1OJHA

Crystal structure of nbla from pcc 7120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
IELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NBLA
publication title Crystal Structure of Nbla from Anabaena Sp. Pcc 7120, a Small Protein Playing a Key Role in Phycobilisome Degradation.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
molecule tags Protein binding
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 1ojhA00
1OJHA 2QDOA 2Q8VA 3CS5A
chains in the Genus database with same CATH superfamily
1RP3B 1IXMA 2C2AA 3LNNA 4JI6O 4HNAB 3I5DA 5H6RA 4LF8B 1MG1A 1PNKA 4DRXA 1US6A 4F6RB 2P4VA 4BWAA 2IJJA 1Z5WA 3O65A 5FL7G 2RN9A 2QSAA 3CCJV 3FB8C 4I9WA 2BSKB 1YI2V 4B3TB 5JWPA 4KHPO 2WSSG 1AP5A 3FYIB 2HKOA 1VQ7V 5IJ9A 2CK3G 4X65B 4YHHB 1N32B 4MVMA 1G4YB 2OCCC 3ZMZA 3SYCA 4L87A 4QPJA 5J2UA 3AG1B 1DLBA 1VEWA 4DV6B 2KSDA 3KG2A 4LNUA 2XUMA 2AZ2A 1VQ9V 4PD4F 3DC6A 1N0JA 1RM1B 1QR9A 2EX3A 4DO2A 2ZM6B 3PJSK 1OHHG 4JI3B 2JIZG 3J80N 4DV2B 1N36B 5LYJB 2HFEC 4NTWA 2IJHA 1XL6A 4EKWA 3EVKA 1V55C 1Y4MA 1NTZH 3GVMA 3WB2A 4ZHQA 2EJRA 2IU3A 1ZL8B 5LL6Y 2A06H 3LNMB 5LP6A 1HNWB 1RSOA 2YUAA 3SJAC 5BMVA 3ASNC 2CH7A 4X1YA 1Q6HA 4NXNB 3K5NA 4E4EA 4JI0B 1XHXA 4WFAV 1NQTA 3BPZA 2ZNIA 3EFFK 4FM0A 3JD1A 5HFMA 3F5WC 2YXHA 4GKKO 4O4JA 2UXXA 1GM9A 2XAJA 1IURA 4UCUA 1TVKA 3E22A 1VQ6V 4MVUA 3CJHB 3CB2A 1L1FA 2QWQB 4DR7B 1PL4A 3OGIB 2ITDC 3VBBA 2LJ2A 4DR6O 1Q6UA 5B5EZ 2VQFO 1XREA 4F4LA 4OX9O 3OTOB 3ZHUA 2BTQB 2QWNB 3CHXA 3SYQA 3WU2Z 3OUFA 5ITZB 1QR8A 1AR4A 1BCCH 2A3QA 1S5LZ 4LFCB 4YJ3A 4JYCA 3RYFA 1FAFA 4K0KB 1BSMA 1WP7A 3HKCB 4QNHB 4BAYA 1JOYA 3U11A 3R65A 2WLIB 3FD9A 1W0JG 4A5UB 2LGWA 3AEIA 2JRIA 3GWOA 3F7VC 1TUEB 2EIJB 2LFRA 2XAHA 3I56V 4PA7A 3QO5A 1M57B 1R73A 2QKAA 1M5IA 4XDLA 4YIPA 4JI6B 4B3MO 3UQ8A 3JCUZ 3SJQC 4JTDB 3GWKC 3CXCU 1Y66A 1VQOV 1SQFA 5DEDA 3ETQA 1PNMA 3JAWB 5KUMA 4RQEA 3NR7A 4KL1A 4TWKA 1IBMB 3K06A 3TXQA 3SPGA 4B3RO 1NJIW 1GN6A 2A7WA 1VQ8V 4C7UA 2ZIOA 3N2GB 2IM9A 3ASOB 4R8CA 1SESA 5B3SC 4I7ZB 2PI4A 2EULA 3E8FA 3X2QB 5DM6V 5LMNO 2JGDB 3HPLC 3ZX6A 3LDEA 4RAIA 1NR1A 1OCCC 1JFFA 4PA6A 3H1KH 1YVWA 4QIWF 3ZN1A 2QGNA 1W2BU 2ZQMA 4Q20A 3E8GA 2IJKA 3BY6A 3K5LA 1XMOB 1JPXA 1NKDA 4LF4O 3JARB 3QTCA 4MTOA 1KUQA 4I55A 1FXKA 2EIKB 1I5XA 2ZE6A 3RYHB 1NVPD 2PYJA 2E75B 1EN4A 4HNAA 1M1KW 5L3EA 2EIMB 4W4LA 5IJ0B 1JMKC 2JEXA 4ZOLB 1TUBA 2UXCB 3EXAA 5IY5B 3SPJA 3CWBH 2O57A 2QTOA 1MOFA 2BTOA 3ZMTA 5K1XA 1NTMH 3ML0A 3K04A 1MNGA 4DXWA 2GDSA 3G71V 4X20B 5KA5A 2OYQA 2N04A 4U3JB 1ZLZA 1WN7A 2F93B 5EYPA 3RVYA 2ARHA 3L74H 2XT9A 3ZEDA 4MVZA 1NT2B 1GN3A 1SA0A 4MS2A 5FNVB 3O9OA 2KB1A 2DYSC 1V54B 5IE9A 2AZ0A 1OCRB 4EFEA 2ZT9B 4CS2A 1KECA 2DYRB 2IW5A 1RPRA 4FJCC 1BQ0A 3F7YC 4IIJB 2WLJA 3CD6V 1XL4A 4WFFA 1I94B 3CRRA 1LNQA 2VWKA 1D5AA 2IU0A 1FKAO 4I5SA 2A9HA 2FMLA 5CA0B 3MD0A 4H37A 3VOUA 1WPBA 2Q6AA 2PTMA 1SS3A 3WFVA 4DV3B 3LSSA 2EZOA 3BRCA 3U0ZA 1S77D 2JVDA 3SYOA 4B3MB 4DV5O 3G67A 1OV9A 2Q5ZA 3WG7B 5JH7A 1W59A 3IC9A 5EBLC 1M4UA 4GCZA 3JASA 2UUBO 2L35A 4QPKA 3CRCA 5JQGA 4J7JA 3CJHA 2M7WA 4DR2B 3H1HH 4LBEC 3IAYA 4B3RB 2PGGA 2Y4UA 2W6JG 2Q9LA 3HKDA 3K58A 4J9ZB 1PP9H 1BT8A 4FFKA 1H38A 2BTQA 1LUWA 5ITZA 4LF8O 4GZRB 5IYDO 3AG2C 3OMIB 2OTJV 2K1EA 3ETDA 1SQQH 4OGQB 4DR4B 1KU9A 4MW3A 4B7EA 3H1IH 1B6QA 4WFBV 1IZ3A 2DMXA 4B3TO 2WLIA 2FB5A 1GN4A 3TXSA 5C8YA 2LGQA 2CTPA 4FMTA 4NR1A 4X65O 3MHSC 4AILC 1N32O 3JALA 4JZGA 4JI5B 4JYAO 1P4RA 1GKFA 4DV6O 1SRYA 4CS3A 3K9AA 5LGUA 2EILC 1QVFU 3A0HZ 1L8DA 2P90A 1X4TA 1Y67A 1JQ0A 2QM7A 2ZD9A 4PA9A 2ZM6O 4R50A 1G1XB 1VQ4V 2GUZB 1WNSA 1N36O 4DK0A 2ZXWB 4UCOA 1GM8A 3QVNA 1NTKH 2YI9A 1I08A 2X6CA 3BFRA 3CCQV 4LFAB 1CEZA 2ZDIA 3N2GA 5GONB 2PY5A 3H1JH 3ZMUA 4JI7B 1DF5A 5JJJB 3ABKB 3G6BA 4LWSB 3K5MA 1ORQC 4NXNO 3RYIA 3ZJZA 4JI0O 3ZS8C 4TV8B 3FAVB 4I50A 4GX5A 2P06A 1GO3F 2XAQA 4BW9A 3SPIA 4PDLA 4FM2A 4X88A 3CCRV 4X8AA 3JARA 3DC5A 2Q69A 4BIUA 1BQZA 4FFBA 3JAMN 3RYHA 1MMMA 3E86A 4H0LB 5LP6C 2Y0PA 3VQYA 1VF7A 1F7YA 5L3FA 4YY3B 2AHYA 4I9QA 2OCCB 2CTWA 4DR7O 1WJZA 2Q7EA 3CPWU 5LMUB 1VP7A 4LR3A 1Y74B 1FFXB 5JCOA 3C90A 4G27B 4LH7A 4OXSA 4JAVA 3OTOO 3T2MA 4I0XA 5KUKA 3ABLC 5KHGA 4LFCO 1ZX3A 1EBOA 2R9RB 4O4IA 3W7SA 2IBZH 3DTUB 5H2FZ 1RFYA 4PA3A 1V55B 3FKSG 1GM7A 4LH6A 4Z1VA 3AK2A 3JD3A 4EFBA 4B7KA 2YIBD 1F51A 5C93A 2V7QG 4KXRA 5HFLA 2E76B 3ASNB 1M9NA 4DV4B 1WLEA 3E8BA 4PI0A 3APQA 4UCTA 4TUYA 1H2MA 3UO2A 3OM3B 4G2KA 3M8AA 1N33B 4DV0B 1K8AW 3JCZA 4O4LB 2IJIA 3B4SA 3OTFA 4NYKA 1IBMO 1P7BA 3FYEB 2Y0IA 2KG7B 2RDCA 4GX2A 3QO7A 3DGEA 3JSNA 1K5SA 4QJFB 1KP2A 4U7OA 3H9VA 5CMUA 2KQXA 1SQGA 1CPYA 1Q3EA 4HBNA 1VQNV 2EBOA 4JYAB 3OFNG 1N8RW 2Q7GA 4CC6A 1R6KA 3RBZA 3E2EA 2IH1C 3THOA 4N23A 2ADPA 1M90W 5CBGA 3RVZA 5LXTB 1XBLA 2DWDC 2QJ1A 3IGAC 4X64O 4LF5B 1XOUA 5GTHZ 5D5QA 1XMOO 3SR2C 4UXNA 3MAQA 1QVGU 2WLHA 4BIZA 5H9CA 4NKGB 3ABMC 1ROPA 1NZ6A 2YXYA 5LHGA 2B1GA 5CA1A 1S72V 3HKBB 1Q86W 1UPGA 1AVMA 4PDRA 2AGAA 1KD1W 3BHPA 2OIGA 3W7WA 2UXCO 1VMGA 1Z2GA 1XNQB 1FPOA 1FYJA 4J7KA 1YJNV 4MW8A 2OTLV 1YIJV 5JJEB 4JI1B 4JV5B 3QG5A 1B04A 4JZ2A 4X9QA 4N21A 2F4VB 1D5NA 1YXBA 4GLXA 1KBHA 3T4ZA 5KMGB 2E3CA 3G4SV 4K8ZA 4Z1MG 2YIDA 3W7XA 1QCEA 1N0NA 3SPHA 1AI5A 5B3SB 1CXZB 4UV9A 1XDCA 5JVDB 4FLZA 1OCCB 4QE7A 2OT5A 1XMQB 2YS8A 2V4DA 2YXLA 4IHJB 4CH6A 1K34A 2P7TC 2ITCC 1D2DA 3CRMA 5K1PA 1GAXA 1YHQV 5CA3A 1XQ8A 3RW0A 4AHCA 2Y69C 2UUCB 3AG1C 1VQKV 2YI8A 1I94O 1WA8B 3L9DA 3MHHC 4MVRA 3T1HB 2Q4PA 3JATA 2H8PC 4DV1B 1RM1C 2Y4TA 4XDKA 3N2KB 4O2AB 5EBMC 4RUEA 3P3PA 1QLNA 1FS0G 3UT5A 3CCEV 2XASA 1QQCA 5FPOA 4PDVA 1Z5VA 4DV3O 4CBCA 2UXNA 5BY1A 3SJCC 2ATKC 5IWAB 5L3CA 1H2NA 4TV9B 1DF4A 2YEVB 1E1RG 1S5HC 5H5NA 3CCSV 1RPOA 4PHZA 5CB4B 2W0FC 2P22C 4O2BB 4FLTA 3ZRWB 4IYIA 1FJGB 1B3QA 4DR2O 3FB5C 1H2SB 4ZI7A 2WLKA 2YDEA 1K4CC 1WPXA 1GRJA 1Y74A 5LOVA 1N4CA 4RQFA 2K9PA 5B1BC 3ZHTA 3DXRB 1S5JA 5KLVH 1ZSPA 1KKCA 1H8EG 2DE0X 4DR4O 4H33A 3E89A 3OD4A 2PYLA 1Y76B 1MSDA 3IJ4A 3SYAA 3TGUH 4X64B 4LF6B 5IT9N 3AK1A 4X1KB 2FKXA 3K3WA 5CBFA 1B06A 4UVAA 1BE3H 3A2FA 3I55V 2F23A 4TT3G 4DUYB 3Q4HB 1P49A 4JI5O 1AR5A 1EN5A 4DR3B 2WA4A 1SF9A 4U7NA 4B3SO 5A2QN 4I4TB 3ZHSA 4F6RA 3OMAB 4H13B 2EINC 1DK1A 1LUVA 1THZA 3BEHA 2HJDA 2Z3YA 1AILA 2AW9A 1NS1A 3B2EE 4W4KA 2BSKA 1YF2A 4GX0A 2WLLB 4WFGA 4PJ0Z 3BCCH 1AJPA 4LFAO 4TOIA 4CH4A 2GTAA 4GT1A 2YIAA 1EFRG 1EM1A 4X62B 3TK1A 1IDSA 4JI7O 3A0RA 1JVMA 3A0BZ 3OMNB 2RCVA 1DGSA 1ZUQA 3CP1A 4J7ZA 4WBNB 5LXTA 3BABA 1N34B 2GV9A 1M56C 2G38A 4PI2A 4UCSA 1EN6A 1MZEA 1Q6IA 3CRQA 1EZJA 1NI8A 3AG2B 4NTYA 2UU9O 4RUFA 3K59A 4EB6B 1NBMG 5LYJA 2BOCC 3CCMV 5EZYB 4U3FH 1SC5B 2ZDIC 2A79B 5DN6G 1VARA 2B5UA 2R9AA 2BCCH 3DSQA 2RNBA 1G6UA 1YEWA 2LP7A 1ZL8A 4DW0A 4YY3O 1JA8A 2QWPB 3L71H 2QM8A 2NR5A 4FIPC 2ZNJA 2QTSA 2DJVA 3B77A 5E79Z 1IX9A 1S76D 2B1IA 2AHZA 2BE3A 2VRZA 5LMUO 4GKJO 1QU7A 2EILB 1ENVA 4ICGA 3AG3C 4MTFA 1TA8A 3K0GA 2MW2B 2FYUH 3HKEB 3K9SA 1WP8A 5EK0A 2EZPA 3ZHVA 4FK5C 3IFXA 3H01A 2R9IA 4BW5A 3OGCC 4D7TA 5DECA 4GYCB 2JS3A 2R72A 3RYCB 3ICXA 1BL8A 1COWG 2IH3C 4WFHA 1VF6A 3L70H 3P32A 5CBHA 2LO1A 5J2UB 3T1YB 2VQEO 4L8JA 1UFIA 1OCOC 1E79G 3OUSA 4FZ0A 4B08A 3ZHQA 1U96A 4DV4O 4DV7O 2M6YA 4IHJA 3RT3C 5KA6A 5KAFZ 5BR8B 1N33O 2DN9A 4DV0O 1R3KC 1GN2A 4KP4A 4CH3A 1WB7A 3B8MA 3LSUA 2XNDG 4JTCB 1NH2D 1SZTA 3HKCA 1HDJA 3JD4A 4XDJA 4ZHQB 4GUNA 3QF7A 1AJQA 4LC1A 5LP6B 4MTXA 1RSOB 2ODMA 2N74A 5BMVB 1HR0B 2CH7B 4X1YB 3K57A 1H2GA 1O9GA 5F2VO 4B3SB 3AG4C 2QA4V 2F1MA 4PV1B 3FB6C 2A0LA 4X66O 4J10A 3K0DA 1M93A 3ABLB 2HLDG 4LF5O 4EEQA 1XI1A 4DUZB 1KP3A 5CB4A 1NVPB 3JAWA 4O4JB 3TJTA 1Q90D 2NN4A 4DR5B 5J2TB 3SGIA 1UJWB 4TSFG 4FVMA 3JYCA 3L72H 2UXDB 3BA9A 1TVKB 3CS5A 3E22B 3K79A 3AG7A 5B1AC 2ADQB 4CZZA 2HVJC 3E83A 3MDSA 3E8HA 3SJBC 2YICA 2JGDA 2ETNA 3AK3A 5B66Z 5IDJA 1X59A 2X0LA 4FLWA 1SQBH 1XNQO 3LSQA 1LR1A 2ZIMA 1IBKB 5J9PC 4ZKIA 2W0XA 4DR1B 2LFSA 4YJ3B 3RYFB 3UKMA 1SQPH 3S3WA 4JI1O 4JV5O 1WAZA 2UU9B 3LDDA 3SYPA 4MT8A 3D36A 2F4VO 2R70A 2WA3A 1HW7A 3FX7A 5IYCO 3ZRVA 2P6JA 4Z2WA 2JK5C 5IYBO 4H44B 1O9HA 3TCUA 5IJ0A 4ZOLA 1ZTEA 4BR6A 2WLMA 2CTRA 4GKJB 4K35A 1XMQO 1KC8W 3CC2V 1MSWD 3N27A 2P4KA 3D3QA 2YSUB 4X20A 4CS4A 1QLEC 3KZIZ 2UUCO 2JGUA 4U3JA 4J11A 3CXHF 3ABMB 1Q7YW 3T1HO 4DV1O 4UB8Z 2VQEB 3FB7C 4GX1A 2UUAB 5A9GA 2XAFA 5FNVA 2CDYA 1XNRB 1YJ9V 1NU1H 3GB7C 2HJFC 4DV7B 5IWAO 2F95B 1AI7A 5EZYA 1P84F 3ZBHA 1G8MA 1FXHA 4IIJA 3VQVA 2HR3A 2JEUA 4LF9B 4X1IB 1HNZB 3K5OA 4I55B 3ABKC 3L75H 4FLVA 1XHZA 1FJGO 1A32A 1GTOA 5GW7A 1FFTB 3CX5F 3T4DA 4IL6Z 4IT5A 5CA0A 3CMEV 1JCHA 1J5EB 1BHAA 1TUBB 1NH2B 1BZKA 2Q67A 3B8NA 4TQDA 3HKEA 5IYZB 2CGNA 1L0LH 4UB6Z 4X66B 1K97A 2Q0OC 1Q82W 4CC5A 2V1DA 3HB3B 4LF7B 4LF6O 1XUQA 3RYCA 5KX5B 2JJ1G 1YITV 2HVKC 2QE7G 2Y69B 1OCZC 2GBOA 1MA1A 4FPPA 3SPCA 2HHHO 4ABMA 1OJHA 4DW1A 5EYPB 3ZMSA 4DUYO 2JS5A 3H1LH 2ZCEA 3QO8A 4DR3O 3ZN0A 4WF9V 1SA0B 1HNXB 4JI8B 2CGOA 1IVSA 3STZC 2W6IG 4J80A 3J7AU 1I5YA 1JR9A 2D2CB 2D3OW 3ZCCA 2DOSA 2PI5A 1V9PA 1BGYH 3EHBB 2RMKB 1Q81W 3F5TA 3LUTB 1R1BA 4FLYA 1NR7A 3OR7C 3CEIA 1FXKC 3R66A 2ZE5A 3UM7A 1PPJH 2LQTA 4X62O 2BOBC 1ZWIC 1AROP 3G6EV 2LW1A 2HP8A 3APOA 1N34O 5B1BB 2WAMA 1L0NH 1TGOA 5J2TA 1K4DC 2E74B 2GUZA 4JPRA 4JAAA 5JH7B 4FLXA 5B1OA 3ABTA 4MTGA 4NXMB 3JASB 4MVQA 1FD9A 4OPAA 5JQGB 4UUJC 2WWWA 3NXSA 4IYHA 5LGTA 3CSXA 4JAUA 5GONA 3CRAA 1JJ2U 5KHKA 3B09A 3ZHRA 4UVCA 2GSMB 5BXZA 1MABG 2X6AA 2NLJC 2XOKG 3HKDB 2DWEC 4LWSA 2WLNA 4TQFA 1KKDA 4ZIBA 2DQ0A 2YC0A 4TV8A 3FAVA 1K92A 5EIBC 2EINB 1URFA 4KUMA 3CYOA 2DW4A 1PL0A 5LA6B 4E2LA 4WCEV 4J41A 5C8YB 4CH5A 2Z0AA 2Z5UA 3U10A 3JALB 3SDLA 3UCSC 1DTOA 1VQLV 2QKSA 3C3TA 4JASA 3RN4A 3T1YO 2XAGA 4NVPA 5L3DA 1H8HG 3D3IA 3CMAV 1J95A 3HR0A 4JI4O 4JYYA 1R3JC 1FFXA 2LW7A 2DQ3A 3OR6C 1E1QG 1M56B 5BR8O 2QDOA 3BAAA 4HAMA 4UFZA 2VS0A 1SQVH 1VF5B 2ZE7A 4Q6GA 4KHPB 2CUGA 2DYSB 2JDIG 1MZFA 4P9OA 3BA8A 5EC1C 1VF6C 1QNMA 2ZR2A 4F6EA 1I0HA 5FPRA 4D7SA 2HHHB 4JI2O 2NNUA 1HR0O 5LHIA 1F4MA 3RYIB 1HP8A 1CP9A 5B1NA 4I50B 1T5EA 1SQXH 3C3SA 3M7MX 1IBLO 3CC4V 3AG3B 3A8TA 4O4LA 3WB0A 4X1IA 4DUZO 1W0KG 4FFBB 4MSWC 5BZBA 4DR5O 1K7DA 4J9YB 2Q0AA 2UXDO 4O4HB 2KG7A 1ZAUA 3T1CA 5EBWC 2ZR3A 1PKXA 4WFEA 2GHYA 3OE7G 1BS3A 2EIJC 1OCOB 2JJ2G 1GMGA 1M57C 4JTAB 2E5LO 1R6NA 2CTQA 5IYZA 4AI8A 4LFBO 1AJNA 3OEHG 4I0XB 2XTAA 5LHHA 3OAAG 1K33A 2MK3A 1IBKO 3PN1A 4DR1O 3LDCA 4QGPA 2QEXV 2ZINA 2QKCA 3BVOA 4GKKB 4JF3A 4O4IB 2RQ6A 5LGNA 5KX5A 1YCIA 3WB1A 2N05A 1YTFD 4X89A 1YJWV 2UXBO 4OPHA 1WB8A 4YJ2B 3ASOC 1KQSU 4PA4A 2PUSA 1FXVA 4KFMA 3ETEA 3OT7A 3X2QC 5L3BA 2ILMA 3HKBA 1QBZA 2QWOB 4FM1A 2P5OA 3ABUA 1BHBA 4DR6B 3JAKB 2VQFB 1Q43A 4TUYB 4OX9B 2EJ7A 1K5QA 2HG5C 3FFQA 3AG4B 4UCRA 4BIOA 4QE9A 1AR1B 4DRXB 5KHIA 3ZRXA 2QR4A 1R3IC 5KHJA 4LP8A 2FL4A 1EZVH 4R7CA 1SETA 1F4NA 3D36C 3W7TA 2Q7HA 2OWOA 4NB5A 2EIKC 4MVSA 5KMGA 2ZE8A 2XHBA 4YXWG 3JD0A 4K3AA 2CAZC 5IJ9B 4AQYO 2EIMC 3K03A 3P3NA 2ZKOA 5B1AB 1P7GA 1Q5OA 3CC7V 4J42A 4XBFA 3RFRA 1SKVA 1SERA 5IY5C 5TISZ 3S3XA 5JVDA 2UUAO 4LNUB 3CCLV 2Q73A 1R3LC 2Q68A 1XNRO 5JCOC 4JI4B 4PDMA 3VQWA 5FLXN 1BMFG 1JX9A 1Q8IA 3TETA 3L73H 1PD3A 3B40A 4LF9O 3RWRD 1HNZO 4IGGA 4MVOA 4FLUA 1WA8A 4JYBA 2H3OA 2Q8VA 1KMIZ 4YIOA 5CA1B 2KKWA 3K08A 3W7UA 1H2KA 1VQMV 3N2KA 4O2AA 4RWUA 1J5EO 5LMNB 4JI2B 2B9ZA 4ASUG 1V54C 2Y48A 1PM9A 5LA6A 1OCRC 5KAIZ 1YDXA 3J81N 2X7RB 2DYRC 4TV9A 2YEVA 1K73W 3E35A 1GK9A 2YIBA 4LF4B 1IBLB 1GH6A 2OIEA 3KKYA 1KYOF 3IC7A 4LF7O 4JGSA 4YHHO 3JSLA 4PELA 4O2BA 3ZRWA 1QLEB 1JJOA 1YZBA 5EC2C 4D6TH 5EIBD 1K9MW 1PNLA 1QHTA 4NTXA 5JJNB 1AI4A 4UVBA 5KHHA 1K3EA 3QNEA 3CCUV 1HNXO 1U97A 4LCUC 2CE4A 5H6QA 4JI8O 3DXRA 2E5LB 4LFBB 4UV8A 4JI3O 4R6ZA 4HYOA 4DV2O 1H2LA 2F66C 4DYLA 1Y76A 2X6BA 3WG7C 3VQXA 2FTKA 4X1KA 1VIBA 2PZSA 3G80A 2P67A 4G28B 1TAEA 1XEQA 3P30A 5L3GA 1HNWO 2PF4E 4P9PA 1IXBA 2UXBB 3JATB 2WPDG 1AB3A 3Q4HA 4P2ZA 3D8CA 3OW2U 1S3JA 1F23A 5LBQA 2H94A 3OEEG 2L6LA 3UT5B 4DK1A 2F43G 2RJZA 4HZ3A 4K8XA 4I4TA 4P30A 1YTFB 4UCVA 1R6TA 2OCHA 1S0VA 1HWYA 5AG2A 5GTIZ 3RGBA 5D5PA 3ZMVA 4O4HA 4NXMO 2WLLA 1KB9F 4FZ1A 4RO2A 4ZBMA 4ZI7B 1VQPV 1OCZB 3ETGA 2QM4A 3ZIAG 2VWJA 1YSCA 1AP6A 4AQYB 5LOVB 1VQ5V 4WBNA 5CN0A 1PV0A 1AI6A 3JD2A 4DV5B 1JFFB 3ZRSA 4K0KO 1I7FA 2ZXWC 2QWRB 4EB6A 3KCXA 1Y6XA 3CE2A 1XILA 5E1AC 2UUBB 2AXTZ 2HEPA 3KCYA 4YJ2A 3STLC 3M99B 1OZ0A 1SZXA 3CCVV 2GTSA 1FXKB 3UO3A 3JAKA
chains in the Genus database with same CATH topology
1OJHA 2QDOA 2Q8VA 3CS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJH A;  2QDO A;  2Q8V A;  3CS5 A; 
#chains in the Genus database with same CATH topology
 1RP3 B;  1IXM A;  2C2A A;  3LNN A;  4JI6 O;  4HNA B;  3I5D A;  5H6R A;  4LF8 B;  1MG1 A;  1PNK A;  4DRX A;  1US6 A;  4F6R B;  2P4V A;  4BWA A;  2IJJ A;  1Z5W A;  3O65 A;  5FL7 G;  2RN9 A;  2QSA A;  3CCJ V;  3FB8 C;  4I9W A;  2BSK B;  1YI2 V;  4B3T B;  5JWP A;  4KHP O;  2WSS G;  1AP5 A;  3FYI B;  2HKO A;  1VQ7 V;  5IJ9 A;  2CK3 G;  4X65 B;  4YHH B;  1N32 B;  4MVM A;  1G4Y B;  2OCC C;  3ZMZ A;  3SYC A;  4L87 A;  4QPJ A;  5J2U A;  3AG1 B;  1DLB A;  1VEW A;  4DV6 B;  2KSD A;  3KG2 A;  4LNU A;  2XUM A;  2AZ2 A;  1VQ9 V;  4PD4 F;  3DC6 A;  1N0J A;  1RM1 B;  1QR9 A;  2EX3 A;  4DO2 A;  2ZM6 B;  3PJS K;  1OHH G;  4JI3 B;  2JIZ G;  3J80 N;  4DV2 B;  1N36 B;  5LYJ B;  2HFE C;  4NTW A;  2IJH A;  1XL6 A;  4EKW A;  3EVK A;  1V55 C;  1Y4M A;  1NTZ H;  3GVM A;  3WB2 A;  4ZHQ A;  2EJR A;  2IU3 A;  1ZL8 B;  5LL6 Y;  2A06 H;  3LNM B;  5LP6 A;  1HNW B;  1RSO A;  2YUA A;  3SJA C;  5BMV A;  3ASN C;  2CH7 A;  4X1Y A;  1Q6H A;  4NXN B;  3K5N A;  4E4E A;  4JI0 B;  1XHX A;  4WFA V;  1NQT A;  3BPZ A;  2ZNI A;  3EFF K;  4FM0 A;  3JD1 A;  5HFM A;  3F5W C;  2YXH A;  4GKK O;  4O4J A;  2UXX A;  1GM9 A;  2XAJ A;  1IUR A;  4UCU A;  1TVK A;  3E22 A;  1VQ6 V;  4MVU A;  3CJH B;  3CB2 A;  1L1F A;  2QWQ B;  4DR7 B;  1PL4 A;  3OGI B;  2ITD C;  3VBB A;  2LJ2 A;  4DR6 O;  1Q6U A;  5B5E Z;  2VQF O;  1XRE A;  4F4L A;  4OX9 O;  3OTO B;  3ZHU A;  2BTQ B;  2QWN B;  3CHX A;  3SYQ A;  3WU2 Z;  3OUF A;  5ITZ B;  1QR8 A;  1AR4 A;  1BCC H;  2A3Q A;  1S5L Z;  4LFC B;  4YJ3 A;  4JYC A;  3RYF A;  1FAF A;  4K0K B;  1BSM A;  1WP7 A;  3HKC B;  4QNH B;  4BAY A;  1JOY A;  3U11 A;  3R65 A;  2WLI B;  3FD9 A;  1W0J G;  4A5U B;  2LGW A;  3AEI A;  2JRI A;  3GWO A;  3F7V C;  1TUE B;  2EIJ B;  2LFR A;  2XAH A;  3I56 V;  4PA7 A;  3QO5 A;  1M57 B;  1R73 A;  2QKA A;  1M5I A;  4XDL A;  4YIP A;  4JI6 B;  4B3M O;  3UQ8 A;  3JCU Z;  3SJQ C;  4JTD B;  3GWK C;  3CXC U;  1Y66 A;  1VQO V;  1SQF A;  5DED A;  3ETQ A;  1PNM A;  3JAW B;  5KUM A;  4RQE A;  3NR7 A;  4KL1 A;  4TWK A;  1IBM B;  3K06 A;  3TXQ A;  3SPG A;  4B3R O;  1NJI W;  1GN6 A;  2A7W A;  1VQ8 V;  4C7U A;  2ZIO A;  3N2G B;  2IM9 A;  3ASO B;  4R8C A;  1SES A;  5B3S C;  4I7Z B;  2PI4 A;  2EUL A;  3E8F A;  3X2Q B;  5DM6 V;  5LMN O;  2JGD B;  3HPL C;  3ZX6 A;  3LDE A;  4RAI A;  1NR1 A;  1OCC C;  1JFF A;  4PA6 A;  3H1K H;  1YVW A;  4QIW F;  3ZN1 A;  2QGN A;  1W2B U;  2ZQM A;  4Q20 A;  3E8G A;  2IJK A;  3BY6 A;  3K5L A;  1XMO B;  1JPX A;  1NKD A;  4LF4 O;  3JAR B;  3QTC A;  4MTO A;  1KUQ A;  4I55 A;  1FXK A;  2EIK B;  1I5X A;  2ZE6 A;  3RYH B;  1NVP D;  2PYJ A;  2E75 B;  1EN4 A;  4HNA A;  1M1K W;  5L3E A;  2EIM B;  4W4L A;  5IJ0 B;  1JMK C;  2JEX A;  4ZOL B;  1TUB A;  2UXC B;  3EXA A;  5IY5 B;  3SPJ A;  3CWB H;  2O57 A;  2QTO A;  1MOF A;  2BTO A;  3ZMT A;  5K1X A;  1NTM H;  3ML0 A;  3K04 A;  1MNG A;  4DXW A;  2GDS A;  3G71 V;  4X20 B;  5KA5 A;  2OYQ A;  2N04 A;  4U3J B;  1ZLZ A;  1WN7 A;  2F93 B;  5EYP A;  3RVY A;  2ARH A;  3L74 H;  2XT9 A;  3ZED A;  4MVZ A;  1NT2 B;  1GN3 A;  1SA0 A;  4MS2 A;  5FNV B;  3O9O A;  2KB1 A;  2DYS C;  1V54 B;  5IE9 A;  2AZ0 A;  1OCR B;  4EFE A;  2ZT9 B;  4CS2 A;  1KEC A;  2DYR B;  2IW5 A;  1RPR A;  4FJC C;  1BQ0 A;  3F7Y C;  4IIJ B;  2WLJ A;  3CD6 V;  1XL4 A;  4WFF A;  1I94 B;  3CRR A;  1LNQ A;  2VWK A;  1D5A A;  2IU0 A;  1FKA O;  4I5S A;  2A9H A;  2FML A;  5CA0 B;  3MD0 A;  4H37 A;  3VOU A;  1WPB A;  2Q6A A;  2PTM A;  1SS3 A;  3WFV A;  4DV3 B;  3LSS A;  2EZO A;  3BRC A;  3U0Z A;  1S77 D;  2JVD A;  3SYO A;  4B3M B;  4DV5 O;  3G67 A;  1OV9 A;  2Q5Z A;  3WG7 B;  5JH7 A;  1W59 A;  3IC9 A;  5EBL C;  1M4U A;  4GCZ A;  3JAS A;  2UUB O;  2L35 A;  4QPK A;  3CRC A;  5JQG A;  4J7J A;  3CJH A;  2M7W A;  4DR2 B;  3H1H H;  4LBE C;  3IAY A;  4B3R B;  2PGG A;  2Y4U A;  2W6J G;  2Q9L A;  3HKD A;  3K58 A;  4J9Z B;  1PP9 H;  1BT8 A;  4FFK A;  1H38 A;  2BTQ A;  1LUW A;  5ITZ A;  4LF8 O;  4GZR B;  5IYD O;  3AG2 C;  3OMI B;  2OTJ V;  2K1E A;  3ETD A;  1SQQ H;  4OGQ B;  4DR4 B;  1KU9 A;  4MW3 A;  4B7E A;  3H1I H;  1B6Q A;  4WFB V;  1IZ3 A;  2DMX A;  4B3T O;  2WLI A;  2FB5 A;  1GN4 A;  3TXS A;  5C8Y A;  2LGQ A;  2CTP A;  4FMT A;  4NR1 A;  4X65 O;  3MHS C;  4AIL C;  1N32 O;  3JAL A;  4JZG A;  4JI5 B;  4JYA O;  1P4R A;  1GKF A;  4DV6 O;  1SRY A;  4CS3 A;  3K9A A;  5LGU A;  2EIL C;  1QVF U;  3A0H Z;  1L8D A;  2P90 A;  1X4T A;  1Y67 A;  1JQ0 A;  2QM7 A;  2ZD9 A;  4PA9 A;  2ZM6 O;  4R50 A;  1G1X B;  1VQ4 V;  2GUZ B;  1WNS A;  1N36 O;  4DK0 A;  2ZXW B;  4UCO A;  1GM8 A;  3QVN A;  1NTK H;  2YI9 A;  1I08 A;  2X6C A;  3BFR A;  3CCQ V;  4LFA B;  1CEZ A;  2ZDI A;  3N2G A;  5GON B;  2PY5 A;  3H1J H;  3ZMU A;  4JI7 B;  1DF5 A;  5JJJ B;  3ABK B;  3G6B A;  4LWS B;  3K5M A;  1ORQ C;  4NXN O;  3RYI A;  3ZJZ A;  4JI0 O;  3ZS8 C;  4TV8 B;  3FAV B;  4I50 A;  4GX5 A;  2P06 A;  1GO3 F;  2XAQ A;  4BW9 A;  3SPI A;  4PDL A;  4FM2 A;  4X88 A;  3CCR V;  4X8A A;  3JAR A;  3DC5 A;  2Q69 A;  4BIU A;  1BQZ A;  4FFB A;  3JAM N;  3RYH A;  1MMM A;  3E86 A;  4H0L B;  5LP6 C;  2Y0P A;  3VQY A;  1VF7 A;  1F7Y A;  5L3F A;  4YY3 B;  2AHY A;  4I9Q A;  2OCC B;  2CTW A;  4DR7 O;  1WJZ A;  2Q7E A;  3CPW U;  5LMU B;  1VP7 A;  4LR3 A;  1Y74 B;  1FFX B;  5JCO A;  3C90 A;  4G27 B;  4LH7 A;  4OXS A;  4JAV A;  3OTO O;  3T2M A;  4I0X A;  5KUK A;  3ABL C;  5KHG A;  4LFC O;  1ZX3 A;  1EBO A;  2R9R B;  4O4I A;  3W7S A;  2IBZ H;  3DTU B;  5H2F Z;  1RFY A;  4PA3 A;  1V55 B;  3FKS G;  1GM7 A;  4LH6 A;  4Z1V A;  3AK2 A;  3JD3 A;  4EFB A;  4B7K A;  2YIB D;  1F51 A;  5C93 A;  2V7Q G;  4KXR A;  5HFL A;  2E76 B;  3ASN B;  1M9N A;  4DV4 B;  1WLE A;  3E8B A;  4PI0 A;  3APQ A;  4UCT A;  4TUY A;  1H2M A;  3UO2 A;  3OM3 B;  4G2K A;  3M8A A;  1N33 B;  4DV0 B;  1K8A W;  3JCZ A;  4O4L B;  2IJI A;  3B4S A;  3OTF A;  4NYK A;  1IBM O;  1P7B A;  3FYE B;  2Y0I A;  2KG7 B;  2RDC A;  4GX2 A;  3QO7 A;  3DGE A;  3JSN A;  1K5S A;  4QJF B;  1KP2 A;  4U7O A;  3H9V A;  5CMU A;  2KQX A;  1SQG A;  1CPY A;  1Q3E A;  4HBN A;  1VQN V;  2EBO A;  4JYA B;  3OFN G;  1N8R W;  2Q7G A;  4CC6 A;  1R6K A;  3RBZ A;  3E2E A;  2IH1 C;  3THO A;  4N23 A;  2ADP A;  1M90 W;  5CBG A;  3RVZ A;  5LXT B;  1XBL A;  2DWD C;  2QJ1 A;  3IGA C;  4X64 O;  4LF5 B;  1XOU A;  5GTH Z;  5D5Q A;  1XMO O;  3SR2 C;  4UXN A;  3MAQ A;  1QVG U;  2WLH A;  4BIZ A;  5H9C A;  4NKG B;  3ABM C;  1ROP A;  1NZ6 A;  2YXY A;  5LHG A;  2B1G A;  5CA1 A;  1S72 V;  3HKB B;  1Q86 W;  1UPG A;  1AVM A;  4PDR A;  2AGA A;  1KD1 W;  3BHP A;  2OIG A;  3W7W A;  2UXC O;  1VMG A;  1Z2G A;  1XNQ B;  1FPO A;  1FYJ A;  4J7K A;  1YJN V;  4MW8 A;  2OTL V;  1YIJ V;  5JJE B;  4JI1 B;  4JV5 B;  3QG5 A;  1B04 A;  4JZ2 A;  4X9Q A;  4N21 A;  2F4V B;  1D5N A;  1YXB A;  4GLX A;  1KBH A;  3T4Z A;  5KMG B;  2E3C A;  3G4S V;  4K8Z A;  4Z1M G;  2YID A;  3W7X A;  1QCE A;  1N0N A;  3SPH A;  1AI5 A;  5B3S B;  1CXZ B;  4UV9 A;  1XDC A;  5JVD B;  4FLZ A;  1OCC B;  4QE7 A;  2OT5 A;  1XMQ B;  2YS8 A;  2V4D A;  2YXL A;  4IHJ B;  4CH6 A;  1K34 A;  2P7T C;  2ITC C;  1D2D A;  3CRM A;  5K1P A;  1GAX A;  1YHQ V;  5CA3 A;  1XQ8 A;  3RW0 A;  4AHC A;  2Y69 C;  2UUC B;  3AG1 C;  1VQK V;  2YI8 A;  1I94 O;  1WA8 B;  3L9D A;  3MHH C;  4MVR A;  3T1H B;  2Q4P A;  3JAT A;  2H8P C;  4DV1 B;  1RM1 C;  2Y4T A;  4XDK A;  3N2K B;  4O2A B;  5EBM C;  4RUE A;  3P3P A;  1QLN A;  1FS0 G;  3UT5 A;  3CCE V;  2XAS A;  1QQC A;  5FPO A;  4PDV A;  1Z5V A;  4DV3 O;  4CBC A;  2UXN A;  5BY1 A;  3SJC C;  2ATK C;  5IWA B;  5L3C A;  1H2N A;  4TV9 B;  1DF4 A;  2YEV B;  1E1R G;  1S5H C;  5H5N A;  3CCS V;  1RPO A;  4PHZ A;  5CB4 B;  2W0F C;  2P22 C;  4O2B B;  4FLT A;  3ZRW B;  4IYI A;  1FJG B;  1B3Q A;  4DR2 O;  3FB5 C;  1H2S B;  4ZI7 A;  2WLK A;  2YDE A;  1K4C C;  1WPX A;  1GRJ A;  1Y74 A;  5LOV A;  1N4C A;  4RQF A;  2K9P A;  5B1B C;  3ZHT A;  3DXR B;  1S5J A;  5KLV H;  1ZSP A;  1KKC A;  1H8E G;  2DE0 X;  4DR4 O;  4H33 A;  3E89 A;  3OD4 A;  2PYL A;  1Y76 B;  1MSD A;  3IJ4 A;  3SYA A;  3TGU H;  4X64 B;  4LF6 B;  5IT9 N;  3AK1 A;  4X1K B;  2FKX A;  3K3W A;  5CBF A;  1B06 A;  4UVA A;  1BE3 H;  3A2F A;  3I55 V;  2F23 A;  4TT3 G;  4DUY B;  3Q4H B;  1P49 A;  4JI5 O;  1AR5 A;  1EN5 A;  4DR3 B;  2WA4 A;  1SF9 A;  4U7N A;  4B3S O;  5A2Q N;  4I4T B;  3ZHS A;  4F6R A;  3OMA B;  4H13 B;  2EIN C;  1DK1 A;  1LUV A;  1THZ A;  3BEH A;  2HJD A;  2Z3Y A;  1AIL A;  2AW9 A;  1NS1 A;  3B2E E;  4W4K A;  2BSK A;  1YF2 A;  4GX0 A;  2WLL B;  4WFG A;  4PJ0 Z;  3BCC H;  1AJP A;  4LFA O;  4TOI A;  4CH4 A;  2GTA A;  4GT1 A;  2YIA A;  1EFR G;  1EM1 A;  4X62 B;  3TK1 A;  1IDS A;  4JI7 O;  3A0R A;  1JVM A;  3A0B Z;  3OMN B;  2RCV A;  1DGS A;  1ZUQ A;  3CP1 A;  4J7Z A;  4WBN B;  5LXT A;  3BAB A;  1N34 B;  2GV9 A;  1M56 C;  2G38 A;  4PI2 A;  4UCS A;  1EN6 A;  1MZE A;  1Q6I A;  3CRQ A;  1EZJ A;  1NI8 A;  3AG2 B;  4NTY A;  2UU9 O;  4RUF A;  3K59 A;  4EB6 B;  1NBM G;  5LYJ A;  2BOC C;  3CCM V;  5EZY B;  4U3F H;  1SC5 B;  2ZDI C;  2A79 B;  5DN6 G;  1VAR A;  2B5U A;  2R9A A;  2BCC H;  3DSQ A;  2RNB A;  1G6U A;  1YEW A;  2LP7 A;  1ZL8 A;  4DW0 A;  4YY3 O;  1JA8 A;  2QWP B;  3L71 H;  2QM8 A;  2NR5 A;  4FIP C;  2ZNJ A;  2QTS A;  2DJV A;  3B77 A;  5E79 Z;  1IX9 A;  1S76 D;  2B1I A;  2AHZ A;  2BE3 A;  2VRZ A;  5LMU O;  4GKJ O;  1QU7 A;  2EIL B;  1ENV A;  4ICG A;  3AG3 C;  4MTF A;  1TA8 A;  3K0G A;  2MW2 B;  2FYU H;  3HKE B;  3K9S A;  1WP8 A;  5EK0 A;  2EZP A;  3ZHV A;  4FK5 C;  3IFX A;  3H01 A;  2R9I A;  4BW5 A;  3OGC C;  4D7T A;  5DEC A;  4GYC B;  2JS3 A;  2R72 A;  3RYC B;  3ICX A;  1BL8 A;  1COW G;  2IH3 C;  4WFH A;  1VF6 A;  3L70 H;  3P32 A;  5CBH A;  2LO1 A;  5J2U B;  3T1Y B;  2VQE O;  4L8J A;  1UFI A;  1OCO C;  1E79 G;  3OUS A;  4FZ0 A;  4B08 A;  3ZHQ A;  1U96 A;  4DV4 O;  4DV7 O;  2M6Y A;  4IHJ A;  3RT3 C;  5KA6 A;  5KAF Z;  5BR8 B;  1N33 O;  2DN9 A;  4DV0 O;  1R3K C;  1GN2 A;  4KP4 A;  4CH3 A;  1WB7 A;  3B8M A;  3LSU A;  2XND G;  4JTC B;  1NH2 D;  1SZT A;  3HKC A;  1HDJ A;  3JD4 A;  4XDJ A;  4ZHQ B;  4GUN A;  3QF7 A;  1AJQ A;  4LC1 A;  5LP6 B;  4MTX A;  1RSO B;  2ODM A;  2N74 A;  5BMV B;  1HR0 B;  2CH7 B;  4X1Y B;  3K57 A;  1H2G A;  1O9G A;  5F2V O;  4B3S B;  3AG4 C;  2QA4 V;  2F1M A;  4PV1 B;  3FB6 C;  2A0L A;  4X66 O;  4J10 A;  3K0D A;  1M93 A;  3ABL B;  2HLD G;  4LF5 O;  4EEQ A;  1XI1 A;  4DUZ B;  1KP3 A;  5CB4 A;  1NVP B;  3JAW A;  4O4J B;  3TJT A;  1Q90 D;  2NN4 A;  4DR5 B;  5J2T B;  3SGI A;  1UJW B;  4TSF G;  4FVM A;  3JYC A;  3L72 H;  2UXD B;  3BA9 A;  1TVK B;  3CS5 A;  3E22 B;  3K79 A;  3AG7 A;  5B1A C;  2ADQ B;  4CZZ A;  2HVJ C;  3E83 A;  3MDS A;  3E8H A;  3SJB C;  2YIC A;  2JGD A;  2ETN A;  3AK3 A;  5B66 Z;  5IDJ A;  1X59 A;  2X0L A;  4FLW A;  1SQB H;  1XNQ O;  3LSQ A;  1LR1 A;  2ZIM A;  1IBK B;  5J9P C;  4ZKI A;  2W0X A;  4DR1 B;  2LFS A;  4YJ3 B;  3RYF B;  3UKM A;  1SQP H;  3S3W A;  4JI1 O;  4JV5 O;  1WAZ A;  2UU9 B;  3LDD A;  3SYP A;  4MT8 A;  3D36 A;  2F4V O;  2R70 A;  2WA3 A;  1HW7 A;  3FX7 A;  5IYC O;  3ZRV A;  2P6J A;  4Z2W A;  2JK5 C;  5IYB O;  4H44 B;  1O9H A;  3TCU A;  5IJ0 A;  4ZOL A;  1ZTE A;  4BR6 A;  2WLM A;  2CTR A;  4GKJ B;  4K35 A;  1XMQ O;  1KC8 W;  3CC2 V;  1MSW D;  3N27 A;  2P4K A;  3D3Q A;  2YSU B;  4X20 A;  4CS4 A;  1QLE C;  3KZI Z;  2UUC O;  2JGU A;  4U3J A;  4J11 A;  3CXH F;  3ABM B;  1Q7Y W;  3T1H O;  4DV1 O;  4UB8 Z;  2VQE B;  3FB7 C;  4GX1 A;  2UUA B;  5A9G A;  2XAF A;  5FNV A;  2CDY A;  1XNR B;  1YJ9 V;  1NU1 H;  3GB7 C;  2HJF C;  4DV7 B;  5IWA O;  2F95 B;  1AI7 A;  5EZY A;  1P84 F;  3ZBH A;  1G8M A;  1FXH A;  4IIJ A;  3VQV A;  2HR3 A;  2JEU A;  4LF9 B;  4X1I B;  1HNZ B;  3K5O A;  4I55 B;  3ABK C;  3L75 H;  4FLV A;  1XHZ A;  1FJG O;  1A32 A;  1GTO A;  5GW7 A;  1FFT B;  3CX5 F;  3T4D A;  4IL6 Z;  4IT5 A;  5CA0 A;  3CME V;  1JCH A;  1J5E B;  1BHA A;  1TUB B;  1NH2 B;  1BZK A;  2Q67 A;  3B8N A;  4TQD A;  3HKE A;  5IYZ B;  2CGN A;  1L0L H;  4UB6 Z;  4X66 B;  1K97 A;  2Q0O C;  1Q82 W;  4CC5 A;  2V1D A;  3HB3 B;  4LF7 B;  4LF6 O;  1XUQ A;  3RYC A;  5KX5 B;  2JJ1 G;  1YIT V;  2HVK C;  2QE7 G;  2Y69 B;  1OCZ C;  2GBO A;  1MA1 A;  4FPP A;  3SPC A;  2HHH O;  4ABM A;  1OJH A;  4DW1 A;  5EYP B;  3ZMS A;  4DUY O;  2JS5 A;  3H1L H;  2ZCE A;  3QO8 A;  4DR3 O;  3ZN0 A;  4WF9 V;  1SA0 B;  1HNX B;  4JI8 B;  2CGO A;  1IVS A;  3STZ C;  2W6I G;  4J80 A;  3J7A U;  1I5Y A;  1JR9 A;  2D2C B;  2D3O W;  3ZCC A;  2DOS A;  2PI5 A;  1V9P A;  1BGY H;  3EHB B;  2RMK B;  1Q81 W;  3F5T A;  3LUT B;  1R1B A;  4FLY A;  1NR7 A;  3OR7 C;  3CEI A;  1FXK C;  3R66 A;  2ZE5 A;  3UM7 A;  1PPJ H;  2LQT A;  4X62 O;  2BOB C;  1ZWI C;  1ARO P;  3G6E V;  2LW1 A;  2HP8 A;  3APO A;  1N34 O;  5B1B B;  2WAM A;  1L0N H;  1TGO A;  5J2T A;  1K4D C;  2E74 B;  2GUZ A;  4JPR A;  4JAA A;  5JH7 B;  4FLX A;  5B1O A;  3ABT A;  4MTG A;  4NXM B;  3JAS B;  4MVQ A;  1FD9 A;  4OPA A;  5JQG B;  4UUJ C;  2WWW A;  3NXS A;  4IYH A;  5LGT A;  3CSX A;  4JAU A;  5GON A;  3CRA A;  1JJ2 U;  5KHK A;  3B09 A;  3ZHR A;  4UVC A;  2GSM B;  5BXZ A;  1MAB G;  2X6A A;  2NLJ C;  2XOK G;  3HKD B;  2DWE C;  4LWS A;  2WLN A;  4TQF A;  1KKD A;  4ZIB A;  2DQ0 A;  2YC0 A;  4TV8 A;  3FAV A;  1K92 A;  5EIB C;  2EIN B;  1URF A;  4KUM A;  3CYO A;  2DW4 A;  1PL0 A;  5LA6 B;  4E2L A;  4WCE V;  4J41 A;  5C8Y B;  4CH5 A;  2Z0A A;  2Z5U A;  3U10 A;  3JAL B;  3SDL A;  3UCS C;  1DTO A;  1VQL V;  2QKS A;  3C3T A;  4JAS A;  3RN4 A;  3T1Y O;  2XAG A;  4NVP A;  5L3D A;  1H8H G;  3D3I A;  3CMA V;  1J95 A;  3HR0 A;  4JI4 O;  4JYY A;  1R3J C;  1FFX A;  2LW7 A;  2DQ3 A;  3OR6 C;  1E1Q G;  1M56 B;  5BR8 O;  2QDO A;  3BAA A;  4HAM A;  4UFZ A;  2VS0 A;  1SQV H;  1VF5 B;  2ZE7 A;  4Q6G A;  4KHP B;  2CUG A;  2DYS B;  2JDI G;  1MZF A;  4P9O A;  3BA8 A;  5EC1 C;  1VF6 C;  1QNM A;  2ZR2 A;  4F6E A;  1I0H A;  5FPR A;  4D7S A;  2HHH B;  4JI2 O;  2NNU A;  1HR0 O;  5LHI A;  1F4M A;  3RYI B;  1HP8 A;  1CP9 A;  5B1N A;  4I50 B;  1T5E A;  1SQX H;  3C3S A;  3M7M X;  1IBL O;  3CC4 V;  3AG3 B;  3A8T A;  4O4L A;  3WB0 A;  4X1I A;  4DUZ O;  1W0K G;  4FFB B;  4MSW C;  5BZB A;  4DR5 O;  1K7D A;  4J9Y B;  2Q0A A;  2UXD O;  4O4H B;  2KG7 A;  1ZAU A;  3T1C A;  5EBW C;  2ZR3 A;  1PKX A;  4WFE A;  2GHY A;  3OE7 G;  1BS3 A;  2EIJ C;  1OCO B;  2JJ2 G;  1GMG A;  1M57 C;  4JTA B;  2E5L O;  1R6N A;  2CTQ A;  5IYZ A;  4AI8 A;  4LFB O;  1AJN A;  3OEH G;  4I0X B;  2XTA A;  5LHH A;  3OAA G;  1K33 A;  2MK3 A;  1IBK O;  3PN1 A;  4DR1 O;  3LDC A;  4QGP A;  2QEX V;  2ZIN A;  2QKC A;  3BVO A;  4GKK B;  4JF3 A;  4O4I B;  2RQ6 A;  5LGN A;  5KX5 A;  1YCI A;  3WB1 A;  2N05 A;  1YTF D;  4X89 A;  1YJW V;  2UXB O;  4OPH A;  1WB8 A;  4YJ2 B;  3ASO C;  1KQS U;  4PA4 A;  2PUS A;  1FXV A;  4KFM A;  3ETE A;  3OT7 A;  3X2Q C;  5L3B A;  2ILM A;  3HKB A;  1QBZ A;  2QWO B;  4FM1 A;  2P5O A;  3ABU A;  1BHB A;  4DR6 B;  3JAK B;  2VQF B;  1Q43 A;  4TUY B;  4OX9 B;  2EJ7 A;  1K5Q A;  2HG5 C;  3FFQ A;  3AG4 B;  4UCR A;  4BIO A;  4QE9 A;  1AR1 B;  4DRX B;  5KHI A;  3ZRX A;  2QR4 A;  1R3I C;  5KHJ A;  4LP8 A;  2FL4 A;  1EZV H;  4R7C A;  1SET A;  1F4N A;  3D36 C;  3W7T A;  2Q7H A;  2OWO A;  4NB5 A;  2EIK C;  4MVS A;  5KMG A;  2ZE8 A;  2XHB A;  4YXW G;  3JD0 A;  4K3A A;  2CAZ C;  5IJ9 B;  4AQY O;  2EIM C;  3K03 A;  3P3N A;  2ZKO A;  5B1A B;  1P7G A;  1Q5O A;  3CC7 V;  4J42 A;  4XBF A;  3RFR A;  1SKV A;  1SER A;  5IY5 C;  5TIS Z;  3S3X A;  5JVD A;  2UUA O;  4LNU B;  3CCL V;  2Q73 A;  1R3L C;  2Q68 A;  1XNR O;  5JCO C;  4JI4 B;  4PDM A;  3VQW A;  5FLX N;  1BMF G;  1JX9 A;  1Q8I A;  3TET A;  3L73 H;  1PD3 A;  3B40 A;  4LF9 O;  3RWR D;  1HNZ O;  4IGG A;  4MVO A;  4FLU A;  1WA8 A;  4JYB A;  2H3O A;  2Q8V A;  1KMI Z;  4YIO A;  5CA1 B;  2KKW A;  3K08 A;  3W7U A;  1H2K A;  1VQM V;  3N2K A;  4O2A A;  4RWU A;  1J5E O;  5LMN B;  4JI2 B;  2B9Z A;  4ASU G;  1V54 C;  2Y48 A;  1PM9 A;  5LA6 A;  1OCR C;  5KAI Z;  1YDX A;  3J81 N;  2X7R B;  2DYR C;  4TV9 A;  2YEV A;  1K73 W;  3E35 A;  1GK9 A;  2YIB A;  4LF4 B;  1IBL B;  1GH6 A;  2OIE A;  3KKY A;  1KYO F;  3IC7 A;  4LF7 O;  4JGS A;  4YHH O;  3JSL A;  4PEL A;  4O2B A;  3ZRW A;  1QLE B;  1JJO A;  1YZB A;  5EC2 C;  4D6T H;  5EIB D;  1K9M W;  1PNL A;  1QHT A;  4NTX A;  5JJN B;  1AI4 A;  4UVB A;  5KHH A;  1K3E A;  3QNE A;  3CCU V;  1HNX O;  1U97 A;  4LCU C;  2CE4 A;  5H6Q A;  4JI8 O;  3DXR A;  2E5L B;  4LFB B;  4UV8 A;  4JI3 O;  4R6Z A;  4HYO A;  4DV2 O;  1H2L A;  2F66 C;  4DYL A;  1Y76 A;  2X6B A;  3WG7 C;  3VQX A;  2FTK A;  4X1K A;  1VIB A;  2PZS A;  3G80 A;  2P67 A;  4G28 B;  1TAE A;  1XEQ A;  3P30 A;  5L3G A;  1HNW O;  2PF4 E;  4P9P A;  1IXB A;  2UXB B;  3JAT B;  2WPD G;  1AB3 A;  3Q4H A;  4P2Z A;  3D8C A;  3OW2 U;  1S3J A;  1F23 A;  5LBQ A;  2H94 A;  3OEE G;  2L6L A;  3UT5 B;  4DK1 A;  2F43 G;  2RJZ A;  4HZ3 A;  4K8X A;  4I4T A;  4P30 A;  1YTF B;  4UCV A;  1R6T A;  2OCH A;  1S0V A;  1HWY A;  5AG2 A;  5GTI Z;  3RGB A;  5D5P A;  3ZMV A;  4O4H A;  4NXM O;  2WLL A;  1KB9 F;  4FZ1 A;  4RO2 A;  4ZBM A;  4ZI7 B;  1VQP V;  1OCZ B;  3ETG A;  2QM4 A;  3ZIA G;  2VWJ A;  1YSC A;  1AP6 A;  4AQY B;  5LOV B;  1VQ5 V;  4WBN A;  5CN0 A;  1PV0 A;  1AI6 A;  3JD2 A;  4DV5 B;  1JFF B;  3ZRS A;  4K0K O;  1I7F A;  2ZXW C;  2QWR B;  4EB6 A;  3KCX A;  1Y6X A;  3CE2 A;  1XIL A;  5E1A C;  2UUB B;  2AXT Z;  2HEP A;  3KCY A;  4YJ2 A;  3STL C;  3M99 B;  1OZ0 A;  1SZX A;  3CCV V;  2GTS A;  1FXK B;  3UO3 A;  3JAK A; 
#chains in the Genus database with same CATH homology
 1OJH A;  2QDO A;  2Q8V A;  3CS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...