1WPXA

Crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase Y
publication title Structure of the carboxypeptidase y inhibitor i(c) in complex with the cognate proteinase reveals a novel mode of the proteinase-protein inhibitor interaction
pubmed doi rcsb
molecule tags Hydrolase
total genus 156
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1wpxA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wpxA01
5CT4A 1AQLA 1YASA 1DWQA 1LPPA 2XUOA 4OYYA 5JZ9A 4XIIA 1P0PA 2V96A 1JJIA 1ZOIA 5FLKA 5A2GA 1VE6A 4IH9A 1ZICA 1PJAA 1N1MA 2PU7A 3H2IA 4W1RA 4MEBA 1M33A 2HA4A 3D4LA 3WL8A 4OPMA 2ZJ7A 3PF9A 5SYNA 3BL8A 1QIGA 3WK8A 3M3DA 4B81A 3IUNA 5AM1A 3R3XA 1H2YA 2Q0XA 1QFMA 3F9CA 2FJPA 4LHEA 2XMCA 4J0DA 2B4KA 5JATA 1W1IA 4OB6A 3LS2A 3H2KA 4FNMA 1ISPA 5CH8A 3QZUA 2VQ6A 5EHXA 2VA9A 4IHAA 1ZI6A 3U1TA 3HJUA 1WHSA 1LPSA 4U2DA 5AK5A 1RWQA 3I2GA 2DCMA 3IUQA 3I2FA 4XX1A 1A8QA 2C7BA 4H35A 5HF8A 4UBIA 2YYSA 2UZ0A 4LIPD 5ALRA 3WYNA 3L1IA 5K3FB 2ZYIA 1CUUA 4DNFA 3PFBA 4AO6A 2XT0A 3VDXA 5AKKA 2WUDA 1SCKA 4RE6A 4JYMA 4QA9A 3HZOA 5AHXA 3O4IA 4X97A 3EBLA 3WLAA 4BBZA 2ZYRA 2Y2UA 4EA6A 3B3QA 3A70A 5CRIA 2RI6A 1Y7HA 4E46A 5F4ZA 3AUKA 3NOXA 4FDMA 2OCIA 2ZYHA 5AKIA 1UT6A 2QKYA 2WG2A 2WFLB 5EIEA 2XQJA 3IIIA 1QTRA 5CT8A 3X3HA 4KAJA 2HU8A 1MAHA 3BE8A 1YSCA 2GBIA 2PKYX 2IITA 5ALDA 2YASA 2ROQA 2XUPA 5D6OA 1UK7A 3STWA 2FUKA 2XE4A 5D7BA 3DDUA 3V9AA 4DMKA 2RIPA 1NU8A 3ZV7A 3GELA 4H7HA 4E11A 2GYUA 4H77A 4BAGA 5FOQA 2VJCA 2O7VA 4WFIA 1GPLA 1IUNA 5AOAA 3KOOA 4NMWA 1HL7A 1ZIXA 3WA7A 3G9ZA 3O4GA 5AIBA 4J0GA 3W05A 5ALLA 3WWPA 5HF5A 4ZXFA 2VSQA 5LZ2A 3LCRA 3AILA 3V1NA 1EXWA 4I4CA 3I6YA 3R3YA 1QOZA 1XRLA 3WA6A 4B82A 3WJ1A 2QS9A 5AK3A 5JARA 3A2NA 2G5PA 1VZ3A 3CN9A 5CBKA 4B6GA 2V97A 1QIEA 3W04A 4DLNA 1D07A 4LXGA 4UPDA 3T52A 3WQHA 4QLAA 3KDAA 4FLMA 1YS2X 3RLIA 4GLBA 1YA4A 2DQZA 5BWCA 3STXA 1XKLA 4BCDA 1EX9A 1QIMA 1TKRA 5EHQA 1Z68A 1DTEA 2X8BA 4X3CA 2ACKA 1SCIA 3OC0A 1CVLA 2WIFA 4DNPA 1X2EA 2PSDA 5K5EA 1TK3A 3F98A 2FX5A 5ALUA 4BZWA 5KWIA 3DKRA 1LPNA 4X6YA 3GZJA 2V9ZA 1E8DA 1TCBA 5C81A 5ALZA 2AJLI 1I6WA 4P08A 4W9RA 5JALA 3JYHA 1XLVA 5ISMA 1CV2A 4OB7A 2VF2A 2WQZA 2W22A 2XLBA 3ZLTA 5E2IA 4DMHA 4H7JA 1B41A 1XFDA 4EY8A 5JD6A 3SC2A 2BKLA 1EH5A 4Y2RA 2CEKA 2QUAA 1QIDA 5DYTA 3E1GA 1WPRA 2K2QB 3OG9A 3SX4A 5D3ZA 4Y2TA 3FAKA 3H04A 4PSCA 1DWOA 4J03A 2RGUA 4CG3A 5C8XA 4UBLA 4OU4A 3VXKA 4EY7A 3H2HA 1QFSA 1MT3A 2ACEA 3TRDA 1CFJA 1EINA 1LNSA 4L9AA 2PBLA 3C8HA 4FWBA 5CURA 1YAHA 5AO9A 2XUDA 4Y2SA 1CUJA 1ACLA 1MNAA 1AC5A 2HFJA 4ZGBA 4CCYA 4UBMA 2WTMA 3H0CA 3ZPXA 2HRQA 5BWBA 1GZ7A 5AI0A 5T4HA 4MXDA 3QMWA 3QITA 2Y1KA 4UHDA 2AJCA 2CKMA 1XQVA 4Y2PA 1XRMA 4Q05A 4OSEA 5BV7A 4EUSA 3R3UA 1QIHA 3HXKA 3W9BA 2PX6A 4HS9A 1DQZA 2CZQA 3I2IA 3TGLA 1CUIA 5ALEA 3QBJA 1VE7A 5FRDA 4YASA 3FYUB 1CUDA 3K2IA 4G9GA 3VJLA 2GYWA 1UK9A 5AI6A 5AI8A 4E15A 3QPAA 1Y7IA 1QJ4A 4RE5A 3WZMA 3G8YA 4JH0A 2I3DA 4WY5A 4G8BA 1VXRA 5KREA 2DHEA 4IH1A 2RHTA 5KWJA 1E8MA 5DLPA 1XLUA 2J4FA 3CCBA 3H17A 3ICVA 2WHPA 5ALKA 4OU5A 3R3VA 2D5LA 4H7DA 4PSUA 4QWWA 5HFNA 4AB1A 4WY8A 5JAUA 2ZJFA 1E89A 4I3FA 3DS8A 1XRNA 3WKBA 1ODCA 1EVQA 5JZSA 5ESRA 1O6FA 5A6VA 3HC7A 2I78A 3C43A 3GBSA 5IVHA 3I2HA 1XRPA 3D7RA 2HRRA 1XQXA 4H7EA 2Z3ZA 5DYWA 5DYYA 1JFRA 4BP8A 1QIIA 3T4UA 3WK5A 1ORVA 1QGED 4PO3X 4BTVA 2XMBA 5FXMA 5AM3A 2PL5A 3AIKA 3PE6A 1MO2A 4U2BA 7YASA 3FNBA 2QOEA 4JEIA 5AP9A 1CR6A 4BVKA 3KWFA 3CXUA 2HM7A 4MYSA 4QWMA 4BAUA 5AKEA 4AZ3A 4TPKA 3G9TA 4AQDA 2ES4A 3EF3A 5AJHA 5ALYA 3ANSA 5CXUA 3DYIA 3G0BA 3D0KA 4CFSA 3FBWA 2JGMA 1ODTC 5YASA 2VAXA 4RNCA 2YH2A 3U0VA 2JEZA 2WJ6A 4A16A 3HACA 3BF7A 4FFVA 3M83A 4K6GA 2VAVA 5JD5A 1VKHA 4GDMA 2AXEA 1UKCA 3IUMA 3STVA 4AX4A 5I8PA 1USWA 2H7YA 2WFMA 1ZJ5A 2HDWA 2C4HA 1J2EA 5ALWA 3JW8A 4QE3A 4X94A 1BRTA 3BIXA 4KYVA 4GEGA 4N5HX 2HA0A 4DM7A 1XZIA 3BXPA 1ZIYA 1SC9A 3OOSA 2WHRA 1CLEA 1JJBA 3VJMA 2H7CA 2NW6A 1XZHA 4EB0A 1CUFA 3DL7A 2WLSA 3IB3A 1HLGA 4EY4A 2HADA 5JIBA 4IH4A 4EZIA 4G8DA 3V1KA 3M82A 3UUFA 1YS1X 4OD0A 1GQSA 3PDCA 1QE3A 1VJ5A 4U2EA 4FLFA 2DHDA 3STUA 5AKZA 4QEKA 2PVSA 1DQYA 2OLEA 1LPOA 3WWDA 1LLFA 2VT6A 1HDEA 4PV7A 1XZEA 1BROA 1TCAA 2XUIA 1WB4A 1P0MA 1SOMA 2HA5A 3D2CA 2IIVA 3R40A 5ALIA 2BCEA 3GROA 1GGVA 4J3JA 3WKAA 3RK4A 4ITVA 5LZ8A 3WIBA 4QLOA 3G0DA 4WDRA 5FPQA 4UBOA 1EVEA 3F96A 2B20A 3O4JA 4BRZA 4MQMA 4ZWNA 3VJKA 3HRHA 1GQRA 3C45A 5CTAA 3D5EA 1CUZA 4YPVA 1N5RA 2PSHA 1W6RA 2QVBA 4CCYB 2VT7A 5HFAA 5JASA 5HQ3A 4W1PA 2WFZA 3ZLUA 1XLWA 5EI5A 4BCCA 2Y2VA 5C7YA 5T4EA 4J7AA 4Y2YA 1FFBA 5J3JA 4N5IX 3ESDA 3PUHA 5LP1A 3N0TA 1XRRA 2XQIA 3O95A 4DMFA 4C4YA 5AK4A 4B83A 1Y37A 2OAGA 1UOPA 2XMDA 3V48A 1JMYA 3BDIA 3C5VA 1P0IA 4UBJA 1CUSA 3ZWQA 3ZI7A 3N2ZB 1AKNA 3MGAA 4OCZA 4HVTA 2HU5A 2ZVDA 3RKSA 4PF1A 5AI5A 1XROA 2GBFA 1T4MA 3D2AA 2OPHA 3A2MA 5AKGA 4GWLA 1R9NA 3O9MA 2VJAA 4BC1A 4DSAA 3VVLA 4LXIA 4AMYA 3C8DA 3YASA 2ECFA 4B85A 4X7BA 5AI9A 2VJBA 3AIMA 3S8YA 3ICWA 4MWTA 2WM2A 4KACA 1CUEA 3MUNA 3I2KA 4MQLA 2DSNA 1KU6A 4K6KA 3G0CA 1W4LA 3EQ8A 1FFCA 1JKMA 3E0XA 4UHHA 5SYMA 3WWEA 1XKTA 4A5SA 1YAJA 4KEAA 3DQZA 1GT6A 4ZV7A 1T2NA 3E4DA 4J0CA 1QTIA 2O2HA 1FFEA 4UHFA 1CUVA 1N8SA 4Z49A 5CT9A 3K9BA 4QZVA 1VLQA 1IUPA 3RM3A 4UFPA 5JAPA 2I03A 4HXGA 4V2IA 1Q84A 1EB9A 3UMJA 4CI9A 2PUJA 4DYHA 1AZWA 4KE8A 1A88A 2C5GA 3GFFA 1UKBA 5HKAA 4DMCA 1UZAA 5ALMA 1LBSA 4Q82A 1EDEA 3UUEA 1C7JA 1LZKA 1XZLA 4FNGA 3IULA 4KAAA 4XWGA 1YA8A 5CT5A 4AO8A 2CBGA 1GKKA 2XLCA 4UBKA 2OQVA 4PNZA 1UWCA 4BE9A 4HXFB 3R3ZA 4IQ4A 4P93A 3I6MA 3A2LA 1R88A 6YASA 1BEEA 1WB5A 2HA7A 2OGZA 1F8UA 1R9MA 4LKOA 3WKCA 1MX1A 2OGTA 2WUFA 4UUQA 2QJWA 3L1HA 4BVLA 4KR0A 2XUKA 2ZYSA 4W1SA 2Z3WA 3FLBA 4A23A 3STYA 4QDTA 3FVRA 3FYTA 3C6YA 1NX9A 4S0XA 3R41A 3S2ZA 4WFKA 4WFJA 3BDVA 2OCKA 3AZPA 2HHAA 2GYVA 1MPXA 3DOHA 3FSGA 4TVKA 4FMPA 5C8VA 5ALTA 2QXUA 4AO7A 3BF8A 1UXOA 2EEPA 3QH4A 4J0IA 4G4GA 2VJDA 2IX9A 1XZBA 4BDSA 1DINA 1E3QA 2JGKA 2J3QA 2QJRA 3GA7A 2BAGA 2J3DA 3EIOA 4EBBA 2GZSA 1QLWA 2QR5A 4CIBA 1KEZA 1EDBA 2ZJ6A 3KSRA 4Y2XA 2B61A 1IZ8A 2XQFA 4UHCA 5D3KA 4DSZA 3NWOA 1TQHA 1HQDA 2HA6A 1X2BA 4X95A 1ZI9A 2QMQA 5JD4A 2C0PA 4CG2A 5A7HA 5K3FA 1CQZA 2HIHA 1FFAA 2O2IA 5ALHA 3C6ZA 4AN0A 3PFCA 1LBTA 2XB6A 4CIAA 1J06A 3HEAA 5DWDA 4L3WA 1XQWA 1DWPA 4B9EA 4BAZA 2ORYA 4EHBA 1TCCA 5AKYA 2WJ3A 5HF9A 3C6BA 3D3NA 3OM8A 5ALXA 1NU6A 2VATA 2G63A 4P92A 4N8SA 1F0NA 4FKBA 3H1AA 5H3HA 4PW0A 3EQ9A 1K6EA 5LKRA 1BCRA 5BOVA 3DEAA 2C5FA 4G4JA 4G9EA 3I2JA 3CN7A 5JADA 1J07A 1AMNA 4ZI5A 5T4FA 2WFLA 2WUGA 4N8DA 5DNUA 4C6HA 4M0FA 1AUOA 1DX6A 2HA2A 4C87A 2XMQA 2JBWA 4H0CA 2WIGA 4W63A 4F21A 4B84A 5ALJA 3R3WA 3NUZA 3QYJA 4UHBA 4KRXA 3OTQA 3Q8WA 4E14A 1R3DA 4H7FA 2FJ0A 4X6XA 3W9UA 1QIJA 1KU0A 3BJRA 4DNQA 4HAIA 1CUCA 1BEZA 4MWSA 5E4YA 2XUAA 3D2BA 5LZ4A 1AGYA 3C5WP 5CH5A 2XUFA 3G7NA 4H18A 2OQIA 4C89A 2JIDA 1SCQA 1ZI8A 2D0DA 4ZRDA 5LLSA 5FKJA 4OB8A 4Q3KA 5IVIA 4HRXA 1XZAA 4PQEA 2G4LA 4IO0A 1W52X 1QONA 4TGLA 5I9IA 3PICA 4UFOA 5DJ5A 4Q3OA 3O9VA 4BDTA 4QDOA 2PU5A 1X70A 2AJ8A 4B80A 1UOQA 2DFPA 3I6ZA 5AM5A 4ARAA 4C4XA 1A8SA 1Q0RA 5A7GA 3WYDA 4YX9A 1CRLA 1G5FA 2PM8A 1GXSA 2P8SA 4NVRA 1S8OA 2WG0A 1H2WA 3DD5A 4Y7DA 1MN6A 5LKAA 1JI3A 4K6HA 5ALSA 3G0GA 5AI4A 5CXXA 5A71A 3V1MA 3F97A 4JUIA 3D59A 1CUGA 5JYCA 4X71A 5I7UA 2OCGA 3FLAA 2WTNA 4QDUA 4AXBA 1GPKA 1EK2A 2HU7A 1WCYA 1U2EA 4M0EA 3H2JA 4JNCA 5CT6A 4Q3LA 1AURA 3DKKA 5ALVA 1HPLA 2QTBA 1LZLA 2XI4A 3I1YA 2JEYA 4BP9A 2BGNA 3FOBA 1IMJA 1BE0A 1BCSA 3ZLVA 5K3DA 4X6UA 4C88A 1XZJA 4KE6A 3IBTA 5LZ7A 1ODSA 2RONA 4K2AA 4GHWA 3I28A 1EA5A 1JJFA 2E3JA 1FJ2A 1QZ3A 3WIOA 2G5TA 3KXPA 1OXMA 1MTZA 1E5TA 1WB6A 2WG1A 3WWOA 5K3EA 5T4BA 2WIJA 3H19A 1IVYA 4I19A 4FHZA 1XQYA 4PSDA 1MX5A 3IA2A 2BGRA 5E4TA 4QDXA 1UFOA 3PF8A 2XQGA 3W2TA 4GW3A 2RAUA 3LIIA 5AM2A 1W75A 4GXNA 2HA3A 3WI7A 1ETHA 4FOLA 4FFWA 2Z5GA 4G4IA 3HYSA 4UBNA 2XMSA 2QXTA 3V1LA 2VEOA 3VVMA 5AKLA 4DIUA 4DGQA 1U65A 5AH0A 5HZGA 5ALQA 5EFZA 5ALPA 4P9NA 4F60A 3I1IA 5JZBA 2BJHA 2ZSIA 4Q34A 2EDCA 4FTWA 2QRUA 3IDAA 3ESAA 3C70A 2PSFA 2J4CA 3CCCA 1YB7A 3O4HA 4U2CA 2PUHA 2CB9A 2OG1A 1JU4A 3AFIA 1PFQA 2OGSA 3FVTA 2PSEA 3WKDA 3G9UA 3FYUA 2ZSHA 1E66A 4AN1A 5LIPA 4K5QA 2O2GA 4LYEA 1CPYA 3STTA 3BJMA 4MJ3A 1WHTA 1WM1A 4WCVA 2JGJA 4HZGA 4GECA 1A8UA 5JAOA 2HFKA 1QIKA 2X76A 1BN7A 1JU3A 1DU4A 3AZQA 4O08A 5AKJA 2XQKA 1Q83A 5AKXA 4CG1A 2WSLA 4GBGA 3F67A 4X00A 2WILA 2AJBA 2JGEA 4OUKX 5HKBA 1BN6A 5HK9A 2Z8XA 3KWJA 3WJ2A 1L7QA 4OYLA 4EY5A 3ESBA 5HCUA 4BB0A 4G8CA 3WK4A 1HBJA 3QMMA 3WK9A 1EHYA 4X85A 2EDAA 5JANA 3TJMA 2RHWA 2WHPB 2V98A 5EIHA 1MAAA 1L7AA 4D9JA 2XMZA 4BVJA 1UKAA 2GZRA 2XUHA 2QM0A 2Y6UA 4RPCA 1EDDA 2GBCA 1FSSA 1FFDA 4L0CA 4C4ZA 2XMRA 5IH7A 2R11A 2H9YA 1H23A 1AX9A 4BRSA 4NZZA 1Q0ZA 3FWHA 3IUJA 4N8EA 3WWCA 4ROTA 1H22A 3ANTA 5AOCA 4U2FA 3H1BA 4J0KA 1THTA 1U4NA 2VTVA 3VISA 1CUXA 1VXOA 3LP5A 3BIWA 4BYMA 4H7KA 2JGIA 2ONCA 2QZPA 1CUAA 1XZFA 3G0IA 4GI1A 4WDQA 2B9VA 5EGNA 1CUBA 1ZJ4A 5EHNA 3B12A 5AM0A 1LPMA 4UHEA 3FCXA 1A7UA 4MEAA 4B7ZA 1MJ5A 1J1IA 1HKHA 4H7IA 3ED1A 2H1IA 1ZD2P 4FLEA 2WUEA 3JWEA 2AJDA 1VA5A 1VA4A 4KJXA 2C0QA 3WL7A 3HI4A 3FLEA 3F8SA 2WHQA 3ILSA 5CH3A 3IURA 3H2GA 1C4XA 3DL4A 5FUMA 5K3AA 3H18A 1CIJA 1DX4A 1K63A 1H2ZA 1TAHA 2XDWA 1YCDA 4NS4A 3QVMA 2H7XA 1G66A 5FP0A 3QPCA 1RYYA 4X93A 2BFNA 4Y2JA 2DHCA 5EHZA 1UK8A 2X5XA 3G02A 4G5XA 1O6GA 3E3AA 4U2GA 3QMVA 5AK6A 1MNQA 4FBLA 3WMRA 3O0DA 2WKWA 1XZKA 4CCWA 4BC0A 4KE9A 1LPAB 1R50A 4HTAA 3WL6A 4Y9SA 1THGA 4AMZA 3LLCA 4BATA 3WK7A 2WU3A 3OURA 4B0PA 1DT3A 2Y6VA 5HK8A 4QDZA 5ALOA 1XZDA 4J0HA 3MVEA 2OAEA 5HF6A 5LZ9A 3IVMA 1ZD4A 2WIDA 1CQWA 4AZ0A 4DTCA 4B0OA 1UK6A 2BUBA 4XJVA 1GKLA 4B9AA 1XZGA 4BTLA 1CUYA 4BE4A 1VOTA 3VKFA 2O7RA 1WOMA 3PUIA 1EI9A 1GPNA 2C58A 3DJYA 4UFNA 2OCLA 5CW2A 1C7IA 5FDFA 3MUOA 4ETWA 4KE7A 5K3BA 5LZ5A 3AJAA 5DTJA 5E4JA 1H2XA 1OILA 2OXEA 3DNMA 3DCNA 4DNOA 3LIPA 1BU8A 4LXHA 4KAFA 3QPDA 4BCBA 2QUBA 1W76A 5HQ3B 2WJ4A 2CMFA 2XUGA 1IZ7A 2CJPA 2PPLA 3Q0TA 2PSJA 4YK7A 2DR0A 1B6GA 2BUAA 1YR2A 1G42A 4X92A 1ZD5A 2XUJA 3K6KA 4F5ZA 1LPBB 3ESCA 1XZCA 5FV4A 2YXPX 1YB6A 2Z8ZA 2LIPA 1N5MA 2DQYA 1L7RA 1CUWA 1XRQA 5IKXA 5IVDA 3AZOA 5AM4A 5DTIA 4W1QA 2JF0A 4QNNA 3DYVA 3C87A 4WJLA 3HABA 3RARA 4Q1VA 4MYDA 1ACJA 3R0VA 3PI6A 2W6CX 5A62A 1MU0A 4ZV9A 1SFRA 3QM1A 4JYPA 1P0QA 2I3ZA 1RP1A 5ALNA 4Y2QA 1VZ2A 4J0JA 5LYYA 2WU4A 3P2MA 5EIAA 4X91A 2HL6A 1UOOA 1ZGCA 1EK1A 3OPMA 1K5PA 2CUTA 1QO7A 3WZLA 1LGYA 1WPXA 4HXEB 1ZGBA 3W06A 5K3CA 1TRHA 2BUCA 1QIFA 1QO9A 2JGLA 1EB8A 3FCYA 4Y2UA 1OCEA 3EQ7A 5DNWA 4F0JA 1G4HA 4KRYA 3WK6A 1BS9A 3B5EA 1ZD3A 4BZZA 1IUOA 1JMKC 1XZMA 4ZREA 4C01A 4EY6A 1F0PA 1E8NA 3FSGD 4INZA 4L72A 1MX9A 1R4ZA 4G1FA 5DNVA 5KBYA 2R8BA 3WKEA 1CEXA 3KD2A 5AOBA 3AINA 3AIOA 3TEJA 3SK0A 2GBGA 4Y2VA 2JGFA 1K8QA 3C6XA 1U8EA 5AICA 3WL5A 5FPPA 3NGMA 3BWXA 3HSSA 3HLKA 4XVCA 3G9XA 1JT2A 1R1DA 1TIBA 1K4YA 5JAHA 3L1JA 2WIKA 3A6ZA 4HRYA 5ALGA 5C8ZA 4X90A 5AIAA 4M0MA 1CUHA 1DT5A 5ALFA 5A7FA 5IVKA 1PV1A 2QT9A 4FBMA 3DLTA 2XUQA 2XMGA 3SWWA 3M81A 3FYUC 1F6WA 1ORWA 3GUUA 5CMLA 5AKHA 3DOIA 4ARBA 4LYDA 4RGYA
chains in the Genus database with same CATH superfamily
5CT4A 4L22A 2ZZMA 1ESZA 1JJIA 5TISZ 4M9XA 3A6EA 3PITA 3QX7A 3G8DA 2ZS8A 3C7KA 2Q9UA 1IB0A 4FHGA 4AJOA 2FN9A 2HRCA 3NHLA 4K88A 2JFVA 4YRQA 5BSUA 1QTQA 2CK3G 1WF6A 3BMQA 2G9NA 1NBOA 2P9ZA 2XZPA 4IIBA 5EXPA 2QVLA 1J2RA 4GLOA 2VQ6A 2VA9A 4XTRA 4J76A 1KA9H 1SQBH 5AK5A 2J33A 5HNKA 4OH1A 1XF9A 1H9CA 1GG8A 1KBHA 1BH6A 2XT6A 4Y2GA 1A1VA 4HGOA 1Z4JA 4RABA 2NNUA 1JHPA 1Q0UA 3PNLA 4WE3A 3IBSA 1PR5A 4I1OA 5AKKA 3N86A 5FWXA 1N2EA 3MPOA 3PTLA 2C00A 3K53A 3TFQA 2Q7EA 1LB1B 3HYNA 3JYCA 1MB0A 4M0KA 2JDID 4G5QA 1VHDA 2ZYRA 3NHJA 4Q6WA 3FXAA 1MA1A 1PFVA 3AOGA 2RMKA 2NU8B 3OLWA 1RWKA 4CV0A 1WABA 1NVXQ 5BV2P 3MJDA 4ABMA 4RXUA 1YVUA 1YZQA 2BRUC 1P7ZA 4LI0A 1JXQA 4YGXB 4DW0A 3LDUA 4CIYA 2G9QA 1QP8A 3NTUA 3AM5A 1YSCA 2ZYTX 1UMBB 2XUPA 3H05A 1US6A 1M75A 3AYXB 3LUBA 4IICA 3UMSA 4GF5A 4ABTA 1E69A 3PSHA 4LWQA 1GSIA 4YXWA 4CM8A 2WNIA 3AVWA 3B3FA 1XNQO 2QVCA 4H77A 2DJVA 1M6VA 1K4MA 3SBXA 4R50A 3K1YA 4WJKB 3P9XA 3OUTA 1EFCA 2FMHA 3PHLA 4XVHA 3KU4A 3OZTA 1GUYA 3W05A 5L3VA 1RZUA 4L16A 4TL9A 2Q7GA 2M1ZA 4RTKA 3AEUB 2P6MA 4CG0A 4JIGA 2UZ1A 3M4NA 1RLMA 1EX7A 2Y1XA 3HA7A 2BSXA 3ADOA 1XVLA 4R1OA 4FIDA 1W8DA 1SHZA 1WL8A 3AMVA 3K6RA 2GN1A 3N2NA 1SCIA 4YRCA 1ODLA 3A2FA 1OBCA 2EJ7A 2Q5OA 1LPNA 4JK3A 3P4YA 4FFMA 1WMSA 3WGGA 4GEKA 3B1KA 1I6WA 2H1WA 5JALA 1AN0A 1NJSA 1D0IA 1UADA 4YAJA 2JLQA 1CV2A 2WQZA 2J30A 2EJBA 2BJVA 5JSUA 1XV5A 5JD6A 4TTAA 1ZPDA 1WDLA 3VX4A 4M54A 3JAKB 1RSZA 1XX6A 5GZ3A 2QR2A 4YRDA 4OREX 2LKCA 4Y2TA 1NXWA 3UO3A 3FLMA 5K45A 5JJBA 4BIZA 4JB8A 3RYCA 3QKWA 2YY5A 1TW2A 4BNTA 1QCYA 2N74A 3VXKA 4DRXA 1QFSA 1MT3A 4W7HA 1LNSA 4B5KA 1P7CA 1XCBA 4KYTA 5C8YA 5CURA 2BT4A 2ECOA 3E03A 4ZYZA 1ILEA 2CUKA 4L8WB 4Y2SA 1MNAA 2HFJA 3RW0A 1VP3A 2WVHA 1PV2A 2Y1KA 3V80A 4X66O 3W6ZA 1QGUB 2OD7A 5G0UA 2CDYA 2OBFA 4YLEA 2ZULA 4EUSA 4ZDJA 1Y9AA 2H63A 4P35A 3AVPA 1JQDA 4UHKA 3BTVA 2R7LA 2QLTA 3WHKA 4EFKA 4E4RA 4PDRA 3FNRA 1Q74A 3NHMA 1NY5A 3LVFO 2COUA 2JHPA 2PKQO 3KAQA 3NBKA 5DBOA 1GT91 2GPTA 4GP6A 1Q43A 1HO3A 1UK9A 3PHGA 3SMVA 1I5EA 5ERYA 3MNFA 1XU7A 4ZT2A 2AXNA 3OX3A 4C2TA 1PEYA 1KJWA 1XLUA 4XUDA 4N54A 5BRJA 3AB8A 4OGKA 1V5IA 4N3NA 1YBAA 1YULA 4OU5A 3U10A 4MT8A 5D87A 5DRYA 4RUKA 2BV3A 4MUXA 5K1XA 1HWYA 3WRVA 3TKLA 2JFYA 3TTYA 4RZQA 5IKMA 3MC1A 3UXHA 2H1VA 2YBDA 2O5RA 3GBSA 3J81A 3E35A 1BWPA 1EUCB 2G3YA 2EFYA 4U6QA 1IBRA 3T4UA 2BSAA 1QGED 1QLNA 4LRYA 2GD2A 3PRKE 2WPDA 4L74A 1CERA 4FHCA 3WP0A 4JEIA 1LF5A 2PXAA 4BVKA 1TPZA 2A33A 3ZVNA 2HM7A 1CY8A 4QWMA 3CS3A 4XIYA 1YD7A 5EXEA 1THMA 4B79A 2QJTA 1RXSA 4FQ8A 5ALYA 3KEQA 1PZNA 3FBWA 3RTAA 4H0NA 1MO6A 1OWNA 3AUYA 2E75B 5KVCA 4MV1A 1N2GA 4C14A 2VAVA 5JD5A 4HNVA 1Q1GA 4K9LA 1SKUA 2JANA 5LFAA 1ZWLA 2IODA 3IUMA 2JJ1D 5KA6A 1N9GA 3UB2A 3QP9A 4WBSA 3KJEA 1W88B 4KYVA 4OHWA 1BQ0A 1W96A 1PD1A 1GM5A 2H7CA 1BHQ1 3Q7IA 3DW1X 2NW6A 3DL7A 3GPCA 5LM3A 2XYVA 1VL2A 1HLGA 1Z9BA 5AMXA 2HBZA 1Q5OA 4G8DA 2NX2A 1U6IA 4YAOA 1RTKA 5B66Z 3WGKA 3QPWA 4CM3A 2ETVA 3JD1A 3D54D 1P1JA 2VJMA 4KR9A 4TQAA 4XYBA 2HZBA 2RD2A 2HHHO 2IIVA 1C30A 3W5IA 2BCEA 1JH9A 1MDBA 2X2EA 3JSLA 4G0OA 4IDCA 1D1SA 5I7AA 2WSSA 4NMXB 2EW8A 3OJOA 4EG5A 4PXAA 1B8UA 1EVEA 3UMFA 2WM3A 3VPGA 4ARZB 3P20A 4Q01A 5HQ3A 1WCV1 2BFDA 1PTJA 3MG9A 2NOAA 2Z95A 1OTXA 4N5IX 3ESDA 2FPWA 2HX1A 5LMUB 1JPVA 3ZZ0A 3KSZO 4PQRA 5KSYA 2GDSA 4YCLA 4CDNA 3L8CA 1FPOA 2FWJA 1UEJA 4L3OA 3P3PA 2SCUB 1ZCJA 3TQOA 1OR8A 1CUSA 3ZQJA 1EA7A 4PF1A 3H5RA 4JYAB 2VP9A 3KEOA 3RAEC 1R9NA 2CXQA 2AOVA 5F3DA 1F1JA 1H2EA 1ZO8A 4TTIA 1QF9A 2OE2A 3OJCA 1EVJA 2WWWA 3CCSV 4GR5A 3W7AA 2GH1A 4YFYA 4AIIA 1ESCA 2H8KA 2DSNA 4V0NA 5BSFA 1KU6A 4NR0A 1W4LA 3JWIA 1QKJA 3FPEA 3INYA 4KQ2A 4A8HA 1HDZA 4JMLA 5CDTA 2Y76A 1H8HD 1E9FA 2FZKA 5DW3A 2WMYA 3SDSA 1J1UA 3DBVO 1PO7A 4MHSA 2JFUA 5TRTA 4JI1B 5LOVA 1QOPB 2R9AA 1O0BA 1UXJA 1XWFA 1AVTA 1V5EA 2ZUUA 4IZOA 5ALMA 1HSZA 3QG1A 4EY3A 3OTFA 3DBIA 4ARUA 4AO8A 2OHGA 2J6HA 4XWGA 1MQ8B 3H5WA 1JZSA 1KZGB 2FB9A 3IJ5A 4HXFB 4J16A 4OXIA 4NK4A 2H1SA 4CQMA 1K7XB 4CF6A 3LTEA 2Q7OE 2EW1A 1Y4MA 3V6MA 4EITA 3GT7A 4IYJA 4DK1A 1G8HA 1NM5A 2R85A 3UV3A 1G9SA 4EIWA 1NYQA 1DZ3A 2RC6A 2AEMA 1V2HE 2HHAA 3N87A 1UDBA 3GGOA 2JJQA 2JFFA 3L7NA 2HYIC 3TZEA 2QXUA 3R7BA 3TE7A 4GZRB 4ERNA 1T34A 1W73A 1E5QA 1ZM4A 2UKDA 4Q20A 4CZ2A 3CZ9A 4HDNB 1B6QA 3OE7A 4QPDA 5KHIA 3EC1A 4AY2A 2VJLA 2SHKA 3NBYC 1WULS 3AHHA 5E6RB 1IL0A 4IYIA 4ES6A 4RWUA 4JVLA 3ZKAA 1EDBA 3H01A 5LP6C 3CH4B 4CFYA 3S2EA 1VHTA 4M46A 3LFTA 4WNCA 3LXXA 4I46A 3RUAA 4ENRA 1Y9ZA 1K1EA 2AN5A 5I01A 4J80A 2A5LA 3ON5A 3ACDA 4EUNA 1IN4A 2VT2A 4X6LA 3Q85A 1MVOA 4KP7A 1XPOA 5T41A 5LGNA 1XQWA 1OAAA 2ORYA 5HIAA 4QQKA 4AS1A 3KKNA 5DGHA 2QRNA 2ARHA 2WJ3A 4JI6O 3OM8A 2HMUA 5ALXA 1N5KA 2I1LA 1X6VA 2JLVA 3VR5A 2C2BA 3QJ5A 4Z9YA 2C5EA 3KQQA 3MJCA 4XVRA 5IJXA 2KM1A 2NUTA 4I9UA 1P6XA 4HVLA 4OIMA 2J3JA 3KUKA 1GGEA 4YMLA 2QEQA 2IQ5A 2GTIA 2WI8A 3O92A 4BWFB 2YZ7A 1FJXA 2R4QA 1KI6A 2MU1A 4O4JF 2Y1DA 4C87A 2QRQA 5K4GA 1WKBA 2P6NA 3LSTA 1II9A 1IBLB 3IIEA 4KR6A 1R3DA 1C3LA 2G83A 5E6SB 1ISFA 5AUPB 3KOYA 1DTWA 2LO1A 5LYJB 1QP0A 3OR7C 4AICA 3LM8A 1T4DA 2WYUA 5EPEA 4HTFA 1UINA 5E4YA 1EZVH 2XUAA 3D2BA 2WSYB 5HIMA 1RQXA 5CITA 3BILA 1FLAA 5K2MA 4ZEOA 1ZI8A 5AVJA 5LLSA 4WWHA 1WPQA 5EJ2A 2NPIA 2I3AA 5I8ZA 4GGPA 1X39A 1JPXA 2FPOA 1C4WA 4HNRA 4IRMA 5DJ5A 3A1UA 4QRDA 3TOCA 4X62B 3CJTA 2VP3A 1MAWA 1KO8A 2DFPA 3O38A 2FX3A 1CRLA 3EAGA 1DQPA 2FLWA 3T38A 1UFRA 2F7SA 3ZMTA 1NGSA 3ME5A 1OV4A 2FEMA 2EIMB 1QB8A 4N0MA 1VKNA 2DQ3A 1A9YA 3GVMA 4D0RA 4WCFC 4LF8B 1RM4A 3B85A 4MWZA 4LWPA 3B38A 5IMBA 2HEGA 1UAAA 4BFTA 2ADOA 4JOBA 4QUIA 1GRQA 4JHLA 1V16A 3EUEA 1EFDN 1E7RA 3PD1A 2QE6A 3DKKA 1QB7A 3HLTA 3NEJA 3ORHA 3U17A 4NTYA 4NCJA 2REQA 2FPIA 3I8OA 2C2AA 4FS8A 1K06A 5TGTA 4JMPA 3VR1A 4EEXA 4XRRA 3M3PA 3BEHA 3M5DA 5FNVA 3K31A 3ZWWA 3O26A 1ZOOA 3CVJA 3F46A 4PGGA 5C18A 3TK1A 1Z6TA 3TLEA 4MDFA 4FD3A 5TS3A 2ZUTA 5K3EA 4R6WA 1KYIA 4CI0B 1QG0A 1TGYA 4GKBA 1XMVA 2RE8A 4PSAA 1X8LA 2GSMB 4RUEA 3EA4A 1TL7C 1JIVA 1HLDA 4A2PA 3U2QA 3D8TA 2WV9A 4TVOA 4DIUA 3QUTA 3L4KA 1W5EA 3I1IA 3TSWA 2OM2A 4FZVA 2EDCA 3EEOA 2LVBA 4HMPA 3HM9A 2IP1A 3UAZA 4JX8A 4N6OA 5IDQA 2CEAA 3O1LA 3FYUA 4DOMA 3U62A 2IP4A 3D6UA 2AFHB 1GP2A 2MYNA 1J7JA 2KMLA 3FZGA 1WP7A 3H84A 2JKVA 1E3WB 3CUWA 2F93B 1M7HA 1R6BX 4YCJA 3AZQA 3UM9A 4RJTA 2WSLA 2BBTA 2E4YA 3MOIA 2NSYA 5IKPA 3LUDA 2BEWB 4W5RA 3I9NA 1XTVA 2AMFA 3AY7A 4RZUA 3BCSA 2PZ8A 2PZEA 2OCCC 1EHYA 1DIAA 1D2NA 5JANA 3GBVA 3N8GA 3V4RA 1INLA 3DM9B 2P9JA 4BVJA 1Q6ZA 4P1ZA 4QPJA 4KHPB 1KBZA 5LD2C 4FN5A 4ZCRA 1Y76A 2XNHA 1U3WA 1G3MA 4X3OA 3FOWA 1K9SA 2W4QA 3QVUA 4O4LF 3K2BA 5CB8A 3VR4D 4KV9A 3SX2A 4YHHO 3L7OA 3A7DA 3LZDA 1UKVY 1LA2A 5H0IA 1ILWA 3LPMA 5CA0B 1DAIA 3QVJA 1IY8A 3ZU2A 4G0MA 5DH9A 2QM3A 1H4VB 2JAUA 4COOA 1BJTA 3MHPA 3KJFA 3M4XA 4FMTA 4MA0A 5EHNA 4TMFA 2FR8A 2WP8J 3C3PA 1Y8QA 3VM6A 3QBTA 3WB2A 1H5NA 4TKLA 4B3MB 3V42A 1ZA1A 1H65A 3BY6A 2VAWA 1LDNA 4NECA 2WHQA 3M6AA 1SU6A 5CH3A 3WNBA 1NH2B 3DDSA 1WU7A 4D3FA 3RD5A 1E99A 4DCUA 1MC8A 4FIZA 1S8NA 1G66A 3AG5A 4R54A 3STLC 1EWYA 4C0QC 3I6BA 1ECBA 1VQPV 4TLBA 1F2UA 3BGVA 3W7SA 3M0EA 5BXYA 1T0BA 4Q47A 4GZ3A 3T5AA 2CMGA 3A9VA 1S96A 1K6XA 3SFTA 2RHBA 3T4EA 3WL6A 1KI1A 5LNK6 1XN1A 4TLDA 1OWLA 2NUAB 1OREA 2YFKA 5E1OA 1QU7A 2H08A 5CHYA 4GLXA 4XSVA 1KRWA 3LNMB 3UMCA 3SIWA 2LGJA 1V48A 3W34A 3UPUA 1GKLA 2AT1A 3OOHA 3ZXYA 4QD3A 5CVVA 5C4GB 2I8LA 3NRCA 2Q41A 3HKBB 5CUQA 5L3QA 2RDCA 1SVNA 3PRHA 3BFKA 2B82A 2NZ2A 2A92A 4QU5A 2QUIA 1OILA 2Q5CA 4UC0A 1FS4A 1KMHB 2P6PA 3IQZA 3LI2A 1I4OA 3IP8A 1N36B 4JUCA 3UT5B 2GD1O 1F8XA 1LQ2A 4AW9A 2D5AA 2X9LA 2VF7A 3LCVB 1AKTA 1CDOA 3QX3A 2JFNA 5M2QA 5ESXA 4PV1B 2X14A 4RTNA 3D7SA 1XXHB 2PZFA 1U9ZA 5F12A 2V3WA 2OXFA 1TE2A 1Q7BA 2Z2KA 3GLHE 2UZIR 4GQBA 3CE2A 4LHWA 1NN5A 4TMVA 3T7SA 1TKAA 3HABA 2C2MA 3RARA 4PC2A 3CM0A 4HJXA 4DR5B 3EFOA 1NJGA 3QW4B 1G7SA 5LQKA 3UAGA 3OEWA 3T4ZA 1Y7PA 3ZOKA 4MO2A 3VDNB 3EGEA 3IPRA 4KK4A 4B3GA 4GRDA 4IEEA 4Q1BA 1C3OA 3N07A 3KQNA 4HOYA 2GUWA 2CXSA 2IOQA 1S89A 4LWOA 5TF4A 7REQA 1TRHA 2HCFA 1I0LA 1THZA 3WHPA 2GI4A 5C2JB 4S04A 1Z18A 2VQEB 3ZV5A 3BMXA 4JUBA 1P72A 1K7FB 3VOBA 4JWKA 1JPUA 1UJ6A 3M99B 4TMKA 5EBMC 1SBZA 2OC9A 1PK8A 4MEJA 2NLJC 3TSZA 4YRPA 2Y4UA 1U8XX 1UL1X 1S3IA 2QAGB 3HPRA 2ZKIA 2JGFA 3KE9A 1GYPA 4B4OA 3DHEA 1U8EA 3S2IA 1G2IA 2PT5A 3BWXA 2OT5A 5CP8A 3Q11A 3RASA 4LDNA 3T35A 3BKWA 1X14A 2KS6A 1Y42X 5IWCA 3CZAA 4MJXA 3WMEA 4GVXA 3PPYA 4A10A 5A7FA 1B8VA 1L5FA 2RJOA 4DR3B 4JHXA 3SWWA 2O8CB 2YKGA 3GPIA 2K5UA 4ZK6A 3ZIAD 1G6UA 4QVIA 3O8OB 1KO5A 3NEAA 2Z83A 4YRFA 1F4VA 3MDSA 3GRYA 4JKOA 4CMGA 3D4NA 4NJOA 1N1MA 3H2IA 4UTXA 3GI1A 1SCJA 4C5CA 3THXB 5LJLA 1R4NA 1BWSA 2GPJA 3GX1A 2BI7A 3IP3A 1XAHA 1N2CB 3I0NA 2R1TB 4GX1A 1ZQ1A 1BVRA 1WHSA 3L49A 1OJLA 1JTEA 2NZWA 2CKDA 3O2SB 1XMSA 5E2BA 2ZYIA 3VC2A 2WYHA 3OAAG 1SCKA 4QHTA 4NBTA 3MS4A 2YOGA 5AHXA 1GAEO 3QOWA 2XRMA 1XE3A 1Y5LA 3MD0A 1NL3A 4QKQA 3AUKA 1BCRB 1B00A 4L9SA 4JI5O 5I3ZA 1U4OA 4I4LA 5AKIA 2AB0A 4MROA 1SUSA 2XQJA 2AK2A 2CNBA 2I2FA 4KIGA 3OJFA 3NIDB 5JJ5A 2XKJE 2VZ8A 3RK1A 3LXUX 2IYVA 1YJ9V 1OI3A 2XTJA 1OFVA 1CS0B 1SQVH 4CNQA 4CTMA 5F21A 1RHUA 4C3OB 4B75A 3ZJTA 2PYDA 4BUJA 3AGPA 5GGXA 5TMPA 2O7VA 1ZUNA 2M2IA 4D1YA 3ETEA 2W6JD 2YV1A 1UQUA 4HUTA 1DOZA 3DMDA 2Z2IA 1XXLA 4KSCA 3W2GA 2DWCA 1ZW1A 3OQ1A 2WA4A 1U2DC 3DE5X 2QS9A 1V43A 4N76A 1DFIA 1QIEA 4GOXA 2RQ6A 3DLBA 4M37A 4G4SO 3KDAA 4FLMA 4UVEA 1YS2X 4HDKB 3T4DA 4RD2A 5BWCA 2X19A 3Q8XB 2VHJA 4X3CA 2Q5ZA 3A3KA 4E70A 3PUXA 4GC9A 2NV2B 3U81A 4K3UA 4GM0A 5ALUA 2CSXA 5D8DA 4F2WA 2HCTA 1BDHA 2ZJ3A 1LWNA 5EZ6B 3JYHA 1R5OA 3S3TA 3V1UA 3CNHA 4WFGA 3EDOA 5G1PA 5KNCD 1L7PA 2W22A 5HMLA 4OKIA 1ZNQO 2V9CA 3JY6A 3IIJA 1WLEA 3CT6A 3SX4A 1KSHA 4ZO8A 2RCVA 4RY0A 3H04A 4MW1A 2GHRA 1N3BA 5EJIA 1H2BA 2Z56A 1FX0A 4BNXA 4MQEA 5E1AC 4O2LA 1E6KA 3FKSD 3FNGA 4MGHA 2ZYUX 5IMSA 3OTWA 1FB5A 5BN5A 2ITCC 1CEEA 4HUQB 5E7MA 3IOBA 4CF5A 2WP0A 2C61A 4GO1A 3L43A 1OV6A 2KE5A 4CCYA 4UBMA 3U3ZA 1EQ2A 4Q0MA 1FK8A 5JSYA 1ZH4A 3BH0A 5LQJA 3L6OO 5HTKA 2WWGA 4UDNA 2RH5A 1GSOA 4NX2A 1E3IA 2NLOA 5HZKA 1WSAA 5H6QA 3RTCA 4CTOA 5LCXA 3JX9A 2WJWA 4AJJA 5H6RA 3KPVA 3F5TA 2GJSA 5IANA 1KJYA 1L4MA 3CRMA 2WTXA 1RBQA 4MAMA 4WOBA 5ENZA 3KIPA 2YS8A 3IPXA 1VG9B 3RSCA 3UAVA 1Z4NA 1JVBA 1Q90D 4AC9A 1JSRA 2BCJQ 4IX1A 5DFAA 4HAYA 1TUIA 3PLRA 3AFNA 4QOFA 1SA0A 4O4HF 4YWJA 1JKXA 1H5UA 2RHTA 4XJTA 3W8EA 4B46A 3CCBA 4N6NA 3S2GA 5G41A 2WY2D 3N8HA 1EVYA 5JYDA 3OIYA 4X8HA 3ZV6A 4QWWA 2AOUA 3FAVA 3OMXA 1DAMA 4Z1MG 3DS8A 1ODCA 2MOKA 2A3NA 4S1TA 4CKBA 4QYIA 2PUWA 1T3TA 3NWBA 3TAUA 3T7TA 5DYWA 3RTEA 4D3DA 4ENQA 5F73A 2O6HA 2IKQA 3K8QA 5JMOA 4YJGA 4L8JA 2NNLD 4XWKA 1VHWA 3FWPA 4F46A 3BUSA 1VRCA 4TPKA 1DF4A 1R66A 1TXGA 5TGDA 4YBZA 3ZD9A 5B3JA 5JH7F 4NC9A 1LNQA 3D8NA 3L72H 2CLFB 2JIZG 4OSOA 1U2QA 2AG5A 4IZHA 1ZGJA 3F71A 1IZ3A 2W8BA 4MVSA 1ZXXA 3C39A 2ZR7A 4HDSA 3ZXSA 1AKYA 4QE3A 3DCYA 1KDTA 4MS2A 3GQBB 3FUUA 3AP2A 2E6UX 1Q1AA 3LPLA 2AG0A 2WM9B 3PS9A 2XZDA 2IWRA 2QRJA 1E6UA 1B2RA 5GZ1A 2VZEA 4AUMA 1VFPA 3G2JA 2ZREA 1M1NB 5GTHZ 2PEYA 4M9SA 2M6SA 4KMRA 3K0FB 1IQRA 2IVZA 3SPJA 4ZIBA 1YZBA 2QY6A 1C80A 1AB5A 3L0YA 3WGMA 1JA0A 2AL7A 2W00A 2P3LA 2I2BA 4XQGA 3BH6A 4L3VA 3DBLB 4MR9B 1SAYA 5CW1A 3L4EA 2GN6A 4JSYA 3HY3A 1JG1A 1SOMA 5G4LA 4DFDA 1GZ4A 2BGJA 3P5SA 1AJQA 2FPSA 3L46A 1OX5A 4F8YA 1Q1BA 4JQCA 5EERA 1WY7A 4IV5A 3SQNA 2JHAA 4BOYA 4FZ0A 1IXBA 4I5IA 1VJRA 1IMOA 1U28A 1GTJ1 4EB8A 1H69A 3P9ZA 4GZMA 1OROA 2HWXA 3MCZA 1KK2A 5HFAA 2FW8A 2F4NA 3GRZA 2WFZA 4GYWA 5DSXA 2EFCB 4WLVA 4BMXA 4N9QA 5DRTA 1II0A 3KO8A 4CT5A 1NVBA 1LDEA 1XALA 3LCJA 1F5SA 4MVYA 4HEA6 4R0MA 2YVLA 5KUMA 3UZUA 2Q9BA 2D2CB 3FFWA 5JJIA 4WUVA 3TG8A 4O5AA 1P0IA 2WR8A 4XUGB 4WXMA 3GGGA 1U6KA 4PR3A 4OCZA 3OLCX 3OJLA 4Z4IA 4LTDA 5IUNC 5FL7G 3GPBA 5JXIA 1YRQA 1P1BA 4GWLA 3S2FA 3X1KA 2ZXFA 1RAIA 1Y8AA 1E92A 3QE4A 4OA5A 3QTCA 1LWOA 4PAQA 4HT3B 2PGGA 4P7BA 2Q6KA 2QJOA 4D81A 4Z4EA 5NLLA 3BAAA 3HN6A 2GHIA 2F4VB 2DULA 3P9KA 1YCFA 2ZJ2A 2K6GA 1ADGA 5BUCA 3GD5A 1C8LA 1HQKA 1XYYA 3EXEB 2AEJA 1JXOA 2PWAA 1NI8A 5ICMA 4NE7A 1D4AA 4LMBA 4K3AA 3PUZA 4QZVA 1XDUA 2HWYA 5BNTA 1IUPA 3WFJA 1EB9A 3N9IA 4OLFA 1SUAA 4UXNA 4Q1AA 4DAEA 4RVSA 4V0RA 2DW4A 1LBSA 1EDEA 1N5OX 3FW1A 5G0TA 3DDOA 4O4JA 5ITVA 4BLQA 3AP1A 3IVRA 4XASA 4IT5A 2VHCA 4JTDB 2J31A 3FROA 4PNZA 3OE5A 1PWEA 3UKJA 4NCHA 3JQBA 2E4ZA 3R3ZA 3OE1A 3A2LA 1WXQA 2Q6VA 2JG3A 3WKCA 1P1CA 2FEWB 2UUAO 4JI7O 3DWEX 1LFDB 2V6JA 2HRDA 2P4QA 2VDKB 2PKRA 4F12A 1Q81W 4TQDA 4B09A 3ZE0B 2HEPA 2J85A 1O9HA 4PA7A 4HWKA 5KIAA 1UXOA 1WW2A 4FDAA 4M7RA 3FYSA 4G4GA 4NQRA 2VJDA 3QPBA 4EO7A 3ZDBA 3PZRA 1QG6A 1NWCA 2OHFA 4NG5A 1UEIA 2IOYA 3ZX6A 4CL2A 4KWEA 1SVOA 5IVPA 2ZJOA 1VPWA 3WVNA 1BGVA 3N3AC 5H5JA 3CCEV 4FK5C 3CE6A 2LV8A 5JD4A 1X9HA 1ENZA 3HEAA 1NPTO 4B43A 2ETXA 4DQDA 1XEQA 4EJ0A 4JLOA 4Q7MB 3WLSA 3PR1A 5AKYA 3W77A 3QBDA 1PK7A 3D3NA 5TQ2A 3ITKA 2G63A 4W7IA 1YI0A 3S7ZA 3H1AA 1G4AE 1K6EA 1PX2A 3PUWA 4O02B 4P30A 1RSOA 1EUZA 3EVNA 5AW2A 1N7IA 2Q2VA 3H6HA 1L4NA 4DQXA 4MP8A 2ZT9B 4NTZA 5IASA 2PH5A 3MQ4A 3EJWA 4FLYA 2EAUA 1BDMA 3C85A 5DXFA 3U4DA 4ZU3A 3SEFA 2IYTA 4DM3A 4AMUA 5D5QA 3R9XB 4PS1A 4NMMA 4ZHSA 4OKSA 2REBA 3MHSC 5A4JA 2QWNB 2X8AA 4MI9A 5HUQA 4QQFA 4MWSA 1ZAYA 3QO8A 3CG0A 2Q6TA 5EWLB 2P6RA 4BMNA 4R05A 4BO5A 2BFCA 2R47A 1EG2A 1KYTA 3COVA 1U3CA 4ENVA 4M9UA 4UNRA 4ER5A 2DY0A 4C08A 2F3TA 4OB8A 1E9EA 2G4LA 4UMDA 3IC7A 5AHOA 3GHYA 2Z2JA 4GE3A 1V26A 2C4UA 1E7YA 3OFVA 1YUMA 3B6KA 4QULA 5DSTA 4EJMA 2QM7A 1UBEA 1E2JA 2CNDA 1O96A 1S1MA 3K57A 2WSMA 1DTOA 3OMNB 3DXRB 4DV3B 2P2NA 3PENA 3UFXB 1LDMA 1L5NA 2ZXWB 1WXWA 3TJTA 3I30X 4EYGA 4R8CA 5KKNB 1F60A 2BE3A 3IAUA 4CIVA 4FMDF 4TLLB 2B8TA 2X9VA 2X7RB 1FUEA 2PRKA 3H2JA 4O0LA 1OYOA 1CP9A 2XCSB 1ZCAA 1KZ6A 2GK6A 1UAGA 4OQEA 5L9AA 1A2QA 4HYEA 2RKWA 3HU3A 4GYYA 3ISJA 2RONA 1EAYA 4K2AA 4BKOA 4EI7A 4WH0A 3KNZA 3U31A 3ZJ4A 4LF4O 2E4WA 4U7WA 2QN1A 3CKMA 3FTCA 1V6AA 1UFOA 3ABIA 2R1UA 5LDHA 2G0TA 4OXSA 4GW3A 3W0LB 5AM2A 2B5OA 2QTLA 2C99A 2A1TR 4KXMA 1TW3A 2QXTA 1FFHA 3OM3B 5ANRB 3VVMA 2F1MA 2V3CC 4WZAB 1UC9A 3P9RA 3CVVA 4L4XA 4KH0A 4PO9A 3O47A 2GETA 4P33A 3S3XA 3ZCQA 1KYXA 4OBEA 2CB9A 1UBMS 1E0SA 2WQ6A 1I3MA 1YB2A 1U9JA 5G3ZA 2M9MA 4KO2S 1Z39A 1FLVA 3L5KA 4IDEA 3FFQA 1F2TA 2ZWAA 4MWGA 4R2HA 1W93A 4WFAV 3NX4A 3NBXX 4H3KB 2YEVB 3OM9A 4CEIA 2RAPA 5G4KA 3FFXA 4IQ8A 2ZAMA 4FCVA 4D4JA 3B6JA 1PR1A 1G1AA 5SV2A 2E7ZA 3TBKA 1YR9A 2O3QA 1J49A 4K1LA 1W0KD 2QB5A 1DRUA 1HA3A 2GESA 4GPIB 1NBEA 3FI9A 1LLCA 1ODKA 3ZR4B 1ECJA 3I9JA 1G17A 3HBJA 1LSOA 3ER6A 2XMZA 1G7TA 4AK9A 4M98A 3STZC 2NSDA 1DP4A 4TLEA 4RPCA 3NKFA 5T8KA 1V41E 2PUTA 3AG2C 3ENNA 3FJYA 4YO8A 3Q9SA 5J2TB 3RH0A 1W581 2FSVA 4G1MB 4Q12A 4WESA 3N3BC 2Q46A 1USGA 4H15A 1WXEA 4M1KA 4I1RA 4U2FA 2BTEA 3LUGA 4Q1CA 2AX3A 3OESA 3FNQA 4D02A 1A72A 1KHTA 3QPUA 5CB0A 1YJWV 4JIMA 2YDYA 1MHTA 2ZYWX 4KOAA 5JI2E 4LBYA 2QMUA 1HQYE 2IPAB 4R8LA 1UJ2A 5AM0A 1V4NA 1ZVKA 4D6PA 5BVHB 3ZRSA 4CEHB 2J0UB 4XLLA 3D0OA 4D9IA 2FP4B 1KYVA 2FA9A 2OWOA 4R7TA 4MS4A 1O89A 2CXTA 4YJ3F 3OZVA 4EDFA 1X7XA 2WM8A 5LBUA 1HTWA 2YINC 1R9GA 2IUYA 3M2TA 5K3AA 5EC2C 1TM1E 4RS4A 1SKQA 2XDWA 1I3OA 2X40A 1RYYA 1UBRS 5EHZA 5CEFA 3FIUA 1RVV1 2C2KA 2A06H 4PX2A 1M2HA 3CU5A 3CP1A 4K0KB 2Z58A 4C7JA 2XAHA 2NXEA 4HTAA 4RDHA 3UH0A 1NNI1 2DLCX 3IHLA 3OTIA 1XMPA 2VPIA 3M34A 1W5SA 1XA0A 3RWRD 3FGOA 3KSDO 1CE8A 2NVUB 1BQZA 1ZJYA 3KHKA 4B0OA 2VN8A 4XJVA 1QU2A 4HYOA 5BSGA 2XNJA 2BEKA 4ILEA 4WHMA 3V1YA 1G2OA 2PTHA 3OX2A 4PDMA 3MUOA 4ETWA 4YUYA 2B7LA 3PDIB 2DY1A 1U2GA 1GDTA 5K0BA 1TZJA 3B3JA 4CF7A 5IXYA 4KQGA 4I5SA 1IDOA 3KZ1E 5H9WA 1N2OA 2FFJA 3AL2A 1O9BA 4ALKA 3AKDA 3OTGA 5BRAA 2WJ4A 2D0IA 4IIJB 1IZ7A 4PLZA 4NYMR 1KI2A 4QOEA 1UQTA 1KMMA 2CVHA 3IPLA 4ZAXA 2VLIA 2BBWA 3V4VB 4JVSB 2EKLA 3T3EA 1VRVA 4OAPA 1HZZC 4B2YA 2OFWA 3GLVA 3C1UA 6AT1A 3I92A 1E94E 3FCUB 1HNXO 3TMYA 4LFCO 4DJ5X 3OMAB 2IJKA 1L7VC 3H4TA 2YXDA 4MVJM 3BBLA 1C50A 4ZI3A 5CVTA 4R71A 3KBBA 4FE4A 1NU1H 1E1MA 1EK1A 1M8PA 1TUBB 3IUEA 1EK5A 1NP6A 1WUYA 1K27A 1OBVA 5FADA 5L7YA 3FGPA 1CNFA 1MIHA 1IOZA 1E6CA 3VR5H 2XOKA 4B6FA 2W6ZA 2WSBA 5LB2A 3ZRXA 3OTHA 3LNNA 4XGKA 4LZJA 3OKAA 4BKUA 1SESA 3GEEA 1UBUS 1II8B 4MPRA 4KL1A 2PBRA 1ZD3A 5H4GA 1YL5A 1XZMA 1SXJB 2BMWA 5CXQA 2WLMA 1I7FA 3BT7A 3L9DA 3NAMA 1CRZA 4IGGA 4G1FA 1T25A 1OCRB 2E5WA 1MJGM 3KD2A 4RVNA 4Y2VA 3RSHA 3GLGE 1RW4A 5FPPA 3NGMA 3PGXA 3HSSA 4XVCA 5CVDA 3GRRA 4RNDB 1S01A 4OXXA 5A2QA 3LKVA 2NU9A 5JBQA 3CF4G 2BY4A 2RARA 1M74A 3SHQA 3P71T 2W6IG 2VP5A 3ZW8A 4ICIA 3GJ7A 2CXPA 3T3IA 5LU9A 1S8FA 1GIAA 3QLJA 1X4TA 4NATA 3G2HA 3D7LA 3QE9Y 1R7RA 1IDN1 1MABB 1LBEA 3NOQA 3OPYA 2CZCA 1E6LA 3WL8A 4UM9D 1V11A 1A71A 2MSKA 2BW0A 1PN3A 3R3XA 4TSRA 3PQ8A 1W0JA 4J0DA 1JHZA 3C15C 4OB6A 5I48A 3KTAB 3LY5A 4HCJA 1YDXA 4CBVA 1F20A 1DB3A 4UPEA 5EHXA 4IGIA 4FLTA 3RU3A 3T7EA 3IAHA 1RWQA 3AM3A 3SKVA 5G0SA 2L2QA 3H1FA 3HZRA 5DCUA 5EJ6A 2B4AA 2CFTA 3PLAE 4RK5A 4D8UA 5JHHB 3WGZA 2RG7A 2NYAA 4BBJA 3VNUA 4YRLA 3RRXA 1JVMA 1NUHA 3UQ8A 3DJFA 1P18A 3TGWA 1P7BA 4K26A 4G0PA 5CRIA 2WAAA 3K8OE 5F4BA 2L18A 2PV0A 2NTJA 3OY2A 3VR6D 2OCDA 4JZ2A 4FDMA 4V39A 1SEVA 2HJVA 1MW9X 3GRUA 4M8IA 2LCIA 2WV7A 3QQPA 3GZ4A 1B43A 1MAHA 3AW8A 1SUDA 1SKVA 2QZ9A 1YJCA 1QCEA 4I9GA 4B3SB 1VJ1A 3I5YA 3D6AA 3EXHC 3CVUA 5DOZA 1E20A 4C04A 5IT9A 2BFWA 4G63A 5CG1A 1XTIA 1VIMA 2BFPA 5F9MA 4BLUA 5IZ4A 3QV1A 1VG0B 1TMYA 5FOQA 3L4BC 2OZPA 1WV0A 2BM9A 2QZ4A 3LCMA 2RGGA 5HTOA 1I0IA 4D0SA 1NBMA 1BAPA 4NMWA 1PSDA 4CR6A 1ZIXA 2L42A 1C1DB 4UEWA 1Y6RA 5AIBA 2CHEA 4I4TB 4E7PA 2RHMA 1S4MA 4TKMA 1R3IC 3WFVA 4EKYA 3BPSA 4QSMA 3WA6A 1PEDA 4DLNA 1VMIA 3T52A 3TVTA 2QN3A 2B78A 3HJRA 4YDSA 5E1DA 4ZOQI 4O4HA 4GLBA 5AW1A 5KX5F 1XKLA 2Q0AA 3KHTA 1WVGA 1V47A 3DTTA 2P79A 2BFEA 3ZMUA 1P33A 4KKVA 4JENA 4RM2A 2V1DA 1D8AA 4AYWA 2H2FA 1TK3A 4L5IA 5JQGF 1RHMA 3UWSA 4URZR 2R96A 2CK3A 2NXWA 4WXEA 2CFRA 1VPEA 1GLNA 4A15A 3HB3B 1BD4A 3DT9A 5ALZA 2EP5A 3N8NA 3HQ4O 5SZHB 1QHGA 1KH1A 3P2OA 1XFDA 3AW9A 1CCWA 1G20A 2EV9A 2PMEA 1WPRA 3ABKB 3P52A 1V1RA 4MCIA 3W2IA 3Q7EA 3FAKA 3SPXA 3H1TA 3ZVLA 1IU9A 2EGUA 5CJ2A 4N5DA 4GWGA 4TTVA 5JH7A 4EO9A 3IKMB 2QX4A 3L1KA 4BN0A 2XQVA 5CLIA 5U4XA 2E48A 3CLSD 2VTEA 4FM1A 4A1OA 3BMCA 2WW8A 3ZY3A 3L1UA 3ROMA 3H0CA 2HRQA 4UW9A 5IFLA 1KVQA 3CJHB 3QTLA 5GM1A 1TA8A 3TX2A 3QMWA 1I6MA 5JMPA 2ZXUA 4WV3A 5I47A 2P5YA 1HL3A 2H1FA 3IS3A 3FX2A 3ZNQA 4HPWA 1Z25A 4OSEA 3MTBA 4YP7A 1KVTA 3QXJA 3S1SA 2EIJB 1Z4PX 3ONVA 4JVMA 1NTKH 2BEUB 1RHKA 2AZ2A 4B6SA 4ND3A 4FYWA 3APOA 3MTIA 4Y3UA 2OQ2A 1D2RA 5CU7A 4XQEA 4B3TO 1KAOA 2VPYA 3OQHA 1ZA2A 5AI6A 4CMIA 1R16A 1E2NA 2Q3FA 1NA5A 2H4FA 5E8RA 1WY5A 2VJKA 3OPQA 3ND6A 5KREA 2MSNA 4MVJG 1T3GA 4M88A 2ONYA 2P69A 4E2LA 3TCNA 4MRMB 3W1EA 1KP3A 3PXBA 3B2EA 2FFBA 5CCEA 4H7DA 1MB2A 4PSUA 1NXVA 4J11A 3CX8A 4H7PA 4POOA 1I7LA 2Q6LA 3V8EA 5KTRA 3K9WA 1H0KA 2WZDA 2CSUA 3UA3A 1GTG1 3WIEA 1VF5B 3TXAA 4LRWA 4LFAB 1WZEA 1RAHA 2HMTA 4U4AA 2Z6QA 3OU6A 2AFIA 2H5JA 5FXMA 3FTEA 1J2TA 1CVRA 3S2UA 3TZCA 3W6NA 2CY0A 5C4IA 1UMCB 4EDHA 1V1JA 3K73O 3LBAA 3CWBH 1L8AA 3CSUA 3M89A 3G9TA 4LJ7A 2X86A 2PF4E 2ES4A 2JS7A 4B3RO 1M56C 2H5LA 1DAKA 4ZCSA 3S6JA 4G1VA 3HACA 3CT4A 4GH5A 4CH4A 5AVRA 2RHRA 3P9CA 3FWNA 4HQRA 2JGNA 3D6JA 4D3SA 4ZN6A 1YQUA 2PD3A 1FJGB 1LI4A 3JQPA 2JA1A 2DOSA 3L1VA 1VQLV 3THYB 1KOLA 3FTQA 1NLFA 2C8LA 3KVOA 4I8DA 3M9WA 1U2RA 2DEUA 3BULA 4X41A 3JARB 1RJEA 1GFZA 4JLPA 4LGVA 4JODA 1H94A 1NTMH 3OIVA 5JY6A 3LLMA 5PNTA 3EXG2 3GCZA 3AF3A 3CWCA 2HYDA 1KK3A 4EI8A 5DEIA 2HSZA 3PDCA 2BR3A 2TMKA 5JDIA 4MR8B 4CW7A 1XJCA 1W35A 5BQOA 1IEWA 2UVPB 3DMRA 5DMHA 4ACAA 1I2CA 1HDEA 1QLHA 2B21A 3S8MA 1ICEA 1G5QA 4PIMA 1DG9A 4U6SA 1FAFA 2H57A 2FN8A 2XWJI 5GVSA 4RF4A 1EAMA 3D02A 3RK4A 4ITVA 2BFFA 2VYQA 2X0RA 1ZNWA 3R3JA 4DCOA 4UBOA 4AZ0B 3A26A 4MS1A 2PJDA 4A8JA 4OBWA 5KWVA 2Y2VA 2QU8A 1R37A 4G5FA 3AF0A 3VKHA 1YACA 1I33A 4A6XA 2ZB3A 4JR0A 3PUHA 3MTEA 1O7JA 1ZD8A 2IDJA 2N42A 1JEQA 2O20A 3PKJA 4FMCB 3FZNA 2Z30A 2I22A 1AVMA 2V0CA 2PUFA 3IMFA 3ISVA 3OQIA 4IGKA 2IPOA 4HLUC 1PQ4A 4D9FA 1WBJB 3W6UA 1D0SA 4FUTA 5AI5A 2W48A 1BKYA 3BL5A 2PRJA 1NXXA 4Q21A 2DKFA 2PUVA 3RGGA 4HRAA 1LR1A 3CC4V 2XECA 1I1QB 1XSEA 3TZHA 2QYOA 4BLTA 3MUNA 4MQ6A 3G0CA 1CR0A 1HNZB 3ZJVA 4A5SA 2P4EA 3CUEF 4N49A 3DWFA 5CA1B 1C1YA 1N8SA 3C3TA 2XE8A 1SM4A 3OPYI 4YAKA 4UFPA 2TS1A 2BGWA 5AW7A 1TQDA 3IXLA 1QK5A 3NB0A 3JAMA 4MTLA 4RA9A 4DMCA 1UZAA 2BE9A 2APJA 2DKNA 1Z2NX 1KUQA 3TTSA 4ENWA 2JS3A 3CFYA 2CBGA 4LV5B 2BJWA 2FGKA 5CDFA 1W85B 2R5WA 3VH1A 4CHTA 3CR7A 1Y98A 4KL8S 3IVGA 3OH8A 2YXNA 1FL9A 3TRFA 4M53A 3OD4A 3SY8A 3PR3A 2P30A 2YNMD 1O08A 3L92A 4D2IA 2NZYA 4FVMA 2RHDA 3OCZA 1B0UA 2ZI6A 4H1WA 3O7WA 1MPXA 3B70A 1N1DA 3DOHA 3FSGA 3LW7A 4LSGA 2HK8A 1C81A 3BF8A 4CMEC 5GPBA 1NFQA 4QPCA 1N2ZA 4X20A 3HVUA 1N2CE 3F6EX 2QRZA 3B1XA 4R5HA 5CBGA 3JAWA 1DMRA 1LC3A 3FPSA 2J3QA 4DA9A 1UBKS 3EIOA 5KTPA 3L7DA 3W5BA 4ND4A 4LSMA 1BE3H 4YNBA 2B61A 2DMRA 2ZRQA 4DSZA 3NWOA 4IDFA 3SF8A 1RQLA 4PLWA 4UTPA 5A7HA 1FFAA 3RG2A 3SYRA 1JLSA 1X92A 4JU9A 2QWRB 5DWDA 4L3WA 1S3JA 1F38A 3A9TA 3SHFA 2H9AA 2YSUB 3F9IA 1TVKB 1CK4A 3USZA 3IESA 1BMFG 1RD4A 1RHJA 3AG4B 4A6PA 1AUXA 3T94A 5JD3A 3QOXA 3ZZTA 1HURA 4BLVA 2DC1A 3FPHA 3I9V6 4Q9KA 3F5DA 2WUGA 1XDDA 2WF9A 3TIFA 2OXIA 5FLXN 3W3AD 4XEHA 3ZU3A 3H6GA 2EBUA 4HUJA 1NJIW 1RI2A 3LT5A 2ET6A 2O2CA 2HSJA 4BRWA 2DVMA 1YJ5A 1EGAA 3ZWXA 2N9UA 4X6XA 1QIJA 3M49A 1LJUA 8OHMA 1U3TA 2PX5A 5H82A 1GZUA 2VSOA 1Q3TA 4R2XA 3BM5A 1A9QA 4P3OA 4NNJA 2W5UA 1C4OA 1PFKA 2L82A 4C2BA 2BGLA 3X1MA 3A1NA 1L2TA 3P0JA 4IO0A 2CV1A 4LC1A 3RR2A 1JA1A 4TGLA 5GZ6A 1RXIA 3R20A 1AE1A 3KQWA 2IHZA 4KO1S 1ID8A 3REQB 1P2FA 4J9VA 3DZKA 3C14C 2J6CA 4GPEA 4IMPA 5FUXA 3ORYA 3LC0A 1I7QB 1Y7TA 1JLKA 4FR0A 2EINB 4HB0A 2BGMA 4QOIA 5SZIA 1XD2B 4LBWA 1G19A 3G5TA 3ZY5A 3F1KA 3OQBA 4UDXX 2HJWA 3RTDA 2GRAA 2BH9A 2V74B 3HCCA 3V1MA 2D4HA 3D59A 1HT0A 2ID9A 4OJMX 3T1OA 1TJ5A 2QUHA 1UANA 3TECE 4AXBA 2Q1TA 3A28A 3KJZA 2CJYA 2FPGA 1AI5A 1O58A 4YP9A 3I1YA 3ANYB 3I01M 4JAUA 2YIMA 3CMAV 2FTKA 1K5DA 4FI3F 3ZN0A 1FFWA 3SR0A 4AI8A 1E2PA 4EG3A 4G0UA 3TOXA 2LP4Y 1R12A 3DTVB 5ULLA 1DF5A 5A4MS 1JJFA 2E3JA 1DBIA 3G5LA 3E82A 2G5TA 3CLSC 3A9CA 3LG2A 1OTYA 5JSZB 5IEJA 3JYQA 4CMJA 5L4SA 4JAVC 1VDZA 1DQRA 2BGRA 3DZ8A 2C03A 1FMFA 1HT3A 1JBQA 2OESA 3PWTA 4CL8A 2Z5GA 1B3RA 5EIWA 2OZVA 3EASA 1E77A 2NG1A 1A4XA 1SD5A 3VHLB 5HZGA 2ZJ1A 2C3MA 1T9DA 4YJ3A 2OUKA 4EB6A 3IDAA 2BOCC 2W0MA 3KCYA 5AK0A 2J5QA 2IY8A 3FHTA 5BSHA 4U7HA 1G0OA 5IBRA 1IQUA 3V2HA 1OGIA 1T3HA 4HFMA 2GKGA 4BB6A 1HGXA 3STTA 4CKEA 1YGPA 1O5OA 4OOFA 1SXIA 1WHTA 1CP2A 4HZGA 4R1LA 5CFOA 2IEIA 4QTTB 2B9ZA 3O1JC 3BXOA 1Y3AA 1E2MA 1KBQA 1M34B 1Q83A 2GF9A 3VKVA 3GLFB 4PFQA 2WMDA 2GEJA 1RT9A 3WJ2A 2V8BA 1GARA 2Q5HA 4OYLA 1KQGA 4IDDA 4MW0A 3ESBA 4GQIA 4Z9AA 2J9XB 1OLUB 1RM0A 1NC3A 4EHJA 2WAMA 1MZPA 2ITDC 2WE7A 3ZHQA 4OXYA 1EFUA 2FW1A 5GONF 4DLKA 3HPLC 3FNEA 1LDGA 2YUTA 4E2WA 4KTVE 1X94A 2WB2A 1L7DA 5IH7A 3AR6A 3B8HA 1FP6A 2EHJA 2ECPA 4OQDA 2OBYA 5L3DA 3Q1KA 5B2ZA 2DT5A 5CEEA 2E0IA 3VHXA 4FINA 1SKBA 3H75A 1VXOA 4H37A 4TT3G 1IBKO 3FY4A 1GKYA 5JNVA 1B1CA 4GI1A 1GYQA 1O95C 1QORA 4ZQFA 4YUWA 1CUBA 4MKGA 3ZTTA 1XELA 2VZLA 1OXBB 4AJKA 1EK6A 4FOTA 1ULUA 2FK8A 3CXHF 1BS3A 1GO2A 3E3MA 5KYKA 3MCUA 4YJFB 2AJDA 3VZSA 2H8PC 2E4AA 1RC1A 3FLEA 4MV4A 1COWD 5E3HA 3B1VA 2WINI 1OPRA 2BL4A 3DC7A 3HKEA 3QVMA 1MZEA 5DHQA 1QHHA 3ZC3A 1ZUD1 4F9FA 2IH5A 3A6DA 5EXSA 3VH4A 2XXBA 2Q1YA 3U39A 3FSJX 1GGKA 2YZNA 3B60A 4D3XA 3H3XA 4OX9B 2VK4A 4MV0A 2GCGA 1J00A 1THGA 3T3NA 2NUBA 1YWGO 3OURA 4H4DA 1WCWA 2I2DA 5HK8A 4QDZA 5BXZA 5C8DA 2OAEA 4TXNA 4ZO9A 4ZEXA 1XL6A 3CGGA 1NVKA 1ZD4A 1AJNA 5CAEB 4WKBA 1EDOA 1T0HB 1ZIPA 3ZBUA 1WTAA 1RACA 2BEJA 4N3GA 3VKFA 5CBPA 2B4RO 2ONZA 1FCJA 1X7GA 4LF9B 2C58A 5HFJA 2CJFA 4RM3A 3OOWA 4R0VA 1JQJC 2WJVA 5DTJA 3DNMA 1I1HA 1QAMA 3NEYA 2O8DA 4BEVA 1USVA 4L28A 4MVJP 3SP1A 4NV1A 2OYRA 4LXHA 2VJYA 3T5PA 1OCZB 1GL6A 2FPPA 1U5BB 3WBKA 4IOLA 2OCPA 4RDXA 4JELA 4WERA 3KV3O 4UTZA 5IJZA 3SNKA 1P4RA 2YOHA 2DR0A 4ZVUA 4YYZA 1UC4B 1G42A 2Q4EA 5GIPE 1X8JA 3QW2A 1TA9A 5CXSA 1N5MA 3UCXA 3LNCA 2DQYA 2QTRA 3FCCA 3AHJA 3IT1A 3KELA 4KFCA 1T35A 5JCJA 4QNNA 3UJPA 4I4IA 1XR3A 1FYEA 1IVSA 4FGSA 3PI6A 1AQJA 1TUEA 5GJWC 5FEUA 4QBFA 3I58A 5DTMA 1VZ2A 2RAFA 4F86A 3P2MA 3NTVA 2OO3A 1YZFA 4W5QA 2YV5A 1P9LA 2ZD9A 1BOFA 1S9DA 3K9HA 3OCYA 4WFBV 4UEKA 2ZIUB 4UB8Z 1UXGA 1UPUA 1WZ2A 4ZRNA 1QMPA 2NUPA 1WQ1R 1PFYA 5I9MA 4GPBA 2J4DA 4B3HA 2OKCA 1BS9A 4YUAA 1VCNA 4QVGA 3G8AA 3CJRA 1PSWA 2W4MA 4EY6A 5KSWB 4PBSA 4YO7A 2YNMC 1P2DA 2V1XA 1SG0A 1GRNA 4DK0A 3TKAA 1MUUA 2J6IA 3WL5A 2BGIA 3UENA 3HLKA 1AQ6A 3IT0A 1KRHA 1J9EA 4QFMA 2WOOA 5DZSA 1PFUA 3B7GA 3G2MA 4YV1A 3WRWA 5FOWA 1XDSA 3K0EA 2PWZA 4ZODA 2PY5A 3GRFA 3AEYA 3MD9A 3C3XA 3TTVA 4QYXA 1N6RA 3EULA 5HE8A 3NHKA 3VHRA 1PL6A 1DWQA 1PDVA 1WTCA 3EDYA 1LSSA 2OV8A 2IKSA 3R0IA 5KVVA 3U60B 1Y74B 3HO1A 4OHPA 4D9EA 3BL8A 3FSRA 1U1CA 4G09A 3OUZA 1XBTA 4RJLA 4LHEA 2XMCA 5FT9A 1J22A 3RC1A 1W1IA 3MMSA 3L6UA 1K97A 3VR3A 5FUQA 3LAWA 5KX5A 3ONEA 3HJUA 4M1YA 4YBRA 1UJBA 2HPVA 1NMEA 2VCHA 4KW7A 2YYSA 2YIBA 5JQGA 2OP0A 5FJJA 1YCIA 2NTEA 2PZKA 2W4IA 1DO2A 3GU3A 3PFBA 3JR7A 3B40A 1BL8A 4B3DA 1OSNA 5MHTA 2I6TA 1FOEB 1FE8A 5H83A 3ZWBA 4X97A 3NDPA 1YQQA 4WVLA 2Y4NA 1HX7A 2Y2UA 1TEVA 4AY4A 3A70A 3ZVMA 2PJRA 4UCUA 3D3WA 4YAFA 4NBLA 3TLAA 1YL7A 3EPRA 3JSXA 2EF0A 3GLIB 2D3TA 4BP3A 4CS3A 2GJ9A 2WG2A 4L85A 2WFLB 1XG5A 4LDZA 1UXKA 3FCOA 3DMYA 3OD1A 4LDPA 1GU1A 5DPMA 5KHJA 1TD1A 4LUCA 3V4LA 2QD4A 3AXTA 2A14A 3Q5GA 4A0SA 2Z6UA 2FUKA 5D7BA 3A11A 3VZBA 3AR8A 4JP5A 2O07A 1GSAA 2XUZA 3QGMA 3RT9A 3EPJA 4JI2O 4BO3A 3GELA 4H7HA 1ORHA 2GYUA 5CLHA 2VJCA 1YHYA 2XA1A 4X61A 2WBLC 3O84A 2ARKA 2XAFA 4BEBA 1BQ3A 3VZPA 2HVJC 3CZ5A 1M6HA 2VSQA 1AD2A 1KMQA 3F4LA 4BY9E 3AILA 1Z36A 3Q2IA 3MWEA 4OHMA 3SJCC 4EQ6B 1VZ3A 3PL5A 2WRZA 5KPJA 3OZAA 2DQ4A 1YGYA 2E49A 1W36B 1ENOA 3LLUA 5LGTA 4LBVA 3ZMVA 2ACKA 3VTKA 3A4LA 4F71A 4KQ1A 2EVWX 5COQA 1QV9A 2WF7A 3EBOA 1WMAA 3GNLA 3OJWA 4YMSA 3F98A 4GZ6A 4N0DA 2QAJA 2CWDA 4X6YA 1DVRA 3GZJA 3UK7A 5HZMA 2H1OA 4DV0B 3I05A 4Y8VA 5HIKA 2DPGA 2XIJA 1FNCA 5DOVA 4FMBB 3U44A 4MK4A 3AKYA 5D84A 3E1GA 2JIBA 3QUBA 1UFVA 421PA 4INOA 2WU0A 1JLLA 1P4AA 1PBTA 4JQOA 1W6UA 1MFZA 4GL2A 1EWRA 4WZAE 1SC6A 4ZA2A 2DERA 2J08A 4DJAA 1WAZA 1Y4DE 5TPZD 2BOVA 1YI8A 1Z15A 4AJ9A 5B6JA 4JNKA 1MCZA 4IKOA 3APQA 1XL0A 3QLVC 3P2JA 1FMTA 4YJ2B 2CLOB 4OQQA 4MDHA 5BN3B 2C82A 1GZ7A 4MUGA 4Z9FA 3RYIB 5CB6A 5T4HA 1UBCA 2CFSA 1IBMB 4Q4AA 2V7QD 1I1OA 3E8GA 1M5IA 1KO7A 1PTKA 4N65A 1ZLZA 2ZRIA 3U3OA 3P0RA 1V9PA 4ZJYA 1CT9A 2IZ1A 4MUMA 4ZYYA 2WJYA 1IWPB 4JBLA 4Q7QA 2Q3EA 4BBPA 2BH2A 3HEMA 2PX8A 5FRDA 1P2BA 2HO4A 2V4ZA 1JKJB 2EFJA 4V0ME 1IAQA 4TUYA 4JH0A 2I3DA 8ABPA 3DGEC 3RAGA 1MB9A 3ZI0A 4REOA 3ZHYA 4Q16A 4EUFA 4Q4JA 4PZZA 3K09C 4BYGA 1TVEA 2O0HA 4PAOA 3QSYA 1QHXA 1DPGA 4MW8A 4WL0A 4TTPA 4DEXA 3I83A 2A7XA 3PX2A 5KNLA 1EVQA 2SICE 1Z0IA 3BSWA 4DCPA 2GXUA 4PZDA 1PR9A 4IJVA 1N4DA 1WV1A 4CDGA 3KXDA 2OORA 1JFRA 3IJEB 2PGNA 2X0IA 3JZIA 4DKXA 3KYDB 3ZE9A 7YASA 4UVGA 3FNBA 1P9WA 3KQHA 1T2VA 3BEOA 4V02A 1Z5WA 1UR5A 2FMFA 1FRQA 2C2XA 2KBEA 1UPFA 3CB4A 2D6FA 4ER7A 3V33A 3SJUA 4IJ6A 4RLSA 3L7JA 3Q3EA 1NJFA 4HD8A 4EATA 2BVNA 3P94A 4RADA 3DL0A 4ARVA 1SBQA 1FNDA 1NYRA 1WZIA 2AC4A 1UKCA 2BGUA 4AX4A 2H7YA 4KXLA 3RLFA 4HN4B 1H6DA 3OD5A 4LR3A 2ZDGA 1N0IA 3QO5A 4RGVA 3BXPA 4UMFA 4DDUA 2AW9A 1UT5A 1P44A 1ZEJA 4DEVA 2HADA 3MTQA 1D5AA 1FQOA 3HXQA 1YFZA 1HH4A 4XPZA 4PC1A 1RVDA 2VDLB 5BMVF 1CDZA 3BJEA 5CIWA 3IQWA 4MS3A 3A1DA 4PFSA 4GX2A 5AVYA 2OV4A 4DR7B 4PZUA 3FX7A 4XPIA 5AKZA 4I1PA 4W5TA 4AKHA 2FE1A 2BEVA 1RC0A 4EJSB 2IF2A 2CJXA 4PBTA 5AJVB 2V7XA 2D2IA 2UAGA 4KIWA 3R40A 5ALIA 4XDJA 3TNDA 2A79B 4X65B 1I3LA 1KQPA 5T57A 2VBFA 5EPOA 2YQZA 3KEGA 3TIGA 4JJ4A 1CJMA 1M0SA 1S2OA 4KQIA 2IXFA 3G0DA 4WTOA 4U9HS 2CUZA 2FN4A 5EJ4A 3T3OA 3G7SA 1ML3A 1PE0A 4Z0NA 1L5QA 3OOEA 5EWMB 4J7JA 4C3UA 2JD1A 2PSHA 3EMVA 3E8SA 3RN4A 2KYRA 1DIHA 4HGYA 2JEXA 1UP4A 2PCJA 1YXBA 1SD1A 2XW6A 2E74B 1Y48E 4MR7B 4ESHA 3CLTC 1NVFA 2DKOA 1XUQA 1Z2OX 1L7MA 2A9FA 1BQ4A 1WCXA 2A3QA 3KJGA 5AW6A 3SLRA 3VV2A 2XHBA 3SXUA 2EIMC 4Z1MA 3QTBA 4DABA 1JMYA 1TADA 3WAGA 3H6KA 1Q7YW 3R9WA 1MOQA 1QQTA 1XIVA 2ZVQX 1RMQA 4PINA 2IYZA 1M1YA 4QFCA 1Y3FE 1T15A 5DCWA 2DWEC 5IZCC 1ZQ9A 2Q29A 2P2ZA 5FTLA 2KSQA 1P5FA 4G1EB 1EBFA 3FFAA 4HNSA 3LY7A 3RJTA 2VJBA 2VYCA 4MWTA 1V4BA 1P2TA 4ZIRB 4L07A 1UKYA 4K6KA 2OB1A 5EIOA 4W5NA 4EK9A 3K58A 4TWKA 3WWEA 5SYMA 4LC9A 2JK1A 3G80A 4MHOA 3TB4A 1HRKA 5A6SA 2Q3CA 1FFEA 1E2HA 4Q3CA 4WADA 2CLEB 3C2QA 1E9SA 3K1TA 3GA0A 1O0CA 4M86A 1OWPA 1FNNA 1IHXA 3GMSA 1NY6A 5AVSA 3A0RA 4FNGA 3EY4A 5CLQA 2EHDA 3FPLA 2DOKA 1AF4A 1R15A 2J6BA 3T7AA 3ZWKA 2J67A 2EZOA 2EATA 1T4BA 5BN4A 4HNGA 3V7NA 4LGCA 1ZM7A 1BX1A 3BHPA 2X9GA 3G88A 2VEDA 2CH7B 4PC6A 2ZDQA 4A23A 3DBRB 3WRYC 3ED5A 3HP4A 1Z73A 1N0WA 1IFXA 3S2ZA 4WFJA 2OCKA 4DIDA 1YT5A 3FMOB 1BX3A 1Q86W 1PNVA 2EJCA 4MW6A 1MENA 3RVQA 4DLRA 3T7JA 2C5BA 1GITA 5J59A 3QVGB 3UCEA 4DV1B 5K01A 3NYQA 1IY9A 4ME6A 4X8LA 5L3BA 2YQ5A 3VKWA 4DR4O 3SZ3A 5GOTA 1YS7A 2Y0PA 1H8EG 4TS9A 3DBOB 5FBWB 1DARA 1WDMA 3G82C 5P8WA 4U9UA 1G4YB 4XVUA 2FKXA 2ZB7A 1FFXA 1KAMA 4KN9S 1LCIA 2BBSA 2FX2A 5IP5A 4JDPA 1T10A 1YS6A 1H4TA 2A58A 2QMQA 1TMKA 2UYOA 2O2IA 1LY1A 1KSJA 3H1PA 1JI0A 3ECAA 4AZWA 1LBTA 4JN6B 4QODA 5F76A 2V59A 4B9EA 2XVYA 4BAZA 4Z2WA 3OA2A 3AGQA 4Q5IA 2FFHA 1Z08A 4WASA 1PZXA 5FL7A 5LBTA 3CVYA 2JCGA 4MQUA 2RGRA 4NCBA 3GDOA 4B73A 1Q6HA 2H3HA 1EE1A 5GY7A 3UWDA 1J5PA 5IRCD 1S5LZ 1ADBA 1K8ZB 4GR4A 5MGNA 4RS3A 4C30A 1AA9A 4LJYA 1WETA 2JBWA 4H0CA 4ND8A 4L8LA 2ID4A 3BYZA 3CQ9A 2VUUA 4NONA 1AXEA 3SFZA 4KRXA 3OTQA 2QTOA 2ONJA 2WJJA 2PMWB 2DAPA 5K8TA 2IOHA 1T4CB 3E58A 3TDNA 1OOEA 2FDXA 4WMLA 1JTVA 1RI1A 1AGYA 3BCUA 3P9PA 2OQIA 3E7DA 4C89A 1IONA 4NFSA 1E1RD 4BV3A 1WG8A 5ICCA 2ZBFA 3ASUA 2WKSA 4Q3KA 2FN3A 2W2LD 1I2BA 3KSBC 1M7GA 3B09A 1GNV