1BE3H

Cytochrome bc1 complex from bovine
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 20
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1be3H00
1PP9H 1SQBH 1PPJH 1BE3H 1SQXH 3H1KH 4PD4F 3BCCH 3CWBH 3L74H 3TGUH 1NTKH 1L0LH 1NTMH 2A06H 4U3FH 1KYOF 3L71H 1NU1H 2FYUH 3CXHF 3L73H 1L0NH 1BGYH 1BCCH 3H1JH 2IBZH 1KB9F 3L75H 3L70H 3CX5F 1SQPH 1P84F 3H1IH 3L72H 1SQQH 1EZVH 4D6TH 3H1LH 1NTZH 5KLVH 3H1HH 1SQVH 2BCCH
chains in the Genus database with same CATH superfamily
2QDOA 2PGGA 1EN5A 2Y69C 5KA5A 1IBLO 1RM1B 1YVWA 1PL0A 3SGIA 1NKDA 5L3GA 4JYYA 4AI8A 1FPOA 1M90W 3K04A 1VQMV 3CJHA 2RN9A 3E8HA 5J2TB 1VQ9V 5LL6Y 3P3NA 5D5PA 1MOFA 4D6TH 3ZBHA 4LP8A 1X59A 2EIJB 1H2MA 3H9VA 2MK3A 4O4JA 3HKDB 3BY6A 2KQXA 1YEWA 3CC4V 3ASOB 3QTCA 4U7NA 3QNEA 5AG2A 3GWKC 3BHPA 2P06A 4JI2B 2ZR2A 3JSNA 4MVSA 1XL4A 1N36B 1MA1A 5CA1A 2H8PC 4B3TB 4LF7O 2YICA 4BIOA 3CHXA 4IIJA 1K3EA 5KX5A 3X2QB 4IT5A 4H13B 3ZHVA 4LF9B 2Y4TA 4J41A 3F5TA 1G4YB 4UVBA 2ZR3A 5KAIZ 4OGQB 1TUBB 4I55A 1SQXH 4JI4B 1N33B 1MG1A 2RNBA 2CAZC 1BQ0A 2UU9B 1JQ0A 2A7WA 4MVMA 3OEHG 4JI8B 3T1YB 3ZHUA 1YHQV 3OT7A 1O9HA 1QQCA 4FLXA 1FYJA 2F43G 1KMIZ 5FPOA 3E89A 3BAAA 1Y76B 2LGQA 1DGSA 4DR4O 1FFXB 4UCTA 1K73W 1EN4A 3SYOA 2W6JG 2YI9A 4IIJB 4X89A 1OCRC 3RVZA 3ZMTA 1AROP 4X8AA 3BRCA 4NXMO 1BZKA 1IXMA 2OIEA 1XILA 3ZIAG 3EFFK 4XBFA 4EKWA 2JEXA 4WF9V 4EFBA 4J10A 2HEPA 2Z5UA 1NR1A 1HNWB 5LOVB 4FLZA 5CB4A 3MHSC 2BOCC 1BMFG 1IXBA 4UUJC 1QVFU 5B1BC 5CB4B 1J5EB 1FXKA 4WFHA 3JD0A 3L9DA 1VQ8V 1W2BU 3TETA 4Q6GA 1JFFA 3AG2C 2QR4A 3K5LA 4H37A 1Y74B 1S5LZ 2YDEA 5JJNB 1NTZH 2Y0PA 5IDJA 1VF6C 3ZHSA 4CH6A 3LDCA 3LDEA 3SDLA 4HAMA 4E4EA 3HKCB 4JYAB 4RUEA 4YHHB 1YZBA 2JGDA 4X66O 2WAMA 4X65B 3RYHA 2BTOA 1IVSA 2PUSA 2A9HA 4CS4A 1GAXA 4O2AA 3G6EV 4FK5C 3CJHB 4J9YB 3OR7C 3CCEV 4K0KO 3KCXA 4FZ0A 1NT2B 3T1CA 2AGAA 3NXSA 4LC1A 3WG7B 5IYBO 4GUNA 3JSLA 3K58A 3JCZA 1QLNA 4DYLA 5BMVB 1NH2B 4U7OA 5IJ9A 4WFEA 1VQ4V 4MS2A 4Z1MG 3DXRA 5JQGB 5IT9N 1YJNV 4I9QA 2RMKB 2YEVA 4MTFA 1NH2D 2P4KA 4CZZA 4LFCO 1SZTA 4KFMA 2V1DA 2XOKG 4NTWA 1F23A 3JARA 4MVRA 4YJ3A 4X1IB 3VOUA 1XHXA 4NYKA 1L0NH 3FYIB 2CTPA 4X9QA 1SQQH 1WP7A 4KXRA 5CBGA 1KC8W 2EIMB 3E83A 5LYJB 4FLWA 3SPIA 1I94B 3F7YC 4NXNO 1XNQO 2C2AA 4I7ZB 1PL4A 5KA6A 2XUMA 5ITZB 4NTXA 1GH6A 2X6CA 4DR7O 4YY3O 2XASA 2BTQB 4RAIA 4DK1A 1SQFA 3ZMSA 2OCCC 1AI6A 1RSOA 4DR1B 5LGTA 4U3JA 1IBMO 1ZL8A 3N2GA 3O65A 4DV1O 5LGNA 4DUZB 2QM4A 3B77A 2QTSA 2P4VA 1HNZO 2F4VO 4K35A 3GB7C 2UXCB 4OPHA 3KKYA 3CE2A 3J81N 2V4DA 5DEDA 2N74A 4DV7O 4I0XB 4HBNA 1KBHA 5KHGA 3VQXA 1NBMG 2Q7EA 4R8CA 5FPRA 4TQDA 1V54B 2HHHB 4CS3A 2QWPB 3SJBC 2EIKB 5BZBA 5CA3A 1WN7A 1PNLA 2BSKA 3AG4B 1EZJA 1XQ8A 5JJEB 3N2KB 3ZRVA 2IJIA 2DWEC 2QKSA 5IYZB 4JTDB 4JI0O 3OW2U 2IBZH 1KP2A 4UV9A 2Q9LA 5GONA 2UUBB 3JAMN 5EC2C 3WG7C 1CXZB 2XHBA 1QNMA 2DWDC 3ABUA 1WNSA 1I0HA 2YEVB 4CS2A 4XDKA 2UXBB 4O4LA 1DK1A 5EYPB 1FJGB 2WWWA 1K9MW 2GV9A 4YJ3B 4GCZA 1ZTEA 1EBOA 2RCVA 4J11A 4GX1A 1HNXB 1IZ3A 2BCCH 2VQFO 3RWRD 4FLYA 3FX7A 2Q68A 1H8EG 4JTCB 4BR6A 1OV9A 4LNUB 4LF5O 2HG5C 2B1GA 5E1AC 4CBCA 1K97A 4GYCB 2YSUB 1NZ6A 4RQEA 3A0HZ 2EX3A 1AR5A 1P4RA 3P3PA 3OTOO 3BPZA 1M9NA 2R9IA 4DRXA 2ARHA 3U0ZA 2A06H 2ZDIC 1WP8A 3SYPA 2FYUH 2EJ7A 1H38A 3ABKB 1R73A 5KUMA 4D7SA 2JGUA 1N4CA 3JASA 4RO2A 4DUYB 5EC1C 1H2LA 3W7TA 4PA7A 2OTJV 3CCQV 3AK2A 3H1KH 2QWQB 2QA4V 4PV1B 1D5NA 4TV8B 5LOVA 3JD3A 1N0JA 4LH6A 3D3QA 3B8NA 2YXHA 2M6YA 1HNXO 3OAAG 4WFAV 4FLVA 3W7XA 3AEIA 1SKVA 3CRQA 5KUKA 1CP9A 2M7WA 4QPJA 1PP9H 5LMNO 1LUVA 3HKEB 4B3RB 4LFAO 5IYDO 1GN2A 1K33A 2WLHA 2WLLB 4J42A 4J7KA 3SJCC 3GWOA 2UXBO 4KHPO 3VQYA 1G1XB 3ZRWB 1MMMA 4DV2O 4LFBO 3H1HH 5LXTB 4AILC 3QO5A 2HP8A 3SPGA 4R6ZA 3WB0A 2CDYA 3A8TA 1M4UA 1K8AW 5KHIA 4ASUG 2UUCB 2EINC 2JDIG 4EFEA 4K8ZA 3SJQC 2XT9A 3LUTB 2QJ1A 1YJWV 1VQKV 1TA8A 2HHHO 2KG7A 3T2MA 1LUWA 1W0JG 3Q4HA 4DV7B 2ZXWB 4X64B 1XREA 4JPRA 1K4DC 2ADQB 3FB5C 5C8YB 2YUAA 4LCUC 3K57A 3U10A 1IBMB 4X1KB 1DTOA 2YXYA 2W0XA 3QO8A 4MW8A 5BXZA 5EZYA 2FB5A 4LF6B 3JARB 4O4LB 4H0LB 3K0DA 4DR7B 2QWRB 3CRRA 1ZWIC 4N21A 1BT8A 1R3JC 2XAJA 2DJVA 2Q5ZA 3IJ4A 3PJSK 4I55B 1E79G 5CA0A 5DM6V 1GRJA 2QE7G 1XMOO 4DR2B 2B5UA 2ZE6A 1P7BA 2F1MA 3DC5A 4NXNB 1XNQB 1M57B 1I94O 4ZI7B 4X62O 1GK9A 2RJZA 1GN4A 3D8CA 3CCUV 5GTIZ 4C7UA 4QGPA 2JJ2G 4GX2A 4IGGA 3LDDA 2LP7A 4LWSA 4LF8B 4Z2WA 2PYLA 1K34A 1DF5A 3FKSG 2WLLA 4LFCB 5EBMC 3ABKC 5IWAB 5TISZ 5LYJA 3RW0A 3RYFB 3L72H 5IYCO 4B08A 1FAFA 4NTYA 4B7EA 5FL7G 4X62B 1XNRO 1GN6A 4O2BB 1JX9A 1MZFA 1XMOB 4QNHB 2Y48A 1VP7A 3ETEA 1SF9A 2JVDA 3I55V 3JAWA 3CX5F 1N32B 2JRIA 4Q20A 2X0LA 2CTRA 3SPCA 2QWNB 1GM9A 1V55C 2ETNA 1D2DA 2ZD9A 1SA0B 1QU7A 1S5JA 4JAVA 5CBHA 1HWYA 2Q6AA 4JYAO 3FB6C 2EILC 1B6QA 4MSWC 1Z2GA 3APOA 4X64O 2OT5A 3DC6A 5LA6A 2ZDIA 3LNMB 3RYHB 3ABMB 5A9GA 1N32O 1AP5A 2ILMA 3CCMV 1VQOV 1YXBA 4R50A 2WLJA 2GTAA 5FNVB 3AG2B 4XDLA 4F6EA 5LHGA 2LGWA 4LH7A 4DR6O 1R3KC 1Q5OA 2KSDA 1CPYA 1HW7A 5KMGB 1XNRB 3JALB 5EK0A 3MDSA 3C3SA 3M99B 2N05A 3T4ZA 4DV2B 1G6UA 4IYIA 3RFRA 5IWAO 4YJ2B 3U11A 2X6BA 3WB1A 4L87A 1M93A 2KG7B 3E2EA 1Y67A 1LNQA 3AG1B 2ZE7A 3TGUH 5L3CA 4JYBA 1JPXA 3O9OA 2EIJC 4LFAB 1TVKA 1OCZB 2YIDA 5L3EA 2CE4A 1OCOC 4K8XA 4P9OA 1BQZA 3AG3C 3HKDA 3ASNB 5EBLC 1EN6A 3ZMVA 3RYFA 5B1OA 3W7SA 1SZXA 5J2TA 1ZUQA 4BIUA 4JI8O 3QVNA 1XOUA 2PF4E 2ZCEA 3DTUB 4JI4O 4CC5A 1JMKC 1KQSU 3K0GA 1P84F 3E22A 4B7KA 3ZCCA 5LP6C 1ZAUA 2YI8A 1NR7A 2E74B 2R72A 1B06A 2HJFC 3OD4A 2DYSC 2ZM6O 4UCSA 2GHYA 3G80A 1XBLA 1VQNV 1K4CC 3AG7A 3OTOB 1SESA 2AW9A 2OWOA 3G4SV 2W6IG 1JJ2U 4RUFA 4JI2O 2BOBC 3HKBB 1Q82W 1J95A 3RYIB 3B4SA 5LMUO 4G28B 1L8DA 4JV5B 2N04A 4XDJA 4J80A 3ZRSA 4LF5B 5IE9A 5CBFA 3HB3B 2JK5C 5JVDA 4QPKA 3ASOC 4LR3A 4GT1A 4LFBB 1FXVA 2LJ2A 2ZINA 3FAVA 4KL1A 5GONB 3ZN1A 3K03A 3OM3B 5IY5B 4UFZA 4KHPB 1EM1A 2D2CB 5LA6B 1Q43A 4TUYA 1VQLV 2NLJC 3UM7A 1NTKH 1AR4A 2H94A 4U3JB 4O4JB 4O4HB 4CH5A 4B3RO 4QIWF 1Y76A 3CXCU 3F5WC 4HZ3A 1ROPA 3ZS8C 4I4TB 4UCRA 3G6BA 1SQBH 1I5YA 4F4LA 1O9GA 1FD9A 4MVOA 4JI0B 4JTAB 3CCRV 4O4IA 4FFBB 1WA8B 3EVKA 4MTXA 3T1HO 1NU1H 1F7YA 4JV5O 5EZYB 3ZHRA 5LMUB 4FLUA 4DR3B 1S72V 3CCVV 1D5AA 1IDSA 2OIGA 4DUYO 3CP1A 1NQTA 5H5NA 1US6A 1AI5A 3OMIB 4FPPA 1TUBA 2GUZB 3WU2Z 5IYZA 2Q0OC 3QG5A 4GKJO 1NTMH 1ZX3A 4DUZO 2FL4A 5LP6B 4LWSB 2ZM6B 1Q8IA 2GTSA 1AJQA 4FM2A 2WLIB 5KAFZ 1RP3B 1SC5B 3F7VC 1WAZA 5IJ9B 2Z3YA 2LW1A 1KD1W 1SQVH 1QBZA 2YIBD 4ZI7A 1OHHG 4ZOLA 5B1AC 1CEZA 4TSFG 2F93B 1VF7A 5EBWC 2JS5A 2AHYA 3VQVA 5KHHA 3VBBA 2DN9A 1PKXA 4ZOLB 3SYCA 3B40A 4BAYA 3OGCC 5L3FA 2WLKA 3S3WA 3DXRB 5H2FZ 1XEQA 4MTGA 3I56V 5IJ0A 2ITDC 2P22C 3SYAA 1FJGO 1BSMA 2D3OW 3VQWA 3JD4A 3AG4C 1F51A 2UUBO 1AB3A 5IJ0B 1T5EA 5EIBC 1YSCA 4UCUA 4DR6B 2MW2B 2Y0IA 1U96A 5EYPA 3FB7C 2NNUA 5LXTA 1KB9F 2JEUA 3CSXA 1XUQA 1YF2A 4PDLA 3P32A 1ORQC 4MVQA 4X65O 3D36A 4DV4O 4WBNA 4X66B 4BWAA 1PM9A 2UXCO 3OGIB 2F4VB 1HNZB 3HKEA 2BSKB 4DV1B 3UO3A 4DR1O 1M1KW 5A2QN 4EB6B 2JS3A 4WBNB 1Q3EA 4ZKIA 3K3WA 3FB8C 1R6KA 3C3TA 1VQ5V 1MABG 2JGDB 1PD3A 1AR1B 3CMEV 2IJJA 4MT8A 2LO1A 1K92A 2JIZG 3UCSC 1J5EO 4EB6A 2VRZA 5B5EZ 5KX5B 1K5SA 2HVKC 3SR2C 3JALA 3CB2A 5KHKA 1W59A 2IH1C 4O4IB 3CD6V 5BMVA 1KUQA 5LP6A 4OPAA 4X1YB 2CGOA 5JJJB 1WPBA 2DYSB 3A0BZ 4LF8O 1P49A 1XDCA 3SJAC 3UO2A 1NVPD 4FMTA 5B1NA 1UJWB 1K5QA 3HR0A 4JZGA 4WFGA 2OCHA 3CEIA 2R9AA 4TT3G 2UXDO 4YIPA 3RBZA 3B09A 3ABLB 5LGUA 4NVPA 2HFEC 2L6LA 1WA8A 2KB1A 4DR2O 2PI4A 2UU9O 2XAQA 1Q6UA 2IM9A 1WPXA 1VF5B 3P30A 2DYRC 2V7QG 3OR6C 3H1JH 2LFRA 4F6RA 2KKWA 4PHZA 4LF6O 1SQPH 2Y69B 5JVDB 4HNAA 1VIBA 4X1YA 1XMQB 5GW7A 1QLEB 4IL6Z 5IY5C 2QKCA 2DW4A 3D36C 1JR9A 5K1XA 3KCYA 1M5IA 3FD9A 1YDXA 2QSAA 4H33A 4DXWA 2GDSA 4B3TO 3E22B 2Z0AA 3DGEA 1H8HG 2DQ0A 2Q73A 2PY5A 2F66C 5B1BB 1R3LC 4FFKA 1MSDA 3K5NA 3MD0A 3A0RA 3W7UA 3ETQA 4I50A 1P7GA 2ZKOA 2GBOA 3K59A 1FKAO 3OMAB 2UUCO 4YIOA 1E1RG 5JCOC 5KHJA 4GZRB 4FFBA 2WLNA 1GTOA 5E79Z 2OYQA 1R3IC 1ENVA 3K9SA 1H2NA 4JI5O 5FNVA 3RVYA 4I50B 1HNWO 1PNKA 4DV3B 4UCOA 3FAVB 1L1FA 3G67A 1TUEB 1IBLB 1V55B 1S0VA 3I5DA 5CN0A 5LMNB 4PJ0Z 3STLC 3STZC 1N8RW 2IJHA 4UB6Z 3B8MA 1VQPV 4X1KA 1SA0A 1BHAA 1R1BA 1S77D 5K1PA 2YIAA 1Y66A 2HR3A 3FFQA 2H3OA 4ZBMA 4JI1B 2PI5A 2IU3A 4LF4B 3ZN0A 1XI1A 3AG3B 1KECA 2K1EA 1N33O 1EFRG 4QE9A 2WA3A 1YCIA 4JI3B 4K3AA 4KUMA 2CGNA 3M8AA 2PYJA 2ITCC 3JYCA 1QR8A 4LF9O 4A5UB 4DR5O 1S76D 3BVOA 1DLBA 3ICXA 4BIZA 2ZIOA 1FS0G 2VQEB 4O2AB 3APQA 4JYCA 2CTWA 3CRMA 2VWJA 1KKDA 2DOSA 1YTFD 4LF7B 4WFFA 4BW9A 3H1IH 2CH7B 3CC7V 1NVPB 4CC6A 2ZNIA 2OTLV 3CWBH 3L74H 3NR7A 3DSQA 3CXHF 2VQFB 4DW0A 3BEHA 2XAHA 4PDMA 4D7TA 1HR0O 4PA9A 3CS5A 1VF6A 3K5OA 4TV8A 1AJPA 3EXAA 4DV0B 2EBOA 2LW7A 4AQYO 2ZXWC 5J2UB 1I5XA 1Q6HA 2HKOA 1OZ0A 2UUAB 3UKMA 3C90A 1M56C 3H01A 1I08A 1IBKO 2P67A 1RSOB 1GN3A 2X7RB 4JZ2A 3JASB 2O57A 4TV9A 2Q0AA 1MSWD 4PDRA 5JH7A 4CH4A 1PNMA 1B04A 5F2VO 5CA1B 1ZSPA 2YS8A 1NS1A 2IJKA 1AI4A 2QWOB 2GSMB 1OJHA 5LHIA 1XL6A 3E86A 1V54C 4GX5A 4R7CA 1KU9A 4HYOA 2QM7A 5D5QA 1SRYA 1ZLZA 4JAAA 4TWKA 3L73H 4TUYB 3THOA 1GKFA 2RQ6A 4B3MB 2EZOA 1Y6XA 1YTFB 1AILA 4JF3A 1TAEA 3RN4A 5BR8B 3SPJA 3ABTA 2NN4A 4DV5B 5H6RA 3IC7A 3JATA 1UPGA 3OUFA 2UXNA 5BR8O 3RGBA 2CK3G 2QGNA 5EIBD 4W4KA 3N2KA 4WCEV 2WLIA 5KLVH 4TQFA 1UFIA 4PI0A 4YY3B 2DYRB 1VARA 2YC0A 2B1IA 3JD1A 1GMGA 3BFRA 2FKXA 1L0LH 1N0NA 2VS0A 2EIMC 4I0XA 5JWPA 3OUSA 3TXSA 5DN6G 2Q8VA 3BA8A 1URFA 5LBQA 1QHTA 1QVGU 2ZQMA 1SETA 4DV6B 2AZ0A 1LR1A 3OEEG 1VMGA 4NKGB 4Z1VA 1Q81W 1RPRA 4MVZA 1FFTB 2XAGA 4HNAB 3L71H 2A0LA 4AQYB 4KP4A 5L3DA 1BGYH 1YITV 3MHHC 2AZ2A 3HPLC 3JAWB 2WA4A 3CCSV 2E5LB 4FZ1A 5CMUA 3SPHA 4NR1A 4P2ZA 1Q7YW 1B3QA 1PPJH 3JAKB 4X20B 3ZHQA 3N2GB 1VEWA 1TVKB 4ABMA 2CTQA 1HDJA 4U3FH 1HP8A 4K0KB 3JAKA 2XAFA 4X20A 3BA9A 3TK1A 3A2FA 3BABA 5JCOA 2R70A 5J9PC 3K08A 3LSQA 4J7ZA 3CC2V 4RQFA 3JCUZ 3ZMZA 4YHHO 1G8MA 1U97A 3AG1C 1N34O 1VQ6V 4PDVA 3E8FA 2Q69A 2QKAA 2VQEO 4B3SO 4P30A 2E75B 1PV0A 4O2BA 2UXXA 5HFMA 4QE7A 4OXSA 3ZRXA 4UXNA 4JI6B 3EHBB 4UVAA 2Q67A 4TOIA 2XTAA 3TCUA 2HJDA 3K79A 3JD2A 3M7MX 1SS3A 3LSUA 5C93A 4FM0A 2P6JA 4JGSA 4LF4O 4JI1O 2DQ3A 3L75H 4FLTA 4PELA 1AP6A 3LSSA 1YJ9V 2R9RB 3T4DA 1NJIW 4MVUA 3E8BA 2F23A 1JVMA 3Q4HB 2EILB 1H2SB 5GTHZ 1JFFB 4NXMB 3K9AA 2P7TC 2EULA 4DV3O 3ZMUA 4G2KA 4JI7O 4UV8A 1IURA 1H2KA 4OX9B 4JI5B 4DR4B 3OTFA 1BS3A 5H6QA 1FXHA 1WB7A 1W0KG 5B3SC 4UVCA 4FM1A 1NI8A 2ZNJA 2HVJC 2ODMA 4FVMA 2Q4PA 3T1YO 2ZE8A 2EJRA 5B1AB 1F4MA 1RFYA 1WJZA 2F95B 4E2LA 2BE3A 1Y74A 1S3JA 4DW1A 4JAUA 3IAYA 1EZVH 4MW3A 1R6NA 3LNNA 4IHJA 4JI6O 1DF4A 3AK1A 4J9ZB 3ZX6A 1BL8A 3GVMA 2Q7HA 3R66A 3K5MA 3RYIA 1AVMA 1QCEA 3JATB 3AK3A 5B66Z 1OCRB 2K9PA 3CMAV 1S5HC 1N36O 5CA0B 1Y4MA 1XMQO 2BTQA 1M56B 2EINB 2IW5A 2FMLA 1QLEC 2P5OA 1M57C 4ICGA 2IH3C 3ML0A 4UB8Z 3W7WA 4L8JA 1R6TA 3BCCH 1ZL8B 2AHZA 5C8YA 1MZEA 2YIBA 1SERA 4WFBV 3CPWU 2E76B 3TJTA 3HKBA 3E35A 3L70H 2A3QA 1F4NA 2YXLA 4IHJB 3J7AU 1RM1C 2UXDB 3H1LH 1Z5VA 4OX9O 2AXTZ 4JI7B 1V9PA 4JASA 4X88A 4DRXB 1BE3H 3ZJZA 4J7JA 4G27B 4H44B 3PN1A 3KZIZ 1Q86W 3KG2A 3SYQA 3IFXA 3FYEB 4PA3A 5LHHA 3WB2A 2FTKA 2PTMA 2QM8A 1JJOA 5J2UA 2HLDG 2Q7GA 3K06A 3WFVA 1BHBA 1KP3A 1Z5WA 3CRCA 5HFLA 3E8GA 1GO3F 3X2QC 4PI2A 4YJ2A 3QF7A 1MNGA 2RDCA 3ZRWA 4DK0A 4GKKB 4NB5A 1Q90D 4DO2A 5KMGA 1FFXA 2DMXA 3MAQA 1I7FA 5DECA 1VQ7V 3CCJV 2QTOA 4QJFB 4W4LA 1X4TA 4B3SB 4IYHA 1N34B 1TGOA 4EEQA 1KYOF 4DV5O 3TXQA 2G38A 1OCOB 3ABLC 1GM8A 4DV4B 1RPOA 4I4TA 1K7DA 2JJ1G 5B3SB 3ETGA 4B3MO 1OCZC 3N27A 3ETDA 4ZHQB 1QR9A 2E3CA 1FXKC 3B2EE 2DE0X 2Y4UA 4O4HA 2ZT9B 2WSSG 5BY1A 3CRAA 1THZA 3OFNG 4ZHQA 1H2GA 2ADPA 4FIPC 1IX9A 2CH7A 2IU0A 2P90A 4X1IA 3IC9A 1GM7A 2E5LO 3G71V 4P9PA 4FJCC 4LBEC 1Q6IA 2ZE5A 1YI2V 3CYOA 1IBKB 3HKCA 1OCCB 2XNDG 2UUAO 4UCVA 5L3BA 3ABMC 3QO7A 4DV0O 2WPDG 4LNUA 2B9ZA 1A32A 5ITZA 3CCLV 4DV6O 3RYCA 1HR0B 3UT5B 4N23A 3J80N 4BW5A 2GUZA 1WLEA 1AJNA 2VWKA 4I5SA 3UT5A 1E1QG 4PA6A 4TV9B 5H9CA 5FLXN 5JH7B 4ZIBA 2EZPA 4MTOA 2WLMA 2X6AA 2A79B 1COWG 2LQTA 4I9WA 2ATKC 3UQ8A 1JA8A 2LFSA 4GX0A 2W0FC 1SQGA 2ZIMA 4PD4F 2CUGA 3IGAC 3ASNC 4GKJB 1AI7A 2OCCB 3ZHTA 4F6RB 3S3XA 3OMNB 1KKCA 3OE7G 1JCHA 3RYCB 1BCCH 1XHZA 4DR5B 3ZEDA 2L35A 4JI3O 4DR3O 3D3IA 4GKKO 4RWUA 3T1HB 4YXWG 2QEXV 4PA4A 2NR5A 1YIJV 3R65A 1FXKB 4GLXA 2PZSA 1OCCC 4CH3A 4AHCA 3RT3C 1WB8A 2EIKC 5JQGA 1JOYA
chains in the Genus database with same CATH topology
1PP9H 1SQBH 1PPJH 1BE3H 1SQXH 3H1KH 4PD4F 3BCCH 3CWBH 3L74H 3TGUH 1NTKH 1L0LH 1NTMH 2A06H 4U3FH 1KYOF 3L71H 1NU1H 2FYUH 3CXHF 3L73H 1L0NH 1BGYH 1BCCH 3H1JH 2IBZH 1KB9F 3L75H 3L70H 3CX5F 1SQPH 1P84F 3H1IH 3L72H 1SQQH 1EZVH 4D6TH 3H1LH 1NTZH 5KLVH 3H1HH 1SQVH 2BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 H;  1SQB H;  1PPJ H;  1BE3 H;  1SQX H;  3H1K H;  4PD4 F;  3BCC H;  3CWB H;  3L74 H;  3TGU H;  1NTK H;  1L0L H;  1NTM H;  2A06 H;  4U3F H;  1KYO F;  3L71 H;  1NU1 H;  2FYU H;  3CXH F;  3L73 H;  1L0N H;  1BGY H;  1BCC H;  3H1J H;  2IBZ H;  1KB9 F;  3L75 H;  3L70 H;  3CX5 F;  1SQP H;  1P84 F;  3H1I H;  3L72 H;  1SQQ H;  1EZV H;  4D6T H;  3H1L H;  1NTZ H;  5KLV H;  3H1H H;  1SQV H;  2BCC H; 
#chains in the Genus database with same CATH topology
 2QDO A;  2PGG A;  1EN5 A;  2Y69 C;  5KA5 A;  1IBL O;  1RM1 B;  1YVW A;  1PL0 A;  3SGI A;  1NKD A;  5L3G A;  4JYY A;  4AI8 A;  1FPO A;  1M90 W;  3K04 A;  1VQM V;  3CJH A;  2RN9 A;  3E8H A;  5J2T B;  1VQ9 V;  5LL6 Y;  3P3N A;  5D5P A;  1MOF A;  4D6T H;  3ZBH A;  4LP8 A;  1X59 A;  2EIJ B;  1H2M A;  3H9V A;  2MK3 A;  4O4J A;  3HKD B;  3BY6 A;  2KQX A;  1YEW A;  3CC4 V;  3ASO B;  3QTC A;  4U7N A;  3QNE A;  5AG2 A;  3GWK C;  3BHP A;  2P06 A;  4JI2 B;  2ZR2 A;  3JSN A;  4MVS A;  1XL4 A;  1N36 B;  1MA1 A;  5CA1 A;  2H8P C;  4B3T B;  4LF7 O;  2YIC A;  4BIO A;  3CHX A;  4IIJ A;  1K3E A;  5KX5 A;  3X2Q B;  4IT5 A;  4H13 B;  3ZHV A;  4LF9 B;  2Y4T A;  4J41 A;  3F5T A;  1G4Y B;  4UVB A;  2ZR3 A;  5KAI Z;  4OGQ B;  1TUB B;  4I55 A;  1SQX H;  4JI4 B;  1N33 B;  1MG1 A;  2RNB A;  2CAZ C;  1BQ0 A;  2UU9 B;  1JQ0 A;  2A7W A;  4MVM A;  3OEH G;  4JI8 B;  3T1Y B;  3ZHU A;  1YHQ V;  3OT7 A;  1O9H A;  1QQC A;  4FLX A;  1FYJ A;  2F43 G;  1KMI Z;  5FPO A;  3E89 A;  3BAA A;  1Y76 B;  2LGQ A;  1DGS A;  4DR4 O;  1FFX B;  4UCT A;  1K73 W;  1EN4 A;  3SYO A;  2W6J G;  2YI9 A;  4IIJ B;  4X89 A;  1OCR C;  3RVZ A;  3ZMT A;  1ARO P;  4X8A A;  3BRC A;  4NXM O;  1BZK A;  1IXM A;  2OIE A;  1XIL A;  3ZIA G;  3EFF K;  4XBF A;  4EKW A;  2JEX A;  4WF9 V;  4EFB A;  4J10 A;  2HEP A;  2Z5U A;  1NR1 A;  1HNW B;  5LOV B;  4FLZ A;  5CB4 A;  3MHS C;  2BOC C;  1BMF G;  1IXB A;  4UUJ C;  1QVF U;  5B1B C;  5CB4 B;  1J5E B;  1FXK A;  4WFH A;  3JD0 A;  3L9D A;  1VQ8 V;  1W2B U;  3TET A;  4Q6G A;  1JFF A;  3AG2 C;  2QR4 A;  3K5L A;  4H37 A;  1Y74 B;  1S5L Z;  2YDE A;  5JJN B;  1NTZ H;  2Y0P A;  5IDJ A;  1VF6 C;  3ZHS A;  4CH6 A;  3LDC A;  3LDE A;  3SDL A;  4HAM A;  4E4E A;  3HKC B;  4JYA B;  4RUE A;  4YHH B;  1YZB A;  2JGD A;  4X66 O;  2WAM A;  4X65 B;  3RYH A;  2BTO A;  1IVS A;  2PUS A;  2A9H A;  4CS4 A;  1GAX A;  4O2A A;  3G6E V;  4FK5 C;  3CJH B;  4J9Y B;  3OR7 C;  3CCE V;  4K0K O;  3KCX A;  4FZ0 A;  1NT2 B;  3T1C A;  2AGA A;  3NXS A;  4LC1 A;  3WG7 B;  5IYB O;  4GUN A;  3JSL A;  3K58 A;  3JCZ A;  1QLN A;  4DYL A;  5BMV B;  1NH2 B;  4U7O A;  5IJ9 A;  4WFE A;  1VQ4 V;  4MS2 A;  4Z1M G;  3DXR A;  5JQG B;  5IT9 N;  1YJN V;  4I9Q A;  2RMK B;  2YEV A;  4MTF A;  1NH2 D;  2P4K A;  4CZZ A;  4LFC O;  1SZT A;  4KFM A;  2V1D A;  2XOK G;  4NTW A;  1F23 A;  3JAR A;  4MVR A;  4YJ3 A;  4X1I B;  3VOU A;  1XHX A;  4NYK A;  1L0N H;  3FYI B;  2CTP A;  4X9Q A;  1SQQ H;  1WP7 A;  4KXR A;  5CBG A;  1KC8 W;  2EIM B;  3E83 A;  5LYJ B;  4FLW A;  3SPI A;  1I94 B;  3F7Y C;  4NXN O;  1XNQ O;  2C2A A;  4I7Z B;  1PL4 A;  5KA6 A;  2XUM A;  5ITZ B;  4NTX A;  1GH6 A;  2X6C A;  4DR7 O;  4YY3 O;  2XAS A;  2BTQ B;  4RAI A;  4DK1 A;  1SQF A;  3ZMS A;  2OCC C;  1AI6 A;  1RSO A;  4DR1 B;  5LGT A;  4U3J A;  1IBM O;  1ZL8 A;  3N2G A;  3O65 A;  4DV1 O;  5LGN A;  4DUZ B;  2QM4 A;  3B77 A;  2QTS A;  2P4V A;  1HNZ O;  2F4V O;  4K35 A;  3GB7 C;  2UXC B;  4OPH A;  3KKY A;  3CE2 A;  3J81 N;  2V4D A;  5DED A;  2N74 A;  4DV7 O;  4I0X B;  4HBN A;  1KBH A;  5KHG A;  3VQX A;  1NBM G;  2Q7E A;  4R8C A;  5FPR A;  4TQD A;  1V54 B;  2HHH B;  4CS3 A;  2QWP B;  3SJB C;  2EIK B;  5BZB A;  5CA3 A;  1WN7 A;  1PNL A;  2BSK A;  3AG4 B;  1EZJ A;  1XQ8 A;  5JJE B;  3N2K B;  3ZRV A;  2IJI A;  2DWE C;  2QKS A;  5IYZ B;  4JTD B;  4JI0 O;  3OW2 U;  2IBZ H;  1KP2 A;  4UV9 A;  2Q9L A;  5GON A;  2UUB B;  3JAM N;  5EC2 C;  3WG7 C;  1CXZ B;  2XHB A;  1QNM A;  2DWD C;  3ABU A;  1WNS A;  1I0H A;  2YEV B;  4CS2 A;  4XDK A;  2UXB B;  4O4L A;  1DK1 A;  5EYP B;  1FJG B;  2WWW A;  1K9M W;  2GV9 A;  4YJ3 B;  4GCZ A;  1ZTE A;  1EBO A;  2RCV A;  4J11 A;  4GX1 A;  1HNX B;  1IZ3 A;  2BCC H;  2VQF O;  3RWR D;  4FLY A;  3FX7 A;  2Q68 A;  1H8E G;  4JTC B;  4BR6 A;  1OV9 A;  4LNU B;  4LF5 O;  2HG5 C;  2B1G A;  5E1A C;  4CBC A;  1K97 A;  4GYC B;  2YSU B;  1NZ6 A;  4RQE A;  3A0H Z;  2EX3 A;  1AR5 A;  1P4R A;  3P3P A;  3OTO O;  3BPZ A;  1M9N A;  2R9I A;  4DRX A;  2ARH A;  3U0Z A;  2A06 H;  2ZDI C;  1WP8 A;  3SYP A;  2FYU H;  2EJ7 A;  1H38 A;  3ABK B;  1R73 A;  5KUM A;  4D7S A;  2JGU A;  1N4C A;  3JAS A;  4RO2 A;  4DUY B;  5EC1 C;  1H2L A;  3W7T A;  4PA7 A;  2OTJ V;  3CCQ V;  3AK2 A;  3H1K H;  2QWQ B;  2QA4 V;  4PV1 B;  1D5N A;  4TV8 B;  5LOV A;  3JD3 A;  1N0J A;  4LH6 A;  3D3Q A;  3B8N A;  2YXH A;  2M6Y A;  1HNX O;  3OAA G;  4WFA V;  4FLV A;  3W7X A;  3AEI A;  1SKV A;  3CRQ A;  5KUK A;  1CP9 A;  2M7W A;  4QPJ A;  1PP9 H;  5LMN O;  1LUV A;  3HKE B;  4B3R B;  4LFA O;  5IYD O;  1GN2 A;  1K33 A;  2WLH A;  2WLL B;  4J42 A;  4J7K A;  3SJC C;  3GWO A;  2UXB O;  4KHP O;  3VQY A;  1G1X B;  3ZRW B;  1MMM A;  4DV2 O;  4LFB O;  3H1H H;  5LXT B;  4AIL C;  3QO5 A;  2HP8 A;  3SPG A;  4R6Z A;  3WB0 A;  2CDY A;  3A8T A;  1M4U A;  1K8A W;  5KHI A;  4ASU G;  2UUC B;  2EIN C;  2JDI G;  4EFE A;  4K8Z A;  3SJQ C;  2XT9 A;  3LUT B;  2QJ1 A;  1YJW V;  1VQK V;  1TA8 A;  2HHH O;  2KG7 A;  3T2M A;  1LUW A;  1W0J G;  3Q4H A;  4DV7 B;  2ZXW B;  4X64 B;  1XRE A;  4JPR A;  1K4D C;  2ADQ B;  3FB5 C;  5C8Y B;  2YUA A;  4LCU C;  3K57 A;  3U10 A;  1IBM B;  4X1K B;  1DTO A;  2YXY A;  2W0X A;  3QO8 A;  4MW8 A;  5BXZ A;  5EZY A;  2FB5 A;  4LF6 B;  3JAR B;  4O4L B;  4H0L B;  3K0D A;  4DR7 B;  2QWR B;  3CRR A;  1ZWI C;  4N21 A;  1BT8 A;  1R3J C;  2XAJ A;  2DJV A;  2Q5Z A;  3IJ4 A;  3PJS K;  4I55 B;  1E79 G;  5CA0 A;  5DM6 V;  1GRJ A;  2QE7 G;  1XMO O;  4DR2 B;  2B5U A;  2ZE6 A;  1P7B A;  2F1M A;  3DC5 A;  4NXN B;  1XNQ B;  1M57 B;  1I94 O;  4ZI7 B;  4X62 O;  1GK9 A;  2RJZ A;  1GN4 A;  3D8C A;  3CCU V;  5GTI Z;  4C7U A;  4QGP A;  2JJ2 G;  4GX2 A;  4IGG A;  3LDD A;  2LP7 A;  4LWS A;  4LF8 B;  4Z2W A;  2PYL A;  1K34 A;  1DF5 A;  3FKS G;  2WLL A;  4LFC B;  5EBM C;  3ABK C;  5IWA B;  5TIS Z;  5LYJ A;  3RW0 A;  3RYF B;  3L72 H;  5IYC O;  4B08 A;  1FAF A;  4NTY A;  4B7E A;  5FL7 G;  4X62 B;  1XNR O;  1GN6 A;  4O2B B;  1JX9 A;  1MZF A;  1XMO B;  4QNH B;  2Y48 A;  1VP7 A;  3ETE A;  1SF9 A;  2JVD A;  3I55 V;  3JAW A;  3CX5 F;  1N32 B;  2JRI A;  4Q20 A;  2X0L A;  2CTR A;  3SPC A;  2QWN B;  1GM9 A;  1V55 C;  2ETN A;  1D2D A;  2ZD9 A;  1SA0 B;  1QU7 A;  1S5J A;  4JAV A;  5CBH A;  1HWY A;  2Q6A A;  4JYA O;  3FB6 C;  2EIL C;  1B6Q A;  4MSW C;  1Z2G A;  3APO A;  4X64 O;  2OT5 A;  3DC6 A;  5LA6 A;  2ZDI A;  3LNM B;  3RYH B;  3ABM B;  5A9G A;  1N32 O;  1AP5 A;  2ILM A;  3CCM V;  1VQO V;  1YXB A;  4R50 A;  2WLJ A;  2GTA A;  5FNV B;  3AG2 B;  4XDL A;  4F6E A;  5LHG A;  2LGW A;  4LH7 A;  4DR6 O;  1R3K C;  1Q5O A;  2KSD A;  1CPY A;  1HW7 A;  5KMG B;  1XNR B;  3JAL B;  5EK0 A;  3MDS A;  3C3S A;  3M99 B;  2N05 A;  3T4Z A;  4DV2 B;  1G6U A;  4IYI A;  3RFR A;  5IWA O;  4YJ2 B;  3U11 A;  2X6B A;  3WB1 A;  4L87 A;  1M93 A;  2KG7 B;  3E2E A;  1Y67 A;  1LNQ A;  3AG1 B;  2ZE7 A;  3TGU H;  5L3C A;  4JYB A;  1JPX A;  3O9O A;  2EIJ C;  4LFA B;  1TVK A;  1OCZ B;  2YID A;  5L3E A;  2CE4 A;  1OCO C;  4K8X A;  4P9O A;  1BQZ A;  3AG3 C;  3HKD A;  3ASN B;  5EBL C;  1EN6 A;  3ZMV A;  3RYF A;  5B1O A;  3W7S A;  1SZX A;  5J2T A;  1ZUQ A;  4BIU A;  4JI8 O;  3QVN A;  1XOU A;  2PF4 E;  2ZCE A;  3DTU B;  4JI4 O;  4CC5 A;  1JMK C;  1KQS U;  3K0G A;  1P84 F;  3E22 A;  4B7K A;  3ZCC A;  5LP6 C;  1ZAU A;  2YI8 A;  1NR7 A;  2E74 B;  2R72 A;  1B06 A;  2HJF C;  3OD4 A;  2DYS C;  2ZM6 O;  4UCS A;  2GHY A;  3G80 A;  1XBL A;  1VQN V;  1K4C C;  3AG7 A;  3OTO B;  1SES A;  2AW9 A;  2OWO A;  3G4S V;  2W6I G;  1JJ2 U;  4RUF A;  4JI2 O;  2BOB C;  3HKB B;  1Q82 W;  1J95 A;  3RYI B;  3B4S A;  5LMU O;  4G28 B;  1L8D A;  4JV5 B;  2N04 A;  4XDJ A;  4J80 A;  3ZRS A;  4LF5 B;  5IE9 A;  5CBF A;  3HB3 B;  2JK5 C;  5JVD A;  4QPK A;  3ASO C;  4LR3 A;  4GT1 A;  4LFB B;  1FXV A;  2LJ2 A;  2ZIN A;  3FAV A;  4KL1 A;  5GON B;  3ZN1 A;  3K03 A;  3OM3 B;  5IY5 B;  4UFZ A;  4KHP B;  1EM1 A;  2D2C B;  5LA6 B;  1Q43 A;  4TUY A;  1VQL V;  2NLJ C;  3UM7 A;  1NTK H;  1AR4 A;  2H94 A;  4U3J B;  4O4J B;  4O4H B;  4CH5 A;  4B3R O;  4QIW F;  1Y76 A;  3CXC U;  3F5W C;  4HZ3 A;  1ROP A;  3ZS8 C;  4I4T B;  4UCR A;  3G6B A;  1SQB H;  1I5Y A;  4F4L A;  1O9G A;  1FD9 A;  4MVO A;  4JI0 B;  4JTA B;  3CCR V;  4O4I A;  4FFB B;  1WA8 B;  3EVK A;  4MTX A;  3T1H O;  1NU1 H;  1F7Y A;  4JV5 O;  5EZY B;  3ZHR A;  5LMU B;  4FLU A;  4DR3 B;  1S72 V;  3CCV V;  1D5A A;  1IDS A;  2OIG A;  4DUY O;  3CP1 A;  1NQT A;  5H5N A;  1US6 A;  1AI5 A;  3OMI B;  4FPP A;  1TUB A;  2GUZ B;  3WU2 Z;  5IYZ A;  2Q0O C;  3QG5 A;  4GKJ O;  1NTM H;  1ZX3 A;  4DUZ O;  2FL4 A;  5LP6 B;  4LWS B;  2ZM6 B;  1Q8I A;  2GTS A;  1AJQ A;  4FM2 A;  2WLI B;  5KAF Z;  1RP3 B;  1SC5 B;  3F7V C;  1WAZ A;  5IJ9 B;  2Z3Y A;  2LW1 A;  1KD1 W;  1SQV H;  1QBZ A;  2YIB D;  4ZI7 A;  1OHH G;  4ZOL A;  5B1A C;  1CEZ A;  4TSF G;  2F93 B;  1VF7 A;  5EBW C;  2JS5 A;  2AHY A;  3VQV A;  5KHH A;  3VBB A;  2DN9 A;  1PKX A;  4ZOL B;  3SYC A;  3B40 A;  4BAY A;  3OGC C;  5L3F A;  2WLK A;  3S3W A;  3DXR B;  5H2F Z;  1XEQ A;  4MTG A;  3I56 V;  5IJ0 A;  2ITD C;  2P22 C;  3SYA A;  1FJG O;  1BSM A;  2D3O W;  3VQW A;  3JD4 A;  3AG4 C;  1F51 A;  2UUB O;  1AB3 A;  5IJ0 B;  1T5E A;  5EIB C;  1YSC A;  4UCU A;  4DR6 B;  2MW2 B;  2Y0I A;  1U96 A;  5EYP A;  3FB7 C;  2NNU A;  5LXT A;  1KB9 F;  2JEU A;  3CSX A;  1XUQ A;  1YF2 A;  4PDL A;  3P32 A;  1ORQ C;  4MVQ A;  4X65 O;  3D36 A;  4DV4 O;  4WBN A;  4X66 B;  4BWA A;  1PM9 A;  2UXC O;  3OGI B;  2F4V B;  1HNZ B;  3HKE A;  2BSK B;  4DV1 B;  3UO3 A;  4DR1 O;  1M1K W;  5A2Q N;  4EB6 B;  2JS3 A;  4WBN B;  1Q3E A;  4ZKI A;  3K3W A;  3FB8 C;  1R6K A;  3C3T A;  1VQ5 V;  1MAB G;  2JGD B;  1PD3 A;  1AR1 B;  3CME V;  2IJJ A;  4MT8 A;  2LO1 A;  1K92 A;  2JIZ G;  3UCS C;  1J5E O;  4EB6 A;  2VRZ A;  5B5E Z;  5KX5 B;  1K5S A;  2HVK C;  3SR2 C;  3JAL A;  3CB2 A;  5KHK A;  1W59 A;  2IH1 C;  4O4I B;  3CD6 V;  5BMV A;  1KUQ A;  5LP6 A;  4OPA A;  4X1Y B;  2CGO A;  5JJJ B;  1WPB A;  2DYS B;  3A0B Z;  4LF8 O;  1P49 A;  1XDC A;  3SJA C;  3UO2 A;  1NVP D;  4FMT A;  5B1N A;  1UJW B;  1K5Q A;  3HR0 A;  4JZG A;  4WFG A;  2OCH A;  3CEI A;  2R9A A;  4TT3 G;  2UXD O;  4YIP A;  3RBZ A;  3B09 A;  3ABL B;  5LGU A;  4NVP A;  2HFE C;  2L6L A;  1WA8 A;  2KB1 A;  4DR2 O;  2PI4 A;  2UU9 O;  2XAQ A;  1Q6U A;  2IM9 A;  1WPX A;  1VF5 B;  3P30 A;  2DYR C;  2V7Q G;  3OR6 C;  3H1J H;  2LFR A;  4F6R A;  2KKW A;  4PHZ A;  4LF6 O;  1SQP H;  2Y69 B;  5JVD B;  4HNA A;  1VIB A;  4X1Y A;  1XMQ B;  5GW7 A;  1QLE B;  4IL6 Z;  5IY5 C;  2QKC A;  2DW4 A;  3D36 C;  1JR9 A;  5K1X A;  3KCY A;  1M5I A;  3FD9 A;  1YDX A;  2QSA A;  4H33 A;  4DXW A;  2GDS A;  4B3T O;  3E22 B;  2Z0A A;  3DGE A;  1H8H G;  2DQ0 A;  2Q73 A;  2PY5 A;  2F66 C;  5B1B B;  1R3L C;  4FFK A;  1MSD A;  3K5N A;  3MD0 A;  3A0R A;  3W7U A;  3ETQ A;  4I50 A;  1P7G A;  2ZKO A;  2GBO A;  3K59 A;  1FKA O;  3OMA B;  2UUC O;  4YIO A;  1E1R G;  5JCO C;  5KHJ A;  4GZR B;  4FFB A;  2WLN A;  1GTO A;  5E79 Z;  2OYQ A;  1R3I C;  1ENV A;  3K9S A;  1H2N A;  4JI5 O;  5FNV A;  3RVY A;  4I50 B;  1HNW O;  1PNK A;  4DV3 B;  4UCO A;  3FAV B;  1L1F A;  3G67 A;  1TUE B;  1IBL B;  1V55 B;  1S0V A;  3I5D A;  5CN0 A;  5LMN B;  4PJ0 Z;  3STL C;  3STZ C;  1N8R W;  2IJH A;  4UB6 Z;  3B8M A;  1VQP V;  4X1K A;  1SA0 A;  1BHA A;  1R1B A;  1S77 D;  5K1P A;  2YIA A;  1Y66 A;  2HR3 A;  3FFQ A;  2H3O A;  4ZBM A;  4JI1 B;  2PI5 A;  2IU3 A;  4LF4 B;  3ZN0 A;  1XI1 A;  3AG3 B;  1KEC A;  2K1E A;  1N33 O;  1EFR G;  4QE9 A;  2WA3 A;  1YCI A;  4JI3 B;  4K3A A;  4KUM A;  2CGN A;  3M8A A;  2PYJ A;  2ITC C;  3JYC A;  1QR8 A;  4LF9 O;  4A5U B;  4DR5 O;  1S76 D;  3BVO A;  1DLB A;  3ICX A;  4BIZ A;  2ZIO A;  1FS0 G;  2VQE B;  4O2A B;  3APQ A;  4JYC A;  2CTW A;  3CRM A;  2VWJ A;  1KKD A;  2DOS A;  1YTF D;  4LF7 B;  4WFF A;  4BW9 A;  3H1I H;  2CH7 B;  3CC7 V;  1NVP B;  4CC6 A;  2ZNI A;  2OTL V;  3CWB H;  3L74 H;  3NR7 A;  3DSQ A;  3CXH F;  2VQF B;  4DW0 A;  3BEH A;  2XAH A;  4PDM A;  4D7T A;  1HR0 O;  4PA9 A;  3CS5 A;  1VF6 A;  3K5O A;  4TV8 A;  1AJP A;  3EXA A;  4DV0 B;  2EBO A;  2LW7 A;  4AQY O;  2ZXW C;  5J2U B;  1I5X A;  1Q6H A;  2HKO A;  1OZ0 A;  2UUA B;  3UKM A;  3C90 A;  1M56 C;  3H01 A;  1I08 A;  1IBK O;  2P67 A;  1RSO B;  1GN3 A;  2X7R B;  4JZ2 A;  3JAS B;  2O57 A;  4TV9 A;  2Q0A A;  1MSW D;  4PDR A;  5JH7 A;  4CH4 A;  1PNM A;  1B04 A;  5F2V O;  5CA1 B;  1ZSP A;  2YS8 A;  1NS1 A;  2IJK A;  1AI4 A;  2QWO B;  2GSM B;  1OJH A;  5LHI A;  1XL6 A;  3E86 A;  1V54 C;  4GX5 A;  4R7C A;  1KU9 A;  4HYO A;  2QM7 A;  5D5Q A;  1SRY A;  1ZLZ A;  4JAA A;  4TWK A;  3L73 H;  4TUY B;  3THO A;  1GKF A;  2RQ6 A;  4B3M B;  2EZO A;  1Y6X A;  1YTF B;  1AIL A;  4JF3 A;  1TAE A;  3RN4 A;  5BR8 B;  3SPJ A;  3ABT A;  2NN4 A;  4DV5 B;  5H6R A;  3IC7 A;  3JAT A;  1UPG A;  3OUF A;  2UXN A;  5BR8 O;  3RGB A;  2CK3 G;  2QGN A;  5EIB D;  4W4K A;  3N2K A;  4WCE V;  2WLI A;  5KLV H;  4TQF A;  1UFI A;  4PI0 A;  4YY3 B;  2DYR B;  1VAR A;  2YC0 A;  2B1I A;  3JD1 A;  1GMG A;  3BFR A;  2FKX A;  1L0L H;  1N0N A;  2VS0 A;  2EIM C;  4I0X A;  5JWP A;  3OUS A;  3TXS A;  5DN6 G;  2Q8V A;  3BA8 A;  1URF A;  5LBQ A;  1QHT A;  1QVG U;  2ZQM A;  1SET A;  4DV6 B;  2AZ0 A;  1LR1 A;  3OEE G;  1VMG A;  4NKG B;  4Z1V A;  1Q81 W;  1RPR A;  4MVZ A;  1FFT B;  2XAG A;  4HNA B;  3L71 H;  2A0L A;  4AQY B;  4KP4 A;  5L3D A;  1BGY H;  1YIT V;  3MHH C;  2AZ2 A;  3HPL C;  3JAW B;  2WA4 A;  3CCS V;  2E5L B;  4FZ1 A;  5CMU A;  3SPH A;  4NR1 A;  4P2Z A;  1Q7Y W;  1B3Q A;  1PPJ H;  3JAK B;  4X20 B;  3ZHQ A;  3N2G B;  1VEW A;  1TVK B;  4ABM A;  2CTQ A;  1HDJ A;  4U3F H;  1HP8 A;  4K0K B;  3JAK A;  2XAF A;  4X20 A;  3BA9 A;  3TK1 A;  3A2F A;  3BAB A;  5JCO A;  2R70 A;  5J9P C;  3K08 A;  3LSQ A;  4J7Z A;  3CC2 V;  4RQF A;  3JCU Z;  3ZMZ A;  4YHH O;  1G8M A;  1U97 A;  3AG1 C;  1N34 O;  1VQ6 V;  4PDV A;  3E8F A;  2Q69 A;  2QKA A;  2VQE O;  4B3S O;  4P30 A;  2E75 B;  1PV0 A;  4O2B A;  2UXX A;  5HFM A;  4QE7 A;  4OXS A;  3ZRX A;  4UXN A;  4JI6 B;  3EHB B;  4UVA A;  2Q67 A;  4TOI A;  2XTA A;  3TCU A;  2HJD A;  3K79 A;  3JD2 A;  3M7M X;  1SS3 A;  3LSU A;  5C93 A;  4FM0 A;  2P6J A;  4JGS A;  4LF4 O;  4JI1 O;  2DQ3 A;  3L75 H;  4FLT A;  4PEL A;  1AP6 A;  3LSS A;  1YJ9 V;  2R9R B;  3T4D A;  1NJI W;  4MVU A;  3E8B A;  2F23 A;  1JVM A;  3Q4H B;  2EIL B;  1H2S B;  5GTH Z;  1JFF B;  4NXM B;  3K9A A;  2P7T C;  2EUL A;  4DV3 O;  3ZMU A;  4G2K A;  4JI7 O;  4UV8 A;  1IUR A;  1H2K A;  4OX9 B;  4JI5 B;  4DR4 B;  3OTF A;  1BS3 A;  5H6Q A;  1FXH A;  1WB7 A;  1W0K G;  5B3S C;  4UVC A;  4FM1 A;  1NI8 A;  2ZNJ A;  2HVJ C;  2ODM A;  4FVM A;  2Q4P A;  3T1Y O;  2ZE8 A;  2EJR A;  5B1A B;  1F4M A;  1RFY A;  1WJZ A;  2F95 B;  4E2L A;  2BE3 A;  1Y74 A;  1S3J A;  4DW1 A;  4JAU A;  3IAY A;  1EZV H;  4MW3 A;  1R6N A;  3LNN A;  4IHJ A;  4JI6 O;  1DF4 A;  3AK1 A;  4J9Z B;  3ZX6 A;  1BL8 A;  3GVM A;  2Q7H A;  3R66 A;  3K5M A;  3RYI A;  1AVM A;  1QCE A;  3JAT B;  3AK3 A;  5B66 Z;  1OCR B;  2K9P A;  3CMA V;  1S5H C;  1N36 O;  5CA0 B;  1Y4M A;  1XMQ O;  2BTQ A;  1M56 B;  2EIN B;  2IW5 A;  2FML A;  1QLE C;  2P5O A;  1M57 C;  4ICG A;  2IH3 C;  3ML0 A;  4UB8 Z;  3W7W A;  4L8J A;  1R6T A;  3BCC H;  1ZL8 B;  2AHZ A;  5C8Y A;  1MZE A;  2YIB A;  1SER A;  4WFB V;  3CPW U;  2E76 B;  3TJT A;  3HKB A;  3E35 A;  3L70 H;  2A3Q A;  1F4N A;  2YXL A;  4IHJ B;  3J7A U;  1RM1 C;  2UXD B;  3H1L H;  1Z5V A;  4OX9 O;  2AXT Z;  4JI7 B;  1V9P A;  4JAS A;  4X88 A;  4DRX B;  1BE3 H;  3ZJZ A;  4J7J A;  4G27 B;  4H44 B;  3PN1 A;  3KZI Z;  1Q86 W;  3KG2 A;  3SYQ A;  3IFX A;  3FYE B;  4PA3 A;  5LHH A;  3WB2 A;  2FTK A;  2PTM A;  2QM8 A;  1JJO A;  5J2U A;  2HLD G;  2Q7G A;  3K06 A;  3WFV A;  1BHB A;  1KP3 A;  1Z5W A;  3CRC A;  5HFL A;  3E8G A;  1GO3 F;  3X2Q C;  4PI2 A;  4YJ2 A;  3QF7 A;  1MNG A;  2RDC A;  3ZRW A;  4DK0 A;  4GKK B;  4NB5 A;  1Q90 D;  4DO2 A;  5KMG A;  1FFX A;  2DMX A;  3MAQ A;  1I7F A;  5DEC A;  1VQ7 V;  3CCJ V;  2QTO A;  4QJF B;  4W4L A;  1X4T A;  4B3S B;  4IYH A;  1N34 B;  1TGO A;  4EEQ A;  1KYO F;  4DV5 O;  3TXQ A;  2G38 A;  1OCO B;  3ABL C;  1GM8 A;  4DV4 B;  1RPO A;  4I4T A;  1K7D A;  2JJ1 G;  5B3S B;  3ETG A;  4B3M O;  1OCZ C;  3N27 A;  3ETD A;  4ZHQ B;  1QR9 A;  2E3C A;  1FXK C;  3B2E E;  2DE0 X;  2Y4U A;  4O4H A;  2ZT9 B;  2WSS G;  5BY1 A;  3CRA A;  1THZ A;  3OFN G;  4ZHQ A;  1H2G A;  2ADP A;  4FIP C;  1IX9 A;  2CH7 A;  2IU0 A;  2P90 A;  4X1I A;  3IC9 A;  1GM7 A;  2E5L O;  3G71 V;  4P9P A;  4FJC C;  4LBE C;  1Q6I A;  2ZE5 A;  1YI2 V;  3CYO A;  1IBK B;  3HKC A;  1OCC B;  2XND G;  2UUA O;  4UCV A;  5L3B A;  3ABM C;  3QO7 A;  4DV0 O;  2WPD G;  4LNU A;  2B9Z A;  1A32 A;  5ITZ A;  3CCL V;  4DV6 O;  3RYC A;  1HR0 B;  3UT5 B;  4N23 A;  3J80 N;  4BW5 A;  2GUZ A;  1WLE A;  1AJN A;  2VWK A;  4I5S A;  3UT5 A;  1E1Q G;  4PA6 A;  4TV9 B;  5H9C A;  5FLX N;  5JH7 B;  4ZIB A;  2EZP A;  4MTO A;  2WLM A;  2X6A A;  2A79 B;  1COW G;  2LQT A;  4I9W A;  2ATK C;  3UQ8 A;  1JA8 A;  2LFS A;  4GX0 A;  2W0F C;  1SQG A;  2ZIM A;  4PD4 F;  2CUG A;  3IGA C;  3ASN C;  4GKJ B;  1AI7 A;  2OCC B;  3ZHT A;  4F6R B;  3S3X A;  3OMN B;  1KKC A;  3OE7 G;  1JCH A;  3RYC B;  1BCC H;  1XHZ A;  4DR5 B;  3ZED A;  2L35 A;  4JI3 O;  4DR3 O;  3D3I A;  4GKK O;  4RWU A;  3T1H B;  4YXW G;  2QEX V;  4PA4 A;  2NR5 A;  1YIJ V;  3R65 A;  1FXK B;  4GLX A;  2PZS A;  1OCC C;  4CH3 A;  4AHC A;  3RT3 C;  1WB8 A;  2EIK C;  5JQG A;  1JOY A; 
#chains in the Genus database with same CATH homology
 1PP9 H;  1SQB H;  1PPJ H;  1BE3 H;  1SQX H;  3H1K H;  4PD4 F;  3BCC H;  3CWB H;  3L74 H;  3TGU H;  1NTK H;  1L0L H;  1NTM H;  2A06 H;  4U3F H;  1KYO F;  3L71 H;  1NU1 H;  2FYU H;  3CXH F;  3L73 H;  1L0N H;  1BGY H;  1BCC H;  3H1J H;  2IBZ H;  1KB9 F;  3L75 H;  3L70 H;  3CX5 F;  1SQP H;  1P84 F;  3H1I H;  3L72 H;  1SQQ H;  1EZV H;  4D6T H;  3H1L H;  1NTZ H;  5KLV H;  3H1H H;  1SQV H;  2BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...