1WPXA

Crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxypeptidase Y
publication title Structure of the carboxypeptidase y inhibitor i(c) in complex with the cognate proteinase reveals a novel mode of the proteinase-protein inhibitor interaction
pubmed doi rcsb
total genus 156
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1wpxA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wpxA01
4UPDA 5AI6A 7YASA 1OILA 5FXMA 2XQIA 1UFOA 1B41A 5CMLA 5C8VA 2Y2UA 2XLCA 4OD0A 2I03A 1DWQA 3O4GA 1TRHA 4BCDA 2YYSA 4Q3KA 4ROTA 5LYYA 4QE3A 1HPLA 2RONA 4PW0A 5K3FA 2YXPX 3DL4A 1W4LA 3QPAA 1MNQA 1U2EA 3C6XA 2OAEA 5E4JA 3HABA 3R3WA 4ZREA 2XMQA 2Z8XA 5DLPA 5A71A 1ZGBA 2PL5A 1USWA 2FJ0A 5DTJA 5HK8A 2X5XA 4UBNA 4WCVA 4FWBA 3I2KA 2WG2A 3BF7A 2XQGA 3PUHA 5JADA 1QIGA 2WJ4A 1EVEA 2JGJA 3I1IA 4PNZA 4U2GA 1MX1A 5CT9A 1F6WA 2DHEA 2J3DA 3STYA 1XRPA 3H2IA 1SOMA 4JUIA 1GPLA 1C4XA 4FBMA 5EFZA 1W52X 2EDCA 1H2YA 3OPMA 5I9IA 4EUSA 2AJDA 4HXGA 4YX9A 3BWXA 4CFSA 4EB0A 1DWOA 1TQHA 3WL6A 1LPAB 2J4CA 4I3FA 5IVHA 3ANTA 2GBGA 4WDQA 1UXOA 1E89A 1GKLA 4KACA 5ALRA 1JKMA 1DWPA 3C87A 3F96A 1FFEA 3GELA 2QXUA 1GZ7A 5CH5A 3A2MA 4UHDA 3I2FA 5CH3A 4B6GA 4K6HA 1BN6A 3R3UA 2XMSA 4OSEA 5DYYA 3OC0A 4ZV7A 1UT6A 5KREA 1R88A 1KEZA 5JAHA 5ALGA 2QS9A 4P93A 3WI7A 2BCEA 1PFQA 1CUVA 3DJYA 3FYUA 3D7RA 4KAFA 1WCYA 1XRNA 2CUTA 4BAGA 3Q8WA 4KAAA 4CG2A 4U2CA 4AMYA 4OPMA 1BEEA 1GKKA 1U65A 4P9NA 1U8EA 2ORYA 4KE8A 1UKAA 4J03A 1ODTC 1NU6A 1YAHA 1QIMA 5DTIA 4KE6A 2XUQA 4XWGA 3ZV7A 3JW8A 4L3WA 1TIBA 2VQ6A 3R0VA 3E4DA 3OG9A 5KWIA 1OCEA 4DM7A 4IH9A 4BE4A 5HFNA 3VDXA 2OG1A 2Y2VA 2WQZA 4YK7A 1ZI6A 2RHWA 2R11A 1AQLA 4X93A 4UFNA 1XRRA 3VVMA 4WFIA 3UMJA 3ZLVA 3G9TA 1WM1A 4AO8A 4DNFA 2WILA 1LGYA 4BATA 4X92A 4DNPA 2RIPA 5EIEA 3FCXA 1X2BA 4CCYA 2HA7A 2OCGA 1QOZA 2B9VA 1LPPA 4N8SA 3IUQA 1AGYA 4PO3X 1MNAA 4QNNA 4G4JA 4BDSA 1XLVA 2FJPA 4NZZA 2HIHA 1H2ZA 1Y7IA 2PUJA 4B84A 3WKCA 4Q3OA 5AI0A 2C7BA 2XMZA 1XKTA 3NUZA 3B5EA 1KU6A 1LPBB 5SYNA 2HM7A 2HL6A 4RE5A 3ZLTA 2WUFA 2Z5GA 1JMYA 3ESDA 3WWEA 5CH8A 1JJBA 1GQRA 4AZ3A 4ARAA 2O7VA 5A2GA 1DX4A 4GI1A 1XZBA 5ALNA 2B61A 2Z3ZA 4FLFA 3ZLUA 1BS9A 5E2IA 4UBOA 1QIIA 3GFFA 4KAJA 3H0CA 5AICA 4QDXA 1THGA 4AZ0A 3MGAA 4GDMA 2QUAA 4B83A 1CR6A 4Y2JA 2BGRA 1QIHA 1ACLA 3X3HA 3VJLA 5JAUA 1J2EA 1ODSA 4IH1A 1U4NA 2AJLI 5FDFA 1E8DA 4JH0A 5CT5A 3QMVA 3FYTA 3U1TA 1EDEA 2BUCA 5AOCA 1CVLA 1XRQA 4AQDA 3I6YA 5KBYA 3WZMA 3D0KA 1TK3A 2WIGA 3A6ZA 4BVLA 4E15A 3AINA 4QA9A 3KD2A 2DHDA 3WK7A 3ZPXA 1XZFA 4IO0A 1CUYA 1FJ2A 4PSUA 4X71A 4ARBA 5ALWA 2I78A 3V48A 3TEJA 2H7YA 4G1FA 3LS2A 1XRMA 2Y6VA 5K3DA 4AO6A 3AIMA 5DYWA 4LIPD 4A16A 5HQ3B 5IKXA 2OGZA 3ANSA 1VE7A 3V9AA 1UKCA 4J0JA 4MXDA 4EY5A 3DKKA 3D3NA 3DL7A 5CXXA 2GYUA 1O6FA 2JGIA 2WFLB 5FP0A 5JD4A 4WDRA 2WSLA 1IUNA 3LCRA 3RARA 2HA4A 1GGVA 3CXUA 1EI9A 1KU0A 1BRTA 2OAGA 4X6YA 1T4MA 3VVLA 1UK6A 5AKYA 3H1AA 2C5FA 3FVRA 1ZIXA 1XZDA 4FFWA 1GPKA 4W1PA 3T4UA 4K6KA 4UBLA 1VA4A 3G9XA 1ZJ4A 2PUHA 2ONCA 4BZZA 2D0DA 1MX9A 5LZ5A 1QIJA 4MQMA 1K63A 2ZYIA 5T4BA 1W76A 1RYYA 4G8CA 5AKHA 5AOBA 1EX9A 1IZ8A 1C7JA 5ISMA 3B3QA 1JU3A 3DQZA 5ALPA 1QIDA 4LYDA 5AI4A 2Q0XA 1JT2A 2WIKA 3ICVA 5AM3A 4E11A 3STUA 2V9ZA 3A2NA 2WU4A 4B80A 4Q1VA 4DSZA 1UKBA 4DNQA 1JMKC 2O7RA 3Q0TA 2GYVA 4BC0A 4XVCA 2C5GA 2FX5A 1AMNA 1Q84A 4MQLA 1CUIA 3WK6A 4GBGA 5AI8A 3UUFA 1DT5A 1LNSA 2HADA 4JYPA 4MJ3A 2I3DA 3RM3A 4BAZA 3I1YA 3IA2A 4I19A 4GXNA 3G9ZA 3AZPA 1BE0A 1R3DA 2AJ8A 4X6UA 5JARA 5H3HA 3QM1A 2HFKA 2XE4A 5T4EA 3D59A 3HLKA 4CG1A 3BIXA 1FSSA 1DT3A 5C81A 5IVKA 3I2JA 3LLCA 2EEPA 3G0IA 3V1NA 2PVSA 4MYSA 4HVTA 4CIAA 3F67A 3L1IA 5HF8A 2GZSA 4C6HA 4FOLA 2WM2A 4KJXA 5IH7A 4LKOA 3O4IA 1CUEA 1THTA 3JYHA 1Q0RA 3ZI7A 1L7QA 3FWHA 5A7FA 4X6XA 5AM2A 5CBKA 4H18A 1X70A 2VJCA 3VJKA 2O2IA 2XUHA 1ZOIA 2RGUA 3GUUA 5A7GA 2W6CX 1K4YA 4J3JA 2XUDA 3DDUA 5LZ8A 4FLEA 3V1KA 2CJPA 3DCNA 4N5HX 2VSQA 1ETHA 3RKSA 2VAVA 1ZD4A 1W1IA 3EQ8A 4AO7A 3H17A 5T4FA 1DTEA 3O9VA 2OXEA 2JGLA 5DNVA 1TKRA 2QT9A 1MJ5A 4G8BA 1QIFA 1VKHA 3FBWA 2HA5A 2PU7A 4G8DA 5AKIA 4AMZA 5CRIA 4B0PA 4ITVA 3L1JA 2K2QB 2WKWA 4TVKA 4A23A 4UHHA 3WK9A 1EHYA 2WTNA 3PI6A 2DHCA 2BGNA 4BYMA 4C89A 4ZXFA 1LPOA 5JZBA 4UFOA 3NOXA 3VISA 2GBCA 4N5IX 3I2HA 3W05A 4C88A 4S0XA 5KWJA 1FFBA 4IH4A 1YAJA 5AKXA 4UBJA 4Z49A 4G5XA 4J0CA 2ZSIA 2VEOA 4J7AA 4XIIA 5FPPA 5LKRA 2V98A 4H7EA 1WPRA 2HA2A 3HACA 4C4YA 2G5PA 2QM0A 5HKAA 2JEZA 5AH0A 1QIEA 1AZWA 4QEKA 2V96A 5HKBA 5JATA 1YSCA 2Y6UA 5JAOA 1CLEA 5D6OA 1CIJA 1WOMA 1L7AA 2OCKA 3WA6A 3R3XA 4H7IA 5I7UA 1SCIA 1YB6A 4X7BA 5HCUA 2XT0A 3VJMA 5HZGA 3EIOA 4FNGA 5IVDA 2RAUA 3FLEA 2WFLA 1QO7A 5ALHA 3FYUC 1XKLA 4DYHA 4NVRA 4OYYA 3R3YA 3LIPA 4E14A 3C45A 3BL8A 4BBZA 5FRDA 1VLQA 2OCLA 4X95A 4RNCA 2C4HA 2P8SA 3AZOA 2BJHA 4OU5A 4L0CA 1R50A 4KRXA 4B9EA 2H9YA 5J3JA 5AIAA 2WHPB 5ALMA 5AKKA 4TPKA 4BZWA 2OGTA 3AIOA 2PU5A 1MAHA 3WL5A 2X8BA 4H7HA 2UZ0A 3W9UA 3BDIA 2NW6A 1NX9A 4X3CA 1QLWA 3KXPA 5AOAA 4X00A 2FUKA 1WPXA 3E3AA 5DNUA 4F0JA 3O0DA 1QONA 2ES4A 4OB6A 1XZIA 1UOPA 3F97A 3OURA 5AKZA 5FPQA 2EDAA 3U0VA 1F8UA 4EY7A 1F0NA 4FFVA 2ZJFA 5JZ9A 3NGMA 4U2EA 5JALA 5AO9A 4M0MA 4J0HA 1Q83A 3WQHA 5T4HA 3WK8A 4H7FA 1GT6A 5CURA 5LZ9A 5JASA 5DWDA 3K9BA 4OB7A 1VE6A 3W2TA 1CUSA 1CRLA 4E46A 5FOQA 4C4XA 1ZI8A 3MUOA 1AX9A 5DYTA 4Y2XA 2CEKA 3LIIA 1EINA 2ACKA 1P0MA 2WIJA 1ISPA 3DS8A 3EF3A 1EB8A 3HZOA 5EHXA 3BDVA 3DOHA 2PSEA 5ESRA 4J0GA 2JGFA 5ALEA 3LP5A 4HZGA 3HC7A 2HU7A 3KOOA 5E4YA 1B6GA 1XZKA 3FNBA 4FHZA 2QRUA 3SC2A 3E1GA 1HLGA 4W63A 1J07A 4RE6A 3WK4A 5C8ZA 4W1QA 3B12A 4W1SA 3D2BA 3FOBA 4GEGA 2H7XA 1DU4A 4PF1A 2G5TA 2VJDA 4BRZA 3D2CA 2ROQA 3G02A 1N5RA 4Y2SA 4C4ZA 4JNCA 1CUHA 2PSDA 3FSGA 1RP1A 2OPHA 4QLAA 3H2GA 3V1MA 1XZCA 3W04A 1CFJA 3WLAA 1YA4A 1XROA 5AK4A 3R40A 4W9RA 3AZQA 5EHZA 1ODCA 5AI9A 3WWDA 3WJ2A 4QLOA 3NWOA 4Y9SA 4P92A 1UWCA 4H35A 4DGQA 1CUAA 5ALXA 3F8SA 1QFMA 4BE9A 1CUUA 5K3FB 1IUOA 1CUDA 1W6RA 3CCBA 1EVQA 1FFAA 3GZJA 4HS9A 4RPCA 3WWPA 3G8YA 4Y2UA 4B85A 2XUGA 1YS1X 3KWJA 2OQIA 4OB8A 4GECA 4Y2RA 1AKNA 2E3JA 3SX4A 3H2JA 1ZD5A 1K5PA 1XZLA 4X91A 1YR2A 3EQ7A 5EHNA 5DJ5A 4EY8A 4KR0A 4NMWA 4AN1A 3BIWA 3EQ9A 2XB6A 4WFKA 3I2IA 4UHCA 1MX5A 4NS4A 2BUAA 3PICA 3STXA 1IUPA 2OGSA 5AKLA 4KYVA 2WG0A 4EZIA 1WHTA 3DLTA 3QBJA 1XFDA 4DSAA 5AHXA 5AK6A 1XLUA 3STTA 1VXRA 4D9JA 1MPXA 4QZVA 4BB0A 2ZJ7A 1ZICA 4H7JA 3M82A 4EHBA 4AN0A 3C43A 4MEBA 2WLSA 2XUFA 1A8QA 1BN7A 3N2ZB 1Z68A 2XUIA 4CIBA 3IULA 2ZVDA 3QPDA 2JGKA 1E8NA 1YASA 4KEAA 1XRLA 4WFJA 3DKRA 2IIVA 3SWWA 4GWLA 4ZWNA 1H2XA 2QKYA 5AKJA 1M33A 3C6ZA 5AM5A 1WHSA 5K3BA 2BUBA 3G0GA 1PJAA 1E3QA 1E5TA 1R9MA 1BCSA 2VA9A 4BP8A 5ALQA 4X94A 2WHPA 4EY6A 2QZPA 2PSJA 1QO9A 4DMFA 3HEAA 1UK7A 3STWA 1R1DA 3RK4A 4K6GA 4EA6A 2J4FA 2XMDA 4FTWA 4XJVA 4CCWA 3C5VA 4JYMA 4BVKA 3WIBA 5HF9A 3IDAA 2RI6A 2HA6A 2IITA 4K5QA 6YASA 5E4TA 2ZYRA 5ALJA 2HU5A 2WHQA 1CUFA 3TJMA 3CN7A 2JGEA 1VZ2A 2GBFA 3HRHA 2CMFA 2QTBA 3CCCA 5K3AA 2I3ZA 1YA8A 4DIUA 4EY4A 4UHFA 4A5SA 2X76A 3WK5A 2HU8A 5LKAA 3D4LA 4QDOA 1QTIA 5JD5A 4G9GA 3W06A 1TCCA 4QDUA 1G5FA 3FLAA 2ZYHA 3L1HA 3C70A 2DCMA 5ALOA 2H7CA 2JBWA 4BVJA 4OYLA 4Y7DA 5F4ZA 3WKDA 4BAUA 1D07A 3G7NA 1CUBA 2Z8ZA 1AUOA 3IUMA 2XUPA 4DTCA 3QMMA 3I6ZA 1EH5A 2XQJA 3WKEA 2WUGA 4BC1A 4BTLA 3WWCA 1BU8A 2XUKA 4F60A 1C7IA 1P0QA 1CUJA 1XZHA 3KWFA 4Y2VA 1WB4A 1H22A 5LLSA 2JEYA 3IURA 3AJAA 3AIKA 3K2IA 4F21A 4N8EA 3FVTA 1XLWA 2IX9A 3UUEA 4GLBA 3AILA 2CB9A 5AM0A 1X2EA 2AJBA 2PSFA 3OM8A 3N0TA 4DMCA 2QXTA 1EDBA 4LXHA 2XDWA 3WYDA 4YASA 3C6YA 3FCYA 2AJCA 3H2HA 5CXUA 4OUKX 4PSCA 4GW3A 5ALKA 2WU3A 4FBLA 3DD5A 4HAIA 1VZ3A 4M0FA 1XQYA 2HA3A 1XQVA 2G4LA 2XUJA 5AP9A 5JIBA 5BOVA 3KSRA 2XLBA 2CBGA 1CUGA 1QZ3A 3OTQA 1UK9A 2W22A 3MUNA 2QMQA 3IVMA 1UZAA 3QMWA 3BJMA 2LIPA 3V1LA 5K3EA 4Q05A 1RWQA 5A62A 4H7DA 2VJBA 4MWSA 3BE8A 2WFMA 5FUMA 4Y2QA 1LLFA 2DFPA 5D3KA 2H1IA 1SFRA 1QJ4A 1O6GA 1EXWA 5ALIA 3FAKA 4X90A 3FLBA 3ED1A 1FFDA 4LXIA 4UBIA 4P08A 4C01A 2WJ3A 1K8QA 2O2GA 3I6MA 2YH2A 4Y2YA 1GPNA 1A7UA 3PDCA 3O95A 1N1MA 2OLEA 1CQZA 5AM4A 5HQ3A 1H2WA 3M3DA 2ECFA 5D7BA 4BRSA 3HXKA 4JEIA 1N8SA 1JJFA 2VF2A 2JGMA 1CV2A 5A7HA 3QVMA 2XMGA 4MEAA 5JANA 4QDTA 1VA5A 2OQVA 1J1IA 3ESAA 4BP9A 1HL7A 1QIKA 5HK9A 5LZ4A 2HRRA 1XZAA 2AXEA 2XUOA 1DQZA 4HRXA 1P0IA 2JF0A 2PPLA 2WUDA 5AI5A 3IUJA 4HRYA 3C5WP 2CKMA 1UOQA 1CUZA 3WA7A 3S8YA 1SCKA 4FKBA 1XZMA 5I8PA 1SC9A 2GBIA 5EI5A 1WB6A 4BDTA 2VJAA 4FDMA 3EBLA 4DMKA 4OU4A 5ALVA 4TGLA 2Y1KA 5ALYA 4J0IA 2JIDA 1W75A 1UK8A 4WY8A 5ALFA 2VTVA 5AK3A 1IMJA 4ZI5A 3QPCA 4UUQA 5EHQA 3S2ZA 2ZJ6A 2BAGA 4J0DA 3G0DA 4CG3A 3BXPA 3PE6A 1ZD3A 3GA7A 5AJHA 5BV7A 4ETWA 2WHRA 3A70A 1MAAA 4G4GA 3TGLA 4C87A 5JAPA 1EDDA 1GXSA 3ESCA 4H77A 4I4CA 2ZSHA 4HXFB 4PQEA 1I6WA 1R9NA 3CN9A 5BWBA 2QR5A 3BF8A 4WJLA 3WKAA 4LXGA 3IBTA 1MO2A 2J3QA 2D5LA 2CZQA 1HQDA 5D3ZA 5A6VA 1UOOA 4UHBA 3D5EA 3KDAA 2PSHA 4AXBA 3R41A 5AKEA 3RLIA 4H0CA 4Y2TA 4ZGBA 5LP1A 2VT7A 4W1RA 4EBBA 3ESBA 3K6KA 4RGYA 1VOTA 4Q3LA 4FNMA 3R3VA 4HXEB 4GHWA 4M0EA 3D2AA 3PFBA 5FLKA 3VXKA 3QITA 2Z3WA 4FMPA 1E66A 1EK2A 4MYDA 3ICWA 1JI3A 1QFSA 5CT4A 3WJ1A 3WYNA 4MWTA 4KE9A 4AX4A 1ACJA 4CI9A 3MVEA 4B82A 3E0XA 5K5EA 3O4HA 4FLMA 4Q34A 4O08A 3PF9A 2WG1A 1R4ZA 1VXOA 1TCAA 3M83A 2DR0A 2B20A 3QZUA 4X85A 1JJIA 4INZA 5FV4A 4LHEA 2XMBA 4PV7A 1YB7A 2ZYSA 3OOSA 3ZWQA 5AM1A 1Y7HA 3HSSA 2HA0A 4WY5A 2VAXA 3YASA 3W9BA 2DSNA 2ACEA 4G4IA 4QWMA 3WL8A 3WL7A 1E8MA 1XQWA 4UFPA 2XQFA 3H1BA 5CT6A 1XZJA 1G4HA 5AKGA 1QTRA 2C0PA 4ZV9A 4H7KA 1OXMA 4B9AA 5JZSA 1TAHA 1AURA 1IVYA 2PX6A 3PF8A 4V2IA 1JU4A 2B4KA 5CT8A 2DQZA 4B0OA 5ALTA 4BTVA 1EA5A 1EK1A 5IVIA 1CEXA 5JD6A 3AUKA 1Y37A 5AK5A 5C7YA 1LBTA 1ORWA 5K3CA 4B81A 2QVBA 2GZRA 3H19A 4Q82A 4UBKA 4L9AA 3A2LA 4UHEA 5EIHA 2WUEA 1LPSA 1DX6A 5LZ7A 1QGED 3STVA 2YASA 4U2FA 4OCZA 5HF5A 2WIFA 3GROA 2WFZA 1HBJA 1ZJ5A 1LPMA 3TRDA 1LZKA 3G0CA 2RHTA 2VATA 3F98A 3H18A 3JWEA 4N8DA 1ZI9A 2QJWA 5FKJA 5ALUA 2XMCA 1AC5A 1NU8A 3IUNA 1LBSA 4QDZA 3C8DA 2GYWA 5CW2A 1XZEA 2QUBA 5EGNA 1CPYA 4PSDA 2WIDA 4KE7A 2WJ6A 1G66A 5HF6A 4B7ZA 3R3ZA 1L7RA 1F0PA 1MN6A 1YS2X 1XQXA 5ALLA 5HFAA 1CQWA 2QJRA 3C8HA 3GBSA 4XX1A 1MTZA 5ALZA 5SYMA 3FYUB 5C8XA 4YPVA 2HDWA 5EIAA 2VT6A 3BJRA 4K2AA 4QWWA 4U2DA 1SCQA 1ZD2P 4U2BA 3I28A 5JYCA 1BEZA 1MT3A 4DMHA 4KRYA 1VJ5A 1ORVA 2HFJA 2C0QA 3HYSA 1A8UA 3DYIA 1TCBA 1YCDA 4Y2PA 5DNWA 2XQKA 5LIPA 1MU0A 1EB9A 3VKFA 4BCCA 2O2HA 3H04A 1XZGA 3WZLA 1A88A 1ZGCA 3PFCA 2XI4A 1DQYA 2G63A 5BWCA 4IHAA 1CUWA 2PBLA 3O9MA 1FFCA 1HKHA 1J06A 4LYEA 4IQ4A 3WKBA 1CUCA 1K6EA 3G0BA 1WB5A 2R8BA 3G9UA 1CUXA 3DYVA 3M81A 2XMRA 3DEAA 2XUAA 3WWOA 4DNOA 3F9CA 2DQYA 5ALSA 4CCYB 2C58A 1N5MA 1BCRA 5ALDA 1DINA 1H23A 1T2NA 2PM8A 3T52A 4L72A 1JFRA 3QYJA 1LPNA 2PKYX 4X97A 2V97A 3SK0A 3HI4A 3WIOA 4DLNA 2HHAA 2HRQA 3O4JA 4BCBA 1IZ7A 1HDEA 4G9EA 4J0KA 3HJUA 1ZIYA 1QE3A 3IIIA 3IB3A 1G42A 4F5ZA 2WTMA 3FSGD 3I2GA 1GQSA 2BKLA 1Q0ZA 1S8OA 3H2KA 5CTAA 4ZRDA 2BFNA 4UBMA 3P2MA 3DNMA 1A8SA 1P0PA 2OCIA 5AIBA 1BROA 4HTAA 3WMRA 5LZ2A 2QOEA 3ILSA 3DOIA 1LZLA 3C6BA 3QH4A 5YASA 3PUIA 4AB1A 3AFIA 1PV1A
chains in the Genus database with same CATH superfamily
2PKQP 2CE2X 1YJ9V 2TMDA 2B1GA 5EQTA 5FL3A 3DQPA 3K7EA 1JDBB 2I6FA 5I9SA 4JGBA 2CHEA 3QPAA 2YJ6A 3V4LA 2QA4V 2LDBA 3GOHA 4RV9A 1G20B 3HYTA 4RHCA 2CFTA 4ZOLF 1EJBA 1SUPA 3S4YA 3IAXA 1DMSA 2C4WA 4XUCA 3A6DA 2XEDA 5LVAA 2EKZA 1PHPA 2P3OA 5IT9N 1TT7A 5FUXA 3OZXA 3FB1A 4PDLA 4WPGA 4RY2A 2JGJA 4BO2A 3H1KH 3KE8A 1EKXA 4CN9A 1XRPA 5G02A 5I7AA 3S40A 1C4XA 1ML3A 4F9FA 1NYRA 1VQMV 4ZA2A 1W52X 3F46A 5K1ZA 3THWB 4YGXB 1KC1A 1R15A 4KMOA 4E13A 3BWXA 1YZBA 4Q3AA 3TG8A 2HV8A 3WL6A 1FBNA 4U00A 4HYTA 3OOYA 3ZHTA 2Y0IA 4UU0A 2J4CA 1R8YA 4UCWA 2JH8A 3L8EA 3C87A 2UV8A 3OEHD 2NXNA 4CF5A 4DWWA 4IRUB 1CDOA 4KFTA 4JUAA 4J3NA 1RLMA 3NANA 1A9PA 5K9ZA 2LNDA 5FR2A 1R88A 3K1YA 4Z54A 1NDHA 3HWX1 3FLMA 4G5YA 5K0LA 1U8YA 3LUTB 4UEKA 1E1NA 3FYUA 1W2BU 1VCNA 4CMIB 4L73A 1X80A 2ZROA 3WMFA 4CV3A 2JJ1D 1YJAA 2XNDG 3ORQA 2VLBA 5J58A 3WYBA 4Z4CA 3F3KA 5D3MA 4M37A 1J5EB 4D42A 1P9NA 4N3AA 4AKIA 3O9OA 5JSUA 4E21A 2C2GA 3TTSA 4OQPA 1TIBA 1ZUWA 1V39A 2E48A 3KAJA 4CDMA 2Y77A 2VHQA 4HNUA 4PDRA 4XFJA 1A3CA 1T5OA 3U7FB 4P30A 5FNVB 3TXQA 1UXGA 2G5GX 3L9DA 3K5WA 4PLTA 3GFSA 4FHGA 2AZDA 4JT9A 4ARVA 2QX6A 1Y4AE 3ZCSA 2BTEA 3WO0A 4DSTA 1GSHA 5JJJB 1SVLA 4NOMA 2C4VA 2P9GA 1K4KA 4CMBA 2JDID 4FYVA 2IH1C 1C7ZA 4MWOA 3IE2A 3L1UA 3KLPX 4RO0A 1ZNWA 1KFCB 5FI3A 5SYNA 4BMPB 1DC5A 2V3WA 3EDQA 3K4PA 3DBHA 5IMSA 3JAMN 1XQ9A 2H48A 3G7UA 3E53A 3AHHA 3NALA 3DLHA 2YCLA 4C7UA 2XGOA 2O7VA 5A2GA 4WBNF 5LM3A 5JCJA 1KJZA 2DLDA 4OXKA 3L05A 2QNBA 1L7OA 1PM9A 5C8YB 2HKOA 1KYYA 4REQB 1VF7A 3OECA 4G1BA 4MICA 4HYEA 2AHOA 5CFQA 3RDPA 3M49A 4G86A 5KS2A 2VHWA 3ED5A 2ID9A 4Q7MB 3UOAB 1IEXA 2YFQA 4CM3A 1V35A 5I4IA 4IH1A 2BCGY 3VM6A 3FOFC 1E8DA 3IP7A 1O0SA 4JYCA 2GD0A 5KWSA 3AHDA 3MWDB 2G83A 4URYR 3A9CA 3N8GA 1X0XA 1DOAA 2X42A 4DCCA 3LRXA 4YMIA 1K06A 3KHTA 4RKRA 3SQWA 1IBLO 1Y1RA 4EHJA 2ZVPX 1OCRC 4DWVA 4JCOA 3BRSA 3ZXUB 3KUCA 5JV5A 4A16A 5FL7D 1FUUA 2EZPA 1XL4A 2F3TA 4MS2A 4CHTA 3DHYA 1Z0SA 3G80A 5CXXA 3O8RA 3NBKA 4YMTA 3RU2A 2V03A 1Z26A 3RT1A 4RL6A 1I5XA 4ZICA 1LI5A 4CKXA 2BFPA 1DRWA 5GV8A 2NXEA 4FSDA 4HDSA 4L6AA 1CFZA 5KWVA 2CUKA 5AG2A 1FUIA 1P1RA 1VSVA 1CQIA 4E33A 3GUHA 1CVIA 2H57A 4WVLA 3MF4A 4BZZA 1BHO1 1A5ZA 4ZYVA 2AG8A 1B6TA 2A86A 4CEHA 3OFNA 3B3QA 1I7LA 1XR3A 4L4RA 1WXDA 5E2AA 4CEIA 3STUA 3ML1A 4G0NA 4Q1VA 2AQ8A 4HNSA 2WLHA 1NYTA 4UM8B 4MQLA 3T0IA 3ZD8A 1W8IA 2PUBA 4N12A 4KOEC 4XKJA 3U40A 1EZZA 1OZFA 2PQ2A 2H4YA 3X1DA 3AVUA 1LNSA 5JEDA 1N9KA 4Q21A 3G9ZA 2WLIA 4MYHA 3GWKC 3IXQA 1GV1A 2C2MA 2ID7A 1XYVA 2BCCH 3CWQA 3DKVA 5D7NA 1AS0A 1POWA 2NZVG 4D9HA 3H1LH 4MVYA 1YDMA 1QR2A 1T1IA 1I5RA 1CULC 4FOLA 4YRJA 2J3KA 1PYOA 4BBAA 4TQ9A 4FZVA 3OQNA 2XUHA 4DV4O 1T8SA 4NAVA 5B30A 2XUDA 2IM9A 2BEWB 5HDQA 1KVUA 3L9WA 4YRSA 3AFOA 1UT5A 3NHJA 1YTLA 2XSZD 1TKRA 5C52B 4G8BA 3FBWA 2PU7A 5CRIA 3PI7A 2K2QB 2EKPA 4N3NA 3CE9A 3QFRA 5T8KC 1U3WA 2XOKD 1KJ9A 2XT6A 4INJA 2HT6A 5G41A 1FMFA 1CNFA 2QX7A 4YEDA 1B0AA 2H4WA 3F5QA 2XIQA 3J7AC 1EN5A 1XDCA 3HJGA 3WLQA 4XIIA 3HADA 1GG8A 2YV4A 4X1IA 4ZHSA 3RLFA 3OMNB 2Q4PA 3JWPA 3ROTA 5IABA 4Z4GA 4I2NA 5E3HA 1U8ZA 4YIOA 1Z2AA 5DBOA 1Q1ZA 3P4YA 5JFGA 3TCNA 1I4EB 1NW7A 4IXDA 5CM2Z 1SA0B 3RADC 5C4MA 3SSAA 1CJKC 4LVOA 4MS4A 4YHBA 1ENYA 1P84F 4NVRA 3BREA 1TL7C 2FTKE 4HQLA 3U7HB 4U7WA 2C4HA 1YB2A 4TYMA 1J9EA 5L95A 3TZEA 3WHIA 2ASVA 1TJ5A 1ZUIA 3MTJA 4WINA 4YJGB 1RC8A 2QTRA 2VF8A 3V4PB 2B83A 2RHOA 2OGTA 2QZJA 3DMPA 4QNRA 5DM60 3E03A 1G9XA 3DULA 1P9LA 3O7WA 3UO8B 3ZQUA 5A1JA 1Z4JA 4GQBA 1WPXA 5EIOA 5DNUA 2XDAA 4OB6A 4S12A 1S02A 5AVJA 1LUVA 3ESRA 4FUTA 4M98A 4RD3A 2O8EA 1V9SA 4RGVA 4YMGA 4PCUA 4NG5A 4O4HA 2VRCA 3GV0A 2IZOA 4U8GA 4DLPA 1P75A 1ZI8A 1T0JB 3SDZA 4OQDA 3CR3C 2CEKA 3T3GA 1L8LA 4K6OA 5CB4F 1YTFD 4H44B 3AG2C 2XB9A 2BRUA 5TE9A 5ARCA 3F6BX 3TQTA 4Q7LA 3IIKA 5B3JA 2FQ1A 3QA3E 2EBFX 4AJ9A 2ILTA 1PQYA 4FOTA 2VSOA 3IR6A 2I0FA 1V95A 2WB2A 4D3SA 3UF0A 4OXQA 4I5EA 3L02A 2VJDA 2TMYA 1U8XX 3JQAB 1NS1A 3KNZA 3FDZA 4GXRA 1Z5NA 2PSDA 3X1WA 4BFYA 3QF7A 2CUNA 3DR3A 3EK2A 1CRPA 3FFBA 3SIPA 1TF7A 5AW3A 1E3SA 4YP6A 1I2AA 3SJAA 2PLWA 3HPRA 2DPXA 3R40A 1A9XA 1QX3A 3IVCA 5ESDA 3MTQA 1ZGJA 3O8OB 2PUWA 2WWXA 1Z6ZA 4R9UC 1VJCA 1F1BA 1NBOA 4EX7A 3M0EA 3NHPA 3V97A 4IXNA 3SBXA 2B21A 5CLHA 3WQSB 3KALA 3KWJA 3VU9A 4UHJA 1YXMA 3PFNA 2DE0X 2W2PA 3U81A 4QE9A 1XNQB 1FRFS 3D6TB 2AYXA 3FRJA 2EC5A 1RKXA 2C1EA 4WFKA 2KSDA 2MSEB 1R1BA 2VPXA 3LPMA 4CWAA 3EA0A 3E7FA 3VO1A 1G7SA 4LYAA 5AKLA 3B85A 5BN3A 4EZIA 2YI8A 3SR4A 1U7TA 2VWJA 1EFTA 1XWWA 5JY1A 3STTA 5BQPA 5DASA 2VT2A 1ZICA 3CZ5A 1XMJA 4XB1A 5BRAA 5CAEA 3OMIB 3QVUA 2HT1A 3W6PA 1O2DA 4QDJA 3QPDA 4HT3B 1YASA 1VP3A 1V3QE 4HMOA 5KI6A 1Q1AA 1UBEA 1VTKA 2RGYA 4D25A 1XTUA 2QKYA 4XSGA 3G2NA 2X7RB 5TDHA 1AQYA 3VR4D 2ZRQA 2ADQB 4R9RA 4J0QA 3WGMA 2HBYA 2QZPA 4Z3OA 3SS8A 2PCJA 2DGDA 4XTCS 2PMDA 3AM5A 3AF2A 2FPIA 3EXG2 1ZEMA 2Z6VA 5CD9A 2A94A 2OO3A 1Z0KA 5LQJA 1VBKA 1S0VA 4LF9O 1XEQA 5J2TA 3P71T 5KUKA 4AMUA 4DCOA 5ALJA 5JI3E 2P2NA 3OX1A 3OCUA 3TTXA 1YUMA 2WR8A 3RRMA 2J32A 4KQWA 2Q8QA 4IQGA 3LC2O 1W8DA 3NBUA 1X7DA 4PELA 4OV6B 3ZJ4A 1M1NA 2G06A 2HU8A 2GPJA 4BLSA 1Y9ZA 4QDOA 4RZUA 3T1HB 1VJ1A 4R8RA 4FZ5A 1LLDA 4EUNA 1C1XA 1BWQA 5KQGA 2BD0A 3PC2A 2VQEB 1BOFA 3A0BZ 1E2NA 5B3LA 1XE3A 3KV1A 2JJMA 3AG5A 4B4OA 2AKYA 3A9TA 1T5BA 4MT8A 3WKEA 3UXEA 1JE0A 2HSGA 2V5VA 3WWCA 1RWMA 1YOBA 4F60A 1QC5B 1ZH2A 1H22A 3ZU2A 1E92A 1WF3A 2FMTA 1QH1A 2X86A 4XYGA 1TGVA 3CZ4A 3I6IA 1KZYC 1R4NA 2GCOA 5GONA 5LDHA 3PPYA 1FUYB 2GDZA 4PINA 4BMZA 4YMHA 2OFPA 3UHPA 4OUKX 4AS3A 1L1EA 4GW3A 2YNMA 4ZAVA 4ZFNA 1SVKA 2CH7A 4MULA 4FR2A 3ZDYB 2XUJA 1BQEA 1D2CA 3JRXA 3OCVA 3RTEA 1Q1BA 1PUJA 1HOTA 4YO7A 3HSKA 3O3OB 3UJ7A 2VPTA 4AN4A 4D46A 2AWNA 3B6MA 3TZHA 5FUMA 3UK2A 3UFXB 1EE2A 3PRJA 4JJAA 4OGGA 3T9EA 3ZBHA 3SX2A 4PGMA 2J31A 4FYKA 3H97A 4XD7A 2P90A 3P4UA 4P08A 3S3XA 1I36A 2VJOA 1JJ7A 2AN4A 2IQ5A 3PDCA 3ZWNA 1C3OB 1YL7A 5K0SA 4PE5B 1VGQA 2XQVA 4Q9HA 1U3UA 1N8SA 3CEHA 2O05A 3BYZA 5F5LA 3CNBA 2JGMA 3ZRVA 4G1MB 5ILGA 2P6PA 5A7HA 2PRSA 2A5JA 2ZWPA 2XAJA 3DE2X 5JANA 4HAZA 4O0LA 2IL1A 2NSHA 2ZXUA 4PBRA 2W4IA 2ATVA 4K8ZA 2I34A 3NYRA 4OP1A 1RD4A 1XZAA 5IT9A 2OXTA 1PJTA 1JB1A 4MS3A 3EF1A 1AKEA 2IW3A 1PJLA 3S8YA 2IOFA 3KT3A 4MYCA 4RCYA 3C3AA 4WASA 3WVNA 1PBTA 4AJEA 7REQA 5EUMA 1N5OX 4TLAA 2IY9A 2LP7A 3LDGA 1SZXA 2PUTA 3IDQA 5JRZA 4ZVRA 4AMBA 2ZPTX 4BPRA 3OX4A 3H6KA 1KSFX 4ZZ1A 4EECA 1JG7A 3BK2A 2GJAA 2XE6A 2ZJ6A 1F2UA 2O2JA 4D3ZA 1XTTA 3X1JA 4ND5A 4TZ0A 3HVIA 3KXDA 1OAKA 1ZESA 3K3WA 1OA1A 3QWAA 1L5KA 4O59O 5AW1A 1E6KA 4LAFA 1E0SA 4YMUA 4KL8S 3FF1A 4GKJB 5FQOA 1JFVA 3LZCA 3AHEA 3TDMA 2F1MA 1LLCA 4OL9A 3LC0A 3U7GA 2FPWA 3AW8A 2CZQA 4FLUA 5D3ZA 4BLWA 3C16C 4GLJA 4H0CA 4Y2TA 4ZVTA 4MUFA 1XL6A 4Q6GA 2K7FA 4LYFA 3PFBA 1DJQA 2FXIA 1EYZA 3CZAA 2AHZA 2CL5A 1XTVA 1Y3DE 221PA 3AETB 1VL0A 5CT4A 1I2BA 3R8XA 4KPUB 4PHTA 5H9WA 3A1NA 4YXWA 5C2JB 4FLMA 1K8RA 4NDAA 1VXOA 4CM1A 4NPHA 5DCUA 2AMLA 4M9XA 4QJIA 3BFPA 4LYJA 4Q4DA 4ERXA 1G6HA 5DWVA 4MRRA 3FYIB 1QDUA 3PPVA 4TX1A 2P40A 16PKA 2VJLA 2GZDA 2I1WA 4OXXA 4IJ6A 4JHLA 1OXMA 1GA1A 4IZHA 1G6Q1 4FIZA 3MS7A 2I4TA 2AOTA 3IFXA 1Y3HA 3UOWA 2UXCB 3A06A 1A9YA 5JS1A 4AY2A 4FB4A 3AWDA 3CVJA 1UBUS 4L4UA 2ZYVX 1VGRA 4OLBA 2YASA 2R87A 5FLXN 4MVRA 4QELA 2Q4TA 2PZSA 2QVZX 1U5AA 4W5WA 5B1IA 4HH4A 3MJEA 2QNRA 4UATA 2DYSB 1F60A 2FK8A 2A79B 1UMKA 2QDOA 2HRDA 5BPFA 1FLNA 4PSDA 3HCWA 3TVYA 1NKSA 4IYIA 1G66A 4FNOA 4P7BA 2YY5A 1A98A 1TO2E 2G38A 4E94A 2YV2A 4JI5B 1YS2X 4EG1A 4RVDA 1M5IA 2D0OB 1RZUA 2NADA 3C8HA 3WRYC 2N0SA 1F4LA 5FFFA 1MW9X 3O9ZA 1GM9A 4MUIA 2JGDA 2NVOA 5SYMA 4QJ5A 1FXVA 1DDOA 2KI5A 1Y66A 5DX8A 3OSUA 4FHCA 4AILC 4OHXA 4B4KA 1J24A 4G0ZA 3G89A 2R7AA 5JYCA 2FL4A 2SKCA 4FD2A 1CVRA 3ITDA 4B3RB 2IY7A 1P17A 5LP6B 2PXHA 3IEKA 5EAIA 2QSJA 4HLDA 4MVZA 1ISJA 3IAS1 1U4SA 1W36D 1EBOA 1ZVJA 1EFDN 3GRZA 4CV0A 3K2EA 5HVNA 4KXVA 1UBCA 1N3YA 1WO8A 3EWSA 4IHAA 1Q8IA 1FXWF 2WT8A 3TR0A 5EXDA 2X1LA 4TVOA 3FI9A 4S1VA 4Z3DA 3F0TA 4ICIA 2PNJA 4Y0NA 4I08A 3AOEA 4G67A 4EYGA 1M6HA 5ALSA 4UULA 9MHTA 2EJVA 4IJWA 4CDRA 3FZQA 1NNLA 1LPNA 2HYDA 2KS6A 3O47A 3LM8A 4IDEA 2HRQA 5EKXA 3PTAA 4LJ9A 3DFKA 4FOSA 3EW7A 1C8KA 2NYVA 4QM6A 1TPZA 5LA6A 3K08A 1R6BX 5C5DA 1U1FA 2A9QA 2OM6A 1WSDA 4ZRDA 5DISB 2C00A 4K9MA 4HTAA 1EFPA 2R8YA 5M5BA 3C6BA 3PUIA 2W43A 4H1WA 1A4XA 1RCTE 4RUEA 5H3LA 3APQA 3ER8A 4PA9A 3FX2A 3KUKA 4RH3A 3J81A 4OD0A 3MBIA 1QVGU 1Q22A 4DM4A 1URFA 4FMCB 1WXHA 2J1LA 4QE3A 1C8LA 2G4CA 2H1WA 1QGUB 3IC9A 2ZSEA 4MRAA 1C9DB 3NIDB 3EGXA 5IKEA 2FR1A 3A4VA 4CM9D 4ZYYA 3HABA 1V7QA 4IEIA 1NLZA 5DHFA 3TG2A 4YR7A 1RS0A 3HDJA 3T5MA 3MOIA 5A03A 3LDDA 4G26A 4INAA 5LQUA 2DN9A 1IWBB 4OXSA 2C9BA 3P0IA 1KR2A 1WE2A 1EVEA 4Q03A 1IHPA 4PR3A 1ZSVA 1FSPA 1T24A 4ZMSA 2OM2A 4JUIA 1GPLA 5DM4A 4IWYA 4C0KA 2ZM6O 5H5JA 4OMUA 2ZB3A 4NY1A 4O0MA 4Q4AA 4JBLA 2LGQA 3KJIA 2PKXA 1J0AA 4Q9AA 3P19A 1JKMA 5JJEB 5BOSA 5IDYA 4CS4A 1NMXA 3VR5A 1N8NA 1P6XA 2HJRA 2IUTA 3IR7A 4UHDA 3FI0A 521PA 1TNDA 3LHIA 4WE3A 3C5CA 2FR0A 2AFHE 4Y1RA 2FWIA 1QNMA 1V0JA 8MHTA 2O2DA 4EARA 3P0EA 1XRNA 2RJZA 1MX3A 3FNHA 4PA6A 2RK4A 3L5OA 4AMYA 1U65A 4P9NA 2P5SA 4IDBA 2DBYA 3NVAA 3INYA 1HG0A 3CPWU 2W2LA 1LDGA 3LKZA 2J0VA 3R0VA 4LBWA 2GZ1A 1K7YA 4YIHA 5AJWA 3RN4A 1X1CA 5JS2A 7ABPA 1MV8A 2Q5JA 2O3RA 4R05A 1SU6A 3LC1O 5BY1A 1FTGA 3N8NA 3FAVA 1VMDA 4WFIA 2POCA 2ZRJA 3A1DA 2ZUCA 4WLUA 4DLBA 5F7JA 3TLEA 4KU4A 2GEBA 1FFWA 4C30A 1RM0A 3ZMZA 2WILA 1MOZA 2OAQ1 1LGYA 6REQB 4BATA 2IYUA 3DONA 4DNPA 4MP6A 3C3JA 2WF8A 4TVSA 5E7MA 4PO3X 2EJBA 5CDSA 4JLKA 4JWTA 1JLLA 3FM9A 4IV5A 4M3NA 4B84A 1SOWA 4JT2A 4R2HA 4R01A 4FEEA 3QLEA 1C9EA 1K3FA 4U6SA 3ESDA 3JWGA 5HZKA 3KKZA 1OVMA 1S9DA 4BS9A 4ARAA 1YH3A 4QAQA 2VO1A 3MM4A 4FLFA 4B6EA 1U7UA 2I7DA 4HUQA 4Y1EA 3SN6A 1HWYA 4QOIA 3WIEA 5CBPB 4DEVA 3CX3A 4D0RA 5FX2A 4AZ0A 1KO4A 3ZHRA 2BFEA 1XU7A 2Z3VA 1LVGA 2R3SA 3X3HA 1ODSA 4FLZA 2AJLI 1ITZA 4DR1B 2V1UA 3QMVA 4H4CA 3W7UA 1XRQA 1T3TA 2RH5A 2OBBA 4BJ6A 2FXVA 3QV1A 4RTPA 1OD6A 3LECA 4B3SB 3OEEA 1WOYA 4C22A 3UIEA 3B53X 2IYZA 5EMLA 3RVRA 3LAWA 1YZKA 4IDPA 5HE8A 4M1MA 2AX4A 4FXPA 1N0NA 1J8FA 4EW2A 2YDEA 5TQJA 1TEXA 3FB8C 1P1HA 4MVXA 3V7UA 3S55A 1GSAA 1BZKA 2CV0A 4XOIA 2D1TA 2O07A 1NXPA 1EI9A 4UOEA 1A95A 2ABWA 4CM8B 4EMUA 1JYFA 3MTAA 2ZIAA 3ABSB 4MQ5A 4D5GA 2ZTLA 2KPOA 2IF2A 1WCWA 4ENTA 3B9PA 2GESA 3CJTA 5K3OA 2M6YA 3L0CA 2VNJA 2GM5A 4B46A 2JFZA 4G0VA 2C2XA 4IRXA 3FNGA 4CEJB 5L3EA 1NUTA 5HFJA 2J3EA 1CJBA 3RNOA 1F0KA 3VR0A 1F2DA 4L5BA 5AW0A 1IM8A 3DW3X 1BL8A 3ZHBA 3RC2A 3A2NA 4M86A 4DSZA 2NTYC 1JMKC 3QY9A 3HXQA 3X44A 3TX6A 2FX5A 4DA9A 3OLXA 3OO0A 4OH7A 4GMHA 4QJBA 4DQLA 2E4UA 3JQ8B 4BKMA 4F2HA 2EKLA 1A1VA 3THRA 3AZPA 3TRKA 1GGMA 1FSGA 5BNFA 5ADHA 2BF7A 1TF2A 3BIXA 3UYKA 2HLHA 3WZ2A 4MUNA 4ETIA 1QRDA 1LS1A 3PXGA 4PHHA 1WMAA 2Y68A 4L2IA 3RTCA 4B3FX 1L7QA 1NTOA 2Y48A 1NE2A 1R9JA 2VJCA 2O2IA 2X9GA 3BD6A 2WA4A 2PQ0A 3BD9A 3D7NA 3O74A 4WKOA 2RDCA 2R6FA 2G1AA 4Q9NA 1W1IA 2XZOA 1CR0A 4AO7A 3KR1A 3P5BA 3PQFA 5HQTA 1R0BA 3MB8A 4BFXA 1QGOA 3TK1A 1GFSA 4JV5B 3C5HA 3DM5A 3U4QB 4OTZA 1RHKA 5KHHA 3RS5A 2EIXA 4D9KA 4FN5A 4XCVA 1H2LA 3A37A 4LBEC 1XWIA 3AW9A 3OQMA 1O89A 4BQOA 2BGNA 1IDOA 4I6JA 1OGJA 4PGAA 3UKOA 2GKGA 5KVVA 4NYIR 5EQJB 1KOLA 3OLWA 1QB7A 3LP8A 3QLUC 1CF2O 4EGQA 1G8HA 1YR7A 2DYSC 3Q7RA 3OUTA 3ASYA 5CVUA 2PYZA 5JATA 2QW0X 4HB2A 1M2VB 4AURA 5HM8A 4GH5A 3AVWA 3FD9A 3QU9A 5EWLA 1IXYA 4BN5A 5IDWA 3NDIA 1S7GA 2HNKA 2XT0A 3SHTA 1HX7A 3TLGB 1OJ7A 2RAUA 4D26A 3H9QA 1W5AA 4OJYA 5T3YA 4HCJA 3LIPA 1OCRB 4QUDA 2QXYA 4L9RA 4PU0A 4L5JA 2QVGA 4EENA 4YV0A 1JALA 2O3JA 1ZM7A 4O4JF 4PPGA 5B5EZ 5LP6C 1WDKA 2GN2A 2JNWA 2J45A 4L8YA 2NVBA 5MHTA 3AB3A 3X0DA 4FI3F 4KIJA 1NQWA 4PAOA 2FEWB 2C4KA 4PGFA 2E75B 1NX6A 3NBMA 3WAGA 3RYTC 1PYGA 3UB3A 2G9QA 3LX4A 1PD3A 1Z4LA 3IXLA 2O54A 3O0DA 2ZDGA 2FDCA 4BQPA 3L0OA 4M9QA 3L49A 2FW0A 4EY7A 3PWSA 1K7XB 3EZFA 1GUBA 2AOUA 4M0MA 3WK8A 4M7RA 5LZ9A 2RCYA 3M4ZA 5JASA 4OFWA 1OH6A 1QDEA 4AUMA 4NENB 4BZPA 2IUEA 4CKEB 1EGAA 1LJ8A 2AMVA 5EZYA 1MCZA 1XTPA 2EKQA 2DETA 1CRLA 4PN3A 3SZUA 5CVJA 2HY7A 4H37A 1SWVA 5CM8B 2PGGA 1HE8B 1KAOA 5AXAA 3BERA 4TLCA 4MUYA 4JWKA 2V6FA 1HW7A 1YFZA 2NYRA 1OFUX 2FLKA 4BKRA 1QHHA 5HOEA 1KO5A 4FZRA 3QO7A 3U16A 4ZAFA 1MC8A 1V16B 3CRAA 2Z9CA 2IK8A 4O33A 3U9SA 4M0KA 1FYWA 2BEVB 1GRNA 1CF9A 1BA2A 3H5RA 2GM4A 1X8LA 1KZ4A 3L8DA 5L9AA 5E6RB 1YJNV 1GRQA 4W9NA 4Y9TA 4KW7A 1PNOA 1GDTA 2VDUE 1RTKA 2DBZA 4JA0A 4B6SA 2Q6AA 2GD1O 3BJEA 3CSXA 3OOJA 5IN5A 3WWDA 2IYEA 2PX0A 4UOQA 1B93A 1TMYA 4P4LA 5GADl 4MIKA 5TMBA 5ICMA 3DV0B 5FOTA 5DHSA 3CZCA 1E1CA 4WAUA 4L8JA 3LH5A 4OB8A 2C97A 2E3JA 2NV6A 1TM3E 3TTYA 4PA4A 2VYVD 3MUEA 1UMBA 4QQ8A 3OFSA 1Z5VA 3JZDA 1QF6A 1ISGA 2YC2C 4N49A 3SFVA 5IWAO 1COWG 4YT5A 3AHGA 3ITEA 5H4HA 5KAMA 1XDDA 4P86A 3FPAA 1B8PA 2ZJ1A 4D9JA 1MPXA 4R50A 1RU3A 4BRUA 4O1HA 3CWBH 4LZWA 3W7TA 1ZM4A 4JN6B 5ES4B 5AT1A 3W4KA 4BMVA 1A8QA 3Q9SA 1EN6A 5C0OE 3UT6A 5DGHA 3TL3A 3WJAA 4EPTA 2UXDB 4BZXA 1QBGA 1NY6A 4HFMA 1ZITA 1PO7A 4QL3A 2Q5LA 1XQ1A 5DXFA 3Q5EA 4JP5A 5IT4A 3G0GA 1AI5A 2RBEA 3IAUA 1RADA 1I1OA 3UW3A 2FZCA 1RQNA 1K9SA 1Z2DA 1H3NA 5ELLA 3LMKA 2J4FA 5L3QA 5ADVA 3EHDA 3M1YA 2RI6A 3OQPA 2X8JA 1YJCA 1B1CA 2Q46A 2X5KO 3OZ7A 2JBAA 2Z5FA 1G9SA 1K88A 2PX8A 3PR3A 4D0GA 2CE7A 1ZG3A 3OVMA 2GN8A 1KUQA 3ZZ0A 1M66A 3W8EA 3K9LA 4DEYA 3COJA 3Q1LA 3SQLA 4QDUA 1W2GA 1DBVO 1XEWY 3NUQA 1IWPB 3OE7G 2CK3G 3L01A 1K8ZB 4MTOA 3N2EA 3GF4A 3KLNA 5EPOA 3WKDA 2CD7A 4GNKA 2AIRA 2O0HA 3IUMA 1XXHE 5HIAA 3MRSA 1G3UA 2Z9BA 5DEDA 2GF0A 5DHPA 1TB4A 3LDUA 4Z4EA 2RIRA 4RDCA 3M7MX 1TK9A 1L5HB 1M7GA 2W00A 1Q6IA 1LQ2A 4TV9F 1CZOA 1CB0A 1YL5A 4QEZA 4BFWA 3WNZA 2GSDA 1HNNA 3DAGA 4GMDA 4E2ZA 4CU5A 4DSOA 4NR0A 4UTPA 1JF8A 1B3QA 3B1VA 5JIBA 3DDOA 3JS5A 1H9CA 5KO2A 3AJDA 4TMKA 1I14A 4ZQFA 1JHUA 2BFAA 4QO8A 3K79A 1FZTA 1XREA 2DQ4A 4JBHA 3I9FA 5B58C 3JALB 4AKTA 1NBME 3PXEA 4H7DA 3LK7A 1VBFA 1LLFA 5D3KA 4OI0A 4AG3A 1P1CA 2KM1A 1ECBA 2P4VA 3L79A 2QVCA 2DC1A 2NUAA 3CPJB 4ILKA 2YH2A 4DMGA 1X7ZA 1TD9A 2WRZA 3L0ZA 3R9XB 4QPCA 4ARZB 3AP3A 3CY6A 4LMBA 4P2GA 1C1YA 3NWEA 4JEIA 4W9MC 3ID6C 1GGNA 4EY3A 3FUWA 3C3KA 4ZI7A 3J7AU 2VDRB 3T9FA 5LYJA 2D13A 3G79A 1MBZA 2QKSA 4MCAA 3RVKA 4MQ4A 4IEEA 5EJMA 1KDZA 1E2DA 2JVJA 2A1UB 1RFYA 2A5FA 3PRHA 1N6PA 4HRYA 4XGKA 1UOQA 1K5GA 3UEOA 1RJFA 3EDYA 1XHZA 3U3JA 1VDMA 4DB4A 2O1EA 4MVJP 1BO6A 3TW6A 2F2TA 1N3IA 3DKPA 1E3IA 3F4BA 3A05A 2JCGA 2JCVA 1W85A 1IMJA 4Q4CA 4JB0A 3C90A 3E5HA 2B3TA 4UCXA 2BAGA 1TEVA 1OZ0A 3DGEC 5HKKD 2C8LA 1FTSA 3A70A 5C46F 1ZS9A 3GVPA 3PNMA 3ZIUA 3N75A 5AJVB 5LB4A 5DGTA 4I4CA 1HO3A 3GGJA 2O2ZA 3ZQJA 1H4SA 2VF4X 2HLDD 4LDPA 1SHZA 2YWJA 3KOYA 5KYWB 2DRIA 5HZHA 1JQKA 3EEOA 4RYDA 1D2HA 2G70A 2VPZA 1QTNA 3VYUB 2H3HA 2OBFA 1CIVA 2FZVA 2R70A 2Z3WA 1E2FA 2LGJA 3THYB 1F8YA 5IX8A 4FINA 1E62A 2ODAA 2OB2A 1XXLA 3UC5A 5CA0A 3WJ1A 2GF9A 1ACJA 4RF2A 3MMNA 2OOKA 3PF9A 3T7JA 1NJFA 4UZSA 4XDKA 1BKSB 1JVSA 3ZWQA 4KSBA 3QXHA 3OTOO 1HDCA 1F5SA 4V03A 4BECA 3K53A 2CTWA 1Z75A 3DF9A 1YR8A 3GEPA 5EJ5A 1G8GA 1HTTA 4B9AA 2WJJA 5JZSA 3E23A 1YITV 3O82A 5ICEA 2JCYA 3PF8A 2F1JA 3CEMA 1FNCA 4NMXB 2ZBFA 3ST7A 1EK1A 2JLUA 2VOJA 3GZNA 3UJ3X 1ZJZA 3N2LA 4COKA 1ORWA 5FBLB 3V80A 3MIZA 4R2JA 5A3JA 4KQGA 3A2LA 4OIMA 1FNMA 1C7QA 3MELA 2XVAA 3B3GA 3RSHA 2UXBO 3GROA 3AM3A 3D0QA 3BC1A 3EMBA 5E38A 1MFPA 2XXJA 3F98A 3JWEA 1VSQA 1JW9B 3HB7A 3ANMA 1BXGA 3KOMA 4MR8A 4PG6A 4QKQA 3UMGA 3FWKA 3LVQE 5ALLA 5JDIC 4QGBA 1OH8A 4RUKA 5G1NA 4PLWA 2PQMA 3E05A 1NXWA 3EXHC 1T9HA 2PTGA 1XNRB 3FYUB 2VZ8A 5CDTA 1SKYB 3H5TA 1A50B 1X80B 1VIYA 3NCTA 4HEQA 4QFDA 4EHDA 3ND6A 2QRPA 3UJDA 1UJMA 2QB5A 5BSMA 1YMVA 1QQCA 1JLMA 4HAWA 3LHKA 3HYSA 4ODIA 5CVTA 2PK3A 4Z9BA 2IHYA 1NW4A 3GCZA 4J0EA 4ESOA 3IPRA 1SK9A 2CDRA 1H0SA 3NKFA 1J25A 1GH6A 2Q7HA 1CTQA 1FVXA 1V2HE 2EP7A 2FWJA 1JJ2U 2G63A 3S6JA 3CC8A 3HKBB 2J0SA 1D0IA 2V5AA 2WAMA 1HKHA 3DSRA 3PFWO 5H5NA 3COYA 3BEHA 3DLAA 2XZTA 3UO2A 3SKXA 1CJSA 3GJ5A 2V54A 5ALDA 3KQWA 1JFRA 3GAMA 4J76A 1Z2OX 2XEXA 2V97A 3HI4A 2EGHA 4MUJA 3J81N 2PO7A 5KUTA 4G9EA 1ST3A 3DBHB 3NPMA 2VFAA 3CEPB 1OXTA 4FW9A 3IJPA 3H2KA 3AF3A 3ETNA 1Y8QB 3ZDQA 4HDAA 1P0FA 3Q6MA 3KQPA 3RHTA 4MVMA 3OU2A 4X20B 2AG0A 4JUCA 3VNRA 2JS5A 5YASA 1O95D 4N3CA 2FEOA 1O6BA 5FXMA 2WV7A 1UFOA 4UE3S 1XT6A 2L6LA 4HV4A 2IELA 1W35A 4C2TA 3ONEA 4QPKA 4ROTA 2Z0MA 1YJBA 5BR7A 2Q1TA 4A0HA 4DCVA 1HK7A 4NXMO 2AF4C 5TVGA 3DL4A 1XWFA 4F2WA 3SM3A 3M4YA 4ZTUB 2AXQA 5JFTA 3FYCA 2PG3A 4KR3A 1UBSB 2J6IA 2DUJA 3FBGA 1RVV1 4MAMA 2PL5A 4UEJA 1VL8A 1P74A 4PWZA 4JLOA 2ZRCA 1I0HA 1BEUB 1A9RA 5AUPB 2A8YA 3KOUA 1ZGGA 1QFZA 4MQ6A 1MSWD 2J3DA 1NDQA 1EZVH 1A2OA 4ZYWA 4FBMA 3I42A 4R8VA 4ZVUA 5BNZA 1OV4A 4FIDA 4GYJA 4LSMA 1YDHA 1AY0A 4DV6O 2OWDA 2IPMA 3RR2A 2Q45A 3CG4A 4IOLA 2W48A 3H5LA 1E89A 2W6JD 5KYKA 2GLTA 1BDMA 3DVAA 4QM7A 3G1UA 1P19A 3FMPB 1T43A 2QXUA 3ZX5A 1GZ7A 2PD4A 3RRBA 5CH5A 3MTDA 3ZU5A 1CQIB 1U2DC 4EHAA 3ZGOA 1GTZA 2Q7DA 2C96A 2IYAA 1NLMA 1L4BA 2QMYA 5B64A 1SIBE 1E3TA 1XI1A 4UCRA 5B1EA 5DN6A 3V8EA 4CEIB 2X9NA 3Q5GA 4KMMA 1A82A 1Y0BA 4D97A 3KBBA 1UKAA 2J7PD 2BZ0A 5ECGC 2R00C 4OJTA 2GHTA 3WO1A 3BULA 4JHXA 1WKCA 2ENWA 1VECA 4ENWA 1PYDA 4YCNA 3FVQA 2WLIB 1AR1B 3WJ7A 3WLPA 5PGMA 4INOA 4CQMB 3AXSA 1UBKS 2Y2VA 3PQ4A 4AXXA 3OP1A 5IXYA 4GC9A 3IBYA 4UFNA 8ADHA 1JQDA 1TW2A 3QVGA 3UMJA 3A1UA 4PHZA 3K6SA 1VYTA 1BFKA 4DNFA 2J67A 4OLHA 3F71A 5C37A 1ODFA 4YRPA 3NETA 5JAQA 4CCYA 3G4SV 4UUMA 1YI0A 2QRVA 2HPAA 1HP8A 4DCJA 1WZEA 3L0IB 2HEGA 1Q7BA 2FJPA 4BVFA 2C82A 1IM2A 2DP4E 2E1PA 2HREA 4DT1A 4JFRA 2ZBEA 3V8NA 5K6TA 4RVCA 4DPMA 3AL0C 1D9ZA 4PPNA 2WZDA 3NT5A 3GFQA 3ROKA 5IJ0A 2YKGA 2YIDA 4LTNA 5H80A 3VSBA 4TUYA 3J7TA 3QE3A 4EJ0A 3ZQ4A 3KCYA 2MINB 2FEAA 1LLQA 4ZAGA 2YJ5A 1Z8HA 1Y3CE 1IXBA 4HXYA 1ES9A 1UDXA 3X2SA 2PKEA 1NJ5A 4E5KA 5FDFA 1Y34E 4CIXA 1OXBB 1TYDE 2FEXA 3O3CA 2IVFA 2QN9A 2E87A 2I80A 2Q6TA 4Q24A 5ALWA 3U3XA 3V2IA 1DO0A 3SYMA 3TE6A 5I9LA 3VPBA 5JLJA 3Q2OA 1E2KA 1KJ8A 3F5MA 3GVCA 3RV4A 3HUDA 3DL7A 4DCNA 5C53B 1BCCH 3C3DA 4RZHA 3L8FA 1NVDA 1KMIZ 1SUIA 3CXUA 3D1JA 5DU2A 3V42A 4KSYA 3MCTA 1LC3A 4X6YA 4Z86A 3SY8A 5K8JB 4GFDA 1GWNA 3P3NA 4MRVA 4JVSB 1ZAUA 5L4NA 3GXBA 1GNVA 1YZLA 4MTCA 1ZIXA 1XZDA 3U44B 2XGSA 1MFZA 4PPFA 4K6KA 5IY5C 2X2PA 3EJWA 4DCSA 3N7TA 1ZLZA 2OE2A 4EB6A 3R5FA 2W2TA 4P31A 3EPLA 1KWKA 1M5RA 1GK9A 4DR6B 4ICGA 5ISMA 2P7IA 5IJAA 2ZUEA 1XRSB 2DJ5A 5AI4A 3QKIA 1IATA 4EKDA 4O4HB 1SUEA 2HB6A 3BA6A 1V47A 4L8GA 5AI8A 2IHJA 3PA8A 3MWGA 4GXNA 3SMQA 1YL6A 2HK6A 3U4IA 4HYOA 1KDRA 1B26A 3RWMB 2A14A 2I55A 3URKA 3F6EX 5SZJA 5KNDH 5H3CA 1NUHA 3I2JA 3HJAA 3G0IA 2GUGA 4HVLA 3AO0B 5BSWA 4CGZA 2GJKA 3HN6A 5A7FA 3OJOA 4ILEA 4LJ4A 1YZQA 4H18A 2CZCA 2YJZA 4HMQA 4TKUA 1FX1A 1L5OA 3I9LA 1BOOA 2I6TA 2P1RA 3RBVA 3R7SA 1A9XB 2Z58A 3RD5A 5EBMC 2F43A 3KYDA 4U5XA 4YAWA 4B6FA 2JAXA 2GSMB 3ZG6A 2JIOA 2AFRA 1ZIDA 2NN4A 4J7XA 4CMCA 5HX7A 1XDBA 5ARDA 2RN9A 1B06A 2YQ4A 5KNCH 2BMWA 2DCUA 5L53A 1M1KW 1E6UA 4MVJD 1J7KA 4S0ZA 2ANCA 1IXZA 1A9TA 3PDHA 2WE7A 1PVOA 4HHEA 3ZLJA 2DUUA 2PFSA 1G3QA 1YZUA 1GZ4A 4LF7O 3VU9B 2ADOA 1JWAB 4B3HA 4I46A 1JKIA 1GM7A 4YRCA 1BGXT 1CQPA 2GBCA 1C3XA 2Z30A 4UQLA 4U5QA 3VYRB 2GJ8A 2IUFA 2DSTA 3RGBA 1FFBA 3NH9A 3HY6A 3OE1A 4UBJA 2R7LA 2OV2A 5BN3B 4WWHA 3TX2A 1ZL0A 2DUNA 2PTMA 3SC4A 1L4FA 4LYYA 2Q5EA 5D6OA 4H4EA 4Q7EA 3B6KA 1RI4A 3BIFA 1W1WA 3O92A 1KQSU 2P22C 4AZVA 3FB6C 1MOFA 4X7BA 1TJNA 4ZC1A 3GRFA 2C61A 1CF4A 1G8MA 1YIAA 2DBQA 4JKIA 2WFLA 3AB8A 3FYUC 1JBKA 2CXXA 3BZUA 1REQA 4I99A 1U98A 3BL8A 1IYZA 5FRDA 1ZQ1A 2G72A 1C81A 1ZVQA 1ZL2A 3KEOA 1WQ1R 3L7JA 1YBFA 3SPIA 1C2TA 1DIHA 3W90A 2PA0A 3NHUA 5AKKA 3SF0A 4PRZA 2FPIB 1T9KA 4OHZA 5CMUA 1X1BA 5DBFA 1XCOA 1TVKA 1KE2A 2CDCA 3IT2A 2YN4A 3HCEA 2FUKA 4I4LA 5J2TB 2G1PA 3HPQA 3CZ9A 4F0JA 2DM6A 3HUEA 1BYUA 4HNRA 1J00A 4Q16A 2H52A 4OK6A 1R18A 5I7WA 3HE3A 2V7EA 3TCXB 5AO9A 3RVYA 3PDIA 5DDIP 5F98A 1GT6A 1XA4A 4FGLA 1TW3A 4GKBA 5HKLA 1M1NB 1U94A 4C08A 3K9BA 3ADCA 1TCVA 1VE6A 3D36A 2AL7A 5CD1A 3CINA 4DVJA 1X1EA 4XYBA 4D4MA 4B8ZA 2DH6A 2GCGA 4DY4A 1C1XB 3MJCA 4PA3A 1P0MA 3EISA 2AUMA 1C9JA 4HGPA 2G76A 6AT1A 4OQMA 2GK3A 3S7ZA 4NMHA 1JTFA 4MW9A 1VQLV 2JGRA 4EX6A 3GDOA 3I6BA 4ZT7A 2QRMA 3WGLA 1KSGA 4A73A 4YC7A 1DU4A 2G5TA 1E61A 2C9YA 1K97A 2FZ5A 1R4NB 2GCOB 5GONB 2JFNA 3ABIA 4DLZA 4AJLA 4C0WA 2XCLA 2PR2A 2X8AA 2EW2A 5KAIZ 2IYWA 1D9XA 1OXVA 1R0XA 2OK8A 3GHHA 2UUCB 1Z82A 1JHXA 3M4XA 5CJ2A 4F5WA 4XDLA 2A0WA 2DPGA 2ZSUA 5IVPA 3VNAA 2CH7B 4ZYXA 1PDVA 3K0CA 3R1IA 4X62B 5ALXA 3SDLA 2DY0A 4RSRA 2AZ4A 4WUTA 1BAPA 2LE0A 2PJUA 1E5QA 5LHGA 5FAKA 4AD8A 3ILYA 2PMEA 4BX2A 4DDHA 1WZNA 3A28A 2PUGA 2QYSA 2BHLA 1I7NA 1IBMO 3E3OA 2H9IA 1P5ZB 1OLSA 1CDDA 4FJCC 2JC3A 2PX5A 2DR2A 5JVDF 4FSXA 1AH2A 1RMYA 1V7CA 2IXEA 2LCQA 4B7UA 3M3PA 4QE7A 5JNSA 2IYVA 3RW0A 4CTKA 4TMVA 5CB0A 2ZSBA 1YQXA 2PD6A 3C43A 1UFIA 5CCEA 5E1AC 3PRKE 4NARA 2GBOA 2WE8A 3RYIB 2JGKA 5TQ0A 4X64O 4KEAA 5JYDA 4BLVA 1YCGA 2L2QA 1V5IA 1JDZA 5L3FA 1TFRA 1Z62A 3HMKA 4MS3B 3RASA 1LDBA 1WHSA 3CLVA 1U1EA 1BCSA 5JAMA 3NVMB 5IYBO 3DSQA 4DW0A 2Y66A 2WHPA 4G2TA 3PD0A 7REQB 2B3DA 4FCCA 2BIFA 5HUJA 2Q3JA 1I2MA 2OCXA 1Z7YA 5JXJA 2Q0SA 3C41J 1NI8A 5MN5A 3H5NA 2P5UA 1PWYE 3WIBA 2YXNA 1F2UB 3NGXA 4N03A 4HDMB 2QYOA 3A4LA 3TJMA 3TQFA 2BH9A 5GZ1A 4MTLA 1MIOA 3UAGA 1I7FA 2EX4A 3TGUH 3C3XA 1EDOA 3LQRA 2QTBA 3CCCA 1XPJA 1DBSA 3WLNA 1DK1A 3ZCUA 3UHJA 3G49A 2FN9A 3OHPA 3FOCA 4GPBA 1MP0A 1Z5UA 1G5IA 1TCCA 4L74A 3TQSA 3UWDA 2BLNA 4RJJA 3GXOA 3FWZA 1E94E 2VP4A 3PWZA 2ATIA 4EA9A 2Q49A 3I4FA 4C20A 3WB9A 3O2SB 2VP3A 5BZBA 4BLUA 4U3FH 3QJYA 2JJ8A 3RRNA 5BN1A 4BC1A 1I5OA 2ZE8A 3PQ3A 1EZ1A 4KBFA 1XZHA 2D8AA 3MWEB 3T41A 2GZHA 2CLDX 4D0LB 2FCRA 1HTBA 1SXIA 4K1XA 3KB6A 1JG3A 4GLBA 5CFMA 2IUUA 1XMSA 3ZCPA 2DZDA 1SG6A 1TUEB 3P0JA 3ASVA 5F9FA 3R24A 3I55V 4MQUA 2ZM5A 1T8PA 5IW8A 2ECKA 5B4TA 4GSKA 1ZUNA 4RANA 2R6AA 1L6RA 3O94A 3PXBA 2HA3A 2ZTMA 1EK6A 2R65A 5FA8A 1KBOA 3A6PC 3V4RA 2TECE 4RMGA 2AOTB 5CB6A 1WVMA 1SVIA 2ZLBA 3K0BA 2KLBA 2AC4A 1SUDA 4I4IA 1SJ9A 1QNLA 1NW5A 1QJ4A 1IIBA 4UEQA 3ED1A 4CMKA 1CEEA 4UBIA 4C01A 2G25A 1MEOA 1I0LA 2OC9A 3ESXA 2ODMA 1DTSA 4JLUA 3K9QO 1BXRA 2AEJA 3HB4X 1CQZA 1L4YA 3LCMA 5EIXA 2B94A 1GT91 4B08A 2LIVA 3B9BA 4JI3O 3B6JA 2Z8YM 3UG6A 4B7KA 2X9QA 3V6LA 1OH5A 3IEIA 3P9QA 4KYIB 4FMTA 5JSFA 2YWDA 2PMCA 3IELA 3PKJA 2ZRDA 4DDKA 3MJFA 1HL7A 2O14A 4S24A 5K7SA 4GVPA 2GN6A 2IYRA 4QFBA 4EG8A 4TL8A 4ND4A 2VF7A 2EJCA 2OZLB 1NTKH 4A27A 4BDTA 4OOEA 1TA4A 3H84A 3NATA 1H8EG 4KWTA 5BR1A 4M0PA 2VDWA 4ZI5A 2VC2B 4HQOA 4LHVA 2FN8A 4UDYX 4L87A 3MTBA 4IP0A 1G1AA 3K5IA 2BRUC 1TLLA 2B98A 1HSOA 2ZIUB 2HTFA 4FX5A 4JC0A 5TJHA 1WR8A 4H77A 4LOAA 4ZJZA 4GP9A 3AV3A 5C8YF 1OW3B 4EH1A 1NP6A 1M90W 1I6WA 3CVUA 3P20A 5H02A 4R1MA 5DKFA 2J6BA 4E2YA 3DMDA 4EO9A 1ETUA 1AIPA 5P21A 5DMXA 1DBWA 3BA8A 1OZAA 3SJAC 4ZGBA 1IPHA 3DTTA 1MRSA 3K6KA 4PNEA 2VWHA 4XWWA 3UNXA 2ACWA 5FLKA 1ZNYA 5IRCD 3PHBE 1Z28A 3TKYA 1AI7A 3ICWA 4TKVA 2KYRA 3TRJA 1IK6A 1P60A 1ECPA 2J07A 5IAAA 3ICEA 4B82A 3EHEA 4DA7A 4Y6OA 4C2BA 3JU3A 1I3LA 1PEKE 4B31A 2Q9AA 1AT1A 1K1EA 5KJ1A 1U02A 3QNEA 1W5BA 3L07A 4ND7A 5FTNA 2IEBA 2NU8A 1G59A 2XPCA 1KQNA 3C3TA 4WEOA 1HH4A 3EGXB 4JQOA 2HTEA 2DQ3A 3PQ2A 1J09A 2BGLA 3D31A 2PGJA 1LK0A 3MTIA 1TAHA 1IZZA 3H87A 2P2LA 1J8YF 3IEVA 4WLNA 4HGQA 1OHHD 5BWLA 4C14A 1JDTA 1EA7A 3IKVA 3Q7SA 5AK5A 3T1TA 1EDZA 1O97C 2MR6A 4TMFA 2GK7A 1C4KA 2C3UA 3ZS9A 3Q15C 4MUHA 1MZVA 3PFKA 2VYCA 2WUEA 3V7FA 1AP5A 3STVA 2IPNA 1P6UA 3KJFA 5BSEA 1HKUA 1SY7A 2X7XA 4Q4AB 2WSBA 1FLAA 1DV1A 3IQXA 5ALUA 3K92A 3F1LA 8ABPA 1XVLA 3RABA 3PNKA 4M46A 5CW2A 3VR1A 3L73H 1JEYA 1T5DX 5EGNA 1WXFA 5BOSB 2Q6KA 4IHJB 1E6WA 4C2UA 1LX7A 2WJ6A 4C1NA 1X9IA 3AVPA 4W99A 2DECA 3U0BA 4KG7A 2QJRA 2XCSB 3CLSC 4WKNA 1EFVB 3S99A 1ENVA 2WNIA 2XYPA 4Y1RB 3PP8A 1GCIA 4Z99A 2QMZA 3M6LA 4K2AA 4U2BA 5TVKA 3O8NA 5KTKA 4WFBV 1ESCA 1C29B 3BHMA 4AS1A 4B7EA 1UAAA 4UTRA 5F76A 3TAXA 3ZWPA 4LC1A 4I0WB 3VKFA 1XZGA 2QYTA 1IN5A 2FMIA 2PYDA 4IJMA 3COSA 2XNDA 5FTMA 4F45A 2H7VA 3KS9A 1FFCA 4C5AA 4B3MB 1W5SA 4GYCB 2W0SA 3MQFA 3LPDA 1PZXA 2VWKA 3M81A 5CLJA 3ELWA 2C2HA 1SVOA 2OHXA 3NHYA 5L8VA 1UBOS 4JLNA 4DR2B 5D87A 1GUYA 3NWPA 3T52A 4MSWC 1KYTA 4MUGA 2NUTB 3DTVD 4D82A 3GQBA 4BNTA 1UOEA 1OWMA 3UVEA 4J0KA 4QBGB 4TQGA 3IIIA 1G42A 3R4VA 2YNMC 1PR2A 1JOYA 2DG2A 2W2NA 3SEZA 2BFNA 5LMZA 2M1XA 4V3CA 2F67A 1QQAA 1JSXA 5B5SA 2X15A 1CBUA 4NYMR 4YNBA 3E84A 4M88A 1Y98A 1P6QA 1IQUA 3AJ9A 4AZ0B 2BFEB 1IEWA 2NNLD 4Q3KA 3LT4A 3I04A 3DE3X 3BGDA 3H1JH 2XCOA 1WLSA 3UZUA 1RHMA 3TYXA 3E8BA 2HOQA 2XKBA 2ZKIA 3WFIA 1DG3A 4XWOA 2D8MA 4DG9A 1EUQA 4BNYA 4F96A 4JBWA 3AF5A 4CKWB 5SYAA 1O5IA 4D45A 3L8ZA 3BF7A 1FDUA 1I80A 1KDYA 4KVFA 3PUHA 5JADA 1V9LA 1GAEO 5LBIA 4UU7A 2Q67A 3Q8LA 3JD4A 1WDWB 3TLBA 1D8TA 1IUKA 5HYVA 5KHOC 1DAFA 3ZI0A 3DMRA 2XTZA 2AJDA 4YX9A 5BP7A 1EZJA 3LDEA 1S2MA 1XJWA 3OCXA 3KO8A 5F2VO 1E5VA 3ANTA 1KA9H 3BIOA 5G3YA 2H0QA 3BFXA 1M8JA 3S2FA 1RRKA 2Y1CA 4WHMA 1N75A 3ZDBA 3BPZA 2DFTA 4ZV7A 1UT6A 1EFAA 1J56A 1LKZA 2BEJA 4JI2B 1SZPA 2R4UA 5ALGA 2CNWD 3H0EA 5K8TA 4BFUA 2BFWA 4FM9A 1OH7A 2QENA 4KH1A 1HG1A 1L9KA 4Q4LA 1QK3A 2OD2A 3D8BA 1L0BA 3EXHB 1I6MA 1OC2A 1YAHA 2NM0A 2Y8EA 4P5PA 2FZEA 4BLPA 4L3WA 4CI0B 4AY3A 1SB8A 1KDOA 4S3MA 4NP6A 4DBVO 1PT9A 4IH9A 3VPCA 2FGKA 1SC1A 3RHZA 2OG1A 4IIJA 3GLSA 1KJQA 3LQKA 4ZT5A 2OVFA 3EBPA 2O6LA 4RLHA 1W44A 2DU8A 3JZFA 3SYCA 3O26A 3K96A 3BGVA 4L2IB 2NACA 3LUDA 2O5EA 4XEUA 1E9SA 3KOWA 3UA3A 1MABB 1GGKA 3B52X 4B8WA 3D8CA 1FSZA 4PYLA 4IM7A 4LXQA 2PT9A 5AUOB 3Q85A 2WF5A 1LTHR 4F3RA 3C0KA 1WS6A 3QLJA 2HIHA 1Q6YA 4G01B 4FFMA 4C76A 2PWBA 3MFQA 3CRNA 5ULLA 3RWBA 5IBCA 2XHBA 4FKZA 3KTOA 1NVTA 3G2KA 3OMWA 1DPFA 5CLGA 3SMVA 2ZP1A 4X3OA 3ANLA 4MB0A 2QTVA 3I64A 3UAVA 2EFGA 4H31A 3ECCA 1TZCA 3FYDA 4ZZ2A 5CK4A 4H1UA 3KUDA 1KIMA 3L2OB 4TWBA 2ZTUA 2ZWOA 5JSZA 1AHHA 1H8HG 1KEKA 3DEIA 1CYEA 1KKMA 4OHKA 5GJWC 3X1ZA 5BN4A 4KHZA 4FZJA 5JNWA 1RRGA 1CDEA 3ZH9B 2C59A 1RKBA 4K9NA 1FQOA 3G82C 2X9VA 2A1TR 3PNBA 1EDEA 4XB2A 5E9AA 1QPZA 4E2LA 4E15A 3N53A 4PSUA 3FSRA 3RQIA 3S1AA 2A4KA 2PAAA 4FN4A 4GPTA 4LXUA 4PWYA 4LFCB 1EWYA 4QRHA 5K3DA 4HNGA 1DV2A 5EXXA 4LIPD 4YBRA 1F38A 1T5IA 1FW8A 1KVTA 4EY5A 3ITKA 2PXCA 2Z2ZA 5FP0A 5TISZ 3NIBA 4AJ4A 3N86A 1NBMG 3UB4A 4AUNA 2BBWA 2AGVA 2BZ1A 3FTEA 3IVXA 2Z5LA 3Q9LA 4S35A 3OQIB 3B3JA 3JD1A 1OKKA 1AB6A 3T7SA 3UY4A 1KP9A 1U7XA 4Z9FA 2BSKB 4KAXA 2H92A 3IKMB 2QN3A 3E9ZA 3IKJA 1ECGA 3GDFA 4A91A 4KTTE 4WEQA 2P9HA 4J42A 2PUFA 4ALLA 1W76A 1UDWA 3VO2A 4NNPA 1J95A 2VBIA 1JH9A 4NXNB 4EAQA 1TU3A 3SXUA 1I3MA 1JU3A 3DQZA 2P27A 2FN7A 3CKKA 3DLBA 4KMRA 2AOUB 3LUJA 1YIJV 1PDWA 1R7RA 1CRZA 2W90A 3CFYA 4DAOA 1NBEA 3EIXA 3AOEC 3O90A 2E4WA 1WY7A 4HC4A 1U0LA 2W4MA 4CMEA 3UCFA 1TO1E 5B1AB 1HUQA 3ZMVA 2A1IA 1WABA 3WGHA 2A92A 3QM1A 1HEUA 1VYHA 4WZBA 3OIDA 1P2GA 2DVMA 1XDUA 4I55B 1IY9A 5ITVA 2EEPA 4FYHA 2WJGA 4N6NA 3DOFA 3VOSA 3F67A 3CLHA 2GA8A 2C84A 1LSJA 1YBHA 4CF4A 1VE5A 1RCFA 3NI2A 4FFSA 3RG2A 3OOWA 1Y63A 4O4IB 2P6RA 1FY2A 4NOLA 1R73A 4UVBA 1X70A 4BNXA 3E9MA 4B3BA 2CFRA 1F20A 3CH6A 3CYFA 2P3QA 2Q3MA 5LZ8A 4BQNA 4FLEA 1Y4UA 1QCEA 2FN3A 3CNLA 2XODA 2VAVA 1ZD4A 4DMMA 3LO5A 2QWXA 5M29A 2UYHA 1YDFA 3CMCO 3EZ2A 3EQZA 2CE4A 4F1JA 1HE2A 3P5SA 4G27B 2GTIA 4QFMA 5FLEX 3LGSA 4NEHB 3R7WA 3K20A 4D6PA 1E1CB 2DBRA 1UQTA 1FAFA 2XTMA 2HWYA 3MB5A 5BR8B 4Y6LA 4NS1A 3AK3A 2DHCA 1XCPA 1CZNA 5HE9A 1DQNA 1DIRA 3GGPA 1P5JA 5KWJA 2P67A 4IH4A 1XNGA 4Q6BA 2JARA 2QL6A 5EY5B 3BSSA 5FPPA 3PEWA 3G85A 3ML0A 1WA8A 2JFGA 3KZ1E 2AOWA 4OAQA 1T8YA 1SKQA 4BFLA 4EFBA 5JAOA 1CLEA 1HDZA 5IT5A 1ISRA 2IH4A 2M6KA 2OCKA 3SHVA 5CNIA 1DLJA 5HOQA 2PRJA 1Y3IA 1YB6A 5TJ9A 3SIXA 3NJ8A 1SKUA 5B3AA 1L4UA 5IVDA 3KKMA 3GRRA 3NAZA 3KUXA 2XITA 3EE6A 4MJLA 1OUMA 4WFQA 4WJKB 1NV9A 2WKPA 2REOA 2ADFA 2CVQA 3EPHA 4OHMA 3GNLA 1ZN9A 1XD2A 3GRCA 3G68A 2O7NA 3ET5A 1ZPDA 1VQOV 1JKXA 5ALMA 4NR1A 2PU5A 1AOXA 2X6QA 5KKCA 1QG0A 4H7HA 1Q95A 1IHOA 1RAHA 3I01A 5L3QB 3R23A 4UCFA 4MQEA 4E88A 2ZT6A 1CEYA 3KXPA 1AQ6A 5GY7A 1SR8A 4AKGA 2BFOA 2AJTA 2X8JB 1L5LA 1Z0ZA 2PIDA 2EDAA 1F8UA 5CX1A 3CCQV 2QSAA 4LFBB 1HT3A 1GPBA 3LE8A 1K89A 2BHNA 5IY5B 5JJIA 2DWEC 4ETMA 4JI1O 1N6HA 1RC0A 3FPSA 1H2AS 3TR5A 2FETA 1YI1A 4EGSA 3EXFA 3W2TA 1YFKA 4ZEOA 3LUGA 2OCPA 4UVHA 1N5DA 5K0JA 2IJHA 4U7DA 4I14A 2JZOA 4Y2XA 3EYWA 3LIIA 1BMQA 2ACKA 2WIJA 1ISPA 5H1YA 3I23A 1SQFA 2QI9C 5BUQA 1GN8A 1X38A 3KOOA 3T3IA 1E2IA 3T3OA 3ITNA 3FYEB 2GEKA 5A4JA 3O93A 4P0PB 2QJ1A 1JIJA 3TN7A 2ZIWB 4OHWA 5DRYA 5FYDA 2C3MA 3D2CA 2QROA 4D8XA 2FJUA 5CYFA 2FX2A 5GZ6A 3AVOA 5B53A 1V8FA 4JTCB 1IN4A 1DIOB 2R25B 3IUYA 4HEA1 1AU9A 5EXTA 5F5XA 4L1KA 3KVYA 3FPKA 5ERXA 5EP4A 2UZIR 2XAGA 3G6BA 2P1ZA 4GICA 4OBEA 3PFHA 1RQGA 3E18A 421PA 5EHZA 4Y67A 3IO5A 1N5LA 4Q47A 4WZAA 2Z43A 4RVUA 2ECPA 4ZO4A 2O50A 2WPDD 2VS0A 1X92A 3ZU6A 2R48A 4I6GA 3RO7A 1XNHA 3W8NA 4XPIA 1T2FA 1ZEJA 4KXFB 1WU8A 1ISMA 5FF9A 4L22A 4FMBB 3G13A 5DJ5A 4L3OA 3ZWYA 1MD9A 2E2WA 2JAOA 4EVIA 5KYGA 4KR0A 4AN1A 4IMJB 2NUAB 2XB6A 4JQCA 5IKPA 3PJGA 4QXAA 4AI8A 2ODEA 4NS4A 2L35A 2D5BA 5LP6F 4XIYA 1VLVA 5DX1A 1YNOA 4XD2A 4EKEA 1G8AA 1QRRA 3EFHA 2CGNA 1Q7GA 2JI4A 2ZJ7A 4X24A 2VPIA 3RW9A 5LYJB 2AHRA 1BGWA 2BFFA 3G7SA 1SC4A 1FEZA 5CDHA 5LN1A 3IODA 3BRCA 2DHRA 3QJGA 1XRLA 3T38A 3INRA 3OZRA 4KP7A 3QXSA 2CNDA 4HX9A 1SXJA 1SC6A 4A6EA 5AM5A 3L40A 4WKGA 5K3BA 2CAZC 2IW5A 2GCNA 1DJNA 1E5TA 2B8WA 3CUVA 3LUCA 4LDQA 1HNXB 1SGWA 1WLYA 1HNWB 1YZFA 4D43A 1I4WA 2E37A 3PFGA 4YAEA 1O58A 5IXSA 2E5WA 2IHBA 5D3MB 3V2UA 5HF9A 2Q5FA 3EDRA 4TN1A 2J8ZA 4O3FA 1IAVA 3IESA 1GV0A 3DBOB 4N0QA 2I4IA 2ZJ5A 1UEXC 2F3PA 4TSKA 5FTLA 2REBA 3U4CA 3P0RA 4PY2A 2CYBA 3JD2A 3OCCA 1QM5A 1IZ9A 1R5JA 4WCFA 2PKWA 3L4SO 4FMCF 2F8TA 3QKRA 1V6AA 4RLFA 4IDCA 1YZ3A 3C70A 3C7AA 1USKA 2UVQA 2Q4RA 2HWUA 4Q1CA 3MAJA 3ZVRA 3WHKA 3CCRV 1YRWA 2AWOA 3UMCA 1FXHA 2PYJA 1A96A 4FFRA 1P9WA 1NULA 3DKIA 1J5PA 3I6ZA 4N7RA 1BU8A 1J0CA 2X4GA 2BBTA 1PGJA 4MYTA 3WYAA 1M7HA