1BE3H

Cytochrome bc1 complex from bovine
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 20
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1be3H00
2A06H 1SQQH 1NTZH 1KB9F 1NTMH 1BE3H 3L71H 1BCCH 4U3FH 3CWBH 3L75H 1SQXH 3H1IH 4PD4F 1SQPH 1EZVH 2FYUH 1L0LH 1PPJH 3H1JH 3L73H 3L72H 1SQBH 2IBZH 3H1HH 1SQVH 3H1LH 1P84F 3L70H 3CXHF 1NU1H 5KLVH 1KYOF 1NTKH 3L74H 3BCCH 2BCCH 1BGYH 1L0NH 3CX5F 4D6TH 1PP9H 3H1KH 3TGUH
chains in the Genus database with same CATH superfamily
1ZAUA 4CH4A 4X64O 2QWQB 4L8JA 2H8PC 3LUTB 2YIBA 5IJ0B 2WAMA 1YITV 3K03A 4XDJA 2WPDG 1IDSA 5CBGA 1QVFU 1AP5A 5KMGB 4LBEC 1BT8A 2ZE8A 3DC5A 2EX3A 1Q7YW 2ZINA 3VBBA 1WPBA 4DV0O 4DR4O 3JD1A 2JGDA 4BR6A 5AG2A 5LHHA 4I0XA 5CBHA 4IIJA 2UXCB 4GYCB 4I50B 3G6EV 2BOBC 4X20A 2WLLB 3BAAA 4MVZA 1N36B 2LFSA 5GONA 3T1YO 1IURA 2NNUA 4YJ3B 4DR5O 4WFHA 3JSNA 2F4VO 4NTXA 2YICA 5EC1C 5CBFA 4HNAA 1BL8A 4O4IA 3MDSA 3N2KB 1I7FA 5L3GA 4UCSA 4CC6A 4JI2O 5JJJB 4QE9A 1OCCC 4DRXA 1IBMO 3MHHC 5BY1A 1N8RW 1HNZO 1F7YA 1V54B 4QPKA 5K1XA 2UXBO 1PKXA 1Z5WA 3B4SA 2LFRA 1RP3B 4I9QA 3ETGA 1NKDA 1E79G 4O2AA 4HAMA 4X64B 3AG4C 3CJHA 4Z2WA 1OCOC 1I5XA 4JV5B 1QQCA 1P4RA 5EBLC 4TSFG 3K5MA 3QNEA 4O4JB 1XHZA 1NTZH 4WBNA 1SETA 3L71H 3HKEA 2B1IA 3HR0A 3AK3A 3ASNC 3CB2A 4DR6B 2HJFC 3CXHF 4LR3A 1CXZB 3K5OA 5LXTA 4MVRA 3STLC 3OT7A 4TV9B 4UCVA 1N33O 2ADPA 4P9PA 4CBCA 4JTAB 1ZTEA 3LDCA 4D7SA 1BCCH 1TVKA 4TUYB 4AI8A 1VARA 3T4ZA 4LNUB 4YJ2B 2W0XA 1YCIA 1Q86W 2PI5A 3BVOA 5BR8O 1NVPD 1Q90D 2F4VB 1Y4MA 2GDSA 4J42A 1VF5B 2RN9A 2EJRA 4JI3O 2Q6AA 3ZBHA 1XMOO 2Y69B 1ORQC 4X8AA 1JX9A 4W4LA 2ZE5A 1SA0B 5D5PA 3ABKB 3JAWA 1K9MW 3A0BZ 1IBMB 4KP4A 3OM3B 1BSMA 4K35A 5EC2C 1NVPB 2ZE7A 1GN2A 4UCUA 1T5EA 1KBHA 3E22B 4LF4O 5KHHA 4WCEV 2XAJA 1WPXA 3VQWA 5J2UA 1Y74B 3K06A 2YEVB 1IX9A 4NXMO 3AG2B 4JI6O 2R9AA 2ZE6A 2XAGA 1Y6XA 4ICGA 2HHHO 3UCSC 2GTAA 3CSXA 3AG1B 1JVMA 2QGNA 2DYRC 1B6QA 2WLKA 4K8ZA 1O9GA 5KHIA 5LP6A 1TUBA 5B3SB 5LMNB 4TT3G 1G8MA 2YC0A 3FB5C 5IJ0A 2DYSC 3HKDA 1AI4A 3G67A 1K5SA 1N33B 5KMGA 1XNRB 4NTWA 5LBQA 1Q5OA 2WSSG 2XNDG 1K4CC 5FL7G 1HNXO 1IZ3A 3W7XA 3SJQC 5IE9A 5LA6A 3B40A 4CH6A 1RM1B 3APQA 4WFBV 3H01A 1VQPV 2YXHA 1DK1A 5FLXN 1GK9A 1S5HC 5LP6C 2OIGA 5LGTA 4B3RB 2Y48A 3E35A 4TV8A 4JI3B 4I50A 1VIBA 1XMOB 4DR3O 4FLVA 2ARHA 4PDRA 2ATKC 3JCUZ 1SZXA 4YJ3A 3BY6A 2LO1A 1K92A 1M4UA 1QCEA 3K79A 1BE3H 4H37A 3MAQA 3RW0A 2M6YA 5L3CA 2FL4A 3N2KA 1NI8A 4FFBB 4LF4B 3D3QA 5FNVB 3EVKA 5KA5A 2H94A 1US6A 4O4HB 1BGYH 4DV6O 4JI6B 4NXMB 4ZHQA 4BW9A 3CE2A 5ITZB 3TCUA 3D3IA 4PHZA 4JI4O 2DE0X 4UUJC 3RN4A 5C93A 1YJWV 2A79B 3K0GA 1D5NA 2EINB 4X65O 4QIWF 3ZRVA 1KUQA 3NXSA 4D7TA 1N0NA 1XOUA 1XMQO 4O4JA 5KUKA 1M90W 1OZ0A 1F4NA 3SJCC 2FYUH 1MMMA 1GN4A 1WJZA 2Q5ZA 3OMIB 3ZMTA 1MOFA 3R65A 1R3JC 2PYJA 4R6ZA 1IBKB 2Q7EA 1H2KA 1QR8A 1QNMA 2UUCO 4TUYA 1XREA 2CK3G 3SPHA 3B2EE 4LNUA 4DR3B 1S76D 1AI7A 5CA0A 1PPJH 4J80A 1IVSA 2GHYA 5JJEB 1Z2GA 2WLJA 5C8YA 1JPXA 2HFEC 4JI1O 2G38A 3JD4A 3M99B 3ZRWB 3L9DA 2Z0AA 1Q6HA 4MVUA 2DOSA 1K7DA 1SA0A 3M8AA 3SYAA 3SYPA 4PA7A 1S77D 3WB1A 4DR1O 3G80A 2ZR3A 5IWAO 2AHYA 4GX0A 4JYCA 3BA8A 4OPAA 3RYIA 4DV6B 1UFIA 2OTLV 3U10A 3DSQA 4NVPA 4FLTA 4JI4B 1JCHA 2Q7HA 3E22A 3HKBB 2E75B 1NT2B 4ZKIA 1Y74A 3RFRA 3I55V 2YEVA 5DECA 4MTGA 4X65B 2Y69C 4QPJA 4R50A 3ABKC 2RNBA 3AK2A 1XMQB 2KQXA 2OCHA 3A0RA 4LF8B 2A3QA 2VRZA 2W0FC 3OMAB 1E1QG 2ZNJA 1YJNV 2C2AA 3QO8A 5B1AC 1GM8A 1R6KA 1EN6A 2ITCC 2YIAA 4PD4F 2R9RB 2HEPA 1YXBA 5IJ9B 3K59A 1Q6IA 2V7QG 3CCUV 3OTOO 1SZTA 4I9WA 1R6TA 4R7CA 3AG2C 3C90A 3JALA 3T4DA 3A8TA 3ZS8C 1K73W 3AG1C 1FFXB 1WAZA 3JD2A 1DLBA 1L8DA 1SKVA 3ZN1A 4LF9B 1VQ9V 5B3SC 5JQGB 1MZEA 1HNWO 1MNGA 4H0LB 2AHZA 1JMKC 1GN3A 4F6RA 3ZMZA 4NXNB 3RVZA 1B06A 4X62B 2YI9A 2A06H 3K9SA 4DUYB 3K04A 3CWBH 1WN7A 4DV2O 1NH2B 1RM1C 1G6UA 3U0ZA 3G71V 2YS8A 4MVQA 5FNVA 3F7VC 1KP3A 5KLVH 5LOVB 4K8XA 1S5LZ 4KHPB 3B8NA 2ZT9B 4UCOA 1JJ2U 4O4HA 1J95A 2EIKB 3SJAC 1NJIW 1U96A 3CC4V 1X59A 2ZM6O 4DXWA 1XNQO 2ZXWB 2ZNIA 3EFFK 4J11A 5B66Z 1M57B 5DEDA 1FXKA 1XEQA 3B77A 1XQ8A 4F4LA 4X1KB 1KMIZ 3O65A 1ZSPA 3FAVB 4E2LA 1R3KC 2DWEC 3OTOB 2CTPA 2UXDB 1L0LH 1PNKA 1VQLV 3JD3A 1RPOA 3K0DA 3UO3A 1RSOB 2IW5A 4OGQB 4LH7A 2JS3A 1VQ4V 3UKMA 3E86A 1FXKC 4U3JB 4FZ0A 2ZKOA 4IL6Z 2R70A 1GMGA 1TA8A 3D36A 4FK5C 1HNWB 3VQXA 4JV5O 2NR5A 1EZVH 3CCJV 1KECA 4RQFA 1YZBA 4NB5A 1CPYA 1M56C 1EN5A 3S3WA 3ABUA 4DV2B 4X66B 3ZRWA 1O9HA 4DR6O 1Q6UA 2PTMA 2P06A 3EXAA 1PL4A 1N0JA 3ZCCA 2AGAA 4ABMA 1NR1A 3I5DA 3I56V 2EIJC 1CP9A 3D36C 1IXBA 3F5WC 2P4KA 2ZM6B 1SERA 4DR2B 1XNQB 2GUZB 1VEWA 5CA1B 3HKBA 4PA9A 5JVDB 2RDCA 5BMVB 3KCXA 5GTIZ 5IDJA 4LC1A 5LGUA 3CRCA 1FPOA 2WA3A 3IJ4A 4H13B 1UPGA 4FLUA 2XT9A 4EB6B 2LQTA 2R9IA 2Z3YA 1N32O 1Y76B 3HPLC 1KU9A 3A2FA 3AG3B 3QG5A 3CMEV 1JJOA 4HYOA 4X1IB 2M7WA 2IU3A 1FJGO 2XAQA 3CCQV 2WLHA 4DK1A 3ZMUA 2YDEA 4B3MB 4B3TO 2V4DA 1NR7A 3B8MA 3GB7C 1R6NA 2HVKC 2ILMA 5BXZA 4GX5A 4MVOA 5KHJA 2VQEB 3SGIA 3W7WA 5CB4A 5L3FA 3OFNG 1FFXA 2PZSA 3F5TA 4GKKB 3CHXA 4FM1A 1YVWA 2XHBA 2XASA 5JH7B 5IT9N 5JQGA 5LMNO 4GX2A 1AVMA 1FYJA 2FMLA 3OGIB 4EKWA 3BRCA 3ZHSA 3N2GA 1XNRO 1NQTA 3JAKB 1HWYA 5K1PA 3ZMSA 3ZHTA 3AEIA 4IYIA 4LFAB 3U11A 3WU2Z 2RMKB 5L3EA 1SQBH 3JYCA 1M9NA 5LOVA 2W6IG 4BAYA 1FS0G 3OUFA 4DV7B 4B3RO 1NBMG 5H6RA 2JK5C 1AI5A 2VWKA 3CX5F 3ZJZA 2VWJA 5A9GA 3DXRA 1X4TA 1KC8W 2OCCC 3WB2A 2BTQB 1K8AW 4X1YA 1N32B 1SQVH 2IH1C 1VF6A 2LW7A 3MD0A 1FJGB 4MSWC 1A32A 5EZYB 1LR1A 4PDLA 1VQKV 4B3TB 3FAVA 2N05A 4U3FH 2YUAA 4YHHB 4QE7A 3RYCB 2EIKC 3CC7V 2XTAA 2F43G 1PNMA 3HKCB 5GTHZ 4UVCA 3T1CA 1BZKA 2MK3A 2ZXWC 2RQ6A 2D2CB 4MW3A 4DUZO 1RPRA 4JI7O 1GM7A 1H2LA 4JYYA 4U3JA 1K33A 3DC6A 1VF6C 4TWKA 3ZMVA 3VQVA 1ZL8B 1TAEA 4LF6O 3H1JH 3D8CA 1QU7A 1G4YB 4I55B 4LF5B 3VOUA 1K3EA 4FM2A 4FZ1A 5EK0A 5DM6V 1AI6A 3TXQA 5HFMA 3OMNB 4D6TH 3H1KH 2Y0IA 1J5EB 1DGSA 3E8HA 4E4EA 2XOKG 1ROPA 1IBKO 1AJNA 3UT5B 3M7MX 3WFVA 2CDYA 2VS0A 4BIOA 1KP2A 2WLLA 2DN9A 2Q68A 2GUZA 3OR7C 4GCZA 2GSMB 5CA1A 2X6BA 5IYZB 2Q67A 5JVDA 4RUEA 4GLXA 1YSCA 2WA4A 1OCRB 1F51A 2ZCEA 2EILB 4LFCB 1IBLB 4AQYB 3E83A 4WFGA 3ZIAG 3SJBC 2PF4E 4FPPA 2LGWA 3C3SA 4IHJB 3UQ8A 1M93A 3JATB 2E5LO 4EFEA 1VQ8V 2UXNA 1Y76A 1TUBB 3E89A 1F23A 4MT8A 4UB6Z 1WA8B 1MG1A 4GUNA 4DV1O 1VQ6V 2NLJC 4DUZB 3JASB 3WG7B 4JI7B 4PA6A 3QVNA 4K3AA 1MABG 5EBMC 3RGBA 1YIJV 2BTOA 2UU9O 2X6AA 4FLXA 3BCCH 3UM7A 1XI1A 2ITDC 4LF6B 3IGAC 4LF8O 4A5UB 1I94O 1QVGU 5KX5B 2ODMA 2E3CA 2W6JG 3BA9A 5JH7A 5FPOA 1V54C 1K4DC 4XDKA 4YY3B 2YSUB 1L1FA 3X2QB 3P32A 3TXSA 2GV9A 4TV9A 1N34O 2CUGA 5IYCO 2UUBO 5CN0A 4DV5B 3RVYA 3JAKA 3FYEB 2YIBD 4UCTA 3RYHB 2JVDA 2XAHA 4YJ2A 2QKSA 5LL6Y 2AW9A 2KB1A 2Y0PA 2BE3A 4PI2A 4LF9O 5KA6A 1JQ0A 3HB3B 1Y66A 3SPCA 4LFBB 2FTKA 4DV3O 1EZJA 2E5LB 2Q7GA 1QBZA 4JZGA 4AHCA 4NXNO 1JFFB 2OT5A 4X62O 3KZIZ 5LHIA 2P5OA 4DUYO 1FAFA 4W4KA 1Z5VA 2F1MA 4DV1B 2B1GA 5HFLA 5EZYA 1H2GA 4WFFA 5EIBD 4LF7B 1OV9A 5J2TB 3CEIA 4CS4A 3W7TA 1K97A 4RO2A 4KHPO 5KUMA 4BWAA 2Z5UA 4IIJB 1OJHA 2PI4A 2LP7A 3ABTA 3HKCA 4H44B 2UU9B 3ABLB 1AR4A 2IBZH 3ZRSA 1HP8A 1P84F 2P22C 1I94B 4X20B 5GONB 1XHXA 3KG2A 4YIOA 2CGOA 4O4IB 4LCUC 2PYLA 1N34B 5B1NA 2PUSA 4CH5A 2UUBB 2CTQA 3ZHQA 1YI2V 2UXDO 1SC5B 2V1DA 3LNMB 3E8BA 1AROP 1GO3F 3LSQA 4OX9B 2NN4A 1AJQA 2Q9LA 4DYLA 1SQXH 4MW8A 3UT5A 2N74A 3BHPA 3SPJA 4O2AB 1DF4A 1LUVA 4DV3B 1H38A 1GM9A 3CCSV 3CXCU 3CJHB 2A0LA 3Q4HB 2F93B 5IYZA 3P3NA 1QLEB 2JEXA 3E2EA 3OEEG 1PP9H 5EYPB 4FMTA 4RUFA 1CEZA 4JYAO 4N21A 3HKEB 1VQMV 1COWG 4X66O 5LMUO 4IHJA 2EZOA 4CZZA 3SYQA 4FFBA 1VQNV 5BZBA 5LXTB 4B08A 3C3TA 2P7TC 4GT1A 1ZLZA 5LHGA 4N23A 3BFRA 4J9ZB 3F7YC 3P3PA 2Q0AA 1SF9A 5ITZA 1SRYA 3JSLA 3RBZA 4DR2O 2CTRA 2O57A 4JAVA 2QDOA 3ASOB 3J81N 3L72H 3CRMA 3TETA 3RYFB 2RCVA 4ZOLB 5DN6G 1JA8A 1OCZB 2HLDG 4O2BB 1AR5A 2HP8A 1V55B 5KX5A 5LGNA 1KB9F 3IC9A 3TJTA 1EBOA 2DYRB 4JF3A 4TQFA 1THZA 3ABMB 3K5LA 2LW1A 4B7KA 1IXMA 2CE4A 5GW7A 1MSDA 2EIMB 2Q4PA 1H2MA 2DYSB 3WG7C 4B3MO 4CH3A 1U97A 2Y4UA 3S3XA 2F23A 2KSDA 3R66A 1SQGA 3GWKC 2YXLA 1P7GA 2EINC 2VQEO 1WB8A 2P6JA 2KG7B 4JAAA 4I5SA 1D5AA 4UV8A 1M5IA 4GKKO 4WFEA 1ENVA 4P9OA 1BQZA 4JYAB 1VMGA 3IFXA 3OTFA 5FPRA 3CCRV 3FYIB 4JI0B 1FXVA 5LMUB 1MZFA 3X2QC 3CPWU 3GVMA 1VQ7V 4BW5A 4C7UA 4GZRB 1GKFA 4R8CA 3FD9A 3HKDB 1JFFA 5H9CA 1WLEA 3KCYA 2P67A 4OPHA 5H2FZ 2WLIB 4YIPA 1FXHA 5KAIZ 1GRJA 2QJ1A 1DTOA 3SYCA 3G4SV 4LFAO 2P90A 3DTUB 1I0HA 4B7EA 3L74H 5LA6B 1YTFD 5J2TA 3FB8C 4J7KA 1XILA 3ZX6A 4ASUG 2QWRB 4DV7O 3H1IH 4Q20A 2KKWA 2L35A 3ZHUA 3CRQA 3ETQA 4FIPC 4TV8B 3W7UA 2B9ZA 1E1RG 1NZ6A 5H6QA 3PJSK 4PV1B 3K57A 2DWDC 5L3DA 2AXTZ 5JJNB 1YTFB 1XDCA 1NTMH 4AILC 5JWPA 1NS1A 2QWNB 1N4CA 1Q43A 2QM8A 3A0HZ 1K34A 5IJ9A 5IY5B 4RQEA 4EEQA 2JIZG 2QM4A 4YHHO 1Q81W 2F95B 2PGGA 1SESA 1JR9A 3ABLC 3GWOA 2K1EA 3NR7A 2IJKA 3OR6C 4J10A 2BSKB 4ZHQB 3K3WA 3OAAG 3CYOA 1K5QA 4JI5B 4LWSB 2X0LA 1PD3A 2XUMA 3AK1A 5EIBC 3QF7A 2IJIA 1H8HG 1NU1H 3BEHA 2A7WA 3Q4HA 4J9YB 4PA3A 3H9VA 4FLYA 3FKSG 4PELA 5EYPA 1AJPA 4LF5O 1BS3A 1Y67A 3O9OA 2GTSA 3L75H 4L87A 4MVSA 1HR0O 4NKGB 5IYDO 4KUMA 4DV0B 4DR4B 1J5EO 2R72A 1EM1A 1GTOA 4UCRA 1WP7A 3STZC 1EN4A 4I4TB 3JAMN 3ZHRA 2Q8VA 1KQSU 1S5JA 2JRIA 3OW2U 1MA1A 4RWUA 3RWRD 5B1BB 1QLEC 3ML0A 1W0KG 2JS5A 5CA0B 4Z1VA 1JOYA 4EFBA 3CRAA 3T1YB 1H8EG 1S72V 3RYFA 4DR5B 1P7BA 4B3SO 1PL0A 4ZOLA 3H1LH 3ICXA 4LFCO 1IBLO 1XL4A 4AQYO 4O2BA 5C8YB 3ZHVA 2UUAO 1ZX3A 4TOIA 3DGEA 4X1KA 3CS5A 5E1AC 4X9QA 1YDXA 4KXRA 4JI2B 4PI0A 5TISZ 3CRRA 3JARB 3OGCC 1HNZB 3RT3C 1TUEB 4CS2A 3MHSC 3ZN0A 3RYIB 5B1AB 2H3OA 2XAFA 1RSOA 2UXBB 3ASOC 2QWPB 1M57C 2AZ0A 2BCCH 2QA4V 2ZDIA 4FLWA 3LSSA 1OCZC 1AR1B 1B04A 3UO2A 2KG7A 1YJ9V 5KAFZ 3B09A 3SPIA 4PDVA 1V55C 2Q0OC 2PY5A 2ZIOA 3THOA 1DF5A 3ABMC 4UXNA 2QWOB 3BPZA 1HR0B 1VF7A 2EIMC 3T1HO 1GH6A 4YY3O 1I08A 3CCMV 1BHBA 2OTJV 2FB5A 2ZQMA 2EJ7A 2MW2B 4QGPA 2CH7B 2WLIA 2ZDIC 1B3QA 1ZWIC 4DV5O 4OXSA 1BQ0A 5J9PC 3QTCA 2OIEA 3E8FA 4XBFA 3JALB 2BOCC 1G1XB 1QLNA 5IYBO 1S3JA 2E74B 2ZIMA 3E8GA 4UB8Z 5BMVA 1GAXA 5BR8B 4B3SB 2EZPA 1R3LC 4J7JA 3P30A 2JJ2G 5B1OA 1H2SB 2UUAB 4LFBO 3QO7A 1VQ5V 4EB6A 2X7RB 4JYBA 4F6RB 5E79Z 3J7AU 2QM7A 4DK0A 4X1IA 1UJWB 4JGSA 2A9HA 4CC5A 2VQFO 1SQPH 4ZI7B 2ZR2A 4LF7O 5CMUA 1M1KW 2CGNA 4DW1A 4O4LB 3CMAV 2QTOA 4QJFB 3LDEA 4DV4O 2UXXA 2JGUA 1NTKH 1EFRG 2BSKA 4NYKA 2HHHB 4BIUA 2X6CA 4FFKA 1YHQV 1PV0A 1BMFG 4LWSA 1WB7A 3AG3C 1FFTB 4FM0A 1S0VA 4JZ2A 4JASA 2E76B 2Q69A 2IU0A 1URFA 1WP8A 3CCEV 3T1HB 4JTCB 4LP8A 1FXKB 1PM9A 3OE7G 5IY5C 2WLMA 5L3BA 2QE7G 5LYJB 1Q3EA 4MTOA 2L6LA 4JPRA 1AB3A 2QKAA 3IC7A 4IYHA 2CTWA 2QKCA 3LNNA 4KL1A 1M56B 1HNXB 1AILA 3ETDA 2P4VA 4OX9O 2HJDA 4XDLA 4UVAA 4DW0A 4MVMA 1QR9A 3OEHG 2JEUA 4I4TA 2JJ1G 1PNLA 4TQDA 3K9AA 1L0NH 3OUSA 4LH6A 2IJJA 4FLZA 1SQQH 5D5QA 1R1BA 2EULA 1LNQA 2DQ3A 2EIJB 3TK1A 5F2VO 2DMXA 2BTQA 3FX7A 1W2BU 3CP1A 3ZEDA 4J7ZA 2DJVA 4Z1MG 3QO5A 3K5NA 4WF9V 2VQFB 1AP6A 4DO2A 3FB6C 1XUQA 5CA3A 1F4MA 2OYQA 2HKOA 5JCOA 3K08A 2JGDB 1H2NA 1I5YA 2B5UA 4I0XB 1R73A 3RYCA 2Q73A 4DV4B 2DQ0A 3JARA 1W59A 3CCLV 1OCCB 2IJHA 1Q8IA 3AG7A 3L70H 5B1BC 4K0KO 2YIDA 4DR7O 4P30A 4MTXA 2QTSA 2AZ2A 3SYOA 2QR4A 1FD9A 2N04A 3CCVV 2IH3C 3EHBB 1VQOV 3JD0A 3VQYA 1ZUQA 3SDLA 3T2MA 4JAUA 3LDDA 4JI8O 3WB0A 2JDIG 3N27A 4HNAB 4KFMA 3AG4B 1ZL8A 2YI8A 3FFQA 1OCOB 5JCOC 4G28B 2HG5C 4GKJO 4I55A 4X89A 2OWOA 2IM9A 1WNSA 4U7NA 4DRXB 2ETNA 3SPGA 4UFZA 3TGUH 1SQFA 1YF2A 3ASNB 1SS3A 2EBOA 4G27B 4J41A 2CH7A 4IT5A 3G6BA 3JCZA 4IGGA 5H5NA 2HVJC 2ZD9A 1W0JG 2UUCB 3CC2V 4FJCC 4GX1A 4ZIBA 4H33A 5CB4B 2GBOA 1XL6A 4BIZA 1KD1W 4UVBA 3W7SA 4WBNB 1NH2D 3LSUA 5KHKA 4JI0O 4PDMA 4JI1B 2WWWA 4JTDB 3JATA 2WLNA 3K58A 1QHTA 4DR1B 4HZ3A 2F66C 1V9PA 1TGOA 2OCCB 1VP7A 1KKCA 5IWAB 1GN6A 3N2GB 4UV9A 4WFAV 4Q6GA 1WA8A 1MSWD 1R3IC 1TVKB 2FKXA 4K0KB 2CAZC 4DR7B 2Y4TA 4ZI7A 5KHGA 4MTFA 1FKAO 4PJ0Z 3L73H 1OCRC 4MS2A 3JASA 5B5EZ 1KKDA 4O4LA 2EILC 3BABA 3J80N 2UXCO 4YXWG 4JI8B 3ETEA 3KKYA 2YXYA 1D2DA 4NTYA 3DXRB 1YEWA 2HR3A 4F6EA 1N36O 4ZBMA 5A2QN 3JAWB 4GKJB 4RAIA 2K9PA 1HDJA 4HBNA 4CS3A 4X1YB 1RFYA 3FB7C 3H1HH 2LGQA 3PN1A 3IAYA 2QSAA 4P2ZA 5LYJA 3SR2C 3ZRXA 1LUWA 1XBLA 1P49A 3CD6V 4FVMA 4I7ZB 5J2UB 3RYHA 4U7OA 4X88A 4PA4A 2D3OW 4QNHB 1Q82W 4G2KA 2DW4A 4NR1A 1BHAA 4JI5O 5EBWC 3OD4A 1KYOF 2QEXV 3APOA 1OHHG 2RJZA 5LP6B 1HW7A 2LJ2A 2ADQB
chains in the Genus database with same CATH topology
2A06H 1SQQH 1NTZH 1KB9F 1NTMH 1BE3H 3L71H 1BCCH 4U3FH 3CWBH 3L75H 1SQXH 3H1IH 4PD4F 1SQPH 1EZVH 2FYUH 1L0LH 1PPJH 3H1JH 3L73H 3L72H 1SQBH 2IBZH 3H1HH 1SQVH 3H1LH 1P84F 3L70H 3CXHF 1NU1H 5KLVH 1KYOF 1NTKH 3L74H 3BCCH 2BCCH 1BGYH 1L0NH 3CX5F 4D6TH 1PP9H 3H1KH 3TGUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 H;  1SQQ H;  1NTZ H;  1KB9 F;  1NTM H;  1BE3 H;  3L71 H;  1BCC H;  4U3F H;  3CWB H;  3L75 H;  1SQX H;  3H1I H;  4PD4 F;  1SQP H;  1EZV H;  2FYU H;  1L0L H;  1PPJ H;  3H1J H;  3L73 H;  3L72 H;  1SQB H;  2IBZ H;  3H1H H;  1SQV H;  3H1L H;  1P84 F;  3L70 H;  3CXH F;  1NU1 H;  5KLV H;  1KYO F;  1NTK H;  3L74 H;  3BCC H;  2BCC H;  1BGY H;  1L0N H;  3CX5 F;  4D6T H;  1PP9 H;  3H1K H;  3TGU H; 
#chains in the Genus database with same CATH topology
 1ZAU A;  4CH4 A;  4X64 O;  2QWQ B;  4L8J A;  2H8P C;  3LUT B;  2YIB A;  5IJ0 B;  2WAM A;  1YIT V;  3K03 A;  4XDJ A;  2WPD G;  1IDS A;  5CBG A;  1QVF U;  1AP5 A;  5KMG B;  4LBE C;  1BT8 A;  2ZE8 A;  3DC5 A;  2EX3 A;  1Q7Y W;  2ZIN A;  3VBB A;  1WPB A;  4DV0 O;  4DR4 O;  3JD1 A;  2JGD A;  4BR6 A;  5AG2 A;  5LHH A;  4I0X A;  5CBH A;  4IIJ A;  2UXC B;  4GYC B;  4I50 B;  3G6E V;  2BOB C;  4X20 A;  2WLL B;  3BAA A;  4MVZ A;  1N36 B;  2LFS A;  5GON A;  3T1Y O;  1IUR A;  2NNU A;  4YJ3 B;  4DR5 O;  4WFH A;  3JSN A;  2F4V O;  4NTX A;  2YIC A;  5EC1 C;  5CBF A;  4HNA A;  1BL8 A;  4O4I A;  3MDS A;  3N2K B;  1I7F A;  5L3G A;  4UCS A;  4CC6 A;  4JI2 O;  5JJJ B;  4QE9 A;  1OCC C;  4DRX A;  1IBM O;  3MHH C;  5BY1 A;  1N8R W;  1HNZ O;  1F7Y A;  1V54 B;  4QPK A;  5K1X A;  2UXB O;  1PKX A;  1Z5W A;  3B4S A;  2LFR A;  1RP3 B;  4I9Q A;  3ETG A;  1NKD A;  1E79 G;  4O2A A;  4HAM A;  4X64 B;  3AG4 C;  3CJH A;  4Z2W A;  1OCO C;  1I5X A;  4JV5 B;  1QQC A;  1P4R A;  5EBL C;  4TSF G;  3K5M A;  3QNE A;  4O4J B;  1XHZ A;  1NTZ H;  4WBN A;  1SET A;  3L71 H;  3HKE A;  2B1I A;  3HR0 A;  3AK3 A;  3ASN C;  3CB2 A;  4DR6 B;  2HJF C;  3CXH F;  4LR3 A;  1CXZ B;  3K5O A;  5LXT A;  4MVR A;  3STL C;  3OT7 A;  4TV9 B;  4UCV A;  1N33 O;  2ADP A;  4P9P A;  4CBC A;  4JTA B;  1ZTE A;  3LDC A;  4D7S A;  1BCC H;  1TVK A;  4TUY B;  4AI8 A;  1VAR A;  3T4Z A;  4LNU B;  4YJ2 B;  2W0X A;  1YCI A;  1Q86 W;  2PI5 A;  3BVO A;  5BR8 O;  1NVP D;  1Q90 D;  2F4V B;  1Y4M A;  2GDS A;  4J42 A;  1VF5 B;  2RN9 A;  2EJR A;  4JI3 O;  2Q6A A;  3ZBH A;  1XMO O;  2Y69 B;  1ORQ C;  4X8A A;  1JX9 A;  4W4L A;  2ZE5 A;  1SA0 B;  5D5P A;  3ABK B;  3JAW A;  1K9M W;  3A0B Z;  1IBM B;  4KP4 A;  3OM3 B;  1BSM A;  4K35 A;  5EC2 C;  1NVP B;  2ZE7 A;  1GN2 A;  4UCU A;  1T5E A;  1KBH A;  3E22 B;  4LF4 O;  5KHH A;  4WCE V;  2XAJ A;  1WPX A;  3VQW A;  5J2U A;  1Y74 B;  3K06 A;  2YEV B;  1IX9 A;  4NXM O;  3AG2 B;  4JI6 O;  2R9A A;  2ZE6 A;  2XAG A;  1Y6X A;  4ICG A;  2HHH O;  3UCS C;  2GTA A;  3CSX A;  3AG1 B;  1JVM A;  2QGN A;  2DYR C;  1B6Q A;  2WLK A;  4K8Z A;  1O9G A;  5KHI A;  5LP6 A;  1TUB A;  5B3S B;  5LMN B;  4TT3 G;  1G8M A;  2YC0 A;  3FB5 C;  5IJ0 A;  2DYS C;  3HKD A;  1AI4 A;  3G67 A;  1K5S A;  1N33 B;  5KMG A;  1XNR B;  4NTW A;  5LBQ A;  1Q5O A;  2WSS G;  2XND G;  1K4C C;  5FL7 G;  1HNX O;  1IZ3 A;  3W7X A;  3SJQ C;  5IE9 A;  5LA6 A;  3B40 A;  4CH6 A;  1RM1 B;  3APQ A;  4WFB V;  3H01 A;  1VQP V;  2YXH A;  1DK1 A;  5FLX N;  1GK9 A;  1S5H C;  5LP6 C;  2OIG A;  5LGT A;  4B3R B;  2Y48 A;  3E35 A;  4TV8 A;  4JI3 B;  4I50 A;  1VIB A;  1XMO B;  4DR3 O;  4FLV A;  2ARH A;  4PDR A;  2ATK C;  3JCU Z;  1SZX A;  4YJ3 A;  3BY6 A;  2LO1 A;  1K92 A;  1M4U A;  1QCE A;  3K79 A;  1BE3 H;  4H37 A;  3MAQ A;  3RW0 A;  2M6Y A;  5L3C A;  2FL4 A;  3N2K A;  1NI8 A;  4FFB B;  4LF4 B;  3D3Q A;  5FNV B;  3EVK A;  5KA5 A;  2H94 A;  1US6 A;  4O4H B;  1BGY H;  4DV6 O;  4JI6 B;  4NXM B;  4ZHQ A;  4BW9 A;  3CE2 A;  5ITZ B;  3TCU A;  3D3I A;  4PHZ A;  4JI4 O;  2DE0 X;  4UUJ C;  3RN4 A;  5C93 A;  1YJW V;  2A79 B;  3K0G A;  1D5N A;  2EIN B;  4X65 O;  4QIW F;  3ZRV A;  1KUQ A;  3NXS A;  4D7T A;  1N0N A;  1XOU A;  1XMQ O;  4O4J A;  5KUK A;  1M90 W;  1OZ0 A;  1F4N A;  3SJC C;  2FYU H;  1MMM A;  1GN4 A;  1WJZ A;  2Q5Z A;  3OMI B;  3ZMT A;  1MOF A;  3R65 A;  1R3J C;  2PYJ A;  4R6Z A;  1IBK B;  2Q7E A;  1H2K A;  1QR8 A;  1QNM A;  2UUC O;  4TUY A;  1XRE A;  2CK3 G;  3SPH A;  3B2E E;  4LNU A;  4DR3 B;  1S76 D;  1AI7 A;  5CA0 A;  1PPJ H;  4J80 A;  1IVS A;  2GHY A;  5JJE B;  1Z2G A;  2WLJ A;  5C8Y A;  1JPX A;  2HFE C;  4JI1 O;  2G38 A;  3JD4 A;  3M99 B;  3ZRW B;  3L9D A;  2Z0A A;  1Q6H A;  4MVU A;  2DOS A;  1K7D A;  1SA0 A;  3M8A A;  3SYA A;  3SYP A;  4PA7 A;  1S77 D;  3WB1 A;  4DR1 O;  3G80 A;  2ZR3 A;  5IWA O;  2AHY A;  4GX0 A;  4JYC A;  3BA8 A;  4OPA A;  3RYI A;  4DV6 B;  1UFI A;  2OTL V;  3U10 A;  3DSQ A;  4NVP A;  4FLT A;  4JI4 B;  1JCH A;  2Q7H A;  3E22 A;  3HKB B;  2E75 B;  1NT2 B;  4ZKI A;  1Y74 A;  3RFR A;  3I55 V;  2YEV A;  5DEC A;  4MTG A;  4X65 B;  2Y69 C;  4QPJ A;  4R50 A;  3ABK C;  2RNB A;  3AK2 A;  1XMQ B;  2KQX A;  2OCH A;  3A0R A;  4LF8 B;  2A3Q A;  2VRZ A;  2W0F C;  3OMA B;  1E1Q G;  2ZNJ A;  1YJN V;  2C2A A;  3QO8 A;  5B1A C;  1GM8 A;  1R6K A;  1EN6 A;  2ITC C;  2YIA A;  4PD4 F;  2R9R B;  2HEP A;  1YXB A;  5IJ9 B;  3K59 A;  1Q6I A;  2V7Q G;  3CCU V;  3OTO O;  1SZT A;  4I9W A;  1R6T A;  4R7C A;  3AG2 C;  3C90 A;  3JAL A;  3T4D A;  3A8T A;  3ZS8 C;  1K73 W;  3AG1 C;  1FFX B;  1WAZ A;  3JD2 A;  1DLB A;  1L8D A;  1SKV A;  3ZN1 A;  4LF9 B;  1VQ9 V;  5B3S C;  5JQG B;  1MZE A;  1HNW O;  1MNG A;  4H0L B;  2AHZ A;  1JMK C;  1GN3 A;  4F6R A;  3ZMZ A;  4NXN B;  3RVZ A;  1B06 A;  4X62 B;  2YI9 A;  2A06 H;  3K9S A;  4DUY B;  3K04 A;  3CWB H;  1WN7 A;  4DV2 O;  1NH2 B;  1RM1 C;  1G6U A;  3U0Z A;  3G71 V;  2YS8 A;  4MVQ A;  5FNV A;  3F7V C;  1KP3 A;  5KLV H;  5LOV B;  4K8X A;  1S5L Z;  4KHP B;  3B8N A;  2ZT9 B;  4UCO A;  1JJ2 U;  4O4H A;  1J95 A;  2EIK B;  3SJA C;  1NJI W;  1U96 A;  3CC4 V;  1X59 A;  2ZM6 O;  4DXW A;  1XNQ O;  2ZXW B;  2ZNI A;  3EFF K;  4J11 A;  5B66 Z;  1M57 B;  5DED A;  1FXK A;  1XEQ A;  3B77 A;  1XQ8 A;  4F4L A;  4X1K B;  1KMI Z;  3O65 A;  1ZSP A;  3FAV B;  4E2L A;  1R3K C;  2DWE C;  3OTO B;  2CTP A;  2UXD B;  1L0L H;  1PNK A;  1VQL V;  3JD3 A;  1RPO A;  3K0D A;  3UO3 A;  1RSO B;  2IW5 A;  4OGQ B;  4LH7 A;  2JS3 A;  1VQ4 V;  3UKM A;  3E86 A;  1FXK C;  4U3J B;  4FZ0 A;  2ZKO A;  4IL6 Z;  2R70 A;  1GMG A;  1TA8 A;  3D36 A;  4FK5 C;  1HNW B;  3VQX A;  4JV5 O;  2NR5 A;  1EZV H;  3CCJ V;  1KEC A;  4RQF A;  1YZB A;  4NB5 A;  1CPY A;  1M56 C;  1EN5 A;  3S3W A;  3ABU A;  4DV2 B;  4X66 B;  3ZRW A;  1O9H A;  4DR6 O;  1Q6U A;  2PTM A;  2P06 A;  3EXA A;  1PL4 A;  1N0J A;  3ZCC A;  2AGA A;  4ABM A;  1NR1 A;  3I5D A;  3I56 V;  2EIJ C;  1CP9 A;  3D36 C;  1IXB A;  3F5W C;  2P4K A;  2ZM6 B;  1SER A;  4DR2 B;  1XNQ B;  2GUZ B;  1VEW A;  5CA1 B;  3HKB A;  4PA9 A;  5JVD B;  2RDC A;  5BMV B;  3KCX A;  5GTI Z;  5IDJ A;  4LC1 A;  5LGU A;  3CRC A;  1FPO A;  2WA3 A;  3IJ4 A;  4H13 B;  1UPG A;  4FLU A;  2XT9 A;  4EB6 B;  2LQT A;  2R9I A;  2Z3Y A;  1N32 O;  1Y76 B;  3HPL C;  1KU9 A;  3A2F A;  3AG3 B;  3QG5 A;  3CME V;  1JJO A;  4HYO A;  4X1I B;  2M7W A;  2IU3 A;  1FJG O;  2XAQ A;  3CCQ V;  2WLH A;  4DK1 A;  3ZMU A;  2YDE A;  4B3M B;  4B3T O;  2V4D A;  1NR7 A;  3B8M A;  3GB7 C;  1R6N A;  2HVK C;  2ILM A;  5BXZ A;  4GX5 A;  4MVO A;  5KHJ A;  2VQE B;  3SGI A;  3W7W A;  5CB4 A;  5L3F A;  3OFN G;  1FFX A;  2PZS A;  3F5T A;  4GKK B;  3CHX A;  4FM1 A;  1YVW A;  2XHB A;  2XAS A;  5JH7 B;  5IT9 N;  5JQG A;  5LMN O;  4GX2 A;  1AVM A;  1FYJ A;  2FML A;  3OGI B;  4EKW A;  3BRC A;  3ZHS A;  3N2G A;  1XNR O;  1NQT A;  3JAK B;  1HWY A;  5K1P A;  3ZMS A;  3ZHT A;  3AEI A;  4IYI A;  4LFA B;  3U11 A;  3WU2 Z;  2RMK B;  5L3E A;  1SQB H;  3JYC A;  1M9N A;  5LOV A;  2W6I G;  4BAY A;  1FS0 G;  3OUF A;  4DV7 B;  4B3R O;  1NBM G;  5H6R A;  2JK5 C;  1AI5 A;  2VWK A;  3CX5 F;  3ZJZ A;  2VWJ A;  5A9G A;  3DXR A;  1X4T A;  1KC8 W;  2OCC C;  3WB2 A;  2BTQ B;  1K8A W;  4X1Y A;  1N32 B;  1SQV H;  2IH1 C;  1VF6 A;  2LW7 A;  3MD0 A;  1FJG B;  4MSW C;  1A32 A;  5EZY B;  1LR1 A;  4PDL A;  1VQK V;  4B3T B;  3FAV A;  2N05 A;  4U3F H;  2YUA A;  4YHH B;  4QE7 A;  3RYC B;  2EIK C;  3CC7 V;  2XTA A;  2F43 G;  1PNM A;  3HKC B;  5GTH Z;  4UVC A;  3T1C A;  1BZK A;  2MK3 A;  2ZXW C;  2RQ6 A;  2D2C B;  4MW3 A;  4DUZ O;  1RPR A;  4JI7 O;  1GM7 A;  1H2L A;  4JYY A;  4U3J A;  1K33 A;  3DC6 A;  1VF6 C;  4TWK A;  3ZMV A;  3VQV A;  1ZL8 B;  1TAE A;  4LF6 O;  3H1J H;  3D8C A;  1QU7 A;  1G4Y B;  4I55 B;  4LF5 B;  3VOU A;  1K3E A;  4FM2 A;  4FZ1 A;  5EK0 A;  5DM6 V;  1AI6 A;  3TXQ A;  5HFM A;  3OMN B;  4D6T H;  3H1K H;  2Y0I A;  1J5E B;  1DGS A;  3E8H A;  4E4E A;  2XOK G;  1ROP A;  1IBK O;  1AJN A;  3UT5 B;  3M7M X;  3WFV A;  2CDY A;  2VS0 A;  4BIO A;  1KP2 A;  2WLL A;  2DN9 A;  2Q68 A;  2GUZ A;  3OR7 C;  4GCZ A;  2GSM B;  5CA1 A;  2X6B A;  5IYZ B;  2Q67 A;  5JVD A;  4RUE A;  4GLX A;  1YSC A;  2WA4 A;  1OCR B;  1F51 A;  2ZCE A;  2EIL B;  4LFC B;  1IBL B;  4AQY B;  3E83 A;  4WFG A;  3ZIA G;  3SJB C;  2PF4 E;  4FPP A;  2LGW A;  3C3S A;  4IHJ B;  3UQ8 A;  1M93 A;  3JAT B;  2E5L O;  4EFE A;  1VQ8 V;  2UXN A;  1Y76 A;  1TUB B;  3E89 A;  1F23 A;  4MT8 A;  4UB6 Z;  1WA8 B;  1MG1 A;  4GUN A;  4DV1 O;  1VQ6 V;  2NLJ C;  4DUZ B;  3JAS B;  3WG7 B;  4JI7 B;  4PA6 A;  3QVN A;  4K3A A;  1MAB G;  5EBM C;  3RGB A;  1YIJ V;  2BTO A;  2UU9 O;  2X6A A;  4FLX A;  3BCC H;  3UM7 A;  1XI1 A;  2ITD C;  4LF6 B;  3IGA C;  4LF8 O;  4A5U B;  1I94 O;  1QVG U;  5KX5 B;  2ODM A;  2E3C A;  2W6J G;  3BA9 A;  5JH7 A;  5FPO A;  1V54 C;  1K4D C;  4XDK A;  4YY3 B;  2YSU B;  1L1F A;  3X2Q B;  3P32 A;  3TXS A;  2GV9 A;  4TV9 A;  1N34 O;  2CUG A;  5IYC O;  2UUB O;  5CN0 A;  4DV5 B;  3RVY A;  3JAK A;  3FYE B;  2YIB D;  4UCT A;  3RYH B;  2JVD A;  2XAH A;  4YJ2 A;  2QKS A;  5LL6 Y;  2AW9 A;  2KB1 A;  2Y0P A;  2BE3 A;  4PI2 A;  4LF9 O;  5KA6 A;  1JQ0 A;  3HB3 B;  1Y66 A;  3SPC A;  4LFB B;  2FTK A;  4DV3 O;  1EZJ A;  2E5L B;  2Q7G A;  1QBZ A;  4JZG A;  4AHC A;  4NXN O;  1JFF B;  2OT5 A;  4X62 O;  3KZI Z;  5LHI A;  2P5O A;  4DUY O;  1FAF A;  4W4K A;  1Z5V A;  2F1M A;  4DV1 B;  2B1G A;  5HFL A;  5EZY A;  1H2G A;  4WFF A;  5EIB D;  4LF7 B;  1OV9 A;  5J2T B;  3CEI A;  4CS4 A;  3W7T A;  1K97 A;  4RO2 A;  4KHP O;  5KUM A;  4BWA A;  2Z5U A;  4IIJ B;  1OJH A;  2PI4 A;  2LP7 A;  3ABT A;  3HKC A;  4H44 B;  2UU9 B;  3ABL B;  1AR4 A;  2IBZ H;  3ZRS A;  1HP8 A;  1P84 F;  2P22 C;  1I94 B;  4X20 B;  5GON B;  1XHX A;  3KG2 A;  4YIO A;  2CGO A;  4O4I B;  4LCU C;  2PYL A;  1N34 B;  5B1N A;  2PUS A;  4CH5 A;  2UUB B;  2CTQ A;  3ZHQ A;  1YI2 V;  2UXD O;  1SC5 B;  2V1D A;  3LNM B;  3E8B A;  1ARO P;  1GO3 F;  3LSQ A;  4OX9 B;  2NN4 A;  1AJQ A;  2Q9L A;  4DYL A;  1SQX H;  4MW8 A;  3UT5 A;  2N74 A;  3BHP A;  3SPJ A;  4O2A B;  1DF4 A;  1LUV A;  4DV3 B;  1H38 A;  1GM9 A;  3CCS V;  3CXC U;  3CJH B;  2A0L A;  3Q4H B;  2F93 B;  5IYZ A;  3P3N A;  1QLE B;  2JEX A;  3E2E A;  3OEE G;  1PP9 H;  5EYP B;  4FMT A;  4RUF A;  1CEZ A;  4JYA O;  4N21 A;  3HKE B;  1VQM V;  1COW G;  4X66 O;  5LMU O;  4IHJ A;  2EZO A;  4CZZ A;  3SYQ A;  4FFB A;  1VQN V;  5BZB A;  5LXT B;  4B08 A;  3C3T A;  2P7T C;  4GT1 A;  1ZLZ A;  5LHG A;  4N23 A;  3BFR A;  4J9Z B;  3F7Y C;  3P3P A;  2Q0A A;  1SF9 A;  5ITZ A;  1SRY A;  3JSL A;  3RBZ A;  4DR2 O;  2CTR A;  2O57 A;  4JAV A;  2QDO A;  3ASO B;  3J81 N;  3L72 H;  3CRM A;  3TET A;  3RYF B;  2RCV A;  4ZOL B;  5DN6 G;  1JA8 A;  1OCZ B;  2HLD G;  4O2B B;  1AR5 A;  2HP8 A;  1V55 B;  5KX5 A;  5LGN A;  1KB9 F;  3IC9 A;  3TJT A;  1EBO A;  2DYR B;  4JF3 A;  4TQF A;  1THZ A;  3ABM B;  3K5L A;  2LW1 A;  4B7K A;  1IXM A;  2CE4 A;  5GW7 A;  1MSD A;  2EIM B;  2Q4P A;  1H2M A;  2DYS B;  3WG7 C;  4B3M O;  4CH3 A;  1U97 A;  2Y4U A;  3S3X A;  2F23 A;  2KSD A;  3R66 A;  1SQG A;  3GWK C;  2YXL A;  1P7G A;  2EIN C;  2VQE O;  1WB8 A;  2P6J A;  2KG7 B;  4JAA A;  4I5S A;  1D5A A;  4UV8 A;  1M5I A;  4GKK O;  4WFE A;  1ENV A;  4P9O A;  1BQZ A;  4JYA B;  1VMG A;  3IFX A;  3OTF A;  5FPR A;  3CCR V;  3FYI B;  4JI0 B;  1FXV A;  5LMU B;  1MZF A;  3X2Q C;  3CPW U;  3GVM A;  1VQ7 V;  4BW5 A;  4C7U A;  4GZR B;  1GKF A;  4R8C A;  3FD9 A;  3HKD B;  1JFF A;  5H9C A;  1WLE A;  3KCY A;  2P67 A;  4OPH A;  5H2F Z;  2WLI B;  4YIP A;  1FXH A;  5KAI Z;  1GRJ A;  2QJ1 A;  1DTO A;  3SYC A;  3G4S V;  4LFA O;  2P90 A;  3DTU B;  1I0H A;  4B7E A;  3L74 H;  5LA6 B;  1YTF D;  5J2T A;  3FB8 C;  4J7K A;  1XIL A;  3ZX6 A;  4ASU G;  2QWR B;  4DV7 O;  3H1I H;  4Q20 A;  2KKW A;  2L35 A;  3ZHU A;  3CRQ A;  3ETQ A;  4FIP C;  4TV8 B;  3W7U A;  2B9Z A;  1E1R G;  1NZ6 A;  5H6Q A;  3PJS K;  4PV1 B;  3K57 A;  2DWD C;  5L3D A;  2AXT Z;  5JJN B;  1YTF B;  1XDC A;  1NTM H;  4AIL C;  5JWP A;  1NS1 A;  2QWN B;  1N4C A;  1Q43 A;  2QM8 A;  3A0H Z;  1K34 A;  5IJ9 A;  5IY5 B;  4RQE A;  4EEQ A;  2JIZ G;  2QM4 A;  4YHH O;  1Q81 W;  2F95 B;  2PGG A;  1SES A;  1JR9 A;  3ABL C;  3GWO A;  2K1E A;  3NR7 A;  2IJK A;  3OR6 C;  4J10 A;  2BSK B;  4ZHQ B;  3K3W A;  3OAA G;  3CYO A;  1K5Q A;  4JI5 B;  4LWS B;  2X0L A;  1PD3 A;  2XUM A;  3AK1 A;  5EIB C;  3QF7 A;  2IJI A;  1H8H G;  1NU1 H;  3BEH A;  2A7W A;  3Q4H A;  4J9Y B;  4PA3 A;  3H9V A;  4FLY A;  3FKS G;  4PEL A;  5EYP A;  1AJP A;  4LF5 O;  1BS3 A;  1Y67 A;  3O9O A;  2GTS A;  3L75 H;  4L87 A;  4MVS A;  1HR0 O;  4NKG B;  5IYD O;  4KUM A;  4DV0 B;  4DR4 B;  1J5E O;  2R72 A;  1EM1 A;  1GTO A;  4UCR A;  1WP7 A;  3STZ C;  1EN4 A;  4I4T B;  3JAM N;  3ZHR A;  2Q8V A;  1KQS U;  1S5J A;  2JRI A;  3OW2 U;  1MA1 A;  4RWU A;  3RWR D;  5B1B B;  1QLE C;  3ML0 A;  1W0K G;  2JS5 A;  5CA0 B;  4Z1V A;  1JOY A;  4EFB A;  3CRA A;  3T1Y B;  1H8E G;  1S72 V;  3RYF A;  4DR5 B;  1P7B A;  4B3S O;  1PL0 A;  4ZOL A;  3H1L H;  3ICX A;  4LFC O;  1IBL O;  1XL4 A;  4AQY O;  4O2B A;  5C8Y B;  3ZHV A;  2UUA O;  1ZX3 A;  4TOI A;  3DGE A;  4X1K A;  3CS5 A;  5E1A C;  4X9Q A;  1YDX A;  4KXR A;  4JI2 B;  4PI0 A;  5TIS Z;  3CRR A;  3JAR B;  3OGC C;  1HNZ B;  3RT3 C;  1TUE B;  4CS2 A;  3MHS C;  3ZN0 A;  3RYI B;  5B1A B;  2H3O A;  2XAF A;  1RSO A;  2UXB B;  3ASO C;  2QWP B;  1M57 C;  2AZ0 A;  2BCC H;  2QA4 V;  2ZDI A;  4FLW A;  3LSS A;  1OCZ C;  1AR1 B;  1B04 A;  3UO2 A;  2KG7 A;  1YJ9 V;  5KAF Z;  3B09 A;  3SPI A;  4PDV A;  1V55 C;  2Q0O C;  2PY5 A;  2ZIO A;  3THO A;  1DF5 A;  3ABM C;  4UXN A;  2QWO B;  3BPZ A;  1HR0 B;  1VF7 A;  2EIM C;  3T1H O;  1GH6 A;  4YY3 O;  1I08 A;  3CCM V;  1BHB A;  2OTJ V;  2FB5 A;  2ZQM A;  2EJ7 A;  2MW2 B;  4QGP A;  2CH7 B;  2WLI A;  2ZDI C;  1B3Q A;  1ZWI C;  4DV5 O;  4OXS A;  1BQ0 A;  5J9P C;  3QTC A;  2OIE A;  3E8F A;  4XBF A;  3JAL B;  2BOC C;  1G1X B;  1QLN A;  5IYB O;  1S3J A;  2E74 B;  2ZIM A;  3E8G A;  4UB8 Z;  5BMV A;  1GAX A;  5BR8 B;  4B3S B;  2EZP A;  1R3L C;  4J7J A;  3P30 A;  2JJ2 G;  5B1O A;  1H2S B;  2UUA B;  4LFB O;  3QO7 A;  1VQ5 V;  4EB6 A;  2X7R B;  4JYB A;  4F6R B;  5E79 Z;  3J7A U;  2QM7 A;  4DK0 A;  4X1I A;  1UJW B;  4JGS A;  2A9H A;  4CC5 A;  2VQF O;  1SQP H;  4ZI7 B;  2ZR2 A;  4LF7 O;  5CMU A;  1M1K W;  2CGN A;  4DW1 A;  4O4L B;  3CMA V;  2QTO A;  4QJF B;  3LDE A;  4DV4 O;  2UXX A;  2JGU A;  1NTK H;  1EFR G;  2BSK A;  4NYK A;  2HHH B;  4BIU A;  2X6C A;  4FFK A;  1YHQ V;  1PV0 A;  1BMF G;  4LWS A;  1WB7 A;  3AG3 C;  1FFT B;  4FM0 A;  1S0V A;  4JZ2 A;  4JAS A;  2E76 B;  2Q69 A;  2IU0 A;  1URF A;  1WP8 A;  3CCE V;  3T1H B;  4JTC B;  4LP8 A;  1FXK B;  1PM9 A;  3OE7 G;  5IY5 C;  2WLM A;  5L3B A;  2QE7 G;  5LYJ B;  1Q3E A;  4MTO A;  2L6L A;  4JPR A;  1AB3 A;  2QKA A;  3IC7 A;  4IYH A;  2CTW A;  2QKC A;  3LNN A;  4KL1 A;  1M56 B;  1HNX B;  1AIL A;  3ETD A;  2P4V A;  4OX9 O;  2HJD A;  4XDL A;  4UVA A;  4DW0 A;  4MVM A;  1QR9 A;  3OEH G;  2JEU A;  4I4T A;  2JJ1 G;  1PNL A;  4TQD A;  3K9A A;  1L0N H;  3OUS A;  4LH6 A;  2IJJ A;  4FLZ A;  1SQQ H;  5D5Q A;  1R1B A;  2EUL A;  1LNQ A;  2DQ3 A;  2EIJ B;  3TK1 A;  5F2V O;  2DMX A;  2BTQ A;  3FX7 A;  1W2B U;  3CP1 A;  3ZED A;  4J7Z A;  2DJV A;  4Z1M G;  3QO5 A;  3K5N A;  4WF9 V;  2VQF B;  1AP6 A;  4DO2 A;  3FB6 C;  1XUQ A;  5CA3 A;  1F4M A;  2OYQ A;  2HKO A;  5JCO A;  3K08 A;  2JGD B;  1H2N A;  1I5Y A;  2B5U A;  4I0X B;  1R73 A;  3RYC A;  2Q73 A;  4DV4 B;  2DQ0 A;  3JAR A;  1W59 A;  3CCL V;  1OCC B;  2IJH A;  1Q8I A;  3AG7 A;  3L70 H;  5B1B C;  4K0K O;  2YID A;  4DR7 O;  4P30 A;  4MTX A;  2QTS A;  2AZ2 A;  3SYO A;  2QR4 A;  1FD9 A;  2N04 A;  3CCV V;  2IH3 C;  3EHB B;  1VQO V;  3JD0 A;  3VQY A;  1ZUQ A;  3SDL A;  3T2M A;  4JAU A;  3LDD A;  4JI8 O;  3WB0 A;  2JDI G;  3N27 A;  4HNA B;  4KFM A;  3AG4 B;  1ZL8 A;  2YI8 A;  3FFQ A;  1OCO B;  5JCO C;  4G28 B;  2HG5 C;  4GKJ O;  4I55 A;  4X89 A;  2OWO A;  2IM9 A;  1WNS A;  4U7N A;  4DRX B;  2ETN A;  3SPG A;  4UFZ A;  3TGU H;  1SQF A;  1YF2 A;  3ASN B;  1SS3 A;  2EBO A;  4G27 B;  4J41 A;  2CH7 A;  4IT5 A;  3G6B A;  3JCZ A;  4IGG A;  5H5N A;  2HVJ C;  2ZD9 A;  1W0J G;  2UUC B;  3CC2 V;  4FJC C;  4GX1 A;  4ZIB A;  4H33 A;  5CB4 B;  2GBO A;  1XL6 A;  4BIZ A;  1KD1 W;  4UVB A;  3W7S A;  4WBN B;  1NH2 D;  3LSU A;  5KHK A;  4JI0 O;  4PDM A;  4JI1 B;  2WWW A;  4JTD B;  3JAT A;  2WLN A;  3K58 A;  1QHT A;  4DR1 B;  4HZ3 A;  2F66 C;  1V9P A;  1TGO A;  2OCC B;  1VP7 A;  1KKC A;  5IWA B;  1GN6 A;  3N2G B;  4UV9 A;  4WFA V;  4Q6G A;  1WA8 A;  1MSW D;  1R3I C;  1TVK B;  2FKX A;  4K0K B;  2CAZ C;  4DR7 B;  2Y4T A;  4ZI7 A;  5KHG A;  4MTF A;  1FKA O;  4PJ0 Z;  3L73 H;  1OCR C;  4MS2 A;  3JAS A;  5B5E Z;  1KKD A;  4O4L A;  2EIL C;  3BAB A;  3J80 N;  2UXC O;  4YXW G;  4JI8 B;  3ETE A;  3KKY A;  2YXY A;  1D2D A;  4NTY A;  3DXR B;  1YEW A;  2HR3 A;  4F6E A;  1N36 O;  4ZBM A;  5A2Q N;  3JAW B;  4GKJ B;  4RAI A;  2K9P A;  1HDJ A;  4HBN A;  4CS3 A;  4X1Y B;  1RFY A;  3FB7 C;  3H1H H;  2LGQ A;  3PN1 A;  3IAY A;  2QSA A;  4P2Z A;  5LYJ A;  3SR2 C;  3ZRX A;  1LUW A;  1XBL A;  1P49 A;  3CD6 V;  4FVM A;  4I7Z B;  5J2U B;  3RYH A;  4U7O A;  4X88 A;  4PA4 A;  2D3O W;  4QNH B;  1Q82 W;  4G2K A;  2DW4 A;  4NR1 A;  1BHA A;  4JI5 O;  5EBW C;  3OD4 A;  1KYO F;  2QEX V;  3APO A;  1OHH G;  2RJZ A;  5LP6 B;  1HW7 A;  2LJ2 A;  2ADQ B; 
#chains in the Genus database with same CATH homology
 2A06 H;  1SQQ H;  1NTZ H;  1KB9 F;  1NTM H;  1BE3 H;  3L71 H;  1BCC H;  4U3F H;  3CWB H;  3L75 H;  1SQX H;  3H1I H;  4PD4 F;  1SQP H;  1EZV H;  2FYU H;  1L0L H;  1PPJ H;  3H1J H;  3L73 H;  3L72 H;  1SQB H;  2IBZ H;  3H1H H;  1SQV H;  3H1L H;  1P84 F;  3L70 H;  3CXH F;  1NU1 H;  5KLV H;  1KYO F;  1NTK H;  3L74 H;  3BCC H;  2BCC H;  1BGY H;  1L0N H;  3CX5 F;  4D6T H;  1PP9 H;  3H1K H;  3TGU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...