1ENVA

Atomic structure of the ectodomain from hiv-1 gp41
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
121
structure length
115
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the ectodomain from HIV-1 gp41.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF G
total genus 59
structure length 115
sequence length 121
ec nomenclature
pdb deposition date 1997-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1envA00
2M7WA 2EZPA 5KA6A 3CP1A 3P30A 1QCEA 1F23A 3H01A 4G2KA 4JGSA 3B8NA 4E2LA 3K9AA 1JPXA 1I5YA 2X7RB 1QR9A 2EZOA 1Y66A 4FJCC 2LP7A 1MOFA 2EBOA 1EBOA 3WFVA 3M99B 5H9CA 2MK3A 4N23A 5HFMA 3GWOA 1QBZA 1MG1A 1DF4A 5CMUA 1DLBA 1QR8A 5KA5A 2P6JA 1I5XA 1ENVA 1K34A 1K33A 3CYOA 3MHHC 5HFLA 1DF5A 2OT5A 4FK5C 1SZTA 4JF3A 3B8MA 3MHSC 4N21A 4JPRA 3B77A 5CN0A 4FIPC 1Y4MA 1JQ0A
chains in the Genus database with same CATH superfamily
3KZIZ 4GX2A 2P90A 2R9IA 4FZ1A 4LNUB 2VQEO 1F23A 2EIJC 2X7RB 3QO5A 3EVKA 4LF8O 3G67A 4N23A 4PD4F 3A2FA 3APOA 4PA6A 4YIPA 4PI2A 2X6AA 3M7MX 3VQWA 3J81N 4R50A 1M56B 1N33B 3CXCU 5LA6A 1KB9F 2NR5A 4JF3A 5H6QA 4DV3O 1IX9A 2YI8A 3CCQV 3B4SA 3ZX6A 4CH4A 1YCIA 1L0LH 3RVYA 3RYIA 3N2GA 2WLIB 4DR4O 2WLKA 4FFBA 4F6RB 1SKVA 2Q7EA 5H5NA 4FM0A 3H1HH 4O4LB 3CYOA 3SJCC 3STLC 2QKCA 5LMUO 3OW2U 2X6CA 1RM1B 2LJ2A 3JD2A 2JRIA 4JPRA 3B77A 1PKXA 3OT7A 4LFCO 2XASA 4FLXA 5JWPA 2Q67A 3ZCCA 4LFBO 4BIZA 2OCCB 3L71H 4DR5B 3JD1A 4OX9B 1QBZA 1WJZA 1Y74B 4AQYB 3SYAA 3S3XA 4AI8A 1IBLB 3T1HB 3SJAC 3CCRV 3CCJV 3FB6C 1XBLA 1THZA 4JYAO 1YTFB 4X65B 2HG5C 2QKAA 3RGBA 3AG4B 4Q20A 2YXHA 4J7JA 2QM7A 1BMFG 3F5TA 4EKWA 2CAZC 4LWSA 4UVCA 2ZE7A 4ZIBA 1SESA 1J5EO 3TXQA 4J80A 2ZXWB 3DC5A 3M8AA 3CCLV 1IVSA 4MVQA 2ZT9B 2OTLV 3K59A 4ASUG 1NR7A 4GLXA 2JVDA 2YIDA 2DWEC 3BFRA 2R72A 3T2MA 3AG1C 5H2FZ 4UCRA 3H01A 1H2GA 3B8NA 2XT9A 1HNXO 4MVOA 1S0VA 1AJPA 2BOBC 3LSUA 4UV9A 4JI4O 4LBEC 5LA6B 1K4DC 1XEQA 3EHBB 1VF7A 2F95B 1MZFA 3IFXA 4KHPB 4HNAA 4LH6A 3CC4V 1PNKA 2FL4A 4X62B 2FMLA 3OTFA 1GK9A 3ETEA 2DQ0A 3UQ8A 4LR3A 1B3QA 3KG2A 3OEHG 4J7KA 2UUCB 1SQXH 1E79G 1YXBA 5IWAB 3HKCB 4FLWA 1R1BA 2DMXA 2JGDB 5IDJA 2W6JG 4BW9A 2L6LA 3KCYA 3SPCA 1NBMG 2V1DA 2W0FC 2VQFB 1W59A 5F2VO 2KSDA 4DW1A 3F7VC 1HW7A 4GKJO 3K9AA 1PL4A 3LDEA 3ZHVA 4K3AA 4DV7O 2YIBD 3AG3C 3PJSK 5L3BA 4JI2O 5LP6A 3QO8A 3WU2Z 4FPPA 1Q5OA 4AQYO 2PY5A 3T4DA 4PDRA 1MMMA 3W7UA 1VQKV 4K0KB 4IHJB 4EEQA 3K5NA 2XOKG 5B1NA 3CSXA 2UXXA 3W7WA 1ZLZA 1HNXB 1QCEA 4B3MO 3ABTA 1OCRB 2ODMA 3K9SA 4JASA 2QR4A 2EINB 2KG7B 4WFFA 3W7TA 4YHHB 1N0NA 4KL1A 3HPLC 1K73W 5HFLA 3ZRVA 3SJQC 1NQTA 2BTQA 4Z2WA 3OEEG 3D3IA 3E89A 4X1KA 5LYJA 1AVMA 2WSSG 3SGIA 4PA4A 1Q6IA 3L75H 4FVMA 1MOFA 1OCCC 2XAQA 1Q43A 2F4VB 2K1EA 1M4UA 5LL6Y 4DR3B 1B6QA 3K0DA 1AR5A 3BCCH 3ZRWA 2GBOA 4NXMO 5J2TB 1Y74A 4N21A 3C3TA 4UFZA 5BXZA 1ZL8B 4L87A 4CS2A 4UCTA 2XTAA 1GM9A 2E5LB 5IJ0B 5H9CA 4DV7B 4TOIA 1H2MA 3SPGA 2QEXV 4YJ2A 4IIJA 1XNRO 2UUBB 2LW1A 4PA7A 1Q6HA 4RAIA 3EFFK 4LH7A 4WFBV 2Q0AA 1BZKA 4JI3O 2ZIOA 4O4IB 5EC1C 2WLIA 1IBMO 5CA1B 2JEXA 4E2LA 1JPXA 4LF9B 4DV6B 4J42A 2P4KA 5E1AC 1SZXA 4FLZA 1NU1H 4XBFA 3BVOA 3B40A 4X8AA 1LNQA 4G27B 2Q68A 4QPKA 3NR7A 3K79A 1OCZC 1W2BU 3X2QC 4O2AA 4GYCB 2YEVB 4PA9A 5L3CA 3C3SA 4U3FH 3E83A 3RYCA 3D3QA 2ZIMA 3CRCA 5B66Z 4MW3A 1K3EA 2A06H 3RYFB 3HKDA 4I50B 3T1YO 1G4YB 4FM2A 4YXWG 4IYHA 4LFAO 2Q6AA 4F6RA 4FFBB 1VQLV 1FXHA 2CUGA 1N32O 4F6EA 3N2GB 2EX3A 1I5XA 4DV2B 2GSMB 1R6TA 3CJHA 5L3EA 4MVSA 1ZTEA 3JD0A 3WB1A 1YJ9V 3BHPA 4LF9O 1WPBA 3RYFA 2GTSA 5L3FA 1AP5A 4UCVA 1AR4A 4UUJC 3OMNB 2WPDG 1QLEC 1ROPA 2HLDG 5CA0A 1Y4MA 4KHPO 3K3WA 1R3KC 5JCOC 2ZXWC 1K97A 1X59A 4JGSA 1VQ7V 2OIEA 4A5UB 1BE3H 1UJWB 1XL6A 4DR5O 1GH6A 2D3OW 3OUFA 5H6RA 1KU9A 4O4HA 3G4SV 3ASNC 3E8FA 2UXBO 4X66B 4UVBA 2IU0A 2VQFO 2ZINA 2FTKA 1FFXA 3K08A 4WFAV 2JK5C 2N05A 3BA8A 4B3TO 1NH2B 3ZHSA 1R6NA 1R6KA 1AI5A 4FLTA 1M93A 3OGCC 3ZHQA 1M5IA 5C8YA 1NZ6A 2ILMA 5EYPA 5IYBO 3SDLA 1KQSU 1F4NA 4X64O 1YHQV 5JH7B 3JD4A 1VQ4V 1FJGO 1OZ0A 4NXNO 1NI8A 1BHAA 1ZL8A 1JMKC 2PTMA 2K9PA 3KCXA 1Q6UA 4FMTA 2BSKB 5C93A 3E8BA 4B3MB 2KB1A 2Z5UA 3CD6V 1YEWA 2Q8VA 4JYCA 4OXSA 5IJ9A 1HR0O 4DRXA 3F7YC 1DGSA 5KA6A 3O65A 2OCHA 3RYHA 1H8HG 1AJNA 5LOVA 2KQXA 1I5YA 3OE7G 3SPHA 1NVPD 1KYOF 1EBOA 4TQDA 2ZR2A 4J9ZB 2ZDIC 4GKJB 2EJ7A 4JI0B 4I55A 3CWBH 1MABG 4QE7A 4L8JA 4MVZA 4DV5B 2W6IG 1OCOB 1Y67A 5CB4B 5KUMA 5EYPB 3JSNA 1XI1A 4B3SO 4LFAB 3R66A 1JOYA 1H2KA 1HNZO 5EC2C 3AG2C 5EBMC 1WPXA 1FXKC 2QWQB 4ABMA 1MZEA 4CZZA 3TK1A 5LP6B 1DTOA 4BIOA 1M9NA 2UUBO 4B08A 1XNRB 3HKEB 1M90W 3ZHUA 1MA1A 4JI4B 5IE9A 2C2AA 1WNSA 1A32A 2HJFC 3JARB 3ABLC 2LP7A 1TGOA 1V55C 1KECA 1KUQA 1VQPV 1QVFU 4YJ3B 3H1KH 4B3RO 1D5AA 3R65A 4FLYA 2ADQB 4OPAA 4DUZB 3KKYA 4JV5B 4U7OA 3CMAV 4JAVA 1URFA 1VF5B 4JTAB 3B09A 4NTWA 3HB3B 3SPIA 2E75B 5ITZA 1FXVA 4JI7B 4DUYB 4DUZO 3HKBB 3K03A 3UCSC 4DR1B 5BMVA 3ABLB 3WB0A 3FYIB 2GTAA 4JZGA 1JQ0A 1YJWV 2Z0AA 3CXHF 4MTXA 4WFGA 3UO3A 1S76D 1HP8A 2YIBA 1AI4A 5JJJB 3K58A 3HR0A 4D6TH 2Y4TA 1I7FA 2MK3A 2QGNA 2AW9A 1NJIW 2WAMA 2P67A 5CBFA 5BZBA 1RPOA 4K0KO 4JAAA 3E8HA 2AGAA 3STZC 5FNVA 2YUAA 1H2LA 4UB8Z 3SJBC 3OTOO 1V55B 3H1IH 4RQFA 2Q69A 3TJTA 1GAXA 3ASOB 3P3NA 1B06A 1MNGA 4RWUA 4KXRA 4QGPA 4I9WA 4TQFA 4DYLA 3ZHTA 5LP6C 4LF7O 2QSAA 5DECA 3H1LH 3CCSV 3RYIB 2UXCB 1V9PA 4XDKA 1COWG 1K33A 2EIMC 3FAVB 5FPRA 1OCOC 2DJVA 3U10A 1BQ0A 2Y69B 1I08A 2F23A 3HKCA 4IYIA 4U3JB 2DN9A 4DR7B 2Q4PA 2ZQMA 3D8CA 4LC1A 2QDOA 4MW8A 3B2EE 2IBZH 3IGAC 3RW0A 1V54C 4O2BA 1EM1A 4JYBA 5DM6V 1N4CA 2HVKC 3OR6C 5KUKA 4UXNA 4DRXB 3ZMVA 4DR7O 4YJ2B 3GVMA 5D5PA 1HNWB 5JJNB 2F1MA 3ZIAG 1H8EG 2ZD9A 2GUZB 1S72V 2ZNIA 5IYCO 1NS1A 3X2QB 2GV9A 1FD9A 3LDCA 2EIKC 3CPWU 2XAGA 3TETA 4NB5A 4DV4O 4X20A 1Z2GA 4DV2O 3T1CA 2DE0X 5L3DA 2UUAO 2QTOA 2HKOA 5J2UB 3OUSA 1EN5A 2WA4A 1KD1W 1ZWIC 1SC5B 1Q3EA 1F51A 3E35A 2WWWA 2RN9A 5IYZB 4MTGA 2PYLA 5LYJB 4X1KB 4R7CA 2M7WA 2EZPA 5LGTA 2Y0IA 1KKCA 1AILA 2WLJA 2ZE8A 1NT2B 2UU9O 2EBOA 1G8MA 2JDIG 3JALB 3TXSA 1MG1A 4TV9B 1Z5VA 5IYZA 4NXMB 2AHZA 2EIMB 3FB5C 1PD3A 2Q9LA 3U11A 2QWNB 1VQ9V 3H9VA 4GX0A 4H13B 1OJHA 1NKDA 3ZMZA 3IC9A 2IH3C 3P32A 1AJQA 2DOSA 2OWOA 1TA8A 5LBQA 1OCCB 1K4CC 4TV8A 5BR8B 4JI5B 2YI9A 4JI7O 1RSOB 3M99B 2HR3A 1K9MW 4B3TB 4DR6B 2E3CA 4TUYA 2HHHB 4WF9V 5CMUA 4ZOLA 1JFFA 4GUNA 5KHJA 3AK2A 4AHCA 4X9QA 2EJRA 1IBMB 3J7AU 3DTUB 4UV8A 5FLXN 2JGUA 3CRRA 3WG7B 3W7SA 1JJ2U 1YTFD 4FIPC 2IJKA 4FFKA 3QO7A 2ARHA 4JI1B 3L73H 1D2DA 2Q0OC 3G6EV 3ABKB 1SRYA 3WFVA 1P4RA 3EXAA 1BL8A 3HKBA 1DF4A 1US6A 4I4TA 1ZSPA 1SQQH 1BGYH 3G71V 4MS2A 4F4LA 5LHIA 1NVPB 1BHBA 3ASOC 4R8CA 5CA1A 5EBLC 1PP9H 1XNQB 2JJ1G 3TGUH 4O4IA 1XMOB 3DXRA 4CBCA 4B7EA 1U96A 5EK0A 3CC2V 4DR4B 4HBNA 3ZRSA 4RUFA 2ZE5A 1QHTA 1VIBA 5BR8O 1R3LC 4LCUC 4ZOLB 4FM1A 1ZUQA 5GW7A 1KP3A 2M6YA 2P6JA 2Z3YA 5KHKA 5KHGA 4X20B 1BS3A 4BWAA 1N36B 5KX5A 3JD3A 1GN6A 1TUEB 5D5QA 1GKFA 3SYOA 3ZS8C 2H94A 3C90A 4WBNA 3L70H 4CC5A 1YJNV 1R3IC 4K8XA 1NTKH 3FX7A 1KMIZ 2NNUA 4J9YB 4DR3O 1YI2V 2E74B 2JS5A 2XNDG 5IJ0A 3JALA 2P22C 1RPRA 2P06A 1ZAUA 3BEHA 3IC7A 3VQXA 1EZVH 3JYCA 3SR2C 4P2ZA 3OMAB 3JCZA 4MSWC 2OYQA 4MT8A 4BIUA 2WLLB 3LUTB 3RVZA 1CPYA 2WLNA 1OCRC 4J11A 3FKSG 5EZYB 3L74H 4B3RB 5J9PC 2UXBB 2EILC 4JAUA 2MW2B 4GCZA 2ZM6B 3LSQA 1KC8W 1XMQB 4LP8A 3E22A 2B9ZA 1GRJA 3SYCA 1EN6A 2CDYA 2O57A 4DV3B 1XL4A 1K8AW 4EFBA 4JI2B 2E76B 1S5JA 5JH7A 1E1RG 5LMNB 3CE2A 3BABA 4IHJA 1MSWD 4BW5A 3N2KB 3K5LA 3ZMSA 4I55B 1SQGA 1L0NH 1RP3B 3JSLA 2PI5A 4H33A 4ZI7B 3LDDA 4FLVA 4U3JA 2RQ6A 3E86A 4HYOA 4DK1A 1TAEA 5K1PA 2UXDB 3A8TA 1EZJA 2YXLA 5K1XA 4CH3A 3JASA 2CTRA 1E1QG 3ICXA 3VQYA 1DLBA 4WCEV 2OT5A 1J95A 2LW7A 2WA3A 3ABKC 3PN1A 5CA0B 2PI4A 4O4JA 4O2AB 2ZDIA 1YIJV 4MTFA 2YDEA 2A79B 2NLJC 1D5NA 3GWOA 4FLUA 5A2QN 1ZX3A 2ZM6O 5B1OA 3JARA 3OFNG 4GX1A 5LHGA 4W4KA 4JI6O 1GMGA 1XMQO 2FYUH 3I55V 4GZRB 3ZJZA 4LWSB 2AZ0A 2EZOA 1HNZB 4WFHA 1XDCA 4DV1B 1Q8IA 1JA8A 5IYDO 1K34A 4NTYA 1L8DA 2GHYA 4JV5O 4DV0B 1V54B 5BMVB 3VQVA 3MHSC 1Y6XA 4J10A 1HNWO 5EIBC 4J41A 2AHYA 2PUSA 4CS3A 1DK1A 2WLMA 5B1AB 4G28B 1FKAO 3T1HO 4LF8B 3ZRWB 1JR9A 2PYJA 4OX9O 4YJ3A 2QM8A 5IJ9B 1PNMA 4RUEA 4H37A 3ZEDA 5BY1A 1IBLO 2BCCH 1WP8A 4HAMA 2VQEB 5LGNA 3AG7A 4DV5O 1SQFA 2YC0A 3DSQA 4ZI7A 2ETNA 3ABUA 2LGQA 5B3SC 1XOUA 1J5EB 2YIAA 1I0HA 4LFBB 2B1GA 1AB3A 3A0BZ 4DO2A 1HWYA 3CCMV 2HP8A 3ZN0A 5DEDA 4ICGA 1YDXA 2FB5A 4QNHB 4DR2O 1M1KW 5C8YB 1WB8A 1SQPH 4DV6O 4DV1O 4QPJA 4TUYB 5TISZ 2W0XA 4O4JB 4E4EA 2IJIA 3J80N 1SETA 4D7TA 3ASNB 3RYCB 3CCVV 3CX5F 2CTPA 4JZ2A 1SA0A 3K57A 2B5UA 3SYPA 3W7XA 4JYAB 2R70A 1O9GA 3I56V 1Y76B 3ZRXA 1H2SB 2QM4A 4PDLA 1FFTB 4YIOA 4NTXA 1GN3A 4NVPA 1DF5A 1PPJH 2F93B 5GTHZ 4OGQB 2PZSA 4X1IA 5CN0A 4DR1O 2NN4A 4CC6A 5KLVH 2BTQB 1UFIA 1WA8B 3RFRA 1GO3F 4DV4B 2YXYA 1IXBA 1OCZB 3ZBHA 4Q6GA 3N2KA 2HHHO 4I9QA 1OV9A 5KA5A 4J7ZA 1Q7YW 3IJ4A 2QE7G 2G38A 3MAQA 1JFFB 5J2UA 5KHIA 4LF4B 3CJHB 4I7ZB 1CEZA 4JI5O 2V4DA 1T5EA 1JVMA 3AEIA 3L9DA 4UCUA 1GM8A 4LF5B 1WP7A 4P9OA 3OM3B 5LMNO 5GTIZ 2LO1A 4JI1O 2ZKOA 1TUBB 1VF6C 4TT3G 1FXKA 4MTOA 3SYQA 3L72H 2XUMA 2Q7HA 2OCCC 1IZ3A 1OHHG 4TWKA 4I50A 1XREA 3HKDB 1K5SA 1S77D 1TVKB 3BA9A 4JI8O 2Y48A 4X1YB 4PDMA 4PA3A 1VEWA 1Q82W 4LF6O 1ENVA 2X0LA 3QF7A 1NR1A 1QLNA 3THOA 2DYRC 3MDSA 4JI0O 4X1YA 1BQZA 1G6UA 5JVDA 2FKXA 1Q90D 1XNQO 2LGWA 2LFSA 4DUYO 3UKMA 2EULA 3K0GA 3QNEA 3A0RA 1GTOA 4MVUA 4C7UA 1YF2A 2CGNA 4IT5A 4FJCC 1Y66A 3FYEB 3FAVA 1XMOO 5HFMA 4X65O 5KX5B 3T1YB 2A3QA 1F4MA 2RDCA 1SA0B 1PNLA 4JI6B 3DGEA 4X66O 1H2NA 2P4VA 4QIWF 3ETGA 3H1JH 4LF5O 2EIJB 2GUZA 3MD0A 1N33O 5GONA 1YITV 1VQ8V 2QWOB 3CRQA 1N0JA 4X64B 1U97A 3GWKC 4JTDB 3APQA 1SZTA 2DWDC 1S5LZ 5A9GA 1RSOA 5AG2A 3BRCA 5EBWC 4DR6O 2HJDA 1GM7A 3FFQA 1VQ6V 1NTMH 4OPHA 2RMKB 5B1AC 1ORQC 2CK3G 4JTCB 3AG4C 4U7NA 3JAKB 2UXDO 4HNAB 4NKGB 1WB7A 4X62O 3ML0A 4I0XA 2R9AA 4DK0A 3JAKA 3OAAG 3OMIB 3AG1B 4LF6B 1S3JA 4PV1B 1S5HC 3ETQA 1QR9A 2QWPB 4LNUA 3BAAA 2JS3A 2HEPA 4IGGA 1VQ5V 4B7KA 4R6ZA 5JCOA 1K5QA 3QG5A 2ZNJA 5L3GA 2X6BA 1TVKA 3FB8C 2JIZG 1AP6A 1M57B 1RM1C 1AI6A 1TUBA 2ADPA 5FNVB 5JJEB 2YS8A 4B3SB 3JCUZ 1HDJA 3U0ZA 4ZHQA 1BCCH 2A0LA 1LUVA 4DR2B 3CC7V 1IURA 3RWRD 4HZ3A 3BY6A 5B1BB 3BPZA 4MVMA 2L35A 3SPJA 4NYKA 5LHHA 4BR6A 4H44B 5LMUB 3QVNA 2YICA 5B1BC 2HFEC 5KAFZ 3E2EA 4FZ0A 4I0XB 1WN7A 5CA3A 2EILB 3ZMTA 4ZKIA 4LF7B 4P30A 5JVDB 1RFYA 4K8ZA 1P7BA 2Y69C 1VMGA 1VF6A 4PDVA 1N8RW 3P3PA 2IU3A 1P49A 2JEUA 3E8GA 1WAZA 3K04A 1FAFA 2IJHA 2Q5ZA 3TCUA 3Q4HA 3ZHRA 2KG7A 2VWKA 4I5SA 4GT1A 2A7WA 3WG7C 2E5LO 3OD4A 3CB2A 3LNMB 2KKWA 3RYHB 3JAWA 1FYJA 4BAYA 1QLEB 2PGGA 2XHBA 4KP4A 4QJFB 5LXTB 3D36C 3AK3A 1IXMA 4QE9A 4LFCB 1G1XB 5GONB 1N36O 1P7GA 1L1FA 2RJZA 4AILC 3ABMC 4X88A 5IWAO 4UVAA 3ETDA 4YY3O 1VQMV 2UUAB 4JI3B 4YY3B 3CMEV 1QR8A 3CRAA 3T4ZA 5CB4A 4FK5C 2QKSA 1VP7A 3NXSA 2JGDA 3JATA 2V7QG 1JJOA 3Q4HB 3AG2B 1VQNV 3ZN1A 2QA4V 2H3OA 1SERA 2IM9A 3IAYA 2UU9B 1KBHA 2AXTZ 2N74A 5IT9N 2Y0PA 5LXTA 2IJJA 3UO2A 2UXNA 3JAMN 1B04A 3JAWB 1IDSA 1Y76A 2BTOA 1LR1A 5ITZB 4G2KA 1XQ8A 2XAJA 2WLLA 2BSKA 4LF4O 3VOUA 3AK1A 2WLHA 3QTCA 5JQGB 4DXWA 2DW4A 2IH1C 2BOCC 2CH7A 1UPGA 1W0JG 5B5EZ 2P7TC 4DV0O 2ZE6A 3CHXA 3G6BA 3GB7C 4GX5A 3A0HZ 2LQTA 3P30A 1BT8A 5FL7G 4KFMA 1P84F 3HKEA 1SS3A 4WBNB 1QVGU 2OIGA 3E22B 5KMGA 4CH6A 1I94B 1R73A 5B3SB 4PHZA 3UT5B 1HR0B 4X1IB 2LFRA 4RQEA 3CEIA 4DW0A 4ZHQB 3N27A 2CTQA 4MVRA 1FPOA 2IW5A 3K5OA 4O4HB 1YSCA 2EIKB 2EINC 5IY5C 2P5OA 2CH7B 1QQCA 2VRZA 5JQGA 3LSSA 2XAHA 4NXNB 2DYSB 2BE3A 2DYRB 2QTSA 1WLEA 5KAIZ 1W0KG 2F4VO 2A9HA 5CBGA 3WB2A 3K06A 4X89A 5CBHA 5IY5B 5LOVB 2YEVA 3D36A 3ZMUA 4CH5A 3AG3B 2D2CB 3G80A 4UCSA 4JI8B 4Z1VA 1M56C 4O4LA 2CGOA 3ABMB 3OTOB 2F66C 3B8MA 1N32B 1CXZB 4D7SA 4KUMA 3UT5A 4GKKB 3CP1A 1X4TA 2F43G 5KHHA 1Q81W 5KMGB 2CE4A 2JJ2G 3CCEV 3JATB 1KKDA 1SQBH 4XDLA 1F7YA 4UB6Z 2Y4UA 4GKKO 3MHHC 1YVWA 2PF4E 2ZR3A 1FJGB 1O9HA 1NTZH 1N34O 1FS0G 5EIBD 4K35A 1PV0A 1PL0A 4Z1MG 2ZCEA 2H8PC 3VBBA 1FFXB 1KP2A 1PM9A 1XHXA 1JX9A 1K92A 4NR1A 4RO2A 4TV8B 5J2TA 3I5DA 4EFEA 1GN2A 4I4TB 1Q86W 2VS0A 3FB7C 1R3JC 4EB6A 3O9OA 4UCOA 3JASB 4IL6Z 3LNNA 2OTJV 1YZBA 4TSFG 5EZYA 2QWRB 1QNMA 2R9RB 4EB6B 1XHZA 1CP9A 5DN6G 4TV9A 4WFEA 1XILA 1K7DA 2ITDC 2DYSC 4PI0A 4PELA 1AROP 1BSMA 1XUQA 3OGIB 1IBKO 4PJ0Z 1M57C 3CCUV 2AZ2A 1QU7A 1IBKB 1I94O 4XDJA 2RNBA 2Q7GA 2YSUB 1MSDA 3DC6A 3RT3C 2XAFA 1SF9A 4IIJB 3RN4A 1FXKB 1GN4A 2GDSA 2CTWA 2DQ3A 1NH2D 3FD9A 4CS4A 2ITCC 4JYYA 2Q73A 5FPOA 1H38A 1AI7A 1WA8A 2ATKC 2UXCO 3RBZA 5E79Z 4H0LB 2UUCO 2N04A 3K5MA 2QJ1A 2B1IA 3S3WA 2HVJC 1LUWA 1VQOV 3F5WC 1VARA 5LGUA 4YHHO 4W4LA 2VWJA 1EN4A 1JCHA 1N34B 3CRMA 1SQVH 4P9PA 2RCVA 1Z5WA 3OR7C 3DXRB 1AR1B 4O2BB 3CS5A 3UM7A 4ZBMA 1EFRG
chains in the Genus database with same CATH topology
2JK5C 4GX2A 2P90A 2R9IA 5EBWC 1F23A 1GM7A 1NH2B 1R6NA 3JD3A 2EIJC 2X7RB 1R6KA 1VQ6V 1AI5A 1TUEB 3QO5A 1GKFA 5B1AC 1ORQC 2CK3G 3SYOA 4JTCB 2H94A 3AG4C 4N23A 4U7NA 3OGCC 4PA6A 1YJNV 2X6AA 4R50A 1R3IC 1M56B 3CXCU 3ML0A 5IYBO 4JF3A 5H6QA 1KQSU 2NNUA 4J9YB 3CCQV 1YI2V 3OAAG 3OMIB 3AG1B 2XNDG 1F4NA 1YHQV 3JD4A 1VQ4V 1S3JA 3RVYA 1OZ0A 1RPRA 1S5HC 3BEHA 3IC7A 1QR9A 1BHAA 3JYCA 2WLIB 4P2ZA 3OMAB 3JCZA 4MSWC 2WLKA 4MT8A 4BIUA 4FMTA 1VQ5V 4R6ZA 2WLLB 5C93A 3E8BA 1K5QA 5L3GA 2KB1A 3LUTB 2X6BA 1CPYA 2Z5UA 3RVZA 2WLNA 3CYOA 1OCRC 3STLC 3FB8C 3OW2U 2JIZG 3CD6V 2X6CA 1RM1B 3FKSG 3JD2A 4JYCA 4JPRA 3B77A 1M57B 4OXSA 1RM1C 1PKXA 1AI6A 3F7YC 2XASA 5KA6A 2Q67A 5J9PC 3ZCCA 1H8HG 1AJNA 2EILC 1I5YA 4BIZA 3OE7G 3SPHA 2A0LA 2OCCB 1NVPD 4JAUA 1EBOA 4GCZA 3CC7V 3JD1A 2ZR2A 3LSQA 4J9ZB 1QBZA 1KC8W 2ZDIC 4LP8A 3SYCA 4HZ3A 3BY6A 3SYAA 1XL4A 5B1BB 1K8AW 4MVMA 3CCRV 1MABG 4QE7A 3CCJV 3FB6C 1E1RG 3SPJA 5LHHA 4MVZA 1THZA 1YTFB 5B1BC 2HFEC 3E2EA 2W6IG 1OCOB 5KUMA 2HG5C 5CA3A 3AG4B 2EILB 3ZMTA 1MSWD 4Q20A 1JOYA 4BW5A 4ZKIA 4P30A 5EC2C 3AG2C 3ZMSA 1P7BA 5EBMC 1WPXA 2Y69C 1FXKC 2QM7A 4PDVA 1N8RW 2IU3A 1BMFG 2JEUA 3K04A 3E8GA 2PI5A 2IJHA 4CZZA 3TK1A 4H33A 4EKWA 1DTOA 3TCUA 1M9NA 3LDDA 4UVCA 4I5SA 4GT1A 1SESA 3E86A 1M90W 4HYOA 3WG7C 2C2AA 2HJFC 3LNMB 2ZXWB 3ABLC 2LP7A 3CCLV 1EZJA 4MVQA 1V55C 1KECA 2OTLV 1VQPV 4ASUG 4BAYA 1QLEB 1NR7A 1QVFU 4KP4A 1E1QG 4QJFB 1DLBA 4WCEV 1IXMA 4QE9A 2OT5A 3R65A 1J95A 1L1FA 2DWEC 4U7OA 3ABMC 3T2MA 3ABKC 3CMAV 3AG1C 4JAVA 4JTAB 4X88A 3HB3B 2PI4A 3H01A 1H2GA 3B8NA 2ZDIA 4UVAA 4MVOA 3SPIA 1YIJV 1S0VA 4MTFA 1AJPA 1FXVA 3ETDA 1VQMV 2A79B 2NLJC 2BOBC 3GWOA 3K03A 4UV9A 3CMEV 5B1OA 1QR8A 3ABLB 3T4ZA 4LBEC 3OFNG 4GX1A 4FK5C 1K4DC 2QKSA 3EHBB 5LHGA 3FYIB 3IFXA 3NXSA 1GMGA 2V7QG 3CC4V 1PNKA 1JQ0A 3I55V 1YJWV 3ZJZA 4MTXA 4WFGA 3AG2B 1VQNV 3ZN1A 1GK9A 3ETEA 2DQ0A 2QA4V 1S76D 1AI4A 3KG2A 3OEHG 2EZOA 1SERA 4WFHA 2MK3A 1E79G 1NJIW 2WAMA 5IYDO 2P67A 5CBFA 5IDJA 2W6JG 5BZBA 1RPOA 1K34A 3E8HA 2GHYA 3SPCA 2IJJA 3STZC 1NBMG 1V54B 2V1DA 2W0FC 2UXNA 3MHSC 1V55B 4RQFA 2Q69A 3F7VC 3ASOB 4G2KA 3K9AA 2AHYA 3LDEA 2XAJA 2WLLA 4I9WA 3AG3C 2WLMA 5B1AB 3PJSK 4G28B 3VOUA 5L3BA 2WLHA 3QO8A 3ZRWB 4DXWA 2DW4A 2IH1C 4FPPA 3CCSV 2BOCC 3T4DA 1W0JG 2P7TC 4PDRA 2QM8A 4XDKA 3W7UA 1COWG 1K33A 1VQKV 3GB7C 4GX5A 1PNMA 4RUEA 2XOKG 5B1NA 4H37A 2EIMC 2UXXA 3P30A 3W7WA 1QCEA 5FL7G 1OCOC 3ABTA 2Y69B 4KFMA 1OCRB 4HAMA 4JASA 5LGNA 2EINB 1QVGU 4WFFA 2ZQMA 4LC1A 3W7TA 3HPLC 1K73W 3ABUA 5HFLA 5B3SC 3ZRVA 3SJQC 4MW8A 1NQTA 1R73A 5B3SB 2B1GA 3IGAC 3OEEG 3RW0A 1V54C 1HWYA 3D3IA 3E89A 4DO2A 4JYBA 5DM6V 2LFRA 4RQEA 3CCMV 2WSSG 3ZN0A 2HVKC 4PA4A 4MVRA 3OR6C 4QNHB 5KUKA 1M1KW 2IW5A 4UXNA 1YSCA 1MOFA 1OCCC 2EIKB 3ZMVA 2XAQA 2K1EA 2EINC 5IY5C 1B6QA 3K0DA 4QPJA 3ZIAG 1H8EG 2ZD9A 3ZRWA 1S72V 3LSSA 2XAHA 5IYCO 2DYSB 4N21A 2IJIA 3X2QB 1SETA 2DYRB 3ASNB 3LDCA 3CCVV 2EIKC 1WLEA 1W0KG 4L87A 2A9HA 2XAGA 5CBGA 3CPWU 3TETA 2B5UA 3K06A 4X89A 3SYPA 3W7XA 5CBHA 5IY5B 2YEVA 3I56V 3T1CA 1GM9A 3ZRXA 5L3DA 3D36A 2QTOA 2HKOA 5H9CA 3ZMUA 3SPGA 3AG3B 3OUSA 4PDLA 2QEXV 1FFTB 1KD1W 4PA7A 1DF5A 1ZWIC 1M56C 1F51A 3E35A 3EFFK 4RAIA 2WWWA 3ABMB 4MTGA 3B8MA 4WFBV 5CN0A 4R7CA 2M7WA 2EZPA 5EC1C 4KUMA 5LGTA 3CP1A 2WLIA 2JEXA 2WLJA 2F43G 4E2LA 1Q81W 1JPXA 1GO3F 2JJ2G 1OCZB 2EBOA 3CCEV 1G8MA 2JDIG 1KKDA 1MG1A 4XDLA 5E1AC 5KA5A 2AHZA 2EIMB 3FB5C 1PD3A 3MHHC 1VQ9V 2ZR3A 1Q7YW 4GX0A 4XBFA 4X8AA 1LNQA 2QE7G 4G27B 2Q68A 1NKDA 4QPKA 3ZMZA 3K79A 1OCZC 2IH3C 3P32A 3X2QC 1W2BU 1AJQA 4PA9A 1CEZA 2YEVB 1FS0G 5LBQA 5L3CA 1OCCB 1K4CC 1JVMA 1PL0A 3AEIA 4Z1MG 1GM8A 2H8PC 3E83A 3M99B 4P9OA 3VBBA 4MW3A 2HR3A 1KP2A 3OM3B 1JX9A 1K92A 4RO2A 1K9MW 1K3EA 1Q86W 3FB7C 1R3JC 1G4YB 4WF9V 5CMUA 4TT3G 1FXKA 2OTJV 4MTOA 4TSFG 4YXWG 3SYQA 2OCCC 2R9RB 1OHHG 4TWKA 1CP9A 1K5SA 5DN6G 1S77D 2EJRA 2Q6AA 4WFEA 3DTUB 4UV8A 1K7DA 2Y48A 2ITDC 1VQLV 1FXHA 4PDMA 4PA3A 2DYSC 1Q82W 4PELA 1I5XA 1AROP 1ENVA 2X0LA 1NR1A 1QLNA 3WG7B 2GSMB 2DYRC 3W7SA 1M57C 3CCUV 1JJ2U 1YTFD 5L3EA 4FIPC 4XDJA 2IJKA 4MVSA 2YSUB 2LFSA 3UKMA 3K0GA 3QO7A 2XAFA 3QNEA 3A0RA 1GTOA 3JD0A 4MVUA 4FJCC 1Y66A 3FYEB 1YJ9V 1FXKB 3G6EV 3ABKB 1SRYA 3WFVA 5HFMA 1P4RA 1BL8A 1DF4A 2DQ3A 1NH2D 2ITCC 5L3FA 3G71V 4MS2A 1H38A 4F4LA 5LHIA 1NVPB 1F4MA 1BHBA 3ASOC 4UUJC 1AI7A 1PNLA 4R8CA 2ATKC 5EBLC 3OMNB 2WPDG 1QLEC 1ROPA 2HLDG 2JJ1G 3RBZA 1Y4MA 3DGEA 3K3WA 1R3KC 4QIWF 3ETGA 2ZXWC 4CBCA 1K97A 2B1IA 2EIJB 5EK0A 4JGSA 3CC2V 2HVJC 1VQOV 1VQ7V 3MD0A 3ZRSA 4RUFA 1UJWB 1XL6A 3F5WC 1YITV 5LGUA 2D3OW 1VQ8V 1R3LC 3OUFA 4LCUC 1JCHA 5GW7A 5H6RA 3G4SV 4P9PA 3ASNC 3E8FA 1KP3A 4JTDB 2P6JA 2Z3YA 3OR7C 1SZTA 4UVBA 2IU0A 2FTKA 2DWDC 1AR1B 3K08A 4WFAV 3UM7A 4ZBMA 1EFRG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7W A;  2EZP A;  5KA6 A;  3CP1 A;  3P30 A;  1QCE A;  1F23 A;  3H01 A;  4G2K A;  4JGS A;  3B8N A;  4E2L A;  3K9A A;  1JPX A;  1I5Y A;  2X7R B;  1QR9 A;  2EZO A;  1Y66 A;  4FJC C;  2LP7 A;  1MOF A;  2EBO A;  1EBO A;  3WFV A;  3M99 B;  5H9C A;  2MK3 A;  4N23 A;  5HFM A;  3GWO A;  1QBZ A;  1MG1 A;  1DF4 A;  5CMU A;  1DLB A;  1QR8 A;  5KA5 A;  2P6J A;  1I5X A;  1ENV A;  1K34 A;  1K33 A;  3CYO A;  3MHH C;  5HFL A;  1DF5 A;  2OT5 A;  4FK5 C;  1SZT A;  4JF3 A;  3B8M A;  3MHS C;  4N21 A;  4JPR A;  3B77 A;  5CN0 A;  4FIP C;  1Y4M A;  1JQ0 A; 
#chains in the Genus database with same CATH topology
 3KZI Z;  4GX2 A;  2P90 A;  2R9I A;  4FZ1 A;  4LNU B;  2VQE O;  1F23 A;  2EIJ C;  2X7R B;  3QO5 A;  3EVK A;  4LF8 O;  3G67 A;  4N23 A;  4PD4 F;  3A2F A;  3APO A;  4PA6 A;  4YIP A;  4PI2 A;  2X6A A;  3M7M X;  3VQW A;  3J81 N;  4R50 A;  1M56 B;  1N33 B;  3CXC U;  5LA6 A;  1KB9 F;  2NR5 A;  4JF3 A;  5H6Q A;  4DV3 O;  1IX9 A;  2YI8 A;  3CCQ V;  3B4S A;  3ZX6 A;  4CH4 A;  1YCI A;  1L0L H;  3RVY A;  3RYI A;  3N2G A;  2WLI B;  4DR4 O;  2WLK A;  4FFB A;  4F6R B;  1SKV A;  2Q7E A;  5H5N A;  4FM0 A;  3H1H H;  4O4L B;  3CYO A;  3SJC C;  3STL C;  2QKC A;  5LMU O;  3OW2 U;  2X6C A;  1RM1 B;  2LJ2 A;  3JD2 A;  2JRI A;  4JPR A;  3B77 A;  1PKX A;  3OT7 A;  4LFC O;  2XAS A;  4FLX A;  5JWP A;  2Q67 A;  3ZCC A;  4LFB O;  4BIZ A;  2OCC B;  3L71 H;  4DR5 B;  3JD1 A;  4OX9 B;  1QBZ A;  1WJZ A;  1Y74 B;  4AQY B;  3SYA A;  3S3X A;  4AI8 A;  1IBL B;  3T1H B;  3SJA C;  3CCR V;  3CCJ V;  3FB6 C;  1XBL A;  1THZ A;  4JYA O;  1YTF B;  4X65 B;  2HG5 C;  2QKA A;  3RGB A;  3AG4 B;  4Q20 A;  2YXH A;  4J7J A;  2QM7 A;  1BMF G;  3F5T A;  4EKW A;  2CAZ C;  4LWS A;  4UVC A;  2ZE7 A;  4ZIB A;  1SES A;  1J5E O;  3TXQ A;  4J80 A;  2ZXW B;  3DC5 A;  3M8A A;  3CCL V;  1IVS A;  4MVQ A;  2ZT9 B;  2OTL V;  3K59 A;  4ASU G;  1NR7 A;  4GLX A;  2JVD A;  2YID A;  2DWE C;  3BFR A;  2R72 A;  3T2M A;  3AG1 C;  5H2F Z;  4UCR A;  3H01 A;  1H2G A;  3B8N A;  2XT9 A;  1HNX O;  4MVO A;  1S0V A;  1AJP A;  2BOB C;  3LSU A;  4UV9 A;  4JI4 O;  4LBE C;  5LA6 B;  1K4D C;  1XEQ A;  3EHB B;  1VF7 A;  2F95 B;  1MZF A;  3IFX A;  4KHP B;  4HNA A;  4LH6 A;  3CC4 V;  1PNK A;  2FL4 A;  4X62 B;  2FML A;  3OTF A;  1GK9 A;  3ETE A;  2DQ0 A;  3UQ8 A;  4LR3 A;  1B3Q A;  3KG2 A;  3OEH G;  4J7K A;  2UUC B;  1SQX H;  1E79 G;  1YXB A;  5IWA B;  3HKC B;  4FLW A;  1R1B A;  2DMX A;  2JGD B;  5IDJ A;  2W6J G;  4BW9 A;  2L6L A;  3KCY A;  3SPC A;  1NBM G;  2V1D A;  2W0F C;  2VQF B;  1W59 A;  5F2V O;  2KSD A;  4DW1 A;  3F7V C;  1HW7 A;  4GKJ O;  3K9A A;  1PL4 A;  3LDE A;  3ZHV A;  4K3A A;  4DV7 O;  2YIB D;  3AG3 C;  3PJS K;  5L3B A;  4JI2 O;  5LP6 A;  3QO8 A;  3WU2 Z;  4FPP A;  1Q5O A;  4AQY O;  2PY5 A;  3T4D A;  4PDR A;  1MMM A;  3W7U A;  1VQK V;  4K0K B;  4IHJ B;  4EEQ A;  3K5N A;  2XOK G;  5B1N A;  3CSX A;  2UXX A;  3W7W A;  1ZLZ A;  1HNX B;  1QCE A;  4B3M O;  3ABT A;  1OCR B;  2ODM A;  3K9S A;  4JAS A;  2QR4 A;  2EIN B;  2KG7 B;  4WFF A;  3W7T A;  4YHH B;  1N0N A;  4KL1 A;  3HPL C;  1K73 W;  5HFL A;  3ZRV A;  3SJQ C;  1NQT A;  2BTQ A;  4Z2W A;  3OEE G;  3D3I A;  3E89 A;  4X1K A;  5LYJ A;  1AVM A;  2WSS G;  3SGI A;  4PA4 A;  1Q6I A;  3L75 H;  4FVM A;  1MOF A;  1OCC C;  2XAQ A;  1Q43 A;  2F4V B;  2K1E A;  1M4U A;  5LL6 Y;  4DR3 B;  1B6Q A;  3K0D A;  1AR5 A;  3BCC H;  3ZRW A;  2GBO A;  4NXM O;  5J2T B;  1Y74 A;  4N21 A;  3C3T A;  4UFZ A;  5BXZ A;  1ZL8 B;  4L87 A;  4CS2 A;  4UCT A;  2XTA A;  1GM9 A;  2E5L B;  5IJ0 B;  5H9C A;  4DV7 B;  4TOI A;  1H2M A;  3SPG A;  2QEX V;  4YJ2 A;  4IIJ A;  1XNR O;  2UUB B;  2LW1 A;  4PA7 A;  1Q6H A;  4RAI A;  3EFF K;  4LH7 A;  4WFB V;  2Q0A A;  1BZK A;  4JI3 O;  2ZIO A;  4O4I B;  5EC1 C;  2WLI A;  1IBM O;  5CA1 B;  2JEX A;  4E2L A;  1JPX A;  4LF9 B;  4DV6 B;  4J42 A;  2P4K A;  5E1A C;  1SZX A;  4FLZ A;  1NU1 H;  4XBF A;  3BVO A;  3B40 A;  4X8A A;  1LNQ A;  4G27 B;  2Q68 A;  4QPK A;  3NR7 A;  3K79 A;  1OCZ C;  1W2B U;  3X2Q C;  4O2A A;  4GYC B;  2YEV B;  4PA9 A;  5L3C A;  3C3S A;  4U3F H;  3E83 A;  3RYC A;  3D3Q A;  2ZIM A;  3CRC A;  5B66 Z;  4MW3 A;  1K3E A;  2A06 H;  3RYF B;  3HKD A;  4I50 B;  3T1Y O;  1G4Y B;  4FM2 A;  4YXW G;  4IYH A;  4LFA O;  2Q6A A;  4F6R A;  4FFB B;  1VQL V;  1FXH A;  2CUG A;  1N32 O;  4F6E A;  3N2G B;  2EX3 A;  1I5X A;  4DV2 B;  2GSM B;  1R6T A;  3CJH A;  5L3E A;  4MVS A;  1ZTE A;  3JD0 A;  3WB1 A;  1YJ9 V;  3BHP A;  4LF9 O;  1WPB A;  3RYF A;  2GTS A;  5L3F A;  1AP5 A;  4UCV A;  1AR4 A;  4UUJ C;  3OMN B;  2WPD G;  1QLE C;  1ROP A;  2HLD G;  5CA0 A;  1Y4M A;  4KHP O;  3K3W A;  1R3K C;  5JCO C;  2ZXW C;  1K97 A;  1X59 A;  4JGS A;  1VQ7 V;  2OIE A;  4A5U B;  1BE3 H;  1UJW B;  1XL6 A;  4DR5 O;  1GH6 A;  2D3O W;  3OUF A;  5H6R A;  1KU9 A;  4O4H A;  3G4S V;  3ASN C;  3E8F A;  2UXB O;  4X66 B;  4UVB A;  2IU0 A;  2VQF O;  2ZIN A;  2FTK A;  1FFX A;  3K08 A;  4WFA V;  2JK5 C;  2N05 A;  3BA8 A;  4B3T O;  1NH2 B;  3ZHS A;  1R6N A;  1R6K A;  1AI5 A;  4FLT A;  1M93 A;  3OGC C;  3ZHQ A;  1M5I A;  5C8Y A;  1NZ6 A;  2ILM A;  5EYP A;  5IYB O;  3SDL A;  1KQS U;  1F4N A;  4X64 O;  1YHQ V;  5JH7 B;  3JD4 A;  1VQ4 V;  1FJG O;  1OZ0 A;  4NXN O;  1NI8 A;  1BHA A;  1ZL8 A;  1JMK C;  2PTM A;  2K9P A;  3KCX A;  1Q6U A;  4FMT A;  2BSK B;  5C93 A;  3E8B A;  4B3M B;  2KB1 A;  2Z5U A;  3CD6 V;  1YEW A;  2Q8V A;  4JYC A;  4OXS A;  5IJ9 A;  1HR0 O;  4DRX A;  3F7Y C;  1DGS A;  5KA6 A;  3O65 A;  2OCH A;  3RYH A;  1H8H G;  1AJN A;  5LOV A;  2KQX A;  1I5Y A;  3OE7 G;  3SPH A;  1NVP D;  1KYO F;  1EBO A;  4TQD A;  2ZR2 A;  4J9Z B;  2ZDI C;  4GKJ B;  2EJ7 A;  4JI0 B;  4I55 A;  3CWB H;  1MAB G;  4QE7 A;  4L8J A;  4MVZ A;  4DV5 B;  2W6I G;  1OCO B;  1Y67 A;  5CB4 B;  5KUM A;  5EYP B;  3JSN A;  1XI1 A;  4B3S O;  4LFA B;  3R66 A;  1JOY A;  1H2K A;  1HNZ O;  5EC2 C;  3AG2 C;  5EBM C;  1WPX A;  1FXK C;  2QWQ B;  4ABM A;  1MZE A;  4CZZ A;  3TK1 A;  5LP6 B;  1DTO A;  4BIO A;  1M9N A;  2UUB O;  4B08 A;  1XNR B;  3HKE B;  1M90 W;  3ZHU A;  1MA1 A;  4JI4 B;  5IE9 A;  2C2A A;  1WNS A;  1A32 A;  2HJF C;  3JAR B;  3ABL C;  2LP7 A;  1TGO A;  1V55 C;  1KEC A;  1KUQ A;  1VQP V;  1QVF U;  4YJ3 B;  3H1K H;  4B3R O;  1D5A A;  3R65 A;  4FLY A;  2ADQ B;  4OPA A;  4DUZ B;  3KKY A;  4JV5 B;  4U7O A;  3CMA V;  4JAV A;  1URF A;  1VF5 B;  4JTA B;  3B09 A;  4NTW A;  3HB3 B;  3SPI A;  2E75 B;  5ITZ A;  1FXV A;  4JI7 B;  4DUY B;  4DUZ O;  3HKB B;  3K03 A;  3UCS C;  4DR1 B;  5BMV A;  3ABL B;  3WB0 A;  3FYI B;  2GTA A;  4JZG A;  1JQ0 A;  1YJW V;  2Z0A A;  3CXH F;  4MTX A;  4WFG A;  3UO3 A;  1S76 D;  1HP8 A;  2YIB A;  1AI4 A;  5JJJ B;  3K58 A;  3HR0 A;  4D6T H;  2Y4T A;  1I7F A;  2MK3 A;  2QGN A;  2AW9 A;  1NJI W;  2WAM A;  2P67 A;  5CBF A;  5BZB A;  1RPO A;  4K0K O;  4JAA A;  3E8H A;  2AGA A;  3STZ C;  5FNV A;  2YUA A;  1H2L A;  4UB8 Z;  3SJB C;  3OTO O;  1V55 B;  3H1I H;  4RQF A;  2Q69 A;  3TJT A;  1GAX A;  3ASO B;  3P3N A;  1B06 A;  1MNG A;  4RWU A;  4KXR A;  4QGP A;  4I9W A;  4TQF A;  4DYL A;  3ZHT A;  5LP6 C;  4LF7 O;  2QSA A;  5DEC A;  3H1L H;  3CCS V;  3RYI B;  2UXC B;  1V9P A;  4XDK A;  1COW G;  1K33 A;  2EIM C;  3FAV B;  5FPR A;  1OCO C;  2DJV A;  3U10 A;  1BQ0 A;  2Y69 B;  1I08 A;  2F23 A;  3HKC A;  4IYI A;  4U3J B;  2DN9 A;  4DR7 B;  2Q4P A;  2ZQM A;  3D8C A;  4LC1 A;  2QDO A;  4MW8 A;  3B2E E;  2IBZ H;  3IGA C;  3RW0 A;  1V54 C;  4O2B A;  1EM1 A;  4JYB A;  5DM6 V;  1N4C A;  2HVK C;  3OR6 C;  5KUK A;  4UXN A;  4DRX B;  3ZMV A;  4DR7 O;  4YJ2 B;  3GVM A;  5D5P A;  1HNW B;  5JJN B;  2F1M A;  3ZIA G;  1H8E G;  2ZD9 A;  2GUZ B;  1S72 V;  2ZNI A;  5IYC O;  1NS1 A;  3X2Q B;  2GV9 A;  1FD9 A;  3LDC A;  2EIK C;  3CPW U;  2XAG A;  3TET A;  4NB5 A;  4DV4 O;  4X20 A;  1Z2G A;  4DV2 O;  3T1C A;  2DE0 X;  5L3D A;  2UUA O;  2QTO A;  2HKO A;  5J2U B;  3OUS A;  1EN5 A;  2WA4 A;  1KD1 W;  1ZWI C;  1SC5 B;  1Q3E A;  1F51 A;  3E35 A;  2WWW A;  2RN9 A;  5IYZ B;  4MTG A;  2PYL A;  5LYJ B;  4X1K B;  4R7C A;  2M7W A;  2EZP A;  5LGT A;  2Y0I A;  1KKC A;  1AIL A;  2WLJ A;  2ZE8 A;  1NT2 B;  2UU9 O;  2EBO A;  1G8M A;  2JDI G;  3JAL B;  3TXS A;  1MG1 A;  4TV9 B;  1Z5V A;  5IYZ A;  4NXM B;  2AHZ A;  2EIM B;  3FB5 C;  1PD3 A;  2Q9L A;  3U11 A;  2QWN B;  1VQ9 V;  3H9V A;  4GX0 A;  4H13 B;  1OJH A;  1NKD A;  3ZMZ A;  3IC9 A;  2IH3 C;  3P32 A;  1AJQ A;  2DOS A;  2OWO A;  1TA8 A;  5LBQ A;  1OCC B;  1K4C C;  4TV8 A;  5BR8 B;  4JI5 B;  2YI9 A;  4JI7 O;  1RSO B;  3M99 B;  2HR3 A;  1K9M W;  4B3T B;  4DR6 B;  2E3C A;  4TUY A;  2HHH B;  4WF9 V;  5CMU A;  4ZOL A;  1JFF A;  4GUN A;  5KHJ A;  3AK2 A;  4AHC A;  4X9Q A;  2EJR A;  1IBM B;  3J7A U;  3DTU B;  4UV8 A;  5FLX N;  2JGU A;  3CRR A;  3WG7 B;  3W7S A;  1JJ2 U;  1YTF D;  4FIP C;  2IJK A;  4FFK A;  3QO7 A;  2ARH A;  4JI1 B;  3L73 H;  1D2D A;  2Q0O C;  3G6E V;  3ABK B;  1SRY A;  3WFV A;  1P4R A;  3EXA A;  1BL8 A;  3HKB A;  1DF4 A;  1US6 A;  4I4T A;  1ZSP A;  1SQQ H;  1BGY H;  3G71 V;  4MS2 A;  4F4L A;  5LHI A;  1NVP B;  1BHB A;  3ASO C;  4R8C A;  5CA1 A;  5EBL C;  1PP9 H;  1XNQ B;  2JJ1 G;  3TGU H;  4O4I A;  1XMO B;  3DXR A;  4CBC A;  4B7E A;  1U96 A;  5EK0 A;  3CC2 V;  4DR4 B;  4HBN A;  3ZRS A;  4RUF A;  2ZE5 A;  1QHT A;  1VIB A;  5BR8 O;  1R3L C;  4LCU C;  4ZOL B;  4FM1 A;  1ZUQ A;  5GW7 A;  1KP3 A;  2M6Y A;  2P6J A;  2Z3Y A;  5KHK A;  5KHG A;  4X20 B;  1BS3 A;  4BWA A;  1N36 B;  5KX5 A;  3JD3 A;  1GN6 A;  1TUE B;  5D5Q A;  1GKF A;  3SYO A;  3ZS8 C;  2H94 A;  3C90 A;  4WBN A;  3L70 H;  4CC5 A;  1YJN V;  1R3I C;  4K8X A;  1NTK H;  3FX7 A;  1KMI Z;  2NNU A;  4J9Y B;  4DR3 O;  1YI2 V;  2E74 B;  2JS5 A;  2XND G;  5IJ0 A;  3JAL A;  2P22 C;  1RPR A;  2P06 A;  1ZAU A;  3BEH A;  3IC7 A;  3VQX A;  1EZV H;  3JYC A;  3SR2 C;  4P2Z A;  3OMA B;  3JCZ A;  4MSW C;  2OYQ A;  4MT8 A;  4BIU A;  2WLL B;  3LUT B;  3RVZ A;  1CPY A;  2WLN A;  1OCR C;  4J11 A;  3FKS G;  5EZY B;  3L74 H;  4B3R B;  5J9P C;  2UXB B;  2EIL C;  4JAU A;  2MW2 B;  4GCZ A;  2ZM6 B;  3LSQ A;  1KC8 W;  1XMQ B;  4LP8 A;  3E22 A;  2B9Z A;  1GRJ A;  3SYC A;  1EN6 A;  2CDY A;  2O57 A;  4DV3 B;  1XL4 A;  1K8A W;  4EFB A;  4JI2 B;  2E76 B;  1S5J A;  5JH7 A;  1E1R G;  5LMN B;  3CE2 A;  3BAB A;  4IHJ A;  1MSW D;  4BW5 A;  3N2K B;  3K5L A;  3ZMS A;  4I55 B;  1SQG A;  1L0N H;  1RP3 B;  3JSL A;  2PI5 A;  4H33 A;  4ZI7 B;  3LDD A;  4FLV A;  4U3J A;  2RQ6 A;  3E86 A;  4HYO A;  4DK1 A;  1TAE A;  5K1P A;  2UXD B;  3A8T A;  1EZJ A;  2YXL A;  5K1X A;  4CH3 A;  3JAS A;  2CTR A;  1E1Q G;  3ICX A;  3VQY A;  1DLB A;  4WCE V;  2OT5 A;  1J95 A;  2LW7 A;  2WA3 A;  3ABK C;  3PN1 A;  5CA0 B;  2PI4 A;  4O4J A;  4O2A B;  2ZDI A;  1YIJ V;  4MTF A;  2YDE A;  2A79 B;  2NLJ C;  1D5N A;  3GWO A;  4FLU A;  5A2Q N;  1ZX3 A;  2ZM6 O;  5B1O A;  3JAR A;  3OFN G;  4GX1 A;  5LHG A;  4W4K A;  4JI6 O;  1GMG A;  1XMQ O;  2FYU H;  3I55 V;  4GZR B;  3ZJZ A;  4LWS B;  2AZ0 A;  2EZO A;  1HNZ B;  4WFH A;  1XDC A;  4DV1 B;  1Q8I A;  1JA8 A;  5IYD O;  1K34 A;  4NTY A;  1L8D A;  2GHY A;  4JV5 O;  4DV0 B;  1V54 B;  5BMV B;  3VQV A;  3MHS C;  1Y6X A;  4J10 A;  1HNW O;  5EIB C;  4J41 A;  2AHY A;  2PUS A;  4CS3 A;  1DK1 A;  2WLM A;  5B1A B;  4G28 B;  1FKA O;  3T1H O;  4LF8 B;  3ZRW B;  1JR9 A;  2PYJ A;  4OX9 O;  4YJ3 A;  2QM8 A;  5IJ9 B;  1PNM A;  4RUE A;  4H37 A;  3ZED A;  5BY1 A;  1IBL O;  2BCC H;  1WP8 A;  4HAM A;  2VQE B;  5LGN A;  3AG7 A;  4DV5 O;  1SQF A;  2YC0 A;  3DSQ A;  4ZI7 A;  2ETN A;  3ABU A;  2LGQ A;  5B3S C;  1XOU A;  1J5E B;  2YIA A;  1I0H A;  4LFB B;  2B1G A;  1AB3 A;  3A0B Z;  4DO2 A;  1HWY A;  3CCM V;  2HP8 A;  3ZN0 A;  5DED A;  4ICG A;  1YDX A;  2FB5 A;  4QNH B;  4DR2 O;  1M1K W;  5C8Y B;  1WB8 A;  1SQP H;  4DV6 O;  4DV1 O;  4QPJ A;  4TUY B;  5TIS Z;  2W0X A;  4O4J B;  4E4E A;  2IJI A;  3J80 N;  1SET A;  4D7T A;  3ASN B;  3RYC B;  3CCV V;  3CX5 F;  2CTP A;  4JZ2 A;  1SA0 A;  3K57 A;  2B5U A;  3SYP A;  3W7X A;  4JYA B;  2R70 A;  1O9G A;  3I56 V;  1Y76 B;  3ZRX A;  1H2S B;  2QM4 A;  4PDL A;  1FFT B;  4YIO A;  4NTX A;  1GN3 A;  4NVP A;  1DF5 A;  1PPJ H;  2F93 B;  5GTH Z;  4OGQ B;  2PZS A;  4X1I A;  5CN0 A;  4DR1 O;  2NN4 A;  4CC6 A;  5KLV H;  2BTQ B;  1UFI A;  1WA8 B;  3RFR A;  1GO3 F;  4DV4 B;  2YXY A;  1IXB A;  1OCZ B;  3ZBH A;  4Q6G A;  3N2K A;  2HHH O;  4I9Q A;  1OV9 A;  5KA5 A;  4J7Z A;  1Q7Y W;  3IJ4 A;  2QE7 G;  2G38 A;  3MAQ A;  1JFF B;  5J2U A;  5KHI A;  4LF4 B;  3CJH B;  4I7Z B;  1CEZ A;  4JI5 O;  2V4D A;  1T5E A;  1JVM A;  3AEI A;  3L9D A;  4UCU A;  1GM8 A;  4LF5 B;  1WP7 A;  4P9O A;  3OM3 B;  5LMN O;  5GTI Z;  2LO1 A;  4JI1 O;  2ZKO A;  1TUB B;  1VF6 C;  4TT3 G;  1FXK A;  4MTO A;  3SYQ A;  3L72 H;  2XUM A;  2Q7H A;  2OCC C;  1IZ3 A;  1OHH G;  4TWK A;  4I50 A;  1XRE A;  3HKD B;  1K5S A;  1S77 D;  1TVK B;  3BA9 A;  4JI8 O;  2Y48 A;  4X1Y B;  4PDM A;  4PA3 A;  1VEW A;  1Q82 W;  4LF6 O;  1ENV A;  2X0L A;  3QF7 A;  1NR1 A;  1QLN A;  3THO A;  2DYR C;  3MDS A;  4JI0 O;  4X1Y A;  1BQZ A;  1G6U A;  5JVD A;  2FKX A;  1Q90 D;  1XNQ O;  2LGW A;  2LFS A;  4DUY O;  3UKM A;  2EUL A;  3K0G A;  3QNE A;  3A0R A;  1GTO A;  4MVU A;  4C7U A;  1YF2 A;  2CGN A;  4IT5 A;  4FJC C;  1Y66 A;  3FYE B;  3FAV A;  1XMO O;  5HFM A;  4X65 O;  5KX5 B;  3T1Y B;  2A3Q A;  1F4M A;  2RDC A;  1SA0 B;  1PNL A;  4JI6 B;  3DGE A;  4X66 O;  1H2N A;  2P4V A;  4QIW F;  3ETG A;  3H1J H;  4LF5 O;  2EIJ B;  2GUZ A;  3MD0 A;  1N33 O;  5GON A;  1YIT V;  1VQ8 V;  2QWO B;  3CRQ A;  1N0J A;  4X64 B;  1U97 A;  3GWK C;  4JTD B;  3APQ A;  1SZT A;  2DWD C;  1S5L Z;  5A9G A;  1RSO A;  5AG2 A;  3BRC A;  5EBW C;  4DR6 O;  2HJD A;  1GM7 A;  3FFQ A;  1VQ6 V;  1NTM H;  4OPH A;  2RMK B;  5B1A C;  1ORQ C;  2CK3 G;  4JTC B;  3AG4 C;  4U7N A;  3JAK B;  2UXD O;  4HNA B;  4NKG B;  1WB7 A;  4X62 O;  3ML0 A;  4I0X A;  2R9A A;  4DK0 A;  3JAK A;  3OAA G;  3OMI B;  3AG1 B;  4LF6 B;  1S3J A;  4PV1 B;  1S5H C;  3ETQ A;  1QR9 A;  2QWP B;  4LNU A;  3BAA A;  2JS3 A;  2HEP A;  4IGG A;  1VQ5 V;  4B7K A;  4R6Z A;  5JCO A;  1K5Q A;  3QG5 A;  2ZNJ A;  5L3G A;  2X6B A;  1TVK A;  3FB8 C;  2JIZ G;  1AP6 A;  1M57 B;  1RM1 C;  1AI6 A;  1TUB A;  2ADP A;  5FNV B;  5JJE B;  2YS8 A;  4B3S B;  3JCU Z;  1HDJ A;  3U0Z A;  4ZHQ A;  1BCC H;  2A0L A;  1LUV A;  4DR2 B;  3CC7 V;  1IUR A;  3RWR D;  4HZ3 A;  3BY6 A;  5B1B B;  3BPZ A;  4MVM A;  2L35 A;  3SPJ A;  4NYK A;  5LHH A;  4BR6 A;  4H44 B;  5LMU B;  3QVN A;  2YIC A;  5B1B C;  2HFE C;  5KAF Z;  3E2E A;  4FZ0 A;  4I0X B;  1WN7 A;  5CA3 A;  2EIL B;  3ZMT A;  4ZKI A;  4LF7 B;  4P30 A;  5JVD B;  1RFY A;  4K8Z A;  1P7B A;  2Y69 C;  1VMG A;  1VF6 A;  4PDV A;  1N8R W;  3P3P A;  2IU3 A;  1P49 A;  2JEU A;  3E8G A;  1WAZ A;  3K04 A;  1FAF A;  2IJH A;  2Q5Z A;  3TCU A;  3Q4H A;  3ZHR A;  2KG7 A;  2VWK A;  4I5S A;  4GT1 A;  2A7W A;  3WG7 C;  2E5L O;  3OD4 A;  3CB2 A;  3LNM B;  2KKW A;  3RYH B;  3JAW A;  1FYJ A;  4BAY A;  1QLE B;  2PGG A;  2XHB A;  4KP4 A;  4QJF B;  5LXT B;  3D36 C;  3AK3 A;  1IXM A;  4QE9 A;  4LFC B;  1G1X B;  5GON B;  1N36 O;  1P7G A;  1L1F A;  2RJZ A;  4AIL C;  3ABM C;  4X88 A;  5IWA O;  4UVA A;  3ETD A;  4YY3 O;  1VQM V;  2UUA B;  4JI3 B;  4YY3 B;  3CME V;  1QR8 A;  3CRA A;  3T4Z A;  5CB4 A;  4FK5 C;  2QKS A;  1VP7 A;  3NXS A;  2JGD A;  3JAT A;  2V7Q G;  1JJO A;  3Q4H B;  3AG2 B;  1VQN V;  3ZN1 A;  2QA4 V;  2H3O A;  1SER A;  2IM9 A;  3IAY A;  2UU9 B;  1KBH A;  2AXT Z;  2N74 A;  5IT9 N;  2Y0P A;  5LXT A;  2IJJ A;  3UO2 A;  2UXN A;  3JAM N;  1B04 A;  3JAW B;  1IDS A;  1Y76 A;  2BTO A;  1LR1 A;  5ITZ B;  4G2K A;  1XQ8 A;  2XAJ A;  2WLL A;  2BSK A;  4LF4 O;  3VOU A;  3AK1 A;  2WLH A;  3QTC A;  5JQG B;  4DXW A;  2DW4 A;  2IH1 C;  2BOC C;  2CH7 A;  1UPG A;  1W0J G;  5B5E Z;  2P7T C;  4DV0 O;  2ZE6 A;  3CHX A;  3G6B A;  3GB7 C;  4GX5 A;  3A0H Z;  2LQT A;  3P30 A;  1BT8 A;  5FL7 G;  4KFM A;  1P84 F;  3HKE A;  1SS3 A;  4WBN B;  1QVG U;  2OIG A;  3E22 B;  5KMG A;  4CH6 A;  1I94 B;  1R73 A;  5B3S B;  4PHZ A;  3UT5 B;  1HR0 B;  4X1I B;  2LFR A;  4RQE A;  3CEI A;  4DW0 A;  4ZHQ B;  3N27 A;  2CTQ A;  4MVR A;  1FPO A;  2IW5 A;  3K5O A;  4O4H B;  1YSC A;  2EIK B;  2EIN C;  5IY5 C;  2P5O A;  2CH7 B;  1QQC A;  2VRZ A;  5JQG A;  3LSS A;  2XAH A;  4NXN B;  2DYS B;  2BE3 A;  2DYR B;  2QTS A;  1WLE A;  5KAI Z;  1W0K G;  2F4V O;  2A9H A;  5CBG A;  3WB2 A;  3K06 A;  4X89 A;  5CBH A;  5IY5 B;  5LOV B;  2YEV A;  3D36 A;  3ZMU A;  4CH5 A;  3AG3 B;  2D2C B;  3G80 A;  4UCS A;  4JI8 B;  4Z1V A;  1M56 C;  4O4L A;  2CGO A;  3ABM B;  3OTO B;  2F66 C;  3B8M A;  1N32 B;  1CXZ B;  4D7S A;  4KUM A;  3UT5 A;  4GKK B;  3CP1 A;  1X4T A;  2F43 G;  5KHH A;  1Q81 W;  5KMG B;  2CE4 A;  2JJ2 G;  3CCE V;  3JAT B;  1KKD A;  1SQB H;  4XDL A;  1F7Y A;  4UB6 Z;  2Y4U A;  4GKK O;  3MHH C;  1YVW A;  2PF4 E;  2ZR3 A;  1FJG B;  1O9H A;  1NTZ H;  1N34 O;  1FS0 G;  5EIB D;  4K35 A;  1PV0 A;  1PL0 A;  4Z1M G;  2ZCE A;  2H8P C;  3VBB A;  1FFX B;  1KP2 A;  1PM9 A;  1XHX A;  1JX9 A;  1K92 A;  4NR1 A;  4RO2 A;  4TV8 B;  5J2T A;  3I5D A;  4EFE A;  1GN2 A;  4I4T B;  1Q86 W;  2VS0 A;  3FB7 C;  1R3J C;  4EB6 A;  3O9O A;  4UCO A;  3JAS B;  4IL6 Z;  3LNN A;  2OTJ V;  1YZB A;  4TSF G;  5EZY A;  2QWR B;  1QNM A;  2R9R B;  4EB6 B;  1XHZ A;  1CP9 A;  5DN6 G;  4TV9 A;  4WFE A;  1XIL A;  1K7D A;  2ITD C;  2DYS C;  4PI0 A;  4PEL A;  1ARO P;  1BSM A;  1XUQ A;  3OGI B;  1IBK O;  4PJ0 Z;  1M57 C;  3CCU V;  2AZ2 A;  1QU7 A;  1IBK B;  1I94 O;  4XDJ A;  2RNB A;  2Q7G A;  2YSU B;  1MSD A;  3DC6 A;  3RT3 C;  2XAF A;  1SF9 A;  4IIJ B;  3RN4 A;  1FXK B;  1GN4 A;  2GDS A;  2CTW A;  2DQ3 A;  1NH2 D;  3FD9 A;  4CS4 A;  2ITC C;  4JYY A;  2Q73 A;  5FPO A;  1H38 A;  1AI7 A;  1WA8 A;  2ATK C;  2UXC O;  3RBZ A;  5E79 Z;  4H0L B;  2UUC O;  2N04 A;  3K5M A;  2QJ1 A;  2B1I A;  3S3W A;  2HVJ C;  1LUW A;  1VQO V;  3F5W C;  1VAR A;  5LGU A;  4YHH O;  4W4L A;  2VWJ A;  1EN4 A;  1JCH A;  1N34 B;  3CRM A;  1SQV H;  4P9P A;  2RCV A;  1Z5W A;  3OR7 C;  3DXR B;  1AR1 B;  4O2B B;  3CS5 A;  3UM7 A;  4ZBM A;  1EFR G; 
#chains in the Genus database with same CATH homology
 2JK5 C;  4GX2 A;  2P90 A;  2R9I A;  5EBW C;  1F23 A;  1GM7 A;  1NH2 B;  1R6N A;  3JD3 A;  2EIJ C;  2X7R B;  1R6K A;  1VQ6 V;  1AI5 A;  1TUE B;  3QO5 A;  1GKF A;  5B1A C;  1ORQ C;  2CK3 G;  3SYO A;  4JTC B;  2H94 A;  3AG4 C;  4N23 A;  4U7N A;  3OGC C;  4PA6 A;  1YJN V;  2X6A A;  4R50 A;  1R3I C;  1M56 B;  3CXC U;  3ML0 A;  5IYB O;  4JF3 A;  5H6Q A;  1KQS U;  2NNU A;  4J9Y B;  3CCQ V;  1YI2 V;  3OAA G;  3OMI B;  3AG1 B;  2XND G;  1F4N A;  1YHQ V;  3JD4 A;  1VQ4 V;  1S3J A;  3RVY A;  1OZ0 A;  1RPR A;  1S5H C;  3BEH A;  3IC7 A;  1QR9 A;  1BHA A;  3JYC A;  2WLI B;  4P2Z A;  3OMA B;  3JCZ A;  4MSW C;  2WLK A;  4MT8 A;  4BIU A;  4FMT A;  1VQ5 V;  4R6Z A;  2WLL B;  5C93 A;  3E8B A;  1K5Q A;  5L3G A;  2KB1 A;  3LUT B;  2X6B A;  1CPY A;  2Z5U A;  3RVZ A;  2WLN A;  3CYO A;  1OCR C;  3STL C;  3FB8 C;  3OW2 U;  2JIZ G;  3CD6 V;  2X6C A;  1RM1 B;  3FKS G;  3JD2 A;  4JYC A;  4JPR A;  3B77 A;  1M57 B;  4OXS A;  1RM1 C;  1PKX A;  1AI6 A;  3F7Y C;  2XAS A;  5KA6 A;  2Q67 A;  5J9P C;  3ZCC A;  1H8H G;  1AJN A;  2EIL C;  1I5Y A;  4BIZ A;  3OE7 G;  3SPH A;  2A0L A;  2OCC B;  1NVP D;  4JAU A;  1EBO A;  4GCZ A;  3CC7 V;  3JD1 A;  2ZR2 A;  3LSQ A;  4J9Z B;  1QBZ A;  1KC8 W;  2ZDI C;  4LP8 A;  3SYC A;  4HZ3 A;  3BY6 A;  3SYA A;  1XL4 A;  5B1B B;  1K8A W;  4MVM A;  3CCR V;  1MAB G;  4QE7 A;  3CCJ V;  3FB6 C;  1E1R G;  3SPJ A;  5LHH A;  4MVZ A;  1THZ A;  1YTF B;  5B1B C;  2HFE C;  3E2E A;  2W6I G;  1OCO B;  5KUM A;  2HG5 C;  5CA3 A;  3AG4 B;  2EIL B;  3ZMT A;  1MSW D;  4Q20 A;  1JOY A;  4BW5 A;  4ZKI A;  4P30 A;  5EC2 C;  3AG2 C;  3ZMS A;  1P7B A;  5EBM C;  1WPX A;  2Y69 C;  1FXK C;  2QM7 A;  4PDV A;  1N8R W;  2IU3 A;  1BMF G;  2JEU A;  3K04 A;  3E8G A;  2PI5 A;  2IJH A;  4CZZ A;  3TK1 A;  4H33 A;  4EKW A;  1DTO A;  3TCU A;  1M9N A;  3LDD A;  4UVC A;  4I5S A;  4GT1 A;  1SES A;  3E86 A;  1M90 W;  4HYO A;  3WG7 C;  2C2A A;  2HJF C;  3LNM B;  2ZXW B;  3ABL C;  2LP7 A;  3CCL V;  1EZJ A;  4MVQ A;  1V55 C;  1KEC A;  2OTL V;  1VQP V;  4ASU G;  4BAY A;  1QLE B;  1NR7 A;  1QVF U;  4KP4 A;  1E1Q G;  4QJF B;  1DLB A;  4WCE V;  1IXM A;  4QE9 A;  2OT5 A;  3R65 A;  1J95 A;  1L1F A;  2DWE C;  4U7O A;  3ABM C;  3T2M A;  3ABK C;  3CMA V;  3AG1 C;  4JAV A;  4JTA B;  4X88 A;  3HB3 B;  2PI4 A;  3H01 A;  1H2G A;  3B8N A;  2ZDI A;  4UVA A;  4MVO A;  3SPI A;  1YIJ V;  1S0V A;  4MTF A;  1AJP A;  1FXV A;  3ETD A;  1VQM V;  2A79 B;  2NLJ C;  2BOB C;  3GWO A;  3K03 A;  4UV9 A;  3CME V;  5B1O A;  1QR8 A;  3ABL B;  3T4Z A;  4LBE C;  3OFN G;  4GX1 A;  4FK5 C;  1K4D C;  2QKS A;  3EHB B;  5LHG A;  3FYI B;  3IFX A;  3NXS A;  1GMG A;  2V7Q G;  3CC4 V;  1PNK A;  1JQ0 A;  3I55 V;  1YJW V;  3ZJZ A;  4MTX A;  4WFG A;  3AG2 B;  1VQN V;  3ZN1 A;  1GK9 A;  3ETE A;  2DQ0 A;  2QA4 V;  1S76 D;  1AI4 A;  3KG2 A;  3OEH G;  2EZO A;  1SER A;  4WFH A;  2MK3 A;  1E79 G;  1NJI W;  2WAM A;  5IYD O;  2P67 A;  5CBF A;  5IDJ A;  2W6J G;  5BZB A;  1RPO A;  1K34 A;  3E8H A;  2GHY A;  3SPC A;  2IJJ A;  3STZ C;  1NBM G;  1V54 B;  2V1D A;  2W0F C;  2UXN A;  3MHS C;  1V55 B;  4RQF A;  2Q69 A;  3F7V C;  3ASO B;  4G2K A;  3K9A A;  2AHY A;  3LDE A;  2XAJ A;  2WLL A;  4I9W A;  3AG3 C;  2WLM A;  5B1A B;  3PJS K;  4G28 B;  3VOU A;  5L3B A;  2WLH A;  3QO8 A;  3ZRW B;  4DXW A;  2DW4 A;  2IH1 C;  4FPP A;  3CCS V;  2BOC C;  3T4D A;  1W0J G;  2P7T C;  4PDR A;  2QM8 A;  4XDK A;  3W7U A;  1COW G;  1K33 A;  1VQK V;  3GB7 C;  4GX5 A;  1PNM A;  4RUE A;  2XOK G;  5B1N A;  4H37 A;  2EIM C;  2UXX A;  3P30 A;  3W7W A;  1QCE A;  5FL7 G;  1OCO C;  3ABT A;  2Y69 B;  4KFM A;  1OCR B;  4HAM A;  4JAS A;  5LGN A;  2EIN B;  1QVG U;  4WFF A;  2ZQM A;  4LC1 A;  3W7T A;  3HPL C;  1K73 W;  3ABU A;  5HFL A;  5B3S C;  3ZRV A;  3SJQ C;  4MW8 A;  1NQT A;  1R73 A;  5B3S B;  2B1G A;  3IGA C;  3OEE G;  3RW0 A;  1V54 C;  1HWY A;  3D3I A;  3E89 A;  4DO2 A;  4JYB A;  5DM6 V;  2LFR A;  4RQE A;  3CCM V;  2WSS G;  3ZN0 A;  2HVK C;  4PA4 A;  4MVR A;  3OR6 C;  4QNH B;  5KUK A;  1M1K W;  2IW5 A;  4UXN A;  1YSC A;  1MOF A;  1OCC C;  2EIK B;  3ZMV A;  2XAQ A;  2K1E A;  2EIN C;  5IY5 C;  1B6Q A;  3K0D A;  4QPJ A;  3ZIA G;  1H8E G;  2ZD9 A;  3ZRW A;  1S72 V;  3LSS A;  2XAH A;  5IYC O;  2DYS B;  4N21 A;  2IJI A;  3X2Q B;  1SET A;  2DYR B;  3ASN B;  3LDC A;  3CCV V;  2EIK C;  1WLE A;  1W0K G;  4L87 A;  2A9H A;  2XAG A;  5CBG A;  3CPW U;  3TET A;  2B5U A;  3K06 A;  4X89 A;  3SYP A;  3W7X A;  5CBH A;  5IY5 B;  2YEV A;  3I56 V;  3T1C A;  1GM9 A;  3ZRX A;  5L3D A;  3D36 A;  2QTO A;  2HKO A;  5H9C A;  3ZMU A;  3SPG A;  3AG3 B;  3OUS A;  4PDL A;  2QEX V;  1FFT B;  1KD1 W;  4PA7 A;  1DF5 A;  1ZWI C;  1M56 C;  1F51 A;  3E35 A;  3EFF K;  4RAI A;  2WWW A;  3ABM B;  4MTG A;  3B8M A;  4WFB V;  5CN0 A;  4R7C A;  2M7W A;  2EZP A;  5EC1 C;  4KUM A;  5LGT A;  3CP1 A;  2WLI A;  2JEX A;  2WLJ A;  2F43 G;  4E2L A;  1Q81 W;  1JPX A;  1GO3 F;  2JJ2 G;  1OCZ B;  2EBO A;  3CCE V;  1G8M A;  2JDI G;  1KKD A;  1MG1 A;  4XDL A;  5E1A C;  5KA5 A;  2AHZ A;  2EIM B;  3FB5 C;  1PD3 A;  3MHH C;  1VQ9 V;  2ZR3 A;  1Q7Y W;  4GX0 A;  4XBF A;  4X8A A;  1LNQ A;  2QE7 G;  4G27 B;  2Q68 A;  1NKD A;  4QPK A;  3ZMZ A;  3K79 A;  1OCZ C;  2IH3 C;  3P32 A;  3X2Q C;  1W2B U;  1AJQ A;  4PA9 A;  1CEZ A;  2YEV B;  1FS0 G;  5LBQ A;  5L3C A;  1OCC B;  1K4C C;  1JVM A;  1PL0 A;  3AEI A;  4Z1M G;  1GM8 A;  2H8P C;  3E83 A;  3M99 B;  4P9O A;  3VBB A;  4MW3 A;  2HR3 A;  1KP2 A;  3OM3 B;  1JX9 A;  1K92 A;  4RO2 A;  1K9M W;  1K3E A;  1Q86 W;  3FB7 C;  1R3J C;  1G4Y B;  4WF9 V;  5CMU A;  4TT3 G;  1FXK A;  2OTJ V;  4MTO A;  4TSF G;  4YXW G;  3SYQ A;  2OCC C;  2R9R B;  1OHH G;  4TWK A;  1CP9 A;  1K5S A;  5DN6 G;  1S77 D;  2EJR A;  2Q6A A;  4WFE A;  3DTU B;  4UV8 A;  1K7D A;  2Y48 A;  2ITD C;  1VQL V;  1FXH A;  4PDM A;  4PA3 A;  2DYS C;  1Q82 W;  4PEL A;  1I5X A;  1ARO P;  1ENV A;  2X0L A;  1NR1 A;  1QLN A;  3WG7 B;  2GSM B;  2DYR C;  3W7S A;  1M57 C;  3CCU V;  1JJ2 U;  1YTF D;  5L3E A;  4FIP C;  4XDJ A;  2IJK A;  4MVS A;  2YSU B;  2LFS A;  3UKM A;  3K0G A;  3QO7 A;  2XAF A;  3QNE A;  3A0R A;  1GTO A;  3JD0 A;  4MVU A;  4FJC C;  1Y66 A;  3FYE B;  1YJ9 V;  1FXK B;  3G6E V;  3ABK B;  1SRY A;  3WFV A;  5HFM A;  1P4R A;  1BL8 A;  1DF4 A;  2DQ3 A;  1NH2 D;  2ITC C;  5L3F A;  3G71 V;  4MS2 A;  1H38 A;  4F4L A;  5LHI A;  1NVP B;  1F4M A;  1BHB A;  3ASO C;  4UUJ C;  1AI7 A;  1PNL A;  4R8C A;  2ATK C;  5EBL C;  3OMN B;  2WPD G;  1QLE C;  1ROP A;  2HLD G;  2JJ1 G;  3RBZ A;  1Y4M A;  3DGE A;  3K3W A;  1R3K C;  4QIW F;  3ETG A;  2ZXW C;  4CBC A;  1K97 A;  2B1I A;  2EIJ B;  5EK0 A;  4JGS A;  3CC2 V;  2HVJ C;  1VQO V;  1VQ7 V;  3MD0 A;  3ZRS A;  4RUF A;  1UJW B;  1XL6 A;  3F5W C;  1YIT V;  5LGU A;  2D3O W;  1VQ8 V;  1R3L C;  3OUF A;  4LCU C;  1JCH A;  5GW7 A;  5H6R A;  3G4S V;  4P9P A;  3ASN C;  3E8F A;  1KP3 A;  4JTD B;  2P6J A;  2Z3Y A;  3OR7 C;  1SZT A;  4UVB A;  2IU0 A;  2FTK A;  2DWD C;  1AR1 B;  3K08 A;  4WFA V;  3UM7 A;  4ZBM A;  1EFR G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...