1OJHA

Crystal structure of nbla from pcc 7120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
IELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords NBLA
publication title Crystal Structure of Nbla from Anabaena Sp. Pcc 7120, a Small Protein Playing a Key Role in Phycobilisome Degradation.
pubmed doi rcsb
source organism Anabaena sp. pcc 7120
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 1ojhA00
2Q8VA 1OJHA 2QDOA 3CS5A
chains in the Genus database with same CATH superfamily
1XHXA 4F4LA 2P7TC 5DECA 3K9AA 4YJ2B 4FPPA 2JGDB 4LCUC 5CA1B 2CAZC 2YI8A 4I4TA 2AGAA 1JMKC 4TV8B 1I7FA 1YSCA 5KMGB 1QLEB 1F51A 2Y4TA 3DC5A 1ZTEA 4FJCC 5JCOC 2Q9LA 1Q90D 4X8AA 1F4MA 2EINC 3CMEV 1ZUQA 5LHGA 4ABMA 2IJIA 3DXRA 3D36A 3T1CA 5F2VO 2PZSA 2OIEA 3MHSC 2ETNA 4GUNA 3G6BA 3D8CA 4X62B 4WFFA 2VQFO 4DR3B 1WA8B 1Y76B 4BIUA 1M56B 3N2KA 3HKEB 1S3JA 3FFQA 2P4VA 4H33A 4LFCO 4IGGA 4QIWF 3BPZA 3FB6C 1HNZO 4GKJO 2ZINA 1DK1A 2JK5C 5A9GA 4GKKB 3B40A 4LF8B 4WBNB 1XMOB 1VQ6V 2KB1A 1ZWIC 4JYYA 2QWRB 5LP6A 1YDXA 3ZIAG 3OEHG 5LMNO 4WFEA 4LWSA 5DM6V 4O2BA 2X6AA 4MVMA 3OTFA 2QWNB 5IYDO 3DSQA 3UO2A 4TQDA 1BHAA 2HVKC 4QE9A 4LR3A 3RVZA 2Y0PA 4JYAB 5KAIZ 4DK1A 2KG7B 3AK3A 2PI4A 2Y69B 1YXBA 3ZRWA 4PDVA 2FL4A 2PTMA 2ZQMA 4LNUA 3WG7B 1XHZA 1FXKB 5B5EZ 3HR0A 4JI0O 3RVYA 4YIPA 1QCEA 1SF9A 3E8FA 3K79A 2CGNA 4C7UA 5H6RA 4EEQA 2HKOA 1XI1A 3WU2Z 4GCZA 3LDDA 3MAQA 1HR0O 2AZ0A 4O4JB 3BRCA 2IH1C 3CRQA 2ZXWB 1OCCB 1NU1H 1XUQA 2GUZB 4G27B 1VF5B 3T1YB 5KA5A 2XUMA 3HB3B 5EZYA 5JQGB 3VQWA 4LFBB 1K8AW 4DR7O 3HKDB 4KHPO 3SJAC 4NXMB 4DUYB 1L0LH 2ODMA 3B09A 1J5EB 1AJQA 2M6YA 3JD0A 2ADQB 4KL1A 4FVMA 3JAWB 2WLLB 2PI5A 3F7VC 1NH2D 1FJGO 5FPRA 3CS5A 1JQ0A 1I08A 1WPXA 1IZ3A 1P49A 5IY5B 3JD1A 3ZMUA 1N32B 1HNWB 1Y67A 2LW7A 1IBLB 3P3NA 1P84F 2CH7B 3BHPA 1FKAO 3HKCB 2CUGA 4I5SA 2Y4UA 3L72H 1R6NA 2DYSC 4IHJB 1NR7A 4UCRA 5CBHA 3OEEG 3ZCCA 1VQ5V 2IW5A 2UXNA 5E1AC 4I55B 1Z5VA 4ZIBA 4DRXB 2EIKC 1TUBA 4CH5A 1P7BA 3W7XA 5JVDB 4KXRA 2F4VB 2QKAA 1G4YB 1NI8A 2Q0OC 2QKCA 1K97A 3AG7A 5GTHZ 2Z0AA 3QO7A 1FFTB 1NS1A 4CS4A 1I5YA 3QO8A 2WLKA 2ZR2A 1GN2A 4R7CA 5IT9N 2FMLA 1DGSA 4MVOA 1VF6A 4BAYA 2JS5A 4O2AB 4ZI7A 3ZRXA 4PD4F 4ICGA 1M57C 3L75H 3D3QA 4AQYB 4DV5B 3E8GA 2E5LB 3JARB 4RQEA 1SC5B 4UVCA 1S5LZ 4PA6A 2L35A 2Q69A 1K5SA 2JJ2G 2UU9B 4JV5O 1NVPB 1AI6A 2BTQA 3IGAC 4RWUA 1XREA 3JATB 1EN5A 4ZOLB 4X9QA 4P2ZA 2W6IG 1EN4A 1SQXH 1FXHA 1U96A 2NN4A 3QTCA 2OCCC 3SPHA 1SQFA 1QLEC 2JGUA 1QR9A 4LF9B 2ZR3A 4F6RA 3AG3B 1N36B 2GBOA 5KAFZ 2QA4V 4UVAA 2HHHB 1U97A 2HJFC 2R9RB 2XAGA 4U7NA 3C3SA 2M7WA 1K34A 3FYEB 4DV2O 2N04A 3K06A 1VQLV 1UJWB 4FZ0A 5IYZA 5B1OA 4I4TB 3JASA 4DR2O 1K3EA 1GH6A 3RT3C 4O4LA 2F43G 1FPOA 5IE9A 4LH6A 1DF4A 2UXDO 1PL4A 3SYOA 3H9VA 3K5NA 2YIBA 1FFXA 3ABUA 1NBMG 1Q81W 5LMUB 3DXRB 5FLXN 1MABG 2CK3G 1OCRB 4YHHO 1GN4A 2H3OA 1N34O 1H2LA 3VQYA 2N74A 3EVKA 2F1MA 4I50A 1EFRG 3RWRD 5B1BC 4MTFA 2QE7G 1AR1B 4LF4O 2ZKOA 3BA9A 5CBFA 4CH3A 4DV0O 3RYCA 2W6JG 4H0LB 5EYPA 5IJ0B 4PDRA 1JOYA 4EKWA 4UXNA 2QM7A 3H1HH 2IH3C 4DXWA 1BS3A 4O4HA 1EN6A 5LP6B 2Z3YA 1Q7YW 4OXSA 1SERA 4LWSB 4O2BB 5B1AB 4NYKA 4RUEA 3G4SV 1XNRO 4D7SA 1XOUA 4MVRA 4FZ1A 3CCVV 1UFIA 1VF7A 3HPLC 2YC0A 3K08A 3AG2B 2XAQA 4Z2WA 5KUKA 4BR6A 1R3KC 1NTKH 2JEXA 4PA9A 3ZRWB 1OCCC 1E79G 4TT3G 3GWOA 1OCOB 4U7OA 4B3TB 1VQNV 4JYCA 4LNUB 1HNXB 4CS3A 2QR4A 4FM1A 3H1JH 3CHXA 5HFMA 4IIJB 4GX2A 3T4ZA 4LBEC 1HW7A 2P06A 3FB8C 4PA7A 2CTPA 3FYIB 2QDOA 4J42A 3L9DA 1ZL8A 5B3SC 2ARHA 3ZEDA 1W0KG 4QNHB 1K5QA 1M1KW 5EZYB 3T2MA 3CC4V 5LBQA 4DV3O 1MMMA 1R3IC 4PA3A 3B8MA 2ZD9A 1NQTA 4E2LA 3N2GB 1VQ7V 1V55B 2BOCC 4TQFA 5IY5C 2UUBB 3ZRVA 4OX9O 3BVOA 4AHCA 4DV1O 3ABKB 4X66O 4JAUA 4X64B 4JGSA 3J81N 3SYPA 5EIBD 3CRMA 1BMFG 4DR4B 4RAIA 4CH6A 1B04A 3R66A 1AI5A 3CCUV 2FYUH 3LSSA 4MW8A 4FFBA 4QGPA 3JD3A 1N33B 2XT9A 2EBOA 1YHQV 4BW9A 3K3WA 3O9OA 3ZMSA 2UUAO 4FLYA 2C2AA 4JI3B 1HP8A 1TVKB 1NH2B 3E22A 4X1YA 1SS3A 5JJEB 1I94B 1GAXA 4YIOA 3L70H 1VEWA 5C93A 3FD9A 3ZHTA 2DN9A 1WAZA 3BAAA 3ABMC 4MT8A 3WFVA 2E75B 3CMAV 2ZM6O 1NVPD 4DYLA 3L74H 4R6ZA 4UV8A 5ITZA 4QPKA 1VQKV 1H8HG 2EX3A 3STLC 3KCXA 2QM4A 5GONA 1R73A 5L3CA 1R3JC 4BIOA 5IYCO 3SYAA 4X89A 1H2MA 4QPJA 5GTIZ 3UO3A 1PPJH 2BOBC 1TGOA 3MD0A 2P22C 2VS0A 1QBZA 2KQXA 4I7ZB 4UB6Z 4JI2B 5LA6A 2IM9A 2D3OW 1R1BA 4UV9A 4TV9B 4PI0A 4J9YB 3OD4A 4J7KA 3U10A 1EZVH 1W0JG 2A9HA 2DMXA 4A5UB 3I55V 5FNVA 4JTDB 1CP9A 2RJZA 1IBMB 3N27A 3T1HB 1D5AA 1RPOA 4ZI7B 2LGQA 3W7WA 4X62O 4DR3O 4DR5B 3K0DA 1AI4A 1RM1C 1H38A 2CTRA 1MNGA 1VQPV 4AI8A 4K8ZA 3AG3C 4DV4B 5JCOA 2RMKB 3G71V 3RYIA 1AP5A 2BTQB 2Q4PA 3ZHQA 5JH7A 2R9IA 3CC7V 1JPXA 4LF8O 1GRJA 1QNMA 1VQ4V 2LW1A 1XMOO 1JR9A 4WCEV 1RSOA 4PHZA 3SPJA 2YI9A 1Q43A 1R6TA 3C3TA 2E74B 3THOA 1Q6UA 1FS0G 4F6RB 2CE4A 4CS2A 4JYAO 4J9ZB 5CA3A 2IJHA 4DV7B 2KKWA 2CGOA 3VQVA 4D7TA 5CN0A 4H37A 4U3FH 4J80A 3ZHRA 3ICXA 1JVMA 5IWAB 2R9AA 4L87A 5L3BA 4O4LB 3CEIA 2D2CB 1ZSPA 2JS3A 4JI4B 3EHBB 2DE0X 2QGNA 2UXCB 3TXQA 4OPHA 4DUZB 1KKCA 2ADPA 5H9CA 1FFXB 1AR5A 3GB7C 1S72V 3B4SA 1GK9A 5EK0A 1DTOA 4U3JA 1ZX3A 2ZT9B 3RN4A 4DUYO 3SYQA 1J5EO 4J41A 5B1AC 5IJ9A 5LYJA 1Q82W 4PI2A 5KX5A 3U0ZA 3KKYA 5H2FZ 1K7DA 3JALA 3BCCH 2ZE7A 3KG2A 3IFXA 1RP3B 4LFCB 1JJOA 3H01A 3RBZA 4FMTA 1JFFA 4DO2A 1HNZB 1T5EA 2ITCC 2VWJA 1BCCH 2PYLA 2P5OA 3LSQA 4O4HB 1N32O 1J95A 2W0FC 5BR8O 3SYCA 3CB2A 3K57A 3APQA 3AG4B 4P9OA 2F95B 4YJ3B 1AI7A 1PNKA 1PV0A 4WFAV 3ASNC 3X2QB 3BY6A 3OUFA 3TXSA 1R3LC 2YEVB 1YF2A 2Q68A 2WLJA 3OFNG 1BQ0A 2V7QG 3WB0A 1BHBA 1KB9F 3CXCU 2X7RB 1S77D 2IJKA 4B08A 3DTUB 1I5XA 4JASA 4LF5B 1PNMA 3BABA 5EBLC 1BZKA 4TOIA 1FYJA 2RQ6A 3ABKC 1NTMH 1ZL8B 5BZBA 1BQZA 1XQ8A 1KBHA 4X1KA 2QJ1A 1VQMV 5J2TA 1UPGA 1HR0B 3CCQV 4G2KA 5L3DA 3AEIA 4HBNA 4DR6B 2F23A 1VQ8V 5LXTB 4KP4A 3EFFK 4AQYO 2EIJC 1QVGU 4BWAA 1SZXA 4FLUA 3BFRA 3OM3B 3ZN0A 1RFYA 2E5LO 4JI5B 5LGNA 1QVFU 1V9PA 1OCZB 3OR6C 4GLXA 1Q5OA 2UU9O 4FFBB 3K04A 3ZRSA 3LDEA 3SPGA 1H8EG 3WB2A 1VP7A 1YEWA 2ATKC 5TISZ 3RYFA 1JJ2U 1KP3A 3E22B 1FJGB 4X1YB 5KLVH 4BIZA 1B6QA 4JAVA 3CRCA 3W7UA 4LF7B 4UB8Z 5KHGA 2IJJA 1N36O 4IL6Z 4RUFA 2VQEB 1WP7A 3B2EE 2A0LA 2HHHO 3ZHUA 4FLWA 5ITZB 5FL7G 2XAFA 4X65B 5GONB 3J80N 3ABLB 1YITV 5BMVA 4TUYA 1KC8W 3K0GA 2IU0A 4DV6O 4K0KB 1US6A 4O4IB 3M8AA 2WLHA 3D3IA 3JD4A 4JI8O 5FPOA 2XOKG 5KMGA 2XAJA 3B77A 4ZKIA 2QWQB 4GX1A 3CD6V 5LMUO 1LUVA 1GM7A 2GHYA 5FNVB 2YDEA 2UXBO 1N4CA 4XDJA 2OYQA 4MSWC 5BXZA 1S76D 1YVWA 3CP1A 4RO2A 3EXAA 3CRAA 3OW2U 3APOA 3LUTB 2YIBD 3FB5C 3U11A 2WA4A 2GDSA 1SQPH 5EBWC 2EINB 3FB7C 3HKEA 2YUAA 5JH7B 1M56C 3GWKC 1F7YA 4LFAB 1OHHG 1VIBA 1M93A 4UCOA 1RSOB 4Z1MG 2PF4E 2GTAA 4JV5B 1YCIA 2HR3A 1S0VA 2AW9A 2P6JA 2AZ2A 3L73H 2ZE5A 2E3CA 3CRRA 3CCLV 1K33A 2WPDG 3B8NA 3HKBA 3P30A 3N2KB 3LNNA 1KYOF 4JI1B 4PV1B 1QR8A 2YIDA 3S3WA 1HNXO 3UKMA 4JI7O 2ZDIC 1QLNA 3SJBC 3AK2A 1YI2V 2Y69C 1L1FA 5H5NA 2HJDA 2W0XA 3G67A 4LF6O 3WG7C 1FXKC 3L71H 1KQSU 1ROPA 3OR7C 1PM9A 2QWOB 5BY1A 1IURA 4Z1VA 1MA1A 1VQOV 1BT8A 3K9SA 3QF7A 1SZTA 1GM8A 1G6UA 4U3JB 4MS2A 1D2DA 5LHIA 5LOVA 1Y4MA 2R70A 2ZXWC 4LP8A 3LNMB 4YHHB 4LH7A 1THZA 2YXYA 1FAFA 5IJ9B 1N34B 4ASUG 4X64O 1SQBH 4W4LA 3AG4C 4F6EA 1WN7A 3F5TA 1XNQO 4JI6B 2QSAA 2ZNJA 2DWEC 1XMQB 3OGCC 1SQQH 1N33O 3JAWA 1P4RA 4JTAB 2A79B 1YJWV 4EFBA 3CCMV 3A0HZ 2UUCB 4Q6GA 2DOSA 3W7SA 2Q6AA 3TCUA 5DN6G 4YY3O 5IYBO 3ZJZA 3LDCA 3M7MX 4DR1O 3IC7A 2JDIG 4NTYA 1QU7A 1K4DC 2CH7A 2QM8A 1F4NA 1BL8A 4NXNO 3STZC 5K1XA 1YIJV 3ZHVA 3HKCA 2PUSA 3DC6A 1KD1W 3RW0A 3BA8A 1S5HC 4IHJA 2YIAA 3CWBH 3CXHF 4UVBA 1PP9H 1H2NA 3NXSA 4N21A 1Z2GA 1Q8IA 1URFA 2B1GA 4AILC 2OIGA 1SRYA 4MTXA 2Q7HA 1AJPA 2X6BA 2B9ZA 3E89A 3P3PA 4X1KB 5J2TB 3QO5A 1M9NA 5IDJA 1OCZC 4B3MB 5CB4A 3S3XA 2HEPA 1AR4A 3QG5A 2DYSB 3ASOB 3KCYA 1KP2A 5EIBC 1AROP 4KFMA 4TSFG 3T1HO 4B3SO 4WF9V 4GT1A 1JX9A 1IX9A 1A32A 1KKDA 1ORQC 1Q3EA 4DR5O 4KUMA 1FD9A 4DV3B 1R6KA 4B3RB 1TUBB 2Q7EA 2LGWA 3MDSA 4WFBV 5HFLA 4PDMA 4X66B 2BSKA 3WB1A 5L3EA 1I0HA 4J11A 4FLZA 4IT5A 4FLVA 3OTOB 1CPYA 3RYFB 1SQVH 1HDJA 2LJ2A 2P67A 4MVSA 1GKFA 2AXTZ 3F7YC 2WLIA 2NNUA 2LQTA 2X6CA 4GX5A 4X20A 4BW5A 4NTWA 3SJQC 1MZEA 3GVMA 2UUAB 2JJ1G 1M57B 1Y74A 3SDLA 4UCVA 3BEHA 2YS8A 4QE7A 5LL6Y 4K35A 1CXZB 4DV7O 1EM1A 2RN9A 1MSWD 3OMIB 5IWAO 3KZIZ 1IXBA 2MK3A 4MVQA 4GYCB 2ZM6B 5BMVB 4B7EA 4TUYB 5A2QN 4GKKO 1MSDA 1OZ0A 4DW0A 1VARA 4JI4O 2OCCB 1V54B 5LGTA 3PJSK 2DYRB 2UXCO 4DUZO 4JF3A 1IBKB 3CC2V 3TK1A 3SR2C 2EILB 5K1PA 2WLMA 3JAKA 3M99B 4I0XA 1N0NA 5E79Z 1M4UA 1BSMA 4NVPA 3UQ8A 4PELA 1B3QA 1Z5WA 4R8CA 2WA3A 3SPCA 2Q73A 1WB7A 2WAMA 3CSXA 4X1IA 3J7AU 2QWPB 2F66C 3ZS8C 1JCHA 5IYZB 1OCRC 3JASB 1M5IA 3D36C 4WFHA 3CYOA 4W4KA 1W59A 1VQ9V 1OJHA 4FFKA 2PYJA 2LP7A 1WB8A 5B1NA 1TAEA 3K58A 3SPIA 1O9HA 1Q6HA 1E1QG 2AHZA 4D6TH 5AG2A 1H2GA 4I9QA 3IC9A 2DW4A 2EIMB 1BGYH 5LHHA 5IJ0A 1E1RG 3ZBHA 4CZZA 1XL4A 2BE3A 2DQ0A 1AB3A 1XDCA 3ZMVA 2RDCA 4JZ2A 3T1YO 1MZFA 3UM7A 3H1KH 3MHHC 4FK5C 5EC2C 4LFBO 3OAAG 1PKXA 1IXMA 2JVDA 1WP8A 4I50B 5B1BB 4J7ZA 3UCSC 2ZIMA 3AG1B 2CDYA 1DF5A 3HKBB 1GN6A 4NXMO 4MTOA 2X0LA 3JAMN 5LP6C 4CBCA 3RYCB 1KECA 3E8HA 4JYBA 5EYPB 1IVSA 5C8YA 4XDKA 2GSMB 2JIZG 5CA0A 2VQFB 1MOFA 2R72A 3AG2C 1SETA 2V1DA 2QKSA 1H2KA 4LF5O 4FLXA 2IU3A 3ETEA 1OCOC 2P90A 3C90A 4GKJB 3OMAB 2Q5ZA 1X4TA 5EC1C 1HNWO 3CJHA 2EULA 3JYCA 2B5UA 3E8BA 1IBLO 3OGIB 4HNAA 4IIJA 5J9PC 3DGEA 3ETGA 4ZHQA 3RYHA 2CTWA 1Q86W 5LMNB 4DR6O 4J7JA 2ZCEA 2HP8A 2A06H 5LOVB 1SESA 1WJZA 2ILMA 3TETA 1AJNA 2N05A 3K5OA 4MW3A 3O65A 1YTFB 2FB5A 3UT5A 1RPRA 5B66Z 4PJ0Z 5GW7A 2AHYA 1AILA 4JI5O 4EB6A 1WLEA 3N2GA 2F4VO 1BE3H 4UCUA 1V55C 4L8JA 4DK0A 5B3SB 4JI0B 1EZJA 3FAVA 3Q4HA 4GZRB 2LO1A 5J2UA 3CCEV 2KSDA 3PN1A 4K8XA 3G6EV 4NKGB 1ZAUA 3A0RA 2MW2B 2ZNIA 1GO3F 1D5NA 1NT2B 1X59A 4OPAA 4LF7O 2E76B 2XAHA 3NR7A 2YICA 2VQEO 2HG5C 1TVKA 5BR8B 3SJCC 2B1IA 4DV5O 2VWKA 3JSNA 2LFRA 3QVNA 2DQ3A 4DR7B 4KHPB 2OTLV 3CPWU 2YSUB 4JAAA 3K5MA 4UUJC 4X65O 1YZBA 3ASOC 1AVMA 1FXVA 3CE2A 4UCTA 3F5WC 1H2SB 2ITDC 1K9MW 3VOUA 4K0KO 3ETDA 4E4EA 1K4CC 1Q6IA 1QHTA 2ZIOA 3AK1A 1SA0A 1N0JA 5CB4B 4LF9O 3ABMB 3K5LA 2Q0AA 3RGBA 1P7GA 1B06A 4TV9A 1Y66A 4MTGA 2VRZA 3IJ4A 4LC1A 2RNBA 5LGUA 2FTKA 1VF6C 2XNDG 4MVUA 2BSKB 2NLJC 3JSLA 2A3QA 4P30A 4YJ2A 2JGDA 1TUEB 2EZPA 5CA1A 4LFAO 3VQXA 4TV8A 5LA6B 2XASA 2YXHA 2HLDG 2XTAA 1ZLZA 1YJ9V 2DJVA 4RQFA 3I5DA 3R65A 3H1LH 2WLIB 4J10A 4X20B 2ZE6A 1Y74B 3LSUA 1PNLA 1V54C 3A2FA 2DYRC 5D5PA 1RM1B 3E35A 1M90W 4N23A 4Q20A 3JCZA 2Q67A 4JI1O 4IYHA 4FM0A 1N8RW 3ZHSA 2EILC 4H44B 1WA8A 1Y76A 3RYIB 1COWG 2Y0IA 5JJJB 2Z5UA 2WLNA 3SGIA 3W7TA 2OWOA 3E83A 2EJ7A 2PY5A 2H8PC 5L3FA 4PDLA 4DV6B 4WBNA 3I56V 1PL0A 4JI8B 4JZGA 4IYIA 1MG1A 3JAKB 4I0XB 2OTJV 2F93B 1NTZH 2EIMC 3TJTA 1OV9A 4X1IB 1NR1A 4B3TO 4XBFA 4EFEA 4P9PA 2UXBB 1WPBA 4FM2A 1LR1A 2KG7A 2ZDIA 4JTCB 2EJRA 1NJIW 5KHJA 4DV2B 3AG1C 5KHHA 5KUMA 1QQCA 4JI6O 1FXKA 1XMQO 4DR2B 1L8DA 1PD3A 1XEQA 1W2BU 1XILA 2BCCH 2UXDB 4XDLA 5JJNB 2UUCO 3CCRV 1YJNV 2Q7GA 3ABTA 1JA8A 1EBOA 1YTFD 3OMNB 4O4JA 1GN3A 1K73W 1AP6A 5L3GA 4K3AA 1KUQA 2GUZA 2UUBO 5JQGA 5D5QA 2G38A 5CMUA 3IAYA 2GV9A 4NB5A 4YJ3A 4ZBMA 5JWPA 5LYJB 1GTOA 3JD2A 5KHKA 3ZN1A 3H1IH 4CC6A 2FKXA 3HKDA 5C8YB 5KX5B 3RFRA 4DR4O 5CA0B 3X2QC 3TGUH 3E2EA 4LF4B 4X88A 4HZ3A 1NZ6A 1ENVA 4PA4A 2YEVA 4DV0B 3JALB 1K92A 2DWDC 3K03A 2EZOA 1IDSA 3E86A 3OE7G 4NTXA 2WLLA 1JFFB 1WNSA 2HVJC 4JI3O 1LNQA 3CJHB 2IBZH 4DW1A 4JI7B 3ETQA 1HWYA 4HNAB 1I94O 4NR1A 1TA8A 3ASNB 2XHBA 3A0BZ 4B3MO 1L0NH 4ZHQB 2WSSG 4LF6B 1GM9A 1O9GA 3RYHB 1F23A 5KHIA 2V4DA 4GX0A 2K9PA 4I9WA 1XNRB 2WWWA 3CCSV 2LFSA 3FX7A 4FIPC 4QJFB 2OCHA 1LUWA 5EBMC 4HAMA 3UT5B 4FLTA 3QNEA 2P4KA 4B3RO 2BTOA 4G28B 4UCSA 4EB6B 1NKDA 3T4DA 3VBBA 1KU9A 5LXTA 2HFEC 1Y6XA 2O57A 4I55A 3FAVB 4DRXA 3Q4HB 2PGGA 5J2UB 4JI2O 1G1XB 3OTOO 5JVDA 2Y48A 4CH4A 2QTOA 1XNQB 1DLBA 5KA6A 1G8MA 1SQGA 1IBMO 4B7KA 4YXWG 1S5JA 2RCVA 2EIJB 2OT5A 3K59A 3P32A 3ZMZA 5CBGA 4JPRA 2K1EA 2EIKB 4R50A 2QEXV 5DEDA 3JCUZ 4YY3B 4HYOA 2GTSA 2YXLA 4O2AA 4DV4O 4OX9B 4DR1B 1XL6A 3CX5F 2JEUA 5H6QA 4DV1B 3FKSG 1CEZA 4NXNB 2JRIA 4H13B 3JARA 4MVZA 4CC5A 3ZMTA 3A8TA 2H94A 1XBLA 1GMGA 1IBKO 3ABLC 1KMIZ 3OUSA 2ZE8A 3OT7A 2L6LA 4TWKA 1SA0B 3JATA 4O4IA 4WFGA 4ZOLA 4OGQB 1SKVA 2A7WA 2QTSA 2Q8VA 4UFZA 3CCJV 3ML0A 3ZX6A 2UXXA 2CTQA 3G80A 1VMGA 2NR5A 4B3SB
chains in the Genus database with same CATH topology
2Q8VA 1OJHA 2QDOA 3CS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8V A;  1OJH A;  2QDO A;  3CS5 A; 
#chains in the Genus database with same CATH topology
 1XHX A;  4F4L A;  2P7T C;  5DEC A;  3K9A A;  4YJ2 B;  4FPP A;  2JGD B;  4LCU C;  5CA1 B;  2CAZ C;  2YI8 A;  4I4T A;  2AGA A;  1JMK C;  4TV8 B;  1I7F A;  1YSC A;  5KMG B;  1QLE B;  1F51 A;  2Y4T A;  3DC5 A;  1ZTE A;  4FJC C;  5JCO C;  2Q9L A;  1Q90 D;  4X8A A;  1F4M A;  2EIN C;  3CME V;  1ZUQ A;  5LHG A;  4ABM A;  2IJI A;  3DXR A;  3D36 A;  3T1C A;  5F2V O;  2PZS A;  2OIE A;  3MHS C;  2ETN A;  4GUN A;  3G6B A;  3D8C A;  4X62 B;  4WFF A;  2VQF O;  4DR3 B;  1WA8 B;  1Y76 B;  4BIU A;  1M56 B;  3N2K A;  3HKE B;  1S3J A;  3FFQ A;  2P4V A;  4H33 A;  4LFC O;  4IGG A;  4QIW F;  3BPZ A;  3FB6 C;  1HNZ O;  4GKJ O;  2ZIN A;  1DK1 A;  2JK5 C;  5A9G A;  4GKK B;  3B40 A;  4LF8 B;  4WBN B;  1XMO B;  1VQ6 V;  2KB1 A;  1ZWI C;  4JYY A;  2QWR B;  5LP6 A;  1YDX A;  3ZIA G;  3OEH G;  5LMN O;  4WFE A;  4LWS A;  5DM6 V;  4O2B A;  2X6A A;  4MVM A;  3OTF A;  2QWN B;  5IYD O;  3DSQ A;  3UO2 A;  4TQD A;  1BHA A;  2HVK C;  4QE9 A;  4LR3 A;  3RVZ A;  2Y0P A;  4JYA B;  5KAI Z;  4DK1 A;  2KG7 B;  3AK3 A;  2PI4 A;  2Y69 B;  1YXB A;  3ZRW A;  4PDV A;  2FL4 A;  2PTM A;  2ZQM A;  4LNU A;  3WG7 B;  1XHZ A;  1FXK B;  5B5E Z;  3HR0 A;  4JI0 O;  3RVY A;  4YIP A;  1QCE A;  1SF9 A;  3E8F A;  3K79 A;  2CGN A;  4C7U A;  5H6R A;  4EEQ A;  2HKO A;  1XI1 A;  3WU2 Z;  4GCZ A;  3LDD A;  3MAQ A;  1HR0 O;  2AZ0 A;  4O4J B;  3BRC A;  2IH1 C;  3CRQ A;  2ZXW B;  1OCC B;  1NU1 H;  1XUQ A;  2GUZ B;  4G27 B;  1VF5 B;  3T1Y B;  5KA5 A;  2XUM A;  3HB3 B;  5EZY A;  5JQG B;  3VQW A;  4LFB B;  1K8A W;  4DR7 O;  3HKD B;  4KHP O;  3SJA C;  4NXM B;  4DUY B;  1L0L H;  2ODM A;  3B09 A;  1J5E B;  1AJQ A;  2M6Y A;  3JD0 A;  2ADQ B;  4KL1 A;  4FVM A;  3JAW B;  2WLL B;  2PI5 A;  3F7V C;  1NH2 D;  1FJG O;  5FPR A;  3CS5 A;  1JQ0 A;  1I08 A;  1WPX A;  1IZ3 A;  1P49 A;  5IY5 B;  3JD1 A;  3ZMU A;  1N32 B;  1HNW B;  1Y67 A;  2LW7 A;  1IBL B;  3P3N A;  1P84 F;  2CH7 B;  3BHP A;  1FKA O;  3HKC B;  2CUG A;  4I5S A;  2Y4U A;  3L72 H;  1R6N A;  2DYS C;  4IHJ B;  1NR7 A;  4UCR A;  5CBH A;  3OEE G;  3ZCC A;  1VQ5 V;  2IW5 A;  2UXN A;  5E1A C;  4I55 B;  1Z5V A;  4ZIB A;  4DRX B;  2EIK C;  1TUB A;  4CH5 A;  1P7B A;  3W7X A;  5JVD B;  4KXR A;  2F4V B;  2QKA A;  1G4Y B;  1NI8 A;  2Q0O C;  2QKC A;  1K97 A;  3AG7 A;  5GTH Z;  2Z0A A;  3QO7 A;  1FFT B;  1NS1 A;  4CS4 A;  1I5Y A;  3QO8 A;  2WLK A;  2ZR2 A;  1GN2 A;  4R7C A;  5IT9 N;  2FML A;  1DGS A;  4MVO A;  1VF6 A;  4BAY A;  2JS5 A;  4O2A B;  4ZI7 A;  3ZRX A;  4PD4 F;  4ICG A;  1M57 C;  3L75 H;  3D3Q A;  4AQY B;  4DV5 B;  3E8G A;  2E5L B;  3JAR B;  4RQE A;  1SC5 B;  4UVC A;  1S5L Z;  4PA6 A;  2L35 A;  2Q69 A;  1K5S A;  2JJ2 G;  2UU9 B;  4JV5 O;  1NVP B;  1AI6 A;  2BTQ A;  3IGA C;  4RWU A;  1XRE A;  3JAT B;  1EN5 A;  4ZOL B;  4X9Q A;  4P2Z A;  2W6I G;  1EN4 A;  1SQX H;  1FXH A;  1U96 A;  2NN4 A;  3QTC A;  2OCC C;  3SPH A;  1SQF A;  1QLE C;  2JGU A;  1QR9 A;  4LF9 B;  2ZR3 A;  4F6R A;  3AG3 B;  1N36 B;  2GBO A;  5KAF Z;  2QA4 V;  4UVA A;  2HHH B;  1U97 A;  2HJF C;  2R9R B;  2XAG A;  4U7N A;  3C3S A;  2M7W A;  1K34 A;  3FYE B;  4DV2 O;  2N04 A;  3K06 A;  1VQL V;  1UJW B;  4FZ0 A;  5IYZ A;  5B1O A;  4I4T B;  3JAS A;  4DR2 O;  1K3E A;  1GH6 A;  3RT3 C;  4O4L A;  2F43 G;  1FPO A;  5IE9 A;  4LH6 A;  1DF4 A;  2UXD O;  1PL4 A;  3SYO A;  3H9V A;  3K5N A;  2YIB A;  1FFX A;  3ABU A;  1NBM G;  1Q81 W;  5LMU B;  3DXR B;  5FLX N;  1MAB G;  2CK3 G;  1OCR B;  4YHH O;  1GN4 A;  2H3O A;  1N34 O;  1H2L A;  3VQY A;  2N74 A;  3EVK A;  2F1M A;  4I50 A;  1EFR G;  3RWR D;  5B1B C;  4MTF A;  2QE7 G;  1AR1 B;  4LF4 O;  2ZKO A;  3BA9 A;  5CBF A;  4CH3 A;  4DV0 O;  3RYC A;  2W6J G;  4H0L B;  5EYP A;  5IJ0 B;  4PDR A;  1JOY A;  4EKW A;  4UXN A;  2QM7 A;  3H1H H;  2IH3 C;  4DXW A;  1BS3 A;  4O4H A;  1EN6 A;  5LP6 B;  2Z3Y A;  1Q7Y W;  4OXS A;  1SER A;  4LWS B;  4O2B B;  5B1A B;  4NYK A;  4RUE A;  3G4S V;  1XNR O;  4D7S A;  1XOU A;  4MVR A;  4FZ1 A;  3CCV V;  1UFI A;  1VF7 A;  3HPL C;  2YC0 A;  3K08 A;  3AG2 B;  2XAQ A;  4Z2W A;  5KUK A;  4BR6 A;  1R3K C;  1NTK H;  2JEX A;  4PA9 A;  3ZRW B;  1OCC C;  1E79 G;  4TT3 G;  3GWO A;  1OCO B;  4U7O A;  4B3T B;  1VQN V;  4JYC A;  4LNU B;  1HNX B;  4CS3 A;  2QR4 A;  4FM1 A;  3H1J H;  3CHX A;  5HFM A;  4IIJ B;  4GX2 A;  3T4Z A;  4LBE C;  1HW7 A;  2P06 A;  3FB8 C;  4PA7 A;  2CTP A;  3FYI B;  2QDO A;  4J42 A;  3L9D A;  1ZL8 A;  5B3S C;  2ARH A;  3ZED A;  1W0K G;  4QNH B;  1K5Q A;  1M1K W;  5EZY B;  3T2M A;  3CC4 V;  5LBQ A;  4DV3 O;  1MMM A;  1R3I C;  4PA3 A;  3B8M A;  2ZD9 A;  1NQT A;  4E2L A;  3N2G B;  1VQ7 V;  1V55 B;  2BOC C;  4TQF A;  5IY5 C;  2UUB B;  3ZRV A;  4OX9 O;  3BVO A;  4AHC A;  4DV1 O;  3ABK B;  4X66 O;  4JAU A;  4X64 B;  4JGS A;  3J81 N;  3SYP A;  5EIB D;  3CRM A;  1BMF G;  4DR4 B;  4RAI A;  4CH6 A;  1B04 A;  3R66 A;  1AI5 A;  3CCU V;  2FYU H;  3LSS A;  4MW8 A;  4FFB A;  4QGP A;  3JD3 A;  1N33 B;  2XT9 A;  2EBO A;  1YHQ V;  4BW9 A;  3K3W A;  3O9O A;  3ZMS A;  2UUA O;  4FLY A;  2C2A A;  4JI3 B;  1HP8 A;  1TVK B;  1NH2 B;  3E22 A;  4X1Y A;  1SS3 A;  5JJE B;  1I94 B;  1GAX A;  4YIO A;  3L70 H;  1VEW A;  5C93 A;  3FD9 A;  3ZHT A;  2DN9 A;  1WAZ A;  3BAA A;  3ABM C;  4MT8 A;  3WFV A;  2E75 B;  3CMA V;  2ZM6 O;  1NVP D;  4DYL A;  3L74 H;  4R6Z A;  4UV8 A;  5ITZ A;  4QPK A;  1VQK V;  1H8H G;  2EX3 A;  3STL C;  3KCX A;  2QM4 A;  5GON A;  1R73 A;  5L3C A;  1R3J C;  4BIO A;  5IYC O;  3SYA A;  4X89 A;  1H2M A;  4QPJ A;  5GTI Z;  3UO3 A;  1PPJ H;  2BOB C;  1TGO A;  3MD0 A;  2P22 C;  2VS0 A;  1QBZ A;  2KQX A;  4I7Z B;  4UB6 Z;  4JI2 B;  5LA6 A;  2IM9 A;  2D3O W;  1R1B A;  4UV9 A;  4TV9 B;  4PI0 A;  4J9Y B;  3OD4 A;  4J7K A;  3U10 A;  1EZV H;  1W0J G;  2A9H A;  2DMX A;  4A5U B;  3I55 V;  5FNV A;  4JTD B;  1CP9 A;  2RJZ A;  1IBM B;  3N27 A;  3T1H B;  1D5A A;  1RPO A;  4ZI7 B;  2LGQ A;  3W7W A;  4X62 O;  4DR3 O;  4DR5 B;  3K0D A;  1AI4 A;  1RM1 C;  1H38 A;  2CTR A;  1MNG A;  1VQP V;  4AI8 A;  4K8Z A;  3AG3 C;  4DV4 B;  5JCO A;  2RMK B;  3G71 V;  3RYI A;  1AP5 A;  2BTQ B;  2Q4P A;  3ZHQ A;  5JH7 A;  2R9I A;  3CC7 V;  1JPX A;  4LF8 O;  1GRJ A;  1QNM A;  1VQ4 V;  2LW1 A;  1XMO O;  1JR9 A;  4WCE V;  1RSO A;  4PHZ A;  3SPJ A;  2YI9 A;  1Q43 A;  1R6T A;  3C3T A;  2E74 B;  3THO A;  1Q6U A;  1FS0 G;  4F6R B;  2CE4 A;  4CS2 A;  4JYA O;  4J9Z B;  5CA3 A;  2IJH A;  4DV7 B;  2KKW A;  2CGO A;  3VQV A;  4D7T A;  5CN0 A;  4H37 A;  4U3F H;  4J80 A;  3ZHR A;  3ICX A;  1JVM A;  5IWA B;  2R9A A;  4L87 A;  5L3B A;  4O4L B;  3CEI A;  2D2C B;  1ZSP A;  2JS3 A;  4JI4 B;  3EHB B;  2DE0 X;  2QGN A;  2UXC B;  3TXQ A;  4OPH A;  4DUZ B;  1KKC A;  2ADP A;  5H9C A;  1FFX B;  1AR5 A;  3GB7 C;  1S72 V;  3B4S A;  1GK9 A;  5EK0 A;  1DTO A;  4U3J A;  1ZX3 A;  2ZT9 B;  3RN4 A;  4DUY O;  3SYQ A;  1J5E O;  4J41 A;  5B1A C;  5IJ9 A;  5LYJ A;  1Q82 W;  4PI2 A;  5KX5 A;  3U0Z A;  3KKY A;  5H2F Z;  1K7D A;  3JAL A;  3BCC H;  2ZE7 A;  3KG2 A;  3IFX A;  1RP3 B;  4LFC B;  1JJO A;  3H01 A;  3RBZ A;  4FMT A;  1JFF A;  4DO2 A;  1HNZ B;  1T5E A;  2ITC C;  2VWJ A;  1BCC H;  2PYL A;  2P5O A;  3LSQ A;  4O4H B;  1N32 O;  1J95 A;  2W0F C;  5BR8 O;  3SYC A;  3CB2 A;  3K57 A;  3APQ A;  3AG4 B;  4P9O A;  2F95 B;  4YJ3 B;  1AI7 A;  1PNK A;  1PV0 A;  4WFA V;  3ASN C;  3X2Q B;  3BY6 A;  3OUF A;  3TXS A;  1R3L C;  2YEV B;  1YF2 A;  2Q68 A;  2WLJ A;  3OFN G;  1BQ0 A;  2V7Q G;  3WB0 A;  1BHB A;  1KB9 F;  3CXC U;  2X7R B;  1S77 D;  2IJK A;  4B08 A;  3DTU B;  1I5X A;  4JAS A;  4LF5 B;  1PNM A;  3BAB A;  5EBL C;  1BZK A;  4TOI A;  1FYJ A;  2RQ6 A;  3ABK C;  1NTM H;  1ZL8 B;  5BZB A;  1BQZ A;  1XQ8 A;  1KBH A;  4X1K A;  2QJ1 A;  1VQM V;  5J2T A;  1UPG A;  1HR0 B;  3CCQ V;  4G2K A;  5L3D A;  3AEI A;  4HBN A;  4DR6 B;  2F23 A;  1VQ8 V;  5LXT B;  4KP4 A;  3EFF K;  4AQY O;  2EIJ C;  1QVG U;  4BWA A;  1SZX A;  4FLU A;  3BFR A;  3OM3 B;  3ZN0 A;  1RFY A;  2E5L O;  4JI5 B;  5LGN A;  1QVF U;  1V9P A;  1OCZ B;  3OR6 C;  4GLX A;  1Q5O A;  2UU9 O;  4FFB B;  3K04 A;  3ZRS A;  3LDE A;  3SPG A;  1H8E G;  3WB2 A;  1VP7 A;  1YEW A;  2ATK C;  5TIS Z;  3RYF A;  1JJ2 U;  1KP3 A;  3E22 B;  1FJG B;  4X1Y B;  5KLV H;  4BIZ A;  1B6Q A;  4JAV A;  3CRC A;  3W7U A;  4LF7 B;  4UB8 Z;  5KHG A;  2IJJ A;  1N36 O;  4IL6 Z;  4RUF A;  2VQE B;  1WP7 A;  3B2E E;  2A0L A;  2HHH O;  3ZHU A;  4FLW A;  5ITZ B;  5FL7 G;  2XAF A;  4X65 B;  5GON B;  3J80 N;  3ABL B;  1YIT V;  5BMV A;  4TUY A;  1KC8 W;  3K0G A;  2IU0 A;  4DV6 O;  4K0K B;  1US6 A;  4O4I B;  3M8A A;  2WLH A;  3D3I A;  3JD4 A;  4JI8 O;  5FPO A;  2XOK G;  5KMG A;  2XAJ A;  3B77 A;  4ZKI A;  2QWQ B;  4GX1 A;  3CD6 V;  5LMU O;  1LUV A;  1GM7 A;  2GHY A;  5FNV B;  2YDE A;  2UXB O;  1N4C A;  4XDJ A;  2OYQ A;  4MSW C;  5BXZ A;  1S76 D;  1YVW A;  3CP1 A;  4RO2 A;  3EXA A;  3CRA A;  3OW2 U;  3APO A;  3LUT B;  2YIB D;  3FB5 C;  3U11 A;  2WA4 A;  2GDS A;  1SQP H;  5EBW C;  2EIN B;  3FB7 C;  3HKE A;  2YUA A;  5JH7 B;  1M56 C;  3GWK C;  1F7Y A;  4LFA B;  1OHH G;  1VIB A;  1M93 A;  4UCO A;  1RSO B;  4Z1M G;  2PF4 E;  2GTA A;  4JV5 B;  1YCI A;  2HR3 A;  1S0V A;  2AW9 A;  2P6J A;  2AZ2 A;  3L73 H;  2ZE5 A;  2E3C A;  3CRR A;  3CCL V;  1K33 A;  2WPD G;  3B8N A;  3HKB A;  3P30 A;  3N2K B;  3LNN A;  1KYO F;  4JI1 B;  4PV1 B;  1QR8 A;  2YID A;  3S3W A;  1HNX O;  3UKM A;  4JI7 O;  2ZDI C;  1QLN A;  3SJB C;  3AK2 A;  1YI2 V;  2Y69 C;  1L1F A;  5H5N A;  2HJD A;  2W0X A;  3G67 A;  4LF6 O;  3WG7 C;  1FXK C;  3L71 H;  1KQS U;  1ROP A;  3OR7 C;  1PM9 A;  2QWO B;  5BY1 A;  1IUR A;  4Z1V A;  1MA1 A;  1VQO V;  1BT8 A;  3K9S A;  3QF7 A;  1SZT A;  1GM8 A;  1G6U A;  4U3J B;  4MS2 A;  1D2D A;  5LHI A;  5LOV A;  1Y4M A;  2R70 A;  2ZXW C;  4LP8 A;  3LNM B;  4YHH B;  4LH7 A;  1THZ A;  2YXY A;  1FAF A;  5IJ9 B;  1N34 B;  4ASU G;  4X64 O;  1SQB H;  4W4L A;  3AG4 C;  4F6E A;  1WN7 A;  3F5T A;  1XNQ O;  4JI6 B;  2QSA A;  2ZNJ A;  2DWE C;  1XMQ B;  3OGC C;  1SQQ H;  1N33 O;  3JAW A;  1P4R A;  4JTA B;  2A79 B;  1YJW V;  4EFB A;  3CCM V;  3A0H Z;  2UUC B;  4Q6G A;  2DOS A;  3W7S A;  2Q6A A;  3TCU A;  5DN6 G;  4YY3 O;  5IYB O;  3ZJZ A;  3LDC A;  3M7M X;  4DR1 O;  3IC7 A;  2JDI G;  4NTY A;  1QU7 A;  1K4D C;  2CH7 A;  2QM8 A;  1F4N A;  1BL8 A;  4NXN O;  3STZ C;  5K1X A;  1YIJ V;  3ZHV A;  3HKC A;  2PUS A;  3DC6 A;  1KD1 W;  3RW0 A;  3BA8 A;  1S5H C;  4IHJ A;  2YIA A;  3CWB H;  3CXH F;  4UVB A;  1PP9 H;  1H2N A;  3NXS A;  4N21 A;  1Z2G A;  1Q8I A;  1URF A;  2B1G A;  4AIL C;  2OIG A;  1SRY A;  4MTX A;  2Q7H A;  1AJP A;  2X6B A;  2B9Z A;  3E89 A;  3P3P A;  4X1K B;  5J2T B;  3QO5 A;  1M9N A;  5IDJ A;  1OCZ C;  4B3M B;  5CB4 A;  3S3X A;  2HEP A;  1AR4 A;  3QG5 A;  2DYS B;  3ASO B;  3KCY A;  1KP2 A;  5EIB C;  1ARO P;  4KFM A;  4TSF G;  3T1H O;  4B3S O;  4WF9 V;  4GT1 A;  1JX9 A;  1IX9 A;  1A32 A;  1KKD A;  1ORQ C;  1Q3E A;  4DR5 O;  4KUM A;  1FD9 A;  4DV3 B;  1R6K A;  4B3R B;  1TUB B;  2Q7E A;  2LGW A;  3MDS A;  4WFB V;  5HFL A;  4PDM A;  4X66 B;  2BSK A;  3WB1 A;  5L3E A;  1I0H A;  4J11 A;  4FLZ A;  4IT5 A;  4FLV A;  3OTO B;  1CPY A;  3RYF B;  1SQV H;  1HDJ A;  2LJ2 A;  2P67 A;  4MVS A;  1GKF A;  2AXT Z;  3F7Y C;  2WLI A;  2NNU A;  2LQT A;  2X6C A;  4GX5 A;  4X20 A;  4BW5 A;  4NTW A;  3SJQ C;  1MZE A;  3GVM A;  2UUA B;  2JJ1 G;  1M57 B;  1Y74 A;  3SDL A;  4UCV A;  3BEH A;  2YS8 A;  4QE7 A;  5LL6 Y;  4K35 A;  1CXZ B;  4DV7 O;  1EM1 A;  2RN9 A;  1MSW D;  3OMI B;  5IWA O;  3KZI Z;  1IXB A;  2MK3 A;  4MVQ A;  4GYC B;  2ZM6 B;  5BMV B;  4B7E A;  4TUY B;  5A2Q N;  4GKK O;  1MSD A;  1OZ0 A;  4DW0 A;  1VAR A;  4JI4 O;  2OCC B;  1V54 B;  5LGT A;  3PJS K;  2DYR B;  2UXC O;  4DUZ O;  4JF3 A;  1IBK B;  3CC2 V;  3TK1 A;  3SR2 C;  2EIL B;  5K1P A;  2WLM A;  3JAK A;  3M99 B;  4I0X A;  1N0N A;  5E79 Z;  1M4U A;  1BSM A;  4NVP A;  3UQ8 A;  4PEL A;  1B3Q A;  1Z5W A;  4R8C A;  2WA3 A;  3SPC A;  2Q73 A;  1WB7 A;  2WAM A;  3CSX A;  4X1I A;  3J7A U;  2QWP B;  2F66 C;  3ZS8 C;  1JCH A;  5IYZ B;  1OCR C;  3JAS B;  1M5I A;  3D36 C;  4WFH A;  3CYO A;  4W4K A;  1W59 A;  1VQ9 V;  1OJH A;  4FFK A;  2PYJ A;  2LP7 A;  1WB8 A;  5B1N A;  1TAE A;  3K58 A;  3SPI A;  1O9H A;  1Q6H A;  1E1Q G;  2AHZ A;  4D6T H;  5AG2 A;  1H2G A;  4I9Q A;  3IC9 A;  2DW4 A;  2EIM B;  1BGY H;  5LHH A;  5IJ0 A;  1E1R G;  3ZBH A;  4CZZ A;  1XL4 A;  2BE3 A;  2DQ0 A;  1AB3 A;  1XDC A;  3ZMV A;  2RDC A;  4JZ2 A;  3T1Y O;  1MZF A;  3UM7 A;  3H1K H;  3MHH C;  4FK5 C;  5EC2 C;  4LFB O;  3OAA G;  1PKX A;  1IXM A;  2JVD A;  1WP8 A;  4I50 B;  5B1B B;  4J7Z A;  3UCS C;  2ZIM A;  3AG1 B;  2CDY A;  1DF5 A;  3HKB B;  1GN6 A;  4NXM O;  4MTO A;  2X0L A;  3JAM N;  5LP6 C;  4CBC A;  3RYC B;  1KEC A;  3E8H A;  4JYB A;  5EYP B;  1IVS A;  5C8Y A;  4XDK A;  2GSM B;  2JIZ G;  5CA0 A;  2VQF B;  1MOF A;  2R72 A;  3AG2 C;  1SET A;  2V1D A;  2QKS A;  1H2K A;  4LF5 O;  4FLX A;  2IU3 A;  3ETE A;  1OCO C;  2P90 A;  3C90 A;  4GKJ B;  3OMA B;  2Q5Z A;  1X4T A;  5EC1 C;  1HNW O;  3CJH A;  2EUL A;  3JYC A;  2B5U A;  3E8B A;  1IBL O;  3OGI B;  4HNA A;  4IIJ A;  5J9P C;  3DGE A;  3ETG A;  4ZHQ A;  3RYH A;  2CTW A;  1Q86 W;  5LMN B;  4DR6 O;  4J7J A;  2ZCE A;  2HP8 A;  2A06 H;  5LOV B;  1SES A;  1WJZ A;  2ILM A;  3TET A;  1AJN A;  2N05 A;  3K5O A;  4MW3 A;  3O65 A;  1YTF B;  2FB5 A;  3UT5 A;  1RPR A;  5B66 Z;  4PJ0 Z;  5GW7 A;  2AHY A;  1AIL A;  4JI5 O;  4EB6 A;  1WLE A;  3N2G A;  2F4V O;  1BE3 H;  4UCU A;  1V55 C;  4L8J A;  4DK0 A;  5B3S B;  4JI0 B;  1EZJ A;  3FAV A;  3Q4H A;  4GZR B;  2LO1 A;  5J2U A;  3CCE V;  2KSD A;  3PN1 A;  4K8X A;  3G6E V;  4NKG B;  1ZAU A;  3A0R A;  2MW2 B;  2ZNI A;  1GO3 F;  1D5N A;  1NT2 B;  1X59 A;  4OPA A;  4LF7 O;  2E76 B;  2XAH A;  3NR7 A;  2YIC A;  2VQE O;  2HG5 C;  1TVK A;  5BR8 B;  3SJC C;  2B1I A;  4DV5 O;  2VWK A;  3JSN A;  2LFR A;  3QVN A;  2DQ3 A;  4DR7 B;  4KHP B;  2OTL V;  3CPW U;  2YSU B;  4JAA A;  3K5M A;  4UUJ C;  4X65 O;  1YZB A;  3ASO C;  1AVM A;  1FXV A;  3CE2 A;  4UCT A;  3F5W C;  1H2S B;  2ITD C;  1K9M W;  3VOU A;  4K0K O;  3ETD A;  4E4E A;  1K4C C;  1Q6I A;  1QHT A;  2ZIO A;  3AK1 A;  1SA0 A;  1N0J A;  5CB4 B;  4LF9 O;  3ABM B;  3K5L A;  2Q0A A;  3RGB A;  1P7G A;  1B06 A;  4TV9 A;  1Y66 A;  4MTG A;  2VRZ A;  3IJ4 A;  4LC1 A;  2RNB A;  5LGU A;  2FTK A;  1VF6 C;  2XND G;  4MVU A;  2BSK B;  2NLJ C;  3JSL A;  2A3Q A;  4P30 A;  4YJ2 A;  2JGD A;  1TUE B;  2EZP A;  5CA1 A;  4LFA O;  3VQX A;  4TV8 A;  5LA6 B;  2XAS A;  2YXH A;  2HLD G;  2XTA A;  1ZLZ A;  1YJ9 V;  2DJV A;  4RQF A;  3I5D A;  3R65 A;  3H1L H;  2WLI B;  4J10 A;  4X20 B;  2ZE6 A;  1Y74 B;  3LSU A;  1PNL A;  1V54 C;  3A2F A;  2DYR C;  5D5P A;  1RM1 B;  3E35 A;  1M90 W;  4N23 A;  4Q20 A;  3JCZ A;  2Q67 A;  4JI1 O;  4IYH A;  4FM0 A;  1N8R W;  3ZHS A;  2EIL C;  4H44 B;  1WA8 A;  1Y76 A;  3RYI B;  1COW G;  2Y0I A;  5JJJ B;  2Z5U A;  2WLN A;  3SGI A;  3W7T A;  2OWO A;  3E83 A;  2EJ7 A;  2PY5 A;  2H8P C;  5L3F A;  4PDL A;  4DV6 B;  4WBN A;  3I56 V;  1PL0 A;  4JI8 B;  4JZG A;  4IYI A;  1MG1 A;  3JAK B;  4I0X B;  2OTJ V;  2F93 B;  1NTZ H;  2EIM C;  3TJT A;  1OV9 A;  4X1I B;  1NR1 A;  4B3T O;  4XBF A;  4EFE A;  4P9P A;  2UXB B;  1WPB A;  4FM2 A;  1LR1 A;  2KG7 A;  2ZDI A;  4JTC B;  2EJR A;  1NJI W;  5KHJ A;  4DV2 B;  3AG1 C;  5KHH A;  5KUM A;  1QQC A;  4JI6 O;  1FXK A;  1XMQ O;  4DR2 B;  1L8D A;  1PD3 A;  1XEQ A;  1W2B U;  1XIL A;  2BCC H;  2UXD B;  4XDL A;  5JJN B;  2UUC O;  3CCR V;  1YJN V;  2Q7G A;  3ABT A;  1JA8 A;  1EBO A;  1YTF D;  3OMN B;  4O4J A;  1GN3 A;  1K73 W;  1AP6 A;  5L3G A;  4K3A A;  1KUQ A;  2GUZ A;  2UUB O;  5JQG A;  5D5Q A;  2G38 A;  5CMU A;  3IAY A;  2GV9 A;  4NB5 A;  4YJ3 A;  4ZBM A;  5JWP A;  5LYJ B;  1GTO A;  3JD2 A;  5KHK A;  3ZN1 A;  3H1I H;  4CC6 A;  2FKX A;  3HKD A;  5C8Y B;  5KX5 B;  3RFR A;  4DR4 O;  5CA0 B;  3X2Q C;  3TGU H;  3E2E A;  4LF4 B;  4X88 A;  4HZ3 A;  1NZ6 A;  1ENV A;  4PA4 A;  2YEV A;  4DV0 B;  3JAL B;  1K92 A;  2DWD C;  3K03 A;  2EZO A;  1IDS A;  3E86 A;  3OE7 G;  4NTX A;  2WLL A;  1JFF B;  1WNS A;  2HVJ C;  4JI3 O;  1LNQ A;  3CJH B;  2IBZ H;  4DW1 A;  4JI7 B;  3ETQ A;  1HWY A;  4HNA B;  1I94 O;  4NR1 A;  1TA8 A;  3ASN B;  2XHB A;  3A0B Z;  4B3M O;  1L0N H;  4ZHQ B;  2WSS G;  4LF6 B;  1GM9 A;  1O9G A;  3RYH B;  1F23 A;  5KHI A;  2V4D A;  4GX0 A;  2K9P A;  4I9W A;  1XNR B;  2WWW A;  3CCS V;  2LFS A;  3FX7 A;  4FIP C;  4QJF B;  2OCH A;  1LUW A;  5EBM C;  4HAM A;  3UT5 B;  4FLT A;  3QNE A;  2P4K A;  4B3R O;  2BTO A;  4G28 B;  4UCS A;  4EB6 B;  1NKD A;  3T4D A;  3VBB A;  1KU9 A;  5LXT A;  2HFE C;  1Y6X A;  2O57 A;  4I55 A;  3FAV B;  4DRX A;  3Q4H B;  2PGG A;  5J2U B;  4JI2 O;  1G1X B;  3OTO O;  5JVD A;  2Y48 A;  4CH4 A;  2QTO A;  1XNQ B;  1DLB A;  5KA6 A;  1G8M A;  1SQG A;  1IBM O;  4B7K A;  4YXW G;  1S5J A;  2RCV A;  2EIJ B;  2OT5 A;  3K59 A;  3P32 A;  3ZMZ A;  5CBG A;  4JPR A;  2K1E A;  2EIK B;  4R50 A;  2QEX V;  5DED A;  3JCU Z;  4YY3 B;  4HYO A;  2GTS A;  2YXL A;  4O2A A;  4DV4 O;  4OX9 B;  4DR1 B;  1XL6 A;  3CX5 F;  2JEU A;  5H6Q A;  4DV1 B;  3FKS G;  1CEZ A;  4NXN B;  2JRI A;  4H13 B;  3JAR A;  4MVZ A;  4CC5 A;  3ZMT A;  3A8T A;  2H94 A;  1XBL A;  1GMG A;  1IBK O;  3ABL C;  1KMI Z;  3OUS A;  2ZE8 A;  3OT7 A;  2L6L A;  4TWK A;  1SA0 B;  3JAT A;  4O4I A;  4WFG A;  4ZOL A;  4OGQ B;  1SKV A;  2A7W A;  2QTS A;  2Q8V A;  4UFZ A;  3CCJ V;  3ML0 A;  3ZX6 A;  2UXX A;  2CTQ A;  3G80 A;  1VMG A;  2NR5 A;  4B3S B; 
#chains in the Genus database with same CATH homology
 2Q8V A;  1OJH A;  2QDO A;  3CS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...