4MTXA

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
AAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Ethylene response sensor 1
total genus 34
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mtxA00
4GCZA 2FTKA 2C2AA 3P32A 3TK1A 4JAUA 2WWWA 3MD0A 3NXSA 4QPJA 4U7OA 3ZRXA 5C93A 2LFSA 4JASA 3ZRWA 3ZCCA 3DGEA 4ZKIA 1IXMA 4FMTA 5B1NA 1F51A 2QM8A 4JYBA 4KP4A 5IDJA 4Q20A 4BIUA 4I5SA 4GT1A 4LC1A 4JYCA 3ZRVA 3ZRWB 4JAVA 4MT8A 4MTXA 4FPPA 2QM7A 2LFRA 4BIZA 4U7NA 3A0RA 2P67A 1JOYA 5B1OA 3D36A 4QPKA
chains in the Genus database with same CATH superfamily
1IDSA 3BCCH 4DR3O 3AG1B 5L3BA 5IYBO 1W59A 3ABLC 4I9WA 1QCEA 3K03A 3ABUA 5LP6A 1H8HG 4KHPO 2YIBD 4RWUA 5LP6C 2PI5A 4DUZO 3BA8A 2Z5UA 1H2KA 4JAAA 3THOA 3PN1A 3ZJZA 4O2BB 4WFBV 5B1OA 2DYSC 1FFXA 3OW2U 2HVJC 1DF5A 3STZC 1UJWB 3EHBB 3ZMZA 3ZN1A 1XUQA 2QJ1A 3CSXA 1JVMA 5IT9N 1V54B 1NKDA 4WFGA 1JFFB 2ZXWC 3CWBH 3HKDB 3UO3A 1XHZA 1S76D 2RN9A 2A0LA 5JCOA 2MK3A 2R9AA 2WWWA 4AI8A 1NZ6A 5JH7B 5CBFA 1MZEA 2GTSA 1D2DA 2UUAB 1E79G 4GLXA 4QE7A 4WCEV 1Q6IA 2HP8A 4O2BA 4YIPA 5CBHA 1FXKB 5IY5B 3E2EA 2AW9A 2DW4A 3C3TA 2ZD9A 3HKEA 4GX5A 2QE7G 4PI0A 4DK1A 3L72H 1PKXA 1R6NA 1J95A 4GKKO 4WBNB 2QTSA 2E76B 4JYBA 3UO2A 5H6QA 3ETGA 3OD4A 3SPCA 3JALB 3G6EV 4F6EA 1Y6XA 1S5LZ 1GM8A 4ZIBA 2OWOA 4MVSA 1AI7A 2NN4A 3CPWU 3KZIZ 1SQXH 1K92A 1ZUQA 1PL0A 2ITCC 4BW5A 4P9PA 4PHZA 1XREA 4JTAB 1AVMA 1DGSA 4UVAA 1R6KA 3K3WA 5C8YB 5KX5B 4I55B 4O2AB 1GRJA 1IBMO 4FIPC 3AK3A 2A3QA 1CP9A 2QWPB 1PPJH 4U3FH 3H1HH 3MDSA 4I5SA 3GVMA 2JVDA 2G38A 1JX9A 1K9MW 2Y48A 3EXAA 3S3WA 2X0LA 3A0RA 5L3DA 2ADQB 1BL8A 1NTKH 3DSQA 3E8FA 4DUYO 5ITZA 3BA9A 3E8GA 3WB2A 2Q7EA 2F1MA 2B5UA 1TAEA 2LP7A 1XNRB 2OYQA 3SYCA 4X9QA 1M1KW 5K1PA 2Q67A 3CE2A 4YJ3B 3WFVA 1L0LH 3SJBC 4K8ZA 1GN4A 1K73W 2IJHA 3CCJV 2P67A 1JOYA 3RYFA 2YICA 4HZ3A 4FLUA 1SETA 3TK1A 2CUGA 3L70H 5LMUO 3JD3A 4TWKA 4EKWA 5K1XA 2V7QG 4UCRA 4MVQA 4AQYO 2FL4A 3E83A 2WLHA 4O4JA 4DUZB 3H1KH 4DV3B 2ILMA 3UKMA 1IBKO 1TVKB 5HFLA 2QA4V 1JMKC 1QQCA 2IH3C 1XNRO 4I0XB 5EC1C 4BW9A 1K34A 3E89A 4KL1A 4X66B 3T1HO 3HKCA 4JI8O 3SDLA 3ETEA 5B5EZ 1VQ8V 1FJGO 5B3SB 3TCUA 1GO3F 3CP1A 5A9GA 4EFBA 4DR1B 4DR2O 3JASA 1NTZH 3SJCC 5L3CA 3UCSC 3ETQA 4GX2A 1BS3A 1Y67A 4MTOA 1D5NA 4JI3B 4CS2A 4MSWC 2V1DA 5LGNA 5JQGA 3IFXA 1PNMA 5IDJA 3CMEV 2IM9A 1K5SA 4GX0A 4PI2A 3RVYA 4Z1VA 3LNNA 3CMAV 1Y74A 4CBCA 3CC7V 2LW1A 2X6AA 4O4IB 2OTLV 4TUYA 3U11A 4NB5A 4U7OA 4YHHO 2ZIMA 1S0VA 1JA8A 1N36B 2W6IG 4JYYA 2UXDB 4LF6B 1HNZO 4UV9A 3A2FA 3D36C 4IHJA 4DV1B 2PY5A 3B8MA 1US6A 1NVPD 3OTOO 2DYRB 3P3PA 3MHSC 5J2TA 2UU9O 3DC6A 3G67A 4UB6Z 3LSSA 3OEHG 4X88A 4NYKA 5C93A 2CH7B 3RYIB 2OIEA 3IC7A 1KQSU 4ZKIA 4FM0A 2QWRB 5BXZA 4IIJA 3E22B 1WA8B 4DRXB 4NKGB 4W4LA 3ZHRA 5IYZA 2HLDG 2PI4A 1WB7A 4U3JA 4YXWG 3D36A 1QNMA 2F4VO 3SPIA 1EN4A 4OPHA 3CC4V 4LFCB 3TXSA 1P7GA 4UUJC 1I5YA 1FFTB 1SERA 3K06A 5FNVB 3MAQA 2P22C 1QVFU 5KMGB 4MT8A 1K4CC 4B3SB 4LBEC 1YCIA 3VOUA 2B1IA 1K7DA 4F6RA 3CC2V 4ZI7A 2PTMA 2R72A 4H33A 3T1CA 2YS8A 4IYHA 4JTCB 1I7FA 3VQWA 3CRRA 3E22A 4DXWA 3ZS8C 4LFBO 3RWRD 1NH2D 2UUBB 1XMQO 5LHHA 1XHXA 3ZHVA 5CA0A 4DV7B 3BY6A 2Y0PA 1T5EA 4BWAA 2H94A 2QKCA 2HR3A 1G1XB 2JEXA 3GWOA 1VF7A 1NU1H 1OJHA 2GDSA 3O65A 1IX9A 2ZE7A 1B6QA 2OT5A 3B09A 2FYUH 3APOA 4BAYA 2KSDA 4GKKB 4B3MO 4FFKA 4GKJO 4B7KA 1SA0B 2GUZA 5DM6V 3CRMA 1O9GA 1QLEB 3P3NA 1S77D 2YSUB 5A2QN 4TOIA 2NR5A 3ZRXA 4UCVA 2EZOA 3BABA 2XAHA 1OCCB 4G27B 2Y69B 3JASB 4CS4A 5JVDA 4LR3A 4RO2A 4JTDB 4O4HA 4R8CA 4JV5O 2EINB 3K9SA 1ZTEA 4E2LA 4JAVA 1JR9A 2Q73A 3FB6C 4JI2O 4MTGA 1EM1A 2ZDIC 1EZVH 3OEEG 2E74B 1M56C 4EFEA 1M57B 4DR7O 2RMKB 1BZKA 5LGTA 1UPGA 3ZEDA 1O9HA 4X1KA 4JI1O 3OR7C 1ZL8A 4B08A 4DW1A 1KU9A 4X1YA 4JI7O 5IYDO 1RP3B 5KHJA 2ZNJA 1WP8A 2D3OW 5GONA 2QDOA 4DV5B 3FAVB 4ASUG 1SA0A 2YXYA 3LSUA 3JD2A 2DJVA 3HPLC 3LDCA 4JI6O 4KHPB 4JZ2A 3JYCA 4FVMA 3DC5A 1SRYA 3OUFA 4X65O 5HFMA 1Q8IA 2PF4E 1XL4A 2UXCO 1MA1A 3SPJA 2ZR3A 2QWOB 4O4HB 2WA4A 1L1FA 2UXXA 1J5EO 3Q4HB 3TXQA 4RAIA 2XAGA 4ZHQA 4D7SA 3HR0A 1N36O 2H3OA 2QGNA 3ZHSA 1P84F 4X1IB 3N27A 4FFBB 2UXDO 3K57A 1PD3A 2GUZB 5LXTB 4FLXA 3K5NA 3L9DA 3BRCA 5IY5C 1URFA 4BIZA 4TV8B 4NTYA 4X1IA 2CTWA 3AG3C 3UQ8A 2Z3YA 3FB5C 1I5XA 4RUEA 3RYFB 4MVMA 1XNQB 1XMQB 4I0XA 4JI4O 1GKFA 4JGSA 1F4MA 4E4EA 3RYHB 1MMMA 2DE0X 4TQFA 4LF9B 1AI6A 1M57C 2DN9A 1N34B 3VQXA 2QWNB 1U97A 3FD9A 4Z2WA 1P7BA 2ZKOA 3NXSA 1DLBA 1OCRC 4K0KO 2EINC 3P30A 4O4LA 1E1RG 4UFZA 4DR1O 1AJPA 1F51A 4H0LB 3JATB 1IBLO 2P7TC 2HFEC 5C8YA 4JI8B 2LFRA 5CA1B 1H2SB 4B3RO 1AI4A 2FTKA 1SQQH 4J7KA 5EZYA 4NXMO 2A7WA 5GONB 1Q7YW 1Q5OA 3JAKB 1TGOA 2EIKB 3AG2B 3IJ4A 1HR0B 3AK1A 3U10A 2OIGA 2BOBC 1H2LA 2NNUA 4NXMB 2PZSA 4IGGA 3CRQA 4FLVA 3JCUZ 4JI5B 2P06A 2P6JA 2ZIOA 1Q3EA 1SQVH 4Q6GA 1R3KC 5JVDB 5TISZ 1Q6HA 1GM7A 2UXNA 1RPRA 2FKXA 3ABKC 2QM8A 5EZYB 3ZBHA 1F4NA 3CCSV 1CPYA 4DV7O 5JJEB 3T1HB 4JYAB 4DV1O 3KCXA 4LF8O 1GK9A 1HNZB 3ZMVA 2VRZA 4QPKA 3T2MA 1MABG 1SF9A 1M9NA 4DV6O 2GV9A 4XBFA 5B3SC 1WP7A 3ZMUA 2BSKA 5AG2A 5EBLC 1OCRB 4TV9B 3W7UA 2VQFO 1YF2A 2YDEA 4EB6A 1GN6A 2YIBA 4N21A 2JJ1G 3K59A 2VQEB 4O4JB 4CH6A 1HW7A 3BPZA 1TUEB 4JI0O 3ASOC 1LR1A 3RYHA 4C7UA 2AHYA 4OX9O 3AG4B 3IC9A 5B1AB 3JD4A 1Z2GA 5LA6A 2CDYA 1OV9A 4PA7A 3MHHC 3QO8A 2F4VB 3CEIA 1KB9F 3W7TA 1X4TA 4IL6Z 1IURA 3CXCU 3RYCA 4X64B 5KHGA 2XTAA 3AG2C 4LNUA 4I50A 5BMVB 2XT9A 2LJ2A 1IBKB 2AHZA 5CA0B 1M5IA 4B3TB 4TT3G 2F95B 4RUFA 2P4KA 3G71V 1VQ6V 3OMNB 1P4RA 4UB8Z 4PDLA 3JD1A 1ORQC 4QIWF 1AP6A 1K97A 4NVPA 3B77A 3N2KA 4UV8A 5L3GA 2P90A 4FK5C 2YXLA 3GWKC 3FAVA 4PA4A 2WLJA 2CGOA 1HWYA 1YXBA 4CC5A 3QNEA 5H2FZ 4UCSA 1AR4A 4QGPA 3ZRWB 4DV0O 4DR6O 2AXTZ 2EZPA 1N0JA 2HJDA 3ABKB 2D2CB 3AG7A 3SYPA 3ZRSA 3RW0A 2XAFA 3A0BZ 5KA5A 4FLWA 3ABTA 3R65A 1KKDA 2ZM6O 2YC0A 4XDKA 3ZIAG 1BHBA 4LC1A 2DOSA 1OHHG 1SS3A 2E75B 4U7NA 2W0FC 1QR9A 1IBMB 4KUMA 2LGWA 3WG7B 4LP8A 4KXRA 2DQ0A 1S5HC 1RPOA 3FYIB 1BGYH 1HP8A 5E1AC 1WA8A 3CXHF 5D5QA 1N34O 1AJNA 4GZRB 4ZOLB 2DWDC 5B1NA 2BTOA 2EIMB 1K5QA 2Q0OC 3K79A 2IJKA 1Z5VA 1FXHA 1AR5A 1K3EA 3JATA 4FZ1A 5EIBD 4LFCO 4RQFA 4HNAB 4X1YB 4LWSA 3S3XA 1QHTA 2P4VA 3CCMV 4CC6A 3SGIA 2LGQA 2WLLB 4P9OA 1KYOF 2O57A 3CCEV 4QE9A 2QEXV 3PJSK 1JJ2U 3P32A 4MVUA 5FL7G 1FD9A 1G4YB 2JEUA 3E8BA 1Q81W 1N8RW 1NQTA 1VQMV 2ZDIA 2DWEC 3SJQC 1FAFA 1AB3A 1GM9A 1AROP 1V54C 4J41A 3OAAG 1YIJV 4MW8A 3QO7A 4X64O 1SESA 2Y0IA 5L3FA 3I5DA 3X2QC 3LDEA 3QG5A 3WG7C 1JJOA 1JCHA 4BIUA 3ABMC 4B3MB 1X59A 4ZBMA 3H1IH 4P30A 4MTFA 3BAAA 1QU7A 1B06A 4LF4O 1Q43A 1IBLB 5LHGA 1V9PA 3OGCC 1XBLA 1YJ9V 2RCVA 1XI1A 4DUYB 1KUQA 1J5EB 3OR6C 4LFBB 1FYJA 3Q4HA 3N2GB 3SYOA 4B3TO 2IJIA 1Z5WA 2AZ2A 4LF5B 3K04A 2XUMA 4PDRA 4FLZA 2JGUA 3L71H 4H44B 5J2TB 1RFYA 5KAFZ 3OGIB 1PNKA 1GH6A 3JAWB 1XEQA 1YTFD 2DYRC 3HB3B 2E5LO 4L87A 3D3QA 5H9CA 4CH5A 1VIBA 3AG3B 3OUSA 1KP3A 3D3IA 2CE4A 4LFAO 1I94B 2CK3G 4OX9B 2AZ0A 5J2UB 1S72V 2V4DA 3M8AA 2WLKA 3J81N 2YEVB 1V55C 3U0ZA 5LOVB 4X66O 5GW7A 1YZBA 2Q4PA 5CBGA 4ZOLA 4PV1B 3ZN0A 4D7TA 3W7XA 3SPHA 4N23A 4TSFG 2JK5C 1PV0A 3ML0A 4DV6B 2K1EA 2Q6AA 1JFFA 4WFFA 5LMUB 3H1LH 3BVOA 3CX5F 4LFAB 1VQ5V 1KP2A 1R3JC 1TVKA 1KECA 4K3AA 2Q5ZA 5IYCO 3LUTB 1DK1A 1B3QA 1KD1W 1NR1A 4JI0B 2X6CA 2L35A 4MW3A 1WN7A 1KBHA 3ASNC 2VQEO 1XNQO 3UT5B 4FLYA 1G6UA 5BR8O 2KG7A 2OCHA 1BE3H 1R6TA 4CH4A 2ZNIA 1VEWA 1YJWV 4LF5O 3D8CA 4X62O 3L75H 1BQZA 3H01A 1F23A 1BMFG 3CYOA 4J10A 5DECA 2Q68A 4DR3B 2DQ3A 1WB8A 4MVOA 2W0XA 2N04A 4LH6A 2BTQB 2ATKC 1FS0G 2ZXWB 3DXRA 2Q9LA 1VF6A 4LH7A 1W0JG 4YIOA 3T1YO 4DRXA 1AP5A 2QKAA 4WFHA 3SPGA 1YDXA 4J7JA 2M7WA 3A8TA 4UCOA 2DYSB 2WA3A 2ZE5A 1R3IC 2F93B 4MS2A 3K58A 4BIOA 1FXKC 3QF7A 3OM3B 3ASOB 1SQBH 3DTUB 3K08A 2ZQMA 2F66C 1VQ4V 2FMLA 5LHIA 4PD4F 2CTQA 3CD6V 1NT2B 4FMTA 2KQXA 4JI7B 4PELA 2R9RB 4R6ZA 4B3RB 4DR2B 2BTQA 3BHPA 4ABMA 1COWG 2WLNA 5D5PA 1OCOC 5LL6Y 4NXNB 1PL4A 5CMUA 1BHAA 3OTOB 2UU9B 5IYZB 2Q0AA 3RN4A 2JGDA 1CXZB 3CRAA 3T4DA 3WB1A 1VQ7V 1HDJA 3R66A 2R70A 3T4ZA 1W0KG 2P5OA 4QJFB 1GAXA 2IU0A 3OTFA 1N32B 2LW7A 4WBNA 4K0KB 2EX3A 3O9OA 3AK2A 5KX5A 2X7RB 5E79Z 3APQA 1MNGA 2WLIB 4YHHB 2JIZG 3KG2A 1R73A 2BE3A 5LA6B 2ZE8A 3CCUV 3JARB 2JDIG 1M4UA 3ZHQA 2KG7B 3IAYA 2M6YA 4DYLA 4JASA 1WNSA 1ZL8B 4CZZA 4XDLA 1S5JA 1KC8W 3RBZA 2ZR2A 1R3LC 1G8MA 2A79B 1EFRG 2PUSA 1YVWA 4JI3O 5JH7A 3JAKA 1Y4MA 1OZ0A 4H13B 3F5WC 1RSOA 4YY3O 1YJNV 5F2VO 3SJAC 1SKVA 2A06H 3DGEA 3VQVA 4F4LA 3J80N 5H6RA 4Q20A 2HG5C 4B7EA 2RQ6A 2EIJB 3CJHA 4YY3B 2JGDB 1H8EG 4WFEA 2GTAA 1KMIZ 5B1BB 4GCZA 5J9PC 5CA1A 2Q8VA 4IYIA 5LXTA 2YIAA 2AGAA 4OXSA 2DMXA 5KA6A 3ETDA 1I0HA 2VWJA 1ENVA 3TGUH 2Y69C 4ZI7B 4DV0B 4RQEA 4GKJB 2LQTA 1QR8A 1NI8A 3FKSG 1F7YA 2E3CA 3ZCCA 2XAJA 4G28B 3WB0A 1ZSPA 4TV8A 3JCZA 2Z0AA 4I55A 1DF4A 2QTOA 5B66Z 3ZHUA 5L3EA 3OMAB 1M93A 2L6LA 2WLMA 1FKAO 1TUBB 1YEWA 3W7SA 3SR2C 3OT7A 4I9QA 1WPBA 1GTOA 1H38A 3QTCA 4DV2B 1XOUA 3FFQA 4J9ZB 4LF6O 1RSOB 1JPXA 2UUCO 2R9IA 2HEPA 3SYQA 1Y76B 1Y74B 4QPJA 1CEZA 2IJJA 2EULA 3EVKA 1QLNA 3K0GA 4WF9V 2IU3A 3X2QB 1N33O 4GT1A 1YITV 1MSWD 2RNBA 2QM4A 2N74A 2ZT9B 1SQFA 1WJZA 3JD0A 2BSKB 1PP9H 4UVCA 4R50A 3LNMB 4DV2O 5FLXN 4W4KA 1H2MA 3W7WA 4FLTA 3CJHB 1VP7A 5KHIA 2EIJC 3AG4C 1FXKA 4LCUC 2GSMB 4O4IA 4J11A 3QO5A 5LBQA 1VF5B 3ZHTA 1E1QG 1S3JA 5IE9A 3JARA 4JPRA 4D6TH 1Q82W 4B3SO 4A5UB 2QR4A 3E35A 1K8AW 2JS5A 4J80A 1LUVA 5LYJB 4NXNO 4GYCB 1NH2B 3EFFK 4DV3O 2Q7GA 5JQGB 1OCOB 3B2EE 2B9ZA 4J7ZA 1EZJA 1WLEA 3JSLA 4JI4B 4HYOA 1MOFA 5DN6G 1PNLA 2YEVA 1BSMA 3K9AA 3BEHA 4J42A 2LO1A 5IJ9B 3JAWA 1N4CA 3L73H 3H9VA 3WU2Z 5GTIZ 4X20A 1ZLZA 1XL6A 1NVPB 3RGBA 5EYPB 1RM1B 3I56V 1YI2V 1NR7A 2BOCC 2GBOA 3B8NA 3VBBA 2ZINA 2CTRA 3NR7A 4JAUA 4K35A 1QBZA 1L0NH 1A32A 4AHCA 4CS3A 1AR1B 1QLEC 4LNUB 2ADPA 3F7VC 3C3SA 3CCVV 5LP6B 3TJTA 2CH7A 2ZE6A 4JYCA 5BY1A 1FPOA 1ZWIC 4DV4B 2HJFC 4LF9O 4K8XA 3OMIB 2CGNA 3ZRWA 1P49A 5EIBC 5FPRA 3CCRV 3N2KB 1ROPA 5LMNO 2XAQA 4NR1A 1JQ0A 2HHHO 2WPDG 4I4TA 3RYIA 1OCCC 2YI9A 4QNHB 1GMGA 5IJ0A 4P2ZA 3CCLV 5KAIZ 2C2AA 5GTHZ 2CAZC 4FM1A 3JAMN 4HAMA 4UXNA 2WLLA 2QKSA 3ZMTA 1EN6A 3K5OA 3VQYA 3T1YB 3KKYA 4LF4B 4X8AA 2ITDC 3CHXA 2EILC 2ETNA 2OCCC 4J9YB 4MTXA 4JI6B 1R1BA 2QSAA 4X65B 4FJCC 3ZX6A 5EK0A 5B1AC 4CH3A 2QWQB 4JI5O 1VQNV 2JRIA 1XMOO 4FZ0A 1HNWB 4BR6A 3UT5A 4DR5B 1MZFA 1B04A 4X62B 2MW2B 4IT5A 2HHHB 1YSCA 2IH1C 5KLVH 1YHQV 4DR7B 5BR8B 1N33B 3SYAA 2XHBA 4L8JA 1SQGA 3CCQV 1OCZB 2ODMA 1XILA 4TV9A 3HKDA 1RM1C 3HKEB 3M7MX 1AJQA 2UUCB 1Q90D 3ABMB 2YXHA 2KKWA 2XNDG 2ZCEA 2VQFB 3TETA 4JV5B 5H5NA 4X1KB 2VS0A 3K5MA 1M90W 3B40A 5CN0A 4YJ2B 3MD0A 2WLIA 4YJ3A 5CA3A 1VQPV 3G4SV 1IVSA 1Y76A 1VQOV 3BFRA 4KP4A 3F5TA 1AILA 1KKCA 5EBMC 2YIDA 3F7YC 1MSDA 3JSNA 2UXBB 2YI8A 3OE7G 3FB7C 1SC5B 4R7CA 3B4SA 2EILB 2OCCB 3AG1C 3L74H 5BZBA 3ABLB 1WAZA 3ICXA 5IJ0B 3N2GA 2JJ2G 2PYLA 2JS3A 3G6BA 2CTPA 1HR0O 4FPPA 2E5LB 1VMGA 4X89A 1VF6C 2ARHA 4GUNA 1IXBA 2UXCB 2Q69A 2EIMC 1HNWO 4KFMA 4JF3A 2HKOA 4JI2B 2RDCA 1IXMA 5KUMA 3HKCB 4LF8B 4ICGA 1FFXB 4OPAA 3UM7A 4I7ZB 1NTMH 4O4LB 2QM7A 3KCYA 5LGUA 4AILC 4FFBA 1QVGU 1FXVA 1Q6UA 1BQ0A 5JJNB 5EBWC 3RT3C 5JCOC 2HVKC 4DV5O 3RYCB 5IWAO 2EIKC 4FM2A 4UCTA 3GB7C 1VQ9V 1THZA 1SZXA 2A9HA 1NS1A 4GX1A 3OFNG 1TUBA 3CRCA 1DTOA 4O2AA 4YJ2A 2K9PA 5DEDA 4WFAV 4IIJB 3J7AU 1LNQA 3K0DA 4MVRA 1ZAUA 5J2UA 2EBOA 4PA3A 2F43G 1NJIW 1K33A 4EB6B 3AEIA 2N05A 4TUYB 4H37A 1VARA 3RFRA 2F23A 2H8PC 2KB1A 3CS5A 3STLC 4ZHQB 3ASNB 2Y4TA 5IJ9A 1IZ3A 4IHJB 2W6JG 4G2KA 3K5LA 2X6BA 5B1BC 1UFIA 1HNXB 4JYAO 2IW5A 3ZMSA 1Q86W 5CB4A 3C90A 5EYPA 4DK0A 2EJ7A 3HKBB 4LF7B 4PJ0Z 1N0NA 1I08A 4DW0A 2XASA 1YTFB 4LWSB 5LYJA 5CB4B 2ZM6B 1H2NA 2OTJV 1EBOA 1MG1A 4TQDA 4PA9A 3FX7A 5KHHA 2B1GA 4DV4O 2UUBO 5LOVA 2WAMA 3G80A 4NTWA 2VWKA 1EN5A 2WSSG 4XDJA 4HBNA 4PDVA 4UCUA 3ZRVA 2IBZH 2GHYA 2UUAO 2XOKG 3IGAC 1NBMG 3HKBA 1LUWA 2PYJA 5KUKA 4OGQB 5IWAB 1GN2A 1N32O 3I55V 1VQKV 1FJGB 2RJZA 1K4DC 4LF7O 4UVBA 2LFSA 4PA6A 1U96A 4DR4B 5JWPA 3LSQA 4F6RB 1D5AA 1ZX3A 5KHKA 4DR4O 1BT8A 1XDCA 3E8HA 1Y66A 1I94O 1SZTA 1AI5A 1W2BU 1PM9A 1H2GA 3M99B 1WPXA 5FPOA 1OCZC 4Z1MG 1M56B 4EEQA 5LMNB 4AQYB 5ITZB 3LDDA 3DXRB 4DO2A 1V55B 4JI1B 4DR5O 2PGGA 4U3JB 3CB2A 1XMOB 3H1JH 1XQ8A 1SQPH 5JJJB 4DR6B 2FB5A 5FNVA 4PDMA 2Q7HA 4I50B 5BMVA 4I4TB 3FYEB 2Y4UA 5KMGA 4X20B 2UXBO 4MVZA 1BCCH 3FB8C 1GN3A 1HNXO 5EC2C 4NTXA 1VQLV 4JZGA 1L8DA 3A0HZ 4HNAA 2BCCH 2NLJC 3JALA 3QVNA 3E86A 2YUAA 3RVZA 1TA8A 2EJRA
chains in the Genus database with same CATH topology
1PNLA 2YEVA 3SYOA 3AG1B 4ASUG 3K9AA 5L3BA 2IJIA 3BEHA 5IYBO 3ABLC 4I9WA 3K04A 1QCEA 3K03A 4PDRA 3ABUA 1H8HG 3JD2A 3HPLC 3LDCA 1XL6A 1NVPB 1PNKA 3JYCA 2PI5A 1SRYA 2Z5UA 1YTFD 3OUFA 1RM1B 5HFMA 3ZJZA 2DYRC 1XL4A 4WFBV 3HB3B 5B1OA 2DYSC 3I56V 1YI2V 3SPJA 1NR7A 2BOCC 3B8NA 2ZR3A 4L87A 3VBBA 5H9CA 3OW2U 1L1FA 2UXXA 2HVJC 4JAUA 3AG3B 1QBZA 1DF5A 3STZC 3OUSA 1KP3A 1UJWB 3EHBB 4RAIA 2XAGA 3ZMZA 3ZN1A 3D3IA 1JVMA 1AR1B 1QLEC 1V54B 1NKDA 2CK3G 3F7VC 1PD3A 4WFGA 3CCVV 2ZXWC 4JYCA 1ZWIC 1S72V 5IY5C 2WLKA 1S76D 4BIZA 2YEVB 1V55C 2A0LA 2HJFC 5GW7A 2MK3A 3AG3C 2WWWA 5CBGA 2Z3YA 3OMIB 3ZN0A 3W7XA 5CBFA 3FB5C 1I5XA 3SPHA 3ZRWA 4RUEA 4MVMA 3CCRV 4N23A 1ROPA 4TSFG 2JK5C 2XAQA 3ML0A 1E79G 1JQ0A 4QE7A 4WCEV 2K1EA 1GKFA 4JGSA 1F4MA 5CBHA 1FXKB 5IY5B 2Q6AA 2WPDG 3E2EA 1AI6A 4WFFA 1M57C 2DW4A 1OCCC 2ZD9A 4QNHB 1GMGA 1VQ5V 4P2ZA 4GX5A 3CCLV 2C2AA 1P7BA 1KP2A 1R3JC 2QE7G 1DLBA 3NXSA 1OCRC 1KECA 2EINC 3P30A 4HAMA 5IYCO 3LUTB 4UXNA 1PKXA 1R6NA 2QKSA 2WLLA 1E1RG 3ZMTA 1J95A 1KD1W 1AJPA 5DN6G 1F51A 4JYBA 1NR1A 5H6QA 3ETGA 2X6CA 4MW3A 3SPCA 3G6EV 2P7TC 3ASNC 1GM8A 4MVSA 1AI7A 2HFEC 2ITDC 4X8AA 3CPWU 2EILC 2OCCC 4J9YB 4MTXA 2LFRA 1K92A 1PL0A 4FJCC 2ITCC 1YJWV 5EK0A 5B1AC 4BW5A 4P9PA 1AI4A 2FTKA 4JTAB 1VQNV 4UVAA 1R6KA 3K3WA 4FIPC 3H01A 1CP9A 1F23A 1BMFG 3CYOA 1Q7YW 4I5SA 2EIKB 2Q68A 3AG2B 1JX9A 2DQ3A 1K9MW 2Y48A 2X0LA 2BOBC 1YSCA 2NNUA 4MVOA 3A0RA 5L3DA 2IH1C 1BL8A 1YHQV 2ATKC 2P6JA 3E8FA 1FS0G 2ZXWB 3SYAA 3E8GA 1W0JG 1R3KC 3CCQV 1OCZB 1GM7A 2UXNA 4WFHA 1RPRA 3SPGA 2B5UA 2LP7A 1RM1C 3ABKC 2QM8A 2M7WA 1F4NA 3SYCA 3CCSV 1M1KW 1CPYA 2DYSB 1AJQA 2Q67A 3ABMB 2XNDG 1R3IC 3WFVA 1GK9A 3TETA 1K73W 3ZMVA 2IJHA 3CCJV 2P67A 1JOYA 4MS2A 1M90W 4QPKA 3T2MA 4HZ3A 1SETA 5CN0A 1MABG 3TK1A 1FXKC 3MD0A 2WLIA 3OM3B 1M9NA 3ASOB 3DTUB 3JD3A 4XBFA 3K08A 4TWKA 4EKWA 2ZQMA 5CA3A 3G4SV 1VQPV 1VQ4V 2V7QG 1VQOV 5LHIA 4MVQA 5B3SC 3CD6V 4FMTA 3E83A 2WLHA 4KP4A 3ZMUA 4PELA 2R9RB 5EBLC 4R6ZA 1OCRB 3W7UA 3UKMA 5EBMC 1COWG 3F7YC 2WLNA 1OCOC 5HFLA 4N21A 2QA4V 2JJ1G 5CMUA 3OE7G 1BHAA 2IH3C 3FB7C 5EC1C 1K34A 3E89A 1TUEB 4R7CA 3ASOC 2EILB 2OCCB 3AG1C 5BZBA 3ETEA 2AHYA 3ABLB 1VQ8V 3AG4B 5B3SB 3T4DA 1VQ7V 5B1AB 3JD4A 3T4ZA 2JJ2G 3TCUA 1GO3F 1W0KG 3CP1A 4QJFB 4PA7A 2IU0A 3MHHC 3QO8A 3W7TA 5L3CA 4FPPA 3CXCU 2X7RB 4GX2A 4X89A 4MTOA 2WLIB 2JIZG 3KG2A 1R73A 3AG2C 3CCUV 2Q69A 2EIMC 2V1DA 4MSWC 2JDIG 4KFMA 5LGNA 4JASA 4JF3A 2HKOA 4CZZA 1IXMA 5KUMA 4XDLA 3IFXA 1PNMA 5IDJA 3CMEV 1KC8W 3RBZA 2ZR2A 1K5SA 4GX0A 2AHZA 1R3LC 3UM7A 1G8MA 2A79B 4TT3G 3RVYA 4RUFA 1EFRG 3CMAV 3G71V 1VQ6V 2QM7A 5LGUA 3OMNB 1P4RA 4CBCA 3CC7V 4PDLA 1QVGU 1FXVA 2X6AA 1Y4MA 1OZ0A 5EBWC 2OTLV 3JD1A 1ORQC 4QIWF 3F5WC 1K97A 2HVKC 3B77A 4U7OA 1YJNV 4UV8A 5L3GA 2EIKC 2P90A 4FK5C 1S0VA 3GB7C 2W6IG 1VQ9V 1THZA 3DGEA 4F4LA 2A9HA 4GX1A 4UV9A 5H6RA 4PA4A 4Q20A 3OFNG 2WLJA 2HG5C 1HWYA 1DTOA 3QNEA 2EIJB 3B8MA 3ZRWB 1NVPD 1H8EG 4WFEA 2DYRB 2EZPA 3MHSC 4WFAV 1LNQA 3ABKB 3K0DA 5B1BB 4GCZA 3LSSA 4MVRA 3SYPA 3ZRSA 3OEHG 5J9PC 3RW0A 2XAFA 5KA5A 4X88A 3ABTA 3R65A 5C93A 2EBOA 1KKDA 4PA3A 2F43G 1NJIW 1K33A 3IC7A 1KQSU 3AEIA 4ZKIA 4H37A 4OXSA 5KA6A 3ETDA 2H8PC 4XDKA 3ZIAG 1BHBA 2KB1A 4LC1A 3STLC 3ASNB 1OHHG 1ENVA 2W6JG 2HLDG 4G2KA 2W0FC 4U7NA 2PI4A 1QR9A 2Y69C 4YXWG 3D36A 2X6BA 5B1BC 4RQEA 4KUMA 3SPIA 3WG7B 4LP8A 3CC4V 2DQ0A 1S5HC 1RPOA 2IW5A 1QR8A 3ZMSA 3FYIB 1Q86W 3FKSG 4UUJC 5E1AC 3ZCCA 1I5YA 1AJNA 2XAJA 1FFTB 1SERA 3K06A 2DWDC 5B1NA 4G28B 1QVFU 2EIMB 1K5QA 3JCZA 3K79A 2XASA 1DF4A 2IJKA 1YTFB 4MT8A 1FXHA 2QTOA 5L3EA 3OMAB 1K3EA 2OTJV 1EBOA 1K4CC 2WLMA 4LBEC 1MG1A 3W7SA 3VOUA 4PA9A 2B1IA 1K7DA 3CC2V 4RQFA 2B1GA 3T1CA 4H33A 1GTOA 4JTCB 3CCMV 1H38A 4DXWA 2WAMA 2WSSG 4XDJA 2WLLB 4P9OA 4PDVA 3ZRVA 1NH2D 2GHYA 2XOKG 5LHHA 3IGAC 4J9ZB 3CCEV 4QE9A 1NBMG 1JPXA 2QEXV 3PJSK 1JJ2U 2R9IA 3BY6A 5KUKA 3P32A 4MVUA 3I55V 3SYQA 5FL7G 1VQKV 1K4DC 4QPJA 2H94A 1G4YB 2HR3A 2JEUA 2IJJA 2JEXA 3E8BA 4UVBA 1CEZA 2LFSA 4PA6A 1Q81W 1N8RW 3GWOA 1QLNA 3K0GA 1NQTA 4WF9V 2IU3A 3LSQA 1VQMV 3X2QB 2ZDIA 1B6QA 2DWEC 4GT1A 2OT5A 3E8HA 1YITV 1MSWD 4BAYA 1Y66A 3SJQC 1SZTA 1AI5A 1W2BU 3JD0A 4UVCA 5DM6V 1GM9A 1AROP 1H2GA 1QLEB 3LNMB 4R50A 1V54C 1S77D 3OAAG 3M99B 1YIJV 2YSUB 4MW8A 3W7WA 1WPXA 3ZRXA 1OCZC 2EZOA 3QO7A 1M56B 4Z1MG 2XAHA 2EIJC 1OCCB 1SESA 4G27B 2Y69B 5L3FA 3AG4C 3LDDA 1FXKA 4LCUC 3X2QC 2GSMB 4RO2A 4DO2A 3LDEA 1V55B 3WG7C 1JCHA 4BIUA 4JTDB 3QO5A 4R8CA 3ABMC 5LBQA 2EINB 1E1QG 4E2LA 1S3JA 4ZBMA 4JAVA 4P30A 4MTFA 4JPRA 3FB6C 1Q82W 4MTGA 4PDMA 2ZDIC 3E35A 1K8AW 3OEEG 3FYEB 1M56C 5LHGA 4MVZA 1M57B 3OGCC 3FB8C 1YJ9V 5EC2C 5LGTA 1NH2B 3EFFK 1VQLV 3OR6C 3OR7C 1OCOB 2NLJC 5IYDO 1EZJA 3E86A 1WLEA 3RVZA 2D3OW 2EJRA 4HYOA 1MOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCZ A;  2FTK A;  2C2A A;  3P32 A;  3TK1 A;  4JAU A;  2WWW A;  3MD0 A;  3NXS A;  4QPJ A;  4U7O A;  3ZRX A;  5C93 A;  2LFS A;  4JAS A;  3ZRW A;  3ZCC A;  3DGE A;  4ZKI A;  1IXM A;  4FMT A;  5B1N A;  1F51 A;  2QM8 A;  4JYB A;  4KP4 A;  5IDJ A;  4Q20 A;  4BIU A;  4I5S A;  4GT1 A;  4LC1 A;  4JYC A;  3ZRV A;  3ZRW B;  4JAV A;  4MT8 A;  4MTX A;  4FPP A;  2QM7 A;  2LFR A;  4BIZ A;  4U7N A;  3A0R A;  2P67 A;  1JOY A;  5B1O A;  3D36 A;  4QPK A; 
#chains in the Genus database with same CATH topology
 1IDS A;  3BCC H;  4DR3 O;  3AG1 B;  5L3B A;  5IYB O;  1W59 A;  3ABL C;  4I9W A;  1QCE A;  3K03 A;  3ABU A;  5LP6 A;  1H8H G;  4KHP O;  2YIB D;  4RWU A;  5LP6 C;  2PI5 A;  4DUZ O;  3BA8 A;  2Z5U A;  1H2K A;  4JAA A;  3THO A;  3PN1 A;  3ZJZ A;  4O2B B;  4WFB V;  5B1O A;  2DYS C;  1FFX A;  3OW2 U;  2HVJ C;  1DF5 A;  3STZ C;  1UJW B;  3EHB B;  3ZMZ A;  3ZN1 A;  1XUQ A;  2QJ1 A;  3CSX A;  1JVM A;  5IT9 N;  1V54 B;  1NKD A;  4WFG A;  1JFF B;  2ZXW C;  3CWB H;  3HKD B;  3UO3 A;  1XHZ A;  1S76 D;  2RN9 A;  2A0L A;  5JCO A;  2MK3 A;  2R9A A;  2WWW A;  4AI8 A;  1NZ6 A;  5JH7 B;  5CBF A;  1MZE A;  2GTS A;  1D2D A;  2UUA B;  1E79 G;  4GLX A;  4QE7 A;  4WCE V;  1Q6I A;  2HP8 A;  4O2B A;  4YIP A;  5CBH A;  1FXK B;  5IY5 B;  3E2E A;  2AW9 A;  2DW4 A;  3C3T A;  2ZD9 A;  3HKE A;  4GX5 A;  2QE7 G;  4PI0 A;  4DK1 A;  3L72 H;  1PKX A;  1R6N A;  1J95 A;  4GKK O;  4WBN B;  2QTS A;  2E76 B;  4JYB A;  3UO2 A;  5H6Q A;  3ETG A;  3OD4 A;  3SPC A;  3JAL B;  3G6E V;  4F6E A;  1Y6X A;  1S5L Z;  1GM8 A;  4ZIB A;  2OWO A;  4MVS A;  1AI7 A;  2NN4 A;  3CPW U;  3KZI Z;  1SQX H;  1K92 A;  1ZUQ A;  1PL0 A;  2ITC C;  4BW5 A;  4P9P A;  4PHZ A;  1XRE A;  4JTA B;  1AVM A;  1DGS A;  4UVA A;  1R6K A;  3K3W A;  5C8Y B;  5KX5 B;  4I55 B;  4O2A B;  1GRJ A;  1IBM O;  4FIP C;  3AK3 A;  2A3Q A;  1CP9 A;  2QWP B;  1PPJ H;  4U3F H;  3H1H H;  3MDS A;  4I5S A;  3GVM A;  2JVD A;  2G38 A;  1JX9 A;  1K9M W;  2Y48 A;  3EXA A;  3S3W A;  2X0L A;  3A0R A;  5L3D A;  2ADQ B;  1BL8 A;  1NTK H;  3DSQ A;  3E8F A;  4DUY O;  5ITZ A;  3BA9 A;  3E8G A;  3WB2 A;  2Q7E A;  2F1M A;  2B5U A;  1TAE A;  2LP7 A;  1XNR B;  2OYQ A;  3SYC A;  4X9Q A;  1M1K W;  5K1P A;  2Q67 A;  3CE2 A;  4YJ3 B;  3WFV A;  1L0L H;  3SJB C;  4K8Z A;  1GN4 A;  1K73 W;  2IJH A;  3CCJ V;  2P67 A;  1JOY A;  3RYF A;  2YIC A;  4HZ3 A;  4FLU A;  1SET A;  3TK1 A;  2CUG A;  3L70 H;  5LMU O;  3JD3 A;  4TWK A;  4EKW A;  5K1X A;  2V7Q G;  4UCR A;  4MVQ A;  4AQY O;  2FL4 A;  3E83 A;  2WLH A;  4O4J A;  4DUZ B;  3H1K H;  4DV3 B;  2ILM A;  3UKM A;  1IBK O;  1TVK B;  5HFL A;  2QA4 V;  1JMK C;  1QQC A;  2IH3 C;  1XNR O;  4I0X B;  5EC1 C;  4BW9 A;  1K34 A;  3E89 A;  4KL1 A;  4X66 B;  3T1H O;  3HKC A;  4JI8 O;  3SDL A;  3ETE A;  5B5E Z;  1VQ8 V;  1FJG O;  5B3S B;  3TCU A;  1GO3 F;  3CP1 A;  5A9G A;  4EFB A;  4DR1 B;  4DR2 O;  3JAS A;  1NTZ H;  3SJC C;  5L3C A;  3UCS C;  3ETQ A;  4GX2 A;  1BS3 A;  1Y67 A;  4MTO A;  1D5N A;  4JI3 B;  4CS2 A;  4MSW C;  2V1D A;  5LGN A;  5JQG A;  3IFX A;  1PNM A;  5IDJ A;  3CME V;  2IM9 A;  1K5S A;  4GX0 A;  4PI2 A;  3RVY A;  4Z1V A;  3LNN A;  3CMA V;  1Y74 A;  4CBC A;  3CC7 V;  2LW1 A;  2X6A A;  4O4I B;  2OTL V;  4TUY A;  3U11 A;  4NB5 A;  4U7O A;  4YHH O;  2ZIM A;  1S0V A;  1JA8 A;  1N36 B;  2W6I G;  4JYY A;  2UXD B;  4LF6 B;  1HNZ O;  4UV9 A;  3A2F A;  3D36 C;  4IHJ A;  4DV1 B;  2PY5 A;  3B8M A;  1US6 A;  1NVP D;  3OTO O;  2DYR B;  3P3P A;  3MHS C;  5J2T A;  2UU9 O;  3DC6 A;  3G67 A;  4UB6 Z;  3LSS A;  3OEH G;  4X88 A;  4NYK A;  5C93 A;  2CH7 B;  3RYI B;  2OIE A;  3IC7 A;  1KQS U;  4ZKI A;  4FM0 A;  2QWR B;  5BXZ A;  4IIJ A;  3E22 B;  1WA8 B;  4DRX B;  4NKG B;  4W4L A;  3ZHR A;  5IYZ A;  2HLD G;  2PI4 A;  1WB7 A;  4U3J A;  4YXW G;  3D36 A;  1QNM A;  2F4V O;  3SPI A;  1EN4 A;  4OPH A;  3CC4 V;  4LFC B;  3TXS A;  1P7G A;  4UUJ C;  1I5Y A;  1FFT B;  1SER A;  3K06 A;  5FNV B;  3MAQ A;  2P22 C;  1QVF U;  5KMG B;  4MT8 A;  1K4C C;  4B3S B;  4LBE C;  1YCI A;  3VOU A;  2B1I A;  1K7D A;  4F6R A;  3CC2 V;  4ZI7 A;  2PTM A;  2R72 A;  4H33 A;  3T1C A;  2YS8 A;  4IYH A;  4JTC B;  1I7F A;  3VQW A;  3CRR A;  3E22 A;  4DXW A;  3ZS8 C;  4LFB O;  3RWR D;  1NH2 D;  2UUB B;  1XMQ O;  5LHH A;  1XHX A;  3ZHV A;  5CA0 A;  4DV7 B;  3BY6 A;  2Y0P A;  1T5E A;  4BWA A;  2H94 A;  2QKC A;  2HR3 A;  1G1X B;  2JEX A;  3GWO A;  1VF7 A;  1NU1 H;  1OJH A;  2GDS A;  3O65 A;  1IX9 A;  2ZE7 A;  1B6Q A;  2OT5 A;  3B09 A;  2FYU H;  3APO A;  4BAY A;  2KSD A;  4GKK B;  4B3M O;  4FFK A;  4GKJ O;  4B7K A;  1SA0 B;  2GUZ A;  5DM6 V;  3CRM A;  1O9G A;  1QLE B;  3P3N A;  1S77 D;  2YSU B;  5A2Q N;  4TOI A;  2NR5 A;  3ZRX A;  4UCV A;  2EZO A;  3BAB A;  2XAH A;  1OCC B;  4G27 B;  2Y69 B;  3JAS B;  4CS4 A;  5JVD A;  4LR3 A;  4RO2 A;  4JTD B;  4O4H A;  4R8C A;  4JV5 O;  2EIN B;  3K9S A;  1ZTE A;  4E2L A;  4JAV A;  1JR9 A;  2Q73 A;  3FB6 C;  4JI2 O;  4MTG A;  1EM1 A;  2ZDI C;  1EZV H;  3OEE G;  2E74 B;  1M56 C;  4EFE A;  1M57 B;  4DR7 O;  2RMK B;  1BZK A;  5LGT A;  1UPG A;  3ZED A;  1O9H A;  4X1K A;  4JI1 O;  3OR7 C;  1ZL8 A;  4B08 A;  4DW1 A;  1KU9 A;  4X1Y A;  4JI7 O;  5IYD O;  1RP3 B;  5KHJ A;  2ZNJ A;  1WP8 A;  2D3O W;  5GON A;  2QDO A;  4DV5 B;  3FAV B;  4ASU G;  1SA0 A;  2YXY A;  3LSU A;  3JD2 A;  2DJV A;  3HPL C;  3LDC A;  4JI6 O;  4KHP B;  4JZ2 A;  3JYC A;  4FVM A;  3DC5 A;  1SRY A;  3OUF A;  4X65 O;  5HFM A;  1Q8I A;  2PF4 E;  1XL4 A;  2UXC O;  1MA1 A;  3SPJ A;  2ZR3 A;  2QWO B;  4O4H B;  2WA4 A;  1L1F A;  2UXX A;  1J5E O;  3Q4H B;  3TXQ A;  4RAI A;  2XAG A;  4ZHQ A;  4D7S A;  3HR0 A;  1N36 O;  2H3O A;  2QGN A;  3ZHS A;  1P84 F;  4X1I B;  3N27 A;  4FFB B;  2UXD O;  3K57 A;  1PD3 A;  2GUZ B;  5LXT B;  4FLX A;  3K5N A;  3L9D A;  3BRC A;  5IY5 C;  1URF A;  4BIZ A;  4TV8 B;  4NTY A;  4X1I A;  2CTW A;  3AG3 C;  3UQ8 A;  2Z3Y A;  3FB5 C;  1I5X A;  4RUE A;  3RYF B;  4MVM A;  1XNQ B;  1XMQ B;  4I0X A;  4JI4 O;  1GKF A;  4JGS A;  1F4M A;  4E4E A;  3RYH B;  1MMM A;  2DE0 X;  4TQF A;  4LF9 B;  1AI6 A;  1M57 C;  2DN9 A;  1N34 B;  3VQX A;  2QWN B;  1U97 A;  3FD9 A;  4Z2W A;  1P7B A;  2ZKO A;  3NXS A;  1DLB A;  1OCR C;  4K0K O;  2EIN C;  3P30 A;  4O4L A;  1E1R G;  4UFZ A;  4DR1 O;  1AJP A;  1F51 A;  4H0L B;  3JAT B;  1IBL O;  2P7T C;  2HFE C;  5C8Y A;  4JI8 B;  2LFR A;  5CA1 B;  1H2S B;  4B3R O;  1AI4 A;  2FTK A;  1SQQ H;  4J7K A;  5EZY A;  4NXM O;  2A7W A;  5GON B;  1Q7Y W;  1Q5O A;  3JAK B;  1TGO A;  2EIK B;  3AG2 B;  3IJ4 A;  1HR0 B;  3AK1 A;  3U10 A;  2OIG A;  2BOB C;  1H2L A;  2NNU A;  4NXM B;  2PZS A;  4IGG A;  3CRQ A;  4FLV A;  3JCU Z;  4JI5 B;  2P06 A;  2P6J A;  2ZIO A;  1Q3E A;  1SQV H;  4Q6G A;  1R3K C;  5JVD B;  5TIS Z;  1Q6H A;  1GM7 A;  2UXN A;  1RPR A;  2FKX A;  3ABK C;  2QM8 A;  5EZY B;  3ZBH A;  1F4N A;  3CCS V;  1CPY A;  4DV7 O;  5JJE B;  3T1H B;  4JYA B;  4DV1 O;  3KCX A;  4LF8 O;  1GK9 A;  1HNZ B;  3ZMV A;  2VRZ A;  4QPK A;  3T2M A;  1MAB G;  1SF9 A;  1M9N A;  4DV6 O;  2GV9 A;  4XBF A;  5B3S C;  1WP7 A;  3ZMU A;  2BSK A;  5AG2 A;  5EBL C;  1OCR B;  4TV9 B;  3W7U A;  2VQF O;  1YF2 A;  2YDE A;  4EB6 A;  1GN6 A;  2YIB A;  4N21 A;  2JJ1 G;  3K59 A;  2VQE B;  4O4J B;  4CH6 A;  1HW7 A;  3BPZ A;  1TUE B;  4JI0 O;  3ASO C;  1LR1 A;  3RYH A;  4C7U A;  2AHY A;  4OX9 O;  3AG4 B;  3IC9 A;  5B1A B;  3JD4 A;  1Z2G A;  5LA6 A;  2CDY A;  1OV9 A;  4PA7 A;  3MHH C;  3QO8 A;  2F4V B;  3CEI A;  1KB9 F;  3W7T A;  1X4T A;  4IL6 Z;  1IUR A;  3CXC U;  3RYC A;  4X64 B;  5KHG A;  2XTA A;  3AG2 C;  4LNU A;  4I50 A;  5BMV B;  2XT9 A;  2LJ2 A;  1IBK B;  2AHZ A;  5CA0 B;  1M5I A;  4B3T B;  4TT3 G;  2F95 B;  4RUF A;  2P4K A;  3G71 V;  1VQ6 V;  3OMN B;  1P4R A;  4UB8 Z;  4PDL A;  3JD1 A;  1ORQ C;  4QIW F;  1AP6 A;  1K97 A;  4NVP A;  3B77 A;  3N2K A;  4UV8 A;  5L3G A;  2P90 A;  4FK5 C;  2YXL A;  3GWK C;  3FAV A;  4PA4 A;  2WLJ A;  2CGO A;  1HWY A;  1YXB A;  4CC5 A;  3QNE A;  5H2F Z;  4UCS A;  1AR4 A;  4QGP A;  3ZRW B;  4DV0 O;  4DR6 O;  2AXT Z;  2EZP A;  1N0J A;  2HJD A;  3ABK B;  2D2C B;  3AG7 A;  3SYP A;  3ZRS A;  3RW0 A;  2XAF A;  3A0B Z;  5KA5 A;  4FLW A;  3ABT A;  3R65 A;  1KKD A;  2ZM6 O;  2YC0 A;  4XDK A;  3ZIA G;  1BHB A;  4LC1 A;  2DOS A;  1OHH G;  1SS3 A;  2E75 B;  4U7N A;  2W0F C;  1QR9 A;  1IBM B;  4KUM A;  2LGW A;  3WG7 B;  4LP8 A;  4KXR A;  2DQ0 A;  1S5H C;  1RPO A;  3FYI B;  1BGY H;  1HP8 A;  5E1A C;  1WA8 A;  3CXH F;  5D5Q A;  1N34 O;  1AJN A;  4GZR B;  4ZOL B;  2DWD C;  5B1N A;  2BTO A;  2EIM B;  1K5Q A;  2Q0O C;  3K79 A;  2IJK A;  1Z5V A;  1FXH A;  1AR5 A;  1K3E A;  3JAT A;  4FZ1 A;  5EIB D;  4LFC O;  4RQF A;  4HNA B;  4X1Y B;  4LWS A;  3S3X A;  1QHT A;  2P4V A;  3CCM V;  4CC6 A;  3SGI A;  2LGQ A;  2WLL B;  4P9O A;  1KYO F;  2O57 A;  3CCE V;  4QE9 A;  2QEX V;  3PJS K;  1JJ2 U;  3P32 A;  4MVU A;  5FL7 G;  1FD9 A;  1G4Y B;  2JEU A;  3E8B A;  1Q81 W;  1N8R W;  1NQT A;  1VQM V;  2ZDI A;  2DWE C;  3SJQ C;  1FAF A;  1AB3 A;  1GM9 A;  1ARO P;  1V54 C;  4J41 A;  3OAA G;  1YIJ V;  4MW8 A;  3QO7 A;  4X64 O;  1SES A;  2Y0I A;  5L3F A;  3I5D A;  3X2Q C;  3LDE A;  3QG5 A;  3WG7 C;  1JJO A;  1JCH A;  4BIU A;  3ABM C;  4B3M B;  1X59 A;  4ZBM A;  3H1I H;  4P30 A;  4MTF A;  3BAA A;  1QU7 A;  1B06 A;  4LF4 O;  1Q43 A;  1IBL B;  5LHG A;  1V9P A;  3OGC C;  1XBL A;  1YJ9 V;  2RCV A;  1XI1 A;  4DUY B;  1KUQ A;  1J5E B;  3OR6 C;  4LFB B;  1FYJ A;  3Q4H A;  3N2G B;  3SYO A;  4B3T O;  2IJI A;  1Z5W A;  2AZ2 A;  4LF5 B;  3K04 A;  2XUM A;  4PDR A;  4FLZ A;  2JGU A;  3L71 H;  4H44 B;  5J2T B;  1RFY A;  5KAF Z;  3OGI B;  1PNK A;  1GH6 A;  3JAW B;  1XEQ A;  1YTF D;  2DYR C;  3HB3 B;  2E5L O;  4L87 A;  3D3Q A;  5H9C A;  4CH5 A;  1VIB A;  3AG3 B;  3OUS A;  1KP3 A;  3D3I A;  2CE4 A;  4LFA O;  1I94 B;  2CK3 G;  4OX9 B;  2AZ0 A;  5J2U B;  1S72 V;  2V4D A;  3M8A A;  2WLK A;  3J81 N;  2YEV B;  1V55 C;  3U0Z A;  5LOV B;  4X66 O;  5GW7 A;  1YZB A;  2Q4P A;  5CBG A;  4ZOL A;  4PV1 B;  3ZN0 A;  4D7T A;  3W7X A;  3SPH A;  4N23 A;  4TSF G;  2JK5 C;  1PV0 A;  3ML0 A;  4DV6 B;  2K1E A;  2Q6A A;  1JFF A;  4WFF A;  5LMU B;  3H1L H;  3BVO A;  3CX5 F;  4LFA B;  1VQ5 V;  1KP2 A;  1R3J C;  1TVK A;  1KEC A;  4K3A A;  2Q5Z A;  5IYC O;  3LUT B;  1DK1 A;  1B3Q A;  1KD1 W;  1NR1 A;  4JI0 B;  2X6C A;  2L35 A;  4MW3 A;  1WN7 A;  1KBH A;  3ASN C;  2VQE O;  1XNQ O;  3UT5 B;  4FLY A;  1G6U A;  5BR8 O;  2KG7 A;  2OCH A;  1BE3 H;  1R6T A;  4CH4 A;  2ZNI A;  1VEW A;  1YJW V;  4LF5 O;  3D8C A;  4X62 O;  3L75 H;  1BQZ A;  3H01 A;  1F23 A;  1BMF G;  3CYO A;  4J10 A;  5DEC A;  2Q68 A;  4DR3 B;  2DQ3 A;  1WB8 A;  4MVO A;  2W0X A;  2N04 A;  4LH6 A;  2BTQ B;  2ATK C;  1FS0 G;  2ZXW B;  3DXR A;  2Q9L A;  1VF6 A;  4LH7 A;  1W0J G;  4YIO A;  3T1Y O;  4DRX A;  1AP5 A;  2QKA A;  4WFH A;  3SPG A;  1YDX A;  4J7J A;  2M7W A;  3A8T A;  4UCO A;  2DYS B;  2WA3 A;  2ZE5 A;  1R3I C;  2F93 B;  4MS2 A;  3K58 A;  4BIO A;  1FXK C;  3QF7 A;  3OM3 B;  3ASO B;  1SQB H;  3DTU B;  3K08 A;  2ZQM A;  2F66 C;  1VQ4 V;  2FML A;  5LHI A;  4PD4 F;  2CTQ A;  3CD6 V;  1NT2 B;  4FMT A;  2KQX A;  4JI7 B;  4PEL A;  2R9R B;  4R6Z A;  4B3R B;  4DR2 B;  2BTQ A;  3BHP A;  4ABM A;  1COW G;  2WLN A;  5D5P A;  1OCO C;  5LL6 Y;  4NXN B;  1PL4 A;  5CMU A;  1BHA A;  3OTO B;  2UU9 B;  5IYZ B;  2Q0A A;  3RN4 A;  2JGD A;  1CXZ B;  3CRA A;  3T4D A;  3WB1 A;  1VQ7 V;  1HDJ A;  3R66 A;  2R70 A;  3T4Z A;  1W0K G;  2P5O A;  4QJF B;  1GAX A;  2IU0 A;  3OTF A;  1N32 B;  2LW7 A;  4WBN A;  4K0K B;  2EX3 A;  3O9O A;  3AK2 A;  5KX5 A;  2X7R B;  5E79 Z;  3APQ A;  1MNG A;  2WLI B;  4YHH B;  2JIZ G;  3KG2 A;  1R73 A;  2BE3 A;  5LA6 B;  2ZE8 A;  3CCU V;  3JAR B;  2JDI G;  1M4U A;  3ZHQ A;  2KG7 B;  3IAY A;  2M6Y A;  4DYL A;  4JAS A;  1WNS A;  1ZL8 B;  4CZZ A;  4XDL A;  1S5J A;  1KC8 W;  3RBZ A;  2ZR2 A;  1R3L C;  1G8M A;  2A79 B;  1EFR G;  2PUS A;  1YVW A;  4JI3 O;  5JH7 A;  3JAK A;  1Y4M A;  1OZ0 A;  4H13 B;  3F5W C;  1RSO A;  4YY3 O;  1YJN V;  5F2V O;  3SJA C;  1SKV A;  2A06 H;  3DGE A;  3VQV A;  4F4L A;  3J80 N;  5H6R A;  4Q20 A;  2HG5 C;  4B7E A;  2RQ6 A;  2EIJ B;  3CJH A;  4YY3 B;  2JGD B;  1H8E G;  4WFE A;  2GTA A;  1KMI Z;  5B1B B;  4GCZ A;  5J9P C;  5CA1 A;  2Q8V A;  4IYI A;  5LXT A;  2YIA A;  2AGA A;  4OXS A;  2DMX A;  5KA6 A;  3ETD A;  1I0H A;  2VWJ A;  1ENV A;  3TGU H;  2Y69 C;  4ZI7 B;  4DV0 B;  4RQE A;  4GKJ B;  2LQT A;  1QR8 A;  1NI8 A;  3FKS G;  1F7Y A;  2E3C A;  3ZCC A;  2XAJ A;  4G28 B;  3WB0 A;  1ZSP A;  4TV8 A;  3JCZ A;  2Z0A A;  4I55 A;  1DF4 A;  2QTO A;  5B66 Z;  3ZHU A;  5L3E A;  3OMA B;  1M93 A;  2L6L A;  2WLM A;  1FKA O;  1TUB B;  1YEW A;  3W7S A;  3SR2 C;  3OT7 A;  4I9Q A;  1WPB A;  1GTO A;  1H38 A;  3QTC A;  4DV2 B;  1XOU A;  3FFQ A;  4J9Z B;  4LF6 O;  1RSO B;  1JPX A;  2UUC O;  2R9I A;  2HEP A;  3SYQ A;  1Y76 B;  1Y74 B;  4QPJ A;  1CEZ A;  2IJJ A;  2EUL A;  3EVK A;  1QLN A;  3K0G A;  4WF9 V;  2IU3 A;  3X2Q B;  1N33 O;  4GT1 A;  1YIT V;  1MSW D;  2RNB A;  2QM4 A;  2N74 A;  2ZT9 B;  1SQF A;  1WJZ A;  3JD0 A;  2BSK B;  1PP9 H;  4UVC A;  4R50 A;  3LNM B;  4DV2 O;  5FLX N;  4W4K A;  1H2M A;  3W7W A;  4FLT A;  3CJH B;  1VP7 A;  5KHI A;  2EIJ C;  3AG4 C;  1FXK A;  4LCU C;  2GSM B;  4O4I A;  4J11 A;  3QO5 A;  5LBQ A;  1VF5 B;  3ZHT A;  1E1Q G;  1S3J A;  5IE9 A;  3JAR A;  4JPR A;  4D6T H;  1Q82 W;  4B3S O;  4A5U B;  2QR4 A;  3E35 A;  1K8A W;  2JS5 A;  4J80 A;  1LUV A;  5LYJ B;  4NXN O;  4GYC B;  1NH2 B;  3EFF K;  4DV3 O;  2Q7G A;  5JQG B;  1OCO B;  3B2E E;  2B9Z A;  4J7Z A;  1EZJ A;  1WLE A;  3JSL A;  4JI4 B;  4HYO A;  1MOF A;  5DN6 G;  1PNL A;  2YEV A;  1BSM A;  3K9A A;  3BEH A;  4J42 A;  2LO1 A;  5IJ9 B;  3JAW A;  1N4C A;  3L73 H;  3H9V A;  3WU2 Z;  5GTI Z;  4X20 A;  1ZLZ A;  1XL6 A;  1NVP B;  3RGB A;  5EYP B;  1RM1 B;  3I56 V;  1YI2 V;  1NR7 A;  2BOC C;  2GBO A;  3B8N A;  3VBB A;  2ZIN A;  2CTR A;  3NR7 A;  4JAU A;  4K35 A;  1QBZ A;  1L0N H;  1A32 A;  4AHC A;  4CS3 A;  1AR1 B;  1QLE C;  4LNU B;  2ADP A;  3F7V C;  3C3S A;  3CCV V;  5LP6 B;  3TJT A;  2CH7 A;  2ZE6 A;  4JYC A;  5BY1 A;  1FPO A;  1ZWI C;  4DV4 B;  2HJF C;  4LF9 O;  4K8X A;  3OMI B;  2CGN A;  3ZRW A;  1P49 A;  5EIB C;  5FPR A;  3CCR V;  3N2K B;  1ROP A;  5LMN O;  2XAQ A;  4NR1 A;  1JQ0 A;  2HHH O;  2WPD G;  4I4T A;  3RYI A;  1OCC C;  2YI9 A;  4QNH B;  1GMG A;  5IJ0 A;  4P2Z A;  3CCL V;  5KAI Z;  2C2A A;  5GTH Z;  2CAZ C;  4FM1 A;  3JAM N;  4HAM A;  4UXN A;  2WLL A;  2QKS A;  3ZMT A;  1EN6 A;  3K5O A;  3VQY A;  3T1Y B;  3KKY A;  4LF4 B;  4X8A A;  2ITD C;  3CHX A;  2EIL C;  2ETN A;  2OCC C;  4J9Y B;  4MTX A;  4JI6 B;  1R1B A;  2QSA A;  4X65 B;  4FJC C;  3ZX6 A;  5EK0 A;  5B1A C;  4CH3 A;  2QWQ B;  4JI5 O;  1VQN V;  2JRI A;  1XMO O;  4FZ0 A;  1HNW B;  4BR6 A;  3UT5 A;  4DR5 B;  1MZF A;  1B04 A;  4X62 B;  2MW2 B;  4IT5 A;  2HHH B;  1YSC A;  2IH1 C;  5KLV H;  1YHQ V;  4DR7 B;  5BR8 B;  1N33 B;  3SYA A;  2XHB A;  4L8J A;  1SQG A;  3CCQ V;  1OCZ B;  2ODM A;  1XIL A;  4TV9 A;  3HKD A;  1RM1 C;  3HKE B;  3M7M X;  1AJQ A;  2UUC B;  1Q90 D;  3ABM B;  2YXH A;  2KKW A;  2XND G;  2ZCE A;  2VQF B;  3TET A;  4JV5 B;  5H5N A;  4X1K B;  2VS0 A;  3K5M A;  1M90 W;  3B40 A;  5CN0 A;  4YJ2 B;  3MD0 A;  2WLI A;  4YJ3 A;  5CA3 A;  1VQP V;  3G4S V;  1IVS A;  1Y76 A;  1VQO V;  3BFR A;  4KP4 A;  3F5T A;  1AIL A;  1KKC A;  5EBM C;  2YID A;  3F7Y C;  1MSD A;  3JSN A;  2UXB B;  2YI8 A;  3OE7 G;  3FB7 C;  1SC5 B;  4R7C A;  3B4S A;  2EIL B;  2OCC B;  3AG1 C;  3L74 H;  5BZB A;  3ABL B;  1WAZ A;  3ICX A;  5IJ0 B;  3N2G A;  2JJ2 G;  2PYL A;  2JS3 A;  3G6B A;  2CTP A;  1HR0 O;  4FPP A;  2E5L B;  1VMG A;  4X89 A;  1VF6 C;  2ARH A;  4GUN A;  1IXB A;  2UXC B;  2Q69 A;  2EIM C;  1HNW O;  4KFM A;  4JF3 A;  2HKO A;  4JI2 B;  2RDC A;  1IXM A;  5KUM A;  3HKC B;  4LF8 B;  4ICG A;  1FFX B;  4OPA A;  3UM7 A;  4I7Z B;  1NTM H;  4O4L B;  2QM7 A;  3KCY A;  5LGU A;  4AIL C;  4FFB A;  1QVG U;  1FXV A;  1Q6U A;  1BQ0 A;  5JJN B;  5EBW C;  3RT3 C;  5JCO C;  2HVK C;  4DV5 O;  3RYC B;  5IWA O;  2EIK C;  4FM2 A;  4UCT A;  3GB7 C;  1VQ9 V;  1THZ A;  1SZX A;  2A9H A;  1NS1 A;  4GX1 A;  3OFN G;  1TUB A;  3CRC A;  1DTO A;  4O2A A;  4YJ2 A;  2K9P A;  5DED A;  4WFA V;  4IIJ B;  3J7A U;  1LNQ A;  3K0D A;  4MVR A;  1ZAU A;  5J2U A;  2EBO A;  4PA3 A;  2F43 G;  1NJI W;  1K33 A;  4EB6 B;  3AEI A;  2N05 A;  4TUY B;  4H37 A;  1VAR A;  3RFR A;  2F23 A;  2H8P C;  2KB1 A;  3CS5 A;  3STL C;  4ZHQ B;  3ASN B;  2Y4T A;  5IJ9 A;  1IZ3 A;  4IHJ B;  2W6J G;  4G2K A;  3K5L A;  2X6B A;  5B1B C;  1UFI A;  1HNX B;  4JYA O;  2IW5 A;  3ZMS A;  1Q86 W;  5CB4 A;  3C90 A;  5EYP A;  4DK0 A;  2EJ7 A;  3HKB B;  4LF7 B;  4PJ0 Z;  1N0N A;  1I08 A;  4DW0 A;  2XAS A;  1YTF B;  4LWS B;  5LYJ A;  5CB4 B;  2ZM6 B;  1H2N A;  2OTJ V;  1EBO A;  1MG1 A;  4TQD A;  4PA9 A;  3FX7 A;  5KHH A;  2B1G A;  4DV4 O;  2UUB O;  5LOV A;  2WAM A;  3G80 A;  4NTW A;  2VWK A;  1EN5 A;  2WSS G;  4XDJ A;  4HBN A;  4PDV A;  4UCU A;  3ZRV A;  2IBZ H;  2GHY A;  2UUA O;  2XOK G;  3IGA C;  1NBM G;  3HKB A;  1LUW A;  2PYJ A;  5KUK A;  4OGQ B;  5IWA B;  1GN2 A;  1N32 O;  3I55 V;  1VQK V;  1FJG B;  2RJZ A;  1K4D C;  4LF7 O;  4UVB A;  2LFS A;  4PA6 A;  1U96 A;  4DR4 B;  5JWP A;  3LSQ A;  4F6R B;  1D5A A;  1ZX3 A;  5KHK A;  4DR4 O;  1BT8 A;  1XDC A;  3E8H A;  1Y66 A;  1I94 O;  1SZT A;  1AI5 A;  1W2B U;  1PM9 A;  1H2G A;  3M99 B;  1WPX A;  5FPO A;  1OCZ C;  4Z1M G;  1M56 B;  4EEQ A;  5LMN B;  4AQY B;  5ITZ B;  3LDD A;  3DXR B;  4DO2 A;  1V55 B;  4JI1 B;  4DR5 O;  2PGG A;  4U3J B;  3CB2 A;  1XMO B;  3H1J H;  1XQ8 A;  1SQP H;  5JJJ B;  4DR6 B;  2FB5 A;  5FNV A;  4PDM A;  2Q7H A;  4I50 B;  5BMV A;  4I4T B;  3FYE B;  2Y4U A;  5KMG A;  4X20 B;  2UXB O;  4MVZ A;  1BCC H;  3FB8 C;  1GN3 A;  1HNX O;  5EC2 C;  4NTX A;  1VQL V;  4JZG A;  1L8D A;  3A0H Z;  4HNA A;  2BCC H;  2NLJ C;  3JAL A;  3QVN A;  3E86 A;  2YUA A;  3RVZ A;  1TA8 A;  2EJR A; 
#chains in the Genus database with same CATH homology
 1PNL A;  2YEV A;  3SYO A;  3AG1 B;  4ASU G;  3K9A A;  5L3B A;  2IJI A;  3BEH A;  5IYB O;  3ABL C;  4I9W A;  3K04 A;  1QCE A;  3K03 A;  4PDR A;  3ABU A;  1H8H G;  3JD2 A;  3HPL C;  3LDC A;  1XL6 A;  1NVP B;  1PNK A;  3JYC A;  2PI5 A;  1SRY A;  2Z5U A;  1YTF D;  3OUF A;  1RM1 B;  5HFM A;  3ZJZ A;  2DYR C;  1XL4 A;  4WFB V;  3HB3 B;  5B1O A;  2DYS C;  3I56 V;  1YI2 V;  3SPJ A;  1NR7 A;  2BOC C;  3B8N A;  2ZR3 A;  4L87 A;  3VBB A;  5H9C A;  3OW2 U;  1L1F A;  2UXX A;  2HVJ C;  4JAU A;  3AG3 B;  1QBZ A;  1DF5 A;  3STZ C;  3OUS A;  1KP3 A;  1UJW B;  3EHB B;  4RAI A;  2XAG A;  3ZMZ A;  3ZN1 A;  3D3I A;  1JVM A;  1AR1 B;  1QLE C;  1V54 B;  1NKD A;  2CK3 G;  3F7V C;  1PD3 A;  4WFG A;  3CCV V;  2ZXW C;  4JYC A;  1ZWI C;  1S72 V;  5IY5 C;  2WLK A;  1S76 D;  4BIZ A;  2YEV B;  1V55 C;  2A0L A;  2HJF C;  5GW7 A;  2MK3 A;  3AG3 C;  2WWW A;  5CBG A;  2Z3Y A;  3OMI B;  3ZN0 A;  3W7X A;  5CBF A;  3FB5 C;  1I5X A;  3SPH A;  3ZRW A;  4RUE A;  4MVM A;  3CCR V;  4N23 A;  1ROP A;  4TSF G;  2JK5 C;  2XAQ A;  3ML0 A;  1E79 G;  1JQ0 A;  4QE7 A;  4WCE V;  2K1E A;  1GKF A;  4JGS A;  1F4M A;  5CBH A;  1FXK B;  5IY5 B;  2Q6A A;  2WPD G;  3E2E A;  1AI6 A;  4WFF A;  1M57 C;  2DW4 A;  1OCC C;  2ZD9 A;  4QNH B;  1GMG A;  1VQ5 V;  4P2Z A;  4GX5 A;  3CCL V;  2C2A A;  1P7B A;  1KP2 A;  1R3J C;  2QE7 G;  1DLB A;  3NXS A;  1OCR C;  1KEC A;  2EIN C;  3P30 A;  4HAM A;  5IYC O;  3LUT B;  4UXN A;  1PKX A;  1R6N A;  2QKS A;  2WLL A;  1E1R G;  3ZMT A;  1J95 A;  1KD1 W;  1AJP A;  5DN6 G;  1F51 A;  4JYB A;  1NR1 A;  5H6Q A;  3ETG A;  2X6C A;  4MW3 A;  3SPC A;  3G6E V;  2P7T C;  3ASN C;  1GM8 A;  4MVS A;  1AI7 A;  2HFE C;  2ITD C;  4X8A A;  3CPW U;  2EIL C;  2OCC C;  4J9Y B;  4MTX A;  2LFR A;  1K92 A;  1PL0 A;  4FJC C;  2ITC C;  1YJW V;  5EK0 A;  5B1A C;  4BW5 A;  4P9P A;  1AI4 A;  2FTK A;  4JTA B;  1VQN V;  4UVA A;  1R6K A;  3K3W A;  4FIP C;  3H01 A;  1CP9 A;  1F23 A;  1BMF G;  3CYO A;  1Q7Y W;  4I5S A;  2EIK B;  2Q68 A;  3AG2 B;  1JX9 A;  2DQ3 A;  1K9M W;  2Y48 A;  2X0L A;  2BOB C;  1YSC A;  2NNU A;  4MVO A;  3A0R A;  5L3D A;  2IH1 C;  1BL8 A;  1YHQ V;  2ATK C;  2P6J A;  3E8F A;  1FS0 G;  2ZXW B;  3SYA A;  3E8G A;  1W0J G;  1R3K C;  3CCQ V;  1OCZ B;  1GM7 A;  2UXN A;  4WFH A;  1RPR A;  3SPG A;  2B5U A;  2LP7 A;  1RM1 C;  3ABK C;  2QM8 A;  2M7W A;  1F4N A;  3SYC A;  3CCS V;  1M1K W;  1CPY A;  2DYS B;  1AJQ A;  2Q67 A;  3ABM B;  2XND G;  1R3I C;  3WFV A;  1GK9 A;  3TET A;  1K73 W;  3ZMV A;  2IJH A;  3CCJ V;  2P67 A;  1JOY A;  4MS2 A;  1M90 W;  4QPK A;  3T2M A;  4HZ3 A;  1SET A;  5CN0 A;  1MAB G;  3TK1 A;  1FXK C;  3MD0 A;  2WLI A;  3OM3 B;  1M9N A;  3ASO B;  3DTU B;  3JD3 A;  4XBF A;  3K08 A;  4TWK A;  4EKW A;  2ZQM A;  5CA3 A;  3G4S V;  1VQP V;  1VQ4 V;  2V7Q G;  1VQO V;  5LHI A;  4MVQ A;  5B3S C;  3CD6 V;  4FMT A;  3E83 A;  2WLH A;  4KP4 A;  3ZMU A;  4PEL A;  2R9R B;  5EBL C;  4R6Z A;  1OCR B;  3W7U A;  3UKM A;  5EBM C;  1COW G;  3F7Y C;  2WLN A;  1OCO C;  5HFL A;  4N21 A;  2QA4 V;  2JJ1 G;  5CMU A;  3OE7 G;  1BHA A;  2IH3 C;  3FB7 C;  5EC1 C;  1K34 A;  3E89 A;  1TUE B;  4R7C A;  3ASO C;  2EIL B;  2OCC B;  3AG1 C;  5BZB A;  3ETE A;  2AHY A;  3ABL B;  1VQ8 V;  3AG4 B;  5B3S B;  3T4D A;  1VQ7 V;  5B1A B;  3JD4 A;  3T4Z A;  2JJ2 G;  3TCU A;  1GO3 F;  1W0K G;  3CP1 A;  4QJF B;  4PA7 A;  2IU0 A;  3MHH C;  3QO8 A;  3W7T A;  5L3C A;  4FPP A;  3CXC U;  2X7R B;  4GX2 A;  4X89 A;  4MTO A;  2WLI B;  2JIZ G;  3KG2 A;  1R73 A;  3AG2 C;  3CCU V;  2Q69 A;  2EIM C;  2V1D A;  4MSW C;  2JDI G;  4KFM A;  5LGN A;  4JAS A;  4JF3 A;  2HKO A;  4CZZ A;  1IXM A;  5KUM A;  4XDL A;  3IFX A;  1PNM A;  5IDJ A;  3CME V;  1KC8 W;  3RBZ A;  2ZR2 A;  1K5S A;  4GX0 A;  2AHZ A;  1R3L C;  3UM7 A;  1G8M A;  2A79 B;  4TT3 G;  3RVY A;  4RUF A;  1EFR G;  3CMA V;  3G71 V;  1VQ6 V;  2QM7 A;  5LGU A;  3OMN B;  1P4R A;  4CBC A;  3CC7 V;  4PDL A;  1QVG U;  1FXV A;  2X6A A;  1Y4M A;  1OZ0 A;  5EBW C;  2OTL V;  3JD1 A;  1ORQ C;  4QIW F;  3F5W C;  1K97 A;  2HVK C;  3B77 A;  4U7O A;  1YJN V;  4UV8 A;  5L3G A;  2EIK C;  2P90 A;  4FK5 C;  1S0V A;  3GB7 C;  2W6I G;  1VQ9 V;  1THZ A;  3DGE A;  4F4L A;  2A9H A;  4GX1 A;  4UV9 A;  5H6R A;  4PA4 A;  4Q20 A;  3OFN G;  2WLJ A;  2HG5 C;  1HWY A;  1DTO A;  3QNE A;  2EIJ B;  3B8M A;  3ZRW B;  1NVP D;  1H8E G;  4WFE A;  2DYR B;  2EZP A;  3MHS C;  4WFA V;  1LNQ A;  3ABK B;  3K0D A;  5B1B B;  4GCZ A;  3LSS A;  4MVR A;  3SYP A;  3ZRS A;  3OEH G;  5J9P C;  3RW0 A;  2XAF A;  5KA5 A;  4X88 A;  3ABT A;  3R65 A;  5C93 A;  2EBO A;  1KKD A;  4PA3 A;  2F43 G;  1NJI W;  1K33 A;  3IC7 A;  1KQS U;  3AEI A;  4ZKI A;  4H37 A;  4OXS A;  5KA6 A;  3ETD A;  2H8P C;  4XDK A;  3ZIA G;  1BHB A;  2KB1 A;  4LC1 A;  3STL C;  3ASN B;  1OHH G;  1ENV A;  2W6J G;  2HLD G;  4G2K A;  2W0F C;  4U7N A;  2PI4 A;  1QR9 A;  2Y69 C;  4YXW G;  3D36 A;  2X6B A;  5B1B C;  4RQE A;  4KUM A;  3SPI A;  3WG7 B;  4LP8 A;  3CC4 V;  2DQ0 A;  1S5H C;  1RPO A;  2IW5 A;  1QR8 A;  3ZMS A;  3FYI B;  1Q86 W;  3FKS G;  4UUJ C;  5E1A C;  3ZCC A;  1I5Y A;  1AJN A;  2XAJ A;  1FFT B;  1SER A;  3K06 A;  2DWD C;  5B1N A;  4G28 B;  1QVF U;  2EIM B;  1K5Q A;  3JCZ A;  3K79 A;  2XAS A;  1DF4 A;  2IJK A;  1YTF B;  4MT8 A;  1FXH A;  2QTO A;  5L3E A;  3OMA B;  1K3E A;  2OTJ V;  1EBO A;  1K4C C;  2WLM A;  4LBE C;  1MG1 A;  3W7S A;  3VOU A;  4PA9 A;  2B1I A;  1K7D A;  3CC2 V;  4RQF A;  2B1G A;  3T1C A;  4H33 A;  1GTO A;  4JTC B;  3CCM V;  1H38 A;  4DXW A;  2WAM A;  2WSS G;  4XDJ A;  2WLL B;  4P9O A;  4PDV A;  3ZRV A;  1NH2 D;  2GHY A;  2XOK G;  5LHH A;  3IGA C;  4J9Z B;  3CCE V;  4QE9 A;  1NBM G;  1JPX A;  2QEX V;  3PJS K;  1JJ2 U;  2R9I A;  3BY6 A;  5KUK A;  3P32 A;  4MVU A;  3I55 V;  3SYQ A;  5FL7 G;  1VQK V;  1K4D C;  4QPJ A;  2H94 A;  1G4Y B;  2HR3 A;  2JEU A;  2IJJ A;  2JEX A;  3E8B A;  4UVB A;  1CEZ A;  2LFS A;  4PA6 A;  1Q81 W;  1N8R W;  3GWO A;  1QLN A;  3K0G A;  1NQT A;  4WF9 V;  2IU3 A;  3LSQ A;  1VQM V;  3X2Q B;  2ZDI A;  1B6Q A;  2DWE C;  4GT1 A;  2OT5 A;  3E8H A;  1YIT V;  1MSW D;  4BAY A;  1Y66 A;  3SJQ C;  1SZT A;  1AI5 A;  1W2B U;  3JD0 A;  4UVC A;  5DM6 V;  1GM9 A;  1ARO P;  1H2G A;  1QLE B;  3LNM B;  4R50 A;  1V54 C;  1S77 D;  3OAA G;  3M99 B;  1YIJ V;  2YSU B;  4MW8 A;  3W7W A;  1WPX A;  3ZRX A;  1OCZ C;  2EZO A;  3QO7 A;  1M56 B;  4Z1M G;  2XAH A;  2EIJ C;  1OCC B;  1SES A;  4G27 B;  2Y69 B;  5L3F A;  3AG4 C;  3LDD A;  1FXK A;  4LCU C;  3X2Q C;  2GSM B;  4RO2 A;  4DO2 A;  3LDE A;  1V55 B;  3WG7 C;  1JCH A;  4BIU A;  4JTD B;  3QO5 A;  4R8C A;  3ABM C;  5LBQ A;  2EIN B;  1E1Q G;  4E2L A;  1S3J A;  4ZBM A;  4JAV A;  4P30 A;  4MTF A;  4JPR A;  3FB6 C;  1Q82 W;  4MTG A;  4PDM A;  2ZDI C;  3E35 A;  1K8A W;  3OEE G;  3FYE B;  1M56 C;  5LHG A;  4MVZ A;  1M57 B;  3OGC C;  3FB8 C;  1YJ9 V;  5EC2 C;  5LGT A;  1NH2 B;  3EFF K;  1VQL V;  3OR6 C;  3OR7 C;  1OCO B;  2NLJ C;  5IYD O;  1EZJ A;  3E86 A;  1WLE A;  3RVZ A;  2D3O W;  2EJR A;  4HYO A;  1MOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...