3I55V

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i55V00
5DM6V 1YJWV 3CC7V 3CC2V 1K8AW 3CMAV 1S72V 2OTLV 1VQ8V 3CCMV 4WF9V 1M1KW 1VQLV 1NJIW 1VQ4V 2QEXV 3CCLV 3CD6V 1YITV 3I56V 1YIJV 2OTJV 1YJ9V 3G6EV 1QVFU 3CCUV 3CCRV 1R73A 1VQOV 1YJNV 1Q86W 3G71V 3CCSV 3CCEV 4WFBV 1K73W 1VQKV 1JJ2U 4WFAV 1M90W 1VQ6V 3CCJV 1VQ5V 2D3OW 1Q81W 3CMEV 1VQ9V 4WCEV 1QVGU 1YI2V 1N8RW 3CC4V 3OW2U 1Q7YW 1KD1W 1KC8W 3CPWU 1K9MW 3CCQV 1VQMV 3CCVV 1KQSU 1VQNV 1VQ7V 1YHQV 2QA4V 1Q82W 3G4SV 3CXCU 1VQPV 1W2BU 3I55V
chains in the Genus database with same CATH superfamily
4L8JA 2YEVA 2HJDA 2GBOA 2KKWA 3CWBH 3G80A 1FS0G 4JV5O 4B3RB 2F93B 3CX5F 4R50A 2WLMA 1EN5A 2E76B 4IGGA 2KB1A 2GDSA 4Z1MG 2QJ1A 1AROP 4X62O 4JI7O 2ZNIA 2QKAA 4X8AA 4DR7B 2BTQB 2OIGA 3CRRA 4J9YB 2Y69C 3HKEA 3T1CA 2PZSA 1XILA 4ASUG 2WLIA 3ZIAG 3ZN1A 1ZSPA 2HR3A 2NR5A 2LGQA 2CE4A 5EBLC 1EM1A 2ZR2A 4HYOA 3P32A 3IC7A 2Q73A 1RPOA 1KYOF 3BCCH 5CMUA 3CCRV 1KP2A 4MVQA 1NTKH 3OUFA 2Y4TA 2EINB 4DV3O 3B40A 2X0LA 1NVPD 4TV9B 2RDCA 2QSAA 1YDXA 5IYDO 5B66Z 2ZXWB 3APQA 3JATA 3K9SA 3VQYA 3E2EA 5JQGB 4DRXA 4C7UA 1P7GA 2UUAO 4BIUA 3SR2C 4FM1A 1K8AW 3GWOA 1NJIW 2Y0PA 4X64O 5JCOA 2FTKA 5KHHA 1KBHA 3HR0A 3G67A 1BHBA 1QLEB 3JD1A 4JI8O 1GN4A 4O4HB 4PA7A 3U0ZA 1FFXA 4DUZB 1V55B 4B7EA 2EIKB 5CBFA 4B3TB 2W6IG 1Q6UA 1NZ6A 2P90A 3AG3C 1AILA 4ZBMA 3RYFA 2FL4A 4HBNA 1U97A 3AG2B 1TVKA 1SQFA 2F4VO 1XL4A 1SKVA 4LF8B 4X1KA 5IYBO 1YJNV 1K73W 4X62B 1ZL8B 5F2VO 1M56B 3DSQA 2CK3G 5L3CA 4FPPA 5B3SB 1VF5B 3C3TA 4TQDA 2A7WA 5IYZB 3CRAA 4DK1A 1AJNA 3CRCA 1PP9H 5TISZ 2EZPA 4DV6B 2XAHA 1Q6HA 2YUAA 5H6QA 2YIBA 1XMOB 3BHPA 4QE7A 2QR4A 4CS4A 3CJHB 3L71H 4LWSB 2QM7A 5LYJB 2ZD9A 2RN9A 3BABA 4EFBA 1R1BA 3QF7A 4MTGA 3ZHRA 1K3EA 4O2BA 3ML0A 2P6JA 4JI7B 5B3SC 2Z3YA 5K1PA 1LUWA 1VQ8V 1IBLB 5GTIZ 2RNBA 3OGCC 1WPXA 3OUSA 1VQKV 4X1IA 2Y48A 4DW0A 4WBNB 3OD4A 3D8CA 3JALA 3JSNA 2K1EA 3CS5A 2XTAA 3F7YC 2IM9A 2B1GA 3UO2A 2NLJC 2HKOA 3CP1A 2ZDIC 1WLEA 2BOCC 1YJWV 5KLVH 3JARA 1IXBA 4LF9O 1DF5A 3BVOA 3LNMB 2HG5C 4IT5A 4EB6B 2UUAB 4TV8A 4W4LA 1FD9A 4JI1B 4K0KB 3MHSC 4JYCA 3SPJA 4PDLA 2LGWA 1OHHG 4DR5B 3HKBB 4JASA 3ETDA 2H3OA 3TETA 3CC7V 5EC1C 1GN3A 4B3RO 5EIBC 3CCMV 1R6NA 4O4LA 2UXBB 5HFLA 3H01A 3JASB 4X1YA 3B4SA 1QU7A 2Y69B 4O4IA 1WB7A 2O57A 2NNUA 2D3OW 3E22B 4U3JA 2EJ7A 2GSMB 1H2GA 3VQXA 3HKCB 2QEXV 4FFBB 4X88A 4UCOA 1MMMA 1JCHA 2HVKC 2ITCC 3H1HH 5EZYA 4J7JA 2F43G 1SZXA 4I0XB 3EVKA 3J81N 4ZIBA 4UXNA 1GK9A 3LDEA 5LYJA 4P30A 3FB6C 3W7WA 2EBOA 5J2UA 1BZKA 1LR1A 4JI4O 3OGIB 5JJJB 3HKCA 4X66O 1IDSA 4E2LA 4WFGA 1K97A 2PGGA 4UV8A 5IWAO 4WFAV 1H2NA 5LP6A 1UJWB 3SJAC 2QWNB 1JVMA 3JD3A 4DXWA 5EK0A 4ZI7B 5JVDB 1UFIA 1N4CA 3W7UA 5LGTA 1B04A 1EZVH 1YVWA 4IL6Z 4WFHA 4I0XA 1FPOA 1GMGA 1H2KA 1VP7A 4DV1B 4P9PA 4FK5C 3K03A 1VQ6V 1M5IA 1Y6XA 2ZNJA 2D2CB 3C3SA 1N8RW 4FLVA 4LF8O 4GKKO 2GTSA 1CP9A 3RYCB 2DW4A 3K5OA 2IH3C 1BSMA 3P30A 2N04A 2UUCB 3JAMN 1XNRB 1ZLZA 2ADPA 4LC1A 2UU9B 4MVRA 2F66C 3FYEB 1QNMA 2PUSA 4TQFA 3SDLA 1GM9A 2A9HA 4JI3O 4TV9A 1R6KA 4FLYA 1ZWIC 3TXQA 5LOVA 3DTUB 2EIMB 3OR6C 4LP8A 5EIBD 5EBWC 3B77A 3AG7A 1H2SB 1MSWD 5C93A 4QPJA 1YCIA 4X64B 5D5PA 2Y0IA 3JAWB 2B9ZA 2IJHA 1KUQA 2VWJA 4LCUC 1E1QG 4BW9A 1K5SA 1KC8W 4JI4B 1T5EA 3WB2A 3CCQV 2IU3A 5FNVA 3C90A 2EJRA 4EFEA 3T1YB 2AW9A 4KP4A 5CB4A 5LP6B 4CBCA 1L0LH 2RJZA 1B06A 1PD3A 3B09A 3CHXA 1KECA 4PHZA 1Y4MA 3A0BZ 3FAVB 3D3IA 2Q4PA 2A3QA 4FIPC 1W2BU 1WJZA 1GN2A 3KCXA 1I5YA 1RP3B 4NXMB 1Q5OA 2JDIG 3QVNA 5EC2C 2BE3A 5LGNA 1Q6IA 1R73A 3OE7G 1AJPA 4UCVA 2UXXA 1PL4A 4FM2A 1Q81W 3RWRD 4I4TA 3AG4C 1K4CC 2WLKA 1BT8A 1ROPA 4LR3A 5C8YB 1EN6A 2QGNA 4JYBA 1FXKA 1QQCA 2P67A 4U3FH 1W0JG 1Z5VA 3FX7A 3KCYA 1OJHA 1YJ9V 4QE9A 1OCRC 1DF4A 2H94A 1NT2B 4G28B 1ZL8A 2FKXA 3R66A 3RYIA 1NH2B 2KSDA 4DV0O 4LF7B 4TOIA 2RMKB 1QBZA 3SJQC 1VQ9V 2MK3A 3B2EE 1FXKC 2XT9A 2ZIMA 5LMUB 4B3SB 4FFKA 2CH7B 3A2FA 4O4JA 4BW5A 1VQ4V 2PYJA 1YITV 4YHHB 3RYIB 1NH2D 3ZRSA 3T1HO 2CTRA 4I50A 1HNZB 1IBMO 1N0NA 1OCOB 4X9QA 3ZHVA 2P4KA 1TUBB 3FKSG 1I7FA 1MA1A 5FPRA 5LXTA 3H9VA 3CRQA 3BEHA 1SRYA 2KQXA 4I4TB 3HKEB 1AJQA 4LF6O 4DR2B 2A0LA 2VS0A 3FD9A 1NR1A 2CGOA 4LNUB 3ZHTA 1JFFB 4X66B 1SESA 2DYSC 3N2GB 3ABKB 4GKJO 4AQYO 4H13B 1NKDA 4JAVA 1Q3EA 4XDLA 5JCOC 4DV6O 4DR1O 1NBMG 4CH5A 4WF9V 3E8GA 4I9WA 2Q68A 1BCCH 1KKCA 3VQVA 3BRCA 4X20B 3ZRXA 5LMNB 5DN6G 2OWOA 4RO2A 5J2TB 4DR3O 2F23A 1AP5A 3TGUH 4NB5A 3BFRA 4J7ZA 1VIBA 4PA9A 3SPCA 2VQEO 2X6BA 2IBZH 1SETA 3MAQA 1IURA 4JI5B 4JZ2A 4ZHQA 1JMKC 4QJFB 4B3SO 1VF7A 4XDJA 3HB3B 1E79G 1XQ8A 3ZS8C 2BTOA 1SQXH 2XAJA 4G2KA 3TCUA 4B3MO 2QM4A 4GZRB 4DUYB 2GTAA 5JJEB 1ZUQA 2JGDB 2M7WA 1X4TA 5A9GA 2YXHA 1TUBA 4DO2A 2WLLB 1SQPH 1N34B 4JTAB 3ASOB 4JAUA 4UVBA 1QCEA 4DR2O 1YHQV 1IBMB 2E5LO 3OEEG 4DR6B 3B8MA 3SGIA 2A06H 4O4JB 1TA8A 3P3PA 5HFMA 2UUBB 4FVMA 2P7TC 1J5EB 4LF5O 2XUMA 1YSCA 3L70H 4CS3A 2AXTZ 4UB8Z 5EBMC 4TUYB 2V4DA 2LFSA 4NVPA 1M57B 3IAYA 2V1DA 1AI7A 1ORQC 1MNGA 2E5LB 3ABTA 1I0HA 1J95A 4Q6GA 4DV2B 1FXKB 1S77D 1XHXA 5C8YA 3CCJV 2N74A 3M99B 3LUTB 4MVUA 3ZHSA 4FZ0A 4DR7O 1R3LC 2EILB 4B3TO 4JF3A 5BY1A 4PV1B 3TXSA 4JI0B 1F4MA 3J80N 4O4HA 1WP7A 3BA9A 3UO3A 1AVMA 3HPLC 3L75H 3CMEV 1JJOA 1JOYA 2Q5ZA 3CPWU 4YHHO 3IFXA 3E83A 4I50B 5JQGA 4BAYA 1RFYA 3K04A 1SERA 2JVDA 5CA1A 3ABUA 3QG5A 2YSUB 3WG7C 3T4ZA 3K9AA 4HNAA 1UPGA 1TGOA 2K9PA 2R72A 3JASA 1M90W 3A0HZ 4J11A 3MHHC 2W6JG 4DV4B 1X59A 2X7RB 2M6YA 1VQNV 5DECA 2ZM6O 5BMVA 3H1KH 4IHJA 3BAAA 4UVAA 4FLWA 2F1MA 1VF6C 1VQOV 4AQYB 2WLIB 1P4RA 4Z1VA 2P4VA 1Y74A 4GCZA 4GX2A 5KMGA 1FYJA 5EYPA 5LHIA 3VBBA 4CZZA 1XBLA 3CXCU 1V54C 4GX5A 3CC2V 4J80A 3RGBA 2OTLV 4RQFA 3JD0A 2VQFB 4CH3A 3LSUA 1SZTA 2IJJA 4X1IB 2AGAA 5KHJA 3CCEV 4K35A 1XMQO 3AG1C 1M4UA 1W59A 3HKDB 2YS8A 4ZOLA 4O2AA 1SA0B 1HW7A 4YJ3B 1OCCC 1AI5A 1COWG 1L0NH 1R3KC 2Y4UA 1PNLA 4IYIA 4GUNA 2QWOB 1K33A 2ZCEA 1AR4A 1RSOA 1EFRG 3CMAV 4L87A 3D3QA 3T1HB 5LA6B 3U11A 2JGUA 5IY5C 4R8CA 2E74B 4FLXA 4LFBO 3CSXA 3WU2Z 3OTFA 4NTXA 2CAZC 1FAFA 3CRMA 4D7TA 2HHHO 4B3MB 1XOUA 2JS3A 3K0GA 1H8HG 1N36B 3D36C 4YY3B 3ZMZA 4DR1B 1HR0B 1H8EG 1KMIZ 1HNWO 1SC5B 4TSFG 2QDOA 4KFMA 2C2AA 3RVZA 2XAQA 4J42A 2ZDIA 4JTCB 1GO3F 1B6QA 2Q0AA 3ABLB 3RYFB 4TT3G 2Q7EA 4JZGA 2JJ2G 4CC5A 3SYOA 3FFQA 2YI8A 1SQGA 2WLLA 4FJCC 4G27B 3F5TA 3E22A 5B1NA 1S5JA 3H1JH 5KHIA 1S3JA 5H9CA 4MVMA 1GN6A 1L1FA 3DC6A 3OEHG 3JATB 1NI8A 2OT5A 5KMGB 2EULA 2BCCH 4JI1O 2Z5UA 5ITZB 2DOSA 1BGYH 1Y74B 3RW0A 3G6EV 4I55A 4P9OA 1GKFA 3ZRVA 5CBHA 2WLJA 1MABG 2GUZA 1IZ3A 3MD0A 1PKXA 2JS5A 4YIOA 3ZHQA 3DGEA 5JVDA 1G8MA 1YI2V 4KHPO 3K5MA 4B08A 4EB6A 3S3XA 3T1YO 5FL7G 1RM1C 3UKMA 5CB4B 3JARB 4UUJC 2OYQA 2HFEC 4PA4A 1LUVA 1WN7A 5KX5B 4QNHB 2QKCA 4K8ZA 3GB7C 1IBLO 5GTHZ 5KX5A 1WPBA 4BR6A 4MSWC 4QIWF 4ZI7A 4JI2B 4YY3O 4DR6O 3LSQA 3ZCCA 1S76D 4MW3A 4JYAB 2W0FC 3N2GA 3ABMB 1BMFG 4JPRA 4LNUA 4R7CA 4UVCA 1THZA 2LW1A 1HNWB 3ETEA 2EILC 2Q7HA 2XHBA 2FYUH 2KG7B 1SS3A 3ASNB 3K5NA 4DV5B 1IBKB 1OZ0A 3QNEA 4LF4O 3AG1B 2GV9A 5EYPB 3AG3B 4CS2A 2QE7G 4PA3A 4O4LB 1GM7A 5KA5A 2ZE5A 3K79A 1XMQB 3I5DA 2DYRC 2LQTA 1XI1A 5KUMA 1BL8A 1BQ0A 2R9IA 4IYHA 1R3JC 1NTZH 4I7ZB 3TK1A 1OV9A 2CH7A 3H1LH 2YIDA 1XNQO 4PDRA 1HWYA 2XASA 2ARHA 1I5XA 2HJFC 1Z2GA 2RQ6A 1G4YB 4JI8B 2IW5A 1Y66A 1NVPB 3IC9A 2OCHA 4JI6O 2ADQB 1VQ5V 1K92A 1EZJA 2IJIA 4UCUA 5CA1B 3X2QC 1TUEB 2R70A 1NR7A 4B7KA 5IJ9A 3J7AU 1K4DC 4NR1A 5E79Z 3CCLV 4H37A 2JK5C 2PY5A 2JGDA 1N33O 1PM9A 4DV2O 4MS2A 5IWAB 1RSOB 1V54B 3L74H 1XMOO 4CH4A 3OT7A 1ZX3A 4FM0A 2Q6AA 2QTOA 2PI4A 3OMNB 1M56C 4PELA 5FPOA 4JI0O 4WFFA 3A0RA 3KKYA 1IVSA 2NN4A 1VARA 1N33B 1CXZB 3AG2C 2BOBC 3QO5A 2P5OA 1I08A 3CC4V 4Z2WA 4W4KA 4YIPA 2B5UA 4X1YB 1PV0A 1N34O 3JYCA 3ZHUA 2CGNA 3SYCA 2Q69A 2G38A 1Q86W 4X65O 1QR8A 5CA0A 3O9OA 3SYQA 4IIJA 4DR4B 3ZMTA 5D5QA 3D36A 2L6LA 3S3WA 2JJ1G 4I55B 3CE2A 5LOVB 1VQPV 4PJ0Z 1AI6A 5L3FA 4YJ2A 4DV7B 1OCZB 2DQ3A 1YIJV 4LH7A 5B1AC 1K34A 4LFCO 3OAAG 1RM1B 3CCSV 3SPHA 4DV0B 1MZEA 2YXYA 4JI2O 4HNAB 3VQWA 3JCUZ 4K8XA 1K7DA 5KAIZ 1OCRB 4DV1O 1XNRO 4NTYA 4WBNA 3APOA 4FMTA 2ZM6B 3RYCA 5JH7A 4EEQA 3U10A 3VOUA 4DR3B 1FKAO 4LF7O 4ZHQB 1QHTA 1HNZO 3G71V 3IGAC 4GYCB 2PTMA 3JD4A 4CH6A 3ZMSA 2VRZA 4LFAB 3FB7C 2DE0X 2OIEA 4PI2A 4JYAO 5CBGA 3N2KA 1MSDA 4A5UB 1Q90D 1SF9A 1S0VA 2F95B 3CD6V 4OPHA 4MVSA 3P3NA 2DWEC 1WNSA 2ZXWC 2AHZA 4E4EA 4LBEC 2CTQA 1P84F 1MG1A 3T2MA 3OTOO 5GONA 3OM3B 4U7OA 5J2UB 2EIJB 3F5WC 3GWKC 4DV4O 5AG2A 3OR7C 4NKGB 2DN9A 5LMNO 1H38A 4LFBB 4AI8A 1XHZA 3X2QB 3ZJZA 1JJ2U 1NS1A 2EIMC 4UCRA 1FFTB 1XNQB 4YJ3A 1FFXB 1HP8A 2ATKC 3E86A 4DV7O 3L73H 5KHKA 5LMUO 2R9AA 2BSKB 1ZTEA 4UCSA 5B1AB 3Q4HA 5DEDA 3IJ4A 2VWKA 2YEVB 4U3JB 3E8FA 4RQEA 3UM7A 1BHAA 3BA8A 4RAIA 4BWAA 3AG4B 4DUYO 3SYPA 4H44B 2P06A 4MVZA 4JAAA 1XUQA 3WB0A 3ETGA 4LFCB 1YZBA 3L9DA 4FLZA 1F23A 2DYSB 1S5HC 1MOFA 4D6TH 2ITDC 4YJ2B 3STLC 3GVMA 4IHJB 5BXZA 5BZBA 3ZMVA 3THOA 2VQFO 5BMVB 2A79B 3RBZA 2F4VB 3E8BA 2WSSG 3K06A 2Q8VA 4ZKIA 3AEIA 3CB2A 1URFA 5KUKA 1D5NA 2LP7A 5IYCO 4EKWA 5JH7B 3F7VC 5BR8B 1D5AA 1GM8A 2RCVA 4CC6A 1BS3A 2Q67A 3R65A 4N23A 1CPYA 1EBOA 2E3CA 4X20A 3A8TA 1P49A 4JGSA 4AHCA 4GT1A 2LJ2A 1FJGB 2V7QG 4GKKB 1CEZA 1SQVH 4O2BB 2XOKG 1JFFA 4IIJB 3RVYA 3JCZA 5CA0B 4KL1A 2ODMA 4JV5B 2Q7GA 2X6AA 3JAKB 2LFRA 4NXNO 1SQQH 1U96A 2FMLA 3ZEDA 1GH6A 2MW2B 2ZE7A 1DGSA 2JEUA 5FLXN 5LP6C 4GKJB 1R6TA 1YTFB 2WA3A 3N27A 4N21A 4OGQB 3CCUV 2B1IA 2ZE6A 3E89A 3CXHF 4NYKA 2XAGA 2XNDG 2UUCO 2QM8A 1R3IC 3UCSC 3ZRWB 2N05A 3JSLA 1JX9A 4FLUA 2WWWA 4LF4B 1PPJH 2Z0AA 1S72V 5ITZA 1QLNA 4DR5O 3W7XA 1J5EO 4LF5B 2QKSA 4PD4F 2HHHB 5EZYB 3RYHA 1GTOA 5LGUA 2WPDG 2EX3A 4X65B 5LXTB 1KKDA 1G6UA 1N36O 2ZIOA 4DV3B 2UU9O 4PA6A 3WG7B 2AHYA 1YF2A 3OW2U 2Q0OC 1OCZC 4QPKA 2E75B 1AR5A 1K5QA 2BSKA 1P7BA 1Q82W 1M93A 2H8PC 2DQ0A 2QWQB 3M7MX 4O4IB 4UFZA 5LBQA 4FLTA 3RYHB 4PI0A 1JQ0A 2YDEA 1DLBA 5B5EZ 1O9GA 4F6EA 4TWKA 1V9PA 3UQ8A 2JRIA 1G1XB 1WAZA 2CTWA 1HNXB 1YTFD 2HLDG 1LNQA 1N32O 1XL6A 3OTOB 4YXWG 4ABMA 1B3QA 3I56V 4TV8B 2UXNA 4MTFA 2ZQMA 2JIZG 5JJNB 1MZFA 4WCEV 2LO1A 3OMAB 5H5NA 3ZMUA 3NXSA 2ZT9B 1VEWA 4F6RA 2PI5A 3JALB 2EZOA 4DV5O 1PL0A 1IBKO 1GRJA 5KHGA 1GAXA 4DUZO 3W7TA 1F51A 4KHPB 3EXAA 3ETQA 2UXDB 1NQTA 4NXMO 1E1RG 1WA8B 2EIJC 3FAVA 1QR9A 1SA0A 3BPZA 1WA8A 1HNXO 4ZOLB 5BR8O 1KD1W 4FFBA 1AP6A 5H2FZ 2JEXA 1AB3A 1Q43A 2LW7A 5CA3A 4DYLA 3QO7A 2WA4A 3ASOC 4J10A 4JI5O 4MW8A 3RFRA 3E8HA 3ZN0A 4MTOA 3QO8A 2VQEB 3H1IH 1Y76A 5IJ0B 4GX1A 5IJ9B 1IX9A 1XEQA 5L3DA 3DXRA 3JAWA 3QTCA 3LDDA 1F7YA 5KAFZ 3FYIB 1ZAUA 1M57C 3OFNG 2CDYA 2YI9A 2GUZB 4UCTA 3K58A 3K3WA 5IY5B 3L72H 5IJ0A 3E35A 2UXCO 5K1XA 1K9MW 1VMGA 4JI3B 3PN1A 1ENVA 3RN4A 2HEPA 1PNKA 3K0DA 3EFFK 1VQLV 5B1BC 3K59A 1S5LZ 4H0LB 4PDVA 4MTXA 1O9HA 4OXSA 1JA8A 4NTWA 1Y76B 3KG2A 1YEWA 1FXHA 4DRXB 4RUEA 1VQ7V 4NXNB 4AILC 5LA6A 4DR4O 3I55V 5DM6V 3AK1A 3UT5A 2ZE8A 3MDSA 3TJTA 3UT5B 3T4DA 4BIOA 1AI4A 1AR1B 4LWSA 3ICXA 3OMIB 4PDMA 3ZRWA 2ETNA 1VF6A 1QVGU 1XREA 2UXDO 1H2LA 2PF4E 1VQMV 4RUFA 5GONB 5IT9N 2YXLA 1SQBH 2EIKC 2GHYA 5IE9A 1OCOC 3WFVA 4F6RB 2ZKOA 4WFBV 4Q20A 2YIBD 5FNVB 1US6A 5E1AC 4X1KB 4LH6A 2PYLA 3JAKA 1F4NA 4TUYA 1Q8IA 1TVKB 4H33A 4XDKA 1KQSU 4F4LA 4JYYA 3HKBA 3SPGA 2L35A 1A32A 1BE3H 1DTOA 3M8AA 1PNMA 1L8DA 3HKDA 3ABKC 4I5SA 3SPIA 4UB6Z 2AZ0A 1KU9A 3LSSA 2FB5A 2WLNA 2QTSA 1QLEC 1N0JA 1V55C 2X6CA 4U7NA 3RT3C 1M1KW 3FB8C 3ABLC 5LHHA 2WLHA 1NU1H 4HZ3A 2Q9LA 3SJBC 1XDCA 2HP8A 1KB9F 1JPXA 1TAEA 1FJGO 3K57A 3CYOA 4J7KA 1BQZA 3O65A 2CUGA 2EINC 4GX0A 2OTJV 5IDJA 4LF6B 2ZR3A 2IJKA 2AZ2A 1W0KG 1IXMA 2YICA 3STZC 3PJSK 5A2QN 3CEIA 4OX9B 2IU0A 5L3GA 2YC0A 3SYAA 5IYZA 3G4SV 1NTMH 1H2MA 3W7SA 1N32B 1QVFU 4GLXA 3Q4HB 4QGPA 3K08A 4I9QA 2DWDC 3EHBB 3G6BA 4LF9B 1DK1A 4DK0A 4D7SA 1HR0O 2HVJC 2WAMA 4OX9O 3CJHA 4ICGA 5LHGA 1WP8A 4O2AB 4UV9A 4R6ZA 1Y67A 4XBFA 5GW7A 2UXBO 3JD2A 3KZIZ 1I94B 5B1BB 3ZX6A 4DW1A 1HDJA 2ILMA 4X89A 1FXVA 1M9NA 5KA6A 4JTDB 2P22C 3CCVV 3FB5C 4J9ZB 2QA4V 1RPRA 1D2DA 3WB1A 2YIAA 2UXCB 4RWUA 4BIZA 2QWPB 2W0XA 1OCCB 5L3BA 3K5LA 1EN4A 2CTPA 3ASNC 3BY6A 5B1OA 3SJCC 5CN0A 4FZ1A 3N2KB 2QWRB 4KUMA 1WB8A 2OCCC 1YXBA 2IH1C 2UUBO 3B8NA 5L3EA 2R9RB 3AK2A 2ZINA 4MVOA 5JWPA 3ABMC 2DYRB 2XAFA 4HAMA 3DXRB 4WFEA 3LDCA 3LNNA 1Z5WA 3NR7A 2OCCB 2DMXA 4JI6B 5J9PC 4KXRA 1I94O 3AK3A 3DC5A 4LFAO 5J2TA 4K3AA 1Q7YW 1JR9A 4OPAA 2BTQA 3ZBHA 5H6RA 4P2ZA 1KP3A 2DJVA 4MT8A 4K0KO 5LL6Y 2KG7A 4J41A
chains in the Genus database with same CATH topology
3UKMA 2YEVA 1S72V 1QLNA 4UUJC 3W7XA 1YJ9V 1FS0G 2HFEC 1OCRC 4PA4A 4QE9A 2QKSA 4QNHB 1DF4A 2H94A 3GB7C 1GTOA 4G28B 5LGUA 2WPDG 1NH2B 1KKDA 4MSWC 4QIWF 4R50A 2WLMA 1QBZA 4PA6A 3SJQC 3WG7B 1VQ9V 2KB1A 2MK3A 4Z1MG 2AHYA 1AROP 3OW2U 1FXKC 1OCZC 4QPKA 3LSQA 1K5QA 4X8AA 1P7BA 3ZCCA 1Q82W 4J9YB 2Y69C 1S76D 2H8PC 2DQ0A 4BW5A 3T1CA 4MW3A 1VQ4V 2W0FC 1YITV 3ABMB 1BMFG 1NH2D 3ZRSA 5LBQA 4JPRA 4R7CA 4ASUG 4UVCA 1THZA 2WLIA 1JQ0A 3ZIAG 3ZN1A 1DLBA 3ETEA 1OCOB 2EILC 4TWKA 2HR3A 3FKSG 5EBLC 3ASNB 1OZ0A 2ZR2A 2HLDG 1YTFD 3QNEA 1LNQA 3BEHA 4HYOA 3P32A 1SRYA 1XL6A 3AG1B 3IC7A 3AG3B 1AJQA 2QE7G 1RPOA 4PA3A 4YXWG 1GM7A 5CMUA 5KA5A 3I56V 3K79A 2UXNA 3CCRV 1KP2A 2A0LA 4MVQA 2DYRC 3OUFA 4MTFA 1NR1A 2EINB 2ZQMA 2X0LA 1NVPD 2JIZG 5KUMA 1SESA 2DYSC 1BL8A 5IYDO 2R9IA 2ZXWB 3ABKB 4WCEV 1R3JC 3OMAB 3ZMUA 1NKDA 3TK1A 4JAVA 4XDLA 3NXSA 3E2EA 4PDRA 2PI5A 1HWYA 1NBMG 2XASA 1I5XA 2HJFC 2EZOA 1PL0A 4BIUA 1K8AW 1G4YB 3GWOA 4WF9V 1NJIW 3E8GA 2IW5A 4I9WA 1Y66A 1NVPB 2Q68A 3W7TA 1F51A 2FTKA 3ZRXA 1NQTA 5DN6G 1QLEB 1BHBA 3JD1A 1VQ5V 4RO2A 4PA7A 1E1RG 2EIJC 1K92A 1QR9A 1V55B 1EZJA 2EIKB 2IJIA 5CBFA 2W6IG 1KD1W 3AG3C 2P90A 3X2QC 4ZBMA 1TUEB 2JEXA 1NR7A 3AG2B 5CA3A 4PA9A 3QO7A 1K4DC 1XL4A 3SPCA 3ASOC 3CCLV 5IYBO 4MW8A 2X6BA 4H37A 1YJNV 2JK5C 1SETA 3E8HA 1K73W 3ZN0A 1M56B 3QO8A 4MTOA 2CK3G 4MS2A 5L3CA 4FPPA 4QJFB 5B3SB 1V54B 4XDJA 4GX1A 3HB3B 1E79G 1AJNA 5L3DA 2EZPA 2XAJA 2Q6AA 2QTOA 2PI4A 4G2KA 2XAHA 3LDDA 3OMNB 3FYIB 1M56C 5H6QA 1M57C 3TCUA 3OFNG 4PELA 4QE7A 2M7WA 2QM7A 4WFFA 3A0RA 2ZD9A 3K3WA 4DO2A 5IY5B 2WLLB 2BOBC 3AG2C 4MTGA 3QO5A 3E35A 3CC4V 4JTAB 3ASOB 4JAUA 4UVBA 1K3EA 1K9MW 3ML0A 2P6JA 1QCEA 1YHQV 5B3SC 1ENVA 2B5UA 3OEEG 1PNKA 2Z3YA 3B8MA 3K0DA 3JYCA 1VQ8V 3EFFK 1VQLV 5B1BC 5HFMA 3SYCA 2Q69A 2P7TC 3OGCC 1Q86W 1QR8A 3SYQA 1WPXA 1YSCA 3OUSA 4PDVA 1VQKV 4MTXA 2Y48A 5EBMC 4OXSA 3KG2A 2LFSA 3ZMTA 3D36A 1FXHA 2K1EA 1M57B 3F7YC 4RUEA 2B1GA 1VQ7V 2JJ1G 2NLJC 2HKOA 2V1DA 3CP1A 1AI7A 2ZDIC 1VQPV 1WLEA 2BOCC 3I55V 5DM6V 1YJWV 1AI6A 1ORQC 5L3FA 3ABTA 1OCZB 2DQ3A 1YIJV 1J95A 5B1AC 3T4DA 1DF5A 1K34A 1AI4A 1FXKB 3OAAG 1S77D 1RM1B 3CCSV 3LNMB 2HG5C 3SPHA 1AR1B 4PDMA 3OMIB 3CCJV 3ZRWA 3M99B 3MHSC 1K7DA 4JYCA 3LUTB 3SPJA 1QVGU 4PDLA 4MVUA 1OCRB 1OHHG 4JASA 3ETDA 4FMTA 1VQMV 1R3LC 4RUFA 2EILB 3TETA 3CC7V 5EC1C 3VOUA 2EIKC 4JF3A 3CCMV 1R6NA 2GHYA 5HFLA 1OCOC 3H01A 3WFVA 1F4MA 3G71V 4WFBV 3IGAC 2Y69B 4Q20A 2NNUA 3JD4A 2D3OW 5E1AC 3HPLC 3ZMSA 3CMEV 1JOYA 1F4NA 3CPWU 3FB7C 4H33A 2GSMB 4XDKA 1KQSU 3IFXA 3E83A 4F4LA 5CBGA 4BAYA 1H2GA 1SERA 3K04A 3SPGA 2QEXV 4X88A 1S0VA 1DTOA 3CD6V 1PNMA 3ABUA 4MVSA 2YSUB 3WG7C 3T4ZA 3K9AA 1JCHA 2DWEC 2HVKC 2ITCC 2ZXWC 3ABKC 4I5SA 3SPIA 2AHZA 2F43G 1M90W 4LBEC 3MHHC 2W6JG 1MG1A 3LSSA 3T2MA 2WLNA 4UXNA 1GK9A 3OM3B 1QLEC 3LDEA 4U7OA 2X7RB 4P30A 1VQNV 2EIJB 3F5WC 3FB6C 1V55C 3W7WA 2EBOA 2X6CA 4U7NA 1M1KW 3OR7C 4UVAA 3FB8C 3ABLC 5LHHA 1H38A 2WLHA 1VQOV 2WLIB 4E2LA 1P4RA 4HZ3A 4WFGA 1K97A 3X2QB 4UV8A 3ZJZA 1JJ2U 4WFAV 2EIMC 1UJWB 1FFTB 1JVMA 3JD3A 4GCZA 4DXWA 5EK0A 4GX2A 1JPXA 5LHIA 2ATKC 3E86A 3W7UA 3CYOA 3VBBA 5B1AB 4CZZA 5LGTA 3CXCU 1V54C 4GX5A 3CC2V 2OTLV 4RQFA 2YEVB 2EINC 4GX0A 3JD0A 3E8FA 4WFHA 3UM7A 4RQEA 5IDJA 2OTJV 1BHAA 1GMGA 1SZTA 2IJJA 4RAIA 3AG4B 4P9PA 3SYPA 4FK5C 3CCEV 2ZR3A 3AG1C 3K03A 1VQ6V 2IJKA 1W0KG 1IXMA 4MVZA 3PJSK 3STZC 1N8RW 3ETGA 1OCCC 1AI5A 1COWG 1R3KC 1PNLA 2IU0A 5L3GA 1CP9A 1F23A 3SYAA 2DYSB 2DW4A 2IH3C 1K33A 1S5HC 3G4SV 1MOFA 3P30A 3W7SA 2ITDC 1EFRG 3CMAV 4L87A 1QVFU 3STLC 4LC1A 5BZBA 5IY5C 3ZMVA 3K08A 4R8CA 4MVRA 2DWDC 3EHBB 2A79B 3FYEB 3RBZA 3E8BA 2WSSG 3K06A 1GM9A 4ZKIA 3AEIA 2A9HA 5KUKA 1R6KA 2LP7A 1ZWIC 5IYCO 2HVJC 2WAMA 4EKWA 3F7VC 3K0GA 3DTUB 1H8HG 2EIMB 3OR6C 4LP8A 5EBWC 3ZMZA 1GM8A 3B77A 5LHGA 1H8EG 1MSWD 5C93A 4QPJA 4UV9A 4TSFG 4R6ZA 2Q67A 4XBFA 5GW7A 3R65A 4N23A 1CPYA 3JD2A 2IJHA 1EBOA 4KFMA 2C2AA 5B1BB 3RVZA 4JGSA 4X89A 2XAQA 1E1QG 1FXVA 4LCUC 2ZDIA 4GT1A 1M9NA 5KA6A 4JTDB 4JTCB 1GO3F 1B6QA 1K5SA 2V7QG 1KC8W 3CCQV 3ABLB 3CCVV 2IU3A 4TT3G 3FB5C 4J9ZB 2JJ2G 2QA4V 1RPRA 1CEZA 2EJRA 3SYOA 4BIZA 2XOKG 1OCCB 5L3BA 4KP4A 2WLLA 3ASNC 3BY6A 5B1OA 5CN0A 4CBCA 3RVYA 4FJCC 1PD3A 4KUMA 3JCZA 2OCCC 1KECA 4G27B 1Y4MA 2X6AA 2LFRA 5B1NA 2IH1C 1S3JA 3B8NA 5L3EA 2R9RB 4MVOA 5H9CA 3ABMC 2DYRB 2JEUA 4MVMA 2XAFA 3D3IA 4HAMA 4WFEA 1L1FA 3OEHG 3LDCA 4FIPC 1W2BU 2OCCB 2OT5A 1I5YA 1YTFB 2Z5UA 2JDIG 5J9PC 4N21A 5EC2C 5LGNA 3RW0A 3G6EV 3CCUV 1R73A 3OE7G 4P9OA 2B1IA 1GKFA 3ZRVA 5CBHA 1AJPA 2WLJA 1MABG 3E89A 3MD0A 2UXXA 1PKXA 1Q81W 2XAGA 2XNDG 3DGEA 3AG4C 1G8MA 2QM8A 1K4CC 1R3IC 1YI2V 2WLKA 3ZRWB 1Q7YW 1ROPA 1JX9A 4P2ZA 5H6RA 1KP3A 2WWWA 4MT8A 4JYBA 1FXKA 2P67A 1W0JG 5FL7G 1RM1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 V;  1YJW V;  3CC7 V;  3CC2 V;  1K8A W;  3CMA V;  1S72 V;  2OTL V;  1VQ8 V;  3CCM V;  4WF9 V;  1M1K W;  1VQL V;  1NJI W;  1VQ4 V;  2QEX V;  3CCL V;  3CD6 V;  1YIT V;  3I56 V;  1YIJ V;  2OTJ V;  1YJ9 V;  3G6E V;  1QVF U;  3CCU V;  3CCR V;  1R73 A;  1VQO V;  1YJN V;  1Q86 W;  3G71 V;  3CCS V;  3CCE V;  4WFB V;  1K73 W;  1VQK V;  1JJ2 U;  4WFA V;  1M90 W;  1VQ6 V;  3CCJ V;  1VQ5 V;  2D3O W;  1Q81 W;  3CME V;  1VQ9 V;  4WCE V;  1QVG U;  1YI2 V;  1N8R W;  3CC4 V;  3OW2 U;  1Q7Y W;  1KD1 W;  1KC8 W;  3CPW U;  1K9M W;  3CCQ V;  1VQM V;  3CCV V;  1KQS U;  1VQN V;  1VQ7 V;  1YHQ V;  2QA4 V;  1Q82 W;  3G4S V;  3CXC U;  1VQP V;  1W2B U;  3I55 V; 
#chains in the Genus database with same CATH topology
 4L8J A;  2YEV A;  2HJD A;  2GBO A;  2KKW A;  3CWB H;  3G80 A;  1FS0 G;  4JV5 O;  4B3R B;  2F93 B;  3CX5 F;  4R50 A;  2WLM A;  1EN5 A;  2E76 B;  4IGG A;  2KB1 A;  2GDS A;  4Z1M G;  2QJ1 A;  1ARO P;  4X62 O;  4JI7 O;  2ZNI A;  2QKA A;  4X8A A;  4DR7 B;  2BTQ B;  2OIG A;  3CRR A;  4J9Y B;  2Y69 C;  3HKE A;  3T1C A;  2PZS A;  1XIL A;  4ASU G;  2WLI A;  3ZIA G;  3ZN1 A;  1ZSP A;  2HR3 A;  2NR5 A;  2LGQ A;  2CE4 A;  5EBL C;  1EM1 A;  2ZR2 A;  4HYO A;  3P32 A;  3IC7 A;  2Q73 A;  1RPO A;  1KYO F;  3BCC H;  5CMU A;  3CCR V;  1KP2 A;  4MVQ A;  1NTK H;  3OUF A;  2Y4T A;  2EIN B;  4DV3 O;  3B40 A;  2X0L A;  1NVP D;  4TV9 B;  2RDC A;  2QSA A;  1YDX A;  5IYD O;  5B66 Z;  2ZXW B;  3APQ A;  3JAT A;  3K9S A;  3VQY A;  3E2E A;  5JQG B;  4DRX A;  4C7U A;  1P7G A;  2UUA O;  4BIU A;  3SR2 C;  4FM1 A;  1K8A W;  3GWO A;  1NJI W;  2Y0P A;  4X64 O;  5JCO A;  2FTK A;  5KHH A;  1KBH A;  3HR0 A;  3G67 A;  1BHB A;  1QLE B;  3JD1 A;  4JI8 O;  1GN4 A;  4O4H B;  4PA7 A;  3U0Z A;  1FFX A;  4DUZ B;  1V55 B;  4B7E A;  2EIK B;  5CBF A;  4B3T B;  2W6I G;  1Q6U A;  1NZ6 A;  2P90 A;  3AG3 C;  1AIL A;  4ZBM A;  3RYF A;  2FL4 A;  4HBN A;  1U97 A;  3AG2 B;  1TVK A;  1SQF A;  2F4V O;  1XL4 A;  1SKV A;  4LF8 B;  4X1K A;  5IYB O;  1YJN V;  1K73 W;  4X62 B;  1ZL8 B;  5F2V O;  1M56 B;  3DSQ A;  2CK3 G;  5L3C A;  4FPP A;  5B3S B;  1VF5 B;  3C3T A;  4TQD A;  2A7W A;  5IYZ B;  3CRA A;  4DK1 A;  1AJN A;  3CRC A;  1PP9 H;  5TIS Z;  2EZP A;  4DV6 B;  2XAH A;  1Q6H A;  2YUA A;  5H6Q A;  2YIB A;  1XMO B;  3BHP A;  4QE7 A;  2QR4 A;  4CS4 A;  3CJH B;  3L71 H;  4LWS B;  2QM7 A;  5LYJ B;  2ZD9 A;  2RN9 A;  3BAB A;  4EFB A;  1R1B A;  3QF7 A;  4MTG A;  3ZHR A;  1K3E A;  4O2B A;  3ML0 A;  2P6J A;  4JI7 B;  5B3S C;  2Z3Y A;  5K1P A;  1LUW A;  1VQ8 V;  1IBL B;  5GTI Z;  2RNB A;  3OGC C;  1WPX A;  3OUS A;  1VQK V;  4X1I A;  2Y48 A;  4DW0 A;  4WBN B;  3OD4 A;  3D8C A;  3JAL A;  3JSN A;  2K1E A;  3CS5 A;  2XTA A;  3F7Y C;  2IM9 A;  2B1G A;  3UO2 A;  2NLJ C;  2HKO A;  3CP1 A;  2ZDI C;  1WLE A;  2BOC C;  1YJW V;  5KLV H;  3JAR A;  1IXB A;  4LF9 O;  1DF5 A;  3BVO A;  3LNM B;  2HG5 C;  4IT5 A;  4EB6 B;  2UUA B;  4TV8 A;  4W4L A;  1FD9 A;  4JI1 B;  4K0K B;  3MHS C;  4JYC A;  3SPJ A;  4PDL A;  2LGW A;  1OHH G;  4DR5 B;  3HKB B;  4JAS A;  3ETD A;  2H3O A;  3TET A;  3CC7 V;  5EC1 C;  1GN3 A;  4B3R O;  5EIB C;  3CCM V;  1R6N A;  4O4L A;  2UXB B;  5HFL A;  3H01 A;  3JAS B;  4X1Y A;  3B4S A;  1QU7 A;  2Y69 B;  4O4I A;  1WB7 A;  2O57 A;  2NNU A;  2D3O W;  3E22 B;  4U3J A;  2EJ7 A;  2GSM B;  1H2G A;  3VQX A;  3HKC B;  2QEX V;  4FFB B;  4X88 A;  4UCO A;  1MMM A;  1JCH A;  2HVK C;  2ITC C;  3H1H H;  5EZY A;  4J7J A;  2F43 G;  1SZX A;  4I0X B;  3EVK A;  3J81 N;  4ZIB A;  4UXN A;  1GK9 A;  3LDE A;  5LYJ A;  4P30 A;  3FB6 C;  3W7W A;  2EBO A;  5J2U A;  1BZK A;  1LR1 A;  4JI4 O;  3OGI B;  5JJJ B;  3HKC A;  4X66 O;  1IDS A;  4E2L A;  4WFG A;  1K97 A;  2PGG A;  4UV8 A;  5IWA O;  4WFA V;  1H2N A;  5LP6 A;  1UJW B;  3SJA C;  2QWN B;  1JVM A;  3JD3 A;  4DXW A;  5EK0 A;  4ZI7 B;  5JVD B;  1UFI A;  1N4C A;  3W7U A;  5LGT A;  1B04 A;  1EZV H;  1YVW A;  4IL6 Z;  4WFH A;  4I0X A;  1FPO A;  1GMG A;  1H2K A;  1VP7 A;  4DV1 B;  4P9P A;  4FK5 C;  3K03 A;  1VQ6 V;  1M5I A;  1Y6X A;  2ZNJ A;  2D2C B;  3C3S A;  1N8R W;  4FLV A;  4LF8 O;  4GKK O;  2GTS A;  1CP9 A;  3RYC B;  2DW4 A;  3K5O A;  2IH3 C;  1BSM A;  3P30 A;  2N04 A;  2UUC B;  3JAM N;  1XNR B;  1ZLZ A;  2ADP A;  4LC1 A;  2UU9 B;  4MVR A;  2F66 C;  3FYE B;  1QNM A;  2PUS A;  4TQF A;  3SDL A;  1GM9 A;  2A9H A;  4JI3 O;  4TV9 A;  1R6K A;  4FLY A;  1ZWI C;  3TXQ A;  5LOV A;  3DTU B;  2EIM B;  3OR6 C;  4LP8 A;  5EIB D;  5EBW C;  3B77 A;  3AG7 A;  1H2S B;  1MSW D;  5C93 A;  4QPJ A;  1YCI A;  4X64 B;  5D5P A;  2Y0I A;  3JAW B;  2B9Z A;  2IJH A;  1KUQ A;  2VWJ A;  4LCU C;  1E1Q G;  4BW9 A;  1K5S A;  1KC8 W;  4JI4 B;  1T5E A;  3WB2 A;  3CCQ V;  2IU3 A;  5FNV A;  3C90 A;  2EJR A;  4EFE A;  3T1Y B;  2AW9 A;  4KP4 A;  5CB4 A;  5LP6 B;  4CBC A;  1L0L H;  2RJZ A;  1B06 A;  1PD3 A;  3B09 A;  3CHX A;  1KEC A;  4PHZ A;  1Y4M A;  3A0B Z;  3FAV B;  3D3I A;  2Q4P A;  2A3Q A;  4FIP C;  1W2B U;  1WJZ A;  1GN2 A;  3KCX A;  1I5Y A;  1RP3 B;  4NXM B;  1Q5O A;  2JDI G;  3QVN A;  5EC2 C;  2BE3 A;  5LGN A;  1Q6I A;  1R73 A;  3OE7 G;  1AJP A;  4UCV A;  2UXX A;  1PL4 A;  4FM2 A;  1Q81 W;  3RWR D;  4I4T A;  3AG4 C;  1K4C C;  2WLK A;  1BT8 A;  1ROP A;  4LR3 A;  5C8Y B;  1EN6 A;  2QGN A;  4JYB A;  1FXK A;  1QQC A;  2P67 A;  4U3F H;  1W0J G;  1Z5V A;  3FX7 A;  3KCY A;  1OJH A;  1YJ9 V;  4QE9 A;  1OCR C;  1DF4 A;  2H94 A;  1NT2 B;  4G28 B;  1ZL8 A;  2FKX A;  3R66 A;  3RYI A;  1NH2 B;  2KSD A;  4DV0 O;  4LF7 B;  4TOI A;  2RMK B;  1QBZ A;  3SJQ C;  1VQ9 V;  2MK3 A;  3B2E E;  1FXK C;  2XT9 A;  2ZIM A;  5LMU B;  4B3S B;  4FFK A;  2CH7 B;  3A2F A;  4O4J A;  4BW5 A;  1VQ4 V;  2PYJ A;  1YIT V;  4YHH B;  3RYI B;  1NH2 D;  3ZRS A;  3T1H O;  2CTR A;  4I50 A;  1HNZ B;  1IBM O;  1N0N A;  1OCO B;  4X9Q A;  3ZHV A;  2P4K A;  1TUB B;  3FKS G;  1I7F A;  1MA1 A;  5FPR A;  5LXT A;  3H9V A;  3CRQ A;  3BEH A;  1SRY A;  2KQX A;  4I4T B;  3HKE B;  1AJQ A;  4LF6 O;  4DR2 B;  2A0L A;  2VS0 A;  3FD9 A;  1NR1 A;  2CGO A;  4LNU B;  3ZHT A;  1JFF B;  4X66 B;  1SES A;  2DYS C;  3N2G B;  3ABK B;  4GKJ O;  4AQY O;  4H13 B;  1NKD A;  4JAV A;  1Q3E A;  4XDL A;  5JCO C;  4DV6 O;  4DR1 O;  1NBM G;  4CH5 A;  4WF9 V;  3E8G A;  4I9W A;  2Q68 A;  1BCC H;  1KKC A;  3VQV A;  3BRC A;  4X20 B;  3ZRX A;  5LMN B;  5DN6 G;  2OWO A;  4RO2 A;  5J2T B;  4DR3 O;  2F23 A;  1AP5 A;  3TGU H;  4NB5 A;  3BFR A;  4J7Z A;  1VIB A;  4PA9 A;  3SPC A;  2VQE O;  2X6B A;  2IBZ H;  1SET A;  3MAQ A;  1IUR A;  4JI5 B;  4JZ2 A;  4ZHQ A;  1JMK C;  4QJF B;  4B3S O;  1VF7 A;  4XDJ A;  3HB3 B;  1E79 G;  1XQ8 A;  3ZS8 C;  2BTO A;  1SQX H;  2XAJ A;  4G2K A;  3TCU A;  4B3M O;  2QM4 A;  4GZR B;  4DUY B;  2GTA A;  5JJE B;  1ZUQ A;  2JGD B;  2M7W A;  1X4T A;  5A9G A;  2YXH A;  1TUB A;  4DO2 A;  2WLL B;  1SQP H;  1N34 B;  4JTA B;  3ASO B;  4JAU A;  4UVB A;  1QCE A;  4DR2 O;  1YHQ V;  1IBM B;  2E5L O;  3OEE G;  4DR6 B;  3B8M A;  3SGI A;  2A06 H;  4O4J B;  1TA8 A;  3P3P A;  5HFM A;  2UUB B;  4FVM A;  2P7T C;  1J5E B;  4LF5 O;  2XUM A;  1YSC A;  3L70 H;  4CS3 A;  2AXT Z;  4UB8 Z;  5EBM C;  4TUY B;  2V4D A;  2LFS A;  4NVP A;  1M57 B;  3IAY A;  2V1D A;  1AI7 A;  1ORQ C;  1MNG A;  2E5L B;  3ABT A;  1I0H A;  1J95 A;  4Q6G A;  4DV2 B;  1FXK B;  1S77 D;  1XHX A;  5C8Y A;  3CCJ V;  2N74 A;  3M99 B;  3LUT B;  4MVU A;  3ZHS A;  4FZ0 A;  4DR7 O;  1R3L C;  2EIL B;  4B3T O;  4JF3 A;  5BY1 A;  4PV1 B;  3TXS A;  4JI0 B;  1F4M A;  3J80 N;  4O4H A;  1WP7 A;  3BA9 A;  3UO3 A;  1AVM A;  3HPL C;  3L75 H;  3CME V;  1JJO A;  1JOY A;  2Q5Z A;  3CPW U;  4YHH O;  3IFX A;  3E83 A;  4I50 B;  5JQG A;  4BAY A;  1RFY A;  3K04 A;  1SER A;  2JVD A;  5CA1 A;  3ABU A;  3QG5 A;  2YSU B;  3WG7 C;  3T4Z A;  3K9A A;  4HNA A;  1UPG A;  1TGO A;  2K9P A;  2R72 A;  3JAS A;  1M90 W;  3A0H Z;  4J11 A;  3MHH C;  2W6J G;  4DV4 B;  1X59 A;  2X7R B;  2M6Y A;  1VQN V;  5DEC A;  2ZM6 O;  5BMV A;  3H1K H;  4IHJ A;  3BAA A;  4UVA A;  4FLW A;  2F1M A;  1VF6 C;  1VQO V;  4AQY B;  2WLI B;  1P4R A;  4Z1V A;  2P4V A;  1Y74 A;  4GCZ A;  4GX2 A;  5KMG A;  1FYJ A;  5EYP A;  5LHI A;  3VBB A;  4CZZ A;  1XBL A;  3CXC U;  1V54 C;  4GX5 A;  3CC2 V;  4J80 A;  3RGB A;  2OTL V;  4RQF A;  3JD0 A;  2VQF B;  4CH3 A;  3LSU A;  1SZT A;  2IJJ A;  4X1I B;  2AGA A;  5KHJ A;  3CCE V;  4K35 A;  1XMQ O;  3AG1 C;  1M4U A;  1W59 A;  3HKD B;  2YS8 A;  4ZOL A;  4O2A A;  1SA0 B;  1HW7 A;  4YJ3 B;  1OCC C;  1AI5 A;  1COW G;  1L0N H;  1R3K C;  2Y4U A;  1PNL A;  4IYI A;  4GUN A;  2QWO B;  1K33 A;  2ZCE A;  1AR4 A;  1RSO A;  1EFR G;  3CMA V;  4L87 A;  3D3Q A;  3T1H B;  5LA6 B;  3U11 A;  2JGU A;  5IY5 C;  4R8C A;  2E74 B;  4FLX A;  4LFB O;  3CSX A;  3WU2 Z;  3OTF A;  4NTX A;  2CAZ C;  1FAF A;  3CRM A;  4D7T A;  2HHH O;  4B3M B;  1XOU A;  2JS3 A;  3K0G A;  1H8H G;  1N36 B;  3D36 C;  4YY3 B;  3ZMZ A;  4DR1 B;  1HR0 B;  1H8E G;  1KMI Z;  1HNW O;  1SC5 B;  4TSF G;  2QDO A;  4KFM A;  2C2A A;  3RVZ A;  2XAQ A;  4J42 A;  2ZDI A;  4JTC B;  1GO3 F;  1B6Q A;  2Q0A A;  3ABL B;  3RYF B;  4TT3 G;  2Q7E A;  4JZG A;  2JJ2 G;  4CC5 A;  3SYO A;  3FFQ A;  2YI8 A;  1SQG A;  2WLL A;  4FJC C;  4G27 B;  3F5T A;  3E22 A;  5B1N A;  1S5J A;  3H1J H;  5KHI A;  1S3J A;  5H9C A;  4MVM A;  1GN6 A;  1L1F A;  3DC6 A;  3OEH G;  3JAT B;  1NI8 A;  2OT5 A;  5KMG B;  2EUL A;  2BCC H;  4JI1 O;  2Z5U A;  5ITZ B;  2DOS A;  1BGY H;  1Y74 B;  3RW0 A;  3G6E V;  4I55 A;  4P9O A;  1GKF A;  3ZRV A;  5CBH A;  2WLJ A;  1MAB G;  2GUZ A;  1IZ3 A;  3MD0 A;  1PKX A;  2JS5 A;  4YIO A;  3ZHQ A;  3DGE A;  5JVD A;  1G8M A;  1YI2 V;  4KHP O;  3K5M A;  4B08 A;  4EB6 A;  3S3X A;  3T1Y O;  5FL7 G;  1RM1 C;  3UKM A;  5CB4 B;  3JAR B;  4UUJ C;  2OYQ A;  2HFE C;  4PA4 A;  1LUV A;  1WN7 A;  5KX5 B;  4QNH B;  2QKC A;  4K8Z A;  3GB7 C;  1IBL O;  5GTH Z;  5KX5 A;  1WPB A;  4BR6 A;  4MSW C;  4QIW F;  4ZI7 A;  4JI2 B;  4YY3 O;  4DR6 O;  3LSQ A;  3ZCC A;  1S76 D;  4MW3 A;  4JYA B;  2W0F C;  3N2G A;  3ABM B;  1BMF G;  4JPR A;  4LNU A;  4R7C A;  4UVC A;  1THZ A;  2LW1 A;  1HNW B;  3ETE A;  2EIL C;  2Q7H A;  2XHB A;  2FYU H;  2KG7 B;  1SS3 A;  3ASN B;  3K5N A;  4DV5 B;  1IBK B;  1OZ0 A;  3QNE A;  4LF4 O;  3AG1 B;  2GV9 A;  5EYP B;  3AG3 B;  4CS2 A;  2QE7 G;  4PA3 A;  4O4L B;  1GM7 A;  5KA5 A;  2ZE5 A;  3K79 A;  1XMQ B;  3I5D A;  2DYR C;  2LQT A;  1XI1 A;  5KUM A;  1BL8 A;  1BQ0 A;  2R9I A;  4IYH A;  1R3J C;  1NTZ H;  4I7Z B;  3TK1 A;  1OV9 A;  2CH7 A;  3H1L H;  2YID A;  1XNQ O;  4PDR A;  1HWY A;  2XAS A;  2ARH A;  1I5X A;  2HJF C;  1Z2G A;  2RQ6 A;  1G4Y B;  4JI8 B;  2IW5 A;  1Y66 A;  1NVP B;  3IC9 A;  2OCH A;  4JI6 O;  2ADQ B;  1VQ5 V;  1K92 A;  1EZJ A;  2IJI A;  4UCU A;  5CA1 B;  3X2Q C;  1TUE B;  2R70 A;  1NR7 A;  4B7K A;  5IJ9 A;  3J7A U;  1K4D C;  4NR1 A;  5E79 Z;  3CCL V;  4H37 A;  2JK5 C;  2PY5 A;  2JGD A;  1N33 O;  1PM9 A;  4DV2 O;  4MS2 A;  5IWA B;  1RSO B;  1V54 B;  3L74 H;  1XMO O;  4CH4 A;  3OT7 A;  1ZX3 A;  4FM0 A;  2Q6A A;  2QTO A;  2PI4 A;  3OMN B;  1M56 C;  4PEL A;  5FPO A;  4JI0 O;  4WFF A;  3A0R A;  3KKY A;  1IVS A;  2NN4 A;  1VAR A;  1N33 B;  1CXZ B;  3AG2 C;  2BOB C;  3QO5 A;  2P5O A;  1I08 A;  3CC4 V;  4Z2W A;  4W4K A;  4YIP A;  2B5U A;  4X1Y B;  1PV0 A;  1N34 O;  3JYC A;  3ZHU A;  2CGN A;  3SYC A;  2Q69 A;  2G38 A;  1Q86 W;  4X65 O;  1QR8 A;  5CA0 A;  3O9O A;  3SYQ A;  4IIJ A;  4DR4 B;  3ZMT A;  5D5Q A;  3D36 A;  2L6L A;  3S3W A;  2JJ1 G;  4I55 B;  3CE2 A;  5LOV B;  1VQP V;  4PJ0 Z;  1AI6 A;  5L3F A;  4YJ2 A;  4DV7 B;  1OCZ B;  2DQ3 A;  1YIJ V;  4LH7 A;  5B1A C;  1K34 A;  4LFC O;  3OAA G;  1RM1 B;  3CCS V;  3SPH A;  4DV0 B;  1MZE A;  2YXY A;  4JI2 O;  4HNA B;  3VQW A;  3JCU Z;  4K8X A;  1K7D A;  5KAI Z;  1OCR B;  4DV1 O;  1XNR O;  4NTY A;  4WBN A;  3APO A;  4FMT A;  2ZM6 B;  3RYC A;  5JH7 A;  4EEQ A;  3U10 A;  3VOU A;  4DR3 B;  1FKA O;  4LF7 O;  4ZHQ B;  1QHT A;  1HNZ O;  3G71 V;  3IGA C;  4GYC B;  2PTM A;  3JD4 A;  4CH6 A;  3ZMS A;  2VRZ A;  4LFA B;  3FB7 C;  2DE0 X;  2OIE A;  4PI2 A;  4JYA O;  5CBG A;  3N2K A;  1MSD A;  4A5U B;  1Q90 D;  1SF9 A;  1S0V A;  2F95 B;  3CD6 V;  4OPH A;  4MVS A;  3P3N A;  2DWE C;  1WNS A;  2ZXW C;  2AHZ A;  4E4E A;  4LBE C;  2CTQ A;  1P84 F;  1MG1 A;  3T2M A;  3OTO O;  5GON A;  3OM3 B;  4U7O A;  5J2U B;  2EIJ B;  3F5W C;  3GWK C;  4DV4 O;  5AG2 A;  3OR7 C;  4NKG B;  2DN9 A;  5LMN O;  1H38 A;  4LFB B;  4AI8 A;  1XHZ A;  3X2Q B;  3ZJZ A;  1JJ2 U;  1NS1 A;  2EIM C;  4UCR A;  1FFT B;  1XNQ B;  4YJ3 A;  1FFX B;  1HP8 A;  2ATK C;  3E86 A;  4DV7 O;  3L73 H;  5KHK A;  5LMU O;  2R9A A;  2BSK B;  1ZTE A;  4UCS A;  5B1A B;  3Q4H A;  5DED A;  3IJ4 A;  2VWK A;  2YEV B;  4U3J B;  3E8F A;  4RQE A;  3UM7 A;  1BHA A;  3BA8 A;  4RAI A;  4BWA A;  3AG4 B;  4DUY O;  3SYP A;  4H44 B;  2P06 A;  4MVZ A;  4JAA A;  1XUQ A;  3WB0 A;  3ETG A;  4LFC B;  1YZB A;  3L9D A;  4FLZ A;  1F23 A;  2DYS B;  1S5H C;  1MOF A;  4D6T H;  2ITD C;  4YJ2 B;  3STL C;  3GVM A;  4IHJ B;  5BXZ A;  5BZB A;  3ZMV A;  3THO A;  2VQF O;  5BMV B;  2A79 B;  3RBZ A;  2F4V B;  3E8B A;  2WSS G;  3K06 A;  2Q8V A;  4ZKI A;  3AEI A;  3CB2 A;  1URF A;  5KUK A;  1D5N A;  2LP7 A;  5IYC O;  4EKW A;  5JH7 B;  3F7V C;  5BR8 B;  1D5A A;  1GM8 A;  2RCV A;  4CC6 A;  1BS3 A;  2Q67 A;  3R65 A;  4N23 A;  1CPY A;  1EBO A;  2E3C A;  4X20 A;  3A8T A;  1P49 A;  4JGS A;  4AHC A;  4GT1 A;  2LJ2 A;  1FJG B;  2V7Q G;  4GKK B;  1CEZ A;  1SQV H;  4O2B B;  2XOK G;  1JFF A;  4IIJ B;  3RVY A;  3JCZ A;  5CA0 B;  4KL1 A;  2ODM A;  4JV5 B;  2Q7G A;  2X6A A;  3JAK B;  2LFR A;  4NXN O;  1SQQ H;  1U96 A;  2FML A;  3ZED A;  1GH6 A;  2MW2 B;  2ZE7 A;  1DGS A;  2JEU A;  5FLX N;  5LP6 C;  4GKJ B;  1R6T A;  1YTF B;  2WA3 A;  3N27 A;  4N21 A;  4OGQ B;  3CCU V;  2B1I A;  2ZE6 A;  3E89 A;  3CXH F;  4NYK A;  2XAG A;  2XND G;  2UUC O;  2QM8 A;  1R3I C;  3UCS C;  3ZRW B;  2N05 A;  3JSL A;  1JX9 A;  4FLU A;  2WWW A;  4LF4 B;  1PPJ H;  2Z0A A;  1S72 V;  5ITZ A;  1QLN A;  4DR5 O;  3W7X A;  1J5E O;  4LF5 B;  2QKS A;  4PD4 F;  2HHH B;  5EZY B;  3RYH A;  1GTO A;  5LGU A;  2WPD G;  2EX3 A;  4X65 B;  5LXT B;  1KKD A;  1G6U A;  1N36 O;  2ZIO A;  4DV3 B;  2UU9 O;  4PA6 A;  3WG7 B;  2AHY A;  1YF2 A;  3OW2 U;  2Q0O C;  1OCZ C;  4QPK A;  2E75 B;  1AR5 A;  1K5Q A;  2BSK A;  1P7B A;  1Q82 W;  1M93 A;  2H8P C;  2DQ0 A;  2QWQ B;  3M7M X;  4O4I B;  4UFZ A;  5LBQ A;  4FLT A;  3RYH B;  4PI0 A;  1JQ0 A;  2YDE A;  1DLB A;  5B5E Z;  1O9G A;  4F6E A;  4TWK A;  1V9P A;  3UQ8 A;  2JRI A;  1G1X B;  1WAZ A;  2CTW A;  1HNX B;  1YTF D;  2HLD G;  1LNQ A;  1N32 O;  1XL6 A;  3OTO B;  4YXW G;  4ABM A;  1B3Q A;  3I56 V;  4TV8 B;  2UXN A;  4MTF A;  2ZQM A;  2JIZ G;  5JJN B;  1MZF A;  4WCE V;  2LO1 A;  3OMA B;  5H5N A;  3ZMU A;  3NXS A;  2ZT9 B;  1VEW A;  4F6R A;  2PI5 A;  3JAL B;  2EZO A;  4DV5 O;  1PL0 A;  1IBK O;  1GRJ A;  5KHG A;  1GAX A;  4DUZ O;  3W7T A;  1F51 A;  4KHP B;  3EXA A;  3ETQ A;  2UXD B;  1NQT A;  4NXM O;  1E1R G;  1WA8 B;  2EIJ C;  3FAV A;  1QR9 A;  1SA0 A;  3BPZ A;  1WA8 A;  1HNX O;  4ZOL B;  5BR8 O;  1KD1 W;  4FFB A;  1AP6 A;  5H2F Z;  2JEX A;  1AB3 A;  1Q43 A;  2LW7 A;  5CA3 A;  4DYL A;  3QO7 A;  2WA4 A;  3ASO C;  4J10 A;  4JI5 O;  4MW8 A;  3RFR A;  3E8H A;  3ZN0 A;  4MTO A;  3QO8 A;  2VQE B;  3H1I H;  1Y76 A;  5IJ0 B;  4GX1 A;  5IJ9 B;  1IX9 A;  1XEQ A;  5L3D A;  3DXR A;  3JAW A;  3QTC A;  3LDD A;  1F7Y A;  5KAF Z;  3FYI B;  1ZAU A;  1M57 C;  3OFN G;  2CDY A;  2YI9 A;  2GUZ B;  4UCT A;  3K58 A;  3K3W A;  5IY5 B;  3L72 H;  5IJ0 A;  3E35 A;  2UXC O;  5K1X A;  1K9M W;  1VMG A;  4JI3 B;  3PN1 A;  1ENV A;  3RN4 A;  2HEP A;  1PNK A;  3K0D A;  3EFF K;  1VQL V;  5B1B C;  3K59 A;  1S5L Z;  4H0L B;  4PDV A;  4MTX A;  1O9H A;  4OXS A;  1JA8 A;  4NTW A;  1Y76 B;  3KG2 A;  1YEW A;  1FXH A;  4DRX B;  4RUE A;  1VQ7 V;  4NXN B;  4AIL C;  5LA6 A;  4DR4 O;  3I55 V;  5DM6 V;  3AK1 A;  3UT5 A;  2ZE8 A;  3MDS A;  3TJT A;  3UT5 B;  3T4D A;  4BIO A;  1AI4 A;  1AR1 B;  4LWS A;  3ICX A;  3OMI B;  4PDM A;  3ZRW A;  2ETN A;  1VF6 A;  1QVG U;  1XRE A;  2UXD O;  1H2L A;  2PF4 E;  1VQM V;  4RUF A;  5GON B;  5IT9 N;  2YXL A;  1SQB H;  2EIK C;  2GHY A;  5IE9 A;  1OCO C;  3WFV A;  4F6R B;  2ZKO A;  4WFB V;  4Q20 A;  2YIB D;  5FNV B;  1US6 A;  5E1A C;  4X1K B;  4LH6 A;  2PYL A;  3JAK A;  1F4N A;  4TUY A;  1Q8I A;  1TVK B;  4H33 A;  4XDK A;  1KQS U;  4F4L A;  4JYY A;  3HKB A;  3SPG A;  2L35 A;  1A32 A;  1BE3 H;  1DTO A;  3M8A A;  1PNM A;  1L8D A;  3HKD A;  3ABK C;  4I5S A;  3SPI A;  4UB6 Z;  2AZ0 A;  1KU9 A;  3LSS A;  2FB5 A;  2WLN A;  2QTS A;  1QLE C;  1N0J A;  1V55 C;  2X6C A;  4U7N A;  3RT3 C;  1M1K W;  3FB8 C;  3ABL C;  5LHH A;  2WLH A;  1NU1 H;  4HZ3 A;  2Q9L A;  3SJB C;  1XDC A;  2HP8 A;  1KB9 F;  1JPX A;  1TAE A;  1FJG O;  3K57 A;  3CYO A;  4J7K A;  1BQZ A;  3O65 A;  2CUG A;  2EIN C;  4GX0 A;  2OTJ V;  5IDJ A;  4LF6 B;  2ZR3 A;  2IJK A;  2AZ2 A;  1W0K G;  1IXM A;  2YIC A;  3STZ C;  3PJS K;  5A2Q N;  3CEI A;  4OX9 B;  2IU0 A;  5L3G A;  2YC0 A;  3SYA A;  5IYZ A;  3G4S V;  1NTM H;  1H2M A;  3W7S A;  1N32 B;  1QVF U;  4GLX A;  3Q4H B;  4QGP A;  3K08 A;  4I9Q A;  2DWD C;  3EHB B;  3G6B A;  4LF9 B;  1DK1 A;  4DK0 A;  4D7S A;  1HR0 O;  2HVJ C;  2WAM A;  4OX9 O;  3CJH A;  4ICG A;  5LHG A;  1WP8 A;  4O2A B;  4UV9 A;  4R6Z A;  1Y67 A;  4XBF A;  5GW7 A;  2UXB O;  3JD2 A;  3KZI Z;  1I94 B;  5B1B B;  3ZX6 A;  4DW1 A;  1HDJ A;  2ILM A;  4X89 A;  1FXV A;  1M9N A;  5KA6 A;  4JTD B;  2P22 C;  3CCV V;  3FB5 C;  4J9Z B;  2QA4 V;  1RPR A;  1D2D A;  3WB1 A;  2YIA A;  2UXC B;  4RWU A;  4BIZ A;  2QWP B;  2W0X A;  1OCC B;  5L3B A;  3K5L A;  1EN4 A;  2CTP A;  3ASN C;  3BY6 A;  5B1O A;  3SJC C;  5CN0 A;  4FZ1 A;  3N2K B;  2QWR B;  4KUM A;  1WB8 A;  2OCC C;  1YXB A;  2IH1 C;  2UUB O;  3B8N A;  5L3E A;  2R9R B;  3AK2 A;  2ZIN A;  4MVO A;  5JWP A;  3ABM C;  2DYR B;  2XAF A;  4HAM A;  3DXR B;  4WFE A;  3LDC A;  3LNN A;  1Z5W A;  3NR7 A;  2OCC B;  2DMX A;  4JI6 B;  5J9P C;  4KXR A;  1I94 O;  3AK3 A;  3DC5 A;  4LFA O;  5J2T A;  4K3A A;  1Q7Y W;  1JR9 A;  4OPA A;  2BTQ A;  3ZBH A;  5H6R A;  4P2Z A;  1KP3 A;  2DJV A;  4MT8 A;  4K0K O;  5LL6 Y;  2KG7 A;  4J41 A; 
#chains in the Genus database with same CATH homology
 3UKM A;  2YEV A;  1S72 V;  1QLN A;  4UUJ C;  3W7X A;  1YJ9 V;  1FS0 G;  2HFE C;  1OCR C;  4PA4 A;  4QE9 A;  2QKS A;  4QNH B;  1DF4 A;  2H94 A;  3GB7 C;  1GTO A;  4G28 B;  5LGU A;  2WPD G;  1NH2 B;  1KKD A;  4MSW C;  4QIW F;  4R50 A;  2WLM A;  1QBZ A;  4PA6 A;  3SJQ C;  3WG7 B;  1VQ9 V;  2KB1 A;  2MK3 A;  4Z1M G;  2AHY A;  1ARO P;  3OW2 U;  1FXK C;  1OCZ C;  4QPK A;  3LSQ A;  1K5Q A;  4X8A A;  1P7B A;  3ZCC A;  1Q82 W;  4J9Y B;  2Y69 C;  1S76 D;  2H8P C;  2DQ0 A;  4BW5 A;  3T1C A;  4MW3 A;  1VQ4 V;  2W0F C;  1YIT V;  3ABM B;  1BMF G;  1NH2 D;  3ZRS A;  5LBQ A;  4JPR A;  4R7C A;  4ASU G;  4UVC A;  1THZ A;  2WLI A;  1JQ0 A;  3ZIA G;  3ZN1 A;  1DLB A;  3ETE A;  1OCO B;  2EIL C;  4TWK A;  2HR3 A;  3FKS G;  5EBL C;  3ASN B;  1OZ0 A;  2ZR2 A;  2HLD G;  1YTF D;  3QNE A;  1LNQ A;  3BEH A;  4HYO A;  3P32 A;  1SRY A;  1XL6 A;  3AG1 B;  3IC7 A;  3AG3 B;  1AJQ A;  2QE7 G;  1RPO A;  4PA3 A;  4YXW G;  1GM7 A;  5CMU A;  5KA5 A;  3I56 V;  3K79 A;  2UXN A;  3CCR V;  1KP2 A;  2A0L A;  4MVQ A;  2DYR C;  3OUF A;  4MTF A;  1NR1 A;  2EIN B;  2ZQM A;  2X0L A;  1NVP D;  2JIZ G;  5KUM A;  1SES A;  2DYS C;  1BL8 A;  5IYD O;  2R9I A;  2ZXW B;  3ABK B;  4WCE V;  1R3J C;  3OMA B;  3ZMU A;  1NKD A;  3TK1 A;  4JAV A;  4XDL A;  3NXS A;  3E2E A;  4PDR A;  2PI5 A;  1HWY A;  1NBM G;  2XAS A;  1I5X A;  2HJF C;  2EZO A;  1PL0 A;  4BIU A;  1K8A W;  1G4Y B;  3GWO A;  4WF9 V;  1NJI W;  3E8G A;  2IW5 A;  4I9W A;  1Y66 A;  1NVP B;  2Q68 A;  3W7T A;  1F51 A;  2FTK A;  3ZRX A;  1NQT A;  5DN6 G;  1QLE B;  1BHB A;  3JD1 A;  1VQ5 V;  4RO2 A;  4PA7 A;  1E1R G;  2EIJ C;  1K92 A;  1QR9 A;  1V55 B;  1EZJ A;  2EIK B;  2IJI A;  5CBF A;  2W6I G;  1KD1 W;  3AG3 C;  2P90 A;  3X2Q C;  4ZBM A;  1TUE B;  2JEX A;  1NR7 A;  3AG2 B;  5CA3 A;  4PA9 A;  3QO7 A;  1K4D C;  1XL4 A;  3SPC A;  3ASO C;  3CCL V;  5IYB O;  4MW8 A;  2X6B A;  4H37 A;  1YJN V;  2JK5 C;  1SET A;  3E8H A;  1K73 W;  3ZN0 A;  1M56 B;  3QO8 A;  4MTO A;  2CK3 G;  4MS2 A;  5L3C A;  4FPP A;  4QJF B;  5B3S B;  1V54 B;  4XDJ A;  4GX1 A;  3HB3 B;  1E79 G;  1AJN A;  5L3D A;  2EZP A;  2XAJ A;  2Q6A A;  2QTO A;  2PI4 A;  4G2K A;  2XAH A;  3LDD A;  3OMN B;  3FYI B;  1M56 C;  5H6Q A;  1M57 C;  3TCU A;  3OFN G;  4PEL A;  4QE7 A;  2M7W A;  2QM7 A;  4WFF A;  3A0R A;  2ZD9 A;  3K3W A;  4DO2 A;  5IY5 B;  2WLL B;  2BOB C;  3AG2 C;  4MTG A;  3QO5 A;  3E35 A;  3CC4 V;  4JTA B;  3ASO B;  4JAU A;  4UVB A;  1K3E A;  1K9M W;  3ML0 A;  2P6J A;  1QCE A;  1YHQ V;  5B3S C;  1ENV A;  2B5U A;  3OEE G;  1PNK A;  2Z3Y A;  3B8M A;  3K0D A;  3JYC A;  1VQ8 V;  3EFF K;  1VQL V;  5B1B C;  5HFM A;  3SYC A;  2Q69 A;  2P7T C;  3OGC C;  1Q86 W;  1QR8 A;  3SYQ A;  1WPX A;  1YSC A;  3OUS A;  4PDV A;  1VQK V;  4MTX A;  2Y48 A;  5EBM C;  4OXS A;  3KG2 A;  2LFS A;  3ZMT A;  3D36 A;  1FXH A;  2K1E A;  1M57 B;  3F7Y C;  4RUE A;  2B1G A;  1VQ7 V;  2JJ1 G;  2NLJ C;  2HKO A;  2V1D A;  3CP1 A;  1AI7 A;  2ZDI C;  1VQP V;  1WLE A;  2BOC C;  3I55 V;  5DM6 V;  1YJW V;  1AI6 A;  1ORQ C;  5L3F A;  3ABT A;  1OCZ B;  2DQ3 A;  1YIJ V;  1J95 A;  5B1A C;  3T4D A;  1DF5 A;  1K34 A;  1AI4 A;  1FXK B;  3OAA G;  1S77 D;  1RM1 B;  3CCS V;  3LNM B;  2HG5 C;  3SPH A;  1AR1 B;  4PDM A;  3OMI B;  3CCJ V;  3ZRW A;  3M99 B;  3MHS C;  1K7D A;  4JYC A;  3LUT B;  3SPJ A;  1QVG U;  4PDL A;  4MVU A;  1OCR B;  1OHH G;  4JAS A;  3ETD A;  4FMT A;  1VQM V;  1R3L C;  4RUF A;  2EIL B;  3TET A;  3CC7 V;  5EC1 C;  3VOU A;  2EIK C;  4JF3 A;  3CCM V;  1R6N A;  2GHY A;  5HFL A;  1OCO C;  3H01 A;  3WFV A;  1F4M A;  3G71 V;  4WFB V;  3IGA C;  2Y69 B;  4Q20 A;  2NNU A;  3JD4 A;  2D3O W;  5E1A C;  3HPL C;  3ZMS A;  3CME V;  1JOY A;  1F4N A;  3CPW U;  3FB7 C;  4H33 A;  2GSM B;  4XDK A;  1KQS U;  3IFX A;  3E83 A;  4F4L A;  5CBG A;  4BAY A;  1H2G A;  1SER A;  3K04 A;  3SPG A;  2QEX V;  4X88 A;  1S0V A;  1DTO A;  3CD6 V;  1PNM A;  3ABU A;  4MVS A;  2YSU B;  3WG7 C;  3T4Z A;  3K9A A;  1JCH A;  2DWE C;  2HVK C;  2ITC C;  2ZXW C;  3ABK C;  4I5S A;  3SPI A;  2AHZ A;  2F43 G;  1M90 W;  4LBE C;  3MHH C;  2W6J G;  1MG1 A;  3LSS A;  3T2M A;  2WLN A;  4UXN A;  1GK9 A;  3OM3 B;  1QLE C;  3LDE A;  4U7O A;  2X7R B;  4P30 A;  1VQN V;  2EIJ B;  3F5W C;  3FB6 C;  1V55 C;  3W7W A;  2EBO A;  2X6C A;  4U7N A;  1M1K W;  3OR7 C;  4UVA A;  3FB8 C;  3ABL C;  5LHH A;  1H38 A;  2WLH A;  1VQO V;  2WLI B;  4E2L A;  1P4R A;  4HZ3 A;  4WFG A;  1K97 A;  3X2Q B;  4UV8 A;  3ZJZ A;  1JJ2 U;  4WFA V;  2EIM C;  1UJW B;  1FFT B;  1JVM A;  3JD3 A;  4GCZ A;  4DXW A;  5EK0 A;  4GX2 A;  1JPX A;  5LHI A;  2ATK C;  3E86 A;  3W7U A;  3CYO A;  3VBB A;  5B1A B;  4CZZ A;  5LGT A;  3CXC U;  1V54 C;  4GX5 A;  3CC2 V;  2OTL V;  4RQF A;  2YEV B;  2EIN C;  4GX0 A;  3JD0 A;  3E8F A;  4WFH A;  3UM7 A;  4RQE A;  5IDJ A;  2OTJ V;  1BHA A;  1GMG A;  1SZT A;  2IJJ A;  4RAI A;  3AG4 B;  4P9P A;  3SYP A;  4FK5 C;  3CCE V;  2ZR3 A;  3AG1 C;  3K03 A;  1VQ6 V;  2IJK A;  1W0K G;  1IXM A;  4MVZ A;  3PJS K;  3STZ C;  1N8R W;  3ETG A;  1OCC C;  1AI5 A;  1COW G;  1R3K C;  1PNL A;  2IU0 A;  5L3G A;  1CP9 A;  1F23 A;  3SYA A;  2DYS B;  2DW4 A;  2IH3 C;  1K33 A;  1S5H C;  3G4S V;  1MOF A;  3P30 A;  3W7S A;  2ITD C;  1EFR G;  3CMA V;  4L87 A;  1QVF U;  3STL C;  4LC1 A;  5BZB A;  5IY5 C;  3ZMV A;  3K08 A;  4R8C A;  4MVR A;  2DWD C;  3EHB B;  2A79 B;  3FYE B;  3RBZ A;  3E8B A;  2WSS G;  3K06 A;  1GM9 A;  4ZKI A;  3AEI A;  2A9H A;  5KUK A;  1R6K A;  2LP7 A;  1ZWI C;  5IYC O;  2HVJ C;  2WAM A;  4EKW A;  3F7V C;  3K0G A;  3DTU B;  1H8H G;  2EIM B;  3OR6 C;  4LP8 A;  5EBW C;  3ZMZ A;  1GM8 A;  3B77 A;  5LHG A;  1H8E G;  1MSW D;  5C93 A;  4QPJ A;  4UV9 A;  4TSF G;  4R6Z A;  2Q67 A;  4XBF A;  5GW7 A;  3R65 A;  4N23 A;  1CPY A;  3JD2 A;  2IJH A;  1EBO A;  4KFM A;  2C2A A;  5B1B B;  3RVZ A;  4JGS A;  4X89 A;  2XAQ A;  1E1Q G;  1FXV A;  4LCU C;  2ZDI A;  4GT1 A;  1M9N A;  5KA6 A;  4JTD B;  4JTC B;  1GO3 F;  1B6Q A;  1K5S A;  2V7Q G;  1KC8 W;  3CCQ V;  3ABL B;  3CCV V;  2IU3 A;  4TT3 G;  3FB5 C;  4J9Z B;  2JJ2 G;  2QA4 V;  1RPR A;  1CEZ A;  2EJR A;  3SYO A;  4BIZ A;  2XOK G;  1OCC B;  5L3B A;  4KP4 A;  2WLL A;  3ASN C;  3BY6 A;  5B1O A;  5CN0 A;  4CBC A;  3RVY A;  4FJC C;  1PD3 A;  4KUM A;  3JCZ A;  2OCC C;  1KEC A;  4G27 B;  1Y4M A;  2X6A A;  2LFR A;  5B1N A;  2IH1 C;  1S3J A;  3B8N A;  5L3E A;  2R9R B;  4MVO A;  5H9C A;  3ABM C;  2DYR B;  2JEU A;  4MVM A;  2XAF A;  3D3I A;  4HAM A;  4WFE A;  1L1F A;  3OEH G;  3LDC A;  4FIP C;  1W2B U;  2OCC B;  2OT5 A;  1I5Y A;  1YTF B;  2Z5U A;  2JDI G;  5J9P C;  4N21 A;  5EC2 C;  5LGN A;  3RW0 A;  3G6E V;  3CCU V;  1R73 A;  3OE7 G;  4P9O A;  2B1I A;  1GKF A;  3ZRV A;  5CBH A;  1AJP A;  2WLJ A;  1MAB G;  3E89 A;  3MD0 A;  2UXX A;  1PKX A;  1Q81 W;  2XAG A;  2XND G;  3DGE A;  3AG4 C;  1G8M A;  2QM8 A;  1K4C C;  1R3I C;  1YI2 V;  2WLK A;  3ZRW B;  1Q7Y W;  1ROP A;  1JX9 A;  4P2Z A;  5H6R A;  1KP3 A;  2WWW A;  4MT8 A;  4JYB A;  1FXK A;  2P67 A;  1W0J G;  5FL7 G;  1RM1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...