3I55V

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome/antibiotic
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 26
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3i55V00
3CCEV 1KQSU 1JJ2U 3CCMV 3I55V 1Q7YW 3CCLV 2QA4V 3G4SV 1YJWV 1VQ6V 1YJ9V 1VQ5V 1M1KW 3G6EV 1Q86W 2OTJV 4WFAV 1W2BU 1VQNV 4WF9V 3CC7V 1YJNV 1S72V 1K8AW 4WFBV 3CCSV 1VQOV 1VQLV 1K9MW 1VQ4V 3OW2U 3CPWU 1VQMV 1VQ9V 3CXCU 1YIJV 5DM6V 1YHQV 1N8RW 2D3OW 3CMAV 1YITV 3CC4V 1R73A 3CMEV 1YI2V 1Q81W 1KC8W 1M90W 1VQ8V 1VQ7V 3CCVV 1K73W 3CCQV 3CCUV 3I56V 1Q82W 3CCRV 2QEXV 1NJIW 3CD6V 1VQPV 3CCJV 2OTLV 1QVFU 4WCEV 3CC2V 1QVGU 1KD1W 3G71V 1VQKV
chains in the Genus database with same CATH superfamily
4PDRA 4HNAA 1EBOA 3AG3B 1ZAUA 1OCRC 1CPYA 1Y67A 4RUFA 2A06H 4LFBO 3RYIB 1EM1A 5LP6A 4DRXB 4GX1A 5B1BC 1Q6IA 3E83A 1MZEA 2A7WA 2P22C 1M57B 2AW9A 2VQEB 1L0LH 3E35A 2EINB 1NTMH 1RP3B 4DV5B 1VEWA 2HG5C 4JI7O 4X66B 1FXKB 3AG1B 1TAEA 4YY3B 1K3EA 4R8CA 5LHGA 1ROPA 5EBMC 1XBLA 3CX5F 4RQEA 1NQTA 4TV9B 2L6LA 1W0JG 2FB5A 4DR1O 2KKWA 3Q4HB 2PZSA 1AI6A 1J5EO 1R6NA 3MHHC 4MSWC 2XUMA 3ZHTA 5KMGA 3AG2C 1XNQB 1QR8A 2UXCB 4K3AA 4JI5O 1FJGB 3AEIA 3BFRA 3BPZA 2VQFO 3LDCA 1AR5A 4FIPC 3ZRWB 2LP7A 4FLVA 2EX3A 3OTFA 4DUYB 3OTOO 2EBOA 2XAHA 3SPJA 3S3WA 3J80N 4B3MB 5CA1B 2XHBA 2WAMA 1TVKB 5DECA 1DLBA 3L74H 2BTQB 3ZBHA 1XL4A 3D8CA 3TJTA 2QWOB 3B09A 4U7OA 2EIJB 1OCCC 3KKYA 3AK2A 1NU1H 2P90A 2PGGA 2BTQA 1HWYA 1YSCA 3K0GA 4JASA 2QWRB 5AG2A 4IIJA 4TV8B 1AP6A 1NTKH 4J41A 3H1JH 3QO7A 1B04A 1OCOB 1HDJA 4F4LA 3T1HO 1K7DA 3CB2A 3N2GA 1L8DA 2WA4A 3CCMV 2ZE7A 4DUZB 3SJCC 4N23A 1XDCA 4WF9V 1K8AW 1V55B 1JPXA 5JJNB 1K4DC 4WFBV 1UJWB 2B1IA 2XTAA 3ABTA 3K79A 1VF6A 4JI8B 3E8GA 1IVSA 3OGCC 1SQFA 2Q4PA 2RNBA 3UKMA 1FPOA 4JI4O 3SDLA 4B3SO 1K4CC 1YJNV 3ICXA 1XL6A 4NYKA 3HPLC 3K9AA 4PI0A 5JH7B 4UCVA 5IWAO 4DR7O 3Q4HA 1FAFA 2Q68A 1I7FA 3ASOC 2GUZB 1OCZC 3CHXA 1GN6A 2EINC 4FLZA 1EZVH 3FB8C 2V1DA 4YIOA 1Z5VA 1GM9A 4F6EA 5BZBA 4Q20A 3THOA 3JD4A 4LH7A 3BCCH 5KA5A 4ICGA 1X59A 3ZHSA 1XOUA 1OCRB 1X4TA 4QE7A 3SJBC 1NR1A 2WLJA 4EFBA 1I08A 3BY6A 4KP4A 1QVGU 1IX9A 4U3FH 1KUQA 3OGIB 5D5PA 4CZZA 1PP9H 4PA9A 4TOIA 1F4NA 1W59A 1AJNA 3HB3B 1G8MA 1K34A 1UPGA 2QKAA 2CTPA 3ZMUA 4DV3B 5B5EZ 5BMVB 4DV0O 4LC1A 2UXDO 4PDVA 1S76D 5CA1A 5B1AB 2CE4A 5D5QA 1R3KC 3JARB 3UM7A 1Y76A 5KLVH 3CRAA 3ZCCA 4DR2B 1S77D 2HJFC 4HZ3A 2P06A 1YXBA 2QM4A 3FB6C 4R7CA 4KHPO 3G4SV 2DWDC 3H9VA 2IU3A 3ZN1A 3HKCB 4F6RB 3L9DA 2UUCB 1K5SA 1XUQA 4CC6A 4DV4O 2ZE6A 1VQ4V 4LNUB 5KA6A 3IAYA 1TVKA 3T4DA 2XAQA 4JI8O 5GONB 4E2LA 5FPOA 3J81N 5JQGB 2EILC 1OCZB 2DE0X 2GTSA 3GWKC 2B5UA 2R9IA 4O4LA 4Q6GA 1WB8A 1SA0B 4LFBB 1SKVA 2Q0AA 3BRCA 3D36A 3RGBA 3ZHUA 1S5HC 1DGSA 4WBNB 1WLEA 2A79B 2HFEC 4ZBMA 2E5LB 1YJWV 3SPCA 1N34O 1V54B 4PA4A 4HNAB 1GKFA 5J2TA 1YCIA 1Q81W 5L3BA 3OMAB 4MW3A 5LA6A 3ASNC 3CCQV 1WAZA 3SYCA 3ABMB 4P9PA 2UXXA 4X62O 3E2EA 2ZQMA 2YUAA 2X0LA 4LF9O 3JAWA 2BOCC 1JFFA 3A2FA 2JDIG 5IJ9A 1MSDA 5LP6C 1CEZA 4X65O 3WFVA 3KG2A 2EJRA 1BCCH 4WCEV 2OT5A 4KL1A 4FLTA 2DJVA 3RN4A 3OE7G 2RMKB 4FFBA 1MG1A 3DXRA 1N33O 2YI8A 5IYZA 1SF9A 3HKEB 3ZMZA 4WFHA 2W6IG 4XDJA 5EC1C 2ADPA 4DYLA 1PD3A 2D3OW 3UQ8A 4TSFG 4NVPA 4X8AA 3A0RA 1ENVA 3CS5A 3WB2A 4DK1A 1G6UA 3HKDA 4LF6B 3RVYA 2YS8A 4X1IB 1IBKB 4UB8Z 3I55V 2RQ6A 4JYAO 3ASNB 3P3NA 2Q5ZA 3CWBH 3JAMN 3JALB 5FNVB 4X89A 2R70A 3CPWU 1H2SB 5KX5A 2CGNA 5LXTA 5IYZB 3CCVV 5FL7G 2JJ2G 1FS0G 3K08A 5LGNA 2RCVA 4YJ3A 2DQ3A 2CH7B 3IGAC 3C3SA 1BE3H 2QR4A 5K1PA 3CJHB 4PA3A 4JI3O 1JX9A 4MS2A 3CXCU 4CH5A 5LOVB 3CE2A 1I94B 1K73W 1Q82W 2EIKB 2F93B 5JH7A 3CEIA 1QQCA 2WPDG 3BAAA 4QPJA 4NKGB 3AG1C 1ZL8A 4DV6O 2P5OA 4JI4B 4GYCB 3AG4B 2A0LA 1Q86W 4MVUA 3OT7A 2WWWA 1NTZH 4UVBA 5CB4A 1XREA 2IW5A 5L3FA 1N8RW 3AG3C 1OV9A 1ZSPA 2UUCO 1QVFU 3BABA 3OEHG 5IWAB 4DR7B 1QLNA 4B3TO 2HR3A 3CYOA 4I55A 3WB1A 2BOBC 4X62B 3E86A 5IYDO 5EIBD 1QHTA 1B06A 2XAJA 1XEQA 2FTKA 4X1YA 1M56B 2Q6AA 2ZNIA 1VMGA 2PF4E 4UXNA 4IHJA 1WP7A 5CA0B 3CD6V 1T5EA 2KSDA 3G71V 3K9SA 1GMGA 3B77A 3LDDA 4GCZA 3X2QB 4JTCB 2F23A 1M4UA 3W7TA 3FB7C 3C90A 5H2FZ 5EZYA 4X20B 1SRYA 3ABMC 3RT3C 5LGUA 2DYSC 4DV3O 3JASB 1IBMO 1RM1B 1NKDA 1AILA 1QLEB 4PELA 1MOFA 4TT3G 4D7SA 4CH4A 1BQ0A 1EZJA 3G67A 3JATA 4I50B 3VQXA 1N36B 4I50A 2RDCA 3N27A 3TXQA 4JI6B 2BSKB 4I0XA 4GKKO 3S3XA 2XT9A 2EZPA 1URFA 4U3JB 4EKWA 3ZRWA 3R65A 3IC9A 3E22B 4IYIA 3SPGA 1KECA 2YC0A 4WFGA 4JAVA 4YXWG 5KMGB 4JYCA 2YSUB 4TUYA 1VQNV 2DQ0A 4LWSA 3AK1A 5IE9A 1N33B 3DSQA 4BIOA 4UUJC 2W6JG 2PI4A 4OX9O 5BR8O 1PNLA 2OCCC 3CRQA 3IFXA 3W7UA 2ZKOA 1XMOB 5KAFZ 1QR9A 1BT8A 2ZR3A 1GN3A 1H8HG 4B3SB 2DWEC 1V55C 3J7AU 1VF5B 1PNKA 2UUAB 2KG7B 3ZRVA 3ZHVA 4K8ZA 1I5XA 3DTUB 5DN6G 4DR2O 1Q6HA 2FKXA 5A2QN 4GUNA 4TUYB 4FVMA 2MW2B 2QWPB 2E74B 3SPHA 2Y4TA 1BZKA 2RN9A 1NT2B 5KHIA 3L72H 1SZTA 2XAFA 1DF4A 1Y66A 2AHZA 1KC8W 2LW7A 2R9RB 1YVWA 2YEVB 1FYJA 2VS0A 2LQTA 1FXKA 1HNZB 3CCEV 5LHHA 4GZRB 4NR1A 4ZIBA 1SQXH 3ABLB 2JGUA 3QTCA 3NXSA 4JTDB 3UT5B 4X1IA 1VP7A 2G38A 4GKJO 1VQMV 1SS3A 2IBZH 4X9QA 1H38A 1PPJH 3RYIA 4O4IA 1IBMB 5EZYB 1Q90D 2M7WA 3G6BA 3N2GB 2JGDB 4YJ3B 4YJ2A 1ZUQA 2CAZC 2DYRB 2QA4V 5IJ0B 3P3PA 3AG4C 1R6TA 3W7SA 1TGOA 1M93A 1J5EB 5KAIZ 1K5QA 5CA0A 4R6ZA 1YITV 3T4ZA 1WN7A 4DW0A 1NH2D 5IY5B 2E3CA 2FL4A 4H0LB 2K1EA 3JASA 1JJ2U 4BW5A 1IBKO 2ADQB 3JAWB 4UCUA 4H37A 2LW1A 1Q5OA 5KHKA 4P9OA 2JRIA 3ZHQA 4FK5C 3ZRSA 1NI8A 4OPHA 1Y74A 3JCUZ 1R6KA 1XHZA 2FMLA 4J42A 4MVQA 3DGEA 3DXRB 2PYLA 5CBGA 3K5MA 1VQKV 4E4EA 1F7YA 5J2UA 2EILB 1KYOF 4DUZO 1B6QA 4LF8O 1G4YB 1ZL8B 2WLLA 5B1NA 2DYSB 5A9GA 4UFZA 5K1XA 4X1YB 1LUWA 5B1BB 3F7VC 1RPRA 5L3EA 4AHCA 4MVMA 5LOVA 2VRZA 1PM9A 3CRRA 4RO2A 3K5NA 1N32B 3SYPA 3X2QC 4PJ0Z 4JI6O 4W4LA 5FPRA 3CP1A 1K92A 4UVAA 3TXSA 2E5LO 4ZI7B 3SYOA 1THZA 1F23A 2CH7A 3EXAA 1QU7A 1AR4A 5H9CA 3LUTB 3CC4V 2C2AA 4G27B 4MVZA 4I4TA 1LUVA 1HNZO 5B1AC 2QJ1A 4MTFA 3JALA 4NXNO 3O9OA 1SC5B 3LSSA 3SJAC 3HKCA 3K5OA 5J9PC 2NN4A 3B8MA 5GTIZ 3ZMTA 2ZM6O 1E1QG 2ETNA 3VBBA 2Y0IA 5H6QA 4JI0O 1VQ8V 2UU9O 3LSUA 3F7YC 1R3JC 2Z5UA 1PNMA 3HKBB 2ZD9A 2Q9LA 4DV4B 1WNSA 1H2GA 4CS3A 4MTXA 1R1BA 2Q7GA 2H94A 1U96A 1UFIA 1ZX3A 4JYBA 1R73A 2PYJA 4GLXA 3M99B 2Q67A 1IBLB 4DR4O 2OIGA 5H5NA 2QM7A 1GK9A 4X65B 2UU9B 3P30A 4QJFB 1RPOA 4FJCC 4J11A 1YDXA 2GSMB 4DO2A 3JAKA 2OWOA 4RWUA 2P7TC 4CC5A 2BCCH 1MMMA 4I4TB 2ITCC 4I9WA 5L3GA 2OTLV 1SQPH 3JD3A 4X88A 1M57C 1TUBA 5EYPB 3ZRXA 2UXBO 3E8HA 1ZTEA 2GV9A 1L1FA 3SJQC 3DC5A 1EN5A 4ZOLB 1KU9A 4PDLA 1IZ3A 4DV7B 4CS4A 2R72A 2VWJA 1Z5WA 3ETDA 2LGWA 4N21A 4JV5B 1SA0A 4DR5O 2X6CA 2PY5A 1VQ6V 1P7GA 1PL4A 4CS2A 2A3QA 1GAXA 2YXYA 3B4SA 3RYHA 3K03A 3ABKB 3ZEDA 3K5LA 1VQOV 2Y69C 2OCHA 4AQYB 2YXHA 3M7MX 3CMEV 1PKXA 4I7ZB 3ZS8C 3FAVB 1M5IA 1SETA 5KHHA 1I5YA 1RFYA 1Y74B 4IL6Z 1XHXA 1YF2A 2LJ2A 4U7NA 1NVPB 3TGUH 2E75B 4H13B 2YIBA 5C93A 1JCHA 2GHYA 4ZKIA 5KHJA 2ZM6B 1HNWB 2HHHB 4JI5B 1FJGO 1MA1A 2JEXA 1JA8A 2EIMC 2ZDIC 1FFTB 1MNGA 2ATKC 3ML0A 2HEPA 3JSNA 2ZXWC 4JZGA 5B3SC 4J7JA 2AGAA 2IH1C 1HNXO 2CTWA 4KUMA 2E76B 3LNNA 5ITZB 5KHGA 3FYEB 2W0FC 4QE9A 2YIDA 5JVDB 4L87A 1ZWIC 1S72V 4I9QA 3ASOB 5KUKA 2QE7G 2WLHA 2QEXV 3SYQA 3JD1A 4FM2A 2EIKC 3D36C 3T1YB 1XQ8A 1Q3EA 3H1IH 1IXMA 1GRJA 4AILC 5JCOA 3JD0A 2V4DA 3E8BA 2BSKA 1SQQH 4I0XB 4IYHA 3K04A 2UUAO 4TV8A 4IIJB 4B3RO 4P2ZA 4QNHB 2QGNA 4MVOA 4IHJB 2L35A 4MTGA 2ZNJA 4LF9B 2JGDA 2EZOA 2O57A 1EFRG 2JK5C 4ZHQA 3VQYA 5BMVA 2F4VB 5B66Z 1AI7A 2PI5A 1YJ9V 4BW9A 4DK0A 4LFCO 4WFFA 4X20A 4Z1VA 4LFAO 3OTOB 2WLIB 4JGSA 1S5LZ 2Q8VA 5DM6V 4J9ZB 1JMKC 3AK3A 2YI9A 4TQDA 5EBWC 1N36O 1Y6XA 2H3OA 4MTOA 2DN9A 4X64B 3K59A 4DR3O 1FFXB 3CCLV 3RYHB 2HLDG 4LF6O 4ABMA 2LFSA 1COWG 3APOA 3KCXA 4O2BB 4J7ZA 2LGQA 2BE3A 1KP3A 4ZOLA 4JI2O 1AP5A 2AXTZ 1M56C 2HP8A 4LWSB 1OCCB 3UO2A 1PL0A 5LP6B 4DV6B 4LR3A 1VF6C 3B2EE 4WFEA 3VQWA 5F2VO 4LF4O 2QSAA 3PN1A 5EYPA 3E22A 1XI1A 5LMUB 3ZMVA 4O4JA 2Q73A 1FKAO 5L3CA 2AZ0A 1VQPV 4J80A 4LH6A 1JVMA 5IYBO 1NZ6A 2X6AA 3F5TA 2YDEA 2Y0PA 3SR2C 3RW0A 5C8YB 4Z1MG 5LYJA 4O2AB 1P49A 1BL8A 1V54C 5JJEB 3BEHA 3FKSG 4UCOA 4DRXA 3P32A 4A5UB 3CMAV 4JTAB 2GBOA 3T1YO 4NTYA 4FFKA 3TCUA 4BAYA 1OJHA 5EIBC 1Q43A 3CXHF 3FX7A 2N74A 5LXTB 2UUBO 4DV5O 1L0NH 3H01A 1FXKC 1P7BA 4HAMA 1VQ9V 3RYFA 4PV1B 3BHPA 1XNRO 2R9AA 1IBLO 1YZBA 1B3QA 1KD1W 1CP9A 1MZFA 3H1HH 1N0NA 3VQVA 2HVJC 2EJ7A 1H2LA 1A32A 3HKDB 4PDMA 4X1KA 2F4VO 2A9HA 1HNXB 3NR7A 4B7EA 2OTJV 4KFMA 3FD9A 4DV1B 4DR1B 3ABUA 4QPKA 2P67A 3F5WC 1YIJV 1CXZB 4TV9A 1GTOA 2CGOA 1D2DA 2F43G 5E79Z 2N05A 5HFMA 1XNRB 3IC7A 1R3LC 4DV2O 4JI0B 3B40A 3OMNB 1SQBH 3BA8A 2NNUA 4DV0B 2JJ1G 5IJ9B 2YIAA 3K06A 5DEDA 3JSLA 4H33A 3MHSC 3K58A 1XMQB 1F4MA 1K33A 2Z0AA 1DTOA 2IU0A 3R66A 4B3TB 3QNEA 4FM1A 1N4CA 2Y69B 4G2KA 1KQSU 1Q8IA 1XMOO 1Q7YW 1WJZA 3MDSA 4J10A 1M1KW 4Z2WA 4GKJB 1MABG 4LF4B 2YXLA 2ZR2A 2NLJC 2YICA 1KKCA 3OFNG 3OR6C 2P4VA 4CBCA 1FXVA 3OMIB 1P4RA 4JYYA 5KX5B 3WG7C 4LFAB 4DR6O 4NXMB 4I5SA 3BVOA 4WBNA 5LMNB 2Q69A 3JAKB 1EN6A 2KB1A 1BHBA 2HHHO 2OCCB 3SYAA 1WA8B 3OM3B 1HR0O 4HBNA 2WLLB 2AZ2A 4TQFA 3QG5A 2UXBB 1Y76B 1OZ0A 1VIBA 4LF5B 4PI2A 2JS3A 2Q7EA 4UCTA 1IDSA 1P84F 2FYUH 5FNVA 4YJ2B 4LCUC 4MVRA 2NR5A 2YIBD 4F6RA 4FLYA 2Q0OC 3RYCA 1MSWD 1GH6A 3O65A 4FZ0A 1WA8A 2CDYA 4EEQA 3ZMSA 3HR0A 1NH2B 1QNMA 4AQYO 2RJZA 2LO1A 1R3IC 1KKDA 3RYCB 1EN4A 1I0HA 2CUGA 4QGPA 4FM0A 2WSSG 2XNDG 2WLNA 4FLXA 2QM8A 1IXBA 4K35A 2F66C 1DF5A 1YTFB 5TISZ 3WB0A 1H2KA 1O9GA 1ORQC 5LA6B 3ABLC 4JI7B 1VQ7V 4BIUA 5JCOC 4RQFA 3CC2V 2DW4A 4YY3O 4FLUA 4GX0A 1TUEB 1BGYH 4ZI7A 3JD2A 3A0HZ 3CRCA 1JJOA 4UCRA 2LFRA 3OW2U 4TWKA 2JEUA 5GTHZ 5JJJB 1SQVH 4JZ2A 2D2CB 4EFEA 5BY1A 1DK1A 4XDLA 1IURA 1F51A 1YTFD 3CCRV 3QVNA 3KCYA 1BS3A 5JWPA 4ASUG 2UXCO 3L75H 2ZT9B 3AG7A 4K0KB 2ZIMA 1KMIZ 2IJJA 4PA6A 1FFXA 1W0KG 5CMUA 4OXSA 1HW7A 5LBQA 1JR9A 1RSOB 2QTOA 5LHIA 4JYAB 1NR7A 2B1GA 2KQXA 3GWOA 3RBZA 5CA3A 4O4HA 1N32O 2MK3A 3A8TA 1KB9F 4NB5A 5LMNO 3N2KB 1AROP 3QO5A 4D7TA 1XNQO 4KHPB 3AG2B 3CSXA 4W4KA 3B8NA 4JI1B 3OR7C 3EFFK 2Z3YA 1QCEA 4B08A 3L73H 1NJIW 1S3JA 5J2UB 3MAQA 3JARA 4RUEA 2DOSA 4LFCB 2EULA 2BTOA 4CH3A 3RVZA 1FD9A 4DR3B 1PV0A 4OX9B 4LNUA 3GB7C 5B1OA 1JOYA 1HNWO 3APQA 3IJ4A 4O4IB 5IY5C 3FYIB 1QBZA 2GDSA 4BWAA 4X1KB 1BSMA 5CN0A 3WG7B 1SERA 2QKCA 2QWQB 1SZXA 2W0XA 4B7KA 4UCSA 2WA3A 4H44B 1BMFG 3UCSC 1YEWA 2HVKC 1D5NA 2YEVA 1AI4A 2X6BA 1Y4MA 1OCOC 3I5DA 4JAAA 2WLKA 2ZINA 3U10A 1AVMA 3EVKA 4IGGA 2PUSA 4LBEC 4LF8B 4EB6A 4MVSA 1AB3A 1J95A 5LMUO 3W7WA 3ZIAG 1TA8A 1H2MA 2QTSA 1K97A 2GUZA 1WB7A 4GX5A 2JS5A 3UT5A 1VQLV 2KG7A 2IJIA 2ITDC 4JPRA 5LYJB 5JVDA 2XAGA 3RFRA 4YHHB 4XBFA 4UVCA 1VF7A 4FMTA 1NBMG 3OEEG 3ZJZA 2N04A 5CB4B 2IH3C 3W7XA 3DC6A 2ZIOA 4LF7O 4DR4B 4K0KO 1GN4A 5EBLC 4PA7A 1NS1A 3T2MA 3U11A 2IJKA 4KXRA 1H8EG 3ETGA 2OYQA 1AJPA 3LDEA 3K3WA 3I56V 4DV7O 2QKSA 2ZE5A 4I55B 2ZDIA 1US6A 1AR1B 2UUBB 2XASA 4YHHO 2WLIA 3QF7A 3PJSK 2WLMA 4DR5B 1LNQA 3FAVA 1NVPD 2JIZG 2XOKG 2P6JA 4ZHQB 4CH6A 3T1HB 1RSOA 4O2BA 4LF7B 4U3JA 5H6RA 3E89A 1VARA 2IJHA 2PTMA 3ZX6A 3GVMA 4DV1O 1GN2A 1O9HA 3BA9A 1HP8A 2B9ZA 2AHYA 2QDOA 4B3RB 4D6TH 2IM9A 4OPAA 3G80A 4DW1A 5BR8B 4WFAV 5KUMA 4NTXA 3CCSV 1K9MW 5HFLA 1M9NA 2JVDA 2QWNB 1E79G 2F95B 3D3IA 4EB6B 2HJDA 2ILMA 4OGQB 2UXDB 2DYRC 3STZC 4LF5O 1N0JA 2ZXWB 1H2NA 5ITZA 2X7RB 1W2BU 2DMXA 2UXNA 4UB6Z 5EK0A 1XMQO 3JATB 1BQZA 4FFBB 1RM1C 3HKBA 1GM8A 2Q7HA 4FZ1A 1JQ0A 4LP8A 1KP2A 4JF3A 3CCUV 3CCJV 1D5AA 3WU2Z 4IT5A 2EIMB 1YHQV 2ZE8A 4JAUA 1GM7A 5FLXN 1V9PA 4NTWA 3N2KA 5EC2C 3D3QA 4K8XA 2ZCEA 5CBFA 2CK3G 5LL6Y 4NXMO 3HKEA 3MD0A 1Z2GA 3H1KH 3STLC 3ABKC 3QO8A 3TETA 2ODMA 5IYCO 4DV2B 1VQ5V 1AI5A 1KBHA 2Y48A 3G6EV 2V7QG 4MW8A 3OAAG 4L8JA 1JFFB 2F1MA 4PHZA 1GO3F 5E1AC 1Q6UA 3K0DA 1G1XB 1YI2V 4BR6A 4G28B 3JCZA 4PD4F 3TK1A 2H8PC 4X64O 3H1LH 4AI8A 2VQEO 1OHHG 1ZLZA 3CJHA 1U97A 5CBHA 4O4HB 1FXHA 3SGIA 3C3TA 3RWRD 2P4KA 3ZN0A 3U0ZA 3OUSA 1TUBB 1SESA 4J9YB 5L3DA 3CC7V 3JYCA 5J2TB 5JQGA 2K9PA 5BXZA 3ETQA 4JI2B 4DR6B 1I94O 4UV8A 4GKKB 4NXNB 4MT8A 4P30A 2HKOA 3VOUA 2CTQA 4QIWF 1WPXA 3ETEA 3E8FA 4FPPA 4GX2A 4YIPA 5IT9N 1QLEC 1AJQA 3UO3A 1HR0B 4JI1O 1XILA 1M90W 4O4LB 4BIZA 2ARHA 2VQFB 1WP8A 3EHBB 2VWKA 3FFQA 5B3SB 4DUYO 2CTRA 1E1RG 5IDJA 4B3MO 5GONA 3FB5C 3ZHRA 4HYOA 5LGTA 1S5JA 5IJ0A 5GW7A 3T1CA 4JV5O 3OUFA 3M8AA 2M6YA 3CRMA 1BHAA 4C7UA 4XDKA 1WPBA 3LSQA 1N34B 2OIEA 2GTAA 4RAIA 3K57A 2Y4UA 4O2AA 4JI3B 5C8YA 1LR1A 4DXWA 3A0BZ 3RYFB 3KZIZ 3L71H 3SPIA 4UV9A 3OD4A 4FLWA 3L70H 1S0VA 4J7KA 4X66O 1SQGA 2EIJC 3LNMB 4GT1A 4O4JB 4R50A
chains in the Genus database with same CATH topology
4PDRA 3JD3A 1EBOA 4X88A 3AG3B 4GX0A 1M57C 1TUEB 3IGAC 3ZRXA 1OCRC 1CPYA 3JD2A 3E8HA 4RUFA 4GX1A 4PA3A 5B1BC 1L1FA 3SJQC 2LFRA 1JX9A 3E83A 4MS2A 3OW2U 4TWKA 1M57B 2JEUA 3CXCU 4XDLA 3E35A 2EINB 1F51A 4PDLA 1Q82W 1K73W 1YTFD 2EIKB 3CCRV 2HG5C 3ETDA 2WPDG 4N21A 4QPJA 1FXKB 3AG1C 3AG1B 2X6CA 4ASUG 1VQ6V 1K3EA 3AG4B 2A0LA 1Q86W 4MVUA 2IJJA 4PA6A 4R8CA 5LHGA 2WWWA 1W0KG 3K03A 4UVBA 1ROPA 3ABKB 4OXSA 5CMUA 2IW5A 1VQOV 5LBQA 2Y69C 2QTOA 5L3FA 5EBMC 5LHIA 1N8RW 1NR7A 3AG3C 3CMEV 2B1GA 4RQEA 1NQTA 1PKXA 1SETA 1I5YA 3GWOA 3RBZA 5CA3A 1QVFU 1W0JG 3OEHG 1QLNA 4U7NA 2MK3A 2HR3A 1NVPB 3CYOA 5C93A 1JCHA 2GHYA 4ZKIA 2BOBC 3E86A 5IYDO 1AI6A 1R6NA 3MHHC 1AROP 4MSWC 3QO5A 2XAJA 3AG2C 1QR8A 2JEXA 3AG2B 2FTKA 2EIMC 2Q6AA 2ZDIC 1M56B 1FFTB 3AEIA 2ATKC 3ML0A 3LDCA 4FIPC 3ZRWB 2LP7A 3B8NA 3OR7C 3EFFK 4UXNA 2ZXWC 2Z3YA 1QCEA 5B3SC 3CD6V 1NJIW 2IH1C 1S3JA 2EBOA 2XAHA 4RUEA 3G71V 3SPJA 1GMGA 3B77A 3LDDA 4KUMA 4GCZA 3RVZA 3X2QB 4JTCB 2WAMA 3FYEB 2W0FC 4QE9A 1DLBA 4L87A 1ZWIC 3GB7C 1S72V 5B1OA 1JOYA 1XL4A 3W7TA 3ASOB 5KUKA 3FB7C 2QE7G 5IY5C 2WLHA 3FYIB 1QBZA 2QEXV 1SRYA 3ABMC 4U7OA 5LGUA 2EIJB 3SYQA 2DYSC 3JD1A 1OCCC 5CN0A 3WG7B 1SERA 2EIKC 1RM1B 2P90A 1NKDA 1QLEB 4PELA 1IXMA 1HWYA 1MOFA 4TT3G 1YSCA 3JD0A 1BMFG 1EZJA 3K0GA 4JASA 3E8BA 2HVKC 3K04A 2YEVA 1AI4A 2X6BA 4P2ZA 3QO7A 4QNHB 1Y4MA 1OCOC 4MVOA 1OCOB 2WLKA 4MTGA 4F4LA 2EZPA 4EKWA 1K7DA 2EZOA 3R65A 3ZRWA 1EFRG 2JK5C 3SPGA 4LBEC 1KECA 4WFGA 3CCMV 4JAVA 4YXWG 4MVSA 1AI7A 2PI5A 4JYCA 1YJ9V 1J95A 4N23A 2YSUB 3W7WA 3ZIAG 4WFFA 1VQNV 2DQ0A 1K97A 4WF9V 2WLIB 4JGSA 1K8AW 1V55B 1JPXA 4GX5A 1K4DC 4WFBV 1VQLV 5DM6V 2IJIA 2B1IA 2ITDC 4J9ZB 4JPRA 1UJWB 3ABTA 5EBWC 2XAGA 4UUJC 2W6JG 3K79A 4XBFA 3E8GA 2PI4A 4MTOA 1PNLA 3OGCC 2OCCC 4UVCA 4FMTA 3UKMA 1NBMG 3OEEG 3IFXA 3ZJZA 3W7UA 2IH3C 3W7XA 3CCLV 1QR9A 2HLDG 2ZR3A 2LFSA 1K4CC 1H8HG 5EBLC 2DWEC 1COWG 1YJNV 4PA7A 3T2MA 1XL6A 2IJKA 1V55C 3HPLC 3K9AA 1H8EG 3ETGA 1PNKA 1AJPA 3LDEA 3K3WA 1KP3A 3I56V 3ZRVA 2QKSA 2Q68A 1I5XA 1M56C 2ZDIA 3DTUB 1AR1B 5DN6G 3ASOC 2XASA 2WLIA 1OCCB 1OCZC 3PJSK 1PL0A 2WLMA 2EINC 1LNQA 3SPHA 1NVPD 2JIZG 4WFEA 3FB8C 2XOKG 2P6JA 2V1DA 1GM9A 5BZBA 4Q20A 5H6RA 3ZMVA 3JD4A 1SZTA 2XAFA 1DF4A 5KA5A 3E89A 1Y66A 2AHZA 1KC8W 2IJHA 1OCRB 2R9RB 4QE7A 5L3CA 1NR1A 2WLJA 1VQPV 2YEVB 3BY6A 4KP4A 1QVGU 1JVMA 5IYBO 2X6AA 1FXKA 3CCEV 5LHHA 2AHYA 4CZZA 3RW0A 3ABLB 4Z1MG 4PA9A 4WFAV 3NXSA 1F4NA 4JTDB 1BL8A 1AJNA 1V54C 3HB3B 5KUMA 3BEHA 3FKSG 1G8MA 3CCSV 1K9MW 5HFLA 1K34A 1VQMV 1M9NA 3P32A 1H38A 3CMAV 1E79G 4JTAB 3ZMUA 3D3IA 2M7WA 3TCUA 4BAYA 4LC1A 2DYRC 2DYRB 2QA4V 4PDVA 3STZC 1S76D 3AG4C 2ZXWB 3W7SA 2X7RB 1W2BU 5B1AB 3H01A 2UXNA 5EK0A 1FXKC 1P7BA 1R3KC 1RM1C 3UM7A 1K5QA 4HAMA 1VQ9V 3ZCCA 4R6ZA 1GM8A 1YITV 1JQ0A 3T4ZA 1S77D 2HJFC 4LP8A 4HZ3A 1KP2A 4JF3A 1NH2D 5IY5B 3CCUV 3CCJV 3FB6C 4R7CA 1KD1W 1CP9A 2EIMB 2K1EA 1YHQV 4JAUA 2HVJC 1GM7A 1JJ2U 4PDMA 4BW5A 3G4SV 4H37A 2A9HA 2DWDC 4P9OA 5EC2C 2IU3A 3ZN1A 2OTJV 4KFMA 4FK5C 3ABUA 4QPKA 3F5WC 1K5SA 2P67A 3ZRSA 1VQ4V 5CBFA 2CK3G 5KA6A 1YIJV 1R6KA 3T4DA 1GTOA 3MD0A 2F43G 4MVQA 2XAQA 3DGEA 5HFMA 4E2LA 3STLC 5CBGA 3ABKC 3IC7A 3QO8A 3TETA 1VQKV 1R3LC 5IYCO 2EILC 1OCZB 3OMNB 2EILB 1B6QA 1VQ5V 2B5UA 1G4YB 1AI5A 2R9IA 2Y48A 3G6EV 2V7QG 2WLLA 4MW8A 2NNUA 2DYSB 5B1NA 3OAAG 2JJ1G 5E1AC 3K06A 1GO3F 5B1BB 3F7VC 1RPRA 3D36A 5L3EA 3K0DA 4H33A 3MHSC 4MVMA 1YI2V 4G28B 1F4MA 3JCZA 1K33A 2IU0A 1DTOA 3TK1A 2H8PC 4RO2A 1S5HC 3QNEA 2Y69B 3SYPA 1OHHG 1WLEA 2A79B 2HFEC 3X2QC 4G2KA 5CBHA 1KQSU 1FXHA 4ZBMA 1Q7YW 3CP1A 1YJWV 1K92A 4UVAA 1M1KW 3ZN0A 3OUSA 1THZA 1MABG 1SESA 1F23A 4J9YB 3SPCA 1V54B 3SYOA 5L3DA 4PA4A 3CC7V 3JYCA 2ZR2A 1GKFA 2NLJC 5H9CA 3LUTB 3OFNG 3CC4V 3OR6C 2C2AA 4G27B 4CBCA 4MVZA 1Q81W 1FXVA 3OMIB 1P4RA 3OMAB 4MW3A 3ASNC 5L3BA 3WG7C 3CCQV 3SYCA 5B1AC 3ABMB 4MTFA 4I5SA 3LSSA 4UV8A 4P9PA 2UXXA 2Q69A 4MT8A 4P30A 5J9PC 2ZQMA 3E2EA 2HKOA 3VOUA 2KB1A 1BHBA 4QIWF 2X0LA 1WPXA 3B8MA 2OCCB 3ETEA 3SYAA 3E8FA 3ZMTA 4FPPA 1E1QG 2BOCC 3VBBA 2JDIG 3OM3B 4GX2A 1QLEC 1AJQA 1CEZA 5H6QA 2WLLB 1VQ8V 1M90W 4BIZA 3WFVA 3KG2A 2EJRA 3F7YC 1R3JC 3EHBB 2Z5UA 4WCEV 2OT5A 1PNMA 5B3SB 3OE7G 1E1RG 1OZ0A 5IDJA 1MG1A 2ZD9A 3FB5C 4HYOA 1H2GA 5LGTA 3ZMZA 4MTXA 4WFHA 2W6IG 2H94A 4XDJA 5GW7A 4LCUC 4MVRA 3T1CA 5EC1C 1PD3A 3OUFA 2D3OW 4JYBA 1R73A 4TSFG 4X8AA 1MSWD 1BHAA 3A0RA 3M99B 1ENVA 2Q67A 4XDKA 2QM7A 1GK9A 3ZMSA 3LSQA 1NH2B 3RVYA 3P30A 4QJFB 3I55V 1RPOA 4FJCC 1R3IC 1KKDA 4RAIA 2GSMB 4DO2A 2WSSG 2XNDG 3ASNB 2WLNA 2P7TC 2QM8A 4DXWA 1DF5A 4X89A 3SPIA 4UV9A 3CPWU 1YTFB 1S0VA 1ORQC 2ITCC 3ABLC 1VQ7V 4BIUA 4I9WA 5FL7G 3CCVV 2JJ2G 5L3GA 4RQFA 1FS0G 2OTLV 2EIJC 3K08A 3LNMB 4GT1A 5LGNA 3CC2V 2DW4A 4R50A 2DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE V;  1KQS U;  1JJ2 U;  3CCM V;  3I55 V;  1Q7Y W;  3CCL V;  2QA4 V;  3G4S V;  1YJW V;  1VQ6 V;  1YJ9 V;  1VQ5 V;  1M1K W;  3G6E V;  1Q86 W;  2OTJ V;  4WFA V;  1W2B U;  1VQN V;  4WF9 V;  3CC7 V;  1YJN V;  1S72 V;  1K8A W;  4WFB V;  3CCS V;  1VQO V;  1VQL V;  1K9M W;  1VQ4 V;  3OW2 U;  3CPW U;  1VQM V;  1VQ9 V;  3CXC U;  1YIJ V;  5DM6 V;  1YHQ V;  1N8R W;  2D3O W;  3CMA V;  1YIT V;  3CC4 V;  1R73 A;  3CME V;  1YI2 V;  1Q81 W;  1KC8 W;  1M90 W;  1VQ8 V;  1VQ7 V;  3CCV V;  1K73 W;  3CCQ V;  3CCU V;  3I56 V;  1Q82 W;  3CCR V;  2QEX V;  1NJI W;  3CD6 V;  1VQP V;  3CCJ V;  2OTL V;  1QVF U;  4WCE V;  3CC2 V;  1QVG U;  1KD1 W;  3G71 V;  1VQK V; 
#chains in the Genus database with same CATH topology
 4PDR A;  4HNA A;  1EBO A;  3AG3 B;  1ZAU A;  1OCR C;  1CPY A;  1Y67 A;  4RUF A;  2A06 H;  4LFB O;  3RYI B;  1EM1 A;  5LP6 A;  4DRX B;  4GX1 A;  5B1B C;  1Q6I A;  3E83 A;  1MZE A;  2A7W A;  2P22 C;  1M57 B;  2AW9 A;  2VQE B;  1L0L H;  3E35 A;  2EIN B;  1NTM H;  1RP3 B;  4DV5 B;  1VEW A;  2HG5 C;  4JI7 O;  4X66 B;  1FXK B;  3AG1 B;  1TAE A;  4YY3 B;  1K3E A;  4R8C A;  5LHG A;  1ROP A;  5EBM C;  1XBL A;  3CX5 F;  4RQE A;  1NQT A;  4TV9 B;  2L6L A;  1W0J G;  2FB5 A;  4DR1 O;  2KKW A;  3Q4H B;  2PZS A;  1AI6 A;  1J5E O;  1R6N A;  3MHH C;  4MSW C;  2XUM A;  3ZHT A;  5KMG A;  3AG2 C;  1XNQ B;  1QR8 A;  2UXC B;  4K3A A;  4JI5 O;  1FJG B;  3AEI A;  3BFR A;  3BPZ A;  2VQF O;  3LDC A;  1AR5 A;  4FIP C;  3ZRW B;  2LP7 A;  4FLV A;  2EX3 A;  3OTF A;  4DUY B;  3OTO O;  2EBO A;  2XAH A;  3SPJ A;  3S3W A;  3J80 N;  4B3M B;  5CA1 B;  2XHB A;  2WAM A;  1TVK B;  5DEC A;  1DLB A;  3L74 H;  2BTQ B;  3ZBH A;  1XL4 A;  3D8C A;  3TJT A;  2QWO B;  3B09 A;  4U7O A;  2EIJ B;  1OCC C;  3KKY A;  3AK2 A;  1NU1 H;  2P90 A;  2PGG A;  2BTQ A;  1HWY A;  1YSC A;  3K0G A;  4JAS A;  2QWR B;  5AG2 A;  4IIJ A;  4TV8 B;  1AP6 A;  1NTK H;  4J41 A;  3H1J H;  3QO7 A;  1B04 A;  1OCO B;  1HDJ A;  4F4L A;  3T1H O;  1K7D A;  3CB2 A;  3N2G A;  1L8D A;  2WA4 A;  3CCM V;  2ZE7 A;  4DUZ B;  3SJC C;  4N23 A;  1XDC A;  4WF9 V;  1K8A W;  1V55 B;  1JPX A;  5JJN B;  1K4D C;  4WFB V;  1UJW B;  2B1I A;  2XTA A;  3ABT A;  3K79 A;  1VF6 A;  4JI8 B;  3E8G A;  1IVS A;  3OGC C;  1SQF A;  2Q4P A;  2RNB A;  3UKM A;  1FPO A;  4JI4 O;  3SDL A;  4B3S O;  1K4C C;  1YJN V;  3ICX A;  1XL6 A;  4NYK A;  3HPL C;  3K9A A;  4PI0 A;  5JH7 B;  4UCV A;  5IWA O;  4DR7 O;  3Q4H A;  1FAF A;  2Q68 A;  1I7F A;  3ASO C;  2GUZ B;  1OCZ C;  3CHX A;  1GN6 A;  2EIN C;  4FLZ A;  1EZV H;  3FB8 C;  2V1D A;  4YIO A;  1Z5V A;  1GM9 A;  4F6E A;  5BZB A;  4Q20 A;  3THO A;  3JD4 A;  4LH7 A;  3BCC H;  5KA5 A;  4ICG A;  1X59 A;  3ZHS A;  1XOU A;  1OCR B;  1X4T A;  4QE7 A;  3SJB C;  1NR1 A;  2WLJ A;  4EFB A;  1I08 A;  3BY6 A;  4KP4 A;  1QVG U;  1IX9 A;  4U3F H;  1KUQ A;  3OGI B;  5D5P A;  4CZZ A;  1PP9 H;  4PA9 A;  4TOI A;  1F4N A;  1W59 A;  1AJN A;  3HB3 B;  1G8M A;  1K34 A;  1UPG A;  2QKA A;  2CTP A;  3ZMU A;  4DV3 B;  5B5E Z;  5BMV B;  4DV0 O;  4LC1 A;  2UXD O;  4PDV A;  1S76 D;  5CA1 A;  5B1A B;  2CE4 A;  5D5Q A;  1R3K C;  3JAR B;  3UM7 A;  1Y76 A;  5KLV H;  3CRA A;  3ZCC A;  4DR2 B;  1S77 D;  2HJF C;  4HZ3 A;  2P06 A;  1YXB A;  2QM4 A;  3FB6 C;  4R7C A;  4KHP O;  3G4S V;  2DWD C;  3H9V A;  2IU3 A;  3ZN1 A;  3HKC B;  4F6R B;  3L9D A;  2UUC B;  1K5S A;  1XUQ A;  4CC6 A;  4DV4 O;  2ZE6 A;  1VQ4 V;  4LNU B;  5KA6 A;  3IAY A;  1TVK A;  3T4D A;  2XAQ A;  4JI8 O;  5GON B;  4E2L A;  5FPO A;  3J81 N;  5JQG B;  2EIL C;  1OCZ B;  2DE0 X;  2GTS A;  3GWK C;  2B5U A;  2R9I A;  4O4L A;  4Q6G A;  1WB8 A;  1SA0 B;  4LFB B;  1SKV A;  2Q0A A;  3BRC A;  3D36 A;  3RGB A;  3ZHU A;  1S5H C;  1DGS A;  4WBN B;  1WLE A;  2A79 B;  2HFE C;  4ZBM A;  2E5L B;  1YJW V;  3SPC A;  1N34 O;  1V54 B;  4PA4 A;  4HNA B;  1GKF A;  5J2T A;  1YCI A;  1Q81 W;  5L3B A;  3OMA B;  4MW3 A;  5LA6 A;  3ASN C;  3CCQ V;  1WAZ A;  3SYC A;  3ABM B;  4P9P A;  2UXX A;  4X62 O;  3E2E A;  2ZQM A;  2YUA A;  2X0L A;  4LF9 O;  3JAW A;  2BOC C;  1JFF A;  3A2F A;  2JDI G;  5IJ9 A;  1MSD A;  5LP6 C;  1CEZ A;  4X65 O;  3WFV A;  3KG2 A;  2EJR A;  1BCC H;  4WCE V;  2OT5 A;  4KL1 A;  4FLT A;  2DJV A;  3RN4 A;  3OE7 G;  2RMK B;  4FFB A;  1MG1 A;  3DXR A;  1N33 O;  2YI8 A;  5IYZ A;  1SF9 A;  3HKE B;  3ZMZ A;  4WFH A;  2W6I G;  4XDJ A;  5EC1 C;  2ADP A;  4DYL A;  1PD3 A;  2D3O W;  3UQ8 A;  4TSF G;  4NVP A;  4X8A A;  3A0R A;  1ENV A;  3CS5 A;  3WB2 A;  4DK1 A;  1G6U A;  3HKD A;  4LF6 B;  3RVY A;  2YS8 A;  4X1I B;  1IBK B;  4UB8 Z;  3I55 V;  2RQ6 A;  4JYA O;  3ASN B;  3P3N A;  2Q5Z A;  3CWB H;  3JAM N;  3JAL B;  5FNV B;  4X89 A;  2R70 A;  3CPW U;  1H2S B;  5KX5 A;  2CGN A;  5LXT A;  5IYZ B;  3CCV V;  5FL7 G;  2JJ2 G;  1FS0 G;  3K08 A;  5LGN A;  2RCV A;  4YJ3 A;  2DQ3 A;  2CH7 B;  3IGA C;  3C3S A;  1BE3 H;  2QR4 A;  5K1P A;  3CJH B;  4PA3 A;  4JI3 O;  1JX9 A;  4MS2 A;  3CXC U;  4CH5 A;  5LOV B;  3CE2 A;  1I94 B;  1K73 W;  1Q82 W;  2EIK B;  2F93 B;  5JH7 A;  3CEI A;  1QQC A;  2WPD G;  3BAA A;  4QPJ A;  4NKG B;  3AG1 C;  1ZL8 A;  4DV6 O;  2P5O A;  4JI4 B;  4GYC B;  3AG4 B;  2A0L A;  1Q86 W;  4MVU A;  3OT7 A;  2WWW A;  1NTZ H;  4UVB A;  5CB4 A;  1XRE A;  2IW5 A;  5L3F A;  1N8R W;  3AG3 C;  1OV9 A;  1ZSP A;  2UUC O;  1QVF U;  3BAB A;  3OEH G;  5IWA B;  4DR7 B;  1QLN A;  4B3T O;  2HR3 A;  3CYO A;  4I55 A;  3WB1 A;  2BOB C;  4X62 B;  3E86 A;  5IYD O;  5EIB D;  1QHT A;  1B06 A;  2XAJ A;  1XEQ A;  2FTK A;  4X1Y A;  1M56 B;  2Q6A A;  2ZNI A;  1VMG A;  2PF4 E;  4UXN A;  4IHJ A;  1WP7 A;  5CA0 B;  3CD6 V;  1T5E A;  2KSD A;  3G71 V;  3K9S A;  1GMG A;  3B77 A;  3LDD A;  4GCZ A;  3X2Q B;  4JTC B;  2F23 A;  1M4U A;  3W7T A;  3FB7 C;  3C90 A;  5H2F Z;  5EZY A;  4X20 B;  1SRY A;  3ABM C;  3RT3 C;  5LGU A;  2DYS C;  4DV3 O;  3JAS B;  1IBM O;  1RM1 B;  1NKD A;  1AIL A;  1QLE B;  4PEL A;  1MOF A;  4TT3 G;  4D7S A;  4CH4 A;  1BQ0 A;  1EZJ A;  3G67 A;  3JAT A;  4I50 B;  3VQX A;  1N36 B;  4I50 A;  2RDC A;  3N27 A;  3TXQ A;  4JI6 B;  2BSK B;  4I0X A;  4GKK O;  3S3X A;  2XT9 A;  2EZP A;  1URF A;  4U3J B;  4EKW A;  3ZRW A;  3R65 A;  3IC9 A;  3E22 B;  4IYI A;  3SPG A;  1KEC A;  2YC0 A;  4WFG A;  4JAV A;  4YXW G;  5KMG B;  4JYC A;  2YSU B;  4TUY A;  1VQN V;  2DQ0 A;  4LWS A;  3AK1 A;  5IE9 A;  1N33 B;  3DSQ A;  4BIO A;  4UUJ C;  2W6J G;  2PI4 A;  4OX9 O;  5BR8 O;  1PNL A;  2OCC C;  3CRQ A;  3IFX A;  3W7U A;  2ZKO A;  1XMO B;  5KAF Z;  1QR9 A;  1BT8 A;  2ZR3 A;  1GN3 A;  1H8H G;  4B3S B;  2DWE C;  1V55 C;  3J7A U;  1VF5 B;  1PNK A;  2UUA B;  2KG7 B;  3ZRV A;  3ZHV A;  4K8Z A;  1I5X A;  3DTU B;  5DN6 G;  4DR2 O;  1Q6H A;  2FKX A;  5A2Q N;  4GUN A;  4TUY B;  4FVM A;  2MW2 B;  2QWP B;  2E74 B;  3SPH A;  2Y4T A;  1BZK A;  2RN9 A;  1NT2 B;  5KHI A;  3L72 H;  1SZT A;  2XAF A;  1DF4 A;  1Y66 A;  2AHZ A;  1KC8 W;  2LW7 A;  2R9R B;  1YVW A;  2YEV B;  1FYJ A;  2VS0 A;  2LQT A;  1FXK A;  1HNZ B;  3CCE V;  5LHH A;  4GZR B;  4NR1 A;  4ZIB A;  1SQX H;  3ABL B;  2JGU A;  3QTC A;  3NXS A;  4JTD B;  3UT5 B;  4X1I A;  1VP7 A;  2G38 A;  4GKJ O;  1VQM V;  1SS3 A;  2IBZ H;  4X9Q A;  1H38 A;  1PPJ H;  3RYI A;  4O4I A;  1IBM B;  5EZY B;  1Q90 D;  2M7W A;  3G6B A;  3N2G B;  2JGD B;  4YJ3 B;  4YJ2 A;  1ZUQ A;  2CAZ C;  2DYR B;  2QA4 V;  5IJ0 B;  3P3P A;  3AG4 C;  1R6T A;  3W7S A;  1TGO A;  1M93 A;  1J5E B;  5KAI Z;  1K5Q A;  5CA0 A;  4R6Z A;  1YIT V;  3T4Z A;  1WN7 A;  4DW0 A;  1NH2 D;  5IY5 B;  2E3C A;  2FL4 A;  4H0L B;  2K1E A;  3JAS A;  1JJ2 U;  4BW5 A;  1IBK O;  2ADQ B;  3JAW B;  4UCU A;  4H37 A;  2LW1 A;  1Q5O A;  5KHK A;  4P9O A;  2JRI A;  3ZHQ A;  4FK5 C;  3ZRS A;  1NI8 A;  4OPH A;  1Y74 A;  3JCU Z;  1R6K A;  1XHZ A;  2FML A;  4J42 A;  4MVQ A;  3DGE A;  3DXR B;  2PYL A;  5CBG A;  3K5M A;  1VQK V;  4E4E A;  1F7Y A;  5J2U A;  2EIL B;  1KYO F;  4DUZ O;  1B6Q A;  4LF8 O;  1G4Y B;  1ZL8 B;  2WLL A;  5B1N A;  2DYS B;  5A9G A;  4UFZ A;  5K1X A;  4X1Y B;  1LUW A;  5B1B B;  3F7V C;  1RPR A;  5L3E A;  4AHC A;  4MVM A;  5LOV A;  2VRZ A;  1PM9 A;  3CRR A;  4RO2 A;  3K5N A;  1N32 B;  3SYP A;  3X2Q C;  4PJ0 Z;  4JI6 O;  4W4L A;  5FPR A;  3CP1 A;  1K92 A;  4UVA A;  3TXS A;  2E5L O;  4ZI7 B;  3SYO A;  1THZ A;  1F23 A;  2CH7 A;  3EXA A;  1QU7 A;  1AR4 A;  5H9C A;  3LUT B;  3CC4 V;  2C2A A;  4G27 B;  4MVZ A;  4I4T A;  1LUV A;  1HNZ O;  5B1A C;  2QJ1 A;  4MTF A;  3JAL A;  4NXN O;  3O9O A;  1SC5 B;  3LSS A;  3SJA C;  3HKC A;  3K5O A;  5J9P C;  2NN4 A;  3B8M A;  5GTI Z;  3ZMT A;  2ZM6 O;  1E1Q G;  2ETN A;  3VBB A;  2Y0I A;  5H6Q A;  4JI0 O;  1VQ8 V;  2UU9 O;  3LSU A;  3F7Y C;  1R3J C;  2Z5U A;  1PNM A;  3HKB B;  2ZD9 A;  2Q9L A;  4DV4 B;  1WNS A;  1H2G A;  4CS3 A;  4MTX A;  1R1B A;  2Q7G A;  2H94 A;  1U96 A;  1UFI A;  1ZX3 A;  4JYB A;  1R73 A;  2PYJ A;  4GLX A;  3M99 B;  2Q67 A;  1IBL B;  4DR4 O;  2OIG A;  5H5N A;  2QM7 A;  1GK9 A;  4X65 B;  2UU9 B;  3P30 A;  4QJF B;  1RPO A;  4FJC C;  4J11 A;  1YDX A;  2GSM B;  4DO2 A;  3JAK A;  2OWO A;  4RWU A;  2P7T C;  4CC5 A;  2BCC H;  1MMM A;  4I4T B;  2ITC C;  4I9W A;  5L3G A;  2OTL V;  1SQP H;  3JD3 A;  4X88 A;  1M57 C;  1TUB A;  5EYP B;  3ZRX A;  2UXB O;  3E8H A;  1ZTE A;  2GV9 A;  1L1F A;  3SJQ C;  3DC5 A;  1EN5 A;  4ZOL B;  1KU9 A;  4PDL A;  1IZ3 A;  4DV7 B;  4CS4 A;  2R72 A;  2VWJ A;  1Z5W A;  3ETD A;  2LGW A;  4N21 A;  4JV5 B;  1SA0 A;  4DR5 O;  2X6C A;  2PY5 A;  1VQ6 V;  1P7G A;  1PL4 A;  4CS2 A;  2A3Q A;  1GAX A;  2YXY A;  3B4S A;  3RYH A;  3K03 A;  3ABK B;  3ZED A;  3K5L A;  1VQO V;  2Y69 C;  2OCH A;  4AQY B;  2YXH A;  3M7M X;  3CME V;  1PKX A;  4I7Z B;  3ZS8 C;  3FAV B;  1M5I A;  1SET A;  5KHH A;  1I5Y A;  1RFY A;  1Y74 B;  4IL6 Z;  1XHX A;  1YF2 A;  2LJ2 A;  4U7N A;  1NVP B;  3TGU H;  2E75 B;  4H13 B;  2YIB A;  5C93 A;  1JCH A;  2GHY A;  4ZKI A;  5KHJ A;  2ZM6 B;  1HNW B;  2HHH B;  4JI5 B;  1FJG O;  1MA1 A;  2JEX A;  1JA8 A;  2EIM C;  2ZDI C;  1FFT B;  1MNG A;  2ATK C;  3ML0 A;  2HEP A;  3JSN A;  2ZXW C;  4JZG A;  5B3S C;  4J7J A;  2AGA A;  2IH1 C;  1HNX O;  2CTW A;  4KUM A;  2E76 B;  3LNN A;  5ITZ B;  5KHG A;  3FYE B;  2W0F C;  4QE9 A;  2YID A;  5JVD B;  4L87 A;  1ZWI C;  1S72 V;  4I9Q A;  3ASO B;  5KUK A;  2QE7 G;  2WLH A;  2QEX V;  3SYQ A;  3JD1 A;  4FM2 A;  2EIK C;  3D36 C;  3T1Y B;  1XQ8 A;  1Q3E A;  3H1I H;  1IXM A;  1GRJ A;  4AIL C;  5JCO A;  3JD0 A;  2V4D A;  3E8B A;  2BSK A;  1SQQ H;  4I0X B;  4IYH A;  3K04 A;  2UUA O;  4TV8 A;  4IIJ B;  4B3R O;  4P2Z A;  4QNH B;  2QGN A;  4MVO A;  4IHJ B;  2L35 A;  4MTG A;  2ZNJ A;  4LF9 B;  2JGD A;  2EZO A;  2O57 A;  1EFR G;  2JK5 C;  4ZHQ A;  3VQY A;  5BMV A;  2F4V B;  5B66 Z;  1AI7 A;  2PI5 A;  1YJ9 V;  4BW9 A;  4DK0 A;  4LFC O;  4WFF A;  4X20 A;  4Z1V A;  4LFA O;  3OTO B;  2WLI B;  4JGS A;  1S5L Z;  2Q8V A;  5DM6 V;  4J9Z B;  1JMK C;  3AK3 A;  2YI9 A;  4TQD A;  5EBW C;  1N36 O;  1Y6X A;  2H3O A;  4MTO A;  2DN9 A;  4X64 B;  3K59 A;  4DR3 O;  1FFX B;  3CCL V;  3RYH B;  2HLD G;  4LF6 O;  4ABM A;  2LFS A;  1COW G;  3APO A;  3KCX A;  4O2B B;  4J7Z A;  2LGQ A;  2BE3 A;  1KP3 A;  4ZOL A;  4JI2 O;  1AP5 A;  2AXT Z;  1M56 C;  2HP8 A;  4LWS B;  1OCC B;  3UO2 A;  1PL0 A;  5LP6 B;  4DV6 B;  4LR3 A;  1VF6 C;  3B2E E;  4WFE A;  3VQW A;  5F2V O;  4LF4 O;  2QSA A;  3PN1 A;  5EYP A;  3E22 A;  1XI1 A;  5LMU B;  3ZMV A;  4O4J A;  2Q73 A;  1FKA O;  5L3C A;  2AZ0 A;  1VQP V;  4J80 A;  4LH6 A;  1JVM A;  5IYB O;  1NZ6 A;  2X6A A;  3F5T A;  2YDE A;  2Y0P A;  3SR2 C;  3RW0 A;  5C8Y B;  4Z1M G;  5LYJ A;  4O2A B;  1P49 A;  1BL8 A;  1V54 C;  5JJE B;  3BEH A;  3FKS G;  4UCO A;  4DRX A;  3P32 A;  4A5U B;  3CMA V;  4JTA B;  2GBO A;  3T1Y O;  4NTY A;  4FFK A;  3TCU A;  4BAY A;  1OJH A;  5EIB C;  1Q43 A;  3CXH F;  3FX7 A;  2N74 A;  5LXT B;  2UUB O;  4DV5 O;  1L0N H;  3H01 A;  1FXK C;  1P7B A;  4HAM A;  1VQ9 V;  3RYF A;  4PV1 B;  3BHP A;  1XNR O;  2R9A A;  1IBL O;  1YZB A;  1B3Q A;  1KD1 W;  1CP9 A;  1MZF A;  3H1H H;  1N0N A;  3VQV A;  2HVJ C;  2EJ7 A;  1H2L A;  1A32 A;  3HKD B;  4PDM A;  4X1K A;  2F4V O;  2A9H A;  1HNX B;  3NR7 A;  4B7E A;  2OTJ V;  4KFM A;  3FD9 A;  4DV1 B;  4DR1 B;  3ABU A;  4QPK A;  2P67 A;  3F5W C;  1YIJ V;  1CXZ B;  4TV9 A;  1GTO A;  2CGO A;  1D2D A;  2F43 G;  5E79 Z;  2N05 A;  5HFM A;  1XNR B;  3IC7 A;  1R3L C;  4DV2 O;  4JI0 B;  3B40 A;  3OMN B;  1SQB H;  3BA8 A;  2NNU A;  4DV0 B;  2JJ1 G;  5IJ9 B;  2YIA A;  3K06 A;  5DED A;  3JSL A;  4H33 A;  3MHS C;  3K58 A;  1XMQ B;  1F4M A;  1K33 A;  2Z0A A;  1DTO A;  2IU0 A;  3R66 A;  4B3T B;  3QNE A;  4FM1 A;  1N4C A;  2Y69 B;  4G2K A;  1KQS U;  1Q8I A;  1XMO O;  1Q7Y W;  1WJZ A;  3MDS A;  4J10 A;  1M1K W;  4Z2W A;  4GKJ B;  1MAB G;  4LF4 B;  2YXL A;  2ZR2 A;  2NLJ C;  2YIC A;  1KKC A;  3OFN G;  3OR6 C;  2P4V A;  4CBC A;  1FXV A;  3OMI B;  1P4R A;  4JYY A;  5KX5 B;  3WG7 C;  4LFA B;  4DR6 O;  4NXM B;  4I5S A;  3BVO A;  4WBN A;  5LMN B;  2Q69 A;  3JAK B;  1EN6 A;  2KB1 A;  1BHB A;  2HHH O;  2OCC B;  3SYA A;  1WA8 B;  3OM3 B;  1HR0 O;  4HBN A;  2WLL B;  2AZ2 A;  4TQF A;  3QG5 A;  2UXB B;  1Y76 B;  1OZ0 A;  1VIB A;  4LF5 B;  4PI2 A;  2JS3 A;  2Q7E A;  4UCT A;  1IDS A;  1P84 F;  2FYU H;  5FNV A;  4YJ2 B;  4LCU C;  4MVR A;  2NR5 A;  2YIB D;  4F6R A;  4FLY A;  2Q0O C;  3RYC A;  1MSW D;  1GH6 A;  3O65 A;  4FZ0 A;  1WA8 A;  2CDY A;  4EEQ A;  3ZMS A;  3HR0 A;  1NH2 B;  1QNM A;  4AQY O;  2RJZ A;  2LO1 A;  1R3I C;  1KKD A;  3RYC B;  1EN4 A;  1I0H A;  2CUG A;  4QGP A;  4FM0 A;  2WSS G;  2XND G;  2WLN A;  4FLX A;  2QM8 A;  1IXB A;  4K35 A;  2F66 C;  1DF5 A;  1YTF B;  5TIS Z;  3WB0 A;  1H2K A;  1O9G A;  1ORQ C;  5LA6 B;  3ABL C;  4JI7 B;  1VQ7 V;  4BIU A;  5JCO C;  4RQF A;  3CC2 V;  2DW4 A;  4YY3 O;  4FLU A;  4GX0 A;  1TUE B;  1BGY H;  4ZI7 A;  3JD2 A;  3A0H Z;  3CRC A;  1JJO A;  4UCR A;  2LFR A;  3OW2 U;  4TWK A;  2JEU A;  5GTH Z;  5JJJ B;  1SQV H;  4JZ2 A;  2D2C B;  4EFE A;  5BY1 A;  1DK1 A;  4XDL A;  1IUR A;  1F51 A;  1YTF D;  3CCR V;  3QVN A;  3KCY A;  1BS3 A;  5JWP A;  4ASU G;  2UXC O;  3L75 H;  2ZT9 B;  3AG7 A;  4K0K B;  2ZIM A;  1KMI Z;  2IJJ A;  4PA6 A;  1FFX A;  1W0K G;  5CMU A;  4OXS A;  1HW7 A;  5LBQ A;  1JR9 A;  1RSO B;  2QTO A;  5LHI A;  4JYA B;  1NR7 A;  2B1G A;  2KQX A;  3GWO A;  3RBZ A;  5CA3 A;  4O4H A;  1N32 O;  2MK3 A;  3A8T A;  1KB9 F;  4NB5 A;  5LMN O;  3N2K B;  1ARO P;  3QO5 A;  4D7T A;  1XNQ O;  4KHP B;  3AG2 B;  3CSX A;  4W4K A;  3B8N A;  4JI1 B;  3OR7 C;  3EFF K;  2Z3Y A;  1QCE A;  4B08 A;  3L73 H;  1NJI W;  1S3J A;  5J2U B;  3MAQ A;  3JAR A;  4RUE A;  2DOS A;  4LFC B;  2EUL A;  2BTO A;  4CH3 A;  3RVZ A;  1FD9 A;  4DR3 B;  1PV0 A;  4OX9 B;  4LNU A;  3GB7 C;  5B1O A;  1JOY A;  1HNW O;  3APQ A;  3IJ4 A;  4O4I B;  5IY5 C;  3FYI B;  1QBZ A;  2GDS A;  4BWA A;  4X1K B;  1BSM A;  5CN0 A;  3WG7 B;  1SER A;  2QKC A;  2QWQ B;  1SZX A;  2W0X A;  4B7K A;  4UCS A;  2WA3 A;  4H44 B;  1BMF G;  3UCS C;  1YEW A;  2HVK C;  1D5N A;  2YEV A;  1AI4 A;  2X6B A;  1Y4M A;  1OCO C;  3I5D A;  4JAA A;  2WLK A;  2ZIN A;  3U10 A;  1AVM A;  3EVK A;  4IGG A;  2PUS A;  4LBE C;  4LF8 B;  4EB6 A;  4MVS A;  1AB3 A;  1J95 A;  5LMU O;  3W7W A;  3ZIA G;  1TA8 A;  1H2M A;  2QTS A;  1K97 A;  2GUZ A;  1WB7 A;  4GX5 A;  2JS5 A;  3UT5 A;  1VQL V;  2KG7 A;  2IJI A;  2ITD C;  4JPR A;  5LYJ B;  5JVD A;  2XAG A;  3RFR A;  4YHH B;  4XBF A;  4UVC A;  1VF7 A;  4FMT A;  1NBM G;  3OEE G;  3ZJZ A;  2N04 A;  5CB4 B;  2IH3 C;  3W7X A;  3DC6 A;  2ZIO A;  4LF7 O;  4DR4 B;  4K0K O;  1GN4 A;  5EBL C;  4PA7 A;  1NS1 A;  3T2M A;  3U11 A;  2IJK A;  4KXR A;  1H8E G;  3ETG A;  2OYQ A;  1AJP A;  3LDE A;  3K3W A;  3I56 V;  4DV7 O;  2QKS A;  2ZE5 A;  4I55 B;  2ZDI A;  1US6 A;  1AR1 B;  2UUB B;  2XAS A;  4YHH O;  2WLI A;  3QF7 A;  3PJS K;  2WLM A;  4DR5 B;  1LNQ A;  3FAV A;  1NVP D;  2JIZ G;  2XOK G;  2P6J A;  4ZHQ B;  4CH6 A;  3T1H B;  1RSO A;  4O2B A;  4LF7 B;  4U3J A;  5H6R A;  3E89 A;  1VAR A;  2IJH A;  2PTM A;  3ZX6 A;  3GVM A;  4DV1 O;  1GN2 A;  1O9H A;  3BA9 A;  1HP8 A;  2B9Z A;  2AHY A;  2QDO A;  4B3R B;  4D6T H;  2IM9 A;  4OPA A;  3G80 A;  4DW1 A;  5BR8 B;  4WFA V;  5KUM A;  4NTX A;  3CCS V;  1K9M W;  5HFL A;  1M9N A;  2JVD A;  2QWN B;  1E79 G;  2F95 B;  3D3I A;  4EB6 B;  2HJD A;  2ILM A;  4OGQ B;  2UXD B;  2DYR C;  3STZ C;  4LF5 O;  1N0J A;  2ZXW B;  1H2N A;  5ITZ A;  2X7R B;  1W2B U;  2DMX A;  2UXN A;  4UB6 Z;  5EK0 A;  1XMQ O;  3JAT B;  1BQZ A;  4FFB B;  1RM1 C;  3HKB A;  1GM8 A;  2Q7H A;  4FZ1 A;  1JQ0 A;  4LP8 A;  1KP2 A;  4JF3 A;  3CCU V;  3CCJ V;  1D5A A;  3WU2 Z;  4IT5 A;  2EIM B;  1YHQ V;  2ZE8 A;  4JAU A;  1GM7 A;  5FLX N;  1V9P A;  4NTW A;  3N2K A;  5EC2 C;  3D3Q A;  4K8X A;  2ZCE A;  5CBF A;  2CK3 G;  5LL6 Y;  4NXM O;  3HKE A;  3MD0 A;  1Z2G A;  3H1K H;  3STL C;  3ABK C;  3QO8 A;  3TET A;  2ODM A;  5IYC O;  4DV2 B;  1VQ5 V;  1AI5 A;  1KBH A;  2Y48 A;  3G6E V;  2V7Q G;  4MW8 A;  3OAA G;  4L8J A;  1JFF B;  2F1M A;  4PHZ A;  1GO3 F;  5E1A C;  1Q6U A;  3K0D A;  1G1X B;  1YI2 V;  4BR6 A;  4G28 B;  3JCZ A;  4PD4 F;  3TK1 A;  2H8P C;  4X64 O;  3H1L H;  4AI8 A;  2VQE O;  1OHH G;  1ZLZ A;  3CJH A;  1U97 A;  5CBH A;  4O4H B;  1FXH A;  3SGI A;  3C3T A;  3RWR D;  2P4K A;  3ZN0 A;  3U0Z A;  3OUS A;  1TUB B;  1SES A;  4J9Y B;  5L3D A;  3CC7 V;  3JYC A;  5J2T B;  5JQG A;  2K9P A;  5BXZ A;  3ETQ A;  4JI2 B;  4DR6 B;  1I94 O;  4UV8 A;  4GKK B;  4NXN B;  4MT8 A;  4P30 A;  2HKO A;  3VOU A;  2CTQ A;  4QIW F;  1WPX A;  3ETE A;  3E8F A;  4FPP A;  4GX2 A;  4YIP A;  5IT9 N;  1QLE C;  1AJQ A;  3UO3 A;  1HR0 B;  4JI1 O;  1XIL A;  1M90 W;  4O4L B;  4BIZ A;  2ARH A;  2VQF B;  1WP8 A;  3EHB B;  2VWK A;  3FFQ A;  5B3S B;  4DUY O;  2CTR A;  1E1R G;  5IDJ A;  4B3M O;  5GON A;  3FB5 C;  3ZHR A;  4HYO A;  5LGT A;  1S5J A;  5IJ0 A;  5GW7 A;  3T1C A;  4JV5 O;  3OUF A;  3M8A A;  2M6Y A;  3CRM A;  1BHA A;  4C7U A;  4XDK A;  1WPB A;  3LSQ A;  1N34 B;  2OIE A;  2GTA A;  4RAI A;  3K57 A;  2Y4U A;  4O2A A;  4JI3 B;  5C8Y A;  1LR1 A;  4DXW A;  3A0B Z;  3RYF B;  3KZI Z;  3L71 H;  3SPI A;  4UV9 A;  3OD4 A;  4FLW A;  3L70 H;  1S0V A;  4J7K A;  4X66 O;  1SQG A;  2EIJ C;  3LNM B;  4GT1 A;  4O4J B;  4R50 A; 
#chains in the Genus database with same CATH homology
 4PDR A;  3JD3 A;  1EBO A;  4X88 A;  3AG3 B;  4GX0 A;  1M57 C;  1TUE B;  3IGA C;  3ZRX A;  1OCR C;  1CPY A;  3JD2 A;  3E8H A;  4RUF A;  4GX1 A;  4PA3 A;  5B1B C;  1L1F A;  3SJQ C;  2LFR A;  1JX9 A;  3E83 A;  4MS2 A;  3OW2 U;  4TWK A;  1M57 B;  2JEU A;  3CXC U;  4XDL A;  3E35 A;  2EIN B;  1F51 A;  4PDL A;  1Q82 W;  1K73 W;  1YTF D;  2EIK B;  3CCR V;  2HG5 C;  3ETD A;  2WPD G;  4N21 A;  4QPJ A;  1FXK B;  3AG1 C;  3AG1 B;  2X6C A;  4ASU G;  1VQ6 V;  1K3E A;  3AG4 B;  2A0L A;  1Q86 W;  4MVU A;  2IJJ A;  4PA6 A;  4R8C A;  5LHG A;  2WWW A;  1W0K G;  3K03 A;  4UVB A;  1ROP A;  3ABK B;  4OXS A;  5CMU A;  2IW5 A;  1VQO V;  5LBQ A;  2Y69 C;  2QTO A;  5L3F A;  5EBM C;  5LHI A;  1N8R W;  1NR7 A;  3AG3 C;  3CME V;  2B1G A;  4RQE A;  1NQT A;  1PKX A;  1SET A;  1I5Y A;  3GWO A;  3RBZ A;  5CA3 A;  1QVF U;  1W0J G;  3OEH G;  1QLN A;  4U7N A;  2MK3 A;  2HR3 A;  1NVP B;  3CYO A;  5C93 A;  1JCH A;  2GHY A;  4ZKI A;  2BOB C;  3E86 A;  5IYD O;  1AI6 A;  1R6N A;  3MHH C;  1ARO P;  4MSW C;  3QO5 A;  2XAJ A;  3AG2 C;  1QR8 A;  2JEX A;  3AG2 B;  2FTK A;  2EIM C;  2Q6A A;  2ZDI C;  1M56 B;  1FFT B;  3AEI A;  2ATK C;  3ML0 A;  3LDC A;  4FIP C;  3ZRW B;  2LP7 A;  3B8N A;  3OR7 C;  3EFF K;  4UXN A;  2ZXW C;  2Z3Y A;  1QCE A;  5B3S C;  3CD6 V;  1NJI W;  2IH1 C;  1S3J A;  2EBO A;  2XAH A;  4RUE A;  3G71 V;  3SPJ A;  1GMG A;  3B77 A;  3LDD A;  4KUM A;  4GCZ A;  3RVZ A;  3X2Q B;  4JTC B;  2WAM A;  3FYE B;  2W0F C;  4QE9 A;  1DLB A;  4L87 A;  1ZWI C;  3GB7 C;  1S72 V;  5B1O A;  1JOY A;  1XL4 A;  3W7T A;  3ASO B;  5KUK A;  3FB7 C;  2QE7 G;  5IY5 C;  2WLH A;  3FYI B;  1QBZ A;  2QEX V;  1SRY A;  3ABM C;  4U7O A;  5LGU A;  2EIJ B;  3SYQ A;  2DYS C;  3JD1 A;  1OCC C;  5CN0 A;  3WG7 B;  1SER A;  2EIK C;  1RM1 B;  2P90 A;  1NKD A;  1QLE B;  4PEL A;  1IXM A;  1HWY A;  1MOF A;  4TT3 G;  1YSC A;  3JD0 A;  1BMF G;  1EZJ A;  3K0G A;  4JAS A;  3E8B A;  2HVK C;  3K04 A;  2YEV A;  1AI4 A;  2X6B A;  4P2Z A;  3QO7 A;  4QNH B;  1Y4M A;  1OCO C;  4MVO A;  1OCO B;  2WLK A;  4MTG A;  4F4L A;  2EZP A;  4EKW A;  1K7D A;  2EZO A;  3R65 A;  3ZRW A;  1EFR G;  2JK5 C;  3SPG A;  4LBE C;  1KEC A;  4WFG A;  3CCM V;  4JAV A;  4YXW G;  4MVS A;  1AI7 A;  2PI5 A;  4JYC A;  1YJ9 V;  1J95 A;  4N23 A;  2YSU B;  3W7W A;  3ZIA G;  4WFF A;  1VQN V;  2DQ0 A;  1K97 A;  4WF9 V;  2WLI B;  4JGS A;  1K8A W;  1V55 B;  1JPX A;  4GX5 A;  1K4D C;  4WFB V;  1VQL V;  5DM6 V;  2IJI A;  2B1I A;  2ITD C;  4J9Z B;  4JPR A;  1UJW B;  3ABT A;  5EBW C;  2XAG A;  4UUJ C;  2W6J G;  3K79 A;  4XBF A;  3E8G A;  2PI4 A;  4MTO A;  1PNL A;  3OGC C;  2OCC C;  4UVC A;  4FMT A;  3UKM A;  1NBM G;  3OEE G;  3IFX A;  3ZJZ A;  3W7U A;  2IH3 C;  3W7X A;  3CCL V;  1QR9 A;  2HLD G;  2ZR3 A;  2LFS A;  1K4C C;  1H8H G;  5EBL C;  2DWE C;  1COW G;  1YJN V;  4PA7 A;  3T2M A;  1XL6 A;  2IJK A;  1V55 C;  3HPL C;  3K9A A;  1H8E G;  3ETG A;  1PNK A;  1AJP A;  3LDE A;  3K3W A;  1KP3 A;  3I56 V;  3ZRV A;  2QKS A;  2Q68 A;  1I5X A;  1M56 C;  2ZDI A;  3DTU B;  1AR1 B;  5DN6 G;  3ASO C;  2XAS A;  2WLI A;  1OCC B;  1OCZ C;  3PJS K;  1PL0 A;  2WLM A;  2EIN C;  1LNQ A;  3SPH A;  1NVP D;  2JIZ G;  4WFE A;  3FB8 C;  2XOK G;  2P6J A;  2V1D A;  1GM9 A;  5BZB A;  4Q20 A;  5H6R A;  3ZMV A;  3JD4 A;  1SZT A;  2XAF A;  1DF4 A;  5KA5 A;  3E89 A;  1Y66 A;  2AHZ A;  1KC8 W;  2IJH A;  1OCR B;  2R9R B;  4QE7 A;  5L3C A;  1NR1 A;  2WLJ A;  1VQP V;  2YEV B;  3BY6 A;  4KP4 A;  1QVG U;  1JVM A;  5IYB O;  2X6A A;  1FXK A;  3CCE V;  5LHH A;  2AHY A;  4CZZ A;  3RW0 A;  3ABL B;  4Z1M G;  4PA9 A;  4WFA V;  3NXS A;  1F4N A;  4JTD B;  1BL8 A;  1AJN A;  1V54 C;  3HB3 B;  5KUM A;  3BEH A;  3FKS G;  1G8M A;  3CCS V;  1K9M W;  5HFL A;  1K34 A;  1VQM V;  1M9N A;  3P32 A;  1H38 A;  3CMA V;  1E79 G;  4JTA B;  3ZMU A;  3D3I A;  2M7W A;  3TCU A;  4BAY A;  4LC1 A;  2DYR C;  2DYR B;  2QA4 V;  4PDV A;  3STZ C;  1S76 D;  3AG4 C;  2ZXW B;  3W7S A;  2X7R B;  1W2B U;  5B1A B;  3H01 A;  2UXN A;  5EK0 A;  1FXK C;  1P7B A;  1R3K C;  1RM1 C;  3UM7 A;  1K5Q A;  4HAM A;  1VQ9 V;  3ZCC A;  4R6Z A;  1GM8 A;  1YIT V;  1JQ0 A;  3T4Z A;  1S77 D;  2HJF C;  4LP8 A;  4HZ3 A;  1KP2 A;  4JF3 A;  1NH2 D;  5IY5 B;  3CCU V;  3CCJ V;  3FB6 C;  4R7C A;  1KD1 W;  1CP9 A;  2EIM B;  2K1E A;  1YHQ V;  4JAU A;  2HVJ C;  1GM7 A;  1JJ2 U;  4PDM A;  4BW5 A;  3G4S V;  4H37 A;  2A9H A;  2DWD C;  4P9O A;  5EC2 C;  2IU3 A;  3ZN1 A;  2OTJ V;  4KFM A;  4FK5 C;  3ABU A;  4QPK A;  3F5W C;  1K5S A;  2P67 A;  3ZRS A;  1VQ4 V;  5CBF A;  2CK3 G;  5KA6 A;  1YIJ V;  1R6K A;  3T4D A;  1GTO A;  3MD0 A;  2F43 G;  4MVQ A;  2XAQ A;  3DGE A;  5HFM A;  4E2L A;  3STL C;  5CBG A;  3ABK C;  3IC7 A;  3QO8 A;  3TET A;  1VQK V;  1R3L C;  5IYC O;  2EIL C;  1OCZ B;  3OMN B;  2EIL B;  1B6Q A;  1VQ5 V;  2B5U A;  1G4Y B;  1AI5 A;  2R9I A;  2Y48 A;  3G6E V;  2V7Q G;  2WLL A;  4MW8 A;  2NNU A;  2DYS B;  5B1N A;  3OAA G;  2JJ1 G;  5E1A C;  3K06 A;  1GO3 F;  5B1B B;  3F7V C;  1RPR A;  3D36 A;  5L3E A;  3K0D A;  4H33 A;  3MHS C;  4MVM A;  1YI2 V;  4G28 B;  1F4M A;  3JCZ A;  1K33 A;  2IU0 A;  1DTO A;  3TK1 A;  2H8P C;  4RO2 A;  1S5H C;  3QNE A;  2Y69 B;  3SYP A;  1OHH G;  1WLE A;  2A79 B;  2HFE C;  3X2Q C;  4G2K A;  5CBH A;  1KQS U;  1FXH A;  4ZBM A;  1Q7Y W;  3CP1 A;  1YJW V;  1K92 A;  4UVA A;  1M1K W;  3ZN0 A;  3OUS A;  1THZ A;  1MAB G;  1SES A;  1F23 A;  4J9Y B;  3SPC A;  1V54 B;  3SYO A;  5L3D A;  4PA4 A;  3CC7 V;  3JYC A;  2ZR2 A;  1GKF A;  2NLJ C;  5H9C A;  3LUT B;  3OFN G;  3CC4 V;  3OR6 C;  2C2A A;  4G27 B;  4CBC A;  4MVZ A;  1Q81 W;  1FXV A;  3OMI B;  1P4R A;  3OMA B;  4MW3 A;  3ASN C;  5L3B A;  3WG7 C;  3CCQ V;  3SYC A;  5B1A C;  3ABM B;  4MTF A;  4I5S A;  3LSS A;  4UV8 A;  4P9P A;  2UXX A;  2Q69 A;  4MT8 A;  4P30 A;  5J9P C;  2ZQM A;  3E2E A;  2HKO A;  3VOU A;  2KB1 A;  1BHB A;  4QIW F;  2X0L A;  1WPX A;  3B8M A;  2OCC B;  3ETE A;  3SYA A;  3E8F A;  3ZMT A;  4FPP A;  1E1Q G;  2BOC C;  3VBB A;  2JDI G;  3OM3 B;  4GX2 A;  1QLE C;  1AJQ A;  1CEZ A;  5H6Q A;  2WLL B;  1VQ8 V;  1M90 W;  4BIZ A;  3WFV A;  3KG2 A;  2EJR A;  3F7Y C;  1R3J C;  3EHB B;  2Z5U A;  4WCE V;  2OT5 A;  1PNM A;  5B3S B;  3OE7 G;  1E1R G;  1OZ0 A;  5IDJ A;  1MG1 A;  2ZD9 A;  3FB5 C;  4HYO A;  1H2G A;  5LGT A;  3ZMZ A;  4MTX A;  4WFH A;  2W6I G;  2H94 A;  4XDJ A;  5GW7 A;  4LCU C;  4MVR A;  3T1C A;  5EC1 C;  1PD3 A;  3OUF A;  2D3O W;  4JYB A;  1R73 A;  4TSF G;  4X8A A;  1MSW D;  1BHA A;  3A0R A;  3M99 B;  1ENV A;  2Q67 A;  4XDK A;  2QM7 A;  1GK9 A;  3ZMS A;  3LSQ A;  1NH2 B;  3RVY A;  3P30 A;  4QJF B;  3I55 V;  1RPO A;  4FJC C;  1R3I C;  1KKD A;  4RAI A;  2GSM B;  4DO2 A;  2WSS G;  2XND G;  3ASN B;  2WLN A;  2P7T C;  2QM8 A;  4DXW A;  1DF5 A;  4X89 A;  3SPI A;  4UV9 A;  3CPW U;  1YTF B;  1S0V A;  1ORQ C;  2ITC C;  3ABL C;  1VQ7 V;  4BIU A;  4I9W A;  5FL7 G;  3CCV V;  2JJ2 G;  5L3G A;  4RQF A;  1FS0 G;  2OTL V;  2EIJ C;  3K08 A;  3LNM B;  4GT1 A;  5LGN A;  3CC2 V;  2DW4 A;  4R50 A;  2DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...