4MTXA

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
AAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ethylene response sensor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mtxA00
3DGEA 4BIZA 2QM7A 3ZRWA 4QPJA 2QM8A 2WWWA 3ZRWB 2FTKA 2P67A 4MTXA 4MT8A 4U7OA 3D36A 1IXMA 3MD0A 4I5SA 3P32A 4FMTA 1F51A 4U7NA 4GCZA 5C93A 4QPKA 3ZCCA 2C2AA 4JAVA 4ZKIA 5B1NA 4Q20A 5B1OA 3ZRXA 4BIUA 3TK1A 4GT1A 2LFSA 4JAUA 4JYCA 4JYBA 3NXSA 4JASA 2LFRA 3ZRVA 5IDJA 1JOYA 4FPPA 4LC1A 3A0RA 4KP4A
chains in the Genus database with same CATH superfamily
1HNXB 4HZ3A 3QO8A 2OCCB 4WFEA 5IE9A 1W59A 1QBZA 4J41A 2QTOA 3H9VA 4IHJB 4JZ2A 3OM3B 3BRCA 3RYCB 1WPXA 3JASB 2BOBC 4WFGA 2QKCA 3E35A 4CH4A 1JPXA 3JALB 4O4JB 5KUMA 5FPOA 2OT5A 2IH3C 3RYHA 2F95B 3LSUA 5B1BB 5EYPA 4DR1B 4B3RO 4XBFA 2H94A 2WSSG 4LFCO 1N4CA 2R9IA 4LCUC 1GTOA 3CCEV 1QVFU 2JIZG 1YEWA 1Q3EA 2UXNA 1SC5B 5H6QA 2L6LA 1K4CC 1N36B 2YEVA 2Q69A 3WB2A 2Y4UA 4K8ZA 3APQA 1ZLZA 3E86A 3AG7A 4X62O 3AG3C 4JF3A 3K57A 3C3TA 4PI2A 2QEXV 3T1YB 1N34O 1WN7A 2JGDB 3CJHA 1IBMB 2CTQA 1LR1A 4B3TB 2R70A 1P7BA 1O9HA 2HR3A 3IC7A 4OXSA 5C93A 4OX9O 1SS3A 1HNWO 2ITDC 5BZBA 3BVOA 5IJ9A 2NNUA 3M7MX 4I55A 4A5UB 3JSNA 1EM1A 4UCTA 2DN9A 4X9QA 5L3DA 4DV7O 4ZI7B 3TXQA 4LFBB 3L72H 4HNAA 4TWKA 4LNUB 1SZXA 4DR4O 1S5LZ 3A0HZ 3N2KA 4JTCB 1R3KC 1IURA 2BCCH 2HEPA 4X66B 4AQYB 2ZIMA 4IIJA 3PN1A 3RT3C 4U3JB 3OTOO 2CTPA 2OCHA 1GM7A 5LA6A 1VQ4V 3BABA 3ASNB 1AB3A 3JSLA 2K1EA 2EILB 4JPRA 1ZL8A 1N32B 5EZYA 2RQ6A 3ZHSA 4B3SB 4DV2B 1YZBA 1H8EG 2O57A 1Q43A 3WG7B 2PUSA 3SDLA 4JZGA 3L70H 1GH6A 1ROPA 5LOVB 4JI2O 1DGSA 3VQXA 4J11A 4DUYO 4I4TB 1PNKA 3RYFA 2ILMA 3STLC 4ZHQA 3J7AU 5IYZB 2ZR3A 4DR2B 4JI5O 1WJZA 5H6RA 1JOYA 4LH6A 1DLBA 3W7WA 4D7SA 4MSWC 3K58A 1MA1A 5CB4B 1WNSA 5IT9N 3RBZA 3JAKB 4DV6B 2D3OW 2ZXWB 4JI7O 4DR3B 1DK1A 2XOKG 2B9ZA 1F4NA 4CZZA 1SA0B 2Q68A 2CGOA 4WFHA 2Q0OC 2QKAA 5KA5A 1H2GA 4GKJB 1FXKB 3K04A 1G6UA 2QM7A 1JJ2U 4KUMA 3ML0A 5L3CA 2Q9LA 1LUWA 4H13B 1TGOA 2IH1C 4KXRA 2QJ1A 3B09A 4DV1B 2LFSA 3I56V 2ZNJA 2P5OA 3T1HB 1HNZB 2WWWA 2GUZB 3E22B 4R8CA 4TT3G 3H1JH 1B04A 2UXCO 4FIPC 4DV0B 4MVRA 4MTXA 3L9DA 2ODMA 4H44B 2G38A 4WBNB 1M56C 1XMOO 2ZCEA 1H2NA 4GUNA 3RGBA 1K5QA 4JYCA 1COWG 3A0BZ 5L3BA 5BMVA 4NTYA 4LF7O 1RSOB 3VQVA 5LBQA 4MVQA 4BR6A 2UXDB 2CUGA 3AG2B 1KB9F 3FX7A 2EIJC 3IAYA 1NH2D 2WAMA 3CC2V 5EIBD 1Q5OA 2B1IA 3NR7A 5LYJB 2EZPA 4TV9A 2DOSA 2MK3A 2Q73A 2A9HA 4MVOA 4TQFA 3UT5B 1EN5A 1A32A 2QWRB 1YTFB 2VRZA 1M90W 1KYOF 5GONA 4QJFB 2Q7GA 2YUAA 1F23A 4RWUA 2CH7B 4EB6A 4UV8A 3HKCB 4ZKIA 5BR8B 2OTLV 3CD6V 4PDLA 5D5QA 4AHCA 5JJEB 4FM1A 3J81N 1XREA 1E79G 1AJQA 3LDCA 1B06A 1NKDA 2CK3G 2WA4A 4EEQA 4PDMA 3HPLC 1JMKC 4I50A 1Y67A 3AK2A 2WA3A 2NR5A 3UCSC 1R6NA 3BPZA 1BGYH 5BXZA 4KHPO 4NR1A 3ABKB 3N2GA 3ZRSA 2LFRA 1WB8A 2A0LA 2CDYA 3DC6A 4TUYB 1GM8A 1PPJH 4B7EA 3M99B 5LMNO 3CCRV 1FPOA 2YIDA 2N04A 3EVKA 1VQ6V 4AQYO 3K5NA 4RUEA 1OCZB 5JVDA 5KUKA 4GX1A 5E79Z 2DYSB 3K06A 3AK3A 2QR4A 2W0FC 1M5IA 1RM1C 4G2KA 2HG5C 3ABMB 1WB7A 5CA3A 4WFBV 2OYQA 1Q6UA 3ZHUA 1ZAUA 1RPRA 1K33A 3AG1C 4NYKA 1OCOC 3G80A 1N32O 2QWQB 3A8TA 2HJFC 1VQ9V 4DV2O 2FYUH 4FLYA 2DE0X 1LNQA 4I9QA 4LWSA 3CMAV 5LHGA 5FPRA 2XAHA 4JYBA 4P9PA 1R73A 4QIWF 1ZUQA 5FNVA 1WPBA 5IWAO 2MW2B 1NZ6A 2P90A 2XTAA 2UUCB 1TVKB 3CRMA 4CC5A 2LP7A 1KECA 3AK1A 5H9CA 2IBZH 2ITCC 4X1IA 3U11A 5KHHA 2EBOA 2KG7A 1GK9A 1Y6XA 5IJ0A 2YIBD 3AG4C 1QLNA 4LH7A 2L35A 2P4KA 4LFAB 2JEUA 2IJHA 4YY3B 3P3PA 2UUBB 4K35A 1WP7A 4DR3O 1F51A 1XMQB 5LGUA 4FLUA 1GO3F 1SQGA 2ZT9B 1GAXA 1OCCB 2F66C 5GW7A 4X65B 2Y4TA 5FLXN 1XUQA 1IZ3A 1PP9H 1PD3A 4RQFA 1BHBA 3JYCA 5B1BC 1QNMA 3QNEA 3BFRA 1VQ7V 3EHBB 1YIJV 1KKDA 2ADPA 2F43G 4FMTA 1I7FA 1RFYA 4TQDA 2OTJV 4N21A 5J2TB 1VQKV 5B1NA 4RAIA 4DK0A 2JS5A 3U0ZA 1TUBA 3T1HO 2VQFB 1F4MA 2ZM6B 1S77D 2B1GA 4EFEA 3LSQA 1W0KG 2DW4A 2DWDC 1AROP 1JX9A 2DYRB 3K5LA 1R3LC 2IM9A 1M57B 5JQGB 1NT2B 3CB2A 3QF7A 3CMEV 1DF4A 2HJDA 3ZJZA 4BW9A 1S3JA 4O4LB 1Q6HA 3EFFK 1EN6A 2A79B 3C90A 1OJHA 2VQEB 4LF4O 2LO1A 4DR7B 3CCMV 1JVMA 1L0LH 5CMUA 2WLLB 1AI7A 1K4DC 1HR0B 3RVYA 4X1KA 1H2LA 3CX5F 3D3IA 3VBBA 4JAAA 4F6EA 3L75H 4JI8O 4JTAB 3HR0A 1KBHA 2X6AA 3IJ4A 1Y76B 1K5SA 3ASNC 1Q86W 3D3QA 3WU2Z 4N23A 3QVNA 3DSQA 4GX0A 4X88A 1YTFD 2V7QG 2YI8A 3BAAA 2F93B 1IDSA 4I0XB 3WG7C 1N0JA 5ITZA 1N8RW 1MZFA 1BT8A 5C8YB 2QM8A 2QKSA 3VQWA 2UXBO 1BZKA 5LXTB 3E8GA 2A7WA 3QTCA 4FM2A 4XDLA 1XNQB 1V54B 2C2AA 2Q5ZA 3G4SV 2BSKB 3OR7C 5B3SB 2V4DA 4UCOA 5B66Z 3RYIA 4G28B 3GWKC 2RDCA 1OCRC 4PI0A 5IY5C 5JH7A 3LNMB 1NH2B 4GX5A 4W4KA 1ENVA 1JFFA 2P4VA 2AHZA 4UUJC 4JI0B 2ZXWC 1VF5B 2PI4A 2BTQB 4ZIBA 2Q6AA 3HB3B 1GN2A 1AR5A 3JAWB 2KSDA 2LJ2A 4K8XA 4BIOA 3CEIA 4QGPA 4B3MO 1R6KA 3JATB 2JEXA 2JGUA 3VOUA 5TISZ 1AVMA 1DTOA 4O4IA 4TV8B 4DV4O 4FM0A 1SKVA 4PDVA 3HKDA 1N33B 3FFQA 3DXRB 3KCYA 1IBKB 2EIMB 2AW9A 1K8AW 2WLHA 1QR8A 4RQEA 2B5UA 4LBEC 4UFZA 1DF5A 2Z5UA 4J7ZA 3K59A 1K34A 1SETA 5CBFA 1Y74A 2X6CA 3KKYA 3ICXA 3FYIB 4L8JA 4MW8A 1THZA 2LGWA 3BEHA 3S3XA 3LSSA 3BA9A 3H1KH 4UCUA 1IXBA 4PA9A 2BOCC 4JI6B 1XOUA 1XNRO 4BIUA 4K0KO 3ABLB 1WA8A 2QDOA 2IJIA 2NLJC 3CXCU 3SJCC 4FFBA 3JD0A 2XAFA 4IL6Z 1K73W 5KX5A 4ABMA 1YVWA 1PV0A 2QWPB 2Q7EA 4DRXB 1NVPB 5CA1A 3AG2C 2QWOB 4ZOLB 4YIOA 3UKMA 3I55V 1YSCA 5D5PA 5L3FA 1FYJA 4YJ2B 4JI4O 4DO2A 4JV5O 5J2UB 3CC7V 3FB5C 1L8DA 4NTWA 1VQMV 4J10A 2DJVA 4XDJA 4C7UA 1XEQA 1S5HC 2HHHO 2PYJA 2BTOA 4O4HB 4Q6GA 1SF9A 4GZRB 4TV9B 3HKBA 4GLXA 1GKFA 4D6TH 4LC1A 3FD9A 2EINB 4X1YB 4JYAO 4F6RB 1D5NA 2GHYA 5LP6B 2D2CB 2F4VB 4JI1O 3ZHTA 5KHJA 1L1FA 2WLIA 4DUZO 3SYAA 4AI8A 1Z5WA 4DV3O 2IW5A 1H38A 1NS1A 4O2BA 2HKOA 1W0JG 1FKAO 1RPOA 1BCCH 1YHQV 2XAJA 3CRRA 4MVUA 2VQEO 4NXNB 3K9SA 3ZIAG 4CH6A 1MSDA 4IHJA 3RYCA 3T4ZA 4X8AA 5LMUO 4NXMO 3JASA 1HW7A 2RCVA 3E8BA 1EFRG 3OAAG 3JALA 4O4JA 3H1HH 1OCZC 2IU3A 1VQPV 1Q81W 4YJ3B 5DM6V 1T5EA 3CE2A 1EBOA 4DW1A 1PNMA 4YHHO 4P2ZA 1AI6A 3SYQA 3MHSC 2UU9O 1P4RA 3X2QB 3K0GA 3T2MA 1Q90D 4UB8Z 2ZINA 1FAFA 2EJRA 3FB6C 4L87A 3R66A 2EJ7A 5EBLC 3SJAC 1BHAA 3KG2A 2ZE8A 4UXNA 4BW5A 5HFLA 3JCZA 2JGDA 2HVJC 2XAQA 1ZWIC 4EFBA 5KMGB 1Q82W 2PY5A 4P9OA 1ZX3A 3RW0A 4UCSA 1G1XB 4UVBA 3AG3B 4Z1MG 4PV1B 1XNQO 1FJGB 2Z0AA 4ZI7A 3TGUH 4DR6B 4LNUA 4YIPA 1HNXO 2HP8A 3SJQC 4NKGB 4U7OA 1AR4A 1YITV 2YXLA 4LR3A 2ATKC 2RNBA 4U3JA 3WB1A 4DV5B 1AI4A 4HYOA 1JR9A 2CGNA 4UB6Z 4DR5B 1OCCC 3TCUA 4DR1O 4WFAV 4JTDB 3M8AA 3RN4A 3SGIA 3ZN0A 5CBGA 1I0HA 5A9GA 3F7YC 5DEDA 2E75B 2Y69C 4MVZA 2XNDG 5LGNA 1N36O 1N33O 5LOVA 1YXBA 4JASA 3ZRVA 4X20B 1X4TA 5IYDO 3D8CA 3L71H 3RWRD 1G8MA 3T1YO 2IJJA 4X64B 1IBMO 1M93A 4I4TA 1J5EB 4B3TO 1SQQH 4J7KA 1NR7A 2DWEC 4MTOA 5IYZA 2E5LB 3CS5A 2QM4A 2DYRC 1Q6IA 2RJZA 2KQXA 3CYOA 4Q20A 2XT9A 2XAGA 1NTZH 1MZEA 1M57C 1NTMH 1S76D 4LFBO 2YDEA 5CB4A 3CRCA 3ZRWB 3H1LH 2ZR2A 4JI3B 3JAKA 4J42A 3B4SA 3T4DA 2CTRA 2XASA 3LUTB 3AEIA 4PA7A 4X66O 3FB7C 4YXWG 5DN6G 4G27B 3QO7A 3W7XA 1SA0A 2X7RB 2EIKC 1NVPD 1FXKA 1BE3H 1QLEB 2WLJA 4BIZA 5CA0B 5KA6A 4LF8B 2YXYA 2DQ0A 2CAZC 4LF9B 3KCXA 4WF9V 3HKEB 4FLZA 2V1DA 1CPYA 3SR2C 1FS0G 4B3SO 1XDCA 1QR9A 4PELA 1K7DA 4KFMA 3ABTA 3CCLV 1KUQA 1IBLB 1HWYA 2GUZA 3E22A 4H33A 3H1IH 4B3RB 2ETNA 3Q4HB 4LFCB 1V55B 4X89A 1VIBA 1FFXB 2F4VO 4ASUG 1SRYA 4JGSA 3ASOC 3E83A 4WBNA 3E8HA 3EXAA 4MW3A 3GWOA 3FAVB 1VARA 3B8MA 3OEHG 4X62B 4DR2O 2E3CA 2A06H 4QNHB 2JJ2G 4GKKB 1RSOA 1N34B 5B3SC 2A3QA 3ZMSA 3SPHA 1EZVH 1M56B 3STZC 2OCCC 3JARB 2GBOA 3P3NA 4DV6O 4OX9B 1HNWB 4U7NA 4O2AB 3K9AA 2Q0AA 5L3EA 4QPKA 4ICGA 5EIBC 5KLVH 1XILA 5LYJA 4DV7B 1NQTA 2ARHA 1P84F 1L0NH 4NTXA 3UT5A 5IDJA 3ZMVA 4DR4B 3ZMUA 3K5OA 4GKJO 3K3WA 2K9PA 1D2DA 1U97A 2EX3A 2IJKA 4J80A 2YC0A 1QCEA 2W6IG 3HKCA 3OTOB 2QA4V 3OT7A 3J80N 4IT5A 1GMGA 3CCQV 3B77A 1I94B 2LQTA 4DV1O 3RYHB 2EIMC 5EYPB 4U3FH 1HNZO 4J7JA 4W4LA 1VQ8V 2LW1A 1MOFA 4BAYA 4I9WA 4DV0O 4CC6A 3QO5A 4K3AA 1YJWV 2VS0A 2ADQB 4GX2A 3CC4V 1PL0A 2YXHA 1YDXA 5H2FZ 2ZNIA 3HKDB 2YEVB 4MTFA 2X0LA 1SQXH 4JI2B 3BCCH 3K5MA 4ZBMA 4NVPA 4TUYA 4OPAA 3SPJA 4DUYB 1YJ9V 3CJHB 1S5JA 2GV9A 2UXDO 3UO3A 1PKXA 4R7CA 2YICA 2W6JG 5DECA 4MVMA 1M9NA 4JI5B 3OR6C 3JD3A 5IJ9B 4DV5O 4I55B 4FZ1A 4HNAB 3UO2A 4LF5B 5EC1C 3F7VC 3N27A 4JI7B 1MNGA 4QE9A 3N2KB 1FXVA 2N05A 2EILC 5KHIA 1SQFA 4UVCA 1E1RG 3SPIA 4IIJB 1W2BU 1RM1B 3ZRXA 3OUSA 1MABG 5BR8O 4UVAA 5LA6B 2OIEA 2UXXA 1UJWB 2R9AA 2ZE7A 3VQYA 4UV9A 1SQVH 1SQBH 1ZL8B 2EINC 4X64O 4EKWA 1TVKA 5EZYB 1JJOA 5LP6C 3OW2U 1Y66A 1CEZA 3G6BA 3GB7C 3G71V 1B6QA 4GCZA 3JD4A 3E8FA 2P22C 3DC5A 4IYIA 2M7WA 3JCUZ 3TXSA 3HKBB 2UXCB 4BWAA 1YF2A 3CRAA 1ZTEA 4FVMA 1YI2V 4PHZA 5KHKA 2HFEC 3I5DA 2PF4E 3THOA 1EZJA 2QE7G 3K0DA 3RYFB 4ZHQB 3AG4B 3K79A 3G67A 3K08A 3NXSA 1BL8A 2GTSA 3T1CA 4H0LB 4LF8O 1JA8A 1KQSU 3ETEA 1FXKC 2RN9A 1MSWD 2OIGA 3CCVV 4LF9O 1XHXA 3OFNG 3P30A 1AJNA 1WAZA 3X2QC 5J2TA 3U10A 3UQ8A 3CCJV 5B1OA 2YSUB 4FK5C 1IBLO 4FPPA 3DGEA 3SYCA 2FTKA 1U96A 3LDDA 2Z3YA 2GTAA 2Q67A 5J9PC 4F4LA 4CH5A 1M4UA 5L3GA 2VWJA 2UUCO 2XHBA 5JQGA 3L73H 4Z2WA 4I7ZB 4CS4A 1I08A 4PDRA 4O4LA 3TJTA 1AP5A 1O9GA 2PTMA 4GKKO 4D7TA 3SYPA 4WFFA 1AI5A 2WLLA 4LFAO 4YY3O 1IXMA 3RVZA 2UUBO 5F2VO 4FLXA 2GSMB 1XMQO 2HVKC 3B2EE 4DK1A 2QGNA 4KHPB 1M1KW 2ZQMA 4B08A 2YS8A 1NR1A 4X65O 5BMVB 1Y76A 2WPDG 3GVMA 3L74H 2XUMA 5LMNB 4E2LA 1VF6C 4J9YB 3ETGA 2H8PC 5EBMC 4JAVA 5HFMA 3LDEA 1BMFG 4I0XA 2JVDA 1I94O 1NTKH 3OMNB 1R3IC 5C8YA 2VQFO 1K97A 2ZM6O 4P30A 4DYLA 5GTHZ 5GONB 3MD0A 2PGGA 5LXTA 4H37A 1QHTA 1TAEA 3OMIB 3ETQA 4UCVA 1AJPA 4WCEV 2LGQA 4EB6B 1GN6A 2BSKA 3A2FA 5K1PA 3O9OA 2P7TC 2W0XA 1Q7YW 2P06A 5IWAB 2BE3A 2DQ3A 3ABKC 4Z1VA 1K9MW 4DR7O 4RUFA 4MS2A 1JQ0A 2Y0IA 2HLDG 1HR0O 2BTQA 2QWNB 3ZHQA 4I50B 2Y0PA 5B1AB 4HBNA 3JAWA 3TK1A 3BY6A 1OCRB 2DYSC 3N2GB 1XL6A 5IY5B 3B8NA 1NI8A 1H2SB 3PJSK 2QTSA 4MVSA 3JATA 4LF5O 1KP2A 3W7UA 1Q8IA 1QLEC 3E2EA 4TV8A 3ABMC 2UUAB 1PL4A 1URFA 3DXRA 5JVDB 4LP8A 1Z5VA 4XDKA 4B7KA 2LW7A 3ZBHA 4GYCB 2RMKB 3OGCC 4CS3A 4TOIA 4LF6B 3H01A 1P7GA 2YI9A 1V55C 2FL4A 3OMAB 4FFKA 3ZCCA 4R6ZA 2AXTZ 1IVSA 1BQ0A 1NBMG 4LWSB 1HP8A 3ZS8C 3JAMN 1R3JC 3MDSA 1I5XA 5FNVB 3IC9A 3KZIZ 1FFTB 5EK0A 5JCOC 3B40A 1PM9A 3CCUV 3CP1A 1AP6A 4DRXA 5B5EZ 2N74A 4ZOLA 1I5YA 3ZN1A 2ZDIC 3D36C 4JI0O 4YJ2A 1OV9A 1CXZB 1EN4A 5J2UA 4X1IB 1GM9A 2KG7B 4PA4A 5IJ0B 4LF4B 5IYCO 2KB1A 2EULA 4FLVA 1GN4A 1TA8A 3ABUA 4MT8A 3OTFA 4CS2A 2ZD9A 2AHYA 4O4HA 1B3QA 1VP7A 1RP3B 2JRIA 4PA3A 1NU1H 1WP8A 3F5TA 2JK5C 4JI8B 3ZEDA 1IBKO 2YIAA 5BY1A 5AG2A 1VMGA 4X1YA 4F6RA 5LP6A 1XI1A 2OWOA 1BSMA 1X59A 2ZKOA 1FD9A 1XQ8A 2F1MA 2AZ2A 3OGIB 2YIBA 3SYOA 5JJNB 4DXWA 4JI6O 3QG5A 4TSFG 1AR1B 3CSXA 4IYHA 2AZ0A 2Q7HA 1TUBB 1KD1W 1GRJA 1SERA 2UXBB 4J9ZB 1R1BA 4FZ0A 1KU9A 5KAFZ 1VQOV 3CPWU 3W7SA 2ZE6A 1Y4MA 1XL4A 2R72A 3CXHF 1SQPH 4FJCC 4PA6A 3O65A 3CRQA 2EZOA 4FLWA 3MHHC 1AILA 4YJ3A 4JAUA 4OPHA 3CCSV 2F23A 3ZHRA 4KP4A 1V9PA 1QU7A 1OZ0A 1VEWA 2CE4A 1K3EA 2Q8VA 3FB8C 4X1KB 1ZSPA 1YJNV 3ZMTA 1J95A 4RO2A 3DTUB 1TUEB 1QVGU 4B3MB 3OE7G 5LHHA 1VQ5V 3LNNA 1US6A 1R6TA 5KMGA 4DV4B 3BA8A 5KHGA 3ZX6A 1HDJA 1VQLV 3S3WA 4CH3A 3WB0A 3APOA 1V54C 5KAIZ 3RFRA 5ITZB 2ZIOA 2WLMA 4NXNO 5CBHA 4HAMA 1P49A 3ZHVA 4MTGA 1N0NA 3ZMZA 1S0VA 1WLEA 1XNRB 1H8HG 3E89A 4K0KB 3R65A 3CWBH 1XBLA 3WFVA 4AILC 3G6EV 2IU0A 2WLNA 3ETDA 3RYIB 2Y48A 5CN0A 1VF6A 2EIJB 3JD2A 5IYBO 2FB5A 5JH7B 2M6YA 3SJBC 1GN3A 1UPGA 1Z2GA 2R9RB 2UUAO 2CH7A 1JFFB 4JI4B 5FL7G 4JV5B 2PZSA 1IX9A 2WLKA 4QE7A 4GT1A 4X20A 2AGAA 4R50A 4LF6O 2HHHB 1SESA 2Y69B 2X6BA 1ORQC 2JJ1G 4O4IB 2E76B 2E74B 3BHPA 3OUFA 1LUVA 1KMIZ 2H3OA 1FJGO 5K1XA 4JYAB 1G4YB 1VQNV 3ABLC 3ZRWA 4JI1B 4DR6O 1H2KA 2JDIG 1Y74B 4DUZB 1D5AA 4JYYA 4I5SA 3P32A 5A2QN 4DW0A 3IFXA 4DV3B 2PYLA 3FYEB 4CBCA 3K03A 2ZE5A 5E1AC 2FKXA 1YCIA 5JWPA 1VF7A 1WA8B 5CA0A 4FFBB 3SPGA 2DMXA 4QPJA 2CTWA 4DR5O 5KX5B 2NN4A 3IGAC 5LMUB 4NXMB 3SPCA 3HKEA 1F7YA 1FXHA 1XHZA 1BQZA 2EIKB 4FLTA 4E4EA 5CA1B 1MG1A 3JD1A 1BS3A 1KP3A 4UCRA 1E1QG 1OHHG 4OGQB 3OD4A 5EBWC 3MAQA 1QQCA 3A0RA 3Q4HA 5LGTA 4YHHB 3W7TA 1PNLA 5JJJB 3AG1B 2UU9B 1OCOB 3OEEG 1FFXA 3FKSG 2GDSA 5LHIA 1JCHA 2P6JA 3FAVA 4PJ0Z 1J5EO 4KL1A 4NB5A 2E5LO 3C3SA 1KKCA 1CP9A 1NJIW 1H2MA 5JCOA 1KC8W 3TETA 4PD4F 5GTIZ 3F5WC 1K92A 2QSAA 3ASOB 3CHXA 2FMLA 5H5NA 1SZTA 2P67A 2ZDIA 2JS3A 2PI5A 3D36A 4JI3O 3JARA 4O2AA 2WLIB 5EC2C 5LL6Y 1S72V 2KKWA 1XMOB 2VWKA 1MMMA 4IGGA 4O2BB 3UM7A 5B1AC 1UFIA 4LF7B 2Q4PA
chains in the Genus database with same CATH topology
5IYDO 4HZ3A 3QO8A 2OCCB 1PD3A 2DQ3A 4WFEA 4RQFA 1BHBA 3JYCA 3ABKC 1QBZA 1K9MW 5B1BC 1G8MA 3QNEA 2IJJA 4RUFA 1VQ7V 3EHBB 1YIJV 1KKDA 2QTOA 4MS2A 1JQ0A 2F43G 3OM3B 4FMTA 1WPXA 2HLDG 1NR7A 2DWEC 2BOBC 4MTOA 2OTJV 4N21A 4WFGA 1VQKV 2DYRC 3CYOA 5B1NA 3E35A 4Q20A 5B1AB 2XAGA 1JPXA 4RAIA 5KUMA 3TK1A 3BY6A 1M57C 2OT5A 2IH3C 1OCRB 2DYSC 1XL6A 5IY5B 3B8NA 3PJSK 5B1BB 1S76D 1F4MA 4MVSA 1S77D 3ZRWB 2B1GA 4XBFA 2H94A 2ZR2A 3LSQA 2WSSG 1W0KG 1KP2A 2DW4A 2DWDC 3W7UA 1QLEC 1AROP 3E2EA 3T4DA 2R9IA 4LCUC 1JX9A 1GTOA 3ABMC 3CCEV 2DYRB 2JIZG 2UXNA 2XASA 1QVFU 3LUTB 3AEIA 4PA7A 5H6QA 1R3LC 1K4CC 1M57B 2YEVA 3FB7C 4YXWG 2Q69A 5DN6G 4LP8A 3CMEV 1DF4A 4G27B 3QO7A 3ZJZA 3W7XA 2X7RB 1S3JA 2EIKC 4XDKA 1NVPD 3E86A 3OGCC 3EFFK 3AG3C 4JF3A 1FXKA 2A79B 1QLEB 2WLJA 4BIZA 3H01A 5KA6A 2QEXV 3CCMV 1JVMA 5CMUA 2DQ0A 2WLLB 1AI7A 1P7BA 1K4DC 4WF9V 1V55C 2HR3A 3IC7A 4OXSA 3RVYA 2V1DA 3OMAB 1CPYA 5C93A 3ZCCA 1FS0G 2ITDC 4R6ZA 5BZBA 1QR9A 4PELA 1K7DA 4KFMA 3ABTA 2NNUA 3D3IA 3CCLV 1NBMG 3VBBA 5L3DA 4JTAB 1HWYA 1R3JC 4H33A 1I5XA 4TWKA 2X6AA 1K5SA 3ASNC 1V55B 1FFTB 1Q86W 4JTCB 4X89A 5EK0A 1R3KC 4N23A 3CCUV 3CP1A 4ASUG 4GX0A 1SRYA 4JGSA 4X88A 3ASOC 3E83A 1YTFD 3E8HA 4MW3A 3GWOA 1I5YA 3ZN1A 2ZDIC 2V7QG 3B8MA 3OEHG 1GM7A 1VQ4V 1GM9A 4QNHB 3ASNB 2JJ2G 4PA4A 3WG7C 1N8RW 2K1EA 5IYCO 2KB1A 5B3SC 2EILB 2QM8A 2QKSA 4JPRA 3ABUA 4MT8A 3ZMSA 3SPHA 1M56B 3STZC 2OCCC 2ZD9A 2AHYA 4U7NA 3E8GA 3K9AA 5L3EA 4QPKA 4PA3A 4XDLA 1V54B 2C2AA 1H8EG 2JK5C 3WG7B 3G4SV 1NQTA 3OR7C 5B3SB 1ROPA 5IDJA 3ZMVA 4G28B 3ZMUA 3K3WA 1OCRC 5IY5C 3LNMB 1NH2B 2IJKA 4GX5A 1ENVA 1PNKA 1QCEA 2W6IG 4UUJC 2AHZA 2QA4V 3STLC 2ZXWC 2PI4A 3SYOA 2ZR3A 2Q6AA 4DXWA 3HB3B 1GMGA 3CCQV 3B77A 4TSFG 5H6RA 1AR1B 1JOYA 1DLBA 2EIMC 3W7WA 4MSWC 1VQ8V 1KD1W 1SERA 1R6KA 4J9ZB 2JEXA 1MOFA 4BAYA 4I9WA 3RBZA 2D3OW 3VOUA 2ZXWB 1VQOV 3CPWU 3QO5A 3W7SA 1Y4MA 1DTOA 1XL4A 1YJWV 4GX2A 3CC4V 1PL0A 2XOKG 4PDVA 1F4NA 4FJCC 2YEVB 4PA6A 4CZZA 4MTFA 2X0LA 2EZOA 2EIMB 3MHHC 2Q68A 4ZBMA 1K8AW 4JAUA 2WLHA 4WFHA 5KA5A 1H2GA 1QR8A 4RQEA 3CCSV 2B5UA 4KP4A 1FXKB 3K04A 4LBEC 1DF5A 2Z5UA 2QM7A 1JJ2U 1K34A 1SETA 3SPJA 5CBFA 4KUMA 1YJ9V 2X6CA 3ML0A 3FYIB 5L3CA 1OZ0A 1PKXA 4R7CA 4MW8A 1THZA 3BEHA 2W6JG 4MVMA 3LSSA 1M9NA 2IH1C 1K3EA 3FB8C 3OR6C 4PA9A 1YJNV 2BOCC 3JD3A 3ZMTA 3ABLB 4BIUA 1J95A 2LFSA 4RO2A 2IJIA 3I56V 2NLJC 3CXCU 3JD0A 2WWWA 1TUEB 3DTUB 1QVGU 2XAFA 4R8CA 4TT3G 1K73W 3OE7G 5LHHA 5EC1C 3F7VC 1VQ5V 4FIPC 4MVRA 4MTXA 4QE9A 1FXVA 2EILC 1NVPB 4UVCA 1E1RG 3AG2C 3SPIA 3UKMA 3I55V 1YSCA 1W2BU 1VQLV 5L3FA 1M56C 1RM1B 3ZRXA 3OUSA 1MABG 4DO2A 4UVAA 3CC7V 1K5QA 3FB5C 4JYCA 1COWG 2UXXA 1V54C 1VQMV 5L3BA 1UJWB 5LBQA 4MVQA 4UV9A 4XDJA 2WLMA 1S5HC 3AG2B 2EINC 4HAMA 5CBHA 4EKWA 2EIJC 4MTGA 3OW2U 1Y66A 3ZMZA 3GB7C 1CEZA 3G71V 1S0VA 1B6QA 1WLEA 4GCZA 3JD4A 2WAMA 3E8FA 1NH2D 3CC2V 1H8HG 3E89A 3R65A 2B1IA 3WFVA 2M7WA 2EZPA 2MK3A 3G6EV 2IU0A 2WLNA 1GKFA 2A9HA 4LC1A 3ETDA 4MVOA 2Y48A 5CN0A 2EINB 1YTFB 1M90W 2GHYA 2EIJB 3JD2A 5IYBO 1YI2V 4QJFB 1L1FA 2HFEC 2WLIA 1F23A 1EZJA 2R9RB 2QE7G 3SYAA 3K0DA 4UV8A 5FL7G 3AG4B 4ZKIA 3K79A 2OTLV 2IW5A 3CD6V 4PDLA 1H38A 2WLKA 4QE7A 2HKOA 4GT1A 3K08A 1W0JG 3NXSA 1BL8A 1E79G 1AJQA 3LDCA 3T1CA 1NKDA 1RPOA 4R50A 1YHQV 2XAJA 2CK3G 4MVUA 3ZIAG 1KQSU 1SESA 2Y69B 3ETEA 1FXKC 4PDMA 1MSWD 2X6BA 3CCVV 1ORQC 2JJ1G 4X8AA 3T4ZA 3OFNG 3P30A 1AJNA 3HPLC 3E8BA 3X2QC 1EFRG 3OAAG 3CCJV 3OUFA 5B1OA 1R6NA 2YSUB 1OCZC 2IU3A 3ABKB 3ZRSA 1VQPV 1Q81W 2LFRA 4FK5C 4FPPA 2A0LA 1G4YB 1VQNV 5DM6V 3DGEA 1EBOA 3ABLC 3SYCA 3ZRWA 1PNMA 1GM8A 2FTKA 4P2ZA 1AI6A 3SYQA 3MHSC 2JDIG 1P4RA 3X2QB 3LDDA 3M99B 3CCRV 2Z3YA 3K0GA 2Q67A 4I5SA 3P32A 3T2MA 4F4LA 5J9PC 5L3GA 1VQ6V 4RUEA 3IFXA 1OCZB 5KUKA 3FYEB 2EJRA 3FB6C 4GX1A 2DYSB 4L87A 3K03A 4CBCA 3K06A 5EBLC 4PDRA 5E1AC 1BHAA 3KG2A 2W0FC 4UXNA 4BW5A 1RM1C 4G2KA 3SPGA 5HFLA 2HG5C 3JCZA 3ABMB 4QPJA 5CA3A 2HVJC 4WFFA 3SYPA 1AI5A 2WLLA 2XAQA 4WFBV 3IGAC 1ZWIC 1RPRA 1K33A 3SPCA 1FXHA 1IXMA 3AG1C 3RVZA 1OCOC 1Q82W 4P9OA 3RW0A 2HJFC 2EIKB 1MG1A 4UVBA 1VQ9V 3JD1A 2GSMB 3AG3B 4Z1MG 2HVKC 1KP3A 1LNQA 1M1KW 1E1QG 3CMAV 1OHHG 2ZQMA 5LHGA 5EBWC 2XAHA 4JYBA 4P9PA 1NR1A 1R73A 3A0RA 4QIWF 5LGTA 2WPDG 3W7TA 1PNLA 3AG1B 1OCOB 3SJQC 3OEEG 2P90A 4E2LA 3FKSG 4U7OA 4J9YB 5LHIA 1JCHA 2P6JA 3ETGA 2H8PC 1YITV 2ATKC 5EBMC 2LP7A 1KECA 5H9CA 4JAVA 2ITCC 5HFMA 1AI4A 3LDEA 1BMFG 2EBOA 1CP9A 1GK9A 4HYOA 1NJIW 3AG4C 1QLNA 1KC8W 3OMNB 1R3IC 3TETA 1OCCC 3TCUA 3F5WC 2JEUA 1K92A 3ASOB 4WFAV 2IJHA 1K97A 1SZTA 2P67A 2ZDIA 4P30A 4JTDB 2PI5A 3D36A 3ZN0A 3MD0A 4H37A 5CBGA 1F51A 3OMIB 2WLIB 5EC2C 1S72V 3F7YC 5LGUA 1AJPA 1GO3F 2Y69C 4MVZA 4WCEV 2XNDG 5LGNA 1OCCB 2P7TC 5GW7A 3UM7A 4JASA 3ZRVA 5B1AC 1Q7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGE A;  4BIZ A;  2QM7 A;  3ZRW A;  4QPJ A;  2QM8 A;  2WWW A;  3ZRW B;  2FTK A;  2P67 A;  4MTX A;  4MT8 A;  4U7O A;  3D36 A;  1IXM A;  3MD0 A;  4I5S A;  3P32 A;  4FMT A;  1F51 A;  4U7N A;  4GCZ A;  5C93 A;  4QPK A;  3ZCC A;  2C2A A;  4JAV A;  4ZKI A;  5B1N A;  4Q20 A;  5B1O A;  3ZRX A;  4BIU A;  3TK1 A;  4GT1 A;  2LFS A;  4JAU A;  4JYC A;  4JYB A;  3NXS A;  4JAS A;  2LFR A;  3ZRV A;  5IDJ A;  1JOY A;  4FPP A;  4LC1 A;  3A0R A;  4KP4 A; 
#chains in the Genus database with same CATH topology
 1HNX B;  4HZ3 A;  3QO8 A;  2OCC B;  4WFE A;  5IE9 A;  1W59 A;  1QBZ A;  4J41 A;  2QTO A;  3H9V A;  4IHJ B;  4JZ2 A;  3OM3 B;  3BRC A;  3RYC B;  1WPX A;  3JAS B;  2BOB C;  4WFG A;  2QKC A;  3E35 A;  4CH4 A;  1JPX A;  3JAL B;  4O4J B;  5KUM A;  5FPO A;  2OT5 A;  2IH3 C;  3RYH A;  2F95 B;  3LSU A;  5B1B B;  5EYP A;  4DR1 B;  4B3R O;  4XBF A;  2H94 A;  2WSS G;  4LFC O;  1N4C A;  2R9I A;  4LCU C;  1GTO A;  3CCE V;  1QVF U;  2JIZ G;  1YEW A;  1Q3E A;  2UXN A;  1SC5 B;  5H6Q A;  2L6L A;  1K4C C;  1N36 B;  2YEV A;  2Q69 A;  3WB2 A;  2Y4U A;  4K8Z A;  3APQ A;  1ZLZ A;  3E86 A;  3AG7 A;  4X62 O;  3AG3 C;  4JF3 A;  3K57 A;  3C3T A;  4PI2 A;  2QEX V;  3T1Y B;  1N34 O;  1WN7 A;  2JGD B;  3CJH A;  1IBM B;  2CTQ A;  1LR1 A;  4B3T B;  2R70 A;  1P7B A;  1O9H A;  2HR3 A;  3IC7 A;  4OXS A;  5C93 A;  4OX9 O;  1SS3 A;  1HNW O;  2ITD C;  5BZB A;  3BVO A;  5IJ9 A;  2NNU A;  3M7M X;  4I55 A;  4A5U B;  3JSN A;  1EM1 A;  4UCT A;  2DN9 A;  4X9Q A;  5L3D A;  4DV7 O;  4ZI7 B;  3TXQ A;  4LFB B;  3L72 H;  4HNA A;  4TWK A;  4LNU B;  1SZX A;  4DR4 O;  1S5L Z;  3A0H Z;  3N2K A;  4JTC B;  1R3K C;  1IUR A;  2BCC H;  2HEP A;  4X66 B;  4AQY B;  2ZIM A;  4IIJ A;  3PN1 A;  3RT3 C;  4U3J B;  3OTO O;  2CTP A;  2OCH A;  1GM7 A;  5LA6 A;  1VQ4 V;  3BAB A;  3ASN B;  1AB3 A;  3JSL A;  2K1E A;  2EIL B;  4JPR A;  1ZL8 A;  1N32 B;  5EZY A;  2RQ6 A;  3ZHS A;  4B3S B;  4DV2 B;  1YZB A;  1H8E G;  2O57 A;  1Q43 A;  3WG7 B;  2PUS A;  3SDL A;  4JZG A;  3L70 H;  1GH6 A;  1ROP A;  5LOV B;  4JI2 O;  1DGS A;  3VQX A;  4J11 A;  4DUY O;  4I4T B;  1PNK A;  3RYF A;  2ILM A;  3STL C;  4ZHQ A;  3J7A U;  5IYZ B;  2ZR3 A;  4DR2 B;  4JI5 O;  1WJZ A;  5H6R A;  1JOY A;  4LH6 A;  1DLB A;  3W7W A;  4D7S A;  4MSW C;  3K58 A;  1MA1 A;  5CB4 B;  1WNS A;  5IT9 N;  3RBZ A;  3JAK B;  4DV6 B;  2D3O W;  2ZXW B;  4JI7 O;  4DR3 B;  1DK1 A;  2XOK G;  2B9Z A;  1F4N A;  4CZZ A;  1SA0 B;  2Q68 A;  2CGO A;  4WFH A;  2Q0O C;  2QKA A;  5KA5 A;  1H2G A;  4GKJ B;  1FXK B;  3K04 A;  1G6U A;  2QM7 A;  1JJ2 U;  4KUM A;  3ML0 A;  5L3C A;  2Q9L A;  1LUW A;  4H13 B;  1TGO A;  2IH1 C;  4KXR A;  2QJ1 A;  3B09 A;  4DV1 B;  2LFS A;  3I56 V;  2ZNJ A;  2P5O A;  3T1H B;  1HNZ B;  2WWW A;  2GUZ B;  3E22 B;  4R8C A;  4TT3 G;  3H1J H;  1B04 A;  2UXC O;  4FIP C;  4DV0 B;  4MVR A;  4MTX A;  3L9D A;  2ODM A;  4H44 B;  2G38 A;  4WBN B;  1M56 C;  1XMO O;  2ZCE A;  1H2N A;  4GUN A;  3RGB A;  1K5Q A;  4JYC A;  1COW G;  3A0B Z;  5L3B A;  5BMV A;  4NTY A;  4LF7 O;  1RSO B;  3VQV A;  5LBQ A;  4MVQ A;  4BR6 A;  2UXD B;  2CUG A;  3AG2 B;  1KB9 F;  3FX7 A;  2EIJ C;  3IAY A;  1NH2 D;  2WAM A;  3CC2 V;  5EIB D;  1Q5O A;  2B1I A;  3NR7 A;  5LYJ B;  2EZP A;  4TV9 A;  2DOS A;  2MK3 A;  2Q73 A;  2A9H A;  4MVO A;  4TQF A;  3UT5 B;  1EN5 A;  1A32 A;  2QWR B;  1YTF B;  2VRZ A;  1M90 W;  1KYO F;  5GON A;  4QJF B;  2Q7G A;  2YUA A;  1F23 A;  4RWU A;  2CH7 B;  4EB6 A;  4UV8 A;  3HKC B;  4ZKI A;  5BR8 B;  2OTL V;  3CD6 V;  4PDL A;  5D5Q A;  4AHC A;  5JJE B;  4FM1 A;  3J81 N;  1XRE A;  1E79 G;  1AJQ A;  3LDC A;  1B06 A;  1NKD A;  2CK3 G;  2WA4 A;  4EEQ A;  4PDM A;  3HPL C;  1JMK C;  4I50 A;  1Y67 A;  3AK2 A;  2WA3 A;  2NR5 A;  3UCS C;  1R6N A;  3BPZ A;  1BGY H;  5BXZ A;  4KHP O;  4NR1 A;  3ABK B;  3N2G A;  3ZRS A;  2LFR A;  1WB8 A;  2A0L A;  2CDY A;  3DC6 A;  4TUY B;  1GM8 A;  1PPJ H;  4B7E A;  3M99 B;  5LMN O;  3CCR V;  1FPO A;  2YID A;  2N04 A;  3EVK A;  1VQ6 V;  4AQY O;  3K5N A;  4RUE A;  1OCZ B;  5JVD A;  5KUK A;  4GX1 A;  5E79 Z;  2DYS B;  3K06 A;  3AK3 A;  2QR4 A;  2W0F C;  1M5I A;  1RM1 C;  4G2K A;  2HG5 C;  3ABM B;  1WB7 A;  5CA3 A;  4WFB V;  2OYQ A;  1Q6U A;  3ZHU A;  1ZAU A;  1RPR A;  1K33 A;  3AG1 C;  4NYK A;  1OCO C;  3G80 A;  1N32 O;  2QWQ B;  3A8T A;  2HJF C;  1VQ9 V;  4DV2 O;  2FYU H;  4FLY A;  2DE0 X;  1LNQ A;  4I9Q A;  4LWS A;  3CMA V;  5LHG A;  5FPR A;  2XAH A;  4JYB A;  4P9P A;  1R73 A;  4QIW F;  1ZUQ A;  5FNV A;  1WPB A;  5IWA O;  2MW2 B;  1NZ6 A;  2P90 A;  2XTA A;  2UUC B;  1TVK B;  3CRM A;  4CC5 A;  2LP7 A;  1KEC A;  3AK1 A;  5H9C A;  2IBZ H;  2ITC C;  4X1I A;  3U11 A;  5KHH A;  2EBO A;  2KG7 A;  1GK9 A;  1Y6X A;  5IJ0 A;  2YIB D;  3AG4 C;  1QLN A;  4LH7 A;  2L35 A;  2P4K A;  4LFA B;  2JEU A;  2IJH A;  4YY3 B;  3P3P A;  2UUB B;  4K35 A;  1WP7 A;  4DR3 O;  1F51 A;  1XMQ B;  5LGU A;  4FLU A;  1GO3 F;  1SQG A;  2ZT9 B;  1GAX A;  1OCC B;  2F66 C;  5GW7 A;  4X65 B;  2Y4T A;  5FLX N;  1XUQ A;  1IZ3 A;  1PP9 H;  1PD3 A;  4RQF A;  1BHB A;  3JYC A;  5B1B C;  1QNM A;  3QNE A;  3BFR A;  1VQ7 V;  3EHB B;  1YIJ V;  1KKD A;  2ADP A;  2F43 G;  4FMT A;  1I7F A;  1RFY A;  4TQD A;  2OTJ V;  4N21 A;  5J2T B;  1VQK V;  5B1N A;  4RAI A;  4DK0 A;  2JS5 A;  3U0Z A;  1TUB A;  3T1H O;  2VQF B;  1F4M A;  2ZM6 B;  1S77 D;  2B1G A;  4EFE A;  3LSQ A;  1W0K G;  2DW4 A;  2DWD C;  1ARO P;  1JX9 A;  2DYR B;  3K5L A;  1R3L C;  2IM9 A;  1M57 B;  5JQG B;  1NT2 B;  3CB2 A;  3QF7 A;  3CME V;  1DF4 A;  2HJD A;  3ZJZ A;  4BW9 A;  1S3J A;  4O4L B;  1Q6H A;  3EFF K;  1EN6 A;  2A79 B;  3C90 A;  1OJH A;  2VQE B;  4LF4 O;  2LO1 A;  4DR7 B;  3CCM V;  1JVM A;  1L0L H;  5CMU A;  2WLL B;  1AI7 A;  1K4D C;  1HR0 B;  3RVY A;  4X1K A;  1H2L A;  3CX5 F;  3D3I A;  3VBB A;  4JAA A;  4F6E A;  3L75 H;  4JI8 O;  4JTA B;  3HR0 A;  1KBH A;  2X6A A;  3IJ4 A;  1Y76 B;  1K5S A;  3ASN C;  1Q86 W;  3D3Q A;  3WU2 Z;  4N23 A;  3QVN A;  3DSQ A;  4GX0 A;  4X88 A;  1YTF D;  2V7Q G;  2YI8 A;  3BAA A;  2F93 B;  1IDS A;  4I0X B;  3WG7 C;  1N0J A;  5ITZ A;  1N8R W;  1MZF A;  1BT8 A;  5C8Y B;  2QM8 A;  2QKS A;  3VQW A;  2UXB O;  1BZK A;  5LXT B;  3E8G A;  2A7W A;  3QTC A;  4FM2 A;  4XDL A;  1XNQ B;  1V54 B;  2C2A A;  2Q5Z A;  3G4S V;  2BSK B;  3OR7 C;  5B3S B;  2V4D A;  4UCO A;  5B66 Z;  3RYI A;  4G28 B;  3GWK C;  2RDC A;  1OCR C;  4PI0 A;  5IY5 C;  5JH7 A;  3LNM B;  1NH2 B;  4GX5 A;  4W4K A;  1ENV A;  1JFF A;  2P4V A;  2AHZ A;  4UUJ C;  4JI0 B;  2ZXW C;  1VF5 B;  2PI4 A;  2BTQ B;  4ZIB A;  2Q6A A;  3HB3 B;  1GN2 A;  1AR5 A;  3JAW B;  2KSD A;  2LJ2 A;  4K8X A;  4BIO A;  3CEI A;  4QGP A;  4B3M O;  1R6K A;  3JAT B;  2JEX A;  2JGU A;  3VOU A;  5TIS Z;  1AVM A;  1DTO A;  4O4I A;  4TV8 B;  4DV4 O;  4FM0 A;  1SKV A;  4PDV A;  3HKD A;  1N33 B;  3FFQ A;  3DXR B;  3KCY A;  1IBK B;  2EIM B;  2AW9 A;  1K8A W;  2WLH A;  1QR8 A;  4RQE A;  2B5U A;  4LBE C;  4UFZ A;  1DF5 A;  2Z5U A;  4J7Z A;  3K59 A;  1K34 A;  1SET A;  5CBF A;  1Y74 A;  2X6C A;  3KKY A;  3ICX A;  3FYI B;  4L8J A;  4MW8 A;  1THZ A;  2LGW A;  3BEH A;  3S3X A;  3LSS A;  3BA9 A;  3H1K H;  4UCU A;  1IXB A;  4PA9 A;  2BOC C;  4JI6 B;  1XOU A;  1XNR O;  4BIU A;  4K0K O;  3ABL B;  1WA8 A;  2QDO A;  2IJI A;  2NLJ C;  3CXC U;  3SJC C;  4FFB A;  3JD0 A;  2XAF A;  4IL6 Z;  1K73 W;  5KX5 A;  4ABM A;  1YVW A;  1PV0 A;  2QWP B;  2Q7E A;  4DRX B;  1NVP B;  5CA1 A;  3AG2 C;  2QWO B;  4ZOL B;  4YIO A;  3UKM A;  3I55 V;  1YSC A;  5D5P A;  5L3F A;  1FYJ A;  4YJ2 B;  4JI4 O;  4DO2 A;  4JV5 O;  5J2U B;  3CC7 V;  3FB5 C;  1L8D A;  4NTW A;  1VQM V;  4J10 A;  2DJV A;  4XDJ A;  4C7U A;  1XEQ A;  1S5H C;  2HHH O;  2PYJ A;  2BTO A;  4O4H B;  4Q6G A;  1SF9 A;  4GZR B;  4TV9 B;  3HKB A;  4GLX A;  1GKF A;  4D6T H;  4LC1 A;  3FD9 A;  2EIN B;  4X1Y B;  4JYA O;  4F6R B;  1D5N A;  2GHY A;  5LP6 B;  2D2C B;  2F4V B;  4JI1 O;  3ZHT A;  5KHJ A;  1L1F A;  2WLI A;  4DUZ O;  3SYA A;  4AI8 A;  1Z5W A;  4DV3 O;  2IW5 A;  1H38 A;  1NS1 A;  4O2B A;  2HKO A;  1W0J G;  1FKA O;  1RPO A;  1BCC H;  1YHQ V;  2XAJ A;  3CRR A;  4MVU A;  2VQE O;  4NXN B;  3K9S A;  3ZIA G;  4CH6 A;  1MSD A;  4IHJ A;  3RYC A;  3T4Z A;  4X8A A;  5LMU O;  4NXM O;  3JAS A;  1HW7 A;  2RCV A;  3E8B A;  1EFR G;  3OAA G;  3JAL A;  4O4J A;  3H1H H;  1OCZ C;  2IU3 A;  1VQP V;  1Q81 W;  4YJ3 B;  5DM6 V;  1T5E A;  3CE2 A;  1EBO A;  4DW1 A;  1PNM A;  4YHH O;  4P2Z A;  1AI6 A;  3SYQ A;  3MHS C;  2UU9 O;  1P4R A;  3X2Q B;  3K0G A;  3T2M A;  1Q90 D;  4UB8 Z;  2ZIN A;  1FAF A;  2EJR A;  3FB6 C;  4L87 A;  3R66 A;  2EJ7 A;  5EBL C;  3SJA C;  1BHA A;  3KG2 A;  2ZE8 A;  4UXN A;  4BW5 A;  5HFL A;  3JCZ A;  2JGD A;  2HVJ C;  2XAQ A;  1ZWI C;  4EFB A;  5KMG B;  1Q82 W;  2PY5 A;  4P9O A;  1ZX3 A;  3RW0 A;  4UCS A;  1G1X B;  4UVB A;  3AG3 B;  4Z1M G;  4PV1 B;  1XNQ O;  1FJG B;  2Z0A A;  4ZI7 A;  3TGU H;  4DR6 B;  4LNU A;  4YIP A;  1HNX O;  2HP8 A;  3SJQ C;  4NKG B;  4U7O A;  1AR4 A;  1YIT V;  2YXL A;  4LR3 A;  2ATK C;  2RNB A;  4U3J A;  3WB1 A;  4DV5 B;  1AI4 A;  4HYO A;  1JR9 A;  2CGN A;  4UB6 Z;  4DR5 B;  1OCC C;  3TCU A;  4DR1 O;  4WFA V;  4JTD B;  3M8A A;  3RN4 A;  3SGI A;  3ZN0 A;  5CBG A;  1I0H A;  5A9G A;  3F7Y C;  5DED A;  2E75 B;  2Y69 C;  4MVZ A;  2XND G;  5LGN A;  1N36 O;  1N33 O;  5LOV A;  1YXB A;  4JAS A;  3ZRV A;  4X20 B;  1X4T A;  5IYD O;  3D8C A;  3L71 H;  3RWR D;  1G8M A;  3T1Y O;  2IJJ A;  4X64 B;  1IBM O;  1M93 A;  4I4T A;  1J5E B;  4B3T O;  1SQQ H;  4J7K A;  1NR7 A;  2DWE C;  4MTO A;  5IYZ A;  2E5L B;  3CS5 A;  2QM4 A;  2DYR C;  1Q6I A;  2RJZ A;  2KQX A;  3CYO A;  4Q20 A;  2XT9 A;  2XAG A;  1NTZ H;  1MZE A;  1M57 C;  1NTM H;  1S76 D;  4LFB O;  2YDE A;  5CB4 A;  3CRC A;  3ZRW B;  3H1L H;  2ZR2 A;  4JI3 B;  3JAK A;  4J42 A;  3B4S A;  3T4D A;  2CTR A;  2XAS A;  3LUT B;  3AEI A;  4PA7 A;  4X66 O;  3FB7 C;  4YXW G;  5DN6 G;  4G27 B;  3QO7 A;  3W7X A;  1SA0 A;  2X7R B;  2EIK C;  1NVP D;  1FXK A;  1BE3 H;  1QLE B;  2WLJ A;  4BIZ A;  5CA0 B;  5KA6 A;  4LF8 B;  2YXY A;  2DQ0 A;  2CAZ C;  4LF9 B;  3KCX A;  4WF9 V;  3HKE B;  4FLZ A;  2V1D A;  1CPY A;  3SR2 C;  1FS0 G;  4B3S O;  1XDC A;  1QR9 A;  4PEL A;  1K7D A;  4KFM A;  3ABT A;  3CCL V;  1KUQ A;  1IBL B;  1HWY A;  2GUZ A;  3E22 A;  4H33 A;  3H1I H;  4B3R B;  2ETN A;  3Q4H B;  4LFC B;  1V55 B;  4X89 A;  1VIB A;  1FFX B;  2F4V O;  4ASU G;  1SRY A;  4JGS A;  3ASO C;  3E83 A;  4WBN A;  3E8H A;  3EXA A;  4MW3 A;  3GWO A;  3FAV B;  1VAR A;  3B8M A;  3OEH G;  4X62 B;  4DR2 O;  2E3C A;  2A06 H;  4QNH B;  2JJ2 G;  4GKK B;  1RSO A;  1N34 B;  5B3S C;  2A3Q A;  3ZMS A;  3SPH A;  1EZV H;  1M56 B;  3STZ C;  2OCC C;  3JAR B;  2GBO A;  3P3N A;  4DV6 O;  4OX9 B;  1HNW B;  4U7N A;  4O2A B;  3K9A A;  2Q0A A;  5L3E A;  4QPK A;  4ICG A;  5EIB C;  5KLV H;  1XIL A;  5LYJ A;  4DV7 B;  1NQT A;  2ARH A;  1P84 F;  1L0N H;  4NTX A;  3UT5 A;  5IDJ A;  3ZMV A;  4DR4 B;  3ZMU A;  3K5O A;  4GKJ O;  3K3W A;  2K9P A;  1D2D A;  1U97 A;  2EX3 A;  2IJK A;  4J80 A;  2YC0 A;  1QCE A;  2W6I G;  3HKC A;  3OTO B;  2QA4 V;  3OT7 A;  3J80 N;  4IT5 A;  1GMG A;  3CCQ V;  3B77 A;  1I94 B;  2LQT A;  4DV1 O;  3RYH B;  2EIM C;  5EYP B;  4U3F H;  1HNZ O;  4J7J A;  4W4L A;  1VQ8 V;  2LW1 A;  1MOF A;  4BAY A;  4I9W A;  4DV0 O;  4CC6 A;  3QO5 A;  4K3A A;  1YJW V;  2VS0 A;  2ADQ B;  4GX2 A;  3CC4 V;  1PL0 A;  2YXH A;  1YDX A;  5H2F Z;  2ZNI A;  3HKD B;  2YEV B;  4MTF A;  2X0L A;  1SQX H;  4JI2 B;  3BCC H;  3K5M A;  4ZBM A;  4NVP A;  4TUY A;  4OPA A;  3SPJ A;  4DUY B;  1YJ9 V;  3CJH B;  1S5J A;  2GV9 A;  2UXD O;  3UO3 A;  1PKX A;  4R7C A;  2YIC A;  2W6J G;  5DEC A;  4MVM A;  1M9N A;  4JI5 B;  3OR6 C;  3JD3 A;  5IJ9 B;  4DV5 O;  4I55 B;  4FZ1 A;  4HNA B;  3UO2 A;  4LF5 B;  5EC1 C;  3F7V C;  3N27 A;  4JI7 B;  1MNG A;  4QE9 A;  3N2K B;  1FXV A;  2N05 A;  2EIL C;  5KHI A;  1SQF A;  4UVC A;  1E1R G;  3SPI A;  4IIJ B;  1W2B U;  1RM1 B;  3ZRX A;  3OUS A;  1MAB G;  5BR8 O;  4UVA A;  5LA6 B;  2OIE A;  2UXX A;  1UJW B;  2R9A A;  2ZE7 A;  3VQY A;  4UV9 A;  1SQV H;  1SQB H;  1ZL8 B;  2EIN C;  4X64 O;  4EKW A;  1TVK A;  5EZY B;  1JJO A;  5LP6 C;  3OW2 U;  1Y66 A;  1CEZ A;  3G6B A;  3GB7 C;  3G71 V;  1B6Q A;  4GCZ A;  3JD4 A;  3E8F A;  2P22 C;  3DC5 A;  4IYI A;  2M7W A;  3JCU Z;  3TXS A;  3HKB B;  2UXC B;  4BWA A;  1YF2 A;  3CRA A;  1ZTE A;  4FVM A;  1YI2 V;  4PHZ A;  5KHK A;  2HFE C;  3I5D A;  2PF4 E;  3THO A;  1EZJ A;  2QE7 G;  3K0D A;  3RYF B;  4ZHQ B;  3AG4 B;  3K79 A;  3G67 A;  3K08 A;  3NXS A;  1BL8 A;  2GTS A;  3T1C A;  4H0L B;  4LF8 O;  1JA8 A;  1KQS U;  3ETE A;  1FXK C;  2RN9 A;  1MSW D;  2OIG A;  3CCV V;  4LF9 O;  1XHX A;  3OFN G;  3P30 A;  1AJN A;  1WAZ A;  3X2Q C;  5J2T A;  3U10 A;  3UQ8 A;  3CCJ V;  5B1O A;  2YSU B;  4FK5 C;  1IBL O;  4FPP A;  3DGE A;  3SYC A;  2FTK A;  1U96 A;  3LDD A;  2Z3Y A;  2GTA A;  2Q67 A;  5J9P C;  4F4L A;  4CH5 A;  1M4U A;  5L3G A;  2VWJ A;  2UUC O;  2XHB A;  5JQG A;  3L73 H;  4Z2W A;  4I7Z B;  4CS4 A;  1I08 A;  4PDR A;  4O4L A;  3TJT A;  1AP5 A;  1O9G A;  2PTM A;  4GKK O;  4D7T A;  3SYP A;  4WFF A;  1AI5 A;  2WLL A;  4LFA O;  4YY3 O;  1IXM A;  3RVZ A;  2UUB O;  5F2V O;  4FLX A;  2GSM B;  1XMQ O;  2HVK C;  3B2E E;  4DK1 A;  2QGN A;  4KHP B;  1M1K W;  2ZQM A;  4B08 A;  2YS8 A;  1NR1 A;  4X65 O;  5BMV B;  1Y76 A;  2WPD G;  3GVM A;  3L74 H;  2XUM A;  5LMN B;  4E2L A;  1VF6 C;  4J9Y B;  3ETG A;  2H8P C;  5EBM C;  4JAV A;  5HFM A;  3LDE A;  1BMF G;  4I0X A;  2JVD A;  1I94 O;  1NTK H;  3OMN B;  1R3I C;  5C8Y A;  2VQF O;  1K97 A;  2ZM6 O;  4P30 A;  4DYL A;  5GTH Z;  5GON B;  3MD0 A;  2PGG A;  5LXT A;  4H37 A;  1QHT A;  1TAE A;  3OMI B;  3ETQ A;  4UCV A;  1AJP A;  4WCE V;  2LGQ A;  4EB6 B;  1GN6 A;  2BSK A;  3A2F A;  5K1P A;  3O9O A;  2P7T C;  2W0X A;  1Q7Y W;  2P06 A;  5IWA B;  2BE3 A;  2DQ3 A;  3ABK C;  4Z1V A;  1K9M W;  4DR7 O;  4RUF A;  4MS2 A;  1JQ0 A;  2Y0I A;  2HLD G;  1HR0 O;  2BTQ A;  2QWN B;  3ZHQ A;  4I50 B;  2Y0P A;  5B1A B;  4HBN A;  3JAW A;  3TK1 A;  3BY6 A;  1OCR B;  2DYS C;  3N2G B;  1XL6 A;  5IY5 B;  3B8N A;  1NI8 A;  1H2S B;  3PJS K;  2QTS A;  4MVS A;  3JAT A;  4LF5 O;  1KP2 A;  3W7U A;  1Q8I A;  1QLE C;  3E2E A;  4TV8 A;  3ABM C;  2UUA B;  1PL4 A;  1URF A;  3DXR A;  5JVD B;  4LP8 A;  1Z5V A;  4XDK A;  4B7K A;  2LW7 A;  3ZBH A;  4GYC B;  2RMK B;  3OGC C;  4CS3 A;  4TOI A;  4LF6 B;  3H01 A;  1P7G A;  2YI9 A;  1V55 C;  2FL4 A;  3OMA B;  4FFK A;  3ZCC A;  4R6Z A;  2AXT Z;  1IVS A;  1BQ0 A;  1NBM G;  4LWS B;  1HP8 A;  3ZS8 C;  3JAM N;  1R3J C;  3MDS A;  1I5X A;  5FNV B;  3IC9 A;  3KZI Z;  1FFT B;  5EK0 A;  5JCO C;  3B40 A;  1PM9 A;  3CCU V;  3CP1 A;  1AP6 A;  4DRX A;  5B5E Z;  2N74 A;  4ZOL A;  1I5Y A;  3ZN1 A;  2ZDI C;  3D36 C;  4JI0 O;  4YJ2 A;  1OV9 A;  1CXZ B;  1EN4 A;  5J2U A;  4X1I B;  1GM9 A;  2KG7 B;  4PA4 A;  5IJ0 B;  4LF4 B;  5IYC O;  2KB1 A;  2EUL A;  4FLV A;  1GN4 A;  1TA8 A;  3ABU A;  4MT8 A;  3OTF A;  4CS2 A;  2ZD9 A;  2AHY A;  4O4H A;  1B3Q A;  1VP7 A;  1RP3 B;  2JRI A;  4PA3 A;  1NU1 H;  1WP8 A;  3F5T A;  2JK5 C;  4JI8 B;  3ZED A;  1IBK O;  2YIA A;  5BY1 A;  5AG2 A;  1VMG A;  4X1Y A;  4F6R A;  5LP6 A;  1XI1 A;  2OWO A;  1BSM A;  1X59 A;  2ZKO A;  1FD9 A;  1XQ8 A;  2F1M A;  2AZ2 A;  3OGI B;  2YIB A;  3SYO A;  5JJN B;  4DXW A;  4JI6 O;  3QG5 A;  4TSF G;  1AR1 B;  3CSX A;  4IYH A;  2AZ0 A;  2Q7H A;  1TUB B;  1KD1 W;  1GRJ A;  1SER A;  2UXB B;  4J9Z B;  1R1B A;  4FZ0 A;  1KU9 A;  5KAF Z;  1VQO V;  3CPW U;  3W7S A;  2ZE6 A;  1Y4M A;  1XL4 A;  2R72 A;  3CXH F;  1SQP H;  4FJC C;  4PA6 A;  3O65 A;  3CRQ A;  2EZO A;  4FLW A;  3MHH C;  1AIL A;  4YJ3 A;  4JAU A;  4OPH A;  3CCS V;  2F23 A;  3ZHR A;  4KP4 A;  1V9P A;  1QU7 A;  1OZ0 A;  1VEW A;  2CE4 A;  1K3E A;  2Q8V A;  3FB8 C;  4X1K B;  1ZSP A;  1YJN V;  3ZMT A;  1J95 A;  4RO2 A;  3DTU B;  1TUE B;  1QVG U;  4B3M B;  3OE7 G;  5LHH A;  1VQ5 V;  3LNN A;  1US6 A;  1R6T A;  5KMG A;  4DV4 B;  3BA8 A;  5KHG A;  3ZX6 A;  1HDJ A;  1VQL V;  3S3W A;  4CH3 A;  3WB0 A;  3APO A;  1V54 C;  5KAI Z;  3RFR A;  5ITZ B;  2ZIO A;  2WLM A;  4NXN O;  5CBH A;  4HAM A;  1P49 A;  3ZHV A;  4MTG A;  1N0N A;  3ZMZ A;  1S0V A;  1WLE A;  1XNR B;  1H8H G;  3E89 A;  4K0K B;  3R65 A;  3CWB H;  1XBL A;  3WFV A;  4AIL C;  3G6E V;  2IU0 A;  2WLN A;  3ETD A;  3RYI B;  2Y48 A;  5CN0 A;  1VF6 A;  2EIJ B;  3JD2 A;  5IYB O;  2FB5 A;  5JH7 B;  2M6Y A;  3SJB C;  1GN3 A;  1UPG A;  1Z2G A;  2R9R B;  2UUA O;  2CH7 A;  1JFF B;  4JI4 B;  5FL7 G;  4JV5 B;  2PZS A;  1IX9 A;  2WLK A;  4QE7 A;  4GT1 A;  4X20 A;  2AGA A;  4R50 A;  4LF6 O;  2HHH B;  1SES A;  2Y69 B;  2X6B A;  1ORQ C;  2JJ1 G;  4O4I B;  2E76 B;  2E74 B;  3BHP A;  3OUF A;  1LUV A;  1KMI Z;  2H3O A;  1FJG O;  5K1X A;  4JYA B;  1G4Y B;  1VQN V;  3ABL C;  3ZRW A;  4JI1 B;  4DR6 O;  1H2K A;  2JDI G;  1Y74 B;  4DUZ B;  1D5A A;  4JYY A;  4I5S A;  3P32 A;  5A2Q N;  4DW0 A;  3IFX A;  4DV3 B;  2PYL A;  3FYE B;  4CBC A;  3K03 A;  2ZE5 A;  5E1A C;  2FKX A;  1YCI A;  5JWP A;  1VF7 A;  1WA8 B;  5CA0 A;  4FFB B;  3SPG A;  2DMX A;  4QPJ A;  2CTW A;  4DR5 O;  5KX5 B;  2NN4 A;  3IGA C;  5LMU B;  4NXM B;  3SPC A;  3HKE A;  1F7Y A;  1FXH A;  1XHZ A;  1BQZ A;  2EIK B;  4FLT A;  4E4E A;  5CA1 B;  1MG1 A;  3JD1 A;  1BS3 A;  1KP3 A;  4UCR A;  1E1Q G;  1OHH G;  4OGQ B;  3OD4 A;  5EBW C;  3MAQ A;  1QQC A;  3A0R A;  3Q4H A;  5LGT A;  4YHH B;  3W7T A;  1PNL A;  5JJJ B;  3AG1 B;  2UU9 B;  1OCO B;  3OEE G;  1FFX A;  3FKS G;  2GDS A;  5LHI A;  1JCH A;  2P6J A;  3FAV A;  4PJ0 Z;  1J5E O;  4KL1 A;  4NB5 A;  2E5L O;  3C3S A;  1KKC A;  1CP9 A;  1NJI W;  1H2M A;  5JCO A;  1KC8 W;  3TET A;  4PD4 F;  5GTI Z;  3F5W C;  1K92 A;  2QSA A;  3ASO B;  3CHX A;  2FML A;  5H5N A;  1SZT A;  2P67 A;  2ZDI A;  2JS3 A;  2PI5 A;  3D36 A;  4JI3 O;  3JAR A;  4O2A A;  2WLI B;  5EC2 C;  5LL6 Y;  1S72 V;  2KKW A;  1XMO B;  2VWK A;  1MMM A;  4IGG A;  4O2B B;  3UM7 A;  5B1A C;  1UFI A;  4LF7 B;  2Q4P A; 
#chains in the Genus database with same CATH homology
 5IYD O;  4HZ3 A;  3QO8 A;  2OCC B;  1PD3 A;  2DQ3 A;  4WFE A;  4RQF A;  1BHB A;  3JYC A;  3ABK C;  1QBZ A;  1K9M W;  5B1B C;  1G8M A;  3QNE A;  2IJJ A;  4RUF A;  1VQ7 V;  3EHB B;  1YIJ V;  1KKD A;  2QTO A;  4MS2 A;  1JQ0 A;  2F43 G;  3OM3 B;  4FMT A;  1WPX A;  2HLD G;  1NR7 A;  2DWE C;  2BOB C;  4MTO A;  2OTJ V;  4N21 A;  4WFG A;  1VQK V;  2DYR C;  3CYO A;  5B1N A;  3E35 A;  4Q20 A;  5B1A B;  2XAG A;  1JPX A;  4RAI A;  5KUM A;  3TK1 A;  3BY6 A;  1M57 C;  2OT5 A;  2IH3 C;  1OCR B;  2DYS C;  1XL6 A;  5IY5 B;  3B8N A;  3PJS K;  5B1B B;  1S76 D;  1F4M A;  4MVS A;  1S77 D;  3ZRW B;  2B1G A;  4XBF A;  2H94 A;  2ZR2 A;  3LSQ A;  2WSS G;  1W0K G;  1KP2 A;  2DW4 A;  2DWD C;  3W7U A;  1QLE C;  1ARO P;  3E2E A;  3T4D A;  2R9I A;  4LCU C;  1JX9 A;  1GTO A;  3ABM C;  3CCE V;  2DYR B;  2JIZ G;  2UXN A;  2XAS A;  1QVF U;  3LUT B;  3AEI A;  4PA7 A;  5H6Q A;  1R3L C;  1K4C C;  1M57 B;  2YEV A;  3FB7 C;  4YXW G;  2Q69 A;  5DN6 G;  4LP8 A;  3CME V;  1DF4 A;  4G27 B;  3QO7 A;  3ZJZ A;  3W7X A;  2X7R B;  1S3J A;  2EIK C;  4XDK A;  1NVP D;  3E86 A;  3OGC C;  3EFF K;  3AG3 C;  4JF3 A;  1FXK A;  2A79 B;  1QLE B;  2WLJ A;  4BIZ A;  3H01 A;  5KA6 A;  2QEX V;  3CCM V;  1JVM A;  5CMU A;  2DQ0 A;  2WLL B;  1AI7 A;  1P7B A;  1K4D C;  4WF9 V;  1V55 C;  2HR3 A;  3IC7 A;  4OXS A;  3RVY A;  2V1D A;  3OMA B;  1CPY A;  5C93 A;  3ZCC A;  1FS0 G;  2ITD C;  4R6Z A;  5BZB A;  1QR9 A;  4PEL A;  1K7D A;  4KFM A;  3ABT A;  2NNU A;  3D3I A;  3CCL V;  1NBM G;  3VBB A;  5L3D A;  4JTA B;  1HWY A;  1R3J C;  4H33 A;  1I5X A;  4TWK A;  2X6A A;  1K5S A;  3ASN C;  1V55 B;  1FFT B;  1Q86 W;  4JTC B;  4X89 A;  5EK0 A;  1R3K C;  4N23 A;  3CCU V;  3CP1 A;  4ASU G;  4GX0 A;  1SRY A;  4JGS A;  4X88 A;  3ASO C;  3E83 A;  1YTF D;  3E8H A;  4MW3 A;  3GWO A;  1I5Y A;  3ZN1 A;  2ZDI C;  2V7Q G;  3B8M A;  3OEH G;  1GM7 A;  1VQ4 V;  1GM9 A;  4QNH B;  3ASN B;  2JJ2 G;  4PA4 A;  3WG7 C;  1N8R W;  2K1E A;  5IYC O;  2KB1 A;  5B3S C;  2EIL B;  2QM8 A;  2QKS A;  4JPR A;  3ABU A;  4MT8 A;  3ZMS A;  3SPH A;  1M56 B;  3STZ C;  2OCC C;  2ZD9 A;  2AHY A;  4U7N A;  3E8G A;  3K9A A;  5L3E A;  4QPK A;  4PA3 A;  4XDL A;  1V54 B;  2C2A A;  1H8E G;  2JK5 C;  3WG7 B;  3G4S V;  1NQT A;  3OR7 C;  5B3S B;  1ROP A;  5IDJ A;  3ZMV A;  4G28 B;  3ZMU A;  3K3W A;  1OCR C;  5IY5 C;  3LNM B;  1NH2 B;  2IJK A;  4GX5 A;  1ENV A;  1PNK A;  1QCE A;  2W6I G;  4UUJ C;  2AHZ A;  2QA4 V;  3STL C;  2ZXW C;  2PI4 A;  3SYO A;  2ZR3 A;  2Q6A A;  4DXW A;  3HB3 B;  1GMG A;  3CCQ V;  3B77 A;  4TSF G;  5H6R A;  1AR1 B;  1JOY A;  1DLB A;  2EIM C;  3W7W A;  4MSW C;  1VQ8 V;  1KD1 W;  1SER A;  1R6K A;  4J9Z B;  2JEX A;  1MOF A;  4BAY A;  4I9W A;  3RBZ A;  2D3O W;  3VOU A;  2ZXW B;  1VQO V;  3CPW U;  3QO5 A;  3W7S A;  1Y4M A;  1DTO A;  1XL4 A;  1YJW V;  4GX2 A;  3CC4 V;  1PL0 A;  2XOK G;  4PDV A;  1F4N A;  4FJC C;  2YEV B;  4PA6 A;  4CZZ A;  4MTF A;  2X0L A;  2EZO A;  2EIM B;  3MHH C;  2Q68 A;  4ZBM A;  1K8A W;  4JAU A;  2WLH A;  4WFH A;  5KA5 A;  1H2G A;  1QR8 A;  4RQE A;  3CCS V;  2B5U A;  4KP4 A;  1FXK B;  3K04 A;  4LBE C;  1DF5 A;  2Z5U A;  2QM7 A;  1JJ2 U;  1K34 A;  1SET A;  3SPJ A;  5CBF A;  4KUM A;  1YJ9 V;  2X6C A;  3ML0 A;  3FYI B;  5L3C A;  1OZ0 A;  1PKX A;  4R7C A;  4MW8 A;  1THZ A;  3BEH A;  2W6J G;  4MVM A;  3LSS A;  1M9N A;  2IH1 C;  1K3E A;  3FB8 C;  3OR6 C;  4PA9 A;  1YJN V;  2BOC C;  3JD3 A;  3ZMT A;  3ABL B;  4BIU A;  1J95 A;  2LFS A;  4RO2 A;  2IJI A;  3I56 V;  2NLJ C;  3CXC U;  3JD0 A;  2WWW A;  1TUE B;  3DTU B;  1QVG U;  2XAF A;  4R8C A;  4TT3 G;  1K73 W;  3OE7 G;  5LHH A;  5EC1 C;  3F7V C;  1VQ5 V;  4FIP C;  4MVR A;  4MTX A;  4QE9 A;  1FXV A;  2EIL C;  1NVP B;  4UVC A;  1E1R G;  3AG2 C;  3SPI A;  3UKM A;  3I55 V;  1YSC A;  1W2B U;  1VQL V;  5L3F A;  1M56 C;  1RM1 B;  3ZRX A;  3OUS A;  1MAB G;  4DO2 A;  4UVA A;  3CC7 V;  1K5Q A;  3FB5 C;  4JYC A;  1COW G;  2UXX A;  1V54 C;  1VQM V;  5L3B A;  1UJW B;  5LBQ A;  4MVQ A;  4UV9 A;  4XDJ A;  2WLM A;  1S5H C;  3AG2 B;  2EIN C;  4HAM A;  5CBH A;  4EKW A;  2EIJ C;  4MTG A;  3OW2 U;  1Y66 A;  3ZMZ A;  3GB7 C;  1CEZ A;  3G71 V;  1S0V A;  1B6Q A;  1WLE A;  4GCZ A;  3JD4 A;  2WAM A;  3E8F A;  1NH2 D;  3CC2 V;  1H8H G;  3E89 A;  3R65 A;  2B1I A;  3WFV A;  2M7W A;  2EZP A;  2MK3 A;  3G6E V;  2IU0 A;  2WLN A;  1GKF A;  2A9H A;  4LC1 A;  3ETD A;  4MVO A;  2Y48 A;  5CN0 A;  2EIN B;  1YTF B;  1M90 W;  2GHY A;  2EIJ B;  3JD2 A;  5IYB O;  1YI2 V;  4QJF B;  1L1F A;  2HFE C;  2WLI A;  1F23 A;  1EZJ A;  2R9R B;  2QE7 G;  3SYA A;  3K0D A;  4UV8 A;  5FL7 G;  3AG4 B;  4ZKI A;  3K79 A;  2OTL V;  2IW5 A;  3CD6 V;  4PDL A;  1H38 A;  2WLK A;  4QE7 A;  2HKO A;  4GT1 A;  3K08 A;  1W0J G;  3NXS A;  1BL8 A;  1E79 G;  1AJQ A;  3LDC A;  3T1C A;  1NKD A;  1RPO A;  4R50 A;  1YHQ V;  2XAJ A;  2CK3 G;  4MVU A;  3ZIA G;  1KQS U;  1SES A;  2Y69 B;  3ETE A;  1FXK C;  4PDM A;  1MSW D;  2X6B A;  3CCV V;  1ORQ C;  2JJ1 G;  4X8A A;  3T4Z A;  3OFN G;  3P30 A;  1AJN A;  3HPL C;  3E8B A;  3X2Q C;  1EFR G;  3OAA G;  3CCJ V;  3OUF A;  5B1O A;  1R6N A;  2YSU B;  1OCZ C;  2IU3 A;  3ABK B;  3ZRS A;  1VQP V;  1Q81 W;  2LFR A;  4FK5 C;  4FPP A;  2A0L A;  1G4Y B;  1VQN V;  5DM6 V;  3DGE A;  1EBO A;  3ABL C;  3SYC A;  3ZRW A;  1PNM A;  1GM8 A;  2FTK A;  4P2Z A;  1AI6 A;  3SYQ A;  3MHS C;  2JDI G;  1P4R A;  3X2Q B;  3LDD A;  3M99 B;  3CCR V;  2Z3Y A;  3K0G A;  2Q67 A;  4I5S A;  3P32 A;  3T2M A;  4F4L A;  5J9P C;  5L3G A;  1VQ6 V;  4RUE A;  3IFX A;  1OCZ B;  5KUK A;  3FYE B;  2EJR A;  3FB6 C;  4GX1 A;  2DYS B;  4L87 A;  3K03 A;  4CBC A;  3K06 A;  5EBL C;  4PDR A;  5E1A C;  1BHA A;  3KG2 A;  2W0F C;  4UXN A;  4BW5 A;  1RM1 C;  4G2K A;  3SPG A;  5HFL A;  2HG5 C;  3JCZ A;  3ABM B;  4QPJ A;  5CA3 A;  2HVJ C;  4WFF A;  3SYP A;  1AI5 A;  2WLL A;  2XAQ A;  4WFB V;  3IGA C;  1ZWI C;  1RPR A;  1K33 A;  3SPC A;  1FXH A;  1IXM A;  3AG1 C;  3RVZ A;  1OCO C;  1Q82 W;  4P9O A;  3RW0 A;  2HJF C;  2EIK B;  1MG1 A;  4UVB A;  1VQ9 V;  3JD1 A;  2GSM B;  3AG3 B;  4Z1M G;  2HVK C;  1KP3 A;  1LNQ A;  1M1K W;  1E1Q G;  3CMA V;  1OHH G;  2ZQM A;  5LHG A;  5EBW C;  2XAH A;  4JYB A;  4P9P A;  1NR1 A;  1R73 A;  3A0R A;  4QIW F;  5LGT A;  2WPD G;  3W7T A;  1PNL A;  3AG1 B;  1OCO B;  3SJQ C;  3OEE G;  2P90 A;  4E2L A;  3FKS G;  4U7O A;  4J9Y B;  5LHI A;  1JCH A;  2P6J A;  3ETG A;  2H8P C;  1YIT V;  2ATK C;  5EBM C;  2LP7 A;  1KEC A;  5H9C A;  4JAV A;  2ITC C;  5HFM A;  1AI4 A;  3LDE A;  1BMF G;  2EBO A;  1CP9 A;  1GK9 A;  4HYO A;  1NJI W;  3AG4 C;  1QLN A;  1KC8 W;  3OMN B;  1R3I C;  3TET A;  1OCC C;  3TCU A;  3F5W C;  2JEU A;  1K92 A;  3ASO B;  4WFA V;  2IJH A;  1K97 A;  1SZT A;  2P67 A;  2ZDI A;  4P30 A;  4JTD B;  2PI5 A;  3D36 A;  3ZN0 A;  3MD0 A;  4H37 A;  5CBG A;  1F51 A;  3OMI B;  2WLI B;  5EC2 C;  1S72 V;  3F7Y C;  5LGU A;  1AJP A;  1GO3 F;  2Y69 C;  4MVZ A;  4WCE V;  2XND G;  5LGN A;  1OCC B;  2P7T C;  5GW7 A;  3UM7 A;  4JAS A;  3ZRV A;  5B1A C;  1Q7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...