1OJHA

Crystal structure of nbla from pcc 7120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
IELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nbla from Anabaena Sp. Pcc 7120, a Small Protein Playing a Key Role in Phycobilisome Degradation.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
molecule tags Protein binding
molecule keywords NBLA
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 1ojhA00
2QDOA 2Q8VA 3CS5A 1OJHA
chains in the Genus database with same CATH superfamily
1M5IA 4LF7O 1VF7A 2VWKA 5LMNO 1FAFA 2BOCC 2Y4UA 2QDOA 4CH4A 1VQNV 4JYBA 1XNQO 2RN9A 3IC7A 1M1KW 2ZNIA 1FD9A 2W0FC 4GUNA 2XTAA 1XMOO 4TV8A 1RM1C 4I4TA 5EBLC 4HYOA 2QKCA 2ZINA 4FVMA 3OFNG 2OWOA 2X0LA 4O4IA 3IFXA 3PN1A 4ABMA 4QGPA 5EK0A 4JI2O 3TJTA 4HAMA 5GONA 4B3MO 1NR1A 4UB8Z 4YY3O 4OPAA 1KBHA 4J9ZB 1TUBB 3OW2U 1FXKC 2DWEC 4R7CA 3LSUA 3FB5C 1URFA 2QM7A 2P5OA 2HLDG 4PDVA 2F1MA 4EB6A 1VQ5V 1BE3H 2QJ1A 2WLNA 2EILC 1BGYH 5JJNB 4J41A 4JGSA 4NR1A 3C3TA 2IBZH 5EIBD 3TK1A 5LOVA 3FAVA 1AVMA 4J7ZA 4BIZA 2IU0A 4AILC 1XL4A 2YDEA 2QTOA 1YVWA 4UCSA 3UCSC 4MS2A 1B06A 3Q4HB 3U11A 2Y48A 5LGTA 2NR5A 1GM7A 1HR0O 2QA4V 1KB9F 1PNMA 3ASOB 2XAGA 4UXNA 3A0BZ 3F7YC 2B1GA 1V9PA 5E79Z 1LNQA 3N27A 5LHHA 2ADQB 1XEQA 4NB5A 3SPJA 1AI5A 3RYCA 4GKJB 2HKOA 4JTCB 2ZIMA 1HNWB 5DM6V 4JI3B 2QWPB 4O2AA 4X20A 5IJ0B 2YIAA 1I5XA 1Q6HA 1BS3A 3HKBA 5FL7G 2YXHA 3RGBA 2QEXV 1JJ2U 1OCCC 1RPRA 2Q5ZA 3A0HZ 3OE7G 4UCTA 1WN7A 1PL0A 1SA0B 4Q20A 2M7WA 1W2BU 5LYJB 5EZYA 4DR6O 4QE7A 2BTQB 2VQFB 2P90A 3J81N 1Y6XA 2Q68A 3CP1A 2ILMA 3ICXA 1ZSPA 3SYAA 1N4CA 2Q73A 3P3NA 4E2LA 4O4LB 1UFIA 2EJRA 3FKSG 2EILB 1WA8B 3ETEA 2LW1A 1VQLV 1J5EO 2ITCC 4YJ2B 3WFVA 5DN6G 4FM0A 3NR7A 4TT3G 1UJWB 4DR7O 4W4LA 1SZTA 3O65A 3KZIZ 2IJIA 2VQEB 5L3GA 1PV0A 4JI4O 4YIOA 4LWSA 1K4DC 4CC6A 4JI0O 3RYFB 1GK9A 2WLLB 3SPIA 4G28B 4JAUA 1VQPV 4WF9V 3DSQA 4WFFA 1LR1A 1YDXA 4EFEA 1ZTEA 4IIJA 2Q6AA 4CBCA 1IDSA 1WP7A 3H1HH 3SPHA 4YHHO 1Y4MA 1QR8A 4I55A 2YXLA 2OTLV 3OT7A 3T1HB 1R3KC 5LL6Y 3BEHA 4FM2A 2R9RB 3G4SV 3RYHB 5FNVB 2UUBB 2WA3A 4LF4B 4UVBA 1EFRG 4Z2WA 5ITZB 4Z1MG 4DR4O 2Q0AA 2ZR2A 2HHHB 2UXBO 1J95A 1JMKC 1EN4A 1IBLB 3ASNB 5KA6A 4LCUC 3QO7A 3ZIAG 2DOSA 3ZRVA 2IH3C 2QGNA 3HKCA 4GKKO 4QNHB 4PELA 4IGGA 4I50A 2ZDIC 1Q7YW 3RVZA 4DR3O 2N05A 1GO3F 2WLJA 1QLEC 3K06A 1W0JG 4F6EA 2EIKC 3Q4HA 2OIGA 4UCRA 1XMQB 4BIUA 4CC5A 5K1PA 1QU7A 3ZHUA 1WB7A 2D3OW 3JATA 2BSKA 3ABKC 2HJDA 2BTOA 4J80A 4X1IB 5B3SB 3OTFA 4ZHQA 5LGUA 3RYCB 1N34B 1JQ0A 2UXDB 3UO2A 3JARB 3VQYA 1YTFB 3D36C 2DQ0A 3HKBB 3JD1A 5JJJB 5L3FA 4LH6A 1G6UA 2DE0X 4EFBA 3MAQA 4FLWA 4XDJA 3CC7V 1NTMH 4H13B 5IYDO 1WA8A 1VQ7V 1DF5A 4MTFA 2CK3G 3K59A 5H5NA 4LWSB 1H2NA 3CYOA 5IYZB 1JA8A 5JWPA 2WLLA 4YJ2A 1AI7A 3OMIB 2JGDB 4HNAB 4DV3B 4GX1A 1PKXA 4RQFA 1L8DA 2X6CA 1WNSA 5KMGB 1NS1A 3DC5A 4DV4B 4IHJA 1IXMA 1L1FA 1OHHG 4LH7A 3SJBC 1RP3B 1D5AA 2R9AA 1M56B 1NTKH 3LDDA 1JOYA 1LUWA 3ETQA 4AQYB 4I55B 3DGEA 1NKDA 2XT9A 4JV5B 4J11A 1S5LZ 2JEXA 3LSQA 4O4IB 2EIMC 1YCIA 2P06A 2Q69A 2YI9A 1GN6A 4FLTA 3CCLV 2P4KA 5FNVA 1DK1A 3BA8A 1K33A 5FPRA 1M9NA 2IH1C 5HFMA 4DR2O 4LR3A 5B66Z 3FFQA 2NLJC 4JI1O 3LNMB 1RM1B 4YJ3A 1R6NA 4I50B 4GX0A 3FYEB 2OCHA 3OEHG 1K34A 3MD0A 3EFFK 2L6LA 4YY3B 3ZX6A 4D7TA 1DTOA 4UVAA 4JI5B 3TXSA 4UUJC 3B4SA 5JCOA 4DV5B 1XILA 3ZHSA 1NH2D 4JYAB 1OCRB 4DUYB 1PL4A 3AG1C 1AR1B 3BCCH 2B5UA 4J7KA 3RYIB 3E8FA 1SA0A 1SQPH 5GONB 1AJNA 4TV9A 2DYRB 3DC6A 1THZA 4I9WA 4E4EA 3K58A 1YITV 4PV1B 5IWAO 4I7ZB 4I5SA 3SPGA 1Q3EA 1M57B 1DF4A 3CC2V 2LGQA 1IBMB 3U0ZA 1NI8A 1GM8A 4FFBB 2ZKOA 3I55V 1E1QG 3B77A 4X1KA 2VQEO 1SETA 1H2KA 4X1YB 2ZNJA 3ETDA 2CTRA 2GTAA 4RO2A 1MG1A 5IYBO 1NR7A 2CE4A 4JI5O 1Q81W 1TAEA 4CH5A 2WLKA 3K9SA 1S5HC 3FB7C 1J5EB 2IJKA 3LDEA 3OM3B 1QNMA 3RYFA 2D2CB 3RT3C 3ABUA 2CDYA 4ICGA 1FJGB 4DV7O 2PI5A 3APOA 4UFZA 5CA3A 5IJ0A 4DV6B 3AG3C 4LF5O 3X2QB 2YICA 3JD4A 4X88A 4LFAO 1TVKB 5BR8O 4U3FH 4K8ZA 4PA6A 5B5EZ 3L71H 1XUQA 1JX9A 3AG3B 4MT8A 1MA1A 3F7VC 3SJCC 1AROP 1VF6C 2UXCO 2ZQMA 5A9GA 3H1IH 5CB4B 3FD9A 1IX9A 4DV0B 3ZN0A 3W7TA 4JAAA 2YUAA 1MMMA 5KUKA 3GB7C 2NNUA 4J10A 3M8AA 2IM9A 4PDLA 2WSSG 2XASA 2QWOB 3CRMA 4F6RB 1ZL8B 1Y67A 1VQOV 1Y74A 3K5MA 2F43G 4JI7B 4WFEA 4Z1VA 5FPOA 1L0LH 1LUVA 1H8HG 2KG7B 2PGGA 2QWRB 4JI6B 1GAXA 4TSFG 1M4UA 4JYAO 3THOA 3OEEG 1FXHA 3S3WA 5C93A 1IURA 4FIPC 3G71V 4FLVA 1IZ3A 4DUYO 1XNRB 4O4HB 5H2FZ 2AXTZ 2P4VA 3BPZA 2VQFO 1WPBA 2YIBD 5F2VO 2EBOA 4YIPA 1YTFD 3CJHB 3L75H 3E8GA 3X2QC 3E83A 3RFRA 5EIBC 2JDIG 3JARA 3VQVA 3WB0A 1EN5A 4MW3A 2PI4A 1ZWIC 2F23A 2RNBA 4MVOA 4B3RO 2GHYA 1TUBA 2YIDA 1BHAA 3T1HO 1I94B 2ZE6A 1VQ6V 1RPOA 2X6BA 1VP7A 4NXNO 3AG1B 4X9QA 5LGNA 4D6TH 4TQDA 5B1BC 4CS2A 5H6RA 2PY5A 4X64O 3AG2B 4GZRB 1S3JA 1WAZA 2QM4A 5B3SC 4RWUA 4R8CA 3FAVB 2R9IA 4MVUA 4GCZA 3CRQA 5IJ9A 2YEVB 3QF7A 1F23A 2W0XA 4LFCO 1M93A 2JJ2G 2UXCB 1UPGA 1QLEB 1QR9A 3CSXA 4NTYA 3EHBB 3I5DA 3QO5A 4WFHA 3ABMB 4LF6O 4PD4F 2OT5A 4IHJB 3SYPA 4K35A 2G38A 2BOBC 2CTWA 2DN9A 2WWWA 1Q8IA 3CMAV 1VMGA 4LF4O 4JI1B 1FJGO 4B7KA 1JFFB 4MVQA 3CWBH 3D8CA 3JCZA 3GVMA 2HP8A 1W59A 1S5JA 4XDKA 5H9CA 4X62B 2OCCC 1H2GA 3CE2A 4A5UB 5JH7A 1P84F 1ZL8A 3CCRV 5LP6A 2AHZA 2MW2B 3KKYA 3QVNA 4WFBV 1N33O 3EXAA 4BR6A 1US6A 3L70H 1K8AW 1U97A 2DJVA 4JI3O 4ZOLB 2UUAO 1A32A 1HNXB 1SQQH 5BMVB 1MSWD 1KP2A 3JAKB 4KHPO 3SYOA 1Z2GA 1YZBA 3RYIA 2DYSC 4LFAB 4NTWA 3J80N 4DV1O 1H38A 4DV5O 2Z3YA 2XHBA 2AHYA 1GN3A 1N8RW 3W7WA 2PYLA 1OCRC 1U96A 4DW0A 5IYCO 1PNKA 2VWJA 3QO8A 1EZJA 3AK2A 2ZM6O 4GX2A 5J2TB 1AR5A 2F93B 3OUSA 2GBOA 5J2UB 2HHHO 4NVPA 3RYHA 4UCOA 3SYCA 3WG7C 4KP4A 2A0LA 4JZGA 2OTJV 4RAIA 2UU9B 3MHHC 1TGOA 2EX3A 3ZRWA 4YHHB 4X1YA 2L35A 1H2LA 3HKCB 1K5SA 4MVSA 3I56V 4N23A 2EIKB 5IJ9B 1K4CC 1VARA 4CZZA 4PDMA 2H3OA 4J9YB 4P9PA 4JI4B 3E35A 5KAIZ 1K5QA 3E22A 1EN6A 4X1IA 2Q8VA 4PA9A 3QG5A 2E75B 5LBQA 3BAAA 3QTCA 2QKSA 1K7DA 5EC2C 3JAWA 3D3IA 1VQ9V 4WCEV 2RDCA 3W7XA 2EIJB 3IAYA 2K9PA 4YXWG 2XAFA 5LHGA 2EINB 3G6BA 5KHJA 4X1KB 4RQEA 1B04A 3SPCA 4DV1B 2O57A 1X4TA 1Q82W 2E5LO 1GTOA 3K0GA 3A2FA 2EINC 2VRZA 4PI0A 3UQ8A 2JJ1G 3RWRD 2IW5A 1K73W 1XHZA 2H94A 3TCUA 1VF6A 1N0JA 1OZ0A 3OUFA 3RW0A 4FLZA 4N21A 3SJAC 3G6EV 4O4JA 1R6TA 2EJ7A 3JAKA 2QWQB 3ZMVA 5CN0A 1JPXA 3CCJV 2B1IA 1XNQB 4DK1A 1R3JC 1N33B 1FS0G 5L3CA 3CHXA 4WBNA 4B7EA 4GLXA 2AZ0A 1KC8W 3HKEA 5J2TA 1AI6A 2GSMB 4ZKIA 4O4HA 1VQMV 4IYHA 4PI2A 1IXBA 5LOVB 3E86A 5CB4A 4R6ZA 5L3DA 2Q9LA 3IJ4A 4HBNA 5KHIA 4UCUA 1COWG 4LFBO 3CCEV 3F5WC 4GT1A 1CXZB 2N04A 2WAMA 3JYCA 5CA0A 3T1CA 4LF5B 1AILA 5J2UA 1KP3A 2CTQA 4DUZO 4OX9B 4PA3A 2Z5UA 3LNNA 4DR3B 4GX5A 3AG4B 1Q6IA 1BCCH 4BAYA 5IY5B 1OCOB 3MDSA 4PA4A 3JSLA 4B3TO 2BE3A 1Q86W 1OCOC 2XUMA 1YIJV 5EYPA 4RUFA 1BQ0A 4JI2B 1O9GA 1VIBA 3CXHF 5EZYB 1VQKV 1YJWV 1B6QA 3STLC 2WLMA 5LMUO 3W7UA 2DQ3A 1GN4A 2UUBO 3HR0A 1GKFA 4O2BA 1QLNA 3KCXA 3CMEV 3ASOC 1FFTB 1QVFU 4JTAB 3L73H 4NXNB 3DTUB 4JYCA 5BZBA 5CA1A 1BSMA 3JAWB 1SQGA 4DRXB 1FXVA 3ZHQA 1EZVH 2Y4TA 1I94O 3F5TA 3FX7A 4FMTA 2ZE5A 4LF8O 1FYJA 2V7QG 3KCYA 2ODMA 3N2GA 2UU9O 5LMUB 3JAMN 1P49A 4OGQB 1MABG 1W0KG 3OAAG 4FZ0A 2DW4A 2W6JG 3QNEA 3T4DA 4P9OA 1IBKO 2OCCB 4WBNB 1SRYA 4MTGA 4WFAV 5LP6B 1JCHA 3HKEB 4TV8B 4PHZA 4ASUG 3T1YB 2RMKB 2CGNA 5CBGA 1QVGU 1Q6UA 4QPKA 3FYIB 2HFEC 3ETGA 4X8AA 1XI1A 2Y0PA 2F4VB 2JEUA 4KHPB 5JQGB 1SQBH 3GWOA 4TUYB 3K5OA 3MHSC 5DECA 3E2EA 2RCVA 2ZT9B 4ZI7B 3ABMC 1PD3A 1T5EA 1HWYA 2OIEA 4CH6A 1I7FA 3R66A 2JGUA 2ZD9A 4GKJO 2C2AA 3RN4A 3JD0A 3OMNB 3E8HA 5A2QN 5JH7B 4B3SO 3A8TA 1S76D 4K0KO 3ZBHA 2F4VO 1Y76A 4JI8O 3CC4V 1G1XB 1SKVA 1EBOA 3CPWU 3TETA 4ZOLA 3J7AU 1OCCB 4MSWC 1YI2V 3WG7B 4ZHQB 3TXQA 3BFRA 3IC9A 4AI8A 4FLUA 1GN2A 3A0RA 4LNUB 4W4KA 4P30A 3ZMTA 1HNZB 2KG7A 1CPYA 2V4DA 1MZFA 2UXNA 4J7JA 3D3QA 2PUSA 4KUMA 4LP8A 4X89A 1V55C 1YXBA 4EEQA 1N32O 4P2ZA 2ZDIA 5B1BB 2Q7EA 5JVDB 2LW7A 4DRXA 1ENVA 3ABTA 4X64B 2PYJA 1IVSA 1F7YA 4NKGB 3OR6C 5D5PA 1N0NA 5E1AC 1Z5VA 2JVDA 2ATKC 4FPPA 1Q90D 2BCCH 3HPLC 3AEIA 2BTQA 3OTOB 4H44B 4B3RB 2XNDG 1YHQV 1H2SB 4JYYA 4HNAA 1KQSU 2QR4A 1F4MA 4JTDB 4O4LA 2Y69C 1XMOB 1YSCA 3OGCC 3W7SA 4DV0O 4DR5B 4MTXA 1N32B 1TA8A 2Z0AA 2A9HA 1XMQO 1BL8A 4NXMB 2Y69B 4B3TB 3JSNA 2MK3A 2KSDA 1ZX3A 2DYSB 2JIZG 4LF7B 2LQTA 1D2DA 4UB6Z 4LF9B 3FB6C 3AG7A 2QKAA 4FFKA 3K57A 4DV6O 3CCQV 4OX9O 4FLYA 1XBLA 5JQGA 1XNRO 4X65B 3S3XA 1AR4A 2FTKA 4DV2O 2HJFC 3UKMA 4DUZB 1M90W 4BW9A 2QSAA 1R6KA 1ZAUA 4KFMA 5LP6C 3SGIA 5CA0B 4DR6B 4B3SB 4FZ1A 3M99B 4JAVA 1BZKA 1XOUA 2DWDC 4MTOA 4LC1A 5EC1C 4G27B 3VQXA 3CB2A 1P4RA 4JI0B 2E74B 4ZIBA 3CXCU 1HNWO 1H2MA 2E3CA 1Q5OA 3L72H 3ZN1A 3JD3A 1FFXA 3SDLA 2FB5A 5EYPB 1KUQA 3H1JH 1XHXA 2QTSA 1KU9A 1K92A 4RUEA 1HP8A 1JR9A 4U7NA 2WLIA 1S72V 3AK3A 4JASA 3T1YO 5BY1A 4EKWA 3SYQA 1JVMA 2LP7A 5BMVA 3E89A 3JASB 2LGWA 4LF9O 1WJZA 3ZEDA 1Y66A 3FB8C 1WP8A 4BWAA 2IJJA 2B9ZA 2GTSA 1Z5WA 2EULA 2Q4PA 3CCUV 3SJQC 3LDCA 3ZS8C 5EBWC 5H6QA 4Q6GA 2HR3A 2HG5C 2V1DA 2HVKC 4I9QA 2AGAA 5CA1B 2CH7B 1AP5A 5IYZA 2CUGA 5TISZ 4MVRA 1M57C 3H1KH 4JF3A 4MVMA 2UXXA 2JGDA 4DO2A 4DR5O 4LF8B 4DR2B 5KLVH 1GM9A 2ARHA 2Q67A 4BIOA 2GV9A 3N2GB 2P6JA 5J9PC 5L3BA 1AJQA 1NT2B 2AW9A 4FM1A 5KA5A 5LXTA 4TQFA 1R3IC 1F4NA 3JCUZ 5KX5A 4J42A 1RFYA 5JJEB 2LO1A 1B3QA 5LHIA 1XQ8A 3WU2Z 4O2BB 4DV2B 2YC0A 3G80A 4FJCC 5C8YA 4UV9A 4TUYA 3B09A 3UO3A 2Q7HA 1SQVH 3B2EE 1JJOA 3ML0A 1HW7A 1KKDA 1MNGA 1Y74B 4DR4B 2UXBB 4NXMO 2X6AA 1XL6A 4XDLA 1KD1W 1MOFA 3BA9A 3P3PA 3EVKA 4CS4A 5B1NA 4JI6O 4DK0A 3HB3B 1Q43A 2JK5C 3LSSA 3UM7A 4WFGA 2EIJC 4LBEC 1H8EG 1VF5B 2ADPA 1CP9A 1Y76B 2XAJA 1ZUQA 5KHHA 3CRAA 3T2MA 4QIWF 4UV8A 1RSOB 4K8XA 1KECA 3K5NA 1HNXO 2X7RB 4MW8A 2ZIOA 2ZXWC 4JI8B 3VOUA 1FKAO 3ABKB 2YI8A 4H37A 4YJ3B 1VQ8V 4UCVA 2R70A 3L74H 4U3JA 4AQYO 2A3QA 5LA6A 4FLXA 3P30A 3C90A 3JASA 2WLIB 3BRCA 1NU1H 1OCZC 3ZRSA 4HZ3A 5GW7A 3G67A 2KKWA 3OMAB 3CRCA 1D5NA 3APQA 5LMNB 1NTZH 1FXKB 5CMUA 4ZBMA 3JALB 4O4JB 1E79G 4DW1A 4L87A 2ETNA 4LNUA 4QJFB 1VEWA 2CH7A 3CX5F 1R3LC 2IJHA 4AHCA 2EZPA 1S77D 1YJNV 3ZHRA 4DV7B 4TV9B 3CCVV 4OXSA 2E76B 1I08A 2F66C 2A06H 3ZMUA 1WLEA 1N36O 1OV9A 1PPJH 1S0VA 1CEZA 1MZEA 2QE7G 1BHBA 1IBLO 2HEPA 4IIJB 2ZE8A 1QCEA 3B8NA 4LF6B 1BQZA 4K3AA 4D7SA 4NYKA 2GUZA 4MVZA 3T4ZA 5IY5C 2RQ6A 3B40A 4CS3A 5C8YB 3N2KA 5CBHA 5LXTB 3HKDA 1FPOA 3ZHVA 1AP6A 1KMIZ 2YSUB 1O9HA 2M6YA 1M56C 1NZ6A 1HDJA 1PM9A 4I0XB 2CTPA 3TGUH 4GYCB 1IBMO 4QE9A 3AK1A 1AI4A 2Q7GA 1AJPA 2LFSA 1NBMG 1BMFG 3DXRB 3L9DA 2PZSA 2JS5A 3RVYA 2QWNB 1TVKA 4X65O 4PDRA 1SQXH 5IT9N 5KUMA 4GKKB 2ZXWB 1BT8A 2XOKG 1DLBA 2ZCEA 2BSKB 2ZM6B 5GTIZ 3GWKC 1ORQC 3B8MA 2XAQA 2FYUH 2A79B 1SC5B 2Y0IA 3CS5A 1RSOA 4I4TB 5GTHZ 3BY6A 2P7TC 4F6RA 3AG2C 5B1AB 1QHTA 2WA4A 3BHPA 1QBZA 1NJIW 5FLXN 1K97A 1NVPB 4IT5A 2ZR3A 3KG2A 5DEDA 3D36A 4IYIA 5D5QA 3BVOA 4K0KB 1R73A 2DMXA 1KKCA 5LYJA 2YS8A 4R50A 1YEWA 2FKXA 2UUAB 1F51A 1V54B 3UT5B 1QQCA 2W6IG 4JV5O 1SS3A 3OR7C 1GMGA 1OJHA 2YXYA 3ZJZA 3CJHA 4DR1B 1HR0B 3E8BA 2HVJC 4DR7B 1N36B 4NTXA 1I0HA 3ZCCA 3ZHTA 3LUTB 1HNZO 3O9OA 4ZI7A 3ZRXA 5IDJA 2IU3A 5K1XA 3CD6V 2FMLA 3HKDB 2EZOA 2WLHA 3WB2A 3H9VA 1P7BA 2PTMA 1NH2B 2E5LB 3STZC 3ZRWB 2UUCB 1AB3A 3E22B 1V55B 2UUCO 1TUEB 3C3SA 5AG2A 2YEVA 4DV3O 3K5LA 2AZ2A 4UVCA 3K3WA 4X66B 2P67A 4B3MB 1GH6A 4O2AB 1SERA 1XDCA 3ASNC 1ROPA 1K9MW 4B08A 4LFCB 4OPHA 4I0XA 2PF4E 3OD4A 5L3EA 3K03A 2CAZC 3K79A 3RBZA 1VQ4V 1JFFA 3OTOO 2NN4A 4TOIA 5ITZA 4PJ0Z 1MSDA 2ITDC 2YIBA 5IWAB 2UXDO 3SR2C 2KQXA 1GRJA 2EIMB 5KAFZ 2GDSA 2LFRA 1G4YB 5EBMC 5JVDA 3OGIB 3IGAC 4TWKA 4U7OA 3VBBA 1N34O 2H8PC 3K0DA 1PP9H 2OYQA 4JZ2A 2XAHA 2P22C 3K04A 4BW5A 3K08A 4H33A 2FL4A 4QPJA 5IE9A 4U3JB 2N74A 1WB8A 2VS0A 3H1LH 5KHGA 1P7GA 5HFLA 5KX5B 1L0NH 2ZE7A 1EM1A 2QM8A 1KYOF 3H01A 1SZXA 1SQFA 4XBFA 4FFBA 3P32A 5LA6B 3CCSV 3ZMZA 1G8MA 1E1RG 3ABLC 1SF9A 4KL1A 1YJ9V 3UT5A 1XREA 1K3EA 4H0LB 3CCMV 4CH3A 1DGSA 4JI7O 4EB6B 4FK5C 3VQWA 3PJSK 3CEIA 2R72A 5B1OA 3JATB 2DYRC 3ZMSA 4PA7A 4IL6Z 1ZLZA 2JRIA 1NQTA 3U10A 4DYLA 5KMGA 4G2KA 2K1EA 1V54C 2LJ2A 3JD2A 4X66O 1NVPD 2Q0OC 1SESA 2F95B 3WB1A 1OCZB 2GUZB 5BXZA 3M7MX 3ABLB 4KXRA 4X62O 3AG4C 3R65A 4JPRA 4C7UA 1R1BA 5B1AC 2JS3A 4DV4O 4DXWA 2A7WA 5BR8B 5JCOC 1IBKB 4L8JA 3BABA 1FFXB 5KHKA 2CGOA 1YF2A 3CRRA 3K9AA 2WPDG 1FXKA 1PNLA 4F4LA 3N2KB 3JALA 3NXSA 4LFBB 5CBFA 1WPXA 1X59A 2RJZA 4X20B 1I5YA 3DXRA 2KB1A 4DR1O
chains in the Genus database with same CATH topology
2QDOA 2Q8VA 3CS5A 1OJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDO A;  2Q8V A;  3CS5 A;  1OJH A; 
#chains in the Genus database with same CATH topology
 1M5I A;  4LF7 O;  1VF7 A;  2VWK A;  5LMN O;  1FAF A;  2BOC C;  2Y4U A;  2QDO A;  4CH4 A;  1VQN V;  4JYB A;  1XNQ O;  2RN9 A;  3IC7 A;  1M1K W;  2ZNI A;  1FD9 A;  2W0F C;  4GUN A;  2XTA A;  1XMO O;  4TV8 A;  1RM1 C;  4I4T A;  5EBL C;  4HYO A;  2QKC A;  2ZIN A;  4FVM A;  3OFN G;  2OWO A;  2X0L A;  4O4I A;  3IFX A;  3PN1 A;  4ABM A;  4QGP A;  5EK0 A;  4JI2 O;  3TJT A;  4HAM A;  5GON A;  4B3M O;  1NR1 A;  4UB8 Z;  4YY3 O;  4OPA A;  1KBH A;  4J9Z B;  1TUB B;  3OW2 U;  1FXK C;  2DWE C;  4R7C A;  3LSU A;  3FB5 C;  1URF A;  2QM7 A;  2P5O A;  2HLD G;  4PDV A;  2F1M A;  4EB6 A;  1VQ5 V;  1BE3 H;  2QJ1 A;  2WLN A;  2EIL C;  1BGY H;  5JJN B;  4J41 A;  4JGS A;  4NR1 A;  3C3T A;  2IBZ H;  5EIB D;  3TK1 A;  5LOV A;  3FAV A;  1AVM A;  4J7Z A;  4BIZ A;  2IU0 A;  4AIL C;  1XL4 A;  2YDE A;  2QTO A;  1YVW A;  4UCS A;  3UCS C;  4MS2 A;  1B06 A;  3Q4H B;  3U11 A;  2Y48 A;  5LGT A;  2NR5 A;  1GM7 A;  1HR0 O;  2QA4 V;  1KB9 F;  1PNM A;  3ASO B;  2XAG A;  4UXN A;  3A0B Z;  3F7Y C;  2B1G A;  1V9P A;  5E79 Z;  1LNQ A;  3N27 A;  5LHH A;  2ADQ B;  1XEQ A;  4NB5 A;  3SPJ A;  1AI5 A;  3RYC A;  4GKJ B;  2HKO A;  4JTC B;  2ZIM A;  1HNW B;  5DM6 V;  4JI3 B;  2QWP B;  4O2A A;  4X20 A;  5IJ0 B;  2YIA A;  1I5X A;  1Q6H A;  1BS3 A;  3HKB A;  5FL7 G;  2YXH A;  3RGB A;  2QEX V;  1JJ2 U;  1OCC C;  1RPR A;  2Q5Z A;  3A0H Z;  3OE7 G;  4UCT A;  1WN7 A;  1PL0 A;  1SA0 B;  4Q20 A;  2M7W A;  1W2B U;  5LYJ B;  5EZY A;  4DR6 O;  4QE7 A;  2BTQ B;  2VQF B;  2P90 A;  3J81 N;  1Y6X A;  2Q68 A;  3CP1 A;  2ILM A;  3ICX A;  1ZSP A;  3SYA A;  1N4C A;  2Q73 A;  3P3N A;  4E2L A;  4O4L B;  1UFI A;  2EJR A;  3FKS G;  2EIL B;  1WA8 B;  3ETE A;  2LW1 A;  1VQL V;  1J5E O;  2ITC C;  4YJ2 B;  3WFV A;  5DN6 G;  4FM0 A;  3NR7 A;  4TT3 G;  1UJW B;  4DR7 O;  4W4L A;  1SZT A;  3O65 A;  3KZI Z;  2IJI A;  2VQE B;  5L3G A;  1PV0 A;  4JI4 O;  4YIO A;  4LWS A;  1K4D C;  4CC6 A;  4JI0 O;  3RYF B;  1GK9 A;  2WLL B;  3SPI A;  4G28 B;  4JAU A;  1VQP V;  4WF9 V;  3DSQ A;  4WFF A;  1LR1 A;  1YDX A;  4EFE A;  1ZTE A;  4IIJ A;  2Q6A A;  4CBC A;  1IDS A;  1WP7 A;  3H1H H;  3SPH A;  4YHH O;  1Y4M A;  1QR8 A;  4I55 A;  2YXL A;  2OTL V;  3OT7 A;  3T1H B;  1R3K C;  5LL6 Y;  3BEH A;  4FM2 A;  2R9R B;  3G4S V;  3RYH B;  5FNV B;  2UUB B;  2WA3 A;  4LF4 B;  4UVB A;  1EFR G;  4Z2W A;  5ITZ B;  4Z1M G;  4DR4 O;  2Q0A A;  2ZR2 A;  2HHH B;  2UXB O;  1J95 A;  1JMK C;  1EN4 A;  1IBL B;  3ASN B;  5KA6 A;  4LCU C;  3QO7 A;  3ZIA G;  2DOS A;  3ZRV A;  2IH3 C;  2QGN A;  3HKC A;  4GKK O;  4QNH B;  4PEL A;  4IGG A;  4I50 A;  2ZDI C;  1Q7Y W;  3RVZ A;  4DR3 O;  2N05 A;  1GO3 F;  2WLJ A;  1QLE C;  3K06 A;  1W0J G;  4F6E A;  2EIK C;  3Q4H A;  2OIG A;  4UCR A;  1XMQ B;  4BIU A;  4CC5 A;  5K1P A;  1QU7 A;  3ZHU A;  1WB7 A;  2D3O W;  3JAT A;  2BSK A;  3ABK C;  2HJD A;  2BTO A;  4J80 A;  4X1I B;  5B3S B;  3OTF A;  4ZHQ A;  5LGU A;  3RYC B;  1N34 B;  1JQ0 A;  2UXD B;  3UO2 A;  3JAR B;  3VQY A;  1YTF B;  3D36 C;  2DQ0 A;  3HKB B;  3JD1 A;  5JJJ B;  5L3F A;  4LH6 A;  1G6U A;  2DE0 X;  4EFB A;  3MAQ A;  4FLW A;  4XDJ A;  3CC7 V;  1NTM H;  4H13 B;  5IYD O;  1WA8 A;  1VQ7 V;  1DF5 A;  4MTF A;  2CK3 G;  3K59 A;  5H5N A;  4LWS B;  1H2N A;  3CYO A;  5IYZ B;  1JA8 A;  5JWP A;  2WLL A;  4YJ2 A;  1AI7 A;  3OMI B;  2JGD B;  4HNA B;  4DV3 B;  4GX1 A;  1PKX A;  4RQF A;  1L8D A;  2X6C A;  1WNS A;  5KMG B;  1NS1 A;  3DC5 A;  4DV4 B;  4IHJ A;  1IXM A;  1L1F A;  1OHH G;  4LH7 A;  3SJB C;  1RP3 B;  1D5A A;  2R9A A;  1M56 B;  1NTK H;  3LDD A;  1JOY A;  1LUW A;  3ETQ A;  4AQY B;  4I55 B;  3DGE A;  1NKD A;  2XT9 A;  4JV5 B;  4J11 A;  1S5L Z;  2JEX A;  3LSQ A;  4O4I B;  2EIM C;  1YCI A;  2P06 A;  2Q69 A;  2YI9 A;  1GN6 A;  4FLT A;  3CCL V;  2P4K A;  5FNV A;  1DK1 A;  3BA8 A;  1K33 A;  5FPR A;  1M9N A;  2IH1 C;  5HFM A;  4DR2 O;  4LR3 A;  5B66 Z;  3FFQ A;  2NLJ C;  4JI1 O;  3LNM B;  1RM1 B;  4YJ3 A;  1R6N A;  4I50 B;  4GX0 A;  3FYE B;  2OCH A;  3OEH G;  1K34 A;  3MD0 A;  3EFF K;  2L6L A;  4YY3 B;  3ZX6 A;  4D7T A;  1DTO A;  4UVA A;  4JI5 B;  3TXS A;  4UUJ C;  3B4S A;  5JCO A;  4DV5 B;  1XIL A;  3ZHS A;  1NH2 D;  4JYA B;  1OCR B;  4DUY B;  1PL4 A;  3AG1 C;  1AR1 B;  3BCC H;  2B5U A;  4J7K A;  3RYI B;  3E8F A;  1SA0 A;  1SQP H;  5GON B;  1AJN A;  4TV9 A;  2DYR B;  3DC6 A;  1THZ A;  4I9W A;  4E4E A;  3K58 A;  1YIT V;  4PV1 B;  5IWA O;  4I7Z B;  4I5S A;  3SPG A;  1Q3E A;  1M57 B;  1DF4 A;  3CC2 V;  2LGQ A;  1IBM B;  3U0Z A;  1NI8 A;  1GM8 A;  4FFB B;  2ZKO A;  3I55 V;  1E1Q G;  3B77 A;  4X1K A;  2VQE O;  1SET A;  1H2K A;  4X1Y B;  2ZNJ A;  3ETD A;  2CTR A;  2GTA A;  4RO2 A;  1MG1 A;  5IYB O;  1NR7 A;  2CE4 A;  4JI5 O;  1Q81 W;  1TAE A;  4CH5 A;  2WLK A;  3K9S A;  1S5H C;  3FB7 C;  1J5E B;  2IJK A;  3LDE A;  3OM3 B;  1QNM A;  3RYF A;  2D2C B;  3RT3 C;  3ABU A;  2CDY A;  4ICG A;  1FJG B;  4DV7 O;  2PI5 A;  3APO A;  4UFZ A;  5CA3 A;  5IJ0 A;  4DV6 B;  3AG3 C;  4LF5 O;  3X2Q B;  2YIC A;  3JD4 A;  4X88 A;  4LFA O;  1TVK B;  5BR8 O;  4U3F H;  4K8Z A;  4PA6 A;  5B5E Z;  3L71 H;  1XUQ A;  1JX9 A;  3AG3 B;  4MT8 A;  1MA1 A;  3F7V C;  3SJC C;  1ARO P;  1VF6 C;  2UXC O;  2ZQM A;  5A9G A;  3H1I H;  5CB4 B;  3FD9 A;  1IX9 A;  4DV0 B;  3ZN0 A;  3W7T A;  4JAA A;  2YUA A;  1MMM A;  5KUK A;  3GB7 C;  2NNU A;  4J10 A;  3M8A A;  2IM9 A;  4PDL A;  2WSS G;  2XAS A;  2QWO B;  3CRM A;  4F6R B;  1ZL8 B;  1Y67 A;  1VQO V;  1Y74 A;  3K5M A;  2F43 G;  4JI7 B;  4WFE A;  4Z1V A;  5FPO A;  1L0L H;  1LUV A;  1H8H G;  2KG7 B;  2PGG A;  2QWR B;  4JI6 B;  1GAX A;  4TSF G;  1M4U A;  4JYA O;  3THO A;  3OEE G;  1FXH A;  3S3W A;  5C93 A;  1IUR A;  4FIP C;  3G71 V;  4FLV A;  1IZ3 A;  4DUY O;  1XNR B;  4O4H B;  5H2F Z;  2AXT Z;  2P4V A;  3BPZ A;  2VQF O;  1WPB A;  2YIB D;  5F2V O;  2EBO A;  4YIP A;  1YTF D;  3CJH B;  3L75 H;  3E8G A;  3X2Q C;  3E83 A;  3RFR A;  5EIB C;  2JDI G;  3JAR A;  3VQV A;  3WB0 A;  1EN5 A;  4MW3 A;  2PI4 A;  1ZWI C;  2F23 A;  2RNB A;  4MVO A;  4B3R O;  2GHY A;  1TUB A;  2YID A;  1BHA A;  3T1H O;  1I94 B;  2ZE6 A;  1VQ6 V;  1RPO A;  2X6B A;  1VP7 A;  4NXN O;  3AG1 B;  4X9Q A;  5LGN A;  4D6T H;  4TQD A;  5B1B C;  4CS2 A;  5H6R A;  2PY5 A;  4X64 O;  3AG2 B;  4GZR B;  1S3J A;  1WAZ A;  2QM4 A;  5B3S C;  4RWU A;  4R8C A;  3FAV B;  2R9I A;  4MVU A;  4GCZ A;  3CRQ A;  5IJ9 A;  2YEV B;  3QF7 A;  1F23 A;  2W0X A;  4LFC O;  1M93 A;  2JJ2 G;  2UXC B;  1UPG A;  1QLE B;  1QR9 A;  3CSX A;  4NTY A;  3EHB B;  3I5D A;  3QO5 A;  4WFH A;  3ABM B;  4LF6 O;  4PD4 F;  2OT5 A;  4IHJ B;  3SYP A;  4K35 A;  2G38 A;  2BOB C;  2CTW A;  2DN9 A;  2WWW A;  1Q8I A;  3CMA V;  1VMG A;  4LF4 O;  4JI1 B;  1FJG O;  4B7K A;  1JFF B;  4MVQ A;  3CWB H;  3D8C A;  3JCZ A;  3GVM A;  2HP8 A;  1W59 A;  1S5J A;  4XDK A;  5H9C A;  4X62 B;  2OCC C;  1H2G A;  3CE2 A;  4A5U B;  5JH7 A;  1P84 F;  1ZL8 A;  3CCR V;  5LP6 A;  2AHZ A;  2MW2 B;  3KKY A;  3QVN A;  4WFB V;  1N33 O;  3EXA A;  4BR6 A;  1US6 A;  3L70 H;  1K8A W;  1U97 A;  2DJV A;  4JI3 O;  4ZOL B;  2UUA O;  1A32 A;  1HNX B;  1SQQ H;  5BMV B;  1MSW D;  1KP2 A;  3JAK B;  4KHP O;  3SYO A;  1Z2G A;  1YZB A;  3RYI A;  2DYS C;  4LFA B;  4NTW A;  3J80 N;  4DV1 O;  1H38 A;  4DV5 O;  2Z3Y A;  2XHB A;  2AHY A;  1GN3 A;  1N8R W;  3W7W A;  2PYL A;  1OCR C;  1U96 A;  4DW0 A;  5IYC O;  1PNK A;  2VWJ A;  3QO8 A;  1EZJ A;  3AK2 A;  2ZM6 O;  4GX2 A;  5J2T B;  1AR5 A;  2F93 B;  3OUS A;  2GBO A;  5J2U B;  2HHH O;  4NVP A;  3RYH A;  4UCO A;  3SYC A;  3WG7 C;  4KP4 A;  2A0L A;  4JZG A;  2OTJ V;  4RAI A;  2UU9 B;  3MHH C;  1TGO A;  2EX3 A;  3ZRW A;  4YHH B;  4X1Y A;  2L35 A;  1H2L A;  3HKC B;  1K5S A;  4MVS A;  3I56 V;  4N23 A;  2EIK B;  5IJ9 B;  1K4C C;  1VAR A;  4CZZ A;  4PDM A;  2H3O A;  4J9Y B;  4P9P A;  4JI4 B;  3E35 A;  5KAI Z;  1K5Q A;  3E22 A;  1EN6 A;  4X1I A;  2Q8V A;  4PA9 A;  3QG5 A;  2E75 B;  5LBQ A;  3BAA A;  3QTC A;  2QKS A;  1K7D A;  5EC2 C;  3JAW A;  3D3I A;  1VQ9 V;  4WCE V;  2RDC A;  3W7X A;  2EIJ B;  3IAY A;  2K9P A;  4YXW G;  2XAF A;  5LHG A;  2EIN B;  3G6B A;  5KHJ A;  4X1K B;  4RQE A;  1B04 A;  3SPC A;  4DV1 B;  2O57 A;  1X4T A;  1Q82 W;  2E5L O;  1GTO A;  3K0G A;  3A2F A;  2EIN C;  2VRZ A;  4PI0 A;  3UQ8 A;  2JJ1 G;  3RWR D;  2IW5 A;  1K73 W;  1XHZ A;  2H94 A;  3TCU A;  1VF6 A;  1N0J A;  1OZ0 A;  3OUF A;  3RW0 A;  4FLZ A;  4N21 A;  3SJA C;  3G6E V;  4O4J A;  1R6T A;  2EJ7 A;  3JAK A;  2QWQ B;  3ZMV A;  5CN0 A;  1JPX A;  3CCJ V;  2B1I A;  1XNQ B;  4DK1 A;  1R3J C;  1N33 B;  1FS0 G;  5L3C A;  3CHX A;  4WBN A;  4B7E A;  4GLX A;  2AZ0 A;  1KC8 W;  3HKE A;  5J2T A;  1AI6 A;  2GSM B;  4ZKI A;  4O4H A;  1VQM V;  4IYH A;  4PI2 A;  1IXB A;  5LOV B;  3E86 A;  5CB4 A;  4R6Z A;  5L3D A;  2Q9L A;  3IJ4 A;  4HBN A;  5KHI A;  4UCU A;  1COW G;  4LFB O;  3CCE V;  3F5W C;  4GT1 A;  1CXZ B;  2N04 A;  2WAM A;  3JYC A;  5CA0 A;  3T1C A;  4LF5 B;  1AIL A;  5J2U A;  1KP3 A;  2CTQ A;  4DUZ O;  4OX9 B;  4PA3 A;  2Z5U A;  3LNN A;  4DR3 B;  4GX5 A;  3AG4 B;  1Q6I A;  1BCC H;  4BAY A;  5IY5 B;  1OCO B;  3MDS A;  4PA4 A;  3JSL A;  4B3T O;  2BE3 A;  1Q86 W;  1OCO C;  2XUM A;  1YIJ V;  5EYP A;  4RUF A;  1BQ0 A;  4JI2 B;  1O9G A;  1VIB A;  3CXH F;  5EZY B;  1VQK V;  1YJW V;  1B6Q A;  3STL C;  2WLM A;  5LMU O;  3W7U A;  2DQ3 A;  1GN4 A;  2UUB O;  3HR0 A;  1GKF A;  4O2B A;  1QLN A;  3KCX A;  3CME V;  3ASO C;  1FFT B;  1QVF U;  4JTA B;  3L73 H;  4NXN B;  3DTU B;  4JYC A;  5BZB A;  5CA1 A;  1BSM A;  3JAW B;  1SQG A;  4DRX B;  1FXV A;  3ZHQ A;  1EZV H;  2Y4T A;  1I94 O;  3F5T A;  3FX7 A;  4FMT A;  2ZE5 A;  4LF8 O;  1FYJ A;  2V7Q G;  3KCY A;  2ODM A;  3N2G A;  2UU9 O;  5LMU B;  3JAM N;  1P49 A;  4OGQ B;  1MAB G;  1W0K G;  3OAA G;  4FZ0 A;  2DW4 A;  2W6J G;  3QNE A;  3T4D A;  4P9O A;  1IBK O;  2OCC B;  4WBN B;  1SRY A;  4MTG A;  4WFA V;  5LP6 B;  1JCH A;  3HKE B;  4TV8 B;  4PHZ A;  4ASU G;  3T1Y B;  2RMK B;  2CGN A;  5CBG A;  1QVG U;  1Q6U A;  4QPK A;  3FYI B;  2HFE C;  3ETG A;  4X8A A;  1XI1 A;  2Y0P A;  2F4V B;  2JEU A;  4KHP B;  5JQG B;  1SQB H;  3GWO A;  4TUY B;  3K5O A;  3MHS C;  5DEC A;  3E2E A;  2RCV A;  2ZT9 B;  4ZI7 B;  3ABM C;  1PD3 A;  1T5E A;  1HWY A;  2OIE A;  4CH6 A;  1I7F A;  3R66 A;  2JGU A;  2ZD9 A;  4GKJ O;  2C2A A;  3RN4 A;  3JD0 A;  3OMN B;  3E8H A;  5A2Q N;  5JH7 B;  4B3S O;  3A8T A;  1S76 D;  4K0K O;  3ZBH A;  2F4V O;  1Y76 A;  4JI8 O;  3CC4 V;  1G1X B;  1SKV A;  1EBO A;  3CPW U;  3TET A;  4ZOL A;  3J7A U;  1OCC B;  4MSW C;  1YI2 V;  3WG7 B;  4ZHQ B;  3TXQ A;  3BFR A;  3IC9 A;  4AI8 A;  4FLU A;  1GN2 A;  3A0R A;  4LNU B;  4W4K A;  4P30 A;  3ZMT A;  1HNZ B;  2KG7 A;  1CPY A;  2V4D A;  1MZF A;  2UXN A;  4J7J A;  3D3Q A;  2PUS A;  4KUM A;  4LP8 A;  4X89 A;  1V55 C;  1YXB A;  4EEQ A;  1N32 O;  4P2Z A;  2ZDI A;  5B1B B;  2Q7E A;  5JVD B;  2LW7 A;  4DRX A;  1ENV A;  3ABT A;  4X64 B;  2PYJ A;  1IVS A;  1F7Y A;  4NKG B;  3OR6 C;  5D5P A;  1N0N A;  5E1A C;  1Z5V A;  2JVD A;  2ATK C;  4FPP A;  1Q90 D;  2BCC H;  3HPL C;  3AEI A;  2BTQ A;  3OTO B;  4H44 B;  4B3R B;  2XND G;  1YHQ V;  1H2S B;  4JYY A;  4HNA A;  1KQS U;  2QR4 A;  1F4M A;  4JTD B;  4O4L A;  2Y69 C;  1XMO B;  1YSC A;  3OGC C;  3W7S A;  4DV0 O;  4DR5 B;  4MTX A;  1N32 B;  1TA8 A;  2Z0A A;  2A9H A;  1XMQ O;  1BL8 A;  4NXM B;  2Y69 B;  4B3T B;  3JSN A;  2MK3 A;  2KSD A;  1ZX3 A;  2DYS B;  2JIZ G;  4LF7 B;  2LQT A;  1D2D A;  4UB6 Z;  4LF9 B;  3FB6 C;  3AG7 A;  2QKA A;  4FFK A;  3K57 A;  4DV6 O;  3CCQ V;  4OX9 O;  4FLY A;  1XBL A;  5JQG A;  1XNR O;  4X65 B;  3S3X A;  1AR4 A;  2FTK A;  4DV2 O;  2HJF C;  3UKM A;  4DUZ B;  1M90 W;  4BW9 A;  2QSA A;  1R6K A;  1ZAU A;  4KFM A;  5LP6 C;  3SGI A;  5CA0 B;  4DR6 B;  4B3S B;  4FZ1 A;  3M99 B;  4JAV A;  1BZK A;  1XOU A;  2DWD C;  4MTO A;  4LC1 A;  5EC1 C;  4G27 B;  3VQX A;  3CB2 A;  1P4R A;  4JI0 B;  2E74 B;  4ZIB A;  3CXC U;  1HNW O;  1H2M A;  2E3C A;  1Q5O A;  3L72 H;  3ZN1 A;  3JD3 A;  1FFX A;  3SDL A;  2FB5 A;  5EYP B;  1KUQ A;  3H1J H;  1XHX A;  2QTS A;  1KU9 A;  1K92 A;  4RUE A;  1HP8 A;  1JR9 A;  4U7N A;  2WLI A;  1S72 V;  3AK3 A;  4JAS A;  3T1Y O;  5BY1 A;  4EKW A;  3SYQ A;  1JVM A;  2LP7 A;  5BMV A;  3E89 A;  3JAS B;  2LGW A;  4LF9 O;  1WJZ A;  3ZED A;  1Y66 A;  3FB8 C;  1WP8 A;  4BWA A;  2IJJ A;  2B9Z A;  2GTS A;  1Z5W A;  2EUL A;  2Q4P A;  3CCU V;  3SJQ C;  3LDC A;  3ZS8 C;  5EBW C;  5H6Q A;  4Q6G A;  2HR3 A;  2HG5 C;  2V1D A;  2HVK C;  4I9Q A;  2AGA A;  5CA1 B;  2CH7 B;  1AP5 A;  5IYZ A;  2CUG A;  5TIS Z;  4MVR A;  1M57 C;  3H1K H;  4JF3 A;  4MVM A;  2UXX A;  2JGD A;  4DO2 A;  4DR5 O;  4LF8 B;  4DR2 B;  5KLV H;  1GM9 A;  2ARH A;  2Q67 A;  4BIO A;  2GV9 A;  3N2G B;  2P6J A;  5J9P C;  5L3B A;  1AJQ A;  1NT2 B;  2AW9 A;  4FM1 A;  5KA5 A;  5LXT A;  4TQF A;  1R3I C;  1F4N A;  3JCU Z;  5KX5 A;  4J42 A;  1RFY A;  5JJE B;  2LO1 A;  1B3Q A;  5LHI A;  1XQ8 A;  3WU2 Z;  4O2B B;  4DV2 B;  2YC0 A;  3G80 A;  4FJC C;  5C8Y A;  4UV9 A;  4TUY A;  3B09 A;  3UO3 A;  2Q7H A;  1SQV H;  3B2E E;  1JJO A;  3ML0 A;  1HW7 A;  1KKD A;  1MNG A;  1Y74 B;  4DR4 B;  2UXB B;  4NXM O;  2X6A A;  1XL6 A;  4XDL A;  1KD1 W;  1MOF A;  3BA9 A;  3P3P A;  3EVK A;  4CS4 A;  5B1N A;  4JI6 O;  4DK0 A;  3HB3 B;  1Q43 A;  2JK5 C;  3LSS A;  3UM7 A;  4WFG A;  2EIJ C;  4LBE C;  1H8E G;  1VF5 B;  2ADP A;  1CP9 A;  1Y76 B;  2XAJ A;  1ZUQ A;  5KHH A;  3CRA A;  3T2M A;  4QIW F;  4UV8 A;  1RSO B;  4K8X A;  1KEC A;  3K5N A;  1HNX O;  2X7R B;  4MW8 A;  2ZIO A;  2ZXW C;  4JI8 B;  3VOU A;  1FKA O;  3ABK B;  2YI8 A;  4H37 A;  4YJ3 B;  1VQ8 V;  4UCV A;  2R70 A;  3L74 H;  4U3J A;  4AQY O;  2A3Q A;  5LA6 A;  4FLX A;  3P30 A;  3C90 A;  3JAS A;  2WLI B;  3BRC A;  1NU1 H;  1OCZ C;  3ZRS A;  4HZ3 A;  5GW7 A;  3G67 A;  2KKW A;  3OMA B;  3CRC A;  1D5N A;  3APQ A;  5LMN B;  1NTZ H;  1FXK B;  5CMU A;  4ZBM A;  3JAL B;  4O4J B;  1E79 G;  4DW1 A;  4L87 A;  2ETN A;  4LNU A;  4QJF B;  1VEW A;  2CH7 A;  3CX5 F;  1R3L C;  2IJH A;  4AHC A;  2EZP A;  1S77 D;  1YJN V;  3ZHR A;  4DV7 B;  4TV9 B;  3CCV V;  4OXS A;  2E76 B;  1I08 A;  2F66 C;  2A06 H;  3ZMU A;  1WLE A;  1N36 O;  1OV9 A;  1PPJ H;  1S0V A;  1CEZ A;  1MZE A;  2QE7 G;  1BHB A;  1IBL O;  2HEP A;  4IIJ B;  2ZE8 A;  1QCE A;  3B8N A;  4LF6 B;  1BQZ A;  4K3A A;  4D7S A;  4NYK A;  2GUZ A;  4MVZ A;  3T4Z A;  5IY5 C;  2RQ6 A;  3B40 A;  4CS3 A;  5C8Y B;  3N2K A;  5CBH A;  5LXT B;  3HKD A;  1FPO A;  3ZHV A;  1AP6 A;  1KMI Z;  2YSU B;  1O9H A;  2M6Y A;  1M56 C;  1NZ6 A;  1HDJ A;  1PM9 A;  4I0X B;  2CTP A;  3TGU H;  4GYC B;  1IBM O;  4QE9 A;  3AK1 A;  1AI4 A;  2Q7G A;  1AJP A;  2LFS A;  1NBM G;  1BMF G;  3DXR B;  3L9D A;  2PZS A;  2JS5 A;  3RVY A;  2QWN B;  1TVK A;  4X65 O;  4PDR A;  1SQX H;  5IT9 N;  5KUM A;  4GKK B;  2ZXW B;  1BT8 A;  2XOK G;  1DLB A;  2ZCE A;  2BSK B;  2ZM6 B;  5GTI Z;  3GWK C;  1ORQ C;  3B8M A;  2XAQ A;  2FYU H;  2A79 B;  1SC5 B;  2Y0I A;  3CS5 A;  1RSO A;  4I4T B;  5GTH Z;  3BY6 A;  2P7T C;  4F6R A;  3AG2 C;  5B1A B;  1QHT A;  2WA4 A;  3BHP A;  1QBZ A;  1NJI W;  5FLX N;  1K97 A;  1NVP B;  4IT5 A;  2ZR3 A;  3KG2 A;  5DED A;  3D36 A;  4IYI A;  5D5Q A;  3BVO A;  4K0K B;  1R73 A;  2DMX A;  1KKC A;  5LYJ A;  2YS8 A;  4R50 A;  1YEW A;  2FKX A;  2UUA B;  1F51 A;  1V54 B;  3UT5 B;  1QQC A;  2W6I G;  4JV5 O;  1SS3 A;  3OR7 C;  1GMG A;  1OJH A;  2YXY A;  3ZJZ A;  3CJH A;  4DR1 B;  1HR0 B;  3E8B A;  2HVJ C;  4DR7 B;  1N36 B;  4NTX A;  1I0H A;  3ZCC A;  3ZHT A;  3LUT B;  1HNZ O;  3O9O A;  4ZI7 A;  3ZRX A;  5IDJ A;  2IU3 A;  5K1X A;  3CD6 V;  2FML A;  3HKD B;  2EZO A;  2WLH A;  3WB2 A;  3H9V A;  1P7B A;  2PTM A;  1NH2 B;  2E5L B;  3STZ C;  3ZRW B;  2UUC B;  1AB3 A;  3E22 B;  1V55 B;  2UUC O;  1TUE B;  3C3S A;  5AG2 A;  2YEV A;  4DV3 O;  3K5L A;  2AZ2 A;  4UVC A;  3K3W A;  4X66 B;  2P67 A;  4B3M B;  1GH6 A;  4O2A B;  1SER A;  1XDC A;  3ASN C;  1ROP A;  1K9M W;  4B08 A;  4LFC B;  4OPH A;  4I0X A;  2PF4 E;  3OD4 A;  5L3E A;  3K03 A;  2CAZ C;  3K79 A;  3RBZ A;  1VQ4 V;  1JFF A;  3OTO O;  2NN4 A;  4TOI A;  5ITZ A;  4PJ0 Z;  1MSD A;  2ITD C;  2YIB A;  5IWA B;  2UXD O;  3SR2 C;  2KQX A;  1GRJ A;  2EIM B;  5KAF Z;  2GDS A;  2LFR A;  1G4Y B;  5EBM C;  5JVD A;  3OGI B;  3IGA C;  4TWK A;  4U7O A;  3VBB A;  1N34 O;  2H8P C;  3K0D A;  1PP9 H;  2OYQ A;  4JZ2 A;  2XAH A;  2P22 C;  3K04 A;  4BW5 A;  3K08 A;  4H33 A;  2FL4 A;  4QPJ A;  5IE9 A;  4U3J B;  2N74 A;  1WB8 A;  2VS0 A;  3H1L H;  5KHG A;  1P7G A;  5HFL A;  5KX5 B;  1L0N H;  2ZE7 A;  1EM1 A;  2QM8 A;  1KYO F;  3H01 A;  1SZX A;  1SQF A;  4XBF A;  4FFB A;  3P32 A;  5LA6 B;  3CCS V;  3ZMZ A;  1G8M A;  1E1R G;  3ABL C;  1SF9 A;  4KL1 A;  1YJ9 V;  3UT5 A;  1XRE A;  1K3E A;  4H0L B;  3CCM V;  4CH3 A;  1DGS A;  4JI7 O;  4EB6 B;  4FK5 C;  3VQW A;  3PJS K;  3CEI A;  2R72 A;  5B1O A;  3JAT B;  2DYR C;  3ZMS A;  4PA7 A;  4IL6 Z;  1ZLZ A;  2JRI A;  1NQT A;  3U10 A;  4DYL A;  5KMG A;  4G2K A;  2K1E A;  1V54 C;  2LJ2 A;  3JD2 A;  4X66 O;  1NVP D;  2Q0O C;  1SES A;  2F95 B;  3WB1 A;  1OCZ B;  2GUZ B;  5BXZ A;  3M7M X;  3ABL B;  4KXR A;  4X62 O;  3AG4 C;  3R65 A;  4JPR A;  4C7U A;  1R1B A;  5B1A C;  2JS3 A;  4DV4 O;  4DXW A;  2A7W A;  5BR8 B;  5JCO C;  1IBK B;  4L8J A;  3BAB A;  1FFX B;  5KHK A;  2CGO A;  1YF2 A;  3CRR A;  3K9A A;  2WPD G;  1FXK A;  1PNL A;  4F4L A;  3N2K B;  3JAL A;  3NXS A;  4LFB B;  5CBF A;  1WPX A;  1X59 A;  2RJZ A;  4X20 B;  1I5Y A;  3DXR A;  2KB1 A;  4DR1 O; 
#chains in the Genus database with same CATH homology
 2QDO A;  2Q8V A;  3CS5 A;  1OJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...