4WFHA

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 98
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfhA00
4MTOA 2HG5C 4EKWA 2WLIB 4P9PA 2WLHA 1XL4A 4QE9A 3E8BA 5CBGA 4MVZA 2QKSA 3BEHA 3IFXA 2BOCC 3R65A 3T2MA 3ZJZA 4QNHB 4R6ZA 3SJQC 4MW8A 2WLJA 2X6BA 2Q67A 4HZ3A 2DYSC 4R8CA 3T4DA 4CBCA 1P7BA 3SYAA 5EK0A 4TWKA 4HYOA 2HVKC 3FB6C 5IY5C 2Q69A 2IH3C 2R9RB 3LDDA 4MSWC 3ZRSA 3TETA 3ABKC 3ASNC 4MVQA 4LBEC 4X8AA 2EIJC 1R3KC 2NLJC 2EINC 2YEVA 5B3SC 5E1AC 3SPGA 2WLIA 1M56C 5J9PC 5CBFA 1BL8A 2ZD9A 3OGCC 4MVMA 4MS2A 1K4DC 2ITDC 3SPHA 2X6CA 3IGAC 1V55C 4WFHA 2WLMA 3OUFA 2A0LA 3KG2A 5B1AC 3TCUA 1ZWIC 4ZBMA 3SYQA 3AG4C 1OCRC 2OCCC 5EBWC 3SYPA 2WLKA 1QLEC 4RO2A 3SPJA 3T1CA 4PDRA 4MTGA 1LNQA 2BOBC 4JTDB 3PJSK 4RAIA 2HFEC 4MVRA 3RBZA 5B1BC 3E86A 4PA9A 3SYOA 3ABMC 1G4YB 3LNMB 4PA3A 4R50A 3RW0A 2ZXWC 4WFGA 2EIKC 4XDKA 4J9YB 3K06A 1ORQC 4P30A 4G27B 1K4CC 3SPCA 4PDMA 2EIMC 1OCOC 4MW3A 4PDVA 4H33A 1M57C 2Q6AA 3ABLC 1S5HC 4R7CA 2Q68A 4X89A 2AHYA 2X6AA 3X2QC 3AG2C 3OUSA 4G28B 4MVSA 3AG1C 4KFMA 5EC1C 5BZBA 3K0DA 3FB5C 1R3IC 3T4ZA 2EILC 3OR6C 5KUKA 5KUMA 3UM7A 3E8GA 2ATKC 3STLC 2HVJC 3FB8C 3F5WC 3VOUA 4UUJC 1JVMA 2A79B 4P9OA 3LDEA 4XDJA 3K0GA 3F7VC 1V54C 2Y69C 4X88A 3WG7C 4MVOA 1OCCC 3LDCA 4PA6A 1OCZC 2WLLB 2HJFC 5EC2C 4LP8A 4PA7A 3UKMA 4GX5A 4MTFA 4GX1A 4P2ZA 4F4LA 4PDLA 2ITCC 3FB7C 4RUFA 2H8PC 3ASOC 3E89A 3F7YC 4JTCB 2WLNA 4DXWA 4LCUC 3STZC 2DYRC 3E83A 3K08A 4WFEA 3SYCA 2A9HA 1R3LC 3LUTB 2AHZA 2W0FC 4OXSA 5CBHA 3RVYA 3JYCA 3AG3C 2JK5C 1KKDA 2IH1C 4GX2A 4H37A 3E8HA 4MVUA 4I9WA 3OR7C 3SPIA 2KB1A 5EBLC 2DWEC 2DWDC 4GX0A 1R3JC 3GB7C 3E8FA 2K1EA 3K03A 1XL6A 5EBMC 4QE7A 3K04A 4RUEA 4XDLA 3RVZA 2WLLA 3EFFK 4WFFA 4BW5A 1J95A 4JTAB 4PA4A 2QTOA 3HPLC 2P7TC 4J9ZB
chains in the Genus database with same CATH superfamily
2IJHA 1SF9A 5L3CA 2VQFB 1J5EB 4EB6A 5KHJA 2QKSA 4IT5A 3ZJZA 4I4TA 4IIJA 1BMFG 3CCRV 4DV2B 4Q20A 2UUAB 4ABMA 5D5QA 4WBNA 5IJ0A 3X2QB 3CRRA 1YCIA 2KQXA 1M56C 2H3OA 4U3JA 1K4DC 2KKWA 1EN4A 2YIBD 2HJDA 1BQ0A 3SYPA 4LFBO 1QLEC 3O9OA 1WLEA 2UXDB 3TGUH 4GKJB 4J41A 4D7SA 4UCUA 1AJQA 1AI5A 2DQ3A 1VQKV 1PKXA 2BCCH 3G67A 4GYCB 4MTXA 4UV8A 4UCVA 2X6AA 3RYFA 4DK1A 1K9MW 2LW7A 5LHHA 1FFTB 4FLVA 3JCZA 5LP6A 4NXMB 1VQMV 3LSQA 3E8GA 3VQWA 3TXQA 4JAVA 5J2TA 4JI0O 1URFA 3VOUA 1OCZB 5B5EZ 4J10A 4O4HB 4KHPO 2WAMA 1AJPA 4X1IA 3C3SA 4B3RB 4LF7O 1O9HA 3ZIAG 2XUMA 4DV6O 2PGGA 3STZC 3K08A 2ZNJA 2ADPA 1T5EA 4BWAA 4JI5B 4H37A 1VQ8V 2GTAA 5IYZB 4I50B 1XL6A 2GUZA 2EBOA 2UXNA 1BGYH 1E1QG 3JAWB 3HPLC 1PP9H 4X9QA 4J9ZB 5CA0B 1SQBH 1GN3A 1BT8A 2QEXV 1XL4A 1K33A 3E8BA 1P7GA 3ETDA 4QNHB 2Q67A 4JI2O 3E2EA 2RCVA 1NR1A 5FNVB 1PL0A 2CGNA 2LP7A 2C2AA 1FFXA 3KKYA 1Q43A 4MVQA 4LH7A 1R6TA 4TV8B 4GKKO 1H2LA 3QO5A 5LA6A 2WLIA 4ZHQA 3KCYA 5JCOA 2NNUA 5KMGA 5BR8O 2RN9A 1OCRC 2WLKA 1K92A 3BCCH 1R73A 1P49A 2ZXWB 4RAIA 1HR0B 5CA3A 2GTSA 4J7KA 2XAJA 4FLZA 4EEQA 5EZYA 3CCQV 2VRZA 4Z1MG 2P67A 4FZ1A 1XNRO 3K57A 2LJ2A 2AHYA 5CN0A 5EC1C 1R3IC 3OR6C 4UVAA 3OTFA 3MHSC 5LMNB 5HFMA 1UPGA 4O4JA 2B1IA 2X7RB 1TUBB 4DV3O 5LP6C 1XHXA 4YJ3B 3DSQA 4RUFA 3F7YC 5IY5B 2W6JG 4LCUC 5IWAO 3I5DA 3ICXA 1GH6A 5DN6G 1GM9A 1FS0G 1N32O 1M5IA 1FXKA 1S72V 3E8HA 3D3QA 3OR7C 1QQCA 5FL7G 5B1AB 4U7NA 3QF7A 3RVZA 2A06H 2Q0AA 3EHBB 4PA4A 1IX9A 3D3IA 2NR5A 2HG5C 4QE9A 3A2FA 4JAUA 2QM7A 2LW1A 4NTWA 4O2BB 3HKEA 4R8CA 2ADQB 3A0RA 2WSSG 3ZCCA 4B3TB 5LXTA 4X65O 1H2MA 1M57B 3G71V 2JDIG 2P90A 3OMNB 2LO1A 3IGAC 1V55C 4AI8A 2VS0A 3DXRA 1RSOB 3AG4C 1IBLB 1JA8A 1HP8A 1JR9A 1XBLA 4FZ0A 3T1CA 4PDRA 1BHBA 4MTGA 5L3GA 3PJSK 5JCOC 4K8XA 3OEHG 3K5NA 1OHHG 2G38A 1N36B 4X20B 3ZN0A 1N34B 4IHJA 1LUWA 1YZBA 4AQYB 2UXCO 3ABLC 4KP4A 3K58A 2CH7B 2FYUH 1HNZO 5CB4B 4KFMA 1WP7A 1K3EA 4LF6B 1XDCA 5KUKA 3QVNA 1YSCA 2ZE7A 4JI3B 1GKFA 2BSKB 4X1KB 3H1LH 3LDEA 3CRCA 2PI4A 1KP3A 2HLDG 2Y69C 3WG7C 3FAVA 1OCZC 2DYSB 5EC2C 4LP8A 5HFLA 3T1HB 3FB7C 2AXTZ 2H8PC 1VQ5V 4JI1O 4PHZA 4DXWA 4JYAO 2DYRC 4X64O 2B5UA 5CBHA 3B77A 5GTIZ 3SPIA 5KLVH 4LF8B 4B7EA 1N33O 1Y6XA 3FKSG 1J95A 4UCRA 3OMIB 1YDXA 1S77D 1XNQO 4LF9B 2Q9LA 4GCZA 3CMEV 3W7WA 3IC7A 3ZMTA 3ZRWB 2HVKC 3R66A 2YXHA 3N2KA 1R6NA 2EIMB 4YJ2B 3T1YO 1S5LZ 4FM0A 2YEVA 2CDYA 3W7UA 4B08A 2DMXA 4DV5O 1DK1A 4LF5O 4HAMA 1VQLV 4B7KA 2EZPA 3SPHA 4Z2WA 4DV4O 2UUBO 1XI1A 2JRIA 4KL1A 4LWSB 4ZBMA 4B3SB 2O57A 2CUGA 1XOUA 4X20A 4EFBA 4F6EA 1I94O 2HFEC 2ODMA 2Q7GA 2QWQB 2QR4A 4NVPA 4LF4O 2ZXWC 4IYHA 2EIKC 4PD4F 2DN9A 1BS3A 1L0LH 4J9YB 2LGQA 5DM6V 3VQYA 1S5HC 3CCEV 2R9IA 4I9QA 2YIDA 3K0DA 2EILC 3ZHUA 5K1XA 4X62O 5L3DA 3KCXA 2QWRB 3ETGA 1I5XA 4RQEA 5BMVA 2LQTA 3DC6A 3ASOB 3K0GA 2MK3A 2JJ2G 2R70A 5B1NA 3W7XA 2PYJA 2WLLB 3L70H 1PPJH 1D5NA 3JAKB 4CC6A 2JGDB 1KQSU 2ITCC 3HKCB 4PV1B 1FAFA 4G2KA 2OTLV 1HNXB 1ENVA 1R3LC 2BTQA 4OXSA 1EN6A 2Y4TA 4GLXA 2K9PA 1I0HA 4I9WA 4FFBB 2VWJA 3E8FA 1Q81W 4NKGB 4YY3B 2ZIMA 1SS3A 4TOIA 3B8MA 2QGNA 2YI9A 1M93A 5KAIZ 3I55V 1NH2B 3DTUB 1AROP 3G80A 5EIBD 4J7ZA 1KU9A 3D36A 5B1BB 4TV9A 4HZ3A 5EK0A 3M99B 2IH3C 5KX5A 1ZL8A 1SC5B 1DF5A 4DR2O 1NTMH 1Y67A 1GAXA 1SZTA 1BL8A 3CPWU 1IXMA 5FPRA 1GN2A 5D5PA 1IBMO 3LNNA 5LHIA 3BHPA 3SYQA 3IC9A 3OM3B 1W0KG 5JQGB 1TAEA 2XASA 3W7TA 5BY1A 1B06A 1FYJA 2F66C 3OFNG 3OD4A 2ILMA 4PA9A 2DJVA 5ITZA 1S0VA 4PA3A 1QVFU 2F4VB 5TISZ 2YC0A 4PDVA 3AG3B 1CPYA 1DGSA 2P4KA 1EM1A 4BIUA 5L3FA 1J5EO 1L8DA 4X1YB 3FX7A 1NZ6A 4JI6B 1EBOA 3UT5B 5AG2A 4DR5B 3TXSA 4K35A 1PL4A 1VQ6V 5H2FZ 2ZQMA 5IYDO 2P4VA 1ZUQA 1PNLA 1LUVA 4JZ2A 4P2ZA 1Y4MA 5L3BA 2UU9O 1TVKA 2IU3A 1AI6A 4JGSA 2QKCA 2P5OA 2UXDO 4YXWG 4DO2A 4TQFA 1SQXH 3EFFK 2XAFA 3HKDB 2UUCB 3QO8A 4MTOA 1Y76A 4BAYA 3CYOA 4AHCA 4DR4O 3ABKB 3OAAG 2AZ0A 4ZI7B 4KUMA 2ZIOA 1HWYA 3CP1A 4MSWC 2MW2B 3VBBA 3ZHRA 4E4EA 3D36C 3HKBB 2NN4A 4MVMA 1CEZA 4DV1O 2WLMA 3OUFA 4UXNA 1H2GA 1YF2A 1Z5VA 5J2UB 3ABMB 4BW9A 5DEDA 2B9ZA 3CMAV 1SQVH 4JI5O 1SA0B 2VWKA 5K1PA 2ZE8A 3G4SV 1NT2B 1KKCA 1E79G 3JATB 3A0BZ 4UCOA 4PDMA 1Y74B 4FLTA 4LFCB 4G28B 5LGTA 1VQ7V 2KG7B 5JVDA 1OV9A 1OCCB 2F95B 1Q6HA 4N23A 4WCEV 3WU2Z 1XMQO 2JS5A 1ROPA 4UCSA 1XUQA 4PJ0Z 5LMUO 1MABG 1AB3A 3ASOC 5CA1A 4DV7B 5IYCO 2IJIA 2AHZA 3CJHB 2EIJB 3JYCA 4CS3A 1KKDA 3H1JH 1M90W 2XAQA 3BVOA 1JQ0A 5EBLC 1DF4A 4U7OA 4GX0A 3GB7C 1M4UA 1XMOO 2ZNIA 2OCCB 1H38A 3PN1A 5BXZA 1Q6IA 4UB6Z 4CS4A 3RYHA 4FM2A 1KC8W 5C8YB 4YHHO 3SJQC 1UJWB 3T4DA 4I0XB 4K8ZA 4TUYB 3UO3A 3ZRSA 1YJ9V 5LBQA 2Q7HA 2OIGA 1RP3B 5KA6A 1AP5A 2NLJC 2EINC 1WPBA 2QTSA 2F43G 3AK2A 2V4DA 2OYQA 4QGPA 3OTOB 2A0LA 3WB1A 1ZWIC 2HHHO 2DOSA 3AK1A 1FKAO 3TK1A 3AG7A 1JPXA 3VQXA 1K34A 1IURA 2W6IG 3SJBC 2FB5A 3CB2A 1FXHA 3JASB 2A7WA 4DR7B 5H9CA 2XNDG 3BPZA 3AG1B 3K06A 1AR1B 4DW0A 2RDCA 3CXHF 3CCJV 1O9GA 4LC1A 4QPKA 4TQDA 5LL6Y 4JZGA 1GO3F 1VEWA 1JFFB 1BZKA 1V54B 3OE7G 3EXAA 2YUAA 4UUJC 3THOA 4B3TO 1AI4A 1NI8A 2RMKB 1LR1A 1KD1W 1QNMA 4O4IB 2ARHA 4F4LA 2ZINA 3BRCA 1K5QA 4DV0B 4WFEA 1H2KA 2YIAA 2A9HA 3CRQA 4I55B 2IH1C 3GWKC 2KB1A 4O4HA 3FD9A 1G8MA 3GVMA 4E2LA 1N36O 1N34O 4JASA 2E76B 1TUEB 1NVPD 2D2CB 3HB3B 3ZHTA 2YSUB 2M6YA 5CBGA 4AQYO 1D5AA 3B40A 3CD6V 4D7TA 2HP8A 3K5MA 1R1BA 5IYZA 4LF6O 4I50A 4ZOLB 3ABKC 3ZX6A 3JAWA 2FL4A 4DR1O 5CA0A 1M9NA 1Q5OA 2RQ6A 4N21A 2LFSA 1KP2A 2N04A 5LGUA 3KZIZ 3FYEB 4W4KA 3T1HO 5FNVA 2YDEA 1KB9F 1FJGO 1Q90D 4JTDB 4TV8A 2PTMA 3BAAA 2Z0AA 3ABMC 2E3CA 4H0LB 3RYCB 5EYPB 4LF8O 4JYYA 4JI8B 3RW0A 1KBHA 2JEXA 4R7CA 2IBZH 3X2QC 1GRJA 4RQFA 5BZBA 1YITV 4LF9O 2L35A 3FB5C 3T4ZA 5JJEB 4K0KB 4GUNA 2E5LB 2HVJC 1OJHA 1W2BU 4P9OA 1YTFD 1OCCC 4PA6A 4BIZA 4FLWA 3N2GB 4HBNA 3C3TA 3TETA 5F2VO 3GWOA 2AW9A 3E83A 1HNWB 1I7FA 3ASNB 1VF7A 3JCUZ 2Q0OC 4NXNB 4CH5A 2XHBA 4B3SO 1SKVA 4JAAA 4PELA 2HEPA 1TUBA 3B09A 5GTHZ 3K03A 4TT3G 2K1EA 3ZMSA 4YJ3A 3CCVV 3MDSA 1MZEA 2Y0IA 3R65A 1AI7A 1SQQH 4JI4O 1GM7A 1X59A 1P7BA 3CE2A 4L87A 1VQPV 4JPRA 4B3MB 1IBKO 4X8AA 1COWG 3E22B 4HNAB 3ZBHA 5E1AC 1F7YA 1KECA 3U11A 5GONB 1K73W 4BIOA 4O2BA 5EBWC 1US6A 2V7QG 4RO2A 3JSLA 4X65B 1HNXO 1WAZA 5JWPA 1KMIZ 2Y48A 1ZAUA 5A9GA 4ZIBA 3LNMB 1AILA 5CMUA 3Q4HB 1X4TA 1Z5WA 1PV0A 3JALB 1ORQC 4DRXB 1RSOA 4H33A 1NS1A 2Q68A 2LGWA 3RYIB 4MVSA 3AG1C 3C90A 2A3QA 3BY6A 4UVBA 4QIWF 5KUMA 1MOFA 2HR3A 1WJZA 2BE3A 2E75B 1NR7A 1OZ0A 1JMKC 3N2GA 1V54C 4NB5A 2ZDIA 2CH7A 5CB4A 4DUYB 1WA8B 3OT7A 1JX9A 2JJ1G 3ZRXA 3WB2A 3E35A 4W4LA 4F6RB 2UXBO 4FPPA 1FD9A 4O2AB 1Q82W 2BSKA 4JYBA 4X1KA 4DR6B 1M56B 5IYBO 4CC5A 2V1DA 5EBMC 3OGIB 4BR6A 4A5UB 3JARB 4JI1B 4PI0A 2F4VO 3QNEA 4MVZA 3BEHA 3IFXA 3T2MA 1VQNV 2XAHA 4AILC 4R6ZA 4IYIA 3OW2U 1YXBA 2X6BA 2JIZG 1N33B 5KHIA 3FB6C 5IY5C 3LDDA 1AJNA 5JH7B 2AGAA 2VQEB 4JI6O 1MSDA 2OWOA 2CAZC 1A32A 4JV5B 5B66Z 4DW1A 3A8TA 3OGCC 3ETQA 1THZA 1VQOV 2X6CA 4OGQB 5B1AC 3TCUA 3ZRWA 4H13B 3JSNA 3MD0A 1H2SB 1Z2GA 3S3WA 1LNQA 4YJ2A 4O4LB 1K5SA 2GDSA 1YJWV 3W7SA 2CTWA 5LYJB 4DV4B 2UUBB 3QTCA 1SQFA 4G27B 4LWSA 4MW3A 1M57C 3B4SA 4UCTA 2UUCO 3VQVA 4I7ZB 1WB8A 1QR8A 4LF4B 5LOVB 5FPOA 2ZE5A 3BA8A 1H8HG 1NJIW 2H94A 2Q73A 3I56V 2HJFC 1ZLZA 2Z3YA 2N74A 4PDLA 4O2AA 5KAFZ 3F5TA 4EB6B 2VQFO 4X62B 2M7WA 2ZDIC 2Z5UA 4I4TB 1WP8A 4C7UA 4IIJB 1CXZB 4OX9B 4QE7A 4DV2O 2W0XA 2WLLA 2UUAO 1OCRB 4JTAB 3JAKA 3SJCC 4WBNB 2JGDA 4FIPC 5IJ0B 1Q86W 5H5NA 3HKCA 4U3JB 2ZKOA 3CC2V 2BOCC 2LFRA 2YXYA 3N27A 4JYCA 3OMAB 3ABUA 4QJFB 1N0NA 2DYSC 4FFBA 2PYLA 4LFCO 1K8AW 4ZKIA 1B6QA 1VF6C 2IJJA 1N8RW 5B3SB 2Q69A 1Q7YW 4H44B 3IJ4A 3ML0A 1R3KC 2HKOA 1HW7A 3D8CA 3CC7V 2AZ2A 4J7JA 4GKJO 1SETA 3K3WA 3L75H 2GBOA 4CH3A 2D3OW 2EJRA 4WFHA 3G6EV 3CCLV 2YI8A 4NTXA 3SJAC 1I5YA 1GM8A 3LSSA 4OPHA 3RYFB 1S76D 1TA8A 4DR2B 5IE9A 1F4MA 5LP6B 3RBZA 4NXMO 1N0JA 3E86A 5IDJA 2QDOA 3AK3A 5J2TB 2Y0PA 1AVMA 4WFGA 2QWOB 1IBMB 3CWBH 4P30A 4J42A 1GN6A 2EIMC 3CCSV 1IDSA 4X1IB 2XT9A 2CTPA 2ZM6B 1CP9A 5JQGA 4B3RO 2FTKA 1H2NA 2YIBA 5KA5A 4XBFA 2BTOA 2JGUA 1GK9A 3JD1A 2EULA 1DLBA 5IT9N 2FMLA 1YHQV 3FB8C 1JVMA 1YJNV 1KYOF 4NR1A 4X66B 3H01A 4J80A 1V9PA 2GUZB 3L71H 4PA7A 4MTFA 1QCEA 1NBMG 4X1YA 3OTOO 2OTJV 3LUTB 3UT5A 4CS2A 2QJ1A 5KHHA 4L8JA 1YI2V 1V55B 3K9SA 4DUZB 1FFXB 4XDLA 4WFFA 3AG4B 4BW5A 2PI5A 4DR7O 2QTOA 2UU9B 5LA6B 2WLIB 4P9PA 4ZHQB 2WLHA 1SRYA 3L73H 4DYLA 2WA4A 1NVPB 5KMGB 1K97A 1EN5A 3S3XA 2ETNA 3UQ8A 3P3PA 3SYAA 3RFRA 1B3QA 4LFAB 4YIPA 1UFIA 4JI7B 3ABLB 3HKDA 1HR0O 1WNSA 3MHHC 3SDLA 3CCUV 5EZYB 3J7AU 4DR4B 1PD3A 4UVCA 1SERA 4ZI7A 1F51A 4DV0O 4D6TH 2QWNB 2Y69B 3WG7B 3HR0A 5B1BC 2GV9A 3CHXA 1EZJA 1RPOA 4DR3B 3H1HH 1G4YB 3HKBA 4DV1B 4R50A 3ZN1A 5LMNO 2DYRB 4O4JB 1K4CC 2OCHA 3JD2A 1XEQA 2Q6AA 1AP6A 4X89A 5J2UA 2YS8A 1SA0A 2ATKC 2YICA 2CGOA 1FXKB 4FVMA 3ZRVA 3ZHQA 4XDJA 3JATA 1Y74A 3OEEG 5L3EA 3L74H 1YTFB 4GX5A 1VIBA 1ZX3A 4LFBB 1IVSA 3RWRD 1JCHA 3BABA 2KG7A 4LNUB 1P4RA 3AG3C 1XREA 1M1KW 3HKEB 4FMTA 3APQA 1XMQB 1R3JC 5LXTB 4RUEA 3CX5F 5H6QA 5LMUB 4LR3A 5DECA 5LHGA 4JI8O 3QG5A 4J11A 1NTKH 3CJHA 2UXXA 3DXRB 4CBCA 4JI0B 2EIKB 1IBLO 4UFZA 4K0KO 1XMOB 4KHPB 2QM4A 2E5LO 1NU1H 3ZMZA 3RN4A 1JJ2U 5B3SC 4LF7B 4NTYA 1QR9A 2CTQA 4OPAA 4IHJB 2EILB 4YHHB 1YEWA 5GW7A 4DV6B 5C8YA 4I0XA 4TUYA 1BCCH 3NXSA 1HNWO 2PZSA 5A2QN 1YVWA 4EFEA 4NXNO 1PNMA 2JS3A 3K5LA 2ZR3A 1F23A 5JJJB 1EZVH 5KHKA 4JI3O 2OT5A 3DC5A 3ZHSA 2HHHB 1BE3H 3FAVB 3TJTA 2GHYA 4JI2B 1XHZA 3JD0A 3ZMVA 1I08A 3U0ZA 4QPJA 2EX3A 3UM7A 3JASA 1JJOA 3K5OA 2R72A 1FXVA 4GKKB 3F5WC 1QHTA 1VMGA 1IXBA 3K79A 4K3AA 4B3MO 4MVOA 5BR8B 4ICGA 3UKMA 1RM1B 2WWWA 4PI2A 1GN4A 4LNUA 3G6BA 5H6RA 1JFFA 2CTRA 2JK5C 2R9AA 4GX2A 5E79Z 2DWEC 5B1OA 1GTOA 1GMGA 4O4IA 3N2KB 3LSUA 2E74B 1Y66A 3P32A 2P7TC 1XNRB 2YEVB 1XQ8A 2QKAA 2Q7EA 3K9AA 4FLUA 3JAMN 3H1KH 4MW8A 2P22C 4I55A 1WB7A 2WPDG 4MT8A 4HYOA 3WFVA 2WA3A 2Q4PA 4DV3B 1PM9A 3WB0A 3CSXA 2EIJC 2IM9A 1XILA 2PF4E 2RJZA 1NKDA 1R6KA 3QO7A 3A0HZ 5IWAB 2L6LA 4DUYO 1N32B 2OCCC 5KHGA 3H1IH 2Y4UA 1VQ9V 1MSWD 4ZOLA 1EFRG 1Q6UA 4DR1B 4CH6A 3ABTA 2QM8A 3CXCU 4DR6O 1QU7A 4WF9V 1OCOB 1MNGA 1TGOA 4DK0A 3FYIB 5BMVB 3AG2B 3CC4V 1FPOA 1MA1A 3IAYA 4FM1A 1FJGB 4IGGA 3OUSA 3SGIA 2IW5A 1G1XB 2BTQB 3RYCA 3STLC 5EYPA 3BA9A 3M8AA 1WPXA 2A79B 3CCMV 3ZEDA 1MMMA 2VQEO 2XAGA 4X88A 1FXKC 3LDCA 4IL6Z 3SR2C 4YY3O 4JV5O 2PY5A 4JTCB 3E89A 3CEIA 3SYCA 3L72H 4FLYA 3ETEA 2QSAA 3P3NA 1VARA 3RVYA 4TV9B 3RT3C 2EZOA 2F23A 4FK5C 4I5SA 1K7DA 5KX5B 3K04A 5C93A 1ZL8B 2P6JA 1VF5B 2UXCB 1YIJV 1HNZB 2DE0X 2KSDA 2WLJA 1MG1A 3JD4A 3RGBA 3H9VA 1NQTA 4Z1VA 3DGEA 4Q6GA 1HDJA 2JVDA 3CRAA 5ITZB 5J9PC 1F4NA 2ZD9A 1VF6A 1QLEB 2Q8VA 1IZ3A 1G6UA 4JYAB 2PUSA 4JI4B 2B1GA 4X64B 3AEIA 1Q8IA 1IBKB 2CK3G 1E1RG 2BOBC 1ZSPA 2ZE6A 4UB8Z 4MVRA 1H8EG 2F1MA 1BSMA 3E22A 4HNAA 3SYOA 1QVGU 5GONA 4OX9O 1XNQB 5IJ9B 4DR5O 1S3JA 3SPCA 4ASUG 5FLXN 4U3FH 1U96A 3L9DA 3M7MX 3B8NA 1S5JA 1TVKB 2X0LA 2EJ7A 3T1YB 3Q4HA 2RNBA 2XOKG 1RFYA 3JALA 4DV5B 4DRXA 2CE4A 4LF5B 3RYIA 1VP7A 3ZS8C 4GX1A 2GSMB 1Y76B 2IU0A 2F93B 2W0FC 1I94B 1SZXA 1N4CA 1RM1C 2EINB 1ZTEA 4WFBV 3APOA 1W0JG 2ZT9B 1B04A 1L1FA 1WA8A 2QE7G 2ZCEA 4EKWA 2UXBB 2P06A 2IJKA 4F6RA 1P84F 4WFAV 2ZM6O 3FFQA 1BHAA 1U97A 4RWUA 1Q3EA 4TWKA 3CRMA 2R9RB 4FJCC 2FKXA 4CH4A 3ASNC 4FLXA 3U10A 2YXLA 4LBEC 3JARA 4X66O 3SPGA 1QBZA 5CBFA 3O65A 4MS2A 2ITDC 3NR7A 1L0NH 1SESA 1W59A 3KG2A 4CZZA 3ZHVA 3K59A 1KUQA 3SPJA 1BQZA 5JH7A 2DQ0A 1SQPH 3BFRA 1QLNA 5IJ9A 5JVDB 4LH6A 5EIBC 4JF3A 1MZFA 4DUZO 4XDKA 1WN7A 4TSFG 3P30A 1OCOC 5LGNA 4KXRA 4YIOA 1VQ4V 3MAQA 1PNKA 2N05A 3AG2C 3UO2A 5CA1B 4DV7O 4O4LA 2XTAA 4GZRB 1DTOA 2JEUA 1AR4A 1RPRA 2DW4A 4LFAO 5LYJA 3J81N 3F7VC 4UV9A 4JI7O 3CS5A 3B2EE 3JD3A 3ZMUA 2QA4V 2OIEA 2QWPB 2WLNA 2ZR2A 1JOYA 3EVKA 4NYKA 3RYHB 5LOVA 3J80N 1NTZH 3UCSC 4FFKA 4MVUA 1SQGA 2DWDC 2Q5ZA 4GT1A 1NH2D 5JJNB 1D2DA 4DR3O 1AR5A
chains in the Genus database with same CATH topology
3I55V 1NH2B 3DTUB 2IJHA 5L3CA 1AROP 2QKSA 3R65A 3ZJZA 3D36A 5B1BB 1AI7A 2UXXA 4HZ3A 1GM7A 4CBCA 1P7BA 5EK0A 1BMFG 3CCRV 3M99B 2EIKB 4L87A 2IH3C 1VQPV 4Q20A 4JPRA 4X8AA 1DF5A 1COWG 3ZMZA 3X2QB 1JJ2U 5B3SC 1SZTA 5E1AC 1KECA 1M56C 1QR9A 1BL8A 1K73W 3CPWU 1IXMA 2EILB 1K4DC 5GW7A 5LHIA 3SYQA 5EBWC 3OM3B 3SYPA 1W0KG 1QLEC 2V7QG 4RO2A 2XASA 3NXSA 1WLEA 3W7TA 3OFNG 2Y48A 1PNMA 2ZR3A 1F23A 4PA9A 1S0VA 3LNMB 2OT5A 5CMUA 4PA3A 1QVFU 1AJQA 1AI5A 2DQ3A 1VQKV 1PKXA 4MTXA 1ORQC 4PDVA 4H33A 3AG3B 4UV8A 2Q68A 2GHYA 2X6AA 1CPYA 1K9MW 4BIUA 4MVSA 5L3FA 3AG1C 3JD0A 3ZMVA 5LHHA 4QPJA 1FFTB 3BY6A 3JCZA 4UVBA 4QIWF 5KUMA 1VQMV 1MOFA 3LSQA 3UM7A 3E8GA 4JAVA 1EBOA 1FXVA 3F5WC 2HR3A 3VOUA 1OCZB 1NR7A 1OZ0A 3K79A 2WAMA 1AJPA 1VQ6V 1V54C 2ZDIA 2ZQMA 4MVOA 5IYDO 1PNLA 3UKMA 1RM1B 4P2ZA 1JX9A 1Y4MA 2WWWA 2JJ1G 3ZIAG 5L3BA 3ZRXA 3STZC 3K08A 3E35A 2IU3A 5H6RA 4FPPA 1AI6A 1Q82W 2JK5C 4JYBA 4GX2A 4H37A 1VQ8V 4JGSA 1M56B 5IYBO 2DWEC 2V1DA 5B1OA 4YXWG 4DO2A 1GTOA 5EBMC 1GMGA 1XL6A 2EBOA 2UXNA 3EFFK 1E1QG 2XAFA 1Y66A 3HPLC 2P7TC 3P32A 4J9ZB 2YEVB 3QO8A 4MTOA 2QEXV 1XL4A 3QNEA 1K33A 3E8BA 3K9AA 4MVZA 4BAYA 3BEHA 3CYOA 3ETDA 3IFXA 3T2MA 4QNHB 1VQNV 2XAHA 4R6ZA 4MW8A 2X6BA 3OW2U 2Q67A 3ABKB 3OAAG 2JIZG 3E2EA 2WPDG 4MT8A 1NR1A 4HYOA 4KUMA 3WFVA 1HWYA 1PL0A 3FB6C 5IY5C 3CP1A 3LDDA 4MSWC 2LP7A 1AJNA 2C2AA 3VBBA 4MVQA 2EIJC 3QO5A 2WLIA 3OGCC 4MVMA 1CEZA 1NKDA 1R6KA 1THZA 3QO7A 2NNUA 2X6CA 1VQOV 2WLMA 3OUFA 4UXNA 5B1AC 1H2GA 3TCUA 3ZRWA 1OCRC 2OCCC 2WLKA 1K92A 3ABMB 1VQ9V 1MSWD 3MD0A 1R73A 1LNQA 2ZXWB 1EFRG 4RAIA 3CMAV 3ABTA 2QM8A 3CXCU 5CA3A 1K5SA 4WF9V 1YJWV 1OCOB 3W7SA 2XAJA 3FYIB 3G4SV 3AG2B 3CC4V 1E79G 4G27B 3CCQV 4PDMA 4MW3A 4Z1MG 1M57C 2P67A 2AHYA 5CN0A 3OUSA 4G28B 5EC1C 5LGTA 1VQ7V 2IW5A 1R3IC 3OR6C 4UVAA 3MHSC 1QR8A 3STLC 1OCCB 1WPXA 2A79B 5HFMA 3CCMV 4N23A 4WCEV 2B1IA 2X7RB 1H8HG 2XAGA 1NJIW 2H94A 3I56V 4X88A 1ROPA 1FXKC 3LDCA 2HJFC 1MABG 2Z3YA 4PDLA 4RUFA 3F7YC 3ASOC 3E89A 4JTCB 5IY5B 2W6JG 4LCUC 3SYCA 3ETEA 5IYCO 2IJIA 2AHZA 2M7WA 5DN6G 1GM9A 1FS0G 2EIJB 3RVYA 3JYCA 1KKDA 2ZDIC 1FXKA 1M90W 1S72V 2Z5UA 2XAQA 3E8HA 2EZOA 1JQ0A 3OR7C 5EBLC 4FK5C 4I5SA 1DF4A 4U7OA 4GX0A 3GB7C 1K7DA 5FL7G 5B1AB 4QE7A 4U7NA 3K04A 3RVZA 5C93A 2WLLA 2P6JA 3EHBB 1OCRB 2OCCB 4JTAB 1H38A 4PA4A 4FIPC 3D3IA 1Q86W 1YIJV 2HG5C 4QE9A 4JAUA 1KC8W 3CC2V 2QM7A 2BOCC 2LFRA 3SJQC 1UJWB 2WLJA 4JYCA 3OMAB 1MG1A 3ABUA 4QJFB 2DYSC 4R8CA 3T4DA 1K8AW 4ZKIA 1B6QA 3JD4A 2IJJA 1N8RW 5B3SB 2Q69A 3A0RA 2WSSG 3ZCCA 3ZRSA 1YJ9V 1Q7YW 1NQTA 5LBQA 3DGEA 1M57B 3ML0A 5KA6A 1R3KC 2NLJC 2HKOA 2EINC 3G71V 3CC7V 2JDIG 2P90A 5J9PC 1F4NA 1SETA 3K3WA 2ZD9A 3OMNB 1QLEB 2D3OW 2F43G 3IGAC 1V55C 2EJRA 4WFHA 3G6EV 2A0LA 2B1GA 3CCLV 1ZWIC 3AG4C 1I5YA 1GM8A 3LSSA 1S76D 1BHBA 3T1CA 3TK1A 4PDRA 3AEIA 4MTGA 2CK3G 1E1RG 1JPXA 2BOBC 5L3GA 3PJSK 1F4MA 1K34A 2W6IG 4MVRA 3RBZA 1H8EG 3OEHG 3E86A 1FXHA 3SYOA 1OHHG 5IDJA 1QVGU 3ZN0A 5H9CA 2XNDG 4WFGA 3AG1B 3K06A 1S3JA 4P30A 3SPCA 3CCSV 2EIMC 1AR1B 1CP9A 3ABLC 4KP4A 4ASUG 2FTKA 5KA5A 4KFMA 3CCJV 1K3EA 3B8NA 4XBFA 4LC1A 1GK9A 3JD1A 4QPKA 5KUKA 1DLBA 1GO3F 2X0LA 1YSCA 1YHQV 1GKFA 1V54B 3FB8C 3OE7G 4UUJC 2XOKG 1JVMA 1YJNV 3LDEA 3H01A 1AI4A 2PI4A 1KD1W 1KP3A 2HLDG 2Y69C 3WG7C 1OCZC 2DYSB 5EC2C 4LP8A 4PA7A 4F4LA 4MTFA 5HFLA 1QCEA 4GX1A 2GSMB 3FB7C 2H8PC 1VQ5V 1NBMG 4DXWA 1K5QA 2DYRC 4WFEA 2OTJV 2A9HA 2IU0A 3LUTB 2W0FC 2B5UA 5CBHA 1RM1C 2EINB 3B77A 2IH1C 3SPIA 2KB1A 4WFBV 1W0JG 1YI2V 1G8MA 1V55B 4E2LA 3FKSG 4XDLA 4WFFA 3AG4B 1J95A 4BW5A 2PI5A 1L1FA 4JASA 2QTOA 1TUEB 1NVPD 2QE7G 3HB3B 3OMIB 4EKWA 1S77D 2WLIB 4P9PA 2WLHA 2IJKA 2YSUB 1SRYA 5CBGA 4WFAV 4GCZA 3CMEV 3W7WA 1NVPB 3CD6V 3IC7A 1K97A 3ZMTA 1BHAA 3ZRWB 3SYAA 4TWKA 2HVKC 2R9RB 4FJCC 3ABKC 3ASNC 1R6NA 2EIMB 4LBEC 3ABLB 2YEVA 3MHHC 1M9NA 3SPGA 3W7UA 1QBZA 5CBFA 4MS2A 4HAMA 1VQLV 2ITDC 4N21A 2EZPA 1KP2A 2LFSA 3SPHA 3CCUV 1SESA 1PD3A 3KG2A 5LGUA 4UVCA 4CZZA 4ZBMA 1SERA 3FYEB 1F51A 3SPJA 4JTDB 2DQ0A 2HFEC 2Y69B 3WG7B 5B1BC 3ABMC 1EZJA 1RPOA 1QLNA 1G4YB 4R50A 4JF3A 2ZXWC 3RW0A 2JEXA 3ZN1A 2EIKC 2DYRB 4XDKA 4TSFG 4J9YB 3P30A 1K4CC 5DM6V 1OCOC 3JD2A 5LGNA 2Q6AA 1VQ4V 1S5HC 4R7CA 4X89A 1PNKA 3X2QC 3AG2C 3CCEV 4RQFA 2R9IA 5BZBA 1YITV 3K0DA 3FB5C 3T4ZA 2EILC 2ATKC 1DTOA 2JEUA 5L3DA 2HVJC 1RPRA 2DW4A 1FXKB 3ETGA 1W2BU 1I5XA 4P9OA 4RQEA 3ZRVA 4XDJA 1YTFD 3ASOB 3K0GA 3F7VC 4UV9A 2MK3A 3OEEG 2JJ2G 5L3EA 1OCCC 5B1NA 4PA6A 4BIZA 3W7XA 2WLLB 3JD3A 3ZMUA 1YTFB 4GX5A 2QA4V 1KQSU 3TETA 2ITCC 3GWOA 4G2KA 2WLNA 2ZR2A 2OTLV 1JOYA 3E83A 1ENVA 3ASNB 1R3LC 1JCHA 4OXSA 1P4RA 3AG3C 1M1KW 4MVUA 4I9WA 4FMTA 4PELA 2DWDC 1R3JC 4GT1A 3K03A 3E8FA 2K1EA 4TT3G 1NH2D 1Q81W 4RUEA 5H6QA 3ZMSA 3CCVV 3B8MA 5LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTO A;  2HG5 C;  4EKW A;  2WLI B;  4P9P A;  2WLH A;  1XL4 A;  4QE9 A;  3E8B A;  5CBG A;  4MVZ A;  2QKS A;  3BEH A;  3IFX A;  2BOC C;  3R65 A;  3T2M A;  3ZJZ A;  4QNH B;  4R6Z A;  3SJQ C;  4MW8 A;  2WLJ A;  2X6B A;  2Q67 A;  4HZ3 A;  2DYS C;  4R8C A;  3T4D A;  4CBC A;  1P7B A;  3SYA A;  5EK0 A;  4TWK A;  4HYO A;  2HVK C;  3FB6 C;  5IY5 C;  2Q69 A;  2IH3 C;  2R9R B;  3LDD A;  4MSW C;  3ZRS A;  3TET A;  3ABK C;  3ASN C;  4MVQ A;  4LBE C;  4X8A A;  2EIJ C;  1R3K C;  2NLJ C;  2EIN C;  2YEV A;  5B3S C;  5E1A C;  3SPG A;  2WLI A;  1M56 C;  5J9P C;  5CBF A;  1BL8 A;  2ZD9 A;  3OGC C;  4MVM A;  4MS2 A;  1K4D C;  2ITD C;  3SPH A;  2X6C A;  3IGA C;  1V55 C;  4WFH A;  2WLM A;  3OUF A;  2A0L A;  3KG2 A;  5B1A C;  3TCU A;  1ZWI C;  4ZBM A;  3SYQ A;  3AG4 C;  1OCR C;  2OCC C;  5EBW C;  3SYP A;  2WLK A;  1QLE C;  4RO2 A;  3SPJ A;  3T1C A;  4PDR A;  4MTG A;  1LNQ A;  2BOB C;  4JTD B;  3PJS K;  4RAI A;  2HFE C;  4MVR A;  3RBZ A;  5B1B C;  3E86 A;  4PA9 A;  3SYO A;  3ABM C;  1G4Y B;  3LNM B;  4PA3 A;  4R50 A;  3RW0 A;  2ZXW C;  4WFG A;  2EIK C;  4XDK A;  4J9Y B;  3K06 A;  1ORQ C;  4P30 A;  4G27 B;  1K4C C;  3SPC A;  4PDM A;  2EIM C;  1OCO C;  4MW3 A;  4PDV A;  4H33 A;  1M57 C;  2Q6A A;  3ABL C;  1S5H C;  4R7C A;  2Q68 A;  4X89 A;  2AHY A;  2X6A A;  3X2Q C;  3AG2 C;  3OUS A;  4G28 B;  4MVS A;  3AG1 C;  4KFM A;  5EC1 C;  5BZB A;  3K0D A;  3FB5 C;  1R3I C;  3T4Z A;  2EIL C;  3OR6 C;  5KUK A;  5KUM A;  3UM7 A;  3E8G A;  2ATK C;  3STL C;  2HVJ C;  3FB8 C;  3F5W C;  3VOU A;  4UUJ C;  1JVM A;  2A79 B;  4P9O A;  3LDE A;  4XDJ A;  3K0G A;  3F7V C;  1V54 C;  2Y69 C;  4X88 A;  3WG7 C;  4MVO A;  1OCC C;  3LDC A;  4PA6 A;  1OCZ C;  2WLL B;  2HJF C;  5EC2 C;  4LP8 A;  4PA7 A;  3UKM A;  4GX5 A;  4MTF A;  4GX1 A;  4P2Z A;  4F4L A;  4PDL A;  2ITC C;  3FB7 C;  4RUF A;  2H8P C;  3ASO C;  3E89 A;  3F7Y C;  4JTC B;  2WLN A;  4DXW A;  4LCU C;  3STZ C;  2DYR C;  3E83 A;  3K08 A;  4WFE A;  3SYC A;  2A9H A;  1R3L C;  3LUT B;  2AHZ A;  2W0F C;  4OXS A;  5CBH A;  3RVY A;  3JYC A;  3AG3 C;  2JK5 C;  1KKD A;  2IH1 C;  4GX2 A;  4H37 A;  3E8H A;  4MVU A;  4I9W A;  3OR7 C;  3SPI A;  2KB1 A;  5EBL C;  2DWE C;  2DWD C;  4GX0 A;  1R3J C;  3GB7 C;  3E8F A;  2K1E A;  3K03 A;  1XL6 A;  5EBM C;  4QE7 A;  3K04 A;  4RUE A;  4XDL A;  3RVZ A;  2WLL A;  3EFF K;  4WFF A;  4BW5 A;  1J95 A;  4JTA B;  4PA4 A;  2QTO A;  3HPL C;  2P7T C;  4J9Z B; 
#chains in the Genus database with same CATH topology
 2IJH A;  1SF9 A;  5L3C A;  2VQF B;  1J5E B;  4EB6 A;  5KHJ A;  2QKS A;  4IT5 A;  3ZJZ A;  4I4T A;  4IIJ A;  1BMF G;  3CCR V;  4DV2 B;  4Q20 A;  2UUA B;  4ABM A;  5D5Q A;  4WBN A;  5IJ0 A;  3X2Q B;  3CRR A;  1YCI A;  2KQX A;  1M56 C;  2H3O A;  4U3J A;  1K4D C;  2KKW A;  1EN4 A;  2YIB D;  2HJD A;  1BQ0 A;  3SYP A;  4LFB O;  1QLE C;  3O9O A;  1WLE A;  2UXD B;  3TGU H;  4GKJ B;  4J41 A;  4D7S A;  4UCU A;  1AJQ A;  1AI5 A;  2DQ3 A;  1VQK V;  1PKX A;  2BCC H;  3G67 A;  4GYC B;  4MTX A;  4UV8 A;  4UCV A;  2X6A A;  3RYF A;  4DK1 A;  1K9M W;  2LW7 A;  5LHH A;  1FFT B;  4FLV A;  3JCZ A;  5LP6 A;  4NXM B;  1VQM V;  3LSQ A;  3E8G A;  3VQW A;  3TXQ A;  4JAV A;  5J2T A;  4JI0 O;  1URF A;  3VOU A;  1OCZ B;  5B5E Z;  4J10 A;  4O4H B;  4KHP O;  2WAM A;  1AJP A;  4X1I A;  3C3S A;  4B3R B;  4LF7 O;  1O9H A;  3ZIA G;  2XUM A;  4DV6 O;  2PGG A;  3STZ C;  3K08 A;  2ZNJ A;  2ADP A;  1T5E A;  4BWA A;  4JI5 B;  4H37 A;  1VQ8 V;  2GTA A;  5IYZ B;  4I50 B;  1XL6 A;  2GUZ A;  2EBO A;  2UXN A;  1BGY H;  1E1Q G;  3JAW B;  3HPL C;  1PP9 H;  4X9Q A;  4J9Z B;  5CA0 B;  1SQB H;  1GN3 A;  1BT8 A;  2QEX V;  1XL4 A;  1K33 A;  3E8B A;  1P7G A;  3ETD A;  4QNH B;  2Q67 A;  4JI2 O;  3E2E A;  2RCV A;  1NR1 A;  5FNV B;  1PL0 A;  2CGN A;  2LP7 A;  2C2A A;  1FFX A;  3KKY A;  1Q43 A;  4MVQ A;  4LH7 A;  1R6T A;  4TV8 B;  4GKK O;  1H2L A;  3QO5 A;  5LA6 A;  2WLI A;  4ZHQ A;  3KCY A;  5JCO A;  2NNU A;  5KMG A;  5BR8 O;  2RN9 A;  1OCR C;  2WLK A;  1K92 A;  3BCC H;  1R73 A;  1P49 A;  2ZXW B;  4RAI A;  1HR0 B;  5CA3 A;  2GTS A;  4J7K A;  2XAJ A;  4FLZ A;  4EEQ A;  5EZY A;  3CCQ V;  2VRZ A;  4Z1M G;  2P67 A;  4FZ1 A;  1XNR O;  3K57 A;  2LJ2 A;  2AHY A;  5CN0 A;  5EC1 C;  1R3I C;  3OR6 C;  4UVA A;  3OTF A;  3MHS C;  5LMN B;  5HFM A;  1UPG A;  4O4J A;  2B1I A;  2X7R B;  1TUB B;  4DV3 O;  5LP6 C;  1XHX A;  4YJ3 B;  3DSQ A;  4RUF A;  3F7Y C;  5IY5 B;  2W6J G;  4LCU C;  5IWA O;  3I5D A;  3ICX A;  1GH6 A;  5DN6 G;  1GM9 A;  1FS0 G;  1N32 O;  1M5I A;  1FXK A;  1S72 V;  3E8H A;  3D3Q A;  3OR7 C;  1QQC A;  5FL7 G;  5B1A B;  4U7N A;  3QF7 A;  3RVZ A;  2A06 H;  2Q0A A;  3EHB B;  4PA4 A;  1IX9 A;  3D3I A;  2NR5 A;  2HG5 C;  4QE9 A;  3A2F A;  4JAU A;  2QM7 A;  2LW1 A;  4NTW A;  4O2B B;  3HKE A;  4R8C A;  2ADQ B;  3A0R A;  2WSS G;  3ZCC A;  4B3T B;  5LXT A;  4X65 O;  1H2M A;  1M57 B;  3G71 V;  2JDI G;  2P90 A;  3OMN B;  2LO1 A;  3IGA C;  1V55 C;  4AI8 A;  2VS0 A;  3DXR A;  1RSO B;  3AG4 C;  1IBL B;  1JA8 A;  1HP8 A;  1JR9 A;  1XBL A;  4FZ0 A;  3T1C A;  4PDR A;  1BHB A;  4MTG A;  5L3G A;  3PJS K;  5JCO C;  4K8X A;  3OEH G;  3K5N A;  1OHH G;  2G38 A;  1N36 B;  4X20 B;  3ZN0 A;  1N34 B;  4IHJ A;  1LUW A;  1YZB A;  4AQY B;  2UXC O;  3ABL C;  4KP4 A;  3K58 A;  2CH7 B;  2FYU H;  1HNZ O;  5CB4 B;  4KFM A;  1WP7 A;  1K3E A;  4LF6 B;  1XDC A;  5KUK A;  3QVN A;  1YSC A;  2ZE7 A;  4JI3 B;  1GKF A;  2BSK B;  4X1K B;  3H1L H;  3LDE A;  3CRC A;  2PI4 A;  1KP3 A;  2HLD G;  2Y69 C;  3WG7 C;  3FAV A;  1OCZ C;  2DYS B;  5EC2 C;  4LP8 A;  5HFL A;  3T1H B;  3FB7 C;  2AXT Z;  2H8P C;  1VQ5 V;  4JI1 O;  4PHZ A;  4DXW A;  4JYA O;  2DYR C;  4X64 O;  2B5U A;  5CBH A;  3B77 A;  5GTI Z;  3SPI A;  5KLV H;  4LF8 B;  4B7E A;  1N33 O;  1Y6X A;  3FKS G;  1J95 A;  4UCR A;  3OMI B;  1YDX A;  1S77 D;  1XNQ O;  4LF9 B;  2Q9L A;  4GCZ A;  3CME V;  3W7W A;  3IC7 A;  3ZMT A;  3ZRW B;  2HVK C;  3R66 A;  2YXH A;  3N2K A;  1R6N A;  2EIM B;  4YJ2 B;  3T1Y O;  1S5L Z;  4FM0 A;  2YEV A;  2CDY A;  3W7U A;  4B08 A;  2DMX A;  4DV5 O;  1DK1 A;  4LF5 O;  4HAM A;  1VQL V;  4B7K A;  2EZP A;  3SPH A;  4Z2W A;  4DV4 O;  2UUB O;  1XI1 A;  2JRI A;  4KL1 A;  4LWS B;  4ZBM A;  4B3S B;  2O57 A;  2CUG A;  1XOU A;  4X20 A;  4EFB A;  4F6E A;  1I94 O;  2HFE C;  2ODM A;  2Q7G A;  2QWQ B;  2QR4 A;  4NVP A;  4LF4 O;  2ZXW C;  4IYH A;  2EIK C;  4PD4 F;  2DN9 A;  1BS3 A;  1L0L H;  4J9Y B;  2LGQ A;  5DM6 V;  3VQY A;  1S5H C;  3CCE V;  2R9I A;  4I9Q A;  2YID A;  3K0D A;  2EIL C;  3ZHU A;  5K1X A;  4X62 O;  5L3D A;  3KCX A;  2QWR B;  3ETG A;  1I5X A;  4RQE A;  5BMV A;  2LQT A;  3DC6 A;  3ASO B;  3K0G A;  2MK3 A;  2JJ2 G;  2R70 A;  5B1N A;  3W7X A;  2PYJ A;  2WLL B;  3L70 H;  1PPJ H;  1D5N A;  3JAK B;  4CC6 A;  2JGD B;  1KQS U;  2ITC C;  3HKC B;  4PV1 B;  1FAF A;  4G2K A;  2OTL V;  1HNX B;  1ENV A;  1R3L C;  2BTQ A;  4OXS A;  1EN6 A;  2Y4T A;  4GLX A;  2K9P A;  1I0H A;  4I9W A;  4FFB B;  2VWJ A;  3E8F A;  1Q81 W;  4NKG B;  4YY3 B;  2ZIM A;  1SS3 A;  4TOI A;  3B8M A;  2QGN A;  2YI9 A;  1M93 A;  5KAI Z;  3I55 V;  1NH2 B;  3DTU B;  1ARO P;  3G80 A;  5EIB D;  4J7Z A;  1KU9 A;  3D36 A;  5B1B B;  4TV9 A;  4HZ3 A;  5EK0 A;  3M99 B;  2IH3 C;  5KX5 A;  1ZL8 A;  1SC5 B;  1DF5 A;  4DR2 O;  1NTM H;  1Y67 A;  1GAX A;  1SZT A;  1BL8 A;  3CPW U;  1IXM A;  5FPR A;  1GN2 A;  5D5P A;  1IBM O;  3LNN A;  5LHI A;  3BHP A;  3SYQ A;  3IC9 A;  3OM3 B;  1W0K G;  5JQG B;  1TAE A;  2XAS A;  3W7T A;  5BY1 A;  1B06 A;  1FYJ A;  2F66 C;  3OFN G;  3OD4 A;  2ILM A;  4PA9 A;  2DJV A;  5ITZ A;  1S0V A;  4PA3 A;  1QVF U;  2F4V B;  5TIS Z;  2YC0 A;  4PDV A;  3AG3 B;  1CPY A;  1DGS A;  2P4K A;  1EM1 A;  4BIU A;  5L3F A;  1J5E O;  1L8D A;  4X1Y B;  3FX7 A;  1NZ6 A;  4JI6 B;  1EBO A;  3UT5 B;  5AG2 A;  4DR5 B;  3TXS A;  4K35 A;  1PL4 A;  1VQ6 V;  5H2F Z;  2ZQM A;  5IYD O;  2P4V A;  1ZUQ A;  1PNL A;  1LUV A;  4JZ2 A;  4P2Z A;  1Y4M A;  5L3B A;  2UU9 O;  1TVK A;  2IU3 A;  1AI6 A;  4JGS A;  2QKC A;  2P5O A;  2UXD O;  4YXW G;  4DO2 A;  4TQF A;  1SQX H;  3EFF K;  2XAF A;  3HKD B;  2UUC B;  3QO8 A;  4MTO A;  1Y76 A;  4BAY A;  3CYO A;  4AHC A;  4DR4 O;  3ABK B;  3OAA G;  2AZ0 A;  4ZI7 B;  4KUM A;  2ZIO A;  1HWY A;  3CP1 A;  4MSW C;  2MW2 B;  3VBB A;  3ZHR A;  4E4E A;  3D36 C;  3HKB B;  2NN4 A;  4MVM A;  1CEZ A;  4DV1 O;  2WLM A;  3OUF A;  4UXN A;  1H2G A;  1YF2 A;  1Z5V A;  5J2U B;  3ABM B;  4BW9 A;  5DED A;  2B9Z A;  3CMA V;  1SQV H;  4JI5 O;  1SA0 B;  2VWK A;  5K1P A;  2ZE8 A;  3G4S V;  1NT2 B;  1KKC A;  1E79 G;  3JAT B;  3A0B Z;  4UCO A;  4PDM A;  1Y74 B;  4FLT A;  4LFC B;  4G28 B;  5LGT A;  1VQ7 V;  2KG7 B;  5JVD A;  1OV9 A;  1OCC B;  2F95 B;  1Q6H A;  4N23 A;  4WCE V;  3WU2 Z;  1XMQ O;  2JS5 A;  1ROP A;  4UCS A;  1XUQ A;  4PJ0 Z;  5LMU O;  1MAB G;  1AB3 A;  3ASO C;  5CA1 A;  4DV7 B;  5IYC O;  2IJI A;  2AHZ A;  3CJH B;  2EIJ B;  3JYC A;  4CS3 A;  1KKD A;  3H1J H;  1M90 W;  2XAQ A;  3BVO A;  1JQ0 A;  5EBL C;  1DF4 A;  4U7O A;  4GX0 A;  3GB7 C;  1M4U A;  1XMO O;  2ZNI A;  2OCC B;  1H38 A;  3PN1 A;  5BXZ A;  1Q6I A;  4UB6 Z;  4CS4 A;  3RYH A;  4FM2 A;  1KC8 W;  5C8Y B;  4YHH O;  3SJQ C;  1UJW B;  3T4D A;  4I0X B;  4K8Z A;  4TUY B;  3UO3 A;  3ZRS A;  1YJ9 V;  5LBQ A;  2Q7H A;  2OIG A;  1RP3 B;  5KA6 A;  1AP5 A;  2NLJ C;  2EIN C;  1WPB A;  2QTS A;  2F43 G;  3AK2 A;  2V4D A;  2OYQ A;  4QGP A;  3OTO B;  2A0L A;  3WB1 A;  1ZWI C;  2HHH O;  2DOS A;  3AK1 A;  1FKA O;  3TK1 A;  3AG7 A;  1JPX A;  3VQX A;  1K34 A;  1IUR A;  2W6I G;  3SJB C;  2FB5 A;  3CB2 A;  1FXH A;  3JAS B;  2A7W A;  4DR7 B;  5H9C A;  2XND G;  3BPZ A;  3AG1 B;  3K06 A;  1AR1 B;  4DW0 A;  2RDC A;  3CXH F;  3CCJ V;  1O9G A;  4LC1 A;  4QPK A;  4TQD A;  5LL6 Y;  4JZG A;  1GO3 F;  1VEW A;  1JFF B;  1BZK A;  1V54 B;  3OE7 G;  3EXA A;  2YUA A;  4UUJ C;  3THO A;  4B3T O;  1AI4 A;  1NI8 A;  2RMK B;  1LR1 A;  1KD1 W;  1QNM A;  4O4I B;  2ARH A;  4F4L A;  2ZIN A;  3BRC A;  1K5Q A;  4DV0 B;  4WFE A;  1H2K A;  2YIA A;  2A9H A;  3CRQ A;  4I55 B;  2IH1 C;  3GWK C;  2KB1 A;  4O4H A;  3FD9 A;  1G8M A;  3GVM A;  4E2L A;  1N36 O;  1N34 O;  4JAS A;  2E76 B;  1TUE B;  1NVP D;  2D2C B;  3HB3 B;  3ZHT A;  2YSU B;  2M6Y A;  5CBG A;  4AQY O;  1D5A A;  3B40 A;  3CD6 V;  4D7T A;  2HP8 A;  3K5M A;  1R1B A;  5IYZ A;  4LF6 O;  4I50 A;  4ZOL B;  3ABK C;  3ZX6 A;  3JAW A;  2FL4 A;  4DR1 O;  5CA0 A;  1M9N A;  1Q5O A;  2RQ6 A;  4N21 A;  2LFS A;  1KP2 A;  2N04 A;  5LGU A;  3KZI Z;  3FYE B;  4W4K A;  3T1H O;  5FNV A;  2YDE A;  1KB9 F;  1FJG O;  1Q90 D;  4JTD B;  4TV8 A;  2PTM A;  3BAA A;  2Z0A A;  3ABM C;  2E3C A;  4H0L B;  3RYC B;  5EYP B;  4LF8 O;  4JYY A;  4JI8 B;  3RW0 A;  1KBH A;  2JEX A;  4R7C A;  2IBZ H;  3X2Q C;  1GRJ A;  4RQF A;  5BZB A;  1YIT V;  4LF9 O;  2L35 A;  3FB5 C;  3T4Z A;  5JJE B;  4K0K B;  4GUN A;  2E5L B;  2HVJ C;  1OJH A;  1W2B U;  4P9O A;  1YTF D;  1OCC C;  4PA6 A;  4BIZ A;  4FLW A;  3N2G B;  4HBN A;  3C3T A;  3TET A;  5F2V O;  3GWO A;  2AW9 A;  3E83 A;  1HNW B;  1I7F A;  3ASN B;  1VF7 A;  3JCU Z;  2Q0O C;  4NXN B;  4CH5 A;  2XHB A;  4B3S O;  1SKV A;  4JAA A;  4PEL A;  2HEP A;  1TUB A;  3B09 A;  5GTH Z;  3K03 A;  4TT3 G;  2K1E A;  3ZMS A;  4YJ3 A;  3CCV V;  3MDS A;  1MZE A;  2Y0I A;  3R65 A;  1AI7 A;  1SQQ H;  4JI4 O;  1GM7 A;  1X59 A;  1P7B A;  3CE2 A;  4L87 A;  1VQP V;  4JPR A;  4B3M B;  1IBK O;  4X8A A;  1COW G;  3E22 B;  4HNA B;  3ZBH A;  5E1A C;  1F7Y A;  1KEC A;  3U11 A;  5GON B;  1K73 W;  4BIO A;  4O2B A;  5EBW C;  1US6 A;  2V7Q G;  4RO2 A;  3JSL A;  4X65 B;  1HNX O;  1WAZ A;  5JWP A;  1KMI Z;  2Y48 A;  1ZAU A;  5A9G A;  4ZIB A;  3LNM B;  1AIL A;  5CMU A;  3Q4H B;  1X4T A;  1Z5W A;  1PV0 A;  3JAL B;  1ORQ C;  4DRX B;  1RSO A;  4H33 A;  1NS1 A;  2Q68 A;  2LGW A;  3RYI B;  4MVS A;  3AG1 C;  3C90 A;  2A3Q A;  3BY6 A;  4UVB A;  4QIW F;  5KUM A;  1MOF A;  2HR3 A;  1WJZ A;  2BE3 A;  2E75 B;  1NR7 A;  1OZ0 A;  1JMK C;  3N2G A;  1V54 C;  4NB5 A;  2ZDI A;  2CH7 A;  5CB4 A;  4DUY B;  1WA8 B;  3OT7 A;  1JX9 A;  2JJ1 G;  3ZRX A;  3WB2 A;  3E35 A;  4W4L A;  4F6R B;  2UXB O;  4FPP A;  1FD9 A;  4O2A B;  1Q82 W;  2BSK A;  4JYB A;  4X1K A;  4DR6 B;  1M56 B;  5IYB O;  4CC5 A;  2V1D A;  5EBM C;  3OGI B;  4BR6 A;  4A5U B;  3JAR B;  4JI1 B;  4PI0 A;  2F4V O;  3QNE A;  4MVZ A;  3BEH A;  3IFX A;  3T2M A;  1VQN V;  2XAH A;  4AIL C;  4R6Z A;  4IYI A;  3OW2 U;  1YXB A;  2X6B A;  2JIZ G;  1N33 B;  5KHI A;  3FB6 C;  5IY5 C;  3LDD A;  1AJN A;  5JH7 B;  2AGA A;  2VQE B;  4JI6 O;  1MSD A;  2OWO A;  2CAZ C;  1A32 A;  4JV5 B;  5B66 Z;  4DW1 A;  3A8T A;  3OGC C;  3ETQ A;  1THZ A;  1VQO V;  2X6C A;  4OGQ B;  5B1A C;  3TCU A;  3ZRW A;  4H13 B;  3JSN A;  3MD0 A;  1H2S B;  1Z2G A;  3S3W A;  1LNQ A;  4YJ2 A;  4O4L B;  1K5S A;  2GDS A;  1YJW V;  3W7S A;  2CTW A;  5LYJ B;  4DV4 B;  2UUB B;  3QTC A;  1SQF A;  4G27 B;  4LWS A;  4MW3 A;  1M57 C;  3B4S A;  4UCT A;  2UUC O;  3VQV A;  4I7Z B;  1WB8 A;  1QR8 A;  4LF4 B;  5LOV B;  5FPO A;  2ZE5 A;  3BA8 A;  1H8H G;  1NJI W;  2H94 A;  2Q73 A;  3I56 V;  2HJF C;  1ZLZ A;  2Z3Y A;  2N74 A;  4PDL A;  4O2A A;  5KAF Z;  3F5T A;  4EB6 B;  2VQF O;  4X62 B;  2M7W A;  2ZDI C;  2Z5U A;  4I4T B;  1WP8 A;  4C7U A;  4IIJ B;  1CXZ B;  4OX9 B;  4QE7 A;  4DV2 O;  2W0X A;  2WLL A;  2UUA O;  1OCR B;  4JTA B;  3JAK A;  3SJC C;  4WBN B;  2JGD A;  4FIP C;  5IJ0 B;  1Q86 W;  5H5N A;  3HKC A;  4U3J B;  2ZKO A;  3CC2 V;  2BOC C;  2LFR A;  2YXY A;  3N27 A;  4JYC A;  3OMA B;  3ABU A;  4QJF B;  1N0N A;  2DYS C;  4FFB A;  2PYL A;  4LFC O;  1K8A W;  4ZKI A;  1B6Q A;  1VF6 C;  2IJJ A;  1N8R W;  5B3S B;  2Q69 A;  1Q7Y W;  4H44 B;  3IJ4 A;  3ML0 A;  1R3K C;  2HKO A;  1HW7 A;  3D8C A;  3CC7 V;  2AZ2 A;  4J7J A;  4GKJ O;  1SET A;  3K3W A;  3L75 H;  2GBO A;  4CH3 A;  2D3O W;  2EJR A;  4WFH A;  3G6E V;  3CCL V;  2YI8 A;  4NTX A;  3SJA C;  1I5Y A;  1GM8 A;  3LSS A;  4OPH A;  3RYF B;  1S76 D;  1TA8 A;  4DR2 B;  5IE9 A;  1F4M A;  5LP6 B;  3RBZ A;  4NXM O;  1N0J A;  3E86 A;  5IDJ A;  2QDO A;  3AK3 A;  5J2T B;  2Y0P A;  1AVM A;  4WFG A;  2QWO B;  1IBM B;  3CWB H;  4P30 A;  4J42 A;  1GN6 A;  2EIM C;  3CCS V;  1IDS A;  4X1I B;  2XT9 A;  2CTP A;  2ZM6 B;  1CP9 A;  5JQG A;  4B3R O;  2FTK A;  1H2N A;  2YIB A;  5KA5 A;  4XBF A;  2BTO A;  2JGU A;  1GK9 A;  3JD1 A;  2EUL A;  1DLB A;  5IT9 N;  2FML A;  1YHQ V;  3FB8 C;  1JVM A;  1YJN V;  1KYO F;  4NR1 A;  4X66 B;  3H01 A;  4J80 A;  1V9P A;  2GUZ B;  3L71 H;  4PA7 A;  4MTF A;  1QCE A;  1NBM G;  4X1Y A;  3OTO O;  2OTJ V;  3LUT B;  3UT5 A;  4CS2 A;  2QJ1 A;  5KHH A;  4L8J A;  1YI2 V;  1V55 B;  3K9S A;  4DUZ B;  1FFX B;  4XDL A;  4WFF A;  3AG4 B;  4BW5 A;  2PI5 A;  4DR7 O;  2QTO A;  2UU9 B;  5LA6 B;  2WLI B;  4P9P A;  4ZHQ B;  2WLH A;  1SRY A;  3L73 H;  4DYL A;  2WA4 A;  1NVP B;  5KMG B;  1K97 A;  1EN5 A;  3S3X A;  2ETN A;  3UQ8 A;  3P3P A;  3SYA A;  3RFR A;  1B3Q A;  4LFA B;  4YIP A;  1UFI A;  4JI7 B;  3ABL B;  3HKD A;  1HR0 O;  1WNS A;  3MHH C;  3SDL A;  3CCU V;  5EZY B;  3J7A U;  4DR4 B;  1PD3 A;  4UVC A;  1SER A;  4ZI7 A;  1F51 A;  4DV0 O;  4D6T H;  2QWN B;  2Y69 B;  3WG7 B;  3HR0 A;  5B1B C;  2GV9 A;  3CHX A;  1EZJ A;  1RPO A;  4DR3 B;  3H1H H;  1G4Y B;  3HKB A;  4DV1 B;  4R50 A;  3ZN1 A;  5LMN O;  2DYR B;  4O4J B;  1K4C C;  2OCH A;  3JD2 A;  1XEQ A;  2Q6A A;  1AP6 A;  4X89 A;  5J2U A;  2YS8 A;  1SA0 A;  2ATK C;  2YIC A;  2CGO A;  1FXK B;  4FVM A;  3ZRV A;  3ZHQ A;  4XDJ A;  3JAT A;  1Y74 A;  3OEE G;  5L3E A;  3L74 H;  1YTF B;  4GX5 A;  1VIB A;  1ZX3 A;  4LFB B;  1IVS A;  3RWR D;  1JCH A;  3BAB A;  2KG7 A;  4LNU B;  1P4R A;  3AG3 C;  1XRE A;  1M1K W;  3HKE B;  4FMT A;  3APQ A;  1XMQ B;  1R3J C;  5LXT B;  4RUE A;  3CX5 F;  5H6Q A;  5LMU B;  4LR3 A;  5DEC A;  5LHG A;  4JI8 O;  3QG5 A;  4J11 A;  1NTK H;  3CJH A;  2UXX A;  3DXR B;  4CBC A;  4JI0 B;  2EIK B;  1IBL O;  4UFZ A;  4K0K O;  1XMO B;  4KHP B;  2QM4 A;  2E5L O;  1NU1 H;  3ZMZ A;  3RN4 A;  1JJ2 U;  5B3S C;  4LF7 B;  4NTY A;  1QR9 A;  2CTQ A;  4OPA A;  4IHJ B;  2EIL B;  4YHH B;  1YEW A;  5GW7 A;  4DV6 B;  5C8Y A;  4I0X A;  4TUY A;  1BCC H;  3NXS A;  1HNW O;  2PZS A;  5A2Q N;  1YVW A;  4EFE A;  4NXN O;  1PNM A;  2JS3 A;  3K5L A;  2ZR3 A;  1F23 A;  5JJJ B;  1EZV H;  5KHK A;  4JI3 O;  2OT5 A;  3DC5 A;  3ZHS A;  2HHH B;  1BE3 H;  3FAV B;  3TJT A;  2GHY A;  4JI2 B;  1XHZ A;  3JD0 A;  3ZMV A;  1I08 A;  3U0Z A;  4QPJ A;  2EX3 A;  3UM7 A;  3JAS A;  1JJO A;  3K5O A;  2R72 A;  1FXV A;  4GKK B;  3F5W C;  1QHT A;  1VMG A;  1IXB A;  3K79 A;  4K3A A;  4B3M O;  4MVO A;  5BR8 B;  4ICG A;  3UKM A;  1RM1 B;  2WWW A;  4PI2 A;  1GN4 A;  4LNU A;  3G6B A;  5H6R A;  1JFF A;  2CTR A;  2JK5 C;  2R9A A;  4GX2 A;  5E79 Z;  2DWE C;  5B1O A;  1GTO A;  1GMG A;  4O4I A;  3N2K B;  3LSU A;  2E74 B;  1Y66 A;  3P32 A;  2P7T C;  1XNR B;  2YEV B;  1XQ8 A;  2QKA A;  2Q7E A;  3K9A A;  4FLU A;  3JAM N;  3H1K H;  4MW8 A;  2P22 C;  4I55 A;  1WB7 A;  2WPD G;  4MT8 A;  4HYO A;  3WFV A;  2WA3 A;  2Q4P A;  4DV3 B;  1PM9 A;  3WB0 A;  3CSX A;  2EIJ C;  2IM9 A;  1XIL A;  2PF4 E;  2RJZ A;  1NKD A;  1R6K A;  3QO7 A;  3A0H Z;  5IWA B;  2L6L A;  4DUY O;  1N32 B;  2OCC C;  5KHG A;  3H1I H;  2Y4U A;  1VQ9 V;  1MSW D;  4ZOL A;  1EFR G;  1Q6U A;  4DR1 B;  4CH6 A;  3ABT A;  2QM8 A;  3CXC U;  4DR6 O;  1QU7 A;  4WF9 V;  1OCO B;  1MNG A;  1TGO A;  4DK0 A;  3FYI B;  5BMV B;  3AG2 B;  3CC4 V;  1FPO A;  1MA1 A;  3IAY A;  4FM1 A;  1FJG B;  4IGG A;  3OUS A;  3SGI A;  2IW5 A;  1G1X B;  2BTQ B;  3RYC A;  3STL C;  5EYP A;  3BA9 A;  3M8A A;  1WPX A;  2A79 B;  3CCM V;  3ZED A;  1MMM A;  2VQE O;  2XAG A;  4X88 A;  1FXK C;  3LDC A;  4IL6 Z;  3SR2 C;  4YY3 O;  4JV5 O;  2PY5 A;  4JTC B;  3E89 A;  3CEI A;  3SYC A;  3L72 H;  4FLY A;  3ETE A;  2QSA A;  3P3N A;  1VAR A;  3RVY A;  4TV9 B;  3RT3 C;  2EZO A;  2F23 A;  4FK5 C;  4I5S A;  1K7D A;  5KX5 B;  3K04 A;  5C93 A;  1ZL8 B;  2P6J A;  1VF5 B;  2UXC B;  1YIJ V;  1HNZ B;  2DE0 X;  2KSD A;  2WLJ A;  1MG1 A;  3JD4 A;  3RGB A;  3H9V A;  1NQT A;  4Z1V A;  3DGE A;  4Q6G A;  1HDJ A;  2JVD A;  3CRA A;  5ITZ B;  5J9P C;  1F4N A;  2ZD9 A;  1VF6 A;  1QLE B;  2Q8V A;  1IZ3 A;  1G6U A;  4JYA B;  2PUS A;  4JI4 B;  2B1G A;  4X64 B;  3AEI A;  1Q8I A;  1IBK B;  2CK3 G;  1E1R G;  2BOB C;  1ZSP A;  2ZE6 A;  4UB8 Z;  4MVR A;  1H8E G;  2F1M A;  1BSM A;  3E22 A;  4HNA A;  3SYO A;  1QVG U;  5GON A;  4OX9 O;  1XNQ B;  5IJ9 B;  4DR5 O;  1S3J A;  3SPC A;  4ASU G;  5FLX N;  4U3F H;  1U96 A;  3L9D A;  3M7M X;  3B8N A;  1S5J A;  1TVK B;  2X0L A;  2EJ7 A;  3T1Y B;  3Q4H A;  2RNB A;  2XOK G;  1RFY A;  3JAL A;  4DV5 B;  4DRX A;  2CE4 A;  4LF5 B;  3RYI A;  1VP7 A;  3ZS8 C;  4GX1 A;  2GSM B;  1Y76 B;  2IU0 A;  2F93 B;  2W0F C;  1I94 B;  1SZX A;  1N4C A;  1RM1 C;  2EIN B;  1ZTE A;  4WFB V;  3APO A;  1W0J G;  2ZT9 B;  1B04 A;  1L1F A;  1WA8 A;  2QE7 G;  2ZCE A;  4EKW A;  2UXB B;  2P06 A;  2IJK A;  4F6R A;  1P84 F;  4WFA V;  2ZM6 O;  3FFQ A;  1BHA A;  1U97 A;  4RWU A;  1Q3E A;  4TWK A;  3CRM A;  2R9R B;  4FJC C;  2FKX A;  4CH4 A;  3ASN C;  4FLX A;  3U10 A;  2YXL A;  4LBE C;  3JAR A;  4X66 O;  3SPG A;  1QBZ A;  5CBF A;  3O65 A;  4MS2 A;  2ITD C;  3NR7 A;  1L0N H;  1SES A;  1W59 A;  3KG2 A;  4CZZ A;  3ZHV A;  3K59 A;  1KUQ A;  3SPJ A;  1BQZ A;  5JH7 A;  2DQ0 A;  1SQP H;  3BFR A;  1QLN A;  5IJ9 A;  5JVD B;  4LH6 A;  5EIB C;  4JF3 A;  1MZF A;  4DUZ O;  4XDK A;  1WN7 A;  4TSF G;  3P30 A;  1OCO C;  5LGN A;  4KXR A;  4YIO A;  1VQ4 V;  3MAQ A;  1PNK A;  2N05 A;  3AG2 C;  3UO2 A;  5CA1 B;  4DV7 O;  4O4L A;  2XTA A;  4GZR B;  1DTO A;  2JEU A;  1AR4 A;  1RPR A;  2DW4 A;  4LFA O;  5LYJ A;  3J81 N;  3F7V C;  4UV9 A;  4JI7 O;  3CS5 A;  3B2E E;  3JD3 A;  3ZMU A;  2QA4 V;  2OIE A;  2QWP B;  2WLN A;  2ZR2 A;  1JOY A;  3EVK A;  4NYK A;  3RYH B;  5LOV A;  3J80 N;  1NTZ H;  3UCS C;  4FFK A;  4MVU A;  1SQG A;  2DWD C;  2Q5Z A;  4GT1 A;  1NH2 D;  5JJN B;  1D2D A;  4DR3 O;  1AR5 A; 
#chains in the Genus database with same CATH homology
 3I55 V;  1NH2 B;  3DTU B;  2IJH A;  5L3C A;  1ARO P;  2QKS A;  3R65 A;  3ZJZ A;  3D36 A;  5B1B B;  1AI7 A;  2UXX A;  4HZ3 A;  1GM7 A;  4CBC A;  1P7B A;  5EK0 A;  1BMF G;  3CCR V;  3M99 B;  2EIK B;  4L87 A;  2IH3 C;  1VQP V;  4Q20 A;  4JPR A;  4X8A A;  1DF5 A;  1COW G;  3ZMZ A;  3X2Q B;  1JJ2 U;  5B3S C;  1SZT A;  5E1A C;  1KEC A;  1M56 C;  1QR9 A;  1BL8 A;  1K73 W;  3CPW U;  1IXM A;  2EIL B;  1K4D C;  5GW7 A;  5LHI A;  3SYQ A;  5EBW C;  3OM3 B;  3SYP A;  1W0K G;  1QLE C;  2V7Q G;  4RO2 A;  2XAS A;  3NXS A;  1WLE A;  3W7T A;  3OFN G;  2Y48 A;  1PNM A;  2ZR3 A;  1F23 A;  4PA9 A;  1S0V A;  3LNM B;  2OT5 A;  5CMU A;  4PA3 A;  1QVF U;  1AJQ A;  1AI5 A;  2DQ3 A;  1VQK V;  1PKX A;  4MTX A;  1ORQ C;  4PDV A;  4H33 A;  3AG3 B;  4UV8 A;  2Q68 A;  2GHY A;  2X6A A;  1CPY A;  1K9M W;  4BIU A;  4MVS A;  5L3F A;  3AG1 C;  3JD0 A;  3ZMV A;  5LHH A;  4QPJ A;  1FFT B;  3BY6 A;  3JCZ A;  4UVB A;  4QIW F;  5KUM A;  1VQM V;  1MOF A;  3LSQ A;  3UM7 A;  3E8G A;  4JAV A;  1EBO A;  1FXV A;  3F5W C;  2HR3 A;  3VOU A;  1OCZ B;  1NR7 A;  1OZ0 A;  3K79 A;  2WAM A;  1AJP A;  1VQ6 V;  1V54 C;  2ZDI A;  2ZQM A;  4MVO A;  5IYD O;  1PNL A;  3UKM A;  1RM1 B;  4P2Z A;  1JX9 A;  1Y4M A;  2WWW A;  2JJ1 G;  3ZIA G;  5L3B A;  3ZRX A;  3STZ C;  3K08 A;  3E35 A;  2IU3 A;  5H6R A;  4FPP A;  1AI6 A;  1Q82 W;  2JK5 C;  4JYB A;  4GX2 A;  4H37 A;  1VQ8 V;  4JGS A;  1M56 B;  5IYB O;  2DWE C;  2V1D A;  5B1O A;  4YXW G;  4DO2 A;  1GTO A;  5EBM C;  1GMG A;  1XL6 A;  2EBO A;  2UXN A;  3EFF K;  1E1Q G;  2XAF A;  1Y66 A;  3HPL C;  2P7T C;  3P32 A;  4J9Z B;  2YEV B;  3QO8 A;  4MTO A;  2QEX V;  1XL4 A;  3QNE A;  1K33 A;  3E8B A;  3K9A A;  4MVZ A;  4BAY A;  3BEH A;  3CYO A;  3ETD A;  3IFX A;  3T2M A;  4QNH B;  1VQN V;  2XAH A;  4R6Z A;  4MW8 A;  2X6B A;  3OW2 U;  2Q67 A;  3ABK B;  3OAA G;  2JIZ G;  3E2E A;  2WPD G;  4MT8 A;  1NR1 A;  4HYO A;  4KUM A;  3WFV A;  1HWY A;  1PL0 A;  3FB6 C;  5IY5 C;  3CP1 A;  3LDD A;  4MSW C;  2LP7 A;  1AJN A;  2C2A A;  3VBB A;  4MVQ A;  2EIJ C;  3QO5 A;  2WLI A;  3OGC C;  4MVM A;  1CEZ A;  1NKD A;  1R6K A;  1THZ A;  3QO7 A;  2NNU A;  2X6C A;  1VQO V;  2WLM A;  3OUF A;  4UXN A;  5B1A C;  1H2G A;  3TCU A;  3ZRW A;  1OCR C;  2OCC C;  2WLK A;  1K92 A;  3ABM B;  1VQ9 V;  1MSW D;  3MD0 A;  1R73 A;  1LNQ A;  2ZXW B;  1EFR G;  4RAI A;  3CMA V;  3ABT A;  2QM8 A;  3CXC U;  5CA3 A;  1K5S A;  4WF9 V;  1YJW V;  1OCO B;  3W7S A;  2XAJ A;  3FYI B;  3G4S V;  3AG2 B;  3CC4 V;  1E79 G;  4G27 B;  3CCQ V;  4PDM A;  4MW3 A;  4Z1M G;  1M57 C;  2P67 A;  2AHY A;  5CN0 A;  3OUS A;  4G28 B;  5EC1 C;  5LGT A;  1VQ7 V;  2IW5 A;  1R3I C;  3OR6 C;  4UVA A;  3MHS C;  1QR8 A;  3STL C;  1OCC B;  1WPX A;  2A79 B;  5HFM A;  3CCM V;  4N23 A;  4WCE V;  2B1I A;  2X7R B;  1H8H G;  2XAG A;  1NJI W;  2H94 A;  3I56 V;  4X88 A;  1ROP A;  1FXK C;  3LDC A;  2HJF C;  1MAB G;  2Z3Y A;  4PDL A;  4RUF A;  3F7Y C;  3ASO C;  3E89 A;  4JTC B;  5IY5 B;  2W6J G;  4LCU C;  3SYC A;  3ETE A;  5IYC O;  2IJI A;  2AHZ A;  2M7W A;  5DN6 G;  1GM9 A;  1FS0 G;  2EIJ B;  3RVY A;  3JYC A;  1KKD A;  2ZDI C;  1FXK A;  1M90 W;  1S72 V;  2Z5U A;  2XAQ A;  3E8H A;  2EZO A;  1JQ0 A;  3OR7 C;  5EBL C;  4FK5 C;  4I5S A;  1DF4 A;  4U7O A;  4GX0 A;  3GB7 C;  1K7D A;  5FL7 G;  5B1A B;  4QE7 A;  4U7N A;  3K04 A;  3RVZ A;  5C93 A;  2WLL A;  2P6J A;  3EHB B;  1OCR B;  2OCC B;  4JTA B;  1H38 A;  4PA4 A;  4FIP C;  3D3I A;  1Q86 W;  1YIJ V;  2HG5 C;  4QE9 A;  4JAU A;  1KC8 W;  3CC2 V;  2QM7 A;  2BOC C;  2LFR A;  3SJQ C;  1UJW B;  2WLJ A;  4JYC A;  3OMA B;  1MG1 A;  3ABU A;  4QJF B;  2DYS C;  4R8C A;  3T4D A;  1K8A W;  4ZKI A;  1B6Q A;  3JD4 A;  2IJJ A;  1N8R W;  5B3S B;  2Q69 A;  3A0R A;  2WSS G;  3ZCC A;  3ZRS A;  1YJ9 V;  1Q7Y W;  1NQT A;  5LBQ A;  3DGE A;  1M57 B;  3ML0 A;  5KA6 A;  1R3K C;  2NLJ C;  2HKO A;  2EIN C;  3G71 V;  3CC7 V;  2JDI G;  2P90 A;  5J9P C;  1F4N A;  1SET A;  3K3W A;  2ZD9 A;  3OMN B;  1QLE B;  2D3O W;  2F43 G;  3IGA C;  1V55 C;  2EJR A;  4WFH A;  3G6E V;  2A0L A;  2B1G A;  3CCL V;  1ZWI C;  3AG4 C;  1I5Y A;  1GM8 A;  3LSS A;  1S76 D;  1BHB A;  3T1C A;  3TK1 A;  4PDR A;  3AEI A;  4MTG A;  2CK3 G;  1E1R G;  1JPX A;  2BOB C;  5L3G A;  3PJS K;  1F4M A;  1K34 A;  2W6I G;  4MVR A;  3RBZ A;  1H8E G;  3OEH G;  3E86 A;  1FXH A;  3SYO A;  1OHH G;  5IDJ A;  1QVG U;  3ZN0 A;  5H9C A;  2XND G;  4WFG A;  3AG1 B;  3K06 A;  1S3J A;  4P30 A;  3SPC A;  3CCS V;  2EIM C;  1AR1 B;  1CP9 A;  3ABL C;  4KP4 A;  4ASU G;  2FTK A;  5KA5 A;  4KFM A;  3CCJ V;  1K3E A;  3B8N A;  4XBF A;  4LC1 A;  1GK9 A;  3JD1 A;  4QPK A;  5KUK A;  1DLB A;  1GO3 F;  2X0L A;  1YSC A;  1YHQ V;  1GKF A;  1V54 B;  3FB8 C;  3OE7 G;  4UUJ C;  2XOK G;  1JVM A;  1YJN V;  3LDE A;  3H01 A;  1AI4 A;  2PI4 A;  1KD1 W;  1KP3 A;  2HLD G;  2Y69 C;  3WG7 C;  1OCZ C;  2DYS B;  5EC2 C;  4LP8 A;  4PA7 A;  4F4L A;  4MTF A;  5HFL A;  1QCE A;  4GX1 A;  2GSM B;  3FB7 C;  2H8P C;  1VQ5 V;  1NBM G;  4DXW A;  1K5Q A;  2DYR C;  4WFE A;  2OTJ V;  2A9H A;  2IU0 A;  3LUT B;  2W0F C;  2B5U A;  5CBH A;  1RM1 C;  2EIN B;  3B77 A;  2IH1 C;  3SPI A;  2KB1 A;  4WFB V;  1W0J G;  1YI2 V;  1G8M A;  1V55 B;  4E2L A;  3FKS G;  4XDL A;  4WFF A;  3AG4 B;  1J95 A;  4BW5 A;  2PI5 A;  1L1F A;  4JAS A;  2QTO A;  1TUE B;  1NVP D;  2QE7 G;  3HB3 B;  3OMI B;  4EKW A;  1S77 D;  2WLI B;  4P9P A;  2WLH A;  2IJK A;  2YSU B;  1SRY A;  5CBG A;  4WFA V;  4GCZ A;  3CME V;  3W7W A;  1NVP B;  3CD6 V;  3IC7 A;  1K97 A;  3ZMT A;  1BHA A;  3ZRW B;  3SYA A;  4TWK A;  2HVK C;  2R9R B;  4FJC C;  3ABK C;  3ASN C;  1R6N A;  2EIM B;  4LBE C;  3ABL B;  2YEV A;  3MHH C;  1M9N A;  3SPG A;  3W7U A;  1QBZ A;  5CBF A;  4MS2 A;  4HAM A;  1VQL V;  2ITD C;  4N21 A;  2EZP A;  1KP2 A;  2LFS A;  3SPH A;  3CCU V;  1SES A;  1PD3 A;  3KG2 A;  5LGU A;  4UVC A;  4CZZ A;  4ZBM A;  1SER A;  3FYE B;  1F51 A;  3SPJ A;  4JTD B;  2DQ0 A;  2HFE C;  2Y69 B;  3WG7 B;  5B1B C;  3ABM C;  1EZJ A;  1RPO A;  1QLN A;  1G4Y B;  4R50 A;  4JF3 A;  2ZXW C;  3RW0 A;  2JEX A;  3ZN1 A;  2EIK C;  2DYR B;  4XDK A;  4TSF G;  4J9Y B;  3P30 A;  1K4C C;  5DM6 V;  1OCO C;  3JD2 A;  5LGN A;  2Q6A A;  1VQ4 V;  1S5H C;  4R7C A;  4X89 A;  1PNK A;  3X2Q C;  3AG2 C;  3CCE V;  4RQF A;  2R9I A;  5BZB A;  1YIT V;  3K0D A;  3FB5 C;  3T4Z A;  2EIL C;  2ATK C;  1DTO A;  2JEU A;  5L3D A;  2HVJ C;  1RPR A;  2DW4 A;  1FXK B;  3ETG A;  1W2B U;  1I5X A;  4P9O A;  4RQE A;  3ZRV A;  4XDJ A;  1YTF D;  3ASO B;  3K0G A;  3F7V C;  4UV9 A;  2MK3 A;  3OEE G;  2JJ2 G;  5L3E A;  1OCC C;  5B1N A;  4PA6 A;  4BIZ A;  3W7X A;  2WLL B;  3JD3 A;  3ZMU A;  1YTF B;  4GX5 A;  2QA4 V;  1KQS U;  3TET A;  2ITC C;  3GWO A;  4G2K A;  2WLN A;  2ZR2 A;  2OTL V;  1JOY A;  3E83 A;  1ENV A;  3ASN B;  1R3L C;  1JCH A;  4OXS A;  1P4R A;  3AG3 C;  1M1K W;  4MVU A;  4I9W A;  4FMT A;  4PEL A;  2DWD C;  1R3J C;  4GT1 A;  3K03 A;  3E8F A;  2K1E A;  4TT3 G;  1NH2 D;  1Q81 W;  4RUE A;  5H6Q A;  3ZMS A;  3CCV V;  3B8M A;  5LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...