1OJHA

Crystal structure of nbla from pcc 7120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
IELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nbla from Anabaena Sp. Pcc 7120, a Small Protein Playing a Key Role in Phycobilisome Degradation.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
molecule tags Protein binding
molecule keywords NBLA
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 1ojhA00
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH superfamily
1TUBA 5E1AC 3TXQA 5J2TB 2OCHA 3SYAA 1S5JA 2W6IG 4JAVA 5CA0A 1JR9A 3T1YB 4PDVA 2YC0A 4WFEA 5H2FZ 4LFAO 2Q4PA 3HKCA 3N2KA 1BQ0A 3ASOB 2QE7G 2OIEA 4UB6Z 2ZKOA 1M90W 3L74H 1L8DA 1L0LH 4L87A 4BIUA 1US6A 5L3EA 1N36B 1WA8B 4BAYA 1SQFA 2VWJA 3QO8A 3I56V 5JJNB 4LH7A 4WFBV 2F4VO 4X1KA 4FM2A 5JVDB 4UV9A 3HKDA 1B04A 3B77A 2ZINA 4U7NA 5H9CA 4LF6B 5JVDA 2BSKB 4GX2A 1Q86W 1RSOA 3UO2A 5EIBC 1V54C 1I7FA 1BHAA 2FMLA 1O9HA 2X6BA 3J80N 1QLNA 3K9AA 1GM8A 1XMOO 2JJ1G 4E4EA 1CXZB 4TSFG 5L3DA 1KBHA 1Z2GA 2QR4A 1GN4A 3F5WC 1FXKB 2QWOB 3B8MA 3E89A 2ADQB 1JPXA 1FXKA 4X1YB 2UXBB 3K58A 5KHHA 4OX9O 1XNRO 1VEWA 4DR7O 5CB4B 1NQTA 4X1YA 4GZRB 1SZTA 1RPOA 1UPGA 2XAHA 2N05A 1JX9A 3SJQC 5CB4A 1T5EA 4B3TB 1IXMA 3LNNA 1TVKA 2FB5A 3A2FA 4Q20A 4LBEC 3CE2A 1OV9A 2WLHA 2OYQA 3BA8A 4I55B 1N8RW 1M93A 1M9NA 5B1NA 1DTOA 2LP7A 2UUBO 5B1BC 4K3AA 1YJ9V 2QJ1A 2QA4V 2E5LO 1JOYA 1AI5A 1THZA 4LWSB 4CH3A 3JD1A 3FD9A 1OCZB 4D7TA 4NTWA 4H44B 4JZ2A 4JGSA 4DUZB 2B1GA 4UCVA 3UCSC 3QG5A 4U3FH 3A0BZ 4BWAA 3SJBC 3JCZA 3JAWA 4X1IB 2WAMA 5IY5C 3CC2V 4WFFA 1FFXA 2L6LA 5B3SC 1IBMB 4KP4A 1SS3A 1IVSA 4X1IA 1XQ8A 3JSLA 4K0KO 4C7UA 1GM9A 1Q43A 3KCYA 4DV7B 2YIBD 3BEHA 3CRAA 2DYRB 4DR4O 2DN9A 3OAAG 1EN4A 1OCZC 1K5SA 1NTMH 4YJ3B 2P06A 1CEZA 4I0XA 3SYPA 1VIBA 3E83A 4G28B 2N04A 3ML0A 4FZ0A 1DLBA 2N74A 1QR8A 3U0ZA 3F7YC 4GX5A 3RW0A 4KL1A 4OPHA 4YIOA 5GW7A 1WPXA 3ZMTA 5DN6G 4KHPO 3C90A 4K8ZA 2CTWA 2ZIMA 3HKDB 3K0GA 1BE3H 2Y4UA 1IBLB 1RPRA 4J9YB 4TQFA 2Y69C 1QLEB 1XOUA 5FNVB 2V4DA 2R70A 1P49A 3CJHA 5IYZB 1P4RA 2JS3A 3LDCA 4X8AA 5IJ9A 3ZMSA 1JMKC 1VARA 2LQTA 4NR1A 3BPZA 2H94A 2Z5UA 5LGTA 2ZE8A 4O2AA 3D8CA 4H13B 1KYOF 4JYAB 4GKJO 2PI4A 4DXWA 2EBOA 3RYHA 2UUCB 1NR7A 2Q68A 4X64B 4EEQA 3JASB 2EX3A 4P2ZA 4I4TA 2HJDA 2EIJC 3BA9A 4B3RO 4LFCO 4O4LA 3SDLA 1H38A 1HR0B 3ZRSA 3QO5A 4LF5B 4LF7B 2BTQB 1VQ4V 1Q82W 4D7SA 4X62O 1BHBA 3K0DA 4ZBMA 5JJJB 2V1DA 1NT2B 3RVZA 2OIGA 5A9GA 4FLWA 1EBOA 2WPDG 5B66Z 1Y67A 1VF5B 4MVZA 3GWKC 2QEXV 2R9IA 2Y69B 5L3CA 4YHHB 1CP9A 4PDRA 4MTOA 3RYIB 3ZHTA 3M8AA 3WG7C 1H2MA 2YXHA 3SGIA 1JQ0A 5EC1C 5IY5B 4FLZA 4H37A 5LA6B 1AI7A 1ZL8A 3HKEA 3OR6C 1BSMA 4XBFA 2QKSA 4MS2A 5IWAO 1ZL8B 4EB6A 1MSWD 2ADPA 2DOSA 2UUAO 2EJ7A 3LUTB 4JI5B 2Q0AA 1KP2A 4X65O 1G6UA 3ZRWA 1TAEA 1TA8A 1AP6A 1N0NA 3FB8C 3ZMVA 1NH2D 5D5QA 2A9HA 1QQCA 1PKXA 3R65A 1GKFA 1H2KA 3ABTA 4OPAA 1P84F 3CHXA 3MDSA 1M56C 1PP9H 1XDCA 5C8YB 3ZN0A 4JYYA 4ZHQA 4RO2A 2CDYA 4DRXA 4NXNO 4DK0A 4NXNB 3B40A 2ZIOA 3SJCC 1AJQA 3SPHA 4PA7A 1P7GA 2RMKB 1W0KG 4QJFB 5CA3A 4B3SB 4IHJB 3A0RA 4AQYB 1K4CC 2V7QG 1YITV 2HKOA 2IW5A 1PD3A 2EINB 5EIBD 4MW3A 2R9RB 1KUQA 1PM9A 4UV8A 4UXNA 3U11A 2EIMC 2JGDA 1M5IA 4X65B 4RUFA 3HB3B 4CBCA 3CXCU 4JI4O 1RFYA 2X7RB 1NU1H 2VWKA 3HPLC 4GT1A 1AVMA 3E22A 2D3OW 1AB3A 3ZHRA 4DR2B 3C3TA 4JI8O 1AJPA 1GK9A 2ITCC 5EYPA 3Q4HB 1Y76B 3L71H 3ZMUA 2H3OA 2KB1A 3IGAC 3CRCA 4PDMA 3OT7A 2IJKA 4DV6B 2DYSC 4EKWA 3F5TA 2AXTZ 1GO3F 4DR2O 4JI2O 3I55V 4O4LB 3ZHVA 2NNUA 4BW9A 1WN7A 3SJAC 2P6JA 3JAKB 2W6JG 4A5UB 3ZEDA 1Q6HA 3N2KB 1I5XA 4DV5O 5LL6Y 4X20B 5GONB 1HNXB 3S3XA 1MG1A 5GONA 4IYHA 1MMMA 3OTFA 3QO7A 2HHHO 3OD4A 4XDLA 4CZZA 3X2QB 3FX7A 1S72V 4DV1O 5LHGA 2E3CA 3L9DA 4KXRA 4PA3A 3W7WA 1UJWB 3H1HH 1EZJA 2DQ0A 4QE9A 3UT5B 2QWQB 1ZSPA 3LSSA 3K79A 1COWG 4U7OA 2IJIA 1IDSA 4U3JB 1K9MW 2ZE5A 1YJNV 2L35A 1B6QA 2E74B 3ABUA 4GKKO 2FTKA 3TCUA 1P7BA 3KZIZ 3DC6A 2IU0A 3QTCA 3ICXA 3A8TA 3SYQA 3D36C 4MVMA 2NLJC 3S3WA 3K9SA 5JJEB 4J9ZB 4CH6A 4CS4A 1G8MA 4FVMA 4PD4F 1DF5A 3K5LA 5LMNB 4X9QA 3ZS8C 3CCRV 4TT3G 4TUYA 4PHZA 1JCHA 1N36O 4TWKA 1GMGA 2HHHB 4IHJA 3NR7A 1YXBA 1FXHA 3K5NA 2DMXA 2HR3A 4I9WA 3RYFB 4LP8A 1EN5A 3T1HB 4DUYO 1Y4MA 5HFLA 1HP8A 5L3GA 3UO3A 1MSDA 2ETNA 5J2UB 5BXZA 3M99B 4LFCB 4B3RB 1NTKH 1N32B 3LSUA 4HYOA 1IZ3A 3P30A 1SC5B 3M7MX 1XMQO 4JI2B 2EILC 5GTIZ 4UVBA 2W0FC 3IC7A 5EK0A 1YIJV 4BR6A 1HNWB 1MZEA 3CRMA 2UUCO 1LNQA 1W0JG 4NTYA 4WBNA 3SPCA 3WB0A 5DECA 5KHKA 2PGGA 4JYAO 3VOUA 5AG2A 5KLVH 2UXDB 2BOCC 1JVMA 1D5NA 1Y6XA 4O2BA 3SR2C 2ZDIA 3F7VC 4RQFA 4DV4B 2PYJA 1URFA 4ABMA 1K33A 1WPBA 2OCCB 1XBLA 3K03A 3E35A 4QPJA 4IL6Z 3CCEV 1VQ7V 2JDIG 3LDEA 1SQPH 3K08A 3EVKA 3D36A 5LP6B 2YSUB 4RQEA 2IH3C 5BY1A 3BVOA 2FL4A 2EILB 2GHYA 2RJZA 3OTOO 2YI8A 3EXAA 1SA0B 4B08A 4ZKIA 1R6KA 1IX9A 3H01A 1MA1A 1S5LZ 1SA0A 1NKDA 3ASOC 4YY3B 5CA1B 3HKBB 2ZNJA 2CE4A 2DQ3A 1AI6A 3UT5A 4DV3B 4CS2A 1YVWA 1VF6C 4K8XA 1WP8A 5IYCO 2AZ2A 1TUEB 3ZHQA 1VQKV 1L0NH 5B1AC 4ZIBA 2QKAA 1H8EG 1TUBB 3GWOA 4TV9B 5J2TA 1N4CA 1Q3EA 1OHHG 5CBHA 5IYDO 1NZ6A 3H9VA 3OM3B 1FXKC 1RP3B 2YIBA 1Q81W 3BHPA 5CBGA 4K35A 2X6CA 5IWAB 3ABKC 3CP1A 4MTGA 1XREA 1R6TA 5KHJA 4FLYA 2Y4TA 1NJIW 4FLTA 5LMUO 4I0XB 4TV8B 3L75H 3G4SV 1V54B 4I7ZB 1SQGA 4QPKA 4DUZO 1QR9A 2A0LA 4JI0O 1AI4A 2QM7A 2ZR2A 1ZLZA 2Q7GA 4FFBA 4UCOA 1NVPD 1WJZA 1K3EA 3OGCC 4YJ2B 3OW2U 5HFMA 1BMFG 2LJ2A 1AROP 4DR5O 2Q5ZA 4IIJB 3W7TA 4I50A 2EIMB 5LOVA 4W4LA 5KUKA 1VF7A 2AZ0A 3E2EA 1Y66A 5LOVB 1WAZA 3I5DA 4MT8A 1XNQO 4XDKA 2WLIB 5JQGB 1HW7A 2EULA 4DR7B 1DF4A 3ZJZA 4DV0O 4O2AB 1R73A 2UXBO 2ZM6O 3JD3A 3K59A 2OCCC 2HFEC 3CEIA 4J42A 2LW7A 3OMAB 3SPJA 1V9PA 1BS3A 3KCXA 2PZSA 2MK3A 3E8FA 3FAVB 3WB1A 2IM9A 4JPRA 4X89A 1R3KC 1XHZA 4BIZA 4LNUB 5BMVB 3FAVA 4MVUA 4JI0B 3BABA 2KKWA 3CD6V 1I5YA 1F7YA 2MW2B 2DYRC 4XDJA 4WF9V 5TISZ 1U97A 3BAAA 3W7SA 4J7KA 1NTZH 1F4MA 1WNSA 1DK1A 2NN4A 3WFVA 3CC4V 1AJNA 2RNBA 1K97A 4MVOA 2E75B 3CYOA 2UXCO 3MD0A 4GKKB 1LR1A 5DM6V 4JF3A 3EHBB 2QGNA 2CH7A 2BE3A 4CC5A 4TOIA 5FNVA 1Q90D 1IURA 1QU7A 1A32A 1R3LC 3ZRXA 1JJ2U 4WFHA 3CJHB 3ABMB 5EBWC 5KMGB 3G67A 3HKCB 1EM1A 5IYZA 2JRIA 2ZM6B 1GN3A 4DV0B 2P90A 2WLJA 5BZBA 2CTRA 1KD1W 1XNQB 2XT9A 4MVSA 4I9QA 3J7AU 1E1RG 4N21A 3K57A 1ZUQA 4TV8A 1SF9A 3KG2A 4YY3O 4JV5O 1HWYA 1K34A 2PTMA 3AG1B 1B06A 4HAMA 3FB6C 3CCQV 4DR5B 3RVYA 3CC7V 1M4UA 1KECA 2WWWA 2Q67A 1MZFA 4EFBA 2CTQA 1FYJA 1YSCA 2GUZB 1YTFD 4UCSA 3E86A 1U96A 2IH1C 3FKSG 3PN1A 2YEVB 2UUBB 1WLEA 2GBOA 1JA8A 4JI1O 1XI1A 4X20A 1OCRB 4PA4A 3TK1A 2QTSA 4DW0A 3STLC 4J41A 1TGOA 1V55C 4AILC 5LXTB 2YUAA 2IU3A 4JZGA 1YCIA 3E22B 1KQSU 1XL4A 3OFNG 3BFRA 4NTXA 3VBBA 1FXVA 4QIWF 1G4YB 3Q4HA 1GRJA 3JASA 5LGNA 5J9PC 3JARB 2HP8A 4JYCA 2UXNA 1Q5OA 5FLXN 2YI9A 4HNAA 3X2QC 3EFFK 4B3SO 1PNLA 4LF8B 4I55A 1QVFU 4IYIA 3H1KH 3CB2A 4DK1A 4G2KA 2DW4A 5H6QA 4DV3O 4GLXA 2UXCB 1YDXA 4HBNA 3N2GA 3NXSA 5LMNO 2XNDG 1BGYH 1VQ9V 1YEWA 4IT5A 5C8YA 2QSAA 3OTOB 1GN2A 1R1BA 4N23A 3ZX6A 3H1JH 5D5PA 2YS8A 2Q8VA 2JS5A 3B2EE 4Z2WA 4O4HA 3ZHSA 1YI2V 2OTLV 4O4JB 2H8PC 4GCZA 2RQ6A 1LUWA 2UUAB 2GV9A 4DO2A 1K5QA 3B09A 3GB7C 4EFEA 2UXDO 2IJHA 4JASA 5LA6A 2F1MA 3ZRWB 4LH6A 1RSOB 4FM0A 4EB6B 2JIZG 5BR8B 1S3JA 1E79G 2KG7A 4DV1B 4PV1B 3SYOA 1VQ5V 2EIKC 3VQWA 1XHXA 2UXXA 3ABMC 1CPYA 4QGPA 4CC6A 1XMQB 5KHIA 1OZ0A 4ZHQB 3RT3C 2PYLA 2R72A 2JEXA 3W7UA 3ZHUA 3J81N 2ZE7A 1H2GA 1NI8A 2XAQA 4LFBB 5JH7A 3RBZA 5IJ0A 2D2CB 3BCCH 1N0JA 2R9AA 1ROPA 5FPRA 4DUYB 4LF5O 4DRXB 2BOBC 4O4IB 2K9PA 3E8HA 1YHQV 3RFRA 2QM4A 3BRCA 1Y74A 2HJFC 1S0VA 3G80A 2YXYA 2Q9LA 2VS0A 1L1FA 3CCJV 3UQ8A 2NR5A 4P9PA 2QDOA 3A0HZ 3LDDA 2WSSG 1R3JC 4DV6O 4Z1MG 1ZX3A 4J10A 1OCCB 3AG3C 3CXHF 1JFFB 3CCVV 4X88A 1NBMG 4LR3A 5IYBO 3THOA 1V55B 4NB5A 1JJOA 3ASNB 4FLXA 1YTFB 1BQZA 3P3PA 4WFAV 4JI3B 4JI4B 2ZR3A 1B3QA 2Q7EA 1PV0A 1MOFA 2JK5C 2OT5A 2HVKC 4WBNB 1BZKA 1S76D 4CH5A 3ETDA 3SYCA 1HNZB 2IBZH 3DXRB 4JYBA 1SQXH 2F66C 2GDSA 5B1OA 4E2LA 4JI7B 1R6NA 1J5EO 5IT9N 1GN6A 4KHPB 2LGWA 1XILA 2CAZC 4UCUA 4DYLA 2E76B 1KC8W 4L8JA 2QWRB 5EC2C 5EBMC 3R66A 1PL0A 1XEQA 1HNXO 4TUYB 2AW9A 2CTPA 3MHSC 2YICA 2RN9A 3CCLV 4KUMA 4MVQA 4NVPA 3ZRVA 1EN6A 5CN0A 2BCCH 2BSKA 3RGBA 1H2LA 2M7WA 4K0KB 4U3JA 4OGQB 1XUQA 1Z5WA 2Q6AA 2C2AA 4GX1A 1IBMO 4ZOLA 3ZMZA 1K73W 5KA6A 2VQFO 1ZWIC 3ASNC 3T1CA 4BW5A 1I94O 4YHHO 2WLKA 3ABKB 4UB8Z 1HNWO 4FJCC 3W7XA 1VP7A 2ATKC 4JI8B 3UM7A 2EINC 2O57A 1QLEC 3VQYA 3O65A 1N32O 4X66O 2CK3G 1K7DA 5KAIZ 5JCOC 1S77D 2F93B 1AR4A 4FFKA 1FKAO 3BY6A 4X62B 2GSMB 2VQEB 3ETGA 3K06A 3T1HO 2XAFA 4UVCA 1N33O 1HR0O 3JSNA 4AQYO 4X1KB 2EJRA 1F4NA 2WLLA 5JWPA 1KB9F 3IAYA 1H2SB 2WLMA 2WLLB 1HDJA 1OCOB 1OCCC 2EZPA 4X64O 4OX9B 4YJ2A 4NXMO 2B9ZA 2XASA 3JCUZ 3ZBHA 4UVAA 2A79B 4GKJB 4TQDA 4ZI7B 1Q6UA 3E8GA 1K92A 1Y76A 4JAUA 5CA1A 3RYCA 3HKBA 2IJJA 3RN4A 2F23A 2ITDC 3CWBH 2PF4E 1E1QG 3GVMA 3K3WA 4CS3A 5LHHA 2P5OA 2LFSA 4RUEA 5B3SB 2DYSB 2WLIA 2CH7B 2HLDG 1OJHA 1FFXB 1PL4A 3OR7C 2XAGA 5FPOA 3JALA 4JI3O 4B3MB 3DXRA 3LNMB 4MVRA 2A3QA 4QNHB 3JAWB 3JATA 3WB2A 1AR5A 4J80A 2PUSA 4F6EA 3HR0A 3FFQA 2ZCEA 1NR1A 2GTSA 3QF7A 2Q73A 1SQQH 2A06H 3ETEA 3ZCCA 1VQ8V 2F4VB 2Q0OC 2ODMA 3B4SA 2DWDC 4DR6B 2RDCA 1O9GA 1VQPV 4UCTA 5KUMA 5L3BA 1W59A 1Q7YW 1K4DC 4YIPA 4JAAA 1OCOC 4W4KA 4D6TH 1G1XB 1FPOA 3MHHC 4DV5B 3D3IA 2PY5A 1KKCA 4Q6GA 4NKGB 3FYIB 5DEDA 4PI0A 4DV7O 2X0LA 1BCCH 1RM1B 4J11A 4I5SA 2F43G 4PA9A 4DR6O 1NS1A 4B7EA 4J7ZA 1SERA 1FD9A 1PNKA 1I94B 2OTJV 5LBQA 4FLVA 5BR8O 2CGOA 5CA0B 2UU9O 3CRQA 1SZXA 5IE9A 3L73H 1DGSA 4FLUA 5JQGA 4YJ3A 4GX0A 4B3MO 2WLNA 1YF2A 1GM7A 2P22C 1VQMV 3AG3B 3WU2Z 3RYHB 5CMUA 4ASUG 2HEPA 1IXBA 3JAMN 2ZNIA 3OEEG 4F4LA 5GTHZ 3C3SA 2EIJB 1EZVH 2BTOA 3UKMA 1FJGO 2WA3A 2F95B 2XOKG 3JD2A 4DR1B 1EFRG 3ABLB 2B1IA 4FFBB 2LW1A 2JVDA 4H0LB 4NXMB 4R6ZA 1D2DA 2G38A 2PI5A 1SRYA 2X6AA 1PNMA 4IGGA 3AK2A 2YEVA 3L70H 2XUMA 4PELA 1XNRB 2P67A 4WFGA 4WCEV 2BTQA 4JI6B 1J5EB 1BT8A 1WB8A 2ZT9B 1QBZA 2DJVA 3APQA 3OMNB 1XL6A 1N33B 1W2BU 1UFIA 1QCEA 5F2VO 4NYKA 5KAFZ 2QWNB 1SKVA 4JI5O 4X66B 3RYIA 4MW8A 4JTDB 3HKEB 1YZBA 3JATB 3JARA 3KKYA 1ORQC 3OGIB 1NH2B 2A7WA 4LNUA 2CUGA 4LF6O 1YJWV 4LCUC 1TVKB 3D3QA 2UU9B 2GTAA 1SESA 1GH6A 3QNEA 5LYJA 5BMVA 3AG4B 4JTCB 4B7KA 5LYJB 1I08A 4R8CA 4RWUA 3OEHG 2ILMA 2QM8A 1M57B 3ZIAG 1SQVH 3MAQA 5KHGA 5IJ0B 2E5LB 3OMIB 2XHBA 4ICGA 4LF4O 5EZYA 2RCVA 1AR1B 4LF7O 3AG7A 3O9OA 4LFAB 4LFBO 1H2NA 2GUZA 3LSQA 3FB5C 3CMAV 3T1YO 1X59A 4GUNA 1ENVA 1SQBH 2HVJC 3ABLC 4TV9A 2QTOA 3DC5A 1Z5VA 5EBLC 4JV5B 3AK3A 1X4TA 3IC9A 3JD4A 2JGDB 1FS0G 1IBKO 3G6BA 1JFFA 4R7CA 5IJ9B 1PPJH 1D5AA 4FK5C 5LP6C 5LGUA 5LXTA 1QHTA 2JJ2G 1FAFA 2P4KA 1HNZO 4Z1VA 4OXSA 2Y48A 3PJSK 5H6RA 3AG2B 2Y0IA 3CSXA 1XMOB 4R50A 4HZ3A 2P4VA 2ZDIC 2AGAA 5IDJA 4DR3O 1N34O 1SETA 4FPPA 5JH7B 2VRZA 2XAJA 1VQ6V 4I4TB 5H5NA 4F6RA 4PDLA 2AHZA 3L72H 3SPIA 4JTAB 4AI8A 1IBLO 4RAIA 2ARHA 2K1EA 4FM1A 2KSDA 3DTUB 2JEUA 3P3NA 1GAXA 3JAKA 4IIJA 3N27A 3FYEB 4I50B 3T2MA 1N34B 4CH4A 5JCOA 4DW1A 3AG1C 3P32A 1OCRC 3CCMV 4G27B 3AEIA 2FYUH 3IJ4A 1KP3A 3CCUV 5CBFA 2FKXA 3JYCA 4FIPC 5K1PA 2P7TC 2VQEO 3G71V 2CGNA 4H33A 4DR4B 5EYPB 2W0XA 4KFMA 4O4JA 4QE7A 4DV2B 3H1IH 2YIDA 4PI2A 1Q8IA 5ITZB 1KU9A 3JD0A 3CS5A 3APOA 3SPGA 3AK1A 1IBKB 1WB7A 5ITZA 5B1AB 2ZE6A 1Q6IA 1LUVA 2LO1A 2M6YA 4MTXA 3T4ZA 2ZD9A 2DWEC 1NVPB 1VF6A 1R3IC 2VQFB 5LHIA 1GTOA 2YXLA 5KA5A 1VQOV 1KKDA 3AG2C 5L3FA 4LF4B 5B5EZ 3N2GB 5C93A 1I0HA 2YDEA 5EZYB 1K8AW 5FL7G 3ETQA 1ZTEA 3OUFA 3TXSA 3VQVA 4O4HB 1ZAUA 4PJ0Z 1AP5A 1WA8A 3CMEV 4LF9B 1WP7A 3IFXA 4UFZA 4P30A 3CPWU 3CRRA 3E8BA 4FMTA 4MSWC 2Q69A 4B3TO 5E79Z 5LMUB 4MTFA 2YIAA 5KMGA 3STZC 3TGUH 1M56B 2QWPB 3WG7B 3RYFA 5J2UA 2AHYA 3K04A 3RWRD 4ZOLB 4DV2O 4JI7O 1BL8A 4UUJC 4LF8O 2HG5C 2KG7B 3RYCB 2ZXWB 3OUSA 2WA4A 2Q7HA 3CX5F 2LGQA 2OWOA 4UCRA 1F23A 3CCSV 3T4DA 1RM1C 4JI6O 1J95A 2Z0AA 2B5UA 3G6EV 3JALB 4F6RB 1QNMA 4O2BB 3ZN1A 5K1XA 3TETA 1H8HG 1S5HC 1VMGA 4GYCB 4O4IA 4P9OA 1VQLV 1AILA 1M57C 3U10A 1KMIZ 1Y74B 3DGEA 4LF9O 2EIKB 4DR1O 5A2QN 5KX5A 3H1LH 1FJGB 4JI1B 2XTAA 1FFTB 2ZQMA 1MNGA 3K5OA 3VQXA 2ZXWC 4DR3B 5B1BB 2QKCA 4PA6A 5KX5B 3FB7C 5LP6A 1VQNV 3AG4C 1M1KW 2EZOA 2DE0X 3QVNA 4DV4O 4ZI7A 4BIOA 2KQXA 4LWSA 3TJTA 4YXWG 4J7JA 1QVGU 3B8NA 1MABG 3DSQA 4LC1A 3OE7G 2LFRA 1F51A 4FZ1A 3K5MA 4AHCA 2Y0PA 4HNAB 2JGUA 2Z3YA
chains in the Genus database with same CATH topology
1OJHA 3CS5A 2Q8VA 2QDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
#chains in the Genus database with same CATH topology
 1TUB A;  5E1A C;  3TXQ A;  5J2T B;  2OCH A;  3SYA A;  1S5J A;  2W6I G;  4JAV A;  5CA0 A;  1JR9 A;  3T1Y B;  4PDV A;  2YC0 A;  4WFE A;  5H2F Z;  4LFA O;  2Q4P A;  3HKC A;  3N2K A;  1BQ0 A;  3ASO B;  2QE7 G;  2OIE A;  4UB6 Z;  2ZKO A;  1M90 W;  3L74 H;  1L8D A;  1L0L H;  4L87 A;  4BIU A;  1US6 A;  5L3E A;  1N36 B;  1WA8 B;  4BAY A;  1SQF A;  2VWJ A;  3QO8 A;  3I56 V;  5JJN B;  4LH7 A;  4WFB V;  2F4V O;  4X1K A;  4FM2 A;  5JVD B;  4UV9 A;  3HKD A;  1B04 A;  3B77 A;  2ZIN A;  4U7N A;  5H9C A;  4LF6 B;  5JVD A;  2BSK B;  4GX2 A;  1Q86 W;  1RSO A;  3UO2 A;  5EIB C;  1V54 C;  1I7F A;  1BHA A;  2FML A;  1O9H A;  2X6B A;  3J80 N;  1QLN A;  3K9A A;  1GM8 A;  1XMO O;  2JJ1 G;  4E4E A;  1CXZ B;  4TSF G;  5L3D A;  1KBH A;  1Z2G A;  2QR4 A;  1GN4 A;  3F5W C;  1FXK B;  2QWO B;  3B8M A;  3E89 A;  2ADQ B;  1JPX A;  1FXK A;  4X1Y B;  2UXB B;  3K58 A;  5KHH A;  4OX9 O;  1XNR O;  1VEW A;  4DR7 O;  5CB4 B;  1NQT A;  4X1Y A;  4GZR B;  1SZT A;  1RPO A;  1UPG A;  2XAH A;  2N05 A;  1JX9 A;  3SJQ C;  5CB4 A;  1T5E A;  4B3T B;  1IXM A;  3LNN A;  1TVK A;  2FB5 A;  3A2F A;  4Q20 A;  4LBE C;  3CE2 A;  1OV9 A;  2WLH A;  2OYQ A;  3BA8 A;  4I55 B;  1N8R W;  1M93 A;  1M9N A;  5B1N A;  1DTO A;  2LP7 A;  2UUB O;  5B1B C;  4K3A A;  1YJ9 V;  2QJ1 A;  2QA4 V;  2E5L O;  1JOY A;  1AI5 A;  1THZ A;  4LWS B;  4CH3 A;  3JD1 A;  3FD9 A;  1OCZ B;  4D7T A;  4NTW A;  4H44 B;  4JZ2 A;  4JGS A;  4DUZ B;  2B1G A;  4UCV A;  3UCS C;  3QG5 A;  4U3F H;  3A0B Z;  4BWA A;  3SJB C;  3JCZ A;  3JAW A;  4X1I B;  2WAM A;  5IY5 C;  3CC2 V;  4WFF A;  1FFX A;  2L6L A;  5B3S C;  1IBM B;  4KP4 A;  1SS3 A;  1IVS A;  4X1I A;  1XQ8 A;  3JSL A;  4K0K O;  4C7U A;  1GM9 A;  1Q43 A;  3KCY A;  4DV7 B;  2YIB D;  3BEH A;  3CRA A;  2DYR B;  4DR4 O;  2DN9 A;  3OAA G;  1EN4 A;  1OCZ C;  1K5S A;  1NTM H;  4YJ3 B;  2P06 A;  1CEZ A;  4I0X A;  3SYP A;  1VIB A;  3E83 A;  4G28 B;  2N04 A;  3ML0 A;  4FZ0 A;  1DLB A;  2N74 A;  1QR8 A;  3U0Z A;  3F7Y C;  4GX5 A;  3RW0 A;  4KL1 A;  4OPH A;  4YIO A;  5GW7 A;  1WPX A;  3ZMT A;  5DN6 G;  4KHP O;  3C90 A;  4K8Z A;  2CTW A;  2ZIM A;  3HKD B;  3K0G A;  1BE3 H;  2Y4U A;  1IBL B;  1RPR A;  4J9Y B;  4TQF A;  2Y69 C;  1QLE B;  1XOU A;  5FNV B;  2V4D A;  2R70 A;  1P49 A;  3CJH A;  5IYZ B;  1P4R A;  2JS3 A;  3LDC A;  4X8A A;  5IJ9 A;  3ZMS A;  1JMK C;  1VAR A;  2LQT A;  4NR1 A;  3BPZ A;  2H94 A;  2Z5U A;  5LGT A;  2ZE8 A;  4O2A A;  3D8C A;  4H13 B;  1KYO F;  4JYA B;  4GKJ O;  2PI4 A;  4DXW A;  2EBO A;  3RYH A;  2UUC B;  1NR7 A;  2Q68 A;  4X64 B;  4EEQ A;  3JAS B;  2EX3 A;  4P2Z A;  4I4T A;  2HJD A;  2EIJ C;  3BA9 A;  4B3R O;  4LFC O;  4O4L A;  3SDL A;  1H38 A;  1HR0 B;  3ZRS A;  3QO5 A;  4LF5 B;  4LF7 B;  2BTQ B;  1VQ4 V;  1Q82 W;  4D7S A;  4X62 O;  1BHB A;  3K0D A;  4ZBM A;  5JJJ B;  2V1D A;  1NT2 B;  3RVZ A;  2OIG A;  5A9G A;  4FLW A;  1EBO A;  2WPD G;  5B66 Z;  1Y67 A;  1VF5 B;  4MVZ A;  3GWK C;  2QEX V;  2R9I A;  2Y69 B;  5L3C A;  4YHH B;  1CP9 A;  4PDR A;  4MTO A;  3RYI B;  3ZHT A;  3M8A A;  3WG7 C;  1H2M A;  2YXH A;  3SGI A;  1JQ0 A;  5EC1 C;  5IY5 B;  4FLZ A;  4H37 A;  5LA6 B;  1AI7 A;  1ZL8 A;  3HKE A;  3OR6 C;  1BSM A;  4XBF A;  2QKS A;  4MS2 A;  5IWA O;  1ZL8 B;  4EB6 A;  1MSW D;  2ADP A;  2DOS A;  2UUA O;  2EJ7 A;  3LUT B;  4JI5 B;  2Q0A A;  1KP2 A;  4X65 O;  1G6U A;  3ZRW A;  1TAE A;  1TA8 A;  1AP6 A;  1N0N A;  3FB8 C;  3ZMV A;  1NH2 D;  5D5Q A;  2A9H A;  1QQC A;  1PKX A;  3R65 A;  1GKF A;  1H2K A;  3ABT A;  4OPA A;  1P84 F;  3CHX A;  3MDS A;  1M56 C;  1PP9 H;  1XDC A;  5C8Y B;  3ZN0 A;  4JYY A;  4ZHQ A;  4RO2 A;  2CDY A;  4DRX A;  4NXN O;  4DK0 A;  4NXN B;  3B40 A;  2ZIO A;  3SJC C;  1AJQ A;  3SPH A;  4PA7 A;  1P7G A;  2RMK B;  1W0K G;  4QJF B;  5CA3 A;  4B3S B;  4IHJ B;  3A0R A;  4AQY B;  1K4C C;  2V7Q G;  1YIT V;  2HKO A;  2IW5 A;  1PD3 A;  2EIN B;  5EIB D;  4MW3 A;  2R9R B;  1KUQ A;  1PM9 A;  4UV8 A;  4UXN A;  3U11 A;  2EIM C;  2JGD A;  1M5I A;  4X65 B;  4RUF A;  3HB3 B;  4CBC A;  3CXC U;  4JI4 O;  1RFY A;  2X7R B;  1NU1 H;  2VWK A;  3HPL C;  4GT1 A;  1AVM A;  3E22 A;  2D3O W;  1AB3 A;  3ZHR A;  4DR2 B;  3C3T A;  4JI8 O;  1AJP A;  1GK9 A;  2ITC C;  5EYP A;  3Q4H B;  1Y76 B;  3L71 H;  3ZMU A;  2H3O A;  2KB1 A;  3IGA C;  3CRC A;  4PDM A;  3OT7 A;  2IJK A;  4DV6 B;  2DYS C;  4EKW A;  3F5T A;  2AXT Z;  1GO3 F;  4DR2 O;  4JI2 O;  3I55 V;  4O4L B;  3ZHV A;  2NNU A;  4BW9 A;  1WN7 A;  3SJA C;  2P6J A;  3JAK B;  2W6J G;  4A5U B;  3ZED A;  1Q6H A;  3N2K B;  1I5X A;  4DV5 O;  5LL6 Y;  4X20 B;  5GON B;  1HNX B;  3S3X A;  1MG1 A;  5GON A;  4IYH A;  1MMM A;  3OTF A;  3QO7 A;  2HHH O;  3OD4 A;  4XDL A;  4CZZ A;  3X2Q B;  3FX7 A;  1S72 V;  4DV1 O;  5LHG A;  2E3C A;  3L9D A;  4KXR A;  4PA3 A;  3W7W A;  1UJW B;  3H1H H;  1EZJ A;  2DQ0 A;  4QE9 A;  3UT5 B;  2QWQ B;  1ZSP A;  3LSS A;  3K79 A;  1COW G;  4U7O A;  2IJI A;  1IDS A;  4U3J B;  1K9M W;  2ZE5 A;  1YJN V;  2L35 A;  1B6Q A;  2E74 B;  3ABU A;  4GKK O;  2FTK A;  3TCU A;  1P7B A;  3KZI Z;  3DC6 A;  2IU0 A;  3QTC A;  3ICX A;  3A8T A;  3SYQ A;  3D36 C;  4MVM A;  2NLJ C;  3S3W A;  3K9S A;  5JJE B;  4J9Z B;  4CH6 A;  4CS4 A;  1G8M A;  4FVM A;  4PD4 F;  1DF5 A;  3K5L A;  5LMN B;  4X9Q A;  3ZS8 C;  3CCR V;  4TT3 G;  4TUY A;  4PHZ A;  1JCH A;  1N36 O;  4TWK A;  1GMG A;  2HHH B;  4IHJ A;  3NR7 A;  1YXB A;  1FXH A;  3K5N A;  2DMX A;  2HR3 A;  4I9W A;  3RYF B;  4LP8 A;  1EN5 A;  3T1H B;  4DUY O;  1Y4M A;  5HFL A;  1HP8 A;  5L3G A;  3UO3 A;  1MSD A;  2ETN A;  5J2U B;  5BXZ A;  3M99 B;  4LFC B;  4B3R B;  1NTK H;  1N32 B;  3LSU A;  4HYO A;  1IZ3 A;  3P30 A;  1SC5 B;  3M7M X;  1XMQ O;  4JI2 B;  2EIL C;  5GTI Z;  4UVB A;  2W0F C;  3IC7 A;  5EK0 A;  1YIJ V;  4BR6 A;  1HNW B;  1MZE A;  3CRM A;  2UUC O;  1LNQ A;  1W0J G;  4NTY A;  4WBN A;  3SPC A;  3WB0 A;  5DEC A;  5KHK A;  2PGG A;  4JYA O;  3VOU A;  5AG2 A;  5KLV H;  2UXD B;  2BOC C;  1JVM A;  1D5N A;  1Y6X A;  4O2B A;  3SR2 C;  2ZDI A;  3F7V C;  4RQF A;  4DV4 B;  2PYJ A;  1URF A;  4ABM A;  1K33 A;  1WPB A;  2OCC B;  1XBL A;  3K03 A;  3E35 A;  4QPJ A;  4IL6 Z;  3CCE V;  1VQ7 V;  2JDI G;  3LDE A;  1SQP H;  3K08 A;  3EVK A;  3D36 A;  5LP6 B;  2YSU B;  4RQE A;  2IH3 C;  5BY1 A;  3BVO A;  2FL4 A;  2EIL B;  2GHY A;  2RJZ A;  3OTO O;  2YI8 A;  3EXA A;  1SA0 B;  4B08 A;  4ZKI A;  1R6K A;  1IX9 A;  3H01 A;  1MA1 A;  1S5L Z;  1SA0 A;  1NKD A;  3ASO C;  4YY3 B;  5CA1 B;  3HKB B;  2ZNJ A;  2CE4 A;  2DQ3 A;  1AI6 A;  3UT5 A;  4DV3 B;  4CS2 A;  1YVW A;  1VF6 C;  4K8X A;  1WP8 A;  5IYC O;  2AZ2 A;  1TUE B;  3ZHQ A;  1VQK V;  1L0N H;  5B1A C;  4ZIB A;  2QKA A;  1H8E G;  1TUB B;  3GWO A;  4TV9 B;  5J2T A;  1N4C A;  1Q3E A;  1OHH G;  5CBH A;  5IYD O;  1NZ6 A;  3H9V A;  3OM3 B;  1FXK C;  1RP3 B;  2YIB A;  1Q81 W;  3BHP A;  5CBG A;  4K35 A;  2X6C A;  5IWA B;  3ABK C;  3CP1 A;  4MTG A;  1XRE A;  1R6T A;  5KHJ A;  4FLY A;  2Y4T A;  1NJI W;  4FLT A;  5LMU O;  4I0X B;  4TV8 B;  3L75 H;  3G4S V;  1V54 B;  4I7Z B;  1SQG A;  4QPK A;  4DUZ O;  1QR9 A;  2A0L A;  4JI0 O;  1AI4 A;  2QM7 A;  2ZR2 A;  1ZLZ A;  2Q7G A;  4FFB A;  4UCO A;  1NVP D;  1WJZ A;  1K3E A;  3OGC C;  4YJ2 B;  3OW2 U;  5HFM A;  1BMF G;  2LJ2 A;  1ARO P;  4DR5 O;  2Q5Z A;  4IIJ B;  3W7T A;  4I50 A;  2EIM B;  5LOV A;  4W4L A;  5KUK A;  1VF7 A;  2AZ0 A;  3E2E A;  1Y66 A;  5LOV B;  1WAZ A;  3I5D A;  4MT8 A;  1XNQ O;  4XDK A;  2WLI B;  5JQG B;  1HW7 A;  2EUL A;  4DR7 B;  1DF4 A;  3ZJZ A;  4DV0 O;  4O2A B;  1R73 A;  2UXB O;  2ZM6 O;  3JD3 A;  3K59 A;  2OCC C;  2HFE C;  3CEI A;  4J42 A;  2LW7 A;  3OMA B;  3SPJ A;  1V9P A;  1BS3 A;  3KCX A;  2PZS A;  2MK3 A;  3E8F A;  3FAV B;  3WB1 A;  2IM9 A;  4JPR A;  4X89 A;  1R3K C;  1XHZ A;  4BIZ A;  4LNU B;  5BMV B;  3FAV A;  4MVU A;  4JI0 B;  3BAB A;  2KKW A;  3CD6 V;  1I5Y A;  1F7Y A;  2MW2 B;  2DYR C;  4XDJ A;  4WF9 V;  5TIS Z;  1U97 A;  3BAA A;  3W7S A;  4J7K A;  1NTZ H;  1F4M A;  1WNS A;  1DK1 A;  2NN4 A;  3WFV A;  3CC4 V;  1AJN A;  2RNB A;  1K97 A;  4MVO A;  2E75 B;  3CYO A;  2UXC O;  3MD0 A;  4GKK B;  1LR1 A;  5DM6 V;  4JF3 A;  3EHB B;  2QGN A;  2CH7 A;  2BE3 A;  4CC5 A;  4TOI A;  5FNV A;  1Q90 D;  1IUR A;  1QU7 A;  1A32 A;  1R3L C;  3ZRX A;  1JJ2 U;  4WFH A;  3CJH B;  3ABM B;  5EBW C;  5KMG B;  3G67 A;  3HKC B;  1EM1 A;  5IYZ A;  2JRI A;  2ZM6 B;  1GN3 A;  4DV0 B;  2P90 A;  2WLJ A;  5BZB A;  2CTR A;  1KD1 W;  1XNQ B;  2XT9 A;  4MVS A;  4I9Q A;  3J7A U;  1E1R G;  4N21 A;  3K57 A;  1ZUQ A;  4TV8 A;  1SF9 A;  3KG2 A;  4YY3 O;  4JV5 O;  1HWY A;  1K34 A;  2PTM A;  3AG1 B;  1B06 A;  4HAM A;  3FB6 C;  3CCQ V;  4DR5 B;  3RVY A;  3CC7 V;  1M4U A;  1KEC A;  2WWW A;  2Q67 A;  1MZF A;  4EFB A;  2CTQ A;  1FYJ A;  1YSC A;  2GUZ B;  1YTF D;  4UCS A;  3E86 A;  1U96 A;  2IH1 C;  3FKS G;  3PN1 A;  2YEV B;  2UUB B;  1WLE A;  2GBO A;  1JA8 A;  4JI1 O;  1XI1 A;  4X20 A;  1OCR B;  4PA4 A;  3TK1 A;  2QTS A;  4DW0 A;  3STL C;  4J41 A;  1TGO A;  1V55 C;  4AIL C;  5LXT B;  2YUA A;  2IU3 A;  4JZG A;  1YCI A;  3E22 B;  1KQS U;  1XL4 A;  3OFN G;  3BFR A;  4NTX A;  3VBB A;  1FXV A;  4QIW F;  1G4Y B;  3Q4H A;  1GRJ A;  3JAS A;  5LGN A;  5J9P C;  3JAR B;  2HP8 A;  4JYC A;  2UXN A;  1Q5O A;  5FLX N;  2YI9 A;  4HNA A;  3X2Q C;  3EFF K;  4B3S O;  1PNL A;  4LF8 B;  4I55 A;  1QVF U;  4IYI A;  3H1K H;  3CB2 A;  4DK1 A;  4G2K A;  2DW4 A;  5H6Q A;  4DV3 O;  4GLX A;  2UXC B;  1YDX A;  4HBN A;  3N2G A;  3NXS A;  5LMN O;  2XND G;  1BGY H;  1VQ9 V;  1YEW A;  4IT5 A;  5C8Y A;  2QSA A;  3OTO B;  1GN2 A;  1R1B A;  4N23 A;  3ZX6 A;  3H1J H;  5D5P A;  2YS8 A;  2Q8V A;  2JS5 A;  3B2E E;  4Z2W A;  4O4H A;  3ZHS A;  1YI2 V;  2OTL V;  4O4J B;  2H8P C;  4GCZ A;  2RQ6 A;  1LUW A;  2UUA B;  2GV9 A;  4DO2 A;  1K5Q A;  3B09 A;  3GB7 C;  4EFE A;  2UXD O;  2IJH A;  4JAS A;  5LA6 A;  2F1M A;  3ZRW B;  4LH6 A;  1RSO B;  4FM0 A;  4EB6 B;  2JIZ G;  5BR8 B;  1S3J A;  1E79 G;  2KG7 A;  4DV1 B;  4PV1 B;  3SYO A;  1VQ5 V;  2EIK C;  3VQW A;  1XHX A;  2UXX A;  3ABM C;  1CPY A;  4QGP A;  4CC6 A;  1XMQ B;  5KHI A;  1OZ0 A;  4ZHQ B;  3RT3 C;  2PYL A;  2R72 A;  2JEX A;  3W7U A;  3ZHU A;  3J81 N;  2ZE7 A;  1H2G A;  1NI8 A;  2XAQ A;  4LFB B;  5JH7 A;  3RBZ A;  5IJ0 A;  2D2C B;  3BCC H;  1N0J A;  2R9A A;  1ROP A;  5FPR A;  4DUY B;  4LF5 O;  4DRX B;  2BOB C;  4O4I B;  2K9P A;  3E8H A;  1YHQ V;  3RFR A;  2QM4 A;  3BRC A;  1Y74 A;  2HJF C;  1S0V A;  3G80 A;  2YXY A;  2Q9L A;  2VS0 A;  1L1F A;  3CCJ V;  3UQ8 A;  2NR5 A;  4P9P A;  2QDO A;  3A0H Z;  3LDD A;  2WSS G;  1R3J C;  4DV6 O;  4Z1M G;  1ZX3 A;  4J10 A;  1OCC B;  3AG3 C;  3CXH F;  1JFF B;  3CCV V;  4X88 A;  1NBM G;  4LR3 A;  5IYB O;  3THO A;  1V55 B;  4NB5 A;  1JJO A;  3ASN B;  4FLX A;  1YTF B;  1BQZ A;  3P3P A;  4WFA V;  4JI3 B;  4JI4 B;  2ZR3 A;  1B3Q A;  2Q7E A;  1PV0 A;  1MOF A;  2JK5 C;  2OT5 A;  2HVK C;  4WBN B;  1BZK A;  1S76 D;  4CH5 A;  3ETD A;  3SYC A;  1HNZ B;  2IBZ H;  3DXR B;  4JYB A;  1SQX H;  2F66 C;  2GDS A;  5B1O A;  4E2L A;  4JI7 B;  1R6N A;  1J5E O;  5IT9 N;  1GN6 A;  4KHP B;  2LGW A;  1XIL A;  2CAZ C;  4UCU A;  4DYL A;  2E76 B;  1KC8 W;  4L8J A;  2QWR B;  5EC2 C;  5EBM C;  3R66 A;  1PL0 A;  1XEQ A;  1HNX O;  4TUY B;  2AW9 A;  2CTP A;  3MHS C;  2YIC A;  2RN9 A;  3CCL V;  4KUM A;  4MVQ A;  4NVP A;  3ZRV A;  1EN6 A;  5CN0 A;  2BCC H;  2BSK A;  3RGB A;  1H2L A;  2M7W A;  4K0K B;  4U3J A;  4OGQ B;  1XUQ A;  1Z5W A;  2Q6A A;  2C2A A;  4GX1 A;  1IBM O;  4ZOL A;  3ZMZ A;  1K73 W;  5KA6 A;  2VQF O;  1ZWI C;  3ASN C;  3T1C A;  4BW5 A;  1I94 O;  4YHH O;  2WLK A;  3ABK B;  4UB8 Z;  1HNW O;  4FJC C;  3W7X A;  1VP7 A;  2ATK C;  4JI8 B;  3UM7 A;  2EIN C;  2O57 A;  1QLE C;  3VQY A;  3O65 A;  1N32 O;  4X66 O;  2CK3 G;  1K7D A;  5KAI Z;  5JCO C;  1S77 D;  2F93 B;  1AR4 A;  4FFK A;  1FKA O;  3BY6 A;  4X62 B;  2GSM B;  2VQE B;  3ETG A;  3K06 A;  3T1H O;  2XAF A;  4UVC A;  1N33 O;  1HR0 O;  3JSN A;  4AQY O;  4X1K B;  2EJR A;  1F4N A;  2WLL A;  5JWP A;  1KB9 F;  3IAY A;  1H2S B;  2WLM A;  2WLL B;  1HDJ A;  1OCO B;  1OCC C;  2EZP A;  4X64 O;  4OX9 B;  4YJ2 A;  4NXM O;  2B9Z A;  2XAS A;  3JCU Z;  3ZBH A;  4UVA A;  2A79 B;  4GKJ B;  4TQD A;  4ZI7 B;  1Q6U A;  3E8G A;  1K92 A;  1Y76 A;  4JAU A;  5CA1 A;  3RYC A;  3HKB A;  2IJJ A;  3RN4 A;  2F23 A;  2ITD C;  3CWB H;  2PF4 E;  1E1Q G;  3GVM A;  3K3W A;  4CS3 A;  5LHH A;  2P5O A;  2LFS A;  4RUE A;  5B3S B;  2DYS B;  2WLI A;  2CH7 B;  2HLD G;  1OJH A;  1FFX B;  1PL4 A;  3OR7 C;  2XAG A;  5FPO A;  3JAL A;  4JI3 O;  4B3M B;  3DXR A;  3LNM B;  4MVR A;  2A3Q A;  4QNH B;  3JAW B;  3JAT A;  3WB2 A;  1AR5 A;  4J80 A;  2PUS A;  4F6E A;  3HR0 A;  3FFQ A;  2ZCE A;  1NR1 A;  2GTS A;  3QF7 A;  2Q73 A;  1SQQ H;  2A06 H;  3ETE A;  3ZCC A;  1VQ8 V;  2F4V B;  2Q0O C;  2ODM A;  3B4S A;  2DWD C;  4DR6 B;  2RDC A;  1O9G A;  1VQP V;  4UCT A;  5KUM A;  5L3B A;  1W59 A;  1Q7Y W;  1K4D C;  4YIP A;  4JAA A;  1OCO C;  4W4K A;  4D6T H;  1G1X B;  1FPO A;  3MHH C;  4DV5 B;  3D3I A;  2PY5 A;  1KKC A;  4Q6G A;  4NKG B;  3FYI B;  5DED A;  4PI0 A;  4DV7 O;  2X0L A;  1BCC H;  1RM1 B;  4J11 A;  4I5S A;  2F43 G;  4PA9 A;  4DR6 O;  1NS1 A;  4B7E A;  4J7Z A;  1SER A;  1FD9 A;  1PNK A;  1I94 B;  2OTJ V;  5LBQ A;  4FLV A;  5BR8 O;  2CGO A;  5CA0 B;  2UU9 O;  3CRQ A;  1SZX A;  5IE9 A;  3L73 H;  1DGS A;  4FLU A;  5JQG A;  4YJ3 A;  4GX0 A;  4B3M O;  2WLN A;  1YF2 A;  1GM7 A;  2P22 C;  1VQM V;  3AG3 B;  3WU2 Z;  3RYH B;  5CMU A;  4ASU G;  2HEP A;  1IXB A;  3JAM N;  2ZNI A;  3OEE G;  4F4L A;  5GTH Z;  3C3S A;  2EIJ B;  1EZV H;  2BTO A;  3UKM A;  1FJG O;  2WA3 A;  2F95 B;  2XOK G;  3JD2 A;  4DR1 B;  1EFR G;  3ABL B;  2B1I A;  4FFB B;  2LW1 A;  2JVD A;  4H0L B;  4NXM B;  4R6Z A;  1D2D A;  2G38 A;  2PI5 A;  1SRY A;  2X6A A;  1PNM A;  4IGG A;  3AK2 A;  2YEV A;  3L70 H;  2XUM A;  4PEL A;  1XNR B;  2P67 A;  4WFG A;  4WCE V;  2BTQ A;  4JI6 B;  1J5E B;  1BT8 A;  1WB8 A;  2ZT9 B;  1QBZ A;  2DJV A;  3APQ A;  3OMN B;  1XL6 A;  1N33 B;  1W2B U;  1UFI A;  1QCE A;  5F2V O;  4NYK A;  5KAF Z;  2QWN B;  1SKV A;  4JI5 O;  4X66 B;  3RYI A;  4MW8 A;  4JTD B;  3HKE B;  1YZB A;  3JAT B;  3JAR A;  3KKY A;  1ORQ C;  3OGI B;  1NH2 B;  2A7W A;  4LNU A;  2CUG A;  4LF6 O;  1YJW V;  4LCU C;  1TVK B;  3D3Q A;  2UU9 B;  2GTA A;  1SES A;  1GH6 A;  3QNE A;  5LYJ A;  5BMV A;  3AG4 B;  4JTC B;  4B7K A;  5LYJ B;  1I08 A;  4R8C A;  4RWU A;  3OEH G;  2ILM A;  2QM8 A;  1M57 B;  3ZIA G;  1SQV H;  3MAQ A;  5KHG A;  5IJ0 B;  2E5L B;  3OMI B;  2XHB A;  4ICG A;  4LF4 O;  5EZY A;  2RCV A;  1AR1 B;  4LF7 O;  3AG7 A;  3O9O A;  4LFA B;  4LFB O;  1H2N A;  2GUZ A;  3LSQ A;  3FB5 C;  3CMA V;  3T1Y O;  1X59 A;  4GUN A;  1ENV A;  1SQB H;  2HVJ C;  3ABL C;  4TV9 A;  2QTO A;  3DC5 A;  1Z5V A;  5EBL C;  4JV5 B;  3AK3 A;  1X4T A;  3IC9 A;  3JD4 A;  2JGD B;  1FS0 G;  1IBK O;  3G6B A;  1JFF A;  4R7C A;  5IJ9 B;  1PPJ H;  1D5A A;  4FK5 C;  5LP6 C;  5LGU A;  5LXT A;  1QHT A;  2JJ2 G;  1FAF A;  2P4K A;  1HNZ O;  4Z1V A;  4OXS A;  2Y48 A;  3PJS K;  5H6R A;  3AG2 B;  2Y0I A;  3CSX A;  1XMO B;  4R50 A;  4HZ3 A;  2P4V A;  2ZDI C;  2AGA A;  5IDJ A;  4DR3 O;  1N34 O;  1SET A;  4FPP A;  5JH7 B;  2VRZ A;  2XAJ A;  1VQ6 V;  4I4T B;  5H5N A;  4F6R A;  4PDL A;  2AHZ A;  3L72 H;  3SPI A;  4JTA B;  4AI8 A;  1IBL O;  4RAI A;  2ARH A;  2K1E A;  4FM1 A;  2KSD A;  3DTU B;  2JEU A;  3P3N A;  1GAX A;  3JAK A;  4IIJ A;  3N27 A;  3FYE B;  4I50 B;  3T2M A;  1N34 B;  4CH4 A;  5JCO A;  4DW1 A;  3AG1 C;  3P32 A;  1OCR C;  3CCM V;  4G27 B;  3AEI A;  2FYU H;  3IJ4 A;  1KP3 A;  3CCU V;  5CBF A;  2FKX A;  3JYC A;  4FIP C;  5K1P A;  2P7T C;  2VQE O;  3G71 V;  2CGN A;  4H33 A;  4DR4 B;  5EYP B;  2W0X A;  4KFM A;  4O4J A;  4QE7 A;  4DV2 B;  3H1I H;  2YID A;  4PI2 A;  1Q8I A;  5ITZ B;  1KU9 A;  3JD0 A;  3CS5 A;  3APO A;  3SPG A;  3AK1 A;  1IBK B;  1WB7 A;  5ITZ A;  5B1A B;  2ZE6 A;  1Q6I A;  1LUV A;  2LO1 A;  2M6Y A;  4MTX A;  3T4Z A;  2ZD9 A;  2DWE C;  1NVP B;  1VF6 A;  1R3I C;  2VQF B;  5LHI A;  1GTO A;  2YXL A;  5KA5 A;  1VQO V;  1KKD A;  3AG2 C;  5L3F A;  4LF4 B;  5B5E Z;  3N2G B;  5C93 A;  1I0H A;  2YDE A;  5EZY B;  1K8A W;  5FL7 G;  3ETQ A;  1ZTE A;  3OUF A;  3TXS A;  3VQV A;  4O4H B;  1ZAU A;  4PJ0 Z;  1AP5 A;  1WA8 A;  3CME V;  4LF9 B;  1WP7 A;  3IFX A;  4UFZ A;  4P30 A;  3CPW U;  3CRR A;  3E8B A;  4FMT A;  4MSW C;  2Q69 A;  4B3T O;  5E79 Z;  5LMU B;  4MTF A;  2YIA A;  5KMG A;  3STZ C;  3TGU H;  1M56 B;  2QWP B;  3WG7 B;  3RYF A;  5J2U A;  2AHY A;  3K04 A;  3RWR D;  4ZOL B;  4DV2 O;  4JI7 O;  1BL8 A;  4UUJ C;  4LF8 O;  2HG5 C;  2KG7 B;  3RYC B;  2ZXW B;  3OUS A;  2WA4 A;  2Q7H A;  3CX5 F;  2LGQ A;  2OWO A;  4UCR A;  1F23 A;  3CCS V;  3T4D A;  1RM1 C;  4JI6 O;  1J95 A;  2Z0A A;  2B5U A;  3G6E V;  3JAL B;  4F6R B;  1QNM A;  4O2B B;  3ZN1 A;  5K1X A;  3TET A;  1H8H G;  1S5H C;  1VMG A;  4GYC B;  4O4I A;  4P9O A;  1VQL V;  1AIL A;  1M57 C;  3U10 A;  1KMI Z;  1Y74 B;  3DGE A;  4LF9 O;  2EIK B;  4DR1 O;  5A2Q N;  5KX5 A;  3H1L H;  1FJG B;  4JI1 B;  2XTA A;  1FFT B;  2ZQM A;  1MNG A;  3K5O A;  3VQX A;  2ZXW C;  4DR3 B;  5B1B B;  2QKC A;  4PA6 A;  5KX5 B;  3FB7 C;  5LP6 A;  1VQN V;  3AG4 C;  1M1K W;  2EZO A;  2DE0 X;  3QVN A;  4DV4 O;  4ZI7 A;  4BIO A;  2KQX A;  4LWS A;  3TJT A;  4YXW G;  4J7J A;  1QVG U;  3B8N A;  1MAB G;  3DSQ A;  4LC1 A;  3OE7 G;  2LFR A;  1F51 A;  4FZ1 A;  3K5M A;  4AHC A;  2Y0P A;  4HNA B;  2JGU A;  2Z3Y A; 
#chains in the Genus database with same CATH homology
 1OJH A;  3CS5 A;  2Q8V A;  2QDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...