1ENVA

Atomic structure of the ectodomain from hiv-1 gp41
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
121
structure length
115
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF G
publication title Atomic structure of the ectodomain from HIV-1 gp41.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 59
structure length 115
sequence length 121
ec nomenclature
pdb deposition date 1997-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1envA00
1MOFA 1QBZA 5KA6A 1ENVA 1Y4MA 5HFMA 3WFVA 3K9AA 5HFLA 3MHSC 5CMUA 3GWOA 3P30A 2M7WA 1DF5A 1EBOA 1K34A 1JPXA 2EZOA 2MK3A 1F23A 2X7RB 3B77A 1QCEA 3CP1A 1JQ0A 4FIPC 1Y66A 3H01A 4G2KA 3M99B 3CYOA 4FK5C 1SZTA 4N23A 2EZPA 1K33A 2EBOA 2OT5A 4FJCC 5H9CA 5KA5A 1MG1A 4JPRA 5CN0A 4E2LA 1DLBA 1I5YA 2LP7A 1QR9A 2P6JA 4JF3A 4N21A 3MHHC 3B8MA 3B8NA 1DF4A 1QR8A 1I5XA 4JGSA
chains in the Genus database with same CATH superfamily
4X8AA 1QBZA 4OPHA 2PY5A 4NTXA 4X62B 5L3FA 5JCOA 5H2FZ 4Q20A 2L6LA 2ITCC 5EBLC 5BZBA 2A79B 3SYOA 3N2GB 4MVMA 2ZKOA 4EKWA 3QNEA 3RT3C 1COWG 3DTUB 3B40A 4QGPA 1HP8A 4MW8A 1Q43A 1XREA 3H1IH 3SPCA 3RGBA 1M9NA 2EIMB 1IXBA 3IJ4A 3H1LH 2IU3A 5LGTA 4FLUA 3NR7A 1F23A 1XMQB 4DRXB 4DV6O 5EYPA 4I4TB 4IIJA 5B1BB 1IBKB 1IBLO 3RYHA 1AR5A 1TA8A 3ZRWA 2WA4A 5ITZB 1FXHA 1KP3A 2RDCA 2DWEC 1H2SB 2Q73A 1W0KG 1HNXO 3SJQC 4H33A 4X64O 1SKVA 2LFSA 1MSDA 1RSOA 1OCOC 5KMGA 2B5UA 4CBCA 1G4YB 3GB7C 5LXTB 1LUVA 1WPBA 4L8JA 1PP9H 3T1YO 4JI8O 2QSAA 1OV9A 1P84F 4MTGA 3W7TA 5L3BA 4Z1MG 4DR2O 1Z5VA 3ZMVA 1OZ0A 5LL6Y 4JI0B 5BXZA 5LMUB 3AG1C 2OTJV 2LW1A 3DGEA 3QO7A 1MOFA 1WA8A 3AG3C 5KUMA 1J95A 4DYLA 4DUZO 2CH7A 1B04A 2EBOA 4KL1A 1TUBB 1IBMO 4X20A 1K8AW 4KP4A 1KYOF 1Y76A 2RNBA 2XASA 3SYPA 1CXZB 4LWSB 3W7UA 4JYAB 2YDEA 2UUCO 2HKOA 4R50A 4YJ3A 2FB5A 2WWWA 4F4LA 2V1DA 3H1JH 3ZN1A 5B1AB 1NT2B 1B06A 1SQXH 3B09A 2HHHB 1H2MA 2DQ3A 4JI7O 2Q6AA 4DR4B 1HNZB 4DV4O 1FPOA 3ZMZA 1I08A 2LGWA 4X1IB 2ZE5A 5TISZ 1G8MA 2ZNIA 4BIUA 3UM7A 2CAZC 5B1BC 3K59A 4F6RA 3AG7A 2VQFB 4NYKA 4HNAA 3BFRA 5KLVH 1XDCA 1N34B 4J80A 2QR4A 1D5NA 3CCQV 5JJEB 1NKDA 4PD4F 4DV1O 1VF6A 3CD6V 5CB4A 2V7QG 4MS2A 1DTOA 2ZIOA 1JQ0A 2B1IA 1I94O 1JFFB 3UKMA 1MG1A 2VRZA 4AHCA 3OM3B 3T4DA 3K5MA 1YJWV 2IJJA 4FLTA 4U7OA 1SF9A 3R65A 3K5OA 4H0LB 5CA3A 2EX3A 1DF5A 4GT1A 4DV0O 1N4CA 3CXCU 1XOUA 3TJTA 2AZ0A 4WFAV 1SRYA 1AI7A 4O4LB 3CC4V 4UCVA 1Q5OA 1YXBA 2DQ0A 1WB7A 2LGQA 1BQZA 4JZGA 3HKCB 5H5NA 4ZI7B 1NS1A 4DV6B 1KKDA 1IBLB 3RBZA 5IYDO 1FD9A 3BHPA 1SZTA 1D5AA 1U96A 2VQEO 1FYJA 4O4JA 1GK9A 5B5EZ 4QPJA 4XDKA 2D2CB 1HNXB 1ZWIC 2UUBO 1H2KA 1QR9A 2DYSB 4RQEA 1AP6A 1UPGA 4X64B 4IYIA 3ABTA 1VQ6V 3ZMUA 4JTCB 4NTYA 1MMMA 4G28B 4F6EA 2XAFA 3T1YB 4JI8B 2EIKB 2EINB 3AEIA 4DR2B 5KHIA 2E5LO 1QNMA 3G80A 5IE9A 1E1RG 1AB3A 4FLVA 1NQTA 4AILC 1NTZH 2Z3YA 2R70A 4U3FH 4FFBB 1PM9A 4DUZB 4O4IB 4FLYA 4ZIBA 2HR3A 2PYLA 4ZBMA 1IBMB 4JI6O 2AHYA 1QLNA 2NNUA 3H01A 3H1KH 3ABMB 2ZDIC 2P90A 2F95B 1VQKV 3ZS8C 2ITDC 4B3SO 3OFNG 2UUCB 3ZHQA 1FXKB 4TWKA 2E76B 3DSQA 3N27A 3OR6C 2XAQA 1JOYA 3JYCA 1VMGA 2JVDA 3ZMSA 5E79Z 4JI7B 1K34A 5D5QA 3E8BA 3JASB 3M99B 4GCZA 1YJNV 4DV4B 4PA3A 1ZSPA 4K8XA 5KUKA 3FD9A 2BOCC 3QTCA 2R9AA 3FB7C 5EBWC 4HAMA 2CTPA 5KX5B 4DV5O 1S5LZ 4X1YB 2C2AA 5BMVA 4CS2A 3W7WA 2DYSC 2MK3A 5L3GA 3SYAA 3SDLA 3KG2A 2UXCO 4J42A 4LF8O 2FTKA 3LNNA 1PL4A 4DV1B 4GYCB 1H2LA 3ZIAG 2ZR2A 4MVQA 5CN0A 5C8YB 2EIKC 4KHPO 2EINC 1M57C 3E86A 2X6BA 2Y0IA 1P4RA 3ZRXA 3ASOC 3SR2C 2ZT9B 5J2TA 1I94B 4DUYO 4BW9A 3RWRD 1FKAO 4GX1A 1SS3A 3LNMB 4DR3O 1ZAUA 2ZQMA 3JALA 1YZBA 3MHHC 3CCRV 1DF4A 2ZIMA 2WLHA 4LF5O 3JARB 4DV0B 4LF9O 2WPDG 1YEWA 2UUAO 3K79A 2YUAA 3GWOA 1X59A 5IJ9A 4YHHO 3U11A 4UCRA 2EJRA 3ABLB 4LFCO 4L87A 5B1OA 1VQ5V 2G38A 4WFEA 1AROP 3LDEA 4DR6O 4OGQB 3TGUH 3JD0A 1R3KC 1KU9A 4NXNO 1VQNV 4NKGB 4JI4O 5CMUA 1XL6A 3F5TA 2VQEB 5B66Z 5IYZB 3T1CA 4EEQA 1EZJA 2UUBB 3J80N 1V9PA 1GRJA 1SA0B 1JCHA 2YXLA 1S72V 1VF7A 1K7DA 1BZKA 4PA7A 2KG7B 4DR1O 1JR9A 5H6QA 2E5LB 1TGOA 5CA1A 1BHBA 1RM1B 3OD4A 3K08A 1V54B 2A06H 1S76D 3CMEV 3I55V 1VQ4V 1NBMG 1Q90D 1SQGA 3OW2U 3UQ8A 2YS8A 1GO3F 4R8CA 1R3JC 3A0BZ 3CB2A 4JI6B 1URFA 5KA6A 1KD1W 3WFVA 3D8CA 3BA9A 2Q8VA 2BCCH 4TV9B 1YITV 3IC7A 4FZ0A 4B3SB 3FAVB 4E4EA 1HWYA 3CCVV 5CA0A 1K3EA 1PNMA 3T4ZA 3F7VC 2QTSA 3RVYA 3CCJV 1VQPV 2JDIG 4PV1B 1TUEB 1V55B 2WLIA 4H13B 3CXHF 3JAWB 2IU0A 3SYCA 5IYCO 2IW5A 3JCZA 2GUZB 3CYOA 4LP8A 3X2QB 3CX5F 1MABG 1WJZA 4X9QA 3HKBB 4DV5B 4YJ2B 3CJHB 2CTRA 2PTMA 4DW0A 5KAIZ 3FB6C 3ABKB 4LR3A 2F4VO 2UXCB 4LF8B 5EZYB 1FFXB 1M4UA 3DC6A 1BGYH 4MVOA 2JS5A 4LFAO 5LOVA 2QWOB 2H8PC 4W4KA 4R7CA 2M6YA 4KHPB 1QLEB 2NN4A 1RM1C 3LSQA 4DUYB 2Q0AA 2ZINA 1NZ6A 1AILA 2OTLV 4H44B 1AJPA 1ENVA 3L9DA 2GSMB 2EIJB 1GN3A 1YIJV 1YJ9V 3EHBB 4I55B 5EBMC 4DR3B 3ZHTA 4LF4O 1B3QA 4D7SA 2HP8A 4O2BB 4LF9B 1VQOV 2UUAB 4LBEC 4PI2A 4YHHB 1P49A 1PV0A 2UXDO 3CCSV 1P7BA 2E3CA 1H8EG 4LFCB 4B3TO 1AI4A 1FJGB 4J7JA 4BW5A 2GV9A 3K58A 3CSXA 4MW3A 2QKCA 4DR6B 4ICGA 3D3IA 4GZRB 4X89A 5JH7A 2ZE7A 3SGIA 1AR1B 4NXNB 2GTAA 4OX9O 1RP3B 2ZR3A 2A7WA 1HR0O 3SPGA 2CE4A 4P2ZA 1PNKA 3HKEA 3ABKC 3L70H 3A2FA 1S0VA 4BIOA 4DR1B 1GH6A 3CRRA 2Y69C 2PZSA 3UO2A 3DXRB 3K3WA 4MT8A 3UCSC 4O2AB 3OEHG 3HKDB 4B7EA 5LYJB 1ZUQA 3AG4B 3OUFA 2Q67A 2RMKB 5JVDB 5GW7A 4LC1A 3N2KB 3B77A 4O4HB 4MVSA 1MNGA 3OGCC 3ASNC 2Y0PA 5GONB 1R1BA 1ZX3A 2EIJC 4LNUB 1OHHG 3GVMA 4WBNB 2EILB 4CS4A 2Q7HA 4C7UA 4LF7O 1KP2A 3CRAA 3RYCB 3RFRA 2QEXV 4RUEA 3QO5A 3K9AA 3RYFA 1AJQA 4X88A 2BTQA 3CC2V 4HYOA 2DE0X 1Y67A 1EBOA 2QM8A 5IWAO 4NVPA 2BSKA 2QWRB 4G2KA 2HEPA 5B3SB 2JGDA 3IFXA 3OAAG 4UVBA 4GX2A 1H2NA 4FLXA 2YI9A 2ZDIA 4Z2WA 3ZN0A 4GX0A 4IHJB 2AZ2A 1WLEA 4CH3A 2YEVA 1NVPD 5EC2C 3CCEV 3FX7A 2IM9A 4JASA 5LP6B 4U3JB 2ZM6O 4DR5O 2UXNA 4MVUA 1FAFA 2ODMA 2EIMC 4FM2A 4BR6A 1WP8A 2F4VB 5LBQA 3SPJA 5JJNB 1NTKH 5LA6A 1WPXA 4W4LA 2F93B 3JD4A 3K03A 4LFAB 1SETA 2XAGA 4FVMA 1EN4A 5LGUA 5C93A 5CBGA 3G67A 4Q6GA 3LDDA 1KBHA 4JV5O 3JAKA 2P4KA 5EYPB 4TV8A 2ZE8A 1GTOA 4IIJB 4UCUA 2QWQB 5H6RA 2KSDA 3RYHB 4J7KA 3TXQA 1YTFB 2YIAA 2ETNA 1N33O 3P32A 3QF7A 4QIWF 3ZRWB 3CPWU 3HB3B 1S5HC 1WAZA 3UO3A 4LF4B 1F4NA 2EILC 2RQ6A 4JTDB 1K33A 1E79G 1D2DA 3FFQA 1M90W 1RSOB 5KMGB 4H37A 3RVZA 2UXDB 5KHGA 3E2EA 3KKYA 4PA9A 3ZX6A 4J10A 3CCMV 1P7GA 2DYRB 1SQFA 1W59A 2OCHA 2F43G 3ICXA 4KXRA 4ZHQA 1WA8B 2XTAA 1YCIA 3FB5C 4R6ZA 5LP6C 1SERA 4P30A 2OIEA 2CH7B 5B1AC 4XDJA 1HR0B 5JCOC 4X20B 2ZNJA 1QR8A 1ZLZA 1TVKA 1Y76B 5IDJA 2Q7GA 3BAAA 3OUSA 2PGGA 2Y4TA 4I5SA 3ETEA 3JSNA 5K1XA 1VQ7V 3B4SA 1JJOA 4YJ3B 4UVCA 1GKFA 3VBBA 1RPOA 1N0JA 4PDMA 4Z1VA 4IT5A 5H9CA 4JI5O 5GTHZ 1LNQA 3GWKC 2PF4E 2JK5C 2IJHA 2H3OA 3OMAB 2YIBA 1N32O 2FYUH 4PJ0Z 5LMNO 3Q4HA 1KKCA 4F6RB 2ARHA 1IVSA 4NXMO 1FXVA 2HVJC 4HNAB 3ZRVA 4A5UB 4TUYA 3RYIA 2AHZA 2KKWA 1SC5B 1K4DC 3G4SV 4LF7B 5IJ0A 4NB5A 1AR4A 4UB8Z 2JJ2G 2WLLA 3E22A 3A0RA 4X65O 1XQ8A 2Q0OC 4JAUA 1OCCB 3DC5A 4FM1A 1O9GA 2Y48A 5CB4B 2PI4A 2P5OA 3CEIA 2EJ7A 2N05A 4ZOLA 1K5QA 4UV8A 3ETQA 1VARA 1X4TA 2HJFC 5D5PA 4GKJO 3FYIB 2HFEC 2WAMA 2ZM6B 1I5XA 3JCUZ 1MZEA 4DR5B 4ASUG 3K5LA 4FZ1A 5LHIA 4YIPA 4XDLA 4X1KA 4JI3O 4B7KA 2GBOA 4X66O 2N74A 4CH5A 1BHAA 2AGAA 1RPRA 5L3CA 2WSSG 5FNVA 1PNLA 2DWDC 4BWAA 2Q4PA 2FL4A 1VIBA 3ZHRA 1SZXA 3IC9A 4JV5B 1GM7A 2QA4V 4MTFA 4I50A 5KHHA 1YHQV 1NR1A 4O4JB 5F2VO 1FFTB 3UT5A 1ZL8A 2BE3A 3BA8A 3CRQA 4JAVA 2B1GA 4WF9V 3SPIA 4UXNA 3KZIZ 4TQFA 4I0XA 4PELA 4DR7O 1H38A 1F7YA 1YSCA 1VF6C 4JZ2A 2R72A 4RO2A 5FPOA 4I7ZB 3ABMC 4DK0A 3BEHA 1IX9A 3S3WA 2GTSA 3EVKA 4EFBA 5HFMA 1FXKC 1PL0A 1XI1A 3JATA 3R66A 4FJCC 3WB2A 4JTAB 1EZVH 1HW7A 1Q3EA 4IL6Z 3QVNA 4G27B 3W7XA 4MSWC 4RWUA 4JGSA 1VEWA 2PI5A 3L71H 3ZHVA 1IURA 1QQCA 4LF6O 3P30A 1BCCH 4PA4A 3K57A 1LUWA 1M5IA 3HR0A 4JI5B 2KB1A 3ZBHA 4YIOA 2ZXWB 3BRCA 1KUQA 5DN6G 3OEEG 4J9ZB 5LMNB 1ORQC 1M56B 4FMTA 3LUTB 2E75B 4NXMB 5KAFZ 1KECA 2Q68A 1Z5WA 5LGNA 1NH2B 3ZCCA 3L75H 5BMVB 2JJ1G 4RAIA 4B3RO 2CK3G 3C3TA 2W6IG 3TETA 4X65B 5JQGA 2K1EA 4DV2O 2WLKA 4GLXA 1XILA 4EB6A 2NLJC 2HLDG 1Q7YW 1EN5A 1Q82W 5J2TB 3SYQA 4GKJB 2CTWA 1BL8A 4JYYA 4BIZA 4PHZA 3ABLC 2QWNB 3QO8A 2YICA 4MVZA 4D6TH 1BS3A 4J7ZA 4IGGA 3RW0A 1N36O 3JALB 1Z2GA 1HNWO 4JI3B 4UCTA 3CCUV 4DV7O 3APOA 4FK5C 4X66B 5IJ9B 1CP9A 3E8FA 3W7SA 2IJIA 4UCSA 4FLWA 5BY1A 1NI8A 2ZXWC 1NR7A 3OE7G 1FS0G 2X6CA 2Q5ZA 4DRXA 1QVFU 2PUSA 4I4TA 1YI2V 2M7WA 2QTOA 1JPXA 4J9YB 1AI6A 1VQ9V 5ITZA 5J2UA 2DOSA 3E8GA 2OYQA 1PKXA 2X0LA 1A32A 1R6TA 2P22C 3PJSK 3BABA 4CZZA 1NJIW 1V54C 4RQFA 4DR7B 5LXTA 3S3XA 3SJAC 3ETGA 4FIPC 1S3JA 2W0XA 1L0LH 2QJ1A 5CA1B 2LJ2A 2QWPB 1WN7A 4LF5B 1W0JG 2O57A 2UU9O 1JX9A 3BVOA 2P6JA 3E89A 1XUQA 2XOKG 2Q69A 3EXAA 5K1PA 2XUMA 2GDSA 4DO2A 1TUBA 3NXSA 5BR8O 1G6UA 3OTOO 3F7YC 4LWSA 3RN4A 1W2BU 4ZKIA 1V55C 1K97A 2A0LA 2NR5A 3AG3B 5IY5B 2QM4A 2JEXA 2Z0AA 3AK1A 4JI4B 4LF6B 4NTWA 5CA0B 3X2QC 1SQPH 3O65A 3WU2Z 2XNDG 4QJFB 1JMKC 4AI8A 2WLIB 1EN6A 1YF2A 1E1QG 4X1IA 1WNSA 3U0ZA 3KCXA 2UXBO 3CWBH 5GTIZ 1M1KW 2P7TC 3ETDA 1SQBH 1GM9A 1QLEC 2OIGA 5FPRA 2E74B 2UXXA 3CRMA 3OR7C 4B3RB 4JAAA 3STZC 3O9OA 2HG5C 4DV3O 5LOVB 3K0GA 4DV2B 3C90A 1NH2D 5J2UB 1JVMA 4QE7A 2JEUA 3LSSA 5CBFA 1LR1A 1XBLA 2GHYA 1JFFA 4RUFA 4P9OA 4PDVA 1THZA 3CP1A 2RCVA 1O9HA 3PN1A 1GN6A 2JGUA 2N04A 1R6KA 2JS3A 2QM7A 4I9WA 4KUMA 1N36B 4WFHA 1Q6UA 2VWJA 1HNWB 4JYCA 5IY5C 4DV7B 4TQDA 5IYBO 2RN9A 1KMIZ 4O4LA 2K9PA 1K5SA 4U7NA 1KQSU 3WB0A 3HKCA 4ZI7A 1N8RW 1XMOO 2PYJA 5E1AC 5JH7B 3JAMN 3M7MX 3VQXA 5JJJB 2ATKC 1GM8A 4PDRA 1QCEA 2Q7EA 4WFGA 2BTOA 3AG4C 2R9RB 3P3NA 3M8AA 3HKEB 4MTXA 1K9MW 4B08A 4FM0A 1VQMV 1VP7A 2IJKA 4YY3O 2VS0A 3JD3A 3IAYA 4GUNA 4K0KO 1Y6XA 4GKKO 3D36C 2UU9B 1CEZA 3T1HO 5KA5A 5A9GA 4FFBA 4O4IA 5B3SC 2H94A 2FKXA 1N0NA 1US6A 3THOA 4B3TB 1XEQA 2YI8A 2QKSA 5BR8B 3OTOB 1L0NH 2F23A 3E35A 1U97A 2LFRA 3K5NA 2X7RB 4CS3A 3WG7B 1K73W 3LSUA 3RYFB 2BTQB 1OCRB 1FXKA 2ZD9A 2BOBC 2P4VA 2Z5UA 3E8HA 4OX9B 2BSKB 5JWPA 2JGDB 2EULA 4K3AA 2WLMA 2ZCEA 3BPZA 1BT8A 2OWOA 1IDSA 3JASA 1Y4MA 2YEVB 2UXBB 1I7FA 2A3QA 4UB6Z 2Q9LA 1Q81W 2OT5A 4I9QA 2ADQB 2L35A 4OXSA 5KX5A 1H2GA 3L73H 1JA8A 2Y4UA 1XNRO 1DLBA 4X1YA 4HBNA 2CTQA 5DEDA 1QVGU 3T2MA 4LH6A 2QKAA 1GAXA 5HFLA 3MHSC 2DN9A 5LA6B 2IH1C 5L3DA 3TXSA 4DV3B 5C8YA 3K04A 3J7AU 3G6EV 3ZEDA 2YXHA 3OTFA 1UJWB 2MW2B 1VF5B 3FYEB 2XAHA 1XNQO 3JAKB 3C3SA 3ML0A 1VQ8V 1YVWA 4TV8B 5IWAB 3SJCC 1JJ2U 4AQYO 2LW7A 4NR1A 2DJVA 4B3MO 1SQQH 1M57B 2B9ZA 2DYRC 1L8DA 1S77D 2OCCB 3ASOB 3HPLC 3JARA 4JI2O 3ZHSA 3WG7C 4BAYA 4N21A 1OCRC 3ZJZA 4JI1O 3VOUA 3ZHUA 3CCLV 5LHHA 1GMGA 3A0HZ 3OMNB 4DK1A 4YXWG 4XBFA 4MTOA 1XMOB 1QU7A 4ZHQB 3FKSG 2KQXA 3OMIB 1TAEA 3H9VA 2JIZG 3B8NA 3MDSA 1BQ0A 4ABMA 5IYZA 3OT7A 4UCOA 5EK0A 3ZRSA 4J11A 5EC1C 4WCEV 1T5EA 2VWKA 1TVKB 2A9HA 3AG2B 1SA0A 1DK1A 3CE2A 1AI5A 1AVMA 3CMAV 3ABUA 4LFBO 4WFFA 2KG7A 4GX5A 2D3OW 1J5EO 2HJDA 1EFRG 3VQWA 4YY3B 1EM1A 2LO1A 2RJZA 1N33B 3BCCH 1IZ3A 2YSUB 4PDLA 1NU1H 2IBZH 4K0KB 5KHJA 4TOIA 3E83A 5IT9N 4GKKB 3T1HB 1I0HA 3G71V 4CH6A 1F51A 1YTFD 1OCZB 3Q4HB 3STLC 4PA6A 2LQTA 2WLNA 4UVAA 2CGNA 1SQVH 1PPJH 3J81N 1OCCC 5DM6V 5CBHA 3CC7V 3L72H 5LHGA 4TV9A 3B8MA 4TUYB 1HDJA 3RYIB 2OCCC 5IJ0B 3FAVA 3CS5A 3CRCA 2WLLB 3E22B 3H1HH 4QPKA 4UV9A 3AK3A 3JD2A 1R6NA 4FPPA 2QE7G 4K35A 3FB8C 1S5JA 1BMFG 2WLJA 3JAWA 4ZOLB 2FMLA 4LH7A 3KCYA 1MSWD 2GUZA 2X6AA 1SESA 4FFKA 2ADPA 1UFIA 3K9SA 1RFYA 3EFFK 2XT9A 5AG2A 5FL7G 3MAQA 1IXMA 3HKBA 1VQLV 1XNRB 1FJGO 4YJ2A 4X62O 3CJHA 3P3PA 1MA1A 4E2LA 1CPYA 3AG2C 4X1KB 5EZYA 5DECA 1FFXA 1XL4A 2W0FC 2HVKC 1N32B 3G6BA 1OJHA 1PD3A 2DMXA 1Q86W 3K0DA 4CC6A 1KB9F 5FNVB 4DXWA 1Q6IA 3I5DA 5EIBC 3I56V 4KFMA 3LDCA 2XAJA 3IGAC 1XMQO 1XNQB 2CDYA 4I50B 1IBKO 1XHXA 4AQYB 1KC8W 1OCZC 2AW9A 4B3MB 3VQYA 4I55A 1DGSA 3U10A 1QHTA 1Y74A 4JYBA 4TT3G 2EZOA 3UT5B 3WB1A 1ZL8B 1K4CC 2QDOA 4JI2B 4O2BA 2P67A 2F66C 3SPHA 4JI1B 4QNHB 4I0XB 1I5YA 4UFZA 2F1MA 2DW4A 3F5WC 2P06A 1NTMH 3SJBC 3APQA 3CHXA 4PI0A 4JI0O 4TSFG 5LMUO 4CC5A 1R3IC 3N2GA 2ILMA 1YDXA 4QE9A 1NVPB 3VQVA 4DW1A 1AP5A 1R3LC 4P9PA 2V4DA 1K92A 3JATB 2AXTZ 3QG5A 4LCUC 2JRIA 2YIDA 4JF3A 4UUJC 5FLXN 1GN4A 4FLZA 2YXYA 1AJNA 4JYAO 3A8TA 3OGIB 3AK2A 3B2EE 4LFBB 1M93A 3TCUA 1J5EB 1G1XB 2CGOA 4MVRA 1M56C 3DXRA 4EFEA 4O2AA 5A2QN 3HKDA 4WFBV 2ZE6A 5LYJA 2XHBA 2YC0A 5J9PC 2HHHO 1WP7A 1GN2A 3D3QA 3TK1A 1Q6HA 5JVDA 4DR4O 3N2KA 1HNZO 1ZTEA 1XHZA 4O4HA 1BE3H 1R73A 4IYHA 2Y69B 5GONA 4J41A 4K8ZA 1Y66A 4LNUA 2EZPA 5EIBD 2VQFO 4WBNA 3K06A 3L74H 4OPAA 3JD1A 1N34O 3D36A 3RYCA 1MZFA 2CUGA 3JSLA 2YIBD 2QGNA 2WA3A 1OCOB 3ASNB 5L3EA 2W6JG 1B6QA 1ROPA 5JQGB 1Q8IA 1H8HG 2IH3C 4N23A 4IHJA 1Y74B 1WB8A 3AG1B 4EB6B 4CH4A 4JPRA 1F4MA 1L1FA 2LP7A 5LP6A 3BY6A 4HZ3A 3MD0A 3ZMTA 1BSMA 5B1NA 4D7TA 2R9IA 4U3JA 5KHKA
chains in the Genus database with same CATH topology
3JD3A 4X8AA 4ASUG 1QBZA 5L3FA 4Q20A 5H6QA 2ITCC 1BHBA 5LHIA 5EBLC 1RM1B 5BZBA 4XDLA 3K08A 1V54B 2A79B 3SYOA 1CEZA 1S76D 4MVMA 5KA5A 4EKWA 3CMEV 3QNEA 3I55V 1VQ4V 1NBMG 3OW2U 1COWG 1BHAA 3DTUB 5B3SC 1GO3F 1RPRA 2H94A 4MW8A 4R8CA 5L3CA 2WSSG 2QKSA 1PNLA 1R3JC 2DWDC 3SPCA 1KD1W 5KA6A 1M9NA 3WFVA 2EIMB 2IU3A 3E35A 5LGTA 1YITV 3IC7A 2LFRA 1F23A 2X7RB 1K73W 3WG7B 1GM7A 2QA4V 4MTFA 1OCRB 1FXKA 2ZD9A 2BOBC 1HWYA 5B1BB 2Z5UA 3CCVV 3E8HA 1YHQV 1K3EA 1PNMA 3T4ZA 3F7VC 3ZRWA 1NR1A 1FXHA 1KP3A 2WLMA 3RVYA 3CCJV 2DWEC 1W0KG 1FFTB 1VQPV 3SJQC 2JDIG 4H33A 1TUEB 1V55B 2WLIA 1Y4MA 2IU0A 4JAVA 3SYCA 5IYCO 2YEVB 2B1GA 4WF9V 3SPIA 2LFSA 2IW5A 3JCZA 4UXNA 1OCOC 3CYOA 2B5UA 4PELA 4CBCA 1G4YB 4LP8A 3GB7C 1H38A 1YSCA 3X2QB 1Q81W 2OT5A 1MABG 4OXSA 4RO2A 1H2GA 4MTGA 3W7TA 1DLBA 4Z1MG 5L3BA 3ZMVA 1OZ0A 3ABMC 3FB6C 3AG1C 1QVGU 3T2MA 2OTJV 3BEHA 3ABKB 3DGEA 3QO7A 1MOFA 5HFMA 3AG3C 5HFLA 3MHSC 5KUMA 2IH1C 5L3DA 1J95A 1FXKC 1PL0A 4MVOA 3K04A 2H8PC 3G6EV 4R7CA 2EBOA 1QLEB 4FJCC 4JTAB 1K8AW 4KP4A 2XASA 3SYPA 1UJWB 4G27B 1RM1C 3W7XA 3W7UA 3LSQA 3FYEB 2XAHA 4MSWC 3ML0A 2HKOA 1VQ8V 4JGSA 4R50A 2OTLV 2PI5A 1AJPA 1ENVA 1JJ2U 2WWWA 4F4LA 3P30A 2GSMB 4PA4A 2EIJB 2V1DA 3ZN1A 1YIJV 1YJ9V 5B1AB 1M57B 3EHBB 2KB1A 5EBMC 2DYRC 2ZXWB 1S77D 2DQ3A 2OCCB 2Q6AA 3ASOB 3HPLC 5DN6G 3WG7C 3OEEG 3ZMZA 4BAYA 1VQOV 4LBEC 4N21A 1G8MA 1OCRC 4J9ZB 3ZJZA 4BIUA 3UM7A 5B1BC 1ORQC 3CCSV 1P7BA 1M56B 3VOUA 3CCLV 1H8EG 4FMTA 3LUTB 5LHHA 1AI4A 1GMGA 4BW5A 1KECA 2Q68A 5LGNA 3OMNB 1NH2B 3ZCCA 4MW3A 4YXWG 4XBFA 4MTOA 3D3IA 3CCQV 4X89A 2JJ1G 1NKDA 4RAIA 1AR1B 2CK3G 3FKSG 3OMIB 2W6IG 3TETA 2JIZG 2K1EA 3B8NA 3CD6V 2ZR3A 2WLKA 2V7QG 5EK0A 3ZRSA 5EC1C 4WCEV 4MS2A 2NLJC 2A9HA 3AG2B 3SPGA 1DTOA 2HLDG 1Q7YW 4P2ZA 1JQ0A 1PNKA 2B1IA 3ABKC 1Q82W 3CMAV 1AI5A 3ABUA 1S0VA 3UKMA 4WFFA 3SYQA 4GX5A 2D3OW 1MG1A 1EFRG 2Y69C 3OM3B 3T4DA 1BL8A 4BIZA 3ABLC 1YJWV 3K3WA 3QO8A 2IJJA 4MT8A 3OEHG 4U7OA 4MVZA 2YSUB 4PDLA 3R65A 3AG4B 3RW0A 5CA3A 3E83A 3OUFA 2Q67A 5GW7A 4LC1A 1DF5A 4GT1A 3CXCU 3B77A 3CCUV 4FK5C 4WFAV 1SRYA 4MVSA 3G71V 3OGCC 1F51A 3ASNC 1OCZB 1YTFD 3STLC 1AI7A 4PA6A 1CP9A 2WLNA 4UVAA 3E8FA 2EIJC 3CC4V 3W7SA 1OHHG 2IJIA 1OCCC 5DM6V 5CBHA 3CC7V 2EILB 2ZXWC 5LHGA 3B8MA 2OCCC 2DQ0A 1KP2A 1NR7A 3OE7G 1FS0G 2X6CA 1QVFU 2QEXV 4RUEA 3QO5A 3K9AA 3CC2V 1AJQA 4X88A 1KKDA 4HYOA 2M7WA 1YI2V 2QTOA 1EBOA 2QM8A 1JPXA 4J9YB 2WLLB 3RBZA 1AI6A 5IYDO 4QPKA 4UV9A 4G2KA 5B3SB 1SZTA 3IFXA 3JD2A 1R6NA 3OAAG 4FPPA 4GX2A 4UVBA 2QE7G 1VQ9V 1GK9A 3E8GA 2ZDIA 3FB8C 4QPJA 4XDKA 1BMFG 1PKXA 1ZWIC 3ZN0A 2X0LA 4GX0A 1QR9A 2DYSB 2WLJA 4RQEA 1WLEA 3PJSK 4CZZA 2YEVA 1NJIW 3ABTA 1NVPD 1VQ6V 5EC2C 1V54C 3ZMUA 3CCEV 4RQFA 1MSWD 4JASA 4JTCB 2X6AA 1SESA 4G28B 3ETGA 2XAFA 3EFFK 2EIKB 2UXNA 4FIPC 1IXMA 2EINB 3AEIA 5FL7G 1VQLV 1S3JA 4MVUA 4E2LA 2EIMC 1CPYA 1E1RG 3AG2C 1W0JG 5LBQA 1NQTA 3SPJA 1JX9A 2P6JA 3E89A 2Z3YA 1WPXA 2W0FC 1XL4A 2HVKC 2XOKG 3JD4A 3K03A 1SETA 1PD3A 2Q69A 2XAGA 1Q86W 2HR3A 3K0DA 4ZBMA 4DO2A 5LGUA 5C93A 3NXSA 2AHYA 5CBGA 1QLNA 2NNUA 3H01A 4DXWA 3ABMB 3F7YC 2ZDIC 1W2BU 2P90A 3LDDA 4ZKIA 3I56V 4KFMA 3LDCA 1V55C 1VQKV 1K97A 2A0LA 2XAJA 2ITDC 3IGAC 3AG3B 5IY5B 3OFNG 2JEXA 1FXKB 4TWKA 1GTOA 5H6RA 1KC8W 1OCZC 3X2QC 1YTFB 3OR6C 2XAQA 2XNDG 3P32A 1JOYA 3ZRWB 4QIWF 4QJFB 3CPWU 3HB3B 1S5HC 3JYCA 4JYBA 1F4NA 4TT3G 2EZOA 1K34A 2EILC 3ZMSA 3E8BA 1K4CC 2WLIB 3M99B 4JTDB 4GCZA 1YJNV 1K33A 4PA3A 1E79G 1E1QG 2P67A 5KUKA 1M90W 4H37A 3RVZA 3SPHA 4QNHB 2BOCC 3E2EA 1I5YA 1M1KW 2P7TC 4PA9A 2DW4A 3ETDA 3F5WC 3CCMV 3FB7C 5EBWC 4HAMA 1GM9A 2DYRB 1QLEC 2C2AA 2F43G 2UXXA 4TSFG 3W7WA 2DYSC 2MK3A 3OR7C 5L3GA 3SYAA 1R3IC 3KG2A 3STZC 4QE9A 1NVPB 2FTKA 3FB5C 4R6ZA 1R3LC 2HG5C 1SERA 3ZIAG 2ZR2A 4MVQA 4P9PA 4P30A 5CN0A 1K92A 3K0GA 2EIKC 2EINC 5B1AC 1NH2D 4XDJA 1M57C 1JVMA 4LCUC 3E86A 4JF3A 4UUJC 4QE7A 1QR8A 2JEUA 5IDJA 2X6BA 3LSSA 3OUSA 5CBFA 1P4RA 3ZRXA 3ASOC 1AJNA 2GHYA 4I5SA 4RUFA 4P9OA 4PDVA 3ETEA 1THZA 1VQ7V 3TCUA 3CP1A 4MVRA 4GX1A 4UVCA 1GKFA 1M56C 3VBBA 1RPOA 3LNMB 4PDMA 5H9CA 1R6KA 4WFBV 2QM7A 4I9WA 1LNQA 5J9PC 4KUMA 3TK1A 2ZQMA 2JK5C 4WFHA 2IJHA 3MHHC 3CCRV 1DF4A 2WLHA 3OMAB 4JYCA 5IY5C 2WPDG 1R73A 3K79A 3GWOA 2Y69B 5IYBO 2EJRA 3ABLB 1Y66A 1K5SA 4L87A 5B1OA 2EZPA 1VQ5V 3K06A 1FXVA 2HVJC 3ZRVA 4U7NA 1KQSU 4WFEA 3JD1A 2AHZA 1AROP 3LDEA 1K4DC 3G4SV 3D36A 1N8RW 3JD0A 2JJ2G 5E1AC 1OCOB 2WLLA 3ASNB 5L3EA 1R3KC 1VQNV 3A0RA 2W6JG 1B6QA 1ROPA 1XL6A 5CMUA 4JAUA 2ATKC 1GM8A 1OCCB 4PDRA 1QCEA 1H8HG 2Y48A 4WFGA 3T1CA 2IH3C 2PI4A 1EZJA 4N23A 3AG1B 3AG4C 2R9RB 1K5QA 4UV8A 1JCHA 4JPRA 1S72V 1F4MA 1K7DA 2HJFC 4MTXA 1L1FA 1K9MW 2LP7A 3BY6A 4HZ3A 4PA7A 1VQMV 3MD0A 3FYIB 3ZMTA 5B1NA 2HFEC 2R9IA 2IJKA 2WAMA 1I5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOF A;  1QBZ A;  5KA6 A;  1ENV A;  1Y4M A;  5HFM A;  3WFV A;  3K9A A;  5HFL A;  3MHS C;  5CMU A;  3GWO A;  3P30 A;  2M7W A;  1DF5 A;  1EBO A;  1K34 A;  1JPX A;  2EZO A;  2MK3 A;  1F23 A;  2X7R B;  3B77 A;  1QCE A;  3CP1 A;  1JQ0 A;  4FIP C;  1Y66 A;  3H01 A;  4G2K A;  3M99 B;  3CYO A;  4FK5 C;  1SZT A;  4N23 A;  2EZP A;  1K33 A;  2EBO A;  2OT5 A;  4FJC C;  5H9C A;  5KA5 A;  1MG1 A;  4JPR A;  5CN0 A;  4E2L A;  1DLB A;  1I5Y A;  2LP7 A;  1QR9 A;  2P6J A;  4JF3 A;  4N21 A;  3MHH C;  3B8M A;  3B8N A;  1DF4 A;  1QR8 A;  1I5X A;  4JGS A; 
#chains in the Genus database with same CATH topology
 4X8A A;  1QBZ A;  4OPH A;  2PY5 A;  4NTX A;  4X62 B;  5L3F A;  5JCO A;  5H2F Z;  4Q20 A;  2L6L A;  2ITC C;  5EBL C;  5BZB A;  2A79 B;  3SYO A;  3N2G B;  4MVM A;  2ZKO A;  4EKW A;  3QNE A;  3RT3 C;  1COW G;  3DTU B;  3B40 A;  4QGP A;  1HP8 A;  4MW8 A;  1Q43 A;  1XRE A;  3H1I H;  3SPC A;  3RGB A;  1M9N A;  2EIM B;  1IXB A;  3IJ4 A;  3H1L H;  2IU3 A;  5LGT A;  4FLU A;  3NR7 A;  1F23 A;  1XMQ B;  4DRX B;  4DV6 O;  5EYP A;  4I4T B;  4IIJ A;  5B1B B;  1IBK B;  1IBL O;  3RYH A;  1AR5 A;  1TA8 A;  3ZRW A;  2WA4 A;  5ITZ B;  1FXH A;  1KP3 A;  2RDC A;  2DWE C;  1H2S B;  2Q73 A;  1W0K G;  1HNX O;  3SJQ C;  4H33 A;  4X64 O;  1SKV A;  2LFS A;  1MSD A;  1RSO A;  1OCO C;  5KMG A;  2B5U A;  4CBC A;  1G4Y B;  3GB7 C;  5LXT B;  1LUV A;  1WPB A;  4L8J A;  1PP9 H;  3T1Y O;  4JI8 O;  2QSA A;  1OV9 A;  1P84 F;  4MTG A;  3W7T A;  5L3B A;  4Z1M G;  4DR2 O;  1Z5V A;  3ZMV A;  1OZ0 A;  5LL6 Y;  4JI0 B;  5BXZ A;  5LMU B;  3AG1 C;  2OTJ V;  2LW1 A;  3DGE A;  3QO7 A;  1MOF A;  1WA8 A;  3AG3 C;  5KUM A;  1J95 A;  4DYL A;  4DUZ O;  2CH7 A;  1B04 A;  2EBO A;  4KL1 A;  1TUB B;  1IBM O;  4X20 A;  1K8A W;  4KP4 A;  1KYO F;  1Y76 A;  2RNB A;  2XAS A;  3SYP A;  1CXZ B;  4LWS B;  3W7U A;  4JYA B;  2YDE A;  2UUC O;  2HKO A;  4R50 A;  4YJ3 A;  2FB5 A;  2WWW A;  4F4L A;  2V1D A;  3H1J H;  3ZN1 A;  5B1A B;  1NT2 B;  1B06 A;  1SQX H;  3B09 A;  2HHH B;  1H2M A;  2DQ3 A;  4JI7 O;  2Q6A A;  4DR4 B;  1HNZ B;  4DV4 O;  1FPO A;  3ZMZ A;  1I08 A;  2LGW A;  4X1I B;  2ZE5 A;  5TIS Z;  1G8M A;  2ZNI A;  4BIU A;  3UM7 A;  2CAZ C;  5B1B C;  3K59 A;  4F6R A;  3AG7 A;  2VQF B;  4NYK A;  4HNA A;  3BFR A;  5KLV H;  1XDC A;  1N34 B;  4J80 A;  2QR4 A;  1D5N A;  3CCQ V;  5JJE B;  1NKD A;  4PD4 F;  4DV1 O;  1VF6 A;  3CD6 V;  5CB4 A;  2V7Q G;  4MS2 A;  1DTO A;  2ZIO A;  1JQ0 A;  2B1I A;  1I94 O;  1JFF B;  3UKM A;  1MG1 A;  2VRZ A;  4AHC A;  3OM3 B;  3T4D A;  3K5M A;  1YJW V;  2IJJ A;  4FLT A;  4U7O A;  1SF9 A;  3R65 A;  3K5O A;  4H0L B;  5CA3 A;  2EX3 A;  1DF5 A;  4GT1 A;  4DV0 O;  1N4C A;  3CXC U;  1XOU A;  3TJT A;  2AZ0 A;  4WFA V;  1SRY A;  1AI7 A;  4O4L B;  3CC4 V;  4UCV A;  1Q5O A;  1YXB A;  2DQ0 A;  1WB7 A;  2LGQ A;  1BQZ A;  4JZG A;  3HKC B;  5H5N A;  4ZI7 B;  1NS1 A;  4DV6 B;  1KKD A;  1IBL B;  3RBZ A;  5IYD O;  1FD9 A;  3BHP A;  1SZT A;  1D5A A;  1U96 A;  2VQE O;  1FYJ A;  4O4J A;  1GK9 A;  5B5E Z;  4QPJ A;  4XDK A;  2D2C B;  1HNX B;  1ZWI C;  2UUB O;  1H2K A;  1QR9 A;  2DYS B;  4RQE A;  1AP6 A;  1UPG A;  4X64 B;  4IYI A;  3ABT A;  1VQ6 V;  3ZMU A;  4JTC B;  4NTY A;  1MMM A;  4G28 B;  4F6E A;  2XAF A;  3T1Y B;  4JI8 B;  2EIK B;  2EIN B;  3AEI A;  4DR2 B;  5KHI A;  2E5L O;  1QNM A;  3G80 A;  5IE9 A;  1E1R G;  1AB3 A;  4FLV A;  1NQT A;  4AIL C;  1NTZ H;  2Z3Y A;  2R70 A;  4U3F H;  4FFB B;  1PM9 A;  4DUZ B;  4O4I B;  4FLY A;  4ZIB A;  2HR3 A;  2PYL A;  4ZBM A;  1IBM B;  4JI6 O;  2AHY A;  1QLN A;  2NNU A;  3H01 A;  3H1K H;  3ABM B;  2ZDI C;  2P90 A;  2F95 B;  1VQK V;  3ZS8 C;  2ITD C;  4B3S O;  3OFN G;  2UUC B;  3ZHQ A;  1FXK B;  4TWK A;  2E76 B;  3DSQ A;  3N27 A;  3OR6 C;  2XAQ A;  1JOY A;  3JYC A;  1VMG A;  2JVD A;  3ZMS A;  5E79 Z;  4JI7 B;  1K34 A;  5D5Q A;  3E8B A;  3JAS B;  3M99 B;  4GCZ A;  1YJN V;  4DV4 B;  4PA3 A;  1ZSP A;  4K8X A;  5KUK A;  3FD9 A;  2BOC C;  3QTC A;  2R9A A;  3FB7 C;  5EBW C;  4HAM A;  2CTP A;  5KX5 B;  4DV5 O;  1S5L Z;  4X1Y B;  2C2A A;  5BMV A;  4CS2 A;  3W7W A;  2DYS C;  2MK3 A;  5L3G A;  3SYA A;  3SDL A;  3KG2 A;  2UXC O;  4J42 A;  4LF8 O;  2FTK A;  3LNN A;  1PL4 A;  4DV1 B;  4GYC B;  1H2L A;  3ZIA G;  2ZR2 A;  4MVQ A;  5CN0 A;  5C8Y B;  2EIK C;  4KHP O;  2EIN C;  1M57 C;  3E86 A;  2X6B A;  2Y0I A;  1P4R A;  3ZRX A;  3ASO C;  3SR2 C;  2ZT9 B;  5J2T A;  1I94 B;  4DUY O;  4BW9 A;  3RWR D;  1FKA O;  4GX1 A;  1SS3 A;  3LNM B;  4DR3 O;  1ZAU A;  2ZQM A;  3JAL A;  1YZB A;  3MHH C;  3CCR V;  1DF4 A;  2ZIM A;  2WLH A;  4LF5 O;  3JAR B;  4DV0 B;  4LF9 O;  2WPD G;  1YEW A;  2UUA O;  3K79 A;  2YUA A;  3GWO A;  1X59 A;  5IJ9 A;  4YHH O;  3U11 A;  4UCR A;  2EJR A;  3ABL B;  4LFC O;  4L87 A;  5B1O A;  1VQ5 V;  2G38 A;  4WFE A;  1ARO P;  3LDE A;  4DR6 O;  4OGQ B;  3TGU H;  3JD0 A;  1R3K C;  1KU9 A;  4NXN O;  1VQN V;  4NKG B;  4JI4 O;  5CMU A;  1XL6 A;  3F5T A;  2VQE B;  5B66 Z;  5IYZ B;  3T1C A;  4EEQ A;  1EZJ A;  2UUB B;  3J80 N;  1V9P A;  1GRJ A;  1SA0 B;  1JCH A;  2YXL A;  1S72 V;  1VF7 A;  1K7D A;  1BZK A;  4PA7 A;  2KG7 B;  4DR1 O;  1JR9 A;  5H6Q A;  2E5L B;  1TGO A;  5CA1 A;  1BHB A;  1RM1 B;  3OD4 A;  3K08 A;  1V54 B;  2A06 H;  1S76 D;  3CME V;  3I55 V;  1VQ4 V;  1NBM G;  1Q90 D;  1SQG A;  3OW2 U;  3UQ8 A;  2YS8 A;  1GO3 F;  4R8C A;  1R3J C;  3A0B Z;  3CB2 A;  4JI6 B;  1URF A;  5KA6 A;  1KD1 W;  3WFV A;  3D8C A;  3BA9 A;  2Q8V A;  2BCC H;  4TV9 B;  1YIT V;  3IC7 A;  4FZ0 A;  4B3S B;  3FAV B;  4E4E A;  1HWY A;  3CCV V;  5CA0 A;  1K3E A;  1PNM A;  3T4Z A;  3F7V C;  2QTS A;  3RVY A;  3CCJ V;  1VQP V;  2JDI G;  4PV1 B;  1TUE B;  1V55 B;  2WLI A;  4H13 B;  3CXH F;  3JAW B;  2IU0 A;  3SYC A;  5IYC O;  2IW5 A;  3JCZ A;  2GUZ B;  3CYO A;  4LP8 A;  3X2Q B;  3CX5 F;  1MAB G;  1WJZ A;  4X9Q A;  3HKB B;  4DV5 B;  4YJ2 B;  3CJH B;  2CTR A;  2PTM A;  4DW0 A;  5KAI Z;  3FB6 C;  3ABK B;  4LR3 A;  2F4V O;  2UXC B;  4LF8 B;  5EZY B;  1FFX B;  1M4U A;  3DC6 A;  1BGY H;  4MVO A;  2JS5 A;  4LFA O;  5LOV A;  2QWO B;  2H8P C;  4W4K A;  4R7C A;  2M6Y A;  4KHP B;  1QLE B;  2NN4 A;  1RM1 C;  3LSQ A;  4DUY B;  2Q0A A;  2ZIN A;  1NZ6 A;  1AIL A;  2OTL V;  4H44 B;  1AJP A;  1ENV A;  3L9D A;  2GSM B;  2EIJ B;  1GN3 A;  1YIJ V;  1YJ9 V;  3EHB B;  4I55 B;  5EBM C;  4DR3 B;  3ZHT A;  4LF4 O;  1B3Q A;  4D7S A;  2HP8 A;  4O2B B;  4LF9 B;  1VQO V;  2UUA B;  4LBE C;  4PI2 A;  4YHH B;  1P49 A;  1PV0 A;  2UXD O;  3CCS V;  1P7B A;  2E3C A;  1H8E G;  4LFC B;  4B3T O;  1AI4 A;  1FJG B;  4J7J A;  4BW5 A;  2GV9 A;  3K58 A;  3CSX A;  4MW3 A;  2QKC A;  4DR6 B;  4ICG A;  3D3I A;  4GZR B;  4X89 A;  5JH7 A;  2ZE7 A;  3SGI A;  1AR1 B;  4NXN B;  2GTA A;  4OX9 O;  1RP3 B;  2ZR3 A;  2A7W A;  1HR0 O;  3SPG A;  2CE4 A;  4P2Z A;  1PNK A;  3HKE A;  3ABK C;  3L70 H;  3A2F A;  1S0V A;  4BIO A;  4DR1 B;  1GH6 A;  3CRR A;  2Y69 C;  2PZS A;  3UO2 A;  3DXR B;  3K3W A;  4MT8 A;  3UCS C;  4O2A B;  3OEH G;  3HKD B;  4B7E A;  5LYJ B;  1ZUQ A;  3AG4 B;  3OUF A;  2Q67 A;  2RMK B;  5JVD B;  5GW7 A;  4LC1 A;  3N2K B;  3B77 A;  4O4H B;  4MVS A;  1MNG A;  3OGC C;  3ASN C;  2Y0P A;  5GON B;  1R1B A;  1ZX3 A;  2EIJ C;  4LNU B;  1OHH G;  3GVM A;  4WBN B;  2EIL B;  4CS4 A;  2Q7H A;  4C7U A;  4LF7 O;  1KP2 A;  3CRA A;  3RYC B;  3RFR A;  2QEX V;  4RUE A;  3QO5 A;  3K9A A;  3RYF A;  1AJQ A;  4X88 A;  2BTQ A;  3CC2 V;  4HYO A;  2DE0 X;  1Y67 A;  1EBO A;  2QM8 A;  5IWA O;  4NVP A;  2BSK A;  2QWR B;  4G2K A;  2HEP A;  5B3S B;  2JGD A;  3IFX A;  3OAA G;  4UVB A;  4GX2 A;  1H2N A;  4FLX A;  2YI9 A;  2ZDI A;  4Z2W A;  3ZN0 A;  4GX0 A;  4IHJ B;  2AZ2 A;  1WLE A;  4CH3 A;  2YEV A;  1NVP D;  5EC2 C;  3CCE V;  3FX7 A;  2IM9 A;  4JAS A;  5LP6 B;  4U3J B;  2ZM6 O;  4DR5 O;  2UXN A;  4MVU A;  1FAF A;  2ODM A;  2EIM C;  4FM2 A;  4BR6 A;  1WP8 A;  2F4V B;  5LBQ A;  3SPJ A;  5JJN B;  1NTK H;  5LA6 A;  1WPX A;  4W4L A;  2F93 B;  3JD4 A;  3K03 A;  4LFA B;  1SET A;  2XAG A;  4FVM A;  1EN4 A;  5LGU A;  5C93 A;  5CBG A;  3G67 A;  4Q6G A;  3LDD A;  1KBH A;  4JV5 O;  3JAK A;  2P4K A;  5EYP B;  4TV8 A;  2ZE8 A;  1GTO A;  4IIJ B;  4UCU A;  2QWQ B;  5H6R A;  2KSD A;  3RYH B;  4J7K A;  3TXQ A;  1YTF B;  2YIA A;  2ETN A;  1N33 O;  3P32 A;  3QF7 A;  4QIW F;  3ZRW B;  3CPW U;  3HB3 B;  1S5H C;  1WAZ A;  3UO3 A;  4LF4 B;  1F4N A;  2EIL C;  2RQ6 A;  4JTD B;  1K33 A;  1E79 G;  1D2D A;  3FFQ A;  1M90 W;  1RSO B;  5KMG B;  4H37 A;  3RVZ A;  2UXD B;  5KHG A;  3E2E A;  3KKY A;  4PA9 A;  3ZX6 A;  4J10 A;  3CCM V;  1P7G A;  2DYR B;  1SQF A;  1W59 A;  2OCH A;  2F43 G;  3ICX A;  4KXR A;  4ZHQ A;  1WA8 B;  2XTA A;  1YCI A;  3FB5 C;  4R6Z A;  5LP6 C;  1SER A;  4P30 A;  2OIE A;  2CH7 B;  5B1A C;  4XDJ A;  1HR0 B;  5JCO C;  4X20 B;  2ZNJ A;  1QR8 A;  1ZLZ A;  1TVK A;  1Y76 B;  5IDJ A;  2Q7G A;  3BAA A;  3OUS A;  2PGG A;  2Y4T A;  4I5S A;  3ETE A;  3JSN A;  5K1X A;  1VQ7 V;  3B4S A;  1JJO A;  4YJ3 B;  4UVC A;  1GKF A;  3VBB A;  1RPO A;  1N0J A;  4PDM A;  4Z1V A;  4IT5 A;  5H9C A;  4JI5 O;  5GTH Z;  1LNQ A;  3GWK C;  2PF4 E;  2JK5 C;  2IJH A;  2H3O A;  3OMA B;  2YIB A;  1N32 O;  2FYU H;  4PJ0 Z;  5LMN O;  3Q4H A;  1KKC A;  4F6R B;  2ARH A;  1IVS A;  4NXM O;  1FXV A;  2HVJ C;  4HNA B;  3ZRV A;  4A5U B;  4TUY A;  3RYI A;  2AHZ A;  2KKW A;  1SC5 B;  1K4D C;  3G4S V;  4LF7 B;  5IJ0 A;  4NB5 A;  1AR4 A;  4UB8 Z;  2JJ2 G;  2WLL A;  3E22 A;  3A0R A;  4X65 O;  1XQ8 A;  2Q0O C;  4JAU A;  1OCC B;  3DC5 A;  4FM1 A;  1O9G A;  2Y48 A;  5CB4 B;  2PI4 A;  2P5O A;  3CEI A;  2EJ7 A;  2N05 A;  4ZOL A;  1K5Q A;  4UV8 A;  3ETQ A;  1VAR A;  1X4T A;  2HJF C;  5D5P A;  4GKJ O;  3FYI B;  2HFE C;  2WAM A;  2ZM6 B;  1I5X A;  3JCU Z;  1MZE A;  4DR5 B;  4ASU G;  3K5L A;  4FZ1 A;  5LHI A;  4YIP A;  4XDL A;  4X1K A;  4JI3 O;  4B7K A;  2GBO A;  4X66 O;  2N74 A;  4CH5 A;  1BHA A;  2AGA A;  1RPR A;  5L3C A;  2WSS G;  5FNV A;  1PNL A;  2DWD C;  4BWA A;  2Q4P A;  2FL4 A;  1VIB A;  3ZHR A;  1SZX A;  3IC9 A;  4JV5 B;  1GM7 A;  2QA4 V;  4MTF A;  4I50 A;  5KHH A;  1YHQ V;  1NR1 A;  4O4J B;  5F2V O;  1FFT B;  3UT5 A;  1ZL8 A;  2BE3 A;  3BA8 A;  3CRQ A;  4JAV A;  2B1G A;  4WF9 V;  3SPI A;  4UXN A;  3KZI Z;  4TQF A;  4I0X A;  4PEL A;  4DR7 O;  1H38 A;  1F7Y A;  1YSC A;  1VF6 C;  4JZ2 A;  2R72 A;  4RO2 A;  5FPO A;  4I7Z B;  3ABM C;  4DK0 A;  3BEH A;  1IX9 A;  3S3W A;  2GTS A;  3EVK A;  4EFB A;  5HFM A;  1FXK C;  1PL0 A;  1XI1 A;  3JAT A;  3R66 A;  4FJC C;  3WB2 A;  4JTA B;  1EZV H;  1HW7 A;  1Q3E A;  4IL6 Z;  3QVN A;  4G27 B;  3W7X A;  4MSW C;  4RWU A;  4JGS A;  1VEW A;  2PI5 A;  3L71 H;  3ZHV A;  1IUR A;  1QQC A;  4LF6 O;  3P30 A;  1BCC H;  4PA4 A;  3K57 A;  1LUW A;  1M5I A;  3HR0 A;  4JI5 B;  2KB1 A;  3ZBH A;  4YIO A;  2ZXW B;  3BRC A;  1KUQ A;  5DN6 G;  3OEE G;  4J9Z B;  5LMN B;  1ORQ C;  1M56 B;  4FMT A;  3LUT B;  2E75 B;  4NXM B;  5KAF Z;  1KEC A;  2Q68 A;  1Z5W A;  5LGN A;  1NH2 B;  3ZCC A;  3L75 H;  5BMV B;  2JJ1 G;  4RAI A;  4B3R O;  2CK3 G;  3C3T A;  2W6I G;  3TET A;  4X65 B;  5JQG A;  2K1E A;  4DV2 O;  2WLK A;  4GLX A;  1XIL A;  4EB6 A;  2NLJ C;  2HLD G;  1Q7Y W;  1EN5 A;  1Q82 W;  5J2T B;  3SYQ A;  4GKJ B;  2CTW A;  1BL8 A;  4JYY A;  4BIZ A;  4PHZ A;  3ABL C;  2QWN B;  3QO8 A;  2YIC A;  4MVZ A;  4D6T H;  1BS3 A;  4J7Z A;  4IGG A;  3RW0 A;  1N36 O;  3JAL B;  1Z2G A;  1HNW O;  4JI3 B;  4UCT A;  3CCU V;  4DV7 O;  3APO A;  4FK5 C;  4X66 B;  5IJ9 B;  1CP9 A;  3E8F A;  3W7S A;  2IJI A;  4UCS A;  4FLW A;  5BY1 A;  1NI8 A;  2ZXW C;  1NR7 A;  3OE7 G;  1FS0 G;  2X6C A;  2Q5Z A;  4DRX A;  1QVF U;  2PUS A;  4I4T A;  1YI2 V;  2M7W A;  2QTO A;  1JPX A;  4J9Y B;  1AI6 A;  1VQ9 V;  5ITZ A;  5J2U A;  2DOS A;  3E8G A;  2OYQ A;  1PKX A;  2X0L A;  1A32 A;  1R6T A;  2P22 C;  3PJS K;  3BAB A;  4CZZ A;  1NJI W;  1V54 C;  4RQF A;  4DR7 B;  5LXT A;  3S3X A;  3SJA C;  3ETG A;  4FIP C;  1S3J A;  2W0X A;  1L0L H;  2QJ1 A;  5CA1 B;  2LJ2 A;  2QWP B;  1WN7 A;  4LF5 B;  1W0J G;  2O57 A;  2UU9 O;  1JX9 A;  3BVO A;  2P6J A;  3E89 A;  1XUQ A;  2XOK G;  2Q69 A;  3EXA A;  5K1P A;  2XUM A;  2GDS A;  4DO2 A;  1TUB A;  3NXS A;  5BR8 O;  1G6U A;  3OTO O;  3F7Y C;  4LWS A;  3RN4 A;  1W2B U;  4ZKI A;  1V55 C;  1K97 A;  2A0L A;  2NR5 A;  3AG3 B;  5IY5 B;  2QM4 A;  2JEX A;  2Z0A A;  3AK1 A;  4JI4 B;  4LF6 B;  4NTW A;  5CA0 B;  3X2Q C;  1SQP H;  3O65 A;  3WU2 Z;  2XND G;  4QJF B;  1JMK C;  4AI8 A;  2WLI B;  1EN6 A;  1YF2 A;  1E1Q G;  4X1I A;  1WNS A;  3U0Z A;  3KCX A;  2UXB O;  3CWB H;  5GTI Z;  1M1K W;  2P7T C;  3ETD A;  1SQB H;  1GM9 A;  1QLE C;  2OIG A;  5FPR A;  2E74 B;  2UXX A;  3CRM A;  3OR7 C;  4B3R B;  4JAA A;  3STZ C;  3O9O A;  2HG5 C;  4DV3 O;  5LOV B;  3K0G A;  4DV2 B;  3C90 A;  1NH2 D;  5J2U B;  1JVM A;  4QE7 A;  2JEU A;  3LSS A;  5CBF A;  1LR1 A;  1XBL A;  2GHY A;  1JFF A;  4RUF A;  4P9O A;  4PDV A;  1THZ A;  3CP1 A;  2RCV A;  1O9H A;  3PN1 A;  1GN6 A;  2JGU A;  2N04 A;  1R6K A;  2JS3 A;  2QM7 A;  4I9W A;  4KUM A;  1N36 B;  4WFH A;  1Q6U A;  2VWJ A;  1HNW B;  4JYC A;  5IY5 C;  4DV7 B;  4TQD A;  5IYB O;  2RN9 A;  1KMI Z;  4O4L A;  2K9P A;  1K5S A;  4U7N A;  1KQS U;  3WB0 A;  3HKC A;  4ZI7 A;  1N8R W;  1XMO O;  2PYJ A;  5E1A C;  5JH7 B;  3JAM N;  3M7M X;  3VQX A;  5JJJ B;  2ATK C;  1GM8 A;  4PDR A;  1QCE A;  2Q7E A;  4WFG A;  2BTO A;  3AG4 C;  2R9R B;  3P3N A;  3M8A A;  3HKE B;  4MTX A;  1K9M W;  4B08 A;  4FM0 A;  1VQM V;  1VP7 A;  2IJK A;  4YY3 O;  2VS0 A;  3JD3 A;  3IAY A;  4GUN A;  4K0K O;  1Y6X A;  4GKK O;  3D36 C;  2UU9 B;  1CEZ A;  3T1H O;  5KA5 A;  5A9G A;  4FFB A;  4O4I A;  5B3S C;  2H94 A;  2FKX A;  1N0N A;  1US6 A;  3THO A;  4B3T B;  1XEQ A;  2YI8 A;  2QKS A;  5BR8 B;  3OTO B;  1L0N H;  2F23 A;  3E35 A;  1U97 A;  2LFR A;  3K5N A;  2X7R B;  4CS3 A;  3WG7 B;  1K73 W;  3LSU A;  3RYF B;  2BTQ B;  1OCR B;  1FXK A;  2ZD9 A;  2BOB C;  2P4V A;  2Z5U A;  3E8H A;  4OX9 B;  2BSK B;  5JWP A;  2JGD B;  2EUL A;  4K3A A;  2WLM A;  2ZCE A;  3BPZ A;  1BT8 A;  2OWO A;  1IDS A;  3JAS A;  1Y4M A;  2YEV B;  2UXB B;  1I7F A;  2A3Q A;  4UB6 Z;  2Q9L A;  1Q81 W;  2OT5 A;  4I9Q A;  2ADQ B;  2L35 A;  4OXS A;  5KX5 A;  1H2G A;  3L73 H;  1JA8 A;  2Y4U A;  1XNR O;  1DLB A;  4X1Y A;  4HBN A;  2CTQ A;  5DED A;  1QVG U;  3T2M A;  4LH6 A;  2QKA A;  1GAX A;  5HFL A;  3MHS C;  2DN9 A;  5LA6 B;  2IH1 C;  5L3D A;  3TXS A;  4DV3 B;  5C8Y A;  3K04 A;  3J7A U;  3G6E V;  3ZED A;  2YXH A;  3OTF A;  1UJW B;  2MW2 B;  1VF5 B;  3FYE B;  2XAH A;  1XNQ O;  3JAK B;  3C3S A;  3ML0 A;  1VQ8 V;  1YVW A;  4TV8 B;  5IWA B;  3SJC C;  1JJ2 U;  4AQY O;  2LW7 A;  4NR1 A;  2DJV A;  4B3M O;  1SQQ H;  1M57 B;  2B9Z A;  2DYR C;  1L8D A;  1S77 D;  2OCC B;  3ASO B;  3HPL C;  3JAR A;  4JI2 O;  3ZHS A;  3WG7 C;  4BAY A;  4N21 A;  1OCR C;  3ZJZ A;  4JI1 O;  3VOU A;  3ZHU A;  3CCL V;  5LHH A;  1GMG A;  3A0H Z;  3OMN B;  4DK1 A;  4YXW G;  4XBF A;  4MTO A;  1XMO B;  1QU7 A;  4ZHQ B;  3FKS G;  2KQX A;  3OMI B;  1TAE A;  3H9V A;  2JIZ G;  3B8N A;  3MDS A;  1BQ0 A;  4ABM A;  5IYZ A;  3OT7 A;  4UCO A;  5EK0 A;  3ZRS A;  4J11 A;  5EC1 C;  4WCE V;  1T5E A;  2VWK A;  1TVK B;  2A9H A;  3AG2 B;  1SA0 A;  1DK1 A;  3CE2 A;  1AI5 A;  1AVM A;  3CMA V;  3ABU A;  4LFB O;  4WFF A;  2KG7 A;  4GX5 A;  2D3O W;  1J5E O;  2HJD A;  1EFR G;  3VQW A;  4YY3 B;  1EM1 A;  2LO1 A;  2RJZ A;  1N33 B;  3BCC H;  1IZ3 A;  2YSU B;  4PDL A;  1NU1 H;  2IBZ H;  4K0K B;  5KHJ A;  4TOI A;  3E83 A;  5IT9 N;  4GKK B;  3T1H B;  1I0H A;  3G71 V;  4CH6 A;  1F51 A;  1YTF D;  1OCZ B;  3Q4H B;  3STL C;  4PA6 A;  2LQT A;  2WLN A;  4UVA A;  2CGN A;  1SQV H;  1PPJ H;  3J81 N;  1OCC C;  5DM6 V;  5CBH A;  3CC7 V;  3L72 H;  5LHG A;  4TV9 A;  3B8M A;  4TUY B;  1HDJ A;  3RYI B;  2OCC C;  5IJ0 B;  3FAV A;  3CS5 A;  3CRC A;  2WLL B;  3E22 B;  3H1H H;  4QPK A;  4UV9 A;  3AK3 A;  3JD2 A;  1R6N A;  4FPP A;  2QE7 G;  4K35 A;  3FB8 C;  1S5J A;  1BMF G;  2WLJ A;  3JAW A;  4ZOL B;  2FML A;  4LH7 A;  3KCY A;  1MSW D;  2GUZ A;  2X6A A;  1SES A;  4FFK A;  2ADP A;  1UFI A;  3K9S A;  1RFY A;  3EFF K;  2XT9 A;  5AG2 A;  5FL7 G;  3MAQ A;  1IXM A;  3HKB A;  1VQL V;  1XNR B;  1FJG O;  4YJ2 A;  4X62 O;  3CJH A;  3P3P A;  1MA1 A;  4E2L A;  1CPY A;  3AG2 C;  4X1K B;  5EZY A;  5DEC A;  1FFX A;  1XL4 A;  2W0F C;  2HVK C;  1N32 B;  3G6B A;  1OJH A;  1PD3 A;  2DMX A;  1Q86 W;  3K0D A;  4CC6 A;  1KB9 F;  5FNV B;  4DXW A;  1Q6I A;  3I5D A;  5EIB C;  3I56 V;  4KFM A;  3LDC A;  2XAJ A;  3IGA C;  1XMQ O;  1XNQ B;  2CDY A;  4I50 B;  1IBK O;  1XHX A;  4AQY B;  1KC8 W;  1OCZ C;  2AW9 A;  4B3M B;  3VQY A;  4I55 A;  1DGS A;  3U10 A;  1QHT A;  1Y74 A;  4JYB A;  4TT3 G;  2EZO A;  3UT5 B;  3WB1 A;  1ZL8 B;  1K4C C;  2QDO A;  4JI2 B;  4O2B A;  2P67 A;  2F66 C;  3SPH A;  4JI1 B;  4QNH B;  4I0X B;  1I5Y A;  4UFZ A;  2F1M A;  2DW4 A;  3F5W C;  2P06 A;  1NTM H;  3SJB C;  3APQ A;  3CHX A;  4PI0 A;  4JI0 O;  4TSF G;  5LMU O;  4CC5 A;  1R3I C;  3N2G A;  2ILM A;  1YDX A;  4QE9 A;  1NVP B;  3VQV A;  4DW1 A;  1AP5 A;  1R3L C;  4P9P A;  2V4D A;  1K92 A;  3JAT B;  2AXT Z;  3QG5 A;  4LCU C;  2JRI A;  2YID A;  4JF3 A;  4UUJ C;  5FLX N;  1GN4 A;  4FLZ A;  2YXY A;  1AJN A;  4JYA O;  3A8T A;  3OGI B;  3AK2 A;  3B2E E;  4LFB B;  1M93 A;  3TCU A;  1J5E B;  1G1X B;  2CGO A;  4MVR A;  1M56 C;  3DXR A;  4EFE A;  4O2A A;  5A2Q N;  3HKD A;  4WFB V;  2ZE6 A;  5LYJ A;  2XHB A;  2YC0 A;  5J9P C;  2HHH O;  1WP7 A;  1GN2 A;  3D3Q A;  3TK1 A;  1Q6H A;  5JVD A;  4DR4 O;  3N2K A;  1HNZ O;  1ZTE A;  1XHZ A;  4O4H A;  1BE3 H;  1R73 A;  4IYH A;  2Y69 B;  5GON A;  4J41 A;  4K8Z A;  1Y66 A;  4LNU A;  2EZP A;  5EIB D;  2VQF O;  4WBN A;  3K06 A;  3L74 H;  4OPA A;  3JD1 A;  1N34 O;  3D36 A;  3RYC A;  1MZF A;  2CUG A;  3JSL A;  2YIB D;  2QGN A;  2WA3 A;  1OCO B;  3ASN B;  5L3E A;  2W6J G;  1B6Q A;  1ROP A;  5JQG B;  1Q8I A;  1H8H G;  2IH3 C;  4N23 A;  4IHJ A;  1Y74 B;  1WB8 A;  3AG1 B;  4EB6 B;  4CH4 A;  4JPR A;  1F4M A;  1L1F A;  2LP7 A;  5LP6 A;  3BY6 A;  4HZ3 A;  3MD0 A;  3ZMT A;  1BSM A;  5B1N A;  4D7T A;  2R9I A;  4U3J A;  5KHK A; 
#chains in the Genus database with same CATH homology
 3JD3 A;  4X8A A;  4ASU G;  1QBZ A;  5L3F A;  4Q20 A;  5H6Q A;  2ITC C;  1BHB A;  5LHI A;  5EBL C;  1RM1 B;  5BZB A;  4XDL A;  3K08 A;  1V54 B;  2A79 B;  3SYO A;  1CEZ A;  1S76 D;  4MVM A;  5KA5 A;  4EKW A;  3CME V;  3QNE A;  3I55 V;  1VQ4 V;  1NBM G;  3OW2 U;  1COW G;  1BHA A;  3DTU B;  5B3S C;  1GO3 F;  1RPR A;  2H94 A;  4MW8 A;  4R8C A;  5L3C A;  2WSS G;  2QKS A;  1PNL A;  1R3J C;  2DWD C;  3SPC A;  1KD1 W;  5KA6 A;  1M9N A;  3WFV A;  2EIM B;  2IU3 A;  3E35 A;  5LGT A;  1YIT V;  3IC7 A;  2LFR A;  1F23 A;  2X7R B;  1K73 W;  3WG7 B;  1GM7 A;  2QA4 V;  4MTF A;  1OCR B;  1FXK A;  2ZD9 A;  2BOB C;  1HWY A;  5B1B B;  2Z5U A;  3CCV V;  3E8H A;  1YHQ V;  1K3E A;  1PNM A;  3T4Z A;  3F7V C;  3ZRW A;  1NR1 A;  1FXH A;  1KP3 A;  2WLM A;  3RVY A;  3CCJ V;  2DWE C;  1W0K G;  1FFT B;  1VQP V;  3SJQ C;  2JDI G;  4H33 A;  1TUE B;  1V55 B;  2WLI A;  1Y4M A;  2IU0 A;  4JAV A;  3SYC A;  5IYC O;  2YEV B;  2B1G A;  4WF9 V;  3SPI A;  2LFS A;  2IW5 A;  3JCZ A;  4UXN A;  1OCO C;  3CYO A;  2B5U A;  4PEL A;  4CBC A;  1G4Y B;  4LP8 A;  3GB7 C;  1H38 A;  1YSC A;  3X2Q B;  1Q81 W;  2OT5 A;  1MAB G;  4OXS A;  4RO2 A;  1H2G A;  4MTG A;  3W7T A;  1DLB A;  4Z1M G;  5L3B A;  3ZMV A;  1OZ0 A;  3ABM C;  3FB6 C;  3AG1 C;  1QVG U;  3T2M A;  2OTJ V;  3BEH A;  3ABK B;  3DGE A;  3QO7 A;  1MOF A;  5HFM A;  3AG3 C;  5HFL A;  3MHS C;  5KUM A;  2IH1 C;  5L3D A;  1J95 A;  1FXK C;  1PL0 A;  4MVO A;  3K04 A;  2H8P C;  3G6E V;  4R7C A;  2EBO A;  1QLE B;  4FJC C;  4JTA B;  1K8A W;  4KP4 A;  2XAS A;  3SYP A;  1UJW B;  4G27 B;  1RM1 C;  3W7X A;  3W7U A;  3LSQ A;  3FYE B;  2XAH A;  4MSW C;  3ML0 A;  2HKO A;  1VQ8 V;  4JGS A;  4R50 A;  2OTL V;  2PI5 A;  1AJP A;  1ENV A;  1JJ2 U;  2WWW A;  4F4L A;  3P30 A;  2GSM B;  4PA4 A;  2EIJ B;  2V1D A;  3ZN1 A;  1YIJ V;  1YJ9 V;  5B1A B;  1M57 B;  3EHB B;  2KB1 A;  5EBM C;  2DYR C;  2ZXW B;  1S77 D;  2DQ3 A;  2OCC B;  2Q6A A;  3ASO B;  3HPL C;  5DN6 G;  3WG7 C;  3OEE G;  3ZMZ A;  4BAY A;  1VQO V;  4LBE C;  4N21 A;  1G8M A;  1OCR C;  4J9Z B;  3ZJZ A;  4BIU A;  3UM7 A;  5B1B C;  1ORQ C;  3CCS V;  1P7B A;  1M56 B;  3VOU A;  3CCL V;  1H8E G;  4FMT A;  3LUT B;  5LHH A;  1AI4 A;  1GMG A;  4BW5 A;  1KEC A;  2Q68 A;  5LGN A;  3OMN B;  1NH2 B;  3ZCC A;  4MW3 A;  4YXW G;  4XBF A;  4MTO A;  3D3I A;  3CCQ V;  4X89 A;  2JJ1 G;  1NKD A;  4RAI A;  1AR1 B;  2CK3 G;  3FKS G;  3OMI B;  2W6I G;  3TET A;  2JIZ G;  2K1E A;  3B8N A;  3CD6 V;  2ZR3 A;  2WLK A;  2V7Q G;  5EK0 A;  3ZRS A;  5EC1 C;  4WCE V;  4MS2 A;  2NLJ C;  2A9H A;  3AG2 B;  3SPG A;  1DTO A;  2HLD G;  1Q7Y W;  4P2Z A;  1JQ0 A;  1PNK A;  2B1I A;  3ABK C;  1Q82 W;  3CMA V;  1AI5 A;  3ABU A;  1S0V A;  3UKM A;  4WFF A;  3SYQ A;  4GX5 A;  2D3O W;  1MG1 A;  1EFR G;  2Y69 C;  3OM3 B;  3T4D A;  1BL8 A;  4BIZ A;  3ABL C;  1YJW V;  3K3W A;  3QO8 A;  2IJJ A;  4MT8 A;  3OEH G;  4U7O A;  4MVZ A;  2YSU B;  4PDL A;  3R65 A;  3AG4 B;  3RW0 A;  5CA3 A;  3E83 A;  3OUF A;  2Q67 A;  5GW7 A;  4LC1 A;  1DF5 A;  4GT1 A;  3CXC U;  3B77 A;  3CCU V;  4FK5 C;  4WFA V;  1SRY A;  4MVS A;  3G71 V;  3OGC C;  1F51 A;  3ASN C;  1OCZ B;  1YTF D;  3STL C;  1AI7 A;  4PA6 A;  1CP9 A;  2WLN A;  4UVA A;  3E8F A;  2EIJ C;  3CC4 V;  3W7S A;  1OHH G;  2IJI A;  1OCC C;  5DM6 V;  5CBH A;  3CC7 V;  2EIL B;  2ZXW C;  5LHG A;  3B8M A;  2OCC C;  2DQ0 A;  1KP2 A;  1NR7 A;  3OE7 G;  1FS0 G;  2X6C A;  1QVF U;  2QEX V;  4RUE A;  3QO5 A;  3K9A A;  3CC2 V;  1AJQ A;  4X88 A;  1KKD A;  4HYO A;  2M7W A;  1YI2 V;  2QTO A;  1EBO A;  2QM8 A;  1JPX A;  4J9Y B;  2WLL B;  3RBZ A;  1AI6 A;  5IYD O;  4QPK A;  4UV9 A;  4G2K A;  5B3S B;  1SZT A;  3IFX A;  3JD2 A;  1R6N A;  3OAA G;  4FPP A;  4GX2 A;  4UVB A;  2QE7 G;  1VQ9 V;  1GK9 A;  3E8G A;  2ZDI A;  3FB8 C;  4QPJ A;  4XDK A;  1BMF G;  1PKX A;  1ZWI C;  3ZN0 A;  2X0L A;  4GX0 A;  1QR9 A;  2DYS B;  2WLJ A;  4RQE A;  1WLE A;  3PJS K;  4CZZ A;  2YEV A;  1NJI W;  3ABT A;  1NVP D;  1VQ6 V;  5EC2 C;  1V54 C;  3ZMU A;  3CCE V;  4RQF A;  1MSW D;  4JAS A;  4JTC B;  2X6A A;  1SES A;  4G28 B;  3ETG A;  2XAF A;  3EFF K;  2EIK B;  2UXN A;  4FIP C;  1IXM A;  2EIN B;  3AEI A;  5FL7 G;  1VQL V;  1S3J A;  4MVU A;  4E2L A;  2EIM C;  1CPY A;  1E1R G;  3AG2 C;  1W0J G;  5LBQ A;  1NQT A;  3SPJ A;  1JX9 A;  2P6J A;  3E89 A;  2Z3Y A;  1WPX A;  2W0F C;  1XL4 A;  2HVK C;  2XOK G;  3JD4 A;  3K03 A;  1SET A;  1PD3 A;  2Q69 A;  2XAG A;  1Q86 W;  2HR3 A;  3K0D A;  4ZBM A;  4DO2 A;  5LGU A;  5C93 A;  3NXS A;  2AHY A;  5CBG A;  1QLN A;  2NNU A;  3H01 A;  4DXW A;  3ABM B;  3F7Y C;  2ZDI C;  1W2B U;  2P90 A;  3LDD A;  4ZKI A;  3I56 V;  4KFM A;  3LDC A;  1V55 C;  1VQK V;  1K97 A;  2A0L A;  2XAJ A;  2ITD C;  3IGA C;  3AG3 B;  5IY5 B;  3OFN G;  2JEX A;  1FXK B;  4TWK A;  1GTO A;  5H6R A;  1KC8 W;  1OCZ C;  3X2Q C;  1YTF B;  3OR6 C;  2XAQ A;  2XND G;  3P32 A;  1JOY A;  3ZRW B;  4QIW F;  4QJF B;  3CPW U;  3HB3 B;  1S5H C;  3JYC A;  4JYB A;  1F4N A;  4TT3 G;  2EZO A;  1K34 A;  2EIL C;  3ZMS A;  3E8B A;  1K4C C;  2WLI B;  3M99 B;  4JTD B;  4GCZ A;  1YJN V;  1K33 A;  4PA3 A;  1E79 G;  1E1Q G;  2P67 A;  5KUK A;  1M90 W;  4H37 A;  3RVZ A;  3SPH A;  4QNH B;  2BOC C;  3E2E A;  1I5Y A;  1M1K W;  2P7T C;  4PA9 A;  2DW4 A;  3ETD A;  3F5W C;  3CCM V;  3FB7 C;  5EBW C;  4HAM A;  1GM9 A;  2DYR B;  1QLE C;  2C2A A;  2F43 G;  2UXX A;  4TSF G;  3W7W A;  2DYS C;  2MK3 A;  3OR7 C;  5L3G A;  3SYA A;  1R3I C;  3KG2 A;  3STZ C;  4QE9 A;  1NVP B;  2FTK A;  3FB5 C;  4R6Z A;  1R3L C;  2HG5 C;  1SER A;  3ZIA G;  2ZR2 A;  4MVQ A;  4P9P A;  4P30 A;  5CN0 A;  1K92 A;  3K0G A;  2EIK C;  2EIN C;  5B1A C;  1NH2 D;  4XDJ A;  1M57 C;  1JVM A;  4LCU C;  3E86 A;  4JF3 A;  4UUJ C;  4QE7 A;  1QR8 A;  2JEU A;  5IDJ A;  2X6B A;  3LSS A;  3OUS A;  5CBF A;  1P4R A;  3ZRX A;  3ASO C;  1AJN A;  2GHY A;  4I5S A;  4RUF A;  4P9O A;  4PDV A;  3ETE A;  1THZ A;  1VQ7 V;  3TCU A;  3CP1 A;  4MVR A;  4GX1 A;  4UVC A;  1GKF A;  1M56 C;  3VBB A;  1RPO A;  3LNM B;  4PDM A;  5H9C A;  1R6K A;  4WFB V;  2QM7 A;  4I9W A;  1LNQ A;  5J9P C;  4KUM A;  3TK1 A;  2ZQM A;  2JK5 C;  4WFH A;  2IJH A;  3MHH C;  3CCR V;  1DF4 A;  2WLH A;  3OMA B;  4JYC A;  5IY5 C;  2WPD G;  1R73 A;  3K79 A;  3GWO A;  2Y69 B;  5IYB O;  2EJR A;  3ABL B;  1Y66 A;  1K5S A;  4L87 A;  5B1O A;  2EZP A;  1VQ5 V;  3K06 A;  1FXV A;  2HVJ C;  3ZRV A;  4U7N A;  1KQS U;  4WFE A;  3JD1 A;  2AHZ A;  1ARO P;  3LDE A;  1K4D C;  3G4S V;  3D36 A;  1N8R W;  3JD0 A;  2JJ2 G;  5E1A C;  1OCO B;  2WLL A;  3ASN B;  5L3E A;  1R3K C;  1VQN V;  3A0R A;  2W6J G;  1B6Q A;  1ROP A;  1XL6 A;  5CMU A;  4JAU A;  2ATK C;  1GM8 A;  1OCC B;  4PDR A;  1QCE A;  1H8H G;  2Y48 A;  4WFG A;  3T1C A;  2IH3 C;  2PI4 A;  1EZJ A;  4N23 A;  3AG1 B;  3AG4 C;  2R9R B;  1K5Q A;  4UV8 A;  1JCH A;  4JPR A;  1S72 V;  1F4M A;  1K7D A;  2HJF C;  4MTX A;  1L1F A;  1K9M W;  2LP7 A;  3BY6 A;  4HZ3 A;  4PA7 A;  1VQM V;  3MD0 A;  3FYI B;  3ZMT A;  5B1N A;  2HFE C;  2R9I A;  2IJK A;  2WAM A;  1I5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...