1ENVA

Atomic structure of the ectodomain from hiv-1 gp41
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
121
structure length
115
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 ENVELOPE PROTEIN CHIMERA CONSISTING OF A FRAGMENT OF G
publication title Atomic structure of the ectodomain from HIV-1 gp41.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 59
structure length 115
sequence length 121
ec nomenclature
pdb deposition date 1997-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1envA00
4FJCC 3WFVA 1SZTA 2X7RB 1QCEA 4N21A 3MHSC 1I5YA 1ENVA 1MOFA 3B8NA 4FK5C 4E2LA 1QR8A 5HFMA 1I5XA 1Y66A 4JF3A 5HFLA 1JPXA 5KA6A 4FIPC 4G2KA 1DF4A 2EZPA 1JQ0A 2LP7A 3GWOA 3CYOA 1QR9A 2EBOA 3B8MA 3MHHC 3K9AA 3M99B 1K33A 1MG1A 2M7WA 3H01A 5CMUA 5CN0A 1Y4MA 1DF5A 3B77A 1EBOA 4JGSA 1DLBA 5KA5A 1F23A 4N23A 1K34A 2EZOA 2OT5A 2MK3A 3P30A 3CP1A 5H9CA 1QBZA 2P6JA 4JPRA
chains in the Genus database with same CATH superfamily
5LOVB 3ABUA 1SKVA 2ZR2A 1PKXA 1XNRB 3BVOA 2ADPA 5K1PA 3CC4V 3APQA 1AI5A 2Q8VA 2DMXA 1HR0B 2CTQA 2HHHO 2QR4A 2NLJC 3HB3B 3ZHSA 5BR8B 3GB7C 3RYFA 2YICA 4DV7O 5IWAO 4QIWF 2WLIB 1NZ6A 2UU9O 2XHBA 3THOA 1XEQA 5IJ0B 3K59A 1NH2B 2YIBD 4JI5B 5J9PC 3OFNG 2UUBO 5EIBD 3TXSA 3HKCB 1ZSPA 2XAJA 4DO2A 4X20A 2UXCB 3JD1A 1W2BU 1W0JG 3K03A 4R50A 1YJNV 1R3IC 5F2VO 4WF9V 4X64B 1RP3B 3ZIAG 4HNAB 4AILC 2QM7A 2LFRA 3AG4C 4Z2WA 5LL6Y 2PF4E 3RW0A 2FB5A 1K9MW 4LF5B 1P84F 4J80A 3GWOA 3L9DA 4KUMA 3CHXA 3BAAA 4JAVA 5CA0B 3QVNA 4LF4O 3JATB 1AR1B 2XTAA 4BR6A 2ATKC 4B3MO 5H9CA 3H1LH 4TV9B 5JJEB 3ETQA 2Q6AA 1NTZH 2GBOA 4KXRA 4Q20A 4JI8B 3BRCA 5LGTA 1N4CA 4FZ1A 3DXRA 1NS1A 2R9AA 3JAWA 2DW4A 4GCZA 1FAFA 1WLEA 5KLVH 2VQEO 1QLEC 1JA8A 5B1BB 1P4RA 2PGGA 4DR7O 1R6TA 3Q4HB 4I7ZB 4ZOLB 1K97A 4O2AB 3KG2A 4G28B 1K4DC 3ZRXA 5GONA 3L71H 5BY1A 4HZ3A 1ZL8B 1FXVA 5CN0A 4FFKA 1SQFA 2DE0X 3JALB 1KP2A 1WJZA 4PI2A 4ICGA 3RYHB 1EFRG 1NKDA 4JZ2A 2CAZC 3N2KB 4YY3B 3TGUH 1MA1A 1GO3F 2RCVA 3EHBB 3T1HB 2AZ2A 3ZJZA 2EIMC 2X0LA 4P9OA 3N2GB 4UCTA 4TQFA 4MVSA 3CCSV 1KYOF 2CH7A 1WPXA 1DLBA 4R6ZA 2ZXWC 3RYFB 4DK0A 1KP3A 5EBMC 2VWJA 1MMMA 4WBNA 3A0BZ 3QO7A 1VARA 3SPCA 5FPOA 2HLDG 4NKGB 4X20B 4GX5A 1Q86W 3ABLC 3J81N 1JVMA 2JEUA 2IBZH 4FLYA 2LW7A 4UV8A 1VP7A 4PDRA 2B5UA 1M57B 3CC2V 1S5JA 3EFFK 3FAVA 1OCZC 2R9IA 3E8FA 4PELA 2WLMA 2F23A 5GTHZ 2QKSA 1BZKA 1UJWB 3RYIA 1EZJA 1N34O 1G8MA 1WP7A 5L3FA 3ZMTA 4GKKB 2Q5ZA 4LF6O 3LUTB 3OR7C 3ZCCA 2OCCB 2E5LO 4DV2O 5B1AC 4U7OA 3DTUB 1NH2D 3SDLA 2RDCA 4D7SA 1SRYA 1M5IA 5LMUB 3OM3B 3DXRB 3JAWB 3WB2A 1MZFA 1ZUQA 2WAMA 2NR5A 4WFBV 1AROP 2H94A 3ZRSA 4ZI7A 5KAFZ 3CX5F 2QE7G 3NXSA 5CBHA 1I5XA 3J7AU 2UXXA 2A3QA 1H2NA 4RO2A 5GONB 1WNSA 3LNMB 1N0NA 2EX3A 2WWWA 4JI4O 4DV3B 5LYJA 2Y0IA 4X89A 1S76D 2O57A 5LGUA 4X62O 3AG3C 4MW3A 3RT3C 4OX9B 2YUAA 3FKSG 4ZBMA 5FLXN 4Z1VA 4CH6A 1IURA 1ENVA 3AK1A 5AG2A 3B40A 4QNHB 4QGPA 4RAIA 1VQKV 3CCMV 2R9RB 5KMGA 2EZPA 1S77D 2EBOA 3AG7A 1SETA 5KHHA 1M56B 1Y74A 3KCYA 4DR4B 4GX0A 3JAKB 3QTCA 2Y4TA 3RN4A 4I50A 2VRZA 5CA1A 2EJRA 1LUWA 2CH7B 5D5QA 3I56V 2V1DA 2Z5UA 1SERA 4LFCB 4KL1A 4DUYB 5DEDA 1HNWB 1PM9A 2WLLA 3JCZA 3OR6C 1DF4A 1BHAA 4UXNA 4MVUA 4FLWA 4WBNB 4X9QA 2EJ7A 5K1XA 4JI2B 5KHJA 1N36B 3KKYA 2XAFA 3W7WA 3SJBC 4A5UB 1CEZA 4DR6O 3TJTA 1K7DA 3OUFA 4B08A 2OTJV 1P7BA 3E86A 4PD4F 1V54C 5LMNO 1U97A 5B66Z 4JYBA 4PHZA 2HJFC 4MSWC 3W7TA 3NR7A 4D7TA 4LFAB 1OCRB 4B3SO 2ZQMA 3FAVB 4FLXA 4UB6Z 1XOUA 4PDLA 5B5EZ 2QTOA 1L8DA 1P7GA 4XDJA 1I08A 3ZEDA 3ETGA 5BXZA 2AGAA 4LH7A 3RYIB 5CBGA 1D2DA 1HNXB 4EKWA 2PI5A 3D36A 1XMQB 2QGNA 1N32O 2UXDO 5GW7A 1WPBA 1PL0A 4JI3B 1BE3H 2ZINA 2BOCC 4PA4A 4JYAB 4FPPA 3FD9A 1EM1A 4FMTA 1BGYH 2ZM6B 4X65B 4I9WA 2E3CA 4J41A 2LQTA 4HAMA 1SQGA 2QA4V 1N33B 4B3RB 4PDVA 3JD2A 1KD1W 2ZCEA 1R1BA 2EIJC 4H44B 4ZI7B 1VQPV 3ABTA 1PPJH 3K5OA 1LNQA 4U7NA 2LO1A 2Q69A 4RUFA 1GTOA 5JCOA 3U10A 4R8CA 3CD6V 2BCCH 4CBCA 3MD0A 4JYYA 4JASA 5LYJB 1I0HA 4R7CA 2V4DA 5LXTA 5FL7G 4JI7B 3K06A 4B3TB 2L6LA 4I5SA 4JF3A 1XQ8A 3S3WA 1IZ3A 5KMGB 3VBBA 3IGAC 1PD3A 3AG4B 1Y74B 1H8EG 1K4CC 3U0ZA 4UB8Z 1TVKA 4I50B 3P3PA 5CA1B 2CE4A 4LFBO 2UXBB 1KECA 2AHYA 3FYEB 1Q81W 4FLUA 4DR2O 1QQCA 5LHGA 5JJJB 5HFLA 2OYQA 3TK1A 4U3FH 1OCOC 3ABMC 5B1NA 1N8RW 3T2MA 1EBOA 2B9ZA 3AG1C 3SJQC 4JI6B 1XMOO 3OTOB 2IW5A 1X59A 2DWEC 1EN6A 1WB7A 2JRIA 2ZKOA 1F7YA 4AI8A 3LDDA 3BFRA 1QLEB 1JCHA 3WG7C 4XBFA 1FXHA 1PP9H 1Q6IA 2H3OA 2WA4A 4RQEA 1GM7A 2FMLA 1XILA 3CRCA 4DV6O 4DV7B 2JS3A 2LP7A 1YVWA 4UUJC 5IWAB 4CS4A 1I94B 2LW1A 3IJ4A 3L75H 5H5NA 4H33A 5IDJA 5C8YA 1AB3A 1KQSU 2UUBB 1CPYA 3C90A 5BMVA 1SC5B 4X66O 3JASA 2EILC 3ZX6A 4UFZA 4JI0B 2F4VB 1BSMA 1F23A 1MABG 2Q0OC 5DN6G 1CP9A 4N23A 1FJGB 1L0LH 1QCEA 3X2QB 1TAEA 1DK1A 3OGIB 4CZZA 3I5DA 5KHIA 2ZXWB 5LP6A 2CUGA 4BW9A 2QKCA 1FYJA 2L35A 3E35A 2LFSA 2W0FC 5FPRA 3K0DA 2WLNA 3G80A 2KQXA 2M6YA 5LHIA 1GK9A 1VQ7V 2HVJC 3H1IH 4XDLA 5LXTB 4F6EA 1K5QA 1Q82W 2YEVA 3ABLB 3CMEV 1BL8A 4W4KA 2XAGA 2JK5C 2ZE8A 3CB2A 2IM9A 3OGCC 1SQBH 1RSOA 1PNMA 1YTFB 1W59A 2LGWA 4MVQA 1B6QA 4OPAA 4LBEC 1M90W 4AQYO 5H6QA 1TVKB 2RMKB 5J2UA 3B8NA 3LDEA 3BA9A 4MTOA 4Q6GA 3RVZA 2LGQA 3GWKC 3ZBHA 3TCUA 4J7ZA 2EINC 4K8XA 2QTSA 4DV5B 2X6BA 5B1AB 1WN7A 1VQ4V 1KKCA 3SYPA 1YCIA 4DR1O 1YJ9V 4EEQA 3IFXA 2YS8A 2BE3A 2HFEC 5D5PA 1XREA 3STZC 4IL6Z 1R6NA 1Y76A 5IJ9A 4JV5O 3AK2A 3RYCA 2WLKA 3CJHA 4LNUA 3J80N 4DW1A 1Q6HA 1V9PA 3G6BA 3OMNB 1QVFU 5CMUA 3MAQA 4LCUC 1GN2A 4DYLA 2DWDC 4YHHB 4K0KB 2WLJA 4PDMA 1FS0G 5DECA 3AG3B 4E4EA 1VQNV 2YXYA 5C8YB 5EIBC 4DV0B 1Y4MA 4IYIA 5BMVB 1EN4A 1SQPH 2Y69B 3JASB 1KUQA 2ETNA 1Q5OA 4DR3B 3FX7A 4OPHA 1NTKH 5IYBO 1YJWV 3H1JH 1AI7A 4LF8O 1GMGA 1JJ2U 3DGEA 1KBHA 5LGNA 3HKBA 1K8AW 5LP6B 2JDIG 4BAYA 2KG7A 4F4LA 3ZMSA 4TSFG 1M9NA 5BZBA 3BHPA 3U11A 1F4MA 4ZIBA 3QO5A 3LSUA 4DV4O 1NI8A 1R3JC 3ZRWA 4BWAA 1VMGA 1YIJV 3UCSC 1J95A 2P5OA 5IYDO 3T4ZA 2YEVB 1I7FA 5IYCO 4H13B 1IBMO 3ABKC 1RSOB 4LF7B 2AW9A 3ETDA 2Y48A 4EFEA 1SQVH 3SYCA 4DRXA 2AZ0A 1PV0A 2X7RB 1H2MA 1UPGA 1XNRO 3T1YB 5J2UB 4MS2A 4GZRB 1RM1B 1V55C 4FLTA 1JQ0A 3CXHF 4NXNB 1FFTB 1HR0O 4PA6A 1FXKC 1T5EA 2XAHA 4JI1O 3FB5C 1WP8A 3RVYA 1TUBA 1CXZB 3FB6C 3TXQA 2HEPA 4X62B 4J10A 4JI5O 2DYSC 1TGOA 4O2BA 2GUZA 4FK5C 5HFMA 1H2GA 2ZR3A 1IX9A 4NXMB 1HWYA 2JVDA 2UXCO 5EBLC 2KSDA 4BW5A 4LP8A 2NN4A 5H2FZ 2EIJB 2Q67A 1F51A 1Y76B 1YTFD 5IJ9B 4X64O 1NT2B 2HR3A 4LC1A 3RYCB 1Z2GA 1M4UA 3CJHB 4LNUB 1R73A 3ZMZA 1IBLO 3D3IA 3RFRA 4QE9A 2UUCB 2HJDA 3QO8A 4LF5O 5JH7A 5EK0A 4WFFA 2YDEA 4O4LA 4EFBA 4JTDB 4UVAA 1GKFA 1FKAO 1MSDA 4DV1B 3ETEA 3AEIA 4IIJA 5L3CA 1AILA 1FFXA 4CH5A 3QG5A 4BIOA 3ZMVA 1AJQA 3ZN0A 4JI8O 1NR7A 1YITV 4FIPC 1HNZB 1GM8A 2NNUA 2K1EA 3HKBB 3K9SA 3SJAC 1GM9A 2KG7B 4Z1MG 4YJ2A 3EXAA 1TA8A 1SZTA 2QWPB 1YI2V 3FB7C 3G6EV 3ZN1A 3AG1B 3ZRWB 2ILMA 3VQXA 2IH3C 5KAIZ 1GH6A 3WG7B 3ASNC 4YY3O 1OCCC 3WFVA 2D2CB 1JOYA 2PYJA 5LA6A 4DRXB 4J42A 3UO3A 3T1HO 1K5SA 1Y66A 4JZGA 5IE9A 1SQXH 3ML0A 2PZSA 5B1OA 1SZXA 2EULA 3ASOB 3A0HZ 2R70A 4O4JA 2YIBA 1EN5A 1RPRA 3CCRV 3PJSK 1XL4A 2JJ1G 1TUBB 1VQ9V 3S3XA 3E8HA 3OEHG 2EILB 5LBQA 4LWSA 3OAAG 2CTPA 3LSQA 4O2BB 2GUZB 4G2KA 4X1KA 1VQ6V 2VQFO 4OXSA 3E8GA 2W0XA 3OE7G 3ZHQA 3JSLA 1R3KC 2EIKC 1AR5A 1NVPB 5KHKA 1GRJA 2EZOA 5JQGA 2JGUA 5L3EA 2IJHA 3AG2B 4N21A 4LFBB 1IDSA 4IYHA 5B1BC 3SJCC 3TETA 1IBKB 2P22C 5JH7B 2D3OW 1Z5VA 4O4LB 2E74B 1J5EO 3CS5A 3HKDA 1FD9A 4X8AA 1B06A 1NR1A 2E76B 3RWRD 4GKKO 1H38A 1SA0A 3CC7V 4BIZA 1QBZA 4DR5B 1FFXB 3WB1A 2F1MA 3K3WA 5GTIZ 3KCXA 4MTFA 2H8PC 3W7XA 3VQYA 1GN3A 3SR2C 1R3LC 2RJZA 5LHHA 3CE2A 3ZHVA 4RQFA 3BA8A 3H1HH 1FXKA 2RQ6A 3CRQA 4YJ2B 4KHPB 4LF9B 2WA3A 2YC0A 4GLXA 2A9HA 3CCJV 1VQLV 3ZRVA 4DV3O 1HW7A 4TWKA 3JARA 1BHBA 2CTRA 1SS3A 3I55V 4B7EA 4DK1A 1S5HC 2UXNA 4OX9O 4GKJB 2Z0AA 2HG5C 3O65A 4PA7A 3MHSC 1VQOV 1XHXA 1FPOA 1ROPA 1XI1A 5LA6B 3VQVA 3CRAA 3A0RA 1KC8W 5C93A 4UCRA 4XDKA 3CYOA 4DR4O 1ZLZA 3SPHA 4UCSA 2KKWA 4FLZA 3P3NA 4PV1B 4L87A 4LFCO 2MK3A 2FTKA 4O4IA 4P9PA 4O4JB 4DUYO 1HNWO 4QE7A 2OIGA 4FM0A 4I4TA 3HR0A 3B4SA 2G38A 5KA6A 1Q7YW 2JJ2G 3A2FA 1XL6A 4LWSB 3ZS8C 1AJNA 1JX9A 2WLLB 2DYRC 5EYPA 4X1KB 2OCCC 4JI2O 1N36O 4GUNA 1SESA 5E1AC 5B3SC 2Q9LA 2BOBC 3K5LA 2ZT9B 4UV9A 3HPLC 1XBLA 4LFAO 3K04A 5KHGA 1BCCH 1YF2A 3VOUA 5KUKA 1L1FA 3BABA 1S72V 4CC5A 2ZNJA 1Y67A 3RGBA 5IY5C 2HHHB 3CWBH 1NU1H 1HNXO 1K34A 2AHZA 3HKDB 1KKDA 3P30A 1XMQO 2N74A 1SA0B 4IT5A 3FB8C 2UU9B 4ZHQA 3ABKB 2BSKA 2FYUH 4MTGA 1ZX3A 3OT7A 3B2EE 4K3AA 3G4SV 3OTFA 1IVSA 1NJIW 4X65O 2OWOA 4NYKA 1N33O 4TQDA 5L3GA 3H9VA 4CH3A 1V55B 4GX1A 4JPRA 1NVPD 4FZ0A 2EIMB 3OD4A 1KU9A 1Q6UA 3WU2Z 3E89A 1FXKB 4LH6A 3OMIB 4J9YB 2B1GA 3BEHA 2PI4A 3STLC 3DC5A 5JJNB 1QVGU 2JS5A 3JARB 1W0KG 4LF4B 1QNMA 1ZAUA 4JI7O 2WLHA 2Q7GA 4B3MB 2X6CA 1WAZA 2JGDA 4B3TO 2YI9A 5KUMA 1AVMA 3SPIA 2QWQB 4QJFB 3JCUZ 1Q43A 1K33A 4JYCA 4P30A 2QWOB 3CPWU 2QEXV 1OCRC 2VQEB 1OCZB 1PNKA 2UXBO 1D5NA 2DQ3A 2W6JG 4DUZO 4DR7B 4JAUA 4FLVA 4O4IB 4AHCA 1MSWD 4L8JA 1H8HG 1ORQC 2OIEA 1OV9A 3F7YC 3R65A 3CXCU 4I4TB 3MHHC 3B8MA 3H01A 1SQQH 5EYPB 2YI8A 4JI6O 3OTOO 2CTWA 2ADQB 2HP8A 3K79A 2PY5A 1XNQO 1VF6C 2DJVA 3JD4A 4MT8A 3KZIZ 5A2QN 1THZA 4RUEA 2B1IA 1VF5B 4C7UA 3N2GA 2KB1A 1AI4A 4CH4A 3EVKA 2XT9A 2XAQA 2A06H 3CRMA 3PN1A 3L74H 2QWRB 1YXBA 4JI1B 1I94O 4FJCC 4CS3A 4WFHA 4MVMA 1NBMG 2MW2B 4J9ZB 2PYLA 4MVZA 1JR9A 4HBNA 3W7UA 2QWNB 4IHJA 2ARHA 4JTCB 4J7JA 4ZHQB 3ASNB 2BSKB 2ZD9A 1OCCB 4H0LB 4X1IA 1XDCA 4O4HA 1S0VA 4JI0O 2F4VO 1FJGO 1OZ0A 4HYOA 4MW8A 4U3JA 4PA3A 3M8AA 5TISZ 2UUAO 1YEWA 2WSSG 1O9HA 2IH1C 4B7KA 3SGIA 1YHQV 3UO2A 2GDSA 1IBLB 2IJKA 4I0XA 3E8BA 3LDCA 2DQ0A 1D5AA 4NB5A 4CS2A 5JVDA 2IJIA 2Y4UA 3DSQA 2ZIMA 2P90A 1VF7A 4UCUA 1N0JA 2F95B 2Q4PA 2OTLV 2ODMA 1DTOA 1N34B 1YDXA 5ITZA 1GN6A 4LF6B 2Q0AA 2GTAA 2Q68A 5L3BA 1PL4A 2EIKB 3E22A 3CCQV 2JGDB 2E5LB 4DV2B 2GV9A 3K9AA 5CBFA 3ZHRA 2ZE5A 3D8CA 1B3QA 1V54B 3GVMA 2Q7HA 4P2ZA 2RNBA 5H6RA 1Z5WA 2BTQA 2CK3G 3E2EA 1GN4A 5KX5A 2ZE7A 1JJOA 3K5MA 1E79G 3W7SA 2N04A 4DV5O 3CRRA 3M99B 1URFA 3SPJA 3D36C 5EC1C 5BR8O 3B77A 4NR1A 1HP8A 4JI4B 5E79Z 5CB4A 3UT5A 1COWG 1AP6A 3CCEV 2Y0PA 3CSXA 3D3QA 4MTXA 4BIUA 3JAKA 2LJ2A 3X2QC 1KMIZ 1LUVA 4I9QA 2YXHA 1M1KW 2V7QG 1SF9A 2ZDIC 4GT1A 5KA5A 1VIBA 4YHHO 1GAXA 4K0KO 5IYZA 5JCOC 2N05A 3T1CA 2ZNIA 5DM6V 4DV0O 2Z3YA 4IHJB 2VQFB 3ICXA 4YJ3A 1A32A 2HKOA 4X1IB 4F6RA 4O4HB 2JEXA 2Q7EA 2A0LA 4DR3O 3CP1A 1XHZA 4U3JB 1ZTEA 1XUQA 3JSNA 4DR6B 4NTXA 3LNNA 5LMNB 3R66A 3LSSA 4I0XB 2YIAA 1S3JA 4K35A 3ZMUA 4B3SB 3BY6A 1VQ5V 3N27A 4ZKIA 2CGNA 5JVDB 1J5EB 1E1RG 1Q8IA 4LR3A 4GYCB 2YSUB 3DC6A 1IXMA 1OCOB 2DYRB 3ABMB 2XUMA 4UCOA 5ITZB 4CC6A 2P67A 1N32B 2UXDB 1VF6A 5B3SB 3SYQA 2GHYA 4IGGA 3JAMN 3E22B 4LF7O 5IT9N 3L70H 2OT5A 1MZEA 3T1YO 1BS3A 3VQWA 5IY5B 2QM4A 1BQZA 1NTMH 4NXNO 4D6TH 3JD0A 2BTQB 5KX5B 1IXBA 2A7WA 4EB6A 1P49A 2F93B 3M7MX 2XASA 1G4YB 4DXWA 4KP4A 5CB4B 2Y69C 4FFBA 3UT5B 4NXMO 3ZHTA 3C3TA 2QKAA 3K0GA 4WCEV 1E1QG 4WFGA 2M7WA 3APOA 1AP5A 3F7VC 1ZWIC 3K57A 2JIZG 2CDYA 2VS0A 2QM8A 5LP6C 2UUCO 2PUSA 4DR2B 5IYZB 1VEWA 3A8TA 1YSCA 4DV1O 1AI6A 3UKMA 5EBWC 4JGSA 4YJ3B 1JFFA 5CA3A 4OGQB 4F6RB 1XMOB 4NTWA 2FL4A 4IIJB 1U96A 4UCVA 4WFEA 1HNZO 3FYIB 1HDJA 1Y6XA 4YIPA 3CCVV 5LMUO 4TUYA 1RM1C 1QU7A 4J7KA 2K9PA 4DV6B 2IJJA 4K8ZA 2ZE6A 4NVPA 3HKEA 1PNLA 4E2LA 2EINB 3L72H 2Q73A 3JYCA 3B09A 3L73H 4QPJA 1OJHA 1QR9A 2ZIOA 4TOIA 5FNVA 4W4LA 4FM1A 4RWUA 4X66B 3IAYA 2DN9A 1H2LA 4X1YA 5EZYA 5J2TA 3CCUV 2XOKG 1MNGA 4I55A 1TUEB 2ZDIA 1B04A 2C2AA 5JWPA 1QR8A 2RN9A 4ASUG 4JAAA 1Q90D 2QJ1A 2IU0A 3FFQA 3QF7A 3IC7A 1QLNA 1UFIA 1M57C 3C3SA 1WA8A 1RPOA 1KB9F 3OMAB 3K5NA 1WB8A 3OUSA 4EB6B 4MVOA 5EC2C 1M93A 1MOFA 3P32A 3E83A 1S5LZ 4FFBB 4TV8A 3OEEG 4PA9A 4X88A 4GX2A 4UVCA 3ZHUA 1BQ0A 1H2KA 2WPDG 2X6AA 1VQMV 2P4VA 3SPGA 2PTMA 3SYAA 5LOVA 4H37A 4J11A 4UVBA 3WB0A 4DUZB 3G71V 2QSAA 4PI0A 4AQYB 1I5YA 5JQGB 1IBKO 2VWKA 3CCLV 1Q3EA 3F5WC 3K58A 3K08A 2P7TC 1DGSA 1DF5A 1K92A 2F43G 2WLIA 2YIDA 4DR5O 1OHHG 5IJ0A 1JFFB 1XNQB 3QNEA 1G6UA 2CGOA 2DOSA 3IC9A 4JI3O 3CEIA 3MDSA 4DR1B 3HKCA 2R72A 2HVKC 1BT8A 4ABMA 3UQ8A 2FKXA 1JPXA 5L3DA 4JYAO 4NTYA 2YXLA 2ZM6O 1NQTA 1K73W 1EZVH 2E75B 2GTSA 4JV5B 3AK3A 3UM7A 4TUYB 2QDOA 3BPZA 4B3RO 3H1KH 4HNAA 4KHPO 4LF9O 1M56C 3JD3A 3ASOC 5A9GA 1G1XB 3HKEB 1LR1A 3RBZA 3O9OA 5CA0A 2AXTZ 2GSMB 1BMFG 2A79B 3JATA 1MG1A 4KFMA 1JMKC 4FM2A 5FNVB 2DYSB 4GKJO 4MVRA 1AJPA 1X4TA 1RFYA 4JTAB 2UUAB 2P06A 3F5TA 4X1YB 4TV9A 5EZYB 2ITCC 5J2TB 2XNDG 4I55B 3BCCH 4YXWG 1F4NA 4DW0A 4WFAV 4QPKA 1US6A 3AG2C 4LF8B 3CMAV 3T4DA 1R6KA 3Q4HA 4ZOLA 4TT3G 1AR4A 1QHTA 2F66C 4O2AA 1VQ8V 1WA8B 2P6JA 3SYOA 2IU3A 4YIOA 4DV4B 2OCHA 4FVMA 1ZL8A 2BTOA 1YZBA 2P4KA 3JALA 4TV8B 3G67A 4G27B 1L0NH 3RYHA 2ITDC 2W6IG 1K3EA 4PJ0Z 1H2SB 1IBMB 3N2KA 1O9GA 3OW2U
chains in the Genus database with same CATH topology
3ABUA 1VQ9V 2ZR2A 1KECA 2AHYA 3FYEB 1PKXA 1Q81W 1COWG 3E8HA 3OEHG 2EILB 5LBQA 3OAAG 5LHGA 3CCEV 3LSQA 5HFLA 4G2KA 3TK1A 4MTXA 1VQ6V 4BIUA 1OCOC 3ABMC 4OXSA 3E8GA 3X2QC 3CC4V 1AI5A 1M1KW 2V7QG 5B1NA 1N8RW 3OE7G 2ZDIC 4GT1A 2NLJC 1EBOA 1R3KC 3HB3B 3T2MA 2EIKC 3AG1C 3SJQC 3GB7C 5KA5A 1NVPB 2EZOA 2IW5A 4QIWF 2DWEC 2WLIB 5L3EA 2IJHA 3AG2B 4N21A 3LDDA 5B1BC 3TETA 3T1CA 1NH2B 1QLEB 1JCHA 3WG7C 5J9PC 3OFNG 4XBFA 5DM6V 1FXHA 2D3OW 2Z3YA 2XAJA 4DO2A 3JD1A 1W2BU 1W0JG 2HKOA 3K03A 4X8AA 2JEXA 1NR1A 4RQEA 4R50A 1GM7A 1YJNV 2A0LA 1H38A 1R3IC 4WF9V 3CC7V 3CP1A 4BIZA 1QBZA 2LP7A 4UUJC 3ZIAG 2QM7A 2LFRA 3AG4C 4H33A 3K3WA 3RW0A 1K9MW 5IDJA 3LSSA 3GWOA 1KQSU 1S3JA 1CPYA 4KUMA 4MTFA 3ZMUA 3BY6A 2H8PC 3W7XA 1VQ5V 2EILC 4ZKIA 4JAVA 1E1RG 1R3LC 1AR1B 1F23A 1MABG 5DN6G 1CP9A 2YSUB 4N23A 5LHHA 1IXMA 2ATKC 5H9CA 4RQFA 1FXKA 1OCOB 2DYRB 1QCEA 3ABMB 3X2QB 4CZZA 2P67A 2Q6AA 4Q20A 5B3SB 2ZXWB 3SYQA 2GHYA 5LGTA 2A9HA 3CCJV 1VQLV 3ZRVA 2DW4A 4TWKA 4GCZA 1BHBA 1WLEA 3E35A 2LFSA 1QLEC 2W0FC 3I55V 5B1BB 1S5HC 3K0DA 2WLNA 2UXNA 1P4RA 2OT5A 2HG5C 5LHIA 1GK9A 1VQ7V 2HVJC 1K97A 4PA7A 3MHSC 4XDLA 1VQOV 3KG2A 1ROPA 5IY5B 4G28B 1K4DC 3ZRXA 1K5QA 3A0RA 1Q82W 5C93A 1KC8W 2YEVA 3ABLB 3CMEV 1BL8A 4XDKA 4HZ3A 3JD0A 2XAGA 3CYOA 2JK5C 3OGCC 1FXVA 1PNMA 3SPHA 1YTFB 5CN0A 4MVQA 1B6QA 1KP2A 1EFRG 1NKDA 4L87A 2MK3A 4LBEC 2FTKA 1G4YB 2XASA 4P9PA 5H6QA 1M90W 4DXWA 4KP4A 4QE7A 3B8NA 2Y69C 3LDEA 4MTOA 3RVZA 1GO3F 3EHBB 5KA6A 1Q7YW 2JJ2G 3ZJZA 1XL6A 1AJNA 1JX9A 2EIMC 3TCUA 2X0LA 2WLLB 3K0GA 2DYRC 4WCEV 4P9OA 1E1QG 4WFGA 2OCCC 2M7WA 2EINC 4MVSA 3CCSV 3F7VC 1ZWIC 1SESA 3OW2U 1WPXA 5E1AC 1DLBA 2X6BA 4R6ZA 2JIZG 2ZXWC 5B1AB 5B3SC 1VQ4V 2BOBC 3SYPA 2QM8A 1YJ9V 1KP3A 3IFXA 5EBMC 4UV9A 3HPLC 2HFEC 3K04A 3STZC 3VOUA 5KUKA 1YSCA 1L1FA 3QO7A 1AI6A 1S72V 3SPCA 1R6NA 3UKMA 5EBWC 5IY5C 2HLDG 2WLKA 4GX5A 4JGSA 1Q86W 3ABLC 3PJSK 3OMNB 1K34A 1JVMA 2AHZA 5CA3A 2JEUA 1KKDA 1QVFU 3P30A 5CMUA 4LCUC 4UV8A 4PDRA 3FB8C 2DWDC 2B5UA 1M57B 3CC2V 4WFEA 3EFFK 3ABKB 1OCZC 2R9IA 3FYIB 2WLJA 4PDMA 4MTGA 1FS0G 3AG3B 3G4SV 3E8FA 4PELA 1VQNV 2WLMA 3CCVV 1NJIW 2QKSA 1Y4MA 1UJWB 1RM1C 2Y69B 5L3GA 1EZJA 1V55B 1G8MA 4GX1A 4JPRA 1NVPD 5L3FA 3ZMTA 2EIMB 2IJJA 3LUTB 3OR7C 3E89A 5IYBO 3ZCCA 1YJWV 1FXKB 2OCCB 1PNLA 4E2LA 2EINB 3OMIB 5B1AC 4U7OA 3JYCA 1AI7A 3DTUB 1GMGA 1JJ2U 3DGEA 4QPJA 5LGNA 1QR9A 1NH2D 1K8AW 4J9YB 2B1GA 1SRYA 2JDIG 3BEHA 4BAYA 3OM3B 2PI4A 3STLC 4F4LA 1QVGU 3ZMSA 4TSFG 1W0KG 1M9NA 2WAMA 5BZBA 1F4MA 3CCUV 4WFBV 2XOKG 1AROP 3QO5A 2H94A 3ZRSA 2WLHA 1TUEB 2ZDIA 2C2AA 2X6CA 2QE7G 1R3JC 1QR8A 3NXSA 3ZRWA 4ASUG 5CBHA 1I5XA 2UXXA 5KUMA 1YIJV 1J95A 5IYDO 4RO2A 2IU0A 3T4ZA 3LNMB 3SPIA 4QJFB 2YEVB 3IC7A 5IYCO 1QLNA 1K33A 4JYCA 1M57C 2WWWA 4P30A 3ABKC 3CPWU 2QEXV 1OCRC 4X89A 1RPOA 3ETDA 1S76D 3OMAB 2Y48A 1OCZB 5LGUA 1PNKA 3AG3C 4MW3A 2DQ3A 2W6JG 3OUSA 3SYCA 4MVOA 3FKSG 4ZBMA 2X7RB 4JAUA 5EC2C 1ENVA 1MOFA 3P32A 1MSWD 4QNHB 1H8HG 3E83A 4MS2A 4RAIA 1VQKV 3CCMV 1ORQC 1RM1B 2R9RB 3F7YC 1V55C 2EZPA 1JQ0A 3OEEG 3R65A 1S77D 4PA9A 3CXCU 3MHHC 2EBOA 4X88A 1FFTB 1SETA 3B8MA 4GX2A 4UVCA 1M56B 4PA6A 3H01A 1FXKC 4GX0A 2WPDG 2X6AA 1VQMV 2XAHA 3SPGA 2EJRA 3FB5C 3RVYA 3SYAA 4H37A 3FB6C 3K79A 3I56V 2V1DA 2Z5UA 1SERA 4UVBA 3G71V 3JD4A 4MT8A 1I5YA 1THZA 2DYSC 4FK5C 4RUEA 5HFMA 1H2GA 2B1IA 2WLLA 2ZR3A 3JCZA 3CCLV 3OR6C 2KB1A 1DF4A 1BHAA 1HWYA 5EBLC 3F5WC 1AI4A 4UXNA 4BW5A 4MVUA 4LP8A 3K08A 2P7TC 2EIJB 1DF5A 2Q67A 2XAQA 1F51A 1K92A 2F43G 2WLIA 2XAFA 1YTFD 3W7WA 2HR3A 4LC1A 1OHHG 1R73A 4FJCC 4WFHA 1CEZA 4MVMA 1NBMG 3QNEA 3ZMZA 4J9ZB 3D3IA 4MVZA 1K7DA 3OUFA 2OTJV 1P7BA 4QE9A 3E86A 1V54C 3QO8A 5EK0A 2HVKC 3W7UA 2HJFC 4JYBA 4MSWC 4WFFA 3W7TA 4JTCB 1JPXA 1OCRB 5L3DA 2ZQMA 3ASNB 4JTDB 2ZD9A 4UVAA 1GKFA 4PDLA 1OCCB 1S0VA 1NQTA 2QTOA 1K73W 4XDJA 3ETEA 1OZ0A 4HYOA 3AEIA 4MW8A 3ETGA 3UM7A 5L3CA 4PA3A 5CBGA 3ZMVA 4EKWA 1M56C 2WSSG 2PI5A 3D36A 1AJQA 2IH1C 3JD3A 3ZN0A 3ASOC 1YHQV 2IJKA 1NR7A 5GW7A 1PL0A 3E8BA 3LDCA 2DQ0A 1YITV 4FIPC 2BOCC 3RBZA 4PA4A 1GM8A 2IJIA 4FPPA 2GSMB 1BMFG 2A79B 2NNUA 1MG1A 2K1EA 4FMTA 4KFMA 4I9WA 2P90A 2DYSB 4MVRA 1GM9A 1AJPA 4HAMA 4Z1MG 2QA4V 2OTLV 4JTAB 1DTOA 1SZTA 2ITCC 4PDVA 3JD2A 1KD1W 2EIJC 2XNDG 1VQPV 1YI2V 2Q68A 5L3BA 3FB7C 3G6EV 3ABTA 3ZN1A 2EIKB 3AG1B 3CCQV 4YXWG 1F4NA 1LNQA 3ZRWB 4WFAV 4QPKA 4U7NA 2Q69A 3AG2C 3CMAV 3K9AA 4RUFA 5CBFA 1GTOA 4R8CA 2IH3C 3T4DA 1R6KA 3CD6V 4CBCA 3MD0A 4JASA 1V54B 3WG7B 4TT3G 3ASNC 1VQ8V 4R7CA 2P6JA 5FL7G 1OCCC 3SYOA 3WFVA 1JOYA 2IU3A 4P2ZA 5H6RA 1K5SA 3K06A 1Y66A 2CK3G 4I5SA 4JF3A 3E2EA 3ML0A 1E79G 3W7SA 3VBBA 4G27B 5B1OA 3M99B 2ITDC 2W6IG 1K3EA 3IGAC 3SPJA 5EC1C 1PD3A 3B77A 3AG4B 3ASOB 1H8EG 1K4CC 1RPRA 3CCRV 1XL4A 2JJ1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC C;  3WFV A;  1SZT A;  2X7R B;  1QCE A;  4N21 A;  3MHS C;  1I5Y A;  1ENV A;  1MOF A;  3B8N A;  4FK5 C;  4E2L A;  1QR8 A;  5HFM A;  1I5X A;  1Y66 A;  4JF3 A;  5HFL A;  1JPX A;  5KA6 A;  4FIP C;  4G2K A;  1DF4 A;  2EZP A;  1JQ0 A;  2LP7 A;  3GWO A;  3CYO A;  1QR9 A;  2EBO A;  3B8M A;  3MHH C;  3K9A A;  3M99 B;  1K33 A;  1MG1 A;  2M7W A;  3H01 A;  5CMU A;  5CN0 A;  1Y4M A;  1DF5 A;  3B77 A;  1EBO A;  4JGS A;  1DLB A;  5KA5 A;  1F23 A;  4N23 A;  1K34 A;  2EZO A;  2OT5 A;  2MK3 A;  3P30 A;  3CP1 A;  5H9C A;  1QBZ A;  2P6J A;  4JPR A; 
#chains in the Genus database with same CATH topology
 5LOV B;  3ABU A;  1SKV A;  2ZR2 A;  1PKX A;  1XNR B;  3BVO A;  2ADP A;  5K1P A;  3CC4 V;  3APQ A;  1AI5 A;  2Q8V A;  2DMX A;  1HR0 B;  2CTQ A;  2HHH O;  2QR4 A;  2NLJ C;  3HB3 B;  3ZHS A;  5BR8 B;  3GB7 C;  3RYF A;  2YIC A;  4DV7 O;  5IWA O;  4QIW F;  2WLI B;  1NZ6 A;  2UU9 O;  2XHB A;  3THO A;  1XEQ A;  5IJ0 B;  3K59 A;  1NH2 B;  2YIB D;  4JI5 B;  5J9P C;  3OFN G;  2UUB O;  5EIB D;  3TXS A;  3HKC B;  1ZSP A;  2XAJ A;  4DO2 A;  4X20 A;  2UXC B;  3JD1 A;  1W2B U;  1W0J G;  3K03 A;  4R50 A;  1YJN V;  1R3I C;  5F2V O;  4WF9 V;  4X64 B;  1RP3 B;  3ZIA G;  4HNA B;  4AIL C;  2QM7 A;  2LFR A;  3AG4 C;  4Z2W A;  5LL6 Y;  2PF4 E;  3RW0 A;  2FB5 A;  1K9M W;  4LF5 B;  1P84 F;  4J80 A;  3GWO A;  3L9D A;  4KUM A;  3CHX A;  3BAA A;  4JAV A;  5CA0 B;  3QVN A;  4LF4 O;  3JAT B;  1AR1 B;  2XTA A;  4BR6 A;  2ATK C;  4B3M O;  5H9C A;  3H1L H;  4TV9 B;  5JJE B;  3ETQ A;  2Q6A A;  1NTZ H;  2GBO A;  4KXR A;  4Q20 A;  4JI8 B;  3BRC A;  5LGT A;  1N4C A;  4FZ1 A;  3DXR A;  1NS1 A;  2R9A A;  3JAW A;  2DW4 A;  4GCZ A;  1FAF A;  1WLE A;  5KLV H;  2VQE O;  1QLE C;  1JA8 A;  5B1B B;  1P4R A;  2PGG A;  4DR7 O;  1R6T A;  3Q4H B;  4I7Z B;  4ZOL B;  1K97 A;  4O2A B;  3KG2 A;  4G28 B;  1K4D C;  3ZRX A;  5GON A;  3L71 H;  5BY1 A;  4HZ3 A;  1ZL8 B;  1FXV A;  5CN0 A;  4FFK A;  1SQF A;  2DE0 X;  3JAL B;  1KP2 A;  1WJZ A;  4PI2 A;  4ICG A;  3RYH B;  1EFR G;  1NKD A;  4JZ2 A;  2CAZ C;  3N2K B;  4YY3 B;  3TGU H;  1MA1 A;  1GO3 F;  2RCV A;  3EHB B;  3T1H B;  2AZ2 A;  3ZJZ A;  2EIM C;  2X0L A;  4P9O A;  3N2G B;  4UCT A;  4TQF A;  4MVS A;  3CCS V;  1KYO F;  2CH7 A;  1WPX A;  1DLB A;  4R6Z A;  2ZXW C;  3RYF B;  4DK0 A;  1KP3 A;  5EBM C;  2VWJ A;  1MMM A;  4WBN A;  3A0B Z;  3QO7 A;  1VAR A;  3SPC A;  5FPO A;  2HLD G;  4NKG B;  4X20 B;  4GX5 A;  1Q86 W;  3ABL C;  3J81 N;  1JVM A;  2JEU A;  2IBZ H;  4FLY A;  2LW7 A;  4UV8 A;  1VP7 A;  4PDR A;  2B5U A;  1M57 B;  3CC2 V;  1S5J A;  3EFF K;  3FAV A;  1OCZ C;  2R9I A;  3E8F A;  4PEL A;  2WLM A;  2F23 A;  5GTH Z;  2QKS A;  1BZK A;  1UJW B;  3RYI A;  1EZJ A;  1N34 O;  1G8M A;  1WP7 A;  5L3F A;  3ZMT A;  4GKK B;  2Q5Z A;  4LF6 O;  3LUT B;  3OR7 C;  3ZCC A;  2OCC B;  2E5L O;  4DV2 O;  5B1A C;  4U7O A;  3DTU B;  1NH2 D;  3SDL A;  2RDC A;  4D7S A;  1SRY A;  1M5I A;  5LMU B;  3OM3 B;  3DXR B;  3JAW B;  3WB2 A;  1MZF A;  1ZUQ A;  2WAM A;  2NR5 A;  4WFB V;  1ARO P;  2H94 A;  3ZRS A;  4ZI7 A;  5KAF Z;  3CX5 F;  2QE7 G;  3NXS A;  5CBH A;  1I5X A;  3J7A U;  2UXX A;  2A3Q A;  1H2N A;  4RO2 A;  5GON B;  1WNS A;  3LNM B;  1N0N A;  2EX3 A;  2WWW A;  4JI4 O;  4DV3 B;  5LYJ A;  2Y0I A;  4X89 A;  1S76 D;  2O57 A;  5LGU A;  4X62 O;  3AG3 C;  4MW3 A;  3RT3 C;  4OX9 B;  2YUA A;  3FKS G;  4ZBM A;  5FLX N;  4Z1V A;  4CH6 A;  1IUR A;  1ENV A;  3AK1 A;  5AG2 A;  3B40 A;  4QNH B;  4QGP A;  4RAI A;  1VQK V;  3CCM V;  2R9R B;  5KMG A;  2EZP A;  1S77 D;  2EBO A;  3AG7 A;  1SET A;  5KHH A;  1M56 B;  1Y74 A;  3KCY A;  4DR4 B;  4GX0 A;  3JAK B;  3QTC A;  2Y4T A;  3RN4 A;  4I50 A;  2VRZ A;  5CA1 A;  2EJR A;  1LUW A;  2CH7 B;  5D5Q A;  3I56 V;  2V1D A;  2Z5U A;  1SER A;  4LFC B;  4KL1 A;  4DUY B;  5DED A;  1HNW B;  1PM9 A;  2WLL A;  3JCZ A;  3OR6 C;  1DF4 A;  1BHA A;  4UXN A;  4MVU A;  4FLW A;  4WBN B;  4X9Q A;  2EJ7 A;  5K1X A;  4JI2 B;  5KHJ A;  1N36 B;  3KKY A;  2XAF A;  3W7W A;  3SJB C;  4A5U B;  1CEZ A;  4DR6 O;  3TJT A;  1K7D A;  3OUF A;  4B08 A;  2OTJ V;  1P7B A;  3E86 A;  4PD4 F;  1V54 C;  5LMN O;  1U97 A;  5B66 Z;  4JYB A;  4PHZ A;  2HJF C;  4MSW C;  3W7T A;  3NR7 A;  4D7T A;  4LFA B;  1OCR B;  4B3S O;  2ZQM A;  3FAV B;  4FLX A;  4UB6 Z;  1XOU A;  4PDL A;  5B5E Z;  2QTO A;  1L8D A;  1P7G A;  4XDJ A;  1I08 A;  3ZED A;  3ETG A;  5BXZ A;  2AGA A;  4LH7 A;  3RYI B;  5CBG A;  1D2D A;  1HNX B;  4EKW A;  2PI5 A;  3D36 A;  1XMQ B;  2QGN A;  1N32 O;  2UXD O;  5GW7 A;  1WPB A;  1PL0 A;  4JI3 B;  1BE3 H;  2ZIN A;  2BOC C;  4PA4 A;  4JYA B;  4FPP A;  3FD9 A;  1EM1 A;  4FMT A;  1BGY H;  2ZM6 B;  4X65 B;  4I9W A;  2E3C A;  4J41 A;  2LQT A;  4HAM A;  1SQG A;  2QA4 V;  1N33 B;  4B3R B;  4PDV A;  3JD2 A;  1KD1 W;  2ZCE A;  1R1B A;  2EIJ C;  4H44 B;  4ZI7 B;  1VQP V;  3ABT A;  1PPJ H;  3K5O A;  1LNQ A;  4U7N A;  2LO1 A;  2Q69 A;  4RUF A;  1GTO A;  5JCO A;  3U10 A;  4R8C A;  3CD6 V;  2BCC H;  4CBC A;  3MD0 A;  4JYY A;  4JAS A;  5LYJ B;  1I0H A;  4R7C A;  2V4D A;  5LXT A;  5FL7 G;  4JI7 B;  3K06 A;  4B3T B;  2L6L A;  4I5S A;  4JF3 A;  1XQ8 A;  3S3W A;  1IZ3 A;  5KMG B;  3VBB A;  3IGA C;  1PD3 A;  3AG4 B;  1Y74 B;  1H8E G;  1K4C C;  3U0Z A;  4UB8 Z;  1TVK A;  4I50 B;  3P3P A;  5CA1 B;  2CE4 A;  4LFB O;  2UXB B;  1KEC A;  2AHY A;  3FYE B;  1Q81 W;  4FLU A;  4DR2 O;  1QQC A;  5LHG A;  5JJJ B;  5HFL A;  2OYQ A;  3TK1 A;  4U3F H;  1OCO C;  3ABM C;  5B1N A;  1N8R W;  3T2M A;  1EBO A;  2B9Z A;  3AG1 C;  3SJQ C;  4JI6 B;  1XMO O;  3OTO B;  2IW5 A;  1X59 A;  2DWE C;  1EN6 A;  1WB7 A;  2JRI A;  2ZKO A;  1F7Y A;  4AI8 A;  3LDD A;  3BFR A;  1QLE B;  1JCH A;  3WG7 C;  4XBF A;  1FXH A;  1PP9 H;  1Q6I A;  2H3O A;  2WA4 A;  4RQE A;  1GM7 A;  2FML A;  1XIL A;  3CRC A;  4DV6 O;  4DV7 B;  2JS3 A;  2LP7 A;  1YVW A;  4UUJ C;  5IWA B;  4CS4 A;  1I94 B;  2LW1 A;  3IJ4 A;  3L75 H;  5H5N A;  4H33 A;  5IDJ A;  5C8Y A;  1AB3 A;  1KQS U;  2UUB B;  1CPY A;  3C90 A;  5BMV A;  1SC5 B;  4X66 O;  3JAS A;  2EIL C;  3ZX6 A;  4UFZ A;  4JI0 B;  2F4V B;  1BSM A;  1F23 A;  1MAB G;  2Q0O C;  5DN6 G;  1CP9 A;  4N23 A;  1FJG B;  1L0L H;  1QCE A;  3X2Q B;  1TAE A;  1DK1 A;  3OGI B;  4CZZ A;  3I5D A;  5KHI A;  2ZXW B;  5LP6 A;  2CUG A;  4BW9 A;  2QKC A;  1FYJ A;  2L35 A;  3E35 A;  2LFS A;  2W0F C;  5FPR A;  3K0D A;  2WLN A;  3G80 A;  2KQX A;  2M6Y A;  5LHI A;  1GK9 A;  1VQ7 V;  2HVJ C;  3H1I H;  4XDL A;  5LXT B;  4F6E A;  1K5Q A;  1Q82 W;  2YEV A;  3ABL B;  3CME V;  1BL8 A;  4W4K A;  2XAG A;  2JK5 C;  2ZE8 A;  3CB2 A;  2IM9 A;  3OGC C;  1SQB H;  1RSO A;  1PNM A;  1YTF B;  1W59 A;  2LGW A;  4MVQ A;  1B6Q A;  4OPA A;  4LBE C;  1M90 W;  4AQY O;  5H6Q A;  1TVK B;  2RMK B;  5J2U A;  3B8N A;  3LDE A;  3BA9 A;  4MTO A;  4Q6G A;  3RVZ A;  2LGQ A;  3GWK C;  3ZBH A;  3TCU A;  4J7Z A;  2EIN C;  4K8X A;  2QTS A;  4DV5 B;  2X6B A;  5B1A B;  1WN7 A;  1VQ4 V;  1KKC A;  3SYP A;  1YCI A;  4DR1 O;  1YJ9 V;  4EEQ A;  3IFX A;  2YS8 A;  2BE3 A;  2HFE C;  5D5P A;  1XRE A;  3STZ C;  4IL6 Z;  1R6N A;  1Y76 A;  5IJ9 A;  4JV5 O;  3AK2 A;  3RYC A;  2WLK A;  3CJH A;  4LNU A;  3J80 N;  4DW1 A;  1Q6H A;  1V9P A;  3G6B A;  3OMN B;  1QVF U;  5CMU A;  3MAQ A;  4LCU C;  1GN2 A;  4DYL A;  2DWD C;  4YHH B;  4K0K B;  2WLJ A;  4PDM A;  1FS0 G;  5DEC A;  3AG3 B;  4E4E A;  1VQN V;  2YXY A;  5C8Y B;  5EIB C;  4DV0 B;  1Y4M A;  4IYI A;  5BMV B;  1EN4 A;  1SQP H;  2Y69 B;  3JAS B;  1KUQ A;  2ETN A;  1Q5O A;  4DR3 B;  3FX7 A;  4OPH A;  1NTK H;  5IYB O;  1YJW V;  3H1J H;  1AI7 A;  4LF8 O;  1GMG A;  1JJ2 U;  3DGE A;  1KBH A;  5LGN A;  3HKB A;  1K8A W;  5LP6 B;  2JDI G;  4BAY A;  2KG7 A;  4F4L A;  3ZMS A;  4TSF G;  1M9N A;  5BZB A;  3BHP A;  3U11 A;  1F4M A;  4ZIB A;  3QO5 A;  3LSU A;  4DV4 O;  1NI8 A;  1R3J C;  3ZRW A;  4BWA A;  1VMG A;  1YIJ V;  3UCS C;  1J95 A;  2P5O A;  5IYD O;  3T4Z A;  2YEV B;  1I7F A;  5IYC O;  4H13 B;  1IBM O;  3ABK C;  1RSO B;  4LF7 B;  2AW9 A;  3ETD A;  2Y48 A;  4EFE A;  1SQV H;  3SYC A;  4DRX A;  2AZ0 A;  1PV0 A;  2X7R B;  1H2M A;  1UPG A;  1XNR O;  3T1Y B;  5J2U B;  4MS2 A;  4GZR B;  1RM1 B;  1V55 C;  4FLT A;  1JQ0 A;  3CXH F;  4NXN B;  1FFT B;  1HR0 O;  4PA6 A;  1FXK C;  1T5E A;  2XAH A;  4JI1 O;  3FB5 C;  1WP8 A;  3RVY A;  1TUB A;  1CXZ B;  3FB6 C;  3TXQ A;  2HEP A;  4X62 B;  4J10 A;  4JI5 O;  2DYS C;  1TGO A;  4O2B A;  2GUZ A;  4FK5 C;  5HFM A;  1H2G A;  2ZR3 A;  1IX9 A;  4NXM B;  1HWY A;  2JVD A;  2UXC O;  5EBL C;  2KSD A;  4BW5 A;  4LP8 A;  2NN4 A;  5H2F Z;  2EIJ B;  2Q67 A;  1F51 A;  1Y76 B;  1YTF D;  5IJ9 B;  4X64 O;  1NT2 B;  2HR3 A;  4LC1 A;  3RYC B;  1Z2G A;  1M4U A;  3CJH B;  4LNU B;  1R73 A;  3ZMZ A;  1IBL O;  3D3I A;  3RFR A;  4QE9 A;  2UUC B;  2HJD A;  3QO8 A;  4LF5 O;  5JH7 A;  5EK0 A;  4WFF A;  2YDE A;  4O4L A;  4EFB A;  4JTD B;  4UVA A;  1GKF A;  1FKA O;  1MSD A;  4DV1 B;  3ETE A;  3AEI A;  4IIJ A;  5L3C A;  1AIL A;  1FFX A;  4CH5 A;  3QG5 A;  4BIO A;  3ZMV A;  1AJQ A;  3ZN0 A;  4JI8 O;  1NR7 A;  1YIT V;  4FIP C;  1HNZ B;  1GM8 A;  2NNU A;  2K1E A;  3HKB B;  3K9S A;  3SJA C;  1GM9 A;  2KG7 B;  4Z1M G;  4YJ2 A;  3EXA A;  1TA8 A;  1SZT A;  2QWP B;  1YI2 V;  3FB7 C;  3G6E V;  3ZN1 A;  3AG1 B;  3ZRW B;  2ILM A;  3VQX A;  2IH3 C;  5KAI Z;  1GH6 A;  3WG7 B;  3ASN C;  4YY3 O;  1OCC C;  3WFV A;  2D2C B;  1JOY A;  2PYJ A;  5LA6 A;  4DRX B;  4J42 A;  3UO3 A;  3T1H O;  1K5S A;  1Y66 A;  4JZG A;  5IE9 A;  1SQX H;  3ML0 A;  2PZS A;  5B1O A;  1SZX A;  2EUL A;  3ASO B;  3A0H Z;  2R70 A;  4O4J A;  2YIB A;  1EN5 A;  1RPR A;  3CCR V;  3PJS K;  1XL4 A;  2JJ1 G;  1TUB B;  1VQ9 V;  3S3X A;  3E8H A;  3OEH G;  2EIL B;  5LBQ A;  4LWS A;  3OAA G;  2CTP A;  3LSQ A;  4O2B B;  2GUZ B;  4G2K A;  4X1K A;  1VQ6 V;  2VQF O;  4OXS A;  3E8G A;  2W0X A;  3OE7 G;  3ZHQ A;  3JSL A;  1R3K C;  2EIK C;  1AR5 A;  1NVP B;  5KHK A;  1GRJ A;  2EZO A;  5JQG A;  2JGU A;  5L3E A;  2IJH A;  3AG2 B;  4N21 A;  4LFB B;  1IDS A;  4IYH A;  5B1B C;  3SJC C;  3TET A;  1IBK B;  2P22 C;  5JH7 B;  2D3O W;  1Z5V A;  4O4L B;  2E74 B;  1J5E O;  3CS5 A;  3HKD A;  1FD9 A;  4X8A A;  1B06 A;  1NR1 A;  2E76 B;  3RWR D;  4GKK O;  1H38 A;  1SA0 A;  3CC7 V;  4BIZ A;  1QBZ A;  4DR5 B;  1FFX B;  3WB1 A;  2F1M A;  3K3W A;  5GTI Z;  3KCX A;  4MTF A;  2H8P C;  3W7X A;  3VQY A;  1GN3 A;  3SR2 C;  1R3L C;  2RJZ A;  5LHH A;  3CE2 A;  3ZHV A;  4RQF A;  3BA8 A;  3H1H H;  1FXK A;  2RQ6 A;  3CRQ A;  4YJ2 B;  4KHP B;  4LF9 B;  2WA3 A;  2YC0 A;  4GLX A;  2A9H A;  3CCJ V;  1VQL V;  3ZRV A;  4DV3 O;  1HW7 A;  4TWK A;  3JAR A;  1BHB A;  2CTR A;  1SS3 A;  3I55 V;  4B7E A;  4DK1 A;  1S5H C;  2UXN A;  4OX9 O;  4GKJ B;  2Z0A A;  2HG5 C;  3O65 A;  4PA7 A;  3MHS C;  1VQO V;  1XHX A;  1FPO A;  1ROP A;  1XI1 A;  5LA6 B;  3VQV A;  3CRA A;  3A0R A;  1KC8 W;  5C93 A;  4UCR A;  4XDK A;  3CYO A;  4DR4 O;  1ZLZ A;  3SPH A;  4UCS A;  2KKW A;  4FLZ A;  3P3N A;  4PV1 B;  4L87 A;  4LFC O;  2MK3 A;  2FTK A;  4O4I A;  4P9P A;  4O4J B;  4DUY O;  1HNW O;  4QE7 A;  2OIG A;  4FM0 A;  4I4T A;  3HR0 A;  3B4S A;  2G38 A;  5KA6 A;  1Q7Y W;  2JJ2 G;  3A2F A;  1XL6 A;  4LWS B;  3ZS8 C;  1AJN A;  1JX9 A;  2WLL B;  2DYR C;  5EYP A;  4X1K B;  2OCC C;  4JI2 O;  1N36 O;  4GUN A;  1SES A;  5E1A C;  5B3S C;  2Q9L A;  2BOB C;  3K5L A;  2ZT9 B;  4UV9 A;  3HPL C;  1XBL A;  4LFA O;  3K04 A;  5KHG A;  1BCC H;  1YF2 A;  3VOU A;  5KUK A;  1L1F A;  3BAB A;  1S72 V;  4CC5 A;  2ZNJ A;  1Y67 A;  3RGB A;  5IY5 C;  2HHH B;  3CWB H;  1NU1 H;  1HNX O;  1K34 A;  2AHZ A;  3HKD B;  1KKD A;  3P30 A;  1XMQ O;  2N74 A;  1SA0 B;  4IT5 A;  3FB8 C;  2UU9 B;  4ZHQ A;  3ABK B;  2BSK A;  2FYU H;  4MTG A;  1ZX3 A;  3OT7 A;  3B2E E;  4K3A A;  3G4S V;  3OTF A;  1IVS A;  1NJI W;  4X65 O;  2OWO A;  4NYK A;  1N33 O;  4TQD A;  5L3G A;  3H9V A;  4CH3 A;  1V55 B;  4GX1 A;  4JPR A;  1NVP D;  4FZ0 A;  2EIM B;  3OD4 A;  1KU9 A;  1Q6U A;  3WU2 Z;  3E89 A;  1FXK B;  4LH6 A;  3OMI B;  4J9Y B;  2B1G A;  3BEH A;  2PI4 A;  3STL C;  3DC5 A;  5JJN B;  1QVG U;  2JS5 A;  3JAR B;  1W0K G;  4LF4 B;  1QNM A;  1ZAU A;  4JI7 O;  2WLH A;  2Q7G A;  4B3M B;  2X6C A;  1WAZ A;  2JGD A;  4B3T O;  2YI9 A;  5KUM A;  1AVM A;  3SPI A;  2QWQ B;  4QJF B;  3JCU Z;  1Q43 A;  1K33 A;  4JYC A;  4P30 A;  2QWO B;  3CPW U;  2QEX V;  1OCR C;  2VQE B;  1OCZ B;  1PNK A;  2UXB O;  1D5N A;  2DQ3 A;  2W6J G;  4DUZ O;  4DR7 B;  4JAU A;  4FLV A;  4O4I B;  4AHC A;  1MSW D;  4L8J A;  1H8H G;  1ORQ C;  2OIE A;  1OV9 A;  3F7Y C;  3R65 A;  3CXC U;  4I4T B;  3MHH C;  3B8M A;  3H01 A;  1SQQ H;  5EYP B;  2YI8 A;  4JI6 O;  3OTO O;  2CTW A;  2ADQ B;  2HP8 A;  3K79 A;  2PY5 A;  1XNQ O;  1VF6 C;  2DJV A;  3JD4 A;  4MT8 A;  3KZI Z;  5A2Q N;  1THZ A;  4RUE A;  2B1I A;  1VF5 B;  4C7U A;  3N2G A;  2KB1 A;  1AI4 A;  4CH4 A;  3EVK A;  2XT9 A;  2XAQ A;  2A06 H;  3CRM A;  3PN1 A;  3L74 H;  2QWR B;  1YXB A;  4JI1 B;  1I94 O;  4FJC C;  4CS3 A;  4WFH A;  4MVM A;  1NBM G;  2MW2 B;  4J9Z B;  2PYL A;  4MVZ A;  1JR9 A;  4HBN A;  3W7U A;  2QWN B;  4IHJ A;  2ARH A;  4JTC B;  4J7J A;  4ZHQ B;  3ASN B;  2BSK B;  2ZD9 A;  1OCC B;  4H0L B;  4X1I A;  1XDC A;  4O4H A;  1S0V A;  4JI0 O;  2F4V O;  1FJG O;  1OZ0 A;  4HYO A;  4MW8 A;  4U3J A;  4PA3 A;  3M8A A;  5TIS Z;  2UUA O;  1YEW A;  2WSS G;  1O9H A;  2IH1 C;  4B7K A;  3SGI A;  1YHQ V;  3UO2 A;  2GDS A;  1IBL B;  2IJK A;  4I0X A;  3E8B A;  3LDC A;  2DQ0 A;  1D5A A;  4NB5 A;  4CS2 A;  5JVD A;  2IJI A;  2Y4U A;  3DSQ A;  2ZIM A;  2P90 A;  1VF7 A;  4UCU A;  1N0J A;  2F95 B;  2Q4P A;  2OTL V;  2ODM A;  1DTO A;  1N34 B;  1YDX A;  5ITZ A;  1GN6 A;  4LF6 B;  2Q0A A;  2GTA A;  2Q68 A;  5L3B A;  1PL4 A;  2EIK B;  3E22 A;  3CCQ V;  2JGD B;  2E5L B;  4DV2 B;  2GV9 A;  3K9A A;  5CBF A;  3ZHR A;  2ZE5 A;  3D8C A;  1B3Q A;  1V54 B;  3GVM A;  2Q7H A;  4P2Z A;  2RNB A;  5H6R A;  1Z5W A;  2BTQ A;  2CK3 G;  3E2E A;  1GN4 A;  5KX5 A;  2ZE7 A;  1JJO A;  3K5M A;  1E79 G;  3W7S A;  2N04 A;  4DV5 O;  3CRR A;  3M99 B;  1URF A;  3SPJ A;  3D36 C;  5EC1 C;  5BR8 O;  3B77 A;  4NR1 A;  1HP8 A;  4JI4 B;  5E79 Z;  5CB4 A;  3UT5 A;  1COW G;  1AP6 A;  3CCE V;  2Y0P A;  3CSX A;  3D3Q A;  4MTX A;  4BIU A;  3JAK A;  2LJ2 A;  3X2Q C;  1KMI Z;  1LUV A;  4I9Q A;  2YXH A;  1M1K W;  2V7Q G;  1SF9 A;  2ZDI C;  4GT1 A;  5KA5 A;  1VIB A;  4YHH O;  1GAX A;  4K0K O;  5IYZ A;  5JCO C;  2N05 A;  3T1C A;  2ZNI A;  5DM6 V;  4DV0 O;  2Z3Y A;  4IHJ B;  2VQF B;  3ICX A;  4YJ3 A;  1A32 A;  2HKO A;  4X1I B;  4F6R A;  4O4H B;  2JEX A;  2Q7E A;  2A0L A;  4DR3 O;  3CP1 A;  1XHZ A;  4U3J B;  1ZTE A;  1XUQ A;  3JSN A;  4DR6 B;  4NTX A;  3LNN A;  5LMN B;  3R66 A;  3LSS A;  4I0X B;  2YIA A;  1S3J A;  4K35 A;  3ZMU A;  4B3S B;  3BY6 A;  1VQ5 V;  3N27 A;  4ZKI A;  2CGN A;  5JVD B;  1J5E B;  1E1R G;  1Q8I A;  4LR3 A;  4GYC B;  2YSU B;  3DC6 A;  1IXM A;  1OCO B;  2DYR B;  3ABM B;  2XUM A;  4UCO A;  5ITZ B;  4CC6 A;  2P67 A;  1N32 B;  2UXD B;  1VF6 A;  5B3S B;  3SYQ A;  2GHY A;  4IGG A;  3JAM N;  3E22 B;  4LF7 O;  5IT9 N;  3L70 H;  2OT5 A;  1MZE A;  3T1Y O;  1BS3 A;  3VQW A;  5IY5 B;  2QM4 A;  1BQZ A;  1NTM H;  4NXN O;  4D6T H;  3JD0 A;  2BTQ B;  5KX5 B;  1IXB A;  2A7W A;  4EB6 A;  1P49 A;  2F93 B;  3M7M X;  2XAS A;  1G4Y B;  4DXW A;  4KP4 A;  5CB4 B;  2Y69 C;  4FFB A;  3UT5 B;  4NXM O;  3ZHT A;  3C3T A;  2QKA A;  3K0G A;  4WCE V;  1E1Q G;  4WFG A;  2M7W A;  3APO A;  1AP5 A;  3F7V C;  1ZWI C;  3K57 A;  2JIZ G;  2CDY A;  2VS0 A;  2QM8 A;  5LP6 C;  2UUC O;  2PUS A;  4DR2 B;  5IYZ B;  1VEW A;  3A8T A;  1YSC A;  4DV1 O;  1AI6 A;  3UKM A;  5EBW C;  4JGS A;  4YJ3 B;  1JFF A;  5CA3 A;  4OGQ B;  4F6R B;  1XMO B;  4NTW A;  2FL4 A;  4IIJ B;  1U96 A;  4UCV A;  4WFE A;  1HNZ O;  3FYI B;  1HDJ A;  1Y6X A;  4YIP A;  3CCV V;  5LMU O;  4TUY A;  1RM1 C;  1QU7 A;  4J7K A;  2K9P A;  4DV6 B;  2IJJ A;  4K8Z A;  2ZE6 A;  4NVP A;  3HKE A;  1PNL A;  4E2L A;  2EIN B;  3L72 H;  2Q73 A;  3JYC A;  3B09 A;  3L73 H;  4QPJ A;  1OJH A;  1QR9 A;  2ZIO A;  4TOI A;  5FNV A;  4W4L A;  4FM1 A;  4RWU A;  4X66 B;  3IAY A;  2DN9 A;  1H2L A;  4X1Y A;  5EZY A;  5J2T A;  3CCU V;  2XOK G;  1MNG A;  4I55 A;  1TUE B;  2ZDI A;  1B04 A;  2C2A A;  5JWP A;  1QR8 A;  2RN9 A;  4ASU G;  4JAA A;  1Q90 D;  2QJ1 A;  2IU0 A;  3FFQ A;  3QF7 A;  3IC7 A;  1QLN A;  1UFI A;  1M57 C;  3C3S A;  1WA8 A;  1RPO A;  1KB9 F;  3OMA B;  3K5N A;  1WB8 A;  3OUS A;  4EB6 B;  4MVO A;  5EC2 C;  1M93 A;  1MOF A;  3P32 A;  3E83 A;  1S5L Z;  4FFB B;  4TV8 A;  3OEE G;  4PA9 A;  4X88 A;  4GX2 A;  4UVC A;  3ZHU A;  1BQ0 A;  1H2K A;  2WPD G;  2X6A A;  1VQM V;  2P4V A;  3SPG A;  2PTM A;  3SYA A;  5LOV A;  4H37 A;  4J11 A;  4UVB A;  3WB0 A;  4DUZ B;  3G71 V;  2QSA A;  4PI0 A;  4AQY B;  1I5Y A;  5JQG B;  1IBK O;  2VWK A;  3CCL V;  1Q3E A;  3F5W C;  3K58 A;  3K08 A;  2P7T C;  1DGS A;  1DF5 A;  1K92 A;  2F43 G;  2WLI A;  2YID A;  4DR5 O;  1OHH G;  5IJ0 A;  1JFF B;  1XNQ B;  3QNE A;  1G6U A;  2CGO A;  2DOS A;  3IC9 A;  4JI3 O;  3CEI A;  3MDS A;  4DR1 B;  3HKC A;  2R72 A;  2HVK C;  1BT8 A;  4ABM A;  3UQ8 A;  2FKX A;  1JPX A;  5L3D A;  4JYA O;  4NTY A;  2YXL A;  2ZM6 O;  1NQT A;  1K73 W;  1EZV H;  2E75 B;  2GTS A;  4JV5 B;  3AK3 A;  3UM7 A;  4TUY B;  2QDO A;  3BPZ A;  4B3R O;  3H1K H;  4HNA A;  4KHP O;  4LF9 O;  1M56 C;  3JD3 A;  3ASO C;  5A9G A;  1G1X B;  3HKE B;  1LR1 A;  3RBZ A;  3O9O A;  5CA0 A;  2AXT Z;  2GSM B;  1BMF G;  2A79 B;  3JAT A;  1MG1 A;  4KFM A;  1JMK C;  4FM2 A;  5FNV B;  2DYS B;  4GKJ O;  4MVR A;  1AJP A;  1X4T A;  1RFY A;  4JTA B;  2UUA B;  2P06 A;  3F5T A;  4X1Y B;  4TV9 A;  5EZY B;  2ITC C;  5J2T B;  2XND G;  4I55 B;  3BCC H;  4YXW G;  1F4N A;  4DW0 A;  4WFA V;  4QPK A;  1US6 A;  3AG2 C;  4LF8 B;  3CMA V;  3T4D A;  1R6K A;  3Q4H A;  4ZOL A;  4TT3 G;  1AR4 A;  1QHT A;  2F66 C;  4O2A A;  1VQ8 V;  1WA8 B;  2P6J A;  3SYO A;  2IU3 A;  4YIO A;  4DV4 B;  2OCH A;  4FVM A;  1ZL8 A;  2BTO A;  1YZB A;  2P4K A;  3JAL A;  4TV8 B;  3G67 A;  4G27 B;  1L0N H;  3RYH A;  2ITD C;  2W6I G;  1K3E A;  4PJ0 Z;  1H2S B;  1IBM B;  3N2K A;  1O9G A;  3OW2 U; 
#chains in the Genus database with same CATH homology
 3ABU A;  1VQ9 V;  2ZR2 A;  1KEC A;  2AHY A;  3FYE B;  1PKX A;  1Q81 W;  1COW G;  3E8H A;  3OEH G;  2EIL B;  5LBQ A;  3OAA G;  5LHG A;  3CCE V;  3LSQ A;  5HFL A;  4G2K A;  3TK1 A;  4MTX A;  1VQ6 V;  4BIU A;  1OCO C;  3ABM C;  4OXS A;  3E8G A;  3X2Q C;  3CC4 V;  1AI5 A;  1M1K W;  2V7Q G;  5B1N A;  1N8R W;  3OE7 G;  2ZDI C;  4GT1 A;  2NLJ C;  1EBO A;  1R3K C;  3HB3 B;  3T2M A;  2EIK C;  3AG1 C;  3SJQ C;  3GB7 C;  5KA5 A;  1NVP B;  2EZO A;  2IW5 A;  4QIW F;  2DWE C;  2WLI B;  5L3E A;  2IJH A;  3AG2 B;  4N21 A;  3LDD A;  5B1B C;  3TET A;  3T1C A;  1NH2 B;  1QLE B;  1JCH A;  3WG7 C;  5J9P C;  3OFN G;  4XBF A;  5DM6 V;  1FXH A;  2D3O W;  2Z3Y A;  2XAJ A;  4DO2 A;  3JD1 A;  1W2B U;  1W0J G;  2HKO A;  3K03 A;  4X8A A;  2JEX A;  1NR1 A;  4RQE A;  4R50 A;  1GM7 A;  1YJN V;  2A0L A;  1H38 A;  1R3I C;  4WF9 V;  3CC7 V;  3CP1 A;  4BIZ A;  1QBZ A;  2LP7 A;  4UUJ C;  3ZIA G;  2QM7 A;  2LFR A;  3AG4 C;  4H33 A;  3K3W A;  3RW0 A;  1K9M W;  5IDJ A;  3LSS A;  3GWO A;  1KQS U;  1S3J A;  1CPY A;  4KUM A;  4MTF A;  3ZMU A;  3BY6 A;  2H8P C;  3W7X A;  1VQ5 V;  2EIL C;  4ZKI A;  4JAV A;  1E1R G;  1R3L C;  1AR1 B;  1F23 A;  1MAB G;  5DN6 G;  1CP9 A;  2YSU B;  4N23 A;  5LHH A;  1IXM A;  2ATK C;  5H9C A;  4RQF A;  1FXK A;  1OCO B;  2DYR B;  1QCE A;  3ABM B;  3X2Q B;  4CZZ A;  2P67 A;  2Q6A A;  4Q20 A;  5B3S B;  2ZXW B;  3SYQ A;  2GHY A;  5LGT A;  2A9H A;  3CCJ V;  1VQL V;  3ZRV A;  2DW4 A;  4TWK A;  4GCZ A;  1BHB A;  1WLE A;  3E35 A;  2LFS A;  1QLE C;  2W0F C;  3I55 V;  5B1B B;  1S5H C;  3K0D A;  2WLN A;  2UXN A;  1P4R A;  2OT5 A;  2HG5 C;  5LHI A;  1GK9 A;  1VQ7 V;  2HVJ C;  1K97 A;  4PA7 A;  3MHS C;  4XDL A;  1VQO V;  3KG2 A;  1ROP A;  5IY5 B;  4G28 B;  1K4D C;  3ZRX A;  1K5Q A;  3A0R A;  1Q82 W;  5C93 A;  1KC8 W;  2YEV A;  3ABL B;  3CME V;  1BL8 A;  4XDK A;  4HZ3 A;  3JD0 A;  2XAG A;  3CYO A;  2JK5 C;  3OGC C;  1FXV A;  1PNM A;  3SPH A;  1YTF B;  5CN0 A;  4MVQ A;  1B6Q A;  1KP2 A;  1EFR G;  1NKD A;  4L87 A;  2MK3 A;  4LBE C;  2FTK A;  1G4Y B;  2XAS A;  4P9P A;  5H6Q A;  1M90 W;  4DXW A;  4KP4 A;  4QE7 A;  3B8N A;  2Y69 C;  3LDE A;  4MTO A;  3RVZ A;  1GO3 F;  3EHB B;  5KA6 A;  1Q7Y W;  2JJ2 G;  3ZJZ A;  1XL6 A;  1AJN A;  1JX9 A;  2EIM C;  3TCU A;  2X0L A;  2WLL B;  3K0G A;  2DYR C;  4WCE V;  4P9O A;  1E1Q G;  4WFG A;  2OCC C;  2M7W A;  2EIN C;  4MVS A;  3CCS V;  3F7V C;  1ZWI C;  1SES A;  3OW2 U;  1WPX A;  5E1A C;  1DLB A;  2X6B A;  4R6Z A;  2JIZ G;  2ZXW C;  5B1A B;  5B3S C;  1VQ4 V;  2BOB C;  3SYP A;  2QM8 A;  1YJ9 V;  1KP3 A;  3IFX A;  5EBM C;  4UV9 A;  3HPL C;  2HFE C;  3K04 A;  3STZ C;  3VOU A;  5KUK A;  1YSC A;  1L1F A;  3QO7 A;  1AI6 A;  1S72 V;  3SPC A;  1R6N A;  3UKM A;  5EBW C;  5IY5 C;  2HLD G;  2WLK A;  4GX5 A;  4JGS A;  1Q86 W;  3ABL C;  3PJS K;  3OMN B;  1K34 A;  1JVM A;  2AHZ A;  5CA3 A;  2JEU A;  1KKD A;  1QVF U;  3P30 A;  5CMU A;  4LCU C;  4UV8 A;  4PDR A;  3FB8 C;  2DWD C;  2B5U A;  1M57 B;  3CC2 V;  4WFE A;  3EFF K;  3ABK B;  1OCZ C;  2R9I A;  3FYI B;  2WLJ A;  4PDM A;  4MTG A;  1FS0 G;  3AG3 B;  3G4S V;  3E8F A;  4PEL A;  1VQN V;  2WLM A;  3CCV V;  1NJI W;  2QKS A;  1Y4M A;  1UJW B;  1RM1 C;  2Y69 B;  5L3G A;  1EZJ A;  1V55 B;  1G8M A;  4GX1 A;  4JPR A;  1NVP D;  5L3F A;  3ZMT A;  2EIM B;  2IJJ A;  3LUT B;  3OR7 C;  3E89 A;  5IYB O;  3ZCC A;  1YJW V;  1FXK B;  2OCC B;  1PNL A;  4E2L A;  2EIN B;  3OMI B;  5B1A C;  4U7O A;  3JYC A;  1AI7 A;  3DTU B;  1GMG A;  1JJ2 U;  3DGE A;  4QPJ A;  5LGN A;  1QR9 A;  1NH2 D;  1K8A W;  4J9Y B;  2B1G A;  1SRY A;  2JDI G;  3BEH A;  4BAY A;  3OM3 B;  2PI4 A;  3STL C;  4F4L A;  1QVG U;  3ZMS A;  4TSF G;  1W0K G;  1M9N A;  2WAM A;  5BZB A;  1F4M A;  3CCU V;  4WFB V;  2XOK G;  1ARO P;  3QO5 A;  2H94 A;  3ZRS A;  2WLH A;  1TUE B;  2ZDI A;  2C2A A;  2X6C A;  2QE7 G;  1R3J C;  1QR8 A;  3NXS A;  3ZRW A;  4ASU G;  5CBH A;  1I5X A;  2UXX A;  5KUM A;  1YIJ V;  1J95 A;  5IYD O;  4RO2 A;  2IU0 A;  3T4Z A;  3LNM B;  3SPI A;  4QJF B;  2YEV B;  3IC7 A;  5IYC O;  1QLN A;  1K33 A;  4JYC A;  1M57 C;  2WWW A;  4P30 A;  3ABK C;  3CPW U;  2QEX V;  1OCR C;  4X89 A;  1RPO A;  3ETD A;  1S76 D;  3OMA B;  2Y48 A;  1OCZ B;  5LGU A;  1PNK A;  3AG3 C;  4MW3 A;  2DQ3 A;  2W6J G;  3OUS A;  3SYC A;  4MVO A;  3FKS G;  4ZBM A;  2X7R B;  4JAU A;  5EC2 C;  1ENV A;  1MOF A;  3P32 A;  1MSW D;  4QNH B;  1H8H G;  3E83 A;  4MS2 A;  4RAI A;  1VQK V;  3CCM V;  1ORQ C;  1RM1 B;  2R9R B;  3F7Y C;  1V55 C;  2EZP A;  1JQ0 A;  3OEE G;  3R65 A;  1S77 D;  4PA9 A;  3CXC U;  3MHH C;  2EBO A;  4X88 A;  1FFT B;  1SET A;  3B8M A;  4GX2 A;  4UVC A;  1M56 B;  4PA6 A;  3H01 A;  1FXK C;  4GX0 A;  2WPD G;  2X6A A;  1VQM V;  2XAH A;  3SPG A;  2EJR A;  3FB5 C;  3RVY A;  3SYA A;  4H37 A;  3FB6 C;  3K79 A;  3I56 V;  2V1D A;  2Z5U A;  1SER A;  4UVB A;  3G71 V;  3JD4 A;  4MT8 A;  1I5Y A;  1THZ A;  2DYS C;  4FK5 C;  4RUE A;  5HFM A;  1H2G A;  2B1I A;  2WLL A;  2ZR3 A;  3JCZ A;  3CCL V;  3OR6 C;  2KB1 A;  1DF4 A;  1BHA A;  1HWY A;  5EBL C;  3F5W C;  1AI4 A;  4UXN A;  4BW5 A;  4MVU A;  4LP8 A;  3K08 A;  2P7T C;  2EIJ B;  1DF5 A;  2Q67 A;  2XAQ A;  1F51 A;  1K92 A;  2F43 G;  2WLI A;  2XAF A;  1YTF D;  3W7W A;  2HR3 A;  4LC1 A;  1OHH G;  1R73 A;  4FJC C;  4WFH A;  1CEZ A;  4MVM A;  1NBM G;  3QNE A;  3ZMZ A;  4J9Z B;  3D3I A;  4MVZ A;  1K7D A;  3OUF A;  2OTJ V;  1P7B A;  4QE9 A;  3E86 A;  1V54 C;  3QO8 A;  5EK0 A;  2HVK C;  3W7U A;  2HJF C;  4JYB A;  4MSW C;  4WFF A;  3W7T A;  4JTC B;  1JPX A;  1OCR B;  5L3D A;  2ZQM A;  3ASN B;  4JTD B;  2ZD9 A;  4UVA A;  1GKF A;  4PDL A;  1OCC B;  1S0V A;  1NQT A;  2QTO A;  1K73 W;  4XDJ A;  3ETE A;  1OZ0 A;  4HYO A;  3AEI A;  4MW8 A;  3ETG A;  3UM7 A;  5L3C A;  4PA3 A;  5CBG A;  3ZMV A;  4EKW A;  1M56 C;  2WSS G;  2PI5 A;  3D36 A;  1AJQ A;  2IH1 C;  3JD3 A;  3ZN0 A;  3ASO C;  1YHQ V;  2IJK A;  1NR7 A;  5GW7 A;  1PL0 A;  3E8B A;  3LDC A;  2DQ0 A;  1YIT V;  4FIP C;  2BOC C;  3RBZ A;  4PA4 A;  1GM8 A;  2IJI A;  4FPP A;  2GSM B;  1BMF G;  2A79 B;  2NNU A;  1MG1 A;  2K1E A;  4FMT A;  4KFM A;  4I9W A;  2P90 A;  2DYS B;  4MVR A;  1GM9 A;  1AJP A;  4HAM A;  4Z1M G;  2QA4 V;  2OTL V;  4JTA B;  1DTO A;  1SZT A;  2ITC C;  4PDV A;  3JD2 A;  1KD1 W;  2EIJ C;  2XND G;  1VQP V;  1YI2 V;  2Q68 A;  5L3B A;  3FB7 C;  3G6E V;  3ABT A;  3ZN1 A;  2EIK B;  3AG1 B;  3CCQ V;  4YXW G;  1F4N A;  1LNQ A;  3ZRW B;  4WFA V;  4QPK A;  4U7N A;  2Q69 A;  3AG2 C;  3CMA V;  3K9A A;  4RUF A;  5CBF A;  1GTO A;  4R8C A;  2IH3 C;  3T4D A;  1R6K A;  3CD6 V;  4CBC A;  3MD0 A;  4JAS A;  1V54 B;  3WG7 B;  4TT3 G;  3ASN C;  1VQ8 V;  4R7C A;  2P6J A;  5FL7 G;  1OCC C;  3SYO A;  3WFV A;  1JOY A;  2IU3 A;  4P2Z A;  5H6R A;  1K5S A;  3K06 A;  1Y66 A;  2CK3 G;  4I5S A;  4JF3 A;  3E2E A;  3ML0 A;  1E79 G;  3W7S A;  3VBB A;  4G27 B;  5B1O A;  3M99 B;  2ITD C;  2W6I G;  1K3E A;  3IGA C;  3SPJ A;  5EC1 C;  1PD3 A;  3B77 A;  3AG4 B;  3ASO B;  1H8E G;  1K4C C;  1RPR A;  3CCR V;  1XL4 A;  2JJ1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...