 2LO1A 5KHKA 4DUYO 4DV7O 2XNDG 4PHZA 5BMVB 2ZDIC 1JVMA 2IW5A 1NH2B 2B1IA 1PNMA 3SJQC 4PI2A 4P2ZA 3C3TA 3ZMUA 3O65A 5B66Z 2HHHO 4AHCA 1GN6A 1LR1A 2YSUB 3OGIB 1ENVA 2KG7B 5CB4A 2WLMA 3JD4A 3U10A 4BW5A 4LWSA 4X62B 1TVKB 4PA3A 2EINC 2IJIA 1I7FA 2JK5C 2Q69A 1EFRG 2YXHA 2ZCEA 2P6JA 4P30A 5JCOC 1XILA 5D5PA 2WLLB 2CGOA 3C90A 3L9DA 4JGSA 3CCJV 4X1KB 1IVSA 3CC7V 1PL4A 1CXZB 3JCZA 1XMQB 4UCUA 4MVUA 5L3EA 3WB0A 2VRZA 3DSQA 3FB7C 5IYCO 2YXLA 1MZFA 2UXDO 1SQVH 2UUBO 1NQTA 4EKWA 1SQXH 4NXNO 4F6EA 4IYHA 1D5AA 4I9WA 1KBHA 1KECA 5LXTB 5LYJB 5EK0A 1YZBA 4TOIA 5JQGA 2CTRA 1Y76A 2BSKB 1N32O 1H2SB 1AR1B 4WFGA 1HW7A 2OYQA 2WLLA 4OPAA 3M99B 2WLJA 4ZBMA 2JDIG 4FLUA 1NKDA 5B3SC 3ASOC 1UJWB 3TXSA 4I5SA 4O4LB 4IL6Z 1Q81W 2HP8A 4X1YB 5DN6G 1KU9A 3CRRA 3T1YO 1I94B 1YJNV 5CA1A 1DK1A 1SQBH 1OCRB 4QE7A 2EBOA 2XASA 1D2DA 2OT5A 3N2GB 1COWG 5J2TB 1N34O 2V7QG 5JH7B 3N2GA 4KUMA 2QKCA 1GH6A 2FTKA 3AG3C 4BIZA 2DJVA 5EC1C 4U3FH 1AROP 1V54C 2GDSA 3APOA 1QVFU 2PUSA 4WBNA 3CS5A 2ARHA 2IM9A 4GKKO 4R8CA 4RAIA 2OIEA 3WG7B 3B40A 4BAYA 4GLXA 4JYAB 2UXXA 1XQ8A 1N8RW 2YI8A 1K9MW 3CX5F 4MTFA 3P3PA 1VQNV 2BOBC 1FPOA 1NTKH 3ASOB 1Q86W 4NKGB 2ZIMA 3J80N 3I56V 4LF4O 1JFFB 2DYRB 3E86A 4UCSA 3SYOA 5LP6A 3B8NA 4PELA 2GHYA 1G1XB 4XDKA 1YTFB 1H38A 1SQFA 4JI8B 3ZRWA 1WLEA 1NS1A 4JTDB 3OFNG 4B3TO 5L3CA 1OHHG 3A0RA 4DV1B 3IAYA 4LFCO 2MK3A 3U0ZA 2DYSC 3VBBA 1XMOB 5BXZA 1BQZA 4Z1MG 2WA4A 5EBMC 5KHJA 3DGEA 1NU1H 5AG2A 3J7AU 5HFMA 4H37A 4NR1A 1K4DC 1DF4A 2QDOA 3K5OA 1XHXA 4JZGA 2BTQA 3UQ8A 4KFMA 4DV7B 4WF9V 1YXBA 1N36B 1CEZA 4JI1B 3OTOB 4TV9A 3CXCU 1NT2B 2PF4E 4AQYB 1R6TA 2R70A 1SERA 3SYQA 3K08A 4JAVA 2EX3A 3K03A 1JR9A 4FFBB 2LJ2A 1K7DA 3IC9A 4HBNA 1NVPD 1SZXA 2UUAB 2IJHA 1G6UA 2QKSA 3F7VC 3G67A 2JJ1G 1XEQA 4CC5A 2ZR3A 3G4SV 2QSAA 2Q7EA 1B04A 1HNWO 3UO2A 3ZRVA 4LF5O 1Q43A 4DK0A 4BWAA 3JATA 2BTQB 1VF5B 2UUCB 2E5LO 2YEVA 2Q9LA 4JZ2A 1NH2D 1N0NA 2DWDC 5B1AC 1M9NA 1DGSA 4UVBA 2CK3G 2EIMB 3JALB 4PDLA 1BGYH 2UUCO 1K97A 3QVNA 3CPWU 5IWAO 4DR2B 2ZQMA 2NN4A 3OAAG 2PZSA 3K5MA 4EB6B 4GX5A 4NTXA 4I4TB 1HNWB 1YTFD 4D7SA 3AG4B 3P32A 4H0LB 3WU2Z 3ZX6A 4B3SO 2BOCC 4ZOLA 1Q5OA 1QBZA 2A3QA 4KL1A 4LWSB 3ZMSA 5B1OA 4WFAV 4U3JA 3BA8A 4JYAO 1DTOA 3CRMA 3OGCC 4I50A 4J7ZA 1UPGA 3SJAC 1WAZA 1GK9A 4EEQA 4I9QA 4AQYO 3A0BZ 2YIBA 3HKEB 1QR9A 4I7ZB 3CCSV 4LFAB 1S0VA 4FLVA 3EVKA 5LA6A 1OCZC 3THOA 3MDSA 3JAMN 3BFRA 3JAKA 1F51A 1YSCA 1E79G 2XOKG 4X89A 2GBOA 2V1DA 2XAHA 3W7UA 4IIJB 2XHBA 3GB7C 2RMKB 4FZ0A 4K8XA 1NTZH 2WLIA 5KAIZ 4DR6O 4LF6B 3CRQA 3ETGA 2E3CA 5EIBD 2D2CB 4O4JB 4DW1A 1D5NA 2ZIOA 5CBHA 1N36O 1VQOV 5KA6A 1VIBA 5H6QA 4LP8A 4JAAA 1IXBA 3H1KH 3LSUA 3T2MA 2Q0AA 3L73H 2UXBO 1WA8B 1OCCB 3DTUB 5FPOA 2ZNJA 3JSNA 5BMVA 2YICA 3OE7G 1HNXO 2MW2B 4TQDA 2GTSA 2JGDA 3KG2A 3OR6C 4MVMA 5GONA 4MVSA 4K3AA 5IT9N 4ZI7A 2R72A 2JVDA 1WP7A 5IJ9B 5J2UA 1Z5WA 3CSXA 1N0JA 1IX9A 3Q4HA 2HFEC 5ITZB 4DR3B 3QO7A 5JQGB 4DR1O 2AZ2A 5B1BB 1YF2A 2DWEC 3AG3B 3ETEA 1H2MA 3KCXA 4YIOA 2KSDA 3STLC 3ASNC 5CA1B 4GX0A 1J5EO 1SC5B 3ZMZA 1Y66A 1UFIA 1NR1A 2FKXA 3K59A 3CP1A 3AK3A 4B3RO 1WN7A 2AGAA 4IHJB 1SA0B 2HHHB 4JI6B 2CTPA 2VS0A 5FPRA 2KQXA 3DXRB 3MD0A 3C3SA 1WPXA 4W4KA 5B3SB 2CTQA 3WB1A 1SQPH 4JI6O 3OR7C 2IU3A 3TK1A 4G27B 1THZA 3QF7A 1HR0B 5EYPA 1L0NH 3VQVA 2EZPA 1BL8A 2Z5UA 3UM7A 2ZM6B 3T1YB 2WSSG 2W6IG 2DMXA 3SPJA 2ZE8A 4F6RB 4F4LA 3JARB 3CRAA 4LF8B 3BCCH 1ZUQA 5B1NA 5BR8O 2C2AA 4QIWF 3SYCA 4CC6A 3STZC 1LUVA 1AI4A 1AILA 4DV5B 4DV3B 1Z2GA 2DYRC 1DLBA 1NBMG 1BMFG 2A9HA 5KHHA 3RYFB 2ZT9B 2QTOA 4MTGA 4I0XA 5CBFA 4FVMA 3X2QB 3APQA 3K9AA 1KP3A 2F23A 4J11A 4YY3B 4FLZA 3OW2U 2UXBB 4X64O 3B09A 4ASUG 3WG7C 1U97A 3FX7A 5B5EZ 2GUZA 4FM2A 4YIPA 3F5TA 1FXKA 1SQGA 1R3IC 1RM1C 4TV9B 4XBFA 5BZBA 4WFFA 4QGPA 1Q6UA 2ZXWC 2QWRB 2N04A 4JPRA 3FAVB 2Y0IA 4CS3A 2F4VO 4UXNA 1QLNA 4J7KA 1QHTA 3R65A 1EBOA 4HZ3A 3IC7A 1AI7A 4UCVA 3P30A 5IYZA 1R3LC 2Y48A 1NR7A 4HYOA 3H01A 3CCLV 1IBLO 2P90A 3GWOA 4PA7A 2VQEO 2ADPA 2IH1C 3H1IH 4E2LA 1JJ2U 4A5UB 1H8EG 1HNXB 2ITDC 3TJTA 1K33A 1VARA 1AJNA 3DC6A 1P84F 2CH7B 4Z1VA 1AJPA 3OM3B 4JF3A 4UCOA 4ZOLB 4O4IA 4DRXB 3ABLB 3E89A 1KC8W 1QNMA 4XDJA 3HKBB 2R9AA 2DOSA 4ZI7B 2RNBA 3HKBA 3SJBC 1YJWV 2QWPB 4DR4B 3CCEV 3D36C 5CB4B 4JI1O 1EZJA 4TV8A 2Q0OC 3R66A 5JWPA 2VQEB 1HNZB 1K92A 3JD0A 1M56C 2GV9A 3ZHRA 2Q4PA 2BCCH 2Q7HA 3FB5C 1BSMA 2WLNA 1GAXA 4BW9A 1Y74A 1B6QA 2XAQA 3UKMA 1VF6A 2W6JG 5FNVA 1SETA 2X0LA 3ZIAG 2ETNA 2DW4A 4GT1A 4DV3O 1QCEA 2YXYA 3ABKB 5LA6B 3T1CA 4LFAO 4YXWG 4B3TB 4OX9B 4PDMA 1M57C 4PA6A 2YIDA 1K5QA 5LOVB 1XNQB 1M56B 2IBZH 5KX5B 1KYOF 1KKDA 3VQYA 4GKJO 3IJ4A 4MW8A 3K04A 2FL4A 3RYIA 3UT5B 3ABMB 1RSOB 4UFZA 2UU9B 5B1BC 4DV5O 5KA5A 1FD9A 5CN0A 4IIJA 4P9OA 1TA8A 1U96A 2P5OA 1SESA 4LBEC 1S5HC 3HKCA 3TETA 4RQEA 2AZ0A 1S5JA 1OCOC 3FB8C 3HKDA 4JI3O 2AW9A 2M6YA 3K79A 3NR7A 2F1MA 5TISZ 1S76D 5JCOA 1BT8A 1TUEB 4O4HB 4WCEV 1IBMB 3MHHC 3CCRV 4FZ1A 5B1AB 3ZN1A 4L8JA 1F4MA 2WLHA 5LGTA 4FLTA 1DF5A 4GKKB 5EZYB 3KZIZ 1EN6A 1P49A 5LHGA 2AHZA 1L8DA 3JAWB 4MS2A 3CMAV 4JTCB 1TVKA 4GYCB 2LFSA 3E8FA 2E5LB 4LC1A 2QGNA 1RPRA 1FJGB 4K0KO 2UXCO 3EXAA 1SKVA 1JCHA 2E76B 4LF8O 3B8MA 1IBKO 5GTIZ 3IFXA 4JI2B 1N4CA 1VF6C 4OPHA 1I94O 2UUAO 5EC2C 3RYFA 4FM1A 3AEIA 3VOUA 3KCYA 2QKAA 1Y74B 1JQ0A 3JAWA 1S77D 3OTOO 2AHYA 4MSWC 1XNRO 4JYYA 1AP6A 2W0FC 2X6BA 4DV4B 3H1LH 3T4DA 2E75B 2ZD9A 4NYKA 3CYOA 5GONB 3W7WA 1Q8IA 5LMNB 1VP7A 1OCZB 1OCRC 1XREA 3ABLC 3ETDA 2A79B 5EYPB 4UUJC 1P7GA 1CPYA 5LHIA 4DR3O 3N2KB 3RYHB 5KUKA 1P7BA 2EILC 1QVGU 2OCCB 2F95B 2UUBB 3TCUA 4O4LA 2OIGA 4DV1O 1Y6XA 1J5EB 3RGBA 1MABG 4QNHB 1BS3A 3UO3A 4YHHO 2E74B 3T1HB 2YEVB 4TUYA 3FB6C 2HVKC 1BZKA 4EFEA 4R6ZA 1M5IA 4PJ0Z 4CS2A 1SA0A 4O2BB 4UCRA 3QO8A 3ZS8C 2A0LA 3SJCC 1JOYA 3I5DA 1N32B 1V9PA 4GKJB 4TQFA 4J9YB 3OTFA 4X1IA 4YJ3B 2QM4A 5K1PA 3K0GA 1GN2A 3N27A 3L71H 3AG1B 3G6BA 1NZ6A 4E4EA 3VQXA 5JH7A 2ZKOA 3SDLA 2PGGA 4TUYB 4CH3A 2Q5ZA 1XMQO 4IGGA 4DV4O 4TSFG 4TT3G 1WPBA 5EBWC 3B2EE 3B77A 5HFLA 1I5YA 3LSQA 4MVOA 1JA8A 4DR6B 4F6RA 1JFFA 3BPZA 4LH7A 3BVOA 3HB3B 2IU0A 1PM9A 3CWBH 5IDJA 5LGUA 2Q67A 3DC5A 4J42A 4U7OA 1WNSA 3A0HZ 4HAMA 1F7YA 3E8GA 4OGQB 2H94A 3CCUV 1Y67A 4CZZA 4JI4B 5EBLC 3ZRWB 2ODMA 4MTOA 3CCQV 3RFRA 4DW0A 2QE7G 5A9GA 5IJ0A 3E8HA 3CB2A 3QTCA 1HP8A 4DR7B 1IBMO 3ICXA 2YDEA 1EN5A 1JPXA 2PTMA 2CH7A 3LDCA 1GM7A 4NXNB 4GCZA 3JALA 4UV8A 3TXQA 3ZRXA 4DXWA 5F2VO 2GSMB 4B3SB 2N74A 2OTJV 4NVPA 5LP6B 3JD2A 4XDLA 5L3BA 1EN4A 4G28B 1XOUA 2L35A 1PD3A 4B3MB 4X20B 4BIOA 4LF5B 2PI5A 5IJ9A 2RJZA 4U3JB 5CBGA 4NXMB 1YIJV 3SYAA 2DE0X 3G6EV 3CMEV 4FFBA 1FXKB 1VQ8V 4I55A 2D3OW 1LUWA 1RFYA 1WP8A 2FB5A 2RDCA 3OEEG 2V4DA 5H5NA 1SZTA 1ORQC 4H44B 3FAVA 1PKXA 3RVZA 2ZE6A 1NVPB 2ILMA 4FM0A 4HNAB 3CJHB 4ABMA 4CH5A 4ICGA 2ATKC 4DR7O 4JYBA 4ZHQA 1FS0G 4X66B 1BHBA 4KXRA 4KHPB 1M4UA 1AI5A 2RQ6A 3RN4A 4PV1B 2F93B 4QPJA 4I55B 2LW1A 3OMAB 2OWOA 4FPPA 2YIAA 3HKCB 3SPIA 1TAEA 1R73A 2ZR2A 3OMIB 5LOVA 3B4SA 4O4JA 3RYCA 1H8HG 1JMKC 5ITZA 2HVJC 2QM8A 4B3MO 5IWAB 5E1AC 4RO2A 1YDXA 3RYIB 3UT5A 2JS5A 5EZYA 1BCCH 2PI4A 2QA4V 4WFEA 1NI8A 2YI9A 3JD1A 4DV6B 4RUFA 2K9PA 2WLKA 4JV5O 2HJDA 3LNNA 5H2FZ 1VF7A 3GWKC 4JI8O 4FMTA 4FIPC 4X1KA 1WB8A 2GTAA 3ZMTA 1G8MA 1K34A 2CAZC 4MVQA 5LMUB 3M7MX 1N34B 2P06A 3FYEB 3RBZA 5JJEB 5LMNO 4MTXA 1US6A 1PP9H 3CD6V 1GO3F 1SS3A 4JI5B 1XUQA 2ZNIA 1VQLV 3E35A 4UVCA 4TWKA 1Q3EA 3CC2V 4JTAB 4DV2O 3L70H 4L87A 1F23A 1M1KW 3BY6A 2P4KA 3ABKC 5IY5B 5DECA 2LFRA 4K8ZA 5FLXN 3K9SA 4EFBA 2P4VA 1QU7A 1ZLZA 3JD3A 4J80A 2LQTA 4ZIBA 5L3GA 2YUAA 5LP6C 2IH3C 2OTLV 4JI0O 1R1BA 4LF7B 2KG7A 4K0KB 1M93A 5LYJA 2UXCB 1Q6IA 1WA8A 4CBCA 2O57A 1IXMA 4PA4A 1YEWA 1XHZA 1FFXB 2BTOA 4FLWA 2UXDB 1KQSU 2CE4A 4DV6O 3BEHA 1GN3A 5E79Z 3WB2A 1AR5A 2Y69B 3JCUZ 5CA0A 4X8AA 1PL0A 2HG5C 2EIKB 5CA0B 1AP5A 3H1HH 5IYDO 1PV0A 2ITCC 1IURA 2EIJC 3FD9A 1AB3A 4NTYA 1YJ9V 4I0XB 3ABMC 3ABUA 2NR5A 2OCHA 1H2GA 4NTWA 1GMGA 3LDEA 5JVDB 4UB8Z 1MSDA 4RQFA 1X4TA 3FYIB 3SPCA 5KMGA 4X66O 3PJSK 1EM1A 4LF6O 1G4YB 5GTHZ 1N33O 2W0XA 5C8YA 2EILB 3FKSG 1XL6A 5KUMA 3W7SA 1T5EA 1J95A 3N2KA 3RYHA 5IY5C 2QWNB 1Z5VA 4X88A 1NJIW 4X20A 3L75H 4UV9A 1I0HA 1IBKB 3ZHSA 1EZVH 2K1EA 3QNEA 4PI0A 3ZHQA 1YHQV 1V54B 1WJZA 3WFVA 4LF7O 1R6KA 2ZE5A 4Q20A 1GN4A 2GUZB 4KP4A 3AK1A 5CMUA 4NXMO 1XNRB 4IYIA 1FXKC 1RM1B 4DR4O 1YITV 1OV9A 5FNVB 2QWQB 1L0LH 4QJFB 2PYLA 2KB1A 1FJGO 5KLVH 4B7EA 3K3WA 1QLEC 3MHSC 2Q7GA 2Z3YA 2YIBD 4J10A 3I55V 5KX5A 2LGQA 1GM9A 2NNUA 3L72H 4ZHQB 2UU9O 2JGUA 1BHAA 1RSOA 2WAMA 2EJRA 2Q6AA 4O2AB 5DEDA 1R3KC 3RWRD 3E8BA 4I50B 1WB7A 1VQMV 3AG4C 4H13B 3OMNB 1V55B 2WA3A 1XNQO 1FAFA 1W59A 3AG2B 2EIJB 2KKWA 3P3NA 2LW7A 4X65O 4RUEA 4LF9B 2EIKC 4O4HA 3UCSC 3JARA 4J7JA 1AI6A 1KD1W 3ZHTA 2FMLA 4JI7B 1FFTB 4CH6A 3MAQA 1VQPV 2ZDIA 1MZEA 1XDCA 3G80A 2YC0A 4UB6Z 4N23A 4DV0B 5C8YB 2FYUH 3ZN0A 3SPHA 4DYLA 1O9HA 1K4CC 3ETQA 1SF9A 3AG7A 1HNZO 1ZX3A 4P9PA 3F5WC 2CUGA 4DV0O 2CGNA 2QM7A 4WBNB 2X6CA 3ZMVA 1K73W 3HKEA 2DQ0A 4DR5B 1AJQA 1M90W 1KP2A 1I5XA 1VMGA 4PDVA 3A8TA 3D36A 3KKYA 2ADQB 1GM8A 1MG1A 2G38A 4LF9O 5CA3A 2A06H 3E83A 5LBQA 2B1GA 2XAGA 3K06A 4MVRA 4B08A 4QE9A 2Y4UA 1GRJA 1B3QA 4DK1A 4YJ2A 3U11A 1AR4A 4FFKA 3S3XA 1AVMA 2B5UA 4Q6GA 3VQWA 1MSWD 4D6TH 3SR2C 1PNLA 2ZINA 3JAKB 2DQ3A 3L74H 4R50A 1BQ0A 4FJCC 2IJKA 1FKAO 3QO5A 4TV8B 2WPDG 2R9RB 2IJJA 1LNQA 2EIMC 3OUFA 3D3QA 4DR2O 1Y76B 3CCMV 1ZWIC 4D7TA 1XL4A 3ZCCA 1KMIZ 4JI7O 4MW3A 1W0JG 3QG5A 1B06A 3ZHUA 5L3DA 2R9IA 1I08A 1SRYA 2P22C 3CCVV 3NXSA 4JYCA 3H9VA 2HJFC 3RYCB 1OJHA 1VQ7V 2JGDB 1MMMA 3BHPA 4H33A 5GW7A 2XAFA 2OCCC 4C7UA 2CTWA 2Z0AA 1W2BU 1QLEB 4O2BA 3K5LA 4GX2A 5L3FA 1VQKV 1A32A 4LNUA 2RCVA 1PPJH 4LNUB 5C93A 1YCIA 2Q68A 1Q82W 4X64B 1TUBA 1MOFA 4Z2WA 2L6LA 4R7CA 2UXNA 4U7NA 5J2TA 2EZOA 3JSLA 4RWUA 3TGUH 1HWYA 3SGIA 3K5NA 3ASNB 1R6NA 3HKDB 1MA1A 2WLIB 4UCTA 2LP7A 3Q4HB 3K0DA 1X59A 4NB5A 4GZRB 2VWJA 3IGAC 3AK2A 3G71V 2F4VB 1H2NA 4UVAA 4MT8A 1O9GA 2P7TC 5D5QA 4YY3O 3HR0A 4LFBO 3OT7A 3LUTB 2WWWA 4K35A 3T4ZA 3ML0A 4N21A 1CP9A 5KMGB 3AG2C 1FFXA 1XMOO 2BSKA 1KUQA 3X2QC 1TUBB 1V55C 3BRCA 1E1RG 2JJ2G 2QJ1A 4DUZB 2VWKA 3CHXA 4G2KA 4I4TA 1GKFA 2QR4A 1OCCC 5LL6Y 1FXVA 5BR8B 1ROPA 3LDDA 1W0KG 3SPGA 4LF4B 5DM6V 4CH4A 3ZHVA 3ABTA 4MVZA 2BE3A 3FFQA 4AI8A 2JRIA 2F66C 3ZBHA 5H6RA 2RN9A 4QPKA 1OCOB 1TGOA 3RW0A 4W4LA 4X9QA 2XTAA 2Y69C 1S72V 1ZL8A 4AILC 2VQFB 2YS8A 1ZL8B 2H3OA 3T1HO 1FXHA 2XUMA 4YHHB 1F4NA 1L1FA 1QQCA 4DUZO 1VEWA 2X7RB 5J2UB 2ZXWB 3DXRA 1FYJA 3A2FA 3HPLC
chains in the Genus database with same CATH topology
3CC2V 1CEZA 4JAUA 4JTAB 3FB5C 4L87A 1M57B 3CXCU 2WLNA 4ZKIA 1F23A 1M1KW 2H8PC 3BY6A 3ABKC 1B6QA 5IY5B 2XAQA 1SERA 3UKMA 3SYQA 3K08A 4JAVA 5LGNA 2LFRA 3K03A 1K3EA 2W6JG 1K7DA 1SETA 1JX9A 2X0LA 3ZIAG 1NVPD 2DW4A 4GT1A 1QCEA 3ABKB 2IJHA 3EFFK 3JD3A 2QKSA 3F7VC 3T1CA 2JJ1G 4YXWG 5L3GA 4PDMA 1M57C 2ZR3A 3G4SV 1VQ6V 2NLJC 4PA6A 4FK5C 1K5QA 1GTOA 3ZRVA 3EHBB 2HLDG 2IH3C 2OTLV 1M56B 4CBCA 1KKDA 3W7XA 4MW8A 1IXMA 3K04A 4PA4A 2JEUA 2HKOA 3ABMB 2YEVA 5B1BC 1K5SA 1NH2D 5KA5A 2DWDC 5CN0A 4P9OA 4WFBV 1KQSU 5B1AC 1M9NA 1SESA 4LBEC 3BEHA 4UVBA 1S5HC 2CK3G 2JIZG 2Y69B 1QR8A 5FL7G 2EIMB 1Y4MA 4LCUC 3TETA 4X8AA 4RQEA 1OCOC 4PDLA 3FB8C 1PL0A 2HG5C 2EIKB 1K97A 3K79A 1OZ0A 1S76D 3CPWU 1TUEB 4WCEV 5IYDO 2ITCC 3MHHC 2EIJC 3CCRV 5B1AB 3ZN1A 2HR3A 2ZQMA 3OAAG 1F4MA 2WLHA 5LGTA 1YJ9V 1DF5A 1PNKA 4GX5A 5H9CA 3ABMC 1YTFD 3AG4B 3P32A 3ABUA 1RPOA 5LHGA 3OUSA 3OEHG 2AHZA 1H2GA 4OXSA 4MS2A 1GMGA 2BOCC 3LDEA 1QBZA 3CMAV 3ZMSA 4RQFA 5B1OA 4WFAV 4JTCB 2LFSA 3E8FA 3FYIB 3SPCA 1R3JC 1DTOA 3OGCC 3D3IA 4LC1A 3E2EA 3PJSK 1RPRA 3CC4V 1JCHA 3JYCA 1GK9A 1G4YB 3LNMB 3B8MA 2EINB 4JASA 1VQ5V 2EILB 3IFXA 3FKSG 1XL6A 5KUMA 3W7SA 4PDRA 5J9PC 3CCSV 1J95A 1QR9A 4DO2A 5IY5C 4X88A 3SYPA 1S0VA 1NJIW 5EC2C 3ZRSA 4BIUA 1OCZC 4UV9A 3AEIA 1YHQV 2K1EA 3QNEA 1F51A 1V54B 1E79G 1YSCA 3VOUA 3WFVA 5IYBO 2XOKG 4X89A 1R6KA 1JQ0A 1K8AW 1S77D 2F43G 1P4RA 2AHYA 2V1DA 4MSWC 4Q20A 3AG1C 2XAHA 2W0FC 2X6BA 3W7UA 3ZJZA 4J9ZB 4KP4A 1VQ9V 3T4DA 5CMUA 2QEXV 2ZD9A 3GB7C 3CYOA 3W7WA 1FXKC 1OCZB 1OCRC 1RM1B 3ABLC 2JEXA 2DYSB 3ETDA 2A79B 2WLIA 4UUJC 1YITV 4QJFB 1CPYA 3ETGA 2XAJA 2KB1A 5LHIA 5KUKA 1P7BA 1VQ4V 2EILC 1QVGU 3K3WA 1QLEC 3MHSC 5CBHA 1Q7YW 1VQOV 2OCCB 5KA6A 3TCUA 2Z3YA 5H6QA 3RVYA 4LP8A 3I55V 2X6AA 3T2MA 1MABG 1GM9A 4QNHB 1OCCB 2NNUA 3DTUB 1S3JA 4GX1A 1BHAA 2YEVB 2WAMA 2EJRA 1E1QG 3FB6C 2Q6AA 3OE7G 2HVKC 1R3KC 3E8BA 1YI2V 1VQMV 3AG4C 3OMNB 1V55B 3LSSA 3KG2A 4MVMA 3OR6C 4R6ZA 4MVSA 3AG2B 2EIJB 4PA9A 2P67A 3F7YC 4RUEA 2EIKC 3QO8A 4WFHA 1AI6A 1KD1W 2HFEC 2A0LA 1JOYA 3QO7A 1FFTB 4J9YB 2M7WA 1VQPV 5LHHA 2ZDIA 3K0GA 5B1BB 4N23A 3W7TA 3AG1B 2DWEC 3AG3B 3ZN0A 3ETEA 3STLC 3SPHA 3ASNC 2XNDG 4GX0A 1K4CC 3ZMZA 2ZDIC 1Y66A 1JVMA 4P9PA 2IW5A 4TSFG 4TT3G 2B1IA 1PNMA 1NR1A 3SJQC 1NH2B 3CP1A 3F5WC 4P2ZA 3ZMUA 5EBWC 3B77A 5HFLA 1I5YA 3LSQA 2YSUB 4MVOA 1ENVA 2QM7A 2X6CA 3ZMVA 1K73W 2DQ0A 2WLMA 3JD4A 4BW5A 1AJQA 1M90W 1KP2A 1I5XA 4PDVA 3D36A 4PA3A 2EINC 1GM8A 1MG1A 2IJIA 3MD0A 2JK5C 5CA3A 3E83A 2Q69A 1WPXA 2B1GA 2XAGA 3HB3B 3K06A 4MVRA 2IU0A 5LBQA 1EFRG 5B3SB 5IDJA 5LGUA 4QE9A 2Q67A 2IU3A 2P6JA 3OR7C 4P30A 3TK1A 2WLLB 4G27B 1THZA 4U7OA 4JGSA 3CCJV 4HAMA 2EZPA 1BL8A 3E8GA 3CC7V 2B5UA 2H94A 3CCUV 2Z5UA 3JCZA 1MSWD 3UM7A 4MVUA 1PNLA 5L3EA 4CZZA 2DQ3A 4R50A 2WSSG 3FB7C 5IYCO 2W6IG 5EBLC 3SPJA 4FJCC 2IJKA 3ZRWB 1NQTA 3QO5A 4MTOA 4EKWA 3CCQV 2QE7G 4F4LA 2WPDG 2R9RB 4I9WA 2IJJA 1KECA 1LNQA 2EIMC 3OUFA 5EK0A 3E8HA 5B1NA 3CCMV 1ZWIC 2C2AA 1XL4A 3ZCCA 4QIWF 3SYCA 4MW3A 1JPXA 1W0JG 3LDCA 5L3DA 1AR1B 1GM7A 2R9IA 1SRYA 4WFGA 4GCZA 3CCVV 3NXSA 4JYCA 4UV8A 3STZC 3ZRXA 4DXWA 2GSMB 1AI4A 2WLLA 2HJFC 2OTJV 3M99B 2DYRC 2WLJA 4ZBMA 2JDIG 1DLBA 1NBMG 3JD2A 1VQ7V 1BMFG 4XDLA 1NKDA 5B3SC 5L3BA 3ASOC 2A9HA 4G28B 4H33A 5GW7A 1UJWB 1PD3A 2XAFA 4I5SA 2QTOA 4MTGA 2OCCC 5CBFA 3X2QB 2PI5A 1Q81W 5DN6G 1W2BU 1QLEB 3K9AA 1KP3A 4GX2A 5L3FA 1VQKV 3OW2U 5CBGA 1YIJV 3SYAA 4ASUG 3G6EV 3WG7C 3CMEV 1YJNV 1FXKA 4QE7A 1OCRB 1R3IC 5C93A 2EBOA 2Q68A 1RM1C 1Q82W 1FXKB 1VQ8V 1MOFA 4XBFA 2XASA 4R7CA 5BZBA 2D3OW 2UXNA 4U7NA 4WFFA 2EZOA 2OT5A 1COWG 2V7QG 2ZXWC 1HWYA 3OEEG 3ASNB 1SZTA 4KUMA 1R6NA 1ORQC 4JPRA 2FTKA 2WLIB 3AG3C 4UXNA 1QLNA 2LP7A 1PKXA 3K0DA 3RVZA 4BIZA 1NVPB 3IGAC 5EC1C 1AROP 1V54C 3G71V 3R65A 1QVFU 1EBOA 4UVAA 4MT8A 4HZ3A 3IC7A 2P7TC 4R8CA 1AI7A 4RAIA 3WG7B 3LUTB 2ATKC 2WWWA 4JYBA 3P30A 4BAYA 3T4ZA 1R3LC 1FS0G 2UXXA 3ML0A 4N21A 1CP9A 1BHBA 3AG2C 1N8RW 1AI5A 2Y48A 1K9MW 1NR7A 4HYOA 4MTFA 3X2QC 1VQNV 4QPJA 1V55C 2BOBC 3H01A 3CCLV 3OMAB 4FPPA 1E1RG 2P90A 3ASOB 2JJ2G 3GWOA 4PA7A 1Q86W 3SPIA 1R73A 2ZR2A 2IH1C 3OMIB 4G2KA 3I56V 1GKFA 4E2LA 1JJ2U 1H8HG 2DYRB 3E86A 3SYOA 1OCCC 3B8NA 2HVJC 2QM8A 2GHYA 4PELA 1H8EG 5E1AC 4RO2A 1FXVA 4XDKA 2ITDC 1ROPA 3LDDA 1K33A 1YTFB 1W0KG 3SPGA 1AJNA 1H38A 5DM6V 3ZRWA 1WLEA 1AJPA 3OM3B 3ABTA 4MVZA 4JF3A 2PI4A 4JTDB 2QA4V 4WFEA 3OFNG 3JD1A 5L3CA 1OHHG 4RUFA 2WLKA 5H6RA 3A0RA 4QPKA 2MK3A 4FMTA 1OCOB 2DYSC 3RW0A 3ABLB 4FIPC 3VBBA 3E89A 1KC8W 2Y69C 4XDJA 1S72V 3ZMTA 1G8MA 1K34A 4MVQA 4Z1MG 5EBMC 3DGEA 1YJWV 1FXHA 3FYEB 3RBZA 5HFMA 1F4NA 1L1FA 3CCEV 4H37A 4MTXA 1EZJA 3CD6V 1GO3F 1K4DC 1DF4A 2X7RB 1K92A 3JD0A 1VQLV 2ZXWB 1M56C 3E35A 4UVCA 4TWKA 4KFMA 4WF9V 3HPLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9P A;  4QE7 A;  1R3I C;  1OCZ C;  2Q68 A;  4JTA B;  3SJQ C;  3FB5 C;  3F5W C;  4P2Z A;  4R7C A;  5BZB A;  4WFF A;  5EBW C;  2WLN A;  2K1E A;  2H8P C;  3VOU A;  3ABK C;  4MVO A;  2ZXW C;  4X89 A;  2X6C A;  3UKM A;  3SYQ A;  1ORQ C;  2WLM A;  3K08 A;  4BW5 A;  3AG3 C;  2AHY A;  2WLI B;  3K03 A;  4MSW C;  4PDV A;  3AG1 C;  4PA3 A;  2W0F C;  2EIN C;  2X6B A;  3K0D A;  3RVZ A;  3ZJZ A;  4J9Z B;  2JK5 C;  3E83 A;  3T4D A;  2Q69 A;  3EFF K;  3K06 A;  2QKS A;  3IGA C;  3F7V C;  4MVR A;  1V54 C;  5EC1 C;  3T1C A;  2ZD9 A;  3GB7 C;  3R65 A;  4PDM A;  1M57 C;  2NLJ C;  4PA6 A;  4HZ3 A;  4QE9 A;  2P7T C;  1OCR C;  2Q67 A;  3OR7 C;  3ABL C;  4P30 A;  4R8C A;  2A79 B;  2WLI A;  2WLL B;  2IH3 C;  4RAI A;  4UUJ C;  4G27 B;  3LUT B;  2ATK C;  4CBC A;  1KKD A;  2KB1 A;  4MW8 A;  3T4Z A;  1R3L C;  3K04 A;  5KUK A;  1P7B A;  4PA4 A;  1BL8 A;  3AG2 C;  3E8G A;  2EIL C;  2YEV A;  1QLE C;  5CBH A;  5B1B C;  4HYO A;  4MTF A;  3X2Q C;  2DWD C;  1V55 C;  2BOB C;  3TCU A;  4P9O A;  3UM7 A;  4MVU A;  5B1A C;  3RVY A;  4LBE C;  4LP8 A;  3BEH A;  4PA7 A;  4R50 A;  3FB7 C;  2X6A A;  3T2M A;  1S5H C;  5EBL C;  3SPJ A;  3SPI A;  4QNH B;  2IH1 C;  4MTO A;  4EKW A;  4LCU C;  3TET A;  4X8A A;  4GX1 A;  1OCO C;  4PDL A;  3FB8 C;  4F4L A;  2R9R B;  2HG5 C;  4I9W A;  1LNQ A;  3E86 A;  3SYO A;  1OCC C;  2EIM C;  3OUF A;  5EK0 A;  2Q6A A;  3E8H A;  3FB6 C;  2HVJ C;  1ZWI C;  2HVK C;  1XL4 A;  1R3K C;  5E1A C;  2ITC C;  3E8B A;  4RO2 A;  4XDK A;  2EIJ C;  2ITD C;  3SYC A;  3AG4 C;  4MW3 A;  2WLH A;  3LDD A;  3LDC A;  3KG2 A;  4MVM A;  3OR6 C;  3SPG A;  4GX5 A;  4R6Z A;  4WFG A;  3ABM C;  4MVS A;  4MVZ A;  3STZ C;  4JTD B;  4DXW A;  3OUS A;  4WFE A;  2AHZ A;  4PA9 A;  4OXS A;  2WLL A;  4MS2 A;  2BOC C;  2WLK A;  3LDE A;  2HJF C;  3F7Y C;  4RUE A;  4RUF A;  2EIK C;  2DYR C;  2WLJ A;  4ZBM A;  4WFH A;  4JTC B;  2DYS C;  3RW0 A;  3E8F A;  2HFE C;  2A0L A;  1R3J C;  3E89 A;  3SPC A;  3OGC C;  2Y69 C;  3PJS K;  4XDJ A;  4XDL A;  5B3S C;  3ASO C;  4J9Y B;  2A9H A;  4G28 B;  4H33 A;  4MVQ A;  5EBM C;  2QTO A;  3JYC A;  1G4Y B;  2OCC C;  3K0G A;  3LNM B;  4MTG A;  3RBZ A;  5CBF A;  4H37 A;  4GX2 A;  2DWE C;  3IFX A;  5CBG A;  1K4D C;  1XL6 A;  5KUM A;  4PDR A;  3STL C;  3SPH A;  3ASN C;  3SYA A;  5J9P C;  4GX0 A;  1J95 A;  1K4C C;  5IY5 C;  3WG7 C;  1M56 C;  4X88 A;  3SYP A;  4TWK A;  4KFM A;  5EC2 C;  1JVM A;  3ZRS A;  3HPL C; 
#chains in the Genus database with same CATH topology
 4YJ3 A;  4JAU A;  4B7K A;  1M57 B;  4J41 A;  3PN1 A;  5K1X A;  4ZKI A;  2H8P C;  1ZSP A;  1IDS A;  4LFB B;  1JJO A;  4DR1 B;  5KHI A;  5LGN A;  3O9O A;  1K3E A;  4LH6 A;  1JX9 A;  1RP3 B;  3EFF K;  4JV5 B;  4DUY B;  4BR6 A;  1VQ6 V;  2NLJ C;  4FK5 C;  5EIB C;  2CDY A;  1GTO A;  3EHB B;  2HLD G;  1N33 B;  4IHJ A;  1YVW A;  2HEP A;  3W7X A;  2VQF O;  4B3R B;  2JEU A;  2HKO A;  3D8C A;  5KAF Z;  5LXT A;  4JI3 B;  1K5S A;  3RT3 C;  4X1I B;  2N05 A;  4WFB V;  1NTM H;  4JI5 O;  2JIZ G;  4JI2 O;  1QR8 A;  5FL7 G;  5IYZ B;  1Y4M A;  5JJN B;  4LCU C;  3CRC A;  1OZ0 A;  2Q73 A;  5LMU O;  2ZE7 A;  5KHG A;  4LR3 A;  2Y4T A;  2HR3 A;  2EUL A;  1XI1 A;  1PNK A;  5H9C A;  1RPO A;  4OX9 O;  3OUS A;  3OEH G;  4OXS A;  1S5L Z;  1Q90 D;  5IJ0 B;  1R3J C;  3E2E A;  3D3I A;  1BE3 H;  2LGW A;  2Q8V A;  2QWO B;  3CC4 V;  3JYC A;  3LNM B;  4JI0 B;  1HDJ A;  4JAS A;  2EIN B;  1VQ5 V;  4O4I B;  4DRX A;  5IE9 A;  4CS4 A;  5BY1 A;  4PDR A;  5J9P C;  2A7W A;  3CE2 A;  4DO2 A;  5A2Q N;  3SYP A;  2PYJ A;  3ZRS A;  3JAS B;  4BIU A;  4FLX A;  4DR5 O;  4KHP O;  4X62 O;  3CJH A;  1XBL A;  1IZ3 A;  5IYB O;  2QTS A;  2XT9 A;  3JAT B;  1K8A W;  2F43 G;  1P4R A;  1H2L A;  4O2A A;  3AG1 C;  4DV2 B;  2B9Z A;  3E22 B;  3ZJZ A;  3J81 N;  4J9Z B;  1VQ9 V;  2QEX V;  2PY5 A;  4X65 B;  2EJ7 A;  1URF A;  4IT5 A;  1SQQ H;  5JJJ B;  2JEX A;  2DYS B;  2DN9 A;  4YJ2 B;  3BA9 A;  3K58 A;  2XAJ A;  4GUN A;  1VQ4 V;  1Q7Y W;  3JAS A;  4LFC B;  3M8A A;  2Y0P A;  1KKC A;  3OD4 A;  3RVY A;  1ZTE A;  4JI4 O;  4HNA A;  3ZED A;  1H2K A;  2X6A A;  1IBL B;  4PD4 F;  3BAA A;  4FLY A;  1S3J A;  4GX1 A;  1Q6H A;  2JS3 A;  1MNG A;  1E1Q G;  3E22 A;  1YI2 V;  3LSS A;  4EB6 A;  3CEI A;  3CXH F;  3BAB A;  2ZM6 O;  4PA9 A;  2P67 A;  3GVM A;  1KB9 F;  3H1J H;  3F7Y C;  4WFH A;  3K57 A;  3S3W A;  1ZAU A;  1HR0 O;  2M7W A;  5LHH A;  4X1Y A;  5JVD A;  3W7T A;  2AXT Z;  2LO1 A;  5KHK A;  4DUY O;  4DV7 O;  2XND G;  4PHZ A;  5BMV B;  2ZDI C;  1JVM A;  2IW5 A;  1NH2 B;  2B1I A;  1PNM A;  3SJQ C;  4PI2 A;  4P2Z A;  3C3T A;  3ZMU A;  3O65 A;  5B66 Z;  2HHH O;  4AHC A;  1GN6 A;  1LR1 A;  2YSU B;  3OGI B;  1ENV A;  2KG7 B;  5CB4 A;  2WLM A;  3JD4 A;  3U10 A;  4BW5 A;  4LWS A;  4X62 B;  1TVK B;  4PA3 A;  2EIN C;  2IJI A;  1I7F A;  2JK5 C;  2Q69 A;  1EFR G;  2YXH A;  2ZCE A;  2P6J A;  4P30 A;  5JCO C;  1XIL A;  5D5P A;  2WLL B;  2CGO A;  3C90 A;  3L9D A;  4JGS A;  3CCJ V;  4X1K B;  1IVS A;  3CC7 V;  1PL4 A;  1CXZ B;  3JCZ A;  1XMQ B;  4UCU A;  4MVU A;  5L3E A;  3WB0 A;  2VRZ A;  3DSQ A;  3FB7 C;  5IYC O;  2YXL A;  1MZF A;  2UXD O;  1SQV H;  2UUB O;  1NQT A;  4EKW A;  1SQX H;  4NXN O;  4F6E A;  4IYH A;  1D5A A;  4I9W A;  1KBH A;  1KEC A;  5LXT B;  5LYJ B;  5EK0 A;  1YZB A;  4TOI A;  5JQG A;  2CTR A;  1Y76 A;  2BSK B;  1N32 O;  1H2S B;  1AR1 B;  4WFG A;  1HW7 A;  2OYQ A;  2WLL A;  4OPA A;  3M99 B;  2WLJ A;  4ZBM A;  2JDI G;  4FLU A;  1NKD A;  5B3S C;  3ASO C;  1UJW B;  3TXS A;  4I5S A;  4O4L B;  4IL6 Z;  1Q81 W;  2HP8 A;  4X1Y B;  5DN6 G;  1KU9 A;  3CRR A;  3T1Y O;  1I94 B;  1YJN V;  5CA1 A;  1DK1 A;  1SQB H;  1OCR B;  4QE7 A;  2EBO A;  2XAS A;  1D2D A;  2OT5 A;  3N2G B;  1COW G;  5J2T B;  1N34 O;  2V7Q G;  5JH7 B;  3N2G A;  4KUM A;  2QKC A;  1GH6 A;  2FTK A;  3AG3 C;  4BIZ A;  2DJV A;  5EC1 C;  4U3F H;  1ARO P;  1V54 C;  2GDS A;  3APO A;  1QVF U;  2PUS A;  4WBN A;  3CS5 A;  2ARH A;  2IM9 A;  4GKK O;  4R8C A;  4RAI A;  2OIE A;  3WG7 B;  3B40 A;  4BAY A;  4GLX A;  4JYA B;  2UXX A;  1XQ8 A;  1N8R W;  2YI8 A;  1K9M W;  3CX5 F;  4MTF A;  3P3P A;  1VQN V;  2BOB C;  1FPO A;  1NTK H;  3ASO B;  1Q86 W;  4NKG B;  2ZIM A;  3J80 N;  3I56 V;  4LF4 O;  1JFF B;  2DYR B;  3E86 A;  4UCS A;  3SYO A;  5LP6 A;  3B8N A;  4PEL A;  2GHY A;  1G1X B;  4XDK A;  1YTF B;  1H38 A;  1SQF A;  4JI8 B;  3ZRW A;  1WLE A;  1NS1 A;  4JTD B;  3OFN G;  4B3T O;  5L3C A;  1OHH G;  3A0R A;  4DV1 B;  3IAY A;  4LFC O;  2MK3 A;  3U0Z A;  2DYS C;  3VBB A;  1XMO B;  5BXZ A;  1BQZ A;  4Z1M G;  2WA4 A;  5EBM C;  5KHJ A;  3DGE A;  1NU1 H;  5AG2 A;  3J7A U;  5HFM A;  4H37 A;  4NR1 A;  1K4D C;  1DF4 A;  2QDO A;  3K5O A;  1XHX A;  4JZG A;  2BTQ A;  3UQ8 A;  4KFM A;  4DV7 B;  4WF9 V;  1YXB A;  1N36 B;  1CEZ A;  4JI1 B;  3OTO B;  4TV9 A;  3CXC U;  1NT2 B;  2PF4 E;  4AQY B;  1R6T A;  2R70 A;  1SER A;  3SYQ A;  3K08 A;  4JAV A;  2EX3 A;  3K03 A;  1JR9 A;  4FFB B;  2LJ2 A;  1K7D A;  3IC9 A;  4HBN A;  1NVP D;  1SZX A;  2UUA B;  2IJH A;  1G6U A;  2QKS A;  3F7V C;  3G67 A;  2JJ1 G;  1XEQ A;  4CC5 A;  2ZR3 A;  3G4S V;  2QSA A;  2Q7E A;  1B04 A;  1HNW O;  3UO2 A;  3ZRV A;  4LF5 O;  1Q43 A;  4DK0 A;  4BWA A;  3JAT A;  2BTQ B;  1VF5 B;  2UUC B;  2E5L O;  2YEV A;  2Q9L A;  4JZ2 A;  1NH2 D;  1N0N A;  2DWD C;  5B1A C;  1M9N A;  1DGS A;  4UVB A;  2CK3 G;  2EIM B;  3JAL B;  4PDL A;  1BGY H;  2UUC O;  1K97 A;  3QVN A;  3CPW U;  5IWA O;  4DR2 B;  2ZQM A;  2NN4 A;  3OAA G;  2PZS A;  3K5M A;  4EB6 B;  4GX5 A;  4NTX A;  4I4T B;  1HNW B;  1YTF D;  4D7S A;  3AG4 B;  3P32 A;  4H0L B;  3WU2 Z;  3ZX6 A;  4B3S O;  2BOC C;  4ZOL A;  1Q5O A;  1QBZ A;  2A3Q A;  4KL1 A;  4LWS B;  3ZMS A;  5B1O A;  4WFA V;  4U3J A;  3BA8 A;  4JYA O;  1DTO A;  3CRM A;  3OGC C;  4I50 A;  4J7Z A;  1UPG A;  3SJA C;  1WAZ A;  1GK9 A;  4EEQ A;  4I9Q A;  4AQY O;  3A0B Z;  2YIB A;  3HKE B;  1QR9 A;  4I7Z B;  3CCS V;  4LFA B;  1S0V A;  4FLV A;  3EVK A;  5LA6 A;  1OCZ C;  3THO A;  3MDS A;  3JAM N;  3BFR A;  3JAK A;  1F51 A;  1YSC A;  1E79 G;  2XOK G;  4X89 A;  2GBO A;  2V1D A;  2XAH A;  3W7U A;  4IIJ B;  2XHB A;  3GB7 C;  2RMK B;  4FZ0 A;  4K8X A;  1NTZ H;  2WLI A;  5KAI Z;  4DR6 O;  4LF6 B;  3CRQ A;  3ETG A;  2E3C A;  5EIB D;  2D2C B;  4O4J B;  4DW1 A;  1D5N A;  2ZIO A;  5CBH A;  1N36 O;  1VQO V;  5KA6 A;  1VIB A;  5H6Q A;  4LP8 A;  4JAA A;  1IXB A;  3H1K H;  3LSU A;  3T2M A;  2Q0A A;  3L73 H;  2UXB O;  1WA8 B;  1OCC B;  3DTU B;  5FPO A;  2ZNJ A;  3JSN A;  5BMV A;  2YIC A;  3OE7 G;  1HNX O;  2MW2 B;  4TQD A;  2GTS A;  2JGD A;  3KG2 A;  3OR6 C;  4MVM A;  5GON A;  4MVS A;  4K3A A;  5IT9 N;  4ZI7 A;  2R72 A;  2JVD A;  1WP7 A;  5IJ9 B;  5J2U A;  1Z5W A;  3CSX A;  1N0J A;  1IX9 A;  3Q4H A;  2HFE C;  5ITZ B;  4DR3 B;  3QO7 A;  5JQG B;  4DR1 O;  2AZ2 A;  5B1B B;  1YF2 A;  2DWE C;  3AG3 B;  3ETE A;  1H2M A;  3KCX A;  4YIO A;  2KSD A;  3STL C;  3ASN C;  5CA1 B;  4GX0 A;  1J5E O;  1SC5 B;  3ZMZ A;  1Y66 A;  1UFI A;  1NR1 A;  2FKX A;  3K59 A;  3CP1 A;  3AK3 A;  4B3R O;  1WN7 A;  2AGA A;  4IHJ B;  1SA0 B;  2HHH B;  4JI6 B;  2CTP A;  2VS0 A;  5FPR A;  2KQX A;  3DXR B;  3MD0 A;  3C3S A;  1WPX A;  4W4K A;  5B3S B;  2CTQ A;  3WB1 A;  1SQP H;  4JI6 O;  3OR7 C;  2IU3 A;  3TK1 A;  4G27 B;  1THZ A;  3QF7 A;  1HR0 B;  5EYP A;  1L0N H;  3VQV A;  2EZP A;  1BL8 A;  2Z5U A;  3UM7 A;  2ZM6 B;  3T1Y B;  2WSS G;  2W6I G;  2DMX A;  3SPJ A;  2ZE8 A;  4F6R B;  4F4L A;  3JAR B;  3CRA A;  4LF8 B;  3BCC H;  1ZUQ A;  5B1N A;  5BR8 O;  2C2A A;  4QIW F;  3SYC A;  4CC6 A;  3STZ C;  1LUV A;  1AI4 A;  1AIL A;  4DV5 B;  4DV3 B;  1Z2G A;  2DYR C;  1DLB A;  1NBM G;  1BMF G;  2A9H A;  5KHH A;  3RYF B;  2ZT9 B;  2QTO A;  4MTG A;  4I0X A;  5CBF A;  4FVM A;  3X2Q B;  3APQ A;  3K9A A;  1KP3 A;  2F23 A;  4J11 A;  4YY3 B;  4FLZ A;  3OW2 U;  2UXB B;  4X64 O;  3B09 A;  4ASU G;  3WG7 C;  1U97 A;  3FX7 A;  5B5E Z;  2GUZ A;  4FM2 A;  4YIP A;  3F5T A;  1FXK A;  1SQG A;  1R3I C;  1RM1 C;  4TV9 B;  4XBF A;  5BZB A;  4WFF A;  4QGP A;  1Q6U A;  2ZXW C;  2QWR B;  2N04 A;  4JPR A;  3FAV B;  2Y0I A;  4CS3 A;  2F4V O;  4UXN A;  1QLN A;  4J7K A;  1QHT A;  3R65 A;  1EBO A;  4HZ3 A;  3IC7 A;  1AI7 A;  4UCV A;  3P30 A;  5IYZ A;  1R3L C;  2Y48 A;  1NR7 A;  4HYO A;  3H01 A;  3CCL V;  1IBL O;  2P90 A;  3GWO A;  4PA7 A;  2VQE O;  2ADP A;  2IH1 C;  3H1I H;  4E2L A;  1JJ2 U;  4A5U B;  1H8E G;  1HNX B;  2ITD C;  3TJT A;  1K33 A;  1VAR A;  1AJN A;  3DC6 A;  1P84 F;  2CH7 B;  4Z1V A;  1AJP A;  3OM3 B;  4JF3 A;  4UCO A;  4ZOL B;  4O4I A;  4DRX B;  3ABL B;  3E89 A;  1KC8 W;  1QNM A;  4XDJ A;  3HKB B;  2R9A A;  2DOS A;  4ZI7 B;  2RNB A;  3HKB A;  3SJB C;  1YJW V;  2QWP B;  4DR4 B;  3CCE V;  3D36 C;  5CB4 B;  4JI1 O;  1EZJ A;  4TV8 A;  2Q0O C;  3R66 A;  5JWP A;  2VQE B;  1HNZ B;  1K92 A;  3JD0 A;  1M56 C;  2GV9 A;  3ZHR A;  2Q4P A;  2BCC H;  2Q7H A;  3FB5 C;  1BSM A;  2WLN A;  1GAX A;  4BW9 A;  1Y74 A;  1B6Q A;  2XAQ A;  3UKM A;  1VF6 A;  2W6J G;  5FNV A;  1SET A;  2X0L A;  3ZIA G;  2ETN A;  2DW4 A;  4GT1 A;  4DV3 O;  1QCE A;  2YXY A;  3ABK B;  5LA6 B;  3T1C A;  4LFA O;  4YXW G;  4B3T B;  4OX9 B;  4PDM A;  1M57 C;  4PA6 A;  2YID A;  1K5Q A;  5LOV B;  1XNQ B;  1M56 B;  2IBZ H;  5KX5 B;  1KYO F;  1KKD A;  3VQY A;  4GKJ O;  3IJ4 A;  4MW8 A;  3K04 A;  2FL4 A;  3RYI A;  3UT5 B;  3ABM B;  1RSO B;  4UFZ A;  2UU9 B;  5B1B C;  4DV5 O;  5KA5 A;  1FD9 A;  5CN0 A;  4IIJ A;  4P9O A;  1TA8 A;  1U96 A;  2P5O A;  1SES A;  4LBE C;  1S5H C;  3HKC A;  3TET A;  4RQE A;  2AZ0 A;  1S5J A;  1OCO C;  3FB8 C;  3HKD A;  4JI3 O;  2AW9 A;  2M6Y A;  3K79 A;  3NR7 A;  2F1M A;  5TIS Z;  1S76 D;  5JCO A;  1BT8 A;  1TUE B;  4O4H B;  4WCE V;  1IBM B;  3MHH C;  3CCR V;  4FZ1 A;  5B1A B;  3ZN1 A;  4L8J A;  1F4M A;  2WLH A;  5LGT A;  4FLT A;  1DF5 A;  4GKK B;  5EZY B;  3KZI Z;  1EN6 A;  1P49 A;  5LHG A;  2AHZ A;  1L8D A;  3JAW B;  4MS2 A;  3CMA V;  4JTC B;  1TVK A;  4GYC B;  2LFS A;  3E8F A;  2E5L B;  4LC1 A;  2QGN A;  1RPR A;  1FJG B;  4K0K O;  2UXC O;  3EXA A;  1SKV A;  1JCH A;  2E76 B;  4LF8 O;  3B8M A;  1IBK O;  5GTI Z;  3IFX A;  4JI2 B;  1N4C A;  1VF6 C;  4OPH A;  1I94 O;  2UUA O;  5EC2 C;  3RYF A;  4FM1 A;  3AEI A;  3VOU A;  3KCY A;  2QKA A;  1Y74 B;  1JQ0 A;  3JAW A;  1S77 D;  3OTO O;  2AHY A;  4MSW C;  1XNR O;  4JYY A;  1AP6 A;  2W0F C;  2X6B A;  4DV4 B;  3H1L H;  3T4D A;  2E75 B;  2ZD9 A;  4NYK A;  3CYO A;  5GON B;  3W7W A;  1Q8I A;  5LMN B;  1VP7 A;  1OCZ B;  1OCR C;  1XRE A;  3ABL C;  3ETD A;  2A79 B;  5EYP B;  4UUJ C;  1P7G A;  1CPY A;  5LHI A;  4DR3 O;  3N2K B;  3RYH B;  5KUK A;  1P7B A;  2EIL C;  1QVG U;  2OCC B;  2F95 B;  2UUB B;  3TCU A;  4O4L A;  2OIG A;  4DV1 O;  1Y6X A;  1J5E B;  3RGB A;  1MAB G;  4QNH B;  1BS3 A;  3UO3 A;  4YHH O;  2E74 B;  3T1H B;  2YEV B;  4TUY A;  3FB6 C;  2HVK C;  1BZK A;  4EFE A;  4R6Z A;  1M5I A;  4PJ0 Z;  4CS2 A;  1SA0 A;  4O2B B;  4UCR A;  3QO8 A;  3ZS8 C;  2A0L A;  3SJC C;  1JOY A;  3I5D A;  1N32 B;  1V9P A;  4GKJ B;  4TQF A;  4J9Y B;  3OTF A;  4X1I A;  4YJ3 B;  2QM4 A;  5K1P A;  3K0G A;  1GN2 A;  3N27 A;  3L71 H;  3AG1 B;  3G6B A;  1NZ6 A;  4E4E A;  3VQX A;  5JH7 A;  2ZKO A;  3SDL A;  2PGG A;  4TUY B;  4CH3 A;  2Q5Z A;  1XMQ O;  4IGG A;  4DV4 O;  4TSF G;  4TT3 G;  1WPB A;  5EBW C;  3B2E E;  3B77 A;  5HFL A;  1I5Y A;  3LSQ A;  4MVO A;  1JA8 A;  4DR6 B;  4F6R A;  1JFF A;  3BPZ A;  4LH7 A;  3BVO A;  3HB3 B;  2IU0 A;  1PM9 A;  3CWB H;  5IDJ A;  5LGU A;  2Q67 A;  3DC5 A;  4J42 A;  4U7O A;  1WNS A;  3A0H Z;  4HAM A;  1F7Y A;  3E8G A;  4OGQ B;  2H94 A;  3CCU V;  1Y67 A;  4CZZ A;  4JI4 B;  5EBL C;  3ZRW B;  2ODM A;  4MTO A;  3CCQ V;  3RFR A;  4DW0 A;  2QE7 G;  5A9G A;  5IJ0 A;  3E8H A;  3CB2 A;  3QTC A;  1HP8 A;  4DR7 B;  1IBM O;  3ICX A;  2YDE A;  1EN5 A;  1JPX A;  2PTM A;  2CH7 A;  3LDC A;  1GM7 A;  4NXN B;  4GCZ A;  3JAL A;  4UV8 A;  3TXQ A;  3ZRX A;  4DXW A;  5F2V O;  2GSM B;  4B3S B;  2N74 A;  2OTJ V;  4NVP A;  5LP6 B;  3JD2 A;  4XDL A;  5L3B A;  1EN4 A;  4G28 B;  1XOU A;  2L35 A;  1PD3 A;  4B3M B;  4X20 B;  4BIO A;  4LF5 B;  2PI5 A;  5IJ9 A;  2RJZ A;  4U3J B;  5CBG A;  4NXM B;  1YIJ V;  3SYA A;  2DE0 X;  3G6E V;  3CME V;  4FFB A;  1FXK B;  1VQ8 V;  4I55 A;  2D3O W;  1LUW A;  1RFY A;  1WP8 A;  2FB5 A;  2RDC A;  3OEE G;  2V4D A;  5H5N A;  1SZT A;  1ORQ C;  4H44 B;  3FAV A;  1PKX A;  3RVZ A;  2ZE6 A;  1NVP B;  2ILM A;  4FM0 A;  4HNA B;  3CJH B;  4ABM A;  4CH5 A;  4ICG A;  2ATK C;  4DR7 O;  4JYB A;  4ZHQ A;  1FS0 G;  4X66 B;  1BHB A;  4KXR A;  4KHP B;  1M4U A;  1AI5 A;  2RQ6 A;  3RN4 A;  4PV1 B;  2F93 B;  4QPJ A;  4I55 B;  2LW1 A;  3OMA B;  2OWO A;  4FPP A;  2YIA A;  3HKC B;  3SPI A;  1TAE A;  1R73 A;  2ZR2 A;  3OMI B;  5LOV A;  3B4S A;  4O4J A;  3RYC A;  1H8H G;  1JMK C;  5ITZ A;  2HVJ C;  2QM8 A;  4B3M O;  5IWA B;  5E1A C;  4RO2 A;  1YDX A;  3RYI B;  3UT5 A;  2JS5 A;  5EZY A;  1BCC H;  2PI4 A;  2QA4 V;  4WFE A;  1NI8 A;  2YI9 A;  3JD1 A;  4DV6 B;  4RUF A;  2K9P A;  2WLK A;  4JV5 O;  2HJD A;  3LNN A;  5H2F Z;  1VF7 A;  3GWK C;  4JI8 O;  4FMT A;  4FIP C;  4X1K A;  1WB8 A;  2GTA A;  3ZMT A;  1G8M A;  1K34 A;  2CAZ C;  4MVQ A;  5LMU B;  3M7M X;  1N34 B;  2P06 A;  3FYE B;  3RBZ A;  5JJE B;  5LMN O;  4MTX A;  1US6 A;  1PP9 H;  3CD6 V;  1GO3 F;  1SS3 A;  4JI5 B;  1XUQ A;  2ZNI A;  1VQL V;  3E35 A;  4UVC A;  4TWK A;  1Q3E A;  3CC2 V;  4JTA B;  4DV2 O;  3L70 H;  4L87 A;  1F23 A;  1M1K W;  3BY6 A;  2P4K A;  3ABK C;  5IY5 B;  5DEC A;  2LFR A;  4K8Z A;  5FLX N;  3K9S A;  4EFB A;  2P4V A;  1QU7 A;  1ZLZ A;  3JD3 A;  4J80 A;  2LQT A;  4ZIB A;  5L3G A;  2YUA A;  5LP6 C;  2IH3 C;  2OTL V;  4JI0 O;  1R1B A;  4LF7 B;  2KG7 A;  4K0K B;  1M93 A;  5LYJ A;  2UXC B;  1Q6I A;  1WA8 A;  4CBC A;  2O57 A;  1IXM A;  4PA4 A;  1YEW A;  1XHZ A;  1FFX B;  2BTO A;  4FLW A;  2UXD B;  1KQS U;  2CE4 A;  4DV6 O;  3BEH A;  1GN3 A;  5E79 Z;  3WB2 A;  1AR5 A;  2Y69 B;  3JCU Z;  5CA0 A;  4X8A A;  1PL0 A;  2HG5 C;  2EIK B;  5CA0 B;  1AP5 A;  3H1H H;  5IYD O;  1PV0 A;  2ITC C;  1IUR A;  2EIJ C;  3FD9 A;  1AB3 A;  4NTY A;  1YJ9 V;  4I0X B;  3ABM C;  3ABU A;  2NR5 A;  2OCH A;  1H2G A;  4NTW A;  1GMG A;  3LDE A;  5JVD B;  4UB8 Z;  1MSD A;  4RQF A;  1X4T A;  3FYI B;  3SPC A;  5KMG A;  4X66 O;  3PJS K;  1EM1 A;  4LF6 O;  1G4Y B;  5GTH Z;  1N33 O;  2W0X A;  5C8Y A;  2EIL B;  3FKS G;  1XL6 A;  5KUM A;  3W7S A;  1T5E A;  1J95 A;  3N2K A;  3RYH A;  5IY5 C;  2QWN B;  1Z5V A;  4X88 A;  1NJI W;  4X20 A;  3L75 H;  4UV9 A;  1I0H A;  1IBK B;  3ZHS A;  1EZV H;  2K1E A;  3QNE A;  4PI0 A;  3ZHQ A;  1YHQ V;  1V54 B;  1WJZ A;  3WFV A;  4LF7 O;  1R6K A;  2ZE5 A;  4Q20 A;  1GN4 A;  2GUZ B;  4KP4 A;  3AK1 A;  5CMU A;  4NXM O;  1XNR B;  4IYI A;  1FXK C;  1RM1 B;  4DR4 O;  1YIT V;  1OV9 A;  5FNV B;  2QWQ B;  1L0L H;  4QJF B;  2PYL A;  2KB1 A;  1FJG O;  5KLV H;  4B7E A;  3K3W A;  1QLE C;  3MHS C;  2Q7G A;  2Z3Y A;  2YIB D;  4J10 A;  3I55 V;  5KX5 A;  2LGQ A;  1GM9 A;  2NNU A;  3L72 H;  4ZHQ B;  2UU9 O;  2JGU A;  1BHA A;  1RSO A;  2WAM A;  2EJR A;  2Q6A A;  4O2A B;  5DED A;  1R3K C;  3RWR D;  3E8B A;  4I50 B;  1WB7 A;  1VQM V;  3AG4 C;  4H13 B;  3OMN B;  1V55 B;  2WA3 A;  1XNQ O;  1FAF A;  1W59 A;  3AG2 B;  2EIJ B;  2KKW A;  3P3N A;  2LW7 A;  4X65 O;  4RUE A;  4LF9 B;  2EIK C;  4O4H A;  3UCS C;  3JAR A;  4J7J A;  1AI6 A;  1KD1 W;  3ZHT A;  2FML A;  4JI7 B;  1FFT B;  4CH6 A;  3MAQ A;  1VQP V;  2ZDI A;  1MZE A;  1XDC A;  3G80 A;  2YC0 A;  4UB6 Z;  4N23 A;  4DV0 B;  5C8Y B;  2FYU H;  3ZN0 A;  3SPH A;  4DYL A;  1O9H A;  1K4C C;  3ETQ A;  1SF9 A;  3AG7 A;  1HNZ O;  1ZX3 A;  4P9P A;  3F5W C;  2CUG A;  4DV0 O;  2CGN A;  2QM7 A;  4WBN B;  2X6C A;  3ZMV A;  1K73 W;  3HKE A;  2DQ0 A;  4DR5 B;  1AJQ A;  1M90 W;  1KP2 A;  1I5X A;  1VMG A;  4PDV A;  3A8T A;  3D36 A;  3KKY A;  2ADQ B;  1GM8 A;  1MG1 A;  2G38 A;  4LF9 O;  5CA3 A;  2A06 H;  3E83 A;  5LBQ A;  2B1G A;  2XAG A;  3K06 A;  4MVR A;  4B08 A;  4QE9 A;  2Y4U A;  1GRJ A;  1B3Q A;  4DK1 A;  4YJ2 A;  3U11 A;  1AR4 A;  4FFK A;  3S3X A;  1AVM A;  2B5U A;  4Q6G A;  3VQW A;  1MSW D;  4D6T H;  3SR2 C;  1PNL A;  2ZIN A;  3JAK B;  2DQ3 A;  3L74 H;  4R50 A;  1BQ0 A;  4FJC C;  2IJK A;  1FKA O;  3QO5 A;  4TV8 B;  2WPD G;  2R9R B;  2IJJ A;  1LNQ A;  2EIM C;  3OUF A;  3D3Q A;  4DR2 O;  1Y76 B;  3CCM V;  1ZWI C;  4D7T A;  1XL4 A;  3ZCC A;  1KMI Z;  4JI7 O;  4MW3 A;  1W0J G;  3QG5 A;  1B06 A;  3ZHU A;  5L3D A;  2R9I A;  1I08 A;  1SRY A;  2P22 C;  3CCV V;  3NXS A;  4JYC A;  3H9V A;  2HJF C;  3RYC B;  1OJH A;  1VQ7 V;  2JGD B;  1MMM A;  3BHP A;  4H33 A;  5GW7 A;  2XAF A;  2OCC C;  4C7U A;  2CTW A;  2Z0A A;  1W2B U;  1QLE B;  4O2B A;  3K5L A;  4GX2 A;  5L3F A;  1VQK V;  1A32 A;  4LNU A;  2RCV A;  1PPJ H;  4LNU B;  5C93 A;  1YCI A;  2Q68 A;  1Q82 W;  4X64 B;  1TUB A;  1MOF A;  4Z2W A;  2L6L A;  4R7C A;  2UXN A;  4U7N A;  5J2T A;  2EZO A;  3JSL A;  4RWU A;  3TGU H;  1HWY A;  3SGI A;  3K5N A;  3ASN B;  1R6N A;  3HKD B;  1MA1 A;  2WLI B;  4UCT A;  2LP7 A;  3Q4H B;  3K0D A;  1X59 A;  4NB5 A;  4GZR B;  2VWJ A;  3IGA C;  3AK2 A;  3G71 V;  2F4V B;  1H2N A;  4UVA A;  4MT8 A;  1O9G A;  2P7T C;  5D5Q A;  4YY3 O;  3HR0 A;  4LFB O;  3OT7 A;  3LUT B;  2WWW A;  4K35 A;  3T4Z A;  3ML0 A;  4N21 A;  1CP9 A;  5KMG B;  3AG2 C;  1FFX A;  1XMO O;  2BSK A;  1KUQ A;  3X2Q C;  1TUB B;  1V55 C;  3BRC A;  1E1R G;  2JJ2 G;  2QJ1 A;  4DUZ B;  2VWK A;  3CHX A;  4G2K A;  4I4T A;  1GKF A;  2QR4 A;  1OCC C;  5LL6 Y;  1FXV A;  5BR8 B;  1ROP A;  3LDD A;  1W0K G;  3SPG A;  4LF4 B;  5DM6 V;  4CH4 A;  3ZHV A;  3ABT A;  4MVZ A;  2BE3 A;  3FFQ A;  4AI8 A;  2JRI A;  2F66 C;  3ZBH A;  5H6R A;  2RN9 A;  4QPK A;  1OCO B;  1TGO A;  3RW0 A;  4W4L A;  4X9Q A;  2XTA A;  2Y69 C;  1S72 V;  1ZL8 A;  4AIL C;  2VQF B;  2YS8 A;  1ZL8 B;  2H3O A;  3T1H O;  1FXH A;  2XUM A;  4YHH B;  1F4N A;  1L1F A;  1QQC A;  4DUZ O;  1VEW A;  2X7R B;  5J2U B;  2ZXW B;  3DXR A;  1FYJ A;  3A2F A;  3HPL C; 
#chains in the Genus database with same CATH homology
 3CC2 V;  1CEZ A;  4JAU A;  4JTA B;  3FB5 C;  4L87 A;  1M57 B;  3CXC U;  2WLN A;  4ZKI A;  1F23 A;  1M1K W;  2H8P C;  3BY6 A;  3ABK C;  1B6Q A;  5IY5 B;  2XAQ A;  1SER A;  3UKM A;  3SYQ A;  3K08 A;  4JAV A;  5LGN A;  2LFR A;  3K03 A;  1K3E A;  2W6J G;  1K7D A;  1SET A;  1JX9 A;  2X0L A;  3ZIA G;  1NVP D;  2DW4 A;  4GT1 A;  1QCE A;  3ABK B;  2IJH A;  3EFF K;  3JD3 A;  2QKS A;  3F7V C;  3T1C A;  2JJ1 G;  4YXW G;  5L3G A;  4PDM A;  1M57 C;  2ZR3 A;  3G4S V;  1VQ6 V;  2NLJ C;  4PA6 A;  4FK5 C;  1K5Q A;  1GTO A;  3ZRV A;  3EHB B;  2HLD G;  2IH3 C;  2OTL V;  1M56 B;  4CBC A;  1KKD A;  3W7X A;  4MW8 A;  1IXM A;  3K04 A;  4PA4 A;  2JEU A;  2HKO A;  3ABM B;  2YEV A;  5B1B C;  1K5S A;  1NH2 D;  5KA5 A;  2DWD C;  5CN0 A;  4P9O A;  4WFB V;  1KQS U;  5B1A C;  1M9N A;  1SES A;  4LBE C;  3BEH A;  4UVB A;  1S5H C;  2CK3 G;  2JIZ G;  2Y69 B;  1QR8 A;  5FL7 G;  2EIM B;  1Y4M A;  4LCU C;  3TET A;  4X8A A;  4RQE A;  1OCO C;  4PDL A;  3FB8 C;  1PL0 A;  2HG5 C;  2EIK B;  1K97 A;  3K79 A;  1OZ0 A;  1S76 D;  3CPW U;  1TUE B;  4WCE V;  5IYD O;  2ITC C;  3MHH C;  2EIJ C;  3CCR V;  5B1A B;  3ZN1 A;  2HR3 A;  2ZQM A;  3OAA G;  1F4M A;  2WLH A;  5LGT A;  1YJ9 V;  1DF5 A;  1PNK A;  4GX5 A;  5H9C A;  3ABM C;  1YTF D;  3AG4 B;  3P32 A;  3ABU A;  1RPO A;  5LHG A;  3OUS A;  3OEH G;  2AHZ A;  1H2G A;  4OXS A;  4MS2 A;  1GMG A;  2BOC C;  3LDE A;  1QBZ A;  3CMA V;  3ZMS A;  4RQF A;  5B1O A;  4WFA V;  4JTC B;  2LFS A;  3E8F A;  3FYI B;  3SPC A;  1R3J C;  1DTO A;  3OGC C;  3D3I A;  4LC1 A;  3E2E A;  3PJS K;  1RPR A;  3CC4 V;  1JCH A;  3JYC A;  1GK9 A;  1G4Y B;  3LNM B;  3B8M A;  2EIN B;  4JAS A;  1VQ5 V;  2EIL B;  3IFX A;  3FKS G;  1XL6 A;  5KUM A;  3W7S A;  4PDR A;  5J9P C;  3CCS V;  1J95 A;  1QR9 A;  4DO2 A;  5IY5 C;  4X88 A;  3SYP A;  1S0V A;  1NJI W;  5EC2 C;  3ZRS A;  4BIU A;  1OCZ C;  4UV9 A;  3AEI A;  1YHQ V;  2K1E A;  3QNE A;  1F51 A;  1V54 B;  1E79 G;  1YSC A;  3VOU A;  3WFV A;  5IYB O;  2XOK G;  4X89 A;  1R6K A;  1JQ0 A;  1K8A W;  1S77 D;  2F43 G;  1P4R A;  2AHY A;  2V1D A;  4MSW C;  4Q20 A;  3AG1 C;  2XAH A;  2W0F C;  2X6B A;  3W7U A;  3ZJZ A;  4J9Z B;  4KP4 A;  1VQ9 V;  3T4D A;  5CMU A;  2QEX V;  2ZD9 A;  3GB7 C;  3CYO A;  3W7W A;  1FXK C;  1OCZ B;  1OCR C;  1RM1 B;  3ABL C;  2JEX A;  2DYS B;  3ETD A;  2A79 B;  2WLI A;  4UUJ C;  1YIT V;  4QJF B;  1CPY A;  3ETG A;  2XAJ A;  2KB1 A;  5LHI A;  5KUK A;  1P7B A;  1VQ4 V;  2EIL C;  1QVG U;  3K3W A;  1QLE C;  3MHS C;  5CBH A;  1Q7Y W;  1VQO V;  2OCC B;  5KA6 A;  3TCU A;  2Z3Y A;  5H6Q A;  3RVY A;  4LP8 A;  3I55 V;  2X6A A;  3T2M A;  1MAB G;  1GM9 A;  4QNH B;  1OCC B;  2NNU A;  3DTU B;  1S3J A;  4GX1 A;  1BHA A;  2YEV B;  2WAM A;  2EJR A;  1E1Q G;  3FB6 C;  2Q6A A;  3OE7 G;  2HVK C;  1R3K C;  3E8B A;  1YI2 V;  1VQM V;  3AG4 C;  3OMN B;  1V55 B;  3LSS A;  3KG2 A;  4MVM A;  3OR6 C;  4R6Z A;  4MVS A;  3AG2 B;  2EIJ B;  4PA9 A;  2P67 A;  3F7Y C;  4RUE A;  2EIK C;  3QO8 A;  4WFH A;  1AI6 A;  1KD1 W;  2HFE C;  2A0L A;  1JOY A;  3QO7 A;  1FFT B;  4J9Y B;  2M7W A;  1VQP V;  5LHH A;  2ZDI A;  3K0G A;  5B1B B;  4N23 A;  3W7T A;  3AG1 B;  2DWE C;  3AG3 B;  3ZN0 A;  3ETE A;  3STL C;  3SPH A;  3ASN C;  2XND G;  4GX0 A;  1K4C C;  3ZMZ A;  2ZDI C;  1Y66 A;  1JVM A;  4P9P A;  2IW5 A;  4TSF G;  4TT3 G;  2B1I A;  1PNM A;  1NR1 A;  3SJQ C;  1NH2 B;  3CP1 A;  3F5W C;  4P2Z A;  3ZMU A;  5EBW C;  3B77 A;  5HFL A;  1I5Y A;  3LSQ A;  2YSU B;  4MVO A;  1ENV A;  2QM7 A;  2X6C A;  3ZMV A;  1K73 W;  2DQ0 A;  2WLM A;  3JD4 A;  4BW5 A;  1AJQ A;  1M90 W;  1KP2 A;  1I5X A;  4PDV A;  3D36 A;  4PA3 A;  2EIN C;  1GM8 A;  1MG1 A;  2IJI A;  3MD0 A;  2JK5 C;  5CA3 A;  3E83 A;  2Q69 A;  1WPX A;  2B1G A;  2XAG A;  3HB3 B;  3K06 A;  4MVR A;  2IU0 A;  5LBQ A;  1EFR G;  5B3S B;  5IDJ A;  5LGU A;  4QE9 A;  2Q67 A;  2IU3 A;  2P6J A;  3OR7 C;  4P30 A;  3TK1 A;  2WLL B;  4G27 B;  1THZ A;  4U7O A;  4JGS A;  3CCJ V;  4HAM A;  2EZP A;  1BL8 A;  3E8G A;  3CC7 V;  2B5U A;  2H94 A;  3CCU V;  2Z5U A;  3JCZ A;  1MSW D;  3UM7 A;  4MVU A;  1PNL A;  5L3E A;  4CZZ A;  2DQ3 A;  4R50 A;  2WSS G;  3FB7 C;  5IYC O;  2W6I G;  5EBL C;  3SPJ A;  4FJC C;  2IJK A;  3ZRW B;  1NQT A;  3QO5 A;  4MTO A;  4EKW A;  3CCQ V;  2QE7 G;  4F4L A;  2WPD G;  2R9R B;  4I9W A;  2IJJ A;  1KEC A;  1LNQ A;  2EIM C;  3OUF A;  5EK0 A;  3E8H A;  5B1N A;  3CCM V;  1ZWI C;  2C2A A;  1XL4 A;  3ZCC A;  4QIW F;  3SYC A;  4MW3 A;  1JPX A;  1W0J G;  3LDC A;  5L3D A;  1AR1 B;  1GM7 A;  2R9I A;  1SRY A;  4WFG A;  4GCZ A;  3CCV V;  3NXS A;  4JYC A;  4UV8 A;  3STZ C;  3ZRX A;  4DXW A;  2GSM B;  1AI4 A;  2WLL A;  2HJF C;  2OTJ V;  3M99 B;  2DYR C;  2WLJ A;  4ZBM A;  2JDI G;  1DLB A;  1NBM G;  3JD2 A;  1VQ7 V;  1BMF G;  4XDL A;  1NKD A;  5B3S C;  5L3B A;  3ASO C;  2A9H A;  4G28 B;  4H33 A;  5GW7 A;  1UJW B;  1PD3 A;  2XAF A;  4I5S A;  2QTO A;  4MTG A;  2OCC C;  5CBF A;  3X2Q B;  2PI5 A;  1Q81 W;  5DN6 G;  1W2B U;  1QLE B;  3K9A A;  1KP3 A;  4GX2 A;  5L3F A;  1VQK V;  3OW2 U;  5CBG A;  1YIJ V;  3SYA A;  4ASU G;  3G6E V;  3WG7 C;  3CME V;  1YJN V;  1FXK A;  4QE7 A;  1OCR B;  1R3I C;  5C93 A;  2EBO A;  2Q68 A;  1RM1 C;  1Q82 W;  1FXK B;  1VQ8 V;  1MOF A;  4XBF A;  2XAS A;  4R7C A;  5BZB A;  2D3O W;  2UXN A;  4U7N A;  4WFF A;  2EZO A;  2OT5 A;  1COW G;  2V7Q G;  2ZXW C;  1HWY A;  3OEE G;  3ASN B;  1SZT A;  4KUM A;  1R6N A;  1ORQ C;  4JPR A;  2FTK A;  2WLI B;  3AG3 C;  4UXN A;  1QLN A;  2LP7 A;  1PKX A;  3K0D A;  3RVZ A;  4BIZ A;  1NVP B;  3IGA C;  5EC1 C;  1ARO P;  1V54 C;  3G71 V;  3R65 A;  1QVF U;  1EBO A;  4UVA A;  4MT8 A;  4HZ3 A;  3IC7 A;  2P7T C;  4R8C A;  1AI7 A;  4RAI A;  3WG7 B;  3LUT B;  2ATK C;  2WWW A;  4JYB A;  3P30 A;  4BAY A;  3T4Z A;  1R3L C;  1FS0 G;  2UXX A;  3ML0 A;  4N21 A;  1CP9 A;  1BHB A;  3AG2 C;  1N8R W;  1AI5 A;  2Y48 A;  1K9M W;  1NR7 A;  4HYO A;  4MTF A;  3X2Q C;  1VQN V;  4QPJ A;  1V55 C;  2BOB C;  3H01 A;  3CCL V;  3OMA B;  4FPP A;  1E1R G;  2P90 A;  3ASO B;  2JJ2 G;  3GWO A;  4PA7 A;  1Q86 W;  3SPI A;  1R73 A;  2ZR2 A;  2IH1 C;  3OMI B;  4G2K A;  3I56 V;  1GKF A;  4E2L A;  1JJ2 U;  1H8H G;  2DYR B;  3E86 A;  3SYO A;  1OCC C;  3B8N A;  2HVJ C;  2QM8 A;  2GHY A;  4PEL A;  1H8E G;  5E1A C;  4RO2 A;  1FXV A;  4XDK A;  2ITD C;  1ROP A;  3LDD A;  1K33 A;  1YTF B;  1W0K G;  3SPG A;  1AJN A;  1H38 A;  5DM6 V;  3ZRW A;  1WLE A;  1AJP A;  3OM3 B;  3ABT A;  4MVZ A;  4JF3 A;  2PI4 A;  4JTD B;  2QA4 V;  4WFE A;  3OFN G;  3JD1 A;  5L3C A;  1OHH G;  4RUF A;  2WLK A;  5H6R A;  3A0R A;  4QPK A;  2MK3 A;  4FMT A;  1OCO B;  2DYS C;  3RW0 A;  3ABL B;  4FIP C;  3VBB A;  3E89 A;  1KC8 W;  2Y69 C;  4XDJ A;  1S72 V;  3ZMT A;  1G8M A;  1K34 A;  4MVQ A;  4Z1M G;  5EBM C;  3DGE A;  1YJW V;  1FXH A;  3FYE B;  3RBZ A;  5HFM A;  1F4N A;  1L1F A;  3CCE V;  4H37 A;  4MTX A;  1EZJ A;  3CD6 V;  1GO3 F;  1K4D C;  1DF4 A;  2X7R B;  1K92 A;  3JD0 A;  1VQL V;  2ZXW B;  1M56 C;  3E35 A;  4UVC A;  4TWK A;  4KFM A;  4WF9 V;  3HPL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...