1QR8A

Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
SGIVQQQNNLLRAIEAQQHLLQLTVRGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP41 ENVELOPE PROTEIN
publication title Inhibition of human immunodeficiency virus type 1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion.
pubmed rcsb
total genus 27
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1999-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qr8A00
4FJCC 3WFVA 2MK3A 1F23A 3CYOA 4G2KA 5HFMA 5KA6A 1DLBA 2EZPA 1K33A 3B8NA 4FK5C 1Y66A 1DF4A 3B77A 5CN0A 4N23A 1QBZA 1JPXA 4N21A 4FIPC 4E2LA 1I5YA 1I5XA 2P6JA 3M99B 1QCEA 4JGSA 1EBOA 1Y4MA 2EZOA 2LP7A 4JPRA 5HFLA 3MHSC 1SZTA 4JF3A 3P30A 5H9CA 1QR9A 1MOFA 1JQ0A 3B8MA 3GWOA 3H01A 3CP1A 1MG1A 1K34A 2OT5A 3K9AA 5CMUA 3MHHC 5KA5A 1ENVA 2X7RB 1DF5A 1QR8A 2M7WA 2EBOA
chains in the Genus database with same CATH superfamily
4JI1B 2DYSB 2VS0A 2FYUH 2ZR3A 4JZGA 1HNZO 1S5JA 2A7WA 4X1KA 3ZIAG 2ZDIA 1N0NA 3ABLC 4CH4A 5JJNB 1ZTEA 4AQYB 4JYCA 4Q6GA 1AI7A 2ZE6A 2FL4A 2GUZA 2EIJB 1Z5VA 3RBZA 4KXRA 1GN3A 1JJOA 4U3FH 1W59A 2YSUB 4PA6A 4LF8O 1GM7A 5DEDA 1I5XA 4I50A 5C93A 3AG7A 3CEIA 3QNEA 3E22B 4OPHA 2A06H 3KCYA 5KAIZ 3ETQA 1N4CA 4J41A 4J7ZA 1F4MA 1XMOO 1ORQC 3JD3A 3RYFA 1LUWA 1V55B 2UU9O 3JALA 1Y66A 2OCCC 2LW7A 2GV9A 3S3WA 1OCZB 1Y74B 5JCOA 1AP6A 3SPJA 3B4SA 1FD9A 1MMMA 5LGTA 3ZHVA 2ZDIC 2JGDA 1M4UA 3FB5C 3J80N 3RVYA 3ETDA 5LXTB 5K1XA 2UXNA 1RSOA 3IC9A 4FIPC 1SKVA 3B2EE 2AHYA 3D36C 4HNAA 3LUTB 5KHHA 4NXMO 2RMKB 2LGWA 2WLKA 1BCCH 4FPPA 2ZE5A 1Z5WA 1FPOA 1K92A 4JV5O 3N2KB 1MZFA 1YIJV 1XNQO 1K5QA 1JA8A 1GK9A 1K9MW 3OR6C 1SC5B 3K08A 4HAMA 2QE7G 1WPXA 3ABKC 4YY3O 1Q7YW 3I56V 3ZN1A 2WA4A 1FJGB 1E1QG 3U10A 1E79G 2Q69A 5JCOC 3JCZA 1VQ7V 2KQXA 5KMGA 2DOSA 1P7GA 3HPLC 4JYYA 3BVOA 3FYIB 1L0LH 2W0FC 4K35A 1W0JG 4X64B 2DQ3A 4FFKA 4QJFB 3ABMC 4JPRA 3T1HO 2WLLA 3L70H 1JCHA 2Y4UA 2UUBB 3L71H 5EC1C 1M90W 2JS5A 4DV1B 5L3FA 2IJIA 4UVAA 3BA9A 2PGGA 4NR1A 3LDCA 2E76B 4O4HB 4LC1A 3BY6A 4LF4B 2RNBA 5CA1B 3OT7A 3JAKB 3E89A 4YJ2A 2DJVA 3IJ4A 2OIEA 2QDOA 4HYOA 1YTFD 1HNZB 1D2DA 2EIMC 5C8YA 1H2NA 2R9IA 4JTAB 2UXCO 1N36O 1MNGA 1SA0B 3CD6V 3OUFA 5H6QA 2Q0AA 2Q68A 4FMTA 5IY5B 3BABA 3KKYA 4IHJA 3P3PA 1OZ0A 5L3DA 3SDLA 5CA3A 4LF8B 2X7RB 4FJCC 3IC7A 1NH2D 1DF4A 1Q8IA 5EBLC 1UFIA 3ZRWA 2YICA 4O2AB 4Z1MG 5E79Z 4JI5O 3I5DA 4JGSA 1RM1C 3G4SV 1VF6A 2A0LA 1XI1A 5CB4B 2E75B 1JR9A 3QO5A 3CE2A 4DR4B 4TOIA 4NTXA 4PD4F 5KA6A 4R8CA 4DW1A 1QVGU 1K3EA 1ZX3A 4BIZA 4DXWA 3W7SA 2OYQA 1IURA 4FZ1A 4HZ3A 1XNRO 2WLIB 2WPDG 3E22A 4TUYB 2JJ2G 3CCLV 4NXMB 3HKEB 4CH6A 4UXNA 4GYCB 4D6TH 3VQVA 3RVZA 1NU1H 4JV5B 4B3RB 3H1JH 1XNQB 2RDCA 1KUQA 4LR3A 1TVKB 1BL8A 4X20A 3K04A 1Y74A 2Q67A 4KUMA 3CCRV 3D3IA 3OMNB 1VF6C 1ZLZA 2DYSC 1Q6IA 3CXCU 1P84F 2HHHB 4ZI7B 1EZJA 3B40A 1FXKB 2UUCO 4JI4O 1JMKC 4P30A 1IBKB 5LXTA 4GX2A 1M5IA 5IJ9A 3P30A 3H01A 4J11A 3S3XA 2OIGA 3PJSK 2XOKG 1AJQA 3U0ZA 4GKJO 4K3AA 3CC4V 1R3IC 4KHPO 4DR6O 2F93B 4J7JA 4FM0A 1BQZA 3RYCB 4DR1O 2NN4A 4LF6O 5IE9A 2H3OA 3CCSV 3SYQA 3ZN0A 4OX9B 1NR1A 3BHPA 4WFAV 2ITCC 4QE7A 2JDIG 1VQMV 1OCZC 3CHXA 4B7EA 1H2KA 1PP9H 3KZIZ 3LDDA 1SRYA 4H33A 4MVOA 1XDCA 3Q4HA 3CX5F 3OGCC 1OV9A 1PNLA 3OUSA 4UCTA 2R72A 2OT5A 3T4ZA 2WLNA 4DV2O 1NI8A 1Q5OA 1B04A 1XBLA 4I55B 4JYAB 3ETGA 1YVWA 2AHZA 4H44B 4EFBA 5LA6B 1N8RW 5TISZ 2YXHA 3HB3B 3JARB 1OCRB 2YEVB 4OPAA 2LQTA 4X1YB 4QE9A 4FLTA 3APQA 1SQQH 3F7YC 3M8AA 3MD0A 2QSAA 4UCSA 5KHJA 1GTOA 1YZBA 3LSSA 5CBHA 5J9PC 2DQ0A 1AVMA 1VQNV 2V4DA 2QGNA 4TSFG 4E2LA 4AHCA 5JQGA 3OEEG 1IBLO 2ZIMA 3E35A 3SYAA 4O4IA 4K0KO 2GHYA 2CTRA 4TQDA 5LHHA 4X65O 1YHQV 2JJ1G 2QTSA 2FMLA 1QR8A 2YI9A 3LNMB 2R9RB 4BIOA 2GBOA 4UCUA 3A0HZ 4U7OA 4MTFA 4RUFA 5FPRA 4W4LA 5FLXN 4LFCO 1BZKA 4JI3O 3QTCA 3CMAV 4I4TA 2HLDG 3L9DA 3K3WA 5LBQA 4LH6A 4O2AA 3K5NA 5J2TA 1GN6A 1DF5A 4YIPA 3WFVA 5HFMA 4RO2A 2YIBA 1AI6A 5CN0A 3OEHG 3EVKA 4N21A 3W7WA 4BW9A 3K5OA 2WLMA 1H2SB 5EZYB 4X1IB 1VQ5V 4CZZA 4ZOLB 1VQPV 2MW2B 3EFFK 3OMIB 3VQXA 3L73H 2B9ZA 4QPKA 1F23A 5IY5C 3C3TA 4RQEA 4DV5B 1Y67A 2WLIA 2UXDB 4TUYA 1GN4A 1MABG 3K5MA 3HKEA 3ZMVA 4P9OA 2LGQA 4IYIA 1PL0A 4LWSB 4O4JB 2YIAA 4F6EA 2ZD9A 4DR1B 1DGSA 4LF6B 1TVKA 2G38A 2YUAA 3SPGA 2YI8A 3E2EA 1THZA 4A5UB 3OAAG 4DRXB 3SJCC 1Y6XA 3TETA 5EK0A 4LFAO 4GCZA 2CGOA 1ZWIC 4LNUB 5EC2C 4BWAA 3VBBA 4HBNA 1AI5A 2Y0IA 4RQFA 1FXKA 3E8HA 5JVDA 3ZX6A 2KG7B 1AB3A 2QWOB 4DR2O 4DUYO 1MSWD 2XAQA 4GKKO 4JAVA 3CCUV 4BIUA 1BGYH 4DO2A 1S5HC 5B5EZ 4DV2B 3G6BA 1R3KC 3L72H 2CAZC 2EJRA 3AK3A 4AILC 4LF5O 1XUQA 3DXRB 3BPZA 4OGQB 1VQ8V 3HKBB 3T1YB 1QNMA 4JTDB 1M57C 3H1HH 4MTXA 4B3MO 3FKSG 3JATB 5DM6V 4GT1A 2BCCH 1OCCB 2M6YA 1XOUA 2EZPA 1TUEB 1BSMA 1G4YB 1VQ9V 1AROP 3OD4A 4MTGA 5D5PA 4X88A 1MSDA 5LMNO 1O9GA 1R3JC 3X2QB 3LSUA 2YXYA 1H2LA 4DR5O 2ITDC 3JASA 2RN9A 2QKSA 1GH6A 1FXKC 2JEXA 1XILA 3VQWA 1L1FA 2ZKOA 1BMFG 3D36A 4IIJB 4X65B 4UVBA 1BT8A 1IXMA 3ZRSA 1SQGA 2YS8A 3P32A 4I55A 1N34O 3K0DA 4TT3G 4WFEA 3CCMV 4DYLA 1RPOA 2YIBD 1I0HA 3W7UA 3UCSC 4JI6O 5LA6A 4B3TO 4DR3O 3CC2V 1PD3A 1SZXA 4LFCB 4JI3B 2IJHA 1J5EO 3JARA 1IX9A 2UUAB 4X1YA 1OJHA 1GM8A 5EIBC 1QVFU 1YDXA 4NB5A 2L35A 1AJPA 4DR7B 4PA4A 1Q81W 2DYRB 3SR2C 5A9GA 2QA4V 3ZMSA 4JI8O 1S72V 1NQTA 5B1OA 4CH5A 5H2FZ 2E5LB 4JI0O 3RYIB 4TV9B 4DV7B 3K79A 1K33A 2CTWA 2WA3A 2Y0PA 3CRAA 4NXNB 1H8EG 2RQ6A 5H9CA 1AR1B 1ZL8B 1VP7A 5J2UB 4X62O 4CH3A 2ETNA 4UCRA 2BSKB 3H1KH 2DWEC 2X6CA 4FZ0A 4BAYA 1YXBA 3WB2A 1FXHA 4QNHB 2F23A 1W2BU 4TWKA 1SESA 3RW0A 1R6KA 1XL4A 3E8BA 3A0BZ 4YJ3B 3JCUZ 2F95B 2PI5A 2N04A 1OCRC 1P7BA 1QCEA 1RFYA 4B3SB 4FFBB 5KX5B 2F66C 1YJWV 5JWPA 2OTJV 1A32A 1F51A 4PHZA 1ZUQA 5FPOA 2FB5A 5JH7A 1M9NA 5IWAO 2VRZA 4EFEA 4X1IA 1JVMA 3M7MX 1QHTA 1Q3EA 4UUJC 4ZOLA 1IDSA 2PYLA 4CS2A 4J42A 2CH7B 4DUYB 3JD2A 2C2AA 2HJFC 2BTOA 1D5NA 4KL1A 3JD0A 3ABUA 4PI2A 1SQVH 3SGIA 4DV3B 3QF7A 4O2BA 4F6RB 3CRCA 3DSQA 2CTQA 2NLJC 2AZ2A 4LWSA 4G2KA 4O4JA 4R6ZA 1NVPB 4LF5B 4BR6A 3BFRA 4MSWC 1I5YA 2LP7A 3D8CA 4CBCA 4XDJA 3HKDB 3ZHTA 2B5UA 4LNUA 4LBEC 4I9WA 1SQPH 3F5TA 4K8ZA 1COWG 3KG2A 4FLUA 1UPGA 4LF7O 1HR0O 5ITZA 1NKDA 4MVSA 4DR5B 3GB7C 3M99B 3J81N 4B7KA 2ODMA 3EXAA 2P67A 3CCJV 5B3SB 1TGOA 3R66A 1N34B 3RYHB 3DXRA 1TUBB 2IW5A 1IVSA 3HKBA 2Q7EA 4CC5A 1G8MA 4JI6B 4B3TB 3OW2U 1N0JA 4MT8A 1XMOB 3C90A 1Y4MA 3I55V 2H8PC 4D7SA 4YHHO 1CEZA 2UU9B 3OTFA 4YXWG 4GX0A 3FD9A 1YJ9V 1WPBA 2QTOA 2QM8A 1HNWO 4QIWF 2JK5C 2VQFO 2UXBO 5L3BA 4X66O 1KP3A 4EB6B 4JI0B 2Z3YA 3RWRD 1KB9F 3B8MA 3UQ8A 3SJQC 5LL6Y 1SQBH 4LFBO 2EINB 2P5OA 4JI7O 4QPJA 1K4CC 3JSLA 1WA8B 5EYPB 2BOCC 4WCEV 4I7ZB 2XUMA 4E4EA 4D7TA 1S76D 2HR3A 3DC6A 1AR5A 2A3QA 2D3OW 2WSSG 3CS5A 2EIKB 1OCCC 3SPCA 1L8DA 4YY3B 4RAIA 2EBOA 4WFHA 2DMXA 1Q43A 3AG1B 4ZBMA 2ARHA 1G1XB 2ADPA 4F4LA 3RYIA 3OTOO 4TV9A 3X2QC 5CA0B 2JS3A 1BE3H 5BMVB 5K1PA 1NTKH 1MA1A 3ZHQA 1LUVA 4L87A 1XL6A 5H5NA 3RN4A 1B3QA 3CCQV 2EIJC 1ZL8A 3OGIB 5BR8O 4L8JA 3T1HB 3JAWB 1B06A 3TXSA 1H2MA 5KUKA 2IJKA 1PV0A 3N2KA 4R7CA 2XAFA 1IBMO 4PA7A 4YJ3A 5DECA 2K1EA 4QGPA 1V55C 4FFBA 5KX5A 3T2MA 1EZVH 1WP7A 2Q7HA 3P3NA 1GRJA 2BE3A 4MVQA 2PZSA 4PDLA 2CGNA 3TXQA 2DYRC 3E8FA 3JD4A 1HNXO 1KC8W 4IL6Z 1V54B 1K5SA 3ML0A 2LW1A 2OTLV 3F5WC 1KKCA 1XHZA 2NNUA 3AK1A 2IH1C 1AILA 1JOYA 3K58A 2UXCB 1HR0B 1N36B 4DUZO 5GTHZ 3ZS8C 1XHXA 2XTAA 3K06A 3MHHC 2ZCEA 4G27B 4FM2A 1I94O 1JJ2U 5LYJB 2A79B 3CJHB 5CBGA 3CXHF 3PN1A 5L3EA 4GZRB 1M56B 1K97A 1US6A 3A8TA 1VARA 2CE4A 2VQEO 1VQOV 4O4HA 1XMQO 3K59A 2QEXV 5CA1A 1OHHG 3ZRXA 2V7QG 1SERA 4EKWA 3JAKA 5DN6G 3CRRA 3HKDA 4JI5B 1YTFB 5FL7G 1KD1W 2JVDA 4YHHB 2CDYA 4UV9A 5IYZB 1S77D 1QU7A 2P6JA 4JI1O 3DC5A 4X89A 3QO8A 1HP8A 1SA0A 4YIOA 3JSNA 2LFSA 3HKCB 2UXBB 3AG2B 4DV6O 2ZT9B 4AQYO 2WLJA 2L6LA 2IM9A 4XBFA 1NH2B 1XQ8A 3LDEA 1XNRB 3RYHA 3ZJZA 4U3JB 4H37A 1TUBA 3NXSA 1EBOA 1Z2GA 3FX7A 1I7FA 1QR9A 4J9YB 3APOA 1NBMG 3T4DA 1RSOB 4MTOA 4ZKIA 5CB4A 1AP5A 2KKWA 5B1AB 3K57A 2AGAA 4PJ0Z 5KHGA 4CS4A 2W0XA 1SETA 2EILB 5HFLA 3SYCA 5B66Z 5LHGA 4MS2A 2WLHA 3E83A 1WNSA 4TQFA 3G6EV 2UUCB 4EB6A 2P7TC 4JI4B 2F4VO 3OTOB 4I5SA 2M7WA 4AI8A 3VQYA 3ASOB 3ZRVA 4UFZA 2Y4TA 2EIMB 2IH3C 2P90A 4GKJB 2Q6AA 1WA8A 4KHPB 5KAFZ 4DR6B 5LGUA 1XEQA 2HFEC 4PV1B 3FB8C 3D3QA 1JX9A 1K8AW 4RUEA 5CMUA 4RWUA 1IBMB 2CK3G 1FKAO 4H13B 4WBNB 4K8XA 4J9ZB 3GVMA 4PDRA 4J10A 1FFTB 2NR5A 1VQLV 3AEIA 5A2QN 1Y76B 2ZE7A 2X6AA 3ETEA 1YITV 4ZI7A 4W4KA 1N32O 1MG1A 1PNKA 2HKOA 2PF4E 2IU0A 5CA0A 1HNXB 2QWNB 5BMVA 2XT9A 1ENVA 3L75H 2MK3A 1FS0G 1FJGO 5GW7A 4O4LB 1S0VA 2Q5ZA 5D5QA 5L3CA 1JPXA 4DUZB 2HJDA 3UT5B 1P4RA 2Q7GA 1SZTA 5GONB 2Y48A 4GLXA 1Q86W 1KBHA 3RYCA 4X64O 2EINC 4Z1VA 2V1DA 2IJJA 2QM4A 2IBZH 3LNNA 2UUBO 3ZCCA 2W6IG 3OE7G 1GN2A 4DV1O 2F43G 3J7AU 1M93A 5IYBO 1YJNV 3ZMTA 4ZIBA 2ZXWB 2XAGA 2F1MA 1V9PA 2EIKC 1H38A 4ABMA 3GWKC 2PY5A 4G28B 1K7DA 4DK1A 3STLC 2YXLA 1N33O 2ATKC 1FFXB 4JI2O 4B08A 2ZM6O 1PL4A 4XDLA 1IBLB 3SYPA 4TV8B 1DLBA 4K0KB 3B77A 4MVUA 4WFFA 3TCUA 3AG4B 1FYJA 3CWBH 5LYJA 3CJHA 4DV6B 4R50A 2E74B 3OM3B 4LH7A 1B6QA 4H0LB 3ABTA 4UCOA 1F7YA 3E8GA 1D5AA 2YEVA 3CYOA 5BZBA 1GAXA 5LGNA 1KU9A 2KSDA 3THOA 4GUNA 4Z2WA 4ZHQB 1QLNA 3O9OA 5IYZA 1CXZB 1YCIA 4UVCA 5AG2A 4DV4O 1R6TA 5IJ0B 1WB8A 1BQ0A 4DK0A 1R1BA 5KHIA 2DE0X 3SPHA 1BHBA 1V54C 4DR4O 4X20B 3CSXA 1PPJH 3ICXA 3HKCA 2PI4A 2ZINA 3WU2Z 2F4VB 3MHSC 4MVMA 4JYBA 3FFQA 3F7VC 1AR4A 4IT5A 4U3JA 2PYJA 2XAJA 1X59A 3WB1A 4FLXA 4X8AA 4Q20A 5IJ9B 1M56C 3N27A 1NTZH 5L3GA 1FXVA 1OCOB 3TGUH 3L74H 1Q6HA 1NJIW 2EZOA 1NS1A 4PDMA 5KLVH 1MZEA 4B3RO 3OMAB 1KKDA 4LFAB 4KP4A 2E3CA 4CC6A 1K4DC 5EZYA 1RPRA 4LCUC 4I0XB 1N32B 4N23A 3ASNB 5EIBD 5JJJB 4FM1A 4DR2B 2HHHO 4GKKB 4WFGA 3EHBB 5IDJA 3QG5A 4DW0A 3AG2C 3H1LH 1FAFA 1IBKO 4FLZA 1M1KW 1KP2A 3Q4HB 2XHBA 1SQFA 3BRCA 5B1BB 3BA8A 1H2GA 1YEWA 5LOVB 1QBZA 4WBNA 4FLVA 1EN4A 4B3MB 3NR7A 5E1AC 3CRQA 2ADQB 3KCXA 3E86A 4DRXA 2UXXA 2CUGA 3ZHRA 1RP3B 5BY1A 3CP1A 4WF9V 2ILMA 1Y76A 5B1AC 5KUMA 1UJWB 2O57A 2GDSA 1CP9A 1XREA 2EILC 4P9PA 4OX9O 2DN9A 5LMNB 2YIDA 2KG7A 3JYCA 1S3JA 3AG3B 3WG7B 3C3SA 2OWOA 1N33B 3IFXA 4JI2B 2ZM6B 4JAUA 2Y69B 4O4LA 3ZHSA 1KYOF 1NR7A 2DWDC 3UT5A 3R65A 2P06A 4FVMA 3ASOC 4LF9O 2PUSA 3IGAC 5GONA 5JQGB 3CMEV 2LO1A 5LP6B 4O4IB 1TAEA 2GSMB 3RGBA 4DR3B 3JATA 1J95A 2Q9LA 4JYAO 1J5EB 1QLEB 4PELA 3RFRA 4ASUG 1ZAUA 3DTUB 2BTQB 1R73A 3SYOA 1PM9A 4I4TB 2X6BA 4DV4B 1FFXA 4JI8B 1U96A 3K5LA 2HG5C 4NYKA 2GTSA 4TV8A 5J2TB 3G71V 3BAAA 1E1RG 2R9AA 5F2VO 4IIJA 4GX1A 3GWOA 1KMIZ 2WAMA 3H1IH 1W0KG 1PNMA 3WB0A 1BHAA 2ZIOA 4X62B 2EJ7A 1R3LC 3SJAC 1T5EA 1DTOA 3UM7A 5IYCO 3K9SA 5FNVB 2Q73A 3TJTA 3CRMA 3K0GA 3W7XA 4LP8A 1CPYA 1R6NA 4ZHQA 3A0RA 2Z0AA 4PDVA 4UCVA 1M57B 2ZXWC 3T1CA 3IAYA 1AI4A 5IJ0A 3SJBC 1WJZA 1Q82W 4XDKA 1TA8A 1GM9A 2YC0A 4IGGA 3B09A 4X9QA 2QKCA 5IWAB 1Q90D 2XASA 3UO2A 1SS3A 4NTWA 2HEPA 3QO7A 1VQKV 4IYHA 3ABLB 3JAMN 2QKAA 4UV8A 1F4NA 3OR7C 5J2UA 3AG4C 2BSKA 3CCEV 1L0NH 1Q6UA 2PTMA 2K9PA 5JVDB 5IT9N 3HR0A 5EBWC 3OFNG 1VF5B 4DV0O 4JAAA 3ZHUA 1DK1A 1MOFA 4DV5O 2UXDO 1WN7A 2CTPA 5LHIA 2YDEA 1VQ4V 1VQ6V 4KFMA 3N2GB 1P49A 1VEWA 4UB6Z 3MAQA 3FAVB 4FLYA 1JFFB 4OXSA 3TK1A 4JF3A 3O65A 1EFRG 2OCCB 4I0XA 4LF7B 1WLEA 2CH7A 1URFA 2ZNJA 4X1KB 4JTCB 2H94A 2OCHA 1VMGA 2EULA 1ROPA 4PA3A 4F6RA 4LF9B 2AXTZ 3JASB 5LMUO 4PA9A 2DW4A 2GUZB 5BXZA 2IU3A 1YSCA 5LOVA 1EM1A 2ZE8A 2QWPB 5JJEB 5IYDO 1VIBA 3MDSA 3K9AA 2AW9A 4I50B 1WAZA 1OCOC 2B1IA 4CS3A 2JIZG 4BW5A 3T1YO 1O9HA 4NTYA 3CC7V 2JRIA 3U11A 1G6UA 1QQCA 3ABKB 3DGEA 3JD1A 2P4VA 3RYFB 1HNWB 3JALB 1BS3A 3VOUA 3CPWU 4U7NA 2VWKA 3ZMZA 2VQFB 5H6RA 2ZR2A 2ZQMA 4X66B 3ZMUA 2RCVA 2P22C 3ASNC 4J7KA 2LJ2A 2Q4PA 2Q8VA 4LFBB 5LP6A 2JGDB 4JI7B 2BOBC 2FTKA 3ABMB 2XNDG 3H9VA 5B1BC 4GX5A 3UO3A 1KQSU 1HW7A 2LFRA 4HNAB 1SF9A 2BTQA 2JEUA 4JZ2A 2UUAO 1LNQA 4MVZA 1KECA 1S5LZ 2D2CB 3G80A 1JQ0A 5CBFA 1GO3F 2B1GA 2R70A 3K03A 5KA5A 2AZ0A 4DR7O 1IZ3A 4UB8Z 1K73W 3FB7C 3RT3C 3AG3C 4P2ZA 3WG7C 4ICGA 2N05A 2RJZA 1ZSPA 1SQXH 2Y69C 4EEQA 1NTMH 3CB2A 2E5LO 5KMGB 5JH7B 4DV7O 5B3SC 1YI2V 3SPIA 5EYPA 5BR8B 1PKXA 1K34A 3QVNA 5LP6C 1YF2A 4NXNO 2XAHA 1NT2B 4MW8A 2QWQB 4MVRA 4DV0B 5FNVA 4C7UA 3FYEB 2WLLB 3B8NA 3FB6C 1QLEC 3ZEDA 1VF7A 3BEHA 2ZNIA 4O2BB 2KB1A 4J80A 1EN5A 1EN6A 4JASA 2W6JG 1H8HG 1LR1A 3ZBHA 2FKXA 2Z5UA 1RM1B 1X4TA 2P4KA 1HWYA 2QJ1A 4B3SO 2VWJA 1NVPD 4PI0A 4NVPA 4YJ2B 4FK5C 1GMGA 1AJNA 1IXBA 4FLWA 1WB7A 3JAWA 1I94B 5GTIZ 5C8YB 5EBMC 2QWRB 2HP8A 1U97A 2WWWA 2EX3A 5ITZB 3BCCH 1HDJA 2N74A 1I08A 2QM7A 5LMUB 5B1NA 1WP8A 4I9QA 5KHKA 2VQEB 1XMQB 2JGUA 3LSQA 1GKFA 3N2GA 4IHJB 4DV3O 3AK2A 3G67A 2HVJC 4NKGB 3UKMA 2A9HA 3CCVV 2GTAA 3A2FA 3W7TA 4MW3A 3STZC 3FAVA 1NZ6A 2X0LA 4LF4O 1JFFA 2QR4A 2HVKC 3AG1C 4WFBV 3ZRWB 2Q0OC
chains in the Genus database with same CATH topology
3LNMB 1W2BU 2R9RB 4WFHA 5B1BB 3AG1B 4U7OA 4MTFA 4ZBMA 4RUFA 1H2GA 2DYSB 1QBZA 2ZR3A 4F4LA 3CMAV 3X2QC 3ZIAG 2ZDIA 5E1AC 3ABLC 3E86A 2HLDG 5LBQA 3K3WA 2UXXA 4L87A 1XL6A 3CP1A 4WF9V 4JYCA 3CCQV 2EIJC 1AI7A 5B1AC 5KUMA 1UJWB 1DF5A 3WFVA 5HFMA 1CP9A 2EIJB 4RO2A 2EILC 3RBZA 4P9PA 1AI6A 5KUKA 2IJKA 2YSUB 4PA6A 5CN0A 3OEHG 3JYCA 4N21A 1S3JA 3AG3B 4R7CA 3WG7B 3W7WA 1GM7A 1I5XA 2XAFA 3IFXA 5C93A 3QNEA 4JAUA 4PA7A 2WLMA 2Y69B 2K1EA 1NR7A 1F4MA 1VQ5V 4CZZA 2DWDC 3R65A 3ASOC 1ORQC 1V55C 3JD3A 1VQPV 3EFFK 3IGAC 3OMIB 3T2MA 3CMEV 4QPKA 1F23A 1V55B 4MVQA 5IY5C 4RQEA 2GSMB 4PDLA 1Y66A 2OCCC 2WLIA 2DYRC 3E8FA 3JD4A 1MABG 1OCZB 1J95A 1KC8W 1V54B 1K5SA 3ML0A 3ZMVA 2OTLV 1QLEB 3F5WC 2NNUA 4P9OA 4PELA 3SPJA 2IH1C 4ASUG 1JOYA 1PL0A 2ZD9A 5LGTA 3DTUB 2ZDIC 3K06A 3MHHC 4G27B 1R73A 3SPGA 3SYOA 3FB5C 3RVYA 1JJ2U 3E2EA 1THZA 3ETDA 3OAAG 2A79B 2UXNA 2X6BA 5CBGA 3TETA 5EK0A 4FIPC 4GCZA 5L3EA 1M56B 1ZWIC 5EC2C 2AHYA 2HG5C 1K97A 3VBBA 3G71V 3LUTB 1E1RG 1AI5A 2WLKA 4RQFA 1VQOV 4GX1A 1FXKA 3E8HA 3GWOA 2QEXV 4FPPA 2WAMA 1OHHG 3ZRXA 2V7QG 1SERA 4EKWA 1K92A 5DN6G 1YIJV 1MSWD 2XAQA 1K5QA 1YTFB 1W0KG 4JAVA 5FL7G 3CCUV 4BIUA 1GK9A 1PNMA 3OR6C 1K9MW 1KD1W 1BHAA 3K08A 4HAMA 4UV9A 2QE7G 1R3LC 1WPXA 4DO2A 3ABKC 1S77D 2P6JA 1S5HC 1DTOA 3UM7A 5IYCO 1R3KC 1Q7YW 3I56V 2EJRA 3ZN1A 4X89A 1E1QG 3QO8A 1E79G 3W7XA 3K0GA 2Q69A 1VQ8V 4LP8A 1CPYA 3JCZA 1VQ7V 4JTDB 1R6NA 1M57C 4MTXA 3FKSG 2LFSA 5DM6V 3A0RA 3HPLC 3AG2B 4GT1A 4PDVA 1OCCB 1M57B 2ZXWC 3T1CA 3FYIB 1AI4A 2EZPA 2WLJA 2W0FC 1TUEB 4XBFA 4XDKA 1W0JG 1Q82W 1NH2B 2DQ3A 3LDEA 1GM9A 3ZJZA 4QJFB 1G4YB 4H37A 1AROP 1VQ9V 3NXSA 1EBOA 3ABMC 4JPRA 4MTGA 4X88A 2WLLA 1JCHA 1QR9A 2XASA 4J9YB 5EC1C 1M90W 1R3JC 1NBMG 3QO7A 3X2QB 1VQKV 3T4DA 3ABLB 5L3FA 4MTOA 2ITDC 4ZKIA 2QKSA 2IJIA 4UV8A 4UVAA 1F4NA 1FXKC 2JEXA 3OR7C 3AG4C 3LDCA 1L1FA 5B1AB 1BMFG 3D36A 3CCEV 4LC1A 3BY6A 4UVBA 1IXMA 3ZRSA 1SETA 3OFNG 5EBWC 2EILB 3P32A 3K0DA 4TT3G 4WFEA 3E89A 5HFLA 3SYCA 3CCMV 1MOFA 1RPOA 3W7UA 5LHGA 3CC2V 4MS2A 2WLHA 1PD3A 3E83A 4HYOA 5LHIA 3G6EV 1YTFD 1VQ4V 1VQ6V 2P7TC 2IJHA 4KFMA 4I5SA 2M7WA 2EIMC 3ASOB 2R9IA 4JTAB 1GM8A 3ZRVA 1QVFU 2EIMB 3CD6V 2IH3C 2P90A 3OUFA 5H6QA 2Q68A 1AJPA 2Q6AA 4FMTA 5IY5B 4OXSA 3TK1A 4JF3A 1EFRG 2OCCB 4PA4A 1Q81W 2DYRB 5LGUA 2HFEC 2QA4V 3ZMSA 1OZ0A 1S72V 3FB8C 5L3DA 1JX9A 1WLEA 1K8AW 4RUEA 5CMUA 1NQTA 5CA3A 5B1OA 2CK3G 2X7RB 4FJCC 4J9ZB 3K79A 3IC7A 4JTCB 1K33A 1NH2D 4PDRA 1FFTB 2H94A 1DF4A 5EBLC 3ZRWA 4Z1MG 1ROPA 4PA3A 1VQLV 3AEIA 4JGSA 1H8EG 1RM1C 3G4SV 2A0LA 4PA9A 5H9CA 2X6AA 3ETEA 1AR1B 2DW4A 2IU3A 1YITV 1YSCA 1MG1A 1PNKA 2DWEC 2HKOA 3QO5A 2X6CA 5IYDO 2IU0A 3K9AA 4BAYA 1FXHA 1ENVA 4QNHB 1OCOC 2MK3A 4TWKA 1FS0G 1SESA 5KA6A 2B1IA 1R6KA 1XL4A 3E8BA 5GW7A 3RW0A 2JIZG 4BW5A 4R8CA 1QVGU 1S0VA 2PI5A 5L3CA 1JPXA 1K3EA 1OCRC 1P7BA 3CC7V 4BIZA 1P4RA 4DXWA 1QCEA 3W7SA 1SZTA 2Y48A 3ABKB 3JD1A 3DGEA 1Q86W 1YJWV 2EINC 4HZ3A 2OTJV 1F51A 2V1DA 3VOUA 3CPWU 2IJJA 2WLIB 2WPDG 4U7NA 3ZMZA 1M9NA 2JJ2G 5H6RA 3CCLV 2ZR2A 2ZQMA 1JVMA 3ZMUA 3ASNC 3ZCCA 4UXNA 4UUJC 2W6IG 3OE7G 2F43G 3RVZA 5IYBO 1YJNV 3ZMTA 2ZXWB 2XAGA 3JD2A 2EIKC 1H38A 2C2AA 2HJFC 4G28B 1BL8A 2BOBC 3JD0A 1K7DA 3ABUA 2FTKA 3K04A 3ABMB 2XNDG 2Q67A 4KUMA 3STLC 3D3IA 5B1BC 3CCRV 3OMNB 2ATKC 4GX5A 2DYSC 2NLJC 3CXCU 1KQSU 4XDLA 4G2KA 4R6ZA 2LFRA 3SYPA 1NVPB 1DLBA 2JEUA 1EZJA 3B77A 4MVUA 1FXKB 4WFFA 4MSWC 3TCUA 3AG4B 1I5YA 4P30A 1LNQA 4MVZA 2LP7A 4GX2A 3P30A 4CBCA 4XDJA 1KECA 4R50A 1JQ0A 5CBFA 2B5UA 3OM3B 3H01A 1GO3F 2B1GA 4LBEC 4I9WA 3PJSK 1B6QA 2XOKG 1AJQA 3K03A 3CC4V 5KA5A 1COWG 3KG2A 3ABTA 1R3IC 3E8GA 1K73W 3FB7C 3AG3C 2YEVA 3CYOA 4P2ZA 3WG7C 5BZBA 5LGNA 2Y69C 1NKDA 4MVSA 3GB7C 3M99B 5B3SC 3CCSV 1YI2V 3SPIA 3SYQA 2P67A 1QLNA 3CCJV 1PKXA 3ZN0A 4UVCA 5B3SB 1K34A 2XAHA 1NR1A 4MW8A 4MVRA 4WFAV 2ITCC 4QE7A 2IW5A 2JDIG 3FYEB 1OCZC 1VQMV 3SPHA 1BHBA 2WLLB 1V54C 3B8NA 3FB6C 1G8MA 3LDDA 1QLEC 3OW2U 1SRYA 2PI4A 4H33A 4MT8A 4MVOA 3BEHA 1Y4MA 3I55V 2H8PC 3MHSC 2KB1A 4JYBA 4MVMA 3OGCC 3F7VC 1PNLA 4JASA 2W6JG 1H8HG 3OUSA 1CEZA 2Z5UA 2XAJA 4YXWG 4GX0A 1RM1B 2OT5A 3T4ZA 1HWYA 2WLNA 4X8AA 1YJ9V 1NVPD 2QTOA 2QM8A 4Q20A 1M56C 3ETGA 2AHZA 1GMGA 4FK5C 5L3GA 1FXVA 4QIWF 1AJNA 2JK5C 1OCOB 1NJIW 1N8RW 2EZOA 5L3BA 1KP3A 2Z3YA 3HB3B 1OCRB 2YEVB 3B8MA 4PDMA 4QE9A 5EBMC 3SJQC 3OMAB 2WWWA 3F7YC 1KKDA 2QM7A 3MD0A 2EINB 4KP4A 1K4DC 5B1NA 1RPRA 4QPJA 1K4CC 1GTOA 4LCUC 3LSSA 5CBHA 2BOCC 5J9PC 4WCEV 2DQ0A 3LSQA 1GKFA 4N23A 1VQNV 4TSFG 4E2LA 3ASNB 1S76D 2HR3A 2HVJC 3UKMA 3OEEG 3E35A 2A9HA 3CCVV 3SYAA 4WFGA 3W7TA 3EHBB 2GHYA 2WSSG 4MW3A 5IDJA 3STZC 2D3OW 5LHHA 1YHQV 3AG2C 2X0LA 2EIKB 1OCCC 3SPCA 2JJ1G 2HVKC 1KP2A 3AG1C 4WFBV 1M1KW 3ZRWB 4RAIA 1QR8A 2EBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJC C;  3WFV A;  2MK3 A;  1F23 A;  3CYO A;  4G2K A;  5HFM A;  5KA6 A;  1DLB A;  2EZP A;  1K33 A;  3B8N A;  4FK5 C;  1Y66 A;  1DF4 A;  3B77 A;  5CN0 A;  4N23 A;  1QBZ A;  1JPX A;  4N21 A;  4FIP C;  4E2L A;  1I5Y A;  1I5X A;  2P6J A;  3M99 B;  1QCE A;  4JGS A;  1EBO A;  1Y4M A;  2EZO A;  2LP7 A;  4JPR A;  5HFL A;  3MHS C;  1SZT A;  4JF3 A;  3P30 A;  5H9C A;  1QR9 A;  1MOF A;  1JQ0 A;  3B8M A;  3GWO A;  3H01 A;  3CP1 A;  1MG1 A;  1K34 A;  2OT5 A;  3K9A A;  5CMU A;  3MHH C;  5KA5 A;  1ENV A;  2X7R B;  1DF5 A;  1QR8 A;  2M7W A;  2EBO A; 
#chains in the Genus database with same CATH topology
 4JI1 B;  2DYS B;  2VS0 A;  2FYU H;  2ZR3 A;  4JZG A;  1HNZ O;  1S5J A;  2A7W A;  4X1K A;  3ZIA G;  2ZDI A;  1N0N A;  3ABL C;  4CH4 A;  5JJN B;  1ZTE A;  4AQY B;  4JYC A;  4Q6G A;  1AI7 A;  2ZE6 A;  2FL4 A;  2GUZ A;  2EIJ B;  1Z5V A;  3RBZ A;  4KXR A;  1GN3 A;  1JJO A;  4U3F H;  1W59 A;  2YSU B;  4PA6 A;  4LF8 O;  1GM7 A;  5DED A;  1I5X A;  4I50 A;  5C93 A;  3AG7 A;  3CEI A;  3QNE A;  3E22 B;  4OPH A;  2A06 H;  3KCY A;  5KAI Z;  3ETQ A;  1N4C A;  4J41 A;  4J7Z A;  1F4M A;  1XMO O;  1ORQ C;  3JD3 A;  3RYF A;  1LUW A;  1V55 B;  2UU9 O;  3JAL A;  1Y66 A;  2OCC C;  2LW7 A;  2GV9 A;  3S3W A;  1OCZ B;  1Y74 B;  5JCO A;  1AP6 A;  3SPJ A;  3B4S A;  1FD9 A;  1MMM A;  5LGT A;  3ZHV A;  2ZDI C;  2JGD A;  1M4U A;  3FB5 C;  3J80 N;  3RVY A;  3ETD A;  5LXT B;  5K1X A;  2UXN A;  1RSO A;  3IC9 A;  4FIP C;  1SKV A;  3B2E E;  2AHY A;  3D36 C;  4HNA A;  3LUT B;  5KHH A;  4NXM O;  2RMK B;  2LGW A;  2WLK A;  1BCC H;  4FPP A;  2ZE5 A;  1Z5W A;  1FPO A;  1K92 A;  4JV5 O;  3N2K B;  1MZF A;  1YIJ V;  1XNQ O;  1K5Q A;  1JA8 A;  1GK9 A;  1K9M W;  3OR6 C;  1SC5 B;  3K08 A;  4HAM A;  2QE7 G;  1WPX A;  3ABK C;  4YY3 O;  1Q7Y W;  3I56 V;  3ZN1 A;  2WA4 A;  1FJG B;  1E1Q G;  3U10 A;  1E79 G;  2Q69 A;  5JCO C;  3JCZ A;  1VQ7 V;  2KQX A;  5KMG A;  2DOS A;  1P7G A;  3HPL C;  4JYY A;  3BVO A;  3FYI B;  1L0L H;  2W0F C;  4K35 A;  1W0J G;  4X64 B;  2DQ3 A;  4FFK A;  4QJF B;  3ABM C;  4JPR A;  3T1H O;  2WLL A;  3L70 H;  1JCH A;  2Y4U A;  2UUB B;  3L71 H;  5EC1 C;  1M90 W;  2JS5 A;  4DV1 B;  5L3F A;  2IJI A;  4UVA A;  3BA9 A;  2PGG A;  4NR1 A;  3LDC A;  2E76 B;  4O4H B;  4LC1 A;  3BY6 A;  4LF4 B;  2RNB A;  5CA1 B;  3OT7 A;  3JAK B;  3E89 A;  4YJ2 A;  2DJV A;  3IJ4 A;  2OIE A;  2QDO A;  4HYO A;  1YTF D;  1HNZ B;  1D2D A;  2EIM C;  5C8Y A;  1H2N A;  2R9I A;  4JTA B;  2UXC O;  1N36 O;  1MNG A;  1SA0 B;  3CD6 V;  3OUF A;  5H6Q A;  2Q0A A;  2Q68 A;  4FMT A;  5IY5 B;  3BAB A;  3KKY A;  4IHJ A;  3P3P A;  1OZ0 A;  5L3D A;  3SDL A;  5CA3 A;  4LF8 B;  2X7R B;  4FJC C;  3IC7 A;  1NH2 D;  1DF4 A;  1Q8I A;  5EBL C;  1UFI A;  3ZRW A;  2YIC A;  4O2A B;  4Z1M G;  5E79 Z;  4JI5 O;  3I5D A;  4JGS A;  1RM1 C;  3G4S V;  1VF6 A;  2A0L A;  1XI1 A;  5CB4 B;  2E75 B;  1JR9 A;  3QO5 A;  3CE2 A;  4DR4 B;  4TOI A;  4NTX A;  4PD4 F;  5KA6 A;  4R8C A;  4DW1 A;  1QVG U;  1K3E A;  1ZX3 A;  4BIZ A;  4DXW A;  3W7S A;  2OYQ A;  1IUR A;  4FZ1 A;  4HZ3 A;  1XNR O;  2WLI B;  2WPD G;  3E22 A;  4TUY B;  2JJ2 G;  3CCL V;  4NXM B;  3HKE B;  4CH6 A;  4UXN A;  4GYC B;  4D6T H;  3VQV A;  3RVZ A;  1NU1 H;  4JV5 B;  4B3R B;  3H1J H;  1XNQ B;  2RDC A;  1KUQ A;  4LR3 A;  1TVK B;  1BL8 A;  4X20 A;  3K04 A;  1Y74 A;  2Q67 A;  4KUM A;  3CCR V;  3D3I A;  3OMN B;  1VF6 C;  1ZLZ A;  2DYS C;  1Q6I A;  3CXC U;  1P84 F;  2HHH B;  4ZI7 B;  1EZJ A;  3B40 A;  1FXK B;  2UUC O;  4JI4 O;  1JMK C;  4P30 A;  1IBK B;  5LXT A;  4GX2 A;  1M5I A;  5IJ9 A;  3P30 A;  3H01 A;  4J11 A;  3S3X A;  2OIG A;  3PJS K;  2XOK G;  1AJQ A;  3U0Z A;  4GKJ O;  4K3A A;  3CC4 V;  1R3I C;  4KHP O;  4DR6 O;  2F93 B;  4J7J A;  4FM0 A;  1BQZ A;  3RYC B;  4DR1 O;  2NN4 A;  4LF6 O;  5IE9 A;  2H3O A;  3CCS V;  3SYQ A;  3ZN0 A;  4OX9 B;  1NR1 A;  3BHP A;  4WFA V;  2ITC C;  4QE7 A;  2JDI G;  1VQM V;  1OCZ C;  3CHX A;  4B7E A;  1H2K A;  1PP9 H;  3KZI Z;  3LDD A;  1SRY A;  4H33 A;  4MVO A;  1XDC A;  3Q4H A;  3CX5 F;  3OGC C;  1OV9 A;  1PNL A;  3OUS A;  4UCT A;  2R72 A;  2OT5 A;  3T4Z A;  2WLN A;  4DV2 O;  1NI8 A;  1Q5O A;  1B04 A;  1XBL A;  4I55 B;  4JYA B;  3ETG A;  1YVW A;  2AHZ A;  4H44 B;  4EFB A;  5LA6 B;  1N8R W;  5TIS Z;  2YXH A;  3HB3 B;  3JAR B;  1OCR B;  2YEV B;  4OPA A;  2LQT A;  4X1Y B;  4QE9 A;  4FLT A;  3APQ A;  1SQQ H;  3F7Y C;  3M8A A;  3MD0 A;  2QSA A;  4UCS A;  5KHJ A;  1GTO A;  1YZB A;  3LSS A;  5CBH A;  5J9P C;  2DQ0 A;  1AVM A;  1VQN V;  2V4D A;  2QGN A;  4TSF G;  4E2L A;  4AHC A;  5JQG A;  3OEE G;  1IBL O;  2ZIM A;  3E35 A;  3SYA A;  4O4I A;  4K0K O;  2GHY A;  2CTR A;  4TQD A;  5LHH A;  4X65 O;  1YHQ V;  2JJ1 G;  2QTS A;  2FML A;  1QR8 A;  2YI9 A;  3LNM B;  2R9R B;  4BIO A;  2GBO A;  4UCU A;  3A0H Z;  4U7O A;  4MTF A;  4RUF A;  5FPR A;  4W4L A;  5FLX N;  4LFC O;  1BZK A;  4JI3 O;  3QTC A;  3CMA V;  4I4T A;  2HLD G;  3L9D A;  3K3W A;  5LBQ A;  4LH6 A;  4O2A A;  3K5N A;  5J2T A;  1GN6 A;  1DF5 A;  4YIP A;  3WFV A;  5HFM A;  4RO2 A;  2YIB A;  1AI6 A;  5CN0 A;  3OEH G;  3EVK A;  4N21 A;  3W7W A;  4BW9 A;  3K5O A;  2WLM A;  1H2S B;  5EZY B;  4X1I B;  1VQ5 V;  4CZZ A;  4ZOL B;  1VQP V;  2MW2 B;  3EFF K;  3OMI B;  3VQX A;  3L73 H;  2B9Z A;  4QPK A;  1F23 A;  5IY5 C;  3C3T A;  4RQE A;  4DV5 B;  1Y67 A;  2WLI A;  2UXD B;  4TUY A;  1GN4 A;  1MAB G;  3K5M A;  3HKE A;  3ZMV A;  4P9O A;  2LGQ A;  4IYI A;  1PL0 A;  4LWS B;  4O4J B;  2YIA A;  4F6E A;  2ZD9 A;  4DR1 B;  1DGS A;  4LF6 B;  1TVK A;  2G38 A;  2YUA A;  3SPG A;  2YI8 A;  3E2E A;  1THZ A;  4A5U B;  3OAA G;  4DRX B;  3SJC C;  1Y6X A;  3TET A;  5EK0 A;  4LFA O;  4GCZ A;  2CGO A;  1ZWI C;  4LNU B;  5EC2 C;  4BWA A;  3VBB A;  4HBN A;  1AI5 A;  2Y0I A;  4RQF A;  1FXK A;  3E8H A;  5JVD A;  3ZX6 A;  2KG7 B;  1AB3 A;  2QWO B;  4DR2 O;  4DUY O;  1MSW D;  2XAQ A;  4GKK O;  4JAV A;  3CCU V;  4BIU A;  1BGY H;  4DO2 A;  1S5H C;  5B5E Z;  4DV2 B;  3G6B A;  1R3K C;  3L72 H;  2CAZ C;  2EJR A;  3AK3 A;  4AIL C;  4LF5 O;  1XUQ A;  3DXR B;  3BPZ A;  4OGQ B;  1VQ8 V;  3HKB B;  3T1Y B;  1QNM A;  4JTD B;  1M57 C;  3H1H H;  4MTX A;  4B3M O;  3FKS G;  3JAT B;  5DM6 V;  4GT1 A;  2BCC H;  1OCC B;  2M6Y A;  1XOU A;  2EZP A;  1TUE B;  1BSM A;  1G4Y B;  1VQ9 V;  1ARO P;  3OD4 A;  4MTG A;  5D5P A;  4X88 A;  1MSD A;  5LMN O;  1O9G A;  1R3J C;  3X2Q B;  3LSU A;  2YXY A;  1H2L A;  4DR5 O;  2ITD C;  3JAS A;  2RN9 A;  2QKS A;  1GH6 A;  1FXK C;  2JEX A;  1XIL A;  3VQW A;  1L1F A;  2ZKO A;  1BMF G;  3D36 A;  4IIJ B;  4X65 B;  4UVB A;  1BT8 A;  1IXM A;  3ZRS A;  1SQG A;  2YS8 A;  3P32 A;  4I55 A;  1N34 O;  3K0D A;  4TT3 G;  4WFE A;  3CCM V;  4DYL A;  1RPO A;  2YIB D;  1I0H A;  3W7U A;  3UCS C;  4JI6 O;  5LA6 A;  4B3T O;  4DR3 O;  3CC2 V;  1PD3 A;  1SZX A;  4LFC B;  4JI3 B;  2IJH A;  1J5E O;  3JAR A;  1IX9 A;  2UUA B;  4X1Y A;  1OJH A;  1GM8 A;  5EIB C;  1QVF U;  1YDX A;  4NB5 A;  2L35 A;  1AJP A;  4DR7 B;  4PA4 A;  1Q81 W;  2DYR B;  3SR2 C;  5A9G A;  2QA4 V;  3ZMS A;  4JI8 O;  1S72 V;  1NQT A;  5B1O A;  4CH5 A;  5H2F Z;  2E5L B;  4JI0 O;  3RYI B;  4TV9 B;  4DV7 B;  3K79 A;  1K33 A;  2CTW A;  2WA3 A;  2Y0P A;  3CRA A;  4NXN B;  1H8E G;  2RQ6 A;  5H9C A;  1AR1 B;  1ZL8 B;  1VP7 A;  5J2U B;  4X62 O;  4CH3 A;  2ETN A;  4UCR A;  2BSK B;  3H1K H;  2DWE C;  2X6C A;  4FZ0 A;  4BAY A;  1YXB A;  3WB2 A;  1FXH A;  4QNH B;  2F23 A;  1W2B U;  4TWK A;  1SES A;  3RW0 A;  1R6K A;  1XL4 A;  3E8B A;  3A0B Z;  4YJ3 B;  3JCU Z;  2F95 B;  2PI5 A;  2N04 A;  1OCR C;  1P7B A;  1QCE A;  1RFY A;  4B3S B;  4FFB B;  5KX5 B;  2F66 C;  1YJW V;  5JWP A;  2OTJ V;  1A32 A;  1F51 A;  4PHZ A;  1ZUQ A;  5FPO A;  2FB5 A;  5JH7 A;  1M9N A;  5IWA O;  2VRZ A;  4EFE A;  4X1I A;  1JVM A;  3M7M X;  1QHT A;  1Q3E A;  4UUJ C;  4ZOL A;  1IDS A;  2PYL A;  4CS2 A;  4J42 A;  2CH7 B;  4DUY B;  3JD2 A;  2C2A A;  2HJF C;  2BTO A;  1D5N A;  4KL1 A;  3JD0 A;  3ABU A;  4PI2 A;  1SQV H;  3SGI A;  4DV3 B;  3QF7 A;  4O2B A;  4F6R B;  3CRC A;  3DSQ A;  2CTQ A;  2NLJ C;  2AZ2 A;  4LWS A;  4G2K A;  4O4J A;  4R6Z A;  1NVP B;  4LF5 B;  4BR6 A;  3BFR A;  4MSW C;  1I5Y A;  2LP7 A;  3D8C A;  4CBC A;  4XDJ A;  3HKD B;  3ZHT A;  2B5U A;  4LNU A;  4LBE C;  4I9W A;  1SQP H;  3F5T A;  4K8Z A;  1COW G;  3KG2 A;  4FLU A;  1UPG A;  4LF7 O;  1HR0 O;  5ITZ A;  1NKD A;  4MVS A;  4DR5 B;  3GB7 C;  3M99 B;  3J81 N;  4B7K A;  2ODM A;  3EXA A;  2P67 A;  3CCJ V;  5B3S B;  1TGO A;  3R66 A;  1N34 B;  3RYH B;  3DXR A;  1TUB B;  2IW5 A;  1IVS A;  3HKB A;  2Q7E A;  4CC5 A;  1G8M A;  4JI6 B;  4B3T B;  3OW2 U;  1N0J A;  4MT8 A;  1XMO B;  3C90 A;  1Y4M A;  3I55 V;  2H8P C;  4D7S A;  4YHH O;  1CEZ A;  2UU9 B;  3OTF A;  4YXW G;  4GX0 A;  3FD9 A;  1YJ9 V;  1WPB A;  2QTO A;  2QM8 A;  1HNW O;  4QIW F;  2JK5 C;  2VQF O;  2UXB O;  5L3B A;  4X66 O;  1KP3 A;  4EB6 B;  4JI0 B;  2Z3Y A;  3RWR D;  1KB9 F;  3B8M A;  3UQ8 A;  3SJQ C;  5LL6 Y;  1SQB H;  4LFB O;  2EIN B;  2P5O A;  4JI7 O;  4QPJ A;  1K4C C;  3JSL A;  1WA8 B;  5EYP B;  2BOC C;  4WCE V;  4I7Z B;  2XUM A;  4E4E A;  4D7T A;  1S76 D;  2HR3 A;  3DC6 A;  1AR5 A;  2A3Q A;  2D3O W;  2WSS G;  3CS5 A;  2EIK B;  1OCC C;  3SPC A;  1L8D A;  4YY3 B;  4RAI A;  2EBO A;  4WFH A;  2DMX A;  1Q43 A;  3AG1 B;  4ZBM A;  2ARH A;  1G1X B;  2ADP A;  4F4L A;  3RYI A;  3OTO O;  4TV9 A;  3X2Q C;  5CA0 B;  2JS3 A;  1BE3 H;  5BMV B;  5K1P A;  1NTK H;  1MA1 A;  3ZHQ A;  1LUV A;  4L87 A;  1XL6 A;  5H5N A;  3RN4 A;  1B3Q A;  3CCQ V;  2EIJ C;  1ZL8 A;  3OGI B;  5BR8 O;  4L8J A;  3T1H B;  3JAW B;  1B06 A;  3TXS A;  1H2M A;  5KUK A;  2IJK A;  1PV0 A;  3N2K A;  4R7C A;  2XAF A;  1IBM O;  4PA7 A;  4YJ3 A;  5DEC A;  2K1E A;  4QGP A;  1V55 C;  4FFB A;  5KX5 A;  3T2M A;  1EZV H;  1WP7 A;  2Q7H A;  3P3N A;  1GRJ A;  2BE3 A;  4MVQ A;  2PZS A;  4PDL A;  2CGN A;  3TXQ A;  2DYR C;  3E8F A;  3JD4 A;  1HNX O;  1KC8 W;  4IL6 Z;  1V54 B;  1K5S A;  3ML0 A;  2LW1 A;  2OTL V;  3F5W C;  1KKC A;  1XHZ A;  2NNU A;  3AK1 A;  2IH1 C;  1AIL A;  1JOY A;  3K58 A;  2UXC B;  1HR0 B;  1N36 B;  4DUZ O;  5GTH Z;  3ZS8 C;  1XHX A;  2XTA A;  3K06 A;  3MHH C;  2ZCE A;  4G27 B;  4FM2 A;  1I94 O;  1JJ2 U;  5LYJ B;  2A79 B;  3CJH B;  5CBG A;  3CXH F;  3PN1 A;  5L3E A;  4GZR B;  1M56 B;  1K97 A;  1US6 A;  3A8T A;  1VAR A;  2CE4 A;  2VQE O;  1VQO V;  4O4H A;  1XMQ O;  3K59 A;  2QEX V;  5CA1 A;  1OHH G;  3ZRX A;  2V7Q G;  1SER A;  4EKW A;  3JAK A;  5DN6 G;  3CRR A;  3HKD A;  4JI5 B;  1YTF B;  5FL7 G;  1KD1 W;  2JVD A;  4YHH B;  2CDY A;  4UV9 A;  5IYZ B;  1S77 D;  1QU7 A;  2P6J A;  4JI1 O;  3DC5 A;  4X89 A;  3QO8 A;  1HP8 A;  1SA0 A;  4YIO A;  3JSN A;  2LFS A;  3HKC B;  2UXB B;  3AG2 B;  4DV6 O;  2ZT9 B;  4AQY O;  2WLJ A;  2L6L A;  2IM9 A;  4XBF A;  1NH2 B;  1XQ8 A;  3LDE A;  1XNR B;  3RYH A;  3ZJZ A;  4U3J B;  4H37 A;  1TUB A;  3NXS A;  1EBO A;  1Z2G A;  3FX7 A;  1I7F A;  1QR9 A;  4J9Y B;  3APO A;  1NBM G;  3T4D A;  1RSO B;  4MTO A;  4ZKI A;  5CB4 A;  1AP5 A;  2KKW A;  5B1A B;  3K57 A;  2AGA A;  4PJ0 Z;  5KHG A;  4CS4 A;  2W0X A;  1SET A;  2EIL B;  5HFL A;  3SYC A;  5B66 Z;  5LHG A;  4MS2 A;  2WLH A;  3E83 A;  1WNS A;  4TQF A;  3G6E V;  2UUC B;  4EB6 A;  2P7T C;  4JI4 B;  2F4V O;  3OTO B;  4I5S A;  2M7W A;  4AI8 A;  3VQY A;  3ASO B;  3ZRV A;  4UFZ A;  2Y4T A;  2EIM B;  2IH3 C;  2P90 A;  4GKJ B;  2Q6A A;  1WA8 A;  4KHP B;  5KAF Z;  4DR6 B;  5LGU A;  1XEQ A;  2HFE C;  4PV1 B;  3FB8 C;  3D3Q A;  1JX9 A;  1K8A W;  4RUE A;  5CMU A;  4RWU A;  1IBM B;  2CK3 G;  1FKA O;  4H13 B;  4WBN B;  4K8X A;  4J9Z B;  3GVM A;  4PDR A;  4J10 A;  1FFT B;  2NR5 A;  1VQL V;  3AEI A;  5A2Q N;  1Y76 B;  2ZE7 A;  2X6A A;  3ETE A;  1YIT V;  4ZI7 A;  4W4K A;  1N32 O;  1MG1 A;  1PNK A;  2HKO A;  2PF4 E;  2IU0 A;  5CA0 A;  1HNX B;  2QWN B;  5BMV A;  2XT9 A;  1ENV A;  3L75 H;  2MK3 A;  1FS0 G;  1FJG O;  5GW7 A;  4O4L B;  1S0V A;  2Q5Z A;  5D5Q A;  5L3C A;  1JPX A;  4DUZ B;  2HJD A;  3UT5 B;  1P4R A;  2Q7G A;  1SZT A;  5GON B;  2Y48 A;  4GLX A;  1Q86 W;  1KBH A;  3RYC A;  4X64 O;  2EIN C;  4Z1V A;  2V1D A;  2IJJ A;  2QM4 A;  2IBZ H;  3LNN A;  2UUB O;  3ZCC A;  2W6I G;  3OE7 G;  1GN2 A;  4DV1 O;  2F43 G;  3J7A U;  1M93 A;  5IYB O;  1YJN V;  3ZMT A;  4ZIB A;  2ZXW B;  2XAG A;  2F1M A;  1V9P A;  2EIK C;  1H38 A;  4ABM A;  3GWK C;  2PY5 A;  4G28 B;  1K7D A;  4DK1 A;  3STL C;  2YXL A;  1N33 O;  2ATK C;  1FFX B;  4JI2 O;  4B08 A;  2ZM6 O;  1PL4 A;  4XDL A;  1IBL B;  3SYP A;  4TV8 B;  1DLB A;  4K0K B;  3B77 A;  4MVU A;  4WFF A;  3TCU A;  3AG4 B;  1FYJ A;  3CWB H;  5LYJ A;  3CJH A;  4DV6 B;  4R50 A;  2E74 B;  3OM3 B;  4LH7 A;  1B6Q A;  4H0L B;  3ABT A;  4UCO A;  1F7Y A;  3E8G A;  1D5A A;  2YEV A;  3CYO A;  5BZB A;  1GAX A;  5LGN A;  1KU9 A;  2KSD A;  3THO A;  4GUN A;  4Z2W A;  4ZHQ B;  1QLN A;  3O9O A;  5IYZ A;  1CXZ B;  1YCI A;  4UVC A;  5AG2 A;  4DV4 O;  1R6T A;  5IJ0 B;  1WB8 A;  1BQ0 A;  4DK0 A;  1R1B A;  5KHI A;  2DE0 X;  3SPH A;  1BHB A;  1V54 C;  4DR4 O;  4X20 B;  3CSX A;  1PPJ H;  3ICX A;  3HKC A;  2PI4 A;  2ZIN A;  3WU2 Z;  2F4V B;  3MHS C;  4MVM A;  4JYB A;  3FFQ A;  3F7V C;  1AR4 A;  4IT5 A;  4U3J A;  2PYJ A;  2XAJ A;  1X59 A;  3WB1 A;  4FLX A;  4X8A A;  4Q20 A;  5IJ9 B;  1M56 C;  3N27 A;  1NTZ H;  5L3G A;  1FXV A;  1OCO B;  3TGU H;  3L74 H;  1Q6H A;  1NJI W;  2EZO A;  1NS1 A;  4PDM A;  5KLV H;  1MZE A;  4B3R O;  3OMA B;  1KKD A;  4LFA B;  4KP4 A;  2E3C A;  4CC6 A;  1K4D C;  5EZY A;  1RPR A;  4LCU C;  4I0X B;  1N32 B;  4N23 A;  3ASN B;  5EIB D;  5JJJ B;  4FM1 A;  4DR2 B;  2HHH O;  4GKK B;  4WFG A;  3EHB B;  5IDJ A;  3QG5 A;  4DW0 A;  3AG2 C;  3H1L H;  1FAF A;  1IBK O;  4FLZ A;  1M1K W;  1KP2 A;  3Q4H B;  2XHB A;  1SQF A;  3BRC A;  5B1B B;  3BA8 A;  1H2G A;  1YEW A;  5LOV B;  1QBZ A;  4WBN A;  4FLV A;  1EN4 A;  4B3M B;  3NR7 A;  5E1A C;  3CRQ A;  2ADQ B;  3KCX A;  3E86 A;  4DRX A;  2UXX A;  2CUG A;  3ZHR A;  1RP3 B;  5BY1 A;  3CP1 A;  4WF9 V;  2ILM A;  1Y76 A;  5B1A C;  5KUM A;  1UJW B;  2O57 A;  2GDS A;  1CP9 A;  1XRE A;  2EIL C;  4P9P A;  4OX9 O;  2DN9 A;  5LMN B;  2YID A;  2KG7 A;  3JYC A;  1S3J A;  3AG3 B;  3WG7 B;  3C3S A;  2OWO A;  1N33 B;  3IFX A;  4JI2 B;  2ZM6 B;  4JAU A;  2Y69 B;  4O4L A;  3ZHS A;  1KYO F;  1NR7 A;  2DWD C;  3UT5 A;  3R65 A;  2P06 A;  4FVM A;  3ASO C;  4LF9 O;  2PUS A;  3IGA C;  5GON A;  5JQG B;  3CME V;  2LO1 A;  5LP6 B;  4O4I B;  1TAE A;  2GSM B;  3RGB A;  4DR3 B;  3JAT A;  1J95 A;  2Q9L A;  4JYA O;  1J5E B;  1QLE B;  4PEL A;  3RFR A;  4ASU G;  1ZAU A;  3DTU B;  2BTQ B;  1R73 A;  3SYO A;  1PM9 A;  4I4T B;  2X6B A;  4DV4 B;  1FFX A;  4JI8 B;  1U96 A;  3K5L A;  2HG5 C;  4NYK A;  2GTS A;  4TV8 A;  5J2T B;  3G71 V;  3BAA A;  1E1R G;  2R9A A;  5F2V O;  4IIJ A;  4GX1 A;  3GWO A;  1KMI Z;  2WAM A;  3H1I H;  1W0K G;  1PNM A;  3WB0 A;  1BHA A;  2ZIO A;  4X62 B;  2EJ7 A;  1R3L C;  3SJA C;  1T5E A;  1DTO A;  3UM7 A;  5IYC O;  3K9S A;  5FNV B;  2Q73 A;  3TJT A;  3CRM A;  3K0G A;  3W7X A;  4LP8 A;  1CPY A;  1R6N A;  4ZHQ A;  3A0R A;  2Z0A A;  4PDV A;  4UCV A;  1M57 B;  2ZXW C;  3T1C A;  3IAY A;  1AI4 A;  5IJ0 A;  3SJB C;  1WJZ A;  1Q82 W;  4XDK A;  1TA8 A;  1GM9 A;  2YC0 A;  4IGG A;  3B09 A;  4X9Q A;  2QKC A;  5IWA B;  1Q90 D;  2XAS A;  3UO2 A;  1SS3 A;  4NTW A;  2HEP A;  3QO7 A;  1VQK V;  4IYH A;  3ABL B;  3JAM N;  2QKA A;  4UV8 A;  1F4N A;  3OR7 C;  5J2U A;  3AG4 C;  2BSK A;  3CCE V;  1L0N H;  1Q6U A;  2PTM A;  2K9P A;  5JVD B;  5IT9 N;  3HR0 A;  5EBW C;  3OFN G;  1VF5 B;  4DV0 O;  4JAA A;  3ZHU A;  1DK1 A;  1MOF A;  4DV5 O;  2UXD O;  1WN7 A;  2CTP A;  5LHI A;  2YDE A;  1VQ4 V;  1VQ6 V;  4KFM A;  3N2G B;  1P49 A;  1VEW A;  4UB6 Z;  3MAQ A;  3FAV B;  4FLY A;  1JFF B;  4OXS A;  3TK1 A;  4JF3 A;  3O65 A;  1EFR G;  2OCC B;  4I0X A;  4LF7 B;  1WLE A;  2CH7 A;  1URF A;  2ZNJ A;  4X1K B;  4JTC B;  2H94 A;  2OCH A;  1VMG A;  2EUL A;  1ROP A;  4PA3 A;  4F6R A;  4LF9 B;  2AXT Z;  3JAS B;  5LMU O;  4PA9 A;  2DW4 A;  2GUZ B;  5BXZ A;  2IU3 A;  1YSC A;  5LOV A;  1EM1 A;  2ZE8 A;  2QWP B;  5JJE B;  5IYD O;  1VIB A;  3MDS A;  3K9A A;  2AW9 A;  4I50 B;  1WAZ A;  1OCO C;  2B1I A;  4CS3 A;  2JIZ G;  4BW5 A;  3T1Y O;  1O9H A;  4NTY A;  3CC7 V;  2JRI A;  3U11 A;  1G6U A;  1QQC A;  3ABK B;  3DGE A;  3JD1 A;  2P4V A;  3RYF B;  1HNW B;  3JAL B;  1BS3 A;  3VOU A;  3CPW U;  4U7N A;  2VWK A;  3ZMZ A;  2VQF B;  5H6R A;  2ZR2 A;  2ZQM A;  4X66 B;  3ZMU A;  2RCV A;  2P22 C;  3ASN C;  4J7K A;  2LJ2 A;  2Q4P A;  2Q8V A;  4LFB B;  5LP6 A;  2JGD B;  4JI7 B;  2BOB C;  2FTK A;  3ABM B;  2XND G;  3H9V A;  5B1B C;  4GX5 A;  3UO3 A;  1KQS U;  1HW7 A;  2LFR A;  4HNA B;  1SF9 A;  2BTQ A;  2JEU A;  4JZ2 A;  2UUA O;  1LNQ A;  4MVZ A;  1KEC A;  1S5L Z;  2D2C B;  3G80 A;  1JQ0 A;  5CBF A;  1GO3 F;  2B1G A;  2R70 A;  3K03 A;  5KA5 A;  2AZ0 A;  4DR7 O;  1IZ3 A;  4UB8 Z;  1K73 W;  3FB7 C;  3RT3 C;  3AG3 C;  4P2Z A;  3WG7 C;  4ICG A;  2N05 A;  2RJZ A;  1ZSP A;  1SQX H;  2Y69 C;  4EEQ A;  1NTM H;  3CB2 A;  2E5L O;  5KMG B;  5JH7 B;  4DV7 O;  5B3S C;  1YI2 V;  3SPI A;  5EYP A;  5BR8 B;  1PKX A;  1K34 A;  3QVN A;  5LP6 C;  1YF2 A;  4NXN O;  2XAH A;  1NT2 B;  4MW8 A;  2QWQ B;  4MVR A;  4DV0 B;  5FNV A;  4C7U A;  3FYE B;  2WLL B;  3B8N A;  3FB6 C;  1QLE C;  3ZED A;  1VF7 A;  3BEH A;  2ZNI A;  4O2B B;  2KB1 A;  4J80 A;  1EN5 A;  1EN6 A;  4JAS A;  2W6J G;  1H8H G;  1LR1 A;  3ZBH A;  2FKX A;  2Z5U A;  1RM1 B;  1X4T A;  2P4K A;  1HWY A;  2QJ1 A;  4B3S O;  2VWJ A;  1NVP D;  4PI0 A;  4NVP A;  4YJ2 B;  4FK5 C;  1GMG A;  1AJN A;  1IXB A;  4FLW A;  1WB7 A;  3JAW A;  1I94 B;  5GTI Z;  5C8Y B;  5EBM C;  2QWR B;  2HP8 A;  1U97 A;  2WWW A;  2EX3 A;  5ITZ B;  3BCC H;  1HDJ A;  2N74 A;  1I08 A;  2QM7 A;  5LMU B;  5B1N A;  1WP8 A;  4I9Q A;  5KHK A;  2VQE B;  1XMQ B;  2JGU A;  3LSQ A;  1GKF A;  3N2G A;  4IHJ B;  4DV3 O;  3AK2 A;  3G67 A;  2HVJ C;  4NKG B;  3UKM A;  2A9H A;  3CCV V;  2GTA A;  3A2F A;  3W7T A;  4MW3 A;  3STZ C;  3FAV A;  1NZ6 A;  2X0L A;  4LF4 O;  1JFF A;  2QR4 A;  2HVK C;  3AG1 C;  4WFB V;  3ZRW B;  2Q0O C; 
#chains in the Genus database with same CATH homology
 3LNM B;  1W2B U;  2R9R B;  4WFH A;  5B1B B;  3AG1 B;  4U7O A;  4MTF A;  4ZBM A;  4RUF A;  1H2G A;  2DYS B;  1QBZ A;  2ZR3 A;  4F4L A;  3CMA V;  3X2Q C;  3ZIA G;  2ZDI A;  5E1A C;  3ABL C;  3E86 A;  2HLD G;  5LBQ A;  3K3W A;  2UXX A;  4L87 A;  1XL6 A;  3CP1 A;  4WF9 V;  4JYC A;  3CCQ V;  2EIJ C;  1AI7 A;  5B1A C;  5KUM A;  1UJW B;  1DF5 A;  3WFV A;  5HFM A;  1CP9 A;  2EIJ B;  4RO2 A;  2EIL C;  3RBZ A;  4P9P A;  1AI6 A;  5KUK A;  2IJK A;  2YSU B;  4PA6 A;  5CN0 A;  3OEH G;  3JYC A;  4N21 A;  1S3J A;  3AG3 B;  4R7C A;  3WG7 B;  3W7W A;  1GM7 A;  1I5X A;  2XAF A;  3IFX A;  5C93 A;  3QNE A;  4JAU A;  4PA7 A;  2WLM A;  2Y69 B;  2K1E A;  1NR7 A;  1F4M A;  1VQ5 V;  4CZZ A;  2DWD C;  3R65 A;  3ASO C;  1ORQ C;  1V55 C;  3JD3 A;  1VQP V;  3EFF K;  3IGA C;  3OMI B;  3T2M A;  3CME V;  4QPK A;  1F23 A;  1V55 B;  4MVQ A;  5IY5 C;  4RQE A;  2GSM B;  4PDL A;  1Y66 A;  2OCC C;  2WLI A;  2DYR C;  3E8F A;  3JD4 A;  1MAB G;  1OCZ B;  1J95 A;  1KC8 W;  1V54 B;  1K5S A;  3ML0 A;  3ZMV A;  2OTL V;  1QLE B;  3F5W C;  2NNU A;  4P9O A;  4PEL A;  3SPJ A;  2IH1 C;  4ASU G;  1JOY A;  1PL0 A;  2ZD9 A;  5LGT A;  3DTU B;  2ZDI C;  3K06 A;  3MHH C;  4G27 B;  1R73 A;  3SPG A;  3SYO A;  3FB5 C;  3RVY A;  1JJ2 U;  3E2E A;  1THZ A;  3ETD A;  3OAA G;  2A79 B;  2UXN A;  2X6B A;  5CBG A;  3TET A;  5EK0 A;  4FIP C;  4GCZ A;  5L3E A;  1M56 B;  1ZWI C;  5EC2 C;  2AHY A;  2HG5 C;  1K97 A;  3VBB A;  3G71 V;  3LUT B;  1E1R G;  1AI5 A;  2WLK A;  4RQF A;  1VQO V;  4GX1 A;  1FXK A;  3E8H A;  3GWO A;  2QEX V;  4FPP A;  2WAM A;  1OHH G;  3ZRX A;  2V7Q G;  1SER A;  4EKW A;  1K92 A;  5DN6 G;  1YIJ V;  1MSW D;  2XAQ A;  1K5Q A;  1YTF B;  1W0K G;  4JAV A;  5FL7 G;  3CCU V;  4BIU A;  1GK9 A;  1PNM A;  3OR6 C;  1K9M W;  1KD1 W;  1BHA A;  3K08 A;  4HAM A;  4UV9 A;  2QE7 G;  1R3L C;  1WPX A;  4DO2 A;  3ABK C;  1S77 D;  2P6J A;  1S5H C;  1DTO A;  3UM7 A;  5IYC O;  1R3K C;  1Q7Y W;  3I56 V;  2EJR A;  3ZN1 A;  4X89 A;  1E1Q G;  3QO8 A;  1E79 G;  3W7X A;  3K0G A;  2Q69 A;  1VQ8 V;  4LP8 A;  1CPY A;  3JCZ A;  1VQ7 V;  4JTD B;  1R6N A;  1M57 C;  4MTX A;  3FKS G;  2LFS A;  5DM6 V;  3A0R A;  3HPL C;  3AG2 B;  4GT1 A;  4PDV A;  1OCC B;  1M57 B;  2ZXW C;  3T1C A;  3FYI B;  1AI4 A;  2EZP A;  2WLJ A;  2W0F C;  1TUE B;  4XBF A;  4XDK A;  1W0J G;  1Q82 W;  1NH2 B;  2DQ3 A;  3LDE A;  1GM9 A;  3ZJZ A;  4QJF B;  1G4Y B;  4H37 A;  1ARO P;  1VQ9 V;  3NXS A;  1EBO A;  3ABM C;  4JPR A;  4MTG A;  4X88 A;  2WLL A;  1JCH A;  1QR9 A;  2XAS A;  4J9Y B;  5EC1 C;  1M90 W;  1R3J C;  1NBM G;  3QO7 A;  3X2Q B;  1VQK V;  3T4D A;  3ABL B;  5L3F A;  4MTO A;  2ITD C;  4ZKI A;  2QKS A;  2IJI A;  4UV8 A;  4UVA A;  1F4N A;  1FXK C;  2JEX A;  3OR7 C;  3AG4 C;  3LDC A;  1L1F A;  5B1A B;  1BMF G;  3D36 A;  3CCE V;  4LC1 A;  3BY6 A;  4UVB A;  1IXM A;  3ZRS A;  1SET A;  3OFN G;  5EBW C;  2EIL B;  3P32 A;  3K0D A;  4TT3 G;  4WFE A;  3E89 A;  5HFL A;  3SYC A;  3CCM V;  1MOF A;  1RPO A;  3W7U A;  5LHG A;  3CC2 V;  4MS2 A;  2WLH A;  1PD3 A;  3E83 A;  4HYO A;  5LHI A;  3G6E V;  1YTF D;  1VQ4 V;  1VQ6 V;  2P7T C;  2IJH A;  4KFM A;  4I5S A;  2M7W A;  2EIM C;  3ASO B;  2R9I A;  4JTA B;  1GM8 A;  3ZRV A;  1QVF U;  2EIM B;  3CD6 V;  2IH3 C;  2P90 A;  3OUF A;  5H6Q A;  2Q68 A;  1AJP A;  2Q6A A;  4FMT A;  5IY5 B;  4OXS A;  3TK1 A;  4JF3 A;  1EFR G;  2OCC B;  4PA4 A;  1Q81 W;  2DYR B;  5LGU A;  2HFE C;  2QA4 V;  3ZMS A;  1OZ0 A;  1S72 V;  3FB8 C;  5L3D A;  1JX9 A;  1WLE A;  1K8A W;  4RUE A;  5CMU A;  1NQT A;  5CA3 A;  5B1O A;  2CK3 G;  2X7R B;  4FJC C;  4J9Z B;  3K79 A;  3IC7 A;  4JTC B;  1K33 A;  1NH2 D;  4PDR A;  1FFT B;  2H94 A;  1DF4 A;  5EBL C;  3ZRW A;  4Z1M G;  1ROP A;  4PA3 A;  1VQL V;  3AEI A;  4JGS A;  1H8E G;  1RM1 C;  3G4S V;  2A0L A;  4PA9 A;  5H9C A;  2X6A A;  3ETE A;  1AR1 B;  2DW4 A;  2IU3 A;  1YIT V;  1YSC A;  1MG1 A;  1PNK A;  2DWE C;  2HKO A;  3QO5 A;  2X6C A;  5IYD O;  2IU0 A;  3K9A A;  4BAY A;  1FXH A;  1ENV A;  4QNH B;  1OCO C;  2MK3 A;  4TWK A;  1FS0 G;  1SES A;  5KA6 A;  2B1I A;  1R6K A;  1XL4 A;  3E8B A;  5GW7 A;  3RW0 A;  2JIZ G;  4BW5 A;  4R8C A;  1QVG U;  1S0V A;  2PI5 A;  5L3C A;  1JPX A;  1K3E A;  1OCR C;  1P7B A;  3CC7 V;  4BIZ A;  1P4R A;  4DXW A;  1QCE A;  3W7S A;  1SZT A;  2Y48 A;  3ABK B;  3JD1 A;  3DGE A;  1Q86 W;  1YJW V;  2EIN C;  4HZ3 A;  2OTJ V;  1F51 A;  2V1D A;  3VOU A;  3CPW U;  2IJJ A;  2WLI B;  2WPD G;  4U7N A;  3ZMZ A;  1M9N A;  2JJ2 G;  5H6R A;  3CCL V;  2ZR2 A;  2ZQM A;  1JVM A;  3ZMU A;  3ASN C;  3ZCC A;  4UXN A;  4UUJ C;  2W6I G;  3OE7 G;  2F43 G;  3RVZ A;  5IYB O;  1YJN V;  3ZMT A;  2ZXW B;  2XAG A;  3JD2 A;  2EIK C;  1H38 A;  2C2A A;  2HJF C;  4G28 B;  1BL8 A;  2BOB C;  3JD0 A;  1K7D A;  3ABU A;  2FTK A;  3K04 A;  3ABM B;  2XND G;  2Q67 A;  4KUM A;  3STL C;  3D3I A;  5B1B C;  3CCR V;  3OMN B;  2ATK C;  4GX5 A;  2DYS C;  2NLJ C;  3CXC U;  1KQS U;  4XDL A;  4G2K A;  4R6Z A;  2LFR A;  3SYP A;  1NVP B;  1DLB A;  2JEU A;  1EZJ A;  3B77 A;  4MVU A;  1FXK B;  4WFF A;  4MSW C;  3TCU A;  3AG4 B;  1I5Y A;  4P30 A;  1LNQ A;  4MVZ A;  2LP7 A;  4GX2 A;  3P30 A;  4CBC A;  4XDJ A;  1KEC A;  4R50 A;  1JQ0 A;  5CBF A;  2B5U A;  3OM3 B;  3H01 A;  1GO3 F;  2B1G A;  4LBE C;  4I9W A;  3PJS K;  1B6Q A;  2XOK G;  1AJQ A;  3K03 A;  3CC4 V;  5KA5 A;  1COW G;  3KG2 A;  3ABT A;  1R3I C;  3E8G A;  1K73 W;  3FB7 C;  3AG3 C;  2YEV A;  3CYO A;  4P2Z A;  3WG7 C;  5BZB A;  5LGN A;  2Y69 C;  1NKD A;  4MVS A;  3GB7 C;  3M99 B;  5B3S C;  3CCS V;  1YI2 V;  3SPI A;  3SYQ A;  2P67 A;  1QLN A;  3CCJ V;  1PKX A;  3ZN0 A;  4UVC A;  5B3S B;  1K34 A;  2XAH A;  1NR1 A;  4MW8 A;  4MVR A;  4WFA V;  2ITC C;  4QE7 A;  2IW5 A;  2JDI G;  3FYE B;  1OCZ C;  1VQM V;  3SPH A;  1BHB A;  2WLL B;  1V54 C;  3B8N A;  3FB6 C;  1G8M A;  3LDD A;  1QLE C;  3OW2 U;  1SRY A;  2PI4 A;  4H33 A;  4MT8 A;  4MVO A;  3BEH A;  1Y4M A;  3I55 V;  2H8P C;  3MHS C;  2KB1 A;  4JYB A;  4MVM A;  3OGC C;  3F7V C;  1PNL A;  4JAS A;  2W6J G;  1H8H G;  3OUS A;  1CEZ A;  2Z5U A;  2XAJ A;  4YXW G;  4GX0 A;  1RM1 B;  2OT5 A;  3T4Z A;  1HWY A;  2WLN A;  4X8A A;  1YJ9 V;  1NVP D;  2QTO A;  2QM8 A;  4Q20 A;  1M56 C;  3ETG A;  2AHZ A;  1GMG A;  4FK5 C;  5L3G A;  1FXV A;  4QIW F;  1AJN A;  2JK5 C;  1OCO B;  1NJI W;  1N8R W;  2EZO A;  5L3B A;  1KP3 A;  2Z3Y A;  3HB3 B;  1OCR B;  2YEV B;  3B8M A;  4PDM A;  4QE9 A;  5EBM C;  3SJQ C;  3OMA B;  2WWW A;  3F7Y C;  1KKD A;  2QM7 A;  3MD0 A;  2EIN B;  4KP4 A;  1K4D C;  5B1N A;  1RPR A;  4QPJ A;  1K4C C;  1GTO A;  4LCU C;  3LSS A;  5CBH A;  2BOC C;  5J9P C;  4WCE V;  2DQ0 A;  3LSQ A;  1GKF A;  4N23 A;  1VQN V;  4TSF G;  4E2L A;  3ASN B;  1S76 D;  2HR3 A;  2HVJ C;  3UKM A;  3OEE G;  3E35 A;  2A9H A;  3CCV V;  3SYA A;  4WFG A;  3W7T A;  3EHB B;  2GHY A;  2WSS G;  4MW3 A;  5IDJ A;  3STZ C;  2D3O W;  5LHH A;  1YHQ V;  3AG2 C;  2X0L A;  2EIK B;  1OCC C;  3SPC A;  2JJ1 G;  2HVK C;  1KP2 A;  3AG1 C;  4WFB V;  1M1K W;  3ZRW B;  4RAI A;  1QR8 A;  2EBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...