4WFHA

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
253
Chain Sequence
b'RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 98
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfhA00
3PJSK 5CBGA 1S5HC 3SYPA 4WFFA 1M57C 3LDEA 4LCUC 2Q67A 4H33A 4WFGA 5J9PC 4PA6A 3GB7C 4XDLA 2A0LA 2DYSC 3ASNC 4ZBMA 2WLMA 3AG1C 3K04A 3OUFA 4RUFA 2R9RB 3K0DA 2AHYA 3STLC 2QTOA 4RUEA 4GX1A 2QKSA 3AG4C 3F7YC 4CBCA 4QNHB 3RVZA 2NLJC 5B3SC 3X2QC 4GX5A 3RVYA 4QE9A 4P9OA 3RBZA 3SPGA 3K0GA 2JK5C 4MVZA 3LDDA 1OCCC 3UKMA 3IGAC 3F5WC 4DXWA 5KUKA 1OCRC 3K03A 5EBLC 3TCUA 4F4LA 2EIMC 4KFMA 2K1EA 4MS2A 2EIKC 3SYOA 2WLLA 4MW8A 4LBEC 4P30A 5EBMC 4EKWA 1KKDA 3T2MA 4R50A 4J9ZB 4HYOA 4JTAB 1K4DC 3OR7C 4JTDB 5BZBA 3IFXA 3ZRSA 2BOBC 3VOUA 2HJFC 2WLIA 2ZXWC 1V55C 2Q69A 4P9PA 4PDLA 3SJQC 3AG2C 3T4ZA 4QE7A 2EINC 4I9WA 3AG3C 4H37A 4MVUA 4R7CA 3FB5C 3T4DA 4X88A 5CBFA 3SPJA 1V54C 4G28B 4UUJC 4JTCB 4WFEA 3E83A 1JVMA 2WLHA 2W0FC 5B1BC 1ORQC 1XL6A 2EILC 2H8PC 4GX2A 2A79B 3K08A 4LP8A 2HFEC 4MSWC 4PDMA 3JYCA 3E8HA 4MVQA 2HVJC 5EC2C 4MTGA 3E8BA 1J95A 5B1AC 2ITCC 1R3IC 1OCOC 5E1AC 3SPIA 3OUSA 1BL8A 3ABMC 4X8AA 3ZJZA 4PDVA 2ITDC 3FB6C 2IH1C 3SYQA 5KUMA 3SPCA 4R6ZA 4X89A 3KG2A 4MVOA 3K06A 2WLJA 4XDKA 2X6AA 3LUTB 3OGCC 1M56C 3WG7C 3F7VC 4PA3A 3LNMB 4MVRA 2DWEC 4G27B 2A9HA 2HG5C 4MVMA 3SYAA 4XDJA 3EFFK 4PA7A 2HVKC 4MTOA 3SYCA 5EBWC 5CBHA 2WLLB 2X6CA 3BEHA 5EK0A 3LDCA 3E8GA 2ZD9A 5EC1C 2Y69C 2AHZA 3ABKC 2X6BA 4PA4A 4R8CA 3RW0A 1P7BA 2WLIB 1G4YB 3OR6C 1R3LC 2EIJC 2YEVA 3FB7C 4MTFA 3E86A 5IY5C 2Q6AA 4BW5A 2DYRC 2Q68A 1R3KC 1QLEC 2ATKC 4GX0A 4PDRA 4OXSA 1LNQA 3UM7A 2P7TC 2WLNA 4HZ3A 3E89A 2OCCC 1R3JC 3ASOC 4J9YB 4MW3A 3R65A 3FB8C 1ZWIC 2IH3C 1OCZC 2DWDC 3SPHA 4TWKA 3STZC 2KB1A 4WFHA 3E8FA 1XL4A 3HPLC 4PA9A 3T1CA 3ABLC 2BOCC 1K4CC 4RAIA 2WLKA 4MVSA 4P2ZA 4RO2A 3TETA
chains in the Genus database with same CATH superfamily
2XOKG 4TV9A 2D3OW 1XNRB 1JX9A 1Q7YW 2P90A 4LF4O 4GYCB 2MK3A 1GM8A 2VRZA 4ZBMA 3OUFA 4JI2O 2XAGA 4I4TB 4Q6GA 2Y4TA 3OFNG 1TVKB 1Y76B 1D5NA 4DW1A 1RP3B 5J2TA 2VS0A 3H1IH 4IHJA 5IJ0A 2AGAA 3OEEG 1TUBA 2ZM6B 4JI5O 1GN6A 2B1IA 1N32O 4GT1A 1Q6HA 1IBKO 4FLYA 2IJJA 4MW8A 5A9GA 5IYBO 4GCZA 2WLIA 1PL4A 3VQVA 4I9WA 3CCLV 4O4HB 1K7DA 4WFEA 3C90A 3O9OA 2W0FC 3JATA 5B1BC 2A79B 4F6RB 4X1KB 2ARHA 1ZUQA 4NVPA 2WSSG 2Y48A 5KHKA 4DR5B 3ASNB 4JYYA 2ZT9B 1K97A 1SRYA 1YF2A 1FKAO 1S5LZ 5DEDA 1P7GA 4FVMA 4O4LB 5BMVA 1E79G 3LSQA 1OCRB 4NTYA 4ASUG 3D36A 1QQCA 4GUNA 2PYJA 2WLLB 5LGTA 1J5EO 1HNXO 1BQ0A 1G4YB 4EFEA 1R3LC 2YEVA 1SQGA 5JJEB 1HR0O 1PKXA 5CN0A 2JEXA 1VF5B 1LNQA 3EHBB 1SQBH 3K58A 2FTKA 3J7AU 3FX7A 2YXHA 5LMUO 2ZR2A 3FAVB 2XHBA 3ZRXA 4FLUA 3HKEB 1H38A 1VF7A 2QKCA 3BPZA 1M56B 2UU9B 1WLEA 4LCUC 1BHBA 1X4TA 4B08A 1FJGO 2XUMA 2OTJV 3ASNC 1SQFA 2FB5A 1I0HA 2AHYA 4ZI7B 4HAMA 5EYPA 4GX5A 2XAQA 2P4VA 3WB0A 2Q7GA 1NJIW 4MVZA 4LF4B 3OM3B 1OCRC 4JI2B 1HW7A 2CTWA 4I9QA 4KP4A 1WN7A 4EKWA 5LHGA 5LHHA 2BCCH 3KCYA 4BR6A 4GLXA 1T5EA 4UB8Z 4TT3G 1XQ8A 2YIAA 5L3CA 1N32B 2QM8A 4UUJC 4NXNO 3E83A 3W7SA 4YIPA 3E8HA 2GV9A 2LW1A 1WNSA 5DM6V 1AJQA 1VQ7V 4G2KA 1FPOA 1MZFA 1FXKA 3UO2A 2X6AA 1M56C 4L87A 4O4JB 1B3QA 2M6YA 4MVRA 3R66A 3ABLB 1E1RG 2Q7EA 3SYAA 2HVKC 3T1YO 5L3GA 5B1NA 1R6KA 3RYCB 3CCVV 1K3EA 3IC7A 2Z3YA 4BIOA 1PD3A 4DRXB 1MSWD 1NR1A 1D5AA 3G67A 1H8EG 1W0JG 5LMNO 4JV5O 3ZRVA 2DOSA 1J5EB 1F4MA 1CP9A 4YY3B 4AILC 3RT3C 3JAKA 1HNXB 1XNQO 1HR0B 3EXAA 2Q9LA 5GONB 3U10A 3SYPA 3MHHC 2IJIA 3QVNA 2CTRA 1KMIZ 2Q0OC 4NR1A 2JRIA 2OT5A 5LMUB 4PI0A 4CS4A 2UXCO 1YSCA 1L0NH 1THZA 1WJZA 2JK5C 2YIDA 1Q81W 1IZ3A 2Q7HA 1QBZA 2ZDIA 4JTDB 5ITZB 1OCZB 3IFXA 5KMGA 3SJAC 4JI3B 1KC8W 5H5NA 1FXHA 3FB5C 1GM9A 4CH5A 4TOIA 2G38A 1NKDA 2Q8VA 4UVBA 3T1HB 4MSWC 1G6UA 2ZE8A 4IYIA 2OIGA 5IT9N 1WA8B 3AK1A 3AK2A 4BWAA 4LF8O 4GKJB 4NXNB 4R6ZA 2XAHA 4UCOA 1YHQV 1ZAUA 2EZOA 1HWYA 1MZEA 4LR3A 4YHHO 3P32A 3KKYA 5JJJB 2YSUB 2DQ0A 4MVMA 4EB6B 4RQFA 2UUAO 5H2FZ 1Y74A 3BEHA 5EC1C 1JQ0A 3ICXA 5EZYA 4PA4A 3RW0A 1F23A 3AG2B 5LP6C 4PELA 4A5UB 2GUZB 4J7KA 4I0XB 3T1YB 5KAFZ 5JQGB 1R3JC 4MW3A 5CA1B 1OCZC 3ZCCA 1MSDA 2KB1A 4OPAA 4BIZA 2JJ1G 3K79A 4WFAV 4GZRB 3HPLC 3UT5B 2ETNA 1K4CC 3SJBC 4O2BB 5LMNB 4JV5B 1K9MW 1M57C 4FPPA 3CEIA 1N0JA 4FFBB 1XNQB 2DYSC 1EBOA 1B04A 5AG2A 4K0KO 3NXSA 2ZKOA 2QTOA 4RUEA 4JASA 2UXBO 5D5PA 3ABTA 3HKBA 1AROP 1NH2B 5L3BA 2FYUH 4X66B 4DV7B 3T2MA 1SF9A 3MDSA 4KXRA 3A0BZ 5K1XA 1S72V 3AG2C 2EINC 3H1HH 4FMTA 2DW4A 5J2UB 2OIEA 1ORQC 2WPDG 1NH2D 4MVQA 1COWG 4FM0A 1BMFG 1JJOA 4CH4A 1ENVA 1QR9A 2ITDC 3AG7A 2VWJA 3OMIB 5B3SB 2YICA 3DC5A 3ABUA 3F7VC 4DV6O 2UUCB 3APQA 4YJ3B 1Z2GA 2F66C 1W2BU 3RN4A 3RYFB 4YHHB 3BCCH 2XT9A 4X1YB 3E86A 5IY5C 5TISZ 4OXSA 1BQZA 1NZ6A 1I94O 3E89A 4J9YB 1AR4A 4D7SA 4I50A 4LC1A 2BTOA 2GDSA 5B1OA 3STZC 2LGQA 5FNVA 3JASB 2XAJA 4YXWG 3HKCA 1DK1A 1HP8A 1XMQO 1JR9A 2Q67A 4WFGA 1YEWA 5JH7B 2XAFA 1I5XA 3K04A 1YVWA 2YS8A 4LFBO 2A3QA 1VMGA 2CGNA 4CBCA 4OX9O 4ICGA 5B3SC 3OGIB 4PV1B 5BY1A 1XNRO 1FAFA 4DK0A 3SPGA 3DTUB 2QJ1A 4FLZA 1SS3A 4QPJA 1Y6XA 3OTOB 3CRAA 5IYZB 5EBLC 4K0KB 3KCXA 4YJ2B 2OCCB 4N21A 4JI1B 4O2AB 1GKFA 5IJ9A 3QO7A 2DE0X 2PI5A 3ZN1A 4CC5A 3ZHTA 4JAAA 2EJ7A 5B66Z 3SPJA 1V54C 3ZRWA 3L75H 3RYIA 3G4SV 4JI7O 3CWBH 4H0LB 2HKOA 3JAWA 4Q20A 2RN9A 1R3IC 3G6BA 5E1AC 4WBNA 1L8DA 3W7TA 4X20B 3K9SA 3KG2A 3AG4B 2ZR3A 4XDKA 3LUTB 4DR5O 1AI4A 1V9PA 2EIMB 3EFFK 3SR2C 3B8MA 3H1JH 1N36O 1N4CA 5CBHA 1DTOA 3E8GA 1GRJA 2ZD9A 3ABKC 1ZSPA 2AW9A 2R9IA 4MTFA 2ZQMA 3ETGA 1FFXA 2VWKA 1VQMV 4B3MO 3A2FA 2E5LO 2RCVA 2OCCC 3CJHB 3R65A 3JALA 4JYBA 1SQQH 2CH7A 4JYAB 5FL7G 2ZINA 1GTOA 1O9GA 3VQYA 3T1CA 2PUSA 4U3FH 4LWSA 1I94B 3BABA 3PJSK 3WG7B 2QSAA 3CX5F 2DQ3A 1NVPB 4PA6A 3W7XA 2QWPB 1M93A 4RUFA 1YCIA 3B8NA 1DF4A 1LR1A 3AG4C 3F7YC 1YZBA 4TV8B 4JI4B 2V4DA 4HNAB 1TAEA 1TUEB 3TXSA 3CRMA 1MABG 2EIMC 4LFBB 2W0XA 5EBMC 4OX9B 1VF6C 1KKDA 4DYLA 2KG7A 1NVPD 2GTAA 2BOBC 1PL0A 5LHIA 2JVDA 4CH6A 4ABMA 3BVOA 1U96A 5CA0A 4BIUA 4AQYO 2YDEA 1M5IA 3N2GB 1QR8A 3LSUA 5D5QA 1PPJH 3B40A 2BSKB 2M7WA 1AP6A 4ZOLA 4CS3A 4U3JA 2H3OA 2F93B 1F51A 4JI7B 3K5LA 5KHGA 3WG7C 5IWAB 2EX3A 1TGOA 1DF5A 1ROPA 3CCMV 2HG5C 3JCUZ 2N05A 3CCQV 3E22A 1PNKA 1NI8A 4X62O 4QGPA 1Q3EA 5DECA 1VIBA 1X59A 2R70A 2YI8A 3SJCC 2EIJC 1MOFA 5JJNB 1N36B 4X64O 4B7KA 3FB8C 3RYHA 2PI4A 4RWUA 3O65A 4FZ0A 1IXBA 1AJNA 2LFSA 1GAXA 2VQEB 2EJRA 3G71V 4B3MB 4QPKA 1E1QG 4IYHA 2E5LB 2IBZH 4P2ZA 3BFRA 3OE7G 4YY3O 1N33O 1AJPA 4WCEV 2ZDIC 2A0LA 2ZNIA 2A7WA 2WLMA 3FD9A 2E74B 1UPGA 3J80N 4O4IA 5BXZA 3CYOA 1SQXH 3M99B 2CTPA 3LDDA 5LXTB 1TA8A 3K03A 2CAZC 1XBLA 3UQ8A 1VARA 2ZE6A 3E35A 2ZE7A 4J9ZB 5LYJA 3K57A 4DUZO 3WB2A 5JVDA 3JD0A 3SJQC 1H8HG 1P49A 3RWRD 4Z1MG 4BW9A 2NNUA 3BA9A 2PTMA 2WA3A 1AVMA 1ZL8A 1NU1H 4JI3O 2HVJC 4J80A 1DGSA 4X1IA 1R6NA 2CK3G 2LJ2A 1PNMA 4W4LA 1Q8IA 3ZJZA 2IH1C 1WB7A 5KX5B 3T1HO 4AQYB 4JPRA 2WLJA 2UXNA 1JA8A 1SA0A 1JPXA 3W7UA 3HB3B 2GSMB 4WF9V 4GKJO 2RNBA 1IXMA 2QWOB 3I55V 3ETQA 1JFFA 1NQTA 1VQ5V 1GO3F 2X6BA 3Q4HB 1RSOB 1QCEA 4IIJB 4FLXA 2Q6AA 3QF7A 2HJDA 1NTMH 4ZHQB 4LFCB 3GWOA 4I55B 4X62B 4K8XA 2N04A 5LOVA 3C3TA 4X64B 4WFFA 2PY5A 3D3IA 3LDEA 4H33A 1BSMA 1SZXA 4OGQB 4LF9O 3S3XA 4J10A 5LGUA 1M9NA 1AI5A 1JMKC 5KAIZ 1GH6A 4YIOA 3VQXA 1Z5VA 1N33B 3RBZA 1K34A 3IGAC 3N2KA 4KUMA 3I5DA 4DV3B 4E2LA 4P30A 3CB2A 3HKDB 3ZHSA 1GM7A 4UCRA 2JGDA 3DGEA 1XMOO 4CS2A 4X66O 4DV7O 1AR5A 2LQTA 3ML0A 1OV9A 1SZTA 3ETEA 2BTQB 1XL6A 1MA1A 3JCZA 3JYCA 4DUZB 4MTGA 1VQ4V 1AI6A 5LP6B 2HHHB 2HP8A 5C8YB 4LNUB 4PDVA 3A0HZ 5LA6A 5CB4A 2JEUA 4XBFA 2ZCEA 1H2SB 1BT8A 2JS5A 3BRCA 3CP1A 3L72H 4JI6O 2YIBA 5LBQA 2L6LA 4DV4O 3OW2U 3E2EA 3JD3A 3U11A 4I4TA 5LL6Y 2OWOA 3SYCA 2P5OA 1TVKA 2FL4A 1M57B 1Y76A 5LGNA 3LNNA 2AHZA 2UUCO 2ZXWB 2DYSB 4FFKA 3S3WA 2ZIMA 1FXVA 3CMAV 5KLVH 2Q68A 4DW0A 1IURA 3DXRB 2LGWA 3ZIAG 1W0KG 4LF7O 2EILB 5IYDO 2CE4A 4UCVA 3SPHA 4TWKA 4O4HA 4DV2B 2WLKA 2NN4A 4F6RA 4X1KA 3L9DA 1FYJA 2EINB 1YDXA 1R73A 3L71H 4K8ZA 4B3RB 1F7YA 2CTQA 3JARB 4D7TA 2LP7A 3QG5A 2V1DA 4AI8A 4QNHB 3X2QC 3CXHF 5KHJA 4O4LA 1EN4A 2Y69B 2QGNA 1PNLA 3CC2V 4LF9B 1Y4MA 1K33A 2KSDA 2Z0AA 2WLLA 4DR2O 1K4DC 3OTOO 2ZXWC 4ZIBA 4X9QA 4NXMO 3H1KH 2KKWA 4NTXA 1HNWO 1MNGA 2JJ2G 1KUQA 4JI1O 5FPRA 2WLHA 4UV8A 2EILC 3K08A 4FIPC 2ODMA 4TV9B 2F4VO 4QIWF 5IY5B 1XMOB 3SPIA 2RDCA 3FAVA 3HKEA 3K06A 4DR7O 2PGGA 3I56V 3CC7V 5J2TB 4UCUA 1EZJA 3K5OA 4IHJB 5IJ0B 1TUBB 4ZI7A 3H1LH 3ZMUA 1IDSA 5L3FA 1H2KA 4JI6B 2Y69C 4EEQA 2E3CA 1V55B 2AZ0A 2WLIB 4DV4B 2KQXA 2P7TC 2P4KA 1NBMG 3JATB 1KB9F 3WB1A 2X0LA 5B1AB 1QVFU 3CS5A 3ABMB 4PA9A 3PN1A 5KHHA 3ZMZA 2V7QG 4LF7B 5CBGA 1Q6IA 4JYAO 1XUQA 5J9PC 5BMVB 3BAAA 3GB7C 4XDLA 1V54B 1CPYA 2IU0A 5B5EZ 2QKSA 3VBBA 3FYEB 4O4JA 2E75B 3K0GA 3D8CA 3UCSC 4J7JA 3F5WC 2YEVB 4KFMA 1L1FA 1BHAA 1NT2B 2K9PA 3ZMVA 1IBLB 3RYCA 4JI4O 4DRXA 1AI7A 2HJFC 4PDLA 1V55C 2N74A 1NTZH 3T4ZA 1SETA 4X88A 1Q82W 2F23A 2WWWA 4JTCB 4PHZA 4FM2A 3BHPA 4DR2B 1Q6UA 3ABKB 5B1AC 1XDCA 2ITCC 2YXYA 4NXMB 1WPXA 3ABMC 4IL6Z 3APOA 4Z2WA 1HNWB 5GONA 1R1BA 5C93A 5EYPB 3OGCC 4PA3A 3LNMB 4UCTA 2F4VB 1OCCB 2Y0IA 2ADPA 1YI2V 4PD4F 1R6TA 3D36C 4PA7A 5EBWC 4QJFB 1YJ9V 3GVMA 3TXQA 1RFYA 3A8TA 4DR7B 5IWAO 2X6CA 3CPWU 1PP9H 2Q4PA 2QA4V 2QR4A 3AG3B 3ZMTA 5IYCO 4BW5A 2DYRC 3UM7A 2EZPA 3K3WA 1H2LA 3JD2A 1JCHA 5FLXN 5ITZA 3CCSV 4LF5B 1Q43A 3U0ZA 3E8FA 5JCOA 2JIZG 3WFVA 1CXZB 2GHYA 2MW2B 1N8RW 1S5HC 1FXKB 1WA8A 3BY6A 2OTLV 1KP3A 2VQEO 2R9RB 4U7OA 2DMXA 4QE9A 3H9VA 1G8MA 3MAQA 1URFA 1OCCC 3WU2Z 4EB6A 3TCUA 2EIKC 2QEXV 4DK1A 2DN9A 4LF6O 1YTFB 3JAKB 4X65B 4ZKIA 3TK1A 3AG3C 2QWNB 2GUZA 5BR8B 3FKSG 4I0XA 3M8AA 1FD9A 5JQGA 3IAYA 1G1XB 5CA1A 5KUMA 4JAUA 1KKCA 2H8PC 1NTKH 3E8BA 3JD4A 1RM1B 2EIJB 2QM7A 2LFRA 3OD4A 4J11A 5KA6A 4X8AA 3UT5A 3ZN0A 4O2BA 4TSFG 4WFBV 1QLNA 3SDLA 4B7EA 1YTFD 1WB8A 3C3SA 4U7NA 1FXKC 2Z5UA 3AK3A 2GBOA 4UVAA 3L74H 4FFBA 2XTAA 5L3DA 1IBMO 2A9HA 3OT7A 2QWRB 1SQVH 1ZLZA 5GTHZ 3CCEV 1VQNV 2ZNJA 1QNMA 1XHZA 4UFZA 5KMGB 2PF4E 2LW7A 1SQPH 3NR7A 4PDRA 3TJTA 3N27A 2OYQA 2XASA 5CMUA 1W59A 2IM9A 5H6RA 4WFHA 1ZTEA 2AZ2A 4LFCO 3G6EV 5J2UA 1JOYA 3P30A 1N34O 5HFLA 4I7ZB 2ILMA 1UFIA 2YIBD 1RM1C 3CE2A 4JI0O 4LH7A 4NKGB 3K0DA 2P67A 1QVGU 1GK9A 2WA4A 4DR1O 1Y74B 1VQ9V 1VQ8V 5EZYB 4UVCA 3B2EE 4YJ3A 3CRCA 3K5NA 1HNZB 2R9AA 3CMEV 1QLEB 2IW5A 1B06A 4B3TO 3RYFA 4HYOA 3OR7C 1KECA 1OJHA 1XOUA 4QE7A 5F2VO 4X1YA 2QM4A 4DV3O 2QDOA 1EN6A 4DR3O 4LF6B 1JVMA 1K73W 4JI8B 4LP8A 4MT8A 2WAMA 4DV0B 4TUYA 3HR0A 3JASA 1AR1B 1SESA 3AG1B 3OUSA 2W6IG 3CSXA 1YITV 3ZS8C 3MD0A 1XHXA 1WP8A 3H01A 3HKBB 2FKXA 2RJZA 4DV5O 2HHHO 4K35A 3J81N 4JZGA 5JH7A 3K9AA 4DUYO 2VQFB 3QO8A 4IT5A 4XDJA 4MTOA 2RMKB 4DR4O 1P7BA 3IJ4A 5IYZA 5A2QN 4JF3A 1Q90D 3UO3A 1IBMB 3A0RA 4YJ2A 1R3KC 1QLEC 2UXXA 4RQEA 2Q5ZA 1DLBA 1EM1A 4HZ3A 4O2AA 4CZZA 1KBHA 1K5QA 1NS1A 1OHHG 2QKAA 2RQ6A 1PV0A 4RO2A 1BE3H 4N23A 1KYOF 5IE9A 4CH3A 2PYLA 3ETDA 4X20A 4JI5B 4DV2O 3AG1C 1WP7A 3M7MX 3STLC 1Z5WA 1K5SA 4GX1A 3TGUH 2NLJC 1IBKB 4CC6A 1N34B 2W6JG 4P9OA 4EFBA 4B3RO 4JI0B 2Y4UA 3MHSC 1L0LH 1M1KW 4F4LA 1VF6A 4DR1B 1S5JA 4I50B 3ZRSA 2P6JA 3VOUA 1VQOV 4KHPO 5FNVB 5CBFA 1U97A 3HKCB 4JYCA 4B3TB 3CJHA 1Y66A 4J41A 4PDMA 3DC6A 5E79Z 2CGOA 5EC2C 4UB6Z 4UXNA 1VP7A 1MMMA 2BE3A 1UJWB 1GN3A 3B4SA 3SPCA 4TQFA 4DR3B 3ZX6A 4PI2A 1AB3A 1YXBA 2E76B 3JAMN 3EVKA 4TV8A 3CCJV 5IJ9B 4HNAA 3CCUV 4DV5B 2OCHA 2JDIG 4DUYB 2F43G 3F5TA 3X2QB 1S76D 1B6QA 3ZRWB 3RYIB 2NR5A 3B77A 1ZWIC 2IH3C 4FLTA 4DR4B 1FFTB 4BAYA 3JAWB 1FJGB 1OCOB 3P3NA 1O9HA 4WBNB 1JJ2U 3ABLC 4F6EA 2B9ZA 2BOCC 3CC4V 3N2GA 3QTCA 5GTIZ 4HBNA 1BCCH 2HR3A 1MG1A 2BSKA 4TQDA 1FS0G 2B5UA 4MTXA 1YJWV 2L35A 3THOA 2UUBO 3CCRV 3CRRA 1KQSU 2AXTZ 1CEZA 5K1PA 3GWKC 1D2DA 3L70H 4MS2A 1YJNV 1FFXB 1I08A 5EIBD 2H94A 3ASOB 4R50A 1HDJA 4JTAB 3ZMSA 5BZBA 3JALB 4J7ZA 2CDYA 2CH7B 2Q69A 2F95B 1IBLO 2Q0AA 3B09A 4FZ1A 3K5MA 1AP5A 1P4RA 3LSSA 4LWSB 4H44B 4GX2A 1IX9A 4I5SA 2JGUA 1J95A 4GKKO 4C7UA 1OCOC 4KHPB 4NYKA 1BL8A 3RFRA 1OZ0A 3FB6C 3SYQA 2QE7G 4X89A 1H2GA 4MVOA 5EIBC 2IJHA 2DWEC 1KD1W 4UV9A 3KZIZ 2JS3A 2GTSA 5CA3A 3ZHRA 5JCOC 2EBOA 4FJCC 5EK0A 3LDCA 1EFRG 2EULA 2KG7B 4R8CA 3ZBHA 5LXTA 3OR6C 4IGGA 4NB5A 3FB7C 1EZVH 5IDJA 4GX0A 4FM1A 5KHIA 4LFAO 5CA0B 3ASOC 3ZHVA 3VQWA 2P22C 2DWDC 1WAZA 4B3SO 1H2MA 1K8AW 2Y0PA 1I7FA 1SKVA 4ZOLB 4RAIA 3T4DA 4U3JB 2IU3A 4W4KA 1QU7A 2UXCB 4FK5C 3D3QA 4LF5O 1QHTA 2R72A 2CUGA 1WPBA 2UXDO 1S3JA 3IC9A 5KX5A 3BA8A 2YI9A 3E22B 3RVZA 1BS3A 5FPOA 5L3EA 1AILA 2QWQB 3UKMA 2QTSA 4DXWA 5KUKA 3FYIB 2K1EA 1VQPV 5KA5A 3SYOA 4LBEC 3QO5A 2UUBB 2Q73A 3G80A 4DV1O 3RYHB 3Q4HA 1RSOA 4P9PA 4UCSA 1P84F 3RGBA 4IIJA 1ZX3A 4H37A 3JSNA 4ZHQA 3CHXA 2LO1A 4LF8B 4I55A 5JWPA 1KU9A 3L73H 4D6TH 1RPRA 3AEIA 4LH6A 4X65O 5BR8O 2DYRB 2UUAB 2X7RB 4O4IB 4J42A 1F4NA 4H13B 1RPOA 4GKKB 3FFQA 4G27B 4JZ2A 4TUYB 2YC0A 1K92A 3W7WA 2YUAA 1VQLV 5LYJB 1EN5A 1H2NA 4PJ0Z 1S0VA 5JVDB 4NTWA 4DR6O 1N0NA 2XNDG 2ATKC 5HFMA 3ZHUA 2WLNA 3OAAG 1SC5B 3HKDA 1ZL8B 3OMAB 1NR7A 3JD1A 2P06A 4X1IB 1XL4A 2EIKB 1LUVA 1I5YA 1XI1A 1YIJV 4LFAB 1S77D 2BTQA 1M4UA 3JSLA 4JAVA 5GW7A 1VQKV 2UXBB 3OEHG 4KL1A 5LP6A 2ZIOA 2D2CB 4B3SB 5H9CA 1SA0B 2ZM6O 3ZEDA 5C8YA 1XEQA 4LNUA 2B1GA 3K59A 3OTFA 4Z1VA 2A06H 3RVYA 1JFFB 1PM9A 1KP2A 3OMNB 2YXLA 1GMGA 2IJKA 2UXDB 1VEWA 4L8JA 3SGIA 3DSQA 2HLDG 1IVSA 1HNZO 4DO2A 2FMLA 4MVUA 4R7CA 5LOVB 4G28B 3DXRA 1M90W 4OPHA 2HFEC 4DV1B 2PZSA 3ZHQA 2DJVA 1Q86W 1VQ6V 1Q5OA 4E4EA 4DV6B 2ADQB 1GN4A 4FLVA 3CXCU 4JI8O 1Y67A 1XILA 3CD6V 4DV0O 3QNEA 5DN6G 2O57A 3N2KB 3JARA 2C2AA 3CRQA 1GN2A 1LUWA 4FLWA 2VQFO 1SERA 2JGDB 1XREA 2ZE5A 5B1BB 2UU9O 3P3PA 2HEPA 1XMQB 2F1MA 1BZKA 1BGYH 4DR6B 1US6A 4JGSA 4K3AA 4AHCA 5LA6B 5H6QA 5CB4B 4MVSA 1A32A 3TETA
chains in the Genus database with same CATH topology
4N23A 2XOKG 2D3OW 1JX9A 2Q67A 4WFGA 2EINB 1Q7YW 2P90A 1R73A 2MK3A 1GM8A 2XAFA 1I5XA 3AG1C 3ETDA 3K04A 3OUFA 4ZBMA 2XAGA 3STLC 1K5SA 4GX1A 2LP7A 4CBCA 2V1DA 4QNHB 2NLJC 5B3SC 3OFNG 3X2QC 2W6JG 4P9OA 2Y69B 3SPGA 3DTUB 1PNLA 3CC2V 3OEEG 4QPJA 2B1IA 3MHSC 1Y4MA 5EBLC 1M1KW 4GT1A 4F4LA 1K33A 2IJJA 2WLLA 4MW8A 5IYBO 2OCCB 4N21A 1GKFA 3QO7A 1K4DC 2PI5A 3ZN1A 3ZRSA 4GCZA 2P6JA 2WLIA 2ZXWC 3VOUA 1VQOV 4I9WA 3CCLV 5CBFA 1K7DA 3SPJA 1V54C 3ZRWA 2JJ2G 4JYCA 4WFEA 3G4SV 2WLHA 1Y66A 2W0FC 4UV8A 5B1BC 2EILC 4PDMA 2A79B 3K08A 4FIPC 5EC2C 2HKOA 4QIWF 4Q20A 4UXNA 2WSSG 2Y48A 1R3IC 3ASNB 5IY5B 5E1AC 3SPIA 3W7TA 1K97A 1UJWB 1SRYA 3SPCA 3KG2A 3AG4B 2ZR3A 3K06A 4XDKA 3LUTB 3I56V 3CC7V 1EZJA 1E79G 1AI4A 3LSQA 1OCRB 4ASUG 3D36A 2EIMB 3EFFK 3B8MA 3ZMUA 5CBHA 2WLLB 5LGTA 3CCJV 1DTOA 5L3FA 3E8GA 2ZD9A 2Y69C 3CCUV 3ABKC 1V55B 2JDIG 2WLIB 1G4YB 2R9IA 1R3LC 2YEVA 4MTFA 2ZQMA 3ETGA 1PKXA 2F43G 5CN0A 1VQMV 2JEXA 1LNQA 3X2QB 2P7TC 1S76D 1B6QA 3ZRWB 1NBMG 2OCCC 3EHBB 3B77A 3R65A 1ZWIC 2IH3C 4JYBA 1FFTB 2X0LA 4BAYA 5B1AB 5FL7G 1QVFU 2FTKA 1GTOA 1OCOB 3ABMB 2ZR2A 4PA9A 3T1CA 1JJ2U 3ABLC 2BOCC 3CC4V 3ZMZA 3ZRXA 2V7QG 3PJSK 5CBGA 1H38A 1BHBA 3WG7B 1M56B 1WLEA 4LCUC 5J9PC 2DQ3A 2HR3A 4PA6A 3W7XA 1NVPB 1MG1A 3GB7C 1FS0G 4XDLA 3ASNC 2OTJV 1V54B 4RUFA 1CPYA 2AHYA 2B5UA 2IU0A 4MTXA 2QKSA 3B8NA 1DF4A 3AG4C 3F7YC 1YJWV 4HAMA 3VBBA 4GX5A 2XAQA 3CCRV 3FYEB 1KQSU 1NJIW 1CEZA 3K0GA 4MVZA 1TUEB 3F5WC 3OM3B 1OCRC 2YEVB 1MABG 2EIMC 4KFMA 4MS2A 1L1FA 4KP4A 1YJNV 3ZMVA 1BHAA 5LHHA 5EBMC 4EKWA 5LHGA 1KKDA 2H94A 3ASOB 4R50A 4JTAB 3ZMSA 1NVPD 5BZBA 1AI7A 4TT3G 2BOBC 2HJFC 4PDLA 1V55C 2Q69A 3T4ZA 1PL0A 1SETA 5LHIA 5L3CA 4X88A 2QM8A 1Q82W 2WWWA 4UUJC 4JTCB 1P4RA 3LSSA 4BIUA 3E83A 3ABKB 4GX2A 3W7SA 1QR8A 4I5SA 3E8HA 5DM6V 1J95A 5B1AC 1AJQA 2ITCC 1OCOC 1VQ7V 2M7WA 1BL8A 1WPXA 3ABMC 1OZ0A 4G2KA 3FB6C 3SYQA 2QE7G 4X89A 1H2GA 5C93A 4MVOA 1F51A 1FXKA 2X6AA 3OGCC 1M56C 3WG7C 4L87A 4PA3A 2IJHA 3LNMB 4MVRA 2DWEC 1DF5A 1OCCB 1KD1W 1ROPA 4UV9A 3ABLB 3CCMV 1YI2V 1E1RG 2HG5C 5CA3A 3SYAA 4PA7A 2HVKC 2EBOA 3CCQV 4FJCC 5EBWC 1PNKA 4QJFB 1YJ9V 5L3GA 5B1NA 1R6KA 2X6CA 3CCVV 5EK0A 1K3EA 3LDCA 3IC7A 2Z3YA 1EFRG 1PD3A 3CPWU 4R8CA 1MSWD 3OR6C 1NR1A 2EIJC 2QA4V 3AG3B 3ZMTA 3FB7C 1MOFA 5IYCO 4BW5A 2DYRC 3UM7A 5IDJA 4GX0A 2EZPA 1H8EG 1W0JG 3K3WA 3JD2A 1JCHA 3ASOC 3ZRVA 1F4MA 1CP9A 3FB8C 2PI4A 3CCSV 2DWDC 3E8FA 1K8AW 2JIZG 1AJNA 3WFVA 2LFSA 2EJRA 3G71V 4QPKA 4RAIA 1E1QG 3T4DA 2GHYA 4P2ZA 2IU3A 3OE7G 1N8RW 4FK5C 1S5HC 3SYPA 3MHHC 1FXKB 1AJPA 2IJIA 3BY6A 4WCEV 2ZDIC 2OTLV 1KP3A 2OT5A 2A0LA 1S3JA 2WLMA 2R9RB 1YSCA 3RVZA 4U7OA 3CYOA 4QE9A 1THZA 3M99B 5L3EA 1G8MA 2JK5C 3LDDA 1OCCC 3UKMA 4DXWA 5KUKA 3K03A 1Q81W 3FYIB 3TCUA 2K1EA 1VQPV 2EIKC 3SYOA 5KA5A 2QEXV 4LBEC 3QO5A 1QBZA 2ZDIA 3E35A 4J9ZB 1YTFB 4JTDB 1OCZB 3IFXA 4P9PA 4ZKIA 1KC8W 3JD0A 3SJQC 1H8HG 3TK1A 3AG3C 1FXHA 4H37A 3FB5C 3FKSG 4Z1MG 1GM9A 2NNUA 1NKDA 4UVBA 5KUMA 4MSWC 4JAUA 2H8PC 1RPRA 3AEIA 2HVJC 3E8BA 3JD4A 1RM1B 2EIJB 2QM7A 2LFRA 1R6NA 2CK3G 5KA6A 2DYRB 1PNMA 4X8AA 3ZJZA 3ZN0A 2IH1C 4TSFG 4WFBV 1QLNA 4R6ZA 2XAHA 1YTFD 4JPRA 2WLJA 1YHQV 2EZOA 1HWYA 2UXNA 2X7RB 4U7NA 1FXKC 1F4NA 2Z5UA 4UVAA 3P32A 1RPOA 1JPXA 3W7UA 3HB3B 5L3DA 2GSMB 2YSUB 2DQ0A 2A9HA 4G27B 4WF9V 4MVMA 4RQFA 1IXMA 3I55V 3CCEV 3BEHA 1VQNV 1NQTA 1K92A 5EC1C 3W7WA 1JQ0A 1GO3F 1VQLV 1VQ5V 2X6BA 4PA4A 3RW0A 1F23A 3AG2B 1S0VA 1QCEA 4PELA 2Q6AA 2XNDG 4PDRA 2ATKC 5HFMA 2WLNA 2XASA 3OAAG 3GWOA 1R3JC 4MW3A 5CMUA 1OCZC 3ZCCA 3OMAB 5H6RA 1NR7A 2KB1A 3JD1A 4WFHA 4BIZA 2JJ1G 1XL4A 3K79A 4WFAV 3HPLC 2EIKB 1I5YA 3G6EV 1K4CC 1JOYA 1YIJV 1S77D 1K9MW 3P30A 4JAVA 5GW7A 4WFFA 1M57C 5HFLA 1VQKV 3D3IA 3LDEA 3OEHG 4FPPA 4H33A 1RM1C 5H9CA 2DYSC 5LGUA 1M9NA 1AI5A 1EBOA 3NXSA 3K0DA 2P67A 2B1GA 1QVGU 2QTOA 4RUEA 1GK9A 4JASA 3RVYA 3ABTA 1AROP 1KP2A 3RBZA 3OMNB 1VQ9V 1K34A 1NH2B 1VQ8V 1GMGA 2IJKA 4UVCA 3IGAC 4KUMA 5L3BA 3CMEV 1QLEB 2IW5A 4E2LA 4P30A 3T2MA 4HYOA 3OR7C 1GM7A 1KECA 2HLDG 1S72V 3AG2C 3DGEA 2EINC 4QE7A 4DO2A 4MVUA 4R7CA 4G28B 1M90W 4FMTA 3ML0A 2DW4A 1SZTA 3ETEA 1JVMA 1K73W 1ORQC 1XL6A 4LP8A 2WPDG 1NH2D 4MT8A 2HFEC 3JCZA 3JYCA 2WAMA 4MVQA 4MTGA 1VQ4V 1COWG 1AI6A 1Q86W 1BMFG 1VQ6V 1AR1B 1SESA 3AG1B 3OUSA 1ENVA 2W6IG 1QR9A 2ITDC 4PDVA 1YITV 3MD0A 2JEUA 4XBFA 3CXCU 3OMIB 3CP1A 5B3SB 3CD6V 3H01A 3ABUA 3F7VC 5LBQA 3QNEA 3K9AA 3OW2U 5DN6G 3JD3A 3E2EA 3QO8A 2C2AA 4XDJA 4MTOA 3SYCA 1W2BU 1M57B 5LGNA 2AHZA 2ZXWB 2DYSB 1P7BA 1SERA 4JF3A 3A0RA 1FXVA 3CMAV 3E86A 5IY5C 2Q68A 1R3KC 1QLEC 2UXXA 4OXSA 4RQEA 1DLBA 4HZ3A 3ZIAG 1W0KG 4CZZA 3E89A 4J9YB 5B1BB 2EILB 5IYDO 4LC1A 1K5QA 1OHHG 3SPHA 4TWKA 5B1OA 3STZC 4JGSA 2XAJA 4YXWG 5H6QA 2WLKA 4MVSA 4RO2A 3TETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJS K;  5CBG A;  1S5H C;  3SYP A;  4WFF A;  1M57 C;  3LDE A;  4LCU C;  2Q67 A;  4H33 A;  4WFG A;  5J9P C;  4PA6 A;  3GB7 C;  4XDL A;  2A0L A;  2DYS C;  3ASN C;  4ZBM A;  2WLM A;  3AG1 C;  3K04 A;  3OUF A;  4RUF A;  2R9R B;  3K0D A;  2AHY A;  3STL C;  2QTO A;  4RUE A;  4GX1 A;  2QKS A;  3AG4 C;  3F7Y C;  4CBC A;  4QNH B;  3RVZ A;  2NLJ C;  5B3S C;  3X2Q C;  4GX5 A;  3RVY A;  4QE9 A;  4P9O A;  3RBZ A;  3SPG A;  3K0G A;  2JK5 C;  4MVZ A;  3LDD A;  1OCC C;  3UKM A;  3IGA C;  3F5W C;  4DXW A;  5KUK A;  1OCR C;  3K03 A;  5EBL C;  3TCU A;  4F4L A;  2EIM C;  4KFM A;  2K1E A;  4MS2 A;  2EIK C;  3SYO A;  2WLL A;  4MW8 A;  4LBE C;  4P30 A;  5EBM C;  4EKW A;  1KKD A;  3T2M A;  4R50 A;  4J9Z B;  4HYO A;  4JTA B;  1K4D C;  3OR7 C;  4JTD B;  5BZB A;  3IFX A;  3ZRS A;  2BOB C;  3VOU A;  2HJF C;  2WLI A;  2ZXW C;  1V55 C;  2Q69 A;  4P9P A;  4PDL A;  3SJQ C;  3AG2 C;  3T4Z A;  4QE7 A;  2EIN C;  4I9W A;  3AG3 C;  4H37 A;  4MVU A;  4R7C A;  3FB5 C;  3T4D A;  4X88 A;  5CBF A;  3SPJ A;  1V54 C;  4G28 B;  4UUJ C;  4JTC B;  4WFE A;  3E83 A;  1JVM A;  2WLH A;  2W0F C;  5B1B C;  1ORQ C;  1XL6 A;  2EIL C;  2H8P C;  4GX2 A;  2A79 B;  3K08 A;  4LP8 A;  2HFE C;  4MSW C;  4PDM A;  3JYC A;  3E8H A;  4MVQ A;  2HVJ C;  5EC2 C;  4MTG A;  3E8B A;  1J95 A;  5B1A C;  2ITC C;  1R3I C;  1OCO C;  5E1A C;  3SPI A;  3OUS A;  1BL8 A;  3ABM C;  4X8A A;  3ZJZ A;  4PDV A;  2ITD C;  3FB6 C;  2IH1 C;  3SYQ A;  5KUM A;  3SPC A;  4R6Z A;  4X89 A;  3KG2 A;  4MVO A;  3K06 A;  2WLJ A;  4XDK A;  2X6A A;  3LUT B;  3OGC C;  1M56 C;  3WG7 C;  3F7V C;  4PA3 A;  3LNM B;  4MVR A;  2DWE C;  4G27 B;  2A9H A;  2HG5 C;  4MVM A;  3SYA A;  4XDJ A;  3EFF K;  4PA7 A;  2HVK C;  4MTO A;  3SYC A;  5EBW C;  5CBH A;  2WLL B;  2X6C A;  3BEH A;  5EK0 A;  3LDC A;  3E8G A;  2ZD9 A;  5EC1 C;  2Y69 C;  2AHZ A;  3ABK C;  2X6B A;  4PA4 A;  4R8C A;  3RW0 A;  1P7B A;  2WLI B;  1G4Y B;  3OR6 C;  1R3L C;  2EIJ C;  2YEV A;  3FB7 C;  4MTF A;  3E86 A;  5IY5 C;  2Q6A A;  4BW5 A;  2DYR C;  2Q68 A;  1R3K C;  1QLE C;  2ATK C;  4GX0 A;  4PDR A;  4OXS A;  1LNQ A;  3UM7 A;  2P7T C;  2WLN A;  4HZ3 A;  3E89 A;  2OCC C;  1R3J C;  3ASO C;  4J9Y B;  4MW3 A;  3R65 A;  3FB8 C;  1ZWI C;  2IH3 C;  1OCZ C;  2DWD C;  3SPH A;  4TWK A;  3STZ C;  2KB1 A;  4WFH A;  3E8F A;  1XL4 A;  3HPL C;  4PA9 A;  3T1C A;  3ABL C;  2BOC C;  1K4C C;  4RAI A;  2WLK A;  4MVS A;  4P2Z A;  4RO2 A;  3TET A; 
#chains in the Genus database with same CATH topology
 2XOK G;  4TV9 A;  2D3O W;  1XNR B;  1JX9 A;  1Q7Y W;  2P90 A;  4LF4 O;  4GYC B;  2MK3 A;  1GM8 A;  2VRZ A;  4ZBM A;  3OUF A;  4JI2 O;  2XAG A;  4I4T B;  4Q6G A;  2Y4T A;  3OFN G;  1TVK B;  1Y76 B;  1D5N A;  4DW1 A;  1RP3 B;  5J2T A;  2VS0 A;  3H1I H;  4IHJ A;  5IJ0 A;  2AGA A;  3OEE G;  1TUB A;  2ZM6 B;  4JI5 O;  1GN6 A;  2B1I A;  1N32 O;  4GT1 A;  1Q6H A;  1IBK O;  4FLY A;  2IJJ A;  4MW8 A;  5A9G A;  5IYB O;  4GCZ A;  2WLI A;  1PL4 A;  3VQV A;  4I9W A;  3CCL V;  4O4H B;  1K7D A;  4WFE A;  3C90 A;  3O9O A;  2W0F C;  3JAT A;  5B1B C;  2A79 B;  4F6R B;  4X1K B;  2ARH A;  1ZUQ A;  4NVP A;  2WSS G;  2Y48 A;  5KHK A;  4DR5 B;  3ASN B;  4JYY A;  2ZT9 B;  1K97 A;  1SRY A;  1YF2 A;  1FKA O;  1S5L Z;  5DED A;  1P7G A;  4FVM A;  4O4L B;  5BMV A;  1E79 G;  3LSQ A;  1OCR B;  4NTY A;  4ASU G;  3D36 A;  1QQC A;  4GUN A;  2PYJ A;  2WLL B;  5LGT A;  1J5E O;  1HNX O;  1BQ0 A;  1G4Y B;  4EFE A;  1R3L C;  2YEV A;  1SQG A;  5JJE B;  1HR0 O;  1PKX A;  5CN0 A;  2JEX A;  1VF5 B;  1LNQ A;  3EHB B;  1SQB H;  3K58 A;  2FTK A;  3J7A U;  3FX7 A;  2YXH A;  5LMU O;  2ZR2 A;  3FAV B;  2XHB A;  3ZRX A;  4FLU A;  3HKE B;  1H38 A;  1VF7 A;  2QKC A;  3BPZ A;  1M56 B;  2UU9 B;  1WLE A;  4LCU C;  1BHB A;  1X4T A;  4B08 A;  1FJG O;  2XUM A;  2OTJ V;  3ASN C;  1SQF A;  2FB5 A;  1I0H A;  2AHY A;  4ZI7 B;  4HAM A;  5EYP A;  4GX5 A;  2XAQ A;  2P4V A;  3WB0 A;  2Q7G A;  1NJI W;  4MVZ A;  4LF4 B;  3OM3 B;  1OCR C;  4JI2 B;  1HW7 A;  2CTW A;  4I9Q A;  4KP4 A;  1WN7 A;  4EKW A;  5LHG A;  5LHH A;  2BCC H;  3KCY A;  4BR6 A;  4GLX A;  1T5E A;  4UB8 Z;  4TT3 G;  1XQ8 A;  2YIA A;  5L3C A;  1N32 B;  2QM8 A;  4UUJ C;  4NXN O;  3E83 A;  3W7S A;  4YIP A;  3E8H A;  2GV9 A;  2LW1 A;  1WNS A;  5DM6 V;  1AJQ A;  1VQ7 V;  4G2K A;  1FPO A;  1MZF A;  1FXK A;  3UO2 A;  2X6A A;  1M56 C;  4L87 A;  4O4J B;  1B3Q A;  2M6Y A;  4MVR A;  3R66 A;  3ABL B;  1E1R G;  2Q7E A;  3SYA A;  2HVK C;  3T1Y O;  5L3G A;  5B1N A;  1R6K A;  3RYC B;  3CCV V;  1K3E A;  3IC7 A;  2Z3Y A;  4BIO A;  1PD3 A;  4DRX B;  1MSW D;  1NR1 A;  1D5A A;  3G67 A;  1H8E G;  1W0J G;  5LMN O;  4JV5 O;  3ZRV A;  2DOS A;  1J5E B;  1F4M A;  1CP9 A;  4YY3 B;  4AIL C;  3RT3 C;  3JAK A;  1HNX B;  1XNQ O;  1HR0 B;  3EXA A;  2Q9L A;  5GON B;  3U10 A;  3SYP A;  3MHH C;  2IJI A;  3QVN A;  2CTR A;  1KMI Z;  2Q0O C;  4NR1 A;  2JRI A;  2OT5 A;  5LMU B;  4PI0 A;  4CS4 A;  2UXC O;  1YSC A;  1L0N H;  1THZ A;  1WJZ A;  2JK5 C;  2YID A;  1Q81 W;  1IZ3 A;  2Q7H A;  1QBZ A;  2ZDI A;  4JTD B;  5ITZ B;  1OCZ B;  3IFX A;  5KMG A;  3SJA C;  4JI3 B;  1KC8 W;  5H5N A;  1FXH A;  3FB5 C;  1GM9 A;  4CH5 A;  4TOI A;  2G38 A;  1NKD A;  2Q8V A;  4UVB A;  3T1H B;  4MSW C;  1G6U A;  2ZE8 A;  4IYI A;  2OIG A;  5IT9 N;  1WA8 B;  3AK1 A;  3AK2 A;  4BWA A;  4LF8 O;  4GKJ B;  4NXN B;  4R6Z A;  2XAH A;  4UCO A;  1YHQ V;  1ZAU A;  2EZO A;  1HWY A;  1MZE A;  4LR3 A;  4YHH O;  3P32 A;  3KKY A;  5JJJ B;  2YSU B;  2DQ0 A;  4MVM A;  4EB6 B;  4RQF A;  2UUA O;  5H2F Z;  1Y74 A;  3BEH A;  5EC1 C;  1JQ0 A;  3ICX A;  5EZY A;  4PA4 A;  3RW0 A;  1F23 A;  3AG2 B;  5LP6 C;  4PEL A;  4A5U B;  2GUZ B;  4J7K A;  4I0X B;  3T1Y B;  5KAF Z;  5JQG B;  1R3J C;  4MW3 A;  5CA1 B;  1OCZ C;  3ZCC A;  1MSD A;  2KB1 A;  4OPA A;  4BIZ A;  2JJ1 G;  3K79 A;  4WFA V;  4GZR B;  3HPL C;  3UT5 B;  2ETN A;  1K4C C;  3SJB C;  4O2B B;  5LMN B;  4JV5 B;  1K9M W;  1M57 C;  4FPP A;  3CEI A;  1N0J A;  4FFB B;  1XNQ B;  2DYS C;  1EBO A;  1B04 A;  5AG2 A;  4K0K O;  3NXS A;  2ZKO A;  2QTO A;  4RUE A;  4JAS A;  2UXB O;  5D5P A;  3ABT A;  3HKB A;  1ARO P;  1NH2 B;  5L3B A;  2FYU H;  4X66 B;  4DV7 B;  3T2M A;  1SF9 A;  3MDS A;  4KXR A;  3A0B Z;  5K1X A;  1S72 V;  3AG2 C;  2EIN C;  3H1H H;  4FMT A;  2DW4 A;  5J2U B;  2OIE A;  1ORQ C;  2WPD G;  1NH2 D;  4MVQ A;  1COW G;  4FM0 A;  1BMF G;  1JJO A;  4CH4 A;  1ENV A;  1QR9 A;  2ITD C;  3AG7 A;  2VWJ A;  3OMI B;  5B3S B;  2YIC A;  3DC5 A;  3ABU A;  3F7V C;  4DV6 O;  2UUC B;  3APQ A;  4YJ3 B;  1Z2G A;  2F66 C;  1W2B U;  3RN4 A;  3RYF B;  4YHH B;  3BCC H;  2XT9 A;  4X1Y B;  3E86 A;  5IY5 C;  5TIS Z;  4OXS A;  1BQZ A;  1NZ6 A;  1I94 O;  3E89 A;  4J9Y B;  1AR4 A;  4D7S A;  4I50 A;  4LC1 A;  2BTO A;  2GDS A;  5B1O A;  3STZ C;  2LGQ A;  5FNV A;  3JAS B;  2XAJ A;  4YXW G;  3HKC A;  1DK1 A;  1HP8 A;  1XMQ O;  1JR9 A;  2Q67 A;  4WFG A;  1YEW A;  5JH7 B;  2XAF A;  1I5X A;  3K04 A;  1YVW A;  2YS8 A;  4LFB O;  2A3Q A;  1VMG A;  2CGN A;  4CBC A;  4OX9 O;  4ICG A;  5B3S C;  3OGI B;  4PV1 B;  5BY1 A;  1XNR O;  1FAF A;  4DK0 A;  3SPG A;  3DTU B;  2QJ1 A;  4FLZ A;  1SS3 A;  4QPJ A;  1Y6X A;  3OTO B;  3CRA A;  5IYZ B;  5EBL C;  4K0K B;  3KCX A;  4YJ2 B;  2OCC B;  4N21 A;  4JI1 B;  4O2A B;  1GKF A;  5IJ9 A;  3QO7 A;  2DE0 X;  2PI5 A;  3ZN1 A;  4CC5 A;  3ZHT A;  4JAA A;  2EJ7 A;  5B66 Z;  3SPJ A;  1V54 C;  3ZRW A;  3L75 H;  3RYI A;  3G4S V;  4JI7 O;  3CWB H;  4H0L B;  2HKO A;  3JAW A;  4Q20 A;  2RN9 A;  1R3I C;  3G6B A;  5E1A C;  4WBN A;  1L8D A;  3W7T A;  4X20 B;  3K9S A;  3KG2 A;  3AG4 B;  2ZR3 A;  4XDK A;  3LUT B;  4DR5 O;  1AI4 A;  1V9P A;  2EIM B;  3EFF K;  3SR2 C;  3B8M A;  3H1J H;  1N36 O;  1N4C A;  5CBH A;  1DTO A;  3E8G A;  1GRJ A;  2ZD9 A;  3ABK C;  1ZSP A;  2AW9 A;  2R9I A;  4MTF A;  2ZQM A;  3ETG A;  1FFX A;  2VWK A;  1VQM V;  4B3M O;  3A2F A;  2E5L O;  2RCV A;  2OCC C;  3CJH B;  3R65 A;  3JAL A;  4JYB A;  1SQQ H;  2CH7 A;  4JYA B;  5FL7 G;  2ZIN A;  1GTO A;  1O9G A;  3VQY A;  3T1C A;  2PUS A;  4U3F H;  4LWS A;  1I94 B;  3BAB A;  3PJS K;  3WG7 B;  2QSA A;  3CX5 F;  2DQ3 A;  1NVP B;  4PA6 A;  3W7X A;  2QWP B;  1M93 A;  4RUF A;  1YCI A;  3B8N A;  1DF4 A;  1LR1 A;  3AG4 C;  3F7Y C;  1YZB A;  4TV8 B;  4JI4 B;  2V4D A;  4HNA B;  1TAE A;  1TUE B;  3TXS A;  3CRM A;  1MAB G;  2EIM C;  4LFB B;  2W0X A;  5EBM C;  4OX9 B;  1VF6 C;  1KKD A;  4DYL A;  2KG7 A;  1NVP D;  2GTA A;  2BOB C;  1PL0 A;  5LHI A;  2JVD A;  4CH6 A;  4ABM A;  3BVO A;  1U96 A;  5CA0 A;  4BIU A;  4AQY O;  2YDE A;  1M5I A;  3N2G B;  1QR8 A;  3LSU A;  5D5Q A;  1PPJ H;  3B40 A;  2BSK B;  2M7W A;  1AP6 A;  4ZOL A;  4CS3 A;  4U3J A;  2H3O A;  2F93 B;  1F51 A;  4JI7 B;  3K5L A;  5KHG A;  3WG7 C;  5IWA B;  2EX3 A;  1TGO A;  1DF5 A;  1ROP A;  3CCM V;  2HG5 C;  3JCU Z;  2N05 A;  3CCQ V;  3E22 A;  1PNK A;  1NI8 A;  4X62 O;  4QGP A;  1Q3E A;  5DEC A;  1VIB A;  1X59 A;  2R70 A;  2YI8 A;  3SJC C;  2EIJ C;  1MOF A;  5JJN B;  1N36 B;  4X64 O;  4B7K A;  3FB8 C;  3RYH A;  2PI4 A;  4RWU A;  3O65 A;  4FZ0 A;  1IXB A;  1AJN A;  2LFS A;  1GAX A;  2VQE B;  2EJR A;  3G71 V;  4B3M B;  4QPK A;  1E1Q G;  4IYH A;  2E5L B;  2IBZ H;  4P2Z A;  3BFR A;  3OE7 G;  4YY3 O;  1N33 O;  1AJP A;  4WCE V;  2ZDI C;  2A0L A;  2ZNI A;  2A7W A;  2WLM A;  3FD9 A;  2E74 B;  1UPG A;  3J80 N;  4O4I A;  5BXZ A;  3CYO A;  1SQX H;  3M99 B;  2CTP A;  3LDD A;  5LXT B;  1TA8 A;  3K03 A;  2CAZ C;  1XBL A;  3UQ8 A;  1VAR A;  2ZE6 A;  3E35 A;  2ZE7 A;  4J9Z B;  5LYJ A;  3K57 A;  4DUZ O;  3WB2 A;  5JVD A;  3JD0 A;  3SJQ C;  1H8H G;  1P49 A;  3RWR D;  4Z1M G;  4BW9 A;  2NNU A;  3BA9 A;  2PTM A;  2WA3 A;  1AVM A;  1ZL8 A;  1NU1 H;  4JI3 O;  2HVJ C;  4J80 A;  1DGS A;  4X1I A;  1R6N A;  2CK3 G;  2LJ2 A;  1PNM A;  4W4L A;  1Q8I A;  3ZJZ A;  2IH1 C;  1WB7 A;  5KX5 B;  3T1H O;  4AQY B;  4JPR A;  2WLJ A;  2UXN A;  1JA8 A;  1SA0 A;  1JPX A;  3W7U A;  3HB3 B;  2GSM B;  4WF9 V;  4GKJ O;  2RNB A;  1IXM A;  2QWO B;  3I55 V;  3ETQ A;  1JFF A;  1NQT A;  1VQ5 V;  1GO3 F;  2X6B A;  3Q4H B;  1RSO B;  1QCE A;  4IIJ B;  4FLX A;  2Q6A A;  3QF7 A;  2HJD A;  1NTM H;  4ZHQ B;  4LFC B;  3GWO A;  4I55 B;  4X62 B;  4K8X A;  2N04 A;  5LOV A;  3C3T A;  4X64 B;  4WFF A;  2PY5 A;  3D3I A;  3LDE A;  4H33 A;  1BSM A;  1SZX A;  4OGQ B;  4LF9 O;  3S3X A;  4J10 A;  5LGU A;  1M9N A;  1AI5 A;  1JMK C;  5KAI Z;  1GH6 A;  4YIO A;  3VQX A;  1Z5V A;  1N33 B;  3RBZ A;  1K34 A;  3IGA C;  3N2K A;  4KUM A;  3I5D A;  4DV3 B;  4E2L A;  4P30 A;  3CB2 A;  3HKD B;  3ZHS A;  1GM7 A;  4UCR A;  2JGD A;  3DGE A;  1XMO O;  4CS2 A;  4X66 O;  4DV7 O;  1AR5 A;  2LQT A;  3ML0 A;  1OV9 A;  1SZT A;  3ETE A;  2BTQ B;  1XL6 A;  1MA1 A;  3JCZ A;  3JYC A;  4DUZ B;  4MTG A;  1VQ4 V;  1AI6 A;  5LP6 B;  2HHH B;  2HP8 A;  5C8Y B;  4LNU B;  4PDV A;  3A0H Z;  5LA6 A;  5CB4 A;  2JEU A;  4XBF A;  2ZCE A;  1H2S B;  1BT8 A;  2JS5 A;  3BRC A;  3CP1 A;  3L72 H;  4JI6 O;  2YIB A;  5LBQ A;  2L6L A;  4DV4 O;  3OW2 U;  3E2E A;  3JD3 A;  3U11 A;  4I4T A;  5LL6 Y;  2OWO A;  3SYC A;  2P5O A;  1TVK A;  2FL4 A;  1M57 B;  1Y76 A;  5LGN A;  3LNN A;  2AHZ A;  2UUC O;  2ZXW B;  2DYS B;  4FFK A;  3S3W A;  2ZIM A;  1FXV A;  3CMA V;  5KLV H;  2Q68 A;  4DW0 A;  1IUR A;  3DXR B;  2LGW A;  3ZIA G;  1W0K G;  4LF7 O;  2EIL B;  5IYD O;  2CE4 A;  4UCV A;  3SPH A;  4TWK A;  4O4H A;  4DV2 B;  2WLK A;  2NN4 A;  4F6R A;  4X1K A;  3L9D A;  1FYJ A;  2EIN B;  1YDX A;  1R73 A;  3L71 H;  4K8Z A;  4B3R B;  1F7Y A;  2CTQ A;  3JAR B;  4D7T A;  2LP7 A;  3QG5 A;  2V1D A;  4AI8 A;  4QNH B;  3X2Q C;  3CXH F;  5KHJ A;  4O4L A;  1EN4 A;  2Y69 B;  2QGN A;  1PNL A;  3CC2 V;  4LF9 B;  1Y4M A;  1K33 A;  2KSD A;  2Z0A A;  2WLL A;  4DR2 O;  1K4D C;  3OTO O;  2ZXW C;  4ZIB A;  4X9Q A;  4NXM O;  3H1K H;  2KKW A;  4NTX A;  1HNW O;  1MNG A;  2JJ2 G;  1KUQ A;  4JI1 O;  5FPR A;  2WLH A;  4UV8 A;  2EIL C;  3K08 A;  4FIP C;  2ODM A;  4TV9 B;  2F4V O;  4QIW F;  5IY5 B;  1XMO B;  3SPI A;  2RDC A;  3FAV A;  3HKE A;  3K06 A;  4DR7 O;  2PGG A;  3I56 V;  3CC7 V;  5J2T B;  4UCU A;  1EZJ A;  3K5O A;  4IHJ B;  5IJ0 B;  1TUB B;  4ZI7 A;  3H1L H;  3ZMU A;  1IDS A;  5L3F A;  1H2K A;  4JI6 B;  2Y69 C;  4EEQ A;  2E3C A;  1V55 B;  2AZ0 A;  2WLI B;  4DV4 B;  2KQX A;  2P7T C;  2P4K A;  1NBM G;  3JAT B;  1KB9 F;  3WB1 A;  2X0L A;  5B1A B;  1QVF U;  3CS5 A;  3ABM B;  4PA9 A;  3PN1 A;  5KHH A;  3ZMZ A;  2V7Q G;  4LF7 B;  5CBG A;  1Q6I A;  4JYA O;  1XUQ A;  5J9P C;  5BMV B;  3BAA A;  3GB7 C;  4XDL A;  1V54 B;  1CPY A;  2IU0 A;  5B5E Z;  2QKS A;  3VBB A;  3FYE B;  4O4J A;  2E75 B;  3K0G A;  3D8C A;  3UCS C;  4J7J A;  3F5W C;  2YEV B;  4KFM A;  1L1F A;  1BHA A;  1NT2 B;  2K9P A;  3ZMV A;  1IBL B;  3RYC A;  4JI4 O;  4DRX A;  1AI7 A;  2HJF C;  4PDL A;  1V55 C;  2N74 A;  1NTZ H;  3T4Z A;  1SET A;  4X88 A;  1Q82 W;  2F23 A;  2WWW A;  4JTC B;  4PHZ A;  4FM2 A;  3BHP A;  4DR2 B;  1Q6U A;  3ABK B;  5B1A C;  1XDC A;  2ITC C;  2YXY A;  4NXM B;  1WPX A;  3ABM C;  4IL6 Z;  3APO A;  4Z2W A;  1HNW B;  5GON A;  1R1B A;  5C93 A;  5EYP B;  3OGC C;  4PA3 A;  3LNM B;  4UCT A;  2F4V B;  1OCC B;  2Y0I A;  2ADP A;  1YI2 V;  4PD4 F;  1R6T A;  3D36 C;  4PA7 A;  5EBW C;  4QJF B;  1YJ9 V;  3GVM A;  3TXQ A;  1RFY A;  3A8T A;  4DR7 B;  5IWA O;  2X6C A;  3CPW U;  1PP9 H;  2Q4P A;  2QA4 V;  2QR4 A;  3AG3 B;  3ZMT A;  5IYC O;  4BW5 A;  2DYR C;  3UM7 A;  2EZP A;  3K3W A;  1H2L A;  3JD2 A;  1JCH A;  5FLX N;  5ITZ A;  3CCS V;  4LF5 B;  1Q43 A;  3U0Z A;  3E8F A;  5JCO A;  2JIZ G;  3WFV A;  1CXZ B;  2GHY A;  2MW2 B;  1N8R W;  1S5H C;  1FXK B;  1WA8 A;  3BY6 A;  2OTL V;  1KP3 A;  2VQE O;  2R9R B;  4U7O A;  2DMX A;  4QE9 A;  3H9V A;  1G8M A;  3MAQ A;  1URF A;  1OCC C;  3WU2 Z;  4EB6 A;  3TCU A;  2EIK C;  2QEX V;  4DK1 A;  2DN9 A;  4LF6 O;  1YTF B;  3JAK B;  4X65 B;  4ZKI A;  3TK1 A;  3AG3 C;  2QWN B;  2GUZ A;  5BR8 B;  3FKS G;  4I0X A;  3M8A A;  1FD9 A;  5JQG A;  3IAY A;  1G1X B;  5CA1 A;  5KUM A;  4JAU A;  1KKC A;  2H8P C;  1NTK H;  3E8B A;  3JD4 A;  1RM1 B;  2EIJ B;  2QM7 A;  2LFR A;  3OD4 A;  4J11 A;  5KA6 A;  4X8A A;  3UT5 A;  3ZN0 A;  4O2B A;  4TSF G;  4WFB V;  1QLN A;  3SDL A;  4B7E A;  1YTF D;  1WB8 A;  3C3S A;  4U7N A;  1FXK C;  2Z5U A;  3AK3 A;  2GBO A;  4UVA A;  3L74 H;  4FFB A;  2XTA A;  5L3D A;  1IBM O;  2A9H A;  3OT7 A;  2QWR B;  1SQV H;  1ZLZ A;  5GTH Z;  3CCE V;  1VQN V;  2ZNJ A;  1QNM A;  1XHZ A;  4UFZ A;  5KMG B;  2PF4 E;  2LW7 A;  1SQP H;  3NR7 A;  4PDR A;  3TJT A;  3N27 A;  2OYQ A;  2XAS A;  5CMU A;  1W59 A;  2IM9 A;  5H6R A;  4WFH A;  1ZTE A;  2AZ2 A;  4LFC O;  3G6E V;  5J2U A;  1JOY A;  3P30 A;  1N34 O;  5HFL A;  4I7Z B;  2ILM A;  1UFI A;  2YIB D;  1RM1 C;  3CE2 A;  4JI0 O;  4LH7 A;  4NKG B;  3K0D A;  2P67 A;  1QVG U;  1GK9 A;  2WA4 A;  4DR1 O;  1Y74 B;  1VQ9 V;  1VQ8 V;  5EZY B;  4UVC A;  3B2E E;  4YJ3 A;  3CRC A;  3K5N A;  1HNZ B;  2R9A A;  3CME V;  1QLE B;  2IW5 A;  1B06 A;  4B3T O;  3RYF A;  4HYO A;  3OR7 C;  1KEC A;  1OJH A;  1XOU A;  4QE7 A;  5F2V O;  4X1Y A;  2QM4 A;  4DV3 O;  2QDO A;  1EN6 A;  4DR3 O;  4LF6 B;  1JVM A;  1K73 W;  4JI8 B;  4LP8 A;  4MT8 A;  2WAM A;  4DV0 B;  4TUY A;  3HR0 A;  3JAS A;  1AR1 B;  1SES A;  3AG1 B;  3OUS A;  2W6I G;  3CSX A;  1YIT V;  3ZS8 C;  3MD0 A;  1XHX A;  1WP8 A;  3H01 A;  3HKB B;  2FKX A;  2RJZ A;  4DV5 O;  2HHH O;  4K35 A;  3J81 N;  4JZG A;  5JH7 A;  3K9A A;  4DUY O;  2VQF B;  3QO8 A;  4IT5 A;  4XDJ A;  4MTO A;  2RMK B;  4DR4 O;  1P7B A;  3IJ4 A;  5IYZ A;  5A2Q N;  4JF3 A;  1Q90 D;  3UO3 A;  1IBM B;  3A0R A;  4YJ2 A;  1R3K C;  1QLE C;  2UXX A;  4RQE A;  2Q5Z A;  1DLB A;  1EM1 A;  4HZ3 A;  4O2A A;  4CZZ A;  1KBH A;  1K5Q A;  1NS1 A;  1OHH G;  2QKA A;  2RQ6 A;  1PV0 A;  4RO2 A;  1BE3 H;  4N23 A;  1KYO F;  5IE9 A;  4CH3 A;  2PYL A;  3ETD A;  4X20 A;  4JI5 B;  4DV2 O;  3AG1 C;  1WP7 A;  3M7M X;  3STL C;  1Z5W A;  1K5S A;  4GX1 A;  3TGU H;  2NLJ C;  1IBK B;  4CC6 A;  1N34 B;  2W6J G;  4P9O A;  4EFB A;  4B3R O;  4JI0 B;  2Y4U A;  3MHS C;  1L0L H;  1M1K W;  4F4L A;  1VF6 A;  4DR1 B;  1S5J A;  4I50 B;  3ZRS A;  2P6J A;  3VOU A;  1VQO V;  4KHP O;  5FNV B;  5CBF A;  1U97 A;  3HKC B;  4JYC A;  4B3T B;  3CJH A;  1Y66 A;  4J41 A;  4PDM A;  3DC6 A;  5E79 Z;  2CGO A;  5EC2 C;  4UB6 Z;  4UXN A;  1VP7 A;  1MMM A;  2BE3 A;  1UJW B;  1GN3 A;  3B4S A;  3SPC A;  4TQF A;  4DR3 B;  3ZX6 A;  4PI2 A;  1AB3 A;  1YXB A;  2E76 B;  3JAM N;  3EVK A;  4TV8 A;  3CCJ V;  5IJ9 B;  4HNA A;  3CCU V;  4DV5 B;  2OCH A;  2JDI G;  4DUY B;  2F43 G;  3F5T A;  3X2Q B;  1S76 D;  1B6Q A;  3ZRW B;  3RYI B;  2NR5 A;  3B77 A;  1ZWI C;  2IH3 C;  4FLT A;  4DR4 B;  1FFT B;  4BAY A;  3JAW B;  1FJG B;  1OCO B;  3P3N A;  1O9H A;  4WBN B;  1JJ2 U;  3ABL C;  4F6E A;  2B9Z A;  2BOC C;  3CC4 V;  3N2G A;  3QTC A;  5GTI Z;  4HBN A;  1BCC H;  2HR3 A;  1MG1 A;  2BSK A;  4TQD A;  1FS0 G;  2B5U A;  4MTX A;  1YJW V;  2L35 A;  3THO A;  2UUB O;  3CCR V;  3CRR A;  1KQS U;  2AXT Z;  1CEZ A;  5K1P A;  3GWK C;  1D2D A;  3L70 H;  4MS2 A;  1YJN V;  1FFX B;  1I08 A;  5EIB D;  2H94 A;  3ASO B;  4R50 A;  1HDJ A;  4JTA B;  3ZMS A;  5BZB A;  3JAL B;  4J7Z A;  2CDY A;  2CH7 B;  2Q69 A;  2F95 B;  1IBL O;  2Q0A A;  3B09 A;  4FZ1 A;  3K5M A;  1AP5 A;  1P4R A;  3LSS A;  4LWS B;  4H44 B;  4GX2 A;  1IX9 A;  4I5S A;  2JGU A;  1J95 A;  4GKK O;  4C7U A;  1OCO C;  4KHP B;  4NYK A;  1BL8 A;  3RFR A;  1OZ0 A;  3FB6 C;  3SYQ A;  2QE7 G;  4X89 A;  1H2G A;  4MVO A;  5EIB C;  2IJH A;  2DWE C;  1KD1 W;  4UV9 A;  3KZI Z;  2JS3 A;  2GTS A;  5CA3 A;  3ZHR A;  5JCO C;  2EBO A;  4FJC C;  5EK0 A;  3LDC A;  1EFR G;  2EUL A;  2KG7 B;  4R8C A;  3ZBH A;  5LXT A;  3OR6 C;  4IGG A;  4NB5 A;  3FB7 C;  1EZV H;  5IDJ A;  4GX0 A;  4FM1 A;  5KHI A;  4LFA O;  5CA0 B;  3ASO C;  3ZHV A;  3VQW A;  2P22 C;  2DWD C;  1WAZ A;  4B3S O;  1H2M A;  1K8A W;  2Y0P A;  1I7F A;  1SKV A;  4ZOL B;  4RAI A;  3T4D A;  4U3J B;  2IU3 A;  4W4K A;  1QU7 A;  2UXC B;  4FK5 C;  3D3Q A;  4LF5 O;  1QHT A;  2R72 A;  2CUG A;  1WPB A;  2UXD O;  1S3J A;  3IC9 A;  5KX5 A;  3BA8 A;  2YI9 A;  3E22 B;  3RVZ A;  1BS3 A;  5FPO A;  5L3E A;  1AIL A;  2QWQ B;  3UKM A;  2QTS A;  4DXW A;  5KUK A;  3FYI B;  2K1E A;  1VQP V;  5KA5 A;  3SYO A;  4LBE C;  3QO5 A;  2UUB B;  2Q73 A;  3G80 A;  4DV1 O;  3RYH B;  3Q4H A;  1RSO A;  4P9P A;  4UCS A;  1P84 F;  3RGB A;  4IIJ A;  1ZX3 A;  4H37 A;  3JSN A;  4ZHQ A;  3CHX A;  2LO1 A;  4LF8 B;  4I55 A;  5JWP A;  1KU9 A;  3L73 H;  4D6T H;  1RPR A;  3AEI A;  4LH6 A;  4X65 O;  5BR8 O;  2DYR B;  2UUA B;  2X7R B;  4O4I B;  4J42 A;  1F4N A;  4H13 B;  1RPO A;  4GKK B;  3FFQ A;  4G27 B;  4JZ2 A;  4TUY B;  2YC0 A;  1K92 A;  3W7W A;  2YUA A;  1VQL V;  5LYJ B;  1EN5 A;  1H2N A;  4PJ0 Z;  1S0V A;  5JVD B;  4NTW A;  4DR6 O;  1N0N A;  2XND G;  2ATK C;  5HFM A;  3ZHU A;  2WLN A;  3OAA G;  1SC5 B;  3HKD A;  1ZL8 B;  3OMA B;  1NR7 A;  3JD1 A;  2P06 A;  4X1I B;  1XL4 A;  2EIK B;  1LUV A;  1I5Y A;  1XI1 A;  1YIJ V;  4LFA B;  1S77 D;  2BTQ A;  1M4U A;  3JSL A;  4JAV A;  5GW7 A;  1VQK V;  2UXB B;  3OEH G;  4KL1 A;  5LP6 A;  2ZIO A;  2D2C B;  4B3S B;  5H9C A;  1SA0 B;  2ZM6 O;  3ZED A;  5C8Y A;  1XEQ A;  4LNU A;  2B1G A;  3K59 A;  3OTF A;  4Z1V A;  2A06 H;  3RVY A;  1JFF B;  1PM9 A;  1KP2 A;  3OMN B;  2YXL A;  1GMG A;  2IJK A;  2UXD B;  1VEW A;  4L8J A;  3SGI A;  3DSQ A;  2HLD G;  1IVS A;  1HNZ O;  4DO2 A;  2FML A;  4MVU A;  4R7C A;  5LOV B;  4G28 B;  3DXR A;  1M90 W;  4OPH A;  2HFE C;  4DV1 B;  2PZS A;  3ZHQ A;  2DJV A;  1Q86 W;  1VQ6 V;  1Q5O A;  4E4E A;  4DV6 B;  2ADQ B;  1GN4 A;  4FLV A;  3CXC U;  4JI8 O;  1Y67 A;  1XIL A;  3CD6 V;  4DV0 O;  3QNE A;  5DN6 G;  2O57 A;  3N2K B;  3JAR A;  2C2A A;  3CRQ A;  1GN2 A;  1LUW A;  4FLW A;  2VQF O;  1SER A;  2JGD B;  1XRE A;  2ZE5 A;  5B1B B;  2UU9 O;  3P3P A;  2HEP A;  1XMQ B;  2F1M A;  1BZK A;  1BGY H;  4DR6 B;  1US6 A;  4JGS A;  4K3A A;  4AHC A;  5LA6 B;  5H6Q A;  5CB4 B;  4MVS A;  1A32 A;  3TET A; 
#chains in the Genus database with same CATH homology
 4N23 A;  2XOK G;  2D3O W;  1JX9 A;  2Q67 A;  4WFG A;  2EIN B;  1Q7Y W;  2P90 A;  1R73 A;  2MK3 A;  1GM8 A;  2XAF A;  1I5X A;  3AG1 C;  3ETD A;  3K04 A;  3OUF A;  4ZBM A;  2XAG A;  3STL C;  1K5S A;  4GX1 A;  2LP7 A;  4CBC A;  2V1D A;  4QNH B;  2NLJ C;  5B3S C;  3OFN G;  3X2Q C;  2W6J G;  4P9O A;  2Y69 B;  3SPG A;  3DTU B;  1PNL A;  3CC2 V;  3OEE G;  4QPJ A;  2B1I A;  3MHS C;  1Y4M A;  5EBL C;  1M1K W;  4GT1 A;  4F4L A;  1K33 A;  2IJJ A;  2WLL A;  4MW8 A;  5IYB O;  2OCC B;  4N21 A;  1GKF A;  3QO7 A;  1K4D C;  2PI5 A;  3ZN1 A;  3ZRS A;  4GCZ A;  2P6J A;  2WLI A;  2ZXW C;  3VOU A;  1VQO V;  4I9W A;  3CCL V;  5CBF A;  1K7D A;  3SPJ A;  1V54 C;  3ZRW A;  2JJ2 G;  4JYC A;  4WFE A;  3G4S V;  2WLH A;  1Y66 A;  2W0F C;  4UV8 A;  5B1B C;  2EIL C;  4PDM A;  2A79 B;  3K08 A;  4FIP C;  5EC2 C;  2HKO A;  4QIW F;  4Q20 A;  4UXN A;  2WSS G;  2Y48 A;  1R3I C;  3ASN B;  5IY5 B;  5E1A C;  3SPI A;  3W7T A;  1K97 A;  1UJW B;  1SRY A;  3SPC A;  3KG2 A;  3AG4 B;  2ZR3 A;  3K06 A;  4XDK A;  3LUT B;  3I56 V;  3CC7 V;  1EZJ A;  1E79 G;  1AI4 A;  3LSQ A;  1OCR B;  4ASU G;  3D36 A;  2EIM B;  3EFF K;  3B8M A;  3ZMU A;  5CBH A;  2WLL B;  5LGT A;  3CCJ V;  1DTO A;  5L3F A;  3E8G A;  2ZD9 A;  2Y69 C;  3CCU V;  3ABK C;  1V55 B;  2JDI G;  2WLI B;  1G4Y B;  2R9I A;  1R3L C;  2YEV A;  4MTF A;  2ZQM A;  3ETG A;  1PKX A;  2F43 G;  5CN0 A;  1VQM V;  2JEX A;  1LNQ A;  3X2Q B;  2P7T C;  1S76 D;  1B6Q A;  3ZRW B;  1NBM G;  2OCC C;  3EHB B;  3B77 A;  3R65 A;  1ZWI C;  2IH3 C;  4JYB A;  1FFT B;  2X0L A;  4BAY A;  5B1A B;  5FL7 G;  1QVF U;  2FTK A;  1GTO A;  1OCO B;  3ABM B;  2ZR2 A;  4PA9 A;  3T1C A;  1JJ2 U;  3ABL C;  2BOC C;  3CC4 V;  3ZMZ A;  3ZRX A;  2V7Q G;  3PJS K;  5CBG A;  1H38 A;  1BHB A;  3WG7 B;  1M56 B;  1WLE A;  4LCU C;  5J9P C;  2DQ3 A;  2HR3 A;  4PA6 A;  3W7X A;  1NVP B;  1MG1 A;  3GB7 C;  1FS0 G;  4XDL A;  3ASN C;  2OTJ V;  1V54 B;  4RUF A;  1CPY A;  2AHY A;  2B5U A;  2IU0 A;  4MTX A;  2QKS A;  3B8N A;  1DF4 A;  3AG4 C;  3F7Y C;  1YJW V;  4HAM A;  3VBB A;  4GX5 A;  2XAQ A;  3CCR V;  3FYE B;  1KQS U;  1NJI W;  1CEZ A;  3K0G A;  4MVZ A;  1TUE B;  3F5W C;  3OM3 B;  1OCR C;  2YEV B;  1MAB G;  2EIM C;  4KFM A;  4MS2 A;  1L1F A;  4KP4 A;  1YJN V;  3ZMV A;  1BHA A;  5LHH A;  5EBM C;  4EKW A;  5LHG A;  1KKD A;  2H94 A;  3ASO B;  4R50 A;  4JTA B;  3ZMS A;  1NVP D;  5BZB A;  1AI7 A;  4TT3 G;  2BOB C;  2HJF C;  4PDL A;  1V55 C;  2Q69 A;  3T4Z A;  1PL0 A;  1SET A;  5LHI A;  5L3C A;  4X88 A;  2QM8 A;  1Q82 W;  2WWW A;  4UUJ C;  4JTC B;  1P4R A;  3LSS A;  4BIU A;  3E83 A;  3ABK B;  4GX2 A;  3W7S A;  1QR8 A;  4I5S A;  3E8H A;  5DM6 V;  1J95 A;  5B1A C;  1AJQ A;  2ITC C;  1OCO C;  1VQ7 V;  2M7W A;  1BL8 A;  1WPX A;  3ABM C;  1OZ0 A;  4G2K A;  3FB6 C;  3SYQ A;  2QE7 G;  4X89 A;  1H2G A;  5C93 A;  4MVO A;  1F51 A;  1FXK A;  2X6A A;  3OGC C;  1M56 C;  3WG7 C;  4L87 A;  4PA3 A;  2IJH A;  3LNM B;  4MVR A;  2DWE C;  1DF5 A;  1OCC B;  1KD1 W;  1ROP A;  4UV9 A;  3ABL B;  3CCM V;  1YI2 V;  1E1R G;  2HG5 C;  5CA3 A;  3SYA A;  4PA7 A;  2HVK C;  2EBO A;  3CCQ V;  4FJC C;  5EBW C;  1PNK A;  4QJF B;  1YJ9 V;  5L3G A;  5B1N A;  1R6K A;  2X6C A;  3CCV V;  5EK0 A;  1K3E A;  3LDC A;  3IC7 A;  2Z3Y A;  1EFR G;  1PD3 A;  3CPW U;  4R8C A;  1MSW D;  3OR6 C;  1NR1 A;  2EIJ C;  2QA4 V;  3AG3 B;  3ZMT A;  3FB7 C;  1MOF A;  5IYC O;  4BW5 A;  2DYR C;  3UM7 A;  5IDJ A;  4GX0 A;  2EZP A;  1H8E G;  1W0J G;  3K3W A;  3JD2 A;  1JCH A;  3ASO C;  3ZRV A;  1F4M A;  1CP9 A;  3FB8 C;  2PI4 A;  3CCS V;  2DWD C;  3E8F A;  1K8A W;  2JIZ G;  1AJN A;  3WFV A;  2LFS A;  2EJR A;  3G71 V;  4QPK A;  4RAI A;  1E1Q G;  3T4D A;  2GHY A;  4P2Z A;  2IU3 A;  3OE7 G;  1N8R W;  4FK5 C;  1S5H C;  3SYP A;  3MHH C;  1FXK B;  1AJP A;  2IJI A;  3BY6 A;  4WCE V;  2ZDI C;  2OTL V;  1KP3 A;  2OT5 A;  2A0L A;  1S3J A;  2WLM A;  2R9R B;  1YSC A;  3RVZ A;  4U7O A;  3CYO A;  4QE9 A;  1THZ A;  3M99 B;  5L3E A;  1G8M A;  2JK5 C;  3LDD A;  1OCC C;  3UKM A;  4DXW A;  5KUK A;  3K03 A;  1Q81 W;  3FYI B;  3TCU A;  2K1E A;  1VQP V;  2EIK C;  3SYO A;  5KA5 A;  2QEX V;  4LBE C;  3QO5 A;  1QBZ A;  2ZDI A;  3E35 A;  4J9Z B;  1YTF B;  4JTD B;  1OCZ B;  3IFX A;  4P9P A;  4ZKI A;  1KC8 W;  3JD0 A;  3SJQ C;  1H8H G;  3TK1 A;  3AG3 C;  1FXH A;  4H37 A;  3FB5 C;  3FKS G;  4Z1M G;  1GM9 A;  2NNU A;  1NKD A;  4UVB A;  5KUM A;  4MSW C;  4JAU A;  2H8P C;  1RPR A;  3AEI A;  2HVJ C;  3E8B A;  3JD4 A;  1RM1 B;  2EIJ B;  2QM7 A;  2LFR A;  1R6N A;  2CK3 G;  5KA6 A;  2DYR B;  1PNM A;  4X8A A;  3ZJZ A;  3ZN0 A;  2IH1 C;  4TSF G;  4WFB V;  1QLN A;  4R6Z A;  2XAH A;  1YTF D;  4JPR A;  2WLJ A;  1YHQ V;  2EZO A;  1HWY A;  2UXN A;  2X7R B;  4U7N A;  1FXK C;  1F4N A;  2Z5U A;  4UVA A;  3P32 A;  1RPO A;  1JPX A;  3W7U A;  3HB3 B;  5L3D A;  2GSM B;  2YSU B;  2DQ0 A;  2A9H A;  4G27 B;  4WF9 V;  4MVM A;  4RQF A;  1IXM A;  3I55 V;  3CCE V;  3BEH A;  1VQN V;  1NQT A;  1K92 A;  5EC1 C;  3W7W A;  1JQ0 A;  1GO3 F;  1VQL V;  1VQ5 V;  2X6B A;  4PA4 A;  3RW0 A;  1F23 A;  3AG2 B;  1S0V A;  1QCE A;  4PEL A;  2Q6A A;  2XND G;  4PDR A;  2ATK C;  5HFM A;  2WLN A;  2XAS A;  3OAA G;  3GWO A;  1R3J C;  4MW3 A;  5CMU A;  1OCZ C;  3ZCC A;  3OMA B;  5H6R A;  1NR7 A;  2KB1 A;  3JD1 A;  4WFH A;  4BIZ A;  2JJ1 G;  1XL4 A;  3K79 A;  4WFA V;  3HPL C;  2EIK B;  1I5Y A;  3G6E V;  1K4C C;  1JOY A;  1YIJ V;  1S77 D;  1K9M W;  3P30 A;  4JAV A;  5GW7 A;  4WFF A;  1M57 C;  5HFL A;  1VQK V;  3D3I A;  3LDE A;  3OEH G;  4FPP A;  4H33 A;  1RM1 C;  5H9C A;  2DYS C;  5LGU A;  1M9N A;  1AI5 A;  1EBO A;  3NXS A;  3K0D A;  2P67 A;  2B1G A;  1QVG U;  2QTO A;  4RUE A;  1GK9 A;  4JAS A;  3RVY A;  3ABT A;  1ARO P;  1KP2 A;  3RBZ A;  3OMN B;  1VQ9 V;  1K34 A;  1NH2 B;  1VQ8 V;  1GMG A;  2IJK A;  4UVC A;  3IGA C;  4KUM A;  5L3B A;  3CME V;  1QLE B;  2IW5 A;  4E2L A;  4P30 A;  3T2M A;  4HYO A;  3OR7 C;  1GM7 A;  1KEC A;  2HLD G;  1S72 V;  3AG2 C;  3DGE A;  2EIN C;  4QE7 A;  4DO2 A;  4MVU A;  4R7C A;  4G28 B;  1M90 W;  4FMT A;  3ML0 A;  2DW4 A;  1SZT A;  3ETE A;  1JVM A;  1K73 W;  1ORQ C;  1XL6 A;  4LP8 A;  2WPD G;  1NH2 D;  4MT8 A;  2HFE C;  3JCZ A;  3JYC A;  2WAM A;  4MVQ A;  4MTG A;  1VQ4 V;  1COW G;  1AI6 A;  1Q86 W;  1BMF G;  1VQ6 V;  1AR1 B;  1SES A;  3AG1 B;  3OUS A;  1ENV A;  2W6I G;  1QR9 A;  2ITD C;  4PDV A;  1YIT V;  3MD0 A;  2JEU A;  4XBF A;  3CXC U;  3OMI B;  3CP1 A;  5B3S B;  3CD6 V;  3H01 A;  3ABU A;  3F7V C;  5LBQ A;  3QNE A;  3K9A A;  3OW2 U;  5DN6 G;  3JD3 A;  3E2E A;  3QO8 A;  2C2A A;  4XDJ A;  4MTO A;  3SYC A;  1W2B U;  1M57 B;  5LGN A;  2AHZ A;  2ZXW B;  2DYS B;  1P7B A;  1SER A;  4JF3 A;  3A0R A;  1FXV A;  3CMA V;  3E86 A;  5IY5 C;  2Q68 A;  1R3K C;  1QLE C;  2UXX A;  4OXS A;  4RQE A;  1DLB A;  4HZ3 A;  3ZIA G;  1W0K G;  4CZZ A;  3E89 A;  4J9Y B;  5B1B B;  2EIL B;  5IYD O;  4LC1 A;  1K5Q A;  1OHH G;  3SPH A;  4TWK A;  5B1O A;  3STZ C;  4JGS A;  2XAJ A;  4YXW G;  5H6Q A;  2WLK A;  4MVS A;  4RO2 A;  3TET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...