3I55V

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i55V00
3G4SV 3G6EV 3CXCU 4WF9V 1YJNV 3I55V 3CCSV 3CCQV 3CCRV 3CCVV 1VQKV 1YHQV 1S72V 1VQOV 1QVGU 3CC2V 1KQSU 1K73W 3CCJV 1YJWV 1KC8W 1YIJV 4WFBV 3CMEV 1N8RW 1JJ2U 1VQMV 1QVFU 1YJ9V 2QA4V 1VQPV 1VQLV 1W2BU 2D3OW 5DM6V 3CD6V 3CC4V 3I56V 1YI2V 2OTJV 1Q86W 4WFAV 4WCEV 3CCUV 3G71V 3CCMV 1KD1W 1YITV 1M90W 3OW2U 1R73A 3CC7V 1NJIW 1VQ4V 1VQ6V 1VQ5V 3CCEV 1K9MW 2OTLV 3CPWU 1Q82W 1VQ8V 1K8AW 1VQNV 1Q81W 1VQ9V 1M1KW 3CCLV 1Q7YW 3CMAV 2QEXV 1VQ7V
chains in the Genus database with same CATH superfamily
4B3TO 4P2ZA 4DK0A 4DV3B 1QR8A 4FZ1A 2W0XA 4JTAB 1VF6C 1VQPV 3CEIA 3MD0A 2X0LA 3KG2A 4MVQA 3SYOA 3E22A 3OGIB 1AJNA 1XNQO 1PNKA 1IBMB 3N27A 3ZHRA 1NTKH 5JJJB 2E74B 3G6BA 3ZRWB 4LF8O 1GM8A 2MW2B 3FB8C 1H8HG 4O4JB 1Q8IA 4WFFA 2ZXWC 5CMUA 3GB7C 3FD9A 1Q6UA 3ZS8C 5H6RA 4X89A 3K59A 2W6JG 3CJHB 3IGAC 4JTCB 1SA0B 2PTMA 1FJGO 3E8HA 1HNWO 1CEZA 3HKBB 1S72V 4I9QA 2NNUA 5LGTA 2M7WA 3ZHQA 3IFXA 3OE7G 4I4TB 4DXWA 4PELA 2QR4A 1TA8A 5L3DA 4D6TH 5IT9N 4JGSA 4XBFA 1RP3B 1A32A 4YXWG 5JVDA 3DSQA 3ZMVA 1JOYA 1BSMA 1MA1A 4KP4A 3G4SV 1S77D 1B06A 5J2TB 4XDJA 2QKAA 1BS3A 1VQLV 1THZA 4WFGA 5KUMA 2DWEC 3ABUA 4WFAV 4JI7O 2JGUA 4FIPC 4JI1B 3JD1A 4YJ2B 2YIDA 2AHZA 5LP6B 1VQ8V 5DN6G 1G4YB 4IGGA 2VQFB 2QSAA 1YJNV 4DR7O 1AVMA 1G1XB 3RGBA 4X1KB 1QNMA 3JYCA 5J2TA 2GDSA 3ZRVA 4IYHA 5IYCO 4DV4O 4DV5O 2Q9LA 2Q7HA 1XMQB 4H13B 3K9AA 2WA3A 4NVPA 3RYHA 3UO3A 2ZKOA 3B09A 1LNQA 1HWYA 4CZZA 1FXHA 2DMXA 1LR1A 2DQ3A 4QIWF 3L9DA 2OT5A 1NVPB 3RYCB 4FFBB 4ZIBA 1XDCA 1QBZA 4W4KA 3TK1A 1V9PA 3PJSK 1XNQB 1P49A 4J41A 2LFSA 3G6EV 1IBKO 4PJ0Z 3HKCA 3WB1A 5BMVB 3IC9A 1H2MA 1SQGA 1MNGA 4CS2A 3OMNB 2O57A 2ZE6A 2ZE5A 5DEDA 2ZR2A 2HLDG 2Q73A 1K4DC 2LGWA 5LMNO 1P84F 2R9IA 2QJ1A 5B1AB 4I0XA 2NR5A 3ZJZA 5LP6C 1VQKV 4YJ3B 1JJ2U 4R8CA 1HR0O 3QNEA 1KBHA 4Q20A 4O2AA 2ZD9A 3CCEV 2PYLA 3O9OA 3S3XA 4DV5B 1K3EA 1F51A 2A7WA 2EJ7A 1E79G 1N33B 4H33A 3JSNA 5B1BB 1YTFD 4GKJB 3ZMSA 4JAUA 5KAFZ 3SYQA 2WLMA 1QLEC 1JFFB 2Z3YA 4GX2A 1F4MA 3EVKA 2QKCA 1DGSA 4TQDA 4JI1O 5J2UA 3DXRB 4WFEA 3AK2A 4DR6B 5GW7A 4BIOA 5EYPA 4OXSA 1ENVA 2WLKA 4BW5A 3OR6C 1V54C 4X62O 4U3JB 2Y69B 3IJ4A 5LMNB 1TUEB 1K9MW 4FMTA 2V4DA 3ZX6A 3U0ZA 4ZHQB 3K08A 2ZT9B 1YTFB 4JTDB 1WJZA 2P06A 2H3OA 3Q4HB 3CMEV 5IYZA 1JJOA 3ASNB 3E89A 2QA4V 1WB8A 2FMLA 2KG7B 4MW3A 4JASA 2K1EA 2E5LO 1ZLZA 3ABLC 1I0HA 3ASNC 4DUZB 3NXSA 4PA7A 4IT5A 3OW2U 4FPPA 1DF5A 2W6IG 2JS3A 2UXCB 3K0GA 3W7TA 1AI6A 3JCZA 1R3JC 3JD4A 4DW0A 1W0JG 2DOSA 4K3AA 5B5EZ 5J2UB 3HKCB 3K5LA 3CP1A 3A0HZ 4BWAA 2P4VA 2UXNA 2B9ZA 2P67A 1AI4A 4GT1A 3HR0A 2F4VB 3ZHSA 3RYFB 2VS0A 2L35A 4LNUB 1UJWB 4K8ZA 3D36C 4NTYA 3CJHA 5HFLA 1QCEA 1G6UA 1AILA 2ATKC 2JVDA 2D3OW 3O65A 2LO1A 3JATB 4TV8A 2QKSA 3AG7A 3WG7B 1R3KC 4MT8A 2JIZG 1URFA 1BE3H 2DWDC 3EFFK 1NBMG 4AQYB 4YJ3A 1Z5VA 5LOVA 1GKFA 4GUNA 2PY5A 1FFTB 1KQSU 4NXNO 3LUTB 4GZRB 1XNRB 3K5MA 3HKDB 1NR7A 4X8AA 2VWJA 1XL6A 2GHYA 5C93A 3K57A 3B77A 1M56B 1KMIZ 2R9AA 4QJFB 5IWAO 4CH3A 1XMOO 5JH7B 4X66B 3ZIAG 1TGOA 5IYBO 4B7KA 4JV5B 1HNWB 3UCSC 3AG3B 2OIGA 4NB5A 4JPRA 4I5SA 2DN9A 2IH3C 1XUQA 1L1FA 2HJFC 3U10A 3K3WA 4B3TB 4I55A 2EIMC 1HR0B 2XOKG 3ML0A 4LF6O 3KZIZ 4UFZA 4KXRA 2PF4E 2EINB 3H1HH 3HKBA 1H38A 1Q86W 1IBMO 3K5OA 3C3SA 2HHHB 2BOCC 3P3PA 3NR7A 5CB4B 5CN0A 3CRMA 2QE7G 4LFBO 4OPHA 2CGNA 3F5WC 3N2KB 4J7ZA 2EIMB 4GYCB 4X20A 4FFKA 4O4IB 2P4KA 3E35A 4U7NA 1VQ5V 1WP7A 2Q0AA 4IIJA 4XDKA 1FFXA 5LYJB 3WG7C 2ETNA 3ETGA 2WLHA 4IHJB 4MVZA 3ZRWA 1FFXB 2IH1C 4QE9A 1ZWIC 3D36A 4HNAB 2EIKB 2YUAA 3ASOB 1D5NA 2N04A 3G67A 3K06A 4PI2A 2EIKC 4TV9B 5IY5C 3SJAC 1LUWA 3OTFA 1K92A 3OMAB 5LGNA 4MTGA 2LJ2A 3R66A 1Y74A 4X88A 3E8GA 2A0LA 3RYIB 3QO5A 4H0LB 4K35A 2DJVA 2XTAA 1NJIW 4ZOLA 2WSSG 4YY3O 3SPHA 1SESA 1K97A 1U96A 1HNXO 4EB6A 1RSOB 2QWPB 4J42A 4CH6A 4JI2O 2LGQA 4FK5C 3CCMV 2GSMB 2GTSA 3ZMTA 4UCTA 1YVWA 2ZNJA 2HVJC 1R6NA 4J7KA 3RWRD 1NT2B 1CXZB 4YIPA 2KB1A 3RVYA 1KC8W 2UUCB 2Y69C 2KSDA 4FM1A 4UV8A 1OCCB 2N74A 1GN2A 5BR8O 2YEVB 5KAIZ 2N05A 3KCYA 1K5SA 3HKEB 4H37A 2LW1A 4F4LA 1PV0A 3IAYA 3DTUB 1MSDA 5IJ9A 1VMGA 1Q81W 5JQGA 1Q7YW 3L73H 2Y4TA 3VQYA 4P9PA 3ETDA 1P7BA 4BIUA 1N32B 1EFRG 4PD4F 1AR1B 3OGCC 1N36O 1D5AA 4R7CA 4ICGA 1QU7A 4FLYA 4O2BB 1IURA 4PA3A 1R1BA 4ZI7A 2PGGA 3N2GB 3JASB 4DV4B 4UCOA 2RN9A 3E86A 1DLBA 4LWSB 1L0LH 3KKYA 2IJJA 4LF7B 1BQ0A 3ZHTA 3EXAA 5H6QA 2HJDA 3QO7A 4MVRA 4B3RB 1V54B 1SZTA 2P5OA 3T1YO 2VQFO 4O2AB 3ZBHA 1OV9A 3MHHC 1JA8A 2C2AA 3ZMZA 3M8AA 2V7QG 2PI4A 2B5UA 1K5QA 3W7UA 4MTXA 3T1HO 5B3SC 3JARA 2X6AA 4PHZA 1NKDA 4DUYB 1AR5A 3CYOA 2LP7A 5IYDO 1WPBA 3JD3A 5FNVA 4KHPO 1BCCH 4WBNA 1M56C 2FB5A 2OCHA 3OUFA 5AG2A 1R73A 3GVMA 3UO2A 2RJZA 3JAMN 2AXTZ 1Q43A 3VOUA 2QWOB 1AP5A 3I55V 1AB3A 3SJQC 1NTMH 1MABG 1GN4A 1YJ9V 3SDLA 3RFRA 1AJQA 4X20B 4UCUA 2VQEB 5B1OA 5LP6A 5KMGB 1YSCA 2HG5C 3TXQA 5FPRA 2YIAA 1MZEA 1KD1W 5LA6B 1ZAUA 4UV9A 5B1NA 1I94O 2BCCH 1VQOV 1GMGA 1NQTA 2ZE7A 5TISZ 3P30A 1B04A 2RMKB 3SPCA 5CA3A 3LSQA 4DUZO 2CK3G 2XAHA 4LFCO 2YXYA 1L0NH 3BA8A 5LXTA 4E4EA 1HDJA 4GX0A 4JI3O 1JMKC 4X9QA 5GONA 1F4NA 2EZPA 2HEPA 5IJ0A 2WA4A 1N34O 2ZNIA 2EULA 5D5QA 4YIOA 1NH2D 4PI0A 5K1PA 1U97A 1VP7A 1OHHG 4J80A 5E79Z 1BL8A 2WLIA 2F43G 1YCIA 1X4TA 1Y4MA 1VEWA 3OTOO 3E83A 3FKSG 4Z1VA 3APOA 1S5HC 3K04A 3E8FA 2YC0A 1BHBA 2JGDB 1XBLA 2R9RB 3W7XA 3G80A 1JCHA 5L3BA 5F2VO 4L87A 4JI4B 4RQFA 2L6LA 3LSUA 1GO3F 5BMVA 4UCVA 1IBLO 4O4LB 4OPAA 3CCUV 3DC6A 2ARHA 3MAQA 3JATA 1FPOA 1HW7A 3UKMA 1GRJA 3W7SA 1E1QG 4HBNA 1SS3A 1BQZA 1PNLA 3J7AU 2EJRA 2Y48A 4MW8A 5KUKA 4DR1B 4GKKO 4DO2A 4H44B 2WPDG 4DV1B 1N0NA 1ROPA 4DR4O 3UT5A 3A0BZ 1K7DA 4QGPA 1RFYA 2PUSA 3ABLB 4CH5A 2DYRC 1YI2V 2OTJV 3FB7C 1PKXA 5CA1B 2UXDO 1WN7A 2WAMA 3B2EE 4JI8B 5JJNB 2XAJA 2RCVA 4PV1B 1M9NA 3OEEG 3CMAV 4GX5A 3T4ZA 1FXVA 3BAAA 1I5XA 4FLTA 1XL4A 4TQFA 1EM1A 3VBBA 1WLEA 4GKKB 2GUZB 1V55B 5CA0B 3OAAG 1PM9A 3CC4V 5EZYB 1BZKA 2BTQA 1NU1H 2IJIA 2IBZH 3EHBB 1KECA 2WLLB 1IZ3A 4PDRA 3CSXA 1M1KW 1H8EG 1PNMA 4YJ2A 4LF8B 1J5EO 3RVZA 3JD2A 4TUYB 3E2EA 2E5LB 4B3SO 3JAKA 3S3WA 4LF9B 3CRRA 4DR7B 1VQ9V 3WB2A 2E76B 5LA6A 4DV2O 1VQ7V 4DV6O 2QTSA 1N36B 2CTRA 4C7UA 2YXHA 3CCJV 1KP2A 2YDEA 1JFFA 3BY6A 2AZ2A 4I7ZB 3B8NA 1WA8B 3H01A 1FS0G 3OFNG 3K03A 2JEXA 1M93A 4JI5B 4LNUA 3BVOA 3W7WA 2YIBA 3TXSA 4MSWC 2Y0IA 1N34B 2UXBB 4LF4B 3OT7A 2PYJA 4CS4A 1B3QA 3SYAA 1FD9A 5BR8B 4TWKA 4X64O 3D8CA 3H1KH 4NKGB 2ZR3A 4RQEA 2XAFA 3TETA 2A79B 3LSSA 3AG3C 2QGNA 3AK1A 3CE2A 2JJ1G 1KP3A 1GN3A 1AJPA 2P22C 1BMFG 2QM7A 4DR2B 3WB0A 1W0KG 4NTXA 2DYSB 4BW9A 2OTLV 5E1AC 1JQ0A 5D5PA 4DR4B 1OCOB 2OCCC 4JI0B 2EILB 3ETQA 1HNXB 5KHJA 1YHQV 2AZ0A 5IYZB 3WU2Z 3ETEA 4MS2A 2YSUB 2XAQA 1H2KA 4X65B 1FAFA 1SQXH 2DW4A 1WA8A 1OJHA 1Q5OA 3BA9A 5EC1C 5KHGA 1YITV 1UPGA 3ZRXA 5ITZB 1IXBA 3FB5C 1JX9A 4KL1A 1K8AW 1TVKA 1Y66A 4D7SA 4WF9V 1PD3A 4JI0O 2Y0PA 2NN4A 4J9YB 2LQTA 1ZL8A 4B7EA 3AK3A 5A2QN 4TUYA 2P6JA 3AG2C 1Q6HA 3K0DA 1Y67A 3B40A 4X1YB 3U11A 3ZMUA 3VQXA 3T2MA 1OCRC 4MVUA 2OWOA 1NVPD 5H9CA 4LF5B 4X1IA 5LHHA 4KHPB 1IBKB 1BHAA 2BTOA 3UT5B 4OX9O 1TUBA 2ZE8A 3RYHB 2JEUA 1FKAO 4EB6B 5IDJA 2UXBO 2KQXA 3RBZA 3QVNA 3J80N 4TT3G 3GWOA 2FTKA 1PL0A 1T5EA 5ITZA 4KUMA 1GAXA 1R6TA 4MTOA 5H5NA 1GK9A 1KB9F 3CWBH 4LF5O 4DR3O 1R3LC 4CS3A 2Z0AA 1S5JA 4JYAB 4DV2B 3CCVV 1Y76A 1MSWD 3JALB 4LFBB 4L8JA 3HPLC 2W0FC 1K33A 4P9OA 4WCEV 4DV0O 3CRAA 5IE9A 3QF7A 2V1DA 2HHHO 3ZN0A 1AP6A 1XQ8A 2ZINA 2UUBB 4DRXB 2WLNA 4CBCA 3JAWB 5CBHA 1YXBA 3ABKC 1N32O 5JVDB 5KHKA 4LBEC 2QM4A 4JI7B 5EK0A 2ILMA 3ZEDA 2WLJA 1WAZA 2CGOA 3P3NA 1EZJA 2B1IA 4NXMB 2IM9A 2YI8A 2HP8A 4TOIA 1Z5WA 4TV9A 4O4IA 2R72A 2H8PC 2UUCO 1SA0A 1OCRB 1R3IC 5GTHZ 1XMOB 2QWNB 4UB8Z 5JCOA 4QE7A 1IXMA 1NZ6A 4PDLA 5LMUB 1JVMA 3STLC 4FLZA 1SQPH 4ZBMA 2FL4A 2F95B 1S5LZ 2YICA 1KKCA 2ZXWB 4F6RB 4DV1O 5KX5A 1FJGB 4NXNB 1I7FA 4NXMO 2Q7GA 5L3CA 5BZBA 2HVKC 1TAEA 3CS5A 4JYCA 5HFMA 5GONB 3SGIA 4IYIA 2WLLA 1MOFA 1SRYA 4R6ZA 4GX1A 5LMUO 4UCSA 1X59A 1KUQA 3T1YB 2FYUH 4BIZA 5L3EA 3CCSV 3FB6C 3B4SA 1N8RW 3JCUZ 1FXKC 4PA9A 3P32A 3K9SA 1M57B 2WWWA 4JI6B 3GWKC 3LDEA 2EIJB 2CDYA 3BEHA 4LR3A 1VQ6V 4JYYA 1TUBB 5B3SB 4N21A 3DXRA 2HR3A 3SPGA 3ZN1A 2VRZA 3HKDA 1QQCA 1J95A 5GTIZ 2CTPA 2RDCA 4I50A 1YEWA 2P90A 4X1YA 1E1RG 1PPJH 3JSLA 2ZDIA 5LOVB 2ZM6O 1ZSPA 5KX5B 4ASUG 5KHIA 3I5DA 3JD0A 4RO2A 4Q6GA 2EX3A 2MK3A 4GLXA 1H2GA 4DV0B 2EBOA 1VF5B 2XNDG 3CRQA 3WFVA 1CPYA 2A9HA 3L70H 4O4JA 3C90A 4IL6Z 4JZGA 4BAYA 4JYAO 1IDSA 1AI5A 2CTQA 3TGUH 4U3FH 5FNVB 3D3IA 3X2QB 5K1XA 3B8MA 4NTWA 2Q7EA 3M99B 3AG2B 3SPIA 4MVOA 1GM7A 2ZM6B 4DR1O 2P7TC 2CTWA 2OIEA 3CCLV 2ITDC 2QTOA 4FLWA 5EC2C 1O9HA 2FKXA 2XT9A 4NYKA 4YY3B 3E8BA 4FVMA 1RM1C 4O4HA 4B08A 2R70A 3LNNA 1ORQC 2XUMA 4JI3B 1SF9A 1N4CA 1FXKA 3MHSC 3OM3B 4X65O 1KYOF 3APQA 4EFEA 4DV7B 1QR9A 4U7OA 2CAZC 4DRXA 4G27B 4GKJO 2EILC 2B1GA 3THOA 4B3SB 1SETA 4A5UB 3ABMB 2DYSC 3RYFA 1MZFA 3K58A 3L75H 1QLEB 5B1AC 4X1IB 3SYPA 3RYCA 4LFAO 4MTFA 5B1BC 1EN6A 4LH6A 1BT8A 4ZHQA 1XREA 2Q0OC 5EIBD 4FLUA 1M5IA 3QG5A 1VQNV 1XNRO 3K5NA 3C3TA 1ZUQA 4FM2A 3CB2A 1HNZB 4X64B 3CXCU 3JAWA 1SC5B 3M7MX 4Z2WA 2QWRB 1SZXA 4AHCA 5EBWC 5JCOC 3VQWA 1JPXA 1F7YA 1N0JA 4J11A 3IC7A 4X1KA 1OZ0A 4O2BA 4DR2O 4JAVA 3FAVB 2Q69A 4JI8O 3JALA 2GBOA 2YIBD 5C8YB 1XI1A 4Z1MG 2ADPA 2BSKB 1YIJV 1EN5A 1XILA 4LFCB 1RSOA 2EZOA 1SERA 1HP8A 3FFQA 4LF4O 1J5EB 5A9GA 2UUAB 2ZIMA 2GUZA 2GV9A 4UUJC 1TVKB 1I94B 1YDXA 3OD4A 2IU0A 1D2DA 1AI7A 4GCZA 2QEXV 2OYQA 3ZHUA 5LHIA 1K4CC 1IBLB 1XOUA 2JJ2G 2YS8A 5LYJA 1EBOA 1WPXA 3BCCH 4I9WA 4HZ3A 2Q6AA 2YXLA 5CBGA 1QHTA 2CH7A 1XEQA 4LF7O 1P7GA 2XASA 4J10A 4WFHA 2X6BA 2Y4UA 1GH6A 3AG1B 1S76D 2Q8VA 4X66O 1I5YA 3FYIB 1DF4A 5LGUA 5KHHA 2F93B 1W59A 1NS1A 4O4LA 1FXKB 3TJTA 1H2LA 4UVCA 4CC6A 3SR2C 1M57C 4O4HB 3RYIA 1K34A 3CPWU 4LWSA 3JASA 1GTOA 4G2KA 5JJEB 4ZI7B 1S3JA 1S0VA 4AQYO 4FFBA 2ZCEA 2BE3A 1HNZO 1W2BU 1GM9A 3I56V 4UCRA 4LFAB 5IJ9B 3CXHF 2UXDB 5B66Z 3AEIA 4FLVA 1N33O 4EEQA 1XHXA 2UU9B 4IIJB 4E2LA 2Q5ZA 2HKOA 1YJWV 2ZDIC 1H2NA 5JH7A 2DQ0A 5EBMC 1Q6IA 3MDSA 3PN1A 5IJ0B 4K8XA 3H1JH 4MVSA 5CA1A 4I50B 2LFRA 3X2QC 1I08A 4JZ2A 3BABA 2IJHA 3L72H 1OCCC 2IJKA 3BHPA 4CC5A 2IU3A 1EZVH 5FPOA 4F6EA 4YHHB 2NLJC 1F23A 5CA0A 5EIBC 3F5TA 4LH7A 3ABKB 4UB6Z 4ZOLB 2JK5C 4RAIA 3OTOB 4EKWA 1RPRA 2A3QA 2ODMA 2F23A 1LUVA 5L3FA 3DC5A 5CBFA 3CCQV 5KMGA 5BY1A 3ZHVA 4JI2B 3BPZA 1XHZA 3SJCC 2ZIOA 4UVAA 1AROP 4UXNA 4P30A 5KLVH 2EINC 2DYRB 1COWG 3OEHG 3T1HB 4X62B 3ZCCA 5BXZA 3STZC 4LF6B 2YI9A 3CRCA 2A06H 2E75B 1GN6A 2GTAA 2K9PA 2QM8A 2WLIB 2XAGA 2IW5A 1JR9A 1VF7A 3CX5F 3HB3B 3RW0A 2X6CA 4TV8B 3LDCA 1PP9H 3A2FA 4WBNB 1KKDA 4FLXA 2PI5A 4I4TA 5FL7G 1YZBA 3ABMC 4LF9O 3L71H 1VIBA 4JF3A 2JGDA 3OUSA 5IY5B 1Y6XA 2HFEC 2AW9A 4N23A 1UFIA 3BFRA 3N2KA 3Q4HA 5IWAB 4YHHO 4WFBV 1VQMV 4MVMA 5LXTB 1RM1B 3SJBC 4HAMA 2LW7A 4J9ZB 1OCZC 4B3MB 1Q90D 2JS5A 1KU9A 4U3JA 3ZRSA 2BOBC 4DYLA 4RWUA 5EYPB 1ZX3A 4JV5O 2Z5UA 2UU9O 2KG7A 3E22B 3ICXA 3AG1C 1B6QA 5LBQA 3FYEB 4B3RO 4BR6A 1P4RA 1WB7A 1V55C 4FM0A 3OR7C 3CHXA 1ZL8B 1NH2B 5L3GA 5DECA 1L8DA 1NTZH 2UXXA 3H1LH 3K79A 1VQ4V 4K0KB 2DE0X 3SYCA 4JYBA 4JI5O 3H1IH 2F66C 3BRCA 4AI8A 3UM7A 4RUEA 1MMMA 4UVBA 5C8YA 1EN4A 3CC2V 4DV6B 3D3QA 2XHBA 5KA5A 2ZQMA 1WP8A 5KA6A 3UQ8A 2UUAO 1BGYH 3LDDA 5H2FZ 3JARB 3VQVA 4LP8A 1XMQO 4JI6O 4PA4A 3RN4A 2QWQB 3A8TA 4F6RA 3T4DA 2F4VO 4QNHB 1Q82W 5EBLC 4KFMA 4RUFA 4HYOA 3H9VA 1IVSA 1YF2A 3OMIB 4DR3B 3ABTA 4LC1A 1QVFU 4DR5O 5DM6V 2D2CB 1OCOC 3DGEA 2AGAA 3SPJA 5LL6Y 1DTOA 5J9PC 4K0KO 1NR1A 2X7RB 3TCUA 2CH7B 1DK1A 4JAAA 4DR6O 1SQVH 2M6YA 4FZ0A 4LCUC 4HNAA 2EIJC 4DW1A 2H94A 2E3CA 3CD6V 4CH4A 1MG1A 4OGQB 1R6KA 4NR1A 3AG4C 1M90W 1OCZB 3HKEA 1G8MA 1SKVA 4EFBA 2F1MA 2RQ6A 2JRIA 3ASOC 4TSFG 3LNMB 2Q4PA 4I0XB 1IX9A 4QPKA 3L74H 4D7TA 4XDLA 2BSKA 2Q68A 1VF6A 1SQBH 1Y76B 1SQFA 2QDOA 3G71V 4FJCC 1CP9A 2G38A 2RNBA 3RT3C 3FAVA 4B3MO 5JQGB 3T1CA 5JWPA 1RPOA 2VQEO 4AILC 1SQQH 4PA6A 3FX7A 1NI8A 5EZYA 4JI4O 4QPJA 3AG4B 1QVGU 2UXCO 2YEVA 2UUBO 5CB4A 2CE4A 3JAKB 2JDIG 2ADQB 5LHGA 2PZSA 1VARA 1Z2GA 4PDVA 3N2GA 1Q3EA 3F7VC 4ABMA 3A0RA 1H2SB 3CC7V 3J81N 1O9GA 3R65A 4DV7O 4J7JA 3F7YC 1FYJA 1PL4A 1US6A 5FLXN 4DV3O 4DK1A 1Y74B 4I55B 1M4UA 3CCRV 2OCCB 1K73W 4R50A 4PDMA 2ITCC 2BTQB 4DUYO 2KKWA 1AR4A 4ZKIA 1QLNA 4W4LA 2AHYA 1WNSA 3QTCA 3QO8A 2VWKA 2Q67A 3KCXA 4OX9B 4IHJA 4G28B 4DR5B 2CUGA 1ZTEA
chains in the Genus database with same CATH topology
5LHIA 1K4CC 4P2ZA 1QR8A 4JTAB 3CCJV 1KP2A 2JJ2G 3F5WC 1EBOA 1WPXA 3BY6A 1VQPV 3B8NA 3MD0A 2X0LA 3H01A 1FS0G 3OFNG 3K03A 2JEXA 4I9WA 2EIMB 3W7WA 3KG2A 4MVQA 3SYOA 4HZ3A 2Q6AA 4MSWC 5CBGA 1AJNA 3E35A 4U7NA 1VQ5V 2XASA 3SYAA 1PNKA 4WFHA 2X6BA 4TWKA 3AG1B 1S76D 2ZR3A 1I5YA 4XDKA 4RQEA 3FYIB 2XAFA 3WG7C 3TETA 1DF4A 3ZRWB 2A79B 3LSSA 5LGUA 3AG3C 3ETGA 1GM8A 3FB8C 1H8HG 2JJ1G 2WLHA 4WFFA 2ZXWC 5CMUA 4MVZA 3ZRWA 1KP3A 3GB7C 1FXKB 2IH1C 1AJPA 4QE9A 4UVCA 1ZWIC 3D36A 1BMFG 2QM7A 5H6RA 2EIKB 1M57C 1W0KG 1K34A 2DYSB 3ASOB 4X89A 2OTLV 3CPWU 2W6JG 5E1AC 1JQ0A 3K06A 3IGAC 4JTCB 1OCOB 2EIKC 1GTOA 3E8HA 2OCCC 4G2KA 2EILB 1CEZA 1S3JA 5IY5C 1S0VA 1YHQV 1S72V 1K92A 3OMAB 2NNUA 4MTGA 5LGTA 3ETEA 5LGNA 2M7WA 4MS2A 1W2BU 4X88A 3E8GA 2YSUB 2XAQA 3IFXA 1GM9A 2A0LA 3OE7G 3I56V 2DW4A 4DXWA 4PELA 3QO5A 5L3DA 4JGSA 1YITV 5EC1C 1NJIW 4XBFA 3ZRXA 2WSSG 4YXWG 3FB5C 1JX9A 3AEIA 1K8AW 3ZMVA 1Y66A 1JOYA 4KP4A 3G4SV 1S77D 4WF9V 1PD3A 3SPHA 4J9YB 1SESA 4XDJA 4E2LA 1K97A 2HKOA 1YJWV 2ZDIC 2DQ0A 1VQLV 5EBMC 1THZA 4WFGA 2P6JA 5KUMA 3AG2C 2DWEC 3ABUA 4WFAV 3K0DA 4FK5C 3CCMV 4FIPC 3ZMUA 3JD1A 4MVSA 2AHZA 2GSMB 3ZMTA 3T2MA 1OCRC 2LFRA 4MVUA 1VQ8V 3X2QC 1NVPD 5H9CA 5DN6G 1G4YB 2HVJC 1R6NA 5LHHA 2IJHA 1BHAA 1OCCC 2IJKA 1YJNV 2IU3A 2KB1A 3RVYA 1KC8W 2Y69C 2JEUA 4UV8A 2NLJC 1F23A 1OCCB 3JYCA 5IDJA 3ZRVA 2YEVB 3RBZA 5IYCO 4TT3G 1K5SA 4H37A 4F4LA 3GWOA 3ABKB 2FTKA 3K9AA 1PL0A 3DTUB 2JK5C 4KUMA 4RAIA 1Q81W 4EKWA 1LNQA 1HWYA 4MTOA 1RPRA 1Q7YW 1GK9A 4CZZA 4P9PA 1FXHA 1R3LC 1P7BA 3ETDA 2DQ3A 4QIWF 4BIUA 5L3FA 1EFRG 5CBFA 1AR1B 3OGCC 3CCQV 3CCVV 1MSWD 2OT5A 4R7CA 3HPLC 2W0FC 1NVPB 1K33A 4PA3A 4P9OA 4WCEV 4UVAA 1AROP 4UXNA 4P30A 2EINC 2DYRB 1QBZA 1COWG 2V1DA 3OEHG 3E86A 1DLBA 3TK1A 3ZN0A 3ZCCA 3PJSK 2IJJA 3STZC 2WLNA 4CBCA 5H6QA 2LFSA 3QO7A 4MVRA 1V54B 5CBHA 1SZTA 3G6EV 2QM8A 2WLIB 2XAGA 2IW5A 3ABKC 3OMNB 3HB3B 3MHHC 4LBEC 3RW0A 2X6CA 2C2AA 5EK0A 3LDCA 3ZMZA 1KKDA 2V7QG 2WLJA 5FL7G 2PI5A 3ABMC 2PI4A 4JF3A 2B5UA 2ZR2A 2HLDG 1EZJA 1K5QA 3OUSA 1K4DC 2B1IA 5IY5B 2HFEC 2R9IA 3W7UA 4MTXA 5B3SC 4N23A 2X6AA 5B1AB 1NKDA 2H8PC 3ZJZA 3CYOA 1OCRB 1VQKV 1R3IC 2LP7A 1JJ2U 4WFBV 5IYDO 1VQMV 3JD3A 4R8CA 4QE7A 1IXMA 4MVMA 4PDLA 1M56C 3QNEA 1RM1B 4HAMA 4J9ZB 4Q20A 1OCZC 3OUFA 1JVMA 1R73A 3STLC 2ZD9A 4ZBMA 3CCEV 2ZXWB 3VOUA 3ZRSA 2BOBC 1K3EA 3I55V 1F51A 3SJQC 5L3CA 1MABG 1E79G 1YJ9V 5BZBA 2HVKC 2Z5UA 4H33A 5B1BB 1YTFD 4JYCA 5HFMA 1AJQA 3ZMSA 4JAUA 5B1OA 3SYQA 2WLMA 3AG1C 1QLEC 2WLLA 1YSCA 2HG5C 1B6QA 1MOFA 2Z3YA 1SRYA 3FYEB 4GX2A 4GX1A 4R6ZA 1F4MA 5LBQA 1KD1W 4WFEA 1P4RA 4BIZA 1V55C 4UV9A 5GW7A 5B1NA 5L3EA 3CCSV 3OR7C 1VQOV 3FB6C 4OXSA 1N8RW 1GMGA 1NH2B 1ENVA 1NQTA 1FXKC 4PA9A 2WLKA 4BW5A 5L3GA 3OR6C 3P30A 1V54C 3P32A 2Y69B 3SPCA 5CA3A 3LSQA 1M57B 2WWWA 3LDEA 2CK3G 2EIJB 2XAHA 2UXXA 3K79A 3BEHA 1TUEB 1VQ4V 1VQ6V 5B3SB 3SYCA 1K9MW 4FMTA 4JYBA 4N21A 2HR3A 3SPGA 3ZN1A 3K08A 3UM7A 1YTFB 4JTDB 4RUEA 4UVBA 1J95A 4GX0A 3CC2V 2P90A 3CMEV 5KA5A 3ASNB 2ZQMA 3E89A 2QA4V 5KA6A 1E1RG 1F4NA 2EZPA 3LDDA 4MW3A 4JASA 2K1EA 2ZDIA 4LP8A 3ABLC 3ASNC 3NXSA 4PA7A 4ASUG 3OW2U 4FPPA 4PA4A 1DF5A 2W6IG 3JD0A 4RO2A 3T4DA 4QNHB 1NH2D 1Q82W 2MK3A 3K0GA 5EBLC 3W7TA 4KFMA 1H2GA 4RUFA 2EBOA 1AI6A 4HYOA 2XNDG 3JCZA 1R3JC 3JD4A 1CPYA 2A9HA 1OHHG 3WFVA 1W0JG 3OMIB 3ABTA 1BL8A 2WLIA 4LC1A 4BAYA 1QVFU 2F43G 1AI5A 3CP1A 5DM6V 1OCOC 1Y4MA 3DGEA 3E83A 3FKSG 3SPJA 3D3IA 3X2QB 1DTOA 1S5HC 2UXNA 3K04A 5J9PC 3B8MA 3E8FA 2P67A 1BHBA 3M99B 3AG2B 1NR1A 2X7RB 1AI4A 4GT1A 3SPIA 4MVOA 3TCUA 1GM7A 2P7TC 3CCLV 2R9RB 2ITDC 2QTOA 3W7XA 1UJWB 1JCHA 5L3BA 5EC2C 1RM1C 5HFLA 3E8BA 4L87A 1QCEA 2ATKC 4LCUC 4RQFA 1ORQC 2D3OW 2EIJC 2H94A 1FXKA 3CD6V 3MHSC 3OM3B 1GO3F 1MG1A 2QKSA 3WG7B 3CCUV 1R6KA 3AG4C 1M90W 1R3KC 4MT8A 3UKMA 1QR9A 3W7SA 1E1QG 4U7OA 1OCZB 4G27B 1G8MA 1PNLA 2JIZG 2EILC 2EJRA 2Y48A 4MW8A 2DWDC 3EFFK 2B1GA 1NBMG 5KUKA 1SETA 3ABMB 1GKFA 2DYSC 3ASOC 3LNMB 2WPDG 4TSFG 4DO2A 1ROPA 4QPKA 1FFTB 1KQSU 4XDLA 1K7DA 2Q68A 3ABLB 1QLEB 3LUTB 5B1AC 2DYRC 1YI2V 2OTJV 3SYPA 3FB7C 3G71V 1NR7A 1PKXA 4FJCC 4MTFA 1CP9A 5B1BC 4X8AA 2WAMA 3T1CA 1XL6A 2GHYA 1RPOA 2XAJA 1M9NA 5C93A 3OEEG 1VQNV 3B77A 4PA6A 1M56B 3CMAV 4GX5A 3T4ZA 4QJFB 1FXVA 3CXCU 4QPJA 1I5XA 3AG4B 1XL4A 1QVGU 3ZIAG 2YEVA 3VBBA 1WLEA 5IYBO 1V55B 3OAAG 5EBWC 2JDIG 1JPXA 3AG3B 3CC4V 5LHGA 3IC7A 4JPRA 4PDVA 4I5SA 3F7VC 2IH3C 3A0RA 2IJIA 1OZ0A 3CC7V 1L1FA 3EHBB 1KECA 2HJFC 4JAVA 3R65A 2WLLB 4PDRA 2Q69A 3K3WA 3F7YC 1M1KW 2EIMC 1H8EG 1PNMA 4Z1MG 2XOKG 3ML0A 3CCRV 2OCCB 1K73W 2EINB 4R50A 4PDMA 2ITCC 1YIJV 3RVZA 3JD2A 1H38A 4ZKIA 1Q86W 1QLNA 3E2EA 2EZOA 1SERA 2AHYA 2BOCC 3QO8A 4UUJC 5CN0A 2Q67A 2IU0A 1VQ9V 1AI7A 4G28B 4GCZA 2QEXV 1VQ7V 2QE7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  3G6E V;  3CXC U;  4WF9 V;  1YJN V;  3I55 V;  3CCS V;  3CCQ V;  3CCR V;  3CCV V;  1VQK V;  1YHQ V;  1S72 V;  1VQO V;  1QVG U;  3CC2 V;  1KQS U;  1K73 W;  3CCJ V;  1YJW V;  1KC8 W;  1YIJ V;  4WFB V;  3CME V;  1N8R W;  1JJ2 U;  1VQM V;  1QVF U;  1YJ9 V;  2QA4 V;  1VQP V;  1VQL V;  1W2B U;  2D3O W;  5DM6 V;  3CD6 V;  3CC4 V;  3I56 V;  1YI2 V;  2OTJ V;  1Q86 W;  4WFA V;  4WCE V;  3CCU V;  3G71 V;  3CCM V;  1KD1 W;  1YIT V;  1M90 W;  3OW2 U;  1R73 A;  3CC7 V;  1NJI W;  1VQ4 V;  1VQ6 V;  1VQ5 V;  3CCE V;  1K9M W;  2OTL V;  3CPW U;  1Q82 W;  1VQ8 V;  1K8A W;  1VQN V;  1Q81 W;  1VQ9 V;  1M1K W;  3CCL V;  1Q7Y W;  3CMA V;  2QEX V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 4B3T O;  4P2Z A;  4DK0 A;  4DV3 B;  1QR8 A;  4FZ1 A;  2W0X A;  4JTA B;  1VF6 C;  1VQP V;  3CEI A;  3MD0 A;  2X0L A;  3KG2 A;  4MVQ A;  3SYO A;  3E22 A;  3OGI B;  1AJN A;  1XNQ O;  1PNK A;  1IBM B;  3N27 A;  3ZHR A;  1NTK H;  5JJJ B;  2E74 B;  3G6B A;  3ZRW B;  4LF8 O;  1GM8 A;  2MW2 B;  3FB8 C;  1H8H G;  4O4J B;  1Q8I A;  4WFF A;  2ZXW C;  5CMU A;  3GB7 C;  3FD9 A;  1Q6U A;  3ZS8 C;  5H6R A;  4X89 A;  3K59 A;  2W6J G;  3CJH B;  3IGA C;  4JTC B;  1SA0 B;  2PTM A;  1FJG O;  3E8H A;  1HNW O;  1CEZ A;  3HKB B;  1S72 V;  4I9Q A;  2NNU A;  5LGT A;  2M7W A;  3ZHQ A;  3IFX A;  3OE7 G;  4I4T B;  4DXW A;  4PEL A;  2QR4 A;  1TA8 A;  5L3D A;  4D6T H;  5IT9 N;  4JGS A;  4XBF A;  1RP3 B;  1A32 A;  4YXW G;  5JVD A;  3DSQ A;  3ZMV A;  1JOY A;  1BSM A;  1MA1 A;  4KP4 A;  3G4S V;  1S77 D;  1B06 A;  5J2T B;  4XDJ A;  2QKA A;  1BS3 A;  1VQL V;  1THZ A;  4WFG A;  5KUM A;  2DWE C;  3ABU A;  4WFA V;  4JI7 O;  2JGU A;  4FIP C;  4JI1 B;  3JD1 A;  4YJ2 B;  2YID A;  2AHZ A;  5LP6 B;  1VQ8 V;  5DN6 G;  1G4Y B;  4IGG A;  2VQF B;  2QSA A;  1YJN V;  4DR7 O;  1AVM A;  1G1X B;  3RGB A;  4X1K B;  1QNM A;  3JYC A;  5J2T A;  2GDS A;  3ZRV A;  4IYH A;  5IYC O;  4DV4 O;  4DV5 O;  2Q9L A;  2Q7H A;  1XMQ B;  4H13 B;  3K9A A;  2WA3 A;  4NVP A;  3RYH A;  3UO3 A;  2ZKO A;  3B09 A;  1LNQ A;  1HWY A;  4CZZ A;  1FXH A;  2DMX A;  1LR1 A;  2DQ3 A;  4QIW F;  3L9D A;  2OT5 A;  1NVP B;  3RYC B;  4FFB B;  4ZIB A;  1XDC A;  1QBZ A;  4W4K A;  3TK1 A;  1V9P A;  3PJS K;  1XNQ B;  1P49 A;  4J41 A;  2LFS A;  3G6E V;  1IBK O;  4PJ0 Z;  3HKC A;  3WB1 A;  5BMV B;  3IC9 A;  1H2M A;  1SQG A;  1MNG A;  4CS2 A;  3OMN B;  2O57 A;  2ZE6 A;  2ZE5 A;  5DED A;  2ZR2 A;  2HLD G;  2Q73 A;  1K4D C;  2LGW A;  5LMN O;  1P84 F;  2R9I A;  2QJ1 A;  5B1A B;  4I0X A;  2NR5 A;  3ZJZ A;  5LP6 C;  1VQK V;  4YJ3 B;  1JJ2 U;  4R8C A;  1HR0 O;  3QNE A;  1KBH A;  4Q20 A;  4O2A A;  2ZD9 A;  3CCE V;  2PYL A;  3O9O A;  3S3X A;  4DV5 B;  1K3E A;  1F51 A;  2A7W A;  2EJ7 A;  1E79 G;  1N33 B;  4H33 A;  3JSN A;  5B1B B;  1YTF D;  4GKJ B;  3ZMS A;  4JAU A;  5KAF Z;  3SYQ A;  2WLM A;  1QLE C;  1JFF B;  2Z3Y A;  4GX2 A;  1F4M A;  3EVK A;  2QKC A;  1DGS A;  4TQD A;  4JI1 O;  5J2U A;  3DXR B;  4WFE A;  3AK2 A;  4DR6 B;  5GW7 A;  4BIO A;  5EYP A;  4OXS A;  1ENV A;  2WLK A;  4BW5 A;  3OR6 C;  1V54 C;  4X62 O;  4U3J B;  2Y69 B;  3IJ4 A;  5LMN B;  1TUE B;  1K9M W;  4FMT A;  2V4D A;  3ZX6 A;  3U0Z A;  4ZHQ B;  3K08 A;  2ZT9 B;  1YTF B;  4JTD B;  1WJZ A;  2P06 A;  2H3O A;  3Q4H B;  3CME V;  5IYZ A;  1JJO A;  3ASN B;  3E89 A;  2QA4 V;  1WB8 A;  2FML A;  2KG7 B;  4MW3 A;  4JAS A;  2K1E A;  2E5L O;  1ZLZ A;  3ABL C;  1I0H A;  3ASN C;  4DUZ B;  3NXS A;  4PA7 A;  4IT5 A;  3OW2 U;  4FPP A;  1DF5 A;  2W6I G;  2JS3 A;  2UXC B;  3K0G A;  3W7T A;  1AI6 A;  3JCZ A;  1R3J C;  3JD4 A;  4DW0 A;  1W0J G;  2DOS A;  4K3A A;  5B5E Z;  5J2U B;  3HKC B;  3K5L A;  3CP1 A;  3A0H Z;  4BWA A;  2P4V A;  2UXN A;  2B9Z A;  2P67 A;  1AI4 A;  4GT1 A;  3HR0 A;  2F4V B;  3ZHS A;  3RYF B;  2VS0 A;  2L35 A;  4LNU B;  1UJW B;  4K8Z A;  3D36 C;  4NTY A;  3CJH A;  5HFL A;  1QCE A;  1G6U A;  1AIL A;  2ATK C;  2JVD A;  2D3O W;  3O65 A;  2LO1 A;  3JAT B;  4TV8 A;  2QKS A;  3AG7 A;  3WG7 B;  1R3K C;  4MT8 A;  2JIZ G;  1URF A;  1BE3 H;  2DWD C;  3EFF K;  1NBM G;  4AQY B;  4YJ3 A;  1Z5V A;  5LOV A;  1GKF A;  4GUN A;  2PY5 A;  1FFT B;  1KQS U;  4NXN O;  3LUT B;  4GZR B;  1XNR B;  3K5M A;  3HKD B;  1NR7 A;  4X8A A;  2VWJ A;  1XL6 A;  2GHY A;  5C93 A;  3K57 A;  3B77 A;  1M56 B;  1KMI Z;  2R9A A;  4QJF B;  5IWA O;  4CH3 A;  1XMO O;  5JH7 B;  4X66 B;  3ZIA G;  1TGO A;  5IYB O;  4B7K A;  4JV5 B;  1HNW B;  3UCS C;  3AG3 B;  2OIG A;  4NB5 A;  4JPR A;  4I5S A;  2DN9 A;  2IH3 C;  1XUQ A;  1L1F A;  2HJF C;  3U10 A;  3K3W A;  4B3T B;  4I55 A;  2EIM C;  1HR0 B;  2XOK G;  3ML0 A;  4LF6 O;  3KZI Z;  4UFZ A;  4KXR A;  2PF4 E;  2EIN B;  3H1H H;  3HKB A;  1H38 A;  1Q86 W;  1IBM O;  3K5O A;  3C3S A;  2HHH B;  2BOC C;  3P3P A;  3NR7 A;  5CB4 B;  5CN0 A;  3CRM A;  2QE7 G;  4LFB O;  4OPH A;  2CGN A;  3F5W C;  3N2K B;  4J7Z A;  2EIM B;  4GYC B;  4X20 A;  4FFK A;  4O4I B;  2P4K A;  3E35 A;  4U7N A;  1VQ5 V;  1WP7 A;  2Q0A A;  4IIJ A;  4XDK A;  1FFX A;  5LYJ B;  3WG7 C;  2ETN A;  3ETG A;  2WLH A;  4IHJ B;  4MVZ A;  3ZRW A;  1FFX B;  2IH1 C;  4QE9 A;  1ZWI C;  3D36 A;  4HNA B;  2EIK B;  2YUA A;  3ASO B;  1D5N A;  2N04 A;  3G67 A;  3K06 A;  4PI2 A;  2EIK C;  4TV9 B;  5IY5 C;  3SJA C;  1LUW A;  3OTF A;  1K92 A;  3OMA B;  5LGN A;  4MTG A;  2LJ2 A;  3R66 A;  1Y74 A;  4X88 A;  3E8G A;  2A0L A;  3RYI B;  3QO5 A;  4H0L B;  4K35 A;  2DJV A;  2XTA A;  1NJI W;  4ZOL A;  2WSS G;  4YY3 O;  3SPH A;  1SES A;  1K97 A;  1U96 A;  1HNX O;  4EB6 A;  1RSO B;  2QWP B;  4J42 A;  4CH6 A;  4JI2 O;  2LGQ A;  4FK5 C;  3CCM V;  2GSM B;  2GTS A;  3ZMT A;  4UCT A;  1YVW A;  2ZNJ A;  2HVJ C;  1R6N A;  4J7K A;  3RWR D;  1NT2 B;  1CXZ B;  4YIP A;  2KB1 A;  3RVY A;  1KC8 W;  2UUC B;  2Y69 C;  2KSD A;  4FM1 A;  4UV8 A;  1OCC B;  2N74 A;  1GN2 A;  5BR8 O;  2YEV B;  5KAI Z;  2N05 A;  3KCY A;  1K5S A;  3HKE B;  4H37 A;  2LW1 A;  4F4L A;  1PV0 A;  3IAY A;  3DTU B;  1MSD A;  5IJ9 A;  1VMG A;  1Q81 W;  5JQG A;  1Q7Y W;  3L73 H;  2Y4T A;  3VQY A;  4P9P A;  3ETD A;  1P7B A;  4BIU A;  1N32 B;  1EFR G;  4PD4 F;  1AR1 B;  3OGC C;  1N36 O;  1D5A A;  4R7C A;  4ICG A;  1QU7 A;  4FLY A;  4O2B B;  1IUR A;  4PA3 A;  1R1B A;  4ZI7 A;  2PGG A;  3N2G B;  3JAS B;  4DV4 B;  4UCO A;  2RN9 A;  3E86 A;  1DLB A;  4LWS B;  1L0L H;  3KKY A;  2IJJ A;  4LF7 B;  1BQ0 A;  3ZHT A;  3EXA A;  5H6Q A;  2HJD A;  3QO7 A;  4MVR A;  4B3R B;  1V54 B;  1SZT A;  2P5O A;  3T1Y O;  2VQF O;  4O2A B;  3ZBH A;  1OV9 A;  3MHH C;  1JA8 A;  2C2A A;  3ZMZ A;  3M8A A;  2V7Q G;  2PI4 A;  2B5U A;  1K5Q A;  3W7U A;  4MTX A;  3T1H O;  5B3S C;  3JAR A;  2X6A A;  4PHZ A;  1NKD A;  4DUY B;  1AR5 A;  3CYO A;  2LP7 A;  5IYD O;  1WPB A;  3JD3 A;  5FNV A;  4KHP O;  1BCC H;  4WBN A;  1M56 C;  2FB5 A;  2OCH A;  3OUF A;  5AG2 A;  1R73 A;  3GVM A;  3UO2 A;  2RJZ A;  3JAM N;  2AXT Z;  1Q43 A;  3VOU A;  2QWO B;  1AP5 A;  3I55 V;  1AB3 A;  3SJQ C;  1NTM H;  1MAB G;  1GN4 A;  1YJ9 V;  3SDL A;  3RFR A;  1AJQ A;  4X20 B;  4UCU A;  2VQE B;  5B1O A;  5LP6 A;  5KMG B;  1YSC A;  2HG5 C;  3TXQ A;  5FPR A;  2YIA A;  1MZE A;  1KD1 W;  5LA6 B;  1ZAU A;  4UV9 A;  5B1N A;  1I94 O;  2BCC H;  1VQO V;  1GMG A;  1NQT A;  2ZE7 A;  5TIS Z;  3P30 A;  1B04 A;  2RMK B;  3SPC A;  5CA3 A;  3LSQ A;  4DUZ O;  2CK3 G;  2XAH A;  4LFC O;  2YXY A;  1L0N H;  3BA8 A;  5LXT A;  4E4E A;  1HDJ A;  4GX0 A;  4JI3 O;  1JMK C;  4X9Q A;  5GON A;  1F4N A;  2EZP A;  2HEP A;  5IJ0 A;  2WA4 A;  1N34 O;  2ZNI A;  2EUL A;  5D5Q A;  4YIO A;  1NH2 D;  4PI0 A;  5K1P A;  1U97 A;  1VP7 A;  1OHH G;  4J80 A;  5E79 Z;  1BL8 A;  2WLI A;  2F43 G;  1YCI A;  1X4T A;  1Y4M A;  1VEW A;  3OTO O;  3E83 A;  3FKS G;  4Z1V A;  3APO A;  1S5H C;  3K04 A;  3E8F A;  2YC0 A;  1BHB A;  2JGD B;  1XBL A;  2R9R B;  3W7X A;  3G80 A;  1JCH A;  5L3B A;  5F2V O;  4L87 A;  4JI4 B;  4RQF A;  2L6L A;  3LSU A;  1GO3 F;  5BMV A;  4UCV A;  1IBL O;  4O4L B;  4OPA A;  3CCU V;  3DC6 A;  2ARH A;  3MAQ A;  3JAT A;  1FPO A;  1HW7 A;  3UKM A;  1GRJ A;  3W7S A;  1E1Q G;  4HBN A;  1SS3 A;  1BQZ A;  1PNL A;  3J7A U;  2EJR A;  2Y48 A;  4MW8 A;  5KUK A;  4DR1 B;  4GKK O;  4DO2 A;  4H44 B;  2WPD G;  4DV1 B;  1N0N A;  1ROP A;  4DR4 O;  3UT5 A;  3A0B Z;  1K7D A;  4QGP A;  1RFY A;  2PUS A;  3ABL B;  4CH5 A;  2DYR C;  1YI2 V;  2OTJ V;  3FB7 C;  1PKX A;  5CA1 B;  2UXD O;  1WN7 A;  2WAM A;  3B2E E;  4JI8 B;  5JJN B;  2XAJ A;  2RCV A;  4PV1 B;  1M9N A;  3OEE G;  3CMA V;  4GX5 A;  3T4Z A;  1FXV A;  3BAA A;  1I5X A;  4FLT A;  1XL4 A;  4TQF A;  1EM1 A;  3VBB A;  1WLE A;  4GKK B;  2GUZ B;  1V55 B;  5CA0 B;  3OAA G;  1PM9 A;  3CC4 V;  5EZY B;  1BZK A;  2BTQ A;  1NU1 H;  2IJI A;  2IBZ H;  3EHB B;  1KEC A;  2WLL B;  1IZ3 A;  4PDR A;  3CSX A;  1M1K W;  1H8E G;  1PNM A;  4YJ2 A;  4LF8 B;  1J5E O;  3RVZ A;  3JD2 A;  4TUY B;  3E2E A;  2E5L B;  4B3S O;  3JAK A;  3S3W A;  4LF9 B;  3CRR A;  4DR7 B;  1VQ9 V;  3WB2 A;  2E76 B;  5LA6 A;  4DV2 O;  1VQ7 V;  4DV6 O;  2QTS A;  1N36 B;  2CTR A;  4C7U A;  2YXH A;  3CCJ V;  1KP2 A;  2YDE A;  1JFF A;  3BY6 A;  2AZ2 A;  4I7Z B;  3B8N A;  1WA8 B;  3H01 A;  1FS0 G;  3OFN G;  3K03 A;  2JEX A;  1M93 A;  4JI5 B;  4LNU A;  3BVO A;  3W7W A;  2YIB A;  3TXS A;  4MSW C;  2Y0I A;  1N34 B;  2UXB B;  4LF4 B;  3OT7 A;  2PYJ A;  4CS4 A;  1B3Q A;  3SYA A;  1FD9 A;  5BR8 B;  4TWK A;  4X64 O;  3D8C A;  3H1K H;  4NKG B;  2ZR3 A;  4RQE A;  2XAF A;  3TET A;  2A79 B;  3LSS A;  3AG3 C;  2QGN A;  3AK1 A;  3CE2 A;  2JJ1 G;  1KP3 A;  1GN3 A;  1AJP A;  2P22 C;  1BMF G;  2QM7 A;  4DR2 B;  3WB0 A;  1W0K G;  4NTX A;  2DYS B;  4BW9 A;  2OTL V;  5E1A C;  1JQ0 A;  5D5P A;  4DR4 B;  1OCO B;  2OCC C;  4JI0 B;  2EIL B;  3ETQ A;  1HNX B;  5KHJ A;  1YHQ V;  2AZ0 A;  5IYZ B;  3WU2 Z;  3ETE A;  4MS2 A;  2YSU B;  2XAQ A;  1H2K A;  4X65 B;  1FAF A;  1SQX H;  2DW4 A;  1WA8 A;  1OJH A;  1Q5O A;  3BA9 A;  5EC1 C;  5KHG A;  1YIT V;  1UPG A;  3ZRX A;  5ITZ B;  1IXB A;  3FB5 C;  1JX9 A;  4KL1 A;  1K8A W;  1TVK A;  1Y66 A;  4D7S A;  4WF9 V;  1PD3 A;  4JI0 O;  2Y0P A;  2NN4 A;  4J9Y B;  2LQT A;  1ZL8 A;  4B7E A;  3AK3 A;  5A2Q N;  4TUY A;  2P6J A;  3AG2 C;  1Q6H A;  3K0D A;  1Y67 A;  3B40 A;  4X1Y B;  3U11 A;  3ZMU A;  3VQX A;  3T2M A;  1OCR C;  4MVU A;  2OWO A;  1NVP D;  5H9C A;  4LF5 B;  4X1I A;  5LHH A;  4KHP B;  1IBK B;  1BHA A;  2BTO A;  3UT5 B;  4OX9 O;  1TUB A;  2ZE8 A;  3RYH B;  2JEU A;  1FKA O;  4EB6 B;  5IDJ A;  2UXB O;  2KQX A;  3RBZ A;  3QVN A;  3J80 N;  4TT3 G;  3GWO A;  2FTK A;  1PL0 A;  1T5E A;  5ITZ A;  4KUM A;  1GAX A;  1R6T A;  4MTO A;  5H5N A;  1GK9 A;  1KB9 F;  3CWB H;  4LF5 O;  4DR3 O;  1R3L C;  4CS3 A;  2Z0A A;  1S5J A;  4JYA B;  4DV2 B;  3CCV V;  1Y76 A;  1MSW D;  3JAL B;  4LFB B;  4L8J A;  3HPL C;  2W0F C;  1K33 A;  4P9O A;  4WCE V;  4DV0 O;  3CRA A;  5IE9 A;  3QF7 A;  2V1D A;  2HHH O;  3ZN0 A;  1AP6 A;  1XQ8 A;  2ZIN A;  2UUB B;  4DRX B;  2WLN A;  4CBC A;  3JAW B;  5CBH A;  1YXB A;  3ABK C;  1N32 O;  5JVD B;  5KHK A;  4LBE C;  2QM4 A;  4JI7 B;  5EK0 A;  2ILM A;  3ZED A;  2WLJ A;  1WAZ A;  2CGO A;  3P3N A;  1EZJ A;  2B1I A;  4NXM B;  2IM9 A;  2YI8 A;  2HP8 A;  4TOI A;  1Z5W A;  4TV9 A;  4O4I A;  2R72 A;  2H8P C;  2UUC O;  1SA0 A;  1OCR B;  1R3I C;  5GTH Z;  1XMO B;  2QWN B;  4UB8 Z;  5JCO A;  4QE7 A;  1IXM A;  1NZ6 A;  4PDL A;  5LMU B;  1JVM A;  3STL C;  4FLZ A;  1SQP H;  4ZBM A;  2FL4 A;  2F95 B;  1S5L Z;  2YIC A;  1KKC A;  2ZXW B;  4F6R B;  4DV1 O;  5KX5 A;  1FJG B;  4NXN B;  1I7F A;  4NXM O;  2Q7G A;  5L3C A;  5BZB A;  2HVK C;  1TAE A;  3CS5 A;  4JYC A;  5HFM A;  5GON B;  3SGI A;  4IYI A;  2WLL A;  1MOF A;  1SRY A;  4R6Z A;  4GX1 A;  5LMU O;  4UCS A;  1X59 A;  1KUQ A;  3T1Y B;  2FYU H;  4BIZ A;  5L3E A;  3CCS V;  3FB6 C;  3B4S A;  1N8R W;  3JCU Z;  1FXK C;  4PA9 A;  3P32 A;  3K9S A;  1M57 B;  2WWW A;  4JI6 B;  3GWK C;  3LDE A;  2EIJ B;  2CDY A;  3BEH A;  4LR3 A;  1VQ6 V;  4JYY A;  1TUB B;  5B3S B;  4N21 A;  3DXR A;  2HR3 A;  3SPG A;  3ZN1 A;  2VRZ A;  3HKD A;  1QQC A;  1J95 A;  5GTI Z;  2CTP A;  2RDC A;  4I50 A;  1YEW A;  2P90 A;  4X1Y A;  1E1R G;  1PPJ H;  3JSL A;  2ZDI A;  5LOV B;  2ZM6 O;  1ZSP A;  5KX5 B;  4ASU G;  5KHI A;  3I5D A;  3JD0 A;  4RO2 A;  4Q6G A;  2EX3 A;  2MK3 A;  4GLX A;  1H2G A;  4DV0 B;  2EBO A;  1VF5 B;  2XND G;  3CRQ A;  3WFV A;  1CPY A;  2A9H A;  3L70 H;  4O4J A;  3C90 A;  4IL6 Z;  4JZG A;  4BAY A;  4JYA O;  1IDS A;  1AI5 A;  2CTQ A;  3TGU H;  4U3F H;  5FNV B;  3D3I A;  3X2Q B;  5K1X A;  3B8M A;  4NTW A;  2Q7E A;  3M99 B;  3AG2 B;  3SPI A;  4MVO A;  1GM7 A;  2ZM6 B;  4DR1 O;  2P7T C;  2CTW A;  2OIE A;  3CCL V;  2ITD C;  2QTO A;  4FLW A;  5EC2 C;  1O9H A;  2FKX A;  2XT9 A;  4NYK A;  4YY3 B;  3E8B A;  4FVM A;  1RM1 C;  4O4H A;  4B08 A;  2R70 A;  3LNN A;  1ORQ C;  2XUM A;  4JI3 B;  1SF9 A;  1N4C A;  1FXK A;  3MHS C;  3OM3 B;  4X65 O;  1KYO F;  3APQ A;  4EFE A;  4DV7 B;  1QR9 A;  4U7O A;  2CAZ C;  4DRX A;  4G27 B;  4GKJ O;  2EIL C;  2B1G A;  3THO A;  4B3S B;  1SET A;  4A5U B;  3ABM B;  2DYS C;  3RYF A;  1MZF A;  3K58 A;  3L75 H;  1QLE B;  5B1A C;  4X1I B;  3SYP A;  3RYC A;  4LFA O;  4MTF A;  5B1B C;  1EN6 A;  4LH6 A;  1BT8 A;  4ZHQ A;  1XRE A;  2Q0O C;  5EIB D;  4FLU A;  1M5I A;  3QG5 A;  1VQN V;  1XNR O;  3K5N A;  3C3T A;  1ZUQ A;  4FM2 A;  3CB2 A;  1HNZ B;  4X64 B;  3CXC U;  3JAW A;  1SC5 B;  3M7M X;  4Z2W A;  2QWR B;  1SZX A;  4AHC A;  5EBW C;  5JCO C;  3VQW A;  1JPX A;  1F7Y A;  1N0J A;  4J11 A;  3IC7 A;  4X1K A;  1OZ0 A;  4O2B A;  4DR2 O;  4JAV A;  3FAV B;  2Q69 A;  4JI8 O;  3JAL A;  2GBO A;  2YIB D;  5C8Y B;  1XI1 A;  4Z1M G;  2ADP A;  2BSK B;  1YIJ V;  1EN5 A;  1XIL A;  4LFC B;  1RSO A;  2EZO A;  1SER A;  1HP8 A;  3FFQ A;  4LF4 O;  1J5E B;  5A9G A;  2UUA B;  2ZIM A;  2GUZ A;  2GV9 A;  4UUJ C;  1TVK B;  1I94 B;  1YDX A;  3OD4 A;  2IU0 A;  1D2D A;  1AI7 A;  4GCZ A;  2QEX V;  2OYQ A;  3ZHU A;  5LHI A;  1K4C C;  1IBL B;  1XOU A;  2JJ2 G;  2YS8 A;  5LYJ A;  1EBO A;  1WPX A;  3BCC H;  4I9W A;  4HZ3 A;  2Q6A A;  2YXL A;  5CBG A;  1QHT A;  2CH7 A;  1XEQ A;  4LF7 O;  1P7G A;  2XAS A;  4J10 A;  4WFH A;  2X6B A;  2Y4U A;  1GH6 A;  3AG1 B;  1S76 D;  2Q8V A;  4X66 O;  1I5Y A;  3FYI B;  1DF4 A;  5LGU A;  5KHH A;  2F93 B;  1W59 A;  1NS1 A;  4O4L A;  1FXK B;  3TJT A;  1H2L A;  4UVC A;  4CC6 A;  3SR2 C;  1M57 C;  4O4H B;  3RYI A;  1K34 A;  3CPW U;  4LWS A;  3JAS A;  1GTO A;  4G2K A;  5JJE B;  4ZI7 B;  1S3J A;  1S0V A;  4AQY O;  4FFB A;  2ZCE A;  2BE3 A;  1HNZ O;  1W2B U;  1GM9 A;  3I56 V;  4UCR A;  4LFA B;  5IJ9 B;  3CXH F;  2UXD B;  5B66 Z;  3AEI A;  4FLV A;  1N33 O;  4EEQ A;  1XHX A;  2UU9 B;  4IIJ B;  4E2L A;  2Q5Z A;  2HKO A;  1YJW V;  2ZDI C;  1H2N A;  5JH7 A;  2DQ0 A;  5EBM C;  1Q6I A;  3MDS A;  3PN1 A;  5IJ0 B;  4K8X A;  3H1J H;  4MVS A;  5CA1 A;  4I50 B;  2LFR A;  3X2Q C;  1I08 A;  4JZ2 A;  3BAB A;  2IJH A;  3L72 H;  1OCC C;  2IJK A;  3BHP A;  4CC5 A;  2IU3 A;  1EZV H;  5FPO A;  4F6E A;  4YHH B;  2NLJ C;  1F23 A;  5CA0 A;  5EIB C;  3F5T A;  4LH7 A;  3ABK B;  4UB6 Z;  4ZOL B;  2JK5 C;  4RAI A;  3OTO B;  4EKW A;  1RPR A;  2A3Q A;  2ODM A;  2F23 A;  1LUV A;  5L3F A;  3DC5 A;  5CBF A;  3CCQ V;  5KMG A;  5BY1 A;  3ZHV A;  4JI2 B;  3BPZ A;  1XHZ A;  3SJC C;  2ZIO A;  4UVA A;  1ARO P;  4UXN A;  4P30 A;  5KLV H;  2EIN C;  2DYR B;  1COW G;  3OEH G;  3T1H B;  4X62 B;  3ZCC A;  5BXZ A;  3STZ C;  4LF6 B;  2YI9 A;  3CRC A;  2A06 H;  2E75 B;  1GN6 A;  2GTA A;  2K9P A;  2QM8 A;  2WLI B;  2XAG A;  2IW5 A;  1JR9 A;  1VF7 A;  3CX5 F;  3HB3 B;  3RW0 A;  2X6C A;  4TV8 B;  3LDC A;  1PP9 H;  3A2F A;  4WBN B;  1KKD A;  4FLX A;  2PI5 A;  4I4T A;  5FL7 G;  1YZB A;  3ABM C;  4LF9 O;  3L71 H;  1VIB A;  4JF3 A;  2JGD A;  3OUS A;  5IY5 B;  1Y6X A;  2HFE C;  2AW9 A;  4N23 A;  1UFI A;  3BFR A;  3N2K A;  3Q4H A;  5IWA B;  4YHH O;  4WFB V;  1VQM V;  4MVM A;  5LXT B;  1RM1 B;  3SJB C;  4HAM A;  2LW7 A;  4J9Z B;  1OCZ C;  4B3M B;  1Q90 D;  2JS5 A;  1KU9 A;  4U3J A;  3ZRS A;  2BOB C;  4DYL A;  4RWU A;  5EYP B;  1ZX3 A;  4JV5 O;  2Z5U A;  2UU9 O;  2KG7 A;  3E22 B;  3ICX A;  3AG1 C;  1B6Q A;  5LBQ A;  3FYE B;  4B3R O;  4BR6 A;  1P4R A;  1WB7 A;  1V55 C;  4FM0 A;  3OR7 C;  3CHX A;  1ZL8 B;  1NH2 B;  5L3G A;  5DEC A;  1L8D A;  1NTZ H;  2UXX A;  3H1L H;  3K79 A;  1VQ4 V;  4K0K B;  2DE0 X;  3SYC A;  4JYB A;  4JI5 O;  3H1I H;  2F66 C;  3BRC A;  4AI8 A;  3UM7 A;  4RUE A;  1MMM A;  4UVB A;  5C8Y A;  1EN4 A;  3CC2 V;  4DV6 B;  3D3Q A;  2XHB A;  5KA5 A;  2ZQM A;  1WP8 A;  5KA6 A;  3UQ8 A;  2UUA O;  1BGY H;  3LDD A;  5H2F Z;  3JAR B;  3VQV A;  4LP8 A;  1XMQ O;  4JI6 O;  4PA4 A;  3RN4 A;  2QWQ B;  3A8T A;  4F6R A;  3T4D A;  2F4V O;  4QNH B;  1Q82 W;  5EBL C;  4KFM A;  4RUF A;  4HYO A;  3H9V A;  1IVS A;  1YF2 A;  3OMI B;  4DR3 B;  3ABT A;  4LC1 A;  1QVF U;  4DR5 O;  5DM6 V;  2D2C B;  1OCO C;  3DGE A;  2AGA A;  3SPJ A;  5LL6 Y;  1DTO A;  5J9P C;  4K0K O;  1NR1 A;  2X7R B;  3TCU A;  2CH7 B;  1DK1 A;  4JAA A;  4DR6 O;  1SQV H;  2M6Y A;  4FZ0 A;  4LCU C;  4HNA A;  2EIJ C;  4DW1 A;  2H94 A;  2E3C A;  3CD6 V;  4CH4 A;  1MG1 A;  4OGQ B;  1R6K A;  4NR1 A;  3AG4 C;  1M90 W;  1OCZ B;  3HKE A;  1G8M A;  1SKV A;  4EFB A;  2F1M A;  2RQ6 A;  2JRI A;  3ASO C;  4TSF G;  3LNM B;  2Q4P A;  4I0X B;  1IX9 A;  4QPK A;  3L74 H;  4D7T A;  4XDL A;  2BSK A;  2Q68 A;  1VF6 A;  1SQB H;  1Y76 B;  1SQF A;  2QDO A;  3G71 V;  4FJC C;  1CP9 A;  2G38 A;  2RNB A;  3RT3 C;  3FAV A;  4B3M O;  5JQG B;  3T1C A;  5JWP A;  1RPO A;  2VQE O;  4AIL C;  1SQQ H;  4PA6 A;  3FX7 A;  1NI8 A;  5EZY A;  4JI4 O;  4QPJ A;  3AG4 B;  1QVG U;  2UXC O;  2YEV A;  2UUB O;  5CB4 A;  2CE4 A;  3JAK B;  2JDI G;  2ADQ B;  5LHG A;  2PZS A;  1VAR A;  1Z2G A;  4PDV A;  3N2G A;  1Q3E A;  3F7V C;  4ABM A;  3A0R A;  1H2S B;  3CC7 V;  3J81 N;  1O9G A;  3R65 A;  4DV7 O;  4J7J A;  3F7Y C;  1FYJ A;  1PL4 A;  1US6 A;  5FLX N;  4DV3 O;  4DK1 A;  1Y74 B;  4I55 B;  1M4U A;  3CCR V;  2OCC B;  1K73 W;  4R50 A;  4PDM A;  2ITC C;  2BTQ B;  4DUY O;  2KKW A;  1AR4 A;  4ZKI A;  1QLN A;  4W4L A;  2AHY A;  1WNS A;  3QTC A;  3QO8 A;  2VWK A;  2Q67 A;  3KCX A;  4OX9 B;  4IHJ A;  4G28 B;  4DR5 B;  2CUG A;  1ZTE A; 
#chains in the Genus database with same CATH homology
 5LHI A;  1K4C C;  4P2Z A;  1QR8 A;  4JTA B;  3CCJ V;  1KP2 A;  2JJ2 G;  3F5W C;  1EBO A;  1WPX A;  3BY6 A;  1VQP V;  3B8N A;  3MD0 A;  2X0L A;  3H01 A;  1FS0 G;  3OFN G;  3K03 A;  2JEX A;  4I9W A;  2EIM B;  3W7W A;  3KG2 A;  4MVQ A;  3SYO A;  4HZ3 A;  2Q6A A;  4MSW C;  5CBG A;  1AJN A;  3E35 A;  4U7N A;  1VQ5 V;  2XAS A;  3SYA A;  1PNK A;  4WFH A;  2X6B A;  4TWK A;  3AG1 B;  1S76 D;  2ZR3 A;  1I5Y A;  4XDK A;  4RQE A;  3FYI B;  2XAF A;  3WG7 C;  3TET A;  1DF4 A;  3ZRW B;  2A79 B;  3LSS A;  5LGU A;  3AG3 C;  3ETG A;  1GM8 A;  3FB8 C;  1H8H G;  2JJ1 G;  2WLH A;  4WFF A;  2ZXW C;  5CMU A;  4MVZ A;  3ZRW A;  1KP3 A;  3GB7 C;  1FXK B;  2IH1 C;  1AJP A;  4QE9 A;  4UVC A;  1ZWI C;  3D36 A;  1BMF G;  2QM7 A;  5H6R A;  2EIK B;  1M57 C;  1W0K G;  1K34 A;  2DYS B;  3ASO B;  4X89 A;  2OTL V;  3CPW U;  2W6J G;  5E1A C;  1JQ0 A;  3K06 A;  3IGA C;  4JTC B;  1OCO B;  2EIK C;  1GTO A;  3E8H A;  2OCC C;  4G2K A;  2EIL B;  1CEZ A;  1S3J A;  5IY5 C;  1S0V A;  1YHQ V;  1S72 V;  1K92 A;  3OMA B;  2NNU A;  4MTG A;  5LGT A;  3ETE A;  5LGN A;  2M7W A;  4MS2 A;  1W2B U;  4X88 A;  3E8G A;  2YSU B;  2XAQ A;  3IFX A;  1GM9 A;  2A0L A;  3OE7 G;  3I56 V;  2DW4 A;  4DXW A;  4PEL A;  3QO5 A;  5L3D A;  4JGS A;  1YIT V;  5EC1 C;  1NJI W;  4XBF A;  3ZRX A;  2WSS G;  4YXW G;  3FB5 C;  1JX9 A;  3AEI A;  1K8A W;  3ZMV A;  1Y66 A;  1JOY A;  4KP4 A;  3G4S V;  1S77 D;  4WF9 V;  1PD3 A;  3SPH A;  4J9Y B;  1SES A;  4XDJ A;  4E2L A;  1K97 A;  2HKO A;  1YJW V;  2ZDI C;  2DQ0 A;  1VQL V;  5EBM C;  1THZ A;  4WFG A;  2P6J A;  5KUM A;  3AG2 C;  2DWE C;  3ABU A;  4WFA V;  3K0D A;  4FK5 C;  3CCM V;  4FIP C;  3ZMU A;  3JD1 A;  4MVS A;  2AHZ A;  2GSM B;  3ZMT A;  3T2M A;  1OCR C;  2LFR A;  4MVU A;  1VQ8 V;  3X2Q C;  1NVP D;  5H9C A;  5DN6 G;  1G4Y B;  2HVJ C;  1R6N A;  5LHH A;  2IJH A;  1BHA A;  1OCC C;  2IJK A;  1YJN V;  2IU3 A;  2KB1 A;  3RVY A;  1KC8 W;  2Y69 C;  2JEU A;  4UV8 A;  2NLJ C;  1F23 A;  1OCC B;  3JYC A;  5IDJ A;  3ZRV A;  2YEV B;  3RBZ A;  5IYC O;  4TT3 G;  1K5S A;  4H37 A;  4F4L A;  3GWO A;  3ABK B;  2FTK A;  3K9A A;  1PL0 A;  3DTU B;  2JK5 C;  4KUM A;  4RAI A;  1Q81 W;  4EKW A;  1LNQ A;  1HWY A;  4MTO A;  1RPR A;  1Q7Y W;  1GK9 A;  4CZZ A;  4P9P A;  1FXH A;  1R3L C;  1P7B A;  3ETD A;  2DQ3 A;  4QIW F;  4BIU A;  5L3F A;  1EFR G;  5CBF A;  1AR1 B;  3OGC C;  3CCQ V;  3CCV V;  1MSW D;  2OT5 A;  4R7C A;  3HPL C;  2W0F C;  1NVP B;  1K33 A;  4PA3 A;  4P9O A;  4WCE V;  4UVA A;  1ARO P;  4UXN A;  4P30 A;  2EIN C;  2DYR B;  1QBZ A;  1COW G;  2V1D A;  3OEH G;  3E86 A;  1DLB A;  3TK1 A;  3ZN0 A;  3ZCC A;  3PJS K;  2IJJ A;  3STZ C;  2WLN A;  4CBC A;  5H6Q A;  2LFS A;  3QO7 A;  4MVR A;  1V54 B;  5CBH A;  1SZT A;  3G6E V;  2QM8 A;  2WLI B;  2XAG A;  2IW5 A;  3ABK C;  3OMN B;  3HB3 B;  3MHH C;  4LBE C;  3RW0 A;  2X6C A;  2C2A A;  5EK0 A;  3LDC A;  3ZMZ A;  1KKD A;  2V7Q G;  2WLJ A;  5FL7 G;  2PI5 A;  3ABM C;  2PI4 A;  4JF3 A;  2B5U A;  2ZR2 A;  2HLD G;  1EZJ A;  1K5Q A;  3OUS A;  1K4D C;  2B1I A;  5IY5 B;  2HFE C;  2R9I A;  3W7U A;  4MTX A;  5B3S C;  4N23 A;  2X6A A;  5B1A B;  1NKD A;  2H8P C;  3ZJZ A;  3CYO A;  1OCR B;  1VQK V;  1R3I C;  2LP7 A;  1JJ2 U;  4WFB V;  5IYD O;  1VQM V;  3JD3 A;  4R8C A;  4QE7 A;  1IXM A;  4MVM A;  4PDL A;  1M56 C;  3QNE A;  1RM1 B;  4HAM A;  4J9Z B;  4Q20 A;  1OCZ C;  3OUF A;  1JVM A;  1R73 A;  3STL C;  2ZD9 A;  4ZBM A;  3CCE V;  2ZXW B;  3VOU A;  3ZRS A;  2BOB C;  1K3E A;  3I55 V;  1F51 A;  3SJQ C;  5L3C A;  1MAB G;  1E79 G;  1YJ9 V;  5BZB A;  2HVK C;  2Z5U A;  4H33 A;  5B1B B;  1YTF D;  4JYC A;  5HFM A;  1AJQ A;  3ZMS A;  4JAU A;  5B1O A;  3SYQ A;  2WLM A;  3AG1 C;  1QLE C;  2WLL A;  1YSC A;  2HG5 C;  1B6Q A;  1MOF A;  2Z3Y A;  1SRY A;  3FYE B;  4GX2 A;  4GX1 A;  4R6Z A;  1F4M A;  5LBQ A;  1KD1 W;  4WFE A;  1P4R A;  4BIZ A;  1V55 C;  4UV9 A;  5GW7 A;  5B1N A;  5L3E A;  3CCS V;  3OR7 C;  1VQO V;  3FB6 C;  4OXS A;  1N8R W;  1GMG A;  1NH2 B;  1ENV A;  1NQT A;  1FXK C;  4PA9 A;  2WLK A;  4BW5 A;  5L3G A;  3OR6 C;  3P30 A;  1V54 C;  3P32 A;  2Y69 B;  3SPC A;  5CA3 A;  3LSQ A;  1M57 B;  2WWW A;  3LDE A;  2CK3 G;  2EIJ B;  2XAH A;  2UXX A;  3K79 A;  3BEH A;  1TUE B;  1VQ4 V;  1VQ6 V;  5B3S B;  3SYC A;  1K9M W;  4FMT A;  4JYB A;  4N21 A;  2HR3 A;  3SPG A;  3ZN1 A;  3K08 A;  3UM7 A;  1YTF B;  4JTD B;  4RUE A;  4UVB A;  1J95 A;  4GX0 A;  3CC2 V;  2P90 A;  3CME V;  5KA5 A;  3ASN B;  2ZQM A;  3E89 A;  2QA4 V;  5KA6 A;  1E1R G;  1F4N A;  2EZP A;  3LDD A;  4MW3 A;  4JAS A;  2K1E A;  2ZDI A;  4LP8 A;  3ABL C;  3ASN C;  3NXS A;  4PA7 A;  4ASU G;  3OW2 U;  4FPP A;  4PA4 A;  1DF5 A;  2W6I G;  3JD0 A;  4RO2 A;  3T4D A;  4QNH B;  1NH2 D;  1Q82 W;  2MK3 A;  3K0G A;  5EBL C;  3W7T A;  4KFM A;  1H2G A;  4RUF A;  2EBO A;  1AI6 A;  4HYO A;  2XND G;  3JCZ A;  1R3J C;  3JD4 A;  1CPY A;  2A9H A;  1OHH G;  3WFV A;  1W0J G;  3OMI B;  3ABT A;  1BL8 A;  2WLI A;  4LC1 A;  4BAY A;  1QVF U;  2F43 G;  1AI5 A;  3CP1 A;  5DM6 V;  1OCO C;  1Y4M A;  3DGE A;  3E83 A;  3FKS G;  3SPJ A;  3D3I A;  3X2Q B;  1DTO A;  1S5H C;  2UXN A;  3K04 A;  5J9P C;  3B8M A;  3E8F A;  2P67 A;  1BHB A;  3M99 B;  3AG2 B;  1NR1 A;  2X7R B;  1AI4 A;  4GT1 A;  3SPI A;  4MVO A;  3TCU A;  1GM7 A;  2P7T C;  3CCL V;  2R9R B;  2ITD C;  2QTO A;  3W7X A;  1UJW B;  1JCH A;  5L3B A;  5EC2 C;  1RM1 C;  5HFL A;  3E8B A;  4L87 A;  1QCE A;  2ATK C;  4LCU C;  4RQF A;  1ORQ C;  2D3O W;  2EIJ C;  2H94 A;  1FXK A;  3CD6 V;  3MHS C;  3OM3 B;  1GO3 F;  1MG1 A;  2QKS A;  3WG7 B;  3CCU V;  1R6K A;  3AG4 C;  1M90 W;  1R3K C;  4MT8 A;  3UKM A;  1QR9 A;  3W7S A;  1E1Q G;  4U7O A;  1OCZ B;  4G27 B;  1G8M A;  1PNL A;  2JIZ G;  2EIL C;  2EJR A;  2Y48 A;  4MW8 A;  2DWD C;  3EFF K;  2B1G A;  1NBM G;  5KUK A;  1SET A;  3ABM B;  1GKF A;  2DYS C;  3ASO C;  3LNM B;  2WPD G;  4TSF G;  4DO2 A;  1ROP A;  4QPK A;  1FFT B;  1KQS U;  4XDL A;  1K7D A;  2Q68 A;  3ABL B;  1QLE B;  3LUT B;  5B1A C;  2DYR C;  1YI2 V;  2OTJ V;  3SYP A;  3FB7 C;  3G71 V;  1NR7 A;  1PKX A;  4FJC C;  4MTF A;  1CP9 A;  5B1B C;  4X8A A;  2WAM A;  3T1C A;  1XL6 A;  2GHY A;  1RPO A;  2XAJ A;  1M9N A;  5C93 A;  3OEE G;  1VQN V;  3B77 A;  4PA6 A;  1M56 B;  3CMA V;  4GX5 A;  3T4Z A;  4QJF B;  1FXV A;  3CXC U;  4QPJ A;  1I5X A;  3AG4 B;  1XL4 A;  1QVG U;  3ZIA G;  2YEV A;  3VBB A;  1WLE A;  5IYB O;  1V55 B;  3OAA G;  5EBW C;  2JDI G;  1JPX A;  3AG3 B;  3CC4 V;  5LHG A;  3IC7 A;  4JPR A;  4PDV A;  4I5S A;  3F7V C;  2IH3 C;  3A0R A;  2IJI A;  1OZ0 A;  3CC7 V;  1L1F A;  3EHB B;  1KEC A;  2HJF C;  4JAV A;  3R65 A;  2WLL B;  4PDR A;  2Q69 A;  3K3W A;  3F7Y C;  1M1K W;  2EIM C;  1H8E G;  1PNM A;  4Z1M G;  2XOK G;  3ML0 A;  3CCR V;  2OCC B;  1K73 W;  2EIN B;  4R50 A;  4PDM A;  2ITC C;  1YIJ V;  3RVZ A;  3JD2 A;  1H38 A;  4ZKI A;  1Q86 W;  1QLN A;  3E2E A;  2EZO A;  1SER A;  2AHY A;  2BOC C;  3QO8 A;  4UUJ C;  5CN0 A;  2Q67 A;  2IU0 A;  1VQ9 V;  1AI7 A;  4G28 B;  4GCZ A;  2QEX V;  1VQ7 V;  2QE7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...