1BE3H

Cytochrome bc1 complex from bovine
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 20
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1be3H00
3L70H 3H1LH 3CX5F 1SQXH 3CXHF 2BCCH 1BGYH 3CWBH 1BCCH 1PPJH 3BCCH 1SQVH 3L71H 1SQQH 1P84F 1NU1H 3TGUH 1L0NH 3L73H 1L0LH 1KB9F 4U3FH 1PP9H 2A06H 3H1KH 1EZVH 2IBZH 3H1HH 5KLVH 1NTKH 3L72H 1KYOF 3H1IH 3H1JH 1SQPH 1NTMH 4PD4F 1NTZH 1SQBH 3L75H 4D6TH 3L74H 2FYUH 1BE3H
chains in the Genus database with same CATH superfamily
3HKDA 5EC2C 2IJIA 3D36A 2NNUA 2L35A 4TV8B 4GLXA 1QR8A 2XOKG 4MVSA 5FL7G 1EBOA 4XDKA 2QE7G 3H1HH 5JJNB 1WAZA 4QE7A 1P7GA 3W7SA 2OYQA 1B06A 2ZM6B 4JTDB 3GWKC 2UXDO 2XAQA 3FB5C 1K4CC 5LL6Y 1D2DA 1OCOC 1AI4A 4YHHO 4FZ1A 1V55C 4FLWA 5K1XA 1IBKO 4MTOA 3CCSV 1ZUQA 1H2GA 1FFXB 1LUWA 1PNKA 3ZCCA 1K3EA 1PL4A 4LFAO 3U10A 3E2EA 2QM8A 1WN7A 1Q8IA 3F7YC 3VQXA 3OTOB 4DV7O 1BQZA 1I08A 1GN6A 1IDSA 3THOA 5LGTA 2ZE6A 4Q6GA 5LYJA 2YXLA 2XT9A 3ZN0A 1YVWA 2F23A 2H8PC 2HVJC 1HNZO 1NT2B 5JWPA 4BAYA 4KHPB 2P06A 4WF9V 3ICXA 3CCJV 2FYUH 2EJ7A 5JH7B 1QR9A 1OV9A 3H9VA 1WLEA 5A2QN 4MW8A 4J7ZA 4UB8Z 3ZMVA 1FXKA 3VBBA 5KHGA 4O4HB 3CRRA 1Q7YW 3E83A 4DR4O 4L8JA 2EIKC 3W7XA 4P30A 1S5LZ 3ZHVA 4PDMA 1JX9A 3G67A 4IGGA 2P7TC 1JFFA 2XTAA 3SPJA 1AROP 2UUBO 4PV1B 2Q7HA 3OD4A 3BABA 3ZHTA 4HNAA 4IHJB 4NTYA 4PI2A 4DV6O 2PGGA 3AG1C 4DRXB 4O4LB 4FFKA 3SYCA 3T2MA 4LF4B 2F1MA 3ABTA 1X59A 2BOBC 3LSUA 2IW5A 4TUYA 3U11A 1K34A 3BY6A 4LF6B 1D5AA 4FIPC 4F6RA 1BSMA 2IBZH 1R1BA 2QWOB 5HFMA 4JYCA 1OCRC 4O2BB 3CRAA 5IWAO 3QNEA 1YIJV 4LF5B 5LP6C 5H6QA 5FNVA 4DUYB 1HNWB 1Y76A 4JF3A 4E4EA 1FPOA 4LC1A 3ABKC 3K0GA 3ETGA 2YEVA 1YJNV 4X8AA 1EN4A 4X1KA 3BAAA 1KBHA 2LQTA 1IZ3A 1NTMH 1Q3EA 2W0FC 4NXNB 4LWSA 3S3WA 5B1AC 4QPJA 1GMGA 1I7FA 2HEPA 2Q9LA 4Q20A 4DR1B 4I50A 4PA6A 4W4KA 4UCUA 3L9DA 1YF2A 1AJQA 1KB9F 4FFBB 5D5QA 2JGUA 1PD3A 2XAHA 3JAWB 4B3MB 2JRIA 5DEDA 3KG2A 2QKSA 5DN6G 1Y74A 3JALB 5LXTB 5GTHZ 4WFHA 3ASOB 2P22C 1R6TA 5JVDA 3SYPA 1ZWIC 2QA4V 4G27B 1N4CA 2ZT9B 1XOUA 3VQVA 5ITZA 3TK1A 1VF5B 4NVPA 4GCZA 3FD9A 1WPBA 3CMAV 4I55B 2UUAO 1TVKB 1XNRO 4G2KA 3LDCA 2ILMA 4UB6Z 1GKFA 5BR8O 4B7EA 3UT5B 1AJPA 1Z5VA 1MNGA 4HBNA 3H01A 2ZXWC 1S0VA 2NLJC 1FXVA 1N36B 4DV3O 4FK5C 1RP3B 1K73W 1RM1B 3KZIZ 1ROPA 2EIJC 4O4JA 5L3EA 2CTWA 3ZRWB 3RYCA 4LF9O 1Q6HA 1XMQB 3J81N 3OGIB 4E2LA 2WLKA 4PHZA 3B2EE 4FLTA 2MK3A 1SKVA 2KKWA 1J5EB 3I56V 4D6TH 1RSOB 4YXWG 1RPOA 3JD2A 1AI7A 1ORQC 2W0XA 5TISZ 4X66O 3IC9A 2EILC 3CRCA 4IIJA 3BVOA 2JJ2G 1V9PA 2WLIB 2ZINA 2YXYA 2ZNJA 2WLHA 1I94B 4UCOA 3FAVB 3KKYA 1S76D 2WWWA 2ZD9A 4ZI7B 1JVMA 3N2GB 4LP8A 1XI1A 4JI4O 3SJAC 4JYAO 2XAJA 5L3GA 2VS0A 2KG7A 3DGEA 1P84F 1BT8A 4I7ZB 1HP8A 2EULA 4G28B 1NBMG 1UPGA 1NTKH 4BW5A 4O2AA 2KB1A 3HKBA 1XDCA 4UCVA 2QTOA 5KX5A 3QO5A 1B3QA 4KP4A 4YJ3A 2HG5C 1FXHA 3K9AA 2P6JA 4EB6A 1N34B 2FMLA 4J7JA 3N2KA 3LNMB 3CYOA 1AJNA 1VQ8V 3B09A 3OAAG 1W0KG 2BTOA 5C8YA 3ETQA 1S5JA 3RYFA 1ZL8A 5JQGB 1NKDA 3T4ZA 2ZE7A 5EK0A 1M5IA 2QKAA 1H2NA 4AQYO 1F23A 2ZNIA 4TOIA 2EBOA 2B1IA 2WA3A 1SRYA 3CXCU 5CA3A 3CCMV 1PPJH 2EIMB 1Z5WA 4F6EA 1XL4A 1KC8W 2Q5ZA 1VIBA 2A06H 2K9PA 2IJKA 3ZN1A 2D2CB 5CB4A 2PI5A 4J9YB 1VQ4V 3ASNB 5IJ9B 2QWQB 2VQEB 2Z5UA 2YIAA 4BIOA 5EZYB 1N0JA 1K92A 2IH1C 4DK0A 4FLVA 3T1YB 1R6NA 2YXHA 1SQVH 4JYBA 1N8RW 1VQ9V 4DR3B 1Q43A 2ZM6O 4PA4A 4K0KB 5CN0A 1Y67A 3WG7B 2YI9A 2K1EA 1YI2V 5LHIA 4LF8B 2FKXA 2E75B 5KHJA 3AG2C 3PN1A 3OEEG 2IJHA 3K79A 4QPKA 1VF7A 2Q0OC 4LR3A 2OTJV 1L8DA 2GV9A 1XQ8A 1KYOF 2HHHO 3AG4B 3HKEB 2C2AA 1DK1A 4O4IB 1ZSPA 3Q4HA 1AP5A 1VQLV 2JGDB 5KHIA 3DXRA 4B7KA 2N04A 2VQFO 1VMGA 3JASB 5LMUO 1HW7A 4KHPO 5B1BB 2WLLA 2XASA 4CH4A 4JI0B 1TA8A 2QWRB 3QF7A 4I9WA 3SYOA 1YCIA 2V1DA 5KAFZ 3I55V 1B04A 1I0HA 2G38A 4NTWA 2UU9O 4FM2A 5LMNO 1Z2GA 1SQQH 1QQCA 3KCXA 3CRQA 3EXAA 4FMTA 2QEXV 2UXCO 2DN9A 3ZHQA 1SZTA 1JQ0A 2BSKA 1YXBA 2P90A 4JASA 2JK5C 1B6QA 4LF7O 3K06A 2CGOA 4GT1A 2QWPB 1LR1A 5JCOC 2R70A 1K7DA 4DR5B 5J2TA 5LA6B 4AI8A 4WFEA 1H2LA 2HFEC 1KECA 4X1IB 4NYKA 5HFLA 3OW2U 3CRMA 4I9QA 2JS5A 4JI1B 4TV9B 1IBLB 2D3OW 4UCTA 4X1YB 4X65O 2JS3A 2VWKA 3T1HB 3OGCC 5CA0B 3CCLV 1M9NA 3RYHA 4WCEV 1IBMO 4DR6O 3CE2A 1K4DC 3W7TA 2Z3YA 4MS2A 3HKDB 4PDRA 3RGBA 1SZXA 1KKDA 2OCCB 2GUZB 4ICGA 2Z0AA 1D5NA 4UVBA 4ZHQB 5E79Z 1HNWO 4J80A 4U3JB 2GHYA 5LP6A 2F4VB 2ZKOA 3RVZA 4AILC 3TETA 1DGSA 4K3AA 2UUCO 4CC6A 2L6LA 1IURA 3E8BA 4B3TO 2EX3A 3FKSG 3ZMUA 4NXNO 2UXNA 3JSLA 5GONB 2AZ2A 2XAGA 3NR7A 2RNBA 2RMKB 2YUAA 4DR1O 1M90W 3QO8A 1JJ2U 1GN4A 1SS3A 1VQ6V 1MG1A 2CTPA 1K5QA 2BCCH 2BTQA 2F66C 1KP2A 2ZCEA 4B3MO 1Q86W 3QTCA 5H9CA 1BQ0A 3HPLC 1PV0A 4JV5O 1Q82W 3EHBB 1W59A 1V54B 4LFBO 1QLEB 4TQFA 3VQYA 3K5NA 4DUZB 4B3RB 3CWBH 1YZBA 4NB5A 5KAIZ 1OCCC 5GTIZ 2AHYA 3RFRA 2AHZA 2XHBA 5IJ0A 4BWAA 4MTGA 5EIBC 1VQNV 4D7SA 2R9IA 1SESA 4CBCA 2YSUB 4QE9A 1OHHG 3SYQA 5LOVA 1TUEB 2ZE5A 3BCCH 2W6IG 1FXKB 1VQKV 2ZDIC 4J11A 1XILA 2LFSA 1N33O 1XMQO 2YIBD 4JI8B 1JJOA 5DM6V 3SDLA 4RO2A 4QNHB 3RYIA 3ABMB 3ZS8C 1S5HC 2QGNA 3MHSC 4DV4O 1JFFB 3CCEV 3U0ZA 3AEIA 3ML0A 1CPYA 1UFIA 3LSQA 2EJRA 1GN3A 2R72A 2DYSB 2Q0AA 4YIOA 2EZPA 3K58A 4B3SB 1NI8A 3BRCA 1GH6A 1NU1H 5H2FZ 2HVKC 4UV8A 4MTFA 5EYPB 2WSSG 2AZ0A 4GX0A 3F5TA 4DV2O 3SPCA 4TUYB 3GVMA 4GKKO 4LFCB 4CS4A 3RBZA 1JCHA 3L73H 4OGQB 5JJEB 1FYJA 2ADPA 1H8HG 2UXXA 3B4SA 1P4RA 3UKMA 4WFGA 1KMIZ 1GN2A 2JEUA 4DV5B 4GX1A 5FNVB 2EINC 1T5EA 3AK2A 4IYIA 1N34O 1N32B 3K5MA 2YEVB 2OIGA 3ETEA 2CGNA 1U97A 4YY3B 5FLXN 4LWSB 3TXSA 5JH7A 1BZKA 3ABLC 3H1IH 4GKJB 4X64O 3M99B 2DQ3A 4WBNB 4OX9O 2QSAA 2CE4A 5KHHA 3LDDA 1OCZB 1P7BA 2DJVA 2OIEA 1H8EG 4Z2WA 5B3SC 3AG3B 2LGQA 1Y74B 1EZVH 4JGSA 1WB7A 3JD1A 2VQEO 1GAXA 1M4UA 5F2VO 3JARA 3ETDA 5GW7A 3EVKA 3TCUA 2A79B 5ITZB 1IXMA 1SQXH 4IHJA 1WJZA 4JI3B 3OMNB 4K8XA 2ETNA 4JAVA 4DR3O 3ZHUA 2ATKC 2JEXA 4K0KO 4BIZA 4YJ2B 1WP8A 3X2QC 2Y69C 4TQDA 4XBFA 3L75H 5CA1A 1VF6C 4FM1A 1TUBA 4DW1A 4O4JB 2XUMA 3UQ8A 1J95A 2LW1A 3RYCB 2JVDA 4J41A 1M57B 3MDSA 2F43G 3P3PA 4JYYA 3A0RA 1BHBA 4IYHA 2FB5A 4DV1O 3JATA 3OMIB 3W7UA 2RQ6A 2QKCA 3BFRA 3OR6C 1NH2B 3EFFK 3ZX6A 2YS8A 5IY5B 3CJHB 3JAMN 1WNSA 4LCUC 4IIJB 4X20A 3LNNA 2DYRB 1R3JC 4W4LA 1E79G 1S3JA 3CS5A 4YHHB 2QDOA 5AG2A 4J10A 4N21A 4OPAA 2PYLA 1G1XB 3ZBHA 4JI0O 1ZX3A 1NR7A 2HKOA 4NXMO 2P4VA 2Y0IA 4X88A 1L1FA 4LFAB 2NN4A 5J2UA 2Q73A 5B1NA 1ENVA 2KG7B 4MT8A 1PL0A 3CMEV 2PI4A 4MSWC 4MW3A 3FB6C 4DV7B 4RQEA 4DV0B 3IFXA 5B5EZ 3HKBB 4JZ2A 4B08A 1GM8A 3AG7A 2IJJA 4YJ3B 1MSDA 1FFTB 1UJWB 1OJHA 5LGUA 2QTSA 3CCUV 4U7OA 3BHPA 4DO2A 3CSXA 2OT5A 3CPWU 4I55A 3N2KB 3K59A 5JCOA 5LHGA 1VQ7V 3CC4V 5C8YB 3RYFB 1ZL8B 2UXBB 3FFQA 3JD0A 1VEWA 4XDJA 4JI1O 2YDEA 4QGPA 3D3IA 4P2ZA 2Q4PA 1VQPV 4PELA 2WA4A 4JTCB 1FS0G 4DYLA 2A0LA 1G6UA 3T1HO 2LW7A 3S3XA 1S77D 1DLBA 4RAIA 4MVZA 3WB1A 1LUVA 1XMOO 4MVMA 4DR7O 1M56B 5CB4B 1O9HA 4ZKIA 1GM7A 2LP7A 2V4DA 5D5PA 2HJDA 1YITV 5K1PA 2WLIA 3OM3B 4DV6B 1AR5A 1HR0O 3CXHF 4JI5O 1VP7A 4DR2B 3N27A 3W7WA 1K5SA 2DOSA 3UM7A 3M7MX 5FPRA 1PNMA 4EKWA 3LUTB 3ZMTA 2E74B 4F4LA 1OCOB 4HAMA 3ZIAG 4J42A 1Y4MA 4LNUA 4WFAV 1V55B 3VOUA 4LF5O 4JI7O 5IWAB 1G4YB 3UO2A 3WB0A 3O65A 1JR9A 5EBLC 4J7KA 2YIDA 1HNXB 4YIPA 2JDIG 3UO3A 4C7UA 5IYDO 1BS3A 3R66A 2KQXA 2AGAA 2DE0X 4TSFG 2QR4A 5JQGA 3MHHC 5B66Z 1FAFA 1MABG 5L3FA 4UXNA 3HKCB 3P32A 2JJ1G 4FLUA 3A2FA 3SJCC 1U96A 1URFA 3K0DA 2X7RB 1SC5B 2Y4TA 2Q7GA 3BA9A 4I4TA 1FJGB 3OTOO 4ABMA 2YI8A 3E8HA 1WPXA 1AP6A 4BW9A 4H33A 4MVUA 5IJ9A 1R6KA 2IU3A 3J7AU 2BSKB 1Y66A 4H44B 2ZDIA 1TAEA 2JIZG 2CUGA 3AK1A 2XAFA 2Y0PA 1YEWA 2UUAB 5J9PC 2EIKB 1DF4A 5J2TB 3GWOA 1ZLZA 5KMGA 1R3KC 1I5YA 4GX2A 5IYCO 5IYBO 5KUMA 4DV3B 1G8MA 3ASOC 5H5NA 3ZHRA 4MTXA 1QCEA 2ODMA 5IDJA 3E35A 4JAAA 1M1KW 3AG1B 2RJZA 1H2SB 1VQOV 1Q6IA 3IAYA 4JI6B 3HB3B 1QNMA 4LBEC 3C3SA 3HKEA 2QM4A 2ARHA 4QJFB 3JCZA 1AI6A 3RVYA 2IU0A 1OCRB 3H1KH 4DV5O 3WU2Z 2FTKA 1RM1C 2PTMA 1XL6A 4GUNA 5LP6B 1SERA 4KFMA 1XREA 4LF4O 1N32O 4ZOLB 3CX5F 1SA0A 4YY3O 3ABKB 2DW4A 2Q8VA 1XNQB 4PA3A 4JI4B 1K97A 4LF6O 1IX9A 3RW0A 4JYAB 4JTAB 4D7TA 3A0HZ 5B1AB 2LO1A 4LH6A 3L72H 4R6ZA 3ABUA 2DWDC 2YIBA 1H2MA 1S72V 2WLMA 4X62B 2CDYA 4RUFA 4DUYO 2R9AA 2A9HA 5IT9N 1CP9A 3E8GA 2A7WA 4R8CA 1Q81W 3K3WA 3QG5A 4PI0A 4NR1A 2CH7A 4I0XA 3SYAA 3HR0A 4HZ3A 4JI3O 3E22A 5BMVA 2GDSA 3SJBC 5LBQA 4PA7A 5IYZA 1E1QG 3B8NA 5L3BA 1BMFG 3E89A 3VQWA 4ASUG 5IJ0B 3STLC 1N0NA 3TJTA 1W2BU 1L0LH 1VQ5V 2A3QA 2RN9A 2IM9A 2E5LB 4N23A 5LOVB 5FPOA 3B77A 2ZXWB 1NS1A 1EFRG 3SGIA 1MOFA 2V7QG 3ZJZA 5LYJB 3CC2V 3P3NA 2P67A 1VF6A 1VQMV 2EIJB 3K57A 2GUZA 2CK3G 3E86A 3RYIB 4ZHQA 3M8AA 4LH7A 3K5LA 4U3JA 3D3QA 1WA8A 3JAKA 2X0LA 5DECA 1AI5A 5L3DA 2KSDA 2EIMC 1EZJA 3ZEDA 2E76B 2PF4E 2Q69A 5GONA 4EFEA 1N36O 2EILB 2BE3A 1RPRA 3ASNC 1KKCA 2DQ0A 2WLJA 3WB2A 4TV8A 3QVNA 1GRJA 3ZHSA 1J5EO 2HHHB 4UFZA 1Q90D 4U7NA 2Y4UA 3FB8C 3WG7C 1YHQV 3JYCA 4DV0O 1R3LC 4EEQA 2M6YA 2B9ZA 3BPZA 4DW0A 5IE9A 2VQFB 5JJJB 1PM9A 4HNAB 2DWEC 3CCVV 4FVMA 4NTXA 3CC7V 3ZMSA 5LMUB 1SF9A 2H3OA 1I94O 2FL4A 4RUEA 3CEIA 1FFXA 3LSSA 3AG4C 3R65A 5BXZA 4IL6Z 1XHZA 4BR6A 2UXBO 5KA5A 2AW9A 2Q7EA 4F6RB 4JI2B 1TGOA 3OUFA 2YC0A 4OPHA 2UU9B 3ZRVA 3D8CA 5LMNB 2WLNA 4GX5A 1IXBA 1PP9H 2ZQMA 4WFFA 4L87A 1XBLA 3UCSC 3CCRV 1THZA 1XHXA 2UXCB 5B1BC 4GZRB 4LF7B 1Y76B 3L74H 4OXSA 5CBGA 1BE3H 3CD6V 4FJCC 3BEHA 4RQFA 4X1KB 3SPHA 1F4MA 3LDEA 5E1AC 1SETA 3JSNA 3JARB 1F51A 2OWOA 4Z1VA 1AR1B 1Q5OA 2P5OA 3O9OA 4I50B 5EYPA 2OCHA 4DK1A 1KP3A 1HWYA 3G6EV 5BY1A 4X65B 3B40A 4DR2O 3GB7C 4PDVA 1CXZB 2F95B 4O4HA 3OE7G 3L71H 1H2KA 3SJQC 5CBFA 1IBMB 4CH6A 5CA1B 4DR6B 4KXRA 1MZEA 1TUBB 4XDLA 2PY5A 1ZAUA 5JVDB 4MVOA 4A5UB 3AG2B 3T1YO 3AK3A 3JATB 1HNXO 1MA1A 1BGYH 1US6A 4DRXA 4O4LA 4X89A 1EM1A 2F93B 3DC5A 1E1RG 3C3TA 2UUCB 1NVPB 4JAUA 1YSCA 4JZGA 4B3TB 1XUQA 4DXWA 1KD1W 1SQPH 3OTFA 4X20B 2ZR3A 4LF8O 4PJ0Z 3APOA 4WFBV 3D36C 1YTFB 1GO3F 2OCCC 4O2BA 4FLZA 3E8FA 4WBNA 4H0LB 4FPPA 1MZFA 1M93A 3TGUH 2ZIMA 5J2UB 4R7CA 4BIUA 3IGAC 4H13B 1FJGO 5EC1C 1F7YA 2CAZC 3OT7A 1IVSA 4PDLA 4JV5B 2BOCC 2UXDB 4UVAA 4CC5A 2OTLV 4MVRA 4LFBB 3CP1A 1P49A 1WP7A 3A0BZ 1IBKB 2M7WA 1GK9A 1F4NA 2RCVA 5LHHA 3CHXA 4YJ2A 1YDXA 4FFBA 2WAMA 3JAWA 4ZBMA 3FYIB 4TWKA 2RDCA 3K03A 1V54C 5CBHA 3JALA 1QLEC 4O2AB 5LXTA 1JMKC 5KX5B 1N33B 1KU9A 4JI6O 1HNZB 4EB6B 2PZSA 2Q6AA 1H38A 4DV4B 1TVKA 4DR5O 4CH5A 3SR2C 1R73A 2ZR2A 3K5OA 4CZZA 3CJHA 1FKAO 3RT3C 3DSQA 3UT5A 2CTRA 4J9ZB 4JPRA 2H94A 4MVQA 1FXKC 1IBLO 1BL8A 2ZE8A 3OMAB 1KUQA 4FLYA 1K9MW 3P30A 4X9QA 5EBWC 1HDJA 4FZ0A 4KL1A 3ZRWA 3ABMC 4AHCA 3T1CA 1MSWD 4UV9A 1XNQO 4DV2B 4DR4B 4RWUA 4FM0A 3B8MA 3ZRSA 4GKKB 3TXQA 1JPXA 1OZ0A 3APQA 1K8AW 1RSOA 2GTAA 3OR7C 2DYSC 4LNUB 1AR4A 4K35A 3SPGA 5H6RA 2GSMB 2UUBB 5KLVH 4ZIBA 4X62O 1PNLA 2QM7A 2XNDG 3ZRXA 2F4VO 3RN4A 3A8TA 3NXSA 1SQGA 2LJ2A 3FAVA 2GTSA 2X6BA 4ZI7A 3N2GA 2PYJA 1NVPD 2PUSA 3KCYA 1VARA 1QVFU 4X64B 1AILA 3STZC 1YTFD 2Y48A 2VRZA 4OX9B 1OCCB 3K9SA 4P9PA 3I5DA 1O9GA 3IJ4A 1QVGU 2E5LO 1JA8A 1I5XA 4I4TB 5KA6A 2YICA 3WFVA 3Q4HB 1X4TA 1Y6XA 1A32A 1AB3A 1NH2D 3DXRB 1NTZH 2O57A 4QIWF 2W6JG 3DC6A 4DUZO 4B3RO 2ADQB 3H1LH 1NR1A 3PJSK 3K08A 2WLLB 2HJFC 4UVCA 3DTUB 3FX7A 2ZIOA 3T4DA 2B5UA 1OCZC 3G6BA 5KMGB 3QO7A 4NKGB 3AG3C 2R9RB 4K8ZA 4EFBA 1SQBH 1Q6UA 1K33A 2EZOA 5KHKA 4R50A 3J80N 3JCUZ 2DMXA 1ZTEA 4JI8O 4P9OA 5EZYA 5C93A 2VWJA 5LGNA 1QU7A 3MAQA 4DV1B 2HP8A 1YJ9V 5KUKA 2B1GA 2QWNB 5BZBA 1XNRB 5BR8B 2HLDG 3L70H 4TT3G 4B3SO 1DTOA 5EBMC 3CCQV 1M57C 3HKCA 1JOYA 3G4SV 4I5SA 3G80A 4NXMB 4CS3A 4LF9B 1COWG 1PKXA 1SA0B 2EINB 5A9GA 3G71V 3FYEB 3RYHB 1EN6A 1KQSU 4JI2O 4LFCO 1R3IC 3ZMZA 5IY5C 2X6AA 1QLNA 2Q68A 4O4IA 3ABLB 2HR3A 4PA9A 3CB2A 2DYRC 2JGDA 3F5WC 4X66B 3RWRD 1QHTA 4PD4F 1NJIW 3JASA 1QBZA 3BA8A 3OFNG 2N74A 5B1OA 4UUJC 1RFYA 3OUSA 2WPDG 5B3SB 4Z1MG 3K04A 1NQTA 2P4KA 2CH7B 2AXTZ 1YJWV 3IC7A 5CMUA 1EN5A 4I0XB 4U3FH 4GKJO 1GM9A 1WB8A 1AVMA 3E22B 5BMVB 2E3CA 1NZ6A 5IYZB 2LFRA 1SQFA 1DF5A 2X6CA 2MW2B 2IH3C 4UCSA 2BTQB 2ITDC 2N05A 2NR5A 1XMOB 1BCCH 3OEHG 1GTOA 1BHAA 3X2QB 4GYCB 2Y69B 4DR7B 5EIBD 2QJ1A 1CEZA 4HYOA 4CS2A 5LA6A 3SPIA 3H1JH 4X1IA 1LNQA 3JD3A 2CTQA 4KUMA 3F7VC 4CH3A 4H37A 4AQYB 1FD9A 1MMMA 1WA8B 4TV9A 3JAKB 3C90A 3FB7C 4X1YA 1HR0B 4JI5B 2LGWA 3JD4A 4ZOLA 2ITCC 1L0NH 5CA0A 2GBOA 4FLXA 1M56C 5L3CA 1XEQA 2Q67A 1W0JG 4UCRA 3MD0A 4IT5A 4JI7B
chains in the Genus database with same CATH topology
3L70H 3H1LH 3CX5F 1SQXH 3CXHF 2BCCH 1BGYH 3CWBH 1BCCH 1PPJH 3BCCH 1SQVH 3L71H 1SQQH 1P84F 1NU1H 3TGUH 1L0NH 3L73H 1L0LH 1KB9F 4U3FH 1PP9H 2A06H 3H1KH 1EZVH 2IBZH 3H1HH 5KLVH 1NTKH 3L72H 1KYOF 3H1IH 3H1JH 1SQPH 1NTMH 4PD4F 1NTZH 1SQBH 3L75H 4D6TH 3L74H 2FYUH 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  3H1L H;  3CX5 F;  1SQX H;  3CXH F;  2BCC H;  1BGY H;  3CWB H;  1BCC H;  1PPJ H;  3BCC H;  1SQV H;  3L71 H;  1SQQ H;  1P84 F;  1NU1 H;  3TGU H;  1L0N H;  3L73 H;  1L0L H;  1KB9 F;  4U3F H;  1PP9 H;  2A06 H;  3H1K H;  1EZV H;  2IBZ H;  3H1H H;  5KLV H;  1NTK H;  3L72 H;  1KYO F;  3H1I H;  3H1J H;  1SQP H;  1NTM H;  4PD4 F;  1NTZ H;  1SQB H;  3L75 H;  4D6T H;  3L74 H;  2FYU H;  1BE3 H; 
#chains in the Genus database with same CATH topology
 3HKD A;  5EC2 C;  2IJI A;  3D36 A;  2NNU A;  2L35 A;  4TV8 B;  4GLX A;  1QR8 A;  2XOK G;  4MVS A;  5FL7 G;  1EBO A;  4XDK A;  2QE7 G;  3H1H H;  5JJN B;  1WAZ A;  4QE7 A;  1P7G A;  3W7S A;  2OYQ A;  1B06 A;  2ZM6 B;  4JTD B;  3GWK C;  2UXD O;  2XAQ A;  3FB5 C;  1K4C C;  5LL6 Y;  1D2D A;  1OCO C;  1AI4 A;  4YHH O;  4FZ1 A;  1V55 C;  4FLW A;  5K1X A;  1IBK O;  4MTO A;  3CCS V;  1ZUQ A;  1H2G A;  1FFX B;  1LUW A;  1PNK A;  3ZCC A;  1K3E A;  1PL4 A;  4LFA O;  3U10 A;  3E2E A;  2QM8 A;  1WN7 A;  1Q8I A;  3F7Y C;  3VQX A;  3OTO B;  4DV7 O;  1BQZ A;  1I08 A;  1GN6 A;  1IDS A;  3THO A;  5LGT A;  2ZE6 A;  4Q6G A;  5LYJ A;  2YXL A;  2XT9 A;  3ZN0 A;  1YVW A;  2F23 A;  2H8P C;  2HVJ C;  1HNZ O;  1NT2 B;  5JWP A;  4BAY A;  4KHP B;  2P06 A;  4WF9 V;  3ICX A;  3CCJ V;  2FYU H;  2EJ7 A;  5JH7 B;  1QR9 A;  1OV9 A;  3H9V A;  1WLE A;  5A2Q N;  4MW8 A;  4J7Z A;  4UB8 Z;  3ZMV A;  1FXK A;  3VBB A;  5KHG A;  4O4H B;  3CRR A;  1Q7Y W;  3E83 A;  4DR4 O;  4L8J A;  2EIK C;  3W7X A;  4P30 A;  1S5L Z;  3ZHV A;  4PDM A;  1JX9 A;  3G67 A;  4IGG A;  2P7T C;  1JFF A;  2XTA A;  3SPJ A;  1ARO P;  2UUB O;  4PV1 B;  2Q7H A;  3OD4 A;  3BAB A;  3ZHT A;  4HNA A;  4IHJ B;  4NTY A;  4PI2 A;  4DV6 O;  2PGG A;  3AG1 C;  4DRX B;  4O4L B;  4FFK A;  3SYC A;  3T2M A;  4LF4 B;  2F1M A;  3ABT A;  1X59 A;  2BOB C;  3LSU A;  2IW5 A;  4TUY A;  3U11 A;  1K34 A;  3BY6 A;  4LF6 B;  1D5A A;  4FIP C;  4F6R A;  1BSM A;  2IBZ H;  1R1B A;  2QWO B;  5HFM A;  4JYC A;  1OCR C;  4O2B B;  3CRA A;  5IWA O;  3QNE A;  1YIJ V;  4LF5 B;  5LP6 C;  5H6Q A;  5FNV A;  4DUY B;  1HNW B;  1Y76 A;  4JF3 A;  4E4E A;  1FPO A;  4LC1 A;  3ABK C;  3K0G A;  3ETG A;  2YEV A;  1YJN V;  4X8A A;  1EN4 A;  4X1K A;  3BAA A;  1KBH A;  2LQT A;  1IZ3 A;  1NTM H;  1Q3E A;  2W0F C;  4NXN B;  4LWS A;  3S3W A;  5B1A C;  4QPJ A;  1GMG A;  1I7F A;  2HEP A;  2Q9L A;  4Q20 A;  4DR1 B;  4I50 A;  4PA6 A;  4W4K A;  4UCU A;  3L9D A;  1YF2 A;  1AJQ A;  1KB9 F;  4FFB B;  5D5Q A;  2JGU A;  1PD3 A;  2XAH A;  3JAW B;  4B3M B;  2JRI A;  5DED A;  3KG2 A;  2QKS A;  5DN6 G;  1Y74 A;  3JAL B;  5LXT B;  5GTH Z;  4WFH A;  3ASO B;  2P22 C;  1R6T A;  5JVD A;  3SYP A;  1ZWI C;  2QA4 V;  4G27 B;  1N4C A;  2ZT9 B;  1XOU A;  3VQV A;  5ITZ A;  3TK1 A;  1VF5 B;  4NVP A;  4GCZ A;  3FD9 A;  1WPB A;  3CMA V;  4I55 B;  2UUA O;  1TVK B;  1XNR O;  4G2K A;  3LDC A;  2ILM A;  4UB6 Z;  1GKF A;  5BR8 O;  4B7E A;  3UT5 B;  1AJP A;  1Z5V A;  1MNG A;  4HBN A;  3H01 A;  2ZXW C;  1S0V A;  2NLJ C;  1FXV A;  1N36 B;  4DV3 O;  4FK5 C;  1RP3 B;  1K73 W;  1RM1 B;  3KZI Z;  1ROP A;  2EIJ C;  4O4J A;  5L3E A;  2CTW A;  3ZRW B;  3RYC A;  4LF9 O;  1Q6H A;  1XMQ B;  3J81 N;  3OGI B;  4E2L A;  2WLK A;  4PHZ A;  3B2E E;  4FLT A;  2MK3 A;  1SKV A;  2KKW A;  1J5E B;  3I56 V;  4D6T H;  1RSO B;  4YXW G;  1RPO A;  3JD2 A;  1AI7 A;  1ORQ C;  2W0X A;  5TIS Z;  4X66 O;  3IC9 A;  2EIL C;  3CRC A;  4IIJ A;  3BVO A;  2JJ2 G;  1V9P A;  2WLI B;  2ZIN A;  2YXY A;  2ZNJ A;  2WLH A;  1I94 B;  4UCO A;  3FAV B;  3KKY A;  1S76 D;  2WWW A;  2ZD9 A;  4ZI7 B;  1JVM A;  3N2G B;  4LP8 A;  1XI1 A;  4JI4 O;  3SJA C;  4JYA O;  2XAJ A;  5L3G A;  2VS0 A;  2KG7 A;  3DGE A;  1P84 F;  1BT8 A;  4I7Z B;  1HP8 A;  2EUL A;  4G28 B;  1NBM G;  1UPG A;  1NTK H;  4BW5 A;  4O2A A;  2KB1 A;  3HKB A;  1XDC A;  4UCV A;  2QTO A;  5KX5 A;  3QO5 A;  1B3Q A;  4KP4 A;  4YJ3 A;  2HG5 C;  1FXH A;  3K9A A;  2P6J A;  4EB6 A;  1N34 B;  2FML A;  4J7J A;  3N2K A;  3LNM B;  3CYO A;  1AJN A;  1VQ8 V;  3B09 A;  3OAA G;  1W0K G;  2BTO A;  5C8Y A;  3ETQ A;  1S5J A;  3RYF A;  1ZL8 A;  5JQG B;  1NKD A;  3T4Z A;  2ZE7 A;  5EK0 A;  1M5I A;  2QKA A;  1H2N A;  4AQY O;  1F23 A;  2ZNI A;  4TOI A;  2EBO A;  2B1I A;  2WA3 A;  1SRY A;  3CXC U;  5CA3 A;  3CCM V;  1PPJ H;  2EIM B;  1Z5W A;  4F6E A;  1XL4 A;  1KC8 W;  2Q5Z A;  1VIB A;  2A06 H;  2K9P A;  2IJK A;  3ZN1 A;  2D2C B;  5CB4 A;  2PI5 A;  4J9Y B;  1VQ4 V;  3ASN B;  5IJ9 B;  2QWQ B;  2VQE B;  2Z5U A;  2YIA A;  4BIO A;  5EZY B;  1N0J A;  1K92 A;  2IH1 C;  4DK0 A;  4FLV A;  3T1Y B;  1R6N A;  2YXH A;  1SQV H;  4JYB A;  1N8R W;  1VQ9 V;  4DR3 B;  1Q43 A;  2ZM6 O;  4PA4 A;  4K0K B;  5CN0 A;  1Y67 A;  3WG7 B;  2YI9 A;  2K1E A;  1YI2 V;  5LHI A;  4LF8 B;  2FKX A;  2E75 B;  5KHJ A;  3AG2 C;  3PN1 A;  3OEE G;  2IJH A;  3K79 A;  4QPK A;  1VF7 A;  2Q0O C;  4LR3 A;  2OTJ V;  1L8D A;  2GV9 A;  1XQ8 A;  1KYO F;  2HHH O;  3AG4 B;  3HKE B;  2C2A A;  1DK1 A;  4O4I B;  1ZSP A;  3Q4H A;  1AP5 A;  1VQL V;  2JGD B;  5KHI A;  3DXR A;  4B7K A;  2N04 A;  2VQF O;  1VMG A;  3JAS B;  5LMU O;  1HW7 A;  4KHP O;  5B1B B;  2WLL A;  2XAS A;  4CH4 A;  4JI0 B;  1TA8 A;  2QWR B;  3QF7 A;  4I9W A;  3SYO A;  1YCI A;  2V1D A;  5KAF Z;  3I55 V;  1B04 A;  1I0H A;  2G38 A;  4NTW A;  2UU9 O;  4FM2 A;  5LMN O;  1Z2G A;  1SQQ H;  1QQC A;  3KCX A;  3CRQ A;  3EXA A;  4FMT A;  2QEX V;  2UXC O;  2DN9 A;  3ZHQ A;  1SZT A;  1JQ0 A;  2BSK A;  1YXB A;  2P90 A;  4JAS A;  2JK5 C;  1B6Q A;  4LF7 O;  3K06 A;  2CGO A;  4GT1 A;  2QWP B;  1LR1 A;  5JCO C;  2R70 A;  1K7D A;  4DR5 B;  5J2T A;  5LA6 B;  4AI8 A;  4WFE A;  1H2L A;  2HFE C;  1KEC A;  4X1I B;  4NYK A;  5HFL A;  3OW2 U;  3CRM A;  4I9Q A;  2JS5 A;  4JI1 B;  4TV9 B;  1IBL B;  2D3O W;  4UCT A;  4X1Y B;  4X65 O;  2JS3 A;  2VWK A;  3T1H B;  3OGC C;  5CA0 B;  3CCL V;  1M9N A;  3RYH A;  4WCE V;  1IBM O;  4DR6 O;  3CE2 A;  1K4D C;  3W7T A;  2Z3Y A;  4MS2 A;  3HKD B;  4PDR A;  3RGB A;  1SZX A;  1KKD A;  2OCC B;  2GUZ B;  4ICG A;  2Z0A A;  1D5N A;  4UVB A;  4ZHQ B;  5E79 Z;  1HNW O;  4J80 A;  4U3J B;  2GHY A;  5LP6 A;  2F4V B;  2ZKO A;  3RVZ A;  4AIL C;  3TET A;  1DGS A;  4K3A A;  2UUC O;  4CC6 A;  2L6L A;  1IUR A;  3E8B A;  4B3T O;  2EX3 A;  3FKS G;  3ZMU A;  4NXN O;  2UXN A;  3JSL A;  5GON B;  2AZ2 A;  2XAG A;  3NR7 A;  2RNB A;  2RMK B;  2YUA A;  4DR1 O;  1M90 W;  3QO8 A;  1JJ2 U;  1GN4 A;  1SS3 A;  1VQ6 V;  1MG1 A;  2CTP A;  1K5Q A;  2BCC H;  2BTQ A;  2F66 C;  1KP2 A;  2ZCE A;  4B3M O;  1Q86 W;  3QTC A;  5H9C A;  1BQ0 A;  3HPL C;  1PV0 A;  4JV5 O;  1Q82 W;  3EHB B;  1W59 A;  1V54 B;  4LFB O;  1QLE B;  4TQF A;  3VQY A;  3K5N A;  4DUZ B;  4B3R B;  3CWB H;  1YZB A;  4NB5 A;  5KAI Z;  1OCC C;  5GTI Z;  2AHY A;  3RFR A;  2AHZ A;  2XHB A;  5IJ0 A;  4BWA A;  4MTG A;  5EIB C;  1VQN V;  4D7S A;  2R9I A;  1SES A;  4CBC A;  2YSU B;  4QE9 A;  1OHH G;  3SYQ A;  5LOV A;  1TUE B;  2ZE5 A;  3BCC H;  2W6I G;  1FXK B;  1VQK V;  2ZDI C;  4J11 A;  1XIL A;  2LFS A;  1N33 O;  1XMQ O;  2YIB D;  4JI8 B;  1JJO A;  5DM6 V;  3SDL A;  4RO2 A;  4QNH B;  3RYI A;  3ABM B;  3ZS8 C;  1S5H C;  2QGN A;  3MHS C;  4DV4 O;  1JFF B;  3CCE V;  3U0Z A;  3AEI A;  3ML0 A;  1CPY A;  1UFI A;  3LSQ A;  2EJR A;  1GN3 A;  2R72 A;  2DYS B;  2Q0A A;  4YIO A;  2EZP A;  3K58 A;  4B3S B;  1NI8 A;  3BRC A;  1GH6 A;  1NU1 H;  5H2F Z;  2HVK C;  4UV8 A;  4MTF A;  5EYP B;  2WSS G;  2AZ0 A;  4GX0 A;  3F5T A;  4DV2 O;  3SPC A;  4TUY B;  3GVM A;  4GKK O;  4LFC B;  4CS4 A;  3RBZ A;  1JCH A;  3L73 H;  4OGQ B;  5JJE B;  1FYJ A;  2ADP A;  1H8H G;  2UXX A;  3B4S A;  1P4R A;  3UKM A;  4WFG A;  1KMI Z;  1GN2 A;  2JEU A;  4DV5 B;  4GX1 A;  5FNV B;  2EIN C;  1T5E A;  3AK2 A;  4IYI A;  1N34 O;  1N32 B;  3K5M A;  2YEV B;  2OIG A;  3ETE A;  2CGN A;  1U97 A;  4YY3 B;  5FLX N;  4LWS B;  3TXS A;  5JH7 A;  1BZK A;  3ABL C;  3H1I H;  4GKJ B;  4X64 O;  3M99 B;  2DQ3 A;  4WBN B;  4OX9 O;  2QSA A;  2CE4 A;  5KHH A;  3LDD A;  1OCZ B;  1P7B A;  2DJV A;  2OIE A;  1H8E G;  4Z2W A;  5B3S C;  3AG3 B;  2LGQ A;  1Y74 B;  1EZV H;  4JGS A;  1WB7 A;  3JD1 A;  2VQE O;  1GAX A;  1M4U A;  5F2V O;  3JAR A;  3ETD A;  5GW7 A;  3EVK A;  3TCU A;  2A79 B;  5ITZ B;  1IXM A;  1SQX H;  4IHJ A;  1WJZ A;  4JI3 B;  3OMN B;  4K8X A;  2ETN A;  4JAV A;  4DR3 O;  3ZHU A;  2ATK C;  2JEX A;  4K0K O;  4BIZ A;  4YJ2 B;  1WP8 A;  3X2Q C;  2Y69 C;  4TQD A;  4XBF A;  3L75 H;  5CA1 A;  1VF6 C;  4FM1 A;  1TUB A;  4DW1 A;  4O4J B;  2XUM A;  3UQ8 A;  1J95 A;  2LW1 A;  3RYC B;  2JVD A;  4J41 A;  1M57 B;  3MDS A;  2F43 G;  3P3P A;  4JYY A;  3A0R A;  1BHB A;  4IYH A;  2FB5 A;  4DV1 O;  3JAT A;  3OMI B;  3W7U A;  2RQ6 A;  2QKC A;  3BFR A;  3OR6 C;  1NH2 B;  3EFF K;  3ZX6 A;  2YS8 A;  5IY5 B;  3CJH B;  3JAM N;  1WNS A;  4LCU C;  4IIJ B;  4X20 A;  3LNN A;  2DYR B;  1R3J C;  4W4L A;  1E79 G;  1S3J A;  3CS5 A;  4YHH B;  2QDO A;  5AG2 A;  4J10 A;  4N21 A;  4OPA A;  2PYL A;  1G1X B;  3ZBH A;  4JI0 O;  1ZX3 A;  1NR7 A;  2HKO A;  4NXM O;  2P4V A;  2Y0I A;  4X88 A;  1L1F A;  4LFA B;  2NN4 A;  5J2U A;  2Q73 A;  5B1N A;  1ENV A;  2KG7 B;  4MT8 A;  1PL0 A;  3CME V;  2PI4 A;  4MSW C;  4MW3 A;  3FB6 C;  4DV7 B;  4RQE A;  4DV0 B;  3IFX A;  5B5E Z;  3HKB B;  4JZ2 A;  4B08 A;  1GM8 A;  3AG7 A;  2IJJ A;  4YJ3 B;  1MSD A;  1FFT B;  1UJW B;  1OJH A;  5LGU A;  2QTS A;  3CCU V;  4U7O A;  3BHP A;  4DO2 A;  3CSX A;  2OT5 A;  3CPW U;  4I55 A;  3N2K B;  3K59 A;  5JCO A;  5LHG A;  1VQ7 V;  3CC4 V;  5C8Y B;  3RYF B;  1ZL8 B;  2UXB B;  3FFQ A;  3JD0 A;  1VEW A;  4XDJ A;  4JI1 O;  2YDE A;  4QGP A;  3D3I A;  4P2Z A;  2Q4P A;  1VQP V;  4PEL A;  2WA4 A;  4JTC B;  1FS0 G;  4DYL A;  2A0L A;  1G6U A;  3T1H O;  2LW7 A;  3S3X A;  1S77 D;  1DLB A;  4RAI A;  4MVZ A;  3WB1 A;  1LUV A;  1XMO O;  4MVM A;  4DR7 O;  1M56 B;  5CB4 B;  1O9H A;  4ZKI A;  1GM7 A;  2LP7 A;  2V4D A;  5D5P A;  2HJD A;  1YIT V;  5K1P A;  2WLI A;  3OM3 B;  4DV6 B;  1AR5 A;  1HR0 O;  3CXH F;  4JI5 O;  1VP7 A;  4DR2 B;  3N27 A;  3W7W A;  1K5S A;  2DOS A;  3UM7 A;  3M7M X;  5FPR A;  1PNM A;  4EKW A;  3LUT B;  3ZMT A;  2E74 B;  4F4L A;  1OCO B;  4HAM A;  3ZIA G;  4J42 A;  1Y4M A;  4LNU A;  4WFA V;  1V55 B;  3VOU A;  4LF5 O;  4JI7 O;  5IWA B;  1G4Y B;  3UO2 A;  3WB0 A;  3O65 A;  1JR9 A;  5EBL C;  4J7K A;  2YID A;  1HNX B;  4YIP A;  2JDI G;  3UO3 A;  4C7U A;  5IYD O;  1BS3 A;  3R66 A;  2KQX A;  2AGA A;  2DE0 X;  4TSF G;  2QR4 A;  5JQG A;  3MHH C;  5B66 Z;  1FAF A;  1MAB G;  5L3F A;  4UXN A;  3HKC B;  3P32 A;  2JJ1 G;  4FLU A;  3A2F A;  3SJC C;  1U96 A;  1URF A;  3K0D A;  2X7R B;  1SC5 B;  2Y4T A;  2Q7G A;  3BA9 A;  4I4T A;  1FJG B;  3OTO O;  4ABM A;  2YI8 A;  3E8H A;  1WPX A;  1AP6 A;  4BW9 A;  4H33 A;  4MVU A;  5IJ9 A;  1R6K A;  2IU3 A;  3J7A U;  2BSK B;  1Y66 A;  4H44 B;  2ZDI A;  1TAE A;  2JIZ G;  2CUG A;  3AK1 A;  2XAF A;  2Y0P A;  1YEW A;  2UUA B;  5J9P C;  2EIK B;  1DF4 A;  5J2T B;  3GWO A;  1ZLZ A;  5KMG A;  1R3K C;  1I5Y A;  4GX2 A;  5IYC O;  5IYB O;  5KUM A;  4DV3 B;  1G8M A;  3ASO C;  5H5N A;  3ZHR A;  4MTX A;  1QCE A;  2ODM A;  5IDJ A;  3E35 A;  4JAA A;  1M1K W;  3AG1 B;  2RJZ A;  1H2S B;  1VQO V;  1Q6I A;  3IAY A;  4JI6 B;  3HB3 B;  1QNM A;  4LBE C;  3C3S A;  3HKE A;  2QM4 A;  2ARH A;  4QJF B;  3JCZ A;  1AI6 A;  3RVY A;  2IU0 A;  1OCR B;  3H1K H;  4DV5 O;  3WU2 Z;  2FTK A;  1RM1 C;  2PTM A;  1XL6 A;  4GUN A;  5LP6 B;  1SER A;  4KFM A;  1XRE A;  4LF4 O;  1N32 O;  4ZOL B;  3CX5 F;  1SA0 A;  4YY3 O;  3ABK B;  2DW4 A;  2Q8V A;  1XNQ B;  4PA3 A;  4JI4 B;  1K97 A;  4LF6 O;  1IX9 A;  3RW0 A;  4JYA B;  4JTA B;  4D7T A;  3A0H Z;  5B1A B;  2LO1 A;  4LH6 A;  3L72 H;  4R6Z A;  3ABU A;  2DWD C;  2YIB A;  1H2M A;  1S72 V;  2WLM A;  4X62 B;  2CDY A;  4RUF A;  4DUY O;  2R9A A;  2A9H A;  5IT9 N;  1CP9 A;  3E8G A;  2A7W A;  4R8C A;  1Q81 W;  3K3W A;  3QG5 A;  4PI0 A;  4NR1 A;  2CH7 A;  4I0X A;  3SYA A;  3HR0 A;  4HZ3 A;  4JI3 O;  3E22 A;  5BMV A;  2GDS A;  3SJB C;  5LBQ A;  4PA7 A;  5IYZ A;  1E1Q G;  3B8N A;  5L3B A;  1BMF G;  3E89 A;  3VQW A;  4ASU G;  5IJ0 B;  3STL C;  1N0N A;  3TJT A;  1W2B U;  1L0L H;  1VQ5 V;  2A3Q A;  2RN9 A;  2IM9 A;  2E5L B;  4N23 A;  5LOV B;  5FPO A;  3B77 A;  2ZXW B;  1NS1 A;  1EFR G;  3SGI A;  1MOF A;  2V7Q G;  3ZJZ A;  5LYJ B;  3CC2 V;  3P3N A;  2P67 A;  1VF6 A;  1VQM V;  2EIJ B;  3K57 A;  2GUZ A;  2CK3 G;  3E86 A;  3RYI B;  4ZHQ A;  3M8A A;  4LH7 A;  3K5L A;  4U3J A;  3D3Q A;  1WA8 A;  3JAK A;  2X0L A;  5DEC A;  1AI5 A;  5L3D A;  2KSD A;  2EIM C;  1EZJ A;  3ZED A;  2E76 B;  2PF4 E;  2Q69 A;  5GON A;  4EFE A;  1N36 O;  2EIL B;  2BE3 A;  1RPR A;  3ASN C;  1KKC A;  2DQ0 A;  2WLJ A;  3WB2 A;  4TV8 A;  3QVN A;  1GRJ A;  3ZHS A;  1J5E O;  2HHH B;  4UFZ A;  1Q90 D;  4U7N A;  2Y4U A;  3FB8 C;  3WG7 C;  1YHQ V;  3JYC A;  4DV0 O;  1R3L C;  4EEQ A;  2M6Y A;  2B9Z A;  3BPZ A;  4DW0 A;  5IE9 A;  2VQF B;  5JJJ B;  1PM9 A;  4HNA B;  2DWE C;  3CCV V;  4FVM A;  4NTX A;  3CC7 V;  3ZMS A;  5LMU B;  1SF9 A;  2H3O A;  1I94 O;  2FL4 A;  4RUE A;  3CEI A;  1FFX A;  3LSS A;  3AG4 C;  3R65 A;  5BXZ A;  4IL6 Z;  1XHZ A;  4BR6 A;  2UXB O;  5KA5 A;  2AW9 A;  2Q7E A;  4F6R B;  4JI2 B;  1TGO A;  3OUF A;  2YC0 A;  4OPH A;  2UU9 B;  3ZRV A;  3D8C A;  5LMN B;  2WLN A;  4GX5 A;  1IXB A;  1PP9 H;  2ZQM A;  4WFF A;  4L87 A;  1XBL A;  3UCS C;  3CCR V;  1THZ A;  1XHX A;  2UXC B;  5B1B C;  4GZR B;  4LF7 B;  1Y76 B;  3L74 H;  4OXS A;  5CBG A;  1BE3 H;  3CD6 V;  4FJC C;  3BEH A;  4RQF A;  4X1K B;  3SPH A;  1F4M A;  3LDE A;  5E1A C;  1SET A;  3JSN A;  3JAR B;  1F51 A;  2OWO A;  4Z1V A;  1AR1 B;  1Q5O A;  2P5O A;  3O9O A;  4I50 B;  5EYP A;  2OCH A;  4DK1 A;  1KP3 A;  1HWY A;  3G6E V;  5BY1 A;  4X65 B;  3B40 A;  4DR2 O;  3GB7 C;  4PDV A;  1CXZ B;  2F95 B;  4O4H A;  3OE7 G;  3L71 H;  1H2K A;  3SJQ C;  5CBF A;  1IBM B;  4CH6 A;  5CA1 B;  4DR6 B;  4KXR A;  1MZE A;  1TUB B;  4XDL A;  2PY5 A;  1ZAU A;  5JVD B;  4MVO A;  4A5U B;  3AG2 B;  3T1Y O;  3AK3 A;  3JAT B;  1HNX O;  1MA1 A;  1BGY H;  1US6 A;  4DRX A;  4O4L A;  4X89 A;  1EM1 A;  2F93 B;  3DC5 A;  1E1R G;  3C3T A;  2UUC B;  1NVP B;  4JAU A;  1YSC A;  4JZG A;  4B3T B;  1XUQ A;  4DXW A;  1KD1 W;  1SQP H;  3OTF A;  4X20 B;  2ZR3 A;  4LF8 O;  4PJ0 Z;  3APO A;  4WFB V;  3D36 C;  1YTF B;  1GO3 F;  2OCC C;  4O2B A;  4FLZ A;  3E8F A;  4WBN A;  4H0L B;  4FPP A;  1MZF A;  1M93 A;  3TGU H;  2ZIM A;  5J2U B;  4R7C A;  4BIU A;  3IGA C;  4H13 B;  1FJG O;  5EC1 C;  1F7Y A;  2CAZ C;  3OT7 A;  1IVS A;  4PDL A;  4JV5 B;  2BOC C;  2UXD B;  4UVA A;  4CC5 A;  2OTL V;  4MVR A;  4LFB B;  3CP1 A;  1P49 A;  1WP7 A;  3A0B Z;  1IBK B;  2M7W A;  1GK9 A;  1F4N A;  2RCV A;  5LHH A;  3CHX A;  4YJ2 A;  1YDX A;  4FFB A;  2WAM A;  3JAW A;  4ZBM A;  3FYI B;  4TWK A;  2RDC A;  3K03 A;  1V54 C;  5CBH A;  3JAL A;  1QLE C;  4O2A B;  5LXT A;  1JMK C;  5KX5 B;  1N33 B;  1KU9 A;  4JI6 O;  1HNZ B;  4EB6 B;  2PZS A;  2Q6A A;  1H38 A;  4DV4 B;  1TVK A;  4DR5 O;  4CH5 A;  3SR2 C;  1R73 A;  2ZR2 A;  3K5O A;  4CZZ A;  3CJH A;  1FKA O;  3RT3 C;  3DSQ A;  3UT5 A;  2CTR A;  4J9Z B;  4JPR A;  2H94 A;  4MVQ A;  1FXK C;  1IBL O;  1BL8 A;  2ZE8 A;  3OMA B;  1KUQ A;  4FLY A;  1K9M W;  3P30 A;  4X9Q A;  5EBW C;  1HDJ A;  4FZ0 A;  4KL1 A;  3ZRW A;  3ABM C;  4AHC A;  3T1C A;  1MSW D;  4UV9 A;  1XNQ O;  4DV2 B;  4DR4 B;  4RWU A;  4FM0 A;  3B8M A;  3ZRS A;  4GKK B;  3TXQ A;  1JPX A;  1OZ0 A;  3APQ A;  1K8A W;  1RSO A;  2GTA A;  3OR7 C;  2DYS C;  4LNU B;  1AR4 A;  4K35 A;  3SPG A;  5H6R A;  2GSM B;  2UUB B;  5KLV H;  4ZIB A;  4X62 O;  1PNL A;  2QM7 A;  2XND G;  3ZRX A;  2F4V O;  3RN4 A;  3A8T A;  3NXS A;  1SQG A;  2LJ2 A;  3FAV A;  2GTS A;  2X6B A;  4ZI7 A;  3N2G A;  2PYJ A;  1NVP D;  2PUS A;  3KCY A;  1VAR A;  1QVF U;  4X64 B;  1AIL A;  3STZ C;  1YTF D;  2Y48 A;  2VRZ A;  4OX9 B;  1OCC B;  3K9S A;  4P9P A;  3I5D A;  1O9G A;  3IJ4 A;  1QVG U;  2E5L O;  1JA8 A;  1I5X A;  4I4T B;  5KA6 A;  2YIC A;  3WFV A;  3Q4H B;  1X4T A;  1Y6X A;  1A32 A;  1AB3 A;  1NH2 D;  3DXR B;  1NTZ H;  2O57 A;  4QIW F;  2W6J G;  3DC6 A;  4DUZ O;  4B3R O;  2ADQ B;  3H1L H;  1NR1 A;  3PJS K;  3K08 A;  2WLL B;  2HJF C;  4UVC A;  3DTU B;  3FX7 A;  2ZIO A;  3T4D A;  2B5U A;  1OCZ C;  3G6B A;  5KMG B;  3QO7 A;  4NKG B;  3AG3 C;  2R9R B;  4K8Z A;  4EFB A;  1SQB H;  1Q6U A;  1K33 A;  2EZO A;  5KHK A;  4R50 A;  3J80 N;  3JCU Z;  2DMX A;  1ZTE A;  4JI8 O;  4P9O A;  5EZY A;  5C93 A;  2VWJ A;  5LGN A;  1QU7 A;  3MAQ A;  4DV1 B;  2HP8 A;  1YJ9 V;  5KUK A;  2B1G A;  2QWN B;  5BZB A;  1XNR B;  5BR8 B;  2HLD G;  3L70 H;  4TT3 G;  4B3S O;  1DTO A;  5EBM C;  3CCQ V;  1M57 C;  3HKC A;  1JOY A;  3G4S V;  4I5S A;  3G80 A;  4NXM B;  4CS3 A;  4LF9 B;  1COW G;  1PKX A;  1SA0 B;  2EIN B;  5A9G A;  3G71 V;  3FYE B;  3RYH B;  1EN6 A;  1KQS U;  4JI2 O;  4LFC O;  1R3I C;  3ZMZ A;  5IY5 C;  2X6A A;  1QLN A;  2Q68 A;  4O4I A;  3ABL B;  2HR3 A;  4PA9 A;  3CB2 A;  2DYR C;  2JGD A;  3F5W C;  4X66 B;  3RWR D;  1QHT A;  4PD4 F;  1NJI W;  3JAS A;  1QBZ A;  3BA8 A;  3OFN G;  2N74 A;  5B1O A;  4UUJ C;  1RFY A;  3OUS A;  2WPD G;  5B3S B;  4Z1M G;  3K04 A;  1NQT A;  2P4K A;  2CH7 B;  2AXT Z;  1YJW V;  3IC7 A;  5CMU A;  1EN5 A;  4I0X B;  4U3F H;  4GKJ O;  1GM9 A;  1WB8 A;  1AVM A;  3E22 B;  5BMV B;  2E3C A;  1NZ6 A;  5IYZ B;  2LFR A;  1SQF A;  1DF5 A;  2X6C A;  2MW2 B;  2IH3 C;  4UCS A;  2BTQ B;  2ITD C;  2N05 A;  2NR5 A;  1XMO B;  1BCC H;  3OEH G;  1GTO A;  1BHA A;  3X2Q B;  4GYC B;  2Y69 B;  4DR7 B;  5EIB D;  2QJ1 A;  1CEZ A;  4HYO A;  4CS2 A;  5LA6 A;  3SPI A;  3H1J H;  4X1I A;  1LNQ A;  3JD3 A;  2CTQ A;  4KUM A;  3F7V C;  4CH3 A;  4H37 A;  4AQY B;  1FD9 A;  1MMM A;  1WA8 B;  4TV9 A;  3JAK B;  3C90 A;  3FB7 C;  4X1Y A;  1HR0 B;  4JI5 B;  2LGW A;  3JD4 A;  4ZOL A;  2ITC C;  1L0N H;  5CA0 A;  2GBO A;  4FLX A;  1M56 C;  5L3C A;  1XEQ A;  2Q67 A;  1W0J G;  4UCR A;  3MD0 A;  4IT5 A;  4JI7 B; 
#chains in the Genus database with same CATH homology
 3L70 H;  3H1L H;  3CX5 F;  1SQX H;  3CXH F;  2BCC H;  1BGY H;  3CWB H;  1BCC H;  1PPJ H;  3BCC H;  1SQV H;  3L71 H;  1SQQ H;  1P84 F;  1NU1 H;  3TGU H;  1L0N H;  3L73 H;  1L0L H;  1KB9 F;  4U3F H;  1PP9 H;  2A06 H;  3H1K H;  1EZV H;  2IBZ H;  3H1H H;  5KLV H;  1NTK H;  3L72 H;  1KYO F;  3H1I H;  3H1J H;  1SQP H;  1NTM H;  4PD4 F;  1NTZ H;  1SQB H;  3L75 H;  4D6T H;  3L74 H;  2FYU H;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...