4WFHA

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 98
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfhA00
4P2ZA 4RUEA 3E8GA 4PA3A 1M56C 1XL6A 4PDRA 4J9ZB 3BEHA 3E8BA 4UUJC 3VOUA 4G28B 4GX2A 2A0LA 5EBLC 4MVSA 4TWKA 2HJFC 4H33A 3KG2A 3PJSK 3IFXA 2Q69A 3K08A 1ZWIC 3K04A 4QE9A 4WFGA 5B1AC 3E8HA 1V54C 2R9RB 3OR7C 4XDKA 5EBMC 2EINC 5EC1C 5CBGA 3RBZA 4R50A 2WLNA 4BW5A 1XL4A 4MVMA 5KUKA 5J9PC 4GX1A 4PDMA 2DYRC 3GB7C 2P7TC 3ASOC 5BZBA 3E86A 1BL8A 2EIKC 2Q6AA 4JTDB 2DWDC 4MTGA 3OR6C 4XDLA 2ZXWC 2WLLA 4GX0A 4XDJA 4WFEA 3OUSA 3ZJZA 3AG3C 3UKMA 3K0DA 1K4DC 2DYSC 3T1CA 3LUTB 2ITCC 3ABLC 2X6AA 2X6CA 2HFEC 2WLMA 4RO2A 4PA7A 4MW3A 3LDDA 4WFHA 3FB7C 2K1EA 1OCOC 2KB1A 2BOCC 1R3IC 3AG4C 3T4DA 2WLIB 3AG2C 3F5WC 1QLEC 3K03A 4MW8A 2OCCC 2WLIA 3IGAC 2WLJA 4PDLA 4X88A 1OCCC 4KFMA 4MSWC 5IY5C 4R7CA 4RUFA 3SYPA 3UM7A 2EIJC 2IH3C 1J95A 2Y69C 4P9OA 2BOBC 1M57C 2YEVA 2ATKC 1V55C 3ZRSA 3F7YC 3TCUA 4RAIA 3T4ZA 1ORQC 1LNQA 5B1BC 4CBCA 5EBWC 2AHZA 3TETA 3F7VC 4PA9A 5EC2C 3SPGA 3ABMC 1OCRC 2NLJC 2ZD9A 3FB5C 4EKWA 2Q67A 4GX5A 1KKDA 4LBEC 1K4CC 4PA4A 3RVYA 4MVQA 2X6BA 2IH1C 2Q68A 4QNHB 3E8FA 4JTAB 3SYAA 2QKSA 3SPHA 4MVOA 4MVZA 3ASNC 2EIMC 3RVZA 2HVJC 3STLC 3FB8C 1OCZC 4LCUC 4P9PA 4MTOA 4X89A 3SPCA 3HPLC 2QTOA 4DXWA 3K06A 4MVUA 3RW0A 1G4YB 2H8PC 4LP8A 5CBHA 3ABKC 3LDCA 2W0FC 5E1AC 3X2QC 4I9WA 4MVRA 3LDEA 3EFFK 3JYCA 4R8CA 4R6ZA 4QE7A 2A9HA 3E83A 4JTCB 5KUMA 1R3LC 5EK0A 3K0GA 3R65A 2HVKC 5B3SC 3SJQC 4X8AA 2JK5C 1R3KC 1P7BA 3LNMB 2DWEC 5CBFA 3E89A 1S5HC 2WLKA 4PA6A 4HZ3A 4MTFA 4J9YB 3OGCC 4P30A 3SYQA 3SYOA 4H37A 2WLLB 1R3JC 2EILC 2HG5C 3WG7C 4F4LA 2ITDC 3FB6C 4MS2A 4OXSA 4ZBMA 3SYCA 1JVMA 3SPJA 3T2MA 2A79B 2AHYA 4HYOA 4PDVA 2WLHA 3SPIA 4G27B 3STZC 4WFFA 3OUFA 3AG1C
chains in the Genus database with same CATH superfamily
1VQOV 1M56B 4DW1A 5K1XA 4J9ZB 1NR1A 4DV7O 4TWKA 3EXAA 5IWAB 1FXVA 3CJHA 1J5EO 3X2QC 3W7XA 3KKYA 3KCXA 1FKAO 3RBZA 4FIPC 4OPAA 4K8XA 1SERA 3HKEA 1TVKB 1QR9A 3ASOC 1KB9F 2AZ0A 4MTGA 2YIBD 4JAUA 4B3TB 1ZAUA 4NXMO 4BIUA 3ABLC 3CC2V 3MDSA 1BT8A 2EULA 2M6YA 3LDDA 2EIMB 3P30A 1Q6HA 4TV9A 3GWOA 2WSSG 4X88A 1K97A 1I94O 1VQKV 4R7CA 2EZOA 4JV5B 5JJNB 1N4CA 1VQ6V 2BOBC 5B3SB 2QTSA 5K1PA 4DV1O 1ZLZA 3JALB 3JAMN 1ZSPA 1IBKO 5JVDA 1W0KG 1K4CC 1OCCB 1H2GA 4X1KA 3BCCH 1Z5WA 2PI4A 4X89A 4BW9A 2P5OA 3CCQV 3K06A 2GSMB 2XAGA 4MVUA 4B3MB 5CBHA 2ZDIC 1T5EA 4JI2O 4YHHB 1FFTB 1XNRB 3E35A 2GUZB 4KXRA 3CRAA 4DUZO 5CBFA 4HBNA 5DM6V 2Q73A 4DR4B 5LMNO 2ITDC 4X64O 1YI2V 4DR3B 3T2MA 3OMNB 2QKAA 2WLHA 3G80A 5IE9A 2DMXA 2EIKB 1PL4A 1SF9A 1NT2B 4GKJB 1KP3A 5KX5A 3CCUV 2IJJA 5FPRA 4AILC 1O9GA 4UB8Z 5KAFZ 3JARB 2EINB 5LMUB 1N0NA 5EC1C 5H5NA 1HP8A 4FFBA 1GH6A 4TUYA 3JATA 2RJZA 3CE2A 1SS3A 5FPOA 4OPHA 4JV5O 1BL8A 1AR1B 3EVKA 2FB5A 3ICXA 4GX0A 4WFEA 3ZJZA 2WPDG 1BCCH 3K0DA 2CTRA 4U7OA 4UCTA 4DO2A 5LXTB 3THOA 4AQYO 5KHIA 4ZI7A 2W6IG 2E5LB 3I5DA 1OCCC 2QM4A 4GUNA 4KFMA 4C7UA 1FJGO 4GCZA 5CB4B 4FM1A 1PP9H 4RQFA 2XAQA 3U0ZA 2DN9A 3CCRV 1SETA 1BQ0A 2QM7A 1JFFB 2P4KA 3OEEG 1AP5A 2QSAA 4LF6O 1FXKB 3CS5A 3ABMC 5DN6G 5DEDA 1HNXB 2Q67A 4CS4A 3OFNG 5B1BB 3FAVA 2HEPA 4LF5O 2N04A 5JCOA 4W4LA 1HR0B 1Y76B 1B3QA 4IYIA 3ASNC 2EIMC 1Y76A 4U7NA 4YY3B 4YIOA 1FYJA 1LUVA 1FD9A 2HJDA 3Q4HA 1FXKC 2QA4V 2ZE6A 4J10A 2GHYA 3DTUB 1ZTEA 2E3CA 3A0HZ 1QLEB 4JYAB 1M1KW 4D7TA 3SDLA 3SYOA 4QIWF 3WU2Z 4FZ0A 1R3JC 4J7ZA 1KKCA 4B7EA 3K9AA 2DQ3A 1UJWB 1IXMA 1S5JA 1O9HA 2RDCA 3SJAC 1M56C 4Q20A 2QM8A 3K5NA 2HHHO 1H2SB 2IJHA 2WAMA 3PJSK 3HB3B 4NTXA 2D2CB 3CCVV 1NTMH 2EBOA 2Q4PA 3SR2C 5KUKA 1HNWO 2OCHA 4LF6B 2H94A 1VARA 2DYRC 4QGPA 4JI7O 5KMGB 1AI5A 4UXNA 2D3OW 2QWOB 2ZXWC 2ZE7A 2VQFB 4GKKB 3H1IH 4DYLA 1YIJV 1H8HG 1ZX3A 4RO2A 4PA7A 2N74A 4O4HA 1GN6A 5GONA 1TUBB 3T4DA 2WLIB 1RSOA 1MA1A 3AG2C 1N34B 4LFBB 2UXNA 2WLJA 1Q43A 2UU9B 3EHBB 4RUFA 2EIJC 2LFRA 2R9AA 3FAVB 5KAIZ 3M8AA 2JVDA 3MAQA 2XTAA 5CA0B 5HFMA 5IYDO 1FFXA 3ZHUA 2EJRA 3JSNA 4FMTA 3ZRWB 1K34A 4GX5A 4X1KB 3UCSC 1AR5A 1JPXA 3VQWA 1AB3A 2IH1C 5LGUA 3OW2U 1NJIW 1H2LA 4DUZB 4JF3A 5A2QN 1XQ8A 1M90W 1FJGB 5CA0A 1S76D 3OE7G 1AJNA 2F43G 3LSUA 2LO1A 1Z2GA 4K35A 4NR1A 5KA6A 1MNGA 5KUMA 4FLWA 2ZDIA 4CH4A 1B06A 5B3SC 3QNEA 1N36O 1P7BA 1SQXH 2ZT9B 1J5EB 1S5HC 4PA6A 1Y4MA 2ODMA 3RYFA 4FFKA 4KUMA 3NR7A 4JI2B 3E22A 4ZBMA 3TJTA 2MK3A 3SPJA 4DR2B 2AHYA 3JAKA 1K33A 1Y66A 4TQDA 3ETEA 4CC6A 5KX5B 1N34O 4LFBO 1PM9A 1ROPA 4WBNB 2A0LA 1YSCA 4E4EA 1BMFG 2CTQA 2AZ2A 1QVGU 1LR1A 1SQQH 1IBMB 1CXZB 4CS3A 1ENVA 3DXRA 2L35A 1Y74B 5BMVA 4FLVA 3LSSA 5KLVH 4J80A 3X2QB 3APQA 4DR5O 3CWBH 1K4DC 3CXHF 2LP7A 3LUTB 2KQXA 3SJBC 2OWOA 2HFEC 3U10A 3QO5A 1S77D 2XASA 1P4RA 3CCMV 1R73A 3ZX6A 1H2MA 1PNMA 1GM7A 3VBBA 1J95A 1M57C 4KHPB 1PPJH 3JSLA 3ZRSA 1NVPD 4RAIA 3CCLV 3DXRB 4B3MO 3ZEDA 2VRZA 2CH7A 2PUSA 3B77A 3O65A 3C3SA 4PA4A 4I50A 4J11A 1JA8A 2PF4E 1K5SA 4L87A 2FTKA 1JFFA 3CRCA 1WP7A 1OCZC 2RCVA 4F6EA 4JYCA 1FAFA 1JMKC 4DR2O 2H8PC 2R70A 4CH6A 2W0FC 2RMKB 3JYCA 5F2VO 1HNZB 3A2FA 4O2BA 1D5AA 2ZR3A 4FJCC 1S3JA 3SJQC 2DWEC 3N27A 4LF8O 4HZ3A 4JI4B 2BSKA 2QDOA 4FFBB 3L71H 4YHHO 2DJVA 3FB6C 4TQFA 1JVMA 5L3FA 3STZC 2LGWA 5LGTA 1NH2D 4LFCO 4IIJA 1DTOA 1WLEA 1HW7A 2Z0AA 4MVSA 4ZHQA 4DV0B 1B6QA 5J2TB 3IJ4A 5EBMC 3P3NA 2L6LA 2WWWA 4X62B 2ADPA 2IW5A 3N2GB 3OD4A 3MD0A 4IGGA 1XBLA 2Q0AA 4LF4B 4DR7O 5C93A 5GONB 1M4UA 1RSOB 3CRRA 5LHGA 5IJ0A 4LH7A 1Q5OA 1IBKB 3ZMZA 2KG7A 3G4SV 2YEVA 1XOUA 1OHHG 3F7YC 2EZPA 4O4IB 3T4ZA 1NVPB 4JI8B 4FLXA 2E76B 1IXBA 2ZM6B 1OCRC 1H38A 4MTXA 2A06H 5EYPA 2Q7EA 4ABMA 3P3PA 4O2AB 5IY5B 1YEWA 5J2UA 4O2AA 1GO3F 5IYZA 2QKSA 3SPHA 1R6KA 4MVZA 4IHJA 2Q5ZA 3G71V 5CN0A 2H3OA 3JAWA 1WB8A 2LJ2A 1L1FA 4I9WA 4DV2B 2DOSA 1B04A 4DK0A 3R65A 4PI2A 4PJ0Z 2XNDG 1QHTA 4LF7B 5JQGA 2ZNIA 3QG5A 4X66B 3H1JH 3HKDB 3AG4B 5BR8O 4DV4B 4P2ZA 5GTHZ 1XDCA 1GM9A 4N21A 5EBLC 1AROP 1OV9A 2CGOA 2CAZC 2E75B 1PKXA 2P67A 3OT7A 4GKKO 1NKDA 3FKSG 1PNLA 2XHBA 1RP3B 4MVMA 1VQ8V 4O4JA 2X0LA 1G6UA 2EILB 2GDSA 3N2KA 4LWSB 1HNWB 2Q6AA 5JQGB 1IURA 4JI1O 3SJCC 1PV0A 2ZE5A 4YJ3A 3BVOA 3HKCB 4H13B 3B09A 5KHKA 2X6AA 2QWQB 1FS0G 1XNRO 3H1LH 3DSQA 3JARA 3K5LA 2ZCEA 3UT5A 1GRJA 4RQEA 2XT9A 2B1GA 1BS3A 2PTMA 4Q6GA 4ZOLB 5H9CA 2JJ1G 5KHJA 5LOVA 3JAWB 3L70H 2UXCB 2VQFO 2X6BA 3H1KH 4QNHB 1RM1C 3UT5B 3VQYA 5H6QA 1SZXA 4YJ2B 1K92A 1M93A 2QWPB 1XNQB 1JJOA 3IC7A 2P06A 2HLDG 1YXBA 3S3XA 3BA8A 4B3SB 4WFAV 4EB6A 5H6RA 3T1HO 3D3IA 2F95B 1K9MW 4HNAB 4DUYB 3WB0A 1WA8A 3SPIA 1BGYH 2OT5A 3AG1C 1TAEA 1W0JG 1HWYA 5LBQA 4X65B 1DF4A 4JI6O 2A3QA 3E8HA 3N2GA 2OYQA 1K3EA 2VS0A 3M7MX 1MSWD 1VF6C 3RYIA 1MZFA 2QE7G 5EZYB 3FFQA 4HNAA 3JCUZ 5CA3A 2VQEB 1EN5A 5C8YB 4X64B 3CCSV 2BTQB 2CTWA 3AG3C 2QJ1A 3ABKB 3I56V 2DYSC 2FYUH 1W2BU 4NTYA 2F4VB 2ETNA 1H8EG 2KB1A 3B8NA 1QLEC 3L74H 4JPRA 1WP8A 1VQ7V 2YXLA 2GV9A 1SC5B 3RGBA 1XUQA 1SQFA 1VEWA 4KP4A 1NBMG 3TCUA 5GW7A 4DR5B 2JS3A 3T1YO 3K5MA 4LFAB 2YICA 5EBWC 1I08A 1YVWA 4LNUA 4LNUB 4BIOA 3QVNA 4O4LA 4EKWA 1TGOA 2DW4A 2KKWA 4QPJA 1EFRG 4FLYA 2VWKA 2CE4A 3ETDA 3ABMB 5JJEB 5LHIA 2AW9A 1EM1A 1M5IA 4NVPA 4J42A 1N32O 1MG1A 1SA0B 3IAYA 4IT5A 2V7QG 3JAKB 1Q82W 4JTCB 1XMQB 2VWJA 3OMAB 1YZBA 2IM9A 4I55A 4UCVA 5JH7B 3AG3B 4LFCB 5CB4A 3LNMB 1GTOA 4IHJB 3RYFB 4CC5A 2RQ6A 4BWAA 1VMGA 2AXTZ 2IJIA 3D3QA 1EZJA 5LA6A 4MS2A 3A0RA 3CRQA 2A79B 4UV9A 3OGIB 3JD3A 3I55V 1QVFU 1BHAA 3VOUA 2IBZH 2ZR2A 2MW2B 3BPZA 4JI4O 4GYCB 1GM8A 3KG2A 2Y48A 2KSDA 2LW7A 1AILA 2EINC 3JATB 3AG1B 2WLNA 1EBOA 1RPRA 3CSXA 5ITZA 5LGNA 1V54B 4NTWA 2EIKC 2JIZG 4I0XB 1K73W 4D7SA 4JTDB 1WAZA 1TA8A 4TSFG 4X66O 2F93B 4JI0O 4D6TH 2X6CA 4B7KA 1AJQA 2Z3YA 2BOCC 4U3JA 2ZQMA 3JASB 3ZRWA 1P7GA 4ZOLA 1WB7A 3KCYA 3ZHVA 1XI1A 1VQNV 3CEIA 1LNQA 2FKXA 1URFA 2AHZA 2JDIG 5EYPB 5EC2C 1XHXA 4PD4F 1KD1W 1E1QG 3DC5A 2ZD9A 4O2BB 4LBEC 4UVCA 2Q68A 3CPWU 4I55B 3ZMSA 5LMNB 1IDSA 4E2LA 1ZL8B 3RW0A 4PHZA 1VIBA 3LDEA 4R8CA 1JQ0A 2UUBO 4DV4O 2QGNA 4LWSA 4DV3B 2YS8A 1BHBA 4LF7O 4DV7B 1AI4A 3ABLB 3D36C 2OCCB 1NR7A 5FNVA 5B1AB 2EILC 2HG5C 2ARHA 1H2NA 5BR8B 3OM3B 4PDVA 3JD2A 2IJKA 2E74B 3LSQA 4HAMA 3B8MA 1YHQV 2LFSA 2Q7GA 1RFYA 2P4VA 2R9RB 1L0LH 3H9VA 2P90A 2OTLV 4R50A 3OEHG 4BW5A 3N2KB 4UCSA 4JI1B 4FPPA 5BZBA 2DWDC 3OR6C 5KHGA 2OIEA 3RYCB 4PV1B 4NYKA 4JGSA 4WFHA 3ZRXA 2ZIOA 5LP6A 1QLNA 3A0BZ 3CMEV 3TXSA 4MSWC 5J2UB 1JCHA 1SKVA 5LP6C 4DRXA 4H0LB 3HKBB 3TGUH 1DLBA 4CBCA 3GVMA 2Y0IA 4L8JA 4UVAA 5EIBD 4JYAO 2M7WA 3F7VC 1A32A 3RYHB 2PGGA 5D5PA 4EEQA 1KMIZ 4ZI7B 2NNUA 3QF7A 4DR6B 4DR7B 2Q0OC 4JTAB 4MVOA 2Q7HA 1QNMA 1E79G 4GKJO 4P9PA 4MTOA 1QR8A 4X1YB 1HR0O 5L3BA 4WFBV 1G4YB 4TOIA 4I7ZB 4QE7A 1HDJA 3E83A 2HHHB 5L3EA 1GK9A 4Z1VA 3CMAV 5IJ9A 2WLKA 1VP7A 4EFEA 1F51A 4J9YB 3OGCC 4O4IA 1XNQO 4JAVA 3WG7C 1KYOF 2QWNB 1GN3A 4FLZA 2XAFA 1KU9A 3B40A 3VQXA 2BCCH 4EFBA 4G27B 1SQPH 5B1OA 4OX9B 3OUFA 4PELA 4KL1A 4WF9V 3ZCCA 1HNZO 4QPKA 3JD0A 3RWRD 1VQ5V 5ITZB 4JI0B 3ZHRA 5CBGA 1DGSA 3ZS8C 5IT9N 3GB7C 4JI3O 2UXBB 4J7JA 1JOYA 4J41A 3UKMA 1KQSU 2ITCC 4X20B 1WJZA 3K9SA 2Y4TA 3MHSC 5LA6B 3K58A 1SZTA 1G8MA 4TV8A 1QQCA 3HKEB 5FLXN 1BQZA 3T1YB 2PYJA 3BRCA 1BE3H 5B1NA 1QCEA 2PYLA 1YF2A 5GTIZ 4TV9B 1IZ3A 2QWRB 4YJ3B 1F4NA 2AGAA 3JD1A 2ZE8A 4K8ZA 1M57B 2NR5A 1QU7A 2HVJC 3FYIB 4UB6Z 1V9PA 1G1XB 1SA0A 2QTOA 4LF9O 2RNBA 4JYBA 5LYJB 2CK3G 5LYJA 3HKBA 2Q9LA 3DGEA 5CMUA 1R3KC 5E79Z 3E89A 4GLXA 4H37A 1LUWA 3E22B 2XOKG 4OXSA 1F7YA 1FPOA 3G6EV 4DR3O 3E8GA 4WBNA 4PDRA 4GX2A 4Z2WA 4DR4O 3R66A 1R6NA 3K04A 5B1AC 4TUYB 2G38A 1HNXO 1IVSA 1TUEB 2LW1A 3GWKC 2F4VO 4U3JB 3WB2A 5J9PC 4GX1A 4TV8B 4K0KB 2YIDA 4BR6A 4JAAA 2C2AA 2YIAA 1AR4A 3CC7V 3ETGA 3OUSA 4MT8A 4AQYB 1DF5A 2UXCO 3H1HH 4B08A 3K59A 4LR3A 3OTOO 3FB7C 3ZN0A 4FM2A 4JASA 3UQ8A 5BXZA 4RWUA 3L75H 2YEVB 3SYPA 1F4MA 2IH3C 4X1IA 1SQBH 3FD9A 4P9OA 4UV8A 4LF9B 1ORQC 1WA8B 1YCIA 4YJ2A 1CPYA 2P22C 4FK5C 3S3WA 1D2DA 4FM0A 1XMOO 3E8FA 4BIZA 3K3WA 4DR1B 2EIJB 2LQTA 2QKCA 3A8TA 2E5LO 3HPLC 2HR3A 1KUQA 3ML0A 4ZKIA 5E1AC 3BABA 3AG2B 1N33B 1S5LZ 2Y69B 2GTSA 2YC0A 5LL6Y 1SRYA 4X8AA 1MSDA 1OCOB 2IU3A 4K3AA 2ZXWB 2XUMA 3C90A 3ABUA 3J81N 3TK1A 2DYRB 3SYCA 4IYHA 4DR6O 1N0JA 1X4TA 4BAYA 3VQVA 4JI5B 3MHHC 3AK3A 1UPGA 3W7WA 3OTOB 2B1IA 3IFXA 3JALA 5J2TA 4WFGA 1RPOA 2JEUA 2FMLA 1XL4A 2O57A 4UVBA 1PL0A 1W59A 3FX7A 1YDXA 1NH2B 1NQTA 1SQGA 4XDLA 4DUYO 1Y67A 4H44B 3ZHTA 2UUAO 2GBOA 2PZSA 4MW3A 3AG7A 1H2KA 3B4SA 2OCCC 3AEIA 3CYOA 3IGAC 1KECA 3UM7A 4G2KA 5JH7A 3ASNB 2ATKC 1V55C 1Q7YW 4CZZA 3D36A 1IBLO 5B1BC 1IX9A 4O4LB 3SPGA 3HR0A 3JCZA 3FB5C 1VQPV 3RYIB 4QJFB 1KKDA 5EZYA 4MVQA 4FLTA 3TXQA 5LMUO 1MABG 4I4TB 2HP8A 4JI5O 1YJWV 3RVZA 4LCUC 1MOFA 2F1MA 2PI5A 4ASUG 5A9GA 4JYYA 4DV2O 3HKDA 2UU9O 3ABKC 4DV1B 4AHCA 2YSUB 4X62O 1R3LC 5EK0A 2HVKC 3D8CA 5EIBC 1VF5B 3L9DA 3SYQA 1SESA 3BY6A 1YJ9V 1MZEA 1EN6A 2ZINA 4GZRB 1S72V 4PA3A 1XL6A 5B5EZ 2P6JA 4I0XA 4G28B 3G67A 5IYZB 4LF8B 4H33A 2PY5A 1IBMO 2UUAB 4OGQB 3ZBHA 1WNSA 1NZ6A 1V54C 2OTJV 2W0XA 1AVMA 4Z1MG 2N05A 4YIPA 4FZ1A 4DV5B 1XHZA 1GKFA 4PDMA 2P7TC 4LC1A 3FYEB 3U11A 1NU1H 4DV3O 2YXYA 3F5TA 1N8RW 3BHPA 1Q86W 3CRMA 4X1IB 5KMGA 2UXBO 4X20A 2YIBA 1QBZA 3CC4V 1UFIA 3RYHA 2B9ZA 3CD6V 1R3IC 1KBHA 1WPBA 1Q3EA 4DRXB 3ZMUA 2EX3A 1WN7A 1PNKA 3O9OA 3UO2A 3L72H 2V4DA 1SQVH 5LOVB 5JWPA 3CB2A 1GN2A 4YXWG 1AI6A 1K5QA 3K5OA 3W7SA 2QEXV 3SPCA 2ZM6O 2CH7B 1E1RG 1V55B 2DQ0A 1U97A 4MVRA 3G6BA 1JJ2U 3M99B 2BTOA 2XAJA 4I50B 1Q81W 2B5UA 1Q6IA 1X59A 4P30A 3RYCA 5LHHA 4JI6B 4DV5O 3ASOB 3APOA 4NB5A 3W7UA 2OIGA 4HYOA 3BAAA 4FLUA 5C8YA 2DYSB 3BEHA 4UUJC 5D5QA 1I94B 3AK1A 4XBFA 1ZWIC 1N33O 4XDKA 2CTPA 3CCJV 1WPXA 4NXMB 1IBLB 2UUBB 2UXDO 1EN4A 4FVMA 5IDJA 3E86A 3JD4A 1VQ4V 4EB6B 1BZKA 2DE0X 1OJHA 3E2EA 4XDJA 1GMGA 1I7FA 2BTQA 1U96A 2X7RB 1I5YA 3BFRA 3J80N 3RFRA 2BSKB 3LNNA 3K57A 1OCOC 2GTAA 4JZGA 1GN4A 3F5WC 4MW8A 4AI8A 4PDLA 4PI0A 1M9NA 1TUBA 4WCEV 5IY5C 2JEXA 1DK1A 2Y69C 3ZIAG 4LF4O 4ZHQB 2YXHA 2A7WA 4UCUA 5FL7G 3CP1A 4A5UB 1Q90D 4F6RB 4ZIBA 3RT3C 3RN4A 1RM1B 4X65O 2UXXA 1K8AW 3NXSA 1K7DA 4OX9O 2CUGA 3DC6A 3ZMTA 1BSMA 3LDCA 2Z5UA 1FXHA 2UXDB 3W7TA 3K0GA 2F66C 1VF7A 4UCOA 5L3DA 2R72A 2GUZA 1NS1A 4JI8O 2HKOA 2VQEO 4GT1A 4MTFA 4O4JB 1JR9A 1XEQA 4F6RA 4DV6O 1XMOB 3Q4HB 3CCEV 4X9QA 4WFFA 3BA9A 3ABTA 1EZVH 4RUEA 4W4KA 2JGDA 2JGDB 1P84F 2CDYA 5IYBO 4NXNB 1VF6A 3K08A 3ZHSA 2CGNA 5AG2A 1OZ0A 5KA5A 1VQMV 1KC8W 1CEZA 1FFXB 1XILA 4KHPO 2W6JG 3OAAG 2WA3A 3IC9A 1JX9A 1GAXA 3OMIB 2EJ7A 5JJJB 4N23A 1AJPA 2ADQB 3T1CA 1N36B 1P49A 4I4TA 2JRIA 2FL4A 3CXCU 1OCZB 2UUCO 3SGIA 4O4HB 4B3RB 3AG4C 4B3SO 2Y0PA 5L3GA 3KZIZ 4JZ2A 3K79A 4B3TO 2Q8VA 3P32A 1YITV 3HKCA 1CP9A 1NTZH 3WB1A 4PA9A 3ZHQA 4U3FH 2ILMA 3QO7A 5BMVB 3QTCA 5DECA 5JVDB 3RVYA 5IWAO 2YI9A 3ZN1A 3SYAA 3J7AU 2WA4A 2ZIMA 5FNVB 3L73H 1ZL8A 1OCRB 1R6TA 1XREA 4YY3O 1D5NA 3WFVA 4R6ZA 2A9HA 1MMMA 3H01A 2JK5C 4NXNO 1I5XA 2WLLB 5IJ0B 5CA1B 4F4LA 3QO8A 2ZNJA 1AP6A 2KG7B 4ICGA 3T1HB 1YTFD 1Z5VA 3AK2A 4I9QA 3E8BA 4DR1O 2R9IA 4IIJB 3CX5F 4TT3G 2HJFC 1NI8A 2Y4UA 2Q69A 1AI7A 4QE9A 3OR7C 2JS5A 4B3RO 3PN1A 5BY1A 2JJ2G 3OTFA 2F23A 2LGQA 4UFZA 3ZRVA 1N32B 2WLLA 4I5SA 1I0HA 3WG7B 2V1DA 5IJ9B 4IL6Z 1Q6UA 2WLMA 3CHXA 2K1EA 3C3TA 5LXTA 3K03A 1COWG 2WLIA 1YJNV 5HFLA 4JI7B 4DV6B 5KHHA 1YTFB 4LFAO 4DW0A 1L0NH 2YDEA 2YUAA 2QR4A 3UO3A 5B66Z 1VQLV 1F23A 3TETA 4DV0O 4CS2A 2NLJC 4CH3A 2NN4A 5JCOC 2UUCB 4J7KA 2RN9A 4K0KO 2IU0A 3STLC 1L8DA 3B2EE 3FB8C 1R1BA 1FXKA 4LH6A 4DXWA 3ZMVA 5TISZ 1KP2A 4NKGB 4LP8A 5CA1A 4X1YA 3EFFK 5LP6B 2JGUA 3JASA 2YI8A 1Q8IA 5IYCO 2BE3A 5H2FZ 4DK1A 3ETQA 1XMQO 2ZKOA 1ZUQA 1VQ9V 5L3CA 4JI3B 2K9PA 3CJHB 1Y74A 1NTKH 1Y6XA 2XAHA 1PD3A 1US6A 4CH5A 1THZA 4UCRA 1S0VA 1TVKA 4LF5B
chains in the Genus database with same CATH topology
2IJKA 1S72V 1NH2D 1VQOV 1M56B 1DTOA 4PA3A 1WLEA 1XL6A 2P6JA 4J9ZB 1NR1A 3LSQA 4G28B 4HAMA 3B8MA 1YHQV 4MVSA 2LFSA 4TWKA 4H33A 1B6QA 1FXVA 3X2QC 3W7XA 1V54C 2R9RB 5EBMC 2OTJV 2P90A 4Z1MG 2OTLV 3RBZA 4R50A 4FIPC 2WWWA 3OEHG 1SERA 4BW5A 2IW5A 3MD0A 1GKFA 4PDMA 1QR9A 4FPPA 2P7TC 3ASOC 4LC1A 5BZBA 3FYEB 1N8RW 2DWDC 4MTGA 3OR6C 1Q86W 4JAUA 4BIUA 3ABLC 1QBZA 5C93A 3CC2V 3CC4V 4JGSA 5LHGA 3LDDA 4WFHA 2EIMB 3ZRXA 3P30A 3CD6V 1R3IC 1QLNA 3GWOA 3CMEV 2WSSG 3ZMZA 4X88A 4MSWC 1K97A 1VQKV 4R7CA 2EZOA 1JCHA 1VQ6V 2BOBC 3ZMUA 3G4SV 2YEVA 1OHHG 3F7YC 1PNKA 2EZPA 3T4ZA 5B3SB 1DLBA 4CBCA 4UVAA 1NVPB 2M7WA 3F7VC 1OCRC 1H38A 4MTXA 1W0KG 1K4CC 4YXWG 5IY5B 1OCCB 2NNUA 1AI6A 1GO3F 1H2GA 4JTAB 2QKSA 3SPHA 4MVOA 1R6KA 1K5QA 2PI4A 4MVZA 1E79G 3W7SA 2QEXV 4P9PA 4X89A 3SPCA 4MTOA 3G71V 1QR8A 5L3BA 5CN0A 3CCQV 3K06A 2GSMB 2XAGA 1G4YB 4MVUA 4WFBV 5CBHA 1E1RG 1V55B 2DQ0A 2ZDIC 4I9WA 4MVRA 1L1FA 1JJ2U 3M99B 4QE7A 3E83A 2XAJA 1FFTB 3R65A 3E35A 1GK9A 2XNDG 5L3EA 1Q81W 2B5UA 3CMAV 5CBFA 2WLKA 1F51A 4P30A 4J9YB 3OGCC 5LHHA 5DM6V 4JAVA 3ASOB 3WG7C 2ITDC 3W7UA 2XAFA 3AG4B 1YI2V 3T2MA 3OMNB 4HYOA 2WLHA 4G27B 5B1OA 3OUFA 4PELA 2EIKB 4P2ZA 4WF9V 2DYSB 3BEHA 4UUJC 1GM9A 3ZCCA 4N21A 5EBLC 1KP3A 1AROP 4QPKA 3JD0A 3CCUV 2IJJA 4XBFA 1ZWIC 1PKXA 2EINB 1VQ5V 4XDKA 2P67A 3CCJV 5EC1C 1NKDA 3FKSG 1PNLA 1WPXA 5CBGA 4MVMA 1VQ8V 2X0LA 5IDJA 2EILB 3GB7C 3E86A 1BL8A 2Q6AA 1AR1B 3JD4A 1VQ4V 4GX0A 3E2EA 4XDJA 4WFEA 3ZJZA 1JOYA 2WPDG 3UKMA 3K0DA 1KQSU 1GMGA 2ITCC 2X6AA 4U7OA 2X7RB 1I5YA 4DO2A 1FS0G 1OCOC 3MHSC 1SZTA 1G8MA 2W6IG 3F5WC 4MW8A 4PDLA 1M9NA 1OCCC 4KFMA 4WCEV 5IY5C 4RQEA 4GCZA 2JEXA 2B1GA 4RQFA 2Y69C 2XAQA 3CCRV 3ZIAG 5H9CA 1SETA 2QM7A 2JJ1G 5B1NA 3OEEG 1FXKB 1QCEA 5FL7G 3ABMC 5DN6G 3CP1A 2Q67A 1F4NA 3OFNG 3JD1A 2X6BA 5B1BB 4QNHB 1RM1B 1RM1C 1M57B 5H6QA 2UXXA 3ASNC 2EIMC 2HVJC 3FYIB 1K8AW 4U7NA 3NXSA 1K7DA 3ZMTA 2QTOA 1K92A 3LDCA 3IC7A 1FXKC 4JYBA 2CK3G 2HLDG 2Z5UA 2QA4V 1FXHA 2GHYA 3W7TA 3K0GA 3DTUB 4WFAV 5L3DA 5H6RA 1QLEB 3DGEA 5CMUA 1R3KC 2HKOA 3D3IA 3E89A 1M1KW 4GT1A 1K9MW 4MTFA 3SYOA 4QIWF 4H37A 1R3JC 2XOKG 4OXSA 3K9AA 2DQ3A 1UJWB 1IXMA 3SPIA 3G6EV 3CCEV 2OT5A 4WFFA 3AG1C 3ABTA 1W0JG 1HWYA 4RUEA 3E8GA 5LBQA 1M56C 4Q20A 4PDRA 2QM8A 4GX2A 1DF4A 2IJHA 2WAMA 3PJSK 3HB3B 5IYBO 1R6NA 3K08A 3CCVV 3K04A 5B1AC 3E8HA 1K3EA 1OZ0A 5KA5A 2EBOA 1TUEB 1VQMV 1KC8W 1CEZA 1MSWD 5KUKA 2QE7G 5J9PC 4GX1A 2W6JG 2H94A 3OAAG 2DYRC 1JX9A 5CA3A 1AI5A 4UXNA 2C2AA 2D3OW 3OMIB 3CCSV 2ZXWC 4N23A 3CC7V 3ETGA 3OUSA 3AG3C 1AJPA 4MT8A 3ABKB 3I56V 2DYSC 3T1CA 1W2BU 1DF5A 1YIJV 1H8HG 4RO2A 3CXCU 4PA7A 1OCZB 1H8EG 3FB7C 2KB1A 3B8NA 3AG4C 3T4DA 3ZN0A 2WLIB 3AG2C 1QLEC 4JPRA 5L3GA 2UXNA 4JASA 2WLJA 1VQ7V 2YEVB 3EHBB 4RUFA 3SYPA 1F4MA 2EIJC 2IH3C 2LFRA 3K79A 4P9OA 4KP4A 1NBMG 3P32A 4UV8A 5GW7A 3TCUA 1YITV 1ORQC 1CP9A 5HFMA 5EBWC 5IYDO 4PA9A 2EJRA 4FMTA 3ZRWB 4EKWA 3QO7A 1CPYA 1K34A 4FK5C 4GX5A 2DW4A 1JPXA 3RVYA 2IH1C 4QPJA 3ZN1A 3E8FA 5LGUA 3OW2U 1NJIW 3SYAA 1EFRG 4BIZA 3K3WA 3ETDA 3ABMB 4JF3A 5LHIA 1M90W 2EIJB 1S76D 3OE7G 1AJNA 2F43G 2HR3A 3HPLC 1MG1A 3ML0A 4ZKIA 5E1AC 3AG2B 1OCRB 2V7QG 5KA6A 2Y69B 3WFVA 4R6ZA 1Q82W 2A9HA 4JTCB 5KUMA 3OMAB 1SRYA 2ZDIA 3H01A 5B3SC 3QNEA 4X8AA 2JK5C 3AG3B 1P7BA 3LNMB 1GTOA 1OCOB 1S5HC 2IU3A 2ZXWB 4PA6A 1Y4MA 3ABUA 2IJIA 1I5XA 2WLLB 4KUMA 3TK1A 1EZJA 2DYRB 4F4LA 3QO8A 4MS2A 3A0RA 4ZBMA 3SYCA 2MK3A 3SPJA 2A79B 2AHYA 4UV9A 1K33A 1YTFD 1Y66A 3JD3A 4BAYA 3ETEA 3I55V 3MHHC 1QVFU 3E8BA 1BHAA 3VOUA 1ROPA 2ZR2A 2R9IA 3W7WA 2A0LA 2HJFC 1YSCA 1GM8A 4TT3G 3KG2A 1BMFG 2Y48A 2B1IA 3IFXA 1QVGU 2Q69A 4WFGA 1RPOA 1AI7A 4QE9A 3OR7C 2EINC 2JEUA 3AG1B 2WLNA 1EBOA 1ENVA 1XL4A 1RPRA 2JJ2G 5LGNA 4UVBA 1PL0A 1V54B 3LSSA 2EIKC 2JIZG 3X2QB 1K73W 4JTDB 1NH2B 3ZRVA 1NQTA 4XDLA 2WLLA 4TSFG 4I5SA 1K4DC 2LP7A 2V1DA 3WG7B 3LUTB 2X6CA 2HFEC 2WLMA 4MW3A 3QO5A 1AJQA 2K1EA 1S77D 2Z3YA 2BOCC 1P4RA 2XASA 3CCMV 1R73A 1PNMA 3K03A 1COWG 2OCCC 2WLIA 2ZQMA 3AEIA 3CYOA 3IGAC 1KECA 1GM7A 3ZRWA 5HFLA 1YJNV 3UM7A 4G2KA 3VBBA 1J95A 3ASNB 1M57C 1YTFB 2ATKC 1V55C 1Q7YW 3ZRSA 4CZZA 1NVPD 3D36A 4RAIA 3CCLV 1VQNV 5B1BC 1LNQA 1VQLV 1F23A 2AHZA 3TETA 2JDIG 5EC2C 3SPGA 2NLJC 1KD1W 1E1QG 2ZD9A 3JCZA 3FB5C 5LGTA 1VQPV 3B77A 4QJFB 1KKDA 4LBEC 4PA4A 4MVQA 4UVCA 2Q68A 1MABG 3CPWU 1K5SA 3ZMSA 4L87A 2FTKA 2IU0A 1YJWV 3RVZA 3STLC 3FB8C 1OCZC 1MOFA 4LCUC 4E2LA 2PI5A 4JYCA 1FXKA 4ASUG 4DXWA 3ZMVA 3RW0A 1KP2A 2H8PC 4LP8A 3ABKC 2W0FC 2YSUB 3EFFK 3LDEA 3JYCA 4R8CA 1JQ0A 5IYCO 1R3LC 5EK0A 2ZR3A 4FJCC 2HVKC 1S3JA 3SJQC 2DWEC 1VQ9V 5L3CA 1BHBA 4HZ3A 1SESA 3SYQA 1AI4A 3BY6A 1YJ9V 3ABLB 2XAHA 2OCCB 1NR7A 2EILC 2HG5C 5B1AB 1PD3A 3FB6C 3OM3B 1JVMA 1THZA 5L3FA 1S0VA 4PDVA 3STZC 3JD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P2Z A;  4RUE A;  3E8G A;  4PA3 A;  1M56 C;  1XL6 A;  4PDR A;  4J9Z B;  3BEH A;  3E8B A;  4UUJ C;  3VOU A;  4G28 B;  4GX2 A;  2A0L A;  5EBL C;  4MVS A;  4TWK A;  2HJF C;  4H33 A;  3KG2 A;  3PJS K;  3IFX A;  2Q69 A;  3K08 A;  1ZWI C;  3K04 A;  4QE9 A;  4WFG A;  5B1A C;  3E8H A;  1V54 C;  2R9R B;  3OR7 C;  4XDK A;  5EBM C;  2EIN C;  5EC1 C;  5CBG A;  3RBZ A;  4R50 A;  2WLN A;  4BW5 A;  1XL4 A;  4MVM A;  5KUK A;  5J9P C;  4GX1 A;  4PDM A;  2DYR C;  3GB7 C;  2P7T C;  3ASO C;  5BZB A;  3E86 A;  1BL8 A;  2EIK C;  2Q6A A;  4JTD B;  2DWD C;  4MTG A;  3OR6 C;  4XDL A;  2ZXW C;  2WLL A;  4GX0 A;  4XDJ A;  4WFE A;  3OUS A;  3ZJZ A;  3AG3 C;  3UKM A;  3K0D A;  1K4D C;  2DYS C;  3T1C A;  3LUT B;  2ITC C;  3ABL C;  2X6A A;  2X6C A;  2HFE C;  2WLM A;  4RO2 A;  4PA7 A;  4MW3 A;  3LDD A;  4WFH A;  3FB7 C;  2K1E A;  1OCO C;  2KB1 A;  2BOC C;  1R3I C;  3AG4 C;  3T4D A;  2WLI B;  3AG2 C;  3F5W C;  1QLE C;  3K03 A;  4MW8 A;  2OCC C;  2WLI A;  3IGA C;  2WLJ A;  4PDL A;  4X88 A;  1OCC C;  4KFM A;  4MSW C;  5IY5 C;  4R7C A;  4RUF A;  3SYP A;  3UM7 A;  2EIJ C;  2IH3 C;  1J95 A;  2Y69 C;  4P9O A;  2BOB C;  1M57 C;  2YEV A;  2ATK C;  1V55 C;  3ZRS A;  3F7Y C;  3TCU A;  4RAI A;  3T4Z A;  1ORQ C;  1LNQ A;  5B1B C;  4CBC A;  5EBW C;  2AHZ A;  3TET A;  3F7V C;  4PA9 A;  5EC2 C;  3SPG A;  3ABM C;  1OCR C;  2NLJ C;  2ZD9 A;  3FB5 C;  4EKW A;  2Q67 A;  4GX5 A;  1KKD A;  4LBE C;  1K4C C;  4PA4 A;  3RVY A;  4MVQ A;  2X6B A;  2IH1 C;  2Q68 A;  4QNH B;  3E8F A;  4JTA B;  3SYA A;  2QKS A;  3SPH A;  4MVO A;  4MVZ A;  3ASN C;  2EIM C;  3RVZ A;  2HVJ C;  3STL C;  3FB8 C;  1OCZ C;  4LCU C;  4P9P A;  4MTO A;  4X89 A;  3SPC A;  3HPL C;  2QTO A;  4DXW A;  3K06 A;  4MVU A;  3RW0 A;  1G4Y B;  2H8P C;  4LP8 A;  5CBH A;  3ABK C;  3LDC A;  2W0F C;  5E1A C;  3X2Q C;  4I9W A;  4MVR A;  3LDE A;  3EFF K;  3JYC A;  4R8C A;  4R6Z A;  4QE7 A;  2A9H A;  3E83 A;  4JTC B;  5KUM A;  1R3L C;  5EK0 A;  3K0G A;  3R65 A;  2HVK C;  5B3S C;  3SJQ C;  4X8A A;  2JK5 C;  1R3K C;  1P7B A;  3LNM B;  2DWE C;  5CBF A;  3E89 A;  1S5H C;  2WLK A;  4PA6 A;  4HZ3 A;  4MTF A;  4J9Y B;  3OGC C;  4P30 A;  3SYQ A;  3SYO A;  4H37 A;  2WLL B;  1R3J C;  2EIL C;  2HG5 C;  3WG7 C;  4F4L A;  2ITD C;  3FB6 C;  4MS2 A;  4OXS A;  4ZBM A;  3SYC A;  1JVM A;  3SPJ A;  3T2M A;  2A79 B;  2AHY A;  4HYO A;  4PDV A;  2WLH A;  3SPI A;  4G27 B;  3STZ C;  4WFF A;  3OUF A;  3AG1 C; 
#chains in the Genus database with same CATH topology
 1VQO V;  1M56 B;  4DW1 A;  5K1X A;  4J9Z B;  1NR1 A;  4DV7 O;  4TWK A;  3EXA A;  5IWA B;  1FXV A;  3CJH A;  1J5E O;  3X2Q C;  3W7X A;  3KKY A;  3KCX A;  1FKA O;  3RBZ A;  4FIP C;  4OPA A;  4K8X A;  1SER A;  3HKE A;  1TVK B;  1QR9 A;  3ASO C;  1KB9 F;  2AZ0 A;  4MTG A;  2YIB D;  4JAU A;  4B3T B;  1ZAU A;  4NXM O;  4BIU A;  3ABL C;  3CC2 V;  3MDS A;  1BT8 A;  2EUL A;  2M6Y A;  3LDD A;  2EIM B;  3P30 A;  1Q6H A;  4TV9 A;  3GWO A;  2WSS G;  4X88 A;  1K97 A;  1I94 O;  1VQK V;  4R7C A;  2EZO A;  4JV5 B;  5JJN B;  1N4C A;  1VQ6 V;  2BOB C;  5B3S B;  2QTS A;  5K1P A;  4DV1 O;  1ZLZ A;  3JAL B;  3JAM N;  1ZSP A;  1IBK O;  5JVD A;  1W0K G;  1K4C C;  1OCC B;  1H2G A;  4X1K A;  3BCC H;  1Z5W A;  2PI4 A;  4X89 A;  4BW9 A;  2P5O A;  3CCQ V;  3K06 A;  2GSM B;  2XAG A;  4MVU A;  4B3M B;  5CBH A;  2ZDI C;  1T5E A;  4JI2 O;  4YHH B;  1FFT B;  1XNR B;  3E35 A;  2GUZ B;  4KXR A;  3CRA A;  4DUZ O;  5CBF A;  4HBN A;  5DM6 V;  2Q73 A;  4DR4 B;  5LMN O;  2ITD C;  4X64 O;  1YI2 V;  4DR3 B;  3T2M A;  3OMN B;  2QKA A;  2WLH A;  3G80 A;  5IE9 A;  2DMX A;  2EIK B;  1PL4 A;  1SF9 A;  1NT2 B;  4GKJ B;  1KP3 A;  5KX5 A;  3CCU V;  2IJJ A;  5FPR A;  4AIL C;  1O9G A;  4UB8 Z;  5KAF Z;  3JAR B;  2EIN B;  5LMU B;  1N0N A;  5EC1 C;  5H5N A;  1HP8 A;  4FFB A;  1GH6 A;  4TUY A;  3JAT A;  2RJZ A;  3CE2 A;  1SS3 A;  5FPO A;  4OPH A;  4JV5 O;  1BL8 A;  1AR1 B;  3EVK A;  2FB5 A;  3ICX A;  4GX0 A;  4WFE A;  3ZJZ A;  2WPD G;  1BCC H;  3K0D A;  2CTR A;  4U7O A;  4UCT A;  4DO2 A;  5LXT B;  3THO A;  4AQY O;  5KHI A;  4ZI7 A;  2W6I G;  2E5L B;  3I5D A;  1OCC C;  2QM4 A;  4GUN A;  4KFM A;  4C7U A;  1FJG O;  4GCZ A;  5CB4 B;  4FM1 A;  1PP9 H;  4RQF A;  2XAQ A;  3U0Z A;  2DN9 A;  3CCR V;  1SET A;  1BQ0 A;  2QM7 A;  1JFF B;  2P4K A;  3OEE G;  1AP5 A;  2QSA A;  4LF6 O;  1FXK B;  3CS5 A;  3ABM C;  5DN6 G;  5DED A;  1HNX B;  2Q67 A;  4CS4 A;  3OFN G;  5B1B B;  3FAV A;  2HEP A;  4LF5 O;  2N04 A;  5JCO A;  4W4L A;  1HR0 B;  1Y76 B;  1B3Q A;  4IYI A;  3ASN C;  2EIM C;  1Y76 A;  4U7N A;  4YY3 B;  4YIO A;  1FYJ A;  1LUV A;  1FD9 A;  2HJD A;  3Q4H A;  1FXK C;  2QA4 V;  2ZE6 A;  4J10 A;  2GHY A;  3DTU B;  1ZTE A;  2E3C A;  3A0H Z;  1QLE B;  4JYA B;  1M1K W;  4D7T A;  3SDL A;  3SYO A;  4QIW F;  3WU2 Z;  4FZ0 A;  1R3J C;  4J7Z A;  1KKC A;  4B7E A;  3K9A A;  2DQ3 A;  1UJW B;  1IXM A;  1S5J A;  1O9H A;  2RDC A;  3SJA C;  1M56 C;  4Q20 A;  2QM8 A;  3K5N A;  2HHH O;  1H2S B;  2IJH A;  2WAM A;  3PJS K;  3HB3 B;  4NTX A;  2D2C B;  3CCV V;  1NTM H;  2EBO A;  2Q4P A;  3SR2 C;  5KUK A;  1HNW O;  2OCH A;  4LF6 B;  2H94 A;  1VAR A;  2DYR C;  4QGP A;  4JI7 O;  5KMG B;  1AI5 A;  4UXN A;  2D3O W;  2QWO B;  2ZXW C;  2ZE7 A;  2VQF B;  4GKK B;  3H1I H;  4DYL A;  1YIJ V;  1H8H G;  1ZX3 A;  4RO2 A;  4PA7 A;  2N74 A;  4O4H A;  1GN6 A;  5GON A;  1TUB B;  3T4D A;  2WLI B;  1RSO A;  1MA1 A;  3AG2 C;  1N34 B;  4LFB B;  2UXN A;  2WLJ A;  1Q43 A;  2UU9 B;  3EHB B;  4RUF A;  2EIJ C;  2LFR A;  2R9A A;  3FAV B;  5KAI Z;  3M8A A;  2JVD A;  3MAQ A;  2XTA A;  5CA0 B;  5HFM A;  5IYD O;  1FFX A;  3ZHU A;  2EJR A;  3JSN A;  4FMT A;  3ZRW B;  1K34 A;  4GX5 A;  4X1K B;  3UCS C;  1AR5 A;  1JPX A;  3VQW A;  1AB3 A;  2IH1 C;  5LGU A;  3OW2 U;  1NJI W;  1H2L A;  4DUZ B;  4JF3 A;  5A2Q N;  1XQ8 A;  1M90 W;  1FJG B;  5CA0 A;  1S76 D;  3OE7 G;  1AJN A;  2F43 G;  3LSU A;  2LO1 A;  1Z2G A;  4K35 A;  4NR1 A;  5KA6 A;  1MNG A;  5KUM A;  4FLW A;  2ZDI A;  4CH4 A;  1B06 A;  5B3S C;  3QNE A;  1N36 O;  1P7B A;  1SQX H;  2ZT9 B;  1J5E B;  1S5H C;  4PA6 A;  1Y4M A;  2ODM A;  3RYF A;  4FFK A;  4KUM A;  3NR7 A;  4JI2 B;  3E22 A;  4ZBM A;  3TJT A;  2MK3 A;  3SPJ A;  4DR2 B;  2AHY A;  3JAK A;  1K33 A;  1Y66 A;  4TQD A;  3ETE A;  4CC6 A;  5KX5 B;  1N34 O;  4LFB O;  1PM9 A;  1ROP A;  4WBN B;  2A0L A;  1YSC A;  4E4E A;  1BMF G;  2CTQ A;  2AZ2 A;  1QVG U;  1LR1 A;  1SQQ H;  1IBM B;  1CXZ B;  4CS3 A;  1ENV A;  3DXR A;  2L35 A;  1Y74 B;  5BMV A;  4FLV A;  3LSS A;  5KLV H;  4J80 A;  3X2Q B;  3APQ A;  4DR5 O;  3CWB H;  1K4D C;  3CXH F;  2LP7 A;  3LUT B;  2KQX A;  3SJB C;  2OWO A;  2HFE C;  3U10 A;  3QO5 A;  1S77 D;  2XAS A;  1P4R A;  3CCM V;  1R73 A;  3ZX6 A;  1H2M A;  1PNM A;  1GM7 A;  3VBB A;  1J95 A;  1M57 C;  4KHP B;  1PPJ H;  3JSL A;  3ZRS A;  1NVP D;  4RAI A;  3CCL V;  3DXR B;  4B3M O;  3ZED A;  2VRZ A;  2CH7 A;  2PUS A;  3B77 A;  3O65 A;  3C3S A;  4PA4 A;  4I50 A;  4J11 A;  1JA8 A;  2PF4 E;  1K5S A;  4L87 A;  2FTK A;  1JFF A;  3CRC A;  1WP7 A;  1OCZ C;  2RCV A;  4F6E A;  4JYC A;  1FAF A;  1JMK C;  4DR2 O;  2H8P C;  2R70 A;  4CH6 A;  2W0F C;  2RMK B;  3JYC A;  5F2V O;  1HNZ B;  3A2F A;  4O2B A;  1D5A A;  2ZR3 A;  4FJC C;  1S3J A;  3SJQ C;  2DWE C;  3N27 A;  4LF8 O;  4HZ3 A;  4JI4 B;  2BSK A;  2QDO A;  4FFB B;  3L71 H;  4YHH O;  2DJV A;  3FB6 C;  4TQF A;  1JVM A;  5L3F A;  3STZ C;  2LGW A;  5LGT A;  1NH2 D;  4LFC O;  4IIJ A;  1DTO A;  1WLE A;  1HW7 A;  2Z0A A;  4MVS A;  4ZHQ A;  4DV0 B;  1B6Q A;  5J2T B;  3IJ4 A;  5EBM C;  3P3N A;  2L6L A;  2WWW A;  4X62 B;  2ADP A;  2IW5 A;  3N2G B;  3OD4 A;  3MD0 A;  4IGG A;  1XBL A;  2Q0A A;  4LF4 B;  4DR7 O;  5C93 A;  5GON B;  1M4U A;  1RSO B;  3CRR A;  5LHG A;  5IJ0 A;  4LH7 A;  1Q5O A;  1IBK B;  3ZMZ A;  2KG7 A;  3G4S V;  2YEV A;  1XOU A;  1OHH G;  3F7Y C;  2EZP A;  4O4I B;  3T4Z A;  1NVP B;  4JI8 B;  4FLX A;  2E76 B;  1IXB A;  2ZM6 B;  1OCR C;  1H38 A;  4MTX A;  2A06 H;  5EYP A;  2Q7E A;  4ABM A;  3P3P A;  4O2A B;  5IY5 B;  1YEW A;  5J2U A;  4O2A A;  1GO3 F;  5IYZ A;  2QKS A;  3SPH A;  1R6K A;  4MVZ A;  4IHJ A;  2Q5Z A;  3G71 V;  5CN0 A;  2H3O A;  3JAW A;  1WB8 A;  2LJ2 A;  1L1F A;  4I9W A;  4DV2 B;  2DOS A;  1B04 A;  4DK0 A;  3R65 A;  4PI2 A;  4PJ0 Z;  2XND G;  1QHT A;  4LF7 B;  5JQG A;  2ZNI A;  3QG5 A;  4X66 B;  3H1J H;  3HKD B;  3AG4 B;  5BR8 O;  4DV4 B;  4P2Z A;  5GTH Z;  1XDC A;  1GM9 A;  4N21 A;  5EBL C;  1ARO P;  1OV9 A;  2CGO A;  2CAZ C;  2E75 B;  1PKX A;  2P67 A;  3OT7 A;  4GKK O;  1NKD A;  3FKS G;  1PNL A;  2XHB A;  1RP3 B;  4MVM A;  1VQ8 V;  4O4J A;  2X0L A;  1G6U A;  2EIL B;  2GDS A;  3N2K A;  4LWS B;  1HNW B;  2Q6A A;  5JQG B;  1IUR A;  4JI1 O;  3SJC C;  1PV0 A;  2ZE5 A;  4YJ3 A;  3BVO A;  3HKC B;  4H13 B;  3B09 A;  5KHK A;  2X6A A;  2QWQ B;  1FS0 G;  1XNR O;  3H1L H;  3DSQ A;  3JAR A;  3K5L A;  2ZCE A;  3UT5 A;  1GRJ A;  4RQE A;  2XT9 A;  2B1G A;  1BS3 A;  2PTM A;  4Q6G A;  4ZOL B;  5H9C A;  2JJ1 G;  5KHJ A;  5LOV A;  3JAW B;  3L70 H;  2UXC B;  2VQF O;  2X6B A;  3H1K H;  4QNH B;  1RM1 C;  3UT5 B;  3VQY A;  5H6Q A;  1SZX A;  4YJ2 B;  1K92 A;  1M93 A;  2QWP B;  1XNQ B;  1JJO A;  3IC7 A;  2P06 A;  2HLD G;  1YXB A;  3S3X A;  3BA8 A;  4B3S B;  4WFA V;  4EB6 A;  5H6R A;  3T1H O;  3D3I A;  2F95 B;  1K9M W;  4HNA B;  4DUY B;  3WB0 A;  1WA8 A;  3SPI A;  1BGY H;  2OT5 A;  3AG1 C;  1TAE A;  1W0J G;  1HWY A;  5LBQ A;  4X65 B;  1DF4 A;  4JI6 O;  2A3Q A;  3E8H A;  3N2G A;  2OYQ A;  1K3E A;  2VS0 A;  3M7M X;  1MSW D;  1VF6 C;  3RYI A;  1MZF A;  2QE7 G;  5EZY B;  3FFQ A;  4HNA A;  3JCU Z;  5CA3 A;  2VQE B;  1EN5 A;  5C8Y B;  4X64 B;  3CCS V;  2BTQ B;  2CTW A;  3AG3 C;  2QJ1 A;  3ABK B;  3I56 V;  2DYS C;  2FYU H;  1W2B U;  4NTY A;  2F4V B;  2ETN A;  1H8E G;  2KB1 A;  3B8N A;  1QLE C;  3L74 H;  4JPR A;  1WP8 A;  1VQ7 V;  2YXL A;  2GV9 A;  1SC5 B;  3RGB A;  1XUQ A;  1SQF A;  1VEW A;  4KP4 A;  1NBM G;  3TCU A;  5GW7 A;  4DR5 B;  2JS3 A;  3T1Y O;  3K5M A;  4LFA B;  2YIC A;  5EBW C;  1I08 A;  1YVW A;  4LNU A;  4LNU B;  4BIO A;  3QVN A;  4O4L A;  4EKW A;  1TGO A;  2DW4 A;  2KKW A;  4QPJ A;  1EFR G;  4FLY A;  2VWK A;  2CE4 A;  3ETD A;  3ABM B;  5JJE B;  5LHI A;  2AW9 A;  1EM1 A;  1M5I A;  4NVP A;  4J42 A;  1N32 O;  1MG1 A;  1SA0 B;  3IAY A;  4IT5 A;  2V7Q G;  3JAK B;  1Q82 W;  4JTC B;  1XMQ B;  2VWJ A;  3OMA B;  1YZB A;  2IM9 A;  4I55 A;  4UCV A;  5JH7 B;  3AG3 B;  4LFC B;  5CB4 A;  3LNM B;  1GTO A;  4IHJ B;  3RYF B;  4CC5 A;  2RQ6 A;  4BWA A;  1VMG A;  2AXT Z;  2IJI A;  3D3Q A;  1EZJ A;  5LA6 A;  4MS2 A;  3A0R A;  3CRQ A;  2A79 B;  4UV9 A;  3OGI B;  3JD3 A;  3I55 V;  1QVF U;  1BHA A;  3VOU A;  2IBZ H;  2ZR2 A;  2MW2 B;  3BPZ A;  4JI4 O;  4GYC B;  1GM8 A;  3KG2 A;  2Y48 A;  2KSD A;  2LW7 A;  1AIL A;  2EIN C;  3JAT B;  3AG1 B;  2WLN A;  1EBO A;  1RPR A;  3CSX A;  5ITZ A;  5LGN A;  1V54 B;  4NTW A;  2EIK C;  2JIZ G;  4I0X B;  1K73 W;  4D7S A;  4JTD B;  1WAZ A;  1TA8 A;  4TSF G;  4X66 O;  2F93 B;  4JI0 O;  4D6T H;  2X6C A;  4B7K A;  1AJQ A;  2Z3Y A;  2BOC C;  4U3J A;  2ZQM A;  3JAS B;  3ZRW A;  1P7G A;  4ZOL A;  1WB7 A;  3KCY A;  3ZHV A;  1XI1 A;  1VQN V;  3CEI A;  1LNQ A;  2FKX A;  1URF A;  2AHZ A;  2JDI G;  5EYP B;  5EC2 C;  1XHX A;  4PD4 F;  1KD1 W;  1E1Q G;  3DC5 A;  2ZD9 A;  4O2B B;  4LBE C;  4UVC A;  2Q68 A;  3CPW U;  4I55 B;  3ZMS A;  5LMN B;  1IDS A;  4E2L A;  1ZL8 B;  3RW0 A;  4PHZ A;  1VIB A;  3LDE A;  4R8C A;  1JQ0 A;  2UUB O;  4DV4 O;  2QGN A;  4LWS A;  4DV3 B;  2YS8 A;  1BHB A;  4LF7 O;  4DV7 B;  1AI4 A;  3ABL B;  3D36 C;  2OCC B;  1NR7 A;  5FNV A;  5B1A B;  2EIL C;  2HG5 C;  2ARH A;  1H2N A;  5BR8 B;  3OM3 B;  4PDV A;  3JD2 A;  2IJK A;  2E74 B;  3LSQ A;  4HAM A;  3B8M A;  1YHQ V;  2LFS A;  2Q7G A;  1RFY A;  2P4V A;  2R9R B;  1L0L H;  3H9V A;  2P90 A;  2OTL V;  4R50 A;  3OEH G;  4BW5 A;  3N2K B;  4UCS A;  4JI1 B;  4FPP A;  5BZB A;  2DWD C;  3OR6 C;  5KHG A;  2OIE A;  3RYC B;  4PV1 B;  4NYK A;  4JGS A;  4WFH A;  3ZRX A;  2ZIO A;  5LP6 A;  1QLN A;  3A0B Z;  3CME V;  3TXS A;  4MSW C;  5J2U B;  1JCH A;  1SKV A;  5LP6 C;  4DRX A;  4H0L B;  3HKB B;  3TGU H;  1DLB A;  4CBC A;  3GVM A;  2Y0I A;  4L8J A;  4UVA A;  5EIB D;  4JYA O;  2M7W A;  3F7V C;  1A32 A;  3RYH B;  2PGG A;  5D5P A;  4EEQ A;  1KMI Z;  4ZI7 B;  2NNU A;  3QF7 A;  4DR6 B;  4DR7 B;  2Q0O C;  4JTA B;  4MVO A;  2Q7H A;  1QNM A;  1E79 G;  4GKJ O;  4P9P A;  4MTO A;  1QR8 A;  4X1Y B;  1HR0 O;  5L3B A;  4WFB V;  1G4Y B;  4TOI A;  4I7Z B;  4QE7 A;  1HDJ A;  3E83 A;  2HHH B;  5L3E A;  1GK9 A;  4Z1V A;  3CMA V;  5IJ9 A;  2WLK A;  1VP7 A;  4EFE A;  1F51 A;  4J9Y B;  3OGC C;  4O4I A;  1XNQ O;  4JAV A;  3WG7 C;  1KYO F;  2QWN B;  1GN3 A;  4FLZ A;  2XAF A;  1KU9 A;  3B40 A;  3VQX A;  2BCC H;  4EFB A;  4G27 B;  1SQP H;  5B1O A;  4OX9 B;  3OUF A;  4PEL A;  4KL1 A;  4WF9 V;  3ZCC A;  1HNZ O;  4QPK A;  3JD0 A;  3RWR D;  1VQ5 V;  5ITZ B;  4JI0 B;  3ZHR A;  5CBG A;  1DGS A;  3ZS8 C;  5IT9 N;  3GB7 C;  4JI3 O;  2UXB B;  4J7J A;  1JOY A;  4J41 A;  3UKM A;  1KQS U;  2ITC C;  4X20 B;  1WJZ A;  3K9S A;  2Y4T A;  3MHS C;  5LA6 B;  3K58 A;  1SZT A;  1G8M A;  4TV8 A;  1QQC A;  3HKE B;  5FLX N;  1BQZ A;  3T1Y B;  2PYJ A;  3BRC A;  1BE3 H;  5B1N A;  1QCE A;  2PYL A;  1YF2 A;  5GTI Z;  4TV9 B;  1IZ3 A;  2QWR B;  4YJ3 B;  1F4N A;  2AGA A;  3JD1 A;  2ZE8 A;  4K8Z A;  1M57 B;  2NR5 A;  1QU7 A;  2HVJ C;  3FYI B;  4UB6 Z;  1V9P A;  1G1X B;  1SA0 A;  2QTO A;  4LF9 O;  2RNB A;  4JYB A;  5LYJ B;  2CK3 G;  5LYJ A;  3HKB A;  2Q9L A;  3DGE A;  5CMU A;  1R3K C;  5E79 Z;  3E89 A;  4GLX A;  4H37 A;  1LUW A;  3E22 B;  2XOK G;  4OXS A;  1F7Y A;  1FPO A;  3G6E V;  4DR3 O;  3E8G A;  4WBN A;  4PDR A;  4GX2 A;  4Z2W A;  4DR4 O;  3R66 A;  1R6N A;  3K04 A;  5B1A C;  4TUY B;  2G38 A;  1HNX O;  1IVS A;  1TUE B;  2LW1 A;  3GWK C;  2F4V O;  4U3J B;  3WB2 A;  5J9P C;  4GX1 A;  4TV8 B;  4K0K B;  2YID A;  4BR6 A;  4JAA A;  2C2A A;  2YIA A;  1AR4 A;  3CC7 V;  3ETG A;  3OUS A;  4MT8 A;  4AQY B;  1DF5 A;  2UXC O;  3H1H H;  4B08 A;  3K59 A;  4LR3 A;  3OTO O;  3FB7 C;  3ZN0 A;  4FM2 A;  4JAS A;  3UQ8 A;  5BXZ A;  4RWU A;  3L75 H;  2YEV B;  3SYP A;  1F4M A;  2IH3 C;  4X1I A;  1SQB H;  3FD9 A;  4P9O A;  4UV8 A;  4LF9 B;  1ORQ C;  1WA8 B;  1YCI A;  4YJ2 A;  1CPY A;  2P22 C;  4FK5 C;  3S3W A;  1D2D A;  4FM0 A;  1XMO O;  3E8F A;  4BIZ A;  3K3W A;  4DR1 B;  2EIJ B;  2LQT A;  2QKC A;  3A8T A;  2E5L O;  3HPL C;  2HR3 A;  1KUQ A;  3ML0 A;  4ZKI A;  5E1A C;  3BAB A;  3AG2 B;  1N33 B;  1S5L Z;  2Y69 B;  2GTS A;  2YC0 A;  5LL6 Y;  1SRY A;  4X8A A;  1MSD A;  1OCO B;  2IU3 A;  4K3A A;  2ZXW B;  2XUM A;  3C90 A;  3ABU A;  3J81 N;  3TK1 A;  2DYR B;  3SYC A;  4IYH A;  4DR6 O;  1N0J A;  1X4T A;  4BAY A;  3VQV A;  4JI5 B;  3MHH C;  3AK3 A;  1UPG A;  3W7W A;  3OTO B;  2B1I A;  3IFX A;  3JAL A;  5J2T A;  4WFG A;  1RPO A;  2JEU A;  2FML A;  1XL4 A;  2O57 A;  4UVB A;  1PL0 A;  1W59 A;  3FX7 A;  1YDX A;  1NH2 B;  1NQT A;  1SQG A;  4XDL A;  4DUY O;  1Y67 A;  4H44 B;  3ZHT A;  2UUA O;  2GBO A;  2PZS A;  4MW3 A;  3AG7 A;  1H2K A;  3B4S A;  2OCC C;  3AEI A;  3CYO A;  3IGA C;  1KEC A;  3UM7 A;  4G2K A;  5JH7 A;  3ASN B;  2ATK C;  1V55 C;  1Q7Y W;  4CZZ A;  3D36 A;  1IBL O;  5B1B C;  1IX9 A;  4O4L B;  3SPG A;  3HR0 A;  3JCZ A;  3FB5 C;  1VQP V;  3RYI B;  4QJF B;  1KKD A;  5EZY A;  4MVQ A;  4FLT A;  3TXQ A;  5LMU O;  1MAB G;  4I4T B;  2HP8 A;  4JI5 O;  1YJW V;  3RVZ A;  4LCU C;  1MOF A;  2F1M A;  2PI5 A;  4ASU G;  5A9G A;  4JYY A;  4DV2 O;  3HKD A;  2UU9 O;  3ABK C;  4DV1 B;  4AHC A;  2YSU B;  4X62 O;  1R3L C;  5EK0 A;  2HVK C;  3D8C A;  5EIB C;  1VF5 B;  3L9D A;  3SYQ A;  1SES A;  3BY6 A;  1YJ9 V;  1MZE A;  1EN6 A;  2ZIN A;  4GZR B;  1S72 V;  4PA3 A;  1XL6 A;  5B5E Z;  2P6J A;  4I0X A;  4G28 B;  3G67 A;  5IYZ B;  4LF8 B;  4H33 A;  2PY5 A;  1IBM O;  2UUA B;  4OGQ B;  3ZBH A;  1WNS A;  1NZ6 A;  1V54 C;  2OTJ V;  2W0X A;  1AVM A;  4Z1M G;  2N05 A;  4YIP A;  4FZ1 A;  4DV5 B;  1XHZ A;  1GKF A;  4PDM A;  2P7T C;  4LC1 A;  3FYE B;  3U11 A;  1NU1 H;  4DV3 O;  2YXY A;  3F5T A;  1N8R W;  3BHP A;  1Q86 W;  3CRM A;  4X1I B;  5KMG A;  2UXB O;  4X20 A;  2YIB A;  1QBZ A;  3CC4 V;  1UFI A;  3RYH A;  2B9Z A;  3CD6 V;  1R3I C;  1KBH A;  1WPB A;  1Q3E A;  4DRX B;  3ZMU A;  2EX3 A;  1WN7 A;  1PNK A;  3O9O A;  3UO2 A;  3L72 H;  2V4D A;  1SQV H;  5LOV B;  5JWP A;  3CB2 A;  1GN2 A;  4YXW G;  1AI6 A;  1K5Q A;  3K5O A;  3W7S A;  2QEX V;  3SPC A;  2ZM6 O;  2CH7 B;  1E1R G;  1V55 B;  2DQ0 A;  1U97 A;  4MVR A;  3G6B A;  1JJ2 U;  3M99 B;  2BTO A;  2XAJ A;  4I50 B;  1Q81 W;  2B5U A;  1Q6I A;  1X59 A;  4P30 A;  3RYC A;  5LHH A;  4JI6 B;  4DV5 O;  3ASO B;  3APO A;  4NB5 A;  3W7U A;  2OIG A;  4HYO A;  3BAA A;  4FLU A;  5C8Y A;  2DYS B;  3BEH A;  4UUJ C;  5D5Q A;  1I94 B;  3AK1 A;  4XBF A;  1ZWI C;  1N33 O;  4XDK A;  2CTP A;  3CCJ V;  1WPX A;  4NXM B;  1IBL B;  2UUB B;  2UXD O;  1EN4 A;  4FVM A;  5IDJ A;  3E86 A;  3JD4 A;  1VQ4 V;  4EB6 B;  1BZK A;  2DE0 X;  1OJH A;  3E2E A;  4XDJ A;  1GMG A;  1I7F A;  2BTQ A;  1U96 A;  2X7R B;  1I5Y A;  3BFR A;  3J80 N;  3RFR A;  2BSK B;  3LNN A;  3K57 A;  1OCO C;  2GTA A;  4JZG A;  1GN4 A;  3F5W C;  4MW8 A;  4AI8 A;  4PDL A;  4PI0 A;  1M9N A;  1TUB A;  4WCE V;  5IY5 C;  2JEX A;  1DK1 A;  2Y69 C;  3ZIA G;  4LF4 O;  4ZHQ B;  2YXH A;  2A7W A;  4UCU A;  5FL7 G;  3CP1 A;  4A5U B;  1Q90 D;  4F6R B;  4ZIB A;  3RT3 C;  3RN4 A;  1RM1 B;  4X65 O;  2UXX A;  1K8A W;  3NXS A;  1K7D A;  4OX9 O;  2CUG A;  3DC6 A;  3ZMT A;  1BSM A;  3LDC A;  2Z5U A;  1FXH A;  2UXD B;  3W7T A;  3K0G A;  2F66 C;  1VF7 A;  4UCO A;  5L3D A;  2R72 A;  2GUZ A;  1NS1 A;  4JI8 O;  2HKO A;  2VQE O;  4GT1 A;  4MTF A;  4O4J B;  1JR9 A;  1XEQ A;  4F6R A;  4DV6 O;  1XMO B;  3Q4H B;  3CCE V;  4X9Q A;  4WFF A;  3BA9 A;  3ABT A;  1EZV H;  4RUE A;  4W4K A;  2JGD A;  2JGD B;  1P84 F;  2CDY A;  5IYB O;  4NXN B;  1VF6 A;  3K08 A;  3ZHS A;  2CGN A;  5AG2 A;  1OZ0 A;  5KA5 A;  1VQM V;  1KC8 W;  1CEZ A;  1FFX B;  1XIL A;  4KHP O;  2W6J G;  3OAA G;  2WA3 A;  3IC9 A;  1JX9 A;  1GAX A;  3OMI B;  2EJ7 A;  5JJJ B;  4N23 A;  1AJP A;  2ADQ B;  3T1C A;  1N36 B;  1P49 A;  4I4T A;  2JRI A;  2FL4 A;  3CXC U;  1OCZ B;  2UUC O;  3SGI A;  4O4H B;  4B3R B;  3AG4 C;  4B3S O;  2Y0P A;  5L3G A;  3KZI Z;  4JZ2 A;  3K79 A;  4B3T O;  2Q8V A;  3P32 A;  1YIT V;  3HKC A;  1CP9 A;  1NTZ H;  3WB1 A;  4PA9 A;  3ZHQ A;  4U3F H;  2ILM A;  3QO7 A;  5BMV B;  3QTC A;  5DEC A;  5JVD B;  3RVY A;  5IWA O;  2YI9 A;  3ZN1 A;  3SYA A;  3J7A U;  2WA4 A;  2ZIM A;  5FNV B;  3L73 H;  1ZL8 A;  1OCR B;  1R6T A;  1XRE A;  4YY3 O;  1D5N A;  3WFV A;  4R6Z A;  2A9H A;  1MMM A;  3H01 A;  2JK5 C;  4NXN O;  1I5X A;  2WLL B;  5IJ0 B;  5CA1 B;  4F4L A;  3QO8 A;  2ZNJ A;  1AP6 A;  2KG7 B;  4ICG A;  3T1H B;  1YTF D;  1Z5V A;  3AK2 A;  4I9Q A;  3E8B A;  4DR1 O;  2R9I A;  4IIJ B;  3CX5 F;  4TT3 G;  2HJF C;  1NI8 A;  2Y4U A;  2Q69 A;  1AI7 A;  4QE9 A;  3OR7 C;  2JS5 A;  4B3R O;  3PN1 A;  5BY1 A;  2JJ2 G;  3OTF A;  2F23 A;  2LGQ A;  4UFZ A;  3ZRV A;  1N32 B;  2WLL A;  4I5S A;  1I0H A;  3WG7 B;  2V1D A;  5IJ9 B;  4IL6 Z;  1Q6U A;  2WLM A;  3CHX A;  2K1E A;  3C3T A;  5LXT A;  3K03 A;  1COW G;  2WLI A;  1YJN V;  5HFL A;  4JI7 B;  4DV6 B;  5KHH A;  1YTF B;  4LFA O;  4DW0 A;  1L0N H;  2YDE A;  2YUA A;  2QR4 A;  3UO3 A;  5B66 Z;  1VQL V;  1F23 A;  3TET A;  4DV0 O;  4CS2 A;  2NLJ C;  4CH3 A;  2NN4 A;  5JCO C;  2UUC B;  4J7K A;  2RN9 A;  4K0K O;  2IU0 A;  3STL C;  1L8D A;  3B2E E;  3FB8 C;  1R1B A;  1FXK A;  4LH6 A;  4DXW A;  3ZMV A;  5TIS Z;  1KP2 A;  4NKG B;  4LP8 A;  5CA1 A;  4X1Y A;  3EFF K;  5LP6 B;  2JGU A;  3JAS A;  2YI8 A;  1Q8I A;  5IYC O;  2BE3 A;  5H2F Z;  4DK1 A;  3ETQ A;  1XMQ O;  2ZKO A;  1ZUQ A;  1VQ9 V;  5L3C A;  4JI3 B;  2K9P A;  3CJH B;  1Y74 A;  1NTK H;  1Y6X A;  2XAH A;  1PD3 A;  1US6 A;  4CH5 A;  1THZ A;  4UCR A;  1S0V A;  1TVK A;  4LF5 B; 
#chains in the Genus database with same CATH homology
 2IJK A;  1S72 V;  1NH2 D;  1VQO V;  1M56 B;  1DTO A;  4PA3 A;  1WLE A;  1XL6 A;  2P6J A;  4J9Z B;  1NR1 A;  3LSQ A;  4G28 B;  4HAM A;  3B8M A;  1YHQ V;  4MVS A;  2LFS A;  4TWK A;  4H33 A;  1B6Q A;  1FXV A;  3X2Q C;  3W7X A;  1V54 C;  2R9R B;  5EBM C;  2OTJ V;  2P90 A;  4Z1M G;  2OTL V;  3RBZ A;  4R50 A;  4FIP C;  2WWW A;  3OEH G;  1SER A;  4BW5 A;  2IW5 A;  3MD0 A;  1GKF A;  4PDM A;  1QR9 A;  4FPP A;  2P7T C;  3ASO C;  4LC1 A;  5BZB A;  3FYE B;  1N8R W;  2DWD C;  4MTG A;  3OR6 C;  1Q86 W;  4JAU A;  4BIU A;  3ABL C;  1QBZ A;  5C93 A;  3CC2 V;  3CC4 V;  4JGS A;  5LHG A;  3LDD A;  4WFH A;  2EIM B;  3ZRX A;  3P30 A;  3CD6 V;  1R3I C;  1QLN A;  3GWO A;  3CME V;  2WSS G;  3ZMZ A;  4X88 A;  4MSW C;  1K97 A;  1VQK V;  4R7C A;  2EZO A;  1JCH A;  1VQ6 V;  2BOB C;  3ZMU A;  3G4S V;  2YEV A;  1OHH G;  3F7Y C;  1PNK A;  2EZP A;  3T4Z A;  5B3S B;  1DLB A;  4CBC A;  4UVA A;  1NVP B;  2M7W A;  3F7V C;  1OCR C;  1H38 A;  4MTX A;  1W0K G;  1K4C C;  4YXW G;  5IY5 B;  1OCC B;  2NNU A;  1AI6 A;  1GO3 F;  1H2G A;  4JTA B;  2QKS A;  3SPH A;  4MVO A;  1R6K A;  1K5Q A;  2PI4 A;  4MVZ A;  1E79 G;  3W7S A;  2QEX V;  4P9P A;  4X89 A;  3SPC A;  4MTO A;  3G71 V;  1QR8 A;  5L3B A;  5CN0 A;  3CCQ V;  3K06 A;  2GSM B;  2XAG A;  1G4Y B;  4MVU A;  4WFB V;  5CBH A;  1E1R G;  1V55 B;  2DQ0 A;  2ZDI C;  4I9W A;  4MVR A;  1L1F A;  1JJ2 U;  3M99 B;  4QE7 A;  3E83 A;  2XAJ A;  1FFT B;  3R65 A;  3E35 A;  1GK9 A;  2XND G;  5L3E A;  1Q81 W;  2B5U A;  3CMA V;  5CBF A;  2WLK A;  1F51 A;  4P30 A;  4J9Y B;  3OGC C;  5LHH A;  5DM6 V;  4JAV A;  3ASO B;  3WG7 C;  2ITD C;  3W7U A;  2XAF A;  3AG4 B;  1YI2 V;  3T2M A;  3OMN B;  4HYO A;  2WLH A;  4G27 B;  5B1O A;  3OUF A;  4PEL A;  2EIK B;  4P2Z A;  4WF9 V;  2DYS B;  3BEH A;  4UUJ C;  1GM9 A;  3ZCC A;  4N21 A;  5EBL C;  1KP3 A;  1ARO P;  4QPK A;  3JD0 A;  3CCU V;  2IJJ A;  4XBF A;  1ZWI C;  1PKX A;  2EIN B;  1VQ5 V;  4XDK A;  2P67 A;  3CCJ V;  5EC1 C;  1NKD A;  3FKS G;  1PNL A;  1WPX A;  5CBG A;  4MVM A;  1VQ8 V;  2X0L A;  5IDJ A;  2EIL B;  3GB7 C;  3E86 A;  1BL8 A;  2Q6A A;  1AR1 B;  3JD4 A;  1VQ4 V;  4GX0 A;  3E2E A;  4XDJ A;  4WFE A;  3ZJZ A;  1JOY A;  2WPD G;  3UKM A;  3K0D A;  1KQS U;  1GMG A;  2ITC C;  2X6A A;  4U7O A;  2X7R B;  1I5Y A;  4DO2 A;  1FS0 G;  1OCO C;  3MHS C;  1SZT A;  1G8M A;  2W6I G;  3F5W C;  4MW8 A;  4PDL A;  1M9N A;  1OCC C;  4KFM A;  4WCE V;  5IY5 C;  4RQE A;  4GCZ A;  2JEX A;  2B1G A;  4RQF A;  2Y69 C;  2XAQ A;  3CCR V;  3ZIA G;  5H9C A;  1SET A;  2QM7 A;  2JJ1 G;  5B1N A;  3OEE G;  1FXK B;  1QCE A;  5FL7 G;  3ABM C;  5DN6 G;  3CP1 A;  2Q67 A;  1F4N A;  3OFN G;  3JD1 A;  2X6B A;  5B1B B;  4QNH B;  1RM1 B;  1RM1 C;  1M57 B;  5H6Q A;  2UXX A;  3ASN C;  2EIM C;  2HVJ C;  3FYI B;  1K8A W;  4U7N A;  3NXS A;  1K7D A;  3ZMT A;  2QTO A;  1K92 A;  3LDC A;  3IC7 A;  1FXK C;  4JYB A;  2CK3 G;  2HLD G;  2Z5U A;  2QA4 V;  1FXH A;  2GHY A;  3W7T A;  3K0G A;  3DTU B;  4WFA V;  5L3D A;  5H6R A;  1QLE B;  3DGE A;  5CMU A;  1R3K C;  2HKO A;  3D3I A;  3E89 A;  1M1K W;  4GT1 A;  1K9M W;  4MTF A;  3SYO A;  4QIW F;  4H37 A;  1R3J C;  2XOK G;  4OXS A;  3K9A A;  2DQ3 A;  1UJW B;  1IXM A;  3SPI A;  3G6E V;  3CCE V;  2OT5 A;  4WFF A;  3AG1 C;  3ABT A;  1W0J G;  1HWY A;  4RUE A;  3E8G A;  5LBQ A;  1M56 C;  4Q20 A;  4PDR A;  2QM8 A;  4GX2 A;  1DF4 A;  2IJH A;  2WAM A;  3PJS K;  3HB3 B;  5IYB O;  1R6N A;  3K08 A;  3CCV V;  3K04 A;  5B1A C;  3E8H A;  1K3E A;  1OZ0 A;  5KA5 A;  2EBO A;  1TUE B;  1VQM V;  1KC8 W;  1CEZ A;  1MSW D;  5KUK A;  2QE7 G;  5J9P C;  4GX1 A;  2W6J G;  2H94 A;  3OAA G;  2DYR C;  1JX9 A;  5CA3 A;  1AI5 A;  4UXN A;  2C2A A;  2D3O W;  3OMI B;  3CCS V;  2ZXW C;  4N23 A;  3CC7 V;  3ETG A;  3OUS A;  3AG3 C;  1AJP A;  4MT8 A;  3ABK B;  3I56 V;  2DYS C;  3T1C A;  1W2B U;  1DF5 A;  1YIJ V;  1H8H G;  4RO2 A;  3CXC U;  4PA7 A;  1OCZ B;  1H8E G;  3FB7 C;  2KB1 A;  3B8N A;  3AG4 C;  3T4D A;  3ZN0 A;  2WLI B;  3AG2 C;  1QLE C;  4JPR A;  5L3G A;  2UXN A;  4JAS A;  2WLJ A;  1VQ7 V;  2YEV B;  3EHB B;  4RUF A;  3SYP A;  1F4M A;  2EIJ C;  2IH3 C;  2LFR A;  3K79 A;  4P9O A;  4KP4 A;  1NBM G;  3P32 A;  4UV8 A;  5GW7 A;  3TCU A;  1YIT V;  1ORQ C;  1CP9 A;  5HFM A;  5EBW C;  5IYD O;  4PA9 A;  2EJR A;  4FMT A;  3ZRW B;  4EKW A;  3QO7 A;  1CPY A;  1K34 A;  4FK5 C;  4GX5 A;  2DW4 A;  1JPX A;  3RVY A;  2IH1 C;  4QPJ A;  3ZN1 A;  3E8F A;  5LGU A;  3OW2 U;  1NJI W;  3SYA A;  1EFR G;  4BIZ A;  3K3W A;  3ETD A;  3ABM B;  4JF3 A;  5LHI A;  1M90 W;  2EIJ B;  1S76 D;  3OE7 G;  1AJN A;  2F43 G;  2HR3 A;  3HPL C;  1MG1 A;  3ML0 A;  4ZKI A;  5E1A C;  3AG2 B;  1OCR B;  2V7Q G;  5KA6 A;  2Y69 B;  3WFV A;  4R6Z A;  1Q82 W;  2A9H A;  4JTC B;  5KUM A;  3OMA B;  1SRY A;  2ZDI A;  3H01 A;  5B3S C;  3QNE A;  4X8A A;  2JK5 C;  3AG3 B;  1P7B A;  3LNM B;  1GTO A;  1OCO B;  1S5H C;  2IU3 A;  2ZXW B;  4PA6 A;  1Y4M A;  3ABU A;  2IJI A;  1I5X A;  2WLL B;  4KUM A;  3TK1 A;  1EZJ A;  2DYR B;  4F4L A;  3QO8 A;  4MS2 A;  3A0R A;  4ZBM A;  3SYC A;  2MK3 A;  3SPJ A;  2A79 B;  2AHY A;  4UV9 A;  1K33 A;  1YTF D;  1Y66 A;  3JD3 A;  4BAY A;  3ETE A;  3I55 V;  3MHH C;  1QVF U;  3E8B A;  1BHA A;  3VOU A;  1ROP A;  2ZR2 A;  2R9I A;  3W7W A;  2A0L A;  2HJF C;  1YSC A;  1GM8 A;  4TT3 G;  3KG2 A;  1BMF G;  2Y48 A;  2B1I A;  3IFX A;  1QVG U;  2Q69 A;  4WFG A;  1RPO A;  1AI7 A;  4QE9 A;  3OR7 C;  2EIN C;  2JEU A;  3AG1 B;  2WLN A;  1EBO A;  1ENV A;  1XL4 A;  1RPR A;  2JJ2 G;  5LGN A;  4UVB A;  1PL0 A;  1V54 B;  3LSS A;  2EIK C;  2JIZ G;  3X2Q B;  1K73 W;  4JTD B;  1NH2 B;  3ZRV A;  1NQT A;  4XDL A;  2WLL A;  4TSF G;  4I5S A;  1K4D C;  2LP7 A;  2V1D A;  3WG7 B;  3LUT B;  2X6C A;  2HFE C;  2WLM A;  4MW3 A;  3QO5 A;  1AJQ A;  2K1E A;  1S77 D;  2Z3Y A;  2BOC C;  1P4R A;  2XAS A;  3CCM V;  1R73 A;  1PNM A;  3K03 A;  1COW G;  2OCC C;  2WLI A;  2ZQM A;  3AEI A;  3CYO A;  3IGA C;  1KEC A;  1GM7 A;  3ZRW A;  5HFL A;  1YJN V;  3UM7 A;  4G2K A;  3VBB A;  1J95 A;  3ASN B;  1M57 C;  1YTF B;  2ATK C;  1V55 C;  1Q7Y W;  3ZRS A;  4CZZ A;  1NVP D;  3D36 A;  4RAI A;  3CCL V;  1VQN V;  5B1B C;  1LNQ A;  1VQL V;  1F23 A;  2AHZ A;  3TET A;  2JDI G;  5EC2 C;  3SPG A;  2NLJ C;  1KD1 W;  1E1Q G;  2ZD9 A;  3JCZ A;  3FB5 C;  5LGT A;  1VQP V;  3B77 A;  4QJF B;  1KKD A;  4LBE C;  4PA4 A;  4MVQ A;  4UVC A;  2Q68 A;  1MAB G;  3CPW U;  1K5S A;  3ZMS A;  4L87 A;  2FTK A;  2IU0 A;  1YJW V;  3RVZ A;  3STL C;  3FB8 C;  1OCZ C;  1MOF A;  4LCU C;  4E2L A;  2PI5 A;  4JYC A;  1FXK A;  4ASU G;  4DXW A;  3ZMV A;  3RW0 A;  1KP2 A;  2H8P C;  4LP8 A;  3ABK C;  2W0F C;  2YSU B;  3EFF K;  3LDE A;  3JYC A;  4R8C A;  1JQ0 A;  5IYC O;  1R3L C;  5EK0 A;  2ZR3 A;  4FJC C;  2HVK C;  1S3J A;  3SJQ C;  2DWE C;  1VQ9 V;  5L3C A;  1BHB A;  4HZ3 A;  1SES A;  3SYQ A;  1AI4 A;  3BY6 A;  1YJ9 V;  3ABL B;  2XAH A;  2OCC B;  1NR7 A;  2EIL C;  2HG5 C;  5B1A B;  1PD3 A;  3FB6 C;  3OM3 B;  1JVM A;  1THZ A;  5L3F A;  1S0V A;  4PDV A;  3STZ C;  3JD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...