4MTXA

Structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
b'AAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ethylene response sensor 1
publication title Structural Model of the Cytosolic Domain of the Plant Ethylene Receptor 1 (ETR1).
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 34
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4mtxA00
3ZRWB 4FMTA 3NXSA 4GCZA 4QPJA 4U7OA 5B1NA 3ZRWA 4FPPA 4LC1A 4BIUA 2LFSA 4JAVA 4MTXA 2WWWA 5B1OA 4KP4A 4U7NA 4Q20A 1IXMA 1F51A 3P32A 3TK1A 2LFRA 4I5SA 4GT1A 3A0RA 2FTKA 4ZKIA 2P67A 4JYCA 3D36A 3ZCCA 3ZRXA 4JASA 5C93A 1JOYA 2C2AA 4MT8A 5IDJA 4JYBA 3MD0A 2QM7A 3DGEA 3ZRVA 4BIZA 4QPKA 4JAUA 2QM8A
chains in the Genus database with same CATH superfamily
1DTOA 1W0JG 3K5OA 3ZIAG 4QPJA 1VQKV 1M93A 2IJJA 2W0XA 5CBHA 3OM3B 2Q8VA 3OMNB 5L3GA 1KYOF 4PA7A 2E74B 2JK5C 3ABLB 3K3WA 1SQGA 1WLEA 4YY3O 3X2QB 1F23A 4PI2A 2PTMA 4DYLA 2XHBA 4UVAA 1NZ6A 1Q81W 1MNGA 2QWRB 2R9AA 3KZIZ 4PELA 1JMKC 4Z1VA 4X64O 1Q7YW 4JAAA 3CC4V 3FYEB 4JAUA 1GTOA 1F4NA 3SJCC 1VF7A 1GMGA 5D5QA 3ZRWA 3JYCA 3K03A 3HR0A 2QE7G 2BTQA 3SYQA 5C8YA 2QKAA 4F6RA 3ZEDA 2DW4A 2UUAB 3OUFA 4ICGA 2A7WA 4L87A 4NR1A 1H8EG 1FFXB 1YI2V 3HKDA 2AHZA 3WB1A 2UU9O 2OWOA 3JARB 1HNWB 3CPWU 1M56C 3W7UA 2PUSA 2N74A 1XILA 4JF3A 2LGQA 3J81N 2E3CA 2FB5A 4HNAB 1YJNV 4F6EA 1RP3B 4MVSA 2VS0A 4IT5A 5F2VO 1SF9A 4LF4B 1N0NA 1QVGU 2ZKOA 4WCEV 1XBLA 2F43G 1L0NH 3MDSA 3LUTB 2RN9A 3DGEA 3ABLC 4X9QA 2A9HA 1BL8A 1ENVA 2YDEA 1H2SB 4LP8A 1KP3A 2YIDA 4JAVA 1OJHA 3SR2C 2DYSC 4JTDB 1EN4A 2Y69B 3EHBB 4JI0O 2YUAA 4J41A 2PY5A 1AROP 1UJWB 3TGUH 1H8HG 3ZHVA 2UXDB 3AG3C 1QCEA 4CZZA 1FS0G 1IBLO 2K1EA 3ABKC 3D36C 3BRCA 2IJHA 4LF6B 4CH6A 3ASNC 3SPJA 3JAMN 1VQMV 2WLHA 4N21A 2NN4A 3CHXA 1QLEC 3OR7C 5BY1A 1XMOB 1I94B 1VARA 1SQFA 4FM1A 3K0GA 4MVOA 4FM2A 4JYBA 5IYZB 3ABMB 1MMMA 4YIPA 3ASOB 2KQXA 4U3FH 1SQBH 3ZMTA 1HR0B 2NLJC 3KCYA 1NT2B 4LFCO 4RAIA 4J7ZA 5KHHA 5L3DA 4FFBA 4LFBO 1PL4A 4B3TB 3ZMSA 1PPJH 1M9NA 3P3NA 4MSWC 1Z5VA 3E89A 2RNBA 1E1QG 2NNUA 3M99B 4JI7B 1AR5A 4X1YB 1QBZA 1G8MA 5KHKA 1P4RA 3AK2A 1NH2B 1SA0B 5J2UA 3RVYA 1EN6A 4X8AA 1BQZA 5FLXN 3FAVA 4ZOLA 3N2KA 3ABMC 2EZOA 4O2BB 3FB8C 3K04A 3RYFB 4NXMB 1XNRO 1KD1W 5E79Z 3Q4HA 3PN1A 4BW9A 3RYHA 5K1PA 2BSKB 2N04A 2EINB 1VF6C 4TV9B 3E22A 3ABTA 3E86A 1XNQB 4DRXA 4LC1A 4DR3O 1CEZA 2WLLB 4OPAA 2RCVA 1H2GA 3EFFK 4JI3B 4OX9B 3SYCA 1VMGA 4GKJO 4J9YB 3G6EV 1XMQO 4KXRA 4PD4F 1K5QA 1YSCA 5DN6G 5IY5B 5FPOA 1AI7A 1Q82W 2QKCA 3FX7A 2QWOB 3OR6C 1CPYA 4QJFB 4B7KA 1K33A 5B1OA 2EIKC 1OCRC 5JCOC 4X66O 1F51A 2X7RB 1N34B 1JJOA 4X62B 4LNUA 4WFEA 5AG2A 3M8AA 1J95A 4X1IA 1Q43A 3C90A 4W4LA 3RYIA 3DXRA 5GTHZ 1WJZA 4MVQA 2E5LB 4IIJA 5EZYB 3D8CA 1M4UA 4FK5C 4MTXA 2EINC 1Y6XA 1P49A 5LYJB 2NR5A 3B40A 5KAFZ 1XOUA 4DUZB 5EYPB 2QTSA 2DWEC 4FIPC 4ZHQA 2H8PC 3JASB 2Y4UA 1QR9A 1V54B 2LW7A 3P30A 2ZDIC 3CE2A 1GM8A 5IY5C 3CXHF 1VQPV 4B08A 1V55B 3O65A 5L3BA 1Q3EA 4QIWF 2AZ0A 3I5DA 2Q7GA 3LNMB 3OW2U 4B3MO 4X1KB 1I08A 1YTFD 2GTSA 3WG7B 2HVKC 4UV9A 1N36O 2WPDG 3CEIA 1XL4A 1FXVA 4JPRA 1FXKC 2HR3A 3B8NA 4PV1B 5B1AB 3OGIB 3CD6V 3ETEA 1I7FA 4I50A 3KG2A 1FJGO 2WA4A 2GTAA 5JVDB 4JYAB 1AJNA 4K0KB 4PA4A 3H01A 2UUCO 1R73A 2ARHA 1AJQA 4JI8O 4YIOA 1JCHA 3AG7A 1TGOA 1P7BA 2R70A 2ATKC 3I56V 1PM9A 2QSAA 1OCOC 2HKOA 4P2ZA 3L73H 1N32B 4NTYA 3QNEA 4N23A 4YJ3A 5LA6A 2JEXA 2JRIA 1V55C 1K92A 2P4KA 2MW2B 1AVMA 1RFYA 1P84F 4MTOA 1SZXA 1R6KA 3RT3C 1RSOA 2ZM6B 4DR2B 2BTQB 3SDLA 4QE9A 1DLBA 4I5SA 3ICXA 4CH5A 4I9WA 4LCUC 2UXBB 3E8BA 3OD4A 4DR4B 3PJSK 1MZEA 1FFTB 3VBBA 1VF6A 4DXWA 1VQ7V 4B3RO 1EZJA 2V7QG 1XREA 5LXTA 5EIBC 1OZ0A 4I55A 1GN2A 4X65O 4QNHB 1YDXA 3OGCC 2CK3G 5IYBO 4IHJA 2QR4A 4G2KA 3JD1A 4UCSA 2P67A 3ZMZA 4JI2B 4TSFG 4DUYB 2W0FC 3T4ZA 3CCLV 1YITV 2QGNA 4MVUA 3JATA 3CJHB 2IH1C 1WNSA 4DV0B 3H1LH 5H6RA 3S3WA 4I4TA 4P30A 3JAWA 4DV3O 2HHHO 3JD0A 1W2BU 4LWSB 3QO8A 5KMGA 1ORQC 2Z0AA 3K9SA 2RMKB 3WFVA 5IYDO 3ZMVA 5B3SB 2JGUA 3LSSA 1T5EA 1W0KG 2Q0AA 5B1BC 4DW1A 5J2TA 3IFXA 4I7ZB 4O4JA 2YS8A 2W6IG 1WA8A 5LMUO 4NXNO 4RQFA 4JI6B 4LFAO 1JA8A 2ZXWC 1AP6A 1GN3A 2ZDIA 1ZL8A 1GK9A 4EB6A 3OEEG 5L3FA 1YZBA 2FYUH 1WB7A 5CA0A 3CMAV 1COWG 1VQ5V 2XAGA 2LQTA 2LGWA 4O4HB 2IU0A 2UXCB 1AILA 4EKWA 4CH3A 1MSWD 2CAZC 3RWRD 1GH6A 4RUFA 3APOA 2PZSA 5LP6C 2JEUA 3BABA 3DSQA 2GBOA 3CCEV 1GKFA 4ZI7A 2OCCC 2F95B 2BE3A 3E8GA 3JAKA 4KUMA 4DV4B 3B2EE 1TUBA 3JCZA 4WFHA 3H1KH 4O4IB 1S72V 1R6TA 3L74H 5DEDA 4ZKIA 4G27B 5LMNB 1M57B 2CGNA 4TWKA 1KMIZ 3LSQA 3FAVB 4ZOLB 1MABG 3N2KB 1GN4A 1AJPA 2VRZA 1LNQA 3J80N 3HB3B 3T1YO 1YTFB 2LW1A 2F4VO 4HZ3A 1MA1A 1AB3A 4IYHA 4WFGA 5JJEB 3Q4HB 4GX1A 3RYHB 2B1IA 5IWAB 5CB4A 4WFBV 4D6TH 2JVDA 3ZHQA 3JSLA 3B77A 4H44B 3ZBHA 5KX5B 1M1KW 3ZHTA 2XNDG 4KHPO 2QWNB 3K59A 3ZRVA 3W7WA 2WAMA 3AG1C 2Q67A 4H37A 4A5UB 2ADQB 1K97A 5JQGA 4DV1B 5E1AC 2DQ0A 5IJ9A 1JFFB 1OCCB 5GONA 4AILC 2IJIA 2FKXA 2KG7B 3G4SV 2FMLA 1PD3A 2XOKG 4U3JB 1IVSA 2D3OW 1CP9A 4JYCA 3TJTA 1MZFA 5JH7B 2OYQA 3ZHSA 5CBFA 2A0LA 3AG4B 4ASUG 4AI8A 4LNUB 3EVKA 4DV6B 1NR1A 4WFFA 1KB9F 2ZE8A 4X1IB 3DC5A 2Q9LA 3CCRV 2DOSA 3THOA 1RM1C 2UUAO 4FLYA 2W6JG 3RYIB 3DXRB 2GV9A 2IW5A 4Q6GA 3SJBC 1VQ9V 2WLMA 1Q86W 1QLNA 4FZ0A 3E8HA 4CS4A 2YSUB 4UVBA 1PV0A 3CB2A 1HNWO 4UB6Z 1S76D 4NTXA 4DV2O 2HLDG 1NTKH 2GUZB 3JD4A 1NVPB 3L71H 3OEHG 3SPIA 1YF2A 1FXHA 2Y0PA 3HKCB 3U10A 2R72A 2HFEC 3X2QC 2EIMB 3GWKC 4QE7A 2Y48A 4JI5B 2DJVA 4X20B 5IE9A 2WA3A 5K1XA 2KSDA 2HP8A 1AI4A 4KL1A 2R9RB 2QKSA 1SRYA 1US6A 2AZ2A 4O4LA 3K57A 2CTWA 4EFBA 2QWQB 5JJJB 3CRRA 3GB7C 1HNXB 1V9PA 5H2FZ 4GKKB 3OMIB 2PF4E 4DR5B 1DGSA 1EBOA 2XUMA 3LDEA 1NS1A 2AXTZ 2ZIOA 1S5HC 2AGAA 5B5EZ 4D7TA 1BCCH 2EX3A 3MHHC 4I0XA 3K06A 1Y76B 1X4TA 2DWDC 2HJDA 3MD0A 4R6ZA 1XMOO 1I94O 3CCUV 2YI8A 1WP8A 3C3TA 4J9ZB 1B6QA 1H2KA 2WLKA 3RBZA 2Q69A 4MVZA 2QJ1A 4YHHB 4Q20A 3U0ZA 2IH3C 2P06A 3SYPA 4GLXA 3S3XA 1HP8A 1HR0O 5EC2C 1P7GA 2GSMB 1G1XB 3L9DA 3E35A 4MS2A 3TXSA 1XL6A 4YJ2A 2HEPA 3FFQA 4HBNA 2Y69C 2D2CB 3M7MX 1Y4MA 4B3TO 1GAXA 1RSOB 1SESA 4BW5A 3CSXA 4PHZA 2Q7EA 3FKSG 4MTFA 4PA6A 2DYRB 5LGUA 4LBEC 4U7NA 2WLIA 4DR6O 3B8MA 1O9HA 4AQYB 2F1MA 2QEXV 3C3SA 2V4DA 1EFRG 3BVOA 2MK3A 4OPHA 4WBNA 2P7TC 2Q0OC 5JJNB 3FB5C 2ZR2A 3F7YC 4C7UA 3R65A 3SGIA 1HNZB 1OV9A 1S3JA 2LFRA 3ASOC 2VQEB 5IJ0B 1IBKB 1KUQA 1FD9A 2RJZA 4O2AA 3CCJV 1H2MA 4NXMO 2LP7A 1LUVA 4D7SA 3K9AA 3CRAA 3JAWB 3CX5F 2IM9A 2YC0A 1R3KC 3CP1A 3K79A 2UUBB 5KMGB 4FLWA 1IURA 2EIJB 1XNQO 3ZHRA 2PGGA 2QA4V 3STZC 4UXNA 5JWPA 4R8CA 4UCVA 4OX9O 4BR6A 3CRMA 3AG2B 5BXZA 4R7CA 4GKJB 5BMVB 4O4JB 2HJFC 3QTCA 3CYOA 3IC7A 1VQOV 1K3EA 5HFLA 3AK1A 1X59A 3CC2V 2QWPB 4LF5B 3SJQC 1VIBA 1QU7A 4X62O 5BR8B 1J5EB 3UKMA 4DR1B 4LH7A 4B3SB 2M7WA 1R6NA 1BE3H 1XQ8A 5H6QA 2RDCA 2LJ2A 2E5LO 5FPRA 5J9PC 3BA8A 3JALA 4UFZA 1FAFA 3D36A 1FFXA 2OIGA 2EIJC 3ZRSA 3JARA 1Y74A 1VP7A 1R3LC 2OTJV 1SS3A 2O57A 1E1RG 4DUZO 1VF5B 5GW7A 4PI0A 4OGQB 2YIBA 2CTQA 4LF7B 3SPHA 3AG2C 1R3IC 3A8TA 3P32A 4PA9A 3N27A 3D3QA 1SC5B 1LUWA 4JI4B 3ZRXA 4LF9O 1H2LA 3CXCU 3HPLC 1K4DC 5L3CA 1TA8A 3KCXA 1WP7A 5EBLC 2CTRA 3K5MA 4NKGB 3G6BA 1EN5A 3W7TA 4B3MB 4FFKA 3OFNG 1FKAO 1TUEB 3APQA 1SERA 1Z5WA 4H13B 3VQXA 2BOBC 3A0HZ 1BHAA 2YI9A 3H1IH 1MG1A 2Q6AA 1EZVH 4DR7B 1QNMA 4TQFA 3MAQA 4JYAO 4DK1A 4K0KO 2CH7A 4LR3A 4JYYA 1HWYA 4CBCA 1SQQH 4U7OA 2Q4PA 1AR1B 4BIUA 5JQGB 4GX0A 5B66Z 4PJ0Z 3E83A 4BWAA 4JI8B 3OTFA 1V54C 2QM4A 1M5IA 1WB8A 3J7AU 2XAFA 4BIOA 1N32O 4JI1O 1ZWIC 3TETA 1BS3A 5IYZA 1VQ6V 4DV5B 3STLC 3ETDA 3ZRWB 2YIAA 1N8RW 3WG7C 1IBMO 3OT7A 5C8YB 3T1HO 1YXBA 4F6RB 3RYCA 1YJWV 4JZGA 5EBWC 2ZM6O 1Q6IA 4DR2O 5B1AC 3HKDB 1KP2A 5KAIZ 3K5NA 3ABUA 2XT9A 1H2NA 1BMFG 1EM1A 3H9VA 4NVPA 4DR4O 5EC1C 4TT3G 3T1CA 3GVMA 1IX9A 2EILB 2VQFB 2Q73A 3ZHUA 4X1YA 1AP5A 3IAYA 2YIBD 4J7JA 1SA0A 1KU9A 2QM7A 3RFRA 5ITZA 3CRCA 4DUYO 5JCOA 1Z2GA 4JGSA 4O4LB 2PYLA 1BQ0A 4DV0O 1GM9A 4HAMA 1N0JA 3RN4A 1LR1A 3ZN0A 2BSKA 1DF4A 5IT9N 4Z1MG 1IXBA 1PNMA 1D5NA 1K7DA 4AHCA 2X0LA 1B04A 1AI6A 2Q68A 3T4DA 3WB2A 4DV7B 1NTZH 2WLLA 4TQDA 5KUMA 2ILMA 3RGBA 4EEQA 3OTOB 2YEVA 2CUGA 3HKBA 1YEWA 1HW7A 3OE7G 1SQPH 3CC7V 4CH4A 2RQ6A 4K3AA 2HG5C 3BHPA 5KLVH 4BIZA 4JI6O 1UPGA 2ZIMA 3GWOA 1B3QA 2LFSA 4LFAB 4FFBB 1O9GA 3K58A 3A0RA 4PA3A 4CS3A 1K8AW 3FB7C 1XHZA 1FXKA 3SYOA 5GTIZ 2BCCH 1SETA 4W4KA 4QPKA 1BZKA 2G38A 3LSUA 4GUNA 2WLIB 5EZYA 4H0LB 5B3SC 5LOVA 4P9PA 2L35A 4GX2A 1URFA 4LF8B 4DV4O 4WBNB 5LYJA 5J2UB 1KKDA 3HKEA 1ZX3A 5CA1A 3CMEV 1KBHA 3W7SA 3ZN1A 5EYPA 2GDSA 1I5XA 5CBGA 4QGPA 5LMNO 1VQLV 4MW3A 1YJ9V 1NH2D 2V1DA 3BPZA 4JV5O 2H94A 4MTGA 3R66A 4O2AB 2M6YA 4FLXA 5KHIA 3SJAC 3T1YB 4FVMA 2XAJA 3CS5A 4ZBMA 1KKCA 3UCSC 1FPOA 3E22B 1L8DA 4DRXB 1K34A 2XAQA 1DK1A 1Q6HA 3OAAG 3W7XA 1S77D 4B7EA 1N33B 2WSSG 4K8ZA 1BSMA 4RQEA 3T2MA 3ZMUA 5JVDA 3N2GA 4J7KA 1NKDA 3RW0A 1WN7A 3JD3A 4DV1O 2ZE6A 1PNLA 1F7YA 2P90A 3F5TA 4FLVA 3CCMV 1M57C 4PDMA 4YY3B 4G28B 2Q7HA 1PL0A 1YIJV 2X6BA 3BFRA 4GT1A 4XBFA 1Y66A 2OTLV 2ADPA 2KKWA 2YXYA 4X64B 4BAYA 1IZ3A 4DV6O 1NTMH 2EJ7A 2DYSB 4FM0A 3RVZA 2IBZH 4IIJB 1QHTA 1JVMA 2JGDA 3AG3B 4TUYA 4CC6A 4GYCB 2UU9B 3JALB 3ABKB 4TV8A 2A3QA 4JASA 3ASNB 5C93A 3K0DA 3I55V 1Y74B 3K08A 4DV2B 3G71V 4ZHQB 4LF4O 2P5OA 4IL6Z 1QLEB 1KECA 1OCCC 1S5JA 1THZA 2B9ZA 2DN9A 4JI5O 1PKXA 2FTKA 3SPCA 4YXWG 5LHGA 3U11A 3CCSV 2X6CA 3P3PA 2QTOA 1I5YA 3AG4C 2X6AA 1HNXO 1K73W 2UXDO 3CJHA 3ML0A 4ZIBA 4GKKO 4I50B 4JI0B 4DR5O 4JZ2A 4X88A 4DK0A 4UVCA 1QVFU 1IXMA 2VWKA 4LWSA 4LF6O 5LP6A 3A0BZ 1IBLB 4XDKA 1PP9H 1RPRA 3AK3A 5BZBA 2KB1A 2N05A 5CA3A 4FLZA 3VQYA 2CH7B 4HYOA 4UCOA 1GN6A 4DO2A 5LBQA 3G80A 5B1NA 4FLUA 2E76B 2JJ2G 5EIBD 1OHHG 1VQNV 2GHYA 1GRJA 2EIMC 4YJ3B 3ZX6A 5LA6B 3H1HH 3WU2Z 4YHHO 3EXAA 1H38A 3WB0A 3QG5A 1SQVH 4LH6A 1AR4A 4LFCB 4XDLA 4FJCC 1OCZB 5H5NA 1K9MW 3SPGA 4LFBB 5TISZ 1TVKA 2ZCEA 1NBMG 1D5AA 2IU3A 3RYCB 4O4HA 1XHXA 1YCIA 3QO5A 4JI7O 4MT8A 4R50A 3VQWA 3LNNA 4AQYO 5LXTB 2JS3A 4J10A 4I55B 3UT5A 3FB6C 2E75B 4K35A 2AHYA 4FPPA 2XASA 4DR6B 1WPXA 1HDJA 4IHJB 4UCUA 4O4IA 5FNVA 1HNZO 1S5LZ 1XI1A 4JTAB 2VQEO 5ITZB 1IBKO 2ZQMA 3JATB 2EIKB 1OCRB 1M90W 3D3IA 5LGNA 5LHIA 3ETGA 4KFMA 1XNRB 4I4TB 2DMXA 3QF7A 2R9IA 3CWBH 4IGGA 1OCZC 1I0HA 2ZNJA 1G4YB 1L1FA 1YHQV 2UUBO 2DYRC 4JI3O 5KX5A 1QQCA 4DR3B 3FD9A 3L72H 4JTCB 2EBOA 2EJRA 3BAAA 3QO7A 4FMTA 5J2TB 1XMQB 2OCHA 1Q8IA 1KC8W 1WA8B 2YEVB 3HKBB 3JSNA 3SYAA 1JFFA 1YVWA 4Z2WA 1BHBA 1ZL8B 2Q5ZA 2ZNIA 2KG7A 2HVJC 1N34O 1JPXA 4EB6B 4U3JA 5CA0B 4X66B 2A79B 4LF5O 3L70H 5JH7A 1GO3F 1ZAUA 5BR8O 1J5EO 3NR7A 4DR1O 4B3SO 3JCUZ 1FXKB 3ZCCA 5IDJA 1AI5A 4DW0A 4RO2A 1JQ0A 4ZI7B 1XEQA 1JJ2U 2OIEA 2WLJA 3JAKB 1QR8A 1U97A 3E8FA 1TUBB 5LOVB 4HNAA 5HFMA 3BA9A 3CRQA 2GUZA 1K5SA 1XUQA 2IJKA 2CTPA 4LF7O 3HKEB 1SZTA 3UO2A 5CA1B 1OCOB 3VOUA 5CMUA 5A2QN 3H1JH 4JI4O 1ZSPA 3TXQA 3HKCA 3IGAC 3DTUB 2L6LA 2CDYA 1BT8A 1BGYH 5LL6Y 4CC5A 1WPBA 4X20A 1RPOA 2DE0X 2BOCC 4LF9B 5CB4B 1IDSA 3TK1A 1L0LH 4J11A 1N36B 3AEIA 3IC9A 3ETQA 1JR9A 1SQXH 5LGTA 3G67A 1GM7A 2PI4A 2QM8A 4DR7O 1FJGB 2UXNA 1E79G 2YXLA 4PDRA 3CCQV 2UUCB 4ABMA 1PNKA 2ODMA 4H33A 3LDCA 2WLNA 5IJ9B 3N2GB 2VWJA 5GONB 1R1BA 1UFIA 1VQ4V 4K8XA 1Y76A 1ZLZA 4NYKA 4PDLA 1KQSU 2ZE7A 4WF9V 3A2FA 4J42A 1G6UA 4DV5O 3F5WC 1A32A 4JI1B 4XDJA 3LDDA 2B1GA 2JJ1G 5DM6V 2YICA 2ETNA 3CCVV 2XAHA 3IJ4A 2UXBO 1Y67A 1IBMB 1F4MA 3T1HB 2JGDB 4P9OA 4TUYB 3UO3A 2ITCC 1VQ8V 4RWUA 4TV8B 4J80A 2ZD9A 2PI5A 4UB8Z 2VQFO 5B1BB 4UUJC 4B3RB 5LHHA 3TCUA 4I9QA 4X65B 1SKVA 2JS5A 2H3OA 1D2DA 4JI2O 3OMAB 1TAEA 2JDIG 4FLTA 1N4CA 2ZR3A 2Z5UA 1NVPD 2F66C 2P22C 3DC6A 4MW8A 5H9CA 2OT5A 2WWWA 2JIZG 2ZXWB 4O2BA 5FL7G 1R3JC 4OXSA 3RYFA 5IJ0A 2P6JA 1JOYA 3E2EA 1S0VA 4E2LA 3B4SA 4X89A 4DV3B 2HHHB 3KKYA 3BCCH 2K9PA 4GCZA 3UQ8A 4TV9A 5LP6B 5KA5A 2LO1A 2CGOA 4MVMA 3QVNA 4I0XB 3BEHA 4DV7O 2OCCB 2EILC 4L8JA 5IYCO 1WAZA 2ZE5A 3OUSA 3OTOO 4CS2A 2P4VA 1ZUQA 5KUKA 4E4EA 2B5UA 1NJIW 3UM7A 5A9GA 4F4LA 1MSDA 3K5LA 2Y0IA 5BMVA 5LMUB 4NXNB 2XTAA 4KP4A 5D5PA 3ZS8C 3VQVA 2BTOA 2YXHA 2DQ3A 3L75H 1FYJA 1W59A 2UXCO 2CE4A 2C2AA 1NI8A 4PDVA 4YJ2B 4FZ1A 5CN0A 4NTWA 5L3EA 3NXSA 1TVKB 2F23A 2PYJA 4WFAV 2EULA 5DECA 4UCTA 4NB5A 1JX9A 1NR7A 1XDCA 1ZTEA 4IYIA 1Q90D 3AG1B 3O9OA 4LF8O 1U96A 4EFEA 2ITDC 2AW9A 3UT5B 4TOIA 2FL4A 3JASA 4MVRA 1NQTA 1B06A 1DF5A 1Q6UA 3ZJZA 5KA6A 5FNVB 3F7VC 3B09A 2Y4TA 1ROPA 5KHGA 4UCRA 2F93B 3BY6A 2ZINA 4X1KA 2F4VB 5IWAO 4GX5A 3MHSC 4UV8A 4JV5B 4GZRB 2EZPA 1NU1H 2Z3YA 2A06H 1RM1B 1M56B 3FYIB 5EBMC 1MOFA 1CXZB 3JD2A 4KHPB 2QDOA 1N33O 1VEWA 5EK0A 4RUEA 1K4CC 5KHJA 2UXXA 2ZT9B 1Q5OA
chains in the Genus database with same CATH topology
1DTOA 1W0JG 1E1RG 1OCZB 2IH1C 1K9MW 5GW7A 3ZIAG 4QPJA 1VQKV 5H6RA 3SPGA 2IJJA 4P30A 5CBHA 3SPHA 3AG2C 3OM3B 1NBMG 3JD0A 3OMNB 1R3IC 5L3GA 1W2BU 2IU3A 3QO8A 4PA7A 3P32A 4PA9A 3QO5A 2JK5C 3ABLB 3K3WA 1WLEA 3X2QB 1ORQC 1F23A 3ZRXA 4MT8A 4UVAA 4R50A 3WFVA 3CXCU 1Q81W 3HPLC 5IYDO 3ZMVA 1K4DC 5B3SB 3LSSA 1Q7YW 4PELA 1W0KG 5L3CA 3CC4V 3FYEB 4JAUA 1GTOA 1F4NA 5B1BC 1GMGA 3FB6C 5EBLC 3ZRWA 2AHYA 4FPPA 3JYCA 2XASA 3W7TA 3K03A 3IFXA 1WPXA 3OFNG 2QE7G 1TUEB 1SERA 3SYQA 2W6IG 2DW4A 2BOBC 3OUFA 1BHAA 4L87A 4RQFA 1H8EG 1MG1A 2Q6AA 1YI2V 4JTAB 2AHZA 2ZXWC 2ZDIA 3CPWU 1M56C 3W7UA 2ZQMA 2EIKB 1GK9A 1OCRB 1M90W 3OEEG 5L3FA 3D3IA 4JF3A 5LHIA 5LGNA 1HWYA 3ETGA 4KFMA 4CBCA 4U7OA 1YJNV 3CMAV 1COWG 1VQ5V 1AR1B 4BIUA 4GX0A 2XAGA 2IU0A 2R9IA 3E83A 4MVSA 1OCZC 1V54C 4EKWA 1QVGU 2XAFA 4WCEV 1MSWD 2F43G 1G4YB 4RUFA 1ZWIC 1L1FA 1YHQV 2DYRC 3TETA 3LUTB 2JEUA 3DGEA 1VQ6V 3ABLC 2A9HA 3STLC 3ETDA 3CCEV 1GKFA 4JTCB 2EBOA 2EJRA 3QO7A 1BL8A 3ZRWB 4FMTA 2OCCC 3E8GA 1ENVA 1N8RW 4KUMA 3WG7C 4LP8A 1KP3A 3JCZA 4JAVA 2DYSC 1KC8W 4WFHA 4JTDB 1S72V 2YEVB 1YJWV 2Y69B 5EBWC 3EHBB 4ZKIA 5B1AC 1AROP 1UJWB 3SYAA 1H8HG 1KP2A 3AG3C 4G27B 1QCEA 4CZZA 3ABUA 1BHBA 1M57B 1FS0G 4TWKA 1BMFG 2HVJC 2K1EA 1JPXA 3LSQA 3ABKC 1MABG 5EC1C 1AJPA 4TT3G 1LNQA 3T1CA 2IJHA 3HB3B 1YTFB 3ASNC 2A79B 3SPJA 4HZ3A 1VQMV 1GO3F 2EILB 2WLHA 4N21A 4WFGA 1QLEC 3OR7C 4GX1A 2B1IA 4WFBV 1FXKB 3K0GA 3ZCCA 4MVOA 3B77A 5IDJA 4JYBA 3ABMB 1M1KW 2QM7A 1AI5A 2XNDG 4RO2A 1JQ0A 3ZRVA 3W7WA 1JJ2U 2WLJA 3ASOB 2WAMA 1QR8A 3AG1C 3E8FA 3ZMTA 5HFMA 2NLJC 4JGSA 2Q67A 4RAIA 4H37A 1K5SA 5L3DA 1GM9A 1K97A 4HAMA 5E1AC 2IJKA 2DQ0A 1OCCB 1SZTA 1OCOB 2IJIA 3G4SV 3VOUA 5CMUA 3ZMSA 3ZN0A 1PD3A 2XOKG 1M9NA 1DF4A 2D3OW 4MSWC 3IGAC 1CP9A 4JYCA 4Z1MG 3DTUB 3E89A 1PNMA 1K7DA 1E1QG 2X0LA 1RPOA 5CBFA 1AI6A 2BOCC 2Q68A 2NNUA 2A0LA 3M99B 3T4DA 3AG4B 4ASUG 2WLLA 5KUMA 3TK1A 1QBZA 1G8MA 1NR1A 4WFFA 2YEVA 3AEIA 1P4RA 1NH2B 3OE7G 5LGTA 3CC7V 3RVYA 3CCRV 1RM1C 2W6JG 2IW5A 2HG5C 1VQ9V 4X8AA 2WLMA 4BIZA 1Q86W 1GM7A 2PI4A 1QLNA 3E8HA 2QM8A 2YSUB 2UXNA 3ABMC 4UVBA 2EZOA 1S76D 1E79G 4PDRA 3GWOA 2HLDG 2LFSA 3FB8C 3K04A 3CCQV 1PNKA 4H33A 3LDCA 1KD1W 2WLNA 3JD4A 3A0RA 4PA3A 1K8AW 1NVPB 1VQ4V 3OEHG 3FB7C 1FXKA 3SPIA 3SYOA 4PDLA 1FXHA 1KQSU 1SETA 4QPKA 2EINB 2HFEC 3X2QC 2EIMB 4QE7A 2Y48A 3ABTA 3E86A 4WF9V 4LC1A 1CEZA 3F5WC 1AI4A 2WLIB 5B3SC 2WLLB 2R9RB 1H2GA 4XDJA 2QKSA 4P9PA 1SRYA 3EFFK 3LDDA 4GX2A 3SYCA 2B1GA 2JJ1G 4J9YB 3G6EV 5DM6V 3GB7C 1KKDA 1S77D 1K5QA 1YSCA 3CCVV 3CMEV 2XAHA 5DN6G 5IY5B 3OMIB 3ZN1A 1AI7A 3W7SA 1Q82W 3OR6C 1I5XA 5CBGA 1CPYA 1F4MA 1VQLV 1EBOA 4MW3A 1YJ9V 4QJFB 4P9OA 1NH2D 3LDEA 2ITCC 1VQ8V 2V1DA 1K33A 5B1OA 2EIKC 1S5HC 2H94A 1OCRC 4MTGA 1F51A 2ZD9A 2PI5A 2X7RB 3MHHC 3K06A 5B1BB 4UUJC 4WFEA 5LHHA 2DWDC 3TCUA 2XAJA 3MD0A 1J95A 4ZBMA 4R6ZA 3CCUV 3OMAB 4J9ZB 2JDIG 1K34A 2XAQA 4MVQA 2ZR3A 2Z5UA 1NVPD 1B6QA 2WLKA 3OAAG 3RBZA 4MW8A 5H9CA 3W7XA 2OT5A 4FK5C 4MTXA 2WWWA 2ZXWB 2JIZG 2Q69A 4MVZA 5FL7G 1R3JC 2EINC 2WSSG 4Q20A 2IH3C 4OXSA 3SYPA 4RQEA 5EC2C 3T2MA 3ZMUA 2GSMB 2P6JA 1JOYA 3E2EA 1S0VA 3E35A 1NKDA 4MS2A 3RW0A 4E2LA 1XL6A 3JD3A 1PNLA 2P90A 2Y69C 4X89A 2DWEC 4FIPC 2H8PC 1Y4MA 1QR9A 1V54B 3P30A 3CCMV 4GCZA 1SESA 4BW5A 2ZDIC 1M57C 1GM8A 3FKSG 5IY5C 4MTFA 4PDMA 4PA6A 1VQPV 4G28B 2DYRB 1PL0A 1V55B 5LGUA 1YIJV 4LBEC 4U7NA 5KA5A 2X6BA 5L3BA 2WLIA 4GT1A 4MVMA 4XBFA 4QIWF 3OW2U 1Y66A 3LNMB 2OTLV 3B8MA 3BEHA 2QEXV 1YTFD 2OCCB 4BAYA 2EILC 1EFRG 2MK3A 2P7TC 3WG7B 5IYCO 3FB5C 3OUSA 2HVKC 2ZR2A 4UV9A 2DYSB 2WPDG 1XL4A 1FXVA 4JPRA 1FXKC 5KUKA 2HR3A 2B5UA 3F7YC 1NJIW 3UM7A 3RVZA 3B8NA 4F4LA 5B1AB 1JVMA 3R65A 3AG3B 3CD6V 3ETEA 4KP4A 3KG2A 1S3JA 2LFRA 3ASOC 3ABKB 2DQ3A 1AJNA 4PA4A 3H01A 1R73A 3CCJV 4JASA 3ASNB 5C93A 3K0DA 1AJQA 2C2AA 3I55V 2LP7A 4PDVA 3K08A 3G71V 1JCHA 3K9AA 1QLEB 1KECA 1P7BA 5CN0A 2ATKC 5L3EA 3I56V 1OCCC 3NXSA 1OCOC 2HKOA 4WFAV 1R3KC 4P2ZA 3CP1A 1THZA 3K79A 2EIJB 1JX9A 1NR7A 1PKXA 2QA4V 3QNEA 2FTKA 4N23A 3STZC 3SPCA 4YXWG 5LHGA 4UXNA 2JEXA 4R8CA 1V55C 1K92A 3CCSV 2X6CA 3AG1B 2QTOA 1I5YA 3AG4C 2X6AA 2ITDC 3AG2B 1K73W 4MTOA 1R6KA 4R7CA 3ML0A 4MVRA 1NQTA 2HJFC 4X88A 4QE9A 1DF5A 3CYOA 3IC7A 4UVCA 1IXMA 3ZJZA 5KA6A 1DLBA 1VQOV 4I5SA 1QVFU 1K3EA 5HFLA 4I9WA 3F7VC 4LCUC 4XDKA 3E8BA 1RPRA 3CC2V 5BZBA 3PJSK 2KB1A 1ROPA 1FFTB 3VBBA 5CA3A 3BY6A 4HYOA 3SJQC 4GX5A 4DXWA 1VQ7V 3MHSC 4UV8A 3UKMA 1EZJA 2V7QG 4DO2A 5LBQA 1OZ0A 5B1NA 2EZPA 2M7WA 4QNHB 2JJ2G 1VQNV 1OHHG 1R6NA 3OGCC 2Z3YA 2CK3G 2GHYA 5H6QA 1RM1B 5IYBO 2EIMC 1M56B 3FYIB 4G2KA 5EBMC 5J9PC 3JD1A 1MOFA 3JD2A 2P67A 3ZMZA 3D36A 4TSFG 1H38A 2W0FC 2EIJC 5EK0A 3T4ZA 3ZRSA 4RUEA 3CCLV 1K4CC 1YITV 1R3LC 4MVUA 2OTJV 2UXXA 4XDLA 4FJCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZRW B;  4FMT A;  3NXS A;  4GCZ A;  4QPJ A;  4U7O A;  5B1N A;  3ZRW A;  4FPP A;  4LC1 A;  4BIU A;  2LFS A;  4JAV A;  4MTX A;  2WWW A;  5B1O A;  4KP4 A;  4U7N A;  4Q20 A;  1IXM A;  1F51 A;  3P32 A;  3TK1 A;  2LFR A;  4I5S A;  4GT1 A;  3A0R A;  2FTK A;  4ZKI A;  2P67 A;  4JYC A;  3D36 A;  3ZCC A;  3ZRX A;  4JAS A;  5C93 A;  1JOY A;  2C2A A;  4MT8 A;  5IDJ A;  4JYB A;  3MD0 A;  2QM7 A;  3DGE A;  3ZRV A;  4BIZ A;  4QPK A;  4JAU A;  2QM8 A; 
#chains in the Genus database with same CATH topology
 1DTO A;  1W0J G;  3K5O A;  3ZIA G;  4QPJ A;  1VQK V;  1M93 A;  2IJJ A;  2W0X A;  5CBH A;  3OM3 B;  2Q8V A;  3OMN B;  5L3G A;  1KYO F;  4PA7 A;  2E74 B;  2JK5 C;  3ABL B;  3K3W A;  1SQG A;  1WLE A;  4YY3 O;  3X2Q B;  1F23 A;  4PI2 A;  2PTM A;  4DYL A;  2XHB A;  4UVA A;  1NZ6 A;  1Q81 W;  1MNG A;  2QWR B;  2R9A A;  3KZI Z;  4PEL A;  1JMK C;  4Z1V A;  4X64 O;  1Q7Y W;  4JAA A;  3CC4 V;  3FYE B;  4JAU A;  1GTO A;  1F4N A;  3SJC C;  1VF7 A;  1GMG A;  5D5Q A;  3ZRW A;  3JYC A;  3K03 A;  3HR0 A;  2QE7 G;  2BTQ A;  3SYQ A;  5C8Y A;  2QKA A;  4F6R A;  3ZED A;  2DW4 A;  2UUA B;  3OUF A;  4ICG A;  2A7W A;  4L87 A;  4NR1 A;  1H8E G;  1FFX B;  1YI2 V;  3HKD A;  2AHZ A;  3WB1 A;  2UU9 O;  2OWO A;  3JAR B;  1HNW B;  3CPW U;  1M56 C;  3W7U A;  2PUS A;  2N74 A;  1XIL A;  4JF3 A;  2LGQ A;  3J81 N;  2E3C A;  2FB5 A;  4HNA B;  1YJN V;  4F6E A;  1RP3 B;  4MVS A;  2VS0 A;  4IT5 A;  5F2V O;  1SF9 A;  4LF4 B;  1N0N A;  1QVG U;  2ZKO A;  4WCE V;  1XBL A;  2F43 G;  1L0N H;  3MDS A;  3LUT B;  2RN9 A;  3DGE A;  3ABL C;  4X9Q A;  2A9H A;  1BL8 A;  1ENV A;  2YDE A;  1H2S B;  4LP8 A;  1KP3 A;  2YID A;  4JAV A;  1OJH A;  3SR2 C;  2DYS C;  4JTD B;  1EN4 A;  2Y69 B;  3EHB B;  4JI0 O;  2YUA A;  4J41 A;  2PY5 A;  1ARO P;  1UJW B;  3TGU H;  1H8H G;  3ZHV A;  2UXD B;  3AG3 C;  1QCE A;  4CZZ A;  1FS0 G;  1IBL O;  2K1E A;  3ABK C;  3D36 C;  3BRC A;  2IJH A;  4LF6 B;  4CH6 A;  3ASN C;  3SPJ A;  3JAM N;  1VQM V;  2WLH A;  4N21 A;  2NN4 A;  3CHX A;  1QLE C;  3OR7 C;  5BY1 A;  1XMO B;  1I94 B;  1VAR A;  1SQF A;  4FM1 A;  3K0G A;  4MVO A;  4FM2 A;  4JYB A;  5IYZ B;  3ABM B;  1MMM A;  4YIP A;  3ASO B;  2KQX A;  4U3F H;  1SQB H;  3ZMT A;  1HR0 B;  2NLJ C;  3KCY A;  1NT2 B;  4LFC O;  4RAI A;  4J7Z A;  5KHH A;  5L3D A;  4FFB A;  4LFB O;  1PL4 A;  4B3T B;  3ZMS A;  1PPJ H;  1M9N A;  3P3N A;  4MSW C;  1Z5V A;  3E89 A;  2RNB A;  1E1Q G;  2NNU A;  3M99 B;  4JI7 B;  1AR5 A;  4X1Y B;  1QBZ A;  1G8M A;  5KHK A;  1P4R A;  3AK2 A;  1NH2 B;  1SA0 B;  5J2U A;  3RVY A;  1EN6 A;  4X8A A;  1BQZ A;  5FLX N;  3FAV A;  4ZOL A;  3N2K A;  3ABM C;  2EZO A;  4O2B B;  3FB8 C;  3K04 A;  3RYF B;  4NXM B;  1XNR O;  1KD1 W;  5E79 Z;  3Q4H A;  3PN1 A;  4BW9 A;  3RYH A;  5K1P A;  2BSK B;  2N04 A;  2EIN B;  1VF6 C;  4TV9 B;  3E22 A;  3ABT A;  3E86 A;  1XNQ B;  4DRX A;  4LC1 A;  4DR3 O;  1CEZ A;  2WLL B;  4OPA A;  2RCV A;  1H2G A;  3EFF K;  4JI3 B;  4OX9 B;  3SYC A;  1VMG A;  4GKJ O;  4J9Y B;  3G6E V;  1XMQ O;  4KXR A;  4PD4 F;  1K5Q A;  1YSC A;  5DN6 G;  5IY5 B;  5FPO A;  1AI7 A;  1Q82 W;  2QKC A;  3FX7 A;  2QWO B;  3OR6 C;  1CPY A;  4QJF B;  4B7K A;  1K33 A;  5B1O A;  2EIK C;  1OCR C;  5JCO C;  4X66 O;  1F51 A;  2X7R B;  1N34 B;  1JJO A;  4X62 B;  4LNU A;  4WFE A;  5AG2 A;  3M8A A;  1J95 A;  4X1I A;  1Q43 A;  3C90 A;  4W4L A;  3RYI A;  3DXR A;  5GTH Z;  1WJZ A;  4MVQ A;  2E5L B;  4IIJ A;  5EZY B;  3D8C A;  1M4U A;  4FK5 C;  4MTX A;  2EIN C;  1Y6X A;  1P49 A;  5LYJ B;  2NR5 A;  3B40 A;  5KAF Z;  1XOU A;  4DUZ B;  5EYP B;  2QTS A;  2DWE C;  4FIP C;  4ZHQ A;  2H8P C;  3JAS B;  2Y4U A;  1QR9 A;  1V54 B;  2LW7 A;  3P30 A;  2ZDI C;  3CE2 A;  1GM8 A;  5IY5 C;  3CXH F;  1VQP V;  4B08 A;  1V55 B;  3O65 A;  5L3B A;  1Q3E A;  4QIW F;  2AZ0 A;  3I5D A;  2Q7G A;  3LNM B;  3OW2 U;  4B3M O;  4X1K B;  1I08 A;  1YTF D;  2GTS A;  3WG7 B;  2HVK C;  4UV9 A;  1N36 O;  2WPD G;  3CEI A;  1XL4 A;  1FXV A;  4JPR A;  1FXK C;  2HR3 A;  3B8N A;  4PV1 B;  5B1A B;  3OGI B;  3CD6 V;  3ETE A;  1I7F A;  4I50 A;  3KG2 A;  1FJG O;  2WA4 A;  2GTA A;  5JVD B;  4JYA B;  1AJN A;  4K0K B;  4PA4 A;  3H01 A;  2UUC O;  1R73 A;  2ARH A;  1AJQ A;  4JI8 O;  4YIO A;  1JCH A;  3AG7 A;  1TGO A;  1P7B A;  2R70 A;  2ATK C;  3I56 V;  1PM9 A;  2QSA A;  1OCO C;  2HKO A;  4P2Z A;  3L73 H;  1N32 B;  4NTY A;  3QNE A;  4N23 A;  4YJ3 A;  5LA6 A;  2JEX A;  2JRI A;  1V55 C;  1K92 A;  2P4K A;  2MW2 B;  1AVM A;  1RFY A;  1P84 F;  4MTO A;  1SZX A;  1R6K A;  3RT3 C;  1RSO A;  2ZM6 B;  4DR2 B;  2BTQ B;  3SDL A;  4QE9 A;  1DLB A;  4I5S A;  3ICX A;  4CH5 A;  4I9W A;  4LCU C;  2UXB B;  3E8B A;  3OD4 A;  4DR4 B;  3PJS K;  1MZE A;  1FFT B;  3VBB A;  1VF6 A;  4DXW A;  1VQ7 V;  4B3R O;  1EZJ A;  2V7Q G;  1XRE A;  5LXT A;  5EIB C;  1OZ0 A;  4I55 A;  1GN2 A;  4X65 O;  4QNH B;  1YDX A;  3OGC C;  2CK3 G;  5IYB O;  4IHJ A;  2QR4 A;  4G2K A;  3JD1 A;  4UCS A;  2P67 A;  3ZMZ A;  4JI2 B;  4TSF G;  4DUY B;  2W0F C;  3T4Z A;  3CCL V;  1YIT V;  2QGN A;  4MVU A;  3JAT A;  3CJH B;  2IH1 C;  1WNS A;  4DV0 B;  3H1L H;  5H6R A;  3S3W A;  4I4T A;  4P30 A;  3JAW A;  4DV3 O;  2HHH O;  3JD0 A;  1W2B U;  4LWS B;  3QO8 A;  5KMG A;  1ORQ C;  2Z0A A;  3K9S A;  2RMK B;  3WFV A;  5IYD O;  3ZMV A;  5B3S B;  2JGU A;  3LSS A;  1T5E A;  1W0K G;  2Q0A A;  5B1B C;  4DW1 A;  5J2T A;  3IFX A;  4I7Z B;  4O4J A;  2YS8 A;  2W6I G;  1WA8 A;  5LMU O;  4NXN O;  4RQF A;  4JI6 B;  4LFA O;  1JA8 A;  2ZXW C;  1AP6 A;  1GN3 A;  2ZDI A;  1ZL8 A;  1GK9 A;  4EB6 A;  3OEE G;  5L3F A;  1YZB A;  2FYU H;  1WB7 A;  5CA0 A;  3CMA V;  1COW G;  1VQ5 V;  2XAG A;  2LQT A;  2LGW A;  4O4H B;  2IU0 A;  2UXC B;  1AIL A;  4EKW A;  4CH3 A;  1MSW D;  2CAZ C;  3RWR D;  1GH6 A;  4RUF A;  3APO A;  2PZS A;  5LP6 C;  2JEU A;  3BAB A;  3DSQ A;  2GBO A;  3CCE V;  1GKF A;  4ZI7 A;  2OCC C;  2F95 B;  2BE3 A;  3E8G A;  3JAK A;  4KUM A;  4DV4 B;  3B2E E;  1TUB A;  3JCZ A;  4WFH A;  3H1K H;  4O4I B;  1S72 V;  1R6T A;  3L74 H;  5DED A;  4ZKI A;  4G27 B;  5LMN B;  1M57 B;  2CGN A;  4TWK A;  1KMI Z;  3LSQ A;  3FAV B;  4ZOL B;  1MAB G;  3N2K B;  1GN4 A;  1AJP A;  2VRZ A;  1LNQ A;  3J80 N;  3HB3 B;  3T1Y O;  1YTF B;  2LW1 A;  2F4V O;  4HZ3 A;  1MA1 A;  1AB3 A;  4IYH A;  4WFG A;  5JJE B;  3Q4H B;  4GX1 A;  3RYH B;  2B1I A;  5IWA B;  5CB4 A;  4WFB V;  4D6T H;  2JVD A;  3ZHQ A;  3JSL A;  3B77 A;  4H44 B;  3ZBH A;  5KX5 B;  1M1K W;  3ZHT A;  2XND G;  4KHP O;  2QWN B;  3K59 A;  3ZRV A;  3W7W A;  2WAM A;  3AG1 C;  2Q67 A;  4H37 A;  4A5U B;  2ADQ B;  1K97 A;  5JQG A;  4DV1 B;  5E1A C;  2DQ0 A;  5IJ9 A;  1JFF B;  1OCC B;  5GON A;  4AIL C;  2IJI A;  2FKX A;  2KG7 B;  3G4S V;  2FML A;  1PD3 A;  2XOK G;  4U3J B;  1IVS A;  2D3O W;  1CP9 A;  4JYC A;  3TJT A;  1MZF A;  5JH7 B;  2OYQ A;  3ZHS A;  5CBF A;  2A0L A;  3AG4 B;  4ASU G;  4AI8 A;  4LNU B;  3EVK A;  4DV6 B;  1NR1 A;  4WFF A;  1KB9 F;  2ZE8 A;  4X1I B;  3DC5 A;  2Q9L A;  3CCR V;  2DOS A;  3THO A;  1RM1 C;  2UUA O;  4FLY A;  2W6J G;  3RYI B;  3DXR B;  2GV9 A;  2IW5 A;  4Q6G A;  3SJB C;  1VQ9 V;  2WLM A;  1Q86 W;  1QLN A;  4FZ0 A;  3E8H A;  4CS4 A;  2YSU B;  4UVB A;  1PV0 A;  3CB2 A;  1HNW O;  4UB6 Z;  1S76 D;  4NTX A;  4DV2 O;  2HLD G;  1NTK H;  2GUZ B;  3JD4 A;  1NVP B;  3L71 H;  3OEH G;  3SPI A;  1YF2 A;  1FXH A;  2Y0P A;  3HKC B;  3U10 A;  2R72 A;  2HFE C;  3X2Q C;  2EIM B;  3GWK C;  4QE7 A;  2Y48 A;  4JI5 B;  2DJV A;  4X20 B;  5IE9 A;  2WA3 A;  5K1X A;  2KSD A;  2HP8 A;  1AI4 A;  4KL1 A;  2R9R B;  2QKS A;  1SRY A;  1US6 A;  2AZ2 A;  4O4L A;  3K57 A;  2CTW A;  4EFB A;  2QWQ B;  5JJJ B;  3CRR A;  3GB7 C;  1HNX B;  1V9P A;  5H2F Z;  4GKK B;  3OMI B;  2PF4 E;  4DR5 B;  1DGS A;  1EBO A;  2XUM A;  3LDE A;  1NS1 A;  2AXT Z;  2ZIO A;  1S5H C;  2AGA A;  5B5E Z;  4D7T A;  1BCC H;  2EX3 A;  3MHH C;  4I0X A;  3K06 A;  1Y76 B;  1X4T A;  2DWD C;  2HJD A;  3MD0 A;  4R6Z A;  1XMO O;  1I94 O;  3CCU V;  2YI8 A;  1WP8 A;  3C3T A;  4J9Z B;  1B6Q A;  1H2K A;  2WLK A;  3RBZ A;  2Q69 A;  4MVZ A;  2QJ1 A;  4YHH B;  4Q20 A;  3U0Z A;  2IH3 C;  2P06 A;  3SYP A;  4GLX A;  3S3X A;  1HP8 A;  1HR0 O;  5EC2 C;  1P7G A;  2GSM B;  1G1X B;  3L9D A;  3E35 A;  4MS2 A;  3TXS A;  1XL6 A;  4YJ2 A;  2HEP A;  3FFQ A;  4HBN A;  2Y69 C;  2D2C B;  3M7M X;  1Y4M A;  4B3T O;  1GAX A;  1RSO B;  1SES A;  4BW5 A;  3CSX A;  4PHZ A;  2Q7E A;  3FKS G;  4MTF A;  4PA6 A;  2DYR B;  5LGU A;  4LBE C;  4U7N A;  2WLI A;  4DR6 O;  3B8M A;  1O9H A;  4AQY B;  2F1M A;  2QEX V;  3C3S A;  2V4D A;  1EFR G;  3BVO A;  2MK3 A;  4OPH A;  4WBN A;  2P7T C;  2Q0O C;  5JJN B;  3FB5 C;  2ZR2 A;  3F7Y C;  4C7U A;  3R65 A;  3SGI A;  1HNZ B;  1OV9 A;  1S3J A;  2LFR A;  3ASO C;  2VQE B;  5IJ0 B;  1IBK B;  1KUQ A;  1FD9 A;  2RJZ A;  4O2A A;  3CCJ V;  1H2M A;  4NXM O;  2LP7 A;  1LUV A;  4D7S A;  3K9A A;  3CRA A;  3JAW B;  3CX5 F;  2IM9 A;  2YC0 A;  1R3K C;  3CP1 A;  3K79 A;  2UUB B;  5KMG B;  4FLW A;  1IUR A;  2EIJ B;  1XNQ O;  3ZHR A;  2PGG A;  2QA4 V;  3STZ C;  4UXN A;  5JWP A;  4R8C A;  4UCV A;  4OX9 O;  4BR6 A;  3CRM A;  3AG2 B;  5BXZ A;  4R7C A;  4GKJ B;  5BMV B;  4O4J B;  2HJF C;  3QTC A;  3CYO A;  3IC7 A;  1VQO V;  1K3E A;  5HFL A;  3AK1 A;  1X59 A;  3CC2 V;  2QWP B;  4LF5 B;  3SJQ C;  1VIB A;  1QU7 A;  4X62 O;  5BR8 B;  1J5E B;  3UKM A;  4DR1 B;  4LH7 A;  4B3S B;  2M7W A;  1R6N A;  1BE3 H;  1XQ8 A;  5H6Q A;  2RDC A;  2LJ2 A;  2E5L O;  5FPR A;  5J9P C;  3BA8 A;  3JAL A;  4UFZ A;  1FAF A;  3D36 A;  1FFX A;  2OIG A;  2EIJ C;  3ZRS A;  3JAR A;  1Y74 A;  1VP7 A;  1R3L C;  2OTJ V;  1SS3 A;  2O57 A;  1E1R G;  4DUZ O;  1VF5 B;  5GW7 A;  4PI0 A;  4OGQ B;  2YIB A;  2CTQ A;  4LF7 B;  3SPH A;  3AG2 C;  1R3I C;  3A8T A;  3P32 A;  4PA9 A;  3N27 A;  3D3Q A;  1SC5 B;  1LUW A;  4JI4 B;  3ZRX A;  4LF9 O;  1H2L A;  3CXC U;  3HPL C;  1K4D C;  5L3C A;  1TA8 A;  3KCX A;  1WP7 A;  5EBL C;  2CTR A;  3K5M A;  4NKG B;  3G6B A;  1EN5 A;  3W7T A;  4B3M B;  4FFK A;  3OFN G;  1FKA O;  1TUE B;  3APQ A;  1SER A;  1Z5W A;  4H13 B;  3VQX A;  2BOB C;  3A0H Z;  1BHA A;  2YI9 A;  3H1I H;  1MG1 A;  2Q6A A;  1EZV H;  4DR7 B;  1QNM A;  4TQF A;  3MAQ A;  4JYA O;  4DK1 A;  4K0K O;  2CH7 A;  4LR3 A;  4JYY A;  1HWY A;  4CBC A;  1SQQ H;  4U7O A;  2Q4P A;  1AR1 B;  4BIU A;  5JQG B;  4GX0 A;  5B66 Z;  4PJ0 Z;  3E83 A;  4BWA A;  4JI8 B;  3OTF A;  1V54 C;  2QM4 A;  1M5I A;  1WB8 A;  3J7A U;  2XAF A;  4BIO A;  1N32 O;  4JI1 O;  1ZWI C;  3TET A;  1BS3 A;  5IYZ A;  1VQ6 V;  4DV5 B;  3STL C;  3ETD A;  3ZRW B;  2YIA A;  1N8R W;  3WG7 C;  1IBM O;  3OT7 A;  5C8Y B;  3T1H O;  1YXB A;  4F6R B;  3RYC A;  1YJW V;  4JZG A;  5EBW C;  2ZM6 O;  1Q6I A;  4DR2 O;  5B1A C;  3HKD B;  1KP2 A;  5KAI Z;  3K5N A;  3ABU A;  2XT9 A;  1H2N A;  1BMF G;  1EM1 A;  3H9V A;  4NVP A;  4DR4 O;  5EC1 C;  4TT3 G;  3T1C A;  3GVM A;  1IX9 A;  2EIL B;  2VQF B;  2Q73 A;  3ZHU A;  4X1Y A;  1AP5 A;  3IAY A;  2YIB D;  4J7J A;  1SA0 A;  1KU9 A;  2QM7 A;  3RFR A;  5ITZ A;  3CRC A;  4DUY O;  5JCO A;  1Z2G A;  4JGS A;  4O4L B;  2PYL A;  1BQ0 A;  4DV0 O;  1GM9 A;  4HAM A;  1N0J A;  3RN4 A;  1LR1 A;  3ZN0 A;  2BSK A;  1DF4 A;  5IT9 N;  4Z1M G;  1IXB A;  1PNM A;  1D5N A;  1K7D A;  4AHC A;  2X0L A;  1B04 A;  1AI6 A;  2Q68 A;  3T4D A;  3WB2 A;  4DV7 B;  1NTZ H;  2WLL A;  4TQD A;  5KUM A;  2ILM A;  3RGB A;  4EEQ A;  3OTO B;  2YEV A;  2CUG A;  3HKB A;  1YEW A;  1HW7 A;  3OE7 G;  1SQP H;  3CC7 V;  4CH4 A;  2RQ6 A;  4K3A A;  2HG5 C;  3BHP A;  5KLV H;  4BIZ A;  4JI6 O;  1UPG A;  2ZIM A;  3GWO A;  1B3Q A;  2LFS A;  4LFA B;  4FFB B;  1O9G A;  3K58 A;  3A0R A;  4PA3 A;  4CS3 A;  1K8A W;  3FB7 C;  1XHZ A;  1FXK A;  3SYO A;  5GTI Z;  2BCC H;  1SET A;  4W4K A;  4QPK A;  1BZK A;  2G38 A;  3LSU A;  4GUN A;  2WLI B;  5EZY A;  4H0L B;  5B3S C;  5LOV A;  4P9P A;  2L35 A;  4GX2 A;  1URF A;  4LF8 B;  4DV4 O;  4WBN B;  5LYJ A;  5J2U B;  1KKD A;  3HKE A;  1ZX3 A;  5CA1 A;  3CME V;  1KBH A;  3W7S A;  3ZN1 A;  5EYP A;  2GDS A;  1I5X A;  5CBG A;  4QGP A;  5LMN O;  1VQL V;  4MW3 A;  1YJ9 V;  1NH2 D;  2V1D A;  3BPZ A;  4JV5 O;  2H94 A;  4MTG A;  3R66 A;  4O2A B;  2M6Y A;  4FLX A;  5KHI A;  3SJA C;  3T1Y B;  4FVM A;  2XAJ A;  3CS5 A;  4ZBM A;  1KKC A;  3UCS C;  1FPO A;  3E22 B;  1L8D A;  4DRX B;  1K34 A;  2XAQ A;  1DK1 A;  1Q6H A;  3OAA G;  3W7X A;  1S77 D;  4B7E A;  1N33 B;  2WSS G;  4K8Z A;  1BSM A;  4RQE A;  3T2M A;  3ZMU A;  5JVD A;  3N2G A;  4J7K A;  1NKD A;  3RW0 A;  1WN7 A;  3JD3 A;  4DV1 O;  2ZE6 A;  1PNL A;  1F7Y A;  2P90 A;  3F5T A;  4FLV A;  3CCM V;  1M57 C;  4PDM A;  4YY3 B;  4G28 B;  2Q7H A;  1PL0 A;  1YIJ V;  2X6B A;  3BFR A;  4GT1 A;  4XBF A;  1Y66 A;  2OTL V;  2ADP A;  2KKW A;  2YXY A;  4X64 B;  4BAY A;  1IZ3 A;  4DV6 O;  1NTM H;  2EJ7 A;  2DYS B;  4FM0 A;  3RVZ A;  2IBZ H;  4IIJ B;  1QHT A;  1JVM A;  2JGD A;  3AG3 B;  4TUY A;  4CC6 A;  4GYC B;  2UU9 B;  3JAL B;  3ABK B;  4TV8 A;  2A3Q A;  4JAS A;  3ASN B;  5C93 A;  3K0D A;  3I55 V;  1Y74 B;  3K08 A;  4DV2 B;  3G71 V;  4ZHQ B;  4LF4 O;  2P5O A;  4IL6 Z;  1QLE B;  1KEC A;  1OCC C;  1S5J A;  1THZ A;  2B9Z A;  2DN9 A;  4JI5 O;  1PKX A;  2FTK A;  3SPC A;  4YXW G;  5LHG A;  3U11 A;  3CCS V;  2X6C A;  3P3P A;  2QTO A;  1I5Y A;  3AG4 C;  2X6A A;  1HNX O;  1K73 W;  2UXD O;  3CJH A;  3ML0 A;  4ZIB A;  4GKK O;  4I50 B;  4JI0 B;  4DR5 O;  4JZ2 A;  4X88 A;  4DK0 A;  4UVC A;  1QVF U;  1IXM A;  2VWK A;  4LWS A;  4LF6 O;  5LP6 A;  3A0B Z;  1IBL B;  4XDK A;  1PP9 H;  1RPR A;  3AK3 A;  5BZB A;  2KB1 A;  2N05 A;  5CA3 A;  4FLZ A;  3VQY A;  2CH7 B;  4HYO A;  4UCO A;  1GN6 A;  4DO2 A;  5LBQ A;  3G80 A;  5B1N A;  4FLU A;  2E76 B;  2JJ2 G;  5EIB D;  1OHH G;  1VQN V;  2GHY A;  1GRJ A;  2EIM C;  4YJ3 B;  3ZX6 A;  5LA6 B;  3H1H H;  3WU2 Z;  4YHH O;  3EXA A;  1H38 A;  3WB0 A;  3QG5 A;  1SQV H;  4LH6 A;  1AR4 A;  4LFC B;  4XDL A;  4FJC C;  1OCZ B;  5H5N A;  1K9M W;  3SPG A;  4LFB B;  5TIS Z;  1TVK A;  2ZCE A;  1NBM G;  1D5A A;  2IU3 A;  3RYC B;  4O4H A;  1XHX A;  1YCI A;  3QO5 A;  4JI7 O;  4MT8 A;  4R50 A;  3VQW A;  3LNN A;  4AQY O;  5LXT B;  2JS3 A;  4J10 A;  4I55 B;  3UT5 A;  3FB6 C;  2E75 B;  4K35 A;  2AHY A;  4FPP A;  2XAS A;  4DR6 B;  1WPX A;  1HDJ A;  4IHJ B;  4UCU A;  4O4I A;  5FNV A;  1HNZ O;  1S5L Z;  1XI1 A;  4JTA B;  2VQE O;  5ITZ B;  1IBK O;  2ZQM A;  3JAT B;  2EIK B;  1OCR B;  1M90 W;  3D3I A;  5LGN A;  5LHI A;  3ETG A;  4KFM A;  1XNR B;  4I4T B;  2DMX A;  3QF7 A;  2R9I A;  3CWB H;  4IGG A;  1OCZ C;  1I0H A;  2ZNJ A;  1G4Y B;  1L1F A;  1YHQ V;  2UUB O;  2DYR C;  4JI3 O;  5KX5 A;  1QQC A;  4DR3 B;  3FD9 A;  3L72 H;  4JTC B;  2EBO A;  2EJR A;  3BAA A;  3QO7 A;  4FMT A;  5J2T B;  1XMQ B;  2OCH A;  1Q8I A;  1KC8 W;  1WA8 B;  2YEV B;  3HKB B;  3JSN A;  3SYA A;  1JFF A;  1YVW A;  4Z2W A;  1BHB A;  1ZL8 B;  2Q5Z A;  2ZNI A;  2KG7 A;  2HVJ C;  1N34 O;  1JPX A;  4EB6 B;  4U3J A;  5CA0 B;  4X66 B;  2A79 B;  4LF5 O;  3L70 H;  5JH7 A;  1GO3 F;  1ZAU A;  5BR8 O;  1J5E O;  3NR7 A;  4DR1 O;  4B3S O;  3JCU Z;  1FXK B;  3ZCC A;  5IDJ A;  1AI5 A;  4DW0 A;  4RO2 A;  1JQ0 A;  4ZI7 B;  1XEQ A;  1JJ2 U;  2OIE A;  2WLJ A;  3JAK B;  1QR8 A;  1U97 A;  3E8F A;  1TUB B;  5LOV B;  4HNA A;  5HFM A;  3BA9 A;  3CRQ A;  2GUZ A;  1K5S A;  1XUQ A;  2IJK A;  2CTP A;  4LF7 O;  3HKE B;  1SZT A;  3UO2 A;  5CA1 B;  1OCO B;  3VOU A;  5CMU A;  5A2Q N;  3H1J H;  4JI4 O;  1ZSP A;  3TXQ A;  3HKC A;  3IGA C;  3DTU B;  2L6L A;  2CDY A;  1BT8 A;  1BGY H;  5LL6 Y;  4CC5 A;  1WPB A;  4X20 A;  1RPO A;  2DE0 X;  2BOC C;  4LF9 B;  5CB4 B;  1IDS A;  3TK1 A;  1L0L H;  4J11 A;  1N36 B;  3AEI A;  3IC9 A;  3ETQ A;  1JR9 A;  1SQX H;  5LGT A;  3G67 A;  1GM7 A;  2PI4 A;  2QM8 A;  4DR7 O;  1FJG B;  2UXN A;  1E79 G;  2YXL A;  4PDR A;  3CCQ V;  2UUC B;  4ABM A;  1PNK A;  2ODM A;  4H33 A;  3LDC A;  2WLN A;  5IJ9 B;  3N2G B;  2VWJ A;  5GON B;  1R1B A;  1UFI A;  1VQ4 V;  4K8X A;  1Y76 A;  1ZLZ A;  4NYK A;  4PDL A;  1KQS U;  2ZE7 A;  4WF9 V;  3A2F A;  4J42 A;  1G6U A;  4DV5 O;  3F5W C;  1A32 A;  4JI1 B;  4XDJ A;  3LDD A;  2B1G A;  2JJ1 G;  5DM6 V;  2YIC A;  2ETN A;  3CCV V;  2XAH A;  3IJ4 A;  2UXB O;  1Y67 A;  1IBM B;  1F4M A;  3T1H B;  2JGD B;  4P9O A;  4TUY B;  3UO3 A;  2ITC C;  1VQ8 V;  4RWU A;  4TV8 B;  4J80 A;  2ZD9 A;  2PI5 A;  4UB8 Z;  2VQF O;  5B1B B;  4UUJ C;  4B3R B;  5LHH A;  3TCU A;  4I9Q A;  4X65 B;  1SKV A;  2JS5 A;  2H3O A;  1D2D A;  4JI2 O;  3OMA B;  1TAE A;  2JDI G;  4FLT A;  1N4C A;  2ZR3 A;  2Z5U A;  1NVP D;  2F66 C;  2P22 C;  3DC6 A;  4MW8 A;  5H9C A;  2OT5 A;  2WWW A;  2JIZ G;  2ZXW B;  4O2B A;  5FL7 G;  1R3J C;  4OXS A;  3RYF A;  5IJ0 A;  2P6J A;  1JOY A;  3E2E A;  1S0V A;  4E2L A;  3B4S A;  4X89 A;  4DV3 B;  2HHH B;  3KKY A;  3BCC H;  2K9P A;  4GCZ A;  3UQ8 A;  4TV9 A;  5LP6 B;  5KA5 A;  2LO1 A;  2CGO A;  4MVM A;  3QVN A;  4I0X B;  3BEH A;  4DV7 O;  2OCC B;  2EIL C;  4L8J A;  5IYC O;  1WAZ A;  2ZE5 A;  3OUS A;  3OTO O;  4CS2 A;  2P4V A;  1ZUQ A;  5KUK A;  4E4E A;  2B5U A;  1NJI W;  3UM7 A;  5A9G A;  4F4L A;  1MSD A;  3K5L A;  2Y0I A;  5BMV A;  5LMU B;  4NXN B;  2XTA A;  4KP4 A;  5D5P A;  3ZS8 C;  3VQV A;  2BTO A;  2YXH A;  2DQ3 A;  3L75 H;  1FYJ A;  1W59 A;  2UXC O;  2CE4 A;  2C2A A;  1NI8 A;  4PDV A;  4YJ2 B;  4FZ1 A;  5CN0 A;  4NTW A;  5L3E A;  3NXS A;  1TVK B;  2F23 A;  2PYJ A;  4WFA V;  2EUL A;  5DEC A;  4UCT A;  4NB5 A;  1JX9 A;  1NR7 A;  1XDC A;  1ZTE A;  4IYI A;  1Q90 D;  3AG1 B;  3O9O A;  4LF8 O;  1U96 A;  4EFE A;  2ITD C;  2AW9 A;  3UT5 B;  4TOI A;  2FL4 A;  3JAS A;  4MVR A;  1NQT A;  1B06 A;  1DF5 A;  1Q6U A;  3ZJZ A;  5KA6 A;  5FNV B;  3F7V C;  3B09 A;  2Y4T A;  1ROP A;  5KHG A;  4UCR A;  2F93 B;  3BY6 A;  2ZIN A;  4X1K A;  2F4V B;  5IWA O;  4GX5 A;  3MHS C;  4UV8 A;  4JV5 B;  4GZR B;  2EZP A;  1NU1 H;  2Z3Y A;  2A06 H;  1RM1 B;  1M56 B;  3FYI B;  5EBM C;  1MOF A;  1CXZ B;  3JD2 A;  4KHP B;  2QDO A;  1N33 O;  1VEW A;  5EK0 A;  4RUE A;  1K4C C;  5KHJ A;  2UXX A;  2ZT9 B;  1Q5O A; 
#chains in the Genus database with same CATH homology
 1DTO A;  1W0J G;  1E1R G;  1OCZ B;  2IH1 C;  1K9M W;  5GW7 A;  3ZIA G;  4QPJ A;  1VQK V;  5H6R A;  3SPG A;  2IJJ A;  4P30 A;  5CBH A;  3SPH A;  3AG2 C;  3OM3 B;  1NBM G;  3JD0 A;  3OMN B;  1R3I C;  5L3G A;  1W2B U;  2IU3 A;  3QO8 A;  4PA7 A;  3P32 A;  4PA9 A;  3QO5 A;  2JK5 C;  3ABL B;  3K3W A;  1WLE A;  3X2Q B;  1ORQ C;  1F23 A;  3ZRX A;  4MT8 A;  4UVA A;  4R50 A;  3WFV A;  3CXC U;  1Q81 W;  3HPL C;  5IYD O;  3ZMV A;  1K4D C;  5B3S B;  3LSS A;  1Q7Y W;  4PEL A;  1W0K G;  5L3C A;  3CC4 V;  3FYE B;  4JAU A;  1GTO A;  1F4N A;  5B1B C;  1GMG A;  3FB6 C;  5EBL C;  3ZRW A;  2AHY A;  4FPP A;  3JYC A;  2XAS A;  3W7T A;  3K03 A;  3IFX A;  1WPX A;  3OFN G;  2QE7 G;  1TUE B;  1SER A;  3SYQ A;  2W6I G;  2DW4 A;  2BOB C;  3OUF A;  1BHA A;  4L87 A;  4RQF A;  1H8E G;  1MG1 A;  2Q6A A;  1YI2 V;  4JTA B;  2AHZ A;  2ZXW C;  2ZDI A;  3CPW U;  1M56 C;  3W7U A;  2ZQM A;  2EIK B;  1GK9 A;  1OCR B;  1M90 W;  3OEE G;  5L3F A;  3D3I A;  4JF3 A;  5LHI A;  5LGN A;  1HWY A;  3ETG A;  4KFM A;  4CBC A;  4U7O A;  1YJN V;  3CMA V;  1COW G;  1VQ5 V;  1AR1 B;  4BIU A;  4GX0 A;  2XAG A;  2IU0 A;  2R9I A;  3E83 A;  4MVS A;  1OCZ C;  1V54 C;  4EKW A;  1QVG U;  2XAF A;  4WCE V;  1MSW D;  2F43 G;  1G4Y B;  4RUF A;  1ZWI C;  1L1F A;  1YHQ V;  2DYR C;  3TET A;  3LUT B;  2JEU A;  3DGE A;  1VQ6 V;  3ABL C;  2A9H A;  3STL C;  3ETD A;  3CCE V;  1GKF A;  4JTC B;  2EBO A;  2EJR A;  3QO7 A;  1BL8 A;  3ZRW B;  4FMT A;  2OCC C;  3E8G A;  1ENV A;  1N8R W;  4KUM A;  3WG7 C;  4LP8 A;  1KP3 A;  3JCZ A;  4JAV A;  2DYS C;  1KC8 W;  4WFH A;  4JTD B;  1S72 V;  2YEV B;  1YJW V;  2Y69 B;  5EBW C;  3EHB B;  4ZKI A;  5B1A C;  1ARO P;  1UJW B;  3SYA A;  1H8H G;  1KP2 A;  3AG3 C;  4G27 B;  1QCE A;  4CZZ A;  3ABU A;  1BHB A;  1M57 B;  1FS0 G;  4TWK A;  1BMF G;  2HVJ C;  2K1E A;  1JPX A;  3LSQ A;  3ABK C;  1MAB G;  5EC1 C;  1AJP A;  4TT3 G;  1LNQ A;  3T1C A;  2IJH A;  3HB3 B;  1YTF B;  3ASN C;  2A79 B;  3SPJ A;  4HZ3 A;  1VQM V;  1GO3 F;  2EIL B;  2WLH A;  4N21 A;  4WFG A;  1QLE C;  3OR7 C;  4GX1 A;  2B1I A;  4WFB V;  1FXK B;  3K0G A;  3ZCC A;  4MVO A;  3B77 A;  5IDJ A;  4JYB A;  3ABM B;  1M1K W;  2QM7 A;  1AI5 A;  2XND G;  4RO2 A;  1JQ0 A;  3ZRV A;  3W7W A;  1JJ2 U;  2WLJ A;  3ASO B;  2WAM A;  1QR8 A;  3AG1 C;  3E8F A;  3ZMT A;  5HFM A;  2NLJ C;  4JGS A;  2Q67 A;  4RAI A;  4H37 A;  1K5S A;  5L3D A;  1GM9 A;  1K97 A;  4HAM A;  5E1A C;  2IJK A;  2DQ0 A;  1OCC B;  1SZT A;  1OCO B;  2IJI A;  3G4S V;  3VOU A;  5CMU A;  3ZMS A;  3ZN0 A;  1PD3 A;  2XOK G;  1M9N A;  1DF4 A;  2D3O W;  4MSW C;  3IGA C;  1CP9 A;  4JYC A;  4Z1M G;  3DTU B;  3E89 A;  1PNM A;  1K7D A;  1E1Q G;  2X0L A;  1RPO A;  5CBF A;  1AI6 A;  2BOC C;  2Q68 A;  2NNU A;  2A0L A;  3M99 B;  3T4D A;  3AG4 B;  4ASU G;  2WLL A;  5KUM A;  3TK1 A;  1QBZ A;  1G8M A;  1NR1 A;  4WFF A;  2YEV A;  3AEI A;  1P4R A;  1NH2 B;  3OE7 G;  5LGT A;  3CC7 V;  3RVY A;  3CCR V;  1RM1 C;  2W6J G;  2IW5 A;  2HG5 C;  1VQ9 V;  4X8A A;  2WLM A;  4BIZ A;  1Q86 W;  1GM7 A;  2PI4 A;  1QLN A;  3E8H A;  2QM8 A;  2YSU B;  2UXN A;  3ABM C;  4UVB A;  2EZO A;  1S76 D;  1E79 G;  4PDR A;  3GWO A;  2HLD G;  2LFS A;  3FB8 C;  3K04 A;  3CCQ V;  1PNK A;  4H33 A;  3LDC A;  1KD1 W;  2WLN A;  3JD4 A;  3A0R A;  4PA3 A;  1K8A W;  1NVP B;  1VQ4 V;  3OEH G;  3FB7 C;  1FXK A;  3SPI A;  3SYO A;  4PDL A;  1FXH A;  1KQS U;  1SET A;  4QPK A;  2EIN B;  2HFE C;  3X2Q C;  2EIM B;  4QE7 A;  2Y48 A;  3ABT A;  3E86 A;  4WF9 V;  4LC1 A;  1CEZ A;  3F5W C;  1AI4 A;  2WLI B;  5B3S C;  2WLL B;  2R9R B;  1H2G A;  4XDJ A;  2QKS A;  4P9P A;  1SRY A;  3EFF K;  3LDD A;  4GX2 A;  3SYC A;  2B1G A;  2JJ1 G;  4J9Y B;  3G6E V;  5DM6 V;  3GB7 C;  1KKD A;  1S77 D;  1K5Q A;  1YSC A;  3CCV V;  3CME V;  2XAH A;  5DN6 G;  5IY5 B;  3OMI B;  3ZN1 A;  1AI7 A;  3W7S A;  1Q82 W;  3OR6 C;  1I5X A;  5CBG A;  1CPY A;  1F4M A;  1VQL V;  1EBO A;  4MW3 A;  1YJ9 V;  4QJF B;  4P9O A;  1NH2 D;  3LDE A;  2ITC C;  1VQ8 V;  2V1D A;  1K33 A;  5B1O A;  2EIK C;  1S5H C;  2H94 A;  1OCR C;  4MTG A;  1F51 A;  2ZD9 A;  2PI5 A;  2X7R B;  3MHH C;  3K06 A;  5B1B B;  4UUJ C;  4WFE A;  5LHH A;  2DWD C;  3TCU A;  2XAJ A;  3MD0 A;  1J95 A;  4ZBM A;  4R6Z A;  3CCU V;  3OMA B;  4J9Z B;  2JDI G;  1K34 A;  2XAQ A;  4MVQ A;  2ZR3 A;  2Z5U A;  1NVP D;  1B6Q A;  2WLK A;  3OAA G;  3RBZ A;  4MW8 A;  5H9C A;  3W7X A;  2OT5 A;  4FK5 C;  4MTX A;  2WWW A;  2ZXW B;  2JIZ G;  2Q69 A;  4MVZ A;  5FL7 G;  1R3J C;  2EIN C;  2WSS G;  4Q20 A;  2IH3 C;  4OXS A;  3SYP A;  4RQE A;  5EC2 C;  3T2M A;  3ZMU A;  2GSM B;  2P6J A;  1JOY A;  3E2E A;  1S0V A;  3E35 A;  1NKD A;  4MS2 A;  3RW0 A;  4E2L A;  1XL6 A;  3JD3 A;  1PNL A;  2P90 A;  2Y69 C;  4X89 A;  2DWE C;  4FIP C;  2H8P C;  1Y4M A;  1QR9 A;  1V54 B;  3P30 A;  3CCM V;  4GCZ A;  1SES A;  4BW5 A;  2ZDI C;  1M57 C;  1GM8 A;  3FKS G;  5IY5 C;  4MTF A;  4PDM A;  4PA6 A;  1VQP V;  4G28 B;  2DYR B;  1PL0 A;  1V55 B;  5LGU A;  1YIJ V;  4LBE C;  4U7N A;  5KA5 A;  2X6B A;  5L3B A;  2WLI A;  4GT1 A;  4MVM A;  4XBF A;  4QIW F;  3OW2 U;  1Y66 A;  3LNM B;  2OTL V;  3B8M A;  3BEH A;  2QEX V;  1YTF D;  2OCC B;  4BAY A;  2EIL C;  1EFR G;  2MK3 A;  2P7T C;  3WG7 B;  5IYC O;  3FB5 C;  3OUS A;  2HVK C;  2ZR2 A;  4UV9 A;  2DYS B;  2WPD G;  1XL4 A;  1FXV A;  4JPR A;  1FXK C;  5KUK A;  2HR3 A;  2B5U A;  3F7Y C;  1NJI W;  3UM7 A;  3RVZ A;  3B8N A;  4F4L A;  5B1A B;  1JVM A;  3R65 A;  3AG3 B;  3CD6 V;  3ETE A;  4KP4 A;  3KG2 A;  1S3J A;  2LFR A;  3ASO C;  3ABK B;  2DQ3 A;  1AJN A;  4PA4 A;  3H01 A;  1R73 A;  3CCJ V;  4JAS A;  3ASN B;  5C93 A;  3K0D A;  1AJQ A;  2C2A A;  3I55 V;  2LP7 A;  4PDV A;  3K08 A;  3G71 V;  1JCH A;  3K9A A;  1QLE B;  1KEC A;  1P7B A;  5CN0 A;  2ATK C;  5L3E A;  3I56 V;  1OCC C;  3NXS A;  1OCO C;  2HKO A;  4WFA V;  1R3K C;  4P2Z A;  3CP1 A;  1THZ A;  3K79 A;  2EIJ B;  1JX9 A;  1NR7 A;  1PKX A;  2QA4 V;  3QNE A;  2FTK A;  4N23 A;  3STZ C;  3SPC A;  4YXW G;  5LHG A;  4UXN A;  2JEX A;  4R8C A;  1V55 C;  1K92 A;  3CCS V;  2X6C A;  3AG1 B;  2QTO A;  1I5Y A;  3AG4 C;  2X6A A;  2ITD C;  3AG2 B;  1K73 W;  4MTO A;  1R6K A;  4R7C A;  3ML0 A;  4MVR A;  1NQT A;  2HJF C;  4X88 A;  4QE9 A;  1DF5 A;  3CYO A;  3IC7 A;  4UVC A;  1IXM A;  3ZJZ A;  5KA6 A;  1DLB A;  1VQO V;  4I5S A;  1QVF U;  1K3E A;  5HFL A;  4I9W A;  3F7V C;  4LCU C;  4XDK A;  3E8B A;  1RPR A;  3CC2 V;  5BZB A;  3PJS K;  2KB1 A;  1ROP A;  1FFT B;  3VBB A;  5CA3 A;  3BY6 A;  4HYO A;  3SJQ C;  4GX5 A;  4DXW A;  1VQ7 V;  3MHS C;  4UV8 A;  3UKM A;  1EZJ A;  2V7Q G;  4DO2 A;  5LBQ A;  1OZ0 A;  5B1N A;  2EZP A;  2M7W A;  4QNH B;  2JJ2 G;  1VQN V;  1OHH G;  1R6N A;  3OGC C;  2Z3Y A;  2CK3 G;  2GHY A;  5H6Q A;  1RM1 B;  5IYB O;  2EIM C;  1M56 B;  3FYI B;  4G2K A;  5EBM C;  5J9P C;  3JD1 A;  1MOF A;  3JD2 A;  2P67 A;  3ZMZ A;  3D36 A;  4TSF G;  1H38 A;  2W0F C;  2EIJ C;  5EK0 A;  3T4Z A;  3ZRS A;  4RUE A;  3CCL V;  1K4C C;  1YIT V;  1R3L C;  4MVU A;  2OTJ V;  2UXX A;  4XDL A;  4FJC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...