4WFHA

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfhA00
1OCCC 3F7YC 4MTGA 1P7BA 2WLIB 4P2ZA 4P30A 3SPCA 1XL6A 3ABMC 3ABKC 3PJSK 4MW8A 5EC2C 2X6BA 3R65A 5B1BC 1V54C 2ATKC 2KB1A 3SPGA 3OUSA 3SYQA 4H33A 4WFEA 1R3JC 3OGCC 3FB5C 5E1AC 2A0LA 3SPHA 4PA3A 5EK0A 1OCRC 2A79B 3AG1C 3UKMA 1LNQA 4F4LA 3TETA 5IY5C 3LDCA 5CBFA 4LBEC 1R3LC 3FB7C 4XDLA 2EIJC 4PDVA 2H8PC 2WLMA 3E8BA 3E8FA 3OR7C 2BOCC 1J95A 4MTOA 4WFGA 1BL8A 4J9YB 4RAIA 3UM7A 3FB8C 1R3IC 3VOUA 4R50A 2Q69A 3GB7C 4QE9A 2R9RB 5EBWC 2IH1C 5EBMC 2JK5C 5B1AC 2DWEC 2HFEC 1ORQC 2QKSA 3LNMB 2WLJA 2WLNA 2ZXWC 3SYPA 3RW0A 2WLLB 4PDLA 2ITDC 2OCCC 1M56C 1V55C 3K06A 4HZ3A 4MVZA 4RUFA 3STLC 5KUKA 3SPJA 2BOBC 1QLEC 3K03A 4LCUC 4DXWA 3RVYA 3BEHA 1M57C 4JTCB 4UUJC 3SYAA 1OCOC 3FB6C 2DYSC 2A9HA 3HPLC 2K1EA 4PA4A 3KG2A 4ZBMA 2QTOA 1K4CC 4GX5A 4H37A 2DWDC 4G27B 3LDEA 4MTFA 4WFFA 5J9PC 3IGAC 4MSWC 4X89A 4PDMA 3OUFA 2EIMC 3LUTB 3AG4C 1JVMA 4MVSA 3ASOC 3SYCA 5BZBA 3E83A 3E86A 3K0GA 4CBCA 4LP8A 3ZRSA 4MVMA 1XL4A 2X6AA 4PA6A 4XDKA 4RUEA 4PDRA 4RO2A 4BW5A 2Q68A 3K04A 2ITCC 2WLKA 2WLIA 3T4DA 2Q6AA 3K08A 4J9ZB 3SJQC 5KUMA 3X2QC 1KKDA 1K4DC 2AHYA 3F5WC 4P9OA 4JTDB 3SPIA 1G4YB 3E8GA 5CBGA 2X6CA 3T2MA 4PA7A 3STZC 3SYOA 3ASNC 4HYOA 2HJFC 3AG2C 2HG5C 2EILC 4I9WA 4R6ZA 3RBZA 1R3KC 4KFMA 3TCUA 2EIKC 4EKWA 2WLHA 4R8CA 4MVQA 3T1CA 2DYRC 3K0DA 4JTAB 4X88A 3RVZA 4X8AA 2HVJC 4P9PA 3WG7C 2EINC 3F7VC 4MS2A 4QNHB 3E89A 4PA9A 2ZD9A 1ZWIC 4G28B 3EFFK 5EBLC 3OR6C 4MW3A 3LDDA 4WFHA 1OCZC 1S5HC 2NLJC 2W0FC 2Y69C 2HVKC 4OXSA 2P7TC 4GX1A 4MVUA 3JYCA 5CBHA 4XDJA 4MVOA 2AHZA 5EC1C 4R7CA 2Q67A 3E8HA 2WLLA 4MVRA 4QE7A 2IH3C 3AG3C 4TWKA 3ZJZA 3IFXA 5B3SC 3ABLC 3T4ZA 4GX2A 2YEVA 4GX0A
chains in the Genus database with same CATH superfamily
1FXKC 5LGUA 3CMAV 1I08A 4H33A 1VMGA 1M93A 5LXTB 3CCQV 5B1AB 4JPRA 1K5QA 3FKSG 1DF5A 4EFBA 1K5SA 2D3OW 1Q6UA 4WBNA 2DW4A 1YTFB 2QR4A 3FYIB 1NVPB 2GTSA 2EIJB 2N74A 1B06A 4GKJO 2VQEB 1SC5B 2OT5A 3EXAA 4JV5O 2HHHB 4FZ1A 1O9HA 2FMLA 5KHKA 4NXMB 1HWYA 2UUAB 1QLEB 2IJJA 4I9QA 1VQ4V 1QNMA 2XTAA 4O4JB 5LHGA 5GTIZ 1R1BA 4Z1VA 3G6EV 3ZHVA 3CXCU 2B5UA 3K0GA 5DECA 1S76D 1LUVA 1CEZA 2F66C 3ZRVA 4DUYB 4DUZB 2H3OA 1RSOA 3TK1A 2VS0A 5KAIZ 1Y66A 2YIDA 1BSMA 1G4YB 4LH6A 2A3QA 1CP9A 1N34B 1R3KC 2WLHA 3HKCA 1JFFB 4KUMA 4MVQA 2B1GA 1EM1A 4JYBA 1NZ6A 5EYPB 2QM8A 1YJWV 4DR2B 3OR6C 5A2QN 2JEUA 5EIBC 4W4KA 1VQ6V 3CJHB 3HB3B 2M6YA 2QWRB 4YXWG 2R9AA 2F4VO 1HP8A 5EZYA 1N33O 5LMNB 3L74H 4GX0A 4J11A 3AG3B 3SPCA 4EB6B 2CK3G 3SPGA 1R3JC 2Y4UA 3OGCC 4DRXA 2UUCO 5L3GA 2CTWA 1ZTEA 2E5LO 4Q6GA 5KAFZ 1FXVA 4NTYA 3OEEG 1GM9A 4B3TO 1HNZB 4DV2B 4ZHQA 4ZOLB 2JS5A 4DR6B 3HKEA 2ODMA 3CC4V 3S3XA 3A0BZ 3GVMA 3RW0A 2EZPA 5L3FA 4KP4A 1V55C 3JCZA 3T1YB 5CB4B 4LNUA 5FPOA 2ZDIA 2F93B 1COWG 4JI5B 3AEIA 1VQ5V 2IM9A 1SS3A 1SESA 3AK1A 2ZE6A 5BZBA 2LJ2A 1U96A 3E86A 1Q86W 4PA6A 4JI0B 3LNNA 1AJQA 4UFZA 2RCVA 4ZKIA 1QR9A 2BTQA 3SJQC 5H9CA 4JI4O 5K1XA 3G71V 2AHYA 3SPIA 5GTHZ 4B3MO 5KX5A 2X6CA 4DV6O 3AG2C 3VQYA 1GRJA 4I9WA 1WPBA 1IBMB 1HDJA 4ZI7B 3SJCC 3N2KB 2V4DA 1IXBA 3CYOA 3H1KH 2YI9A 1WPXA 3JASA 3CC7V 4WFHA 2HVKC 4OPHA 1VIBA 4ZIBA 3ZMVA 3AG1B 1WA8A 1XREA 5LP6B 3O65A 3JD2A 4JI1B 2VWJA 3K5MA 1SA0B 3NXSA 4MTGA 3JAMN 3CCVV 2VWKA 1PKXA 4IYIA 5KHJA 2VQEO 1Y76B 1MNGA 5KHGA 1AI5A 2HHHO 3FD9A 1WN7A 2RNBA 3E8FA 4YY3B 4O4HB 2UUAO 2JJ1G 3ETGA 3FB8C 2A7WA 4DW0A 3EHBB 4K0KB 4JI3B 1IX9A 2YSUB 3OMNB 4TT3G 2KG7A 5C8YA 4O4JA 1VQ7V 2L35A 3K03A 1AP6A 4JTCB 2ZE7A 4NXNB 4ZBMA 4D6TH 4G27B 1G1XB 1N34O 1NKDA 4FVMA 5KA6A 4MVSA 4AQYB 2YICA 5ITZA 2GDSA 4DV7B 4IT5A 4TUYA 2WAMA 1WAZA 4XBFA 3OE7G 3SJBC 4BAYA 2XASA 1JFFA 2QA4V 2X7RB 3ZHTA 4JI2B 3MHHC 2LW1A 5LMNO 4KFMA 4PJ0Z 4X9QA 1I94O 4J7ZA 2DOSA 1IBKO 1YJ9V 2M7WA 2F95B 2HVJC 4P9PA 2EINC 4QNHB 1XBLA 1WLEA 2ZD9A 1XI1A 3K9SA 4JAVA 5EBLC 2KQXA 3J7AU 4EB6A 2WLLA 5B3SC 1ZAUA 4LF4B 2GUZA 5IYDO 4DV2O 3F7YC 1P7BA 1R73A 3JSNA 1X59A 3OUSA 3SYQA 4IHJB 2L6LA 1PNKA 4ZOLA 3C3SA 1YSCA 2OYQA 2LW7A 5LHHA 4X1KB 5BMVB 3T1YO 1PM9A 4BWAA 4PDVA 3QO8A 1H2KA 4JI5O 3NR7A 1ZUQA 5CB4A 1E79G 1CPYA 3CRCA 3I5DA 3SYPA 4YJ3A 3CWBH 5DEDA 1YF2A 1BGYH 1M56C 3OEHG 3H1HH 3G6BA 4RUFA 3STLC 3H9VA 2RJZA 2BOBC 1UPGA 3CCEV 1FPOA 4EEQA 2O57A 2A9HA 1VQMV 3B09A 4WFFA 2MW2B 1GN3A 4GT1A 4X65B 3SYCA 4CH6A 1EZVH 2Q73A 3OTOO 3K79A 2XUMA 1Y74B 3DTUB 3I56V 1PPJH 2Q6AA 2OIEA 4GYCB 3X2QC 4ZI7A 2IBZH 3N2KA 1BCCH 3F5WC 2QWOB 4DV4B 1QHTA 1JPXA 3T1HB 1UFIA 3STZC 2FYUH 1PV0A 3SYOA 1KC8W 4FLXA 3RT3C 4JAAA 1MOFA 3BPZA 1XHXA 4UV8A 3W7UA 3ASNB 1H2SB 4GZRB 5DM6V 1FXKB 1SA0A 3H1IH 4FMTA 2NLJC 1F4MA 5CBHA 4MVOA 1NJIW 2UU9B 1Y76A 4JI8B 1A32A 1AROP 1MZEA 4YY3O 1XUQA 2EJRA 4K0KO 2QJ1A 1V54C 1RSOB 4PI0A 1VQ9V 1MSDA 3FB5C 2BSKA 1Z2GA 2QGNA 1N32B 3LSSA 3HKCB 1P4RA 1F23A 4MTOA 1SQPH 1US6A 3VOUA 4X62B 4NXNO 4LF5O 2R9RB 5J2TA 2HFEC 5FLXN 1NQTA 4AQYO 2FKXA 2ZXWC 2VQFB 1AP5A 4DV5B 5EZYB 3L70H 4HZ3A 2H94A 1HW7A 1Y6XA 2R9IA 1OCOC 3CEIA 4PA4A 4X64O 2QTOA 4JYAB 2HKOA 4KHPB 3LUTB 1R6NA 1FXHA 1N36O 1JVMA 1PL4A 4K8ZA 1NH2B 1JCHA 2KSDA 3ASOB 4PHZA 3K04A 3QG5A 2WLIA 1AB3A 2P06A 4ZHQB 1W0KG 3HKEB 1JA8A 4X1YA 3CCSV 1V9PA 4WFAV 3M7MX 1Q81W 4LF4O 2GBOA 3RFRA 2W6JG 1AI4A 1ROPA 3K0DA 4L87A 3K5NA 1NI8A 1XEQA 2YXHA 3JARA 4PA9A 1P84F 3SPJA 3DC5A 1NTMH 1S5HC 2Y69C 5IYZA 1K9MW 2Y48A 1MZFA 2DJVA 2ADQB 4MVRA 3PN1A 2B1IA 5LGTA 4KXRA 3ZJZA 2DN9A 4LF6O 2YEVA 4DV0B 1YHQV 2BTQB 4FLUA 1Y4MA 2ATKC 2JJ2G 4WF9V 1PNLA 2A0LA 3ML0A 5KX5B 2P5OA 1Q3EA 1Q5OA 3ZHSA 4J7KA 1V55B 1G8MA 3HKBB 1EFRG 2DE0X 3CC2V 2BOCC 4DV1B 2PUSA 5H2FZ 4DV3B 3GB7C 1QU7A 3O9OA 1ZX3A 3LNMB 5IWAB 1WA8B 3SR2C 3UO3A 4YIOA 3RYHB 4B3SB 2UXBO 1H2GA 3ZX6A 1I7FA 3IC9A 2V7QG 3K59A 1Y74A 4MSWC 1I5YA 1JR9A 2XAJA 4DW1A 1KMIZ 3RWRD 5B5EZ 1NTZH 2PI4A 4X66B 3AG2B 4I0XB 2CE4A 4BIZA 3E83A 3A2FA 1FFXA 4O2AA 1N0NA 4IYHA 3JD3A 1J5EB 3JSLA 4LFAB 1FXKA 4AILC 2UU9O 3E8GA 4UB6Z 4JI8O 3T2MA 4NR1A 2ZT9B 2QWNB 4R6ZA 2KG7B 1AI6A 5C8YB 4TQFA 4QIWF 2ZM6B 4JASA 3K5LA 1GTOA 1YZBA 3OFNG 2F1MA 5KMGB 4LF8B 5LGNA 1K97A 1ZWIC 3B2EE 4DYLA 4L8JA 4MW3A 1OCZC 3RYCA 3WG7B 4DR7B 4MVUA 3JYCA 4F6EA 2AHZA 1N32O 5ITZB 5HFMA 5JJNB 3BFRA 3IFXA 4TUYB 3BVOA 2QWPB 1KYOF 1WB7A 2GTAA 4J9ZB 4UVBA 4X62O 2KKWA 1ZL8A 1XL6A 1ZSPA 5KHHA 3KKYA 4BR6A 1D5AA 4TSFG 3K3WA 3FX7A 4DR5B 1U97A 3FB7C 1NS1A 1GN6A 3ZN1A 5CA1B 1G6UA 2YC0A 4RAIA 1NVPD 2Q7GA 1IVSA 3M99B 4QE9A 4JI7B 5TISZ 4KHPO 4JYAO 3JCUZ 3R66A 1NU1H 2ZIOA 3DC6A 2WLJA 2WLNA 4UVAA 3W7SA 2WLLB 1VF5B 2N04A 1FS0G 1TUBA 4MVZA 2GUZB 3ETEA 4O2BA 3E35A 3HPLC 3N2GA 2QM7A 1F4NA 2C2AA 3DGEA 1M57B 4K35A 4UCOA 2QM4A 3AG4C 1BHBA 4DR4O 1K3EA 2PGGA 4B7KA 2IU0A 3RGBA 1QLNA 3K57A 2UXXA 1L8DA 1AVMA 2ZCEA 1GKFA 2YIBD 5LYJA 1YEWA 4YJ3B 5KLVH 3L71H 3UCSC 2EIKC 5B3SB 3AG7A 4X20A 4AHCA 1H2LA 4MS2A 4LF7B 1Z5VA 1RP3B 2PF4E 2LO1A 2HEPA 1KD1W 3UT5B 1GN2A 1UJWB 4TQDA 1JJOA 2IH3C 2E76B 1O9GA 1NTKH 4DV1O 2YS8A 3SJAC 5KA5A 4DV3O 2E74B 3PJSK 1THZA 3HKBA 2UXDB 3IC7A 5BR8B 4WFEA 4PD4F 5IWAO 5EK0A 5LOVA 2AGAA 3CB2A 3RYIA 1OV9A 1KU9A 3P3PA 3B8NA 5JVDA 1JOYA 1XMOB 2EIJC 1AILA 1D5NA 4IIJA 2Q9LA 3UM7A 2BCCH 4R50A 2XAHA 1HR0B 2OTJV 3RYHA 4NTWA 1I0HA 1SQVH 2IH1C 3E22B 1BQ0A 3VQXA 1FKAO 4O4IA 1QVFU 2ITDC 2WSSG 3D3IA 5FL7G 2R72A 1BS3A 1QLEC 4I0XA 3SYAA 4FLZA 4NXMO 4B3RB 3KG2A 3X2QB 1J5EO 1K4CC 2BSKB 4HAMA 5IJ0A 2ZM6O 5BY1A 3BA9A 1XNQB 4MVMA 2Y0PA 4XDKA 3CRQA 4RUEA 5CMUA 2UXCB 3T4DA 1VQ8V 2VRZA 3L73H 3BHPA 5J2TB 4DR7O 1K4DC 5KMGA 4DUYO 4DUZO 3A0RA 2QSAA 1H8HG 3ZRWB 1L0LH 3LSQA 1XHZA 3L9DA 2Q4PA 1VF6C 1LUWA 3E89A 5F2VO 4CC5A 4OX9B 4BIUA 2IJHA 1WB8A 2OTLV 4DR2O 3KCXA 3D3QA 3GWOA 1R6KA 3AG3C 3I55V 2Y4TA 5IJ9A 4RQEA 1AJPA 4CH5A 3ZHUA 5IYCO 3T4ZA 1H38A 4GX2A 4CS2A 2YIBA 1WP8A 2WLIB 3B40A 3ABKC 2WWWA 2HP8A 3R65A 3QO5A 5CA1A 2QE7G 3KZIZ 4X1YB 3FAVB 5B66Z 1OCRC 3UKMA 2ZXWB 5B1OA 2Q8VA 3TETA 3CCMV 2EULA 3JD0A 2JVDA 4XDLA 4C7UA 3H01A 4PI2A 4UCRA 1GK9A 3JARB 4WFGA 1VF6A 4CS3A 1Q43A 1OCOB 3E2EA 1HNZO 2CH7A 2P4KA 5IYZB 4LF9B 4DR6O 4IGGA 1XNRB 3B4SA 2LQTA 3CCLV 4H44B 2OCCC 1SQFA 4LH7A 3TJTA 2YEVB 4LCUC 3RVYA 1K33A 2N05A 2Y0IA 1M90W 1DF4A 2Q5ZA 3S3WA 4GX5A 2XAFA 1X4TA 1FAFA 3ZHRA 4CH4A 3AK2A 1K73W 2ZR3A 4FM1A 4GUNA 3VQVA 4YHHB 1YITV 4PDRA 2WA4A 2EX3A 4JI0O 3OMAB 1EN4A 4E2LA 2F43G 4K3AA 1QVGU 2R70A 4PV1B 3UO2A 4PA7A 2IJIA 1Y67A 2IJKA 3ABUA 1AJNA 2HJFC 3H1JH 3RBZA 1S5LZ 5L3CA 4QGPA 4R8CA 3UT5A 3RVZA 2G38A 2EILB 3GWKC 4X8AA 4X88A 1R6TA 1IBMO 5L3BA 2D2CB 2UXDO 3P30A 4G28B 1TVKA 2CGOA 2W0FC 3ZS8C 1JX9A 4RWUA 1L1FA 2YIAA 1BHAA 1KBHA 4U3JA 1FYJA 4QE7A 3OGIB 1FFXB 1B04A 4O2AB 3ZMTA 2JGDA 4JI1O 5EBMC 1OCCC 4P2ZA 4JYCA 3M8AA 1VP7A 3L75H 2PYLA 5E1AC 4PA3A 1DGSA 1EN5A 2RMKB 1IDSA 3LDCA 5IY5C 4B7EA 3E22A 1R3LC 4TV8A 2H8PC 4I7ZB 1H2NA 2IU3A 1J95A 4HNAA 4TOIA 5L3DA 1S77D 3RYCB 4J41A 4FM2A 3ZIAG 2YI8A 4JV5B 3C3TA 2CAZC 4JI3O 1YIJV 1QCEA 3N27A 5KHIA 3Q4HA 4UV9A 2WA3A 5JQGB 1ZL8B 2Z3YA 2DYSC 2K1EA 4LR3A 3A0HZ 3LDEA 4D7SA 3IGAC 4PDMA 4MTXA 2EIMC 2DQ3A 3HR0A 3ZEDA 4NYKA 5JH7B 1XL4A 2X6AA 4K8XA 4DV7O 1TGOA 4U3FH 3ZRWA 1K34A 2ZE8A 3JAKA 1PL0A 1KKDA 3P3NA 3WB1A 3K58A 3C90A 1WP7A 5CBGA 4UCSA 2RN9A 4JI2O 3QNEA 3P32A 4DR3B 1TUBB 4O4LA 1MA1A 4CS4A 4I55A 1RM1C 4O2BB 1NR1A 3LSUA 1D2DA 3N2GB 3CS5A 2EZOA 3CRRA 4GX1A 4J7JA 2ADPA 3D36C 3ZMSA 1MMMA 1EN6A 2LFRA 3FAVA 1SERA 1XILA 5CA0B 4U7NA 1GAXA 1XMQB 2ZE5A 1SF9A 3ABMC 3MAQA 2ZNJA 3CD6V 1FFTB 2KB1A 4I50B 2UUCB 4LF9O 4FPPA 2P67A 2JEXA 5LYJB 2QWQB 5JCOC 2GSMB 4IL6Z 4B3TB 2JDIG 3L72H 4X20B 4YIPA 2XHBA 3THOA 1GH6A 2QKCA 3SDLA 2W6IG 3D36A 3AG4B 4I4TB 4Z2WA 2JGUA 4OPAA 3QTCA 4CH3A 3AK3A 4PELA 1VQNV 3D8CA 4NTXA 2DQ0A 4OGQB 5B1BC 4LWSA 5J9PC 4MT8A 1RFYA 4YJ2A 5LOVB 2ZQMA 3RYIB 2NN4A 5JVDB 4N23A 5JCOA 4X65O 2EIKB 4LP8A 5CN0A 3QF7A 5IYBO 4IIJB 4LFBB 5HFLA 2ITCC 2DMXA 1XOUA 3VQWA 4KL1A 4B3MB 2XNDG 4DV6B 3JD1A 2Q7HA 4O4IB 4LFCB 4DV4O 3T1HO 3ASNC 1LR1A 1S5JA 1N4CA 2BE3A 4JTAB 1E1RG 3F7VC 4N21A 1VQOV 1RPRA 1OHHG 5LHIA 3IAYA 4XDJA 3JD4A 5IJ0B 4UB8Z 4WCEV 1WNSA 3ABLC 3ZN0A 4TV9B 3CCRV 2HLDG 2ZNIA 2X6BA 5CA3A 1H8EG 1QR8A 3ETDA 3OMIB 5LA6A 2XOKG 1B6QA 1AI7A 5LMUB 4FLTA 4F4LA 1MG1A 3BAAA 1AR1B 2PZSA 1B3QA 3JAWB 4FZ0A 2ZKOA 3K9AA 1BL8A 4HBNA 4GLXA 2AZ2A 5JQGA 4CZZA 2DWEC 3G4SV 5JJJB 5IJ9B 2VQFO 1Q8IA 4DV5O 1VF7A 5IE9A 5JH7A 3QVNA 3FB6C 1ENVA 4A5UB 2JIZG 1YTFD 2P90A 4X89A 1SKVA 4EFEA 1W59A 5J2UA 3ASOC 4DR3O 3BY6A 2ZIMA 3CP1A 2RQ6A 4BW5A 4W4LA 1FJGB 1Q90D 4ICGA 1JMKC 5KUMA 1WJZA 1BZKA 5B1NA 2CH7B 4X1IB 4QPKA 3W7TA 1I94B 5JWPA 3CE2A 1IBKB 2ZDIC 2P22C 1CXZB 1XMQO 3T1CA 2DYRC 2QKAA 3JALA 3BA8A 5CA0A 3ABKB 3UQ8A 5L3EA 4JZGA 1N0JA 2EINB 4UCUA 2UUBB 1OCRB 1SZTA 4E4EA 4I50A 2PTMA 5D5PA 1JQ0A 2B9ZA 4GKKB 4DO2A 4P30A 5H5NA 1L0NH 2XAQA 4FFBB 4J42A 2ARHA 4AI8A 4DV0O 4ASUG 3G80A 1KECA 1YVWA 3SPHA 3FYEB 1N8RW 5BXZA 1LNQA 3JATB 3J80N 2OCCB 4QPJA 1IXMA 4I4TA 2WPDG 3E8BA 1BT8A 1F51A 4RQFA 1TVKB 3F5TA 2A06H 2NR5A 5B1AC 5GONA 1ORQC 3DXRA 4U3JB 2EBOA 1SRYA 2Z0AA 4DK1A 2XAGA 3IJ4A 1SETA 4LFBO 2PY5A 2AZ0A 2JGDB 3CPWU 3OM3B 1M56B 3G67A 2GHYA 1T5EA 1Q7YW 4B3SO 3U0ZA 4Z1MG 4LFCO 3OTOB 3ZCCA 4FIPC 4DK0A 2ZR2A 3EVKA 1SQBH 3W7WA 4CBCA 4JGSA 4LC1A 4TV8B 5A9GA 4X66O 2CGNA 1SQGA 1TUEB 2WLKA 4HNAB 1KUQA 5LXTA 1KP2A 1K7DA 4LFAO 4JF3A 3Q4HB 3WFVA 3SGIA 4EKWA 3APOA 1PD3A 1OCCB 1OJHA 1PNMA 3WG7C 2YUAA 1VARA 3EFFK 4TV9A 3LDDA 4UVCA 4LF8O 4OXSA 4NVPA 5LMUO 3ZBHA 1P7GA 2XT9A 3WB2A 4R7CA 2Q67A 2GV9A 3E8HA 5IY5B 3U10A 4TWKA 4FM0A 1YI2V 1VQLV 1KQSU 4D7TA 1XQ8A 1KKCA 1NBMG 4JI6B 1YJNV 3CSXA 3JAKB 4MW8A 5EC2C 1IBLB 3JAWA 1ZLZA 3KCYA 3DSQA 4FFKA 5DN6G 1KB9F 3ZRXA 4B08A 1V54B 5CBFA 3CRMA 4LBEC 1W0JG 2Q0AA 4O4LB 4DR5O 4I55B 3OW2U 4LF5B 1HNXB 2PYJA 3RN4A 1DK1A 4J9YB 3RYFB 1R3IC 2Q69A 2DYSB 2QTSA 1SQQH 1YXBA 1Q6HA 4JI7O 4UCVA 4FLYA 2EIMB 3WB0A 4GCZA 4U7OA 3K06A 1PP9H 2Q0OC 5KUKA 4H0LB 5IT9N 1HNWB 1FJGO 3OAAG 4X64B 1M57C 2RDCA 2CTQA 5EYPA 1H2MA 2NNUA 2YXLA 4J80A 4H37A 1N36B 3B77A 3OUFA 3CJHA 4FJCC 1Q82W 1M9NA 4JYYA 2UXNA 4X1IA 1YDXA 1RM1B 3OT7A 4BW9A 3H1LH 3K5OA 1F7YA 1RPOA 4P9OA 5H6QA 2UUBO 4DR1B 3MDSA 4GKKO 4HYOA 1M4UA 4FLWA 2LGWA 3TCUA 4UXNA 3MD0A 3QO7A 3ZMZA 1BE3H 2P4VA 3TXSA 4F6RB 3ABMB 1Q6IA 1GO3F 4LWSB 4LF7O 3OD4A 3W7XA 4FFBA 1JJ2U 4YJ2B 2Y69B 2ILMA 4LF6B 3CX5F 1GM8A 4JAUA 3JATA 3ZMUA 3HKDB 2P6JA 5C93A 3CCJV 4QJFB 4NB5A 5BR8O 3AG1C 2AW9A 1XDCA 5LP6C 5FNVB 2OWOA 1SZXA 2V1DA 1QQCA 2WLMA 1S3JA 3OR7C 2IW5A 5LBQA 1XMOO 2HJDA 4FK5C 5B1BB 2K9PA 1GMGA 5EBWC 2JK5C 1HR0O 4WBNB 1S72V 2QKSA 5E79Z 1VQKV 4PDLA 2LFSA 3ZHQA 1IURA 2YXYA 2UXBB 2W0XA 3A8TA 3BEHA 2JS3A 2QEXV 4CC6A 1URFA 2Z5UA 2HR3A 4MTFA 4GKJB 1DLBA 3U11A 4B3RO 1MABG 5LA6B 5AG2A 2LGQA 5LP6A 3TGUH 1Z5WA 1AR5A 2Q68A 1XNQO 1MSWD 3ETQA 4UCTA 1QBZA 2UXCO 2PI5A 2QDOA 1AR4A 1YCIA 3VBBA 4H13B 1TA8A 1W2BU 2Q7EA 1NR7A 1VEWA 3ABLB 1I5XA 3TXQA 4JI6O 4O4HA 2OIGA 4FLVA 3OTFA 1IBLO 2YDEA 1OZ0A 2P7TC 1M5IA 4OX9O 2OCHA 1BQZA 5J2UB 5EC1C 1OCZB 5JJEB 1VQPV 1IZ3A 1HNXO 2ETNA 2E3CA 2AXTZ 1NT2B 1EZJA 3RYFA 4BIOA 1K92A 1GM7A 2A79B 3CRAA 2FTKA 4G2KA 2F4VB 4ABMA 1N33B 1HNWO 3JALB 4DRXB 1EBOA 1DTOA 2FB5A 1M1KW 2CUGA 2E75B 5H6RA 3BABA 3APQA 5IDJA 1SQXH 3CMEV 1XNRO 2FL4A 3WU2Z 2E5LB 4I5SA 4DXWA 1K8AW 4UUJC 2CTPA 2ZINA 1BMFG 2F23A 2DWDC 1E1QG 4DR1O 4DR4B 4LNUB 3ABTA 4NKGB 2CTRA 3J81N 3FFQA 3ZRSA 2MK3A 1S0VA 4RO2A 3BRCA 2DYRB 4YHHO 3CCUV 1KP3A 3K08A 3CHXA 4IHJA 4F6RA 4JTDB 1P49A 5GONB 3DXRB 2CDYA 2JRIA 2HG5C 2EILC 4X1KA 5BMVA 1FD9A 5FPRA 4J10A 1TAEA 2EJ7A 5LL6Y 3B8MA 4WFBV 4JZ2A 1NH2D 3CXHF 3MHSC 2X0LA 4JI4B 2BTOA 3HKDA 3ICXA 1GN4A 5GW7A 4Q20A 5EIBD 5D5QA 2LP7A 3JASB 3BCCH 5K1PA 5FNVA
chains in the Genus database with same CATH topology
4P30A 2WLIB 1FXKC 2XAQA 2EJRA 3ABKC 5LGUA 2WWWA 3CMAV 3R65A 3QO5A 1V54C 1VQ9V 4ASUG 2QE7G 4H33A 3CCQV 5B1AB 1KECA 3FB5C 4JPRA 1K5QA 3SPHA 3FYEB 1OCRC 3FKSG 2ZXWB 3UKMA 1DF5A 5B1OA 1N8RW 1LNQA 3TETA 1K5SA 2OCCB 2D3OW 3LSSA 4QPJA 3CCMV 1IXMA 3JD0A 4XDLA 3H01A 2DW4A 2WPDG 3E8BA 1YTFB 1P4RA 1F23A 3FYIB 1GK9A 4MTOA 1NVPB 4WFGA 3VOUA 2EIJB 1OCOB 1F51A 4RQFA 3E2EA 2R9RB 5B1AC 2HFEC 2OT5A 1NQTA 1ORQC 3CCLV 2ZXWC 2EBOA 1SRYA 2OCCC 2XAGA 1SETA 4HZ3A 2H94A 2YEVB 3CPWU 4LCUC 3OM3B 2R9IA 3RVYA 1K33A 1M56B 2GHYA 1M90W 1DF4A 1HWYA 1OCOC 4PA4A 1Q7YW 2QTOA 1QLEB 2IJJA 2XAFA 4GX5A 2HKOA 1VQ4V 4Z1MG 3LUTB 1R6NA 3ZCCA 1FXHA 4FIPC 1JVMA 5LHGA 1K73W 2ZR2A 2ZR3A 3G6EV 3CXCU 2B5UA 3W7WA 4CBCA 3K0GA 1NH2B 4JGSA 4LC1A 1S76D 1JCHA 3ASOB 1YITV 4PDRA 3K04A 1TUEB 2WLKA 3OMAB 2WLIA 1CEZA 4E2LA 2F43G 3ZRVA 1W0KG 3TK1A 1QVGU 1Y66A 3CCSV 1G4YB 4WFAV 1CP9A 1KP2A 1K7DA 4PA7A 2IJIA 2IJKA 3ABUA 3RBZA 1AJNA 2HJFC 4JF3A 1Q81W 1R3KC 3WFVA 4EKWA 2WLHA 5L3CA 4KUMA 4MVQA 2W6JG 4R8CA 1AI4A 2B1GA 1ROPA 3RVZA 3K0DA 4X88A 2EILB 4L87A 1PD3A 4JYBA 1OCCB 4X8AA 1PNMA 3WG7C 5L3BA 4PA9A 3P30A 2QM8A 4G28B 1YJWV 3EFFK 3SPJA 3OR6C 3LDDA 1S5HC 4UVCA 2W0FC 2JEUA 2Y69C 1K9MW 4OXSA 1JX9A 1VQ6V 2Y48A 1L1FA 1BHAA 3HB3B 4R7CA 2Q67A 3E8HA 4YXWG 4MVRA 4QE7A 5IY5B 2B1IA 5LGTA 4TWKA 3ZJZA 1YI2V 1VQLV 1KQSU 3ZMTA 2YEVA 1NBMG 4GX0A 1OCCC 4P2ZA 5EBMC 3AG3B 4JYCA 1YHQV 1YJNV 3SPCA 1Y4MA 4MW8A 5EC2C 2ATKC 2CK3G 3SPGA 2JJ2G 4WF9V 1PNLA 1R3JC 3OGCC 5E1AC 2A0LA 3ML0A 4PA3A 5DN6G 5L3GA 3ZRXA 1V54B 5IY5C 3LDCA 5CBFA 4LBEC 1W0JG 1R3LC 1V55B 1G8MA 1EFRG 2H8PC 1FXVA 3CC2V 3OW2U 2BOCC 3OEEG 1GM9A 2IU3A 1J95A 4J9YB 1R3IC 2Q69A 2DYSB 3GB7C 5L3DA 1S77D 3CC4V 3ZIAG 2EIMB 3LNMB 3RW0A 1YIJV 2EZPA 4GCZA 5L3FA 4U7OA 1QCEA 4KP4A 1V55C 3K06A 3JCZA 4UV9A 5KUKA 2ZDIA 1COWG 3OAAG 1M57C 3AEIA 2Z3YA 1H2GA 2DYSC 2V7QG 2K1EA 2NNUA 4H37A 1VQ5V 3LDEA 3IGAC 4MSWC 1I5YA 2XAJA 3B77A 3OUFA 4PDMA 4MTXA 1SESA 2EIMC 4FJCC 2DQ3A 5BZBA 2PI4A 1Q82W 1M9NA 3AG2B 2UXNA 4BIZA 3E83A 3E86A 1Q86W 4PA6A 1XL4A 2X6AA 1AJQA 1RM1B 3ZRWA 4ZKIA 1QR9A 1K34A 1PL0A 5H9CA 3SJQC 1KKDA 3JD3A 3G71V 1RPOA 2AHYA 4P9OA 1FXKA 5H6QA 3SPIA 3E8GA 5CBGA 2X6CA 3T2MA 3QNEA 3AG2C 3P32A 4HYOA 4R6ZA 4I9WA 1AI6A 4QIWF 3TCUA 4UXNA 3MD0A 3QO7A 3ZMZA 1RM1C 4JASA 1GTOA 3OFNG 1NR1A 3CYOA 3ABMB 5LGNA 1K97A 1WPXA 1ZWIC 1GO3F 4MW3A 3CC7V 4WFHA 1OCZC 2HVKC 3WG7B 2EZOA 3W7XA 4GX1A 4MVUA 3JYCA 1JJ2U 2AHZA 3ZMSA 3AG1B 3ZMVA 2Y69B 5HFMA 2LFRA 3JD2A 1SERA 1GM8A 3IFXA 4JAUA 4U7NA 4J9ZB 4UVBA 3ZMUA 3NXSA 4MTGA 1XL6A 3ABMC 3CCVV 1PKXA 3CD6V 1FFTB 2KB1A 2P6JA 5C93A 3CCJV 4QJFB 4FPPA 2P67A 2JEXA 4TSFG 3AG1C 3K3WA 1AI5A 2GSMB 2V1DA 3FB7C 2JDIG 1S3JA 2WLMA 3E8FA 3OR7C 2IW5A 3ZN1A 5LBQA 2JJ1G 4RAIA 3ETGA 3FB8C 4FK5C 1NVPD 3M99B 3EHBB 4QE9A 5B1BB 1GMGA 5EBWC 2YSUB 2JK5C 2W6IG 3D36A 3AG4B 1S72V 2QKSA 3OMNB 2WLJA 2WLNA 4UVAA 1VQKV 3W7SA 4TT3G 2WLLB 4PDLA 2LFSA 1FS0G 4MVZA 4PELA 1VQNV 1VQ7V 3K03A 3ETEA 3BEHA 2QEXV 2DQ0A 4JTCB 2Z5UA 3E35A 3HPLC 5B1BC 4ZBMA 2QM7A 2HR3A 1F4NA 2C2AA 4G27B 4MTFA 5J9PC 3DGEA 1M57B 1DLBA 4MT8A 1MABG 1NKDA 5KA6A 3AG4C 2ZQMA 4MVSA 1BHBA 4N23A 1K3EA 2EIKB 4LP8A 2WAMA 2IU0A 5CN0A 4XBFA 5IYBO 3OE7G 2Q68A 5HFLA 2ITCC 1QLNA 4BAYA 1MSWD 2XASA 2QA4V 2X7RB 2UXXA 1QBZA 2PI5A 2XNDG 3MHHC 1GKFA 3JD1A 3VBBA 3ASNC 4KFMA 1W2BU 2EIKC 1NR7A 5B3SB 1YJ9V 3ABLB 2M7WA 1I5XA 4JTAB 2HVJC 4P9PA 1E1RG 2EINC 3F7VC 4MS2A 4N21A 4QNHB 1VQOV 1WLEA 2ZD9A 4JAVA 5EBLC 1RPRA 1OZ0A 1OHHG 2P7TC 5LHIA 4XDJA 1KD1W 3JD4A 5EC1C 1OCZB 2WLLA 1UJWB 1VQPV 2IH3C 4WCEV 5B3SC 3ABLC 3ZN0A 5IYDO 5KA5A 3CCRV 2HLDG 3F7YC 1P7BA 1R73A 3PJSK 1THZA 2X6BA 5CA3A 1EZJA 3IC7A 3OUSA 3SYQA 1H8EG 4WFEA 1QR8A 3ETDA 3OMIB 1PNKA 1K92A 2XOKG 1GM7A 1B6QA 5EK0A 2A79B 1AI7A 1YSCA 4F4LA 3B8NA 5LHHA 1MG1A 2FTKA 4G2KA 1JOYA 2EIJC 4PDVA 1AR1B 3QO8A 3K9AA 1BL8A 3UM7A 4R50A 1EBOA 2XAHA 1DTOA 1E79G 2OTJV 1CPYA 4CZZA 2IH1C 1M1KW 2DWEC 3G4SV 5H6RA 3SYPA 1QVFU 5IDJA 2ITDC 3CMEV 1M56C 3OEHG 4RUFA 2WSSG 3D3IA 3STLC 4I5SA 5FL7G 2BOBC 1QLEC 3CCEV 4DXWA 1K8AW 4UUJC 3SYAA 3FB6C 2A9HA 1ENVA 3KG2A 1BMFG 3X2QB 1K4CC 2JIZG 1VQMV 2DWDC 4WFFA 1E1QG 1YTFD 2P90A 4X89A 4GT1A 4HAMA 3ASOC 3SYCA 3BY6A 3ABTA 3CP1A 3K79A 3ZRSA 4MVMA 4XDKA 2MK3A 1S0VA 4RUEA 4RO2A 2DYRB 4BW5A 3I56V 3DTUB 5CMUA 3CCUV 1KP3A 3T4DA 1VQ8V 2Q6AA 3K08A 5KUMA 3X2QC 5B1NA 1K4DC 3F5WC 1JPXA 4JTDB 4QPKA 3A0RA 3W7TA 3STZC 3SYOA 1KC8W 2ZDIC 1H8HG 2HG5C 2EILC 3ZRWB 3LSQA 1MOFA 4UV8A 3W7UA 3T1CA 3ASNB 2DYRC 5DM6V 1FXKB 3B8MA 3E89A 3ABKB 4WFBV 1NH2D 4BIUA 2IJHA 4FMTA 5L3EA 2NLJC 3MHSC 2X0LA 2OTLV 1F4MA 2EINB 5CBHA 4MVOA 1NJIW 1OCRB 1SZTA 5GW7A 4Q20A 1JQ0A 1R6KA 3GWOA 3AG3C 3I55V 1AROP 4RQEA 1AJPA 4DO2A 5IYCO 2LP7A 3T4ZA 1H38A 4GX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC C;  3F7Y C;  4MTG A;  1P7B A;  2WLI B;  4P2Z A;  4P30 A;  3SPC A;  1XL6 A;  3ABM C;  3ABK C;  3PJS K;  4MW8 A;  5EC2 C;  2X6B A;  3R65 A;  5B1B C;  1V54 C;  2ATK C;  2KB1 A;  3SPG A;  3OUS A;  3SYQ A;  4H33 A;  4WFE A;  1R3J C;  3OGC C;  3FB5 C;  5E1A C;  2A0L A;  3SPH A;  4PA3 A;  5EK0 A;  1OCR C;  2A79 B;  3AG1 C;  3UKM A;  1LNQ A;  4F4L A;  3TET A;  5IY5 C;  3LDC A;  5CBF A;  4LBE C;  1R3L C;  3FB7 C;  4XDL A;  2EIJ C;  4PDV A;  2H8P C;  2WLM A;  3E8B A;  3E8F A;  3OR7 C;  2BOC C;  1J95 A;  4MTO A;  4WFG A;  1BL8 A;  4J9Y B;  4RAI A;  3UM7 A;  3FB8 C;  1R3I C;  3VOU A;  4R50 A;  2Q69 A;  3GB7 C;  4QE9 A;  2R9R B;  5EBW C;  2IH1 C;  5EBM C;  2JK5 C;  5B1A C;  2DWE C;  2HFE C;  1ORQ C;  2QKS A;  3LNM B;  2WLJ A;  2WLN A;  2ZXW C;  3SYP A;  3RW0 A;  2WLL B;  4PDL A;  2ITD C;  2OCC C;  1M56 C;  1V55 C;  3K06 A;  4HZ3 A;  4MVZ A;  4RUF A;  3STL C;  5KUK A;  3SPJ A;  2BOB C;  1QLE C;  3K03 A;  4LCU C;  4DXW A;  3RVY A;  3BEH A;  1M57 C;  4JTC B;  4UUJ C;  3SYA A;  1OCO C;  3FB6 C;  2DYS C;  2A9H A;  3HPL C;  2K1E A;  4PA4 A;  3KG2 A;  4ZBM A;  2QTO A;  1K4C C;  4GX5 A;  4H37 A;  2DWD C;  4G27 B;  3LDE A;  4MTF A;  4WFF A;  5J9P C;  3IGA C;  4MSW C;  4X89 A;  4PDM A;  3OUF A;  2EIM C;  3LUT B;  3AG4 C;  1JVM A;  4MVS A;  3ASO C;  3SYC A;  5BZB A;  3E83 A;  3E86 A;  3K0G A;  4CBC A;  4LP8 A;  3ZRS A;  4MVM A;  1XL4 A;  2X6A A;  4PA6 A;  4XDK A;  4RUE A;  4PDR A;  4RO2 A;  4BW5 A;  2Q68 A;  3K04 A;  2ITC C;  2WLK A;  2WLI A;  3T4D A;  2Q6A A;  3K08 A;  4J9Z B;  3SJQ C;  5KUM A;  3X2Q C;  1KKD A;  1K4D C;  2AHY A;  3F5W C;  4P9O A;  4JTD B;  3SPI A;  1G4Y B;  3E8G A;  5CBG A;  2X6C A;  3T2M A;  4PA7 A;  3STZ C;  3SYO A;  3ASN C;  4HYO A;  2HJF C;  3AG2 C;  2HG5 C;  2EIL C;  4I9W A;  4R6Z A;  3RBZ A;  1R3K C;  4KFM A;  3TCU A;  2EIK C;  4EKW A;  2WLH A;  4R8C A;  4MVQ A;  3T1C A;  2DYR C;  3K0D A;  4JTA B;  4X88 A;  3RVZ A;  4X8A A;  2HVJ C;  4P9P A;  3WG7 C;  2EIN C;  3F7V C;  4MS2 A;  4QNH B;  3E89 A;  4PA9 A;  2ZD9 A;  1ZWI C;  4G28 B;  3EFF K;  5EBL C;  3OR6 C;  4MW3 A;  3LDD A;  4WFH A;  1OCZ C;  1S5H C;  2NLJ C;  2W0F C;  2Y69 C;  2HVK C;  4OXS A;  2P7T C;  4GX1 A;  4MVU A;  3JYC A;  5CBH A;  4XDJ A;  4MVO A;  2AHZ A;  5EC1 C;  4R7C A;  2Q67 A;  3E8H A;  2WLL A;  4MVR A;  4QE7 A;  2IH3 C;  3AG3 C;  4TWK A;  3ZJZ A;  3IFX A;  5B3S C;  3ABL C;  3T4Z A;  4GX2 A;  2YEV A;  4GX0 A; 
#chains in the Genus database with same CATH topology
 1FXK C;  5LGU A;  3CMA V;  1I08 A;  4H33 A;  1VMG A;  1M93 A;  5LXT B;  3CCQ V;  5B1A B;  4JPR A;  1K5Q A;  3FKS G;  1DF5 A;  4EFB A;  1K5S A;  2D3O W;  1Q6U A;  4WBN A;  2DW4 A;  1YTF B;  2QR4 A;  3FYI B;  1NVP B;  2GTS A;  2EIJ B;  2N74 A;  1B06 A;  4GKJ O;  2VQE B;  1SC5 B;  2OT5 A;  3EXA A;  4JV5 O;  2HHH B;  4FZ1 A;  1O9H A;  2FML A;  5KHK A;  4NXM B;  1HWY A;  2UUA B;  1QLE B;  2IJJ A;  4I9Q A;  1VQ4 V;  1QNM A;  2XTA A;  4O4J B;  5LHG A;  5GTI Z;  1R1B A;  4Z1V A;  3G6E V;  3ZHV A;  3CXC U;  2B5U A;  3K0G A;  5DEC A;  1S76 D;  1LUV A;  1CEZ A;  2F66 C;  3ZRV A;  4DUY B;  4DUZ B;  2H3O A;  1RSO A;  3TK1 A;  2VS0 A;  5KAI Z;  1Y66 A;  2YID A;  1BSM A;  1G4Y B;  4LH6 A;  2A3Q A;  1CP9 A;  1N34 B;  1R3K C;  2WLH A;  3HKC A;  1JFF B;  4KUM A;  4MVQ A;  2B1G A;  1EM1 A;  4JYB A;  1NZ6 A;  5EYP B;  2QM8 A;  1YJW V;  4DR2 B;  3OR6 C;  5A2Q N;  2JEU A;  5EIB C;  4W4K A;  1VQ6 V;  3CJH B;  3HB3 B;  2M6Y A;  2QWR B;  4YXW G;  2R9A A;  2F4V O;  1HP8 A;  5EZY A;  1N33 O;  5LMN B;  3L74 H;  4GX0 A;  4J11 A;  3AG3 B;  3SPC A;  4EB6 B;  2CK3 G;  3SPG A;  1R3J C;  2Y4U A;  3OGC C;  4DRX A;  2UUC O;  5L3G A;  2CTW A;  1ZTE A;  2E5L O;  4Q6G A;  5KAF Z;  1FXV A;  4NTY A;  3OEE G;  1GM9 A;  4B3T O;  1HNZ B;  4DV2 B;  4ZHQ A;  4ZOL B;  2JS5 A;  4DR6 B;  3HKE A;  2ODM A;  3CC4 V;  3S3X A;  3A0B Z;  3GVM A;  3RW0 A;  2EZP A;  5L3F A;  4KP4 A;  1V55 C;  3JCZ A;  3T1Y B;  5CB4 B;  4LNU A;  5FPO A;  2ZDI A;  2F93 B;  1COW G;  4JI5 B;  3AEI A;  1VQ5 V;  2IM9 A;  1SS3 A;  1SES A;  3AK1 A;  2ZE6 A;  5BZB A;  2LJ2 A;  1U96 A;  3E86 A;  1Q86 W;  4PA6 A;  4JI0 B;  3LNN A;  1AJQ A;  4UFZ A;  2RCV A;  4ZKI A;  1QR9 A;  2BTQ A;  3SJQ C;  5H9C A;  4JI4 O;  5K1X A;  3G71 V;  2AHY A;  3SPI A;  5GTH Z;  4B3M O;  5KX5 A;  2X6C A;  4DV6 O;  3AG2 C;  3VQY A;  1GRJ A;  4I9W A;  1WPB A;  1IBM B;  1HDJ A;  4ZI7 B;  3SJC C;  3N2K B;  2V4D A;  1IXB A;  3CYO A;  3H1K H;  2YI9 A;  1WPX A;  3JAS A;  3CC7 V;  4WFH A;  2HVK C;  4OPH A;  1VIB A;  4ZIB A;  3ZMV A;  3AG1 B;  1WA8 A;  1XRE A;  5LP6 B;  3O65 A;  3JD2 A;  4JI1 B;  2VWJ A;  3K5M A;  1SA0 B;  3NXS A;  4MTG A;  3JAM N;  3CCV V;  2VWK A;  1PKX A;  4IYI A;  5KHJ A;  2VQE O;  1Y76 B;  1MNG A;  5KHG A;  1AI5 A;  2HHH O;  3FD9 A;  1WN7 A;  2RNB A;  3E8F A;  4YY3 B;  4O4H B;  2UUA O;  2JJ1 G;  3ETG A;  3FB8 C;  2A7W A;  4DW0 A;  3EHB B;  4K0K B;  4JI3 B;  1IX9 A;  2YSU B;  3OMN B;  4TT3 G;  2KG7 A;  5C8Y A;  4O4J A;  1VQ7 V;  2L35 A;  3K03 A;  1AP6 A;  4JTC B;  2ZE7 A;  4NXN B;  4ZBM A;  4D6T H;  4G27 B;  1G1X B;  1N34 O;  1NKD A;  4FVM A;  5KA6 A;  4MVS A;  4AQY B;  2YIC A;  5ITZ A;  2GDS A;  4DV7 B;  4IT5 A;  4TUY A;  2WAM A;  1WAZ A;  4XBF A;  3OE7 G;  3SJB C;  4BAY A;  2XAS A;  1JFF A;  2QA4 V;  2X7R B;  3ZHT A;  4JI2 B;  3MHH C;  2LW1 A;  5LMN O;  4KFM A;  4PJ0 Z;  4X9Q A;  1I94 O;  4J7Z A;  2DOS A;  1IBK O;  1YJ9 V;  2M7W A;  2F95 B;  2HVJ C;  4P9P A;  2EIN C;  4QNH B;  1XBL A;  1WLE A;  2ZD9 A;  1XI1 A;  3K9S A;  4JAV A;  5EBL C;  2KQX A;  3J7A U;  4EB6 A;  2WLL A;  5B3S C;  1ZAU A;  4LF4 B;  2GUZ A;  5IYD O;  4DV2 O;  3F7Y C;  1P7B A;  1R73 A;  3JSN A;  1X59 A;  3OUS A;  3SYQ A;  4IHJ B;  2L6L A;  1PNK A;  4ZOL A;  3C3S A;  1YSC A;  2OYQ A;  2LW7 A;  5LHH A;  4X1K B;  5BMV B;  3T1Y O;  1PM9 A;  4BWA A;  4PDV A;  3QO8 A;  1H2K A;  4JI5 O;  3NR7 A;  1ZUQ A;  5CB4 A;  1E79 G;  1CPY A;  3CRC A;  3I5D A;  3SYP A;  4YJ3 A;  3CWB H;  5DED A;  1YF2 A;  1BGY H;  1M56 C;  3OEH G;  3H1H H;  3G6B A;  4RUF A;  3STL C;  3H9V A;  2RJZ A;  2BOB C;  1UPG A;  3CCE V;  1FPO A;  4EEQ A;  2O57 A;  2A9H A;  1VQM V;  3B09 A;  4WFF A;  2MW2 B;  1GN3 A;  4GT1 A;  4X65 B;  3SYC A;  4CH6 A;  1EZV H;  2Q73 A;  3OTO O;  3K79 A;  2XUM A;  1Y74 B;  3DTU B;  3I56 V;  1PPJ H;  2Q6A A;  2OIE A;  4GYC B;  3X2Q C;  4ZI7 A;  2IBZ H;  3N2K A;  1BCC H;  3F5W C;  2QWO B;  4DV4 B;  1QHT A;  1JPX A;  3T1H B;  1UFI A;  3STZ C;  2FYU H;  1PV0 A;  3SYO A;  1KC8 W;  4FLX A;  3RT3 C;  4JAA A;  1MOF A;  3BPZ A;  1XHX A;  4UV8 A;  3W7U A;  3ASN B;  1H2S B;  4GZR B;  5DM6 V;  1FXK B;  1SA0 A;  3H1I H;  4FMT A;  2NLJ C;  1F4M A;  5CBH A;  4MVO A;  1NJI W;  2UU9 B;  1Y76 A;  4JI8 B;  1A32 A;  1ARO P;  1MZE A;  4YY3 O;  1XUQ A;  2EJR A;  4K0K O;  2QJ1 A;  1V54 C;  1RSO B;  4PI0 A;  1VQ9 V;  1MSD A;  3FB5 C;  2BSK A;  1Z2G A;  2QGN A;  1N32 B;  3LSS A;  3HKC B;  1P4R A;  1F23 A;  4MTO A;  1SQP H;  1US6 A;  3VOU A;  4X62 B;  4NXN O;  4LF5 O;  2R9R B;  5J2T A;  2HFE C;  5FLX N;  1NQT A;  4AQY O;  2FKX A;  2ZXW C;  2VQF B;  1AP5 A;  4DV5 B;  5EZY B;  3L70 H;  4HZ3 A;  2H94 A;  1HW7 A;  1Y6X A;  2R9I A;  1OCO C;  3CEI A;  4PA4 A;  4X64 O;  2QTO A;  4JYA B;  2HKO A;  4KHP B;  3LUT B;  1R6N A;  1FXH A;  1N36 O;  1JVM A;  1PL4 A;  4K8Z A;  1NH2 B;  1JCH A;  2KSD A;  3ASO B;  4PHZ A;  3K04 A;  3QG5 A;  2WLI A;  1AB3 A;  2P06 A;  4ZHQ B;  1W0K G;  3HKE B;  1JA8 A;  4X1Y A;  3CCS V;  1V9P A;  4WFA V;  3M7M X;  1Q81 W;  4LF4 O;  2GBO A;  3RFR A;  2W6J G;  1AI4 A;  1ROP A;  3K0D A;  4L87 A;  3K5N A;  1NI8 A;  1XEQ A;  2YXH A;  3JAR A;  4PA9 A;  1P84 F;  3SPJ A;  3DC5 A;  1NTM H;  1S5H C;  2Y69 C;  5IYZ A;  1K9M W;  2Y48 A;  1MZF A;  2DJV A;  2ADQ B;  4MVR A;  3PN1 A;  2B1I A;  5LGT A;  4KXR A;  3ZJZ A;  2DN9 A;  4LF6 O;  2YEV A;  4DV0 B;  1YHQ V;  2BTQ B;  4FLU A;  1Y4M A;  2ATK C;  2JJ2 G;  4WF9 V;  1PNL A;  2A0L A;  3ML0 A;  5KX5 B;  2P5O A;  1Q3E A;  1Q5O A;  3ZHS A;  4J7K A;  1V55 B;  1G8M A;  3HKB B;  1EFR G;  2DE0 X;  3CC2 V;  2BOC C;  4DV1 B;  2PUS A;  5H2F Z;  4DV3 B;  3GB7 C;  1QU7 A;  3O9O A;  1ZX3 A;  3LNM B;  5IWA B;  1WA8 B;  3SR2 C;  3UO3 A;  4YIO A;  3RYH B;  4B3S B;  2UXB O;  1H2G A;  3ZX6 A;  1I7F A;  3IC9 A;  2V7Q G;  3K59 A;  1Y74 A;  4MSW C;  1I5Y A;  1JR9 A;  2XAJ A;  4DW1 A;  1KMI Z;  3RWR D;  5B5E Z;  1NTZ H;  2PI4 A;  4X66 B;  3AG2 B;  4I0X B;  2CE4 A;  4BIZ A;  3E83 A;  3A2F A;  1FFX A;  4O2A A;  1N0N A;  4IYH A;  3JD3 A;  1J5E B;  3JSL A;  4LFA B;  1FXK A;  4AIL C;  2UU9 O;  3E8G A;  4UB6 Z;  4JI8 O;  3T2M A;  4NR1 A;  2ZT9 B;  2QWN B;  4R6Z A;  2KG7 B;  1AI6 A;  5C8Y B;  4TQF A;  4QIW F;  2ZM6 B;  4JAS A;  3K5L A;  1GTO A;  1YZB A;  3OFN G;  2F1M A;  5KMG B;  4LF8 B;  5LGN A;  1K97 A;  1ZWI C;  3B2E E;  4DYL A;  4L8J A;  4MW3 A;  1OCZ C;  3RYC A;  3WG7 B;  4DR7 B;  4MVU A;  3JYC A;  4F6E A;  2AHZ A;  1N32 O;  5ITZ B;  5HFM A;  5JJN B;  3BFR A;  3IFX A;  4TUY B;  3BVO A;  2QWP B;  1KYO F;  1WB7 A;  2GTA A;  4J9Z B;  4UVB A;  4X62 O;  2KKW A;  1ZL8 A;  1XL6 A;  1ZSP A;  5KHH A;  3KKY A;  4BR6 A;  1D5A A;  4TSF G;  3K3W A;  3FX7 A;  4DR5 B;  1U97 A;  3FB7 C;  1NS1 A;  1GN6 A;  3ZN1 A;  5CA1 B;  1G6U A;  2YC0 A;  4RAI A;  1NVP D;  2Q7G A;  1IVS A;  3M99 B;  4QE9 A;  4JI7 B;  5TIS Z;  4KHP O;  4JYA O;  3JCU Z;  3R66 A;  1NU1 H;  2ZIO A;  3DC6 A;  2WLJ A;  2WLN A;  4UVA A;  3W7S A;  2WLL B;  1VF5 B;  2N04 A;  1FS0 G;  1TUB A;  4MVZ A;  2GUZ B;  3ETE A;  4O2B A;  3E35 A;  3HPL C;  3N2G A;  2QM7 A;  1F4N A;  2C2A A;  3DGE A;  1M57 B;  4K35 A;  4UCO A;  2QM4 A;  3AG4 C;  1BHB A;  4DR4 O;  1K3E A;  2PGG A;  4B7K A;  2IU0 A;  3RGB A;  1QLN A;  3K57 A;  2UXX A;  1L8D A;  1AVM A;  2ZCE A;  1GKF A;  2YIB D;  5LYJ A;  1YEW A;  4YJ3 B;  5KLV H;  3L71 H;  3UCS C;  2EIK C;  5B3S B;  3AG7 A;  4X20 A;  4AHC A;  1H2L A;  4MS2 A;  4LF7 B;  1Z5V A;  1RP3 B;  2PF4 E;  2LO1 A;  2HEP A;  1KD1 W;  3UT5 B;  1GN2 A;  1UJW B;  4TQD A;  1JJO A;  2IH3 C;  2E76 B;  1O9G A;  1NTK H;  4DV1 O;  2YS8 A;  3SJA C;  5KA5 A;  4DV3 O;  2E74 B;  3PJS K;  1THZ A;  3HKB A;  2UXD B;  3IC7 A;  5BR8 B;  4WFE A;  4PD4 F;  5IWA O;  5EK0 A;  5LOV A;  2AGA A;  3CB2 A;  3RYI A;  1OV9 A;  1KU9 A;  3P3P A;  3B8N A;  5JVD A;  1JOY A;  1XMO B;  2EIJ C;  1AIL A;  1D5N A;  4IIJ A;  2Q9L A;  3UM7 A;  2BCC H;  4R50 A;  2XAH A;  1HR0 B;  2OTJ V;  3RYH A;  4NTW A;  1I0H A;  1SQV H;  2IH1 C;  3E22 B;  1BQ0 A;  3VQX A;  1FKA O;  4O4I A;  1QVF U;  2ITD C;  2WSS G;  3D3I A;  5FL7 G;  2R72 A;  1BS3 A;  1QLE C;  4I0X A;  3SYA A;  4FLZ A;  4NXM O;  4B3R B;  3KG2 A;  3X2Q B;  1J5E O;  1K4C C;  2BSK B;  4HAM A;  5IJ0 A;  2ZM6 O;  5BY1 A;  3BA9 A;  1XNQ B;  4MVM A;  2Y0P A;  4XDK A;  3CRQ A;  4RUE A;  5CMU A;  2UXC B;  3T4D A;  1VQ8 V;  2VRZ A;  3L73 H;  3BHP A;  5J2T B;  4DR7 O;  1K4D C;  5KMG A;  4DUY O;  4DUZ O;  3A0R A;  2QSA A;  1H8H G;  3ZRW B;  1L0L H;  3LSQ A;  1XHZ A;  3L9D A;  2Q4P A;  1VF6 C;  1LUW A;  3E89 A;  5F2V O;  4CC5 A;  4OX9 B;  4BIU A;  2IJH A;  1WB8 A;  2OTL V;  4DR2 O;  3KCX A;  3D3Q A;  3GWO A;  1R6K A;  3AG3 C;  3I55 V;  2Y4T A;  5IJ9 A;  4RQE A;  1AJP A;  4CH5 A;  3ZHU A;  5IYC O;  3T4Z A;  1H38 A;  4GX2 A;  4CS2 A;  2YIB A;  1WP8 A;  2WLI B;  3B40 A;  3ABK C;  2WWW A;  2HP8 A;  3R65 A;  3QO5 A;  5CA1 A;  2QE7 G;  3KZI Z;  4X1Y B;  3FAV B;  5B66 Z;  1OCR C;  3UKM A;  2ZXW B;  5B1O A;  2Q8V A;  3TET A;  3CCM V;  2EUL A;  3JD0 A;  2JVD A;  4XDL A;  4C7U A;  3H01 A;  4PI2 A;  4UCR A;  1GK9 A;  3JAR B;  4WFG A;  1VF6 A;  4CS3 A;  1Q43 A;  1OCO B;  3E2E A;  1HNZ O;  2CH7 A;  2P4K A;  5IYZ B;  4LF9 B;  4DR6 O;  4IGG A;  1XNR B;  3B4S A;  2LQT A;  3CCL V;  4H44 B;  2OCC C;  1SQF A;  4LH7 A;  3TJT A;  2YEV B;  4LCU C;  3RVY A;  1K33 A;  2N05 A;  2Y0I A;  1M90 W;  1DF4 A;  2Q5Z A;  3S3W A;  4GX5 A;  2XAF A;  1X4T A;  1FAF A;  3ZHR A;  4CH4 A;  3AK2 A;  1K73 W;  2ZR3 A;  4FM1 A;  4GUN A;  3VQV A;  4YHH B;  1YIT V;  4PDR A;  2WA4 A;  2EX3 A;  4JI0 O;  3OMA B;  1EN4 A;  4E2L A;  2F43 G;  4K3A A;  1QVG U;  2R70 A;  4PV1 B;  3UO2 A;  4PA7 A;  2IJI A;  1Y67 A;  2IJK A;  3ABU A;  1AJN A;  2HJF C;  3H1J H;  3RBZ A;  1S5L Z;  5L3C A;  4QGP A;  4R8C A;  3UT5 A;  3RVZ A;  2G38 A;  2EIL B;  3GWK C;  4X8A A;  4X88 A;  1R6T A;  1IBM O;  5L3B A;  2D2C B;  2UXD O;  3P30 A;  4G28 B;  1TVK A;  2CGO A;  2W0F C;  3ZS8 C;  1JX9 A;  4RWU A;  1L1F A;  2YIA A;  1BHA A;  1KBH A;  4U3J A;  1FYJ A;  4QE7 A;  3OGI B;  1FFX B;  1B04 A;  4O2A B;  3ZMT A;  2JGD A;  4JI1 O;  5EBM C;  1OCC C;  4P2Z A;  4JYC A;  3M8A A;  1VP7 A;  3L75 H;  2PYL A;  5E1A C;  4PA3 A;  1DGS A;  1EN5 A;  2RMK B;  1IDS A;  3LDC A;  5IY5 C;  4B7E A;  3E22 A;  1R3L C;  4TV8 A;  2H8P C;  4I7Z B;  1H2N A;  2IU3 A;  1J95 A;  4HNA A;  4TOI A;  5L3D A;  1S77 D;  3RYC B;  4J41 A;  4FM2 A;  3ZIA G;  2YI8 A;  4JV5 B;  3C3T A;  2CAZ C;  4JI3 O;  1YIJ V;  1QCE A;  3N27 A;  5KHI A;  3Q4H A;  4UV9 A;  2WA3 A;  5JQG B;  1ZL8 B;  2Z3Y A;  2DYS C;  2K1E A;  4LR3 A;  3A0H Z;  3LDE A;  4D7S A;  3IGA C;  4PDM A;  4MTX A;  2EIM C;  2DQ3 A;  3HR0 A;  3ZED A;  4NYK A;  5JH7 B;  1XL4 A;  2X6A A;  4K8X A;  4DV7 O;  1TGO A;  4U3F H;  3ZRW A;  1K34 A;  2ZE8 A;  3JAK A;  1PL0 A;  1KKD A;  3P3N A;  3WB1 A;  3K58 A;  3C90 A;  1WP7 A;  5CBG A;  4UCS A;  2RN9 A;  4JI2 O;  3QNE A;  3P32 A;  4DR3 B;  1TUB B;  4O4L A;  1MA1 A;  4CS4 A;  4I55 A;  1RM1 C;  4O2B B;  1NR1 A;  3LSU A;  1D2D A;  3N2G B;  3CS5 A;  2EZO A;  3CRR A;  4GX1 A;  4J7J A;  2ADP A;  3D36 C;  3ZMS A;  1MMM A;  1EN6 A;  2LFR A;  3FAV A;  1SER A;  1XIL A;  5CA0 B;  4U7N A;  1GAX A;  1XMQ B;  2ZE5 A;  1SF9 A;  3ABM C;  3MAQ A;  2ZNJ A;  3CD6 V;  1FFT B;  2KB1 A;  4I50 B;  2UUC B;  4LF9 O;  4FPP A;  2P67 A;  2JEX A;  5LYJ B;  2QWQ B;  5JCO C;  2GSM B;  4IL6 Z;  4B3T B;  2JDI G;  3L72 H;  4X20 B;  4YIP A;  2XHB A;  3THO A;  1GH6 A;  2QKC A;  3SDL A;  2W6I G;  3D36 A;  3AG4 B;  4I4T B;  4Z2W A;  2JGU A;  4OPA A;  3QTC A;  4CH3 A;  3AK3 A;  4PEL A;  1VQN V;  3D8C A;  4NTX A;  2DQ0 A;  4OGQ B;  5B1B C;  4LWS A;  5J9P C;  4MT8 A;  1RFY A;  4YJ2 A;  5LOV B;  2ZQM A;  3RYI B;  2NN4 A;  5JVD B;  4N23 A;  5JCO A;  4X65 O;  2EIK B;  4LP8 A;  5CN0 A;  3QF7 A;  5IYB O;  4IIJ B;  4LFB B;  5HFL A;  2ITC C;  2DMX A;  1XOU A;  3VQW A;  4KL1 A;  4B3M B;  2XND G;  4DV6 B;  3JD1 A;  2Q7H A;  4O4I B;  4LFC B;  4DV4 O;  3T1H O;  3ASN C;  1LR1 A;  1S5J A;  1N4C A;  2BE3 A;  4JTA B;  1E1R G;  3F7V C;  4N21 A;  1VQO V;  1RPR A;  1OHH G;  5LHI A;  3IAY A;  4XDJ A;  3JD4 A;  5IJ0 B;  4UB8 Z;  4WCE V;  1WNS A;  3ABL C;  3ZN0 A;  4TV9 B;  3CCR V;  2HLD G;  2ZNI A;  2X6B A;  5CA3 A;  1H8E G;  1QR8 A;  3ETD A;  3OMI B;  5LA6 A;  2XOK G;  1B6Q A;  1AI7 A;  5LMU B;  4FLT A;  4F4L A;  1MG1 A;  3BAA A;  1AR1 B;  2PZS A;  1B3Q A;  3JAW B;  4FZ0 A;  2ZKO A;  3K9A A;  1BL8 A;  4HBN A;  4GLX A;  2AZ2 A;  5JQG A;  4CZZ A;  2DWE C;  3G4S V;  5JJJ B;  5IJ9 B;  2VQF O;  1Q8I A;  4DV5 O;  1VF7 A;  5IE9 A;  5JH7 A;  3QVN A;  3FB6 C;  1ENV A;  4A5U B;  2JIZ G;  1YTF D;  2P90 A;  4X89 A;  1SKV A;  4EFE A;  1W59 A;  5J2U A;  3ASO C;  4DR3 O;  3BY6 A;  2ZIM A;  3CP1 A;  2RQ6 A;  4BW5 A;  4W4L A;  1FJG B;  1Q90 D;  4ICG A;  1JMK C;  5KUM A;  1WJZ A;  1BZK A;  5B1N A;  2CH7 B;  4X1I B;  4QPK A;  3W7T A;  1I94 B;  5JWP A;  3CE2 A;  1IBK B;  2ZDI C;  2P22 C;  1CXZ B;  1XMQ O;  3T1C A;  2DYR C;  2QKA A;  3JAL A;  3BA8 A;  5CA0 A;  3ABK B;  3UQ8 A;  5L3E A;  4JZG A;  1N0J A;  2EIN B;  4UCU A;  2UUB B;  1OCR B;  1SZT A;  4E4E A;  4I50 A;  2PTM A;  5D5P A;  1JQ0 A;  2B9Z A;  4GKK B;  4DO2 A;  4P30 A;  5H5N A;  1L0N H;  2XAQ A;  4FFB B;  4J42 A;  2ARH A;  4AI8 A;  4DV0 O;  4ASU G;  3G80 A;  1KEC A;  1YVW A;  3SPH A;  3FYE B;  1N8R W;  5BXZ A;  1LNQ A;  3JAT B;  3J80 N;  2OCC B;  4QPJ A;  1IXM A;  4I4T A;  2WPD G;  3E8B A;  1BT8 A;  1F51 A;  4RQF A;  1TVK B;  3F5T A;  2A06 H;  2NR5 A;  5B1A C;  5GON A;  1ORQ C;  3DXR A;  4U3J B;  2EBO A;  1SRY A;  2Z0A A;  4DK1 A;  2XAG A;  3IJ4 A;  1SET A;  4LFB O;  2PY5 A;  2AZ0 A;  2JGD B;  3CPW U;  3OM3 B;  1M56 B;  3G67 A;  2GHY A;  1T5E A;  1Q7Y W;  4B3S O;  3U0Z A;  4Z1M G;  4LFC O;  3OTO B;  3ZCC A;  4FIP C;  4DK0 A;  2ZR2 A;  3EVK A;  1SQB H;  3W7W A;  4CBC A;  4JGS A;  4LC1 A;  4TV8 B;  5A9G A;  4X66 O;  2CGN A;  1SQG A;  1TUE B;  2WLK A;  4HNA B;  1KUQ A;  5LXT A;  1KP2 A;  1K7D A;  4LFA O;  4JF3 A;  3Q4H B;  3WFV A;  3SGI A;  4EKW A;  3APO A;  1PD3 A;  1OCC B;  1OJH A;  1PNM A;  3WG7 C;  2YUA A;  1VAR A;  3EFF K;  4TV9 A;  3LDD A;  4UVC A;  4LF8 O;  4OXS A;  4NVP A;  5LMU O;  3ZBH A;  1P7G A;  2XT9 A;  3WB2 A;  4R7C A;  2Q67 A;  2GV9 A;  3E8H A;  5IY5 B;  3U10 A;  4TWK A;  4FM0 A;  1YI2 V;  1VQL V;  1KQS U;  4D7T A;  1XQ8 A;  1KKC A;  1NBM G;  4JI6 B;  1YJN V;  3CSX A;  3JAK B;  4MW8 A;  5EC2 C;  1IBL B;  3JAW A;  1ZLZ A;  3KCY A;  3DSQ A;  4FFK A;  5DN6 G;  1KB9 F;  3ZRX A;  4B08 A;  1V54 B;  5CBF A;  3CRM A;  4LBE C;  1W0J G;  2Q0A A;  4O4L B;  4DR5 O;  4I55 B;  3OW2 U;  4LF5 B;  1HNX B;  2PYJ A;  3RN4 A;  1DK1 A;  4J9Y B;  3RYF B;  1R3I C;  2Q69 A;  2DYS B;  2QTS A;  1SQQ H;  1YXB A;  1Q6H A;  4JI7 O;  4UCV A;  4FLY A;  2EIM B;  3WB0 A;  4GCZ A;  4U7O A;  3K06 A;  1PP9 H;  2Q0O C;  5KUK A;  4H0L B;  5IT9 N;  1HNW B;  1FJG O;  3OAA G;  4X64 B;  1M57 C;  2RDC A;  2CTQ A;  5EYP A;  1H2M A;  2NNU A;  2YXL A;  4J80 A;  4H37 A;  1N36 B;  3B77 A;  3OUF A;  3CJH A;  4FJC C;  1Q82 W;  1M9N A;  4JYY A;  2UXN A;  4X1I A;  1YDX A;  1RM1 B;  3OT7 A;  4BW9 A;  3H1L H;  3K5O A;  1F7Y A;  1RPO A;  4P9O A;  5H6Q A;  2UUB O;  4DR1 B;  3MDS A;  4GKK O;  4HYO A;  1M4U A;  4FLW A;  2LGW A;  3TCU A;  4UXN A;  3MD0 A;  3QO7 A;  3ZMZ A;  1BE3 H;  2P4V A;  3TXS A;  4F6R B;  3ABM B;  1Q6I A;  1GO3 F;  4LWS B;  4LF7 O;  3OD4 A;  3W7X A;  4FFB A;  1JJ2 U;  4YJ2 B;  2Y69 B;  2ILM A;  4LF6 B;  3CX5 F;  1GM8 A;  4JAU A;  3JAT A;  3ZMU A;  3HKD B;  2P6J A;  5C93 A;  3CCJ V;  4QJF B;  4NB5 A;  5BR8 O;  3AG1 C;  2AW9 A;  1XDC A;  5LP6 C;  5FNV B;  2OWO A;  1SZX A;  2V1D A;  1QQC A;  2WLM A;  1S3J A;  3OR7 C;  2IW5 A;  5LBQ A;  1XMO O;  2HJD A;  4FK5 C;  5B1B B;  2K9P A;  1GMG A;  5EBW C;  2JK5 C;  1HR0 O;  4WBN B;  1S72 V;  2QKS A;  5E79 Z;  1VQK V;  4PDL A;  2LFS A;  3ZHQ A;  1IUR A;  2YXY A;  2UXB B;  2W0X A;  3A8T A;  3BEH A;  2JS3 A;  2QEX V;  4CC6 A;  1URF A;  2Z5U A;  2HR3 A;  4MTF A;  4GKJ B;  1DLB A;  3U11 A;  4B3R O;  1MAB G;  5LA6 B;  5AG2 A;  2LGQ A;  5LP6 A;  3TGU H;  1Z5W A;  1AR5 A;  2Q68 A;  1XNQ O;  1MSW D;  3ETQ A;  4UCT A;  1QBZ A;  2UXC O;  2PI5 A;  2QDO A;  1AR4 A;  1YCI A;  3VBB A;  4H13 B;  1TA8 A;  1W2B U;  2Q7E A;  1NR7 A;  1VEW A;  3ABL B;  1I5X A;  3TXQ A;  4JI6 O;  4O4H A;  2OIG A;  4FLV A;  3OTF A;  1IBL O;  2YDE A;  1OZ0 A;  2P7T C;  1M5I A;  4OX9 O;  2OCH A;  1BQZ A;  5J2U B;  5EC1 C;  1OCZ B;  5JJE B;  1VQP V;  1IZ3 A;  1HNX O;  2ETN A;  2E3C A;  2AXT Z;  1NT2 B;  1EZJ A;  3RYF A;  4BIO A;  1K92 A;  1GM7 A;  2A79 B;  3CRA A;  2FTK A;  4G2K A;  2F4V B;  4ABM A;  1N33 B;  1HNW O;  3JAL B;  4DRX B;  1EBO A;  1DTO A;  2FB5 A;  1M1K W;  2CUG A;  2E75 B;  5H6R A;  3BAB A;  3APQ A;  5IDJ A;  1SQX H;  3CME V;  1XNR O;  2FL4 A;  3WU2 Z;  2E5L B;  4I5S A;  4DXW A;  1K8A W;  4UUJ C;  2CTP A;  2ZIN A;  1BMF G;  2F23 A;  2DWD C;  1E1Q G;  4DR1 O;  4DR4 B;  4LNU B;  3ABT A;  4NKG B;  2CTR A;  3J81 N;  3FFQ A;  3ZRS A;  2MK3 A;  1S0V A;  4RO2 A;  3BRC A;  2DYR B;  4YHH O;  3CCU V;  1KP3 A;  3K08 A;  3CHX A;  4IHJ A;  4F6R A;  4JTD B;  1P49 A;  5GON B;  3DXR B;  2CDY A;  2JRI A;  2HG5 C;  2EIL C;  4X1K A;  5BMV A;  1FD9 A;  5FPR A;  4J10 A;  1TAE A;  2EJ7 A;  5LL6 Y;  3B8M A;  4WFB V;  4JZ2 A;  1NH2 D;  3CXH F;  3MHS C;  2X0L A;  4JI4 B;  2BTO A;  3HKD A;  3ICX A;  1GN4 A;  5GW7 A;  4Q20 A;  5EIB D;  5D5Q A;  2LP7 A;  3JAS B;  3BCC H;  5K1P A;  5FNV A; 
#chains in the Genus database with same CATH homology
 4P30 A;  2WLI B;  1FXK C;  2XAQ A;  2EJR A;  3ABK C;  5LGU A;  2WWW A;  3CMA V;  3R65 A;  3QO5 A;  1V54 C;  1VQ9 V;  4ASU G;  2QE7 G;  4H33 A;  3CCQ V;  5B1A B;  1KEC A;  3FB5 C;  4JPR A;  1K5Q A;  3SPH A;  3FYE B;  1OCR C;  3FKS G;  2ZXW B;  3UKM A;  1DF5 A;  5B1O A;  1N8R W;  1LNQ A;  3TET A;  1K5S A;  2OCC B;  2D3O W;  3LSS A;  4QPJ A;  3CCM V;  1IXM A;  3JD0 A;  4XDL A;  3H01 A;  2DW4 A;  2WPD G;  3E8B A;  1YTF B;  1P4R A;  1F23 A;  3FYI B;  1GK9 A;  4MTO A;  1NVP B;  4WFG A;  3VOU A;  2EIJ B;  1OCO B;  1F51 A;  4RQF A;  3E2E A;  2R9R B;  5B1A C;  2HFE C;  2OT5 A;  1NQT A;  1ORQ C;  3CCL V;  2ZXW C;  2EBO A;  1SRY A;  2OCC C;  2XAG A;  1SET A;  4HZ3 A;  2H94 A;  2YEV B;  3CPW U;  4LCU C;  3OM3 B;  2R9I A;  3RVY A;  1K33 A;  1M56 B;  2GHY A;  1M90 W;  1DF4 A;  1HWY A;  1OCO C;  4PA4 A;  1Q7Y W;  2QTO A;  1QLE B;  2IJJ A;  2XAF A;  4GX5 A;  2HKO A;  1VQ4 V;  4Z1M G;  3LUT B;  1R6N A;  3ZCC A;  1FXH A;  4FIP C;  1JVM A;  5LHG A;  1K73 W;  2ZR2 A;  2ZR3 A;  3G6E V;  3CXC U;  2B5U A;  3W7W A;  4CBC A;  3K0G A;  1NH2 B;  4JGS A;  4LC1 A;  1S76 D;  1JCH A;  3ASO B;  1YIT V;  4PDR A;  3K04 A;  1TUE B;  2WLK A;  3OMA B;  2WLI A;  1CEZ A;  4E2L A;  2F43 G;  3ZRV A;  1W0K G;  3TK1 A;  1QVG U;  1Y66 A;  3CCS V;  1G4Y B;  4WFA V;  1CP9 A;  1KP2 A;  1K7D A;  4PA7 A;  2IJI A;  2IJK A;  3ABU A;  3RBZ A;  1AJN A;  2HJF C;  4JF3 A;  1Q81 W;  1R3K C;  3WFV A;  4EKW A;  2WLH A;  5L3C A;  4KUM A;  4MVQ A;  2W6J G;  4R8C A;  1AI4 A;  2B1G A;  1ROP A;  3RVZ A;  3K0D A;  4X88 A;  2EIL B;  4L87 A;  1PD3 A;  4JYB A;  1OCC B;  4X8A A;  1PNM A;  3WG7 C;  5L3B A;  4PA9 A;  3P30 A;  2QM8 A;  4G28 B;  1YJW V;  3EFF K;  3SPJ A;  3OR6 C;  3LDD A;  1S5H C;  4UVC A;  2W0F C;  2JEU A;  2Y69 C;  1K9M W;  4OXS A;  1JX9 A;  1VQ6 V;  2Y48 A;  1L1F A;  1BHA A;  3HB3 B;  4R7C A;  2Q67 A;  3E8H A;  4YXW G;  4MVR A;  4QE7 A;  5IY5 B;  2B1I A;  5LGT A;  4TWK A;  3ZJZ A;  1YI2 V;  1VQL V;  1KQS U;  3ZMT A;  2YEV A;  1NBM G;  4GX0 A;  1OCC C;  4P2Z A;  5EBM C;  3AG3 B;  4JYC A;  1YHQ V;  1YJN V;  3SPC A;  1Y4M A;  4MW8 A;  5EC2 C;  2ATK C;  2CK3 G;  3SPG A;  2JJ2 G;  4WF9 V;  1PNL A;  1R3J C;  3OGC C;  5E1A C;  2A0L A;  3ML0 A;  4PA3 A;  5DN6 G;  5L3G A;  3ZRX A;  1V54 B;  5IY5 C;  3LDC A;  5CBF A;  4LBE C;  1W0J G;  1R3L C;  1V55 B;  1G8M A;  1EFR G;  2H8P C;  1FXV A;  3CC2 V;  3OW2 U;  2BOC C;  3OEE G;  1GM9 A;  2IU3 A;  1J95 A;  4J9Y B;  1R3I C;  2Q69 A;  2DYS B;  3GB7 C;  5L3D A;  1S77 D;  3CC4 V;  3ZIA G;  2EIM B;  3LNM B;  3RW0 A;  1YIJ V;  2EZP A;  4GCZ A;  5L3F A;  4U7O A;  1QCE A;  4KP4 A;  1V55 C;  3K06 A;  3JCZ A;  4UV9 A;  5KUK A;  2ZDI A;  1COW G;  3OAA G;  1M57 C;  3AEI A;  2Z3Y A;  1H2G A;  2DYS C;  2V7Q G;  2K1E A;  2NNU A;  4H37 A;  1VQ5 V;  3LDE A;  3IGA C;  4MSW C;  1I5Y A;  2XAJ A;  3B77 A;  3OUF A;  4PDM A;  4MTX A;  1SES A;  2EIM C;  4FJC C;  2DQ3 A;  5BZB A;  2PI4 A;  1Q82 W;  1M9N A;  3AG2 B;  2UXN A;  4BIZ A;  3E83 A;  3E86 A;  1Q86 W;  4PA6 A;  1XL4 A;  2X6A A;  1AJQ A;  1RM1 B;  3ZRW A;  4ZKI A;  1QR9 A;  1K34 A;  1PL0 A;  5H9C A;  3SJQ C;  1KKD A;  3JD3 A;  3G71 V;  1RPO A;  2AHY A;  4P9O A;  1FXK A;  5H6Q A;  3SPI A;  3E8G A;  5CBG A;  2X6C A;  3T2M A;  3QNE A;  3AG2 C;  3P32 A;  4HYO A;  4R6Z A;  4I9W A;  1AI6 A;  4QIW F;  3TCU A;  4UXN A;  3MD0 A;  3QO7 A;  3ZMZ A;  1RM1 C;  4JAS A;  1GTO A;  3OFN G;  1NR1 A;  3CYO A;  3ABM B;  5LGN A;  1K97 A;  1WPX A;  1ZWI C;  1GO3 F;  4MW3 A;  3CC7 V;  4WFH A;  1OCZ C;  2HVK C;  3WG7 B;  2EZO A;  3W7X A;  4GX1 A;  4MVU A;  3JYC A;  1JJ2 U;  2AHZ A;  3ZMS A;  3AG1 B;  3ZMV A;  2Y69 B;  5HFM A;  2LFR A;  3JD2 A;  1SER A;  1GM8 A;  3IFX A;  4JAU A;  4U7N A;  4J9Z B;  4UVB A;  3ZMU A;  3NXS A;  4MTG A;  1XL6 A;  3ABM C;  3CCV V;  1PKX A;  3CD6 V;  1FFT B;  2KB1 A;  2P6J A;  5C93 A;  3CCJ V;  4QJF B;  4FPP A;  2P67 A;  2JEX A;  4TSF G;  3AG1 C;  3K3W A;  1AI5 A;  2GSM B;  2V1D A;  3FB7 C;  2JDI G;  1S3J A;  2WLM A;  3E8F A;  3OR7 C;  2IW5 A;  3ZN1 A;  5LBQ A;  2JJ1 G;  4RAI A;  3ETG A;  3FB8 C;  4FK5 C;  1NVP D;  3M99 B;  3EHB B;  4QE9 A;  5B1B B;  1GMG A;  5EBW C;  2YSU B;  2JK5 C;  2W6I G;  3D36 A;  3AG4 B;  1S72 V;  2QKS A;  3OMN B;  2WLJ A;  2WLN A;  4UVA A;  1VQK V;  3W7S A;  4TT3 G;  2WLL B;  4PDL A;  2LFS A;  1FS0 G;  4MVZ A;  4PEL A;  1VQN V;  1VQ7 V;  3K03 A;  3ETE A;  3BEH A;  2QEX V;  2DQ0 A;  4JTC B;  2Z5U A;  3E35 A;  3HPL C;  5B1B C;  4ZBM A;  2QM7 A;  2HR3 A;  1F4N A;  2C2A A;  4G27 B;  4MTF A;  5J9P C;  3DGE A;  1M57 B;  1DLB A;  4MT8 A;  1MAB G;  1NKD A;  5KA6 A;  3AG4 C;  2ZQM A;  4MVS A;  1BHB A;  4N23 A;  1K3E A;  2EIK B;  4LP8 A;  2WAM A;  2IU0 A;  5CN0 A;  4XBF A;  5IYB O;  3OE7 G;  2Q68 A;  5HFL A;  2ITC C;  1QLN A;  4BAY A;  1MSW D;  2XAS A;  2QA4 V;  2X7R B;  2UXX A;  1QBZ A;  2PI5 A;  2XND G;  3MHH C;  1GKF A;  3JD1 A;  3VBB A;  3ASN C;  4KFM A;  1W2B U;  2EIK C;  1NR7 A;  5B3S B;  1YJ9 V;  3ABL B;  2M7W A;  1I5X A;  4JTA B;  2HVJ C;  4P9P A;  1E1R G;  2EIN C;  3F7V C;  4MS2 A;  4N21 A;  4QNH B;  1VQO V;  1WLE A;  2ZD9 A;  4JAV A;  5EBL C;  1RPR A;  1OZ0 A;  1OHH G;  2P7T C;  5LHI A;  4XDJ A;  1KD1 W;  3JD4 A;  5EC1 C;  1OCZ B;  2WLL A;  1UJW B;  1VQP V;  2IH3 C;  4WCE V;  5B3S C;  3ABL C;  3ZN0 A;  5IYD O;  5KA5 A;  3CCR V;  2HLD G;  3F7Y C;  1P7B A;  1R73 A;  3PJS K;  1THZ A;  2X6B A;  5CA3 A;  1EZJ A;  3IC7 A;  3OUS A;  3SYQ A;  1H8E G;  4WFE A;  1QR8 A;  3ETD A;  3OMI B;  1PNK A;  1K92 A;  2XOK G;  1GM7 A;  1B6Q A;  5EK0 A;  2A79 B;  1AI7 A;  1YSC A;  4F4L A;  3B8N A;  5LHH A;  1MG1 A;  2FTK A;  4G2K A;  1JOY A;  2EIJ C;  4PDV A;  1AR1 B;  3QO8 A;  3K9A A;  1BL8 A;  3UM7 A;  4R50 A;  1EBO A;  2XAH A;  1DTO A;  1E79 G;  2OTJ V;  1CPY A;  4CZZ A;  2IH1 C;  1M1K W;  2DWE C;  3G4S V;  5H6R A;  3SYP A;  1QVF U;  5IDJ A;  2ITD C;  3CME V;  1M56 C;  3OEH G;  4RUF A;  2WSS G;  3D3I A;  3STL C;  4I5S A;  5FL7 G;  2BOB C;  1QLE C;  3CCE V;  4DXW A;  1K8A W;  4UUJ C;  3SYA A;  3FB6 C;  2A9H A;  1ENV A;  3KG2 A;  1BMF G;  3X2Q B;  1K4C C;  2JIZ G;  1VQM V;  2DWD C;  4WFF A;  1E1Q G;  1YTF D;  2P90 A;  4X89 A;  4GT1 A;  4HAM A;  3ASO C;  3SYC A;  3BY6 A;  3ABT A;  3CP1 A;  3K79 A;  3ZRS A;  4MVM A;  4XDK A;  2MK3 A;  1S0V A;  4RUE A;  4RO2 A;  2DYR B;  4BW5 A;  3I56 V;  3DTU B;  5CMU A;  3CCU V;  1KP3 A;  3T4D A;  1VQ8 V;  2Q6A A;  3K08 A;  5KUM A;  3X2Q C;  5B1N A;  1K4D C;  3F5W C;  1JPX A;  4JTD B;  4QPK A;  3A0R A;  3W7T A;  3STZ C;  3SYO A;  1KC8 W;  2ZDI C;  1H8H G;  2HG5 C;  2EIL C;  3ZRW B;  3LSQ A;  1MOF A;  4UV8 A;  3W7U A;  3T1C A;  3ASN B;  2DYR C;  5DM6 V;  1FXK B;  3B8M A;  3E89 A;  3ABK B;  4WFB V;  1NH2 D;  4BIU A;  2IJH A;  4FMT A;  5L3E A;  2NLJ C;  3MHS C;  2X0L A;  2OTL V;  1F4M A;  2EIN B;  5CBH A;  4MVO A;  1NJI W;  1OCR B;  1SZT A;  5GW7 A;  4Q20 A;  1JQ0 A;  1R6K A;  3GWO A;  3AG3 C;  3I55 V;  1ARO P;  4RQE A;  1AJP A;  4DO2 A;  5IYC O;  2LP7 A;  3T4Z A;  1H38 A;  4GX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...