1BE3H

Cytochrome bc1 complex from bovine
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1be3H00
3H1IH 2FYUH 3CX5F 3H1JH 2A06H 3L75H 1NTKH 3L74H 4PD4F 1KB9F 2BCCH 3H1HH 3H1KH 3L73H 4U3FH 1SQXH 1SQBH 1P84F 1L0NH 1NU1H 3TGUH 1SQQH 3BCCH 3CXHF 1BCCH 1BE3H 1KYOF 3L70H 3L71H 4D6TH 1SQVH 1EZVH 1BGYH 1PP9H 3CWBH 3H1LH 5KLVH 1NTZH 3L72H 1L0LH 1NTMH 1SQPH 1PPJH 2IBZH
chains in the Genus database with same CATH superfamily
2F95B 4FFBA 4I5SA 5L3CA 3ABMB 5IYZA 3C3TA 1AP6A 2FTKA 1UPGA 1G4YB 3FYIB 4DV4B 2HVKC 1YDXA 3CYOA 2Z3YA 3IFXA 5EYPB 1W0KG 3H01A 4LC1A 1A32A 2CTPA 2Q4PA 3BABA 5LP6A 2DW4A 2YI9A 5CN0A 5C8YB 1EN4A 4DYLA 1XMOO 5BXZA 1D5AA 1XNRO 3N2GA 2DMXA 4JYBA 3CCRV 4B7EA 4WFAV 2Q7GA 1N33O 3D3QA 5KHHA 2HP8A 3VQWA 1ZL8A 4LF7B 5JQGA 4B08A 3CCLV 2MK3A 4LBEC 2JDIG 4I7ZB 4CBCA 3MDSA 3JD0A 2FYUH 3H1JH 3SPGA 3BAAA 3DXRA 1N32O 3ZHTA 1EBOA 2HHHO 1NU1H 1G1XB 3VQXA 1XILA 3QF7A 1YJNV 1SETA 3GWOA 1AI6A 4H13B 3O65A 5LXTB 3N27A 3RN4A 1NJIW 4B3SB 1XNQO 4JV5O 2UXDO 4G2KA 2HLDG 4UCOA 3Q4HB 3HKBA 1BQ0A 3CB2A 4IYIA 1KKCA 4HBNA 4JZ2A 1PL4A 1P84F 3F5WC 4O2BA 3CXHF 2DYRC 2JJ1G 1ZTEA 1LUWA 5CA1A 4OX9O 1IBKB 4TT3G 5B1OA 5DEDA 1OV9A 2P4VA 3UCSC 5GTHZ 2CGOA 1I5XA 4A5UB 1JFFB 2IJJA 1NZ6A 5B1BC 3H1HH 1YI2V 1SQBH 4DV2B 3ETEA 3UO3A 1SS3A 2ZT9B 5IJ9A 2UUAB 1Q3EA 4LNUB 4CH5A 2ZXWC 4JI0B 5JCOC 1F7YA 3ETQA 1Q82W 1MMMA 3D3IA 4JI1B 4JI5O 1VQPV 2LW7A 1J95A 4JI6B 3OR7C 3SR2C 4LWSB 3HB3B 2P7TC 2UXBO 2QKCA 3HKCB 2E5LB 3UQ8A 1PNKA 1FJGO 3ABLB 1YITV 4GYCB 1VQ8V 2IJHA 4GKKO 3ZMVA 5IDJA 1OZ0A 4LH7A 2VS0A 4EKWA 1LNQA 4LF4B 4DR6B 2EIKB 2Y0PA 4GZRB 1XMQO 2A9HA 5D5PA 4I0XA 5J2TB 4ZBMA 4JI4B 2LGWA 2JGDB 3JYCA 2QKSA 3FB7C 4TUYA 4K35A 2FL4A 3STZC 4JAUA 4X1IB 2ZE8A 1OCRC 1XL6A 3K0GA 5FPOA 5IJ0A 1N4CA 1HNZO 2DWEC 2E3CA 3F5TA 4JI2O 4B3RB 3HKDA 4D7SA 4CH3A 1V54B 3E8FA 1S5JA 3WB2A 5JJNB 3CRMA 3JAKB 3K9SA 4PDRA 3R65A 3ZHVA 3ABTA 5DM6V 2UU9O 4CS4A 2A7WA 2GUZB 3ASNB 1QLEC 2CTWA 5L3GA 4PDVA 3CP1A 3W7UA 2YIAA 1QU7A 5B66Z 1N34B 2PI4A 2ZIMA 3UT5B 3A0HZ 3THOA 3ZHSA 2LFSA 4TV8B 5KAFZ 4H33A 4YJ3B 1FXHA 1GN2A 1YIJV 3U10A 4QJFB 1JX9A 2UXCB 3QVNA 4DR1O 3RT3C 5J2UB 1PPJH 4DV0O 1B04A 3ASOB 1DF4A 2M6YA 1OCOB 4X1YA 2EJ7A 1KMIZ 3ZEDA 1K9MW 2GBOA 3RYFA 3JSLA 3SPJA 3KG2A 5LOVA 3RWRD 2X6BA 1EZVH 1N36B 1Q6IA 5KHJA 2XAJA 1S0VA 4KHPO 5LGNA 2FKXA 2A06H 3RYCB 4WFHA 2AGAA 2FB5A 2ZDIA 1F4MA 2Y0IA 4FM1A 4NXNO 1TA8A 3P3NA 4ASUG 1ZAUA 3DSQA 4LF7O 1Q6UA 4O4LB 4JPRA 1AR5A 2XHBA 1OJHA 3E83A 4ZHQB 1VARA 1VQMV 4HZ3A 4DXWA 4DV3B 3LDDA 4PJ0Z 2V4DA 2CH7A 2KG7B 3O9OA 1MA1A 5JJJB 4I4TB 2JVDA 1R3IC 2L35A 3K59A 3HPLC 1SESA 1IXMA 4AHCA 3UKMA 1GN6A 1PD3A 4NXMO 2R9RB 2ITDC 4N21A 2Q0AA 4HNAB 1Q5OA 3CCEV 1R6KA 3QO5A 3TXSA 5LP6C 2XASA 3ZHUA 3JATB 2PI5A 1MSDA 5KMGB 2JIZG 5EIBC 5CA3A 4EFEA 2PF4E 1XMOB 2RCVA 3E22A 1QQCA 3LSUA 1IBKO 4I55B 2YIDA 2N05A 2P5OA 3LDEA 4WFGA 1TVKB 2RMKB 4IYHA 1ZLZA 2JRIA 1KYOF 2ADQB 5GW7A 4FVMA 3B09A 1Q43A 3JAWA 2WA3A 3JALB 1VQ6V 4F6RB 1MABG 4TSFG 2DYSC 2YICA 2UXNA 4U3JB 4JI1O 5CB4A 5JCOA 3SPIA 1JJ2U 2QWOB 4B3MB 4O4IA 2EJRA 2ZCEA 5DN6G 4MTGA 2YXYA 1TUBA 3DC5A 1XNQB 4JV5B 1IX9A 1GTOA 3SPHA 1SC5B 2QDOA 4I50B 4PI2A 3L75H 4O4JB 2FMLA 4MTXA 5H6RA 2F4VO 4LF4O 4DR6O 3ZS8C 1QNMA 2HR3A 4R7CA 4IIJA 4OXSA 2EIJB 4GX1A 4PA9A 4JI4O 1URFA 5J9PC 3OAAG 2GSMB 3M7MX 3ZJZA 3SJBC 2KB1A 1Y76B 3AG1C 2YXHA 5D5QA 4JF3A 4MT8A 4B3RO 4ZI7B 2EIKC 2GHYA 3QTCA 3TXQA 4QPJA 1AI5A 4JI7B 3L9DA 4UV9A 4X20B 4G28B 1IXBA 1MZEA 2RN9A 1JMKC 1VF6A 4GCZA 3MHHC 1BT8A 4DV5B 4GKJB 3SYQA 4CZZA 1NI8A 1DK1A 1OCCB 3IC9A 3W7SA 1DLBA 5LA6A 3FB5C 1V54C 3E8GA 1SZTA 4LF8B 1FJGB 1NKDA 3LSQA 3GWKC 4GKKB 2MW2B 1GKFA 3KKYA 1BL8A 3WG7B 2UXCO 5L3BA 2W0XA 1OCZB 3ZHQA 1S3JA 1G8MA 1Y6XA 4JTAB 4J10A 3T4DA 5KUMA 4ABMA 3QO7A 2VQEO 1WJZA 5FLXN 1O9GA 5H9CA 3ZHRA 3RYHA 5DECA 4HYOA 1BHBA 4NTWA 1Q90D 1XBLA 4FLXA 1VQKV 4RO2A 1GRJA 1S77D 1BZKA 3E8BA 1KUQA 2QR4A 1N36O 4JI2B 4K8XA 2QWNB 3ZN0A 5IWAO 1QBZA 3CD6V 4FLZA 3SYCA 1RM1B 2UU9B 2JS5A 1OCOC 4TV9B 3IAYA 2QGNA 2P6JA 4EFBA 2BE3A 3JASB 3IGAC 3FB8C 3AG3B 3ZN1A 1HNXB 4LR3A 3N2KB 1D2DA 2XNDG 4X89A 2HFEC 5EYPA 3SPCA 1GO3F 5FNVB 3CCUV 1Q8IA 1AVMA 3OMIB 4DV3O 1NH2D 4WBNB 4D7TA 2UUCB 1M1KW 4O4HB 5C8YA 2Q0OC 2YC0A 2WAMA 2N04A 1SA0A 3NXSA 3K06A 4DV0B 4EEQA 1SF9A 4GT1A 1YSCA 1N0JA 3STLC 1WA8B 5IYDO 4J9YB 3DC6A 4PA7A 1NH2B 3FX7A 1XL4A 4O2AB 4UCSA 1L0NH 5A9GA 4PDMA 1BCCH 1V55B 4DV7B 3KZIZ 4QNHB 1VEWA 1GH6A 2OCHA 3OT7A 2Z5UA 2B1IA 3JD2A 4KHPB 2W6IG 5B1AC 2IBZH 1GN4A 2ZDIC 3H1IH 3B77A 4MVRA 3APQA 3AG4C 2YIBD 3FAVB 4U3FH 4NXNB 5LXTA 2LGQA 1NT2B 2AZ2A 4K8ZA 2F66C 1GM7A 4OPHA 2CDYA 2W0FC 1Z2GA 2BTQB 1XOUA 2X7RB 1H2NA 5CBHA 3BFRA 2EIMC 2ZE5A 1THZA 4ICGA 3M99B 2AHZA 4FFBB 2UXXA 1I0HA 5IYZB 1S72V 4J9ZB 4NTXA 3CRCA 2ZM6O 1TUEB 4B3MO 1QVGU 5EBMC 4DR7O 4R8CA 4MW8A 3AK1A 4NXMB 4KL1A 2WLNA 3K5NA 1QLNA 1EN5A 4X1KB 4LNUA 3EVKA 4DO2A 5CA0B 3BRCA 4LCUC 1US6A 4IHJB 1BGYH 3CWBH 4MS2A 4B3TB 5JQGB 3ABKC 1Y66A 1DTOA 2RJZA 2ZKOA 5KHIA 4UB8Z 1AJPA 4YXWG 3HKCA 3JCUZ 3OMAB 4MW3A 4P30A 1KD1W 2PGGA 2L6LA 4YJ2A 3K57A 1XI1A 2EINC 2Y69B 5LMUB 3RVYA 4BR6A 1F23A 1Z5VA 3BA9A 3P32A 2QA4V 1FXKB 4JI7O 1YCIA 2EIJC 2WLKA 4E2LA 1XHXA 2VRZA 4Z1VA 4DR5B 5L3DA 3HR0A 1PM9A 1SQFA 4FLUA 3X2QB 2JGDA 4DV5O 4GKJO 3I55V 1PL0A 3W7XA 2X0LA 1COWG 4X62B 2ATKC 2C2AA 4CH6A 2XAFA 2WA4A 4X1IA 4XBFA 1BS3A 1J5EO 1BE3H 5K1PA 3R66A 4LF8O 1R3KC 1KBHA 1E1RG 3JAKA 3FFQA 4DV1B 3C3SA 1TGOA 4JTCB 2F4VB 3CCVV 3K58A 2GUZA 3ML0A 4PD4F 3AK2A 2YSUB 3IJ4A 1E79G 2DN9A 5B3SB 2WSSG 3QNEA 1OCCC 4QE9A 3UT5A 1KP2A 4PDLA 4Z2WA 4H44B 2G38A 2PY5A 1JQ0A 3CC7V 1VMGA 4X64B 1EN6A 1AROP 2A0LA 4JAVA 1GN3A 2RDCA 1IVSA 1AP5A 4E4EA 1B3QA 4FLVA 4WCEV 1K97A 1VF6C 2XUMA 2DE0X 2UUBB 2KKWA 1VF5B 1GK9A 3T1HB 4DR4O 5LMNO 2Q8VA 4JGSA 3T1CA 2Q67A 4FM0A 1Y74B 3JARA 3FB6C 5LHGA 4UCTA 4YY3B 1HNXO 4NVPA 4MSWC 1U97A 1MSWD 2Q68A 1K3EA 4IGGA 1RM1C 1P49A 4FPPA 4EB6A 1I08A 1H38A 2UUCO 3BVOA 2HJFC 2BOCC 2B9ZA 5IYBO 3T1YO 4FMTA 3W7WA 2YI8A 1M57C 2CK3G 1VQ9V 4H0LB 4YIPA 2VQEB 4O4LA 1H2KA 2HEPA 5BMVB 1MOFA 1ZSPA 5HFLA 5LGUA 4G27B 4QGPA 4K3AA 4ZHQA 4DV7O 4D6TH 3CMAV 4DR3B 3CEIA 1RSOB 2E75B 1YHQV 4RUFA 2XTAA 1K4CC 5IWAB 1NBMG 4UVCA 2Q9LA 1K5QA 4FLWA 2KG7A 1ENVA 2NR5A 1WNSA 4CC6A 3ABMC 2ODMA 4I4TA 1LR1A 3WFVA 4KUMA 1XEQA 1R6NA 4RWUA 5GONB 1VQLV 4HNAA 4PA3A 4J41A 4LF6O 3JATA 2QSAA 1EZJA 2P67A 4MTFA 4PV1B 4CC5A 2NNUA 2Y4TA 4PHZA 4X1YB 1WAZA 2EX3A 1CP9A 1U96A 3OMNB 2WPDG 1SQGA 3CCSV 2ITCC 1NTMH 1AR1B 1TVKA 1NS1A 4MVSA 2OYQA 2Y4UA 1IBLO 4QIWF 4JZGA 2A3QA 1QR9A 2JEXA 4UVAA 1CPYA 3JALA 2WLMA 2QM8A 4F6RA 5IYCO 4KP4A 1K7DA 1M90W 2W6JG 4LF5B 4U3JA 1L0LH 1RPOA 4B3TO 1P4RA 3JD4A 3MHSC 1KC8W 5KA5A 3ZRSA 1OHHG 3L73H 5BZBA 2QE7G 1YJWV 1NR7A 1KU9A 5TISZ 1RFYA 4MVZA 3ZMSA 4N23A 4BW9A 1HR0O 4I50A 3CXCU 3A2FA 4NYKA 4O4JA 5LMUO 2CH7B 3ETGA 1PNLA 3CE2A 3C90A 4PI0A 4DR5O 1H2LA 4LFAB 3OD4A 5EBWC 3CJHA 2F43G 1WLEA 1K33A 3JD3A 2ZM6B 4X62O 4BW5A 1GM9A 2IU3A 4DR7B 2WLJA 4WFEA 1K8AW 2R9AA 3KCYA 4ZI7A 4OPAA 2NLJC 4J42A 5EZYA 1PNMA 4CH4A 1FXKC 5EC1C 5L3FA 1HNWO 4DV1O 2DOSA 2EZPA 3OTFA 3OE7G 2DYRB 4X20A 3QG5A 3X2QC 3AEIA 4X65O 3SYAA 2E76B 3K0DA 3SGIA 4RUEA 1Z5WA 3P30A 5KX5B 3L70H 2LFRA 4LP8A 1VQOV 3G67A 1NTZH 4YHHB 2YXLA 5JJEB 4ZIBA 3ZMUA 3K5OA 5LBQA 5B1BB 1FFXA 3RGBA 5H2FZ 3CSXA 3ABLC 3ZRWB 4FM2A 1SRYA 3ETDA 1DGSA 1MZFA 4X64O 3E8HA 2ZNIA 3LNMB 2P22C 2Z0AA 2A79B 1SERA 1M5IA 1SQQH 2Y48A 2ZXWB 5CB4B 3OR6C 2IM9A 2GV9A 2BSKA 2UUBO 3TK1A 4O4IB 3ZX6A 3T1HO 4NTYA 1BQZA 5H6QA 1TUBB 2Q69A 4I9QA 1T5EA 1ZUQA 3MAQA 2O57A 4K0KO 2P90A 4YY3O 3H1KH 1J5EB 3ICXA 2CTRA 5CBGA 5EC2C 1V9PA 2NN4A 3HKEB 4IIJB 4NB5A 4JYCA 4P9PA 3OTOB 2WLLA 2H8PC 3FYEB 3UM7A 3ASNC 1Q81W 4UCUA 1JA8A 3A0BZ 3ZIAG 2ZINA 2WLIB 4TV9A 4DRXB 5JVDB 1JJOA 2OWOA 3DGEA 1SQXH 5ITZB 4F6EA 4WFBV 3JASA 1L1FA 1OCRB 4TQFA 3N2KA 4U7OA 5LYJB 1H2MA 4GX2A 4J7ZA 1RP3B 4DR3O 5AG2A 3RYIB 1FXVA 3OEHG 3B8NA 1Q6HA 1NTKH 4U7NA 1QLEB 3ZRXA 3ASOC 3M8AA 4UXNA 5BR8O 5K1XA 3B2EE 3RVZA 4DR4B 1JCHA 5LMNB 3E2EA 2EZOA 4LFBO 3BA8A 4J11A 2HJDA 2IH3C 1B6QA 5JH7B 3D8CA 1AILA 2Q7HA 4O2AA 2AZ0A 1UFIA 1GAXA 2OTLV 1KB9F 3MD0A 1ROPA 1Y67A 1S5HC 4L8JA 2KQXA 5EK0A 1R3JC 1Y4MA 4Z1MG 2EBOA 2IJKA 3T1YB 4FZ1A 1FPOA 3FAVA 3NR7A 3OW2U 2ARHA 3FD9A 1E1QG 3E35A 1IURA 1KKDA 4FZ0A 2BCCH 1FKAO 2LW1A 1GM8A 1HP8A 2ZD9A 1CEZA 2PYLA 1FD9A 3D36C 2QJ1A 5B5EZ 1FFTB 1YZBA 2V7QG 5FL7G 2JJ2G 4DUZB 1SQPH 2X6AA 4UCRA 4LF5O 3WU2Z 3VOUA 3BPZA 2QWPB 3BEHA 4Q6GA 5FPRA 5KAIZ 2K1EA 1EFRG 2QM7A 1TAEA 1QHTA 2XAGA 3Q4HA 2K9PA 2YEVB 2ZIOA 4UCVA 4QE7A 2KSDA 4OGQB 4X1KA 5L3EA 1JR9A 4JTDB 4LF6B 1SA0B 4ZOLB 5CA0A 1VP7A 4JYAB 1AI7A 4IHJA 3ZRVA 2R9IA 3RW0A 4LFAO 2CAZC 1H8HG 1P7GA 1M93A 2R72A 5KHGA 1WP7A 3U11A 1HWYA 4JI3O 1AB3A 5EIBD 2ADPA 5IY5B 2B1GA 3T2MA 2QEXV 5KHKA 1ORQC 2QTSA 1JFFA 4MTOA 3EHBB 3G4SV 1M9NA 5LP6B 1IBLB 1R73A 2D3OW 2JS3A 1FXKA 3P3PA 3N2GB 1M56B 1MNGA 4LFCB 2ZR2A 3EFFK 4AILC 4WFFA 3H1LH 4I9WA 2VQFO 1EM1A 3CCQV 1ZL8B 5IE9A 4PA4A 4F4LA 1RPRA 4DK0A 4YHHO 1K4DC 4LWSA 4DUYO 3OGCC 4J7KA 1HW7A 1ZX3A 1QCEA 1JVMA 2IU0A 2E74B 4DR2B 3K08A 3BHPA 2EILB 1K73W 1NQTA 2LP7A 3DXRB 1HR0B 1FAFA 2OTJV 1YTFD 5LHIA 4LH6A 2DYSB 2HKOA 3WB1A 4MVQA 3APOA 1S76D 3K9AA 3J81N 2ZQMA 2LJ2A 3CS5A 1M4UA 4XDLA 1VIBA 4AI8A 5J2TA 2IW5A 5BY1A 1AR4A 1YTFB 3HKBB 2QTOA 2QKAA 2ILMA 3AG2B 2ZR3A 1SKVA 4O2BB 3K3WA 3OTOO 4MVMA 1VQ4V 5HFMA 1HNWB 5CA1B 4JI8O 5KUKA 3CC4V 1R1BA 4JYYA 4X65B 3E86A 5E1AC 4IT5A 4FIPC 1Y74A 3AG1B 4YJ2B 4BIOA 3SDLA 1F4NA 4TV8A 3TJTA 3PJSK 5IJ9B 3A8TA 1GMGA 4YJ3A 4MVOA 3ZMTA 3OFNG 3WG7C 1BSMA 3DTUB 1OCZC 2OIGA 4AQYB 2DWDC 4BIZA 2RNBA 4GX5A 2OT5A 1I94O 5J2UA 3PN1A 5IT9N 3G6EV 4DK1A 1MG1A 1X59A 2P4KA 1AJNA 2GTSA 5GTIZ 2B5UA 3LDCA 4K0KB 2EULA 2OCCB 3J80N 5BMVA 3JSNA 4P2ZA 4MVUA 4DV6O 4P9OA 4R50A 1YEWA 2R70A 1K34A 1RSOA 1JPXA 2XAHA 4W4KA 4DW0A 2LO1A 2QWQB 1YXBA 4I0XB 1IBMB 3RYCA 4TUYB 3VQYA 2XT9A 1CXZB 4GLXA 4W4LA 5H5NA 3AG3C 1YVWA 5IJ0B 1BMFG 4JAAA 1I5YA 1PV0A 3HKDB 3SJQC 5GONA 1N0NA 1W0JG 3BY6A 1WB7A 2DJVA 1XREA 1XDCA 2GDSA 2IH1C 3H9VA 3D36A 3JCZA 4QPKA 2PZSA 4DUZO 2VWKA 4X66O 3B40A 2Q73A 1YJ9V 2JGUA 4UV8A 3G80A 3OUSA 5BR8B 3JARB 4DV4O 3E89A 3W7TA 4RQFA 4LFBB 1R3LC 2N74A 5C93A 1W59A 2YUAA 4GUNA 4TOIA 4EB6B 1V55C 4X88A 4BAYA 4KXRA 3TCUA 4LF9B 4WF9V 1YF2A 1K5SA 2CTQA 5B1NA 5KMGA 2X6CA 3K04A 4JYAO 4CS2A 1NR1A 2DQ0A 3ZCCA 4J7JA 1VQ5V 3RYFB 1N8RW 4I55A 3SYPA 5CBFA 5LOVB 2AW9A 1Q86W 1NVPD 3GVMA 1JOYA 4FJCC 2Q6AA 5B1AB 2CUGA 4LFCO 3JD1A 1AI4A 3OM3B 2M7WA 3AG4B 5IY5C 3CCJV 4B3SO 4NR1A 1NVPB 2XAQA 3VBBA 4XDJA 4GX0A 2H94A 2V1DA 1WPXA 3SYOA 1W2BU 1XUQA 3UO2A 4NKGB 4DR2O 2EIMB 3CPWU 1LUVA 1IDSA 1WPBA 1M56C 2OIEA 3SJAC 1XNRB 2WWWA 4JASA 2AHYA 1K92A 2PTMA 1N33B 3L74H 5JWPA 5EBLC 3A0RA 5KX5A 3G6BA 4JI3B 4BWAA 4IL6Z 3BCCH 1SZXA 3J7AU 4DV2O 2EILC 3ZRWA 1SQVH 1PP9H 1Y76A 2JK5C 2UUAO 3AK3A 3CC2V 1H2SB 2ETNA 2Y69C 1N32B 3LSSA 4JI0O 1KP3A 2IJIA 1G6UA 2Q5ZA 2HHHB 4X8AA 2QWRB 5LHHA 2QM4A 2XOKG 5LL6Y 3E22B 3OGIB 4JI6O 4TQDA 3ABKB 5E79Z 1WB8A 1UJWB 3T4ZA 2VQFB 1KECA 5KLVH 2E5LO 3AG2C 2UXDB 4UUJC 3SJCC 4HAMA 3CX5F 5A2QN 4DUYB 3TETA 3JAWB 2EINB 1DF5A 2F1MA 1D5NA 3HKEA 2HG5C 1PKXA 3AG7A 1XQ8A 2VWJA 2DQ3A 4X9QA 3K5MA 4AQYO 4OX9B 2P06A 3I56V 3CJHB 3ZMZA 4DRXA 5B3SC 2WLIA 3F7VC 1F51A 2D2CB 5JVDA 3L72H 1AJQA 5ITZA 1O9HA 3JAMN 5LGTA 4UB6Z 1VF7A 1I7FA 3B4SA 5LYJA 5EZYB 2F93B 3EXAA 3CRAA 3ABUA 1R6TA 3WB0A 4ZKIA 1P7BA 2RQ6A 1ZWIC 2ZNJA 3RYIA 3FKSG 4CS3A 3CCMV 3G71V 2ZE6A 1Q7YW 1N34O 3CRQA 1IBMO 2F23A 4UFZA 4JI5B 4RQEA 4JI8B 2GTAA 1B06A 1QVFU 1FFXB 2UXBB 2OCCC 3TGUH 3K03A 5JH7A 2WLHA 1X4TA 3K79A 3OEEG 3CMEV 4Q20A 2BTOA 2PYJA 1XHZA 3ZBHA 4RAIA 1H8EG 2BSKB 1S5LZ 5FNVA 1XMQB 2JEUA 4DW1A 4WBNA 1H2GA 3CHXA 4O4HA 3RBZA 3S3XA 2BOBC 1IZ3A 2LQTA 1I94B 1FYJA 3L71H 5LA6B 3QO8A 1HNZB 4FK5C 4L87A 1WA8A 1VQ7V 4FLYA 3I5DA 4PA6A 3S3WA 2Q7EA 4C7UA 3LUTB 2WLLB 4LF9O 4UVBA 4J80A 4DV6B 2CE4A 2PUSA 2CGNA 3F7YC 2YS8A 3KCXA 4H37A 3GB7C 3VQVA 1QR8A 5F2VO 4XDKA 1KQSU 1HDJA 1M57B 2AXTZ 3K5LA 3CRRA 3RYHB 1WN7A 4YIOA 1BHAA 2H3OA 5KA6A 5CMUA 1VQNV 4KFMA 2BTQA 3U0ZA 2ZE7A 1WP8A 2YEVA 4R6ZA 4TWKA 3OUFA 4PELA 4FFKA 4DR1B 4ZOLA 1FS0G 1L8DA 2YIBA 2YDEA 3B8MA 3IC7A 4B7KA 2HVJC 4BIUA 3RFRA 4FLTA 4X66B 3LNNA
chains in the Genus database with same CATH topology
3H1IH 2FYUH 3CX5F 3H1JH 2A06H 3L75H 1NTKH 3L74H 4PD4F 1KB9F 2BCCH 3H1HH 3H1KH 3L73H 4U3FH 1SQXH 1SQBH 1P84F 1L0NH 1NU1H 3TGUH 1SQQH 3BCCH 3CXHF 1BCCH 1BE3H 1KYOF 3L70H 3L71H 4D6TH 1SQVH 1EZVH 1BGYH 1PP9H 3CWBH 3H1LH 5KLVH 1NTZH 3L72H 1L0LH 1NTMH 1SQPH 1PPJH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I H;  2FYU H;  3CX5 F;  3H1J H;  2A06 H;  3L75 H;  1NTK H;  3L74 H;  4PD4 F;  1KB9 F;  2BCC H;  3H1H H;  3H1K H;  3L73 H;  4U3F H;  1SQX H;  1SQB H;  1P84 F;  1L0N H;  1NU1 H;  3TGU H;  1SQQ H;  3BCC H;  3CXH F;  1BCC H;  1BE3 H;  1KYO F;  3L70 H;  3L71 H;  4D6T H;  1SQV H;  1EZV H;  1BGY H;  1PP9 H;  3CWB H;  3H1L H;  5KLV H;  1NTZ H;  3L72 H;  1L0L H;  1NTM H;  1SQP H;  1PPJ H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 2F95 B;  4FFB A;  4I5S A;  5L3C A;  3ABM B;  5IYZ A;  3C3T A;  1AP6 A;  2FTK A;  1UPG A;  1G4Y B;  3FYI B;  4DV4 B;  2HVK C;  1YDX A;  3CYO A;  2Z3Y A;  3IFX A;  5EYP B;  1W0K G;  3H01 A;  4LC1 A;  1A32 A;  2CTP A;  2Q4P A;  3BAB A;  5LP6 A;  2DW4 A;  2YI9 A;  5CN0 A;  5C8Y B;  1EN4 A;  4DYL A;  1XMO O;  5BXZ A;  1D5A A;  1XNR O;  3N2G A;  2DMX A;  4JYB A;  3CCR V;  4B7E A;  4WFA V;  2Q7G A;  1N33 O;  3D3Q A;  5KHH A;  2HP8 A;  3VQW A;  1ZL8 A;  4LF7 B;  5JQG A;  4B08 A;  3CCL V;  2MK3 A;  4LBE C;  2JDI G;  4I7Z B;  4CBC A;  3MDS A;  3JD0 A;  2FYU H;  3H1J H;  3SPG A;  3BAA A;  3DXR A;  1N32 O;  3ZHT A;  1EBO A;  2HHH O;  1NU1 H;  1G1X B;  3VQX A;  1XIL A;  3QF7 A;  1YJN V;  1SET A;  3GWO A;  1AI6 A;  4H13 B;  3O65 A;  5LXT B;  3N27 A;  3RN4 A;  1NJI W;  4B3S B;  1XNQ O;  4JV5 O;  2UXD O;  4G2K A;  2HLD G;  4UCO A;  3Q4H B;  3HKB A;  1BQ0 A;  3CB2 A;  4IYI A;  1KKC A;  4HBN A;  4JZ2 A;  1PL4 A;  1P84 F;  3F5W C;  4O2B A;  3CXH F;  2DYR C;  2JJ1 G;  1ZTE A;  1LUW A;  5CA1 A;  4OX9 O;  1IBK B;  4TT3 G;  5B1O A;  5DED A;  1OV9 A;  2P4V A;  3UCS C;  5GTH Z;  2CGO A;  1I5X A;  4A5U B;  1JFF B;  2IJJ A;  1NZ6 A;  5B1B C;  3H1H H;  1YI2 V;  1SQB H;  4DV2 B;  3ETE A;  3UO3 A;  1SS3 A;  2ZT9 B;  5IJ9 A;  2UUA B;  1Q3E A;  4LNU B;  4CH5 A;  2ZXW C;  4JI0 B;  5JCO C;  1F7Y A;  3ETQ A;  1Q82 W;  1MMM A;  3D3I A;  4JI1 B;  4JI5 O;  1VQP V;  2LW7 A;  1J95 A;  4JI6 B;  3OR7 C;  3SR2 C;  4LWS B;  3HB3 B;  2P7T C;  2UXB O;  2QKC A;  3HKC B;  2E5L B;  3UQ8 A;  1PNK A;  1FJG O;  3ABL B;  1YIT V;  4GYC B;  1VQ8 V;  2IJH A;  4GKK O;  3ZMV A;  5IDJ A;  1OZ0 A;  4LH7 A;  2VS0 A;  4EKW A;  1LNQ A;  4LF4 B;  4DR6 B;  2EIK B;  2Y0P A;  4GZR B;  1XMQ O;  2A9H A;  5D5P A;  4I0X A;  5J2T B;  4ZBM A;  4JI4 B;  2LGW A;  2JGD B;  3JYC A;  2QKS A;  3FB7 C;  4TUY A;  4K35 A;  2FL4 A;  3STZ C;  4JAU A;  4X1I B;  2ZE8 A;  1OCR C;  1XL6 A;  3K0G A;  5FPO A;  5IJ0 A;  1N4C A;  1HNZ O;  2DWE C;  2E3C A;  3F5T A;  4JI2 O;  4B3R B;  3HKD A;  4D7S A;  4CH3 A;  1V54 B;  3E8F A;  1S5J A;  3WB2 A;  5JJN B;  3CRM A;  3JAK B;  3K9S A;  4PDR A;  3R65 A;  3ZHV A;  3ABT A;  5DM6 V;  2UU9 O;  4CS4 A;  2A7W A;  2GUZ B;  3ASN B;  1QLE C;  2CTW A;  5L3G A;  4PDV A;  3CP1 A;  3W7U A;  2YIA A;  1QU7 A;  5B66 Z;  1N34 B;  2PI4 A;  2ZIM A;  3UT5 B;  3A0H Z;  3THO A;  3ZHS A;  2LFS A;  4TV8 B;  5KAF Z;  4H33 A;  4YJ3 B;  1FXH A;  1GN2 A;  1YIJ V;  3U10 A;  4QJF B;  1JX9 A;  2UXC B;  3QVN A;  4DR1 O;  3RT3 C;  5J2U B;  1PPJ H;  4DV0 O;  1B04 A;  3ASO B;  1DF4 A;  2M6Y A;  1OCO B;  4X1Y A;  2EJ7 A;  1KMI Z;  3ZED A;  1K9M W;  2GBO A;  3RYF A;  3JSL A;  3SPJ A;  3KG2 A;  5LOV A;  3RWR D;  2X6B A;  1EZV H;  1N36 B;  1Q6I A;  5KHJ A;  2XAJ A;  1S0V A;  4KHP O;  5LGN A;  2FKX A;  2A06 H;  3RYC B;  4WFH A;  2AGA A;  2FB5 A;  2ZDI A;  1F4M A;  2Y0I A;  4FM1 A;  4NXN O;  1TA8 A;  3P3N A;  4ASU G;  1ZAU A;  3DSQ A;  4LF7 O;  1Q6U A;  4O4L B;  4JPR A;  1AR5 A;  2XHB A;  1OJH A;  3E83 A;  4ZHQ B;  1VAR A;  1VQM V;  4HZ3 A;  4DXW A;  4DV3 B;  3LDD A;  4PJ0 Z;  2V4D A;  2CH7 A;  2KG7 B;  3O9O A;  1MA1 A;  5JJJ B;  4I4T B;  2JVD A;  1R3I C;  2L35 A;  3K59 A;  3HPL C;  1SES A;  1IXM A;  4AHC A;  3UKM A;  1GN6 A;  1PD3 A;  4NXM O;  2R9R B;  2ITD C;  4N21 A;  2Q0A A;  4HNA B;  1Q5O A;  3CCE V;  1R6K A;  3QO5 A;  3TXS A;  5LP6 C;  2XAS A;  3ZHU A;  3JAT B;  2PI5 A;  1MSD A;  5KMG B;  2JIZ G;  5EIB C;  5CA3 A;  4EFE A;  2PF4 E;  1XMO B;  2RCV A;  3E22 A;  1QQC A;  3LSU A;  1IBK O;  4I55 B;  2YID A;  2N05 A;  2P5O A;  3LDE A;  4WFG A;  1TVK B;  2RMK B;  4IYH A;  1ZLZ A;  2JRI A;  1KYO F;  2ADQ B;  5GW7 A;  4FVM A;  3B09 A;  1Q43 A;  3JAW A;  2WA3 A;  3JAL B;  1VQ6 V;  4F6R B;  1MAB G;  4TSF G;  2DYS C;  2YIC A;  2UXN A;  4U3J B;  4JI1 O;  5CB4 A;  5JCO A;  3SPI A;  1JJ2 U;  2QWO B;  4B3M B;  4O4I A;  2EJR A;  2ZCE A;  5DN6 G;  4MTG A;  2YXY A;  1TUB A;  3DC5 A;  1XNQ B;  4JV5 B;  1IX9 A;  1GTO A;  3SPH A;  1SC5 B;  2QDO A;  4I50 B;  4PI2 A;  3L75 H;  4O4J B;  2FML A;  4MTX A;  5H6R A;  2F4V O;  4LF4 O;  4DR6 O;  3ZS8 C;  1QNM A;  2HR3 A;  4R7C A;  4IIJ A;  4OXS A;  2EIJ B;  4GX1 A;  4PA9 A;  4JI4 O;  1URF A;  5J9P C;  3OAA G;  2GSM B;  3M7M X;  3ZJZ A;  3SJB C;  2KB1 A;  1Y76 B;  3AG1 C;  2YXH A;  5D5Q A;  4JF3 A;  4MT8 A;  4B3R O;  4ZI7 B;  2EIK C;  2GHY A;  3QTC A;  3TXQ A;  4QPJ A;  1AI5 A;  4JI7 B;  3L9D A;  4UV9 A;  4X20 B;  4G28 B;  1IXB A;  1MZE A;  2RN9 A;  1JMK C;  1VF6 A;  4GCZ A;  3MHH C;  1BT8 A;  4DV5 B;  4GKJ B;  3SYQ A;  4CZZ A;  1NI8 A;  1DK1 A;  1OCC B;  3IC9 A;  3W7S A;  1DLB A;  5LA6 A;  3FB5 C;  1V54 C;  3E8G A;  1SZT A;  4LF8 B;  1FJG B;  1NKD A;  3LSQ A;  3GWK C;  4GKK B;  2MW2 B;  1GKF A;  3KKY A;  1BL8 A;  3WG7 B;  2UXC O;  5L3B A;  2W0X A;  1OCZ B;  3ZHQ A;  1S3J A;  1G8M A;  1Y6X A;  4JTA B;  4J10 A;  3T4D A;  5KUM A;  4ABM A;  3QO7 A;  2VQE O;  1WJZ A;  5FLX N;  1O9G A;  5H9C A;  3ZHR A;  3RYH A;  5DEC A;  4HYO A;  1BHB A;  4NTW A;  1Q90 D;  1XBL A;  4FLX A;  1VQK V;  4RO2 A;  1GRJ A;  1S77 D;  1BZK A;  3E8B A;  1KUQ A;  2QR4 A;  1N36 O;  4JI2 B;  4K8X A;  2QWN B;  3ZN0 A;  5IWA O;  1QBZ A;  3CD6 V;  4FLZ A;  3SYC A;  1RM1 B;  2UU9 B;  2JS5 A;  1OCO C;  4TV9 B;  3IAY A;  2QGN A;  2P6J A;  4EFB A;  2BE3 A;  3JAS B;  3IGA C;  3FB8 C;  3AG3 B;  3ZN1 A;  1HNX B;  4LR3 A;  3N2K B;  1D2D A;  2XND G;  4X89 A;  2HFE C;  5EYP A;  3SPC A;  1GO3 F;  5FNV B;  3CCU V;  1Q8I A;  1AVM A;  3OMI B;  4DV3 O;  1NH2 D;  4WBN B;  4D7T A;  2UUC B;  1M1K W;  4O4H B;  5C8Y A;  2Q0O C;  2YC0 A;  2WAM A;  2N04 A;  1SA0 A;  3NXS A;  3K06 A;  4DV0 B;  4EEQ A;  1SF9 A;  4GT1 A;  1YSC A;  1N0J A;  3STL C;  1WA8 B;  5IYD O;  4J9Y B;  3DC6 A;  4PA7 A;  1NH2 B;  3FX7 A;  1XL4 A;  4O2A B;  4UCS A;  1L0N H;  5A9G A;  4PDM A;  1BCC H;  1V55 B;  4DV7 B;  3KZI Z;  4QNH B;  1VEW A;  1GH6 A;  2OCH A;  3OT7 A;  2Z5U A;  2B1I A;  3JD2 A;  4KHP B;  2W6I G;  5B1A C;  2IBZ H;  1GN4 A;  2ZDI C;  3H1I H;  3B77 A;  4MVR A;  3APQ A;  3AG4 C;  2YIB D;  3FAV B;  4U3F H;  4NXN B;  5LXT A;  2LGQ A;  1NT2 B;  2AZ2 A;  4K8Z A;  2F66 C;  1GM7 A;  4OPH A;  2CDY A;  2W0F C;  1Z2G A;  2BTQ B;  1XOU A;  2X7R B;  1H2N A;  5CBH A;  3BFR A;  2EIM C;  2ZE5 A;  1THZ A;  4ICG A;  3M99 B;  2AHZ A;  4FFB B;  2UXX A;  1I0H A;  5IYZ B;  1S72 V;  4J9Z B;  4NTX A;  3CRC A;  2ZM6 O;  1TUE B;  4B3M O;  1QVG U;  5EBM C;  4DR7 O;  4R8C A;  4MW8 A;  3AK1 A;  4NXM B;  4KL1 A;  2WLN A;  3K5N A;  1QLN A;  1EN5 A;  4X1K B;  4LNU A;  3EVK A;  4DO2 A;  5CA0 B;  3BRC A;  4LCU C;  1US6 A;  4IHJ B;  1BGY H;  3CWB H;  4MS2 A;  4B3T B;  5JQG B;  3ABK C;  1Y66 A;  1DTO A;  2RJZ A;  2ZKO A;  5KHI A;  4UB8 Z;  1AJP A;  4YXW G;  3HKC A;  3JCU Z;  3OMA B;  4MW3 A;  4P30 A;  1KD1 W;  2PGG A;  2L6L A;  4YJ2 A;  3K57 A;  1XI1 A;  2EIN C;  2Y69 B;  5LMU B;  3RVY A;  4BR6 A;  1F23 A;  1Z5V A;  3BA9 A;  3P32 A;  2QA4 V;  1FXK B;  4JI7 O;  1YCI A;  2EIJ C;  2WLK A;  4E2L A;  1XHX A;  2VRZ A;  4Z1V A;  4DR5 B;  5L3D A;  3HR0 A;  1PM9 A;  1SQF A;  4FLU A;  3X2Q B;  2JGD A;  4DV5 O;  4GKJ O;  3I55 V;  1PL0 A;  3W7X A;  2X0L A;  1COW G;  4X62 B;  2ATK C;  2C2A A;  4CH6 A;  2XAF A;  2WA4 A;  4X1I A;  4XBF A;  1BS3 A;  1J5E O;  1BE3 H;  5K1P A;  3R66 A;  4LF8 O;  1R3K C;  1KBH A;  1E1R G;  3JAK A;  3FFQ A;  4DV1 B;  3C3S A;  1TGO A;  4JTC B;  2F4V B;  3CCV V;  3K58 A;  2GUZ A;  3ML0 A;  4PD4 F;  3AK2 A;  2YSU B;  3IJ4 A;  1E79 G;  2DN9 A;  5B3S B;  2WSS G;  3QNE A;  1OCC C;  4QE9 A;  3UT5 A;  1KP2 A;  4PDL A;  4Z2W A;  4H44 B;  2G38 A;  2PY5 A;  1JQ0 A;  3CC7 V;  1VMG A;  4X64 B;  1EN6 A;  1ARO P;  2A0L A;  4JAV A;  1GN3 A;  2RDC A;  1IVS A;  1AP5 A;  4E4E A;  1B3Q A;  4FLV A;  4WCE V;  1K97 A;  1VF6 C;  2XUM A;  2DE0 X;  2UUB B;  2KKW A;  1VF5 B;  1GK9 A;  3T1H B;  4DR4 O;  5LMN O;  2Q8V A;  4JGS A;  3T1C A;  2Q67 A;  4FM0 A;  1Y74 B;  3JAR A;  3FB6 C;  5LHG A;  4UCT A;  4YY3 B;  1HNX O;  4NVP A;  4MSW C;  1U97 A;  1MSW D;  2Q68 A;  1K3E A;  4IGG A;  1RM1 C;  1P49 A;  4FPP A;  4EB6 A;  1I08 A;  1H38 A;  2UUC O;  3BVO A;  2HJF C;  2BOC C;  2B9Z A;  5IYB O;  3T1Y O;  4FMT A;  3W7W A;  2YI8 A;  1M57 C;  2CK3 G;  1VQ9 V;  4H0L B;  4YIP A;  2VQE B;  4O4L A;  1H2K A;  2HEP A;  5BMV B;  1MOF A;  1ZSP A;  5HFL A;  5LGU A;  4G27 B;  4QGP A;  4K3A A;  4ZHQ A;  4DV7 O;  4D6T H;  3CMA V;  4DR3 B;  3CEI A;  1RSO B;  2E75 B;  1YHQ V;  4RUF A;  2XTA A;  1K4C C;  5IWA B;  1NBM G;  4UVC A;  2Q9L A;  1K5Q A;  4FLW A;  2KG7 A;  1ENV A;  2NR5 A;  1WNS A;  4CC6 A;  3ABM C;  2ODM A;  4I4T A;  1LR1 A;  3WFV A;  4KUM A;  1XEQ A;  1R6N A;  4RWU A;  5GON B;  1VQL V;  4HNA A;  4PA3 A;  4J41 A;  4LF6 O;  3JAT A;  2QSA A;  1EZJ A;  2P67 A;  4MTF A;  4PV1 B;  4CC5 A;  2NNU A;  2Y4T A;  4PHZ A;  4X1Y B;  1WAZ A;  2EX3 A;  1CP9 A;  1U96 A;  3OMN B;  2WPD G;  1SQG A;  3CCS V;  2ITC C;  1NTM H;  1AR1 B;  1TVK A;  1NS1 A;  4MVS A;  2OYQ A;  2Y4U A;  1IBL O;  4QIW F;  4JZG A;  2A3Q A;  1QR9 A;  2JEX A;  4UVA A;  1CPY A;  3JAL A;  2WLM A;  2QM8 A;  4F6R A;  5IYC O;  4KP4 A;  1K7D A;  1M90 W;  2W6J G;  4LF5 B;  4U3J A;  1L0L H;  1RPO A;  4B3T O;  1P4R A;  3JD4 A;  3MHS C;  1KC8 W;  5KA5 A;  3ZRS A;  1OHH G;  3L73 H;  5BZB A;  2QE7 G;  1YJW V;  1NR7 A;  1KU9 A;  5TIS Z;  1RFY A;  4MVZ A;  3ZMS A;  4N23 A;  4BW9 A;  1HR0 O;  4I50 A;  3CXC U;  3A2F A;  4NYK A;  4O4J A;  5LMU O;  2CH7 B;  3ETG A;  1PNL A;  3CE2 A;  3C90 A;  4PI0 A;  4DR5 O;  1H2L A;  4LFA B;  3OD4 A;  5EBW C;  3CJH A;  2F43 G;  1WLE A;  1K33 A;  3JD3 A;  2ZM6 B;  4X62 O;  4BW5 A;  1GM9 A;  2IU3 A;  4DR7 B;  2WLJ A;  4WFE A;  1K8A W;  2R9A A;  3KCY A;  4ZI7 A;  4OPA A;  2NLJ C;  4J42 A;  5EZY A;  1PNM A;  4CH4 A;  1FXK C;  5EC1 C;  5L3F A;  1HNW O;  4DV1 O;  2DOS A;  2EZP A;  3OTF A;  3OE7 G;  2DYR B;  4X20 A;  3QG5 A;  3X2Q C;  3AEI A;  4X65 O;  3SYA A;  2E76 B;  3K0D A;  3SGI A;  4RUE A;  1Z5W A;  3P30 A;  5KX5 B;  3L70 H;  2LFR A;  4LP8 A;  1VQO V;  3G67 A;  1NTZ H;  4YHH B;  2YXL A;  5JJE B;  4ZIB A;  3ZMU A;  3K5O A;  5LBQ A;  5B1B B;  1FFX A;  3RGB A;  5H2F Z;  3CSX A;  3ABL C;  3ZRW B;  4FM2 A;  1SRY A;  3ETD A;  1DGS A;  1MZF A;  4X64 O;  3E8H A;  2ZNI A;  3LNM B;  2P22 C;  2Z0A A;  2A79 B;  1SER A;  1M5I A;  1SQQ H;  2Y48 A;  2ZXW B;  5CB4 B;  3OR6 C;  2IM9 A;  2GV9 A;  2BSK A;  2UUB O;  3TK1 A;  4O4I B;  3ZX6 A;  3T1H O;  4NTY A;  1BQZ A;  5H6Q A;  1TUB B;  2Q69 A;  4I9Q A;  1T5E A;  1ZUQ A;  3MAQ A;  2O57 A;  4K0K O;  2P90 A;  4YY3 O;  3H1K H;  1J5E B;  3ICX A;  2CTR A;  5CBG A;  5EC2 C;  1V9P A;  2NN4 A;  3HKE B;  4IIJ B;  4NB5 A;  4JYC A;  4P9P A;  3OTO B;  2WLL A;  2H8P C;  3FYE B;  3UM7 A;  3ASN C;  1Q81 W;  4UCU A;  1JA8 A;  3A0B Z;  3ZIA G;  2ZIN A;  2WLI B;  4TV9 A;  4DRX B;  5JVD B;  1JJO A;  2OWO A;  3DGE A;  1SQX H;  5ITZ B;  4F6E A;  4WFB V;  3JAS A;  1L1F A;  1OCR B;  4TQF A;  3N2K A;  4U7O A;  5LYJ B;  1H2M A;  4GX2 A;  4J7Z A;  1RP3 B;  4DR3 O;  5AG2 A;  3RYI B;  1FXV A;  3OEH G;  3B8N A;  1Q6H A;  1NTK H;  4U7N A;  1QLE B;  3ZRX A;  3ASO C;  3M8A A;  4UXN A;  5BR8 O;  5K1X A;  3B2E E;  3RVZ A;  4DR4 B;  1JCH A;  5LMN B;  3E2E A;  2EZO A;  4LFB O;  3BA8 A;  4J11 A;  2HJD A;  2IH3 C;  1B6Q A;  5JH7 B;  3D8C A;  1AIL A;  2Q7H A;  4O2A A;  2AZ0 A;  1UFI A;  1GAX A;  2OTL V;  1KB9 F;  3MD0 A;  1ROP A;  1Y67 A;  1S5H C;  4L8J A;  2KQX A;  5EK0 A;  1R3J C;  1Y4M A;  4Z1M G;  2EBO A;  2IJK A;  3T1Y B;  4FZ1 A;  1FPO A;  3FAV A;  3NR7 A;  3OW2 U;  2ARH A;  3FD9 A;  1E1Q G;  3E35 A;  1IUR A;  1KKD A;  4FZ0 A;  2BCC H;  1FKA O;  2LW1 A;  1GM8 A;  1HP8 A;  2ZD9 A;  1CEZ A;  2PYL A;  1FD9 A;  3D36 C;  2QJ1 A;  5B5E Z;  1FFT B;  1YZB A;  2V7Q G;  5FL7 G;  2JJ2 G;  4DUZ B;  1SQP H;  2X6A A;  4UCR A;  4LF5 O;  3WU2 Z;  3VOU A;  3BPZ A;  2QWP B;  3BEH A;  4Q6G A;  5FPR A;  5KAI Z;  2K1E A;  1EFR G;  2QM7 A;  1TAE A;  1QHT A;  2XAG A;  3Q4H A;  2K9P A;  2YEV B;  2ZIO A;  4UCV A;  4QE7 A;  2KSD A;  4OGQ B;  4X1K A;  5L3E A;  1JR9 A;  4JTD B;  4LF6 B;  1SA0 B;  4ZOL B;  5CA0 A;  1VP7 A;  4JYA B;  1AI7 A;  4IHJ A;  3ZRV A;  2R9I A;  3RW0 A;  4LFA O;  2CAZ C;  1H8H G;  1P7G A;  1M93 A;  2R72 A;  5KHG A;  1WP7 A;  3U11 A;  1HWY A;  4JI3 O;  1AB3 A;  5EIB D;  2ADP A;  5IY5 B;  2B1G A;  3T2M A;  2QEX V;  5KHK A;  1ORQ C;  2QTS A;  1JFF A;  4MTO A;  3EHB B;  3G4S V;  1M9N A;  5LP6 B;  1IBL B;  1R73 A;  2D3O W;  2JS3 A;  1FXK A;  3P3P A;  3N2G B;  1M56 B;  1MNG A;  4LFC B;  2ZR2 A;  3EFF K;  4AIL C;  4WFF A;  3H1L H;  4I9W A;  2VQF O;  1EM1 A;  3CCQ V;  1ZL8 B;  5IE9 A;  4PA4 A;  4F4L A;  1RPR A;  4DK0 A;  4YHH O;  1K4D C;  4LWS A;  4DUY O;  3OGC C;  4J7K A;  1HW7 A;  1ZX3 A;  1QCE A;  1JVM A;  2IU0 A;  2E74 B;  4DR2 B;  3K08 A;  3BHP A;  2EIL B;  1K73 W;  1NQT A;  2LP7 A;  3DXR B;  1HR0 B;  1FAF A;  2OTJ V;  1YTF D;  5LHI A;  4LH6 A;  2DYS B;  2HKO A;  3WB1 A;  4MVQ A;  3APO A;  1S76 D;  3K9A A;  3J81 N;  2ZQM A;  2LJ2 A;  3CS5 A;  1M4U A;  4XDL A;  1VIB A;  4AI8 A;  5J2T A;  2IW5 A;  5BY1 A;  1AR4 A;  1YTF B;  3HKB B;  2QTO A;  2QKA A;  2ILM A;  3AG2 B;  2ZR3 A;  1SKV A;  4O2B B;  3K3W A;  3OTO O;  4MVM A;  1VQ4 V;  5HFM A;  1HNW B;  5CA1 B;  4JI8 O;  5KUK A;  3CC4 V;  1R1B A;  4JYY A;  4X65 B;  3E86 A;  5E1A C;  4IT5 A;  4FIP C;  1Y74 A;  3AG1 B;  4YJ2 B;  4BIO A;  3SDL A;  1F4N A;  4TV8 A;  3TJT A;  3PJS K;  5IJ9 B;  3A8T A;  1GMG A;  4YJ3 A;  4MVO A;  3ZMT A;  3OFN G;  3WG7 C;  1BSM A;  3DTU B;  1OCZ C;  2OIG A;  4AQY B;  2DWD C;  4BIZ A;  2RNB A;  4GX5 A;  2OT5 A;  1I94 O;  5J2U A;  3PN1 A;  5IT9 N;  3G6E V;  4DK1 A;  1MG1 A;  1X59 A;  2P4K A;  1AJN A;  2GTS A;  5GTI Z;  2B5U A;  3LDC A;  4K0K B;  2EUL A;  2OCC B;  3J80 N;  5BMV A;  3JSN A;  4P2Z A;  4MVU A;  4DV6 O;  4P9O A;  4R50 A;  1YEW A;  2R70 A;  1K34 A;  1RSO A;  1JPX A;  2XAH A;  4W4K A;  4DW0 A;  2LO1 A;  2QWQ B;  1YXB A;  4I0X B;  1IBM B;  3RYC A;  4TUY B;  3VQY A;  2XT9 A;  1CXZ B;  4GLX A;  4W4L A;  5H5N A;  3AG3 C;  1YVW A;  5IJ0 B;  1BMF G;  4JAA A;  1I5Y A;  1PV0 A;  3HKD B;  3SJQ C;  5GON A;  1N0N A;  1W0J G;  3BY6 A;  1WB7 A;  2DJV A;  1XRE A;  1XDC A;  2GDS A;  2IH1 C;  3H9V A;  3D36 A;  3JCZ A;  4QPK A;  2PZS A;  4DUZ O;  2VWK A;  4X66 O;  3B40 A;  2Q73 A;  1YJ9 V;  2JGU A;  4UV8 A;  3G80 A;  3OUS A;  5BR8 B;  3JAR B;  4DV4 O;  3E89 A;  3W7T A;  4RQF A;  4LFB B;  1R3L C;  2N74 A;  5C93 A;  1W59 A;  2YUA A;  4GUN A;  4TOI A;  4EB6 B;  1V55 C;  4X88 A;  4BAY A;  4KXR A;  3TCU A;  4LF9 B;  4WF9 V;  1YF2 A;  1K5S A;  2CTQ A;  5B1N A;  5KMG A;  2X6C A;  3K04 A;  4JYA O;  4CS2 A;  1NR1 A;  2DQ0 A;  3ZCC A;  4J7J A;  1VQ5 V;  3RYF B;  1N8R W;  4I55 A;  3SYP A;  5CBF A;  5LOV B;  2AW9 A;  1Q86 W;  1NVP D;  3GVM A;  1JOY A;  4FJC C;  2Q6A A;  5B1A B;  2CUG A;  4LFC O;  3JD1 A;  1AI4 A;  3OM3 B;  2M7W A;  3AG4 B;  5IY5 C;  3CCJ V;  4B3S O;  4NR1 A;  1NVP B;  2XAQ A;  3VBB A;  4XDJ A;  4GX0 A;  2H94 A;  2V1D A;  1WPX A;  3SYO A;  1W2B U;  1XUQ A;  3UO2 A;  4NKG B;  4DR2 O;  2EIM B;  3CPW U;  1LUV A;  1IDS A;  1WPB A;  1M56 C;  2OIE A;  3SJA C;  1XNR B;  2WWW A;  4JAS A;  2AHY A;  1K92 A;  2PTM A;  1N33 B;  3L74 H;  5JWP A;  5EBL C;  3A0R A;  5KX5 A;  3G6B A;  4JI3 B;  4BWA A;  4IL6 Z;  3BCC H;  1SZX A;  3J7A U;  4DV2 O;  2EIL C;  3ZRW A;  1SQV H;  1PP9 H;  1Y76 A;  2JK5 C;  2UUA O;  3AK3 A;  3CC2 V;  1H2S B;  2ETN A;  2Y69 C;  1N32 B;  3LSS A;  4JI0 O;  1KP3 A;  2IJI A;  1G6U A;  2Q5Z A;  2HHH B;  4X8A A;  2QWR B;  5LHH A;  2QM4 A;  2XOK G;  5LL6 Y;  3E22 B;  3OGI B;  4JI6 O;  4TQD A;  3ABK B;  5E79 Z;  1WB8 A;  1UJW B;  3T4Z A;  2VQF B;  1KEC A;  5KLV H;  2E5L O;  3AG2 C;  2UXD B;  4UUJ C;  3SJC C;  4HAM A;  3CX5 F;  5A2Q N;  4DUY B;  3TET A;  3JAW B;  2EIN B;  1DF5 A;  2F1M A;  1D5N A;  3HKE A;  2HG5 C;  1PKX A;  3AG7 A;  1XQ8 A;  2VWJ A;  2DQ3 A;  4X9Q A;  3K5M A;  4AQY O;  4OX9 B;  2P06 A;  3I56 V;  3CJH B;  3ZMZ A;  4DRX A;  5B3S C;  2WLI A;  3F7V C;  1F51 A;  2D2C B;  5JVD A;  3L72 H;  1AJQ A;  5ITZ A;  1O9H A;  3JAM N;  5LGT A;  4UB6 Z;  1VF7 A;  1I7F A;  3B4S A;  5LYJ A;  5EZY B;  2F93 B;  3EXA A;  3CRA A;  3ABU A;  1R6T A;  3WB0 A;  4ZKI A;  1P7B A;  2RQ6 A;  1ZWI C;  2ZNJ A;  3RYI A;  3FKS G;  4CS3 A;  3CCM V;  3G71 V;  2ZE6 A;  1Q7Y W;  1N34 O;  3CRQ A;  1IBM O;  2F23 A;  4UFZ A;  4JI5 B;  4RQE A;  4JI8 B;  2GTA A;  1B06 A;  1QVF U;  1FFX B;  2UXB B;  2OCC C;  3TGU H;  3K03 A;  5JH7 A;  2WLH A;  1X4T A;  3K79 A;  3OEE G;  3CME V;  4Q20 A;  2BTO A;  2PYJ A;  1XHZ A;  3ZBH A;  4RAI A;  1H8E G;  2BSK B;  1S5L Z;  5FNV A;  1XMQ B;  2JEU A;  4DW1 A;  4WBN A;  1H2G A;  3CHX A;  4O4H A;  3RBZ A;  3S3X A;  2BOB C;  1IZ3 A;  2LQT A;  1I94 B;  1FYJ A;  3L71 H;  5LA6 B;  3QO8 A;  1HNZ B;  4FK5 C;  4L87 A;  1WA8 A;  1VQ7 V;  4FLY A;  3I5D A;  4PA6 A;  3S3W A;  2Q7E A;  4C7U A;  3LUT B;  2WLL B;  4LF9 O;  4UVB A;  4J80 A;  4DV6 B;  2CE4 A;  2PUS A;  2CGN A;  3F7Y C;  2YS8 A;  3KCX A;  4H37 A;  3GB7 C;  3VQV A;  1QR8 A;  5F2V O;  4XDK A;  1KQS U;  1HDJ A;  1M57 B;  2AXT Z;  3K5L A;  3CRR A;  3RYH B;  1WN7 A;  4YIO A;  1BHA A;  2H3O A;  5KA6 A;  5CMU A;  1VQN V;  4KFM A;  2BTQ A;  3U0Z A;  2ZE7 A;  1WP8 A;  2YEV A;  4R6Z A;  4TWK A;  3OUF A;  4PEL A;  4FFK A;  4DR1 B;  4ZOL A;  1FS0 G;  1L8D A;  2YIB A;  2YDE A;  3B8M A;  3IC7 A;  4B7K A;  2HVJ C;  4BIU A;  3RFR A;  4FLT A;  4X66 B;  3LNN A; 
#chains in the Genus database with same CATH homology
 3H1I H;  2FYU H;  3CX5 F;  3H1J H;  2A06 H;  3L75 H;  1NTK H;  3L74 H;  4PD4 F;  1KB9 F;  2BCC H;  3H1H H;  3H1K H;  3L73 H;  4U3F H;  1SQX H;  1SQB H;  1P84 F;  1L0N H;  1NU1 H;  3TGU H;  1SQQ H;  3BCC H;  3CXH F;  1BCC H;  1BE3 H;  1KYO F;  3L70 H;  3L71 H;  4D6T H;  1SQV H;  1EZV H;  1BGY H;  1PP9 H;  3CWB H;  3H1L H;  5KLV H;  1NTZ H;  3L72 H;  1L0L H;  1NTM H;  1SQP H;  1PPJ H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...