1ENVA

Atomic structure of the ectodomain from hiv-1 gp41
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
121
structure length
115
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF G
publication title Atomic structure of the ectodomain from HIV-1 gp41.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 59
structure length 115
sequence length 121
ec nomenclature
pdb deposition date 1997-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1envA00
3B8MA 5CN0A 1K34A 1MG1A 1Y4MA 1SZTA 4JGSA 5HFMA 4N23A 1MOFA 1DF5A 1F23A 4N21A 1DLBA 1QBZA 2MK3A 2X7RB 3H01A 3MHHC 3B8NA 1QR9A 1K33A 2EBOA 4G2KA 1DF4A 5CMUA 2LP7A 4FK5C 5H9CA 5KA6A 1I5YA 5HFLA 2P6JA 2EZOA 1JPXA 3CP1A 1EBOA 4JPRA 3P30A 2EZPA 3B77A 4E2LA 3K9AA 1QCEA 3CYOA 4JF3A 2OT5A 1Y66A 5KA5A 4FIPC 3WFVA 1I5XA 3MHSC 2M7WA 1JQ0A 1QR8A 3M99B 4FJCC 3GWOA 1ENVA
chains in the Genus database with same CATH superfamily
4F6RA 1IBMB 4JI4O 3ETDA 5L3GA 5H6RA 5LMNO 4DV7O 5ITZB 3K3WA 4WCEV 3UCSC 5CA3A 4EB6B 4DUZB 1NJIW 2ARHA 3WG7B 2B9ZA 5FPRA 1Q82W 2ZXWB 4DV6B 3AG2B 1SQGA 3ABKC 4B3RO 1NKDA 2AW9A 5EBLC 2F66C 4G27B 2IM9A 1AVMA 2YEVB 4JTAB 4NXMO 2KB1A 2RNBA 3RYHA 3ABLC 1VF7A 1PNMA 3SPIA 2DW4A 2PY5A 3OTFA 1MZFA 4FFKA 5LHIA 4TUYA 1QU7A 3JATB 3B8MA 3SYQA 4DK0A 2H8PC 3PN1A 3CB2A 2HR3A 3J80N 2UU9O 3CRRA 4WFAV 1LUWA 3OMNB 3TK1A 3CXCU 4PA6A 1VQ6V 3OAAG 4MVZA 4GX5A 4XDLA 1VQLV 3C3TA 3ZMUA 1LR1A 4FLTA 4CC5A 1KP2A 4DR3B 3RGBA 1ENVA 2ADQB 4ICGA 2Q7HA 5JQGB 1HNZB 3DC6A 1BSMA 3JAWA 5L3EA 2ZINA 4PA4A 1JOYA 1WAZA 2VQFO 5J2UB 2DQ0A 1ZL8A 3D36C 4FIPC 1BZKA 3OGCC 2UXBO 1FD9A 5KAIZ 1D5AA 2HP8A 4LNUA 1DF5A 3K5MA 4N21A 3AG7A 5FNVA 2EJRA 2O57A 3K9SA 1N34O 4HAMA 1L0LH 3MDSA 4RO2A 4BIUA 2OCHA 1I5YA 1BQZA 2EZOA 2IJHA 4YY3B 1YTFB 1SERA 1QQCA 2E75B 5IJ9B 1NT2B 5KHHA 1MG1A 1R3JC 3IJ4A 2VRZA 3T4DA 3ASNB 2XNDG 1ZAUA 1DLBA 2MK3A 3D3QA 3QO8A 1IBLO 3CPWU 4O4IA 3T2MA 3GWKC 3SR2C 2Z5UA 2QKAA 2ZQMA 1VQOV 2XOKG 3L73H 2IH3C 4X66B 1CEZA 1JJ2U 1F4NA 4JZ2A 3CCQV 1Q8IA 4LF7B 1FPOA 4QPJA 3EXAA 4ZIBA 2WSSG 1XMQB 4PI0A 1Y74B 1GM7A 2PZSA 2JS5A 1K8AW 1WPXA 4MTXA 1AI5A 2JGUA 3F5TA 4FZ0A 1A32A 2Y4UA 3LUTB 4UCRA 1IBKB 4H13B 4KP4A 2XUMA 1H2SB 4A5UB 1IVSA 4TV8A 4NYKA 5IJ0A 5K1XA 4B08A 1H2KA 2Q7EA 1OCZB 3L75H 3EHBB 4I9WA 4ZI7B 3QNEA 1KKDA 1OCRB 1K33A 4WBNA 1NH2B 1B04A 3EFFK 4YJ3A 4AI8A 4KL1A 2IJJA 2WLIB 1Z5WA 3UO3A 4QJFB 4NVPA 1QLNA 3JALA 4PDVA 5CB4A 2HVJC 2GUZB 4GYCB 4FLUA 2PI5A 4DRXB 2CH7B 5CA0B 4AQYB 3JCUZ 1COWG 4MW3A 4YIOA 4JYAB 2VQEO 2PF4E 3OGIB 4UUJC 2YXHA 4LFAB 3AG3B 1K73W 1ZWIC 2HHHO 2AZ0A 3ZMZA 4CBCA 4L87A 3ZCCA 3LSUA 1TUBA 1OCOC 5EYPB 4DV2B 4B3TO 1XREA 3ABLB 4FLXA 4OX9O 2H3OA 1IURA 1GM8A 5A9GA 4NKGB 2C2AA 1RPOA 5LXTB 2BTQA 1GN3A 3P3NA 1XDCA 4HBNA 4W4KA 1N32O 3HPLC 5IYZA 3JAKB 1I5XA 5DN6G 4XDKA 2JS3A 1BCCH 3N2GB 2EIKC 4OGQB 3STLC 2Q68A 5CA1B 5CMUA 3UT5A 1Q43A 3CSXA 3B40A 2DYRB 2JK5C 3APQA 1NQTA 2E74B 3HKBA 4KFMA 4HNAA 1TAEA 2DJVA 2FKXA 2Q6AA 1QNMA 3OTOO 5JVDB 3TXQA 3JD3A 2W6JG 4KHPB 2A9HA 3S3WA 5FL7G 4OPHA 4LC1A 2RMKB 5IYDO 5LYJB 4E4EA 2OWOA 4BIZA 1FYJA 2RCVA 1HNXO 3ZX6A 4F6RB 2ZNIA 1BHAA 1EN4A 4PA7A 4JF3A 2NLJC 5KMGA 3CCRV 3M8AA 3DC5A 3BY6A 3H1JH 3LDDA 1VF5B 1Q6UA 3H1LH 1OV9A 3I55V 3A2FA 3WB2A 3FB8C 3K0DA 3ZN1A 4JV5O 2FMLA 4GKJB 4JI5B 2AGAA 1J95A 4RUFA 5L3CA 2HFEC 2OIGA 1N33B 5IYBO 1JA8A 1TVKB 2Q4PA 4CH6A 3HKDA 2ZDIC 1FXVA 2YI8A 1N4CA 4X1KA 4DW0A 4R50A 3RYHB 3CXHF 2JGDA 3A0HZ 4MSWC 1G1XB 2X7RB 2YIBD 4FFBA 1SRYA 3MHHC 1M4UA 4I5SA 4FK5C 4UB6Z 1US6A 3WU2Z 1XUQA 3JD4A 1YI2V 4X64B 5FLXN 4GX1A 3KKYA 3WG7C 1MSDA 2PYLA 4J42A 2ZXWC 1AI7A 2RJZA 1F23A 5JJJB 2QWPB 4DR6B 4LWSA 4G2KA 1SETA 2CTPA 1PKXA 1YDXA 1YJNV 3E8FA 1P7BA 3P3PA 4X1IA 4ZBMA 3K9AA 2B1GA 2Y69B 1MNGA 1M57C 4BWAA 1OCCB 5LMUB 3BVOA 4JYCA 3U10A 2DWEC 2WWWA 3H1HH 1FJGB 3FB7C 1IBMO 1WN7A 4X1YA 2Q73A 1ZL8B 4JAAA 5KUMA 3SPGA 4EFEA 2UXNA 5LGTA 4X89A 2E5LB 4DUZO 4P30A 4LNUB 4LP8A 5LGNA 5BY1A 4X20A 1VQPV 5BR8B 5FNVB 5CBGA 4DV6O 4O4HA 2E3CA 2CE4A 4MW8A 5BMVA 1AP6A 4TWKA 1R1BA 3E22B 1G8MA 4FZ1A 3CC4V 4O2AA 2V1DA 1KMIZ 2ZE8A 3ZRWA 2DQ3A 1MA1A 1N0JA 4WFHA 1JQ0A 3K03A 4O2BB 1OCOB 5D5QA 3SJBC 3ZN0A 4Z2WA 2KKWA 1Q5OA 4O4IB 4K0KB 4H0LB 4UVCA 2Q0OC 1YTFD 1I0HA 5H9CA 2A0LA 2BOBC 4X62B 4PA3A 4J7JA 3K08A 1BHBA 1IX9A 1KU9A 2V4DA 2N05A 5EIBD 4JAUA 4DR3O 4RQEA 3WB0A 2A7WA 1PP9H 2V7QG 1EZVH 2Q0AA 2YDEA 3WB1A 1FXKA 2RN9A 3ASNC 3VBBA 1XNRB 5GW7A 3O65A 4CS4A 3K0GA 1HNZO 4TV8B 3ICXA 5EIBC 1RP3B 1D2DA 3O9OA 2JEXA 4ZHQA 1VF6A 3OD4A 3ABMB 4JI8B 5KX5B 4NXNB 1FFXA 5IY5B 4YJ3B 3CRQA 4J9YB 1W0KG 1D5NA 1VQKV 2QWQB 2EBOA 2XAHA 3CS5A 1Q90D 1LUVA 1UFIA 5KA6A 4GKKB 5JCOC 2WLHA 3CCEV 3CMAV 1SQPH 3JALB 5CB4B 2IH1C 1PPJH 2AHYA 1O9GA 1NTMH 3ZHUA 4FLVA 4UFZA 4YY3O 4PDLA 2ZE5A 2QKSA 1XI1A 1NH2D 5EZYB 4X65B 5EK0A 4J41A 1VP7A 1J5EB 3T1YB 3OMAB 4OXSA 3W7WA 1OCZC 4GZRB 3E8BA 2UUCB 4JZGA 2XT9A 4BW9A 4MS2A 1OCRC 4O4LB 3E8GA 1H2MA 5FPOA 4JTDB 2EIMB 1Y66A 4MTOA 4UV9A 1KECA 4MTGA 4X66O 2ZD9A 1ZSPA 1PL4A 3OE7G 2PGGA 2GTAA 3RBZA 4LF7O 1SZTA 2X0LA 3FX7A 3IC7A 5LOVA 3UQ8A 1XMQO 1XQ8A 1JR9A 1Y67A 1QR9A 2QWOB 5IYZB 2ZT9B 3E8HA 1VQ5V 4LF5B 4H37A 1WA8A 4B7KA 1HDJA 4LFBB 3CCVV 1Z2GA 3AG3C 1IBKO 4UCTA 3A0BZ 1GK9A 2Y48A 2VWKA 3UT5B 2LW1A 5DECA 1GTOA 2CGOA 5B1NA 2QA4V 2EIJC 3VQVA 2GSMB 3HKBB 1AJPA 3A0RA 4HNAB 3K06A 4UCSA 3PJSK 5J2TB 3ZHQA 1VIBA 4R6ZA 1I7FA 3JYCA 1M57B 1BT8A 3CWBH 1QVFU 4MTFA 4JYYA 4D7SA 2QTOA 2XASA 4TSFG 2A79B 2GV9A 3VQXA 3VQYA 5IE9A 2DYSB 3EVKA 4OPAA 1W59A 4DR4B 1M56B 3KCXA 4B3SB 3L74H 4DXWA 1MZEA 2ITCC 1IDSA 4AQYO 3T1HB 3L70H 5KMGB 4JYAO 2DYRC 1U96A 1TA8A 4LFAO 3JSLA 4X8AA 3ZIAG 1AILA 2K9PA 4K3AA 4YXWG 4TV9B 1JX9A 3FB6C 4I55A 4P2ZA 4DV2O 4LH7A 4F4LA 4LF6B 4PELA 4C7UA 4X1KB 4IL6Z 4YIPA 1I08A 1VEWA 4JASA 5B66Z 2JGDB 1SS3A 4FFBB 1SZXA 1FKAO 2P67A 2X6BA 4DR5B 4U3FH 2F95B 3G6BA 2ZIMA 4FLYA 3K04A 5A2QN 2WA3A 3AG1B 1R3LC 3D8CA 3ZHRA 2FYUH 4UCVA 2CTWA 4I9QA 1Q6HA 4IT5A 4LWSB 2Z0AA 5LP6A 4FM0A 2QSAA 4J10A 4KHPO 1GN4A 1B6QA 3ZS8C 4L8JA 2B1IA 3R65A 3D3IA 2WLJA 2MW2B 3JD2A 1V55C 1JFFA 1S77D 3F7VC 1KP3A 5F2VO 1ZUQA 4J9ZB 2L6LA 4I50A 3JARA 2YICA 4HZ3A 4F6EA 1PNLA 4PDMA 1K5SA 1V9PA 3DGEA 3OUFA 4IYIA 4GKJO 4JI5O 4O4HB 1BS3A 1F7YA 4B7EA 3LSQA 1N33O 2Y69C 1XBLA 3VQWA 4DR7B 4TQFA 4O2AB 3ASOB 1RM1B 4PHZA 1OCCC 3ZRWB 1N36B 3Q4HA 3QG5A 3ZBHA 4DUYB 2JJ2G 2AXTZ 2KG7A 4PV1B 2ADPA 4I4TA 1KUQA 4MVRA 3SGIA 2YC0A 4X64O 1T5EA 1VQ9V 3LDCA 1WP7A 3L9DA 1P7GA 5GONA 2QDOA 4JTCB 5LBQA 3FB5C 3GB7C 3G67A 4RQFA 2HVKC 4UV8A 4JI6B 2Q5ZA 5B1AC 5LA6A 2FTKA 2Y0PA 2UUBB 1XMOB 2W0XA 3I5DA 4DR6O 3CP1A 1M9NA 1W2BU 1XL4A 4DV3B 3KCYA 5E1AC 1Q3EA 1FXKB 2Z3YA 1NTKH 1K3EA 1XILA 2QJ1A 2EIJB 1XOUA 1S0VA 2UXXA 1E79G 2LGQA 5KHIA 3JCZA 5LMUO 2Q69A 4GLXA 1FJGO 2D2CB 2WLMA 2OCCB 3QO5A 1HR0B 2Q9LA 4NTXA 2NN4A 1BQ0A 1QVGU 3G80A 5B3SB 3J81N 2E5LO 1K34A 2BSKA 4LCUC 1U97A 2ILMA 1IXBA 5BR8O 2Y4TA 1NI8A 1L8DA 2UXDB 2JDIG 1S5LZ 1HW7A 3HKCB 1WP8A 1Q6IA 1YVWA 2HKOA 2KSDA 3SYAA 2XTAA 1QLEB 3BA9A 5EC1C 3BAAA 3ZHVA 3TJTA 2YXYA 3ZMVA 3RYFA 2WLKA 4WFEA 2VS0A 2E76B 3OFNG 3ABMC 4PD4F 1FXHA 4MVMA 1NTZH 4K0KO 5IY5C 2UUAB 4QGPA 4JI2B 2QM8A 3W7XA 2AHZA 3W7SA 4CH5A 1UPGA 3MHSC 4X62O 5BZBA 3B2EE 5D5PA 4LR3A 1K4CC 3SYCA 3LNMB 4P9OA 1AR1B 3ETEA 1K97A 2IW5A 1B3QA 3ZEDA 4QNHB 5LGUA 3B77A 1XNRO 2EJ7A 4P9PA 2QGNA 1AJQA 2JEUA 3ML0A 2QEXV 2A3QA 5CN0A 2EIMC 1AI4A 1YEWA 3NR7A 2NR5A 1P4RA 4JI8O 2EULA 3K5LA 3H01A 4NXNO 4LFCB 2Q8VA 2HLDG 3SDLA 3U11A 1CP9A 1V55B 4TUYB 4DR2B 1GRJA 1SC5B 4DV1B 4GKKO 2BOCC 4I7ZB 5B1OA 4JAVA 1AJNA 3ZMTA 2ZM6B 1I94B 5H5NA 1G6UA 2XAQA 2XAFA 3RWRD 1DGSA 2ETNA 4X65O 4TT3G 4JI7B 1VQNV 3BHPA 3F7YC 1J5EO 3T1YO 5BXZA 4JYBA 3AEIA 3OM3B 1BGYH 5AG2A 3SPJA 2UUCO 3KZIZ 1KKCA 3M99B 2QTSA 2LFRA 3RYCA 5IWAB 2HEPA 3JAWB 3K59A 2D3OW 3AK3A 1QBZA 2R70A 4DV4B 2DYSC 1URFA 4ASUG 1OJHA 3BPZA 4CZZA 1M56C 5HFLA 5KHJA 4U3JA 5GTHZ 3UM7A 1BL8A 4X9QA 1S5JA 3TCUA 2F4VB 1H2LA 4B3MB 3I56V 5C8YA 4YHHB 4LF5O 2QWNB 3S3XA 1NR1A 4LFBO 1N0NA 3DSQA 5B1AB 1FFTB 4DK1A 4CC6A 3JD0A 5EC2C 3MD0A 2UXCB 3IFXA 3RN4A 1EBOA 5KHGA 3LNNA 1QCEA 1GO3F 3K5NA 1MMMA 1IXMA 1SESA 2P7TC 1R73A 2N04A 3HR0A 2WLLA 3VOUA 4LF8B 1R3IC 4FLWA 1YCIA 1OZ0A 5JWPA 4D6TH 1NU1H 2EINB 4DR4O 4MT8A 3MAQA 4B3SO 1NBMG 3T1HO 3AG1C 5IT9N 3RT3C 1R6KA 4I50B 1YJ9V 3OEHG 3JARB 2F43G 3AK2A 3TXSA 3OT7A 3ZRVA 4Q20A 4DRXA 2W6IG 4QE9A 3STZC 1KC8W 1ROPA 5B1BB 5IJ0B 3K5OA 4LF6O 4QE7A 3WFVA 3RYIA 3GWOA 2QKCA 3FYIB 4Z1VA 3Q4HB 4WBNB 4UCOA 5EYPA 2KG7B 3J7AU 4KXRA 4LF9B 2B5UA 3DTUB 4DR5O 5JH7A 3CRCA 2RQ6A 4I4TB 4GUNA 1MSWD 1JPXA 1SA0A 4GCZA 3SJAC 5LXTA 4JI3B 5GONB 4GX2A 1Q7YW 1EN6A 1E1QG 2IJKA 3IC9A 2QM7A 3CEIA 1GAXA 1VQ4V 5LA6B 1DTOA 2EILC 1M93A 1EZJA 3ASOC 1RM1C 1PL0A 4MVSA 4PI2A 5CA1A 4QIWF 3CJHA 4R8CA 1MABG 1TUBB 4UCUA 2OYQA 3HKEA 1GM9A 3IGAC 1RSOA 5LHHA 3K58A 2CUGA 1SKVA 1GH6A 2H94A 2BTQB 3ZMSA 4XBFA 2DOSA 1G4YB 2L35A 3CRMA 2BSKB 2BTOA 2Q7GA 2ZCEA 4JI1B 3D36A 4DV5B 1CPYA 1PD3A 3B09A 3C90A 1HNWB 2KQXA 5HFMA 1FXKC 2ZE6A 3GVMA 1GMGA 3M7MX 4DR7O 4ZKIA 3RYFB 1N36O 1YZBA 1H8EG 2OCCC 1B06A 1VF6C 1K9MW 4J80A 4BW5A 4DUYO 2W0FC 4LBEC 4DV0B 1TVKA 1JMKC 5KHKA 5B3SC 4N23A 4LF4B 2BCCH 3QF7A 5H6QA 1TUEB 1BMFG 4O4JA 2AZ2A 4JI6O 1P84F 3FYEB 2UUBO 3E86A 1XMOO 3OUSA 3W7UA 2P5OA 1QLEC 1WB8A 4DV3O 1PV0A 5JJEB 4J11A 4DO2A 3ZRSA 4FPPA 4KUMA 3HKDB 1AR5A 3DXRA 1HR0O 1KD1W 4WF9V 4J7ZA 4PDRA 1SQBH 5B5EZ 5KAFZ 2Q67A 2WA4A 3HB3B 1ZLZA 4K8XA 5DM6V 2LP7A 1AR4A 2P4KA 2UXDO 2LGWA 3OR7C 1H8HG 1XNQB 3T4ZA 4DR1B 3JASA 1TGOA 4BIOA 1X59A 2P4VA 1Y76A 3OEEG 4IHJA 3C3SA 4WFBV 1UJWB 4JGSA 1K7DA 2IBZH 2QM4A 4YJ2A 2CGNA 2BE3A 3LDEA 1ZX3A 1XHZA 2ATKC 4X1IB 2QWRB 1N8RW 1V54C 1E1RG 5CBHA 3RYCB 2QR4A 3LSSA 3E22A 3JSNA 2A06H 2UUAO 4JI2O 1RPRA 1HP8A 3G71V 3JD1A 1K4DC 4O2BA 1H2GA 4FMTA 4X1YB 2YIAA 5L3FA 1Y6XA 3AG4B 4U3JB 1AP5A 3TETA 1H38A 3OR6C 4GX0A 4JI0B 5C8YB 2P6JA 4K35A 3CHXA 3T1CA 2JJ1G 4X20B 3ZJZA 4EKWA 4JI4B 1SQVH 2CK3G 1QHTA 4BAYA 2F93B 5BMVB 4IYHA 3N27A 1R6NA 1RFYA 5LMNB 4DV7B 2EILB 3E2EA 3FAVA 3N2KA 4RAIA 1HWYA 1JJOA 4FLZA 1YJWV 1KYOF 1L0NH 4D7TA 2RDCA 2R9IA 4IIJA 1WB7A 2Y0IA 2YSUB 4B3RB 4ZOLA 4AILC 4LFCO 2WLLB 2VWJA 3B4SA 4U7NA 5JJNB 1EN5A 5EBMC 4DR2O 1Z5VA 3ZHSA 3CC2V 3L71H 4DV1O 3NXSA 2OTLV 4NXMB 3QTCA 1YITV 4GT1A 4TQDA 1F51A 5KX5A 1YF2A 2ZM6O 1I94O 2CDYA 3G4SV 5GTIZ 2FB5A 1YSCA 2JIZG 1IZ3A 2ZR2A 4JI7O 4I0XA 4X88A 1S3JA 1S72V 1ORQC 3L72H 2UU9B 1K92A 5LL6Y 5LP6C 5IWAO 1NVPD 5EZYA 1R6TA 1GKFA 4ZHQB 4H33A 2HJFC 2WPDG 3RYIB 1SQFA 5IDJA 4DV4O 2EINC 3X2QC 3ABKB 3SJQC 2IJIA 2X6CA 2DN9A 4O4LA 1FFXB 1VMGA 3IAYA 2ZDIA 2F4VO 2PYJA 4B3MO 4Z1MG 4YHHO 2YXLA 5JH7B 5DEDA 2VQFB 1VQ8V 1SA0B 1SF9A 2YS8A 2YI9A 1THZA 3CE2A 5ITZA 2UXBB 1WLEA 2IU0A 2N74A 4EB6A 2UXCO 4MVUA 3CMEV 3ABUA 5B1BC 2CAZC 4HYOA 2YIBA 3R66A 3CC7V 4UXNA 1N34B 1LNQA 1PNKA 2GBOA 1SQXH 4LF8O 3F5WC 5L3DA 2CTRA 3BFRA 3CJHB 2YEVA 3K79A 1M1KW 4Q6GA 5CBFA 4BR6A 4NTYA 3HKEB 2FL4A 1RSOB 3TGUH 5J2TA 2LFSA 1IBLB 3APOA 3BRCA 5LOVB 5E79Z 2R72A 1NZ6A 2IU3A 3JATA 4WFGA 2ZNJA 2JRIA 1WA8B 2G38A 3ETGA 2F23A 1NR7A 4G28B 3W7TA 5KLVH 4NTWA 3QO7A 3THOA 2F1MA 5KUKA 2M6YA 5KA5A 1O9HA 4CH4A 1S5HC 1XL6A 2LW7A 1MOFA 2YUAA 1FAFA 3CRAA 1V54B 1GN6A 1KQSU 5JQGA 3UO2A 4TV9A 5L3BA 4J7KA 2PUSA 4U7OA 4CH3A 4FM1A 4LH6A 1GN2A 3CX5F 2OT5A 4LF9O 3FKSG 5J2UA 2PI4A 1L1FA 4XDJA 1VQ7V 4JI3O 3KG2A 2P06A 5IYCO 1Q81W 4O4JB 4PJ0Z 3A8TA 4FM2A 2ZE7A 3CD6V 1PM9A 3SJCC 1ZTEA 3CCUV 3H1IH 3RVYA 2PTMA 4RWUA 3JAMN 3AG2C 3OMIB 4I55B 5IJ9A 4UB8Z 4DYLA 2VQEB 1K5QA 5TISZ 3B8NA 2DWDC 3DXRB 1AROP 2HHHB 2LQTA 2ZIOA 2LJ2A 1WNSA 5J9PC 1P49A 2WAMA 4FJCC 3G6EV 4B3TB 1F4MA 2YIDA 4OX9B 4CS3A 4K8ZA 4JI1O 1JCHA 4DV5O 2NNUA 2GDSA 1BE3H 3CCLV 1HNWO 2DMXA 1Y74A 1OHHG 1N32B 1NS1A 3JASB 5JCOA 1H2NA 2DE0X 1Y76B 3SYOA 4IHJB 1VARA 3AK1A 1CXZB 4NR1A 3ABTA 2M7WA 4YJ2B 5LP6B 3OW2U 3BEHA 1Y4MA 4MVOA 4DV0O 4H44B 1KBHA 2ODMA 2XAJA 3E83A 4WFFA 3UKMA 4ABMA 3X2QB 2HJDA 4LF4O 1W0JG 4ZI7A 4FVMA 4W4LA 1X4TA 4NB5A 1JFFB 1M5IA 3ETQA 3FD9A 4JPRA 2OTJV 2EZPA 3OTOB 1NVPB 2QE7G 3CYOA 3E35A 2WLIA 1YXBA 3BA8A 1EFRG 4AHCA 5C93A 1Q86W 3BABA 3U0ZA 4QPKA 3SYPA 1EM1A 1HNXB 2GUZA 2HG5C 3H1KH 5H2FZ 1M90W 2CH7A 5CA0A 1R3KC 5K1PA 2GTSA 3CCJV 4EFBA 2GHYA 4E2LA 3FAVB 3N2KB 2EIKB 1AB3A 3RVZA 4JV5B 3ZHTA 3QVNA 3FFQA 4IIJB 2OIEA 2WLNA 5EBWC 4ZOLB 4PA9A 4EEQA 4RUEA 3AG4C 3P32A 1KB9F 3CCMV 2CTQA 1SQQH 3K57A 2LO1A 1XHXA 1AI6A 2R9AA 3BCCH 2XHBA 1XNQO 1FS0G 4IGGA 4DR1O 2JVDA 3JAKA 1JVMA 3SPCA 5LHGA 2ZKOA 1VQMV 2P90A 1DK1A 4MVQA 3N2GA 4I0XB 1WJZA 3H9VA 1YHQV 4UVAA 3E89A 3RFRA 1XEQA 3HKCA 2P22C 1QR8A 4DW1A 2ZR3A 2ITDC 1S76D 2K1EA 3SPHA 4R7CA 3ZRXA 2X6AA 4UVBA 4CS2A 1WPBA 5JVDA 1YIJV 1DF4A 3CCSV 3P30A 5LYJA 2XAGA 2R9RB 4TOIA 4JI0O 2EX3A 3RW0A
chains in the Genus database with same CATH topology
2WLKA 1VQPV 4WFEA 5CBGA 3ETDA 3JD1A 1K4DC 3G71V 1H2GA 4MW8A 3OFNG 5L3GA 4FMTA 3ABMC 5L3FA 4TWKA 3AG4B 5H6RA 3TETA 1FXHA 1H38A 4MVMA 1G8MA 3OR6C 3K3WA 4WCEV 5IY5C 5CA3A 3CC4V 2V1DA 4GX0A 1NJIW 2P6JA 3WG7B 2QM8A 3W7XA 2AHZA 3T1CA 1Q82W 2JJ1G 3ZRWA 2DQ3A 3W7SA 2ZXWB 3ZJZA 4EKWA 4WFHA 2CK3G 3AG2B 3MHSC 1JQ0A 3K03A 4BAYA 5BZBA 1OCOB 3ABKC 3ZN0A 1R6NA 3E2EA 2EILB 1NKDA 4RAIA 5EBLC 1HWYA 4G27B 1YJWV 4UVCA 1K4CC 2YEVB 4JTAB 3SYCA 3LNMB 1YTFD 2KB1A 4P9OA 3ABLC 1AR1B 3ETEA 5H9CA 1K97A 2R9IA 1PNMA 2A0LA 2BOBC 2DW4A 2IW5A 3SPIA 2YSUB 4PA3A 4QNHB 5LGUA 3B77A 3K08A 2WLLB 4P9PA 5LHIA 1BHBA 4U7NA 1AJQA 5EBMC 3B8MA 2JEUA 3ML0A 3SYQA 2QEXV 5CN0A 2H8PC 2EIMC 4JAUA 3CC2V 1AI4A 3NXSA 2OTLV 4RQEA 1YITV 2HR3A 4GT1A 1F51A 2V7QG 1P4RA 1FXKA 4WFAV 3H01A 3ASNC 3OMNB 3TK1A 3CXCU 4PA6A 3VBBA 2HLDG 3G4SV 1VQ6V 5GW7A 3OAAG 3K0GA 4MVZA 1YSCA 4GX5A 4XDLA 2JIZG 1VQLV 1CP9A 2ZR2A 1V55B 3ZMUA 2JEXA 4X88A 1KP2A 1S3JA 2BOCC 1S72V 5B1OA 4JAVA 1ENVA 1ORQC 3ABMB 1AJNA 3ZMTA 1K92A 2XAQA 5IY5B 4J9YB 2XAFA 1W0KG 1NVPD 1VQKV 2EBOA 2XAHA 4TT3G 5L3EA 1VQNV 1GKFA 4H33A 5KA6A 3F7YC 4PA4A 1JOYA 2WPDG 2HJFC 2WLHA 3CCEV 5IDJA 2EINC 3X2QC 4JYBA 3CMAV 3ABKB 3SJQC 2DQ0A 3AEIA 3OM3B 3SPJA 2IH1C 2IJIA 2X6CA 2AHYA 4FIPC 3OGCC 3M99B 2LFRA 4PDLA 2QKSA 2ZDIA 1NH2D 5EK0A 2D3OW 4Z1MG 1DF5A 4N21A 1QBZA 3OMAB 4OXSA 3W7WA 1OCZC 1VQ8V 2DYSC 2EJRA 3E8BA 4ASUG 4HAMA 4BIUA 4RO2A 1THZA 4CZZA 1M56C 1I5YA 5HFLA 4MS2A 1OCRC 2EZOA 3E8GA 2IJHA 1WLEA 3UM7A 1BL8A 2IU0A 1YTFB 4JTDB 2EIMB 1SERA 3TCUA 1Y66A 4MTOA 4UV9A 4MVUA 1KECA 3CMEV 3ABUA 3I56V 4MTGA 5B1BC 2ZD9A 4HYOA 3OE7G 3CC7V 1MG1A 3RBZA 1NR1A 1R3JC 1SZTA 4UXNA 3T4DA 2X0LA 3ASNB 2XNDG 3IC7A 1LNQA 1PNKA 1DLBA 2MK3A 3QO8A 5B1AB 3CPWU 3T2MA 3F5WC 1QR9A 5L3DA 1FFTB 3JD0A 5EC2C 2YEVA 3K79A 2ZQMA 2Z5UA 3IFXA 3E8HA 3MD0A 1VQOV 2XOKG 1M1KW 5CBFA 1VQ5V 2IH3C 1CEZA 4H37A 1EBOA 1JJ2U 1F4NA 1QCEA 1GO3F 3CCQV 4QPJA 3CCVV 1IXMA 1SESA 2P7TC 3AG3C 2WSSG 2LFSA 1R73A 1GK9A 2WLLA 3VOUA 2Y48A 1R3IC 1GM7A 2IU3A 1OZ0A 4WFGA 1GTOA 1K8AW 1WPXA 2EINB 4MTXA 5B1NA 2QA4V 1AI5A 2EIJC 3ETGA 2GSMB 1NR7A 1AJPA 4G28B 3A0RA 4MT8A 3K06A 3W7TA 3LUTB 3PJSK 3QO7A 1NBMG 4R6ZA 4KP4A 3JYCA 1M57B 3AG1C 1QVFU 5KUKA 4MTFA 5KA5A 2QTOA 2XASA 4TSFG 1R6KA 1S5HC 2A79B 1YJ9V 1XL6A 3OEHG 1OCZB 2DYSB 2F43G 3EHBB 1MOFA 4I9WA 3QNEA 3ZRVA 1M56B 1KKDA 4Q20A 1OCRB 1V54B 4DXWA 2ITCC 1K33A 1NH2B 1KQSU 2W6IG 4QE9A 3STZC 1KC8W 3EFFK 5L3BA 2IJJA 1ROPA 2WLIB 4U7OA 5B1BB 2OT5A 3FKSG 4QE7A 3WFVA 4QJFB 2DYRC 3GWOA 1QLNA 2PI4A 4PDVA 1L1FA 4X8AA 3FYIB 4XDJA 1VQ7V 3ZIAG 2HVJC 2PI5A 3KG2A 1COWG 5IYCO 1Q81W 4YXWG 4MW3A 1JX9A 3FB6C 4P2ZA 3CD6V 4F4LA 2B5UA 3DTUB 4UUJC 1MSWD 1JPXA 3AG3B 4PELA 3CCUV 4GCZA 1K73W 3RVYA 1ZWIC 4JASA 3ZMZA 4GX2A 4CBCA 4L87A 3ZCCA 1Q7YW 1E1QG 2IJKA 3AG2C 3OMIB 2P67A 1OCOC 2QM7A 1VQ4V 2X6BA 1DTOA 2EILC 3ABLB 1K5QA 1EZJA 1GM8A 3B8NA 3K04A 2C2AA 1RPOA 2DWDC 1AROP 3AG1B 3ASOC 1RM1C 1R3LC 1PL0A 4MVSA 5J9PC 3HPLC 4QIWF 4R8CA 2WAMA 1I5XA 1MABG 4FJCC 3G6EV 1F4MA 5DN6G 1GM9A 3IGAC 4XDKA 5LHHA 1JCHA 2EIKC 2NNUA 2H94A 3STLC 2Q68A 3CCLV 1B6QA 1OHHG 5CMUA 3ZMSA 4XBFA 2B1IA 3R65A 2DYRB 2JK5C 3D3IA 1G4YB 2WLJA 3SYOA 3JD2A 1NQTA 3ABTA 4KFMA 1V55C 2M7WA 3D36A 1CPYA 1S77D 3F7VC 1KP3A 2Q6AA 1PD3A 3OW2U 3BEHA 1Y4MA 4MVOA 3JD3A 2W6JG 5HFMA 2A9HA 5FL7G 4J9ZB 4LC1A 1FXKC 2XAJA 1GMGA 5IYDO 3E83A 4WFFA 3UKMA 3X2QB 4HZ3A 1W0JG 1PNLA 4PDMA 4ZKIA 4BIZA 1K5SA 3DGEA 4JPRA 2OTJV 2EZPA 3OUFA 1NVPB 1BHAA 2QE7G 1H8EG 3CYOA 2OCCC 4JF3A 4PA7A 1K9MW 3E35A 2NLJC 4BW5A 2WLIA 3CCRV 2W0FC 4LBEC 3LSQA 3BY6A 1EFRG 3LDDA 2Y69C 5B3SC 5C93A 1Q86W 3I55V 4QPKA 4N23A 3ASOB 3FB8C 3SYPA 1RM1B 1OCCC 2HG5C 3K0DA 1TUEB 5H6QA 3ZRWB 3ZN1A 1M90W 1BMFG 1J95A 1R3KC 2JJ2G 4RUFA 5L3CA 3CCJV 2HFEC 2GHYA 5IYBO 4E2LA 3FYEB 3E86A 3OUSA 3W7UA 2EIKB 4MVRA 2ZDIC 1FXVA 1QLEC 1VQ9V 3RVZA 3LDCA 4R50A 4JTCB 4MSWC 2X7RB 5LBQA 2WLNA 1SRYA 3FB5C 3GB7C 3MHHC 4PA9A 5EBWC 4DO2A 4RQFA 2HVKC 4UV8A 4RUEA 3AG4C 4I5SA 5B1AC 4FK5C 2FTKA 3ZRSA 3P32A 4FPPA 4KUMA 3CP1A 3JD4A 1M9NA 3CCMV 1YI2V 1W2BU 4GX1A 1XL4A 1KD1W 4WF9V 3WG7C 4PDRA 5E1AC 1AI6A 1FXKB 1FS0G 2ZXWC 2Z3YA 1AI7A 1K3EA 1JVMA 3SPCA 1F23A 2EIJB 2Q67A 5LHGA 3HB3B 1VQMV 1S0VA 2P90A 2UXXA 1E79G 4G2KA 1SETA 3JCZA 1PKXA 2Q69A 4MVQA 5DM6V 2LP7A 2WLMA 2OCCB 3QO5A 4UVAA 1YHQV 3E89A 1YJNV 3E8FA 1P7BA 3OR7C 1H8HG 4ZBMA 1QVGU 3K9AA 3T4ZA 2B1GA 2Y69B 5B3SB 1QR8A 1M57C 2ZR3A 3OEEG 2ITDC 4WFBV 1K34A 1S76D 1UJWB 2K1EA 1OCCB 4JGSA 1K7DA 4JYCA 4LCUC 3SPHA 4R7CA 2DWEC 3ZRXA 2WWWA 2X6AA 3FB7C 4UVBA 3LDEA 2JDIG 2ATKC 1YIJV 1DF4A 5KUMA 3SPGA 1N8RW 2HKOA 1V54C 1E1RG 2UXNA 5CBHA 3CCSV 5LGTA 3LSSA 4X89A 3P30A 3SYAA 2XAGA 2R9RB 1QLEB 4P30A 1RPRA 5EC1C 3RW0A 4LP8A 3ZMVA 5LGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  5CN0 A;  1K34 A;  1MG1 A;  1Y4M A;  1SZT A;  4JGS A;  5HFM A;  4N23 A;  1MOF A;  1DF5 A;  1F23 A;  4N21 A;  1DLB A;  1QBZ A;  2MK3 A;  2X7R B;  3H01 A;  3MHH C;  3B8N A;  1QR9 A;  1K33 A;  2EBO A;  4G2K A;  1DF4 A;  5CMU A;  2LP7 A;  4FK5 C;  5H9C A;  5KA6 A;  1I5Y A;  5HFL A;  2P6J A;  2EZO A;  1JPX A;  3CP1 A;  1EBO A;  4JPR A;  3P30 A;  2EZP A;  3B77 A;  4E2L A;  3K9A A;  1QCE A;  3CYO A;  4JF3 A;  2OT5 A;  1Y66 A;  5KA5 A;  4FIP C;  3WFV A;  1I5X A;  3MHS C;  2M7W A;  1JQ0 A;  1QR8 A;  3M99 B;  4FJC C;  3GWO A;  1ENV A; 
#chains in the Genus database with same CATH topology
 4F6R A;  1IBM B;  4JI4 O;  3ETD A;  5L3G A;  5H6R A;  5LMN O;  4DV7 O;  5ITZ B;  3K3W A;  4WCE V;  3UCS C;  5CA3 A;  4EB6 B;  4DUZ B;  1NJI W;  2ARH A;  3WG7 B;  2B9Z A;  5FPR A;  1Q82 W;  2ZXW B;  4DV6 B;  3AG2 B;  1SQG A;  3ABK C;  4B3R O;  1NKD A;  2AW9 A;  5EBL C;  2F66 C;  4G27 B;  2IM9 A;  1AVM A;  2YEV B;  4JTA B;  4NXM O;  2KB1 A;  2RNB A;  3RYH A;  3ABL C;  1VF7 A;  1PNM A;  3SPI A;  2DW4 A;  2PY5 A;  3OTF A;  1MZF A;  4FFK A;  5LHI A;  4TUY A;  1QU7 A;  3JAT B;  3B8M A;  3SYQ A;  4DK0 A;  2H8P C;  3PN1 A;  3CB2 A;  2HR3 A;  3J80 N;  2UU9 O;  3CRR A;  4WFA V;  1LUW A;  3OMN B;  3TK1 A;  3CXC U;  4PA6 A;  1VQ6 V;  3OAA G;  4MVZ A;  4GX5 A;  4XDL A;  1VQL V;  3C3T A;  3ZMU A;  1LR1 A;  4FLT A;  4CC5 A;  1KP2 A;  4DR3 B;  3RGB A;  1ENV A;  2ADQ B;  4ICG A;  2Q7H A;  5JQG B;  1HNZ B;  3DC6 A;  1BSM A;  3JAW A;  5L3E A;  2ZIN A;  4PA4 A;  1JOY A;  1WAZ A;  2VQF O;  5J2U B;  2DQ0 A;  1ZL8 A;  3D36 C;  4FIP C;  1BZK A;  3OGC C;  2UXB O;  1FD9 A;  5KAI Z;  1D5A A;  2HP8 A;  4LNU A;  1DF5 A;  3K5M A;  4N21 A;  3AG7 A;  5FNV A;  2EJR A;  2O57 A;  3K9S A;  1N34 O;  4HAM A;  1L0L H;  3MDS A;  4RO2 A;  4BIU A;  2OCH A;  1I5Y A;  1BQZ A;  2EZO A;  2IJH A;  4YY3 B;  1YTF B;  1SER A;  1QQC A;  2E75 B;  5IJ9 B;  1NT2 B;  5KHH A;  1MG1 A;  1R3J C;  3IJ4 A;  2VRZ A;  3T4D A;  3ASN B;  2XND G;  1ZAU A;  1DLB A;  2MK3 A;  3D3Q A;  3QO8 A;  1IBL O;  3CPW U;  4O4I A;  3T2M A;  3GWK C;  3SR2 C;  2Z5U A;  2QKA A;  2ZQM A;  1VQO V;  2XOK G;  3L73 H;  2IH3 C;  4X66 B;  1CEZ A;  1JJ2 U;  1F4N A;  4JZ2 A;  3CCQ V;  1Q8I A;  4LF7 B;  1FPO A;  4QPJ A;  3EXA A;  4ZIB A;  2WSS G;  1XMQ B;  4PI0 A;  1Y74 B;  1GM7 A;  2PZS A;  2JS5 A;  1K8A W;  1WPX A;  4MTX A;  1AI5 A;  2JGU A;  3F5T A;  4FZ0 A;  1A32 A;  2Y4U A;  3LUT B;  4UCR A;  1IBK B;  4H13 B;  4KP4 A;  2XUM A;  1H2S B;  4A5U B;  1IVS A;  4TV8 A;  4NYK A;  5IJ0 A;  5K1X A;  4B08 A;  1H2K A;  2Q7E A;  1OCZ B;  3L75 H;  3EHB B;  4I9W A;  4ZI7 B;  3QNE A;  1KKD A;  1OCR B;  1K33 A;  4WBN A;  1NH2 B;  1B04 A;  3EFF K;  4YJ3 A;  4AI8 A;  4KL1 A;  2IJJ A;  2WLI B;  1Z5W A;  3UO3 A;  4QJF B;  4NVP A;  1QLN A;  3JAL A;  4PDV A;  5CB4 A;  2HVJ C;  2GUZ B;  4GYC B;  4FLU A;  2PI5 A;  4DRX B;  2CH7 B;  5CA0 B;  4AQY B;  3JCU Z;  1COW G;  4MW3 A;  4YIO A;  4JYA B;  2VQE O;  2PF4 E;  3OGI B;  4UUJ C;  2YXH A;  4LFA B;  3AG3 B;  1K73 W;  1ZWI C;  2HHH O;  2AZ0 A;  3ZMZ A;  4CBC A;  4L87 A;  3ZCC A;  3LSU A;  1TUB A;  1OCO C;  5EYP B;  4DV2 B;  4B3T O;  1XRE A;  3ABL B;  4FLX A;  4OX9 O;  2H3O A;  1IUR A;  1GM8 A;  5A9G A;  4NKG B;  2C2A A;  1RPO A;  5LXT B;  2BTQ A;  1GN3 A;  3P3N A;  1XDC A;  4HBN A;  4W4K A;  1N32 O;  3HPL C;  5IYZ A;  3JAK B;  1I5X A;  5DN6 G;  4XDK A;  2JS3 A;  1BCC H;  3N2G B;  2EIK C;  4OGQ B;  3STL C;  2Q68 A;  5CA1 B;  5CMU A;  3UT5 A;  1Q43 A;  3CSX A;  3B40 A;  2DYR B;  2JK5 C;  3APQ A;  1NQT A;  2E74 B;  3HKB A;  4KFM A;  4HNA A;  1TAE A;  2DJV A;  2FKX A;  2Q6A A;  1QNM A;  3OTO O;  5JVD B;  3TXQ A;  3JD3 A;  2W6J G;  4KHP B;  2A9H A;  3S3W A;  5FL7 G;  4OPH A;  4LC1 A;  2RMK B;  5IYD O;  5LYJ B;  4E4E A;  2OWO A;  4BIZ A;  1FYJ A;  2RCV A;  1HNX O;  3ZX6 A;  4F6R B;  2ZNI A;  1BHA A;  1EN4 A;  4PA7 A;  4JF3 A;  2NLJ C;  5KMG A;  3CCR V;  3M8A A;  3DC5 A;  3BY6 A;  3H1J H;  3LDD A;  1VF5 B;  1Q6U A;  3H1L H;  1OV9 A;  3I55 V;  3A2F A;  3WB2 A;  3FB8 C;  3K0D A;  3ZN1 A;  4JV5 O;  2FML A;  4GKJ B;  4JI5 B;  2AGA A;  1J95 A;  4RUF A;  5L3C A;  2HFE C;  2OIG A;  1N33 B;  5IYB O;  1JA8 A;  1TVK B;  2Q4P A;  4CH6 A;  3HKD A;  2ZDI C;  1FXV A;  2YI8 A;  1N4C A;  4X1K A;  4DW0 A;  4R50 A;  3RYH B;  3CXH F;  2JGD A;  3A0H Z;  4MSW C;  1G1X B;  2X7R B;  2YIB D;  4FFB A;  1SRY A;  3MHH C;  1M4U A;  4I5S A;  4FK5 C;  4UB6 Z;  1US6 A;  3WU2 Z;  1XUQ A;  3JD4 A;  1YI2 V;  4X64 B;  5FLX N;  4GX1 A;  3KKY A;  3WG7 C;  1MSD A;  2PYL A;  4J42 A;  2ZXW C;  1AI7 A;  2RJZ A;  1F23 A;  5JJJ B;  2QWP B;  4DR6 B;  4LWS A;  4G2K A;  1SET A;  2CTP A;  1PKX A;  1YDX A;  1YJN V;  3E8F A;  1P7B A;  3P3P A;  4X1I A;  4ZBM A;  3K9A A;  2B1G A;  2Y69 B;  1MNG A;  1M57 C;  4BWA A;  1OCC B;  5LMU B;  3BVO A;  4JYC A;  3U10 A;  2DWE C;  2WWW A;  3H1H H;  1FJG B;  3FB7 C;  1IBM O;  1WN7 A;  4X1Y A;  2Q73 A;  1ZL8 B;  4JAA A;  5KUM A;  3SPG A;  4EFE A;  2UXN A;  5LGT A;  4X89 A;  2E5L B;  4DUZ O;  4P30 A;  4LNU B;  4LP8 A;  5LGN A;  5BY1 A;  4X20 A;  1VQP V;  5BR8 B;  5FNV B;  5CBG A;  4DV6 O;  4O4H A;  2E3C A;  2CE4 A;  4MW8 A;  5BMV A;  1AP6 A;  4TWK A;  1R1B A;  3E22 B;  1G8M A;  4FZ1 A;  3CC4 V;  4O2A A;  2V1D A;  1KMI Z;  2ZE8 A;  3ZRW A;  2DQ3 A;  1MA1 A;  1N0J A;  4WFH A;  1JQ0 A;  3K03 A;  4O2B B;  1OCO B;  5D5Q A;  3SJB C;  3ZN0 A;  4Z2W A;  2KKW A;  1Q5O A;  4O4I B;  4K0K B;  4H0L B;  4UVC A;  2Q0O C;  1YTF D;  1I0H A;  5H9C A;  2A0L A;  2BOB C;  4X62 B;  4PA3 A;  4J7J A;  3K08 A;  1BHB A;  1IX9 A;  1KU9 A;  2V4D A;  2N05 A;  5EIB D;  4JAU A;  4DR3 O;  4RQE A;  3WB0 A;  2A7W A;  1PP9 H;  2V7Q G;  1EZV H;  2Q0A A;  2YDE A;  3WB1 A;  1FXK A;  2RN9 A;  3ASN C;  3VBB A;  1XNR B;  5GW7 A;  3O65 A;  4CS4 A;  3K0G A;  1HNZ O;  4TV8 B;  3ICX A;  5EIB C;  1RP3 B;  1D2D A;  3O9O A;  2JEX A;  4ZHQ A;  1VF6 A;  3OD4 A;  3ABM B;  4JI8 B;  5KX5 B;  4NXN B;  1FFX A;  5IY5 B;  4YJ3 B;  3CRQ A;  4J9Y B;  1W0K G;  1D5N A;  1VQK V;  2QWQ B;  2EBO A;  2XAH A;  3CS5 A;  1Q90 D;  1LUV A;  1UFI A;  5KA6 A;  4GKK B;  5JCO C;  2WLH A;  3CCE V;  3CMA V;  1SQP H;  3JAL B;  5CB4 B;  2IH1 C;  1PPJ H;  2AHY A;  1O9G A;  1NTM H;  3ZHU A;  4FLV A;  4UFZ A;  4YY3 O;  4PDL A;  2ZE5 A;  2QKS A;  1XI1 A;  1NH2 D;  5EZY B;  4X65 B;  5EK0 A;  4J41 A;  1VP7 A;  1J5E B;  3T1Y B;  3OMA B;  4OXS A;  3W7W A;  1OCZ C;  4GZR B;  3E8B A;  2UUC B;  4JZG A;  2XT9 A;  4BW9 A;  4MS2 A;  1OCR C;  4O4L B;  3E8G A;  1H2M A;  5FPO A;  4JTD B;  2EIM B;  1Y66 A;  4MTO A;  4UV9 A;  1KEC A;  4MTG A;  4X66 O;  2ZD9 A;  1ZSP A;  1PL4 A;  3OE7 G;  2PGG A;  2GTA A;  3RBZ A;  4LF7 O;  1SZT A;  2X0L A;  3FX7 A;  3IC7 A;  5LOV A;  3UQ8 A;  1XMQ O;  1XQ8 A;  1JR9 A;  1Y67 A;  1QR9 A;  2QWO B;  5IYZ B;  2ZT9 B;  3E8H A;  1VQ5 V;  4LF5 B;  4H37 A;  1WA8 A;  4B7K A;  1HDJ A;  4LFB B;  3CCV V;  1Z2G A;  3AG3 C;  1IBK O;  4UCT A;  3A0B Z;  1GK9 A;  2Y48 A;  2VWK A;  3UT5 B;  2LW1 A;  5DEC A;  1GTO A;  2CGO A;  5B1N A;  2QA4 V;  2EIJ C;  3VQV A;  2GSM B;  3HKB B;  1AJP A;  3A0R A;  4HNA B;  3K06 A;  4UCS A;  3PJS K;  5J2T B;  3ZHQ A;  1VIB A;  4R6Z A;  1I7F A;  3JYC A;  1M57 B;  1BT8 A;  3CWB H;  1QVF U;  4MTF A;  4JYY A;  4D7S A;  2QTO A;  2XAS A;  4TSF G;  2A79 B;  2GV9 A;  3VQX A;  3VQY A;  5IE9 A;  2DYS B;  3EVK A;  4OPA A;  1W59 A;  4DR4 B;  1M56 B;  3KCX A;  4B3S B;  3L74 H;  4DXW A;  1MZE A;  2ITC C;  1IDS A;  4AQY O;  3T1H B;  3L70 H;  5KMG B;  4JYA O;  2DYR C;  1U96 A;  1TA8 A;  4LFA O;  3JSL A;  4X8A A;  3ZIA G;  1AIL A;  2K9P A;  4K3A A;  4YXW G;  4TV9 B;  1JX9 A;  3FB6 C;  4I55 A;  4P2Z A;  4DV2 O;  4LH7 A;  4F4L A;  4LF6 B;  4PEL A;  4C7U A;  4X1K B;  4IL6 Z;  4YIP A;  1I08 A;  1VEW A;  4JAS A;  5B66 Z;  2JGD B;  1SS3 A;  4FFB B;  1SZX A;  1FKA O;  2P67 A;  2X6B A;  4DR5 B;  4U3F H;  2F95 B;  3G6B A;  2ZIM A;  4FLY A;  3K04 A;  5A2Q N;  2WA3 A;  3AG1 B;  1R3L C;  3D8C A;  3ZHR A;  2FYU H;  4UCV A;  2CTW A;  4I9Q A;  1Q6H A;  4IT5 A;  4LWS B;  2Z0A A;  5LP6 A;  4FM0 A;  2QSA A;  4J10 A;  4KHP O;  1GN4 A;  1B6Q A;  3ZS8 C;  4L8J A;  2B1I A;  3R65 A;  3D3I A;  2WLJ A;  2MW2 B;  3JD2 A;  1V55 C;  1JFF A;  1S77 D;  3F7V C;  1KP3 A;  5F2V O;  1ZUQ A;  4J9Z B;  2L6L A;  4I50 A;  3JAR A;  2YIC A;  4HZ3 A;  4F6E A;  1PNL A;  4PDM A;  1K5S A;  1V9P A;  3DGE A;  3OUF A;  4IYI A;  4GKJ O;  4JI5 O;  4O4H B;  1BS3 A;  1F7Y A;  4B7E A;  3LSQ A;  1N33 O;  2Y69 C;  1XBL A;  3VQW A;  4DR7 B;  4TQF A;  4O2A B;  3ASO B;  1RM1 B;  4PHZ A;  1OCC C;  3ZRW B;  1N36 B;  3Q4H A;  3QG5 A;  3ZBH A;  4DUY B;  2JJ2 G;  2AXT Z;  2KG7 A;  4PV1 B;  2ADP A;  4I4T A;  1KUQ A;  4MVR A;  3SGI A;  2YC0 A;  4X64 O;  1T5E A;  1VQ9 V;  3LDC A;  1WP7 A;  3L9D A;  1P7G A;  5GON A;  2QDO A;  4JTC B;  5LBQ A;  3FB5 C;  3GB7 C;  3G67 A;  4RQF A;  2HVK C;  4UV8 A;  4JI6 B;  2Q5Z A;  5B1A C;  5LA6 A;  2FTK A;  2Y0P A;  2UUB B;  1XMO B;  2W0X A;  3I5D A;  4DR6 O;  3CP1 A;  1M9N A;  1W2B U;  1XL4 A;  4DV3 B;  3KCY A;  5E1A C;  1Q3E A;  1FXK B;  2Z3Y A;  1NTK H;  1K3E A;  1XIL A;  2QJ1 A;  2EIJ B;  1XOU A;  1S0V A;  2UXX A;  1E79 G;  2LGQ A;  5KHI A;  3JCZ A;  5LMU O;  2Q69 A;  4GLX A;  1FJG O;  2D2C B;  2WLM A;  2OCC B;  3QO5 A;  1HR0 B;  2Q9L A;  4NTX A;  2NN4 A;  1BQ0 A;  1QVG U;  3G80 A;  5B3S B;  3J81 N;  2E5L O;  1K34 A;  2BSK A;  4LCU C;  1U97 A;  2ILM A;  1IXB A;  5BR8 O;  2Y4T A;  1NI8 A;  1L8D A;  2UXD B;  2JDI G;  1S5L Z;  1HW7 A;  3HKC B;  1WP8 A;  1Q6I A;  1YVW A;  2HKO A;  2KSD A;  3SYA A;  2XTA A;  1QLE B;  3BA9 A;  5EC1 C;  3BAA A;  3ZHV A;  3TJT A;  2YXY A;  3ZMV A;  3RYF A;  2WLK A;  4WFE A;  2VS0 A;  2E76 B;  3OFN G;  3ABM C;  4PD4 F;  1FXH A;  4MVM A;  1NTZ H;  4K0K O;  5IY5 C;  2UUA B;  4QGP A;  4JI2 B;  2QM8 A;  3W7X A;  2AHZ A;  3W7S A;  4CH5 A;  1UPG A;  3MHS C;  4X62 O;  5BZB A;  3B2E E;  5D5P A;  4LR3 A;  1K4C C;  3SYC A;  3LNM B;  4P9O A;  1AR1 B;  3ETE A;  1K97 A;  2IW5 A;  1B3Q A;  3ZED A;  4QNH B;  5LGU A;  3B77 A;  1XNR O;  2EJ7 A;  4P9P A;  2QGN A;  1AJQ A;  2JEU A;  3ML0 A;  2QEX V;  2A3Q A;  5CN0 A;  2EIM C;  1AI4 A;  1YEW A;  3NR7 A;  2NR5 A;  1P4R A;  4JI8 O;  2EUL A;  3K5L A;  3H01 A;  4NXN O;  4LFC B;  2Q8V A;  2HLD G;  3SDL A;  3U11 A;  1CP9 A;  1V55 B;  4TUY B;  4DR2 B;  1GRJ A;  1SC5 B;  4DV1 B;  4GKK O;  2BOC C;  4I7Z B;  5B1O A;  4JAV A;  1AJN A;  3ZMT A;  2ZM6 B;  1I94 B;  5H5N A;  1G6U A;  2XAQ A;  2XAF A;  3RWR D;  1DGS A;  2ETN A;  4X65 O;  4TT3 G;  4JI7 B;  1VQN V;  3BHP A;  3F7Y C;  1J5E O;  3T1Y O;  5BXZ A;  4JYB A;  3AEI A;  3OM3 B;  1BGY H;  5AG2 A;  3SPJ A;  2UUC O;  3KZI Z;  1KKC A;  3M99 B;  2QTS A;  2LFR A;  3RYC A;  5IWA B;  2HEP A;  3JAW B;  3K59 A;  2D3O W;  3AK3 A;  1QBZ A;  2R70 A;  4DV4 B;  2DYS C;  1URF A;  4ASU G;  1OJH A;  3BPZ A;  4CZZ A;  1M56 C;  5HFL A;  5KHJ A;  4U3J A;  5GTH Z;  3UM7 A;  1BL8 A;  4X9Q A;  1S5J A;  3TCU A;  2F4V B;  1H2L A;  4B3M B;  3I56 V;  5C8Y A;  4YHH B;  4LF5 O;  2QWN B;  3S3X A;  1NR1 A;  4LFB O;  1N0N A;  3DSQ A;  5B1A B;  1FFT B;  4DK1 A;  4CC6 A;  3JD0 A;  5EC2 C;  3MD0 A;  2UXC B;  3IFX A;  3RN4 A;  1EBO A;  5KHG A;  3LNN A;  1QCE A;  1GO3 F;  3K5N A;  1MMM A;  1IXM A;  1SES A;  2P7T C;  1R73 A;  2N04 A;  3HR0 A;  2WLL A;  3VOU A;  4LF8 B;  1R3I C;  4FLW A;  1YCI A;  1OZ0 A;  5JWP A;  4D6T H;  1NU1 H;  2EIN B;  4DR4 O;  4MT8 A;  3MAQ A;  4B3S O;  1NBM G;  3T1H O;  3AG1 C;  5IT9 N;  3RT3 C;  1R6K A;  4I50 B;  1YJ9 V;  3OEH G;  3JAR B;  2F43 G;  3AK2 A;  3TXS A;  3OT7 A;  3ZRV A;  4Q20 A;  4DRX A;  2W6I G;  4QE9 A;  3STZ C;  1KC8 W;  1ROP A;  5B1B B;  5IJ0 B;  3K5O A;  4LF6 O;  4QE7 A;  3WFV A;  3RYI A;  3GWO A;  2QKC A;  3FYI B;  4Z1V A;  3Q4H B;  4WBN B;  4UCO A;  5EYP A;  2KG7 B;  3J7A U;  4KXR A;  4LF9 B;  2B5U A;  3DTU B;  4DR5 O;  5JH7 A;  3CRC A;  2RQ6 A;  4I4T B;  4GUN A;  1MSW D;  1JPX A;  1SA0 A;  4GCZ A;  3SJA C;  5LXT A;  4JI3 B;  5GON B;  4GX2 A;  1Q7Y W;  1EN6 A;  1E1Q G;  2IJK A;  3IC9 A;  2QM7 A;  3CEI A;  1GAX A;  1VQ4 V;  5LA6 B;  1DTO A;  2EIL C;  1M93 A;  1EZJ A;  3ASO C;  1RM1 C;  1PL0 A;  4MVS A;  4PI2 A;  5CA1 A;  4QIW F;  3CJH A;  4R8C A;  1MAB G;  1TUB B;  4UCU A;  2OYQ A;  3HKE A;  1GM9 A;  3IGA C;  1RSO A;  5LHH A;  3K58 A;  2CUG A;  1SKV A;  1GH6 A;  2H94 A;  2BTQ B;  3ZMS A;  4XBF A;  2DOS A;  1G4Y B;  2L35 A;  3CRM A;  2BSK B;  2BTO A;  2Q7G A;  2ZCE A;  4JI1 B;  3D36 A;  4DV5 B;  1CPY A;  1PD3 A;  3B09 A;  3C90 A;  1HNW B;  2KQX A;  5HFM A;  1FXK C;  2ZE6 A;  3GVM A;  1GMG A;  3M7M X;  4DR7 O;  4ZKI A;  3RYF B;  1N36 O;  1YZB A;  1H8E G;  2OCC C;  1B06 A;  1VF6 C;  1K9M W;  4J80 A;  4BW5 A;  4DUY O;  2W0F C;  4LBE C;  4DV0 B;  1TVK A;  1JMK C;  5KHK A;  5B3S C;  4N23 A;  4LF4 B;  2BCC H;  3QF7 A;  5H6Q A;  1TUE B;  1BMF G;  4O4J A;  2AZ2 A;  4JI6 O;  1P84 F;  3FYE B;  2UUB O;  3E86 A;  1XMO O;  3OUS A;  3W7U A;  2P5O A;  1QLE C;  1WB8 A;  4DV3 O;  1PV0 A;  5JJE B;  4J11 A;  4DO2 A;  3ZRS A;  4FPP A;  4KUM A;  3HKD B;  1AR5 A;  3DXR A;  1HR0 O;  1KD1 W;  4WF9 V;  4J7Z A;  4PDR A;  1SQB H;  5B5E Z;  5KAF Z;  2Q67 A;  2WA4 A;  3HB3 B;  1ZLZ A;  4K8X A;  5DM6 V;  2LP7 A;  1AR4 A;  2P4K A;  2UXD O;  2LGW A;  3OR7 C;  1H8H G;  1XNQ B;  3T4Z A;  4DR1 B;  3JAS A;  1TGO A;  4BIO A;  1X59 A;  2P4V A;  1Y76 A;  3OEE G;  4IHJ A;  3C3S A;  4WFB V;  1UJW B;  4JGS A;  1K7D A;  2IBZ H;  2QM4 A;  4YJ2 A;  2CGN A;  2BE3 A;  3LDE A;  1ZX3 A;  1XHZ A;  2ATK C;  4X1I B;  2QWR B;  1N8R W;  1V54 C;  1E1R G;  5CBH A;  3RYC B;  2QR4 A;  3LSS A;  3E22 A;  3JSN A;  2A06 H;  2UUA O;  4JI2 O;  1RPR A;  1HP8 A;  3G71 V;  3JD1 A;  1K4D C;  4O2B A;  1H2G A;  4FMT A;  4X1Y B;  2YIA A;  5L3F A;  1Y6X A;  3AG4 B;  4U3J B;  1AP5 A;  3TET A;  1H38 A;  3OR6 C;  4GX0 A;  4JI0 B;  5C8Y B;  2P6J A;  4K35 A;  3CHX A;  3T1C A;  2JJ1 G;  4X20 B;  3ZJZ A;  4EKW A;  4JI4 B;  1SQV H;  2CK3 G;  1QHT A;  4BAY A;  2F93 B;  5BMV B;  4IYH A;  3N27 A;  1R6N A;  1RFY A;  5LMN B;  4DV7 B;  2EIL B;  3E2E A;  3FAV A;  3N2K A;  4RAI A;  1HWY A;  1JJO A;  4FLZ A;  1YJW V;  1KYO F;  1L0N H;  4D7T A;  2RDC A;  2R9I A;  4IIJ A;  1WB7 A;  2Y0I A;  2YSU B;  4B3R B;  4ZOL A;  4AIL C;  4LFC O;  2WLL B;  2VWJ A;  3B4S A;  4U7N A;  5JJN B;  1EN5 A;  5EBM C;  4DR2 O;  1Z5V A;  3ZHS A;  3CC2 V;  3L71 H;  4DV1 O;  3NXS A;  2OTL V;  4NXM B;  3QTC A;  1YIT V;  4GT1 A;  4TQD A;  1F51 A;  5KX5 A;  1YF2 A;  2ZM6 O;  1I94 O;  2CDY A;  3G4S V;  5GTI Z;  2FB5 A;  1YSC A;  2JIZ G;  1IZ3 A;  2ZR2 A;  4JI7 O;  4I0X A;  4X88 A;  1S3J A;  1S72 V;  1ORQ C;  3L72 H;  2UU9 B;  1K92 A;  5LL6 Y;  5LP6 C;  5IWA O;  1NVP D;  5EZY A;  1R6T A;  1GKF A;  4ZHQ B;  4H33 A;  2HJF C;  2WPD G;  3RYI B;  1SQF A;  5IDJ A;  4DV4 O;  2EIN C;  3X2Q C;  3ABK B;  3SJQ C;  2IJI A;  2X6C A;  2DN9 A;  4O4L A;  1FFX B;  1VMG A;  3IAY A;  2ZDI A;  2F4V O;  2PYJ A;  4B3M O;  4Z1M G;  4YHH O;  2YXL A;  5JH7 B;  5DED A;  2VQF B;  1VQ8 V;  1SA0 B;  1SF9 A;  2YS8 A;  2YI9 A;  1THZ A;  3CE2 A;  5ITZ A;  2UXB B;  1WLE A;  2IU0 A;  2N74 A;  4EB6 A;  2UXC O;  4MVU A;  3CME V;  3ABU A;  5B1B C;  2CAZ C;  4HYO A;  2YIB A;  3R66 A;  3CC7 V;  4UXN A;  1N34 B;  1LNQ A;  1PNK A;  2GBO A;  1SQX H;  4LF8 O;  3F5W C;  5L3D A;  2CTR A;  3BFR A;  3CJH B;  2YEV A;  3K79 A;  1M1K W;  4Q6G A;  5CBF A;  4BR6 A;  4NTY A;  3HKE B;  2FL4 A;  1RSO B;  3TGU H;  5J2T A;  2LFS A;  1IBL B;  3APO A;  3BRC A;  5LOV B;  5E79 Z;  2R72 A;  1NZ6 A;  2IU3 A;  3JAT A;  4WFG A;  2ZNJ A;  2JRI A;  1WA8 B;  2G38 A;  3ETG A;  2F23 A;  1NR7 A;  4G28 B;  3W7T A;  5KLV H;  4NTW A;  3QO7 A;  3THO A;  2F1M A;  5KUK A;  2M6Y A;  5KA5 A;  1O9H A;  4CH4 A;  1S5H C;  1XL6 A;  2LW7 A;  1MOF A;  2YUA A;  1FAF A;  3CRA A;  1V54 B;  1GN6 A;  1KQS U;  5JQG A;  3UO2 A;  4TV9 A;  5L3B A;  4J7K A;  2PUS A;  4U7O A;  4CH3 A;  4FM1 A;  4LH6 A;  1GN2 A;  3CX5 F;  2OT5 A;  4LF9 O;  3FKS G;  5J2U A;  2PI4 A;  1L1F A;  4XDJ A;  1VQ7 V;  4JI3 O;  3KG2 A;  2P06 A;  5IYC O;  1Q81 W;  4O4J B;  4PJ0 Z;  3A8T A;  4FM2 A;  2ZE7 A;  3CD6 V;  1PM9 A;  3SJC C;  1ZTE A;  3CCU V;  3H1I H;  3RVY A;  2PTM A;  4RWU A;  3JAM N;  3AG2 C;  3OMI B;  4I55 B;  5IJ9 A;  4UB8 Z;  4DYL A;  2VQE B;  1K5Q A;  5TIS Z;  3B8N A;  2DWD C;  3DXR B;  1ARO P;  2HHH B;  2LQT A;  2ZIO A;  2LJ2 A;  1WNS A;  5J9P C;  1P49 A;  2WAM A;  4FJC C;  3G6E V;  4B3T B;  1F4M A;  2YID A;  4OX9 B;  4CS3 A;  4K8Z A;  4JI1 O;  1JCH A;  4DV5 O;  2NNU A;  2GDS A;  1BE3 H;  3CCL V;  1HNW O;  2DMX A;  1Y74 A;  1OHH G;  1N32 B;  1NS1 A;  3JAS B;  5JCO A;  1H2N A;  2DE0 X;  1Y76 B;  3SYO A;  4IHJ B;  1VAR A;  3AK1 A;  1CXZ B;  4NR1 A;  3ABT A;  2M7W A;  4YJ2 B;  5LP6 B;  3OW2 U;  3BEH A;  1Y4M A;  4MVO A;  4DV0 O;  4H44 B;  1KBH A;  2ODM A;  2XAJ A;  3E83 A;  4WFF A;  3UKM A;  4ABM A;  3X2Q B;  2HJD A;  4LF4 O;  1W0J G;  4ZI7 A;  4FVM A;  4W4L A;  1X4T A;  4NB5 A;  1JFF B;  1M5I A;  3ETQ A;  3FD9 A;  4JPR A;  2OTJ V;  2EZP A;  3OTO B;  1NVP B;  2QE7 G;  3CYO A;  3E35 A;  2WLI A;  1YXB A;  3BA8 A;  1EFR G;  4AHC A;  5C93 A;  1Q86 W;  3BAB A;  3U0Z A;  4QPK A;  3SYP A;  1EM1 A;  1HNX B;  2GUZ A;  2HG5 C;  3H1K H;  5H2F Z;  1M90 W;  2CH7 A;  5CA0 A;  1R3K C;  5K1P A;  2GTS A;  3CCJ V;  4EFB A;  2GHY A;  4E2L A;  3FAV B;  3N2K B;  2EIK B;  1AB3 A;  3RVZ A;  4JV5 B;  3ZHT A;  3QVN A;  3FFQ A;  4IIJ B;  2OIE A;  2WLN A;  5EBW C;  4ZOL B;  4PA9 A;  4EEQ A;  4RUE A;  3AG4 C;  3P32 A;  1KB9 F;  3CCM V;  2CTQ A;  1SQQ H;  3K57 A;  2LO1 A;  1XHX A;  1AI6 A;  2R9A A;  3BCC H;  2XHB A;  1XNQ O;  1FS0 G;  4IGG A;  4DR1 O;  2JVD A;  3JAK A;  1JVM A;  3SPC A;  5LHG A;  2ZKO A;  1VQM V;  2P90 A;  1DK1 A;  4MVQ A;  3N2G A;  4I0X B;  1WJZ A;  3H9V A;  1YHQ V;  4UVA A;  3E89 A;  3RFR A;  1XEQ A;  3HKC A;  2P22 C;  1QR8 A;  4DW1 A;  2ZR3 A;  2ITD C;  1S76 D;  2K1E A;  3SPH A;  4R7C A;  3ZRX A;  2X6A A;  4UVB A;  4CS2 A;  1WPB A;  5JVD A;  1YIJ V;  1DF4 A;  3CCS V;  3P30 A;  5LYJ A;  2XAG A;  2R9R B;  4TOI A;  4JI0 O;  2EX3 A;  3RW0 A; 
#chains in the Genus database with same CATH homology
 2WLK A;  1VQP V;  4WFE A;  5CBG A;  3ETD A;  3JD1 A;  1K4D C;  3G71 V;  1H2G A;  4MW8 A;  3OFN G;  5L3G A;  4FMT A;  3ABM C;  5L3F A;  4TWK A;  3AG4 B;  5H6R A;  3TET A;  1FXH A;  1H38 A;  4MVM A;  1G8M A;  3OR6 C;  3K3W A;  4WCE V;  5IY5 C;  5CA3 A;  3CC4 V;  2V1D A;  4GX0 A;  1NJI W;  2P6J A;  3WG7 B;  2QM8 A;  3W7X A;  2AHZ A;  3T1C A;  1Q82 W;  2JJ1 G;  3ZRW A;  2DQ3 A;  3W7S A;  2ZXW B;  3ZJZ A;  4EKW A;  4WFH A;  2CK3 G;  3AG2 B;  3MHS C;  1JQ0 A;  3K03 A;  4BAY A;  5BZB A;  1OCO B;  3ABK C;  3ZN0 A;  1R6N A;  3E2E A;  2EIL B;  1NKD A;  4RAI A;  5EBL C;  1HWY A;  4G27 B;  1YJW V;  4UVC A;  1K4C C;  2YEV B;  4JTA B;  3SYC A;  3LNM B;  1YTF D;  2KB1 A;  4P9O A;  3ABL C;  1AR1 B;  3ETE A;  5H9C A;  1K97 A;  2R9I A;  1PNM A;  2A0L A;  2BOB C;  2DW4 A;  2IW5 A;  3SPI A;  2YSU B;  4PA3 A;  4QNH B;  5LGU A;  3B77 A;  3K08 A;  2WLL B;  4P9P A;  5LHI A;  1BHB A;  4U7N A;  1AJQ A;  5EBM C;  3B8M A;  2JEU A;  3ML0 A;  3SYQ A;  2QEX V;  5CN0 A;  2H8P C;  2EIM C;  4JAU A;  3CC2 V;  1AI4 A;  3NXS A;  2OTL V;  4RQE A;  1YIT V;  2HR3 A;  4GT1 A;  1F51 A;  2V7Q G;  1P4R A;  1FXK A;  4WFA V;  3H01 A;  3ASN C;  3OMN B;  3TK1 A;  3CXC U;  4PA6 A;  3VBB A;  2HLD G;  3G4S V;  1VQ6 V;  5GW7 A;  3OAA G;  3K0G A;  4MVZ A;  1YSC A;  4GX5 A;  4XDL A;  2JIZ G;  1VQL V;  1CP9 A;  2ZR2 A;  1V55 B;  3ZMU A;  2JEX A;  4X88 A;  1KP2 A;  1S3J A;  2BOC C;  1S72 V;  5B1O A;  4JAV A;  1ENV A;  1ORQ C;  3ABM B;  1AJN A;  3ZMT A;  1K92 A;  2XAQ A;  5IY5 B;  4J9Y B;  2XAF A;  1W0K G;  1NVP D;  1VQK V;  2EBO A;  2XAH A;  4TT3 G;  5L3E A;  1VQN V;  1GKF A;  4H33 A;  5KA6 A;  3F7Y C;  4PA4 A;  1JOY A;  2WPD G;  2HJF C;  2WLH A;  3CCE V;  5IDJ A;  2EIN C;  3X2Q C;  4JYB A;  3CMA V;  3ABK B;  3SJQ C;  2DQ0 A;  3AEI A;  3OM3 B;  3SPJ A;  2IH1 C;  2IJI A;  2X6C A;  2AHY A;  4FIP C;  3OGC C;  3M99 B;  2LFR A;  4PDL A;  2QKS A;  2ZDI A;  1NH2 D;  5EK0 A;  2D3O W;  4Z1M G;  1DF5 A;  4N21 A;  1QBZ A;  3OMA B;  4OXS A;  3W7W A;  1OCZ C;  1VQ8 V;  2DYS C;  2EJR A;  3E8B A;  4ASU G;  4HAM A;  4BIU A;  4RO2 A;  1THZ A;  4CZZ A;  1M56 C;  1I5Y A;  5HFL A;  4MS2 A;  1OCR C;  2EZO A;  3E8G A;  2IJH A;  1WLE A;  3UM7 A;  1BL8 A;  2IU0 A;  1YTF B;  4JTD B;  2EIM B;  1SER A;  3TCU A;  1Y66 A;  4MTO A;  4UV9 A;  4MVU A;  1KEC A;  3CME V;  3ABU A;  3I56 V;  4MTG A;  5B1B C;  2ZD9 A;  4HYO A;  3OE7 G;  3CC7 V;  1MG1 A;  3RBZ A;  1NR1 A;  1R3J C;  1SZT A;  4UXN A;  3T4D A;  2X0L A;  3ASN B;  2XND G;  3IC7 A;  1LNQ A;  1PNK A;  1DLB A;  2MK3 A;  3QO8 A;  5B1A B;  3CPW U;  3T2M A;  3F5W C;  1QR9 A;  5L3D A;  1FFT B;  3JD0 A;  5EC2 C;  2YEV A;  3K79 A;  2ZQM A;  2Z5U A;  3IFX A;  3E8H A;  3MD0 A;  1VQO V;  2XOK G;  1M1K W;  5CBF A;  1VQ5 V;  2IH3 C;  1CEZ A;  4H37 A;  1EBO A;  1JJ2 U;  1F4N A;  1QCE A;  1GO3 F;  3CCQ V;  4QPJ A;  3CCV V;  1IXM A;  1SES A;  2P7T C;  3AG3 C;  2WSS G;  2LFS A;  1R73 A;  1GK9 A;  2WLL A;  3VOU A;  2Y48 A;  1R3I C;  1GM7 A;  2IU3 A;  1OZ0 A;  4WFG A;  1GTO A;  1K8A W;  1WPX A;  2EIN B;  4MTX A;  5B1N A;  2QA4 V;  1AI5 A;  2EIJ C;  3ETG A;  2GSM B;  1NR7 A;  1AJP A;  4G28 B;  3A0R A;  4MT8 A;  3K06 A;  3W7T A;  3LUT B;  3PJS K;  3QO7 A;  1NBM G;  4R6Z A;  4KP4 A;  3JYC A;  1M57 B;  3AG1 C;  1QVF U;  5KUK A;  4MTF A;  5KA5 A;  2QTO A;  2XAS A;  4TSF G;  1R6K A;  1S5H C;  2A79 B;  1YJ9 V;  1XL6 A;  3OEH G;  1OCZ B;  2DYS B;  2F43 G;  3EHB B;  1MOF A;  4I9W A;  3QNE A;  3ZRV A;  1M56 B;  1KKD A;  4Q20 A;  1OCR B;  1V54 B;  4DXW A;  2ITC C;  1K33 A;  1NH2 B;  1KQS U;  2W6I G;  4QE9 A;  3STZ C;  1KC8 W;  3EFF K;  5L3B A;  2IJJ A;  1ROP A;  2WLI B;  4U7O A;  5B1B B;  2OT5 A;  3FKS G;  4QE7 A;  3WFV A;  4QJF B;  2DYR C;  3GWO A;  1QLN A;  2PI4 A;  4PDV A;  1L1F A;  4X8A A;  3FYI B;  4XDJ A;  1VQ7 V;  3ZIA G;  2HVJ C;  2PI5 A;  3KG2 A;  1COW G;  5IYC O;  1Q81 W;  4YXW G;  4MW3 A;  1JX9 A;  3FB6 C;  4P2Z A;  3CD6 V;  4F4L A;  2B5U A;  3DTU B;  4UUJ C;  1MSW D;  1JPX A;  3AG3 B;  4PEL A;  3CCU V;  4GCZ A;  1K73 W;  3RVY A;  1ZWI C;  4JAS A;  3ZMZ A;  4GX2 A;  4CBC A;  4L87 A;  3ZCC A;  1Q7Y W;  1E1Q G;  2IJK A;  3AG2 C;  3OMI B;  2P67 A;  1OCO C;  2QM7 A;  1VQ4 V;  2X6B A;  1DTO A;  2EIL C;  3ABL B;  1K5Q A;  1EZJ A;  1GM8 A;  3B8N A;  3K04 A;  2C2A A;  1RPO A;  2DWD C;  1ARO P;  3AG1 B;  3ASO C;  1RM1 C;  1R3L C;  1PL0 A;  4MVS A;  5J9P C;  3HPL C;  4QIW F;  4R8C A;  2WAM A;  1I5X A;  1MAB G;  4FJC C;  3G6E V;  1F4M A;  5DN6 G;  1GM9 A;  3IGA C;  4XDK A;  5LHH A;  1JCH A;  2EIK C;  2NNU A;  2H94 A;  3STL C;  2Q68 A;  3CCL V;  1B6Q A;  1OHH G;  5CMU A;  3ZMS A;  4XBF A;  2B1I A;  3R65 A;  2DYR B;  2JK5 C;  3D3I A;  1G4Y B;  2WLJ A;  3SYO A;  3JD2 A;  1NQT A;  3ABT A;  4KFM A;  1V55 C;  2M7W A;  3D36 A;  1CPY A;  1S77 D;  3F7V C;  1KP3 A;  2Q6A A;  1PD3 A;  3OW2 U;  3BEH A;  1Y4M A;  4MVO A;  3JD3 A;  2W6J G;  5HFM A;  2A9H A;  5FL7 G;  4J9Z B;  4LC1 A;  1FXK C;  2XAJ A;  1GMG A;  5IYD O;  3E83 A;  4WFF A;  3UKM A;  3X2Q B;  4HZ3 A;  1W0J G;  1PNL A;  4PDM A;  4ZKI A;  4BIZ A;  1K5S A;  3DGE A;  4JPR A;  2OTJ V;  2EZP A;  3OUF A;  1NVP B;  1BHA A;  2QE7 G;  1H8E G;  3CYO A;  2OCC C;  4JF3 A;  4PA7 A;  1K9M W;  3E35 A;  2NLJ C;  4BW5 A;  2WLI A;  3CCR V;  2W0F C;  4LBE C;  3LSQ A;  3BY6 A;  1EFR G;  3LDD A;  2Y69 C;  5B3S C;  5C93 A;  1Q86 W;  3I55 V;  4QPK A;  4N23 A;  3ASO B;  3FB8 C;  3SYP A;  1RM1 B;  1OCC C;  2HG5 C;  3K0D A;  1TUE B;  5H6Q A;  3ZRW B;  3ZN1 A;  1M90 W;  1BMF G;  1J95 A;  1R3K C;  2JJ2 G;  4RUF A;  5L3C A;  3CCJ V;  2HFE C;  2GHY A;  5IYB O;  4E2L A;  3FYE B;  3E86 A;  3OUS A;  3W7U A;  2EIK B;  4MVR A;  2ZDI C;  1FXV A;  1QLE C;  1VQ9 V;  3RVZ A;  3LDC A;  4R50 A;  4JTC B;  4MSW C;  2X7R B;  5LBQ A;  2WLN A;  1SRY A;  3FB5 C;  3GB7 C;  3MHH C;  4PA9 A;  5EBW C;  4DO2 A;  4RQF A;  2HVK C;  4UV8 A;  4RUE A;  3AG4 C;  4I5S A;  5B1A C;  4FK5 C;  2FTK A;  3ZRS A;  3P32 A;  4FPP A;  4KUM A;  3CP1 A;  3JD4 A;  1M9N A;  3CCM V;  1YI2 V;  1W2B U;  4GX1 A;  1XL4 A;  1KD1 W;  4WF9 V;  3WG7 C;  4PDR A;  5E1A C;  1AI6 A;  1FXK B;  1FS0 G;  2ZXW C;  2Z3Y A;  1AI7 A;  1K3E A;  1JVM A;  3SPC A;  1F23 A;  2EIJ B;  2Q67 A;  5LHG A;  3HB3 B;  1VQM V;  1S0V A;  2P90 A;  2UXX A;  1E79 G;  4G2K A;  1SET A;  3JCZ A;  1PKX A;  2Q69 A;  4MVQ A;  5DM6 V;  2LP7 A;  2WLM A;  2OCC B;  3QO5 A;  4UVA A;  1YHQ V;  3E89 A;  1YJN V;  3E8F A;  1P7B A;  3OR7 C;  1H8H G;  4ZBM A;  1QVG U;  3K9A A;  3T4Z A;  2B1G A;  2Y69 B;  5B3S B;  1QR8 A;  1M57 C;  2ZR3 A;  3OEE G;  2ITD C;  4WFB V;  1K34 A;  1S76 D;  1UJW B;  2K1E A;  1OCC B;  4JGS A;  1K7D A;  4JYC A;  4LCU C;  3SPH A;  4R7C A;  2DWE C;  3ZRX A;  2WWW A;  2X6A A;  3FB7 C;  4UVB A;  3LDE A;  2JDI G;  2ATK C;  1YIJ V;  1DF4 A;  5KUM A;  3SPG A;  1N8R W;  2HKO A;  1V54 C;  1E1R G;  2UXN A;  5CBH A;  3CCS V;  5LGT A;  3LSS A;  4X89 A;  3P30 A;  3SYA A;  2XAG A;  2R9R B;  1QLE B;  4P30 A;  1RPR A;  5EC1 C;  3RW0 A;  4LP8 A;  3ZMV A;  5LGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...