1WPXA

Crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
421
structure length
421
Chain Sequence
b'KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase Y
molecule tags Hydrolase
publication title Structure of the carboxypeptidase y inhibitor i(c) in complex with the cognate proteinase reveals a novel mode of the proteinase-protein inhibitor interaction
pubmed doi rcsb
total genus 156
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1wpxA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wpxA01
1DT5A 2RHTA 3FYUC 1LPAB 3F98A 3MUOA 3GELA 1HL7A 4W1RA 4EA6A 4BVJA 4BZWA 5LYYA 4UBKA 2BUCA 3ANSA 5ALDA 4X6UA 2OCKA 2ZYSA 4J0HA 5JAOA 2FJ0A 5LKAA 3MGAA 1EDDA 2V97A 4GBGA 5ALWA 3I2IA 2GBFA 2EDAA 4B9AA 1YAHA 3H2HA 3M82A 1XLWA 2ZVDA 3O9MA 1MPXA 1YB7A 5AKHA 1QIHA 5EHNA 4OYLA 4CG2A 1YAJA 5EIEA 3DQZA 5T4HA 2HIHA 2XDWA 2VEOA 4DMKA 2GBCA 3H2IA 4KRXA 1YB6A 2WIGA 2RONA 1EK2A 1WOMA 4ZREA 2P8SA 3R3ZA 5AK4A 2WIDA 5AKKA 2XI4A 1IVYA 3PI6A 1IZ8A 4G8CA 1EB9A 4LXIA 4BATA 4QWWA 2OXEA 5AI9A 1CUVA 4AX4A 3PUIA 4RPCA 3C6BA 1VE7A 2WU4A 3HRHA 2JGMA 1CVLA 1W4LA 1RYYA 1N5MA 5E4YA 3BE8A 1WPRA 1CUHA 2DR0A 2XUAA 4BAUA 1ODTC 2AJ8A 1XROA 2C4HA 3V9AA 4BE4A 4DSAA 5ALPA 5KWIA 1R88A 2XQJA 3HXKA 3I1YA 5CT9A 5AI5A 2HA3A 2QR5A 3FSGA 1QIIA 4LXHA 5JZSA 3YASA 2XUQA 2Z3ZA 2ONCA 1EHYA 3STYA 4HAIA 3I2HA 3AZPA 3D2CA 2QXTA 5CT6A 1EDEA 4I4CA 5JANA 1QFSA 3G9ZA 5A7FA 3U1TA 2D5LA 4DMHA 4F60A 2G4LA 2WFLB 2HRQA 1ZD2P 4H7DA 3WZLA 5JARA 2XQKA 3CN7A 3QMWA 3EBLA 3O4GA 4UBLA 1WHSA 1JT2A 2I03A 2C5FA 3IBTA 3KXPA 1UZAA 5JD6A 2XUPA 1J2EA 4YK7A 5LZ8A 5EGNA 5HQ3B 1R9NA 1XRRA 4DTCA 5LP1A 3G0DA 5LIPA 2O7VA 4G8BA 3WIBA 4EY4A 4KEAA 4Y2UA 5FP0A 4KE9A 1P0IA 4X6XA 4FOLA 3IA2A 4U2DA 2QRUA 4INZA 2O2HA 4IH4A 4J0KA 1ODCA 4XIIA 5AM2A 2XT0A 1E89A 5JASA 3SX4A 2WJ4A 4F0JA 1Q84A 4K6KA 3B5EA 1GKKA 1NU8A 1X2BA 3G8YA 3RLIA 3B3QA 1EDBA 2OAGA 4AZ0A 1XZAA 5AKLA 5CXUA 2CUTA 4X94A 3VKFA 1MN6A 3H18A 1UXOA 3R3WA 4BCCA 3WKEA 1CUBA 1ZICA 2BJHA 2JGLA 3ICWA 3E0XA 3HSSA 2WTNA 5ALLA 1USWA 5ALQA 3VJLA 2XMDA 1QIMA 4K6HA 3H17A 3C43A 4U2BA 2DQZA 1OCEA 5HF8A 2WQZA 2DCMA 3H2JA 3PFBA 4FKBA 1MNQA 4BCDA 1SCQA 2XLCA 3DLTA 5HF6A 3WYDA 5AK6A 1AX9A 4A16A 4ARAA 3O4IA 3WWPA 2JEZA 2D0DA 1EI9A 3GA7A 1HLGA 2ZYHA 4Q3LA 3IUQA 3R3UA 1EH5A 3GFFA 2OAEA 2Y1KA 2WTMA 3AILA 4PV7A 4MQLA 4ZGBA 1L7QA 1XKTA 2OGZA 2CKMA 2GBGA 4TGLA 3WIOA 2NW6A 4W63A 4BE9A 3LS2A 4E14A 4Y2VA 1QLWA 3G0CA 2HM7A 1CRLA 1LZLA 5E2IA 1HDEA 3OPMA 1ZI8A 3P2MA 3D2BA 4RE6A 1MJ5A 3HLKA 3W06A 4F21A 5CBKA 4BB0A 4G4IA 4BVKA 1JJIA 5FOQA 3C6ZA 2HRRA 1ISPA 5FPQA 3JYHA 3VXKA 2QTBA 2WFMA 1TCCA 5C7YA 1XQVA 1GQSA 5EI5A 1CPYA 5AI4A 1Q0RA 3DOHA 5C8XA 1GGVA 3K6KA 2RI6A 4Y2RA 4J0DA 2C58A 2XUFA 1UK7A 3DCNA 4BZZA 2QJWA 1DQZA 3I6MA 1K6EA 3F9CA 3DYIA 1YA4A 3ZLUA 2I3DA 4Q3OA 1AMNA 5CH8A 1RP1A 4U2FA 4OCZA 5A7HA 4UHHA 2AJCA 3C5WP 3HC7A 3W2TA 1CUZA 3R3YA 5ALTA 4LHEA 1Y7HA 1W1IA 4FMPA 1QGED 5ALOA 5JAPA 4J0JA 1A7UA 2VJBA 4C4YA 5A2GA 1LPSA 2JEYA 2HFKA 3WYNA 4N8SA 3BIWA 1UFOA 3F8SA 2ZJ6A 3O0DA 2H7CA 4U2GA 4B84A 1LLFA 4BRSA 1H2XA 4HRYA 2CMFA 1E8MA 5T4EA 1ZOIA 1VXOA 4J3JA 1CV2A 2H7YA 3NUZA 3PICA 2OGSA 4UFOA 3RM3A 1KU6A 2BUAA 5EIAA 4DNQA 4K5QA 3I28A 1LPNA 4UFPA 1XZMA 2DHCA 4YX9A 4UBJA 1CUDA 5IVDA 1CUGA 4N5IX 2XMRA 4QDOA 3W9BA 3C70A 4DMCA 3WJ1A 2OCIA 3HZOA 2W6CX 5CMLA 2QZPA 1HBJA 1SOMA 4Y7DA 5CT5A 3CN9A 3RKSA 5ALVA 2QUBA 2PBLA 1QONA 3D7RA 2V98A 4XWGA 4UFNA 1F8UA 6YASA 5JZ9A 1G42A 4E46A 3G9TA 4M0MA 3IVMA 1G66A 2R8BA 2BUBA 2PSFA 4ITVA 4ZV7A 4G1FA 3G0IA 4MWSA 3JWEA 4ZI5A 5KWJA 3BJRA 4BDSA 2X5XA 5ALYA 5K5EA 3D2AA 2AJBA 2PU7A 4IH1A 4GLBA 3WL7A 2RGUA 3VJKA 5ALRA 2HA5A 5LZ2A 4MQMA 2Z3WA 4B81A 5HFNA 4L9AA 5FRDA 5AI0A 4WY5A 1C4XA 2CB9A 4GDMA 4BDTA 4ZWNA 2HA0A 4FLFA 2O2IA 5FPPA 2BCEA 4V2IA 3CCBA 5AM5A 4EB0A 2DHDA 2XB6A 2XMGA 2QT9A 2XMCA 3ESBA 2ZSIA 5AM3A 1MAAA 1ZIYA 3O4JA 4DYHA 3HI4A 3WWOA 1E66A 1E8DA 3QH4A 5DYYA 4CFSA 4D9JA 2ACEA 2VJCA 1LPPA 1QTRA 4KAJA 3O9VA 1QZ3A 2ES4A 1EVEA 4MEAA 1J06A 4HXFB 3ICVA 1JFRA 2XUOA 2O2GA 3E3AA 4X93A 4BAGA 1YSCA 1JKMA 2G5PA 1XRMA 5BWCA 2DFPA 1ZI6A 1ACJA 5AKGA 2GYVA 4FWBA 4BC1A 4X3CA 4J7AA 1QTIA 1KU0A 1CUIA 1W52X 3PF9A 4CCYB 1LBTA 5JATA 1Q83A 2YXPX 4HRXA 5YASA 2B20A 1T4MA 3W04A 3WZMA 5HK9A 4PSCA 1XRQA 1SCKA 4MYSA 1VXRA 3Q8WA 4Q82A 4MJ3A 2WFLA 1XZBA 4QDZA 3IUJA 2QOEA 2WHPB 4JYMA 2OQVA 1FJ2A 2X8BA 4HZGA 4HXGA 3T52A 3PDCA 3VISA 1YS2X 4GHWA 1W76A 5J3JA 3BJMA 2ZSHA 5D6OA 3NOXA 3QPAA 2VTVA 1GT6A 2J3QA 4KE6A 5DJ5A 2WUFA 1IUPA 1O6FA 4FHZA 4B83A 4H7FA 2WUGA 1PV1A 5ALEA 5HZGA 2IIVA 4AZ3A 1XRNA 1I6WA 5FV4A 3C45A 3RARA 3VDXA 4W9RA 2HU7A 3IB3A 3C6YA 4ZXFA 3TJMA 1FFDA 1EINA 4G9EA 4BTVA 1YCDA 4DM7A 1AC5A 2OQIA 3FCYA 5E4JA 4OD0A 4HS9A 2J3DA 1XZKA 3W05A 1CUAA 1VZ2A 1IUOA 4X7BA 4C6HA 3R40A 3STXA 5AOBA 4TVKA 3CXUA 1U4NA 4UBOA 4N8EA 4XJVA 3QVMA 1AQLA 5JYCA 4OB6A 1VE6A 2RHWA 4F5ZA 4B7ZA 1W75A 4FFVA 2ZJ7A 1S8OA 3JW8A 1CQZA 3D59A 3PF8A 1F0NA 4J0IA 5AHXA 2FUKA 1GPKA 4KAAA 4PQEA 1JMKC 3DL7A 1C7JA 1B6GA 3FLAA 3BIXA 5FDFA 3OTQA 5IVIA 1QIEA 3L1IA 4OU4A 5AJHA 1TQHA 3T4UA 4BBZA 4AMYA 2HDWA 4BYMA 4DLNA 1CQWA 3GZJA 4M0EA 4JH0A 1R50A 5ALMA 5AP9A 2OPHA 1L7AA 1K63A 1DWQA 3D5EA 3AZOA 2BKLA 3PFCA 4L0CA 3VJMA 1ORWA 2PSEA 1GPLA 3FLBA 1VOTA 1K8QA 2DHEA 2XQIA 5EHZA 5AK3A 3TEJA 2Y2VA 3G9XA 4KRYA 3ANTA 2WLSA 3E1GA 4X85A 3ED1A 2AJDA 1VKHA 2C5GA 1THTA 4P92A 4Y9SA 3S8YA 2O7RA 5CH3A 1BROA 4DMFA 5BWBA 2CBGA 4WFIA 5AH0A 4UUQA 4QEKA 4CI9A 1KEZA 3WK5A 1QIFA 3QYJA 1BEEA 4H77A 4DNPA 3ESDA 1TIBA 5AI6A 4AO6A 4AQDA 5AO9A 2CEKA 2VT7A 2JGEA 3BDIA 1DX6A 3DS8A 1B41A 1OXMA 3U0VA 4PF1A 3QMVA 2IITA 1IUNA 2GYWA 2YYSA 4L3WA 1F6WA 3LCRA 1ODSA 4UBIA 3FSGD 4UHCA 3AUKA 3GBSA 2Y6VA 1EVQA 2ZYIA 3I6YA 1O6GA 1N8SA 4HTAA 3QPDA 4W1QA 5AKXA 2XUGA 5SYNA 2IX9A 1FFCA 5A62A 3ZPXA 1MU0A 3HEAA 5IKXA 2WILA 4MEBA 3LLCA 3IUMA 3BDVA 4EY8A 2HA7A 4BP9A 1SCIA 1A8UA 1EA5A 1AZWA 4EY5A 1VA4A 2FJPA 5ALIA 2XMZA 5H3HA 2WKWA 1NX9A 4UBMA 4C88A 1CUJA 1UK9A 1DT3A 1JJBA 3W9UA 4WFKA 4QA9A 4KE8A 5HF9A 1XQWA 4X6YA 3V1MA 3D4LA 5I9IA 5T4BA 4H0CA 1XZDA 4L72A 4B0OA 3H19A 4WY8A 1TCAA 2GBIA 1WB4A 4X95A 4YPVA 3IULA 3AIMA 3FYUB 3UMJA 1W6RA 4H7EA 3HYSA 5AKEA 5E4TA 5AM0A 2QXUA 3WJ2A 3BXPA 1J1IA 5EIHA 2OG1A 2XUIA 2Y6UA 5AIAA 4LYDA 1U8EA 2OGTA 2ECFA 4GXNA 1NU6A 4CG3A 3VVLA 4KAFA 3TGLA 5AIBA 4EBBA 5JALA 5DNWA 3HABA 1LPMA 4K2AA 2WG0A 1LPBB 5K3DA 4S0XA 1FFAA 2QKYA 4OUKX 1H23A 4LKOA 3FBWA 1JU4A 2B61A 4WCVA 5JAHA 1DWOA 1AURA 1UKCA 1VA5A 3STUA 1UKAA 5LZ9A 4WJLA 1XLUA 1Y37A 1MAHA 1C7IA 3UUEA 1HKHA 3AIKA 2FX5A 2WUDA 5JAUA 2VSQA 2PU5A 5JD5A 2PVSA 1XZGA 2PM8A 4IO0A 3DD5A 2QJRA 3QBJA 4AO7A 1QOZA 5ESRA 3EQ8A 3I2KA 3KWFA 4U2EA 1H22A 2EEPA 1JJFA 3FVRA 5AKYA 2J4CA 1R9MA 2HA2A 5D3ZA 1IMJA 2XUKA 1A88A 1XQXA 2RIPA 5HK8A 4OB7A 5AKZA 4RE5A 5CT8A 3DNMA 4Q3KA 1EX9A 3H1BA 3VVMA 5DLPA 1QE3A 4EZIA 5HF5A 4YASA 5IVKA 3G02A 2WG1A 5FLKA 4Y2SA 4EUSA 1WB6A 1E3QA 2V96A 4OB8A 3WK4A 4P08A 5CT4A 1UOOA 3FAKA 4LIPD 4NVRA 1JU3A 5AM1A 1BN6A 2YASA 1CUCA 1OILA 1G4HA 5CRIA 1DQYA 4H7JA 4KJXA 1YA8A 1M33A 3WL8A 2XLBA 4X00A 2H7XA 3H0CA 4BAZA 1Z68A 2DQYA 2VAVA 4AXBA 4C4XA 1RWQA 2PKYX 4GEGA 4BC0A 3FNBA 1H2WA 4XVCA 4RGYA 1FFEA 1BU8A 4X97A 1HPLA 4LYEA 4KACA 1GQRA 4RNCA 2JGIA 4J0GA 3WQHA 1QIDA 1XLVA 1JI3A 2VAXA 5ALSA 1THGA 3C5VA 2PSHA 1P0PA 5IVHA 3C8HA 3ESCA 1WB5A 4P9NA 5LKRA 3QZUA 3AIOA 1DTEA 2OCGA 1WCYA 4H35A 2LIPA 4KE7A 2I3ZA 1U65A 1A8SA 3E4DA 3QM1A 4LXGA 4WDRA 4H7HA 3ZLTA 3WLAA 1P0MA 1QO9A 1ZD3A 5ALGA 1CUEA 5FXMA 3IDAA 4C89A 5AOCA 3LP5A 4BP8A 2VF2A 5CTAA 5ALUA 1VZ3A 2W22A 1TAHA 5LLSA 3ESAA 4H18A 4A5SA 4OSEA 4PNZA 4FLEA 5AM4A 1PFQA 4W1PA 2AJLI 5CH5A 1LGYA 2K2QB 1ZD4A 1DX4A 4QDTA 1N5RA 4CG1A 4G8DA 5AOAA 5IH7A 1AGYA 3OC0A 1EXWA 5I8PA 3MUNA 4B85A 3G0BA 1XFDA 1GPNA 1YASA 5ALZA 4UBNA 2XMQA 2QUAA 3STWA 4DSZA 1XZHA 5KBYA 5I7UA 1MT3A 5CXXA 1ZIXA 3H2GA 4UPDA 2JGJA 3F67A 1G5FA 5D3KA 2YH2A 3R3VA 1XZIA 4QDXA 4Y2XA 4FFWA 1QFMA 2XQGA 2OCLA 1TKRA 4TPKA 4AN1A 2JBWA 4QLAA 1XRPA 3MVEA 4FTWA 1XZJA 1EB8A 1ZGBA 2PX6A 1CLEA 3WL5A 3WI7A 3K9BA 1Q0ZA 5DYWA 1MTZA 1E5TA 7YASA 3G9UA 4K6GA 4QWMA 3R3XA 2VJDA 1LZKA 2PPLA 3NWOA 4GI1A 1E8NA 2PUHA 3G7NA 3QITA 3M81A 1AUOA 3AJAA 4C4ZA 3DEAA 2JGKA 3X3HA 3WKCA 3KD2A 5LZ5A 2AXEA 4O08A 1UOPA 4ZRDA 4M0FA 5ALJA 1GZ7A 3H04A 3KDAA 5DTIA 1X2EA 3ILSA 4FLMA 1YR2A 4UHEA 4ARBA 5HKBA 3FOBA 4CCYA 4FBLA 5HQ3A 1ZJ5A 3WWCA 3I2FA 1ZGCA 2PL5A 1DU4A 1CUXA 3EF3A 2XMSA 1FSSA 1QIKA 2G5TA 2XUHA 3WKDA 3R0VA 2WHPA 3D0KA 3AZQA 4J0CA 3DDUA 4KR0A 4DNOA 4UHBA 5SYMA 2E3JA 3PE6A 5HFAA 2OLEA 5HCUA 3WK6A 1QJ4A 5K3FB 3PUHA 2HFJA 2JGFA 2GYUA 3SK0A 3N0TA 3F96A 2C7BA 4J03A 5JZBA 3BF8A 3V1KA 2Q0XA 1PJAA 1N1MA 4I19A 4QLOA 3OM8A 1X70A 3LIIA 1XKLA 1UWCA 3EQ9A 1XZCA 4GW3A 3GUUA 4NS4A 2G63A 1DINA 5K3CA 4Y2PA 2QMQA 1CR6A 3ZLVA 3SWWA 3FLEA 4CIAA 1ZJ4A 1UOQA 1CUYA 1R3DA 2WM2A 2WFZA 5LZ7A 2VA9A 4BTLA 1QIJA 3D3NA 4OYYA 4QZVA 3NGMA 1BCRA 2V9ZA 2CZQA 5AI8A 3V1LA 2Z8ZA 3G0GA 3C87A 2XUJA 3RK4A 4JYPA 2X76A 1U2EA 3DYVA 3QPCA 3H1AA 2PSDA 4G5XA 2BGRA 1R4ZA 2WUEA 3BL8A 5K3AA 3IUNA 2R11A 3WA7A 1IZ7A 5K3FA 5DNVA 3WL6A 4CIBA 3I2GA 4AO8A 1ORVA 1CUFA 2WU3A 3ZWQA 1EK1A 1UT6A 3CCCA 1VLQA 3BWXA 1WHTA 1K5PA 4AMZA 5C81A 2WHQA 2GZRA 3FYUA 4X90A 4Y2QA 2QS9A 1TK3A 1J07A 4PW0A 4W1SA 3C6XA 4ZV9A 2WIFA 1BE0A 4MXDA 4X92A 1CFJA 4N5HX 3A2MA 2XQFA 2XE4A 4B0PA 2JIDA 2VATA 1XRLA 1BRTA 2CJPA 3O4HA 3A2NA 4B82A 3STVA 2VJAA 4B9EA 4FNGA 4BRZA 3DKRA 4FNMA 2VQ6A 5JD4A 4GECA 2BGNA 5F4ZA 3WKAA 2C0QA 2HA4A 4JEIA 2WJ6A 2EDCA 4DIUA 1ZD5A 1XZEA 2PUJA 4A23A 4X71A 3FYTA 5HKAA 4DNFA 3WWDA 4CCWA 3L1JA 1BCSA 3M3DA 2ZJFA 1QIGA 2WG2A 2ROQA 2J4FA 5LZ4A 5DTJA 5EHXA 4U2CA 4Q1VA 5FUMA 3OOSA 4C87A 1L7RA 1UKBA 5A7GA 3N2ZB 5DYTA 1TRHA 1H2YA 1WM1A 3DKKA 1YS1X 3KWJA 4AB1A 4IQ4A 2ACKA 4OPMA 3R41A 1ACLA 2RAUA 3B12A 2Z8XA 4FBMA 5EFZA 4EY6A 3FWHA 1H2ZA 3V48A 1MX9A 3I1IA 2WHRA 5A6VA 4EHBA 1TCBA 3O95A 4DGQA 5CW2A 3STTA 1WPXA 1MNAA 1FFBA 1T2NA 1K4YA 2HU8A 1AKNA 3A70A 1ZI9A 1MX1A 4XX1A 1D07A 2HHAA 3EQ7A 3UUFA 4QE3A 2H1IA 4N8DA 5CURA 3HJUA 3TRDA 3A2LA 3AFIA 4MWTA 4HVTA 3ZI7A 5DWDA 3DJYA 3QMMA 2B4KA 2BFNA 4ROTA 1CIJA 5EHQA 2XMBA 4H7KA 3A6ZA 4PSDA 3M83A 5AKJA 3GROA 2HA6A 1LBSA 3DL4A 4EY7A 2DSNA 3WA6A 4IH9A 5ALHA 1MX5A 3OG9A 5BOVA 4ETWA 3C8DA 4B80A 4GWLA 2VT6A 4JNCA 4E11A 1CUUA 4PSUA 3F97A 1BS9A 3WK7A 1LPOA 1P0QA 1UK6A 5ALKA 5ALFA 5T4FA 4Z49A 5DNUA 3WMRA 3KOOA 1XZLA 1CEXA 1GKLA 5ALXA 3SC2A 3H2KA 3K2IA 4KYVA 4BVLA 2Z5GA 2PSJA 1BEZA 2WIJA 3DOIA 1BN7A 1A8QA 1F0PA 2HU5A 2B9VA 3LIPA 4G4GA 4C01A 1CUSA 4UHDA 3I2JA 4G9GA 2Y2UA 5KREA 1JMYA 3FVTA 5K3EA 4HXEB 1Y7IA 1CUWA 2H9YA 2WJ3A 2HADA 4BCBA 4QNNA 5BV7A 2I78A 4Y2JA 1R1DA 4P93A 2C0PA 4NZZA 5D7BA 3OURA 3S2ZA 4WFJA 3AINA 5C8VA 4WDQA 5JADA 2ORYA 5AICA 2UZ0A 2XUDA 5A71A 1LNSA 4OU5A 2GZSA 3IURA 3L1HA 1QO7A 5C8ZA 2WIKA 2QM0A 3KSRA 4H7IA 4JUIA 5JIBA 2WSLA 4UHFA 4Q05A 5ISMA 5FKJA 4I3FA 4E15A 4Y2TA 5K3BA 4Y2YA 3IIIA 4X91A 5AK5A 3WWEA 4IHAA 3FCXA 2BAGA 2HL6A 1DWPA 1HQDA 1VJ5A 3Q0TA 4NMWA 1UK8A 4Q34A 1ETHA 4G4JA 4PO3X 2QVBA 3WKBA 4MYDA 3V1NA 3WK9A 3EIOA 5ALNA 3HACA 4AN0A 1MO2A 1SFRA 3BF7A 4QDUA 2ZYRA 5AKIA 4FDMA 1SC9A 3I6ZA 4B6GA 1GXSA 2JF0A 1XZFA 3ZV7A 3WK8A 1XQYA
chains in the Genus database with same CATH superfamily
1ZKMA 2RHTA 2I62A 1DOAA 4XGIA 3VNRA 1GPAA 1HFWA 2JS7A 1DPGA 1M2OA 4E94A 5DN6A 3E1SA 3PUWA 1C8VB 4OXYA 5LYJB 3WMGA 1L4HA 1VYVA 4KLRA 3TZQA 2CTRA 2M1XA 3ZCUA 3LDHA 1YBAA 3A36A 1CE8B 2WJGA 1ESDA 4W1RA 5LUBA 4CDGA 5ARBA 5BV8A 2CF6A 3P2OA 4JJEA 3TD9A 4UBKA 2BUCA 4KXVA 1NMYA 2GZ2A 4X6UA 3PDIB 3NYWA 3K9HA 3CD6V 3DSRA 4AS1A 1E0DA 1P7CA 4CQLA 1WAMA 3X2FA 4L5JA 1DDGA 2ZTMA 9ABPA 1PDWA 1TEXA 2CKDA 3A3OA 5AVWA 1JHOA 3U56A 2C8VA 4C6SA 3DE2X 2XCQA 1JSXA 4IKEA 2HNAA 3U4AA 4BFUA 1GO3F 3A9CA 4OQYA 4CUJA 3CPWU 3H2HA 2LFRA 3FOZA 1ZS9A 3A05A 3HU3A 3IIMA 1U9JA 3JYQA 4MTLA 5GV7A 1NBWB 2JGNA 3EHDA 3TUJC 3O9MA 3AC0A 1SBCA 3VO2A 4ZU1X 4LSGA 1T5OA 3AB7A 3AY6A 3K1JA 5CA0F 1CEEA 3K05A 1YZFA 2XOKA 3D7LA 1YB7A 3KAPA 4YB8A 3MS7A 3TBHA 4IIJA 3G82C 3Q12A 1VIAA 4RANA 3MDSA 4L4ZA 1HI9A 2ZRLA 3DVQX 1B8OA 1H69A 2CLKB 1YAJA 3LOPA 2MMGA 2WSSD 4QT0A 1Z13A 2HIHA 2XDWA 3AKEA 3CR8A 3R6WA 5IY5C 1GZ5A 4DN6A 1ZUNA 5JMOA 3B38A 4JYZA 3H2IA 3ZWCA 1YB6A 2WIGA 3FNQA 4JUAA 5FOXA 3UVEA 4MI6A 1USGA 1L1EA 4X1OA 3TOCA 4DABA 2QZSA 3AVUA 4W9MC 4AVYA 3ZWYA 4MVJI 1XCOA 3KQMA 3R3ZA 2IZ0A 2V59A 3SJCA 5IG2A 1RC8A 4AJOA 4HMQA 1MIOB 4YRSA 2PGDA 4MAMA 5KZMB 1IVYA 1Z5GA 3VMFA 1XA0A 1GNSA 1NLFA 3HCBA 5HIKA 3A9TA 4LJAA 5EUCA 3FI9A 1SIOA 3GRYA 4BATA 4J9YB 1VJ0A 2B8TA 3QTTA 3QXSA 4LF9O 3CLSD 5IUNC 4O4HA 3A11A 3BVOA 3PCTA 3UV7A 1XNQO 5EVCA 3GT4A 4I8IA 3F6EX 4IHKA 3WSTA 3C6BA 5EIWA 2DUNA 3D6VA 5SICE 3U4GA 3VOTA 1OLUA 2XVXA 2XR1A 3BB3A 5J9FA 2EINB 2YXBA 2YICA 3IDZA 4B3SB 2CFTA 4WKCA 4I1VA 3ZIUA 1I5XA 2RE8A 3PLAE 3CJTA 5LCXA 3R5XA 2JGMA 1P3Y1 3H86A 3HN7A 1QE5A 3TLJA 4C6RA 1JBEA 2WKQA 1CVLA 2J0VA 1KJJA 4BVEA 1Z56C 5FYDA 3HKBA 2HWWA 1RYYA 1N5MA 1YV9A 2Y68A 2JI7A 2DOSA 3WC4A 3AG4C 5E4YA 3FZEA 3BE8A 1PNVA 1K3TA 4G1CA 4IBOA 3IMFA 4NAHA 2M6YA 1VCHA 1U2ZA 2ZU6A 4RTKA 4W5NA 1LR1A 2DR0A 4DV1B 1NQWA 4ZCLA 2HRCA 4V3CA 3FCAA 3GDWA 4QJBA 3GLFE 1YK1A 4F06A 2AJ8A 4IJUA 1K3UB 2DQ3A 5BR8B 3B3GA 3F6CA 3LQQA 3FH0A 3U3DA 4J1TC 3TUZC 1WB8A 1WJZA 4O8CA 4K6OA 4R8RA 3EGDB 3WDKA 2DFKB 3OEEA 5CDUA 2HSWA 1LDMA 1S9DA 4OXNA 4DSAA 4P7FA 4CEHA 1Z17A 3WB1A 4FMTA 1JBKA 1ZRHA 3ZS8A 4XSVA 2ZBPA 5ICFA 2X6RA 3F8WA 4MV8A 1YDFA 1VB5A 1R88A 2GJSA 3B1WA 1NMXA 5LB4A 3I1YA 4AS3A 3GLHB 4C5AA 3D8TA 4E5KA 2GEDA 2WTEA 2JLBA 4EUNA 2KSQA 3JATA 2WC1A 3MGCA 5TXGA 4PG8A 3NG1A 3HLTA 2WABA 3W9YA 4CLOA 5TEWA 3MD9A 4CKCA 4R2KA 1ZYUA 3LUAA 2W11A 3G71V 1HTBA 1HR0B 3TMKA 3K70B 2NU8B 4DLSA 4RVCA 1RBYA 1XHFA 2HSGA 2XGSA 4E5VA 3PEWA 1ZA1A 2Z3ZA 2VNAA 4DIBA 5AVQA 3KPUA 2BM9A 4OQMA 2LWIA 1EHYA 2EHJA 4TKZA 2O8CA 1C1YA 4B09A 1DRKA 2IYNA 5DP1A 4CMJA 4W7IA 3JD0A 3OQVA 2O8DB 1B2RA 3KUCA 3L0OA 1NP7A 2V7QG 1X74A 4FGZA 1X1CA 5ERYA 2X3YA 3CFYA 3GEEA 4BO4A 1PNTA 3KQTA 5DYGA 3VV3A 1MZVA 2BOCC 1T9BA 4I4CA 2CLMB 2V6MA 3CC7V 4FPPA 3HJNA 3VPHA 1HDRA 3JQ9A 4IZOA 1WXGA 4H1HA 1QFSA 3E9NA 2QSZA 3G2JA 2GSDA 1QGDA 4C08A 1JWLA 4YCLA 1A95A 2DLCX 1WCV1 2JZOA 3NLLA 4V03A 4Q1BA 2Q68A 1QC5A 4ZVLA 5TJHA 4C0WA 3B5IA 4GU5A 2B6NA 3W0LB 3G68A 5I7VA 3VU9B 1NG1A 4YRJA 1ESNA 1KI7A 4C7UA 1P9LA 2QLNA 3AXSA 3KZIZ 3D8BA 3GDFA 4A3SA 5AW6A 1YHZA 2Z2JA 1SUAA 3ORRA 1MHTA 1RRPA 2GEKA 5ELMA 4EARA 1R6XA 1KZ4A 1S9HA 2X1HA 4PLHA 3EPLA 1H1TA 1LVHA 1YMQA 4UHJA 3MWYW 1VC2A 3WZLA 1OGYA 2Q4TA 5BNTA 1Z6AA 3CN7A 3QMWA 1SK8A 4OI4A 1EG2A 1F7UA 3PIRA 1YGYA 2BEVB 4KQKA 3CX3A 2R0QC 3HVKA 3OZVA 3P7MA 4LRYA 5DLQC 5CA1B 3EZXA 3KXPA 5CK4A 2AHOA 4X1IB 2NQ8A 4G1VA 5JD6A 1JHAA 4LJSA 3SHFA 2IEYA 3M6WA 4RXUA 1XZNA 3BQ9A 4ZVTA 6CHYA 5CA0B 1FXHA 3WVNA 5I8WA 4R54A 5DYIA 2QMYA 4O3MA 2Y05A 2FEOA 3G0DA 1WETA 3MJRA 1TEZA 4J2HA 4L4YA 3WGMA 3SLRA 4QG3A 1YDHA 5I3CA 1US8B 1VPWA 4A03A 4RVGA 2K2WA 2Q3FA 2C2KA 3N70A 4RF5A 4CEIA 1NG9A 3CM0A 4Y2UA 3NI2A 5G4KB 1MP0A 1P0IA 2CDYA 1U5BA 2EJTA 3D6HA 4PYMA 1G4YB 3TLCA 3ST7A 2GPBA 1EIZA 3GGDA 1FUYB 2QLMA 1V96A 2D1YA 3GOQA 4BAYA 4B5LA 1UAGA 1XTRA 2NO7A 2WM3A 4FZ5A 4INZA 3S2GA 4FPXA 4LF4B 1QJCA 4IH4A 1R3KC 3ESRA 1BO6A 3LF1A 1B42A 5KYWB 4K3UA 2WSMA 1AVTA 4Y3UA 2VP4A 5FOWA 3ZR4B 4Q6BA 1L4KA 5E1BA 4G5OA 1T1JA 3VR2D 1XDBA 1KJWA 3W77A 4ZHQA 4M1KA 1IBMO 2C0CA 3GDGA 2Z8YA 3CKYA 3O2QB 4EH1A 4A15A 4URUR 2IHVA 4F0JA 1J0DA 4BLWA 1NQAO 3B5EA 4PWZA 3D8NA 3HCPA 1QAOA 3E5MA 2C42A 1FJGB 1GKKA 4PQGA 3G8YA 4Q6WA 4TXJA 1U28A 3IB6A 3RLIA 4PXAA 3R65A 1I3OA 4JENA 4DRYA 1QCDA 1IONA 4OGFA 3T34A 1GYRA 4AZ0A 3OO1A 3GGSA 5J4VA 3NDIA 1Z0DA 4R2IA 3DVAA 2FPIB 3N58A 4MRRA 5AKLA 4GLXA 3R9XA 1LDYA 1SHKA 2X0NA 4KLCA 2AXTZ 1YRAA 4KVFA 4M0KA 4A2CA 2WPNA 2O8NA 4GWGA 1WUHS 5C7OO 3ZY5A 1N3IA 1NN3A 1XTPA 1EJ0A 1UXOA 1TIPA 2J67A 3Q40A 3U7GA 2IBSA 1PX0A 3WKEA 4A8PA 1CUBA 2VTBB 3G80A 1NQUA 3VOUA 3W1EA 3DO8A 4CS3A 3PL1A 3CLUD 3RS3A 1MPTA 1ZNYA 3N8GA 2JGRA 1JEEA 1V3VA 1R73A 2DFVA 4QREA 4S3MA 3K1YA 1USWA 3G2LA 2ERXA 5ALQA 5FOSA 3PFIA 3UJ8A 4AIIA 4BMXA 6NULA 3Q8LA 1JL3A 3G0HA 4UTZA 4ZYXA 1U0OC 2E1RA 2ZTVA 2Q62A 1MMFB 3H17A 1MGPA 3IRVA 4NYMQ 3FX7A 1OCEA 4LFBO 1UUFA 2C9DA 3DE0X 1V9CA 5H5NA 4PAOA 4RW0A 1SBYA 1RM0A 2ZBQA 3AR9A 2R60A 2IXGA 4JT4A 4FKBA 4Q4DA 3ROXA 1KECA 4C0QC 5G1PA 3U3ZA 3IE0A 2SCUB 3SC4A 1B6QA 4M60A 1Z2GA 4WOKA 4DCJA 2CNWD 1SCQA 4BVHA 2E18A 2XCIA 4EJSA 4OREX 2XLCA 3NXKA 5KJ6A 1CIPA 2PNJA 2MR5A 5KQSA 1KFBB 5LL6Y 1YR9A 4IMJB 3OFND 1KJNA 3TSOA 4DT1B 3PENA 2QBYA 2R00C 2C3UA 2YOFA 2B7LA 3OP1A 5AK6A 2IXFA 2AOWA 1DRUA 1SQXH 4MVZA 4ZKEA 5KOJA 3I9OA 2VUSA 2FCRA 1BQZA 1CJVC 2ILVA 3VHXB 3L6BA 4F4HA 4TN1A 3CMCO 4UE2A 1VQ9V 4EG4A 4PFQA 1Z06A 3HB4X 5AUPB 4LUCA 1KMQA 1MSDA 4UJ3A 2VJOA 3OE1A 2D3WA 1UJCA 2EWMA 2RGAA 1IPHA 3EUAA 4UXHA 1UH5A 1HLGA 4OXSA 1FXKB 1NPDA 2ZYHA 1A04A 3AHGA 4I5EA 4ZCQA 2E4VA 4IX1A 1M2KA 1LXCA 2JFBA 3G9QA 2PH5A 3IUQA 4RHCA 3EGWA 1JFFA 5DT2A 3GFFA 3BVPA 1MAUA 1JVSA 3GGPA 1GO2A 2CNNA 1E1QG 1CEQA 1U3DA 3TTSA 2R6JA 1JR4A 4HAVA 2WAMA 1I14A 2WTMA 2Q2OA 4FOSA 5JXWA 3BL5A 1UKZA 1E1CA 1WE2A 1HF3A 3EVGA 1XTJA 2QWNB 2YRXA 4GOOD 4LVUA 5L7YA 1ZH2A 1M1XB 3CKMA 1W0KG 4TOIA 1JVMA 3HDGA 1S8FA 3HV2A 4W6QA 1U0HC 4HADA 2GBGA 4TGLA 4ZVNA 4DR4O 4JI3O 4HPWA 2NW6A 4W63A 5THKA 5JISA 4BVAA 3C6KA 3GAZA 5JCOA 1NAHA 2YOGA 5K2OA 4BQRA 3RC3A 1H8EG 4M9UA 2Q2NA 1G3QA 4HWOA 1J5EO 2ZSFA 4RK0A 4WGFA 1UT5A 3BMQA 3LK7A 1V26A 4MYHA 2OFWA 1HNZB 4XAQA 3T35A 1XJCA 3NDPA 3CCVV 2OIGA 2PUVA 2VT3A 2N75A 4LHZA 3D4OA 2NR5A 4QYWA 4QFMA 1W2BU 3VYRB 2I91A 1OI7A 2RCVA 3VFDA 2EFDB 1CWUA 2X6BA 2QTCA 3D2BA 4C07A 5CCBA 1MJNA 4DLRA 2B5OA 3HLKA 2CV1A 3W06A 2H51A 2JFYA 4K3AA 5U4QA 4BGDA 3N1UA 3AP3A 4B6QA 3P0FA 3DAYA 1RM4A 3UBTA 3ZI0A 1U81A 3TLZA 2XYGA 1J9GA 3L4BC 5HCIA 2VK1A 4GYWA 1TJNA 1M2GA 1VJGA 3IODA 3C6ZA 1UXIA 4FHDA 2GHTA 3GGOA 1QVFU 1GTG1 4PCVA 5FPQA 4YRIA 2PT9A 4RCVA 1YRBA 3P9CA 4CM9A 3OQOA 3RSCA 3IHWA 3DFIA 2QTBA 1Q2UA 1XA3A 2YY6A 4TTAA 2CNLA 5C7YA 4LJRA 2B94A 1Z5UA 2BH9A 1QLEB 1GQSA 2Y4OA 3UQYS 3JCUZ 4YCMA 1Y81A 3ROQA 3B7WA 1G8MA 3TW4A 3DONA 2BP7A 3I4CA 4JCOA 5M29A 5C8XA 3K6KA 2RI6A 1KI9A 2PJDA 3NALA 1DG1G 1Z33A 3L92A 4FM2A 1L9XA 2FTKE 4Y2RA 4CE6A 4GX0A 1SN7A 2I2BA 2ZBDA 4UPEA 1JNXX 3BFJA 1DJPA 4MRVA 1IQPA 4KKXB 1NX6A 4W4KA 2LKCA 4BZZA 1DCTA 1CJTC 3S8EA 1DQZA 1CETA 2NUPA 1UFRA 1FYFA 4NDZA 1YACA 1PKEA 1E2FA 3GFSA 3K0KA 1RCUA 2WLTA 3JASB 2AN5A 2VNJA 2YQZA 3F9CA 3OP4A 4K9LA 1H9CA 2FH5B 3ZLUA 3N2YA 4QYMA 4IVPA 5DOZA 3WLRA 4GP7A 2I3DA 2VQFB 3I04M 4Q3BA 4Q3OA 1AMNA 4RSMA 5DM70 3C8ZA 1S0UA 4NTWA 1GFIA 4FT4A 4R9SA 3USES 3A2KA 3MM4A 3T0FA 4N49A 4TYPA 4G27B 4CR8A 5EIBC 5GINE 1JECA 1Q7EA 1ZGZA 3LT1A 3PITA 1CRWG 1WN7A 2GDJA 3QV2A 4RNDB 3TLXA 3ZYCA 4DYVA 4BO0A 3EA5A 3J7AU 2B2NA 3HC7A 4A9AA 3ZDEA 4KG7A 2X9QA 3FOAA 1LDGA 3EZLA 3V5NA 3R3YA 1NV9A 2B4QA 3GI1A 1T3TA 3HA3A 1JU9A 5ALTA 3OQNA 2HRDA 4P4UA 3UV6A 3SEFA 3C3MA 2ZE8A 4J4TA 5EJAA 1IM2A 1SA0A 3KQVA 1VCNA 3QLUA 3JY6A 1VJRA 1QC5B 4PYKA 1Y3DE 2A35A 4J0JA 3LOUA 4YLGA 2RBEA 4ZJYA 5FL7D 3VSDA 3RF7A 3ROZA 4XARA 5A2GA 1T9ZA 2QE6A 2BEJA 2R4UA 1KORA 2AH5A 3PQ2A 1NT2A 4RF2A 3WLEA 3CVYA 1OXVA 3BE4A 4TMTA 1XSEA 3OEHG 3WYNA 1PT7A 1SRRA 1YCGA 3GPCA 2YZKA 4N8SA 4IIUA 3WYEA 3TW6A 3E8XA 5EP1A 2VHEA 4MQEA 1R5NA 4LNUB 2ZS7A 4JJFA 5HJEA 4C22A 3MYYA 1T91A 5TVKA 2VNHA 4KMSA 2ONKA 2Q3BA 2ZJ6A 3UIEA 1J42A 3MWDA 4LZAA 4XOIA 3E15A 1DKUA 3PWSA 1FFHA 1N7IA 5BWMA 5IBPA 1LLFA 4FLYA 3DZFA 5D00A 1QHNA 1K8XB 1CS0A 1PJBA 1XNQB 3FDFA 1P19A 5HWSA 1TZCA 2H08A 4RQUA 1E8MA 3IMEA 1KI6B 1PWEA 5FOUA 5T4EA 1L5LA 1GN4A 4MW8A 5BN3A 4B40A 2FLVA 5C18A 5B1NA 3DC5A 1LBHA 3KJEA 1G5PA 1VXOA 4ZP1A 5B55A 1I7NA 4F7DA 3WGHA 1BVHA 1F6DA 2J0UA 1P4RA 2DWQA 3UJ6A 3T3MB 4JZGA 5ITVA 1ZJWA 1MGOA 2ZRKA 3GRVA 2I5PO 1ZC4A 3PICA 2I0FA 2AFVA 3IH5A 1RLMA 3RM3A 2PRZA 2HHJA 3AGPA 3MAAC 4JR1A 3FOEC 3GFBA 3MXOA 2AG0A 5DU2A 2XASA 1YRHA 2OGUA 1QQAA 4QQNA 3P0EA 1VIVA 2DBYA 2GS9A 5E1AC 3SXPA 5ARCA 1QPBA 3ZGXA 2BMJA 1TKBA 4ZAWA 2Z83A 2IYUA 1N36B 2FPWA 2OBMA 3E48A 4MP3A 3U4MA 3BQNB 1BNCA 3SYKA 3OEHA 4EKGA 2WFAA 1YGPA 1Q1QA 4C7JA 2DX7A 4Z4CA 1PKXA 1N9GB 1QRRA 2OSBA 4JSTA 1MTOA 1ENZA 1XDUA 3FDJA 4P32A 3H1IH 1IBLB 4JAUA 1GAXA 3OZRA 4HWPA 4O2BF 4XQ9A 5CPFA 3I53A 3FGNA 3I55V 2YWEA 3ISJA 3SSMA 5LQUA 3EVTA 2XMRA 2QB5A 3W9BA 3BCHA 2VL7A 1Y4ZA 1J6UA 3C7KA 3MLAA 5BN5A 1AMUA 3H6GA 1DEOA 1RXCA 3M9LA 1TTHA 2COUA 4NLLA 3W8FA 4LF5B 1T24A 3HCOA 4YP9A 1XCMA 4K05A 4MPDA 3ZJYA 2ECQA 3U7JA 1JQDA 1ZPDA 3CRNA 4R71A 1TB4A 1KAEA 1VIDA 1Y66A 2R8OA 2BFEB 2IUFA 5K4HA 1DP4A 1RC0A 2O7SA 4KUHA 4Q24A 3HWX1 4DUZO 4H17A 1HBJA 2WJJA 3BGDA 8ADHA 1JA9A 4KDRA 2XBLA 2G1JA 3RAFC 1VF5B 3RUFA 2RGWA 4ICIA 4JEUA 4H6VA 3PIIA 4MRAA 4P5DA 5FPYA 4KO4S 2XMPA 1T2UA 3RKSA 1HSOA 5IYZA 1P8JA 1Y1SA 5FNVB 1U99A 1KQGA 2JLRA 1LVGA 1SS3A 3D7RA 2YWRA 3BFPA 4GC9A 4H6PA 1N6HA 3FD9A 4XWGA 2FWRA 4CUZA 3X1YA 4UFNA 1F8UA 4B3DA 4DQDA 5B4VA 1LBEA 1RQPA 2FTKA 4B2PA 3SYOA 4G1MB 4UEWA 1SD5A 2XAAA 1ZY2A 3LY5A 5IP5A 1NWHA 3CXRA 5ABPA 4E46A 5KSYA 2I2CA 1CU1A 4MKIA 1I1OA 2BMVA 2HF7A 1AUPA 2QD4A 3C8MA 4I5FA 4LZLA 4MP6A 1G66A 4M0MA 3BK7A 4R69A 3G1UA 1Q0PA 3WNVA 4B43A 1MRNA 3D5QA 1JDPA 1ZUHA 2JI9A 2AFIB 2YMQA 4ITVA 4DIKA 1OREA 3A0BZ 2VSOA 5BT9A 5KDOA 3HSKA 4IILA 2QVYX 4A2WA 4LDQA 3GUZA 4WNAA 4H1UA 2A9JA 3ZGOA 1KDTA 1YC2A 3CNLA 1KI6A 1ZQ9A 5BN3B 8ABPA 3RCBA 1KK0A 4DR1B 2C88A 2IY9A 3LDFA 1YITV 5GONF 1QRUA 4F6RB 3LE8A 1O4WA 4FWIB 4P36A 4AYXA 1VP7A 2PMKA 2QRZA 3I04A 3NDRA 4U3JB 3OTGA 5G40A 2I4OA 2X42A 5K5EA 1WA5A 1KMIY 3D2AA 3SC2B 2I29A 4JQCA 4BLSA 2GAAA 2LGJA 3FYSA 4URXR 5LN1A 2Q2VA 1X7WA 4N0DA 4YI5A 4P31A 4TMXA 1QVAA 2A58A 2XUZA 3AY0A 4ENTA 4UXJA 1DDOA 4AF8A 4Z8YA 5HZKA 4FQ8A 2AUNA 4L75A 3KR2A 3RIMA 3SEAA 4KREA 3CNBA 1TM7E 2Q45A 3H1GA 4PGMA 3VJKA 5ALRA 3GY0A 3BWBA 5JWPA 5LZ2A 5A0TA 2DE0X 4XB2A 4B81A 1M72A 2I7VA 4TLMB 2AD1A 4MV0A 4XPIB 3MQ4A 5JCXA 2QW0X 1Q12A 2YW2A 3LI2A 4RSGA 2MSKA 2HWKA 3SBOA 3VH1A 4DJDC 5KOJB 5JSFA 1SGWA 1BQ0A 2CB9A 2FWAA 4CKBB 4FX5A 4ACAA 3UHFA 4DUZB 2GK7A 2JIBA 3A6HA 5DHQA 2W42A 5ETJA 3ZX6A 2QM7A 1BXRA 1XCPA 2WB4A 5FPPA 4R8LA 4V2IA 4EF6A 1DMRA 4MPTA 4YGYA 5H83A 2ZIAA 1TZMA 2GTPA 5JDCC 1H6AA 2G17A 4QM7A 5M04A 3REFA 4BN0A 2Q4EA 1OJ7A 1BS2A 5AM3A 5B3LA 2RB4A 3BBLA 3T7RA 3UK2A 4FUQA 4W4LA 3S2UA 5H6QA 1N2ZA 1T0PA 3GVHA 3IKJA 4WK0B 2HK8A 4ICGA 1Q6IA 3RYHB 1BAPA 3PX2A 4PHGA 3KOUA 4DS3A 2EATA 3RNOA 5I9NA 1QX3A 1K5QA 2VLIA 1E9AA 3BE5A 3NGXA 4F3TA 4JLSA 4I7ZB 1E8DA 3MTJA 3QEJA 4CMGA 1PVDA 1TEHA 4P4NA 3EK2A 4TSRA 2O0JA 5HP4A 3ZD8A 1MC1A 2FPGA 1I0LA 2ACEA 4DMGA 4OOEA 5IYZB 1GADO 2R6R1 4E5YA 2UUCB 1TQ4A 5B1YA 3PLRA 4MA4A 4ZRMA 3UTCA 4CT5A 2OD2A 4KAJA 5TQ0A 4IV8A 1SUCA 3OT5A 4U9IS 2ZP1A 1EVEA 1Q77A 1SNYA 2AOTA 1AR5A 1M1YB 2G9VA 4FIDA 4RKWA 1IDOA 3S2SA 2AMVA 1JFRA 1G41A 3SC6A 2FSPA 2J08A 2X5OA 3NZEA 1AHHA 2H3HA 1N25A 5EJ4A 5CBGA 4X93A 5D87A 3AOGA 4C0LA 2DHRA 3PEVA 2X5JO 4OSPA 1KEWA 1NW8A 5IHPA 2YDYA 3ADBA 2V1UA 4DGSA 1O9HA 1RU3A 2YWXA 3AOEA 1L5FA 1RZ3A 2JVDA 1N2EA 4YC7A 2ZB7A 4IT5A 2IPOA 1Y5RA 4HMPA 4K28A 3ORSA 2GYVA 1YDEA 1NMSA 3AEKA 3UPDA 1RLUA 4IDGA 2WKSA 4X3CA 4GNRA 4J7AA 1IQUA 1GRCA 2C1EA 1TT7A 5EA2A 3E9DA 1CDEA 1CUIA 1FQKA 1AI6A 2C98A 2MMCA 1LBTA 3VMMA 3TI9A 4F6EA 4YS6A 1AKVA 4DIFA 1MUUA 3K15A 3P0HA 5C3UA 1T4MA 2ODNA 3HCRA 4NCHA 2RC5A 3HB7A 1JVBA 5DM6V 5H9CA 4NXMB 1WXEA 1EEHA 4PSCA 3VZBA 5BVGB 4ALJA 1RZRD 5JSZA 1HG1A 4GAEA 4RMIA 1UT8A 4MJ3A 5AHKA 1PQPA 1ZVQA 1N77A 4DOMA 1XZBA 5DLYA 4IIXA 2QOEA 2WHPB 1O6BA 3PPVA 2LGWA 2ZXWC 4R3NA 1U0LA 4JXZA 4KQ1A 3EPJA 4WXMA 2J9YB 3M9WA 2O8EB 2LCIA 4ZO8A 4DQLA 2R5WA 4NTYA 2HJVA 1WLEA 2IVFA 3PDCA 5BQ3A 3K53A 3GLRA 1YS2X 3OQJA 5H02A 2Q69A 1EXMA 2N1BA 5BMVA 1E98A 3KBOA 3QU4A 1OAKA 5EQDA 3R8XA 1HYHA 5EJFA 2XB4A 3BJMA 1A4XA 5LMCA 4I6JA 5D6OA 4EFBA 1A0OA 3DW3X 3K0AA 2BW0A 3TAHA 4OH1A 4BPBA 2RIRA 2Q46A 1J9ZA 3FVWA 4W8OA 2B37A 2GQ0A 2J3QA 1QGZA 2PZJA 2QY9A 1GD1O 1QB8A 4L15A 1YIOA 2M6SA 1NXTA 3CH4B 3WISA 4MB6A 4B83A 4JLAA 4QOGA 8AT1A 5KWVA 1PV1A 1QH1A 3SG0A 2VHCA 1PDOA 3B6IA 1U6IA 3D5TA 2P22C 1ESZA 1ZXBA 3NEPX 3NIWA 2EYQA 3NVMB 1JQBA 4GOXA 4I4TA 1OIWA 2PLRA 4J7XA 3WNCA 3KE9A 1ONOA 4QPCA 4CQJA 4R5MA 3L9WA 4PICA 1FZTA 4R6WA 2NLJC 1HOXA 5GY7A 5HJ2A 1QHEA 2ATIA 2CF5A 2K5UA 3WHLA 3KCYA 4JL6A 3VDXA 1SXHA 2C4TA 1HDXA 3N05A 5JCJA 2OK8A 1L3BA 1IHDA 5E1OA 3ADDA 2J4DA 1Y4DE 4ZI2A 2PX3A 3V4SA 3PWZA 4N6NA 4X7PA 5EZ5A 3RFFA 1EINA 4Y6SA 1W0JG 2D1SA 4OKNA 2JAOA 4M53A 3LYHA 2BSXA 2DPXA 4RZIA 4UOQA 1F8XA 1AC5A 3RUIA 5K2MA 1VDZA 3U4HA 3WHKA 5LQKA 1JEYB 3S27A 4BJHB 3EIQA 4OD0A 4LFAB 2PRYA 3E86A 2C59A 1IY8A 4HS9A 2F66C 2J3DA 4G5GA 3RSOA 1GTZA 4GDFA 2D4AA 3DL0A 4NKGB 1BDBA 2REQA 1PL4A 4WHMA 4E2ZA 2XZLA 1A9XB 1CF4A 3UTDA 1IUOA 3O74A 1YB2A 4C6HA 3TFQA 4O2BA 1MDBA 1W47A 1CY4A 4JI0O 3MB8A 4GQAA 2KYRA 4XJSA 4BBAA 4TVKA 2NTEA 4K2HA 4KQIA 4X9XA 1KKCA 1CVIA 1G3RA 2L0XA 2ZWOA 3ZU6A 3UOGA 1IURA 2BEWB 4UBOA 2EIJB 1E1YA 1N8TA 1HZZC 3DBHA 4KN8A 2OP1A 1GGHA 4IIYA 1KTVA 3WGJA 3DR5A 1AQLA 3QVMA 1TTQB 5LXTF 4Q6GA 3M5DA 4RL4A 1E63A 3COWA 4QJFB 4IWXA 4GMKA 3P2EA 3KHTA 2WLLB 3JQEA 1FDOA 1R00A 2ZJ7A 5SV2A 1CY1A 4Y98A 3L40A 3UAYA 3FF1A 1FPOA 4ZRNA 2IDZA 2I33A 3PXAA 3I6IA 2I7XA 2GVZC 3PF8A 1LUWA 4ED9A 5IXYA 1KEKA 1CP2A 1GNRA 1PGJA 4QJ4A 4BGEA 1XX6A 4KAAA 2O8EA 2PD3A 4PQEA 1T5TA 1XMQO 2AW3A 3H6HA 4JI4O 4H2DA 4CDMA 2P6MA 3RYFA 2YWJA 4HFNA 1ZP6A 2VHUA 4MVJG 3RC8A 2PJUA 4G0WA 1TA0A 4GT1A 1SQFA 3P30A 1V5EA 3OTQA 1L5KA 1QGOA 4HGQA 4J76A 3UGJA 1RBMA 3K0AB 3NJ8A 3PWKA 1PNLA 3BIJA 3RVDA 4NNJA 2E6KA 1NTOA 4NK5A 1FFXB 4DWVA 3AF6A 2CWDA 2HDWA 3NJ4A 3C5HA 1V5WA 2HTEA 3E05A 3EVCA 4DLNA 2ZSEA 3GZJA 3FPSA 3OD1A 2V7EA 5A6SA 3GA0A 1DTOA 5CEEA 1H4SA 5IWCA 1K4DC 2WWIA 3HHPA 3GMSA 2XB2A 1E3DA 2O7NA 5JH7A 2W2PA 4UDYX 3QYFA 3V7FA 2VHVA 2YZ2A 3OW2U 2VF8A 2P2NA 4WNAB 5LDGA 1RJWA 3L77A 2Y93A 4EBFA 1XVTA 4J1NA 5BYKA 1DWQA 1QLHA 2F90A 3D5EA 3HCDA 1HNWB 1Z8DA 2ZI7A 3AZOA 1J33A 3PFCA 5LPNA 1Q91A 4X66O 3SYPA 1G20A 1KI3A 1ZCAA 3MSCA 3LQFA 2DMXA 1BX1A 1ORWA 3D1VA 4MYTA 2V7TA 5B53A 4BLPA 3P0RA 4RTMA 3TZBA 2FX3A 3U60B 2VJQA 4J7JA 1Q14A 1ZN2A 3GW8A 5PNTA 3TTTA 4EF4A 2QWOB 1LJ8A 3BTUA 2L35A 4DDUA 5JLAA 1PO7A 2XQIA 3UJ9A 1AS2A 1SVIA 3GLVA 3TEJA 1JH8A 2LVBA 5CA3A 2Y2VA 1B3QA 3WYGA 1PK7A 5KUKA 1BMQA 1J2TA 1V71A 3A6LA 1NI3A 1XK7A 3G9XA 3P9IA 1RBZA 1E6EA 3Q15C 4KN6A 3V3TA 4KRYA 1NI4A 1T26A 4AYWA 1C7EA 2JLVA 3FUVA 2BFMA 4D9BA 3ANTA 1VL0A 4AUEA 4C4RA 2J9ZB 2WLSA 3LDDA 1MLDA 1XZQA 2IVZA 4CKZA 4ASUG 3IAFA 4X85A 2A67A 1NJ1A 5F3DA 1JG1A 5C5DA 4KR7A 4F9EA 2C5GA 3ILHA 4N12A 5E6RA 3S8YA 3DPSA 3M6IA 2ZM5A 4DEYA 1YR1A 3EMKA 1CC1S 3FXAA 4DG9A 4NFSA 4DMFA 1TA4A 5EPOA 2HJWA 3BD7A 1BOOA 4PSAA 5BWNA 4WBNF 3OAAG 1JHZA 3H3FA 2ETXA 3AV3A 3JVUA 4JYYA 1T8TA 4KO3S 4NH4A 4A7PA 2N3ZA 4UUQA 5DPMA 3VC1A 4TLDA 3DE3X 4DJ5X 5FULA 1GGJA 1H0RA 4X89A 4AJHA 4TVOA 3TZ6A 2Q6IA 2QLJA 1Q90D 3EAQA 4JFAA 4K8OA 3WK5A 4EPVA 2EBHX 1AKTA 4RACA 5IDWA 5HTOA 4TLLB 1N33O 4Y1EA 1CY0A 4E21A 3RD5A 2EBWA 2F1IA 4ZZ2A 4GYCB 2JJ1G 1TF7A 2N46A 2SHKA 4R81A 3W7UA 4RHXA 4C6TB 2JAUA 2RHBA 3GUCA 1N3BA 1GDHA 1Q3KA 2JLCA 3S28A 5GZ1A 3W3ZB 1HMPA 1EKXA 3BDIA 3DR3A 1F5SA 3DS8A 3DV2A 3I4FA 4PAWA 4U5XA 3O94A 5DASA 4ZQCB 3U0VA 2GEBA 4P0TA 4EPXA 4IDFA 2ASVA 2IITA 4WD3A 4DLTA 1IUNA 3D54D 3MJCA 1JHQA 1U0TA 1TK9A 1A5ZA 4LRXA 3HGQA 4UM5A 2WKRA 1Q1AA 1VHDA 5CLFA 1MV8A 1BCSB 1N5IA 4L3WA 2C7PA 3QA9A 2A14A 1ODSA 2O14A 3K8YA 4UBIA 3FSGD 1GZHB 5A1TA 1V54B 4P2ZA 2QTNA 2VHXA 4DLKA 2XNKA 3BIFA 3KXKA 1U0FA 4Q0MA 5EFOA 1TFRA 2FDRA 2GZAA 1YJXA 3FUTA 2Q6AA 2DXIA 1C4WA 3C7DB 4PPYA 5FAKA 2E6UX 2EFEB 4RIEA 2EZUA 1VKJA 5DEIA 3CCEV 2C9MA 2IYSA 1VE9A 5LD2C 1NZFA 3QPDA 1SOAA 2RI1A 1GVHA 1V45E 1Y8RB 1JG4A 3BY6A 2Z95A 4FI3C 4R1UA 3V2HA 2C3OA 3E7FA 4B08A 1HT0A 3AY7A 2VK8A 3B1YA 1ECJA 5K8VA 3THXA 5GADl 4KQCA 2HK9A 4PYJA 5K99A 2G7MC 2QUKA 3H5OA 4MV6A 1QQ5A 3MMNA 5EXPA 1P75A 1KS2A 4LC1A 1AK2A 3IBCA 3L18A 4QFBA 2A8YA 3NHYA 2NZ8A 3OPQA 5DBFA 1UBRS 1M8KA 2IU6A 5GONB 2C83A 1WP7A 1RXEA 3A9WA 1RCTE 2FPIA 2WU1A 3RYTC 3FVVA 4WE3A 3EEFA 1VSUA 3LLCA 1OXUA 3BDVA 3UMCA 3VKHA 1A4IA 2HA7A 4XVRA 1KPHA 5FOTA 1KJ9A 5BQPA 4DWOA 2O1WA 4BXOB 4KL1A 3K96A 4YJ3B 2I4IA 1C30A 1K7YA 3ZIAA 1I9CA 1WW2A 1MFZA 1Q0SA 3AHHA 1A8UA 1BRMA 3AM5A 3HN2A 1O0SA 2H4HA 4EI7A 1EUQA 4B3RO 3C15C 1VA4A 3O9OA 2KBEA 3DD1A 3P4YA 5IDYA 1E2MA 1UJBA 3QX7A 2MYTA 3OOWA 4O3FA 4ENUA 2NXEA 2QDKA 3KQQA 1E2LA 4I9GA 5E6RB 2WLIA 5I7AA 3REQB 2JD1A 3KP1A 4HX9A 3EVBA 4LWSB 3TDKA 2XWBF 5HQ3B 5IK2D 2SKCA 1NNEA 2AZXA 4Q1EA 1QCCA 4M37A 3HBJA 2I6GA 3DPUA 4WXEA 2C54A 1MZFA 3AFMA 5IT4A 2I76A 1YQXA 4MHTA 4UCRA 4I6GA 3O1LA 1CEZA 4QFDA 1KY2A 3DDZX 3T0GA 4FLZA 1HE8B 1EZ4A 3T1CA 1FQWA 3A6DA 3CCRV 1VQ8V 3IHLA 3M3HA 5KUMA 3OKPA 4KE8A 2CMDA 4QOSA 3QE2A 1C0IA 3KKYA 3PHHA 4MRMA 5A05A 2ZT8A 4KQFA 5CP8A 3KSMA 4DUYB 3KYCB 4IDNA 2DHQA 5T64A 4B75A 3LY9A 2CXQA 2PR7A 2VOJA 5DBGA 4YV0A 1VJCA 5I9IA 3CRAA 3EOZA 3K5MA 1AJQA 1EFUA 2XGMA 4IKOA 3K9GA 3C74A 5IE9A 1KH2A 1RLIA 2IYEA 1Y1LA 3DP9A 1NV8A 4G56A 4EO9A 2ZQYA 3WLNA 3H19A 4CMHA 3D81A 5FWDA 4F4FA 1TCAA 3OCWA 3P94A 5AW2A 1GCGA 5HMMA 4QULA 2JZCA 1LSSA 4J4HA 1E1KA 4FVMA 3T1YO 3W7AA 4KITB 2IODA 3O91A 4I1IA 4G5FA 2EJCA 4NC9A 3U7QB 4WBNB 3NRBA 4JBIA 5HFMA 2IYLD 4ZCIA 5EEGA 2CK3A 3VSAA 3PNBA 4N21A 3IV6A 4UM9D 1WTAA 1EVKA 2QXUA 4WSOA 5KIAA 4HDSB 1H0KA 3FGPA 5EL0A 4IF4A 5KVVA 3DE4X 5EXDA 3WJ2A 1OBOA 3KELA 1GTJ1 3BXPA 2B99A 2XUIA 5DEDA 5AIAA 2Y1EA 4DDKA 2OGTA 1ZXXA 2ZBUA 1GY8A 1MO4A 4HRAA 1Y1QA 1IDSA 2E2WA 4WFQA 1GT91 1ZOSA 1ABBA 3A4YA 4QUIA 3RFTA 3Q3CA 4BASA 4BNHA 1KK3A 2JFUA 1RBQA 3CW8X 4AMGA 5KKCA 1D8AA 4C03A 3EPHA 3BEOA 1I10A 1LPMA 2GFIA 1PZGA 3AKCA 2GZDA 4BQFA 2O8BA 2ZAIA 1ID1A 3PVCA 1O5TA 2I2WA 5T8KC 1AK9A 4S0XA 4AQYB 3OZBA 2QKYA 3KEGA 5GTDA 3T7AA 4N5LA 4LZJA 3FBWA 2EJ7A 2P9YA 1C4KA 1FP4B 1JU4A 2JJ2A 4M21A 2GJ9A 1R4NB 3GA5A 1KZHA 4G0PA 3ZD6A 3UWOA 2GT1A 4ZANA 1VA5A 1C0KA 5TX7A 3UC5A 3N5KA 3DVRX 4WA7A 4QUJA 4BB6A 1OI3A 1STOA 5E6UB 3LA6A 4OHCA 3INRA 1RI1A 4K0RA 2XNSA 1PJCA 1W7AA 4GS5A 1NUAA 2Q6OA 1F48A 2GM5A 3UUEA 3OCXA 3SIXA 2QRKA 1V11B 1PGQA 2Y71A 3JAMN 1Y1RA 4MI3A 3DHVA 3AIKA 3VC3A 2Z04A 3CIOA 5MFZA 2FX5A 2VXYA 2E55A 3FUUA 3ZCCA 4HZUB 4X8OA 1JJ7A 2PWYA 4Z1VA 3G8AA 2VPWA 2SNIE 1NVXQ 2PM8A 3QP9A 3IP7A 4DSUA 1SVOA 2Q6VA 4MZXA 4WBSA 1JDBC 3HUDA 1RRKA 3A37A 3HY3A 3S40A 5I7FA 1G1AA 3JQBA 4MRMB 4E6EA 3QBJA 4GOLD 4FM1A 1NKVA 3OR6C 1V48A 4RZSA 3TW8A 3SBDA 3SHOA 1EFVB 3T3NA 1JF8A 1SVWA 2FW6A 4HAUA 4XYBA 1UMBA 2UXDB 4HQKA 3PEYA 1KU9A 2QD1A 2DJVA 2PR2A 1AKYA 1BVUA 1YBHA 4O6VA 2K6GA 2FN4A 4MR7B 1KC1A 4X84A 3WRYC 2P78A 1UFQA 1PZFA 3EQZA 3ZHXA 4C7OB 2XA2A 2EEPA 4X20B 3IVAA 1BW9B 1FDTA 4QLBA 4OJQA 2D54A 3EY4A 3FVRA 3U40A 4KJZA 4KK3A 3UCEA 3AFGA 4MMYB 2W8BB 5CAEA 4HDCA 2JS5A 1U0JA 3N86A 3ND9A 4RZQA 4CV3A 5JCJD 5LGNA 1IBRA 1F12A 1VBNA 3SQWA 2HA2A 5D3ZA 2CAZC 1OLSB 1H3FA 2CXUA 4LH7A 2H63A 2XUKA 5EWLA 4V24A 5IBRA 4R1LA 4E07A 4FC7A 1PJLA 2QTSA 1XQXA 3AB8A 3ZHZA 2UKDA 4LJKA 2EF1A 1MQSA 2EZTA 2JFFA 4IFIA 5GIPE 4Q4JA 2JHCA 4BWGA 3VX3A 2Q6LA 2G4CA 3L5KA 3M2TA 4L7VA 3RFCA 1WDLA 2JVIA 5F5XA 2QTVA 1JR2A 2FVXA 3K57A 3TTXA 3VYWA 4HPXB 3RHFA 2XB9A 3EFOB 2QQGA 1QHGA 1W0JA 2YVAA 2XADA 1AO3A 3BRWA 2C4MA 2GPSA 1Z83A 2W6PA 1XTZA 4L1KA 3RU9A 1N78A 1M3SA 3K2QA 2ZOSA 3OHSX 4Y6OA 2HVJC 2HB6A 4YASA 3UW3A 2WT4A 3FETA 5IVKA 2PUDA 3OSZA 3KEFA 2PN1A 2WG1A 4DDWA 3PUZA 4Y2SA 3F9RA 4F4DA 4W5OA 1XJWA 2QL6A 3DDNA 2CTWA 5F51A 3LMKA 3DOEA 4X5OA 3B53X 3TX2A 5EMLA 3QKWA 4EKIA 2PWZA 4PZEA 2FMTA 1MO3A 1XAJA 2HR3A 2P2YA 1GN8A 3VQYA 3OLQA 4LY0A 5CT4A 1TT5B 1OVGA 1U63A 1KIFA 1V8DA 3HBAA 1JU3A 4NL4H 1QLJA 1BN6A 1GPWB 1Q0UA 1S5PA 1U31A 4HN4B 2YASA 1OU0A 3MLEA 2TMYA 2ZJBA 4PRYA 5E6UA 3EZNA 3KJGA 1KY4A 3LGXA 4UMDA 5E95A 1U7OA 1C3EA 1G8AA 2WMDA 2I3BA 2WTUA 4B3SO 4BLRA 4OMCA 2CMKA 1E7WA 1RWWA 4HDRA 4EB6A 4EUKA 2YVLA 1R3LC 3ZE1B 2B4TO 1Y3BE 3T1HO 3FTNA 2WNHA 1T6BY 3LT2A 4X00A 2FDCA 5CMUA 2O8VA 2PCLA 1D1SA 1P7YA 1VI5A 1ESEA 2M98A 2Z08A 1K6IA 2A5YB 2JCYA 5JVDB 3K58A 2VJPA 2ZLBA 3DOOA 3P4XA 1R0XA 2WI8A 4FS3A 2G7ZA 3SXJA 3WQRA 4BAZA 4C3OB 2QRGA 2F43A 4KMMA 4OQDA 2R9RB 5JAMA 5D3MA 4AXBA 4C4XA 5HRAA 2WEKA 1O95D 4DR5B 1YO6A 2PKYX 3PC7A 3LRXA 1E3EA 1K33A 1NHGA 3M99B 1LLQA 4DV1O 2O54A 1JVNA 2ZPUA 1T4CA 5CB4A 2WK1A 3FYEB 1S01A 1MJHA 1VKOA 3DHYA 3DMGA 3JS5A 3MQ2A 4FZVA 4MDHA 3CXCU 1FFEA 1XMVA 4J7KA 3W5VA 5H2FZ 4ZI7A 4OFZA 5KOYA 4RNCA 3UA4A 4R0MA 1HNZO 2JGIA 1JTFA 1Z75A 2PKWA 1DO8A 5L3QB 4QYSA 5SZJA 4DC9A 3U19A 3DBRA 3WWZA 3CF4G 1E0KA 3U11A 2VAXA 4P4GA 2F23A 3NT4A 3WDSA 4POAA 3ANYB 1LVUA 4UVEA 4JV5B 1JHYA 2B6HA 3FCCA 4WOBA 2PL9A 5KVCA 4I0XA 5FUYA 1KPIA 2CZCA 4BGVA 1TTTA 2EERA 4G81A 4DB2A 4JXXA 3DLBA 4X3PA 2G0TA 3LW8A 2FZGA 1LV8A 1OV4A 4A1OA 3VHRA 2HH9A 3ZDZB 2HFEC 1M7GA 1U2DA 3AY3A 1SPBS 2H1HA 4KE7A 1GARA 1A8SA 3FMFA 3DM5A 5DI9A 1DEHA 3CJHB 4RIFA 3SNHA 3ZLTA 4TKUB 1O0BA 2OPBA 1Q1BA 3WLAA 3KOXA 3H9QA 1IOLA 1ZD3A 5CUQA 1CUEA 2QSYA 4PELA 5FXMA 2UXBO 2X14A 3P0JA 3N87A 2H00A 1FDRA 4QOHA 5BQOA 4HPJB 3KT0A 4L74A 4CL8A 1O9GA 1EWYA 4YHHB 5HIMA 3HXMA 4DHEA 4TWAA 3H3JA 4F71A 5AD1A 3CVUA 1S1CA 4IDQA 4U02A 4RTNA 1Q3EA 5DZSA 4X41A 1M74A 5D1NA 3GPDG 3QI2A 3S0JA 2W2OA 5IAEA 1FPQA 1W4AA 2XDYA 4H18A 2O6HA 1PEDA 4M1WA 3B1KA 4PNZA 2R62A 3GD7A 3EGEA 4K26A 2PUGA 3DF9A 4UVCA 1T1IA 2O20A 2VPQA 3KO8A 2NSDA 1DAGA 4QFCA 3F7YC 1Q1EA 4LKRA 1C9KA 4PWYA 3PCXA 5BXZA 3PKJA 3RUCA 1IOVA 2B5VA 1JSLA 2K2QB 5B6IA 3O2NA 1D2AA 1O7JA 2G1AA 2NU7A 1RPNA 1DX4A 2YI8A 4N0PA 3RT1A 1NDUA 2ZTUA 3TINA 4NTZA 1H9AA 3A6EA 5CR9A 2D2IA 3FNRA 4F92B 3UG6A 1LF5A 1XNJA 4G8DA 2QORA 4YRZA 5IH7A 4F1KA 2G6BA 1A1SA 1J95A 3QXXA 4TQ9A 1Q5PA 4QOEA 5CVEA 3BFRA 4CT4B 1G4UR 2AR7A 3I83A 4RLSA 3G0BA 5BNFA 3PFGA 4Q7EA 1YI2V 4KDEA 3ZWAA 4DA9A 1JNYA 1XYYA 1NQOA 3IEIA 2AHRA 2FR1A 2ZYAA 4UBNA 4D6TH 1ZVMA 2QUAA 2I1WA 3N0XA 3R1IA 5JPIA 1K08A 2XXJA 3CT6A 2YIJA 4DSZA 2IH4A 5KBYA 2QTTA 5I7UA 2Q4DA 3ELUA 3FTFA 2ZB3A 2ZULA 1MT3A 1F23A 4B44A 5CXXA 2YCBA 2OXTA 3H2GA 1E3LA 1NSYA 1Z0FA 2W4IA 2WVJA 3RT7A 5ECDA 5KPDA 1YS7A 2YH2A 1UPXA 2PGAA 3KJZA 4PVCA 1TC2A 3JQ6A 5D3KA 3WY9A 4EY3A 1TA9A 3HUUA 4IUCS 2YFYA 3OZXA 4Y2XA 3TIGA 2QDXA 5CG1A 4FGUA 3URMA 3F0TA 4HCJA 4HYEA 2XQGA 1EVYA 2IXTA 2Q9AA 3AQIA 4LSWA 1ARZA 2OCLA 3OF5A 3WYBA 3GFPA 1P2TA 1YRYE 4NXNO 4LZNA 5L3FA 4PS0A 1OA1A 2APJA 4QLAA 2ZYGA 3QU5A 4M1EA 1Q22A 2Q4BA 1UJ5A 2PX6A 5CX4A 2OTLV 1I1NA 4GBJA 1C9DB 2DPHA 2GJ4A 4RD4A 4ZHQF 4QAJA 1R15A 1QOQB 4PDVA 1WDKA 2UAGA 3R3JA 3WI7A 5DNCA 2NT4A 4KNYA 1Q16A 1MQAA 1NKTA 4G84A 1GGFA 3C90A 4MDEA 1MTZA 4MQ4A 2ZPTX 7YASA 1RHKA 3GJTA 1USKA 4K6GA 1FLNA 4I5GA 3AG3C 2WNSA 4XXHA 2DY1A 1C1XB 2XUMA 1RDFA 2B30A 3K9WA 3LAWA 4ZICA 3O1IC 5IFKA 2HKIA 2C78A 4RGYA 2DY0A 1KE1A 3DMHA 4QUHA 5EP4A 2NVBA 3AJRA 4J11A 1SKQA 4G2NA 3SFVA 5E3HA 4ER5A 1SO8A 3M81A 4NKRA 3CLUC 1S0VA 3M8AA 1JUDA 1AT1A 3FWKA 3AJAA 4RVOA 4C4ZA 5L3EA 3NKLA 1NW6A 4R9VA 2WYUA 2F4NA 2I1VB 4Q4HA 1ZAUA 4C7MA 6ABPA 3WKCA 3HHEA 3KXLA 5HKKA 1RJ9A 2Q1XA 1Z4MA 4HD8A 5A4MS 5C8YA 3EVNA 1DOZA 4GZLA 5FJJA 1TYAE 1IOWA 4R8SA 5CLJA 4D9FA 5DE3A 4DV5B 5EYPB 4PIVA 1DADA 1UOPA 1HQKA 1GZ7A 4S1VA 4JGSA 3CWZA 4Q3EA 5EKUA 1N2CA 1U8CB 2DWCA 2ZIXA 3HDJA 5CX1A 3MERA 4EKYA 2VWGA 4D4KA 2RKBA 5IWAO 3Q6NA 5H68A 3TX6A 3ZMZA 2Y1DA 4V0QA 4BHTA 1NU1H 2ODMA 3H1LH 2ZPAA 1DVRA 4UHEA 3CYOA 4MUJA 4JPRA 2ZWVA 4EVSA 4YP1A 4H1VA 1RPRA 1M1NB 1M2NA 2UXBB 1KBZA 2FHSA 2QJOA 1CUXA 3ELYA 3Q6MA 1SCBA 4WERA 2IOHA 4W8HA 1VYHA 3WGGA 1DZIA 3KVNA 5EKTA 4FHCA 2XMSA 1D0VA 4JXJA 1FSSA 3K70D 5A0VA 1RFGE 2QTWB 3BM5A 4NCIA 5KHKA 2V3VA 3LUBA 1VQ6V 4ETMA 4RJTA 3EDCA 2XUHA 5BSHA 4LVCA 4RESA 4Z0NA 1UP4A 1WCIB 3AZQA 3D0KA 3LT4A 4RZ2A 2FB5A 3N2KA 1C3LA 1F2VA 1MX3A 2YC4C 3NHBA 3R5KA 4D8YA 5ED0A 5K05A 1UWKA 1JSZA 1W0KA 1KBOA 2AWOA 4J0EA 3W8EA 2WYOA 4R4JA 2E3JA 4Q3AA 4TTPA 4B3BA 1MCZA 4YRTA 1N0VC 2OLEA 1SD1A 3UY4A 3V2GA 1T1SA 4JLUA 1O5IA 3OFJA 5K3FB 1JE1A 1NTKH 1KMHA 1YTUA 1PR1A 4FR0A 2HFJA 2JGFA 4WFBV 2GYUA 2KW5A 2HHHO 1U8ZA 4H1WA 1G1MA 2Q29A 3BMXA 3CHYA 1CQXA 4X1KA 3H87A 4DDVA 4HHEA 4QTTB 1VP9A 4C4AA 1X7ZA 2WUVA 4UVGA 4E22A 2C7BA 3R0ZA 2F2TA 1VCOA 3ET4A 3P32A 4UCQA 2EW1A 3AM3A 2FPMA 1QRAA 4ERNA 5IXJA 1HFEL 4KIJA 2G0AA 5FWXB 3LNNA 3C4QA 2OCYC 3QWFA 1N0HA 2BKVA 4B3TO 2HHCA 2P9GA 3MCTA 4Z9BA 5TV2A 3SM9A 1MNGA 4JGIA 3BICA 3CTPA 2AMFA 1M2VB 4ZYVA 2JBAA 4QT4A 2JBHA 4JAAA 1N1MA 2JASA 2W2MA 3CEPB 5DGTA 1MDFA 1ZUQA 4YAIA 1JEDA 1X70A 3R4CA 1M10A 5CXSA 1GRVA 1QH8A 1USIA 1PNQA 2VTBA 1XKLA 2NZJA 1UWCA 3JWPA 1ZONA 3U3MA 1NY6A 2KLHA 4NCJA 1XXLA 3C3JA 2BMWA 3S68A 2CL6X 1PSWA 1XEFA 1PJQA 3U09A 3COJA 1P4HA 2FQWA 3QENA 2E4YA 1BHSA 2I6TA 4XGKA 5J4YA 4GZ5A 2G63A 4F6LA 2CE7A 4LI3X 1BSVA 4DG8A 3PQDA 4Y2PA 3SICE 1NVGA 2ADQB 4F97A 4B2IA 2AW9A 2GX6A 5DN6G 1I5RA 3FLEA 1GQ2A 3NTUA 4M1SA 4AAYA 5JNUA 4HR7A 1JEYA 5LZ7A 1R3DA 2HJHA 2HK7A 1BE8A 3RTBA 3WADA 4AK9A 3DV9A 1QFYA 1C8KA 2K4MA 2NZXA 2QX8A 2G82A 1KZ7B 1N0JA 3QO7A 4RVHA 4BRWA 4QZVA 3HA5A 2VH2A 2XBUA 3GCXA 4PFSA 1IPFA 5DB4A 3OT1A 3K92A 3WYDA 5TMPA 5CBFA 4B3MB 2V9ZA 1Y5IA 1VF6C 2XE8A 3JQBC 1DXQA 3KALA 2B7BA 3QSGA 1OWNA 3G0GA 2XAHA 4W5JA 3UMFA 3C87A 4JROA 4ITUA 1ONBA 2IQIA 3RK4A 4M9SA 1IK4A 2X76A 4S2EA 3PXUA 4BNXA 5K0NA 2VTDA 3F6PA 1HFJA 3H1AA 3QPCA 5CM9C 4MYRA 2QKAA 4MS2A 1WRBA 2Q5JA 3ITEA 4Z2WA 3KXIA 3I8SA 5DECA 4PCUA 4G5XA 2CHVA 5JO0A 2W7TA 5FNZA 3SR4A 4RK4A 4F4CA 3ITKA 1RKVA 2WF8A 1R4ZA 5K51A 5K3AA 3TS1A 3ZZ1A 5J2TB 1WNFA 2RAVA 3ICOA 2ACVA 2GTSA 3X2QB 2XNDD 3SJQC 2DTEA 4FFDA 3I9JA 4MUGA 3SD7A 3GVCA 3TIVA 1J8YF 1TZJA 2ZWPA 1CFZA 5D5PA 4D9MA 1V1MA 1IZ7A 2H1RA 4RFLA 5DNVA 5A3RA 1CQIA 2F1MA 1TF5A 1MB2A 4NOJA 4D98A 3IR6A 1SUSA 4NYKA 2CUKA 3B20A 3UAWA 3KYCA 1IM8A 4JC0A 4FDVA 5BW6B 2O9JA 1CUFA 2GCGA 3B89A 3CC4V 3OIWA 3PC6A 1E3WB 3PEFA 1UT6A 2YX1A 4NBUA 3ZHQA 1KH1A 3LZ6A 4JT2A 4D7TA 1WSAA 3EE6A 2BHRA 3H5LA 3N6XA 1XPJA 3Q5DA 4PG7A 2WSIA 4Q9NA 5E8RA 1JDBB 1WHTA 5BPHA 2ZRFA 1RKUA 2ESRA 2PT7A 3GH3A 1BHJA 4LG1A 4PZCA 4HX5A 5FTJA 1CJCA 3OOYA 4S05A 3THWB 3P3PA 1RABA 3IKVA 4L5CA 4DXWA 3PCRB 1XO1A 9LDTA 3DKIA 1DAHA 2GZRA 4PBSA 3HYLA 2QWRB 1XG5A 1YI8A 4JJ8A 3HWSA 4Y2QA 3CSDA 2FW9A 3NFRA 3IKTA 2D6FA 3U7QA 1QM5A 3KQNA 1BYUA 1P1HA 1J07A 4DZZA 3C6XA 2P67A 3IVRA 1OC2A 5HGXA 3DWGA 3IAM6 4JJIA 3GJ3A 1PT9A 2Q3CA 4NJEB 4D9CA 4HK4A 4XGQA 3ZY3A 4Q7JB 2CUGA 1EN6A 4LRTB 1L4FA 5A3QA 4Z1MA 4PZUA 1DJLA 3IKMB 4PSVA 1R27A 2P4HX 3RGWS 1QYIA 2CLLB 4XYMA 4B0PA 2JIDA 5JQGF 3TD2A 3I3OA 1FYEA 1MV5A 4LZWA 4QAQA 1AR4A 4RWZA 3KT8A 1NVMB 4L8WB 1RP3B 3AF1A 2OXIA 3UMMA 3MC1A 3WYCA 4W4TA 2XODA 4IHQA 4KWIA 3P9RA 2PA3A 1B6RA 5E9WA 2QSUA 1KF0A 4MUXA 2O8BB 1YFJA 3MCVA 3CVOA 1RIFA 3IT1A 2FFBA 5IEJA 3VR5D 1O94D 1XXHB 2AYZA 3F1KA 3STVA 2V6FA 4Z7OB 2P75A 1J00A 1YQEA 2FP3A 2W2TA 4YJFA 2B69A 3HKCB 1SETA 3O9ZA 3CE2A 3CCQV 4EG6A 4EPWA 1OXSC 2R9AA 1E2QA 4LX8A 3AR6A 3ZIAD 1H0HA 5F52A 4YRNA 1URFA 4D0GA 4OAPA 4Y1RB 3ZK8A 1C3VA 4KR2A 5BRNA 2DSTA 4GKKB 2WF6A 1V11A 3V6LA 2DKNA 4CKEB 1G1XB 1JPVA 1XJQA 2I7DA 4LH6A 3FUCA 3PRKE 4C6TA 2DFTA 2X7RB 2QAGC 1ISHA 3A4IA 1S77D 2I22A 2LPMA 1M2HA 3B2NA 3FYTA 1QF7A 4RIGA 4V3BA 2DKOA 3AM4A 4JJ4A 3JALB 3UJHA 3KCQA 5GJCA 5HDBB 1R4AA 3F2IA 4LE2A 4O1HA 4P30A 1FP7A 3UKDA 3IEXA 3FGOA 1YZKA 1BCSA 3I9LA 3IMGA 5DM60 4BNYA 2XPCA 3SDBA 1J99A 2Q3JA 1A8IA 2KM1A 4GC5A 1X94A 3TKAA 5E7MA 2FPPA 2WG2A 2X0KA 3L0SA 4URWR 1ICIA 2ROQA 1DUVG 2J4FA 1D6NA 3KCNA 3PX3A 5C4MA 2QRMA 5LZ4A 4MUEA 2MINB 2OCPA 2WD7A 3IP1A 3T1NA 2QMEA 2XB8A 4HNGA 4EHKA 3JQFA 1LW7A 2DCUA 2NV6A 3IOEA 4PZDA 2BFOA 4UXNA 2FWIA 1G6HA 1U0SY 3IEKA 3JWJA 4JOQA 4P6VF 3WRWA 4CQMD 2BZ1A 5FUMA 3TB4A 1L7RA 2AX4A 2PGJA 1O97C 3LUPA 4JI7O 1TLTA 1U3FA 2BEKA 2NLOA 4BU0A 2GF2A 5EYPA 1CF9A 4PX2A 2NACA 1GG5A 4R31A 4C7BA 3R9WA 3AONB 2M6RA 1IC6A 5A7GA 2FG5A 3PGMA 2R25B 3SQOA 1KYVA 2AC4A 1P2BA 3I52A 1BHBA 1E79A 1TVCA 5FF9A 1QB7A 5F7OA 1VRVA 3UYLA 3TGPA 3GCGA 3L2OB 1JFLA 4K1LA 1T0JB 3G2QA 4OHOA 4EJ2A 4YDQA 3EF1A 1Z08A 1E4VA 1TRHA 2BFBB 2HF9A 4IIHA 1LRLA 2WJYA 1WM1A 4GM1A 3SYLA 2O57A 4IQ4A 1PZEA 3ND6A 4Q7QA 2GI4A 4LYHA 3ZKWA 1VHWA 3BWCA 4PZ0A 1HE3A 2WF9A 4BO7A 4D96A 4CU5A 5FPRA 3ZJZA 3B12A 3M4YA 2GUZB 4FDUA 1VI2A 4G5YA 2DZDA 3LL7A 3MINA 2AE2A 4U0JA 3HNRA 5A2QN 5EFZA 2A0WA 1H2ZA 2H2GA 4IIBA 3RAEC 1D2NA 1M8PA 1U7TA 1ESMA 3VJRA 4K9RA 4P54A 2VWJA 2FRXA 2J6HA 1J2UA 2QW8A 2X2OA 3K0BA 5LXTB 2J45A 4KLAA 1UR5A 3WLKX 4K46A 1PDVA 4EHBA 1SKAA 2EKPA 1V39A 1X80A 4HB4A 3W7BA 4D44A 1QH0A 5CW2A 2OB2A 1CR0A 1Z2NX 2H8PC 3QKSA 1NOJA 4O4HB 2PZFA 5H8WA 4U39A 4YJ2F 1RZVA 3Q8XB 1N6LA 4MKFA 4DUGD 4GXRA 2CK3D 4MS1B 1P1JA 3OLCX 1TIKA 4WV3A 1YE3A 2IUUA 1W34A 1ZI9A 3R7SA 4IYJA 3EQ7A 3NC1C 2YYZA 4ZQIA 3MTDA 4L5YA 2A1UB 1X1QA 3BG5A 5DBEX 4Q00A 3WJ7A 4AXXA 1DAPA 5TGDA 2ZRMA 1QDEA 4IEFB 2P2ZA 3H1HH 2OAQ1 3AI1A 3EGOA 1YDMA 3HXTA 4MAFA 4RKYA 1CDDA 621PA 1P3DA 2ZIEA 2MYNA 1G5RA 2N47A 2WW8A 3I9NA 2IS2A 2XA9A 3RYCA 3N7UA 2YL2A 1LLDA 2A6PA 3HL0A 4HUTA 3C3AA 4LE0A 3EDOA 4LI0A 3DXZA 1J09A 3CO0S 4QGAA 4TQGA 2SKDA 3OZIA 3SZRA 6AT1A 1AS3A 4HNTA 2OFOA 3TR5A 2BGTA 5D2CA 5FL3A 2YV5A 2IDJA 3JWGA 2EVWX 3BGIA 3OHPA 2Q0AA 2YS7A 3MRXA 2XMBA 4IIDA 4M1TA 3PTLA 3CHXA 3I72A 1J23A 1KE2A 4ME6A 5KWEA 3LY7A 1U1EA 2WA2A 4H7KA 1T3ZA