1OJHA

Crystal structure of nbla from pcc 7120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
b'IELSLEQQFSIRSFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NBLA
molecule tags Protein binding
source organism Anabaena sp. pcc 7120
publication title Crystal Structure of Nbla from Anabaena Sp. Pcc 7120, a Small Protein Playing a Key Role in Phycobilisome Degradation.
pubmed doi rcsb
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2003-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 1ojhA00
1OJHA 2QDOA 2Q8VA 3CS5A
chains in the Genus database with same CATH superfamily
3ZEDA 3T1YO 3AEIA 2HFEC 4R7CA 1HNWB 2QWNB 4GKKO 3MHSC 2GHYA 5EIBD 4OXSA 2JJ2G 3E8HA 2WLHA 1N8RW 2X0LA 5JJEB 5JVDA 5B1BC 5L3BA 1RM1B 1DF5A 1PP9H 1GM7A 4GX0A 4IHJB 3DXRB 3B4SA 2ILMA 1JMKC 1CEZA 5EZYB 4ZBMA 1FJGO 1KECA 2QM8A 1CPYA 3ZN1A 1N36B 4X20B 2B5UA 3Q4HA 5B1OA 5EYPB 3K9AA 1R3LC 1I0HA 4HYOA 4FJCC 1GKFA 1Q90D 1IXMA 2N05A 4I0XB 1P4RA 2LGQA 2QEXV 4LF7O 3QVNA 4EFEA 3PN1A 1K73W 4GX2A 4RUFA 2NNUA 2QTSA 5HFMA 4LF5O 5EIBC 5JH7A 3CC7V 4LWSB 2ZDIA 2FL4A 4I55A 1H38A 4FK5C 1KP2A 3ZRXA 5D5PA 3DTUB 4JI5B 4YJ2A 2HJDA 1QHTA 2YXYA 4JYAO 1YJWV 4L8JA 3CRCA 2W6IG 5L3EA 4DV4B 4IIJB 4UVAA 2YDEA 4WFGA 3J7AU 5FNVB 2CTWA 4MSWC 4U7OA 4ZHQB 4DR3B 4KHPB 1WAZA 4X1KB 2Q6AA 1XHZA 1VQ4V 3A2FA 5ITZA 4TV9A 2A7WA 2QGNA 3K57A 1Y74A 4JYBA 4LH7A 5E79Z 4X1IA 1NTZH 2GSMB 3FD9A 1XL6A 5EBLC 4DV2B 1U96A 5LMUO 3CMEV 2RQ6A 5EK0A 5LP6C 5KA5A 1NR1A 2BTOA 2OCHA 1D5AA 3RYHA 3RYFB 2Q8VA 1JJOA 4Z1MG 1XDCA 1YI2V 3STZC 5BR8B 2Q73A 3ZHQA 1PM9A 5B1AB 3OEEG 1XUQA 5ITZB 1LUVA 1Y4MA 4J42A 2M6YA 1GM9A 5LMNO 4MTGA 3AG2C 3HKCB 2QM4A 3MHHC 1AI7A 4B3MO 4J10A 4LF9O 1FS0G 1RSOA 2ZNIA 1VARA 1OCCB 4YJ3A 2EIJB 5FL7G 1LNQA 1US6A 4K35A 4EEQA 3IC7A 4KP4A 4K8ZA 3WB1A 4BW5A 4JZGA 2VWKA 1F4NA 1M9NA 4CC6A 2UUBB 3X2QB 4QJFB 2DN9A 5IWAB 1Q6UA 4CH5A 2FB5A 1AP5A 2GV9A 5LHIA 1WP7A 1N32B 4JTAB 1I5XA 1G8MA 4JI4O 3RYCB 3SYQA 1L8DA 1SESA 1EN4A 3HKBB 5CB4A 3CPWU 1M5IA 2Y0PA 1GN2A 5B1NA 3RVYA 3Q4HB 1VIBA 4ASUG 4X88A 2UUAB 2Q7GA 3JAKA 3LUTB 1FYJA 2DWDC 1XHXA 1XBLA 3KKYA 2HHHB 2PGGA 2H94A 1YSCA 2YI9A 1BHBA 4K0KB 3KZIZ 4NXMO 2OTJV 1YDXA 1MZFA 1AJNA 1ORQC 2JEXA 2WLIB 2AZ2A 5DECA 1S72V 5LHGA 3DGEA 3UT5A 1WA8B 3SYPA 2X7RB 2P5OA 1NI8A 2ZXWC 3TGUH 1H2NA 1NTMH 4I7ZB 1JFFB 5JH7B 3NR7A 3OUSA 1VQKV 1F23A 5IJ9B 2F23A 4ZIBA 1O9HA 5CA1B 3AK1A 2DJVA 2V1DA 5J2UA 1JVMA 4X65O 2JGDA 2EIKC 4QNHB 4YY3O 4PA9A 4DUYB 2OYQA 5B1AC 4JI2B 4I0XA 4CZZA 4X62O 4G2KA 5B1BB 4P9PA 3OM3B 1SQGA 4DO2A 1H2GA 2LO1A 3G80A 4JPRA 3WG7B 4GKKB 2LW7A 4TV8B 2XNDG 3SYOA 3JSLA 3KCYA 1YTFB 5LMNB 1Q6HA 4Q6GA 2XASA 1SA0A 4PELA 5C8YA 1HR0O 5EBWC 1XOUA 3WB2A 3OR7C 1S5HC 3B2EE 5L3CA 1MABG 3KCXA 2ATKC 1JX9A 2IM9A 2ZE7A 2Y48A 1D5NA 2FTKA 3SDLA 3TXQA 3JATB 4ZI7A 4OPHA 2WA3A 3OE7G 1MOFA 3L9DA 4KHPO 1BS3A 2IW5A 2A79B 4FM0A 4BIZA 1V9PA 4P2ZA 4ZKIA 1F4MA 3CJHA 1NVPB 3CRAA 4PV1B 3CEIA 1B3QA 2E74B 1S5LZ 3L74H 2QR4A 3CMAV 3H01A 4NR1A 4O4HB 1L1FA 3SJCC 3CS5A 2F95B 4JF3A 3ZRWB 1V54B 1WNSA 1VF7A 4MTOA 4DV5B 3ZRWA 1Q43A 3UO2A 3ABLC 2AHYA 4C7UA 2RJZA 4DR1O 3ZRVA 3U0ZA 4CH4A 2XAQA 3QF7A 4DR4B 4PDRA 1N36O 1PL0A 2H8PC 4JV5O 3ML0A 2AZ0A 3AG1C 1P7BA 5C93A 3ETQA 1JCHA 2IH1C 4XBFA 5GTIZ 2Z5UA 4JI6O 2EBOA 4K8XA 4YJ2B 2Z0AA 4DR1B 3W7SA 2RCVA 5DN6G 1I94B 4X64O 4X65B 4LP8A 4JI0O 3F5WC 3APQA 4QE7A 4FMTA 2DE0X 2KQXA 4F6EA 2LFRA 1OJHA 3ZJZA 4NTYA 2EJRA 4E2LA 5CA0B 3RW0A 3P3PA 1IZ3A 2ZT9B 1KKDA 1YVWA 3EVKA 1XNQB 1GM8A 3D36A 3F5TA 4KFMA 1XQ8A 4LF6O 3OT7A 1QVFU 2ZE6A 3UQ8A 4MTFA 4YXWG 5D5QA 5FPRA 1P7GA 2ZDIC 4FLTA 3CXCU 4PA7A 2PI5A 2KKWA 1V54C 2R9AA 4B7KA 3B77A 1I5YA 1KP3A 4WCEV 1XNQO 2EZPA 5L3GA 2QWPB 4LF5B 1P49A 1OCZC 3F7VC 4DYLA 2VWJA 3MAQA 4UVBA 5H2FZ 2UXBB 4GCZA 4XDKA 3JD1A 1JFFA 5IJ0A 1N32O 4O2AA 4DR2B 2VQFB 3C3TA 1Q3EA 3T4DA 3QG5A 4DUZO 4YJ3B 4FLXA 5EZYA 3CJHB 1OCRB 2JJ1G 4LNUB 3T1HB 1KYOF 4JI3B 1B6QA 3JARA 4JTCB 4FLZA 4F6RB 1THZA 5KMGA 4JI2O 3SPIA 4X89A 4O4JA 4I9QA 1R3JC 2CGOA 1SQXH 1DK1A 4NTWA 4DUZB 2BE3A 5LGUA 2CE4A 3OMAB 1VQOV 4TOIA 4R6ZA 5K1PA 3SJQC 4QPJA 5LOVB 1BE3H 1JQ0A 4X66B 2IJJA 1HNZO 3AK2A 1N34O 4LFAO 1TUBB 5KX5A 1SETA 5KHHA 1HNXO 1I7FA 1UJWB 1B06A 2NR5A 2ZINA 4AILC 4X9QA 2EINB 3W7UA 3JARB 3WG7C 2RDCA 3E8BA 4N23A 5AG2A 5KX5B 4DR6O 1EN6A 2E76B 5H9CA 2P90A 4PHZA 4UCOA 1TUEB 2P4KA 4JTDB 3S3WA 3AG2B 3ASNC 2DWEC 4UCVA 1VQLV 2EIKB 4GYCB 3SYCA 2Q9LA 4Q20A 1Z5WA 2EILC 4X1KA 2DQ0A 4B08A 1N0JA 3FFQA 4DR7O 4AQYB 4B7EA 5KUMA 1QLNA 3BABA 5B66Z 2YICA 3OW2U 3VQXA 4HBNA 3BY6A 3JAKB 3K5OA 1GRJA 1PD3A 1X4TA 3JAWB 3K0GA 4OPAA 2Y69C 3N2GA 1W59A 1G6UA 5CA1A 1VQMV 4U3JB 1X59A 2R9RB 1GK9A 2XAGA 5KA6A 4A5UB 4J9YB 4WF9V 3W7XA 1XREA 3FYEB 3JALA 4JI1O 3W7WA 4FPPA 4JI3O 5JVDB 4GZRB 2YC0A 4D7TA 2XT9A 3BA9A 3RN4A 4MW8A 4LWSA 1RPOA 2JS3A 4CS4A 2YEVA 1TVKB 1NBMG 1WA8A 5E1AC 3AG3B 4JV5B 5EYPA 2VRZA 3OAAG 1AB3A 1VQ9V 4HAMA 4MVMA 4UCRA 3ZMSA 3L75H 5IY5C 4H0LB 3HR0A 1KQSU 2W0FC 3IGAC 2CTQA 2ZIOA 3DC5A 1SZXA 2A3QA 2QJ1A 1EZJA 5IYDO 1URFA 2HR3A 3FB8C 1VP7A 4G27B 3OFNG 1QLEB 3SJAC 1VQ7V 1L0LH 4JI8B 2PYLA 4FVMA 3VQVA 1BCCH 1FXVA 1SZTA 1BGYH 5KLVH 1YEWA 2Q68A 3AG7A 1WB7A 1JA8A 3GWOA 4Z1VA 4X1IB 4TUYA 5CN0A 1NQTA 1AROP 2WLKA 2JDIG 3BVOA 1W0JG 3M7MX 4JI6B 5IT9N 1TUBA 4UB8Z 2HKOA 3CCSV 1LR1A 3RBZA 4LNUA 4CS2A 4RWUA 1R3IC 1D2DA 2OIEA 3RYHB 3LSQA 2Q67A 5BMVB 4EB6A 3E2EA 1MG1A 3QNEA 1IVSA 1K3EA 2P6JA 4UVCA 3OMNB 1FFTB 4HZ3A 4TV8A 1Q6IA 3J81N 3T1YB 5K1XA 2BOBC 1HNWO 3EFFK 1IBLO 5LMUB 1SERA 1VQPV 3T1HO 1K92A 3TCUA 3L70H 3SR2C 3AG4C 1Q82W 2CH7A 2B9ZA 3K9SA 3D36C 2UXNA 4PD4F 4YIOA 1SA0B 1IBMB 1Y67A 2EX3A 3JAMN 3FB6C 4TWKA 2F4VB 3CE2A 4YHHO 1AILA 3BA8A 2F93B 1PNLA 4W4KA 1XL4A 1R6NA 1TA8A 3ZHTA 1SQQH 3CWBH 4PJ0Z 5DEDA 2RNBA 3OUFA 3LDEA 2F1MA 1YJ9V 2E75B 5BXZA 3SPHA 2QWOB 5IDJA 5HFLA 2WLNA 3JD3A 3ASOC 2GTSA 2XTAA 3G4SV 2HLDG 1OCOC 3BAAA 4OGQB 2ITCC 3WB0A 1PPJH 5LL6Y 1FXKC 4H13B 2ZKOA 4I4TA 2B1IA 4LCUC 3BEHA 4LF4B 5CMUA 4DV3O 1NZ6A 2ZNJA 3JYCA 1BQ0A 4BIOA 5KHGA 5LYJA 1WB8A 1F7YA 4CH3A 2ZE5A 5BMVA 1V55C 2GBOA 4ICGA 1QR9A 2UXXA 4BIUA 1Y6XA 3APOA 2QKCA 1YJNV 3TXSA 2N04A 2UU9O 4RAIA 2EIMB 1K4DC 3U10A 4DR4O 3HPLC 3VBBA 1W0KG 1FXKB 3ZMUA 3N2KA 1ZAUA 2P7TC 1QR8A 3HKDA 4U7NA 1ZL8A 3P32A 2QWQB 2Q5ZA 5LYJB 3F7YC 2Q0AA 5A9GA 3RVZA 2R9IA 4IGGA 4TUYB 3A0HZ 1GN3A 4CC5A 2PZSA 4KL1A 1IXBA 1KUQA 4IT5A 3J80N 3FX7A 4DV4O 5BY1A 2BOCC 2ADPA 2A9HA 5LOVA 1KB9F 4TSFG 2KSDA 4DR5B 4FM2A 4DR3O 3TJTA 1M57C 1S0VA 3K5MA 2HVJC 1ZWIC 4FIPC 1OCOB 3CSXA 5JJNB 3K08A 4P9OA 4MVQA 2FYUH 3L71H 1ZSPA 5EC2C 3P3NA 3ETDA 4UXNA 2UUCO 4MVUA 2F43G 2DYRC 3QO7A 3K0DA 2BCCH 4WFEA 2OTLV 2P4VA 4KUMA 1AP6A 3EXAA 4QE9A 5J2UB 2CTRA 5KAIZ 4X64B 2WLLB 2MK3A 1IBKO 4U3FH 4DUYO 1EZVH 3VQYA 3ABMC 1FFXB 3O9OA 3ABLB 4QGPA 1ENVA 5L3FA 1AJPA 2HJFC 3E83A 4RO2A 3CXHF 1GAXA 2BSKA 1SQBH 1QLEC 4NXMB 4MVRA 1WP8A 2BTQA 4HNAA 2UXCO 1UFIA 4DV5O 2VQFO 4DR5O 2Y4TA 5GTHZ 1PL4A 4X20A 3ZX6A 2E3CA 1Y66A 4OX9O 5GONA 2CDYA 3T4ZA 4DV6O 2UUAO 5H6RA 3E89A 4DV0B 3UT5B 1VQ6V 1DGSA 2P67A 1SQVH 2YS8A 4LFBB 1F51A 2HEPA 3OEHG 3CP1A 2Q0OC 4UUJC 4LFAB 1JR9A 2WLMA 3GWKC 4U3JA 1IBLB 1HNZB 2ZM6O 1MMMA 1OHHG 5GW7A 4O4IB 4DV6B 1S77D 1S76D 3N2KB 3MDSA 4DV0O 5IWAO 4I5SA 1RSOB 5KHIA 4FZ1A 2LP7A 4LBEC 3E86A 5CBGA 4JI7O 2QKAA 2RMKB 3ZHRA 3CRRA 3CD6V 1HNXB 4I50B 1VF5B 3JD2A 3UKMA 1SS3A 5L3DA 1Q7YW 2D2CB 4DV3B 2YIBA 3CCRV 4FLUA 4FZ0A 3AG3C 1HW7A 4JI0B 2EIJC 2L6LA 3SPJA 1NTKH 3RYFA 2CK3G 4JI7B 1AR4A 3GB7C 1SRYA 2HVKC 3ZHVA 1J95A 2PTMA 1AI5A 3SYAA 5JWPA 4DV7O 4DR7B 1XI1A 1BSMA 1Y76B 1Z2GA 5IYBO 4O4LA 4PA3A 1K7DA 3AK3A 3ASNB 1SC5B 2WPDG 2YUAA 3HKDB 3WFVA 3CHXA 1AJQA 5KMGB 4ZOLA 1FXKA 1H2MA 1N4CA 1RM1C 4AQYO 1KKCA 4NXNB 5JCOC 3JASB 2V4DA 2G38A 1LUWA 2WWWA 2ZR2A 1IBMO 3ZMVA 2PF4E 5J2TA 4JGSA 3CCEV 4F4LA 4GUNA 1JJ2U 5LA6B 3ZMZA 4LR3A 3HB3B 2RN9A 2DYSB 2OIGA 1FXHA 4FFBB 4WBNB 4J9ZB 1Y74B 2Q7HA 2R70A 3N2GB 2Y69B 3H1JH 1NR7A 2WLIA 2Y0IA 2GTAA 1S3JA 3ABTA 1SKVA 3HKEB 1N33O 4H44B 2Z3YA 4J7JA 3SPGA 5GONB 3ABKC 4X1YA 4X66O 1RFYA 1KC8W 4LF8O 4PDLA 3OMIB 3LNNA 1OCCC 4RUEA 1XILA 3UM7A 2QA4V 4RQFA 3JD0A 3SJBC 1NH2B 4P30A 1Q5OA 3D8CA 3E22A 4MVOA 3IJ4A 2VQEB 2JGUA 1MSWD 3CX5F 4TQDA 3HKBA 2PUSA 1DF4A 5J9PC 2WLLA 1PV0A 1MNGA 4NYKA 2HP8A 4PDVA 5JJJB 1IX9A 3CCVV 2QE7G 3OGIB 1R1BA 2PYJA 1K4CC 1M56C 5BR8O 4B3TB 3K79A 5B3SC 5LXTA 3T1CA 1G1XB 3H1KH 4DV1O 5KAFZ 3K58A 1FJGB 2IU3A 1QU7A 3FAVB 3I5DA 4UB6Z 2IJKA 2EINC 1H2KA 2GDSA 3FKSG 3THOA 3S3XA 1G4YB 2QDOA 4MT8A 1NS1A 4HNAB 4IYIA 1GN4A 5H5NA 3D3IA 2JVDA 4XDJA 2OWOA 4DK0A 1GTOA 3K5NA 4DW0A 2LJ2A 5A2QN 1NJIW 3L72H 3HKCA 5LGNA 1ROPA 3I55V 2ZIMA 1R6TA 1OCRC 2YIDA 2F4VO 1QNMA 3JASA 1N33B 2W6JG 5IYCO 4DR6B 1K97A 1BT8A 2N74A 1PNMA 2AGAA 4O4HA 1W2BU 2KB1A 2EIMC 1OCZB 3OGCC 2C2AA 3SPCA 4J80A 5IE9A 3PJSK 2H3OA 2IBZH 2WA4A 4MVSA 3LSSA 1COWG 5EC1C 4BW9A 1FAFA 3CRMA 3UO3A 3FB5C 4O4IA 2YXLA 4LH6A 2EULA 1K34A 3FYIB 3A0BZ 3IFXA 3ZCCA 2XUMA 2QM7A 2R72A 4EKWA 3JATA 4ZI7B 1CXZB 2YXHA 1IBKB 1K5SA 4UCUA 2DW4A 4XDLA 4FLYA 4I4TB 3RGBA 1V55B 1TVKA 4DV1B 1Q81W 4B3MB 4LF9B 4X62B 3U11A 4I55B 2QSAA 4WFHA 1I94O 1P84F 1RP3B 3CCLV 3CCQV 1VQ5V 1K8AW 3E35A 2Q7EA 2VQEO 4TV9B 4PDMA 2PY5A 5JQGB 5FNVA 1AR1B 4DV2O 2D3OW 4F6RA 2PI4A 4J7KA 4IIJA 4LFCB 3JCUZ 5CBFA 1XNRO 2ZD9A 1BMFG 2UXDO 1HDJA 3CCUV 1OZ0A 3LDDA 2YEVB 5IJ9A 3JAWA 2IJHA 1BQZA 4DRXA 1FPOA 3P30A 3FAVA 2M7WA 5FLXN 4FFBA 4WBNA 3ZS8C 2CAZC 4GX1A 2OCCB 3R65A 1QBZA 1M56B 2W0XA 1Q86W 2DMXA 1BL8A 4JYAB 4B3SO 1H8HG 4DRXB 2VS0A 3ETEA 3B40A 3QO8A 2UUBO 4G28B 3CYOA 5B3SB 1KBHA 2CH7B 3BCCH 3NXSA 2ZXWB 2LQTA 5IY5B 2ZE8A 2UU9B 1K5QA 2B1GA 2XHBA 4BWAA 1VF6A 4DV7B 3K5LA 3DXRA 4QPKA 2K9PA 1WJZA 2CTPA 1HR0B 1SQPH 1XMQO 3B09A 1JPXA 1YTFD 1SF9A 1H2SB 4LC1A 4JYYA 4ZOLB 5B5EZ 2P22C 1E79G 1AI4A 3OTFA 2WAMA 3K03A 1YITV 5CB4B 3G71V 1E1QG 2X6AA 2A0LA 2Y4UA 1MA1A 4O4JB 3IC9A 4D7SA 5C8YB 2WLJA 4DW1A 3X2QC 3DC6A 1GMGA 1NVPD 5KUKA 3H9VA 1K33A 5BZBA 1AR5A 4EB6B 1TGOA 2FMLA 1L0NH 2O57A 1HP8A 1H2LA 5FPOA 4GKJB 1Z5VA 3ZHUA 4BAYA 2ZM6B 4JI4B 2Q69A 3RYIA 4PI2A 3AG4B 2UXDB 1CP9A 2YSUB 2ITDC 4IL6Z 3OR6C 4FM1A 4FLVA 1FKAO 2ODMA 4YHHB 2ADQB 3E8FA 4NKGB 1ZL8B 3LNMB 3UCSC 1QQCA 3M99B 3CC2V 1H8EG 3K06A 2DOSA 2NN4A 3FB7C 1WPBA 1VQNV 4NTXA 5LXTB 4D6TH 1B04A 3C3SA 3ABKB 1GO3F 5LP6B 3CB2A 2IJIA 2OT5A 5F2VO 4MS2A 1XEQA 5H6QA 1NH2D 4PA4A 4O2AB 2V7QG 1M93A 3OD4A 2FKXA 4LF4O 4H37A 5JCOA 1M90W 1DLBA 4N21A 4UV9A 4NVPA 3JSNA 1SQFA 5CBHA 4AI8A 2ZCEA 2DYSC 3BFRA 4GX5A 4JYCA 5LP6A 2JRIA 4ABMA 1I08A 2ETNA 4TT3G 4X8AA 1RPRA 2CGNA 1NU1H 4X1YB 3TK1A 4YY3B 2EZOA 2A06H 3BHPA 3K59A 4Z2WA 2QTOA 2DQ3A 4J7ZA 4AHCA 3R66A 5JQGA 4WFBV 2EILB 1XMQB 3STLC 2JEUA 4TQFA 4GT1A 2JK5C 3VOUA 2HHHO 2LFSA 1WPXA 2YI8A 4PA6A 1QCEA 2AXTZ 3LDCA 4RQEA 4IYHA 1N0NA 1UPGA 4JAVA 1J5EB 3RFRA 5LHHA 4WFFA 3W7TA 1HWYA 5TISZ 3ETGA 4B3SB 4LFBO 4JAAA 3T2MA 4GKJO 5LA6A 3E8GA 1R6KA 1QVGU 4L87A 1FFXA 1MZEA 4W4LA 3DSQA 5DM6V 2LGWA 3JD4A 1J5EO 3CCJV 3ZRSA 2P06A 2ARHA 4JZ2A 2IH3C 3ZMTA 3OTOB 4LFCO 2K1EA 3G6BA 3ZIAG 4JI5O 1JOYA 1FD9A 4PI0A 2X6BA 1BZKA 1Q8IA 4MTXA 5LGTA 4LF7B 1WN7A 4H33A 3LSUA 3MD0A 3QTCA 1EFRG 2LW1A 3CRQA 2L35A 1AVMA 1KD1W 1NT2B 1R73A 1PKXA 1YHQV 3ZBHA 1K9MW 2ZR3A 1VMGA 3A8TA 1N34B 2KG7B 4FFKA 4J41A 3ZN0A 4ZHQA 1VF6C 1M1KW 4JAUA 2E5LO 1DTOA 1BHAA 3ICXA 4R8CA 4JI1B 2MW2B 1TAEA 1ZX3A 2Q4PA 4I50A 3I56V 1WLEA 3QO5A 4B3RB 4WFAV 2CUGA 4BR6A 4EFBA 3ZHSA 4NB5A 3D3QA 2JIZG 5IJ0B 4UCTA 3O65A 3H1HH 2AHZA 3ABMB 3SGIA 5KHJA 5LBQA 1IDSA 3IAYA 1VEWA 4FLWA 3H1IH 1VQ8V 4K3AA 2UUCB 2GUZB 3OTOO 2XAHA 4JASA 2XOKG 4MVZA 1XMOO 3GVMA 1EBOA 1ZUQA 2HG5C 2DYRB 1YIJV 4GLXA 1R3KC 3BPZA 5IYZA 1PNKA 1ZLZA 3E22B 4LF6B 2XAJA 2QKSA 1U97A 2BTQB 1NKDA 2UXCB 3WU2Z 1YF2A 3KG2A 1T5EA 3RT3C 2OCCC 3B8MA 2IU0A 1S5JA 4OX9B 3H1LH 2YIAA 1KMIZ 2NLJC 1EN5A 2XAFA 4CS3A 1E1RG 5CA3A 5IYZB 3JALB 1IURA 3RYIB 4QIWF 2BSKB 3G67A 4YIPA 4NXNO 3RWRD 4B3TO 4R50A 4UV8A 3N27A 4B3RO 3CCMV 1M57B 4DXWA 2WSSG 5J2TB 4E4EA 1O9GA 5KHKA 3CC4V 2X6CA 3AG1B 3B8NA 3HKEA 2F66C 3BRCA 3K3WA 4J11A 4LF8B 4KXRA 3VQWA 3G6EV 3M8AA 2EJ7A 1Y76A 5EBMC 1GH6A 1OV9A 2E5LB 4UFZA 1M4UA 2QWRB 4IHJA 5CA0A 3RYCA 2GUZA 1A32A 4JI8O 2KG7A 3K04A 4UCSA 4K0KO 1ZTEA 1MSDA 2UXBO 4MW3A 2ZQMA 1AI6A 2YIBD 1YXBA 3EHBB 4CH6A 4DR2O 1KU9A 4I9WA 3A0RA 1YCIA 3C90A 1GN6A 3ASOB 4O4LB 1EM1A 1YZBA 3JCZA 4O2BA 2JS5A 3L73H 4O2BB 2JGDB 1XMOB 4CBCA 3TETA 4DK1A 2AW9A 3ABUA 1XNRB
chains in the Genus database with same CATH topology
1OJHA 2QDOA 2Q8VA 3CS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJH A;  2QDO A;  2Q8V A;  3CS5 A; 
#chains in the Genus database with same CATH topology
 3ZED A;  3T1Y O;  3AEI A;  2HFE C;  4R7C A;  1HNW B;  2QWN B;  4GKK O;  3MHS C;  2GHY A;  5EIB D;  4OXS A;  2JJ2 G;  3E8H A;  2WLH A;  1N8R W;  2X0L A;  5JJE B;  5JVD A;  5B1B C;  5L3B A;  1RM1 B;  1DF5 A;  1PP9 H;  1GM7 A;  4GX0 A;  4IHJ B;  3DXR B;  3B4S A;  2ILM A;  1JMK C;  1CEZ A;  5EZY B;  4ZBM A;  1FJG O;  1KEC A;  2QM8 A;  1CPY A;  3ZN1 A;  1N36 B;  4X20 B;  2B5U A;  3Q4H A;  5B1O A;  5EYP B;  3K9A A;  1R3L C;  1I0H A;  4HYO A;  4FJC C;  1GKF A;  1Q90 D;  1IXM A;  2N05 A;  4I0X B;  1P4R A;  2LGQ A;  2QEX V;  4LF7 O;  3QVN A;  4EFE A;  3PN1 A;  1K73 W;  4GX2 A;  4RUF A;  2NNU A;  2QTS A;  5HFM A;  4LF5 O;  5EIB C;  5JH7 A;  3CC7 V;  4LWS B;  2ZDI A;  2FL4 A;  4I55 A;  1H38 A;  4FK5 C;  1KP2 A;  3ZRX A;  5D5P A;  3DTU B;  4JI5 B;  4YJ2 A;  2HJD A;  1QHT A;  2YXY A;  4JYA O;  1YJW V;  4L8J A;  3CRC A;  2W6I G;  5L3E A;  4DV4 B;  4IIJ B;  4UVA A;  2YDE A;  4WFG A;  3J7A U;  5FNV B;  2CTW A;  4MSW C;  4U7O A;  4ZHQ B;  4DR3 B;  4KHP B;  1WAZ A;  4X1K B;  2Q6A A;  1XHZ A;  1VQ4 V;  3A2F A;  5ITZ A;  4TV9 A;  2A7W A;  2QGN A;  3K57 A;  1Y74 A;  4JYB A;  4LH7 A;  5E79 Z;  4X1I A;  1NTZ H;  2GSM B;  3FD9 A;  1XL6 A;  5EBL C;  4DV2 B;  1U96 A;  5LMU O;  3CME V;  2RQ6 A;  5EK0 A;  5LP6 C;  5KA5 A;  1NR1 A;  2BTO A;  2OCH A;  1D5A A;  3RYH A;  3RYF B;  2Q8V A;  1JJO A;  4Z1M G;  1XDC A;  1YI2 V;  3STZ C;  5BR8 B;  2Q73 A;  3ZHQ A;  1PM9 A;  5B1A B;  3OEE G;  1XUQ A;  5ITZ B;  1LUV A;  1Y4M A;  4J42 A;  2M6Y A;  1GM9 A;  5LMN O;  4MTG A;  3AG2 C;  3HKC B;  2QM4 A;  3MHH C;  1AI7 A;  4B3M O;  4J10 A;  4LF9 O;  1FS0 G;  1RSO A;  2ZNI A;  1VAR A;  1OCC B;  4YJ3 A;  2EIJ B;  5FL7 G;  1LNQ A;  1US6 A;  4K35 A;  4EEQ A;  3IC7 A;  4KP4 A;  4K8Z A;  3WB1 A;  4BW5 A;  4JZG A;  2VWK A;  1F4N A;  1M9N A;  4CC6 A;  2UUB B;  3X2Q B;  4QJF B;  2DN9 A;  5IWA B;  1Q6U A;  4CH5 A;  2FB5 A;  1AP5 A;  2GV9 A;  5LHI A;  1WP7 A;  1N32 B;  4JTA B;  1I5X A;  1G8M A;  4JI4 O;  3RYC B;  3SYQ A;  1L8D A;  1SES A;  1EN4 A;  3HKB B;  5CB4 A;  3CPW U;  1M5I A;  2Y0P A;  1GN2 A;  5B1N A;  3RVY A;  3Q4H B;  1VIB A;  4ASU G;  4X88 A;  2UUA B;  2Q7G A;  3JAK A;  3LUT B;  1FYJ A;  2DWD C;  1XHX A;  1XBL A;  3KKY A;  2HHH B;  2PGG A;  2H94 A;  1YSC A;  2YI9 A;  1BHB A;  4K0K B;  3KZI Z;  4NXM O;  2OTJ V;  1YDX A;  1MZF A;  1AJN A;  1ORQ C;  2JEX A;  2WLI B;  2AZ2 A;  5DEC A;  1S72 V;  5LHG A;  3DGE A;  3UT5 A;  1WA8 B;  3SYP A;  2X7R B;  2P5O A;  1NI8 A;  2ZXW C;  3TGU H;  1H2N A;  1NTM H;  4I7Z B;  1JFF B;  5JH7 B;  3NR7 A;  3OUS A;  1VQK V;  1F23 A;  5IJ9 B;  2F23 A;  4ZIB A;  1O9H A;  5CA1 B;  3AK1 A;  2DJV A;  2V1D A;  5J2U A;  1JVM A;  4X65 O;  2JGD A;  2EIK C;  4QNH B;  4YY3 O;  4PA9 A;  4DUY B;  2OYQ A;  5B1A C;  4JI2 B;  4I0X A;  4CZZ A;  4X62 O;  4G2K A;  5B1B B;  4P9P A;  3OM3 B;  1SQG A;  4DO2 A;  1H2G A;  2LO1 A;  3G80 A;  4JPR A;  3WG7 B;  4GKK B;  2LW7 A;  4TV8 B;  2XND G;  3SYO A;  3JSL A;  3KCY A;  1YTF B;  5LMN B;  1Q6H A;  4Q6G A;  2XAS A;  1SA0 A;  4PEL A;  5C8Y A;  1HR0 O;  5EBW C;  1XOU A;  3WB2 A;  3OR7 C;  1S5H C;  3B2E E;  5L3C A;  1MAB G;  3KCX A;  2ATK C;  1JX9 A;  2IM9 A;  2ZE7 A;  2Y48 A;  1D5N A;  2FTK A;  3SDL A;  3TXQ A;  3JAT B;  4ZI7 A;  4OPH A;  2WA3 A;  3OE7 G;  1MOF A;  3L9D A;  4KHP O;  1BS3 A;  2IW5 A;  2A79 B;  4FM0 A;  4BIZ A;  1V9P A;  4P2Z A;  4ZKI A;  1F4M A;  3CJH A;  1NVP B;  3CRA A;  4PV1 B;  3CEI A;  1B3Q A;  2E74 B;  1S5L Z;  3L74 H;  2QR4 A;  3CMA V;  3H01 A;  4NR1 A;  4O4H B;  1L1F A;  3SJC C;  3CS5 A;  2F95 B;  4JF3 A;  3ZRW B;  1V54 B;  1WNS A;  1VF7 A;  4MTO A;  4DV5 B;  3ZRW A;  1Q43 A;  3UO2 A;  3ABL C;  2AHY A;  4C7U A;  2RJZ A;  4DR1 O;  3ZRV A;  3U0Z A;  4CH4 A;  2XAQ A;  3QF7 A;  4DR4 B;  4PDR A;  1N36 O;  1PL0 A;  2H8P C;  4JV5 O;  3ML0 A;  2AZ0 A;  3AG1 C;  1P7B A;  5C93 A;  3ETQ A;  1JCH A;  2IH1 C;  4XBF A;  5GTI Z;  2Z5U A;  4JI6 O;  2EBO A;  4K8X A;  4YJ2 B;  2Z0A A;  4DR1 B;  3W7S A;  2RCV A;  5DN6 G;  1I94 B;  4X64 O;  4X65 B;  4LP8 A;  4JI0 O;  3F5W C;  3APQ A;  4QE7 A;  4FMT A;  2DE0 X;  2KQX A;  4F6E A;  2LFR A;  1OJH A;  3ZJZ A;  4NTY A;  2EJR A;  4E2L A;  5CA0 B;  3RW0 A;  3P3P A;  1IZ3 A;  2ZT9 B;  1KKD A;  1YVW A;  3EVK A;  1XNQ B;  1GM8 A;  3D36 A;  3F5T A;  4KFM A;  1XQ8 A;  4LF6 O;  3OT7 A;  1QVF U;  2ZE6 A;  3UQ8 A;  4MTF A;  4YXW G;  5D5Q A;  5FPR A;  1P7G A;  2ZDI C;  4FLT A;  3CXC U;  4PA7 A;  2PI5 A;  2KKW A;  1V54 C;  2R9A A;  4B7K A;  3B77 A;  1I5Y A;  1KP3 A;  4WCE V;  1XNQ O;  2EZP A;  5L3G A;  2QWP B;  4LF5 B;  1P49 A;  1OCZ C;  3F7V C;  4DYL A;  2VWJ A;  3MAQ A;  4UVB A;  5H2F Z;  2UXB B;  4GCZ A;  4XDK A;  3JD1 A;  1JFF A;  5IJ0 A;  1N32 O;  4O2A A;  4DR2 B;  2VQF B;  3C3T A;  1Q3E A;  3T4D A;  3QG5 A;  4DUZ O;  4YJ3 B;  4FLX A;  5EZY A;  3CJH B;  1OCR B;  2JJ1 G;  4LNU B;  3T1H B;  1KYO F;  4JI3 B;  1B6Q A;  3JAR A;  4JTC B;  4FLZ A;  4F6R B;  1THZ A;  5KMG A;  4JI2 O;  3SPI A;  4X89 A;  4O4J A;  4I9Q A;  1R3J C;  2CGO A;  1SQX H;  1DK1 A;  4NTW A;  4DUZ B;  2BE3 A;  5LGU A;  2CE4 A;  3OMA B;  1VQO V;  4TOI A;  4R6Z A;  5K1P A;  3SJQ C;  4QPJ A;  5LOV B;  1BE3 H;  1JQ0 A;  4X66 B;  2IJJ A;  1HNZ O;  3AK2 A;  1N34 O;  4LFA O;  1TUB B;  5KX5 A;  1SET A;  5KHH A;  1HNX O;  1I7F A;  1UJW B;  1B06 A;  2NR5 A;  2ZIN A;  4AIL C;  4X9Q A;  2EIN B;  3W7U A;  3JAR B;  3WG7 C;  2RDC A;  3E8B A;  4N23 A;  5AG2 A;  5KX5 B;  4DR6 O;  1EN6 A;  2E76 B;  5H9C A;  2P90 A;  4PHZ A;  4UCO A;  1TUE B;  2P4K A;  4JTD B;  3S3W A;  3AG2 B;  3ASN C;  2DWE C;  4UCV A;  1VQL V;  2EIK B;  4GYC B;  3SYC A;  2Q9L A;  4Q20 A;  1Z5W A;  2EIL C;  4X1K A;  2DQ0 A;  4B08 A;  1N0J A;  3FFQ A;  4DR7 O;  4AQY B;  4B7E A;  5KUM A;  1QLN A;  3BAB A;  5B66 Z;  2YIC A;  3OW2 U;  3VQX A;  4HBN A;  3BY6 A;  3JAK B;  3K5O A;  1GRJ A;  1PD3 A;  1X4T A;  3JAW B;  3K0G A;  4OPA A;  2Y69 C;  3N2G A;  1W59 A;  1G6U A;  5CA1 A;  1VQM V;  4U3J B;  1X59 A;  2R9R B;  1GK9 A;  2XAG A;  5KA6 A;  4A5U B;  4J9Y B;  4WF9 V;  3W7X A;  1XRE A;  3FYE B;  3JAL A;  4JI1 O;  3W7W A;  4FPP A;  4JI3 O;  5JVD B;  4GZR B;  2YC0 A;  4D7T A;  2XT9 A;  3BA9 A;  3RN4 A;  4MW8 A;  4LWS A;  1RPO A;  2JS3 A;  4CS4 A;  2YEV A;  1TVK B;  1NBM G;  1WA8 A;  5E1A C;  3AG3 B;  4JV5 B;  5EYP A;  2VRZ A;  3OAA G;  1AB3 A;  1VQ9 V;  4HAM A;  4MVM A;  4UCR A;  3ZMS A;  3L75 H;  5IY5 C;  4H0L B;  3HR0 A;  1KQS U;  2W0F C;  3IGA C;  2CTQ A;  2ZIO A;  3DC5 A;  1SZX A;  2A3Q A;  2QJ1 A;  1EZJ A;  5IYD O;  1URF A;  2HR3 A;  3FB8 C;  1VP7 A;  4G27 B;  3OFN G;  1QLE B;  3SJA C;  1VQ7 V;  1L0L H;  4JI8 B;  2PYL A;  4FVM A;  3VQV A;  1BCC H;  1FXV A;  1SZT A;  1BGY H;  5KLV H;  1YEW A;  2Q68 A;  3AG7 A;  1WB7 A;  1JA8 A;  3GWO A;  4Z1V A;  4X1I B;  4TUY A;  5CN0 A;  1NQT A;  1ARO P;  2WLK A;  2JDI G;  3BVO A;  1W0J G;  3M7M X;  4JI6 B;  5IT9 N;  1TUB A;  4UB8 Z;  2HKO A;  3CCS V;  1LR1 A;  3RBZ A;  4LNU A;  4CS2 A;  4RWU A;  1R3I C;  1D2D A;  2OIE A;  3RYH B;  3LSQ A;  2Q67 A;  5BMV B;  4EB6 A;  3E2E A;  1MG1 A;  3QNE A;  1IVS A;  1K3E A;  2P6J A;  4UVC A;  3OMN B;  1FFT B;  4HZ3 A;  4TV8 A;  1Q6I A;  3J81 N;  3T1Y B;  5K1X A;  2BOB C;  1HNW O;  3EFF K;  1IBL O;  5LMU B;  1SER A;  1VQP V;  3T1H O;  1K92 A;  3TCU A;  3L70 H;  3SR2 C;  3AG4 C;  1Q82 W;  2CH7 A;  2B9Z A;  3K9S A;  3D36 C;  2UXN A;  4PD4 F;  4YIO A;  1SA0 B;  1IBM B;  1Y67 A;  2EX3 A;  3JAM N;  3FB6 C;  4TWK A;  2F4V B;  3CE2 A;  4YHH O;  1AIL A;  3BA8 A;  2F93 B;  1PNL A;  4W4K A;  1XL4 A;  1R6N A;  1TA8 A;  3ZHT A;  1SQQ H;  3CWB H;  4PJ0 Z;  5DED A;  2RNB A;  3OUF A;  3LDE A;  2F1M A;  1YJ9 V;  2E75 B;  5BXZ A;  3SPH A;  2QWO B;  5IDJ A;  5HFL A;  2WLN A;  3JD3 A;  3ASO C;  2GTS A;  2XTA A;  3G4S V;  2HLD G;  1OCO C;  3BAA A;  4OGQ B;  2ITC C;  3WB0 A;  1PPJ H;  5LL6 Y;  1FXK C;  4H13 B;  2ZKO A;  4I4T A;  2B1I A;  4LCU C;  3BEH A;  4LF4 B;  5CMU A;  4DV3 O;  1NZ6 A;  2ZNJ A;  3JYC A;  1BQ0 A;  4BIO A;  5KHG A;  5LYJ A;  1WB8 A;  1F7Y A;  4CH3 A;  2ZE5 A;  5BMV A;  1V55 C;  2GBO A;  4ICG A;  1QR9 A;  2UXX A;  4BIU A;  1Y6X A;  3APO A;  2QKC A;  1YJN V;  3TXS A;  2N04 A;  2UU9 O;  4RAI A;  2EIM B;  1K4D C;  3U10 A;  4DR4 O;  3HPL C;  3VBB A;  1W0K G;  1FXK B;  3ZMU A;  3N2K A;  1ZAU A;  2P7T C;  1QR8 A;  3HKD A;  4U7N A;  1ZL8 A;  3P32 A;  2QWQ B;  2Q5Z A;  5LYJ B;  3F7Y C;  2Q0A A;  5A9G A;  3RVZ A;  2R9I A;  4IGG A;  4TUY B;  3A0H Z;  1GN3 A;  4CC5 A;  2PZS A;  4KL1 A;  1IXB A;  1KUQ A;  4IT5 A;  3J80 N;  3FX7 A;  4DV4 O;  5BY1 A;  2BOC C;  2ADP A;  2A9H A;  5LOV A;  1KB9 F;  4TSF G;  2KSD A;  4DR5 B;  4FM2 A;  4DR3 O;  3TJT A;  1M57 C;  1S0V A;  3K5M A;  2HVJ C;  1ZWI C;  4FIP C;  1OCO B;  3CSX A;  5JJN B;  3K08 A;  4P9O A;  4MVQ A;  2FYU H;  3L71 H;  1ZSP A;  5EC2 C;  3P3N A;  3ETD A;  4UXN A;  2UUC O;  4MVU A;  2F43 G;  2DYR C;  3QO7 A;  3K0D A;  2BCC H;  4WFE A;  2OTL V;  2P4V A;  4KUM A;  1AP6 A;  3EXA A;  4QE9 A;  5J2U B;  2CTR A;  5KAI Z;  4X64 B;  2WLL B;  2MK3 A;  1IBK O;  4U3F H;  4DUY O;  1EZV H;  3VQY A;  3ABM C;  1FFX B;  3O9O A;  3ABL B;  4QGP A;  1ENV A;  5L3F A;  1AJP A;  2HJF C;  3E83 A;  4RO2 A;  3CXH F;  1GAX A;  2BSK A;  1SQB H;  1QLE C;  4NXM B;  4MVR A;  1WP8 A;  2BTQ A;  4HNA A;  2UXC O;  1UFI A;  4DV5 O;  2VQF O;  4DR5 O;  2Y4T A;  5GTH Z;  1PL4 A;  4X20 A;  3ZX6 A;  2E3C A;  1Y66 A;  4OX9 O;  5GON A;  2CDY A;  3T4Z A;  4DV6 O;  2UUA O;  5H6R A;  3E89 A;  4DV0 B;  3UT5 B;  1VQ6 V;  1DGS A;  2P67 A;  1SQV H;  2YS8 A;  4LFB B;  1F51 A;  2HEP A;  3OEH G;  3CP1 A;  2Q0O C;  4UUJ C;  4LFA B;  1JR9 A;  2WLM A;  3GWK C;  4U3J A;  1IBL B;  1HNZ B;  2ZM6 O;  1MMM A;  1OHH G;  5GW7 A;  4O4I B;  4DV6 B;  1S77 D;  1S76 D;  3N2K B;  3MDS A;  4DV0 O;  5IWA O;  4I5S A;  1RSO B;  5KHI A;  4FZ1 A;  2LP7 A;  4LBE C;  3E86 A;  5CBG A;  4JI7 O;  2QKA A;  2RMK B;  3ZHR A;  3CRR A;  3CD6 V;  1HNX B;  4I50 B;  1VF5 B;  3JD2 A;  3UKM A;  1SS3 A;  5L3D A;  1Q7Y W;  2D2C B;  4DV3 B;  2YIB A;  3CCR V;  4FLU A;  4FZ0 A;  3AG3 C;  1HW7 A;  4JI0 B;  2EIJ C;  2L6L A;  3SPJ A;  1NTK H;  3RYF A;  2CK3 G;  4JI7 B;  1AR4 A;  3GB7 C;  1SRY A;  2HVK C;  3ZHV A;  1J95 A;  2PTM A;  1AI5 A;  3SYA A;  5JWP A;  4DV7 O;  4DR7 B;  1XI1 A;  1BSM A;  1Y76 B;  1Z2G A;  5IYB O;  4O4L A;  4PA3 A;  1K7D A;  3AK3 A;  3ASN B;  1SC5 B;  2WPD G;  2YUA A;  3HKD B;  3WFV A;  3CHX A;  1AJQ A;  5KMG B;  4ZOL A;  1FXK A;  1H2M A;  1N4C A;  1RM1 C;  4AQY O;  1KKC A;  4NXN B;  5JCO C;  3JAS B;  2V4D A;  2G38 A;  1LUW A;  2WWW A;  2ZR2 A;  1IBM O;  3ZMV A;  2PF4 E;  5J2T A;  4JGS A;  3CCE V;  4F4L A;  4GUN A;  1JJ2 U;  5LA6 B;  3ZMZ A;  4LR3 A;  3HB3 B;  2RN9 A;  2DYS B;  2OIG A;  1FXH A;  4FFB B;  4WBN B;  4J9Z B;  1Y74 B;  2Q7H A;  2R70 A;  3N2G B;  2Y69 B;  3H1J H;  1NR7 A;  2WLI A;  2Y0I A;  2GTA A;  1S3J A;  3ABT A;  1SKV A;  3HKE B;  1N33 O;  4H44 B;  2Z3Y A;  4J7J A;  3SPG A;  5GON B;  3ABK C;  4X1Y A;  4X66 O;  1RFY A;  1KC8 W;  4LF8 O;  4PDL A;  3OMI B;  3LNN A;  1OCC C;  4RUE A;  1XIL A;  3UM7 A;  2QA4 V;  4RQF A;  3JD0 A;  3SJB C;  1NH2 B;  4P30 A;  1Q5O A;  3D8C A;  3E22 A;  4MVO A;  3IJ4 A;  2VQE B;  2JGU A;  1MSW D;  3CX5 F;  4TQD A;  3HKB A;  2PUS A;  1DF4 A;  5J9P C;  2WLL A;  1PV0 A;  1MNG A;  4NYK A;  2HP8 A;  4PDV A;  5JJJ B;  1IX9 A;  3CCV V;  2QE7 G;  3OGI B;  1R1B A;  2PYJ A;  1K4C C;  1M56 C;  5BR8 O;  4B3T B;  3K79 A;  5B3S C;  5LXT A;  3T1C A;  1G1X B;  3H1K H;  4DV1 O;  5KAF Z;  3K58 A;  1FJG B;  2IU3 A;  1QU7 A;  3FAV B;  3I5D A;  4UB6 Z;  2IJK A;  2EIN C;  1H2K A;  2GDS A;  3FKS G;  3THO A;  3S3X A;  1G4Y B;  2QDO A;  4MT8 A;  1NS1 A;  4HNA B;  4IYI A;  1GN4 A;  5H5N A;  3D3I A;  2JVD A;  4XDJ A;  2OWO A;  4DK0 A;  1GTO A;  3K5N A;  4DW0 A;  2LJ2 A;  5A2Q N;  1NJI W;  3L72 H;  3HKC A;  5LGN A;  1ROP A;  3I55 V;  2ZIM A;  1R6T A;  1OCR C;  2YID A;  2F4V O;  1QNM A;  3JAS A;  1N33 B;  2W6J G;  5IYC O;  4DR6 B;  1K97 A;  1BT8 A;  2N74 A;  1PNM A;  2AGA A;  4O4H A;  1W2B U;  2KB1 A;  2EIM C;  1OCZ B;  3OGC C;  2C2A A;  3SPC A;  4J80 A;  5IE9 A;  3PJS K;  2H3O A;  2IBZ H;  2WA4 A;  4MVS A;  3LSS A;  1COW G;  5EC1 C;  4BW9 A;  1FAF A;  3CRM A;  3UO3 A;  3FB5 C;  4O4I A;  2YXL A;  4LH6 A;  2EUL A;  1K34 A;  3FYI B;  3A0B Z;  3IFX A;  3ZCC A;  2XUM A;  2QM7 A;  2R72 A;  4EKW A;  3JAT A;  4ZI7 B;  1CXZ B;  2YXH A;  1IBK B;  1K5S A;  4UCU A;  2DW4 A;  4XDL A;  4FLY A;  4I4T B;  3RGB A;  1V55 B;  1TVK A;  4DV1 B;  1Q81 W;  4B3M B;  4LF9 B;  4X62 B;  3U11 A;  4I55 B;  2QSA A;  4WFH A;  1I94 O;  1P84 F;  1RP3 B;  3CCL V;  3CCQ V;  1VQ5 V;  1K8A W;  3E35 A;  2Q7E A;  2VQE O;  4TV9 B;  4PDM A;  2PY5 A;  5JQG B;  5FNV A;  1AR1 B;  4DV2 O;  2D3O W;  4F6R A;  2PI4 A;  4J7K A;  4IIJ A;  4LFC B;  3JCU Z;  5CBF A;  1XNR O;  2ZD9 A;  1BMF G;  2UXD O;  1HDJ A;  3CCU V;  1OZ0 A;  3LDD A;  2YEV B;  5IJ9 A;  3JAW A;  2IJH A;  1BQZ A;  4DRX A;  1FPO A;  3P30 A;  3FAV A;  2M7W A;  5FLX N;  4FFB A;  4WBN A;  3ZS8 C;  2CAZ C;  4GX1 A;  2OCC B;  3R65 A;  1QBZ A;  1M56 B;  2W0X A;  1Q86 W;  2DMX A;  1BL8 A;  4JYA B;  4B3S O;  1H8H G;  4DRX B;  2VS0 A;  3ETE A;  3B40 A;  3QO8 A;  2UUB O;  4G28 B;  3CYO A;  5B3S B;  1KBH A;  2CH7 B;  3BCC H;  3NXS A;  2ZXW B;  2LQT A;  5IY5 B;  2ZE8 A;  2UU9 B;  1K5Q A;  2B1G A;  2XHB A;  4BWA A;  1VF6 A;  4DV7 B;  3K5L A;  3DXR A;  4QPK A;  2K9P A;  1WJZ A;  2CTP A;  1HR0 B;  1SQP H;  1XMQ O;  3B09 A;  1JPX A;  1YTF D;  1SF9 A;  1H2S B;  4LC1 A;  4JYY A;  4ZOL B;  5B5E Z;  2P22 C;  1E79 G;  1AI4 A;  3OTF A;  2WAM A;  3K03 A;  1YIT V;  5CB4 B;  3G71 V;  1E1Q G;  2X6A A;  2A0L A;  2Y4U A;  1MA1 A;  4O4J B;  3IC9 A;  4D7S A;  5C8Y B;  2WLJ A;  4DW1 A;  3X2Q C;  3DC6 A;  1GMG A;  1NVP D;  5KUK A;  3H9V A;  1K33 A;  5BZB A;  1AR5 A;  4EB6 B;  1TGO A;  2FML A;  1L0N H;  2O57 A;  1HP8 A;  1H2L A;  5FPO A;  4GKJ B;  1Z5V A;  3ZHU A;  4BAY A;  2ZM6 B;  4JI4 B;  2Q69 A;  3RYI A;  4PI2 A;  3AG4 B;  2UXD B;  1CP9 A;  2YSU B;  2ITD C;  4IL6 Z;  3OR6 C;  4FM1 A;  4FLV A;  1FKA O;  2ODM A;  4YHH B;  2ADQ B;  3E8F A;  4NKG B;  1ZL8 B;  3LNM B;  3UCS C;  1QQC A;  3M99 B;  3CC2 V;  1H8E G;  3K06 A;  2DOS A;  2NN4 A;  3FB7 C;  1WPB A;  1VQN V;  4NTX A;  5LXT B;  4D6T H;  1B04 A;  3C3S A;  3ABK B;  1GO3 F;  5LP6 B;  3CB2 A;  2IJI A;  2OT5 A;  5F2V O;  4MS2 A;  1XEQ A;  5H6Q A;  1NH2 D;  4PA4 A;  4O2A B;  2V7Q G;  1M93 A;  3OD4 A;  2FKX A;  4LF4 O;  4H37 A;  5JCO A;  1M90 W;  1DLB A;  4N21 A;  4UV9 A;  4NVP A;  3JSN A;  1SQF A;  5CBH A;  4AI8 A;  2ZCE A;  2DYS C;  3BFR A;  4GX5 A;  4JYC A;  5LP6 A;  2JRI A;  4ABM A;  1I08 A;  2ETN A;  4TT3 G;  4X8A A;  1RPR A;  2CGN A;  1NU1 H;  4X1Y B;  3TK1 A;  4YY3 B;  2EZO A;  2A06 H;  3BHP A;  3K59 A;  4Z2W A;  2QTO A;  2DQ3 A;  4J7Z A;  4AHC A;  3R66 A;  5JQG A;  4WFB V;  2EIL B;  1XMQ B;  3STL C;  2JEU A;  4TQF A;  4GT1 A;  2JK5 C;  3VOU A;  2HHH O;  2LFS A;  1WPX A;  2YI8 A;  4PA6 A;  1QCE A;  2AXT Z;  3LDC A;  4RQE A;  4IYH A;  1N0N A;  1UPG A;  4JAV A;  1J5E B;  3RFR A;  5LHH A;  4WFF A;  3W7T A;  1HWY A;  5TIS Z;  3ETG A;  4B3S B;  4LFB O;  4JAA A;  3T2M A;  4GKJ O;  5LA6 A;  3E8G A;  1R6K A;  1QVG U;  4L87 A;  1FFX A;  1MZE A;  4W4L A;  3DSQ A;  5DM6 V;  2LGW A;  3JD4 A;  1J5E O;  3CCJ V;  3ZRS A;  2P06 A;  2ARH A;  4JZ2 A;  2IH3 C;  3ZMT A;  3OTO B;  4LFC O;  2K1E A;  3G6B A;  3ZIA G;  4JI5 O;  1JOY A;  1FD9 A;  4PI0 A;  2X6B A;  1BZK A;  1Q8I A;  4MTX A;  5LGT A;  4LF7 B;  1WN7 A;  4H33 A;  3LSU A;  3MD0 A;  3QTC A;  1EFR G;  2LW1 A;  3CRQ A;  2L35 A;  1AVM A;  1KD1 W;  1NT2 B;  1R73 A;  1PKX A;  1YHQ V;  3ZBH A;  1K9M W;  2ZR3 A;  1VMG A;  3A8T A;  1N34 B;  2KG7 B;  4FFK A;  4J41 A;  3ZN0 A;  4ZHQ A;  1VF6 C;  1M1K W;  4JAU A;  2E5L O;  1DTO A;  1BHA A;  3ICX A;  4R8C A;  4JI1 B;  2MW2 B;  1TAE A;  1ZX3 A;  2Q4P A;  4I50 A;  3I56 V;  1WLE A;  3QO5 A;  4B3R B;  4WFA V;  2CUG A;  4BR6 A;  4EFB A;  3ZHS A;  4NB5 A;  3D3Q A;  2JIZ G;  5IJ0 B;  4UCT A;  3O65 A;  3H1H H;  2AHZ A;  3ABM B;  3SGI A;  5KHJ A;  5LBQ A;  1IDS A;  3IAY A;  1VEW A;  4FLW A;  3H1I H;  1VQ8 V;  4K3A A;  2UUC B;  2GUZ B;  3OTO O;  2XAH A;  4JAS A;  2XOK G;  4MVZ A;  1XMO O;  3GVM A;  1EBO A;  1ZUQ A;  2HG5 C;  2DYR B;  1YIJ V;  4GLX A;  1R3K C;  3BPZ A;  5IYZ A;  1PNK A;  1ZLZ A;  3E22 B;  4LF6 B;  2XAJ A;  2QKS A;  1U97 A;  2BTQ B;  1NKD A;  2UXC B;  3WU2 Z;  1YF2 A;  3KG2 A;  1T5E A;  3RT3 C;  2OCC C;  3B8M A;  2IU0 A;  1S5J A;  4OX9 B;  3H1L H;  2YIA A;  1KMI Z;  2NLJ C;  1EN5 A;  2XAF A;  4CS3 A;  1E1R G;  5CA3 A;  5IYZ B;  3JAL B;  1IUR A;  3RYI B;  4QIW F;  2BSK B;  3G67 A;  4YIP A;  4NXN O;  3RWR D;  4B3T O;  4R50 A;  4UV8 A;  3N27 A;  4B3R O;  3CCM V;  1M57 B;  4DXW A;  2WSS G;  5J2T B;  4E4E A;  1O9G A;  5KHK A;  3CC4 V;  2X6C A;  3AG1 B;  3B8N A;  3HKE A;  2F66 C;  3BRC A;  3K3W A;  4J11 A;  4LF8 B;  4KXR A;  3VQW A;  3G6E V;  3M8A A;  2EJ7 A;  1Y76 A;  5EBM C;  1GH6 A;  1OV9 A;  2E5L B;  4UFZ A;  1M4U A;  2QWR B;  4IHJ A;  5CA0 A;  3RYC A;  2GUZ A;  1A32 A;  4JI8 O;  2KG7 A;  3K04 A;  4UCS A;  4K0K O;  1ZTE A;  1MSD A;  2UXB O;  4MW3 A;  2ZQM A;  1AI6 A;  2YIB D;  1YXB A;  3EHB B;  4CH6 A;  4DR2 O;  1KU9 A;  4I9W A;  3A0R A;  1YCI A;  3C90 A;  1GN6 A;  3ASO B;  4O4L B;  1EM1 A;  1YZB A;  3JCZ A;  4O2B A;  2JS5 A;  3L73 H;  4O2B B;  2JGD B;  1XMO B;  4CBC A;  3TET A;  4DK1 A;  2AW9 A;  3ABU A;  1XNR B; 
#chains in the Genus database with same CATH homology
 1OJH A;  2QDO A;  2Q8V A;  3CS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...