1QR8A

Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVRGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 ENVELOPE PROTEIN
publication title Inhibition of human immunodeficiency virus type 1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion.
pubmed rcsb
molecule tags Viral protein
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qr8A00
1F23A 3H01A 1DF4A 2OT5A 3GWOA 1EBOA 5CMUA 1QR8A 1Y66A 2P6JA 5HFMA 2M7WA 1K33A 3K9AA 1QR9A 2EZOA 3M99B 1MOFA 2EZPA 2LP7A 5H9CA 1ENVA 5HFLA 1MG1A 4N21A 1JQ0A 4JF3A 1SZTA 3B8NA 4N23A 5CN0A 2MK3A 4FIPC 3P30A 1I5XA 4JPRA 5KA6A 1QBZA 1DF5A 1QCEA 1Y4MA 4G2KA 4E2LA 3B8MA 3CP1A 3B77A 3WFVA 1I5YA 3CYOA 2EBOA 4FK5C 3MHSC 1K34A 1JPXA 5KA5A 2X7RB 4JGSA 3MHHC 4FJCC 1DLBA
chains in the Genus database with same CATH superfamily
4W4KA 2LW1A 2E76B 2XOKG 4GX0A 4E4EA 2YUAA 4QIWF 1M90W 4AQYO 3G67A 1I08A 1M4UA 3SJQC 1CEZA 2HLDG 5C93A 1P7BA 1Y74A 2M6YA 3W7SA 4YJ2B 5KHHA 4HZ3A 2WA3A 3X2QC 1WNSA 5LP6A 5KMGA 4LFBB 4DV3O 5LMNO 3B40A 3D3IA 4PA4A 3JCZA 1K5QA 3EFFK 3Q4HA 3ZHSA 2JJ2G 1PNKA 3BPZA 3QO8A 3G80A 4JI3O 1AR1B 2WLIA 1BCCH 3F7YC 2AW9A 3S3WA 3ZMSA 4RQEA 1YIJV 2W6JG 2QM7A 5LHIA 2F4VO 2A7WA 1I7FA 5FL7G 2M7WA 2XHBA 3BVOA 3ZJZA 2EIKC 3B4SA 3FYEB 1YI2V 3ETEA 4PA3A 3B8NA 3AG4C 1YZBA 2ZDIA 2XNDG 3UKMA 1AP5A 1XL6A 4UB8Z 1XNRB 1LR1A 2ZIMA 4CH3A 2BTQA 4DV2B 1AJQA 4YIOA 3L72H 1F4MA 1I0HA 1R3LC 1H2LA 2F23A 3IC7A 4WFAV 3L71H 2YICA 1R3IC 4I4TA 3TJTA 4QJFB 4UVAA 2Q7GA 4O2AB 3C90A 2Q7HA 4X20A 2B9ZA 4LFBO 1Q43A 4NKGB 3A0BZ 2NLJC 3T4DA 3HKDA 4UV8A 2IU3A 4OGQB 2QM4A 1K33A 4LNUB 5C8YB 4DR5B 4PA7A 4UCOA 2V7QG 4LFAO 2DMXA 4I55B 3OFNG 3TCUA 5JVDB 1WA8B 4QE7A 5JCOC 2Y4UA 4LH6A 1F51A 1NU1H 1JPXA 1K92A 2JGUA 2DJVA 3SYCA 4TUYB 3JSNA 3L9DA 2HEPA 1SRYA 1NZ6A 3O9OA 2QTOA 3M99B 4X1IB 2LP7A 5EC2C 3M7MX 3FFQA 1XNRO 2OTJV 5EIBD 4ASUG 2MK3A 5ITZA 4PJ0Z 4DV2O 3DC6A 1NTKH 2ZM6B 4B3RB 1BHBA 4PELA 4X89A 1THZA 2Q68A 5CB4A 2WA4A 4ZBMA 4K0KB 2EZOA 5KUKA 1KECA 2O57A 2AZ2A 1HP8A 1SQPH 1WP7A 2IJHA 3TXSA 1SF9A 1VQ5V 3AG2B 4Q6GA 4DR5O 1P49A 4CS2A 1K7DA 2VS0A 4FVMA 5CBGA 3GWOA 2E75B 1LNQA 1NJIW 3AG3B 1TUBB 3EVKA 3H1IH 3U11A 2QKAA 1Q7YW 5LL6Y 3HB3B 3CCUV 1SC5B 1SZTA 1EZVH 2QEXV 3H1HH 3THOA 4PI2A 4B3SB 2X6CA 4G2KA 3ZN1A 5LHGA 2EINB 2YIBD 1W2BU 2B1GA 3UM7A 2F93B 1YTFD 5CMUA 5LHHA 4CC5A 2JS5A 2ZM6O 3RW0A 5K1PA 5J2TA 4GUNA 4B3RO 1KUQA 1VF6C 4YHHB 4DV4B 4KP4A 4JYCA 3W7XA 5IJ0B 2WPDG 5IWAB 3N2GB 1QHTA 4K0KO 1BMFG 1JJ2U 2VRZA 3E22A 3CMEV 1XEQA 3DSQA 5CA1A 5B1NA 2W0XA 4JTCB 3ZMTA 4GX2A 3MAQA 4B3MB 2RQ6A 1HNZB 3AG2C 4I50B 2QR4A 5KUMA 4BIZA 1K73W 1QQCA 1FFTB 2ZT9B 1EM1A 2Z5UA 4X1KA 3CC4V 2R72A 1JX9A 4CH4A 2GDSA 4MVZA 4J10A 3F5WC 2N04A 1ZSPA 2D2CB 2EINC 3BA8A 3BABA 4N21A 4NR1A 3L73H 1U96A 4PV1B 4JTAB 3K03A 3KCXA 4IIJB 2Y48A 1FXVA 5KHGA 1NTZH 5FLXN 3CP1A 3OTOB 2XTAA 2GSMB 1WB8A 1QNMA 3T1HB 3H1KH 4YHHO 4DV4O 5LBQA 5A2QN 3L75H 5GONB 4DR7B 3J81N 3GVMA 2XUMA 1KYOF 1YVWA 1VMGA 2UU9B 4GCZA 4XBFA 3BY6A 3RYFB 4LWSA 4FIPC 2H3OA 1EFRG 1W0JG 4B3MO 3RBZA 1FD9A 1AILA 4I7ZB 1VQ4V 1HNZO 3AG7A 4CS3A 3A0RA 3K5LA 1WA8A 3ABKB 3F5TA 1KP3A 3JASB 1JCHA 1BE3H 1K9MW 5BMVB 2ZKOA 2EULA 1UPGA 1MSWD 1QCEA 4JI5B 4KFMA 2P7TC 1B04A 2QSAA 3QVNA 2YEVB 4ZOLA 3HPLC 1NKDA 2A06H 4I0XB 3PN1A 3BA9A 3OTOO 4DRXB 4FLTA 4O4HB 2IM9A 4PDVA 3APOA 4EEQA 4MTXA 3WB1A 2W0FC 1HWYA 2CGOA 2ZR2A 4X88A 4DR1B 2ZE5A 4NTWA 5EBMC 2UU9O 4TSFG 2LJ2A 2EIMB 3AK3A 4JYYA 3ABKC 1ROPA 1BSMA 4FMTA 1Y74B 3CE2A 3FYIB 4AI8A 3SYPA 3LSQA 2BOCC 5LP6B 2YIBA 1MZFA 2DE0X 5KMGB 2OT5A 3QF7A 5EK0A 2KSDA 1MA1A 4JI5O 3STLC 1LUWA 3Q4HB 2WLJA 4MVUA 4X62B 3ZMUA 3P3NA 3ZS8C 3NR7A 3C3SA 1KKDA 3N2GA 1Q81W 1VQ8V 2KQXA 3E35A 3SPHA 3JATA 1VQ6V 1A32A 4DR1O 3SJBC 2HG5C 2ILMA 5IYDO 5CBFA 1D5NA 2YXLA 2VQFB 2QWPB 2CTQA 3CRCA 1L1FA 5GTHZ 2CAZC 1K34A 5LA6B 3IAYA 1GH6A 1ZTEA 3CCEV 2GTAA 2IBZH 5LP6C 3W7WA 2DYSB 4FLYA 4X20B 4GKJO 3RWRD 1M5IA 4EFBA 3CCQV 3BHPA 2UUCB 4Z2WA 2P5OA 3HKDB 1F4NA 3T1CA 4TV9B 4NXNB 2F1MA 4X62O 4A5UB 2W6IG 3G4SV 3CJHA 3G71V 1BT8A 1NH2D 3CPWU 1VQMV 2BTOA 3OGCC 1QVGU 1O9GA 2UXDO 2R9AA 4NTYA 4YY3B 2ZDIC 1XQ8A 2ZXWB 3SYOA 4MTOA 5J2UA 2VQFO 4FLZA 1OJHA 2G38A 2LGWA 3OGIB 1AJNA 5ITZB 4KUMA 5B1AB 2A3QA 3T4ZA 1KMIZ 5DECA 3DXRA 5BMVA 3LDDA 1OCOC 2LGQA 1Y4MA 5B3SB 5LMUB 1G4YB 1EN4A 2HJDA 1G6UA 1XILA 1N32B 1Q6IA 3B2EE 4FJCC 2DYRC 3SPIA 2YXHA 4IYHA 1GKFA 2PGGA 1W59A 4J7ZA 1VF7A 4PHZA 2DQ3A 3K59A 4MTGA 2UUCO 1AB3A 1FPOA 1S77D 1KP2A 2WLKA 1UJWB 4GKKO 4NXNO 3JARA 5H6RA 3CXHF 5KAIZ 1BHAA 2Y0PA 5CBHA 4RAIA 4UXNA 4FZ1A 1SQVH 1N36B 4NVPA 5HFMA 3K58A 4UCTA 2CH7B 2CGNA 2LFSA 5B1BB 4MT8A 2ZXWC 3GB7C 4YY3O 1MZEA 1TA8A 1GN6A 3CC2V 5EBLC 5B1OA 4JTDB 4FPPA 1XOUA 1GK9A 2P4KA 2QJ1A 4TOIA 3TK1A 3FB5C 5IJ9B 4LF5B 4U7OA 5J2TB 1GRJA 5A9GA 3A0HZ 5LMUO 2DWEC 3E86A 2YC0A 1N32O 1BGYH 1OCRB 1Q90D 2P22C 4R7CA 1JOYA 3E22B 1OCZB 2GHYA 2UXNA 5CA1B 2WLHA 1SQFA 4LFAB 1Z2GA 4GT1A 1JA8A 4AHCA 2CDYA 1KC8W 3FB7C 2NR5A 3P30A 4X1KB 5JQGA 3EXAA 4DR3B 4JYBA 1N36O 5B1BC 3SJCC 2NN4A 1VQ7V 4J7KA 4U3FH 1UFIA 2ARHA 5BZBA 4X66B 1Q6HA 2JK5C 5LA6A 2CK3G 5KAFZ 2Q69A 1GN4A 3HKBA 4BR6A 3HKEA 1FKAO 4J41A 1I5XA 1M1KW 3KZIZ 4LF5O 2FKXA 5GW7A 3ASNB 3CYOA 5TISZ 1OCRC 2AXTZ 3QTCA 2OIEA 3ABUA 3D3QA 3ZHUA 1N8RW 3SYQA 2HHHB 1JVMA 2L35A 1QR9A 4R6ZA 1AI4A 4TV9A 3JD2A 2Z3YA 4WBNA 4LWSB 2XASA 3CWBH 4GLXA 2ZIOA 1M57B 2PYLA 1XMOB 2GUZB 4RWUA 2KG7A 2X7RB 2Q6AA 1BZKA 4BW9A 4G27B 4UVCA 4W4LA 4DR3O 3JAMN 2IJKA 2VWKA 3FD9A 3QO7A 1JFFA 2RDCA 3R66A 2E74B 4D7TA 4X66O 3OR7C 4WFEA 2HVKC 2ADQB 4ZOLB 1AVMA 4OXSA 2RN9A 4JI6B 4RO2A 4JGSA 2YSUB 1IURA 1DLBA 3K5NA 4RUFA 1TAEA 1Y67A 3L74H 3ASNC 5K1XA 2KB1A 3W7UA 4DW1A 2XAJA 3AK2A 3UO3A 1GM7A 5L3EA 3I5DA 1CXZB 4X65B 1I94B 1ZX3A 1DK1A 1T5EA 4H37A 2HHHO 3IJ4A 2GTSA 4X8AA 3ETQA 1M57C 1PNLA 1R6TA 1VQNV 1XL4A 3BFRA 1XMOO 2CH7A 3J7AU 1Q3EA 2ZD9A 4F6EA 2Q5ZA 4K35A 1S5JA 4LF8O 5EIBC 1GN3A 1EZJA 1H2MA 4O2BA 2RMKB 4IL6Z 1YTFB 4ZHQA 3CX5F 4EB6B 4O4LA 5IJ9A 1NBMG 1XHZA 2ZE8A 2PTMA 4WCEV 3E8FA 4JI6O 2ADPA 1YSCA 1GMGA 4F6RB 1GAXA 5IDJA 4HNAA 1IBLB 1D5AA 1ZAUA 4F4LA 2JS3A 1KKCA 1FAFA 1NVPD 3MHHC 5LGTA 3JATB 1FXKA 2DOSA 4X65O 1I94O 1L8DA 4EKWA 3VQXA 2HR3A 1OCCB 2VWJA 1U97A 1YJNV 4JI8O 5KLVH 2E3CA 3AG3C 4FM1A 1WN7A 1MSDA 1H2GA 1VIBA 3B8MA 2X6BA 4YXWG 1R3JC 1AR5A 4BW5A 1V9PA 1ZWIC 3WFVA 5IYZA 4BIOA 3T2MA 3AG1B 3SR2C 3KCYA 2X0LA 2ZNJA 1QLEB 2R9RB 3OM3B 5IT9N 1W0KG 4J42A 3ZEDA 4O4IB 2YDEA 3CCVV 2Q67A 3IFXA 4JYAO 3ZRWA 3AK1A 3JAWB 2UXBO 1V54B 4P2ZA 1S5LZ 2DW4A 4BIUA 2AHZA 3CJHB 2AHYA 4UCSA 1IBLO 3RGBA 4TWKA 1SS3A 2HKOA 2YI8A 1JJOA 2ODMA 4DUZB 1Q8IA 3BRCA 1OCCC 3RFRA 5J2UB 1CP9A 1R1BA 1R3KC 1VQ9V 2GUZA 1RM1B 1IXBA 5BXZA 1LUVA 3ZHVA 4TQFA 3B09A 2Y0IA 3JAKA 3AG1C 3DXRB 5L3FA 1JQ0A 5EZYA 3E8HA 2DQ0A 1QLEC 1P84F 1PKXA 1WPXA 1QVFU 1GN2A 4PDMA 3GWKC 2ZQMA 3CXCU 1RPOA 4OPHA 4JAAA 3WG7B 3AEIA 4JI2B 1WAZA 3OMIB 5JJNB 4HYOA 2XAGA 2WWWA 3A2FA 4DK1A 3JARB 3OE7G 2CTRA 1KBHA 1R6NA 4DK0A 2ZE7A 1QU7A 1IBKO 4JAVA 4JZGA 4CH5A 2PYJA 4UCRA 1N33B 4DUZO 2PI5A 4G28B 4P30A 3K5OA 3ABLB 1RM1C 1KB9F 3JD3A 4MW8A 2UXXA 2P4VA 2JJ1G 1WB7A 4FK5C 2CTWA 4R50A 1ZL8A 3OT7A 4UB6Z 3DC5A 3IGAC 5DEDA 4GKJB 1AJPA 3RT3C 3I55V 3CRQA 2H8PC 3WG7C 2VQEB 4EB6A 1XUQA 1EN5A 4JI2O 2QE7G 4X1YB 2Q0OC 5FPRA 2OCHA 4F6RA 2K9PA 3K04A 1FS0G 4MVMA 3U10A 3VQVA 1KD1W 1VARA 3TETA 3DTUB 2UXDB 4B7KA 1H2KA 4LF6B 1P4RA 2WSSG 3I56V 4TV8B 2C2AA 5JQGB 2ZINA 5CN0A 3UT5B 3OMNB 1ORQC 1N33O 2EIMC 3UO2A 3LSSA 3WB2A 4K8ZA 3ABLC 3ZHQA 5KA5A 1NI8A 1VQOV 3JD1A 3G6BA 3HKBB 3HKEB 5JH7A 3OTFA 4D7SA 2BE3A 2UUBO 5BR8B 4I9QA 1SETA 4JF3A 3CRMA 5KA6A 1JMKC 1OV9A 4O4IA 3APQA 3E8GA 3FAVA 2VQEO 3JAWA 3E2EA 3N2KA 2IH3C 4X9QA 4C7UA 4LP8A 4XDKA 1Q82W 2YI9A 1YXBA 1EBOA 4GKKB 1QR8A 1S3JA 1VP7A 4WBNB 2ZR3A 2QWQB 5H9CA 1E1QG 1NH2B 4YJ3A 5B5EZ 3OW2U 3E89A 4DUYB 4J80A 3SGIA 2FMLA 1Y6XA 4J9YB 1QBZA 4MTFA 3W7TA 2ITCC 2F95B 2B1IA 2DWDC 2KG7B 2N05A 1AI5A 4LF6O 3A8TA 1NS1A 3K79A 4ZI7B 1S76D 2OWOA 1JFFB 1M9NA 4PDLA 3UQ8A 4K8XA 3QG5A 1S72V 2IJIA 3N27A 5GTIZ 3OEEG 2FL4A 4GX5A 2EX3A 5DN6G 1WLEA 2DYSC 4FM0A 5BR8O 2Q8VA 4DYLA 3FX7A 1MOFA 4CH6A 2PZSA 4CBCA 3OMAB 2MW2B 2HVJC 1GM9A 4QPJA 2QTSA 3X2QB 3SPGA 1O9HA 4DXWA 1ZLZA 2BSKA 3CRAA 1BL8A 1SA0A 1GM8A 4DV0B 4DUYO 2UXCO 2LW7A 2DN9A 1Z5VA 3JD4A 3EHBB 1N4CA 3K9AA 3ABMB 1HNXB 1L0NH 1SKVA 4JAUA 3HKCA 1AI7A 1DGSA 3D36A 3SJAC 1F7YA 3T1YB 2CTPA 3QO5A 4O2BB 1I5YA 5B1AC 4QGPA 3ZBHA 3OD4A 1YF2A 4ZHQB 4I5SA 3CB2A 1YEWA 4O4LB 1PM9A 4H13B 3AG4B 2Q7EA 1YJ9V 2IH1C 3DGEA 5B3SC 1ZUQA 4DR4B 5HFLA 1YHQV 3BCCH 3HR0A 4JI4B 3JALB 1URFA 4HNAB 3CS5A 1FFXB 3STZC 2OTLV 1TVKB 4H0LB 2CUGA 5CA3A 4B3TB 4X1YA 3SPJA 1YCIA 4FLWA 1BS3A 1IX9A 4O4JB 1FXKB 3LSUA 1IXMA 4TQDA 2EZPA 4MVOA 4UCUA 1H2SB 1HNWB 2D3OW 4DV0O 4TV8A 2FB5A 4IGGA 3LUTB 3ABMC 2ETNA 5JWPA 3UT5A 1HNXO 5IYZB 4NTXA 4EFEA 2EJRA 4JI1B 2OIGA 3OR6C 4QPKA 1FXHA 5LGUA 3T1YO 2ITDC 5IYBO 2R9IA 3LNNA 4LBEC 3ZRWB 4FFBA 2Q0AA 1S0VA 4FLVA 1EN6A 2QM8A 3B77A 4DR4O 4OPAA 3P32A 2JGDB 5LXTA 5LYJB 2LO1A 1E1RG 2YIAA 4JI4O 3H01A 3VQYA 5KHIA 1OCZC 2P6JA 3FB8C 2B5UA 2K1EA 1K4DC 1R73A 1H38A 2Q4PA 2QGNA 1X4TA 2QA4V 4B3TO 3OUFA 1YITV 1FXKC 2F43G 4N23A 3RN4A 1DF5A 3ICXA 4P9PA 5LOVB 4BWAA 2HFEC 5EYPA 4K3AA 3RYHA 4LH7A 1YDXA 3ZMZA 4UFZA 3JSLA 2PY5A 4PD4F 1HNWO 3MDSA 3ZX6A 3RYCB 5KX5B 4LF8B 2QWNB 4ZI7A 3VBBA 3JAKB 1TUEB 2WLLB 3IC9A 4WF9V 5EZYB 2JRIA 3KKYA 3JYCA 4Q20A 1Q86W 3RVZA 1PL4A 1VF5B 3O65A 1SESA 1K8AW 3WU2Z 2PI4A 4JI1O 2PUSA 1HDJA 5FNVA 1S5HC 4PDRA 4FZ0A 1X59A 2QWRB 1VQLV 2YXYA 4LF4B 1Q6UA 4PA9A 5L3GA 4JI7B 4JV5B 4ABMA 3K5MA 4CS4A 3U0ZA 1Y76A 3BEHA 1VEWA 3CCLV 3H9VA 2V1DA 4KL1A 3CD6V 1OHHG 1XBLA 3ETGA 4BAYA 4CC6A 1WJZA 2UUAB 2A9HA 4JASA 4PA6A 4JI8B 2ATKC 2EIJB 1OZ0A 3ZN0A 2CE4A 1AP6A 4MVSA 4KHPB 1COWG 2L6LA 4H33A 4MVRA 1IBMB 3JCUZ 3QNEA 3F7VC 4LFCB 4LR3A 1RSOA 2P06A 4DV1B 5BY1A 4D6TH 5D5QA 5L3DA 2JIZG 1ZL8B 3ASOB 3MHSC 4JYAB 2UXBB 1HW7A 5L3CA 2Z0AA 2WLNA 4NB5A 1XHXA 5EBWC 5IYCO 2ZE6A 1E79G 3JALA 3CCMV 1FFXA 4DV6B 2EJ7A 3H1JH 4LF4O 2YS8A 1TVKA 1NVPB 1GTOA 4JI7O 4JV5O 4PI0A 4MW3A 4YJ2A 1FYJA 3K9SA 4IT5A 4X64B 3BAAA 4MVQA 4WFFA 3CCRV 4O4JA 2EIJC 4GX1A 5E1AC 2UUAO 1WPBA 3M8AA 3RYIB 2RCVA 4U3JB 1KQSU 3ABTA 3CEIA 2QKCA 4GYCB 2BOBC 2YIDA 3OAAG 4KHPO 5D5PA 2RJZA 4QE9A 1IBMO 2GV9A 1XMQB 5JH7B 3NXSA 3FB6C 4LFCO 3JD0A 2AGAA 1SZXA 3ASOC 2R70A 4DV1O 1VQPV 1XI1A 5JCOA 1K97A 4UV9A 4R8CA 4KXRA 3SDLA 3FAVB 4FFKA 5E79Z 3N2KB 4Z1VA 4WFBV 4JZ2A 1H8EG 1DF4A 3LNMB 1SQQH 2JGDA 4J11A 1CPYA 4IHJB 5LYJA 4B3SO 1M56B 1M93A 2F66C 4YJ3B 1KU9A 1PNMA 1IBKB 4OX9B 2Q9LA 4DV6O 1TGOA 4GZRB 2LFRA 2Q73A 4LC1A 1J5EB 1K4CC 1JR9A 4X64O 2IJJA 1BQZA 1DTOA 4O2AA 2WAMA 1H2NA 4E2LA 2JEXA 3ETDA 3D8CA 4L8JA 1N0JA 5LOVA 3CCJV 4DW0A 2E5LB 4ZIBA 5JJJB 5IWAO 3LDCA 2N74A 3L70H 1XDCA 3K3WA 4NXMB 5H2FZ 3OEHG 3RYCA 5KX5A 4LNUA 5C8YA 1PD3A 1H8HG 2WLLA 5DM6V 4LF7B 1XMQO 2GBOA 4ZKIA 4I55A 4XDLA 3K0DA 3LDEA 5JVDA 1GO3F 1MNGA 4RUEA 3CC7V 2EILB 1B3QA 4LCUC 3ZRSA 1PL0A 5H6QA 2A0LA 2OCCB 1AI6A 1V54C 3R65A 4TUYA 1MABG 1N34B 2AZ0A 1PPJH 2QWOB 3J80N 3K57A 4X1IA 4RQFA 1M56C 2PF4E 4L87A 1MMMA 4TT3G 2BSKB 2X6AA 5CA0B 1PP9H 2Y69B 1SA0B 4DO2A 5B66Z 1RPRA 2XAFA 4P9OA 4OX9O 3ML0A 1XNQB 5IY5B 4XDJA 5JJEB 2RNBA 1VF6A 1WP8A 1IZ3A 2IU0A 3S3XA 1IDSA 1J5EO 1FJGB 3UCSC 2JEUA 3HKCB 2IW5A 4MSWC 3T1HO 4FLXA 3C3TA 2JDIG 2E5LO 2QKSA 4DR7O 1B06A 2UUBB 2Y4TA 4NXMO 1QLNA 4IYIA 4UUJC 1XREA 4HAMA 4Z1MG 4LF7O 4U7NA 4DV5B 1US6A 4FLUA 4J7JA 3PJSK 2EILC 1R6KA 2HJFC 1TUBA 4UVBA 2H94A 4DR6B 2OCCC 4H44B 3TXQA 1J95A 1NR7A 1N34O 3KG2A 1RFYA 3FKSG 2NNUA 5AG2A 3OUSA 3G6EV 2Y69C 2A79B 3K06A 1V55B 4LF9B 5IY5C 5H5NA 2HP8A 1XNQO 1PV0A 1NTMH 2FTKA 4JPRA 1NR1A 4J9ZB 2WLIB 3ZRVA 5IJ0A 1FJGO 3D36C 3RYIA 4U3JA 4I9WA 1VQKV 2BCCH 4WFHA 5KHKA 2V4DA 1SERA 1ENVA 4FFBB 3K0GA 4WFGA 3CCSV 4I50A 3ZRXA 3CMAV 2ZCEA 4DR2B 1IVSA 3E83A 4DV5O 5LXTB 3E8BA 3CRRA 2XAQA 2BTQB 2P67A 2FYUH 3ZMVA 4DR6O 3H1LH 4DV7B 1OCOB 3CHXA 1HR0B 4I4TB 4IHJA 1BQ0A 1YJWV 3SPCA 4AILC 2UXCB 1NQTA 5EYPB 3RYHB 2DYRB 1V55C 4IIJA 4JI0B 4LF9O 4YIPA 1D2DA 4ICGA 2XAHA 1Y66A 4MS2A 1G1XB 5GONA 4B08A 2QDOA 4HBNA 2OYQA 1AR4A 1Z5WA 2XT9A 5F2VO 3CSXA 5FNVB 1N0NA 2LQTA 3RYFA 3ZHTA 3RVYA 1L0LH 3SYAA 4AQYB 2WLMA 3ZHRA 1B6QA 1F23A 4DR2O 4UCVA 3JASA 5EC1C 1MG1A 1Y76B 5IE9A 2P90A 4FM2A 1SQXH 4DV3B 3WB0A 5FPOA 4DV7O 1G8MA 5LMNB 5L3BA 1HR0O 5CB4B 5CA0A 5LGNA 4CZZA 2YEVA 4QNHB 3ZCCA 5KHJA 4NYKA 1K5SA 4JI3B 2JVDA 1Q5OA 3TGUH 4JI0O 1P7GA 1AROP 2ZNIA 4I0XA 1K3EA 2F4VB 1RSOB 4DRXA 5J9PC 3MD0A 4O4HA 1RP3B 3P3PA 3VQWA 3K08A 3VOUA 4B7EA 3ZIAG 1NT2B 2KKWA 2EBOA 1SQGA 2EIKB 1SQBH
chains in the Genus database with same CATH topology
1Q81W 4BIUA 2AHZA 1VQ8V 3E35A 1VQLV 2AHYA 3SPHA 4PA9A 1VQ6V 4TWKA 5L3GA 2XOKG 4GX0A 2HKOA 2HG5C 5IYDO 5CBFA 4QIWF 1M90W 3BEHA 3SJQC 3CCLV 1CEZA 2HLDG 2V1DA 5C93A 1P7BA 3CD6V 1L1FA 3W7SA 1OHHG 1OCCC 3ETGA 4BAYA 1K34A 1CP9A 4HZ3A 2A9HA 1R3KC 4JASA 3X2QC 4PA6A 1VQ9V 1RM1B 2ATKC 2EIJB 3CCEV 1OZ0A 3ZN0A 4MVSA 1COWG 4H33A 3D3IA 4PA4A 4MVRA 3JCZA 3W7WA 3AG1C 5L3FA 1JQ0A 3QNEA 2DYSB 3E8HA 3F7VC 2DQ0A 1K5QA 3EFFK 1QLEC 1PKXA 1WPXA 2JJ2G 1PNKA 1QVFU 3QO8A 4PDMA 2ZQMA 5L3DA 2JIZG 3CXCU 1AR1B 3CCQV 2WLIA 1RPOA 3ASOB 3F7YC 3MHSC 3WG7B 3AEIA 4RQEA 1F4NA 3OMIB 3ZMSA 1YIJV 2W6JG 2QM7A 3T1CA 5LHIA 4HYOA 5FL7G 2M7WA 2W6IG 3G4SV 3ZJZA 5L3CA 2EIKC 3FYEB 3G71V 1NH2D 2XAGA 2WWWA 3CPWU 1VQMV 1YI2V 3ETEA 4PA3A 3OGCC 3B8NA 3AG4C 2WLNA 3OE7G 5EBWC 1QVGU 5IYCO 1E79G 2XNDG 2ZDIA 1R6NA 3UKMA 3CCMV 1XL6A 2ZDIC 4JAVA 1NVPB 1GTOA 4MW3A 2ZXWB 3SYOA 4MTOA 1AJQA 4MVQA 1F4MA 4WFFA 3CCRV 2PI5A 1R3LC 4G28B 4P30A 1AJNA 4WFAV 3IC7A 4KUMA 5B1AB 3ABLB 1RM1C 2EIJC 4GX1A 3T4ZA 1R3IC 5E1AC 3JD3A 4QJFB 4UVAA 3LDDA 1OCOC 4MW8A 1KQSU 1Y4MA 3ABTA 2BOBC 5B3SB 1G4YB 2UXXA 3OAAG 2JJ1G 4FK5C 4QE9A 4FJCC 4R50A 2NLJC 3IGAC 3T4DA 2DYRC 4UV8A 3SPIA 1AJPA 2IU3A 3NXSA 3FB6C 1K33A 3JD0A 3ASOC 3I55V 2H8PC 1GKFA 3WG7C 4PA7A 1VQPV 2DQ3A 4MTGA 1K97A 2V7QG 4UV9A 1S77D 1KP2A 2QE7G 3OFNG 4R8CA 2WLKA 3TCUA 1UJWB 4QE7A 5H6RA 3K04A 1BHAA 1F51A 4WFBV 1JPXA 1K92A 1FS0G 5CBHA 4MVMA 1H8EG 4RAIA 3SYCA 4UXNA 1DF4A 3LNMB 1CPYA 1SRYA 5HFMA 1M56B 1KD1W 3TETA 2QTOA 3DTUB 1PNMA 3M99B 2LP7A 2LFSA 4MT8A 5EC2C 5B1BB 1P4RA 2WSSG 3I56V 2C2AA 2OTJV 2ZXWC 2LFRA 3GB7C 4LC1A 4ASUG 5CN0A 2MK3A 3OMNB 1ORQC 1K4CC 2EIMC 2IJJA 3LSSA 1DTOA 3CC2V 2WAMA 4E2LA 1BHBA 2JEXA 5EBLC 3ABLC 3ETDA 4PELA 5B1OA 4JTDB 4FPPA 5KA5A 4X89A 1THZA 3CCJV 2Q68A 1GK9A 3TK1A 1VQOV 3FB5C 3JD1A 4ZBMA 3LDCA 4U7OA 2EZOA 3K3WA 3OEHG 5KUKA 1KECA 2DWEC 1SETA 1PD3A 1H8HG 4JF3A 3E86A 2WLLA 5DM6V 2IJHA 1OCRB 5KA6A 4R7CA 4ZKIA 1JOYA 4XDLA 1OCZB 3K0DA 3LDEA 2GHYA 3E8GA 1GO3F 1VQ5V 2UXNA 4RUEA 3AG2B 2EILB 3CC7V 3E2EA 2IH3C 2WLHA 4LP8A 1K7DA 4LCUC 4XDKA 3ZRSA 5CBGA 1PL0A 5H6QA 1Q82W 3GWOA 1EBOA 2A0LA 2OCCB 1LNQA 1QR8A 4GT1A 1AI6A 1S3JA 1V54C 3R65A 1NJIW 1MABG 2ZR3A 3AG3B 1KC8W 5H9CA 1E1QG 3FB7C 1NH2B 3OW2U 1Q7YW 3E89A 3HB3B 3CCUV 4RQFA 1SZTA 2QEXV 1M56C 3P30A 4L87A 4J9YB 1QBZA 4JYBA 4TT3G 4MTFA 2X6CA 3W7TA 5B1BC 2ITCC 2X6AA 4G2KA 3ZN1A 2B1IA 2DWDC 2Y69B 4DO2A 1VQ7V 1AI5A 1RPRA 2XAFA 4P9OA 5LHGA 2EINB 1W2BU 3ML0A 5IY5B 5BZBA 2B1GA 3K79A 3UM7A 4XDJA 1S76D 1YTFD 2JK5C 5CMUA 2IU0A 5LHHA 2JEUA 2CK3G 2Q69A 3RW0A 2IW5A 1M9NA 4PDLA 4MSWC 4KP4A 4JYCA 3W7XA 2JDIG 1I5XA 2QKSA 2WPDG 1M1KW 1S72V 2IJIA 1BMFG 3OEEG 5GW7A 3ASNB 4GX5A 3CYOA 1JJ2U 3CMEV 5DN6G 1QLNA 1WLEA 2DYSC 4UUJC 1OCRC 3ABUA 4HAMA 5B1NA 4JTCB 3ZMTA 4Z1MG 4GX2A 4U7NA 1N8RW 3SYQA 3PJSK 1JVMA 3AG2C 2EILC 1QR9A 4R6ZA 1AI4A 1R6KA 1MOFA 2HJFC 5KUMA 4BIZA 3JD2A 2Z3YA 1K73W 4UVBA 2H94A 2XASA 4CBCA 1FFTB 3OMAB 2OCCC 2HVJC 1M57B 1GM9A 4QPJA 3X2QB 1J95A 2Z5UA 3CC4V 3SPGA 1NR7A 4DXWA 1BL8A 1JX9A 3KG2A 1GM8A 2X7RB 2Q6AA 4MVZA 3FKSG 2NNUA 3OUSA 3G6EV 3F5WC 2Y69C 2A79B 3JD4A 3EHBB 4G27B 4UVCA 3K06A 3ABMB 3K9AA 2IJKA 2EINC 1V55B 3QO7A 5IY5C 4N21A 4JTAB 4JAUA 3K03A 1AI7A 2FTKA 4JPRA 3D36A 3OR7C 4WFEA 2Y48A 1FXVA 1NR1A 2HVKC 4J9ZB 2WLIB 3ZRVA 3QO5A 3CP1A 1I5YA 4OXSA 5B1AC 2GSMB 4RO2A 4JGSA 4I9WA 2YSUB 4I5SA 1DLBA 5LBQA 1VQKV 4RUFA 1YJ9V 3AG4B 2IH1C 3DGEA 4WFHA 3ASNC 1SERA 5B3SC 5HFLA 1ENVA 2KB1A 3K0GA 4GCZA 4WFGA 4XBFA 2XAJA 3W7UA 3CCSV 1YHQV 3BY6A 4FIPC 3ZRXA 3CMAV 1GM7A 5L3EA 1EFRG 1W0JG 3STZC 3E83A 2OTLV 3RBZA 5CA3A 1VQ4V 4H37A 3E8BA 3A0RA 2XAQA 3SPJA 4X8AA 2P67A 1M57C 3ABKB 3ZMVA 1PNLA 1FXKB 1KP3A 1OCOB 1JCHA 1XL4A 1VQNV 1IXMA 1K9MW 2EZPA 4MVOA 1YJWV 3SPCA 2D3OW 1MSWD 1NQTA 2ZD9A 3LUTB 3ABMC 2DYRB 1QCEA 1V55C 4KFMA 2P7TC 1EZJA 2YEVB 1YTFB 2EJRA 2XAHA 1Y66A 4MS2A 3OR6C 4QPKA 1FXHA 3HPLC 5LGUA 2ITDC 1NKDA 5IYBO 2R9IA 1NBMG 4WCEV 3E8FA 4LBEC 4PDVA 3ZRWB 4MTXA 1YSCA 2W0FC 1GMGA 1S0VA 5IDJA 1HWYA 2QM8A 2ZR2A 4X88A 4F4LA 3RVYA 3B77A 3SYAA 3P32A 5EBMC 2WLMA 1NVPD 1B6QA 3MHHC 5LGTA 1E1RG 1F23A 3H01A 4TSFG 1OCZC 2P6JA 3FB8C 1FXKA 2B5UA 2EIMB 2K1EA 1K4DC 1R73A 1H38A 3ABKC 5EC1C 1MG1A 4EKWA 2QA4V 3OUFA 1ROPA 2HR3A 1OCCB 1YITV 1FXKC 2F43G 2P90A 4N23A 1YJNV 4FMTA 3FYIB 1DF5A 3AG3C 4P9PA 1G8MA 2HFEC 3B8MA 1H2GA 5L3BA 3SYPA 2X6BA 4YXWG 3ZMZA 1R3JC 3LSQA 4BW5A 5LGNA 2BOCC 1ZWIC 4CZZA 3WFVA 2YEVA 3T2MA 3AG1B 4QNHB 2OT5A 3ZCCA 5EK0A 2X0LA 1K5SA 1QLEB 3VBBA 1TUEB 2WLLB 2R9RB 3OM3B 4WF9V 1W0KG 4Q20A 3STLC 3JYCA 1Q86W 3RVZA 1AROP 1K3EA 2WLJA 4MVUA 3CCVV 5J9PC 1SESA 2Q67A 3IFXA 3MD0A 3ZMUA 1K8AW 2PI4A 3ZRWA 3K08A 3VOUA 3ZIAG 1V54B 4P2ZA 1KKDA 1S5HC 2EBOA 4PDRA 2EIKB 2DW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  3H01 A;  1DF4 A;  2OT5 A;  3GWO A;  1EBO A;  5CMU A;  1QR8 A;  1Y66 A;  2P6J A;  5HFM A;  2M7W A;  1K33 A;  3K9A A;  1QR9 A;  2EZO A;  3M99 B;  1MOF A;  2EZP A;  2LP7 A;  5H9C A;  1ENV A;  5HFL A;  1MG1 A;  4N21 A;  1JQ0 A;  4JF3 A;  1SZT A;  3B8N A;  4N23 A;  5CN0 A;  2MK3 A;  4FIP C;  3P30 A;  1I5X A;  4JPR A;  5KA6 A;  1QBZ A;  1DF5 A;  1QCE A;  1Y4M A;  4G2K A;  4E2L A;  3B8M A;  3CP1 A;  3B77 A;  3WFV A;  1I5Y A;  3CYO A;  2EBO A;  4FK5 C;  3MHS C;  1K34 A;  1JPX A;  5KA5 A;  2X7R B;  4JGS A;  3MHH C;  4FJC C;  1DLB A; 
#chains in the Genus database with same CATH topology
 4W4K A;  2LW1 A;  2E76 B;  2XOK G;  4GX0 A;  4E4E A;  2YUA A;  4QIW F;  1M90 W;  4AQY O;  3G67 A;  1I08 A;  1M4U A;  3SJQ C;  1CEZ A;  2HLD G;  5C93 A;  1P7B A;  1Y74 A;  2M6Y A;  3W7S A;  4YJ2 B;  5KHH A;  4HZ3 A;  2WA3 A;  3X2Q C;  1WNS A;  5LP6 A;  5KMG A;  4LFB B;  4DV3 O;  5LMN O;  3B40 A;  3D3I A;  4PA4 A;  3JCZ A;  1K5Q A;  3EFF K;  3Q4H A;  3ZHS A;  2JJ2 G;  1PNK A;  3BPZ A;  3QO8 A;  3G80 A;  4JI3 O;  1AR1 B;  2WLI A;  1BCC H;  3F7Y C;  2AW9 A;  3S3W A;  3ZMS A;  4RQE A;  1YIJ V;  2W6J G;  2QM7 A;  5LHI A;  2F4V O;  2A7W A;  1I7F A;  5FL7 G;  2M7W A;  2XHB A;  3BVO A;  3ZJZ A;  2EIK C;  3B4S A;  3FYE B;  1YI2 V;  3ETE A;  4PA3 A;  3B8N A;  3AG4 C;  1YZB A;  2ZDI A;  2XND G;  3UKM A;  1AP5 A;  1XL6 A;  4UB8 Z;  1XNR B;  1LR1 A;  2ZIM A;  4CH3 A;  2BTQ A;  4DV2 B;  1AJQ A;  4YIO A;  3L72 H;  1F4M A;  1I0H A;  1R3L C;  1H2L A;  2F23 A;  3IC7 A;  4WFA V;  3L71 H;  2YIC A;  1R3I C;  4I4T A;  3TJT A;  4QJF B;  4UVA A;  2Q7G A;  4O2A B;  3C90 A;  2Q7H A;  4X20 A;  2B9Z A;  4LFB O;  1Q43 A;  4NKG B;  3A0B Z;  2NLJ C;  3T4D A;  3HKD A;  4UV8 A;  2IU3 A;  4OGQ B;  2QM4 A;  1K33 A;  4LNU B;  5C8Y B;  4DR5 B;  4PA7 A;  4UCO A;  2V7Q G;  4LFA O;  2DMX A;  4I55 B;  3OFN G;  3TCU A;  5JVD B;  1WA8 B;  4QE7 A;  5JCO C;  2Y4U A;  4LH6 A;  1F51 A;  1NU1 H;  1JPX A;  1K92 A;  2JGU A;  2DJV A;  3SYC A;  4TUY B;  3JSN A;  3L9D A;  2HEP A;  1SRY A;  1NZ6 A;  3O9O A;  2QTO A;  3M99 B;  4X1I B;  2LP7 A;  5EC2 C;  3M7M X;  3FFQ A;  1XNR O;  2OTJ V;  5EIB D;  4ASU G;  2MK3 A;  5ITZ A;  4PJ0 Z;  4DV2 O;  3DC6 A;  1NTK H;  2ZM6 B;  4B3R B;  1BHB A;  4PEL A;  4X89 A;  1THZ A;  2Q68 A;  5CB4 A;  2WA4 A;  4ZBM A;  4K0K B;  2EZO A;  5KUK A;  1KEC A;  2O57 A;  2AZ2 A;  1HP8 A;  1SQP H;  1WP7 A;  2IJH A;  3TXS A;  1SF9 A;  1VQ5 V;  3AG2 B;  4Q6G A;  4DR5 O;  1P49 A;  4CS2 A;  1K7D A;  2VS0 A;  4FVM A;  5CBG A;  3GWO A;  2E75 B;  1LNQ A;  1NJI W;  3AG3 B;  1TUB B;  3EVK A;  3H1I H;  3U11 A;  2QKA A;  1Q7Y W;  5LL6 Y;  3HB3 B;  3CCU V;  1SC5 B;  1SZT A;  1EZV H;  2QEX V;  3H1H H;  3THO A;  4PI2 A;  4B3S B;  2X6C A;  4G2K A;  3ZN1 A;  5LHG A;  2EIN B;  2YIB D;  1W2B U;  2B1G A;  3UM7 A;  2F93 B;  1YTF D;  5CMU A;  5LHH A;  4CC5 A;  2JS5 A;  2ZM6 O;  3RW0 A;  5K1P A;  5J2T A;  4GUN A;  4B3R O;  1KUQ A;  1VF6 C;  4YHH B;  4DV4 B;  4KP4 A;  4JYC A;  3W7X A;  5IJ0 B;  2WPD G;  5IWA B;  3N2G B;  1QHT A;  4K0K O;  1BMF G;  1JJ2 U;  2VRZ A;  3E22 A;  3CME V;  1XEQ A;  3DSQ A;  5CA1 A;  5B1N A;  2W0X A;  4JTC B;  3ZMT A;  4GX2 A;  3MAQ A;  4B3M B;  2RQ6 A;  1HNZ B;  3AG2 C;  4I50 B;  2QR4 A;  5KUM A;  4BIZ A;  1K73 W;  1QQC A;  1FFT B;  2ZT9 B;  1EM1 A;  2Z5U A;  4X1K A;  3CC4 V;  2R72 A;  1JX9 A;  4CH4 A;  2GDS A;  4MVZ A;  4J10 A;  3F5W C;  2N04 A;  1ZSP A;  2D2C B;  2EIN C;  3BA8 A;  3BAB A;  4N21 A;  4NR1 A;  3L73 H;  1U96 A;  4PV1 B;  4JTA B;  3K03 A;  3KCX A;  4IIJ B;  2Y48 A;  1FXV A;  5KHG A;  1NTZ H;  5FLX N;  3CP1 A;  3OTO B;  2XTA A;  2GSM B;  1WB8 A;  1QNM A;  3T1H B;  3H1K H;  4YHH O;  4DV4 O;  5LBQ A;  5A2Q N;  3L75 H;  5GON B;  4DR7 B;  3J81 N;  3GVM A;  2XUM A;  1KYO F;  1YVW A;  1VMG A;  2UU9 B;  4GCZ A;  4XBF A;  3BY6 A;  3RYF B;  4LWS A;  4FIP C;  2H3O A;  1EFR G;  1W0J G;  4B3M O;  3RBZ A;  1FD9 A;  1AIL A;  4I7Z B;  1VQ4 V;  1HNZ O;  3AG7 A;  4CS3 A;  3A0R A;  3K5L A;  1WA8 A;  3ABK B;  3F5T A;  1KP3 A;  3JAS B;  1JCH A;  1BE3 H;  1K9M W;  5BMV B;  2ZKO A;  2EUL A;  1UPG A;  1MSW D;  1QCE A;  4JI5 B;  4KFM A;  2P7T C;  1B04 A;  2QSA A;  3QVN A;  2YEV B;  4ZOL A;  3HPL C;  1NKD A;  2A06 H;  4I0X B;  3PN1 A;  3BA9 A;  3OTO O;  4DRX B;  4FLT A;  4O4H B;  2IM9 A;  4PDV A;  3APO A;  4EEQ A;  4MTX A;  3WB1 A;  2W0F C;  1HWY A;  2CGO A;  2ZR2 A;  4X88 A;  4DR1 B;  2ZE5 A;  4NTW A;  5EBM C;  2UU9 O;  4TSF G;  2LJ2 A;  2EIM B;  3AK3 A;  4JYY A;  3ABK C;  1ROP A;  1BSM A;  4FMT A;  1Y74 B;  3CE2 A;  3FYI B;  4AI8 A;  3SYP A;  3LSQ A;  2BOC C;  5LP6 B;  2YIB A;  1MZF A;  2DE0 X;  5KMG B;  2OT5 A;  3QF7 A;  5EK0 A;  2KSD A;  1MA1 A;  4JI5 O;  3STL C;  1LUW A;  3Q4H B;  2WLJ A;  4MVU A;  4X62 B;  3ZMU A;  3P3N A;  3ZS8 C;  3NR7 A;  3C3S A;  1KKD A;  3N2G A;  1Q81 W;  1VQ8 V;  2KQX A;  3E35 A;  3SPH A;  3JAT A;  1VQ6 V;  1A32 A;  4DR1 O;  3SJB C;  2HG5 C;  2ILM A;  5IYD O;  5CBF A;  1D5N A;  2YXL A;  2VQF B;  2QWP B;  2CTQ A;  3CRC A;  1L1F A;  5GTH Z;  2CAZ C;  1K34 A;  5LA6 B;  3IAY A;  1GH6 A;  1ZTE A;  3CCE V;  2GTA A;  2IBZ H;  5LP6 C;  3W7W A;  2DYS B;  4FLY A;  4X20 B;  4GKJ O;  3RWR D;  1M5I A;  4EFB A;  3CCQ V;  3BHP A;  2UUC B;  4Z2W A;  2P5O A;  3HKD B;  1F4N A;  3T1C A;  4TV9 B;  4NXN B;  2F1M A;  4X62 O;  4A5U B;  2W6I G;  3G4S V;  3CJH A;  3G71 V;  1BT8 A;  1NH2 D;  3CPW U;  1VQM V;  2BTO A;  3OGC C;  1QVG U;  1O9G A;  2UXD O;  2R9A A;  4NTY A;  4YY3 B;  2ZDI C;  1XQ8 A;  2ZXW B;  3SYO A;  4MTO A;  5J2U A;  2VQF O;  4FLZ A;  1OJH A;  2G38 A;  2LGW A;  3OGI B;  1AJN A;  5ITZ B;  4KUM A;  5B1A B;  2A3Q A;  3T4Z A;  1KMI Z;  5DEC A;  3DXR A;  5BMV A;  3LDD A;  1OCO C;  2LGQ A;  1Y4M A;  5B3S B;  5LMU B;  1G4Y B;  1EN4 A;  2HJD A;  1G6U A;  1XIL A;  1N32 B;  1Q6I A;  3B2E E;  4FJC C;  2DYR C;  3SPI A;  2YXH A;  4IYH A;  1GKF A;  2PGG A;  1W59 A;  4J7Z A;  1VF7 A;  4PHZ A;  2DQ3 A;  3K59 A;  4MTG A;  2UUC O;  1AB3 A;  1FPO A;  1S77 D;  1KP2 A;  2WLK A;  1UJW B;  4GKK O;  4NXN O;  3JAR A;  5H6R A;  3CXH F;  5KAI Z;  1BHA A;  2Y0P A;  5CBH A;  4RAI A;  4UXN A;  4FZ1 A;  1SQV H;  1N36 B;  4NVP A;  5HFM A;  3K58 A;  4UCT A;  2CH7 B;  2CGN A;  2LFS A;  5B1B B;  4MT8 A;  2ZXW C;  3GB7 C;  4YY3 O;  1MZE A;  1TA8 A;  1GN6 A;  3CC2 V;  5EBL C;  5B1O A;  4JTD B;  4FPP A;  1XOU A;  1GK9 A;  2P4K A;  2QJ1 A;  4TOI A;  3TK1 A;  3FB5 C;  5IJ9 B;  4LF5 B;  4U7O A;  5J2T B;  1GRJ A;  5A9G A;  3A0H Z;  5LMU O;  2DWE C;  3E86 A;  2YC0 A;  1N32 O;  1BGY H;  1OCR B;  1Q90 D;  2P22 C;  4R7C A;  1JOY A;  3E22 B;  1OCZ B;  2GHY A;  2UXN A;  5CA1 B;  2WLH A;  1SQF A;  4LFA B;  1Z2G A;  4GT1 A;  1JA8 A;  4AHC A;  2CDY A;  1KC8 W;  3FB7 C;  2NR5 A;  3P30 A;  4X1K B;  5JQG A;  3EXA A;  4DR3 B;  4JYB A;  1N36 O;  5B1B C;  3SJC C;  2NN4 A;  1VQ7 V;  4J7K A;  4U3F H;  1UFI A;  2ARH A;  5BZB A;  4X66 B;  1Q6H A;  2JK5 C;  5LA6 A;  2CK3 G;  5KAF Z;  2Q69 A;  1GN4 A;  3HKB A;  4BR6 A;  3HKE A;  1FKA O;  4J41 A;  1I5X A;  1M1K W;  3KZI Z;  4LF5 O;  2FKX A;  5GW7 A;  3ASN B;  3CYO A;  5TIS Z;  1OCR C;  2AXT Z;  3QTC A;  2OIE A;  3ABU A;  3D3Q A;  3ZHU A;  1N8R W;  3SYQ A;  2HHH B;  1JVM A;  2L35 A;  1QR9 A;  4R6Z A;  1AI4 A;  4TV9 A;  3JD2 A;  2Z3Y A;  4WBN A;  4LWS B;  2XAS A;  3CWB H;  4GLX A;  2ZIO A;  1M57 B;  2PYL A;  1XMO B;  2GUZ B;  4RWU A;  2KG7 A;  2X7R B;  2Q6A A;  1BZK A;  4BW9 A;  4G27 B;  4UVC A;  4W4L A;  4DR3 O;  3JAM N;  2IJK A;  2VWK A;  3FD9 A;  3QO7 A;  1JFF A;  2RDC A;  3R66 A;  2E74 B;  4D7T A;  4X66 O;  3OR7 C;  4WFE A;  2HVK C;  2ADQ B;  4ZOL B;  1AVM A;  4OXS A;  2RN9 A;  4JI6 B;  4RO2 A;  4JGS A;  2YSU B;  1IUR A;  1DLB A;  3K5N A;  4RUF A;  1TAE A;  1Y67 A;  3L74 H;  3ASN C;  5K1X A;  2KB1 A;  3W7U A;  4DW1 A;  2XAJ A;  3AK2 A;  3UO3 A;  1GM7 A;  5L3E A;  3I5D A;  1CXZ B;  4X65 B;  1I94 B;  1ZX3 A;  1DK1 A;  1T5E A;  4H37 A;  2HHH O;  3IJ4 A;  2GTS A;  4X8A A;  3ETQ A;  1M57 C;  1PNL A;  1R6T A;  1VQN V;  1XL4 A;  3BFR A;  1XMO O;  2CH7 A;  3J7A U;  1Q3E A;  2ZD9 A;  4F6E A;  2Q5Z A;  4K35 A;  1S5J A;  4LF8 O;  5EIB C;  1GN3 A;  1EZJ A;  1H2M A;  4O2B A;  2RMK B;  4IL6 Z;  1YTF B;  4ZHQ A;  3CX5 F;  4EB6 B;  4O4L A;  5IJ9 A;  1NBM G;  1XHZ A;  2ZE8 A;  2PTM A;  4WCE V;  3E8F A;  4JI6 O;  2ADP A;  1YSC A;  1GMG A;  4F6R B;  1GAX A;  5IDJ A;  4HNA A;  1IBL B;  1D5A A;  1ZAU A;  4F4L A;  2JS3 A;  1KKC A;  1FAF A;  1NVP D;  3MHH C;  5LGT A;  3JAT B;  1FXK A;  2DOS A;  4X65 O;  1I94 O;  1L8D A;  4EKW A;  3VQX A;  2HR3 A;  1OCC B;  2VWJ A;  1U97 A;  1YJN V;  4JI8 O;  5KLV H;  2E3C A;  3AG3 C;  4FM1 A;  1WN7 A;  1MSD A;  1H2G A;  1VIB A;  3B8M A;  2X6B A;  4YXW G;  1R3J C;  1AR5 A;  4BW5 A;  1V9P A;  1ZWI C;  3WFV A;  5IYZ A;  4BIO A;  3T2M A;  3AG1 B;  3SR2 C;  3KCY A;  2X0L A;  2ZNJ A;  1QLE B;  2R9R B;  3OM3 B;  5IT9 N;  1W0K G;  4J42 A;  3ZED A;  4O4I B;  2YDE A;  3CCV V;  2Q67 A;  3IFX A;  4JYA O;  3ZRW A;  3AK1 A;  3JAW B;  2UXB O;  1V54 B;  4P2Z A;  1S5L Z;  2DW4 A;  4BIU A;  2AHZ A;  3CJH B;  2AHY A;  4UCS A;  1IBL O;  3RGB A;  4TWK A;  1SS3 A;  2HKO A;  2YI8 A;  1JJO A;  2ODM A;  4DUZ B;  1Q8I A;  3BRC A;  1OCC C;  3RFR A;  5J2U B;  1CP9 A;  1R1B A;  1R3K C;  1VQ9 V;  2GUZ A;  1RM1 B;  1IXB A;  5BXZ A;  1LUV A;  3ZHV A;  4TQF A;  3B09 A;  2Y0I A;  3JAK A;  3AG1 C;  3DXR B;  5L3F A;  1JQ0 A;  5EZY A;  3E8H A;  2DQ0 A;  1QLE C;  1P84 F;  1PKX A;  1WPX A;  1QVF U;  1GN2 A;  4PDM A;  3GWK C;  2ZQM A;  3CXC U;  1RPO A;  4OPH A;  4JAA A;  3WG7 B;  3AEI A;  4JI2 B;  1WAZ A;  3OMI B;  5JJN B;  4HYO A;  2XAG A;  2WWW A;  3A2F A;  4DK1 A;  3JAR B;  3OE7 G;  2CTR A;  1KBH A;  1R6N A;  4DK0 A;  2ZE7 A;  1QU7 A;  1IBK O;  4JAV A;  4JZG A;  4CH5 A;  2PYJ A;  4UCR A;  1N33 B;  4DUZ O;  2PI5 A;  4G28 B;  4P30 A;  3K5O A;  3ABL B;  1RM1 C;  1KB9 F;  3JD3 A;  4MW8 A;  2UXX A;  2P4V A;  2JJ1 G;  1WB7 A;  4FK5 C;  2CTW A;  4R50 A;  1ZL8 A;  3OT7 A;  4UB6 Z;  3DC5 A;  3IGA C;  5DED A;  4GKJ B;  1AJP A;  3RT3 C;  3I55 V;  3CRQ A;  2H8P C;  3WG7 C;  2VQE B;  4EB6 A;  1XUQ A;  1EN5 A;  4JI2 O;  2QE7 G;  4X1Y B;  2Q0O C;  5FPR A;  2OCH A;  4F6R A;  2K9P A;  3K04 A;  1FS0 G;  4MVM A;  3U10 A;  3VQV A;  1KD1 W;  1VAR A;  3TET A;  3DTU B;  2UXD B;  4B7K A;  1H2K A;  4LF6 B;  1P4R A;  2WSS G;  3I56 V;  4TV8 B;  2C2A A;  5JQG B;  2ZIN A;  5CN0 A;  3UT5 B;  3OMN B;  1ORQ C;  1N33 O;  2EIM C;  3UO2 A;  3LSS A;  3WB2 A;  4K8Z A;  3ABL C;  3ZHQ A;  5KA5 A;  1NI8 A;  1VQO V;  3JD1 A;  3G6B A;  3HKB B;  3HKE B;  5JH7 A;  3OTF A;  4D7S A;  2BE3 A;  2UUB O;  5BR8 B;  4I9Q A;  1SET A;  4JF3 A;  3CRM A;  5KA6 A;  1JMK C;  1OV9 A;  4O4I A;  3APQ A;  3E8G A;  3FAV A;  2VQE O;  3JAW A;  3E2E A;  3N2K A;  2IH3 C;  4X9Q A;  4C7U A;  4LP8 A;  4XDK A;  1Q82 W;  2YI9 A;  1YXB A;  1EBO A;  4GKK B;  1QR8 A;  1S3J A;  1VP7 A;  4WBN B;  2ZR3 A;  2QWQ B;  5H9C A;  1E1Q G;  1NH2 B;  4YJ3 A;  5B5E Z;  3OW2 U;  3E89 A;  4DUY B;  4J80 A;  3SGI A;  2FML A;  1Y6X A;  4J9Y B;  1QBZ A;  4MTF A;  3W7T A;  2ITC C;  2F95 B;  2B1I A;  2DWD C;  2KG7 B;  2N05 A;  1AI5 A;  4LF6 O;  3A8T A;  1NS1 A;  3K79 A;  4ZI7 B;  1S76 D;  2OWO A;  1JFF B;  1M9N A;  4PDL A;  3UQ8 A;  4K8X A;  3QG5 A;  1S72 V;  2IJI A;  3N27 A;  5GTI Z;  3OEE G;  2FL4 A;  4GX5 A;  2EX3 A;  5DN6 G;  1WLE A;  2DYS C;  4FM0 A;  5BR8 O;  2Q8V A;  4DYL A;  3FX7 A;  1MOF A;  4CH6 A;  2PZS A;  4CBC A;  3OMA B;  2MW2 B;  2HVJ C;  1GM9 A;  4QPJ A;  2QTS A;  3X2Q B;  3SPG A;  1O9H A;  4DXW A;  1ZLZ A;  2BSK A;  3CRA A;  1BL8 A;  1SA0 A;  1GM8 A;  4DV0 B;  4DUY O;  2UXC O;  2LW7 A;  2DN9 A;  1Z5V A;  3JD4 A;  3EHB B;  1N4C A;  3K9A A;  3ABM B;  1HNX B;  1L0N H;  1SKV A;  4JAU A;  3HKC A;  1AI7 A;  1DGS A;  3D36 A;  3SJA C;  1F7Y A;  3T1Y B;  2CTP A;  3QO5 A;  4O2B B;  1I5Y A;  5B1A C;  4QGP A;  3ZBH A;  3OD4 A;  1YF2 A;  4ZHQ B;  4I5S A;  3CB2 A;  1YEW A;  4O4L B;  1PM9 A;  4H13 B;  3AG4 B;  2Q7E A;  1YJ9 V;  2IH1 C;  3DGE A;  5B3S C;  1ZUQ A;  4DR4 B;  5HFL A;  1YHQ V;  3BCC H;  3HR0 A;  4JI4 B;  3JAL B;  1URF A;  4HNA B;  3CS5 A;  1FFX B;  3STZ C;  2OTL V;  1TVK B;  4H0L B;  2CUG A;  5CA3 A;  4B3T B;  4X1Y A;  3SPJ A;  1YCI A;  4FLW A;  1BS3 A;  1IX9 A;  4O4J B;  1FXK B;  3LSU A;  1IXM A;  4TQD A;  2EZP A;  4MVO A;  4UCU A;  1H2S B;  1HNW B;  2D3O W;  4DV0 O;  4TV8 A;  2FB5 A;  4IGG A;  3LUT B;  3ABM C;  2ETN A;  5JWP A;  3UT5 A;  1HNX O;  5IYZ B;  4NTX A;  4EFE A;  2EJR A;  4JI1 B;  2OIG A;  3OR6 C;  4QPK A;  1FXH A;  5LGU A;  3T1Y O;  2ITD C;  5IYB O;  2R9I A;  3LNN A;  4LBE C;  3ZRW B;  4FFB A;  2Q0A A;  1S0V A;  4FLV A;  1EN6 A;  2QM8 A;  3B77 A;  4DR4 O;  4OPA A;  3P32 A;  2JGD B;  5LXT A;  5LYJ B;  2LO1 A;  1E1R G;  2YIA A;  4JI4 O;  3H01 A;  3VQY A;  5KHI A;  1OCZ C;  2P6J A;  3FB8 C;  2B5U A;  2K1E A;  1K4D C;  1R73 A;  1H38 A;  2Q4P A;  2QGN A;  1X4T A;  2QA4 V;  4B3T O;  3OUF A;  1YIT V;  1FXK C;  2F43 G;  4N23 A;  3RN4 A;  1DF5 A;  3ICX A;  4P9P A;  5LOV B;  4BWA A;  2HFE C;  5EYP A;  4K3A A;  3RYH A;  4LH7 A;  1YDX A;  3ZMZ A;  4UFZ A;  3JSL A;  2PY5 A;  4PD4 F;  1HNW O;  3MDS A;  3ZX6 A;  3RYC B;  5KX5 B;  4LF8 B;  2QWN B;  4ZI7 A;  3VBB A;  3JAK B;  1TUE B;  2WLL B;  3IC9 A;  4WF9 V;  5EZY B;  2JRI A;  3KKY A;  3JYC A;  4Q20 A;  1Q86 W;  3RVZ A;  1PL4 A;  1VF5 B;  3O65 A;  1SES A;  1K8A W;  3WU2 Z;  2PI4 A;  4JI1 O;  2PUS A;  1HDJ A;  5FNV A;  1S5H C;  4PDR A;  4FZ0 A;  1X59 A;  2QWR B;  1VQL V;  2YXY A;  4LF4 B;  1Q6U A;  4PA9 A;  5L3G A;  4JI7 B;  4JV5 B;  4ABM A;  3K5M A;  4CS4 A;  3U0Z A;  1Y76 A;  3BEH A;  1VEW A;  3CCL V;  3H9V A;  2V1D A;  4KL1 A;  3CD6 V;  1OHH G;  1XBL A;  3ETG A;  4BAY A;  4CC6 A;  1WJZ A;  2UUA B;  2A9H A;  4JAS A;  4PA6 A;  4JI8 B;  2ATK C;  2EIJ B;  1OZ0 A;  3ZN0 A;  2CE4 A;  1AP6 A;  4MVS A;  4KHP B;  1COW G;  2L6L A;  4H33 A;  4MVR A;  1IBM B;  3JCU Z;  3QNE A;  3F7V C;  4LFC B;  4LR3 A;  1RSO A;  2P06 A;  4DV1 B;  5BY1 A;  4D6T H;  5D5Q A;  5L3D A;  2JIZ G;  1ZL8 B;  3ASO B;  3MHS C;  4JYA B;  2UXB B;  1HW7 A;  5L3C A;  2Z0A A;  2WLN A;  4NB5 A;  1XHX A;  5EBW C;  5IYC O;  2ZE6 A;  1E79 G;  3JAL A;  3CCM V;  1FFX A;  4DV6 B;  2EJ7 A;  3H1J H;  4LF4 O;  2YS8 A;  1TVK A;  1NVP B;  1GTO A;  4JI7 O;  4JV5 O;  4PI0 A;  4MW3 A;  4YJ2 A;  1FYJ A;  3K9S A;  4IT5 A;  4X64 B;  3BAA A;  4MVQ A;  4WFF A;  3CCR V;  4O4J A;  2EIJ C;  4GX1 A;  5E1A C;  2UUA O;  1WPB A;  3M8A A;  3RYI B;  2RCV A;  4U3J B;  1KQS U;  3ABT A;  3CEI A;  2QKC A;  4GYC B;  2BOB C;  2YID A;  3OAA G;  4KHP O;  5D5P A;  2RJZ A;  4QE9 A;  1IBM O;  2GV9 A;  1XMQ B;  5JH7 B;  3NXS A;  3FB6 C;  4LFC O;  3JD0 A;  2AGA A;  1SZX A;  3ASO C;  2R70 A;  4DV1 O;  1VQP V;  1XI1 A;  5JCO A;  1K97 A;  4UV9 A;  4R8C A;  4KXR A;  3SDL A;  3FAV B;  4FFK A;  5E79 Z;  3N2K B;  4Z1V A;  4WFB V;  4JZ2 A;  1H8E G;  1DF4 A;  3LNM B;  1SQQ H;  2JGD A;  4J11 A;  1CPY A;  4IHJ B;  5LYJ A;  4B3S O;  1M56 B;  1M93 A;  2F66 C;  4YJ3 B;  1KU9 A;  1PNM A;  1IBK B;  4OX9 B;  2Q9L A;  4DV6 O;  1TGO A;  4GZR B;  2LFR A;  2Q73 A;  4LC1 A;  1J5E B;  1K4C C;  1JR9 A;  4X64 O;  2IJJ A;  1BQZ A;  1DTO A;  4O2A A;  2WAM A;  1H2N A;  4E2L A;  2JEX A;  3ETD A;  3D8C A;  4L8J A;  1N0J A;  5LOV A;  3CCJ V;  4DW0 A;  2E5L B;  4ZIB A;  5JJJ B;  5IWA O;  3LDC A;  2N74 A;  3L70 H;  1XDC A;  3K3W A;  4NXM B;  5H2F Z;  3OEH G;  3RYC A;  5KX5 A;  4LNU A;  5C8Y A;  1PD3 A;  1H8H G;  2WLL A;  5DM6 V;  4LF7 B;  1XMQ O;  2GBO A;  4ZKI A;  4I55 A;  4XDL A;  3K0D A;  3LDE A;  5JVD A;  1GO3 F;  1MNG A;  4RUE A;  3CC7 V;  2EIL B;  1B3Q A;  4LCU C;  3ZRS A;  1PL0 A;  5H6Q A;  2A0L A;  2OCC B;  1AI6 A;  1V54 C;  3R65 A;  4TUY A;  1MAB G;  1N34 B;  2AZ0 A;  1PPJ H;  2QWO B;  3J80 N;  3K57 A;  4X1I A;  4RQF A;  1M56 C;  2PF4 E;  4L87 A;  1MMM A;  4TT3 G;  2BSK B;  2X6A A;  5CA0 B;  1PP9 H;  2Y69 B;  1SA0 B;  4DO2 A;  5B66 Z;  1RPR A;  2XAF A;  4P9O A;  4OX9 O;  3ML0 A;  1XNQ B;  5IY5 B;  4XDJ A;  5JJE B;  2RNB A;  1VF6 A;  1WP8 A;  1IZ3 A;  2IU0 A;  3S3X A;  1IDS A;  1J5E O;  1FJG B;  3UCS C;  2JEU A;  3HKC B;  2IW5 A;  4MSW C;  3T1H O;  4FLX A;  3C3T A;  2JDI G;  2E5L O;  2QKS A;  4DR7 O;  1B06 A;  2UUB B;  2Y4T A;  4NXM O;  1QLN A;  4IYI A;  4UUJ C;  1XRE A;  4HAM A;  4Z1M G;  4LF7 O;  4U7N A;  4DV5 B;  1US6 A;  4FLU A;  4J7J A;  3PJS K;  2EIL C;  1R6K A;  2HJF C;  1TUB A;  4UVB A;  2H94 A;  4DR6 B;  2OCC C;  4H44 B;  3TXQ A;  1J95 A;  1NR7 A;  1N34 O;  3KG2 A;  1RFY A;  3FKS G;  2NNU A;  5AG2 A;  3OUS A;  3G6E V;  2Y69 C;  2A79 B;  3K06 A;  1V55 B;  4LF9 B;  5IY5 C;  5H5N A;  2HP8 A;  1XNQ O;  1PV0 A;  1NTM H;  2FTK A;  4JPR A;  1NR1 A;  4J9Z B;  2WLI B;  3ZRV A;  5IJ0 A;  1FJG O;  3D36 C;  3RYI A;  4U3J A;  4I9W A;  1VQK V;  2BCC H;  4WFH A;  5KHK A;  2V4D A;  1SER A;  1ENV A;  4FFB B;  3K0G A;  4WFG A;  3CCS V;  4I50 A;  3ZRX A;  3CMA V;  2ZCE A;  4DR2 B;  1IVS A;  3E83 A;  4DV5 O;  5LXT B;  3E8B A;  3CRR A;  2XAQ A;  2BTQ B;  2P67 A;  2FYU H;  3ZMV A;  4DR6 O;  3H1L H;  4DV7 B;  1OCO B;  3CHX A;  1HR0 B;  4I4T B;  4IHJ A;  1BQ0 A;  1YJW V;  3SPC A;  4AIL C;  2UXC B;  1NQT A;  5EYP B;  3RYH B;  2DYR B;  1V55 C;  4IIJ A;  4JI0 B;  4LF9 O;  4YIP A;  1D2D A;  4ICG A;  2XAH A;  1Y66 A;  4MS2 A;  1G1X B;  5GON A;  4B08 A;  2QDO A;  4HBN A;  2OYQ A;  1AR4 A;  1Z5W A;  2XT9 A;  5F2V O;  3CSX A;  5FNV B;  1N0N A;  2LQT A;  3RYF A;  3ZHT A;  3RVY A;  1L0L H;  3SYA A;  4AQY B;  2WLM A;  3ZHR A;  1B6Q A;  1F23 A;  4DR2 O;  4UCV A;  3JAS A;  5EC1 C;  1MG1 A;  1Y76 B;  5IE9 A;  2P90 A;  4FM2 A;  1SQX H;  4DV3 B;  3WB0 A;  5FPO A;  4DV7 O;  1G8M A;  5LMN B;  5L3B A;  1HR0 O;  5CB4 B;  5CA0 A;  5LGN A;  4CZZ A;  2YEV A;  4QNH B;  3ZCC A;  5KHJ A;  4NYK A;  1K5S A;  4JI3 B;  2JVD A;  1Q5O A;  3TGU H;  4JI0 O;  1P7G A;  1ARO P;  2ZNI A;  4I0X A;  1K3E A;  2F4V B;  1RSO B;  4DRX A;  5J9P C;  3MD0 A;  4O4H A;  1RP3 B;  3P3P A;  3VQW A;  3K08 A;  3VOU A;  4B7E A;  3ZIA G;  1NT2 B;  2KKW A;  2EBO A;  1SQG A;  2EIK B;  1SQB H; 
#chains in the Genus database with same CATH homology
 1Q81 W;  4BIU A;  2AHZ A;  1VQ8 V;  3E35 A;  1VQL V;  2AHY A;  3SPH A;  4PA9 A;  1VQ6 V;  4TWK A;  5L3G A;  2XOK G;  4GX0 A;  2HKO A;  2HG5 C;  5IYD O;  5CBF A;  4QIW F;  1M90 W;  3BEH A;  3SJQ C;  3CCL V;  1CEZ A;  2HLD G;  2V1D A;  5C93 A;  1P7B A;  3CD6 V;  1L1F A;  3W7S A;  1OHH G;  1OCC C;  3ETG A;  4BAY A;  1K34 A;  1CP9 A;  4HZ3 A;  2A9H A;  1R3K C;  4JAS A;  3X2Q C;  4PA6 A;  1VQ9 V;  1RM1 B;  2ATK C;  2EIJ B;  3CCE V;  1OZ0 A;  3ZN0 A;  4MVS A;  1COW G;  4H33 A;  3D3I A;  4PA4 A;  4MVR A;  3JCZ A;  3W7W A;  3AG1 C;  5L3F A;  1JQ0 A;  3QNE A;  2DYS B;  3E8H A;  3F7V C;  2DQ0 A;  1K5Q A;  3EFF K;  1QLE C;  1PKX A;  1WPX A;  2JJ2 G;  1PNK A;  1QVF U;  3QO8 A;  4PDM A;  2ZQM A;  5L3D A;  2JIZ G;  3CXC U;  1AR1 B;  3CCQ V;  2WLI A;  1RPO A;  3ASO B;  3F7Y C;  3MHS C;  3WG7 B;  3AEI A;  4RQE A;  1F4N A;  3OMI B;  3ZMS A;  1YIJ V;  2W6J G;  2QM7 A;  3T1C A;  5LHI A;  4HYO A;  5FL7 G;  2M7W A;  2W6I G;  3G4S V;  3ZJZ A;  5L3C A;  2EIK C;  3FYE B;  3G71 V;  1NH2 D;  2XAG A;  2WWW A;  3CPW U;  1VQM V;  1YI2 V;  3ETE A;  4PA3 A;  3OGC C;  3B8N A;  3AG4 C;  2WLN A;  3OE7 G;  5EBW C;  1QVG U;  5IYC O;  1E79 G;  2XND G;  2ZDI A;  1R6N A;  3UKM A;  3CCM V;  1XL6 A;  2ZDI C;  4JAV A;  1NVP B;  1GTO A;  4MW3 A;  2ZXW B;  3SYO A;  4MTO A;  1AJQ A;  4MVQ A;  1F4M A;  4WFF A;  3CCR V;  2PI5 A;  1R3L C;  4G28 B;  4P30 A;  1AJN A;  4WFA V;  3IC7 A;  4KUM A;  5B1A B;  3ABL B;  1RM1 C;  2EIJ C;  4GX1 A;  3T4Z A;  1R3I C;  5E1A C;  3JD3 A;  4QJF B;  4UVA A;  3LDD A;  1OCO C;  4MW8 A;  1KQS U;  1Y4M A;  3ABT A;  2BOB C;  5B3S B;  1G4Y B;  2UXX A;  3OAA G;  2JJ1 G;  4FK5 C;  4QE9 A;  4FJC C;  4R50 A;  2NLJ C;  3IGA C;  3T4D A;  2DYR C;  4UV8 A;  3SPI A;  1AJP A;  2IU3 A;  3NXS A;  3FB6 C;  1K33 A;  3JD0 A;  3ASO C;  3I55 V;  2H8P C;  1GKF A;  3WG7 C;  4PA7 A;  1VQP V;  2DQ3 A;  4MTG A;  1K97 A;  2V7Q G;  4UV9 A;  1S77 D;  1KP2 A;  2QE7 G;  3OFN G;  4R8C A;  2WLK A;  3TCU A;  1UJW B;  4QE7 A;  5H6R A;  3K04 A;  1BHA A;  1F51 A;  4WFB V;  1JPX A;  1K92 A;  1FS0 G;  5CBH A;  4MVM A;  1H8E G;  4RAI A;  3SYC A;  4UXN A;  1DF4 A;  3LNM B;  1CPY A;  1SRY A;  5HFM A;  1M56 B;  1KD1 W;  3TET A;  2QTO A;  3DTU B;  1PNM A;  3M99 B;  2LP7 A;  2LFS A;  4MT8 A;  5EC2 C;  5B1B B;  1P4R A;  2WSS G;  3I56 V;  2C2A A;  2OTJ V;  2ZXW C;  2LFR A;  3GB7 C;  4LC1 A;  4ASU G;  5CN0 A;  2MK3 A;  3OMN B;  1ORQ C;  1K4C C;  2EIM C;  2IJJ A;  3LSS A;  1DTO A;  3CC2 V;  2WAM A;  4E2L A;  1BHB A;  2JEX A;  5EBL C;  3ABL C;  3ETD A;  4PEL A;  5B1O A;  4JTD B;  4FPP A;  5KA5 A;  4X89 A;  1THZ A;  3CCJ V;  2Q68 A;  1GK9 A;  3TK1 A;  1VQO V;  3FB5 C;  3JD1 A;  4ZBM A;  3LDC A;  4U7O A;  2EZO A;  3K3W A;  3OEH G;  5KUK A;  1KEC A;  2DWE C;  1SET A;  1PD3 A;  1H8H G;  4JF3 A;  3E86 A;  2WLL A;  5DM6 V;  2IJH A;  1OCR B;  5KA6 A;  4R7C A;  4ZKI A;  1JOY A;  4XDL A;  1OCZ B;  3K0D A;  3LDE A;  2GHY A;  3E8G A;  1GO3 F;  1VQ5 V;  2UXN A;  4RUE A;  3AG2 B;  2EIL B;  3CC7 V;  3E2E A;  2IH3 C;  2WLH A;  4LP8 A;  1K7D A;  4LCU C;  4XDK A;  3ZRS A;  5CBG A;  1PL0 A;  5H6Q A;  1Q82 W;  3GWO A;  1EBO A;  2A0L A;  2OCC B;  1LNQ A;  1QR8 A;  4GT1 A;  1AI6 A;  1S3J A;  1V54 C;  3R65 A;  1NJI W;  1MAB G;  2ZR3 A;  3AG3 B;  1KC8 W;  5H9C A;  1E1Q G;  3FB7 C;  1NH2 B;  3OW2 U;  1Q7Y W;  3E89 A;  3HB3 B;  3CCU V;  4RQF A;  1SZT A;  2QEX V;  1M56 C;  3P30 A;  4L87 A;  4J9Y B;  1QBZ A;  4JYB A;  4TT3 G;  4MTF A;  2X6C A;  3W7T A;  5B1B C;  2ITC C;  2X6A A;  4G2K A;  3ZN1 A;  2B1I A;  2DWD C;  2Y69 B;  4DO2 A;  1VQ7 V;  1AI5 A;  1RPR A;  2XAF A;  4P9O A;  5LHG A;  2EIN B;  1W2B U;  3ML0 A;  5IY5 B;  5BZB A;  2B1G A;  3K79 A;  3UM7 A;  4XDJ A;  1S76 D;  1YTF D;  2JK5 C;  5CMU A;  2IU0 A;  5LHH A;  2JEU A;  2CK3 G;  2Q69 A;  3RW0 A;  2IW5 A;  1M9N A;  4PDL A;  4MSW C;  4KP4 A;  4JYC A;  3W7X A;  2JDI G;  1I5X A;  2QKS A;  2WPD G;  1M1K W;  1S72 V;  2IJI A;  1BMF G;  3OEE G;  5GW7 A;  3ASN B;  4GX5 A;  3CYO A;  1JJ2 U;  3CME V;  5DN6 G;  1QLN A;  1WLE A;  2DYS C;  4UUJ C;  1OCR C;  3ABU A;  4HAM A;  5B1N A;  4JTC B;  3ZMT A;  4Z1M G;  4GX2 A;  4U7N A;  1N8R W;  3SYQ A;  3PJS K;  1JVM A;  3AG2 C;  2EIL C;  1QR9 A;  4R6Z A;  1AI4 A;  1R6K A;  1MOF A;  2HJF C;  5KUM A;  4BIZ A;  3JD2 A;  2Z3Y A;  1K73 W;  4UVB A;  2H94 A;  2XAS A;  4CBC A;  1FFT B;  3OMA B;  2OCC C;  2HVJ C;  1M57 B;  1GM9 A;  4QPJ A;  3X2Q B;  1J95 A;  2Z5U A;  3CC4 V;  3SPG A;  1NR7 A;  4DXW A;  1BL8 A;  1JX9 A;  3KG2 A;  1GM8 A;  2X7R B;  2Q6A A;  4MVZ A;  3FKS G;  2NNU A;  3OUS A;  3G6E V;  3F5W C;  2Y69 C;  2A79 B;  3JD4 A;  3EHB B;  4G27 B;  4UVC A;  3K06 A;  3ABM B;  3K9A A;  2IJK A;  2EIN C;  1V55 B;  3QO7 A;  5IY5 C;  4N21 A;  4JTA B;  4JAU A;  3K03 A;  1AI7 A;  2FTK A;  4JPR A;  3D36 A;  3OR7 C;  4WFE A;  2Y48 A;  1FXV A;  1NR1 A;  2HVK C;  4J9Z B;  2WLI B;  3ZRV A;  3QO5 A;  3CP1 A;  1I5Y A;  4OXS A;  5B1A C;  2GSM B;  4RO2 A;  4JGS A;  4I9W A;  2YSU B;  4I5S A;  1DLB A;  5LBQ A;  1VQK V;  4RUF A;  1YJ9 V;  3AG4 B;  2IH1 C;  3DGE A;  4WFH A;  3ASN C;  1SER A;  5B3S C;  5HFL A;  1ENV A;  2KB1 A;  3K0G A;  4GCZ A;  4WFG A;  4XBF A;  2XAJ A;  3W7U A;  3CCS V;  1YHQ V;  3BY6 A;  4FIP C;  3ZRX A;  3CMA V;  1GM7 A;  5L3E A;  1EFR G;  1W0J G;  3STZ C;  3E83 A;  2OTL V;  3RBZ A;  5CA3 A;  1VQ4 V;  4H37 A;  3E8B A;  3A0R A;  2XAQ A;  3SPJ A;  4X8A A;  2P67 A;  1M57 C;  3ABK B;  3ZMV A;  1PNL A;  1FXK B;  1KP3 A;  1OCO B;  1JCH A;  1XL4 A;  1VQN V;  1IXM A;  1K9M W;  2EZP A;  4MVO A;  1YJW V;  3SPC A;  2D3O W;  1MSW D;  1NQT A;  2ZD9 A;  3LUT B;  3ABM C;  2DYR B;  1QCE A;  1V55 C;  4KFM A;  2P7T C;  1EZJ A;  2YEV B;  1YTF B;  2EJR A;  2XAH A;  1Y66 A;  4MS2 A;  3OR6 C;  4QPK A;  1FXH A;  3HPL C;  5LGU A;  2ITD C;  1NKD A;  5IYB O;  2R9I A;  1NBM G;  4WCE V;  3E8F A;  4LBE C;  4PDV A;  3ZRW B;  4MTX A;  1YSC A;  2W0F C;  1GMG A;  1S0V A;  5IDJ A;  1HWY A;  2QM8 A;  2ZR2 A;  4X88 A;  4F4L A;  3RVY A;  3B77 A;  3SYA A;  3P32 A;  5EBM C;  2WLM A;  1NVP D;  1B6Q A;  3MHH C;  5LGT A;  1E1R G;  1F23 A;  3H01 A;  4TSF G;  1OCZ C;  2P6J A;  3FB8 C;  1FXK A;  2B5U A;  2EIM B;  2K1E A;  1K4D C;  1R73 A;  1H38 A;  3ABK C;  5EC1 C;  1MG1 A;  4EKW A;  2QA4 V;  3OUF A;  1ROP A;  2HR3 A;  1OCC B;  1YIT V;  1FXK C;  2F43 G;  2P90 A;  4N23 A;  1YJN V;  4FMT A;  3FYI B;  1DF5 A;  3AG3 C;  4P9P A;  1G8M A;  2HFE C;  3B8M A;  1H2G A;  5L3B A;  3SYP A;  2X6B A;  4YXW G;  3ZMZ A;  1R3J C;  3LSQ A;  4BW5 A;  5LGN A;  2BOC C;  1ZWI C;  4CZZ A;  3WFV A;  2YEV A;  3T2M A;  3AG1 B;  4QNH B;  2OT5 A;  3ZCC A;  5EK0 A;  2X0L A;  1K5S A;  1QLE B;  3VBB A;  1TUE B;  2WLL B;  2R9R B;  3OM3 B;  4WF9 V;  1W0K G;  4Q20 A;  3STL C;  3JYC A;  1Q86 W;  3RVZ A;  1ARO P;  1K3E A;  2WLJ A;  4MVU A;  3CCV V;  5J9P C;  1SES A;  2Q67 A;  3IFX A;  3MD0 A;  3ZMU A;  1K8A W;  2PI4 A;  3ZRW A;  3K08 A;  3VOU A;  3ZIA G;  1V54 B;  4P2Z A;  1KKD A;  1S5H C;  2EBO A;  4PDR A;  2EIK B;  2DW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...