1VQPV

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqpV00
3CCQV 2QA4V 1VQMV 1KC8W 2QEXV 3OW2U 1M90W 1YITV 3I55V 1VQPV 3CCSV 3CCLV 3CC4V 4WF9V 1K9MW 1VQKV 3CC7V 1YI2V 1JJ2U 3CD6V 3G71V 1YJ9V 1R73A 5DM6V 1K73W 1VQ8V 3G6EV 1YIJV 1KQSU 1YJNV 2OTJV 1VQNV 1VQ5V 1YJWV 1VQ7V 1QVFU 4WFBV 2D3OW 1Q86W 4WFAV 4WCEV 3CMEV 1W2BU 3CMAV 1VQOV 2OTLV 1KD1W 3CCMV 3CCVV 3CC2V 3CCRV 1VQ9V 1Q82W 3CXCU 3CCUV 1Q7YW 1QVGU 3I56V 3G4SV 3CCEV 1S72V 1K8AW 3CPWU 1VQLV 1M1KW 1Q81W 1YHQV 1VQ4V 1VQ6V 1N8RW 1NJIW 3CCJV
chains in the Genus database with same CATH superfamily
1X4TA 5C93A 2P06A 2ZR2A 5LHGA 4LC1A 3H1KH 4OX9B 2E74B 5BY1A 2FB5A 3FB5C 1JX9A 2QTSA 4UCSA 2FTKA 1Q86W 4LP8A 3H1LH 1H2SB 1NU1H 3KZIZ 1AI5A 1NR1A 1FS0G 1MNGA 3IAYA 4LF4O 1DTOA 1VP7A 5HFLA 1K9MW 3LDEA 4DXWA 4R50A 4ZBMA 4FK5C 2H94A 1DLBA 2HFEC 2OTLV 2JVDA 4UVAA 3A0RA 4ZHQA 2Y69B 1RP3B 4JTCB 4X9QA 5CB4A 3OT7A 5IE9A 2YXYA 5GTIZ 3AK3A 3LSQA 3OR6C 1BMFG 1R3JC 3KG2A 4YJ2B 4NXMB 3ZN0A 4ZI7B 3K3WA 4I0XB 2Y4UA 5JCOC 2FYUH 3SJCC 2F43G 3AG2C 1HW7A 2N04A 3K0DA 1YITV 1JQ0A 4Z1VA 3A8TA 2AHZA 2BTQB 1P84F 5DN6G 1HNXO 1M57B 1XQ8A 2OIEA 5H5NA 4UUJC 2CH7B 2IU3A 2WA3A 2IU0A 3QVNA 1S5HC 1K8AW 1VIBA 4JI4O 3DC5A 3BHPA 4FVMA 4ICGA 4ABMA 2DN9A 2DJVA 4FIPC 3FYEB 4LFBO 4E2LA 4NTYA 3ABKB 2JEXA 4WFBV 4J9ZB 4PA7A 5EYPB 4PDMA 4JTDB 5LOVB 4DR5O 1Y66A 1SZTA 2IJJA 5L3CA 4Q20A 3T1YO 1XMOB 4BIZA 4QJFB 2R9AA 3AG2B 1WPBA 4YJ2A 4JI0O 3K0GA 2GUZB 4ZI7A 1MZFA 1GTOA 4I0XA 3F5WC 4FFKA 2XAQA 3JSLA 2JS5A 1SETA 5JVDB 3CSXA 1AJPA 3ML0A 1S0VA 5JH7B 2BTQA 4QGPA 5IWAO 3OUSA 2KQXA 2V1DA 3A2FA 2CH7A 4OPHA 5J2UB 4CS3A 2F66C 3OR7C 3ICXA 4FPPA 3X2QB 2YS8A 4JI8O 1ORQC 3L70H 5DEDA 3D8CA 5GW7A 2MW2B 4Z2WA 1OHHG 2WLNA 3MD0A 4RO2A 5KHIA 2RN9A 3OTOO 5EZYB 1NI8A 4DR3B 2PI4A 1F7YA 3S3WA 3ZMUA 3FYIB 5EYPA 2JK5C 4LF7B 3ZMVA 4X64O 3WG7C 3E2EA 5LOVA 2BSKB 3ZBHA 3VQXA 4J42A 4NXNB 2K1EA 3AG1B 5CA0B 1A32A 2CE4A 2FL4A 4XDJA 3K9AA 2ZM6B 4JAVA 1GK9A 2ZIOA 3CJHB 4DR6B 2KB1A 4DUZB 2VQFB 4P30A 2YEVB 1FAFA 2GUZA 4J41A 4RUFA 2ZIMA 5B66Z 1DK1A 1IZ3A 4L87A 4PI0A 4YIOA 1U97A 5JVDA 2Q5ZA 2XAHA 1XI1A 5JH7A 2QKAA 1JJ2U 2ZDIA 5LXTB 3CC7V 2JDIG 5CMUA 3AG4B 5LMNO 2Q8VA 1F51A 3BA8A 1Y76B 5J2UA 3SJQC 2Z3YA 3E86A 1IBMO 1E79G 3WG7B 5CBHA 3OGIB 4PDVA 3ZHVA 1VQPV 4J9YB 4YY3O 3E22B 1BQZA 5JJJB 5EZYA 3W7UA 1XUQA 3VQYA 1NBMG 4JI6O 4B3RB 2QKCA 3N2GB 2DWEC 1GRJA 3D36A 2BSKA 4JI7O 2LQTA 4GX2A 3TXQA 1QNMA 1H2LA 4J7JA 4ASUG 1NTMH 3ASOC 5CA0A 4X62O 1N32O 3KCXA 1K4CC 3ABMB 3CJHA 1KP2A 3BFRA 4ZOLB 5EBLC 1HR0B 1F4MA 2YEVA 2BTOA 2HR3A 1AP6A 2QTOA 3N27A 5L3EA 1DF4A 4X65O 1S77D 3CPWU 5LGTA 3L73H 5IDJA 1AR4A 3BPZA 4PHZA 2EIKC 2L6LA 5LMUO 3OW2U 1Q8IA 4GX0A 5LXTA 1PP9H 3K59A 4LF6O 5LL6Y 3P3PA 3CRMA 3B8MA 3EFFK 4GZRB 4CC5A 3C3SA 3MAQA 1Y76A 2DWDC 2DW4A 4DV7B 3T4DA 3LNMB 1KYOF 1VQ8V 1QLEC 4AILC 2ODMA 1AJQA 2DYRC 3BRCA 1R3IC 2UXBO 2WA4A 3E22A 4DV6B 5LBQA 1MMMA 1NTZH 1R73A 3QTCA 2NR5A 4XBFA 2EIMC 3ASOB 3N2GA 2P90A 4F6RB 3DC6A 4K8ZA 2Y4TA 1PV0A 2BE3A 4MVSA 2YIDA 4LFAO 4DV1O 4GUNA 2HJFC 4K35A 4EFBA 4B3MO 1GAXA 4LNUB 3H1IH 1IBLB 1VQMV 4DR1B 3J7AU 4U7NA 1M93A 2UXNA 4B3SO 4U3JB 4JV5B 3MDSA 4FM2A 4H0LB 2A0LA 2LFSA 3HKCB 3G6BA 1K4DC 4ZOLA 3ZHRA 3S3XA 4LF8O 3K57A 3HKBB 3STLC 3Q4HB 3OAAG 1SESA 1YEWA 2QKSA 5D5PA 3UCSC 3OFNG 1OCZB 4DRXB 3B40A 2A9HA 4I7ZB 4DR4B 4JF3A 5H9CA 3BVOA 3JATA 5GTHZ 4DR7O 3CC4V 5FPOA 4A5UB 2N74A 1SRYA 2L35A 3H01A 5DM6V 3JAWB 4LF5B 3RWRD 1M56C 3CS5A 2CGNA 2EIJC 1ENVA 1SQFA 1K97A 1OCRC 4RQFA 3CEIA 1QR8A 2JEUA 4FZ0A 1B06A 1IURA 5EBMC 2UUBO 1IXMA 4TSFG 4B7EA 4JPRA 2IW5A 4FZ1A 5A2QN 3ASNC 4PA4A 4UCRA 2Q4PA 5KA5A 1SERA 3EVKA 2RNBA 4KXRA 4TQDA 4F6RA 1G4YB 3ZMTA 2F23A 3CC2V 4UCTA 1SQBH 3P3NA 2ZQMA 3CRQA 4LNUA 4MVRA 2QWRB 1FD9A 2NNUA 3U11A 2IH3C 4MVOA 4U3JA 5H6RA 4DV0B 1BGYH 1XL4A 3HKCA 1KQSU 5B1NA 3HB3B 3K06A 5IYBO 1G6UA 4JI5O 1MABG 3HKBA 1V9PA 1RPRA 4UCOA 4IHJB 5JWPA 2A7WA 3Q4HA 1S3JA 5BXZA 4DV4O 5IJ0B 3G80A 5ITZB 4DRXA 1JJOA 1EZVH 4X66O 1VF5B 1XMQO 1RPOA 1MZEA 1VF7A 4O4HB 2BOBC 3JAWA 1I0HA 3ETQA 2ZE8A 3RYHB 2AW9A 1EN4A 3CMEV 1L1FA 3KCYA 4BW5A 1N0JA 3R66A 3JCUZ 1PL0A 2YIAA 5KUKA 1V54C 4JI2B 2EZOA 1URFA 1AI4A 2A06H 3H1HH 2R9RB 1VF6C 3K04A 1KB9F 1QVFU 2WLKA 2CUGA 3QO8A 3STZC 1AR1B 5B3SC 4LR3A 1XREA 1KC8W 4P9OA 4GKJO 1P7BA 3ZRWB 1QCEA 4J11A 1AI6A 2WLMA 2OT5A 5LP6B 4JYBA 2WSSG 3SYCA 1Q90D 2VWJA 2DQ0A 3EHBB 4IHJA 2HVJC 5KHHA 4GLXA 5B1BC 3WB2A 1KKDA 3UM7A 2QDOA 5IJ0A 5ITZA 1WB8A 3A0BZ 1OCOC 3APOA 4KL1A 3CRAA 3ZMZA 1AB3A 1S76D 4O4HA 1GN2A 3K03A 2P4KA 3VBBA 4TV9B 4NXMO 4UV9A 3EXAA 3RYHA 1R6NA 4G2KA 2EJ7A 1AJNA 3CCMV 3CHXA 2XASA 4X1KB 1FJGB 2Q7EA 5E1AC 1M90W 3LDCA 3OMIB 3G71V 1WA8B 4P9PA 3B09A 4DO2A 1VQNV 3L71H 1EN6A 2QR4A 3K9SA 2E75B 1YZBA 1FXKC 1Q5OA 1NVPD 1OCCC 2UU9O 4TQFA 2HLDG 1B6QA 2P67A 1MOFA 2PYLA 1H2NA 4XDKA 2CDYA 1PPJH 3ZRWA 1FFXB 4XDLA 5LP6A 4R7CA 1OCOB 2DE0X 3ZX6A 5TISZ 4TUYB 3P30A 4AQYB 2WLJA 3RBZA 1AROP 3ZMSA 1GN4A 1K92A 5KX5B 4X1YB 1I5XA 1PNMA 2EILC 2BOCC 3T1HB 2Z5UA 4BWAA 2GTAA 3ETGA 1GN6A 5KHGA 1NZ6A 2GSMB 4TV9A 2XAFA 3VQWA 3H9VA 4U3FH 4D6TH 1XNRO 2DOSA 4X1KA 5K1PA 1M1KW 2GDSA 2UXDO 2B1IA 4QIWF 5BMVB 3DSQA 4LF4B 4Z1MG 4JYYA 1SZXA 2DMXA 1WA8A 1YSCA 1V55C 2RQ6A 3QF7A 1H2KA 2OWOA 4AI8A 1SQVH 2JGDB 4LFCB 1OJHA 4L8JA 4OPAA 2PGGA 2Y48A 4O4IB 4UVCA 1D5AA 4TV8B 1R6KA 4G27B 3K5NA 1BS3A 1FFXA 2PTMA 2UUAO 4DR3O 2YC0A 5CBFA 4TUYA 3ABTA 3I5DA 4HZ3A 2OTJV 2IH1C 2HHHB 1TAEA 4LF7O 3FFQA 5KX5A 4X1YA 3G67A 4IYIA 4B3TB 4NXNO 4CH3A 5IYDO 1HP8A 1B3QA 2JIZG 4CH4A 3BABA 1ZWIC 1LUWA 3RGBA 2ZM6O 1VMGA 4MVQA 1H2GA 4JI3O 1YJ9V 1K73W 4DUZO 2VQFO 2GHYA 2W0FC 3ZHUA 2CGOA 4PA3A 5BR8O 4FLWA 1J5EB 1IBKB 4LF9B 4F6EA 5K1XA 1EN5A 1QVGU 2WPDG 2FKXA 3M99B 4JI4B 4U7OA 2E76B 5BMVA 2AZ0A 4Q6GA 4J10A 3SPJA 2QA4V 2Q0OC 1I08A 3N2KB 3FD9A 2QWPB 4LH6A 4DV2B 1B04A 4D7SA 3C3TA 2Q7HA 1GM8A 2JGDA 1WP8A 1HDJA 3I56V 2EINC 4DR5B 4O4IA 4TV8A 4J7KA 1NJIW 1BT8A 3AK2A 1AI7A 3UKMA 1BL8A 1UJWB 3RVYA 3IJ4A 2OCCC 2W6IG 3T2MA 1MA1A 5JCOA 5KA6A 2P6JA 3J81N 4W4LA 1XBLA 2XT9A 3WB1A 1H8HG 3SYPA 1S5LZ 1LNQA 4QE7A 1KD1W 4JI0B 1HNWB 5IYCO 3ZRXA 4NYKA 1TUEB 3IC9A 2ILMA 4ZKIA 2ZCEA 2LP7A 3SR2C 4DYLA 2UXXA 1NVPB 2Q9LA 4IGGA 2UXCO 2HJDA 4FJCC 4H44B 2DYSC 3AG3C 1BCCH 2E5LB 2EX3A 1BZKA 3N2KA 3ZRSA 2GV9A 5IY5C 1SQGA 3CE2A 3E8FA 1G1XB 1JOYA 4DV7O 4WFAV 2OCCB 4BIUA 3B4SA 3CB2A 2NN4A 4WFFA 1N33O 3C90A 2HVKC 2ZKOA 4DV6O 3MHHC 1PNKA 1SS3A 5CN0A 1IDSA 1Q6HA 2VRZA 4MTXA 5CBGA 4UB6Z 4DUYB 2ZXWC 1K7DA 3OE7G 3NR7A 4DR1O 4NTWA 2XTAA 3TGUH 4X1IB 4YHHB 1KBHA 4JV5O 2EULA 4UXNA 5L3FA 1VARA 2M7WA 3BAAA 3IFXA 3JSNA 3AG7A 5IY5B 3CXCU 3ZN1A 1Q7YW 3GWOA 5B1OA 5KHKA 1I5YA 1COWG 2XOKG 3WFVA 1E1QG 2CAZC 1IBMB 3F7YC 3OMAB 1YVWA 2RJZA 1EM1A 4CS2A 4MTGA 3LSUA 4NB5A 4LF5O 3K08A 4EB6B 1HWYA 4DR2O 3ZCCA 4PA9A 5FLXN 2IM9A 3OTFA 2R9IA 1N0NA 1CEZA 4KHPO 2ZE5A 1Q43A 2XUMA 1WNSA 2LFRA 1FKAO 5GONB 2WLIB 2ZXWB 3D3IA 1Z5WA 1FYJA 5IT9N 2EIKB 4PELA 2D3OW 1IXBA 3ZRVA 1ZUQA 4CC6A 4D7TA 2CTQA 4FLVA 3ABLC 5LYJB 1L0LH 4NVPA 3OD4A 2VWKA 4DV5B 4H13B 4X1IA 3E8HA 4DV3B 1ROPA 4DV0O 1JFFB 2QWOB 4JYAB 1QLEB 4GKKO 2M6YA 2KG7B 3LSSA 1MG1A 2DYRB 1F4NA 4F4LA 5H6QA 3LDDA 4NR1A 1D2DA 4AHCA 1ZL8B 1N34B 1ZX3A 3SPCA 1Q81W 1KMIZ 3CYOA 2EIMB 4JZ2A 3VOUA 5LHIA 3K79A 1F23A 1YDXA 4PJ0Z 3FAVB 4P2ZA 1EFRG 3M7MX 4GYCB 1L8DA 4EB6A 4O4JB 1GO3F 1NTKH 1RSOB 2MK3A 1GN3A 2UUCB 3KKYA 1XL6A 4PV1B 1L0NH 1S72V 4JI2O 4LFAB 4DV1B 3SYQA 5L3GA 2QM8A 4B3MB 3HPLC 5GONA 3ZS8C 2WLIA 1JPXA 3CCLV 2YUAA 1XDCA 4KFMA 4UB8Z 4CBCA 3JARB 2V4DA 4H33A 1R3LC 1KU9A 2QWQB 1WJZA 4I9WA 3CP1A 5J9PC 1T5EA 5LYJA 1NT2B 3HKDB 1XNQB 1M56B 2EIJB 3SJAC 4YJ3B 2VQEO 1AILA 1OCRB 4I5SA 3RVZA 1JFFA 4R8CA 4PDRA 2KG7A 1I94B 2KKWA 1YJWV 3OEEG 1J95A 1ZL8A 2H8PC 4CH5A 3ASNB 2Q69A 1AVMA 4TWKA 4BW9A 2F4VB 2Q68A 3FAVA 4W4KA 2BCCH 1CPYA 5EIBC 4OX9O 4BAYA 5L3DA 3F5TA 4O4JA 1WN7A 4O4LB 1PD3A 3ZHSA 1RSOA 3ZIAG 3M8AA 3CMAV 3QO5A 1NH2B 2LW1A 1FJGO 3FX7A 4PDLA 4JI1B 1KKCA 2QE7G 1GM7A 2VS0A 3JARA 3WU2Z 2JJ1G 2CK3G 1H8EG 2LO1A 1YJNV 4I9QA 1TGOA 5FL7G 2LGQA 4HNAB 3ZEDA 1VQ9V 3UT5B 4GX1A 3SYAA 2XAJA 2JGUA 3ABUA 1XEQA 1QLNA 3HKDA 2IJKA 3JYCA 4OXSA 1XOUA 4YJ3A 3SYOA 4X66B 2IJHA 1K34A 1HNZB 1GM9A 2LJ2A 3IGAC 3QG5A 1V54B 1Z5VA 4AQYO 2Y69C 1ZSPA 4LCUC 4JZGA 5FNVB 5IJ9B 2HEPA 3JCZA 3T1HO 5C8YB 1XHZA 1N36B 4FLYA 2Q0AA 1FXHA 4O4LA 5B3SB 2P22C 3CRCA 2A3QA 4K0KB 2AHYA 3JASB 1GMGA 2X0LA 1Q82W 3JALB 5KHJA 3CCJV 4FM1A 1M57C 2CTWA 2EZPA 3A0HZ 4GKJB 2ZINA 5B1BB 3WB0A 3TCUA 5LGNA 2ZNIA 2B9ZA 4MTFA 3JD3A 3K58A 2O57A 3L74H 1IX9A 1VQ7V 4RWUA 2ZE6A 4HNAA 4LFCO 3TXSA 3FB7C 1CP9A 3UT5A 4R6ZA 4QE9A 1SQPH 5JJNB 1AR5A 4LBEC 1N8RW 4QPKA 2P7TC 2QEXV 1BHBA 3ABKC 1YTFD 1XMOO 4FLUA 3JD0A 1W0KG 3U10A 3K5MA 2EJRA 2HHHO 5KUMA 4WFEA 3TETA 1S5JA 3THOA 1VQ5V 3W7SA 2B5UA 5FNVA 5IJ9A 4WFHA 4B3TO 2P5OA 2YSUB 5LGUA 1XHXA 4UVBA 1VF6A 1FXVA 1NQTA 2K9PA 1YCIA 4I55B 5C8YA 4H37A 3SDLA 2RDCA 2WAMA 4PI2A 1FXKB 3K5LA 2YIBD 4WBNB 1WB7A 4WFGA 1OCCB 5KAFZ 5EK0A 5EBWC 4EKWA 2CTRA 1J5EO 1IBKO 3JASA 2HP8A 4CH6A 4LF9O 3T1CA 1GKFA 2YI9A 2AXTZ 2ZDIC 3JALA 2UU9B 1R1BA 1WAZA 4DV2O 5KAIZ 3T4ZA 2EILB 3UO3A 1XILA 4N21A 3IC7A 3X2QC 1YIJV 4GX5A 2ATKC 2F95B 1DF5A 1QHTA 4YXWG 4X89A 2D2CB 3DXRB 3TK1A 2B1GA 1EBOA 1IVSA 3D36C 4ZIBA 3JD4A 1QR9A 4DR6O 1U96A 3DGEA 3L75H 3D3QA 4JTAB 3QNEA 1HNWO 1HNXB 2Y0PA 3AG1C 4PD4F 2QGNA 1XNRB 1V55B 3G4SV 4MVZA 1JVMA 4I55A 1YHQV 1SKVA 4QNHB 5A9GA 1WPXA 2UXDB 4MT8A 4MW8A 4FFBB 3SPIA 1ZTEA 1FXKA 2F1MA 4WF9V 4WBNA 1TUBB 4TT3G 4C7UA 1THZA 1M5IA 5F2VO 5AG2A 1Y74B 2ADQB 4LFBB 4FLXA 2OYQA 2ZT9B 1QBZA 2F93B 2XNDG 2E5LO 2ZE7A 3E83A 4KP4A 5CA1B 3AEIA 3APQA 3AG4C 3HR0A 3OUFA 2PYJA 1SQXH 3J80N 3T1YB 2UUAB 2QWNB 3OMNB 1Y4MA 3CWBH 2R70A 5J2TB 3GWKC 2NLJC 4B3RO 5E79Z 3LUTB 1VQOV 1FPOA 2YXLA 4DW1A 2QSAA 3DXRA 1BSMA 2C2AA 2R72A 1SC5B 2WLLB 3I55V 1YXBA 1X59A 1PL4A 3E89A 4JI3B 3OEHG 1HR0O 3O65A 4DUYO 5IWAB 5BR8B 1KECA 3GB7C 1O9HA 4O2BB 2DQ3A 3PJSK 2G38A 2YXHA 3ABMC 4JI8B 1MSDA 4YHHO 4FFBA 3RYFB 1ZAUA 1Y6XA 4NTXA 1Q3EA 1TUBA 3UQ8A 3W7WA 4RQEA 4MW3A 2EINB 1Y74A 5HFMA 2IJIA 3OTOB 3BA9A 2Q6AA 3JAKB 1NS1A 4X8AA 2ZNJA 1OV9A 3ETDA 1QU7A 1WP7A 3MHSC 3R65A 1KUQA 1YTFB 1KP3A 4X64B 2GBOA 2W0XA 5CA1A 4GT1A 3CCQV 3O9OA 1SA0B 1TA8A 1SQQH 1Y67A 3RW0A 1P49A 4UCUA 2YDEA 1W59A 5J2TA 3UO2A 4UCVA 1K5QA 4WCEV 2JRIA 3ZJZA 2ARHA 1JA8A 4X20B 4K3AA 3RYIB 1IBLO 1H2MA 2X6AA 1PNLA 1NH2D 2WLHA 2WLLA 5L3BA 1E1RG 2DYSB 3QO7A 1D5NA 1DGSA 3AG3B 5BZBA 4MS2A 3TJTA 1TVKB 4JAAA 4JAUA 5LMNB 2UXCB 3CCVV 3FB8C 1LUVA 2IBZH 4O2BA 2Y0IA 4IL6Z 4DV5O 1VQ6V 4DR4O 4DV3O 1NKDA 5IYZB 1CXZB 3RYFA 3JATB 4J7ZA 5KMGB 1K5SA 4JYAO 1YI2V 4KUMA 4YY3B 4HBNA 2XHBA 3G6EV 2Z0AA 4X88A 4FM0A 1OCZC 3JAKA 2QM4A 3E8GA 1BE3H 4JI6B 4MTOA 1N34O 4BR6A 3B8NA 3FB6C 1ZLZA 4JI7B 2AZ2A 3SPHA 2FMLA 3GVMA 4N23A 5EIBD 3E8BA 4LH7A 3RYCB 4FLTA 1SA0A 2AGAA 2YI8A 1N33B 3VQVA 1RM1C 1O9GA 4UFZA 5EC2C 3CX5F 5B5EZ 3CCSV 3FKSG 4X62B 1QQCA 1N32B 2GTSA 4MSWC 2UUCO 4DK0A 4OGQB 1BQ0A 2ADPA 4UV8A 4X20A 2V7QG 2ETNA 4X65B 3RYIA 2YIBA 3BEHA 2PF4E 3OM3B 2Q67A 4B7KA 1LR1A 1G8MA 4K8XA 5LMUB 2E3CA 4EFEA 2ZD9A 4PA6A 3ETEA 2CTPA 2LGWA 2HKOA 3ZHQA 4LF6B 1TVKA 2X6BA 4LWSB 4FMTA 3L9DA 2EBOA 4E4EA 2P4VA 1P7GA 2ITDC 1P4RA 4I50B 5LA6B 4RAIA 1XNQO 2N05A 5JJEB 5IYZA 5LHHA 5KMGA 2HG5C 1MSWD 1VQKV 2UXBB 1I94O 2H3OA 4DK1A 3LNNA 1UFIA 1JR9A 4IYHA 2QJ1A 4JGSA 1PM9A 4IT5A 3CRRA 4O2AB 1M4UA 5CA3A 1RM1B 3U0ZA 3BCCH 4DR2B 4I4TB 2YICA 3HKEB 3L72H 3JAMN 2W6JG 4KHPB 4JYCA 3RYCA 2F4VO 2A79B 5B1AC 2XAGA 1EZJA 3ABLB 4MVMA 4J80A 4B3SB 5JQGB 2OIGA 3NXSA 2PUSA 1VEWA 4GCZA 1W0JG 3P32A 4YIPA 1W2BU 4RUEA 3B77A 4LF8B 1M9NA 3CCUV 5KLVH 3CCEV 5EC1C 4TOIA 1JCHA 4JI1O 2KSDA 1JMKC 3W7XA 4CZZA 2PZSA 3E35A 4DR7B 5DECA 2PY5A 4HYOA 3SPGA 4GKKB 2RCVA 3RFRA 2Q7GA 1K33A 1R6TA 3F7VC 1K3EA 1N4CA 4LWSA 4HAMA 1Q6UA 2X6CA 5LA6A 2JS3A 4I50A 4IIJB 5LP6C 5FPRA 1VQ4V 1FFTB 4CS4A 1YF2A 1Z2GA 2RMKB 1HNZO 2UUBB 3W7TA 1PKXA 4O2AA 1NR7A 2QM7A 5D5QA 5B1AB 3RN4A 3SGIA 4I4TA 1BHAA 1AP5A 3HKEA 1I7FA 4JASA 3AK1A 1VQLV 3DTUB 1N36O 1R3KC 4NKGB 3JD1A 1GH6A 1OZ0A 2ZR3A 4EEQA 5JQGA 3BY6A 3JD2A 2WWWA 4K0KO 3K5OA 3ZHTA 3PN1A 1UPGA 4BIOA 4FLZA 2X7RB 4QPJA 2PI5A 4JI5B 4DW0A 3CCRV 3OGCC 1RFYA 1WLEA 4ZHQB 4DV4B 5CB4B 3SJBC 1H38A 2ITCC 2VQEB 4G28B 1XMQB 3CD6V 2JJ2G 2Q73A 3H1JH 3RT3C 4B08A 2LW7A 1SF9A 3B2EE 1Q6IA 3CXHF 4IIJA 1US6A 2OCHA 4MVUA 5H2FZ
chains in the Genus database with same CATH topology
4WFFA 2HVKC 1IXMA 5C93A 3TK1A 4TSFG 2B1GA 3MHHC 1PNKA 1EBOA 2ZR2A 4LC1A 4JPRA 5CN0A 5LHGA 2IW5A 4MTXA 3JD4A 1QR9A 3FB5C 5CBGA 1JX9A 3ASNC 4PA4A 3DGEA 5KA5A 1SERA 2FTKA 4JTAB 3QNEA 1Q86W 1G4YB 4LP8A 3ZMTA 3AG1C 3CC2V 2ZXWC 1K7DA 1V55B 3OE7G 3G4SV 4MVZA 1AI5A 1JVMA 1NR1A 1YHQV 2ZQMA 4QNHB 1FS0G 4MVRA 1WPXA 2NNUA 4MT8A 4MW8A 2IH3C 3SPIA 1DTOA 1FXKA 5HFLA 4WF9V 3LDEA 4DXWA 1K9MW 4MVOA 4R50A 4TT3G 5H6RA 4ZBMA 1THZA 1XL4A 1KQSU 4UXNA 5L3FA 5B1NA 3HB3B 3K06A 2M7WA 4FK5C 2H94A 5IYBO 1MABG 1DLBA 1QBZA 2HFEC 3IFXA 2OTLV 1RPRA 2XNDG 5IY5B 3CXCU 3ZN1A 4UVAA 1Q7YW 3A0RA 3E83A 1S3JA 4KP4A 3GWOA 5B1OA 2Y69B 4JTCB 3AEIA 1I5YA 1COWG 2XOKG 3AG4C 3OUFA 1E1QG 3WFVA 3F7YC 3OMAB 1RPOA 4MTGA 3OMNB 1Y4MA 2BOBC 3K08A 3LSQA 1HWYA 3OR6C 1BMFG 1R3JC 2NLJC 3KG2A 3ZN0A 3ZCCA 4PA9A 3CMEV 3LUTB 1L1FA 1VQOV 3K3WA 2R9IA 1CEZA 4BW5A 5KUKA 1PL0A 1V54C 2C2AA 2EZOA 2F43G 2LFRA 3AG2C 2WLLB 3K0DA 1YITV 2WLIB 2ZXWB 3D3IA 3I55V 1JQ0A 1AI4A 2AHZA 3E89A 2R9RB 3K04A 3OEHG 5DN6G 2EIKB 4PELA 1M57B 1QVFU 2D3OW 4UUJC 3ZRVA 2WLKA 1KECA 2IU3A 3QO8A 3ABLC 3GB7C 2IU0A 1S5HC 1K8AW 2DQ3A 3STZC 3PJSK 1AR1B 3ABMC 5B3SC 1KC8W 4P9OA 3E8HA 1P7BA 3ZRWB 1QCEA 1ROPA 1AI6A 4FIPC 3W7WA 2WLMA 4MW3A 3FYEB 2EINB 2OT5A 4RQEA 4JYBA 1QLEB 2WSSG 4E2LA 3SYCA 3LSSA 2IJIA 5HFMA 2Q6AA 1MG1A 2DYRB 1F4NA 3ABKB 2JEXA 4F4LA 4WFBV 4X8AA 4J9ZB 5H6QA 4PA7A 3ETDA 3LDDA 2DQ0A 3EHBB 4PDMA 4JTDB 2HVJC 3MHSC 3R65A 5B1BC 1YTFB 1KP3A 1KKDA 3SPCA 3UM7A 1Y66A 1Q81W 1SZTA 3CYOA 1OCOC 2IJJA 5L3CA 4Q20A 2EIMB 4GT1A 3CCQV 3VOUA 3ZMZA 3K79A 5LHIA 1F23A 4P2ZA 1S76D 3RW0A 1EFRG 4BIZA 3K03A 3VBBA 1GO3F 4QJFB 3AG2B 4UV9A 2MK3A 1K5QA 1R6NA 4G2KA 4WCEV 3K0GA 3ZJZA 1AJNA 3CCMV 1XL6A 2XASA 1GTOA 1S72V 3F5WC 2XAQA 5E1AC 3SYQA 5L3GA 2QM8A 2X6AA 1PNLA 1NH2D 3HPLC 2WLHA 1SETA 2WLLA 5L3BA 1M90W 2WLIA 1AJPA 1E1RG 1JPXA 3ML0A 1S0VA 3CCLV 2DYSB 3QO7A 4KFMA 4CBCA 3AG3B 3LDCA 3OMIB 4H33A 3G71V 4P9PA 1R3LC 5BZBA 3OUSA 1VQNV 4DO2A 4MS2A 2V1DA 4I9WA 4JAUA 3CP1A 5J9PC 3CCVV 1FXKC 3OR7C 3FB8C 4FPPA 3X2QB 1NVPD 1OCCC 1ORQC 1VQ6V 2HLDG 1M56B 1B6QA 5GW7A 1NKDA 2P67A 1MOFA 2EIJB 4XDKA 1OHHG 2WLNA 3ZRWA 1OCRB 3MD0A 1K5SA 4RO2A 4I5SA 3RVZA 4R8CA 1YI2V 4XDLA 4PDRA 4KUMA 4R7CA 1OCOB 3G6EV 2PI4A 4X88A 1OCZC 1YJWV 3P30A 3ZMUA 2WLJA 3E8GA 3FYIB 3RBZA 1AROP 2JK5C 3ZMSA 3ZMVA 3OEEG 1K92A 4MTOA 3WG7C 1I5XA 3E2EA 1J95A 2H8PC 3B8NA 3FB6C 1PNMA 2EILC 2BOCC 3ASNB 2Q69A 3SPHA 4N23A 4TWKA 3E8BA 2K1EA 2Z5UA 2Q68A 3ETGA 1RM1C 3AG1B 5EC2C 3CCSV 3FKSG 1CPYA 4XDJA 3K9AA 4BAYA 4JAVA 1GK9A 5L3DA 2GSMB 1PD3A 2XAFA 4MSWC 2KB1A 4P30A 3ZIAG 2YEVB 3CMAV 4RUFA 3QO5A 1NH2B 4UV8A 2V7QG 4PDLA 1M1KW 4L87A 2B1IA 3BEHA 4QIWF 3OM3B 4Z1MG 2XAHA 2QE7G 2Q67A 1GM7A 1G8MA 1JJ2U 2JJ1G 2ZDIA 2ZD9A 2CK3G 3ETEA 4PA6A 3CC7V 1H8EG 2JDIG 1YSCA 1V55C 5CMUA 1YJNV 3AG4B 2HKOA 5FL7G 1F51A 2X6BA 4FMTA 3SJQC 1VQ9V 4GX1A 2EBOA 2Z3YA 2ITDC 2XAJA 1P4RA 3ABUA 3SYAA 4RAIA 1QLNA 2Y48A 3E86A 2IJKA 4UVCA 3JYCA 4OXSA 1R6KA 4G27B 5LHHA 1E79G 3SYOA 3WG7B 5CBHA 4PDVA 2HG5C 1VQPV 2IJHA 1MSWD 4J9YB 1K34A 1VQKV 1GM9A 3IGAC 3W7UA 1V54B 5CBFA 4JGSA 3ABTA 4HZ3A 2Y69C 2IH1C 2OTJV 4LCUC 5CA3A 1RM1B 1NBMG 2DWEC 3D36A 3JCZA 5IYDO 4GX2A 2W6JG 2JIZG 4JYCA 1ZWIC 4ASUG 2A79B 3ASOC 5B1AC 4MVQA 1H2GA 2XAGA 1EZJA 1FXHA 3ABLB 4MVMA 1K4CC 1YJ9V 1K73W 3ABMB 5B3SB 1KP2A 3NXSA 2GHYA 5EBLC 1F4MA 2YEVA 4GCZA 1W0JG 2AHYA 2W0FC 3P32A 1W2BU 2HR3A 1GMGA 4PA3A 2X0LA 4RUEA 2QTOA 5L3EA 1DF4A 3B77A 1M9NA 3CCUV 1Q82W 1S77D 1QVGU 2WPDG 5EC1C 3CCEV 3CPWU 5LGTA 3M99B 1JCHA 5IDJA 4U7OA 3CCJV 2EIKC 2QA4V 3SPJA 1M57C 3OW2U 2EZPA 3W7XA 4CZZA 4GX0A 5B1BB 3E35A 5LGNA 3TCUA 4HYOA 4MTFA 3JD3A 3SPGA 1VQ7V 1K33A 3F7VC 1K3EA 3B8MA 3EFFK 1GM8A 2DWDC 2DW4A 3FB7C 4HAMA 1CP9A 2X6CA 4R6ZA 3T4DA 3LNMB 4QE9A 3I56V 1VQ8V 2EINC 1QLEC 1VQ4V 4LBEC 1N8RW 1NJIW 1FFTB 4QPKA 2P7TC 2QEXV 1BHBA 1AJQA 2DYRC 3ABKC 1YTFD 1AI7A 1R3IC 3UKMA 1BL8A 1UJWB 3RVYA 2OCCC 2W6IG 1W0KG 3JD0A 3T2MA 3W7TA 5LBQA 2EJRA 5KA6A 1R73A 5KUMA 2P6JA 1PKXA 4WFEA 3TETA 1NR7A 1H8HG 2QM7A 3SYPA 1VQ5V 4XBFA 2EIMC 1LNQA 3ASOB 5B1AB 2B5UA 3W7SA 2P90A 1BHAA 4WFHA 2YSUB 4MVSA 4QE7A 5LGUA 1KD1W 4UVBA 4JASA 5IYCO 2HJFC 1VQLV 1FXVA 1NQTA 3DTUB 1R3KC 3ZRXA 1VQMV 1TUEB 3JD1A 4H37A 4U7NA 2WAMA 2UXNA 1OZ0A 1FXKB 2ZR3A 4WFGA 1OCCB 3BY6A 3JD2A 2A0LA 4ZKIA 5EK0A 2LFSA 2WWWA 1K4DC 2LP7A 5EBWC 4EKWA 2UXXA 1NVPB 4FJCC 3T1CA 2X7RB 1GKFA 4QPJA 2PI5A 3CCRV 2DYSC 3AG3C 3STLC 2ZDIC 3OGCC 1SESA 3OAAG 2QKSA 1WLEA 3OFNG 1OCZB 2A9HA 1H38A 2ITCC 4JF3A 5H9CA 3ZRSA 4G28B 3CC4V 3T4ZA 1SRYA 2EILB 3CD6V 2JJ2G 5IY5C 4N21A 3H01A 3IC7A 3X2QC 5DM6V 1YIJV 3E8FA 1JOYA 4GX5A 1M56C 4WFAV 2ATKC 2OCCB 2EIJC 1ENVA 1K97A 1DF5A 1OCRC 4RQFA 4BIUA 4YXWG 1QR8A 4X89A 2JEUA 4MVUA 5EBMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ V;  2QA4 V;  1VQM V;  1KC8 W;  2QEX V;  3OW2 U;  1M90 W;  1YIT V;  3I55 V;  1VQP V;  3CCS V;  3CCL V;  3CC4 V;  4WF9 V;  1K9M W;  1VQK V;  3CC7 V;  1YI2 V;  1JJ2 U;  3CD6 V;  3G71 V;  1YJ9 V;  1R73 A;  5DM6 V;  1K73 W;  1VQ8 V;  3G6E V;  1YIJ V;  1KQS U;  1YJN V;  2OTJ V;  1VQN V;  1VQ5 V;  1YJW V;  1VQ7 V;  1QVF U;  4WFB V;  2D3O W;  1Q86 W;  4WFA V;  4WCE V;  3CME V;  1W2B U;  3CMA V;  1VQO V;  2OTL V;  1KD1 W;  3CCM V;  3CCV V;  3CC2 V;  3CCR V;  1VQ9 V;  1Q82 W;  3CXC U;  3CCU V;  1Q7Y W;  1QVG U;  3I56 V;  3G4S V;  3CCE V;  1S72 V;  1K8A W;  3CPW U;  1VQL V;  1M1K W;  1Q81 W;  1YHQ V;  1VQ4 V;  1VQ6 V;  1N8R W;  1NJI W;  3CCJ V; 
#chains in the Genus database with same CATH topology
 1X4T A;  5C93 A;  2P06 A;  2ZR2 A;  5LHG A;  4LC1 A;  3H1K H;  4OX9 B;  2E74 B;  5BY1 A;  2FB5 A;  3FB5 C;  1JX9 A;  2QTS A;  4UCS A;  2FTK A;  1Q86 W;  4LP8 A;  3H1L H;  1H2S B;  1NU1 H;  3KZI Z;  1AI5 A;  1NR1 A;  1FS0 G;  1MNG A;  3IAY A;  4LF4 O;  1DTO A;  1VP7 A;  5HFL A;  1K9M W;  3LDE A;  4DXW A;  4R50 A;  4ZBM A;  4FK5 C;  2H94 A;  1DLB A;  2HFE C;  2OTL V;  2JVD A;  4UVA A;  3A0R A;  4ZHQ A;  2Y69 B;  1RP3 B;  4JTC B;  4X9Q A;  5CB4 A;  3OT7 A;  5IE9 A;  2YXY A;  5GTI Z;  3AK3 A;  3LSQ A;  3OR6 C;  1BMF G;  1R3J C;  3KG2 A;  4YJ2 B;  4NXM B;  3ZN0 A;  4ZI7 B;  3K3W A;  4I0X B;  2Y4U A;  5JCO C;  2FYU H;  3SJC C;  2F43 G;  3AG2 C;  1HW7 A;  2N04 A;  3K0D A;  1YIT V;  1JQ0 A;  4Z1V A;  3A8T A;  2AHZ A;  2BTQ B;  1P84 F;  5DN6 G;  1HNX O;  1M57 B;  1XQ8 A;  2OIE A;  5H5N A;  4UUJ C;  2CH7 B;  2IU3 A;  2WA3 A;  2IU0 A;  3QVN A;  1S5H C;  1K8A W;  1VIB A;  4JI4 O;  3DC5 A;  3BHP A;  4FVM A;  4ICG A;  4ABM A;  2DN9 A;  2DJV A;  4FIP C;  3FYE B;  4LFB O;  4E2L A;  4NTY A;  3ABK B;  2JEX A;  4WFB V;  4J9Z B;  4PA7 A;  5EYP B;  4PDM A;  4JTD B;  5LOV B;  4DR5 O;  1Y66 A;  1SZT A;  2IJJ A;  5L3C A;  4Q20 A;  3T1Y O;  1XMO B;  4BIZ A;  4QJF B;  2R9A A;  3AG2 B;  1WPB A;  4YJ2 A;  4JI0 O;  3K0G A;  2GUZ B;  4ZI7 A;  1MZF A;  1GTO A;  4I0X A;  3F5W C;  4FFK A;  2XAQ A;  3JSL A;  2JS5 A;  1SET A;  5JVD B;  3CSX A;  1AJP A;  3ML0 A;  1S0V A;  5JH7 B;  2BTQ A;  4QGP A;  5IWA O;  3OUS A;  2KQX A;  2V1D A;  3A2F A;  2CH7 A;  4OPH A;  5J2U B;  4CS3 A;  2F66 C;  3OR7 C;  3ICX A;  4FPP A;  3X2Q B;  2YS8 A;  4JI8 O;  1ORQ C;  3L70 H;  5DED A;  3D8C A;  5GW7 A;  2MW2 B;  4Z2W A;  1OHH G;  2WLN A;  3MD0 A;  4RO2 A;  5KHI A;  2RN9 A;  3OTO O;  5EZY B;  1NI8 A;  4DR3 B;  2PI4 A;  1F7Y A;  3S3W A;  3ZMU A;  3FYI B;  5EYP A;  2JK5 C;  4LF7 B;  3ZMV A;  4X64 O;  3WG7 C;  3E2E A;  5LOV A;  2BSK B;  3ZBH A;  3VQX A;  4J42 A;  4NXN B;  2K1E A;  3AG1 B;  5CA0 B;  1A32 A;  2CE4 A;  2FL4 A;  4XDJ A;  3K9A A;  2ZM6 B;  4JAV A;  1GK9 A;  2ZIO A;  3CJH B;  4DR6 B;  2KB1 A;  4DUZ B;  2VQF B;  4P30 A;  2YEV B;  1FAF A;  2GUZ A;  4J41 A;  4RUF A;  2ZIM A;  5B66 Z;  1DK1 A;  1IZ3 A;  4L87 A;  4PI0 A;  4YIO A;  1U97 A;  5JVD A;  2Q5Z A;  2XAH A;  1XI1 A;  5JH7 A;  2QKA A;  1JJ2 U;  2ZDI A;  5LXT B;  3CC7 V;  2JDI G;  5CMU A;  3AG4 B;  5LMN O;  2Q8V A;  1F51 A;  3BA8 A;  1Y76 B;  5J2U A;  3SJQ C;  2Z3Y A;  3E86 A;  1IBM O;  1E79 G;  3WG7 B;  5CBH A;  3OGI B;  4PDV A;  3ZHV A;  1VQP V;  4J9Y B;  4YY3 O;  3E22 B;  1BQZ A;  5JJJ B;  5EZY A;  3W7U A;  1XUQ A;  3VQY A;  1NBM G;  4JI6 O;  4B3R B;  2QKC A;  3N2G B;  2DWE C;  1GRJ A;  3D36 A;  2BSK A;  4JI7 O;  2LQT A;  4GX2 A;  3TXQ A;  1QNM A;  1H2L A;  4J7J A;  4ASU G;  1NTM H;  3ASO C;  5CA0 A;  4X62 O;  1N32 O;  3KCX A;  1K4C C;  3ABM B;  3CJH A;  1KP2 A;  3BFR A;  4ZOL B;  5EBL C;  1HR0 B;  1F4M A;  2YEV A;  2BTO A;  2HR3 A;  1AP6 A;  2QTO A;  3N27 A;  5L3E A;  1DF4 A;  4X65 O;  1S77 D;  3CPW U;  5LGT A;  3L73 H;  5IDJ A;  1AR4 A;  3BPZ A;  4PHZ A;  2EIK C;  2L6L A;  5LMU O;  3OW2 U;  1Q8I A;  4GX0 A;  5LXT A;  1PP9 H;  3K59 A;  4LF6 O;  5LL6 Y;  3P3P A;  3CRM A;  3B8M A;  3EFF K;  4GZR B;  4CC5 A;  3C3S A;  3MAQ A;  1Y76 A;  2DWD C;  2DW4 A;  4DV7 B;  3T4D A;  3LNM B;  1KYO F;  1VQ8 V;  1QLE C;  4AIL C;  2ODM A;  1AJQ A;  2DYR C;  3BRC A;  1R3I C;  2UXB O;  2WA4 A;  3E22 A;  4DV6 B;  5LBQ A;  1MMM A;  1NTZ H;  1R73 A;  3QTC A;  2NR5 A;  4XBF A;  2EIM C;  3ASO B;  3N2G A;  2P90 A;  4F6R B;  3DC6 A;  4K8Z A;  2Y4T A;  1PV0 A;  2BE3 A;  4MVS A;  2YID A;  4LFA O;  4DV1 O;  4GUN A;  2HJF C;  4K35 A;  4EFB A;  4B3M O;  1GAX A;  4LNU B;  3H1I H;  1IBL B;  1VQM V;  4DR1 B;  3J7A U;  4U7N A;  1M93 A;  2UXN A;  4B3S O;  4U3J B;  4JV5 B;  3MDS A;  4FM2 A;  4H0L B;  2A0L A;  2LFS A;  3HKC B;  3G6B A;  1K4D C;  4ZOL A;  3ZHR A;  3S3X A;  4LF8 O;  3K57 A;  3HKB B;  3STL C;  3Q4H B;  3OAA G;  1SES A;  1YEW A;  2QKS A;  5D5P A;  3UCS C;  3OFN G;  1OCZ B;  4DRX B;  3B40 A;  2A9H A;  4I7Z B;  4DR4 B;  4JF3 A;  5H9C A;  3BVO A;  3JAT A;  5GTH Z;  4DR7 O;  3CC4 V;  5FPO A;  4A5U B;  2N74 A;  1SRY A;  2L35 A;  3H01 A;  5DM6 V;  3JAW B;  4LF5 B;  3RWR D;  1M56 C;  3CS5 A;  2CGN A;  2EIJ C;  1ENV A;  1SQF A;  1K97 A;  1OCR C;  4RQF A;  3CEI A;  1QR8 A;  2JEU A;  4FZ0 A;  1B06 A;  1IUR A;  5EBM C;  2UUB O;  1IXM A;  4TSF G;  4B7E A;  4JPR A;  2IW5 A;  4FZ1 A;  5A2Q N;  3ASN C;  4PA4 A;  4UCR A;  2Q4P A;  5KA5 A;  1SER A;  3EVK A;  2RNB A;  4KXR A;  4TQD A;  4F6R A;  1G4Y B;  3ZMT A;  2F23 A;  3CC2 V;  4UCT A;  1SQB H;  3P3N A;  2ZQM A;  3CRQ A;  4LNU A;  4MVR A;  2QWR B;  1FD9 A;  2NNU A;  3U11 A;  2IH3 C;  4MVO A;  4U3J A;  5H6R A;  4DV0 B;  1BGY H;  1XL4 A;  3HKC A;  1KQS U;  5B1N A;  3HB3 B;  3K06 A;  5IYB O;  1G6U A;  4JI5 O;  1MAB G;  3HKB A;  1V9P A;  1RPR A;  4UCO A;  4IHJ B;  5JWP A;  2A7W A;  3Q4H A;  1S3J A;  5BXZ A;  4DV4 O;  5IJ0 B;  3G80 A;  5ITZ B;  4DRX A;  1JJO A;  1EZV H;  4X66 O;  1VF5 B;  1XMQ O;  1RPO A;  1MZE A;  1VF7 A;  4O4H B;  2BOB C;  3JAW A;  1I0H A;  3ETQ A;  2ZE8 A;  3RYH B;  2AW9 A;  1EN4 A;  3CME V;  1L1F A;  3KCY A;  4BW5 A;  1N0J A;  3R66 A;  3JCU Z;  1PL0 A;  2YIA A;  5KUK A;  1V54 C;  4JI2 B;  2EZO A;  1URF A;  1AI4 A;  2A06 H;  3H1H H;  2R9R B;  1VF6 C;  3K04 A;  1KB9 F;  1QVF U;  2WLK A;  2CUG A;  3QO8 A;  3STZ C;  1AR1 B;  5B3S C;  4LR3 A;  1XRE A;  1KC8 W;  4P9O A;  4GKJ O;  1P7B A;  3ZRW B;  1QCE A;  4J11 A;  1AI6 A;  2WLM A;  2OT5 A;  5LP6 B;  4JYB A;  2WSS G;  3SYC A;  1Q90 D;  2VWJ A;  2DQ0 A;  3EHB B;  4IHJ A;  2HVJ C;  5KHH A;  4GLX A;  5B1B C;  3WB2 A;  1KKD A;  3UM7 A;  2QDO A;  5IJ0 A;  5ITZ A;  1WB8 A;  3A0B Z;  1OCO C;  3APO A;  4KL1 A;  3CRA A;  3ZMZ A;  1AB3 A;  1S76 D;  4O4H A;  1GN2 A;  3K03 A;  2P4K A;  3VBB A;  4TV9 B;  4NXM O;  4UV9 A;  3EXA A;  3RYH A;  1R6N A;  4G2K A;  2EJ7 A;  1AJN A;  3CCM V;  3CHX A;  2XAS A;  4X1K B;  1FJG B;  2Q7E A;  5E1A C;  1M90 W;  3LDC A;  3OMI B;  3G71 V;  1WA8 B;  4P9P A;  3B09 A;  4DO2 A;  1VQN V;  3L71 H;  1EN6 A;  2QR4 A;  3K9S A;  2E75 B;  1YZB A;  1FXK C;  1Q5O A;  1NVP D;  1OCC C;  2UU9 O;  4TQF A;  2HLD G;  1B6Q A;  2P67 A;  1MOF A;  2PYL A;  1H2N A;  4XDK A;  2CDY A;  1PPJ H;  3ZRW A;  1FFX B;  4XDL A;  5LP6 A;  4R7C A;  1OCO B;  2DE0 X;  3ZX6 A;  5TIS Z;  4TUY B;  3P30 A;  4AQY B;  2WLJ A;  3RBZ A;  1ARO P;  3ZMS A;  1GN4 A;  1K92 A;  5KX5 B;  4X1Y B;  1I5X A;  1PNM A;  2EIL C;  2BOC C;  3T1H B;  2Z5U A;  4BWA A;  2GTA A;  3ETG A;  1GN6 A;  5KHG A;  1NZ6 A;  2GSM B;  4TV9 A;  2XAF A;  3VQW A;  3H9V A;  4U3F H;  4D6T H;  1XNR O;  2DOS A;  4X1K A;  5K1P A;  1M1K W;  2GDS A;  2UXD O;  2B1I A;  4QIW F;  5BMV B;  3DSQ A;  4LF4 B;  4Z1M G;  4JYY A;  1SZX A;  2DMX A;  1WA8 A;  1YSC A;  1V55 C;  2RQ6 A;  3QF7 A;  1H2K A;  2OWO A;  4AI8 A;  1SQV H;  2JGD B;  4LFC B;  1OJH A;  4L8J A;  4OPA A;  2PGG A;  2Y48 A;  4O4I B;  4UVC A;  1D5A A;  4TV8 B;  1R6K A;  4G27 B;  3K5N A;  1BS3 A;  1FFX A;  2PTM A;  2UUA O;  4DR3 O;  2YC0 A;  5CBF A;  4TUY A;  3ABT A;  3I5D A;  4HZ3 A;  2OTJ V;  2IH1 C;  2HHH B;  1TAE A;  4LF7 O;  3FFQ A;  5KX5 A;  4X1Y A;  3G67 A;  4IYI A;  4B3T B;  4NXN O;  4CH3 A;  5IYD O;  1HP8 A;  1B3Q A;  2JIZ G;  4CH4 A;  3BAB A;  1ZWI C;  1LUW A;  3RGB A;  2ZM6 O;  1VMG A;  4MVQ A;  1H2G A;  4JI3 O;  1YJ9 V;  1K73 W;  4DUZ O;  2VQF O;  2GHY A;  2W0F C;  3ZHU A;  2CGO A;  4PA3 A;  5BR8 O;  4FLW A;  1J5E B;  1IBK B;  4LF9 B;  4F6E A;  5K1X A;  1EN5 A;  1QVG U;  2WPD G;  2FKX A;  3M99 B;  4JI4 B;  4U7O A;  2E76 B;  5BMV A;  2AZ0 A;  4Q6G A;  4J10 A;  3SPJ A;  2QA4 V;  2Q0O C;  1I08 A;  3N2K B;  3FD9 A;  2QWP B;  4LH6 A;  4DV2 B;  1B04 A;  4D7S A;  3C3T A;  2Q7H A;  1GM8 A;  2JGD A;  1WP8 A;  1HDJ A;  3I56 V;  2EIN C;  4DR5 B;  4O4I A;  4TV8 A;  4J7K A;  1NJI W;  1BT8 A;  3AK2 A;  1AI7 A;  3UKM A;  1BL8 A;  1UJW B;  3RVY A;  3IJ4 A;  2OCC C;  2W6I G;  3T2M A;  1MA1 A;  5JCO A;  5KA6 A;  2P6J A;  3J81 N;  4W4L A;  1XBL A;  2XT9 A;  3WB1 A;  1H8H G;  3SYP A;  1S5L Z;  1LNQ A;  4QE7 A;  1KD1 W;  4JI0 B;  1HNW B;  5IYC O;  3ZRX A;  4NYK A;  1TUE B;  3IC9 A;  2ILM A;  4ZKI A;  2ZCE A;  2LP7 A;  3SR2 C;  4DYL A;  2UXX A;  1NVP B;  2Q9L A;  4IGG A;  2UXC O;  2HJD A;  4FJC C;  4H44 B;  2DYS C;  3AG3 C;  1BCC H;  2E5L B;  2EX3 A;  1BZK A;  3N2K A;  3ZRS A;  2GV9 A;  5IY5 C;  1SQG A;  3CE2 A;  3E8F A;  1G1X B;  1JOY A;  4DV7 O;  4WFA V;  2OCC B;  4BIU A;  3B4S A;  3CB2 A;  2NN4 A;  4WFF A;  1N33 O;  3C90 A;  2HVK C;  2ZKO A;  4DV6 O;  3MHH C;  1PNK A;  1SS3 A;  5CN0 A;  1IDS A;  1Q6H A;  2VRZ A;  4MTX A;  5CBG A;  4UB6 Z;  4DUY B;  2ZXW C;  1K7D A;  3OE7 G;  3NR7 A;  4DR1 O;  4NTW A;  2XTA A;  3TGU H;  4X1I B;  4YHH B;  1KBH A;  4JV5 O;  2EUL A;  4UXN A;  5L3F A;  1VAR A;  2M7W A;  3BAA A;  3IFX A;  3JSN A;  3AG7 A;  5IY5 B;  3CXC U;  3ZN1 A;  1Q7Y W;  3GWO A;  5B1O A;  5KHK A;  1I5Y A;  1COW G;  2XOK G;  3WFV A;  1E1Q G;  2CAZ C;  1IBM B;  3F7Y C;  3OMA B;  1YVW A;  2RJZ A;  1EM1 A;  4CS2 A;  4MTG A;  3LSU A;  4NB5 A;  4LF5 O;  3K08 A;  4EB6 B;  1HWY A;  4DR2 O;  3ZCC A;  4PA9 A;  5FLX N;  2IM9 A;  3OTF A;  2R9I A;  1N0N A;  1CEZ A;  4KHP O;  2ZE5 A;  1Q43 A;  2XUM A;  1WNS A;  2LFR A;  1FKA O;  5GON B;  2WLI B;  2ZXW B;  3D3I A;  1Z5W A;  1FYJ A;  5IT9 N;  2EIK B;  4PEL A;  2D3O W;  1IXB A;  3ZRV A;  1ZUQ A;  4CC6 A;  4D7T A;  2CTQ A;  4FLV A;  3ABL C;  5LYJ B;  1L0L H;  4NVP A;  3OD4 A;  2VWK A;  4DV5 B;  4H13 B;  4X1I A;  3E8H A;  4DV3 B;  1ROP A;  4DV0 O;  1JFF B;  2QWO B;  4JYA B;  1QLE B;  4GKK O;  2M6Y A;  2KG7 B;  3LSS A;  1MG1 A;  2DYR B;  1F4N A;  4F4L A;  5H6Q A;  3LDD A;  4NR1 A;  1D2D A;  4AHC A;  1ZL8 B;  1N34 B;  1ZX3 A;  3SPC A;  1Q81 W;  1KMI Z;  3CYO A;  2EIM B;  4JZ2 A;  3VOU A;  5LHI A;  3K79 A;  1F23 A;  1YDX A;  4PJ0 Z;  3FAV B;  4P2Z A;  1EFR G;  3M7M X;  4GYC B;  1L8D A;  4EB6 A;  4O4J B;  1GO3 F;  1NTK H;  1RSO B;  2MK3 A;  1GN3 A;  2UUC B;  3KKY A;  1XL6 A;  4PV1 B;  1L0N H;  1S72 V;  4JI2 O;  4LFA B;  4DV1 B;  3SYQ A;  5L3G A;  2QM8 A;  4B3M B;  3HPL C;  5GON A;  3ZS8 C;  2WLI A;  1JPX A;  3CCL V;  2YUA A;  1XDC A;  4KFM A;  4UB8 Z;  4CBC A;  3JAR B;  2V4D A;  4H33 A;  1R3L C;  1KU9 A;  2QWQ B;  1WJZ A;  4I9W A;  3CP1 A;  5J9P C;  1T5E A;  5LYJ A;  1NT2 B;  3HKD B;  1XNQ B;  1M56 B;  2EIJ B;  3SJA C;  4YJ3 B;  2VQE O;  1AIL A;  1OCR B;  4I5S A;  3RVZ A;  1JFF A;  4R8C A;  4PDR A;  2KG7 A;  1I94 B;  2KKW A;  1YJW V;  3OEE G;  1J95 A;  1ZL8 A;  2H8P C;  4CH5 A;  3ASN B;  2Q69 A;  1AVM A;  4TWK A;  4BW9 A;  2F4V B;  2Q68 A;  3FAV A;  4W4K A;  2BCC H;  1CPY A;  5EIB C;  4OX9 O;  4BAY A;  5L3D A;  3F5T A;  4O4J A;  1WN7 A;  4O4L B;  1PD3 A;  3ZHS A;  1RSO A;  3ZIA G;  3M8A A;  3CMA V;  3QO5 A;  1NH2 B;  2LW1 A;  1FJG O;  3FX7 A;  4PDL A;  4JI1 B;  1KKC A;  2QE7 G;  1GM7 A;  2VS0 A;  3JAR A;  3WU2 Z;  2JJ1 G;  2CK3 G;  1H8E G;  2LO1 A;  1YJN V;  4I9Q A;  1TGO A;  5FL7 G;  2LGQ A;  4HNA B;  3ZED A;  1VQ9 V;  3UT5 B;  4GX1 A;  3SYA A;  2XAJ A;  2JGU A;  3ABU A;  1XEQ A;  1QLN A;  3HKD A;  2IJK A;  3JYC A;  4OXS A;  1XOU A;  4YJ3 A;  3SYO A;  4X66 B;  2IJH A;  1K34 A;  1HNZ B;  1GM9 A;  2LJ2 A;  3IGA C;  3QG5 A;  1V54 B;  1Z5V A;  4AQY O;  2Y69 C;  1ZSP A;  4LCU C;  4JZG A;  5FNV B;  5IJ9 B;  2HEP A;  3JCZ A;  3T1H O;  5C8Y B;  1XHZ A;  1N36 B;  4FLY A;  2Q0A A;  1FXH A;  4O4L A;  5B3S B;  2P22 C;  3CRC A;  2A3Q A;  4K0K B;  2AHY A;  3JAS B;  1GMG A;  2X0L A;  1Q82 W;  3JAL B;  5KHJ A;  3CCJ V;  4FM1 A;  1M57 C;  2CTW A;  2EZP A;  3A0H Z;  4GKJ B;  2ZIN A;  5B1B B;  3WB0 A;  3TCU A;  5LGN A;  2ZNI A;  2B9Z A;  4MTF A;  3JD3 A;  3K58 A;  2O57 A;  3L74 H;  1IX9 A;  1VQ7 V;  4RWU A;  2ZE6 A;  4HNA A;  4LFC O;  3TXS A;  3FB7 C;  1CP9 A;  3UT5 A;  4R6Z A;  4QE9 A;  1SQP H;  5JJN B;  1AR5 A;  4LBE C;  1N8R W;  4QPK A;  2P7T C;  2QEX V;  1BHB A;  3ABK C;  1YTF D;  1XMO O;  4FLU A;  3JD0 A;  1W0K G;  3U10 A;  3K5M A;  2EJR A;  2HHH O;  5KUM A;  4WFE A;  3TET A;  1S5J A;  3THO A;  1VQ5 V;  3W7S A;  2B5U A;  5FNV A;  5IJ9 A;  4WFH A;  4B3T O;  2P5O A;  2YSU B;  5LGU A;  1XHX A;  4UVB A;  1VF6 A;  1FXV A;  1NQT A;  2K9P A;  1YCI A;  4I55 B;  5C8Y A;  4H37 A;  3SDL A;  2RDC A;  2WAM A;  4PI2 A;  1FXK B;  3K5L A;  2YIB D;  4WBN B;  1WB7 A;  4WFG A;  1OCC B;  5KAF Z;  5EK0 A;  5EBW C;  4EKW A;  2CTR A;  1J5E O;  1IBK O;  3JAS A;  2HP8 A;  4CH6 A;  4LF9 O;  3T1C A;  1GKF A;  2YI9 A;  2AXT Z;  2ZDI C;  3JAL A;  2UU9 B;  1R1B A;  1WAZ A;  4DV2 O;  5KAI Z;  3T4Z A;  2EIL B;  3UO3 A;  1XIL A;  4N21 A;  3IC7 A;  3X2Q C;  1YIJ V;  4GX5 A;  2ATK C;  2F95 B;  1DF5 A;  1QHT A;  4YXW G;  4X89 A;  2D2C B;  3DXR B;  3TK1 A;  2B1G A;  1EBO A;  1IVS A;  3D36 C;  4ZIB A;  3JD4 A;  1QR9 A;  4DR6 O;  1U96 A;  3DGE A;  3L75 H;  3D3Q A;  4JTA B;  3QNE A;  1HNW O;  1HNX B;  2Y0P A;  3AG1 C;  4PD4 F;  2QGN A;  1XNR B;  1V55 B;  3G4S V;  4MVZ A;  1JVM A;  4I55 A;  1YHQ V;  1SKV A;  4QNH B;  5A9G A;  1WPX A;  2UXD B;  4MT8 A;  4MW8 A;  4FFB B;  3SPI A;  1ZTE A;  1FXK A;  2F1M A;  4WF9 V;  4WBN A;  1TUB B;  4TT3 G;  4C7U A;  1THZ A;  1M5I A;  5F2V O;  5AG2 A;  1Y74 B;  2ADQ B;  4LFB B;  4FLX A;  2OYQ A;  2ZT9 B;  1QBZ A;  2F93 B;  2XND G;  2E5L O;  2ZE7 A;  3E83 A;  4KP4 A;  5CA1 B;  3AEI A;  3APQ A;  3AG4 C;  3HR0 A;  3OUF A;  2PYJ A;  1SQX H;  3J80 N;  3T1Y B;  2UUA B;  2QWN B;  3OMN B;  1Y4M A;  3CWB H;  2R70 A;  5J2T B;  3GWK C;  2NLJ C;  4B3R O;  5E79 Z;  3LUT B;  1VQO V;  1FPO A;  2YXL A;  4DW1 A;  2QSA A;  3DXR A;  1BSM A;  2C2A A;  2R72 A;  1SC5 B;  2WLL B;  3I55 V;  1YXB A;  1X59 A;  1PL4 A;  3E89 A;  4JI3 B;  3OEH G;  1HR0 O;  3O65 A;  4DUY O;  5IWA B;  5BR8 B;  1KEC A;  3GB7 C;  1O9H A;  4O2B B;  2DQ3 A;  3PJS K;  2G38 A;  2YXH A;  3ABM C;  4JI8 B;  1MSD A;  4YHH O;  4FFB A;  3RYF B;  1ZAU A;  1Y6X A;  4NTX A;  1Q3E A;  1TUB A;  3UQ8 A;  3W7W A;  4RQE A;  4MW3 A;  2EIN B;  1Y74 A;  5HFM A;  2IJI A;  3OTO B;  3BA9 A;  2Q6A A;  3JAK B;  1NS1 A;  4X8A A;  2ZNJ A;  1OV9 A;  3ETD A;  1QU7 A;  1WP7 A;  3MHS C;  3R65 A;  1KUQ A;  1YTF B;  1KP3 A;  4X64 B;  2GBO A;  2W0X A;  5CA1 A;  4GT1 A;  3CCQ V;  3O9O A;  1SA0 B;  1TA8 A;  1SQQ H;  1Y67 A;  3RW0 A;  1P49 A;  4UCU A;  2YDE A;  1W59 A;  5J2T A;  3UO2 A;  4UCV A;  1K5Q A;  4WCE V;  2JRI A;  3ZJZ A;  2ARH A;  1JA8 A;  4X20 B;  4K3A A;  3RYI B;  1IBL O;  1H2M A;  2X6A A;  1PNL A;  1NH2 D;  2WLH A;  2WLL A;  5L3B A;  1E1R G;  2DYS B;  3QO7 A;  1D5N A;  1DGS A;  3AG3 B;  5BZB A;  4MS2 A;  3TJT A;  1TVK B;  4JAA A;  4JAU A;  5LMN B;  2UXC B;  3CCV V;  3FB8 C;  1LUV A;  2IBZ H;  4O2B A;  2Y0I A;  4IL6 Z;  4DV5 O;  1VQ6 V;  4DR4 O;  4DV3 O;  1NKD A;  5IYZ B;  1CXZ B;  3RYF A;  3JAT B;  4J7Z A;  5KMG B;  1K5S A;  4JYA O;  1YI2 V;  4KUM A;  4YY3 B;  4HBN A;  2XHB A;  3G6E V;  2Z0A A;  4X88 A;  4FM0 A;  1OCZ C;  3JAK A;  2QM4 A;  3E8G A;  1BE3 H;  4JI6 B;  4MTO A;  1N34 O;  4BR6 A;  3B8N A;  3FB6 C;  1ZLZ A;  4JI7 B;  2AZ2 A;  3SPH A;  2FML A;  3GVM A;  4N23 A;  5EIB D;  3E8B A;  4LH7 A;  3RYC B;  4FLT A;  1SA0 A;  2AGA A;  2YI8 A;  1N33 B;  3VQV A;  1RM1 C;  1O9G A;  4UFZ A;  5EC2 C;  3CX5 F;  5B5E Z;  3CCS V;  3FKS G;  4X62 B;  1QQC A;  1N32 B;  2GTS A;  4MSW C;  2UUC O;  4DK0 A;  4OGQ B;  1BQ0 A;  2ADP A;  4UV8 A;  4X20 A;  2V7Q G;  2ETN A;  4X65 B;  3RYI A;  2YIB A;  3BEH A;  2PF4 E;  3OM3 B;  2Q67 A;  4B7K A;  1LR1 A;  1G8M A;  4K8X A;  5LMU B;  2E3C A;  4EFE A;  2ZD9 A;  4PA6 A;  3ETE A;  2CTP A;  2LGW A;  2HKO A;  3ZHQ A;  4LF6 B;  1TVK A;  2X6B A;  4LWS B;  4FMT A;  3L9D A;  2EBO A;  4E4E A;  2P4V A;  1P7G A;  2ITD C;  1P4R A;  4I50 B;  5LA6 B;  4RAI A;  1XNQ O;  2N05 A;  5JJE B;  5IYZ A;  5LHH A;  5KMG A;  2HG5 C;  1MSW D;  1VQK V;  2UXB B;  1I94 O;  2H3O A;  4DK1 A;  3LNN A;  1UFI A;  1JR9 A;  4IYH A;  2QJ1 A;  4JGS A;  1PM9 A;  4IT5 A;  3CRR A;  4O2A B;  1M4U A;  5CA3 A;  1RM1 B;  3U0Z A;  3BCC H;  4DR2 B;  4I4T B;  2YIC A;  3HKE B;  3L72 H;  3JAM N;  2W6J G;  4KHP B;  4JYC A;  3RYC A;  2F4V O;  2A79 B;  5B1A C;  2XAG A;  1EZJ A;  3ABL B;  4MVM A;  4J80 A;  4B3S B;  5JQG B;  2OIG A;  3NXS A;  2PUS A;  1VEW A;  4GCZ A;  1W0J G;  3P32 A;  4YIP A;  1W2B U;  4RUE A;  3B77 A;  4LF8 B;  1M9N A;  3CCU V;  5KLV H;  3CCE V;  5EC1 C;  4TOI A;  1JCH A;  4JI1 O;  2KSD A;  1JMK C;  3W7X A;  4CZZ A;  2PZS A;  3E35 A;  4DR7 B;  5DEC A;  2PY5 A;  4HYO A;  3SPG A;  4GKK B;  2RCV A;  3RFR A;  2Q7G A;  1K33 A;  1R6T A;  3F7V C;  1K3E A;  1N4C A;  4LWS A;  4HAM A;  1Q6U A;  2X6C A;  5LA6 A;  2JS3 A;  4I50 A;  4IIJ B;  5LP6 C;  5FPR A;  1VQ4 V;  1FFT B;  4CS4 A;  1YF2 A;  1Z2G A;  2RMK B;  1HNZ O;  2UUB B;  3W7T A;  1PKX A;  4O2A A;  1NR7 A;  2QM7 A;  5D5Q A;  5B1A B;  3RN4 A;  3SGI A;  4I4T A;  1BHA A;  1AP5 A;  3HKE A;  1I7F A;  4JAS A;  3AK1 A;  1VQL V;  3DTU B;  1N36 O;  1R3K C;  4NKG B;  3JD1 A;  1GH6 A;  1OZ0 A;  2ZR3 A;  4EEQ A;  5JQG A;  3BY6 A;  3JD2 A;  2WWW A;  4K0K O;  3K5O A;  3ZHT A;  3PN1 A;  1UPG A;  4BIO A;  4FLZ A;  2X7R B;  4QPJ A;  2PI5 A;  4JI5 B;  4DW0 A;  3CCR V;  3OGC C;  1RFY A;  1WLE A;  4ZHQ B;  4DV4 B;  5CB4 B;  3SJB C;  1H38 A;  2ITC C;  2VQE B;  4G28 B;  1XMQ B;  3CD6 V;  2JJ2 G;  2Q73 A;  3H1J H;  3RT3 C;  4B08 A;  2LW7 A;  1SF9 A;  3B2E E;  1Q6I A;  3CXH F;  4IIJ A;  1US6 A;  2OCH A;  4MVU A;  5H2F Z; 
#chains in the Genus database with same CATH homology
 4WFF A;  2HVK C;  1IXM A;  5C93 A;  3TK1 A;  4TSF G;  2B1G A;  3MHH C;  1PNK A;  1EBO A;  2ZR2 A;  4LC1 A;  4JPR A;  5CN0 A;  5LHG A;  2IW5 A;  4MTX A;  3JD4 A;  1QR9 A;  3FB5 C;  5CBG A;  1JX9 A;  3ASN C;  4PA4 A;  3DGE A;  5KA5 A;  1SER A;  2FTK A;  4JTA B;  3QNE A;  1Q86 W;  1G4Y B;  4LP8 A;  3ZMT A;  3AG1 C;  3CC2 V;  2ZXW C;  1K7D A;  1V55 B;  3OE7 G;  3G4S V;  4MVZ A;  1AI5 A;  1JVM A;  1NR1 A;  1YHQ V;  2ZQM A;  4QNH B;  1FS0 G;  4MVR A;  1WPX A;  2NNU A;  4MT8 A;  4MW8 A;  2IH3 C;  3SPI A;  1DTO A;  1FXK A;  5HFL A;  4WF9 V;  3LDE A;  4DXW A;  1K9M W;  4MVO A;  4R50 A;  4TT3 G;  5H6R A;  4ZBM A;  1THZ A;  1XL4 A;  1KQS U;  4UXN A;  5L3F A;  5B1N A;  3HB3 B;  3K06 A;  2M7W A;  4FK5 C;  2H94 A;  5IYB O;  1MAB G;  1DLB A;  1QBZ A;  2HFE C;  3IFX A;  2OTL V;  1RPR A;  2XND G;  5IY5 B;  3CXC U;  3ZN1 A;  4UVA A;  1Q7Y W;  3A0R A;  3E83 A;  1S3J A;  4KP4 A;  3GWO A;  5B1O A;  2Y69 B;  4JTC B;  3AEI A;  1I5Y A;  1COW G;  2XOK G;  3AG4 C;  3OUF A;  1E1Q G;  3WFV A;  3F7Y C;  3OMA B;  1RPO A;  4MTG A;  3OMN B;  1Y4M A;  2BOB C;  3K08 A;  3LSQ A;  1HWY A;  3OR6 C;  1BMF G;  1R3J C;  2NLJ C;  3KG2 A;  3ZN0 A;  3ZCC A;  4PA9 A;  3CME V;  3LUT B;  1L1F A;  1VQO V;  3K3W A;  2R9I A;  1CEZ A;  4BW5 A;  5KUK A;  1PL0 A;  1V54 C;  2C2A A;  2EZO A;  2F43 G;  2LFR A;  3AG2 C;  2WLL B;  3K0D A;  1YIT V;  2WLI B;  2ZXW B;  3D3I A;  3I55 V;  1JQ0 A;  1AI4 A;  2AHZ A;  3E89 A;  2R9R B;  3K04 A;  3OEH G;  5DN6 G;  2EIK B;  4PEL A;  1M57 B;  1QVF U;  2D3O W;  4UUJ C;  3ZRV A;  2WLK A;  1KEC A;  2IU3 A;  3QO8 A;  3ABL C;  3GB7 C;  2IU0 A;  1S5H C;  1K8A W;  2DQ3 A;  3STZ C;  3PJS K;  1AR1 B;  3ABM C;  5B3S C;  1KC8 W;  4P9O A;  3E8H A;  1P7B A;  3ZRW B;  1QCE A;  1ROP A;  1AI6 A;  4FIP C;  3W7W A;  2WLM A;  4MW3 A;  3FYE B;  2EIN B;  2OT5 A;  4RQE A;  4JYB A;  1QLE B;  2WSS G;  4E2L A;  3SYC A;  3LSS A;  2IJI A;  5HFM A;  2Q6A A;  1MG1 A;  2DYR B;  1F4N A;  3ABK B;  2JEX A;  4F4L A;  4WFB V;  4X8A A;  4J9Z B;  5H6Q A;  4PA7 A;  3ETD A;  3LDD A;  2DQ0 A;  3EHB B;  4PDM A;  4JTD B;  2HVJ C;  3MHS C;  3R65 A;  5B1B C;  1YTF B;  1KP3 A;  1KKD A;  3SPC A;  3UM7 A;  1Y66 A;  1Q81 W;  1SZT A;  3CYO A;  1OCO C;  2IJJ A;  5L3C A;  4Q20 A;  2EIM B;  4GT1 A;  3CCQ V;  3VOU A;  3ZMZ A;  3K79 A;  5LHI A;  1F23 A;  4P2Z A;  1S76 D;  3RW0 A;  1EFR G;  4BIZ A;  3K03 A;  3VBB A;  1GO3 F;  4QJF B;  3AG2 B;  4UV9 A;  2MK3 A;  1K5Q A;  1R6N A;  4G2K A;  4WCE V;  3K0G A;  3ZJZ A;  1AJN A;  3CCM V;  1XL6 A;  2XAS A;  1GTO A;  1S72 V;  3F5W C;  2XAQ A;  5E1A C;  3SYQ A;  5L3G A;  2QM8 A;  2X6A A;  1PNL A;  1NH2 D;  3HPL C;  2WLH A;  1SET A;  2WLL A;  5L3B A;  1M90 W;  2WLI A;  1AJP A;  1E1R G;  1JPX A;  3ML0 A;  1S0V A;  3CCL V;  2DYS B;  3QO7 A;  4KFM A;  4CBC A;  3AG3 B;  3LDC A;  3OMI B;  4H33 A;  3G71 V;  4P9P A;  1R3L C;  5BZB A;  3OUS A;  1VQN V;  4DO2 A;  4MS2 A;  2V1D A;  4I9W A;  4JAU A;  3CP1 A;  5J9P C;  3CCV V;  1FXK C;  3OR7 C;  3FB8 C;  4FPP A;  3X2Q B;  1NVP D;  1OCC C;  1ORQ C;  1VQ6 V;  2HLD G;  1M56 B;  1B6Q A;  5GW7 A;  1NKD A;  2P67 A;  1MOF A;  2EIJ B;  4XDK A;  1OHH G;  2WLN A;  3ZRW A;  1OCR B;  3MD0 A;  1K5S A;  4RO2 A;  4I5S A;  3RVZ A;  4R8C A;  1YI2 V;  4XDL A;  4PDR A;  4KUM A;  4R7C A;  1OCO B;  3G6E V;  2PI4 A;  4X88 A;  1OCZ C;  1YJW V;  3P30 A;  3ZMU A;  2WLJ A;  3E8G A;  3FYI B;  3RBZ A;  1ARO P;  2JK5 C;  3ZMS A;  3ZMV A;  3OEE G;  1K92 A;  4MTO A;  3WG7 C;  1I5X A;  3E2E A;  1J95 A;  2H8P C;  3B8N A;  3FB6 C;  1PNM A;  2EIL C;  2BOC C;  3ASN B;  2Q69 A;  3SPH A;  4N23 A;  4TWK A;  3E8B A;  2K1E A;  2Z5U A;  2Q68 A;  3ETG A;  1RM1 C;  3AG1 B;  5EC2 C;  3CCS V;  3FKS G;  1CPY A;  4XDJ A;  3K9A A;  4BAY A;  4JAV A;  1GK9 A;  5L3D A;  2GSM B;  1PD3 A;  2XAF A;  4MSW C;  2KB1 A;  4P30 A;  3ZIA G;  2YEV B;  3CMA V;  4RUF A;  3QO5 A;  1NH2 B;  4UV8 A;  2V7Q G;  4PDL A;  1M1K W;  4L87 A;  2B1I A;  3BEH A;  4QIW F;  3OM3 B;  4Z1M G;  2XAH A;  2QE7 G;  2Q67 A;  1GM7 A;  1G8M A;  1JJ2 U;  2JJ1 G;  2ZDI A;  2ZD9 A;  2CK3 G;  3ETE A;  4PA6 A;  3CC7 V;  1H8E G;  2JDI G;  1YSC A;  1V55 C;  5CMU A;  1YJN V;  3AG4 B;  2HKO A;  5FL7 G;  1F51 A;  2X6B A;  4FMT A;  3SJQ C;  1VQ9 V;  4GX1 A;  2EBO A;  2Z3Y A;  2ITD C;  2XAJ A;  1P4R A;  3ABU A;  3SYA A;  4RAI A;  1QLN A;  2Y48 A;  3E86 A;  2IJK A;  4UVC A;  3JYC A;  4OXS A;  1R6K A;  4G27 B;  5LHH A;  1E79 G;  3SYO A;  3WG7 B;  5CBH A;  4PDV A;  2HG5 C;  1VQP V;  2IJH A;  1MSW D;  4J9Y B;  1K34 A;  1VQK V;  1GM9 A;  3IGA C;  3W7U A;  1V54 B;  5CBF A;  4JGS A;  3ABT A;  4HZ3 A;  2Y69 C;  2IH1 C;  2OTJ V;  4LCU C;  5CA3 A;  1RM1 B;  1NBM G;  2DWE C;  3D36 A;  3JCZ A;  5IYD O;  4GX2 A;  2W6J G;  2JIZ G;  4JYC A;  1ZWI C;  4ASU G;  2A79 B;  3ASO C;  5B1A C;  4MVQ A;  1H2G A;  2XAG A;  1EZJ A;  1FXH A;  3ABL B;  4MVM A;  1K4C C;  1YJ9 V;  1K73 W;  3ABM B;  5B3S B;  1KP2 A;  3NXS A;  2GHY A;  5EBL C;  1F4M A;  2YEV A;  4GCZ A;  1W0J G;  2AHY A;  2W0F C;  3P32 A;  1W2B U;  2HR3 A;  1GMG A;  4PA3 A;  2X0L A;  4RUE A;  2QTO A;  5L3E A;  1DF4 A;  3B77 A;  1M9N A;  3CCU V;  1Q82 W;  1S77 D;  1QVG U;  2WPD G;  5EC1 C;  3CCE V;  3CPW U;  5LGT A;  3M99 B;  1JCH A;  5IDJ A;  4U7O A;  3CCJ V;  2EIK C;  2QA4 V;  3SPJ A;  1M57 C;  3OW2 U;  2EZP A;  3W7X A;  4CZZ A;  4GX0 A;  5B1B B;  3E35 A;  5LGN A;  3TCU A;  4HYO A;  4MTF A;  3JD3 A;  3SPG A;  1VQ7 V;  1K33 A;  3F7V C;  1K3E A;  3B8M A;  3EFF K;  1GM8 A;  2DWD C;  2DW4 A;  3FB7 C;  4HAM A;  1CP9 A;  2X6C A;  4R6Z A;  3T4D A;  3LNM B;  4QE9 A;  3I56 V;  1VQ8 V;  2EIN C;  1QLE C;  1VQ4 V;  4LBE C;  1N8R W;  1NJI W;  1FFT B;  4QPK A;  2P7T C;  2QEX V;  1BHB A;  1AJQ A;  2DYR C;  3ABK C;  1YTF D;  1AI7 A;  1R3I C;  3UKM A;  1BL8 A;  1UJW B;  3RVY A;  2OCC C;  2W6I G;  1W0K G;  3JD0 A;  3T2M A;  3W7T A;  5LBQ A;  2EJR A;  5KA6 A;  1R73 A;  5KUM A;  2P6J A;  1PKX A;  4WFE A;  3TET A;  1NR7 A;  1H8H G;  2QM7 A;  3SYP A;  1VQ5 V;  4XBF A;  2EIM C;  1LNQ A;  3ASO B;  5B1A B;  2B5U A;  3W7S A;  2P90 A;  1BHA A;  4WFH A;  2YSU B;  4MVS A;  4QE7 A;  5LGU A;  1KD1 W;  4UVB A;  4JAS A;  5IYC O;  2HJF C;  1VQL V;  1FXV A;  1NQT A;  3DTU B;  1R3K C;  3ZRX A;  1VQM V;  1TUE B;  3JD1 A;  4H37 A;  4U7N A;  2WAM A;  2UXN A;  1OZ0 A;  1FXK B;  2ZR3 A;  4WFG A;  1OCC B;  3BY6 A;  3JD2 A;  2A0L A;  4ZKI A;  5EK0 A;  2LFS A;  2WWW A;  1K4D C;  2LP7 A;  5EBW C;  4EKW A;  2UXX A;  1NVP B;  4FJC C;  3T1C A;  2X7R B;  1GKF A;  4QPJ A;  2PI5 A;  3CCR V;  2DYS C;  3AG3 C;  3STL C;  2ZDI C;  3OGC C;  1SES A;  3OAA G;  2QKS A;  1WLE A;  3OFN G;  1OCZ B;  2A9H A;  1H38 A;  2ITC C;  4JF3 A;  5H9C A;  3ZRS A;  4G28 B;  3CC4 V;  3T4Z A;  1SRY A;  2EIL B;  3CD6 V;  2JJ2 G;  5IY5 C;  4N21 A;  3H01 A;  3IC7 A;  3X2Q C;  5DM6 V;  1YIJ V;  3E8F A;  1JOY A;  4GX5 A;  1M56 C;  4WFA V;  2ATK C;  2OCC B;  2EIJ C;  1ENV A;  1K97 A;  1DF5 A;  1OCR C;  4RQF A;  4BIU A;  4YXW G;  1QR8 A;  4X89 A;  2JEU A;  4MVU A;  5EBM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...