1WPXA

Crystal structure of carboxypeptidase y inhibitor complexed with the cognate proteinase
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFELGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase Y
publication title Structure of the carboxypeptidase y inhibitor i(c) in complex with the cognate proteinase reveals a novel mode of the proteinase-protein inhibitor interaction
pubmed doi rcsb
molecule tags Hydrolase
total genus 156
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1wpxA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wpxA01
4FFWA 5T4HA 5H3HA 1SCQA 3AJAA 3O9MA 4HRXA 4BDTA 1UT6A 1F0PA 3ANTA 1UOPA 3VJMA 4MXDA 1DINA 3C6YA 4FDMA 5AKEA 2OCGA 5E4JA 1D07A 3ESAA 1QONA 4Y2XA 3C5WP 3KOOA 4AZ3A 3QM1A 1WHTA 5EIEA 3IBTA 5DNWA 4ZWNA 1AC5A 5LZ5A 1DT3A 2XQKA 1ZI8A 4CCYB 2CBGA 2I03A 4QE3A 4BP8A 2WKWA 4X7BA 2QR5A 3BIWA 5JAOA 1WPRA 3IUQA 2W22A 5KWIA 5K3EA 2VJCA 1UKBA 3ZPXA 4EY7A 2VATA 1BCSA 3FYUC 1AX9A 3BE8A 1EDEA 4NS4A 1HKHA 4DNFA 1XZKA 5EFZA 2H7XA 4QZVA 2RAUA 4K6GA 4J7AA 2HM7A 1P0QA 4N8SA 1CEXA 1SFRA 2WU4A 3PFBA 3WIOA 3M3DA 5IVHA 3H1BA 3O4JA 1TRHA 3H2GA 3V1LA 4K6KA 3WA6A 3R3VA 4Y2YA 2O7VA 3WK9A 3WKBA 2HIHA 4LXGA 3TGLA 2WUDA 3C70A 3C6XA 3O0DA 1MO2A 3AFIA 3WL7A 4G8CA 1ZGCA 3W04A 4XJVA 1QIEA 3PF8A 4X6XA 3I2GA 1CUGA 5HQ3A 4LIPD 4F5ZA 4Y2SA 2HA0A 2AJBA 5LLSA 2Y1KA 1OXMA 2K2QB 2ZYIA 4MWSA 1P0IA 2PSDA 5CMLA 3WWDA 5AK4A 2WIFA 3HI4A 4AN0A 2I78A 1R9MA 2HU8A 4DMFA 4PNZA 5BV7A 1UKCA 4KJXA 1XZLA 4ZV9A 2DSNA 3HABA 1YASA 4QLOA 2D0DA 1HQDA 4JYPA 1YSCA 1LPAB 3H04A 4MQMA 1G42A 5ISMA 5AJHA 2YYSA 2I3DA 5AIAA 2CUTA 3O4GA 4GBGA 2BGNA 3UMJA 5DNVA 1SC9A 5AKYA 2X5XA 2OPHA 1PFQA 2OG1A 2ECFA 1A7UA 1CQZA 3FLBA 4C89A 3KD2A 3OC0A 5LZ7A 4F0JA 1A8UA 3FNBA 4AN1A 2H9YA 5CT8A 4Z49A 2ZJFA 4RPCA 3I2IA 3FLEA 2RI6A 4WDQA 3VVLA 4FTWA 1X2EA 3NOXA 3QZUA 4TGLA 4H18A 4MEBA 1VKHA 1FJ2A 1ZIYA 5D7BA 4WFJA 5JIBA 4L72A 4O08A 1QIKA 4HRYA 1SCKA 2HHAA 3YASA 2HA5A 3SX4A 4FNMA 4EA6A 2OCLA 1ZD2P 1K6EA 4KE7A 1J07A 2XUOA 5AKJA 2HRRA 1WM1A 4B84A 3WQHA 1F0NA 4CCYA 1CUAA 4G8DA 3VJLA 2IIVA 5HKBA 4W1PA 4MYDA 4ITVA 4J0HA 1FSSA 3BJMA 4I3FA 2GZRA 2HU5A 4IH1A 3H2KA 3STVA 5IH7A 2HA3A 2DR0A 4CG3A 4AO7A 4WFKA 2HU7A 3R3ZA 4UHEA 2P8SA 4H7IA 1J06A 3WKEA 4HVTA 1TQHA 1T4MA 3TEJA 3D3NA 5AM4A 5D6OA 3DL4A 1GKLA 3PUHA 4X93A 2ZJ6A 1MNQA 5HF9A 5CT9A 1K8QA 5AK5A 4DYHA 2XUIA 1YAHA 1R50A 1MJ5A 2XUDA 3DOIA 1JU4A 2WIGA 4AXBA 1XROA 3G7NA 5K5EA 1BN6A 4UBOA 4ZI5A 4CCWA 3QBJA 3WWPA 2ZYRA 1QFMA 1EB9A 1ZI6A 2VAVA 5AKKA 1U65A 1LPPA 2ZVDA 4DNQA 2PSHA 2BAGA 4J3JA 3L1JA 1Q0ZA 3WI7A 1B41A 1QTIA 3WJ1A 1WB5A 3C6ZA 5HZGA 4PQEA 5HKAA 2B9VA 1KU0A 4N5HX 1AZWA 3STXA 2ZJ7A 3RM3A 5K3CA 1JU3A 1XZMA 1VLQA 4EY5A 4CFSA 4AMYA 5IVDA 1GT6A 4G5XA 1LPMA 3LIIA 1QZ3A 2WHPB 3ZI7A 3SC2A 3AILA 1VJ5A 5JADA 5AI4A 1YS1X 1XQWA 4KRYA 5C7YA 1XZCA 4G4JA 3DQZA 1Q83A 1R1DA 2WUGA 4IHAA 5AIBA 4PF1A 1W4LA 1VE6A 4H7JA 4C4ZA 3C43A 2G63A 4JYMA 1CUEA 3ZWQA 2ZSIA 1C7IA 4Q05A 4C4XA 2OLEA 1DWQA 3BF7A 1MX9A 3QPDA 4G4IA 5HK9A 1GPKA 2BFNA 4C4YA 1H2YA 2X8BA 3W9BA 3I2JA 2Z8ZA 2WUEA 3WJ2A 5EGNA 5F4ZA 3RKSA 2WQZA 1R9NA 4X00A 4JNCA 1LLFA 1XZIA 3UUFA 4C88A 1WHSA 3WL8A 4Q3LA 3Q8WA 1ISPA 1Z68A 3A2LA 3WWCA 1TCAA 4G9GA 3B3QA 1XRLA 4ETWA 4B6GA 3I1YA 3FWHA 1QO9A 2ZSHA 2DQZA 2PUHA 4W1RA 1IZ7A 4BE4A 3IIIA 3FCYA 1NU6A 2RHWA 5JZBA 3EBLA 5ALVA 5YASA 1FFAA 3G9UA 4NMWA 4XX1A 1CR6A 3W2TA 4H77A 4LYDA 2HA4A 1IZ8A 3M81A 3HLKA 5AI0A 1IUOA 1JJBA 4B81A 1JJIA 4KAAA 3SK0A 1E8DA 3VVMA 4ZREA 2VT6A 1QJ4A 4HXFB 5DYTA 3I28A 4WY5A 4Q3KA 4KE8A 1S8OA 1MN6A 2R8BA 2WJ3A 4W63A 1ZJ4A 5FUMA 5LKAA 5FPQA 4OB8A 1XZBA 2EEPA 5A7GA 1M33A 1XFDA 1H22A 1LBSA 4OB7A 2H7CA 5K3AA 5I8PA 2XUFA 4B7ZA 1QOZA 5ALKA 1TKRA 2IITA 3PF9A 3FAKA 5AICA 4Y2PA 4P08A 5A7HA 2DHDA 2WLSA 1H2XA 2PPLA 5BWCA 3RK4A 2UZ0A 5ALZA 5T4FA 3WLAA 3PUIA 1MAHA 2DHEA 2XUPA 3BF8A 1CUDA 3WZMA 5ALIA 3WKDA 1EA5A 4TPKA 1F8UA 4UBJA 3LCRA 1X70A 1UXOA 3QPCA 5KWJA 1XLWA 4DM7A 2HADA 4ZRDA 5AI5A 1E89A 1QIIA 1UFOA 2OCKA 3HZOA 4HTAA 5CT6A 3HEAA 1TAHA 5CXUA 3G0DA 1PV1A 1QTRA 1RWQA 4H7FA 4OSEA 5JALA 1YAJA 3HC7A 2VEOA 2V96A 1BN7A 5EHXA 5CW2A 3DKKA 5CH5A 2Q0XA 5JAPA 2RHTA 2WHPA 1ZD4A 2RONA 4DNPA 2XMGA 4ZGBA 1L7QA 5AKLA 4K6HA 5ALRA 5HK8A 3IDAA 5JD4A 3R3XA 2BKLA 1AQLA 1W52X 5ALSA 1FFEA 3FYUB 1XLUA 2G4LA 5ALEA 3RARA 3G0GA 1E66A 5AKXA 2JGKA 1ODTC 3KWJA 3F96A 5JZSA 1TK3A 2XUAA 3IUMA 2G5TA 3I2FA 1CVLA 4P93A 3GA7A 4Q3OA 2C58A 3QH4A 3W05A 5D3ZA 1E3QA 5DLPA 4EY4A 3CN9A 2XMQA 5CRIA 5FXMA 2AJDA 4EB0A 3R41A 3F9CA 4BATA 2XMCA 2VSQA 1JKMA 4WFIA 5AH0A 4CIAA 3N2ZB 2V9ZA 4DGQA 2X76A 7YASA 1UZAA 2CJPA 2XQIA 5A71A 2XMRA 2WFZA 2VJBA 3AZOA 3L1HA 1CUYA 4JH0A 3U1TA 3ESBA 4GW3A 5DTIA 3MGAA 5ALLA 5JASA 5ALWA 1JJFA 4W9RA 1CUCA 1BEZA 2ONCA 3QITA 4BAUA 5JAHA 1E5TA 1YA8A 4B0PA 1XKTA 3I2KA 4Y2UA 1GZ7A 1UK9A 4LYEA 1X2BA 4ARAA 2WFLB 4H7EA 3ZLUA 3EQ9A 1XZGA 4GDMA 5KBYA 2B20A 4MWTA 2CZQA 1XQVA 3FBWA 4Q82A 3AUKA 5ALYA 4D9JA 4H7KA 1L7RA 3DYVA 4MYSA 5JAUA 3PICA 4QDOA 2XUKA 3A70A 5AOBA 4Y2RA 4KYVA 5AM2A 5LZ9A 2HA6A 4QDZA 4BAZA 3VDXA 3O95A 4UFOA 5IVKA 1QFSA 2VAXA 4E14A 1QO7A 1XRPA 3VXKA 1EINA 1RP1A 4EZIA 1LPSA 4CI9A 2C0QA 3WKAA 1DTEA 1DT5A 3CN7A 5IKXA 4K5QA 1PJAA 4H0CA 1U4NA 4DTCA 2OQIA 3DLTA 4OU5A 1CUBA 4UHCA 3BDVA 2B61A 1JMKC 4E46A 3O4HA 4N8EA 5A7FA 3WK5A 2WTMA 3FSGD 4UBKA 2O7RA 2Z3ZA 2DHCA 3ZLTA 2FJ0A 4F21A 4B9AA 5AP9A 4YX9A 1CFJA 4OYYA 3GELA 3DCNA 5ALJA 4FWBA 3FYUA 2QUBA 4M0EA 3H0CA 2Y2UA 4CG2A 5FOQA 4ZXFA 3KSRA 2DFPA 5JZ9A 1UK8A 4H7DA 5DTJA 1QIGA 3DD5A 4QDTA 1T2NA 2CKMA 1XRNA 2XLBA 2D5LA 3WWOA 1TCCA 2PVSA 1AGYA 4QDUA 1AKNA 3NUZA 2OGZA 5LIPA 3R0VA 1MX1A 3M83A 4LXHA 2H7YA 3LLCA 1LNSA 4P92A 3FVTA 2QUAA 3E1GA 1ETHA 1B6GA 1MNAA 3B12A 4G4GA 1CLEA 5JATA 1UWCA 1DQZA 2XUJA 1DX6A 3E3AA 3EQ7A 5HF5A 2AXEA 5FV4A 4I19A 1Y7HA 4OD0A 2C4HA 3WA7A 3WL6A 2JGJA 4A23A 1N5MA 2WG0A 4OUKX 1QGED 4L3WA 3QMMA 2PM8A 3G0BA 3K6KA 4FHZA 3FYTA 2PUJA 1IUNA 4H7HA 4FKBA 4LKOA 5AM5A 3FSGA 4BE9A 2H1IA 2ROQA 4X85A 5E4TA 4OPMA 1EXWA 1VE7A 4ZV7A 2C5GA 2J4CA 1AMNA 3F8SA 2WFLA 1EDDA 3GUUA 1CRLA 1CUWA 3IA2A 1GPNA 5CT4A 5LKRA 2VTVA 5CBKA 1K5PA 3BXPA 3K9BA 4FNGA 3AZPA 5EI5A 1FFCA 4B82A 3SWWA 2J3DA 4YASA 2QKYA 1QE3A 2BUCA 2WIDA 4UHHA 5AM3A 4C87A 1OCEA 4RE5A 5K3DA 5AKZA 1YS2X 4EY6A 3DJYA 2ZYHA 5JD5A 2Z5GA 3PI6A 2WU3A 3FLAA 1TIBA 4W1QA 1JFRA 3R3UA 3GROA 1HL7A 4ARBA 1CUUA 2YXPX 1LZKA 4B83A 4PW0A 5C8ZA 1XZHA 4QWWA 4XVCA 1CUJA 1VZ2A 4QEKA 5K3FB 2HDWA 3WK4A 4S0XA 5AM1A 3OPMA 1VXOA 5CXXA 3WZLA 1W76A 5ALPA 3QVMA 4FBMA 3ESCA 3LP5A 1XZAA 2XQJA 4QWMA 4B80A 4BVJA 4AB1A 3V1KA 3IUNA 5AHXA 1HLGA 2HL6A 4GEGA 4B0OA 5HF6A 3QYJA 1THGA 1CIJA 2GYVA 1N5RA 1YA4A 1U2EA 4L9AA 4XIIA 4L0CA 2QTBA 3G9ZA 1WPXA 2B4KA 1LPNA 4BP9A 4H35A 4WY8A 4U2BA 5ESRA 4MEAA 1HBJA 4W1SA 2IX9A 1G66A 1QIMA 3UUEA 2VJAA 3BIXA 2ES4A 1R3DA 4BCBA 5I7UA 1XKLA 2O2HA 3QMVA 3BJRA 4JEIA 4EHBA 1ZJ5A 2C7BA 1USWA 3DS8A 1EX9A 1EH5A 3AIOA 5AI6A 3WMRA 4BTLA 4DSZA 2XMZA 1EK2A 2HA2A 3WKCA 5DNUA 4DLNA 4HS9A 1XQXA 3AIMA 2G5PA 1ZGBA 1CUHA 4AO6A 1VA5A 3MVEA 3WK8A 2Y6UA 2PX6A 5K3BA 2JBWA 3S8YA 2GYWA 4X95A 4DMKA 4QNNA 4UBIA 1J1IA 1XZDA 4KR0A 1XZJA 2QVBA 2PSEA 1W1IA 1OILA 2PBLA 3FVRA 4RGYA 2OGSA 2PSFA 3DKRA 4BCDA 1SCIA 4BVLA 3STWA 3H2JA 2AJ8A 2GBGA 1GPLA 4KEAA 4KACA 4BVKA 3RLIA 4AZ0A 2EDAA 4BYMA 1DWPA 4Y2TA 1KU6A 4BC0A 2JIDA 4I4CA 4LHEA 1ZD5A 3C87A 3WK7A 5CT5A 4PO3X 2RIPA 3G0IA 3ICVA 2O2IA 1VA4A 3I2HA 3NGMA 4IQ4A 4YPVA 5CH3A 5I9IA 5EHZA 3G0CA 3O4IA 4U2DA 3T4UA 4DIUA 4AQDA 1VZ3A 2WFMA 3HJUA 1ZICA 1O6GA 4FOLA 3I6MA 3F98A 3MUOA 2C0PA 2YASA 5ALGA 3DDUA 2WSLA 3H18A 4PSCA 1C4XA 2QJRA 1UOOA 2PSJA 1G5FA 5DYYA 3D2CA 2XB6A 5K3FA 3E4DA 2GBFA 5ALUA 1EHYA 1XZEA 2LIPA 1FFBA 2BUBA 5SYNA 2PKYX 2OAEA 1CUZA 3F97A 4FMPA 5FDFA 5FP0A 4U2EA 5ALDA 3QPAA 4LXIA 1THTA 3R3WA 1UK6A 1XRMA 1U8EA 2VT7A 5E4YA 2AJCA 1SOMA 2OGTA 2OXEA 4WDRA 4Y2VA 1CUXA 3EF3A 2GBCA 2JGMA 1GQRA 3WYNA 5ALHA 3V48A 1WB6A 3MUNA 4CIBA 1I6WA 3H17A 3KDAA 3GFFA 3CCCA 4C6HA 5AK3A 2R11A 2JGIA 4HZGA 4YK7A 2HFKA 1DX4A 5EIHA 1IUPA 2I3ZA 2RGUA 5E2IA 2OCIA 1G4HA 2V97A 3PDCA 1IMJA 3IB3A 3IURA 1CUIA 3M82A 3AIKA 3QMWA 3K2IA 3A2MA 4QA9A 4Q34A 4WCVA 2QM0A 3WL5A 2CEKA 2DCMA 3OOSA 2GBIA 3CCBA 3HXKA 2AJLI 2VQ6A 5AI8A 4BC1A 1NX9A 4FLEA 2Z8XA 4GECA 3I1IA 1VOTA 1F6WA 3OTQA 3KWFA 4ROTA 2BJHA 3ANSA 4GI1A 1DWOA 2WIJA 5JANA 1QIFA 4UPDA 3Q0TA 5LYYA 3P2MA 4UBLA 4OCZA 1VXRA 4X97A 1YB6A 3BDIA 4FBLA 3EQ8A 4EBBA 4DSAA 1BEEA 1E8NA 1AURA 3TRDA 4AX4A 2PU5A 4V2IA 3W06A 1YB7A 3HYSA 2WG1A 4MJ3A 5DYWA 1QIHA 4UBNA 1DQYA 1QIDA 2XDWA 2WIKA 4P9NA 2NW6A 5FRDA 3OM8A 1GKKA 1MX5A 1FFDA 4X71A 3OG9A 1WB4A 3B5EA 1CUVA 3BL8A 1MPXA 4UUQA 3A2NA 4U2FA 1LZLA 3F67A 3G8YA 5AO9A 4N8DA 4FFVA 2CMFA 4E15A 4KE6A 5A62A 1R88A 2BCEA 1LPBB 4A5SA 2WJ6A 5JYCA 1KEZA 2QMQA 4AO8A 5AM0A 2CB9A 3H2IA 4OYLA 4X6YA 4F60A 1GGVA 5AOCA 3A6ZA 2QXTA 4NZZA 4EUSA 2HA7A 3C8DA 2XUQA 4G1FA 5D3KA 1YR2A 4BZWA 5C81A 1HDEA 3DYIA 3ILSA 2YH2A 3GZJA 4QDXA 5AKIA 1MT3A 3I6ZA 2XT0A 2DQYA 1LGYA 5J3JA 1Q84A 3AINA 5HFNA 1LPOA 5AK6A 2JGFA 1W6RA 5FPPA 3JW8A 4BAGA 2JEZA 5IVIA 3WYDA 5DJ5A 4DMCA 4JUIA 4BTVA 2BGRA 4Y7DA 4J0KA 4J0IA 4HXGA 1C7JA 5EHNA 1N8SA 5HCUA 5FLKA 5BWBA 3DL7A 1Y7IA 3STYA 4B9EA 2VA9A 5LZ4A 2JGLA 4AMZA 1UKAA 5SYMA 1UK7A 3H2HA 3IVMA 1JT2A 3C5VA 2VJDA 3CXUA 2JGEA 2JEYA 4X92A 1GXSA 4IH4A 1O6FA 4HAIA 4A16A 2WUFA 5ALOA 1AUOA 4J0CA 3R3YA 5ALTA 3C8HA 1R4ZA 2E3JA 2XUHA 4GWLA 5LZ2A 5C8XA 4M0FA 3D4LA 1ZOIA 2WJ4A 4KAJA 4UFPA 3ED1A 4BBZA 3GBSA 1BCRA 4GHWA 4N5IX 3FCXA 2EDCA 3FOBA 3ZV7A 3V1MA 4C01A 2OQVA 3WK6A 1JI3A 2Z3WA 6YASA 4KRXA 5CH8A 4J03A 1EI9A 3D2BA 1UOQA 4K2AA 5AI9A 4WJLA 5ALXA 3R40A 4X91A 1MTZA 4UHDA 2HRQA 2WG2A 2QT9A 4UHFA 1BU8A 5AKGA 2QJWA 3T52A 1CUSA 1EVQA 2ACKA 3G9XA 4XWGA 1JMYA 5AKHA 3STTA 5ALFA 3ZLVA 4U2GA 1BS9A 2XMBA 3DOHA 1ODCA 1Y37A 4U2CA 1NU8A 4TVKA 4KE9A 1XRRA 2WM2A 2XQFA 4J0DA 5A6VA 1XLVA 2XI4A 4X94A 2FJPA 4OB6A 4UFNA 2XMDA 2XMSA 5HFAA 3WIBA 2BUAA 3DNMA 1E8MA 3JWEA 1DU4A 4BDSA 4PSUA 1J2EA 3D2AA 1K4YA 3G02A 1CUFA 5LZ8A 1WOMA 5CTAA 4MQLA 4BRZA 1ZIXA 1GQSA 3AZQA 2XLCA 2QOEA 4BB0A 4G8BA 1A8QA 2Y2VA 1ORVA 1CQWA 1ACLA 5ALNA 5ALQA 1CV2A 2QZPA 4HXEB 4M0MA 4EY8A 1XRQA 2QXUA 5A2GA 5C8VA 2VF2A 5T4EA 4RNCA 4B85A 3O9VA 1EK1A 2WHRA 1IVYA 4PV7A 1QLWA 3VKFA 3ICWA 5AOAA 5HF8A 1P0PA 4BCCA 2WTNA 4CG1A 3PFCA 5LP1A 4QLAA 4FLFA 3KXPA 2O2GA 4INZA 3STUA 1H23A 4DMHA 3HACA 5BOVA 4NVRA 4Y9SA 4IO0A 1Q0RA 4RE6A 1RYYA 4PSDA 4Y2QA 4GXNA 2C5FA 2J3QA 3HSSA 4J0GA 3D59A 1A88A 4E11A 2HFJA 5CURA 1MAAA 5ALMA 3BWXA 1BROA 3W9UA 2V98A 4X90A 1EDBA 3E0XA 3H1AA 2JF0A 3LIPA 5HQ3B 3JYHA 2ORYA 3WWEA 1LBTA 3D5EA 4J0JA 3X3HA 2WHQA 2XUGA 2GZSA 2WILA 3H19A 1XZFA 3IUJA 4X6UA 1YCDA 3D7RA 1EVEA 3NWOA 3ESDA 2OAGA 1EB8A 1W75A 4DNOA 2FUKA 1TCBA 3HRHA 1N1MA 1K63A 1QIJA 3D0KA 4GLBA 1P0MA 3I6YA 5KREA 1ACJA 1H2ZA 2J4FA 5JD6A 2QS9A 2W6CX 4BRSA 1BRTA 4G9EA 3OURA 2FX5A 3EIOA 3L1IA 1ZD3A 1CPYA 3LS2A 3V1NA 1HPLA 3VJKA 5EHQA 1BE0A 4X3CA 4KAFA 3S2ZA 1A8SA 1L7AA 2XE4A 3C6BA 2XQGA 3DEAA 3U0VA 3G9TA 2ACEA 4BZZA 4OU4A 5DWDA 2GYUA 4UHBA 3C45A 3IULA 5T4BA 2PL5A 2Y6VA 3V9AA 5EIAA 4IH9A 2ZYSA 1MU0A 3PE6A 4Y2JA 4UBMA 4Q1VA 3VISA 3N0TA 1XQYA 1ZI9A 4FLMA 3TJMA 2QRUA 5JARA 2PU7A 1ORWA 1H2WA 1ODSA 5FKJA 1WCYA
chains in the Genus database with same CATH superfamily
1RZRD 3LXUX 4U63A 2IZ1A 3KHUA 4MXDA 5AKEA 1WSDA 1JQKA 1QGUB 1LRLA 4I5EA 1TYZA 5EIEA 5DNWA 3VBBA 5ER9A 4QQ8A 4ZAXA 3E9RA 2IHJA 3ZTTA 2PMCA 3U0ZA 4CM1A 2UDPA 4NULA 2PX8A 3CEHA 4M22A 3RG8A 2K7ZA 2D2EA 4R68A 1K6IA 3PZRA 1M1NB 1QNLA 3KZNA 1FZQA 4M37A 4MINA 2ZIEA 1MXFA 1YZHA 1R4MA 1QUFA 3KAPA 2IEGA 3HZRA 2IRWA 1FDTA 3OT1A 2VPZA 2E89A 4Q20A 4DR2O 4DN6A 4JCCA 3R5KA 4Z54A 4Z1VA 3K0CC 4C4RA 1SXIA 1SG9A 1A9XB 2ZQZA 5B3JC 5IULC 1ULZA 2ZI9A 1G3MA 3CHYA 3LA8A 5B58C 5G0UA 3RW9A 2ZT6A 3VC7A 3FUVA 3ZY2A 1Q22A 1GN3A 4L9SA 3QRWA 5JWRA 3Q10A 4TTTS 3N2GB 3QEJA 2I7XA 3WTCA 1BXRB 4RZHA 1FMCA 5C9ZA 1XZLA 3I42A 4ND6A 1T2VA 4JQSA 1KEEA 4WIAA 1D1SA 2YICA 1LPAB 1OFVA 3LWNA 1N75A 3SM3A 1IUKA 4DQLA 4F3NA 4K9LA 2Q4RA 3MTAA 1S4MA 4TMKA 4ZVNA 4WTOA 1M57B 3A3PA 4HQ6A 1W36C 1NXXA 2AKEA 2YWCA 4W9NC 2PN1A 4X1YB 2GJ8A 2P9CA 1W47A 4IL6Z 2L17A 9GPBA 4C89A 1O77A 4N54A 1S9HA 3ZWWA 1X9GA 1J5XA 3ZDBA 1EJ0A 3QX7A 1U7XA 1FBTA 3NYQA 2Z6VA 1U2QA 1QTQA 2L2QA 4Z53A 1DKNA 1ZIYA 1FJ2A 4JAAA 2OBFA 4NCXA 4BNZA 3LMKA 2IEBA 1GUDA 5C8DA 4MWOA 1K6EA 3TDKA 4GYWA 4HMPA 3G79A 4F72A 4JI5O 3HZZA 1H3FA 1KI6A 1R0LA 2ERXA 5K0LA 2CNBA 2PSSA 3D8UA 4WKBA 1CTQA 4GBMA 3FKSG 3PGXA 3VA7A 2AEMA 3WRXA 2PGOA 2N9UA 3TSWA 2JI9A 2P8SA 2PUCA 2FMIA 1U1GA 1V48A 3JASB 5KVQA 4CEJA 5D6OA 1JSRA 3O83A 1HL3A 2DPMA 3RU2A 1HDYA 5KQPA 4YRQA 3DFUA 3KVVA 4FR2A 5AVTA 4RSHA 3DCYA 2HKIA 1RHRA 4HLUA 1ZI6A 1DXYA 1NVDA 3JQCA 1LQUA 2VZ9A 4RTSA 3RC2A 3JVUA 2FPSA 4KXQA 2GAAA 5COBA 4A8JA 3VC2A 4AULA 2NUBA 5I4IA 3KB8A 4RQFA 4IHQA 3PVZA 2DKFA 4CIWA 5HZGA 2EC5A 1UKVY 2GCNA 1KU0A 4N5HX 2ILTA 1I51A 1M76A 1YQTA 1QF9A 3T1HO 1U2ZA 4B79A 1Q77A 3NT4A 3CLTD 5HBRA 4Y18A 3TSCA 4D9FA 5BV1A 5LMZA 1JEJA 3PQ5A 1KI3A 3VZQA 1Z33A 3DQZA 3BAFA 2VC2B 4QICA 1CUEA 3FHOA 2OLEA 1YQEA 2VPYA 1YD7A 3TPZA 3W9BA 3B3FA 2FF7A 5IBQA 5LA6F 4HF7A 4BKUA 5LXTA 3SJUA 3H4TA 3SJCA 2P7IA 2YXDA 4Q3LA 3KYDB 4RPIA 4E88A 4G9GA 4BQEA 3INYA 3R8CA 2RCNA 2BEUB 2PUHA 2CWWA 1I7QB 1KE1A 2GAOA 3CS5A 1R6XA 1QO0D 5JZBA 1QMPA 5CB8A 4PZPA 4Z4GA 3W2TA 2TSYB 4LYDA 4DMUB 4G56A 2HYDA 1ZM9A 2FPGB 2VZLA 5DIZA 1U81A 5EMLA 3FDZA 1JJIA 4FLVA 3K8OE 2LW7A 4JP5A 4JI7B 4KE8A 2WJ3A 4RMJA 1RKXA 2UUBO 1WULS 2AFIA 2HIGA 1BX3A 3LBIA 2P6OA 1RHMA 4Y0NA 4M89A 3C3SA 1MVLA 1OLXA 1WIWA 4H6XA 1VQ5V 3QFFA 2GO7A 1W0JA 1D0VA 3LC1O 1SB8A 5ALIA 5KU7A 1Y1TA 2NUAA 3RBVA 1X70A 3D36A 2WJWA 1HMPA 4D43A 4GBJA 4FWIB 5BSFA 1J95A 3HL0A 4TVOA 1T2EA 1BN7A 2HOQA 1C1DB 4CKWB 2IHTA 1Y9AA 4MQ6A 4WFEA 3E22A 4J7CA 4FLUA 3HL4A 4NARA 2XE7A 4MW6A 4D2IA 2Q3HA 1HO3A 1RAEA 3X1YA 4BNXA 3T7EA 4POAA 1F38A 1LF0A 1XLUA 1TT7A 5ALEA 2WYHA 1CY6A 5L3SB 4AMUA 4TN1A 3KWJA 4YACA 1JF8A 4B3SB 4JOBA 5EK0A 1TK3A 2WB4A 3U7QB 5IT0A 4GSYA 3P9ZA 4U1RA 4XH9B 1NDQA 3OQ6A 4CS2A 5FH9A 3N75A 5IFKA 2G7ZA 2EINC 4EB0A 3PE3A 2GHRA 3F9CA 5DRYA 4H17A 3TK1A 2V9ZA 4OHRA 2FI1A 1WQ3A 2VBGA 1UZAA 4UEJA 1FXUA 2PXHA 1X87A 1XL1A 3HCBA 5BZBA 4QJIA 1PDWA 4D9KA 5IJ9A 4K1LA 5DTIA 4HNSA 3Q0EA 4BAUA 3UFBA 4J3NA 4U3JA 2IXGA 1AT1A 2BRUC 1Z6AA 4IDHA 1GZ7A 3LHIA 4I5GA 1GTZA 4D4HA 4JJGA 4ANFA 4R2HA 4P9PA 1RYMA 2E82A 2G4CA 4HQKA 3E15A 1P31A 1FRQA 4D9JA 4H7KA 5IYDO 4JI1B 3DGEA 1ONSA 1F4NA 5K03A 3DDSA 2ATKC 4XDHA 4JLVA 1GV1A 4KJZA 5GZ6A 5L6MB 3TQFA 3TX2A 4QDZA 2Q1UA 1LBIA 3QXXA 3O95A 1KJZA 5AW6A 4JKOA 4QPZA 3L0CA 4K9RA 4RFLA 1AKYA 2H4HA 1KEVA 5FF9A 3SKYA 2I4IA 4MS3B 1CJMA 4X41A 1FBNA 1KMCA 2PQ0A 3L7CA 2P4VA 4N8EA 3MS2A 5GGYA 4M9SA 1OH8A 4DSOA 3VNUA 1AQ6A 1ZWIC 1XDCA 2DR3A 1MO6A 3WLPA 4TXHA 5C0OE 4D0SA 3CLVA 4FWBA 4BB9A 1ZY2A 3RFCA 1L4MA 2Q5IA 1SUSA 3HP1A 4ZALA 5G3ZA 3VI3B 3D3IA 4MI9A 2DFPA 3GN2A 1WXEA 1HLPA 2WSSD 3OQIA 3IDFA 2D5LA 2JJ1G 1NHGA 2B8EA 2IYVA 1AGYA 5IS2A 2XNCA 4ZOQI 4NCIA 3GFQA 1MX1A 4Z3DA 1RXCA 2FR1A 3C8ZA 2ORVA 3RJ9A 4L78A 3ND5A 3RUIA 1B6GA 6REQB 3B12A 1IE3A 3E7XA 2I9PA 2Z2KA 1UJCA 4LBVA 2DPLA 1DQZA 1RXVA 2YNMC 3EEFA 3OEHG 3Q87B 2R68A 1QHXA 3DV0A 2IXEA 2FPRA 2V3VA 1GRRA 1DRVA 1D5AA 1IVSA 1I5EA 2Q6OA 1LV7A 2I6SA 5KQLA 2G9VA 1ZNYA 3KSMA 3FYTA 1DC8A 4MVJH 2O8FB 3MJVA 3V8QA 1W0KA 3LXRA 4G84A 5AUQA 3TCXB 3Q3HA 4ZZIA 3RVJA 4BFYA 2BDUA 4MGEA 4FYIA 1CUWA 1XEQA 1DBPA 3IBGA 5EMHA 1MF7A 1N32O 4KPYA 2PNFA 1RABA 4OX9B 1W9MA 3C7TA 4JI8B 3M6AA 3G71V 2VAPA 5CUQA 1OMOA 4HMOA 1T8RA 4E13A 1W5SA 1Z82A 1RTTA 2DPGA 2VHEA 1FU4A 3HFGA 2EKLA 4JVLA 3CINA 2DRIA 4Q66C 4CGYA 4ECAA 1IBKO 1J8QA 1K9SA 2Q21A 3FZYA 2YDYA 4RXTA 1LZKA 1I0HA 4QWWA 1M2EA 1T0JB 4KYTA 4XPIA 1XJWA 5KKCA 5BYAA 3MQ4A 3Q40A 4OHPA 3WZLA 3L7DA 5ALPA 4UEWA 1U9CA 3LP5A 4LMRA 2QT0A 1V25A 4BVJA 3LBHA 3TLJA 5HIKA 2DERA 3WDLA 2Q3EA 1RQ7A 4OQEA 5KHKA 2ZKLA 2DPXA 4R3NA 4TLMB 1GSAA 1GCUA 3QWFA 3V1TC 5JT1A 1WPXA 3PRKE 4C14A 4MW3A 4JQYA 4RVNA 4O2AF 3P0JA 4B32A 3HBJA 3H01A 3WLRA 2P0YA 1ECJA 6AT1A 3TSYA 2VEDA 2R751 3DGFC 1OPRA 4QG7A 3PNOA 4IUBS 3GJSA 4HWTA 2AKYA 1O94C 1G18A 4NFSA 1N6OA 3W2FA 2JANA 1P81A 3AM3A 1A8PA 3K0DA 4UBIA 4BIZA 1EUDB 3TCKA 2PYJA 3ABUA 3X2QB 1GNRA 1QC5A 4R8LA 4EW3A 3FVRA 5T67A 3QTBA 4YXFA 3IE0A 5AT1A 1SCIA 5IM4A 4PQYA 3SS7X 1QH8B 1SRQA 2GBGA 3T06B 1U3VA 1YJCA 2HX1A 3TN7A 4XDKA 1BFDA 4RH1A 1Z7BA 4Y2TA 4E5NA 4DJJA 2BM8A 4I4CA 2GDSA 4CHTA 1K86A 3VVBA 4FFPA 3WK7A 3DZKA 3G0IA 1NBWB 3TUIC 4P36A 5COQA 3UY4A 2I5PO 2GXQA 4MJXA 4LYHA 1G8GA 5E79Z 1W0CA 4KP4A 1B0ZA 2WFMA 5BW4A 1NT2B 3NRBA 4JNKA 4LFBO 5HRAA 2VKQA 1RWKA 5FEMA 3L82B 3OF3A 3NUQA 1G2QA 4HNRA 3EZ9A 5F64A 3LNMB 1YONA 1XZEA 2YJ4A 3OCJA 4PGHA 3PHLA 2LIPA 3VHRA 2GTPA 4NIMA 2Y1XA 1KH1A 3DMGA 4EGFA 1Z0AA 4C5BA 4P81A 4EL5A 5I51A 1PFKA 3VV3A 1L5GB 3DM5A 2G1PA 5JS6A 1IRXA 1JR6A 4X1OA 2UVDA 4D8TA 2XNDG 3SHTA 2BF7A 4HAOA 4AUMA 2NR5A 3KDAA 3BERA 4C6TB 3OAAA 3PDCA 4TWIA 3IVGA 5GWXA 3LDUA 1JFFB 5H6QA 1R1BA 3G8BA 2X2EA 4TUYB 4B71A 5IXSA 2QLMA 3ACBA 3BCRA 4GECA 3NBKA 3QHQA 3MNFA 4DK1A 4RBNA 2ZJ1A 2B9ZA 2BJHA 3PT9A 2QZJA 1JWLA 1OFUA 3K92A 4J7JA 3COZA 5LYYA 1WDWB 4Z3OA 2GQ0A 1OREA 3PU6A 2NSYA 4CQJA 4D8VA 4HGZA 2JLQA 1VXRA 2VNSA 1NFRA 1JHOA 3LP6A 2CGEA 4FBLA 4Q0MA 4TTPA 3UPTA 1YDFA 3OQ1A 4XQCA 3O4VA 5DW0A 1Y9ZA 4X24A 3QVSA 1TEZA 3MFYA 2Z58A 2WG1A 2DJVA 3T1VA 3JPYA 2INGX 1QIDA 1ETUA 1WP7A 3EH1A 5G0WA 4B3XA 1HE5A 2QW1A 3OG9A 5I47A 1CUVA 5SY6A 4UFZA 5AJXA 1DRKA 3CISA 2YUIA 3WO0A 2AWNA 1KVTA 4P4NA 3JD2A 3PHJA 4KE6A 1I5OA 2WHYA 9LDTA 4BO3A 3IEIA 4JHLA 2RI0A 2QX8A 2Q4TA 4FM0A 4XM2A 2IBMA 1BQEA 3HJFA 2IJHA 1XU4A 4HPJB 1NKSA 2G1KA 2Q6AA 2PRYA 2R85A 4EG3A 2WNSA 1WEKA 3PC6A 1TYCA 3EHDA 2P90A 4GI3A 1ZSPA 1NMZA 2QSAA 3B7WA 5DGXA 5DGHA 3M9WA 4MYRA 1D2EA 3DE4X 3L6UA 3L7NA 4KIJA 5FPPA 4YCAA 1ABBA 3JWGA 5KKAA 3B82A 3P0HA 3MOSA 1GN2A 5DJ5A 4CTJA 3BL6A 1IC6A 4ONEA 5CA1B 3HBMA 3V8EA 2Q0HA 3TX6A 4AWBA 1MSDA 2VA9A 3UUWA 3JQ6A 4Q21A 3QVWA 2I6QA 2VHVA 2HJGA 2EIXA 4MVJE 3BVOA 3L8CA 1O58A 1U8YA 5F98A 4LDRA 2RMKA 4U0JA 4LRXA 3EIUA 4OHXA 1ZONA 4RM3A 1QQ6A 4U7TB 4XSVA 4HQ0A 1DX9A 3WGUA 3R3YA 2M32A 4D99A 4DG5A 4L4RA 2E3JA 2FSIA 3OZDA 4OHCA 2YW2A 4QDJA 5CDYA 5FADA 5BRNA 2K4MA 4JJ8A 3FOBA 1KORA 4XDLA 3QELA 5CYFA 4C01A 1YIOA 2OHFA 3DXYA 3SSAA 1DP4A 2BHTA 3A6FA 1H6AA 3P9NA 3T1YO 3R40A 4KDFA 5LMCA 4MVSA 2NUTA 1RKQA 2UZ3A 1I6KA 1EVQA 1PEKE 4CCAA 3G9XA 1CXZB 2HUNA 4DV6O 4XYBA 1CHNA 1WU7A 1ULSA 1M2HA 4G81A 3P3PA 4EKYA 4O2BA 2EEZA 3OO0A 4TV9A 1N2JA 2WM2A 2N05A 4MP8A 5FTKA 4FYVA 3FYCA 3OFJA 5FPKA 5DWQA 1T25A 5F1YA 1GUZA 4CMEA 2XMDA 2FW0A 4OJYA 2M6KA 1H6DA 2EARA 2BUAA 3F5QA 2J3IA 1PT5A 4OX9Y 4PSUA 5CM8B 2BFFB 3OQVA 1K4YA 4HSEA 2X8LA 4MQLA 1F2TA 3AZQA 1GO2A 2KLBA 1HE1C 3CKYA 3H05A 1V37A 3K5NA 1A9YA 2VPXA 4X9XA 4UAJA 3RFFA 3TR6A 3BQNB 4F7WA 1H1LB 4CR7A 3I76A 3VPSA 3RU3A 1XRQA 4O8ZA 1ISHA 5DFAA 2GHTA 1BCSB 4K3UA 2ZBGA 4MV8A 2WHRA 1KDYA 1P0PA 2MT9A 3KB1A 2ZXEA 4DUZB 5K9ZA 3BRQA 1P1JA 4D1YA 4O2RA 2AIRA 1USIA 5BQFA 4QG3A 3FBTA 4R8MA 4UOZA 3CVUA 5CN0A 4KV9A 1M9NA 1LK5A 4AKTA 3QF7A 4HDKB 3T2MA 4GRDA 3KQSA 5K8TA 3ZWDA 2P4KA 4UULA 1SHUX 3EEYA 4C4OA 3R75A 1R6KA 3L8GA 3MTGA 1E6EA 1COWG 2Y1CA 2RHGB 3H42B 4DLUA 3ZVNA 3AF4A 3D0KA 4U6SA 4A0HA 2QS9A 2GPAA 5JH7B 1I7SB 1EWYA 2FFQA 2WK1A 2QRLA 3LS2A 2FMUA 1EFDN 1WF6A 3O94A 5EHQA 3QFSA 4LOKA 1Y80A 5DH9A 3KOWA 1I4EB 3MGCA 4XR9A 2XOEA 3S2ZA 1MT0A 4BZZA 1B6TA 3JSXA 5EWLA 3JYOA 5T4BA 2Z3YA 1M8GA 4IFBA 4BU0A 4ZEVA 3I32A 3QWHA 1F2UA 5FOTA 4Y2JA 1AG9A 1MXHA 2KE5A 1GFSA 3M6FA 3REQA 1QH1A 2M7WA 3AMVA 3NIFB 2HSDA 2BWJA 3MAJA 5H3HA 3LPLA 1Q3TA 3VJMA 1V2GA 4XGKA 1DINA 2OCGA 5LGNA 2K1EA 4P5EA 3GA5A 5K8JB 1NN5A 4BO1A 2R00C 5BUSA 2GZ2A 2VRWA 1ZGHA 1X4TA 1PR3A 5F1PA 3UOWA 2QR5A 2D3TA 4IXDA 2WC1A 3R5TA 3RRFA 2JD2A 3F71A 5ICEA 3ZPXA 4ENPA 2A0YA 3FYUC 3GUZA 2ERCA 3NVDA 3ZZ0A 1JEOA 3N8IA 3K3WA 1EGVB 1PG0A 3NWEA 2HM7A 4N8SA 1CEXA 4IKPA 4YT5A 3RFTA 1OV9A 5ECDA 3DLPX 2O7VA 1UBRS 4Z7QB 1L7DA 2M6RA 3WKBA 3TGLA 4ZKDA 3FPKA 3UJ9A 4EVRA 1L4EA 1CQJB 2OWOA 4XJVA 4PXAA 3IDSA 3I64A 4Y2SA 3VZBA 5EKSA 3I5DA 2FCRA 1T43A 2Q4PA 3FOWA 3W34A 1XDZA 3CLUC 4FPPA 5T3UA 3DBHA 3IE1A 1V8PA 3G2OA 2E6UX 3CE9A 4X7RA 2CUNA 4F3YA 1EUCA 5AW4A 2GM5A 4QSHA 3ZGLA 5I8ZA 3H04A 4LG1A 1USGA 3BH0A 2KSDA 3ASOC 1C8VB 1Z3IX 1QYWA 3NH9A 2FN4A 2PA0A 4FZ0A 2JHFA 1GITA 5BT8A 1UJBA 2EATA 2TECE 2VTBB 4EJSA 1Q0PA 2PUFA 1Q92A 5JR3A 4KAXA 4CM6A 2IJKA 3K09C 5JQGA 4AMVA 3V4FA 2FN7A 1G20A 3ZXXA 3ND7A 4JAUA 4JOQA 4JASA 1D9XA 2UVQA 2ZJFA 3RUCA 5EXEA 4WH0A 3BVPA 2NZ8A 3DO6A 2C00A 3WE7A 2X0FA 3QZUA 3LY9A 3UT6A 4TGLA 4E5SA 3V4LA 2DPYA 2BF4A 4TWRA 5DNDA 4LY9A 3TIXB 1HT1E 3ITNA 1IN5A 2A0WA 3T7CA 1B8NA 3DONA 4UNPA 3AJEA 4MRPA 1RQGA 1FSSA 4Z6KA 3W5DA 4TRRA 4OUDA 3MLAA 4YMSA 1WCIA 1KK0A 3B09A 4NE7A 3ZH2A 2HU7A 1G19A 3HEBA 4A8HA 3FWKA 4HVTA 2ZE5A 4XLZA 1ZR4A 1H9AA 5AM4A 2C95A 3ZWAA 3KYBA 2A9PA 4DEVA 3KAJA 1YE5A 4DR6B 1YAHA 3GFBA 5CA0F 1HTBA 1DAMA 2ZRNA 2R9IA 4IJUA 1FYEA 1OJHA 1JU4A 2EILB 1XAIA 5K5EA 4GF5A 4P3XA 1XNJA 2GXSA 3TG8A 1EWRA 2P9ZA 4XAQA 1YA6A 2ZVDA 3KETA 1E59A 4HLCA 4J3JA 4JTAB 1QTIA 3P27A 4G0ZA 4ZO9A 4LRTB 3ZS8C 2IUYA 4PQEA 4G1UC 4G25A 1W5EA 4MJ7A 3KZCA 1X8JA 4YGXB 3UQYS 3ZXUB 4OI1A 2ZAMA 4EATA 1UJ4A 4BV8A 1VQPV 3NPMA 3EIQA 3OZAA 5FNZA 2WYIA 1K2VN 5C7YA 5IX8A 2GSMB 4PLHA 3SIRA 3FNIA 1FX1A 4C4ZA 4GLJA 4JYMA 1N8NA 2AMYA 3D5QA 3D8BA 2Z5LA 2OBYA 1SQ0A 1DWQA 4MV5A 3BTOA 1ZJ6A 2IV2X 2IK8A 2RHCA 2O5CA 5ICGA 4LWOA 1Y76B 1YQUA 3R76A 1R2QA 1XZIA 3OQMA 5FUQA 2X0DA 2AUNA 3UCSC 3A2LA 1SO8A 3OHPA 1PQUA 4B6GA 3AVYA 3WLSA 1F7YA 1Z6GA 3BA9A 2Z2IA 4CL0A 3AYXB 3KM0A 1GN4A 5BN5B 3IIIA 1NU6A 1T1JA 2BHRA 2CNDA 1VLJA 3A4MA 3S2SA 4GYCB 3ML0A 2RGEA 5IWAB 3UATA 4EGJA 3K4PA 1IUOA 4GMDA 2CFTA 2HHJA 1G6Q1 5C5EA 2VP9A 4LNUA 3E8SA 2R1VA 1VPEA 5DNAA 4OB8A 3RKRA 3SQNA 2WYWA 5EGSA 2VDWB 2IH2A 1LI5A 3JQAA 5IF9A 3UWDA 1NR7A 3L4EA 2PXCA 2VUTA 1WBDA 4P08A 5A5GA 3P9XA 5ALZA 1G20E 4MUXA 1CWUA 3EGWA 3QUQA 2DTXA 1VCHA 4UBJA 4LF6B 4Q7QA 2GERA 3QPCA 4J43A 3UK6A 3AKCA 1WW8A 3TLMA 4BBAA 2QG6A 1QIIA 2MYPA 4BBPA 1ORDA 4FVMA 4LJ9A 3FTCA 4PSAA 1YAJA 4M9UA 4RIHA 3GUVA 1Z83A 1NWHA 3EH2A 3TXSA 1LK7A 1DJOA 2ZSDA 2ON6A 2RNBA 3D8HA 1CZUA 3GG2A 1Z2DA 5JNTA 1HE3A 1GSHA 3KQTA 2KB1A 2W2XA 4K6HA 1I4DD 3GLFA 2C97A 2LGWA 1O2DA 1I9CA 4RTNA 3TIGA 5IYCO 1V0JA 4OY3A 2KLHA 4XDJA 2Z30A 1V5GA 5D2CA 3RARA 3HJNA 2R7MA 1OKKD 1AH2A 1KYOF 2XUAA 3L71H 4Y30A 5ER6A 1JQ5A 3B9PA 1T9ZA 2C58A 3UJHA 5LQRA 2AH5A 4TVBA 3H4MA 2YTZA 1MV8A 1JDBB 1NUAA 3T7SA 1ISSA 1M93A 4JC8A 5ECWA 4Z9FA 4FYWA 4J0FA 2AZDA 5JV5A 4YY3O 1GTJ1 1INLA 1UH5A 3G5LA 3AZOA 1TUEB 3O93A 3JRNA 5ALLA 3R6LA 5JASA 2IVZA 2ONCA 3T9AA 3BL5A 1VMAA 5DI3B 3VHQA 2B30A 2YWGA 3BWDD 2ATIA 5JNWA 1TEXA 1O9BA 1CF9A 3RODA 4MI3A 4QBIA 3FBWA 2UXNA 2WWRA 1C9KA 1EZ1A 2YS7A 5JRJA 2QX7A 2C1EA 2VWJA 4NJOA 4C2BA 4NENB 1JG1A 3AEZA 1CK4A 5I9LA 4KXYA 2GI4A 4PLVA 2EX1A 1G291 4GCZA 4LHSA 4IS2A 3RU9A 3DCJA 3BMQA 4YJ2B 2BJWA 1OASA 3Q6MA 2JCXA 1KY2A 2RG7A 5M5BA 4DUYO 4KQ9A 1NYQA 3EXHB 2N47A 3O6VA 4UHCA 1ZCFA 2ISSD 5KYXA 1JMKC 3CGWA 3O4HA 3UHFA 2G0NA 3GDHA 2AC4A 4J6EA 3I05A 5JRZA 1LU9A 3E7FA 2AEFA 2DHCA 3BWVA 1AB6A 1FX0A 4YX9A 2F3QA 1RAHA 3SHFA 3WGYA 4PE5B 1BOOA 3OUSA 4EPTA 1FPQA 4CG2A 5DN6D 4KOAA 1QFZA 2XNHA 3AGPA 3L6DA 2P22C 1U31A 1T2NA 1U9YA 2OTJV 5J2UB 1TCCA 1IQUA 1GL9B 4ZDJA 1NBMD 3A31A 3K0CA 3Q3VA 1YR7A 4F71A 1IG3A 3EVKA 4RHXA 3RHFA 5L3QA 4Q9KA 2X9VA 2XTJA 1Q6IA 2I4LA 4AURA 3TB6A 4ZYZA 1T91A 2B1JA 4YMUA 1OBCA 1AB5A 2PFGA 1WY7A 1Y7HA 2VQ3A 3IP8A 2GEJA 1BE6A 4TM7A 1DPFA 3BWEA 3QLTA 1R73A 2X7JA 3NNNA 4U7GA 9ABPA 3CMEV 2DT8A 2CLDX 2PZKA 3G0BA 1OC2A 4OQLA 4BGIA 2QP3A 4I08A 1E9VA 1KP9A 2ZINA 4LKOA 1JAHA 2HRBA 4BIMA 4X85A 1IL0A 1DGQA 5DVZA 4DIKA 1QWSA 3F8SA 3A6KA 4W9NA 3GLFE 2RFLA 1I14A 5JZOA 4KVAA 3B3JA 1DC5A 4LP8A 1GL6A 1MENA 2A79B 4IOMA 3WG9A 1QDLB 3AEXA 3X0DA 2IXAA 5KYKA 1IWBB 5JVDB 5E1BA 4E4TA 2VZ8A 4JSYA 2OEPA 1N4DA 1QE3A 1ZW1A 3MYYA 4U9UA 2PANA 2FWNA 4TMXA 1KTIA 5CHEA 2J48A 2VDUE 1TX4B 2EFJA 3J81N 4OQMA 4QPDA 5EP3A 1S77D 4MV4A 3AL3A 1X94A 4KXRA 4M2LA 1KZ4A 1V39A 1E7SA 2VHUA 1N5DA 1VMKA 4FBMA 4BX9A 3JYNA 2CFOA 5DLQC 2YINC 3GGOA 4YJ3F 4BP3A 4BNIA 4KOEC 4PQFA 3K57A 1XZ8A 1T9GS 4RY9A 3PVSA 2HF9A 1KO7A 3FX2A 4KR7A 1PJ2A 3LDAA 4ZT7A 4E03A 2PFKA 2UUPA 3HPRA 1RFGE 2FH5B 3CRRA 5IY5B 4BWGA 2O2EA 3L7BA 2O2HA 1TYBE 1EGQA 4QOEA 1U3UA 2R8YA 5K51A 3KUCA 3RVQA 2YV1A 4H0FA 1Y5RA 2W6ID 1VPDA 3U4IA 4YRCA 1Y98A 5JG7A 2JAOA 3JQ7B 4V1CI 4B6JA 3BB3A 4BW9A 3R9KA 1JA1A 3COYA 2PKXA 3TVYA 1VIYA 2GYWA 2HH9A 2Q4DA 4PZLA 5AHWA 5KHGA 2IEYA 4R7CA 3QJGA 2FETA 3BWYA 1H0SA 2PBLA 1DKPA 4P80A 5AHKA 1I6LA 1Y63A 2O3QA 4F97A 2WAOA 3ABMC 3EX7C 2C7GA 3Q3GE 2NXNA 4JJ6A 4DSNA 2QE7G 4CN8A 4BC0A 3K5HA 3VR3A 1ESDA 4LHEA 3KELA 2Z1DA 3I1FA 3MN1A 1MEEA 4NK4A 1AILA 3TOSA 3R23A 5TQVA 5CW1A 3H5IA 3H11A 2P4UA 1P5ZB 1YHNA 1TA8A 3BREA 4PZAA 2JJYA 1CIVA 3OZEA 3ZWVA 5LD2C 4L3OA 3OLWA 3ORRA 3NORA 3E4DA 1AKMA 1B26A 3P4YA 1BDIA 1EHYA 1KVQA 4DV3B 2FN9A 3MTQA 1Z6XA 1T5HX 3DUFA 3SXJA 4FU0A 4P83A 2XASA 1E9RA 1A4XA 3W6UA 3DW1X 4XYGA 1UK6A 4KR3A 2A88A 1N36B 4O1IA 5E4YA 3TNJA 1BT8A 1C9JA 3KC2A 4MR8B 3P8ZA 5CHYA 4EG5A 1R9JA 4QUGA 2F17A 4L4SA 4PR0A 4CTMA 4HDSB 3MTBA 1XCJA 3CCCA 1TECE 3MBKA 5EIHA 1RBZA 2B25A 4JYAB 1JPVA 4IGFA 1MBZA 4EB6A 3RN4A 4YIHA 1E1RD 3IH5A 4BC1A 5KS2A 1KJ9A 1GPAA 4UVIA 3JQGA 4BIUA 2PWAA 1DC4A 2VFAA 4XZ3A 2X1MA 4CMGA 3Q0TA 1K66A 3MHPA 1S8AA 1FJXA 1AI6A 3KIPA 1ADFA 3O3CA 2GJAA 3FE2A 4MYUA 1OI2A 1NRIA 4OHMA 2Q5FA 3ZDZB 4ZI7A 4IRUB 4HVLA 1ELOA 3U4DA 3R6WA 1CR0A 4FYXA 1ICEA 3OM8A 5E3IA 2RKOA 3OH8A 3W8RA 1G1MA 5EXXA 2A7XA 2FDRA 4NQRA 4I8XA 1GNVA 1QOQB 2FQQA 4A36A 3B52X 3AK4A 4W6ZA 2VRCA 4G5GA 2QTVA 5CITA 2Q7XA 2WMYA 3F67A 2VP3A 4LK2A 2JGUA 4K8RB 4N41A 2NNUA 1RE0A 1UC5B 1FSFA 1E2JA 4A1FA 3E86A 2KBEA 2GEBA 4B6SA 2ZWAA 3RS0A 4QULA 2DBQA 3EYWA 4EFMA 3DOJA 5D3KA 3LHFA 5LSAA 1YR2A 5I9SA 4ZQBA 4RLFA 4DWWA 3ER8A 1DUVG 2ZD9A 2XV1A 4C6SA 3SJAC 1P18A 4ZOBA 2QM3A 4NXMO 1AQIA 1G21A 1FFXA 4IUDS 2C9OA 2BRUA 3PUYA 3RVMA 1EVLA 1DNPA 4YDHB 4DZTA 3B53X 5DEDA 4MQEB 2NP6A 4D96A 4EFDA 5T41A 1N77A 3KV3O 1JQEA 4YRFA 4NTWA 4P0PB 3DVAB 3LOPA 2ZRGA 4YH1A 4O4LA 2H85A 2ODBA 4DYVA 1GMGA 2O50A 3OX2A 2VJDA 3E1KA 1WA8A 5EPEA 2N0SA 2JEYA 2ZXUA 4A10A 3CH5A 4I55A 3OKFA 1F8XA 4I1UA 2NO4A 1ZN2A 2WT9A 1T3GA 4MIYA 2FR8C 4HGPA 2OSBA 1BS2A 3W7VA 3WYFA 1W46A 2FUEA 4BNHA 4AUKA 3DHWC 3R9IA 2QV7A 2AWOA 3QTCA 5AR1A 1DBQA 3ANNA 4UFPA 4A92A 4BBZA 1JP7A 2QDXA 1Z25A 3GHHA 4E1BA 5K2OA 3IESA 4EQ6A 2J67A 3AG4B 1E58A 3RG2A 2QZ4A 1RI1A 3KOZA 4B47A 3G89A 3STZC 4ARZB 4DF3A 4LF8O 4LN1A 2REXB 2C82A 2Y27A 2XGJA 5KNDD 4J6FA 1OVGA 2NU9B 3PWSA 4C29A 4L4XA 4J0DA 4J4HA 1OHHA 4B08A 4YMWA 4A5UB 1QF7A 1QZTA 3QBVA 1CKEA 5HFAA 1PJSA 2RBGA 2JK5C 1R8QA 1JQJC 4G27B 3TGUH 1E8MA 4JLKA 2H1CA 4HNVA 1IHOA 4YAGA 2QN6A 3KOUA 2YNMA 3MINA 4BO2A 4RLQA 5HR5A 5CBGA 4PI2A 1JHAA 3SQDA 2YIBA 1W4CA 1QXSA 4Z2AA 2PH1A 4MVYA 4BB0A 1FNBA 3NRCA 1ORVA 3EZYA 3OEWA 1JIQA 4DMRA 1EFLA 1EZVH 3VBEA 2QXUA 1JBQA 4TKUA 3K9NA 1V2HE 5ESXA 4UCRA 1NXWA 5ICSA 1L4YA 4BCCA 2RJNA 2P9GA 4PLCA 1NVEA 2F62A 1NXPA 2EF0A 1DADA 3LUGA 3G85A 4ZU6X 3OPYI 5BOVA 3EUEA 2IUEA 3TSAA 2ZBEA 1YZ3A 2C5FA 1JA0A 3HSSA 5FR2A 2ZIXA 3RYIB 3KJFA 2FUCA 5H70A 4F9EA 4LJKA 2AX4A 4UUBA 2VSNA 3QTLA 4IJKA 4Q00A 3TLAA 5EP4A 5DWVA 3WLNA 1ZISA 3OZTA 1MOFA 2J3LA 4CTOA 5DBEX 5FWNA 3INGA 1I2MA 3J81A 3U61B 1K63A 1GGHA 3TI9A 2WNHA 4PA9A 4YYEA 5TPZD 5I9NA 3BH6A 4QGHA 3IC7A 4MRMA 4RTMA 2HEGA 4F4IA 3NKFA 1JTFA 2F8MA 1G21E 4L50A 4GOND 1ZI9A 3DHEA 3OJXA 4B6RA 4AJJA 4B3MB 1ORWA 2IH1C 5CNKA 3LHKA 4FQ7A 4JSRA 3HXQA 1SCQA 5SV2A 4LFAB 3SOZA 3ANTA 2WTAA 5ILOA 3UFXA 1LR1A 4RJ2A 4AZ3A 2AI3A 1GPBA 3GMDA 3KZKA 4DR7O 5MDHA 3G17A 5GZ1A 1K4CC 1WXQA 4QQFA 1JFVA 1BU5A 1TT5B 3H6HA 2XRFA 2R5WA 1MAWA 1JL3A 2JLSA 2W22A 4GKKO 4ZQEA 3PGKA 2PMEA 2R25B 2VATA 3B8NA 3KUKA 1RWWA 1I10A 3ENWA 4BNGA 1C3LA 2XVYA 2DLCX 5BR8O 4M1TA 5M34A 3OGCC 3A1SA 3C6KA 3V1LA 4YCDA 4YUWA 3FPCA 2VRBA 1NJSA 5FBWB 2LQTA 4HB2A 1KSJA 1XP8A 4C0AC 5HQ3A 3Q8KA 2GPJA 2CGOA 1CDDA 1SH7A 1GK9A 5HA5A 2ODMA 1A9TA 1IM5A 1A95A 3SHOA 1SUWA 5DRTA 2Y68A 4DPKA 2H59A 5CMLA 4TQDA 2ZUEA 3ILYA 2ZXFA 2H1RA 1PTKA 2BDEA 1M1YB 3LDEA 2H1LA 3D8CA 3BMOB 4H4CA 2H16A 2O9JA 2D0DA 5F1OA 1W5BA 4MQMA 1G42A 1WP9A 4RA6B 3KR9A 2NV0A 4Y0AA 2FLVA 2FSGA 1G7RA 4C3UA 3ZIAA 3CH7A 1L4KA 3H5NA 3NDBB 2WD9A 1KA9H 1WR8A 3I39X 3M99B 1P77A 3WV5A 3O1LA 1O96A 5LZ7A 4CZZA 3FNBA 1OH5A 5D3QA 5JJNB 3G49A 1ARZA 3I2IA 3TH5A 3NOXA 1S02A 1S2OA 4L72A 4ZYTA 2Y0BA 1VQMV 2OBNA 4R8CA 4HRYA 1WABA 2F43A 2H4XA 4LI3X 5TLSA 3T4DA 3IIKA 2YWRA 3B13B 3AG7A 4PRZA 3FUCA 2EKQA 2CFRA 1SRRA 1RQRA 1I80A 4KE7A 2QHXA 1E32A 1XD2A 3OCYA 3L6EA 4CCYA 1K6MA 1PW5A 2C7OA 2G9QA 1WJGA 4X0EA 3OM1A 1PK7A 5LDDC 4KI7A 1AKQA 3OQNA 3OPNA 4PRKA 1BMTA 3AR7A 3JATB 4XVUA 4AO7A 2HXSA 5C4GB 2YS6A 1KKCA 4V0KA 4MUKA 4ZYXA 1P1CA 2OD2A 3GLKA 4J3FA 4K7JA 3QVUA 1L7VC 4WCFC 3MLBA 3OETA 1K5DA 1YB5A 3F6PA 3DEYX 4F84A 1ZGAA 4MJLA 2G71A 4DKJA 3JD0A 4L28A 2WWTA 3DXXA 4KXFB 4XARA 1CB0A 4XFKA 5GV8A 1U8XX 1Z4NA 3WQSB 4QOFA 3F6YA 5GVRA 3VUFA 5B7GA 5CEJA 1Q1AA 4A15A 2VAVA 3VR6D 1US8B 1MHPA 3ZYCA 1WXFA 4YCMA 2WOOA 4UCVA 5L53A 4XX0A 3NBAA 2HRCA 4B3HA 4FZRA 4G4SO 3F73A 4LF7B 3C6ZA 4RKQA 2ZJ7A 4OXRA 1PJBA 2PIDA 1T1IA 3HM9A 2MINA 3HFJA 2YVAA 2W6QA 4ES6A 3UG6A 3HJGA 2P62A 3I73A 2DWQA 3VSAA 4P34A 4TSFD 1V16A 4YECA 2ZAIA 4E2LA 4EVIA 2ZT7A 4MIKA 4OL9A 1XQWA 1ZM2A 3KKZA 1F0YA 1Q17A 4WOKA 5C1BA 3GVMA 4Q12A 2UYCA 1ZL8B 3KSDO 1DQPA 4II2A 4PELA 3LH5A 2B3DA 2X5NA 2EP7A 3HUTA 2C1ZA 4C4YA 1BH2A 2Z8ZA 2QTRA 3WJ2A 5F4ZA 2PUDA 3KOXA 4MYTA 4QYMA 2B36A 1R9NA 4X00A 2BI4A 2ZAOA 3TUZC 3R5XA 1IN4A 4YAFA 2QNIA 4AJEA 3VMFA 3OE7A 1PG2A 3FMOB 2QD4A 1AMUA 3FWHA 3GD7A 3O26A 2O57A 2VF7A 2TRSB 3X1XA 4BE4A 4XUGB 4PYJA 4IJ6A 3BN3A 1VSTA 1C9MA 4ZJPA 1XRSB 4KKXB 1QU3A 4I7EA 5BUCA 1UWLA 4RULA 3TW0A 3K9WA 4D92A 4W99A 2IIBA 1DHRA 3ZUGA 1LSUA 1QM5A 1A77A 5A3SA 5KWSA 4KV7A 1O95A 2V6JA 3F74A 5AVJA 3H16A 2DBYA 5DYTA 5ANRB 2DQKA 3L01A 3RD5A 1V5IA 4TT3A 3NW9A 1H22A 4DLLA 4TL8A 3DA8A 3FR7A 3C16C 4ERNA 1SVKA 1MO4A 1OCCB 3PI7A 2FUG1 4DLXA 2UZ0A 2A3NA 3QU4A 3OOJA 4S05A 2IS4A 4HSGA 1BS3A 1CDOA 4N76A 2FMHA 1BEUB 2IW3A 1YZLA 2GPWA 5J1TB 1KS9A 4MVJA 4H33A 4XFDA 5EOVA 5CDSA 5HX7A 3T9BA 3L43A 4MWZA 4JLOA 2BMEA 4BEWA 4AXXA 2ZW9A 5K0JA 4O33A 1DIRA 4B8ZA 5BNWA 5CJ2A 4NEHB 4IPTA 3DXRA 3WAKA 2JJ2A 3ZQ4A 1SHTX 2P78A 2ASVA 2RGYA 1HE2A 1JFLA 5DHTA 1TYEB 1CF2O 2JGKA 4BFSA 4GR9A 4BEJA 4IEIA 3CLRC 2G5TA 3I92A 2ITCC 2QA5A 4UTZA 3AVQA 3R4VA 5B3LA 3JVVA 1DV1A 5DLPA 4BEVA 1M6VA 4I4TB 4LBZA 1G8SA 2AJDA 1KK2A 4CQMD 3CYOA 4J11A 3HB5X 1FDSA 1O03A 3LD9A 3URMA 1LWNA 1GZHB 3LT5A 1QQTA 2EZ8A 4IT5A 4DA7A 1G98A 5A71A 4AJKA 1BWQA 1YKFA 4PC6A 3GJ8A 3K16A 1XU9A 1RMQA 5LQDA 4OP2A 2Y0EA 2O8DA 5L7WA 1L5QA 3CMMA 3T9CA 3IVCA 1KAHA 4FC7A 4NDZA 3VQVA 3DM9B 1ZMRA 4GZLA 4QVKA 3PC2A 2FZWA 1MG1A 3K1YA 4FCTA 3D31A 4H3KB 1WPBA 1I3MA 4W6QA 3WY9A 4MS4A 2QG9A 1J24A 2YC4C 2AOUB 1UZNA 3OBBA 5FWYB 3G3EA 3DEIA 2WM9B 3WLEA 5LZ9A 2CDRA 4TL6A 5KNBD 5F7OA 4CFYA 4BB5A 2VAXA 1KYVA 1IRIA 3N5CA 4CV0A 4P7GA 4C0LA 1RP1A 4MAMA 3T5CA 4FGLA 4UZFA 3C98A 3MJEA 5ERYA 3ZCSA 1PL6A 2R00A 3NOVA 4KBFA 1IZ9A 2PKCA 3MWKA 3PV0A 3VU9A 3H3JA 3BRCA 2PFSA 4OFZA 3FSGD 3CJHA 3BIOA 1NJ2A 3LCUA 2D1SA 2PY6A 3QUTA 2FJ0A 2AQHA 2PBFA 5JNSA 2BZ0A 3FYUA 1SHLA 2ZCJA 1KIFA 1HZJA 2BEWB 2X0KA 1W2WB 5JZ9A 1U9JA 4C7OA 4EO9A 3GVPA 3C97A 4IV0A 4ZVQA 2AG8A 2RN9A 4CH5A 1AKNA 1FTQA 1IJEA 1GZSA 3IKJA 4REMA 1TIKA 3CT4A 4GI7A 4KGZA 1VI5A 4JROA 4FZ5A 3ELYA 4CF5A 4CQLB 2ZI6A 3BXHA 2Z09A 1KY4A 1QUEA 5DBIA 4YONB 4CF4A 1DX6A 2JD0A 3IOMA 2XE6A 3RSQA 4BNLA 2GFIA 4UARA 5JNRA 4N65A 4N5MA 5KNCD 1EVIA 4ZEWA 2IGTA 2XNSA 4NBRA 3W7SA 5EJAA 3ITEA 4A4DA 3WGNA 3THXB 4LF4B 1BVRA 3K5PA 1HSOA 5TQ2B 4B7KA 1F9EA 4PAQA 3W4JA 3HWSA 2A7QA 3D6NB 4DANA 4JQOA 3E9ZA 3LSUA 4JI3B 1Q43A 1IEQA 3LSTA 4KQWA 4F1JA 4TV8F 4WXMA 3IAEA 5DV9A 3K09A 5DTMA 1Z0DA 5B1AC 5EI5A 1RWXA 2V9CA 2I7DA 4X89A 2BTQB 3Q41A 1YZGA 2I1VB 2C0CA 4LJ4A 3V6LA 1C5KA 1BDBA 1ZD8A 3IBCA 4CKEA 5LMUO 2J87A 2ZGVA 3EGEA 3BGIA 2YCLA 1CUJA 4GO1A 2KSQA 3AW9A 5AWFC 1EE1A 1PJRA 3EULA 3L6CA 1IJKA 2PMFA 1ZXLA 3E70C 3S8MA 1U8FO 2DFKB 3ZMSA 4MARA 4A6DA 5G4KA 4F2HA 1I94B 5EIBD 1M54A 3M6WA 4WLEA 1JEQB 4W5QA 3N86A 2NO7A 2P5OA 1VIMA 2I2XB 4NSNA 4NV3A 2CGNA 1FQKA 2RB4A 4XIIA 4CH6A 2BH9A 2YHBA 3G6KA 3LT0A 4O5AA 4UASA 2QI9C 4BCBA 1VHWA 1DC3A 1HQKA 4MP6A 1KXZA 2Q7OE 5KUTA 2HXYA 1AA6A 2VXYA 3DS8A 5C93A 5HNKA 4QL3A 1UJ6A 3EZ7A 4O1MA 2IC5A 5C7OO 3AR5A 5KPJA 1CQIA 3BYZA 4QBGB 2J46A 1Q15A 3RRZA 3II6X 3AERB 3ZS8A 2Y6UA 3P20A 3QVVA 5HJEA 4X61A 1V55C 3F6CA 4MI6A 1E1YA 3AG2B 5JS8A 2AK3A 1V54C 1H1TA 3U2QA 2KQXA 3LUFA 5D6NA 2QVBA 3VOAA 1YR9A 1VP3A 3K5IA 5CLLA 1E1QG 3A58B 4L8GA 3FSRA 5A6SB 3IAAA 3GJRA 2G72A 1E2MA 1M6HA 1M2OB 2OZPA 3OMNB 1S2DA 3RBZA 4MPDA 4Z9AA 2VTDA 1PR1A 5IBPA 3L46A 3R65A 1H8EA 5EUBA 1D9ZA 2RH5A 4XTCS 4RA9B 3B2NA 4IQ4A 4DUGA 1A9RA 2O2SA 4UPVA 4MGHA 4E07A 3GEHA 4MUYA 3ZHXA 4JAVC 2ZATA 4H0NA 3FCUB 2HMTA 3M4YA 1AJPA 1RM5A 1N5LA 1K7EB 4BMPB 1RM1C 2Z9CA 2K6GA 2FFJA 1Y3FE 3I8XA 4C7MA 4JTDB 3UOGA 3R1IA 4GPAA 1N3IA 4QM7A 3AL2A 4N6NA 1QHSA 2Q6TA 1XOIA 5ED4A 3T7KA 2X8AA 3O74A 5SYNA 1CZOA 3UHOA 4XCXA 3SYPA 3S1LA 1XYGA 1US6A 2P40A 5AOVA 2H2GA 3ZV3A 3CNEA 1XTVA 1GRNA 3LHSA 2FVYA 5EKDA 3OFNA 1U7DA 2X8JA 1CY7A 2BV3A 3Q5EA 1CR4A 2BCCH 1I5XA 3V48A 1ZAKA 1K8XB 4CT0A 1I6WA 2WUVA 1AHHA 4FHFA 1YS7A 1PDOA 1K7SN 2PE5A 4HBGA 3OTGA 3S3TA 3IURA 1Z88A 2E75B 3KKNA 2R96A 1T1RA 4I1RA 5AXCA 4FDVA 2HQRA 3D8SA 1NZ6A 5HCNA 2QAIA 5C34B 4Q3EA 4M3NA 3OMIB 3DCIA 2Q07A 4OGFA 2KHZA 4GI1A 4ZAVA 3FPFA 1TW3A 4UAUA 4KPUB 1PNQA 4X64O 2JZOA 3BSSA 2IOFA 3AEQB 1BCRB 4D7AA 1E1MA 1TF2A 1QBGA 3JV7A 1LI7A 1W93A 5CPBA 4UD2A 1JSXA 4F9TA 1Z18A 1KRHA 4RD4A 2NW6A 1GKKA 4HH0A 1T2CA 1FFDA 3C3BA 1X39A 5IJZA 4PHZA 3G1WA 2HLNA 1P5HA 4TYWA 2GRJA 1U7OA 4Y8VA 3VOSA 2R79A 4HAUA 2ZQMA 3V4PB 521PA 4JB0A 3GCXA 3SBEA 1EWTA 1UKEA 1XNQB 1SOWA 3IXQA 1Q21A 4D57A 1CE8A 3OI7A 3DEFA 3ASNC 3GYBA 1JUDA 2WB2A 3PX2A 2R6AA 1J21A 4ASUA 1Y8AA 2C98A 3ZH9B 2BFBB 1VQNV 2QENA 3SQOA 1ZN8A 2DP4E 5T8KC 1JLHA 2JVDA 4GG1A 1HYQA 1KYYA 1HWYA 1C4KA 5DEIA 2JEZA 3RRJA 4JODA 4L2IB 1NVVR 3ZU5A 4PBSA 2QMEA 4DILA 4F4UA 1QYRA 3TRHA 4BMDA 3S0JA 2X42A 3DFIA 3OEEA 1UKAA 3VH3A 2B7BA 2B8JA 5U9CA 3CH6A 3EC1A 3PP8A 3FUTA 3H2YA 4F4LA 4CMHA 3FPLA 1JOYA 1OB2A 1FYXA 3T5MA 4HZIA 1AUOA 2QTOA 1RJEA 1S0VA 4M0FA 3OT4A 2I54A 2Y0DA 4CM7A 4DA8A 2IY7A 1PIWA 3CLTC 3VHXA 3V1MA 5DNEA 4JFRA 3Q6NA 3VSEA 4XLTA 4A3SA 1EI9A 4KLAA 5SY9A 1UBLS 4MVJM 3OOWA 2BSQA 1D2DA 4Z5XA 1GTRA 1ZRHA 2OXFA 3ZCRA 3Q12A 4HEHA 1C3OB 5KAPA 3BPZA 3GLIB 2NZUG 4LOIA 4M0CA 4URWR 1SVMA 3HEMA 1WNTA 1TJ5A 4R83A 2J5QA 3A0RB 3FZQA 3DPSA 4CXMA 4LHVA 1AKUA 2P2SA 3M70A 1ZLXA 4IFEA 1JDZA 2G80A 1J49A 4YRJA 4NMHA 4Z51A 5EAIA 3GVCA 3LZDA 5B1DA 1NMSA 2WWFA 3QVKA 1RI4A 1C4OA 4FM9A 4CL2A 2GM9A 1WOMA 1GQSA 5K6RA 2ZDHA 1C0EA 4IZOA 2BKAA 2ZSBA 4ZZ0A 3VTAA 4RGQA 2D74A 2DBVO 2O59A 2GFQA 3KE9A 4TZ0A 3EN0A 2WLNA 3EXIB 3A0HZ 4Y6OA 2VF2A 1OXVA 1EK1A 3PKZA 1C1XA 5KX5F 2X6CA 4LY3A 1P3JA 4YAOA 1HYBA 4MQFA 1Y8RB 4ZVLA 1VCOA 1CRPA 4D9HA 3D6AA 3GPDG 4IO0A 4ML3A 4ZT3A 3N0WA 3PLAE 4GXNA 4B48A 3R7WB 3MQFA 4PZCA 3R3SA 1SBQA 2V98A 1E4YA 4BJHB 3NHWA 1GU0A 3UMYA 5FL7G 3TWOA 2F9MA 4J0JA 4QJ3A 1V11B 3DAHA 2CY0A 3ESDA 1EJ2A 2EGHA 1GAXA 1W75A 3CF2A 2C2ZA 1SXJD 2DQSA 1WKCA 5E7IA 3T95A 2IH5A 1UODA 4WEOA 1E4EA 1HOXA 1VDZA 2QVZX 4YREA 1L7AA 1NP3A 8ADHA 4ID3A 2JI4A 4X20B 5HTOA 4DWJA 4UBMA 3I5MA 1PX2A 3DZDA 1C30B 2OSVA 5KQMA 3PUVA 4I5FA 3RYTC 3CUKA 4FFWA 4K9DA 4HRXA 1MB0A 1G8MA 3CSDA 5E1MA 1RACA 4RVHA 3NHPA 3ZKWA 5E4JA 3G5UA 2X22A 1GCAA 2YV5A 4IM7A 5AVZA 3RS3A 2GJSA 3PYXA 1NW9B 4CIYA 1C14A 3KO8A 2C61A 3T7RA 4QE3A 2JGRA 1BHQ1 2QX9A 3BQMB 1QK4A 2A8YA 4WSOA 1UM9A 1OX4A 5KWIA 3NHBA 1KZ6A 1JEYB 5ADVA 3C1AA 1Y6XA 5EA2A 5E6UA 4COOA 2Z1NA 3S2YA 5HTKA 2WIBA 2ZRMA 4AKIA 1UBCA 3HN6A 1R0SA 1YULA 1NRWA 1CR1A 4K6GA 3O1JC 4OXQA 3V4RA 3NKVA 2PX5A 3X1WA 1H8HA 1TYDE 5IVHA 3BWBA 4FI3C 4IGAA 2Z95A 1MQSA 3EG9B 1TGYA 4QVGA 1QP4A 3FW1A 5FOWA 1ZD1A 3C6XA 5E9JA 2HMVA 2VP5A 2YV2A 1GFZA 4BNMA 4PXYA 5C32A 2H3OA 3A9UA 3BXOA 4Q47A 4IW3B 2UYYA 1PUXA 5INTA 1JTVA 3HJRA 3OQPA 3E61A 1D8TA 3QV2A 3JARB 4KRFA 3FTFA 1HKUA 2AXNA 1F2DA 4BNFA 1V9CA 4TSKA 1J70A 2XMPA 5KTSA 2YYSA 3FDXA 4EO4A 2P30A 3BCCH 1QRDA 3DTVA 2QM8A 3OUZA 4QQKA 1SR8A 1VHQA 3FLBA 1E63A 2IPOA 4Y6SA 3OC0A 3UIEA 2HIAA 5IC6A 4N48A 4B45A 2LW1A 4YALA 5TPWA 2H94A 1QGOA 3H8JA 3H9UA 1ZA2A 4NESA 4LTMA 4MWDA 2XTZA 4Y1RB 5MGNA 4WXPA 3FFAA 4ILEA 2HA5A 3KPJA 3SX4A 4GMXA 3ZDYB 4BWYA 5B6IA 3ZC3A 3VSBA 4JI0B 5H2FZ 2BBTA 2YBEA 4MYDA 4G5HA 1PZGA 2WZBA 4F45A 3C7DB 2ZYDA 5IDJA 3KPVA 5B3JA 3T54A 1MC8A 2HWWA 3ZVKA 3T12A 2D5IA 1F14A 1DPGA 3L8ZA 3IEKA 5C52B 1FJGB 1ZJZA 4M99A 1KK3A 3NGLA 1F0KA 4GMGA 4HD8A 2J8ZA 5IYZA 2HPZA 4L51A 4KK4A 2XCUA 3MOIA 1IZZA 2GV9A 2ZRQA 2UAGA 1D2GA 4ZTZB 4N82A 4LX0A 2RHLA 4CV1A 4JBHA 4GVXA 4URUR 1U65A 2DPHA 5JSZA 1U3CA 5FEUA 3EVFA 3GGPA 4ZPXA 4ZQCB 3WI7A 4DLBA 5IVPA 3IV7A 1IULA 1YDXA 3LY8A 2HKOA 4URVR 3KYIB 3A3OA 4W8GA 5GONF 4FN5A 3PEFA 4HAZA 4ZCIA 4JUAA 4G2KA 4Q7KA 1XTPA 1QCZA 3SGLA 5LYJA 2P2ZA 1XE3A 1QZ3A 4KGVA 4ZZ2A 3FKSD 4G28B 1EFRA 2HK8A 3P7MA 5F9MA 4B6QA 3EVZA 4Q4HB 3SJAA 4O4JB 4ZICA 1HW7A 1FFGA 2A0FA 1DF5A 3DVQX 1SVWA 1I0LA 3WDKA 2P7TC 3IT2A 2ZBUA 3NC4A 3T5PA 3L6OO 2QWNB 3EWSA 2ZJ5A 2Z9BA 5DASA 3JQ8A 3K70B 1X7WA 3DZHA 1MJFA 1NF2A 4IDPA 4O4HA 1QV7A 5AVXA 3B3QA 4EK9A 1Z17A 2VOJA 3JQ9C 1BMDA 5HKLA 4EVSA 2Y9PB 2MMCA 4Z7JA 1H69A 2OV3A 2CK3A 3A4TA 3FMVA 3STLC 4WFQA 3AHHA 5ALVA 3MMPA 1SQPH 4V24A 4CUJA 2FR8A 5FWXB 1Y1LA 1SIBE 1KNQA 1X1RA 5CGQB 3M81A 5CYOA 1DG9A 5KTPA 3ZHOA 2P11A 4YGYA 5CLJA 2ZYUX 2M2IA 3I9MA 2GEDA 3IAS6 1XF1A 5KWEA 2JZNA 2RDCA 4IUCS 2IYYA 2Q2NA 3QKRB 2BTEA 1RWVA 2Y67A 3FTQA 1YBHA 1POXA 2FW6A 3D6UA 5KDOA 1AMOA 4BLTA 1L6IA 1P73A 3MGBA 5L3FA 1NVBA 1XFDA 4R51A 4YR7A 2PGLA 1ULAA 1OXKB 1ZK3A 2QTMA 1K5HA 1TKRA 1CY8A 3M7MX 2VNAA 4CM4B 4MW9A 3UK2A 3N2EA 1KI9A 3BWCA 5IJXA 5A7HA 1GVHA 1H2XA 1NRXA 1VGQA 2O4CA 5BWCA 1YDHA 3RK4A 1LTKA 1Q6UA 1PRYA 2CUKA 4QXQA 1JB9A 3K9QO 1EA5A 4TPKA 1F8UA 2A1UB 4BZPA 2JEXA 1P2DA 1KVRA 4GH5A 3DV2A 2YC2C 4P38A 1BQZA 1TQ6A 3SNHA 4NJMA 5EXTA 1B00A 1YFLA 4EYQA 4DK0A 1ISRA 5F77A 2Z83A 1FPOA 1PT9A 4KN8A 3ZRWA 3R7LA 2AFVA 2WHPA 4NPAA 2PS9A 3A9VA 2YEVA 4FUQA 1ONPA 3INTA 3LU1A 4M6WB 4FYYA 3L7LA 3Q7PA 4MS1A 1SBYA 3UGJA 3B70A 2G4LA 1BYUA 5DM60 3ELBA 2C4MA 3G0GA 4ZARA 5H5JA 5B4VA 1TA0A 1VIBA 2W6NA 4V3CA 1IY9A 3UV6A 4OYRA 5A06A 1WEHA 3KQHA 1X7XB 1E3QA 4R84A 5TGZA 3H1IH 2YQ5A 4EY4A 2Y4NA 3T8YA 1U8UA 4Q4AA 2GJKA 1KNXA 3MWGA 1ZIOA 1XMOB 5E3JA 3LRTA 2G7MC 1E9DA 3HKBB 3DAGA 2CJPA 1GKFA 4ZQHA 4B3JA 4Y1FA 4CDGA 2ZXWC 5DMHA 1FYVA 1BAPA 2IYFA 2EBHX 4UVAA 1L4LA 1PK8A 2HF2A 4K6OA 3F3YA 2VNJA 5JAHA 3BJEA 1SUEA 3B6ZA 1Q95A 1I3NA 1ZITA 4IJ5A 3EGXA 1X2BA 1CY2A 2WJIA 2WFLB 3ZLUA 1RRVA 5DNYB 4JMLA 1SPBS 1W2HA 1LW7A 1ONOA 2NN4A 4NEGA 3VR0A 5J59A 1A9SA 1P60A 2OCXA 3IDZA 3ESXA 1U0JA 4EMBA 1AZLA 3LGSA 1NBAA 5A4MS 2JFZA 3ULKA 3HGMA 1PQWA 4PYIA 4F1KA 1KAQA 2P1ZA 3HNOA 5C8YB 4CJXA 3GLSA 4ENVA 4AY2A 4W7SA 5FB3A 5HS6A 1LF5A 2Z0AA 2OHOA 4FFDA 4RPJA 2J41A 3ECCA 1CB7A 1OU0A 5KYVA 1TUGA 4ON9A 3HB3B 3EEIA 2X6AA 3QP9A 1FYDA 5KOHB 2R1TA 2H2HA 3L0BA 3Q8LA 3NNDA 2CJXA 1IHUA 4WZBB 3ZYZA 2J6IA 2QLBA 4BO0A 2WUWE 4FN4A 1XRNA 4WZ6A 3GPIA 1J99A 2JARA 2PVSA 3ASUA 4J1NA 1YWGO 4G1BA 3VYVA 5DF1A 3LLCA 3FVTA 5DHFA 4OQYA 3PQFA 3D8TA 1DDOA 1WVMA 3VOBA 1U1EA 1CLEA 5EXSA 3CCQV 2GN6A 1DGSA 3TIVA 1I4OA 2H8KA 3GLTA 3T3OA 2XB9A 4JITA 1T5SA 3W6OA 5EJ9A 5CTJA 2XOKG 1JWBB 4N3AA 1IMOA 4U7NA 4KQMA 1YKGA 1KFEB 1MLDA 1N9KA 4XD7D 2A0XA 1Y1RA 2Q45A 2Z4SA 2VHZA 3HCAA 3WAGA 4Y9DA 2PS1A 4HKTA 5B12A 3S2UA 2EQBA 4XIYA 3A6PC 4WECA 2IIQA 5CVJA 3KP1A 4AWXA 1NDUA 3U49A 4L07A 5FJJA 3S1AB 1CRLA 4ZZ3A 3HXPA 4ENRA 2G67A 1ENZA 3ZCUA 2UZ1A 5DYIA 3KZMA 1PV2A 3H9EO 2O23A 2JB9A 4JL5A 1NU1H 4R0NA 3OT5A 4Z1MA 3W78A 4EWLA 4H4EA 2EWWA 1HNZO 4YXWA 4YASA 3ENNA 4TKVA 3GC6A 3ZXIA 5IEBA 4MIEA 4IYHA 4NAUA 1YS2X 1E5DA 5WRFA 3DJYA 5JD5A 1VI6A 2GVZC 1DXQA 3GLUA 1JG4A 3JVDA 3MW8A 1F12A 2JFPA 3N2LA 1HL7A 1XMPA 3KOYA 4B83A 2BZ1A 3G7SA 1XEWX 4JB2A 2WKQA 3G1UA 4RF3A 1BWSA 3DLCA 4DC9A 1BJTA 2HK6A 1XZAA 4P0TA 2QUZA 3GVXA 2FK8A 1ODKA 3HY4A 1ORIA 3AKYA 1RPJA 1NQ5A 2HK7A 1FMJA 1CIJA 5FO0A 3LVRE 4WCFA 1Q7TA 2RGCA 4GKVA 5HSGA 2QTBA 1OLSA 5HRUA 2VAMA 2I8LA 4HPWA 1MVOA 2JFGA 4GX5A 1LDBA 1KZHA 4YCBA 3GV0A 3A9WA 2DJIA 4PO1A 3DHNA 1T36B 4N39A 3QLEA 3IAUA 1XMXA 2XMZA 1W88A 2VQDA 2RHDA 3HCWA 4UUAA 5C80A 5HYVA 3P0IA 1WS6A 2SECE 5F52A 4Q7LA 3HU1A 1GUAA 3EY9A 4BZXA 4HN4B 3MSCA 4D8UA 4C3VA 2VP0A 3CZ5A 3EGVA 4F3KA 3WYAA 3GU3A 4A91A 1RADA 2OA0A 4BRWA 5BOSA 2FKNA 5IG2A 1J1IA 2VJKA 4MHTA 1EFTA 2F48A 2PSEA 5LPNA 1ID1A 5HZKA 1OILA 1UWKA 2UV8A 1ISGA 3MFQA 2IY8A 4LZNA 4BVLA 3A0BZ 1GAWA 3STWA 2AB0A 4EEXA 4RVOA 1X7DA 4KEAA 1KS2A 3NWPA 4ID9A 4HL6A 1GQOA 4AU1A 3M4XA 3ICEA 2J09A 4AZ0A 3QKSB 4TMZA 5DTRA 1DWPA 1XVAA 2Y05A 4DJTA 2ODNA 1XNRB 3FCSB 2P0AA 4TT8A 2Q3BA 2W71A 3NHFA 1LUVA 4EUNA 3CEAA 5KHLB 4LWSA 3DOEA 3SSMA 4DTIA 4DOM