1VQPV

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqpV00
1M1KW 4WCEV 1VQ6V 3CCLV 3CD6V 1Q86W 1VQKV 1YITV 3CMAV 2QA4V 1YI2V 3CCJV 1N8RW 2OTJV 1VQPV 1YJNV 1VQNV 1Q7YW 1JJ2U 1KQSU 2OTLV 1KD1W 1VQOV 1R73A 1VQMV 1YJ9V 1YIJV 4WFBV 3OW2U 3CCSV 1S72V 1QVGU 4WFAV 3CC7V 3CMEV 1VQ9V 1YHQV 3CCEV 3G6EV 1VQLV 1QVFU 1VQ7V 4WF9V 3CCQV 3CXCU 3G71V 1YJWV 1Q82W 3G4SV 3CCMV 1VQ8V 3CC2V 3I55V 1K9MW 1K8AW 3CCUV 1Q81W 1M90W 3CC4V 3CCRV 1K73W 1W2BU 2D3OW 1KC8W 3CPWU 2QEXV 1VQ5V 1VQ4V 1NJIW 3CCVV 5DM6V 3I56V
chains in the Genus database with same CATH superfamily
3AG7A 2ATKC 2QDOA 1F51A 1YJ9V 4UV8A 2UUAO 4LFCB 3RFRA 2W0XA 3JCUZ 5KAIZ 5KA5A 4CH6A 3JAKA 4WF9V 1R3IC 4O4JA 3CCMV 5LL6Y 3RVZA 4ZOLA 4DXWA 4TQDA 3ETDA 1KECA 2Q7EA 1BCCH 2G38A 2OCCB 4DUYB 4PDMA 2ZXWC 2W0FC 3SPGA 4PA9A 3ZMZA 3T1CA 4MSWC 4DW1A 5DN6G 5CA1B 3K0GA 2CTWA 4DV2B 4LF8O 4OPHA 2ZDIA 2OWOA 4FFBB 4PHZA 2LGWA 1VEWA 1XDCA 4UCVA 2WPDG 1XNRB 5EK0A 1Q6HA 2EINC 4PDVA 3OMNB 5C93A 4Z1MG 2GTSA 1SF9A 5JJJB 3R66A 4IGGA 4UCUA 3AEIA 4IIJA 2BE3A 1OCCB 2DWEC 3CXCU 1YJWV 3OE7G 5LMUO 2QR4A 1K8AW 5KHGA 5LBQA 1KUQA 4H13B 1QLEB 1N36B 1PP9H 4LBEC 4LFAO 4U7NA 3FB8C 5FNVB 1KU9A 1NZ6A 4CBCA 2QWOB 3F5WC 3L71H 5JVDB 3JALB 2GTAA 1ORQC 4FFBA 3CS5A 2FKXA 3N2KA 3OT7A 4LFBB 4JI1B 4X62B 1YI2V 1R6TA 5H5NA 3RN4A 2L6LA 5L3BA 1HNWO 3RWRD 1I94O 4WFEA 3F7VC 2JEUA 1NTZH 1EN5A 3L70H 2H8PC 3M8AA 2HVKC 1XQ8A 5AG2A 4BW5A 1RM1C 5L3CA 1CEZA 4KHPO 5IYBO 5JJNB 2QKCA 1VQPV 3D3QA 1JJ2U 4QE7A 2OT5A 5KMGB 2GUZB 1HNZO 4LNUB 2B1GA 1P7BA 2XNDG 5LP6B 4G28B 4O4HB 1WPBA 2K9PA 5BXZA 4HAMA 3IC7A 1GM8A 3ASNB 2ZE8A 2YUAA 5CMUA 5IY5B 4DV5B 3B40A 2JDIG 3D3IA 2P5OA 2ZE5A 4MVQA 3JD3A 5IWAO 1XNQB 4FLYA 2JEXA 3LNMB 2WLIA 1BT8A 3HKCA 1V9PA 2R9RB 2Q68A 3K58A 1E1RG 3LDCA 5DEDA 3G4SV 4GKJB 2KQXA 3KZIZ 4FLZA 2X6AA 4AHCA 1G1XB 2ITCC 4F6RA 4JYAO 2ZNIA 4N21A 3TGUH 2HLDG 1LUWA 1VQKV 4RAIA 2NN4A 1AI5A 1YITV 3TETA 1BMFG 2YIBD 4UUJC 1KQSU 1OZ0A 3SDLA 2YIBA 3LUTB 4WFAV 1KKCA 2CTQA 5LP6A 2F95B 3CC2V 5CA0A 2RCVA 1VF7A 3AG4C 3ZMUA 1W59A 3DC5A 1BHAA 1SQVH 3CCLV 4JYBA 5JH7A 3N2GB 2HJDA 1Q6IA 1G4YB 4JYCA 1NVPD 3FB7C 3OD4A 2QE7G 3OM3B 5JQGA 3RYFB 1YTFB 4JI6O 5B66Z 4ZBMA 2WA4A 1VMGA 3MAQA 1ENVA 3M99B 2P6JA 4UVAA 3HKBB 3SPHA 2CGOA 4JAVA 1QR8A 4TUYB 4AI8A 4JASA 1GTOA 2JGDB 2Q9LA 4ICGA 1Q90D 2JJ2G 2BTOA 1ZWIC 2ZE6A 3C3TA 2UXDB 4JI2O 3CCSV 4YJ3B 2HR3A 3ZMTA 1WP8A 2IH3C 1WAZA 1Y74B 5KHJA 1MZEA 4TV8B 2LFSA 1XOUA 4QPJA 2KSDA 3UT5B 3J81N 4DV2O 3THOA 4YIPA 4JTCB 3H1KH 3H01A 3DSQA 1K3EA 5EC2C 4UXNA 2ARHA 5LOVA 3IJ4A 5IYDO 4AQYO 5B1BB 4JI7O 3JASA 3G71V 1CXZB 2WLMA 1Z2GA 2DYRC 2Q73A 1K9MW 2Q8VA 5BMVB 2DQ3A 1K73W 2D3OW 1PM9A 2VQFB 4DV4B 5KLVH 4O4LB 1PKXA 4MW8A 2ZINA 3B8NA 3J80N 2JGDA 3AG1B 1XMOB 3D8CA 2A7WA 3AG3B 3FYEB 5LYJB 1OCRC 3HKEB 3BAAA 3EFFK 4J9YB 2XAFA 4DV0B 3UT5A 5EC1C 4LWSA 3G6BA 1QQCA 2HFEC 3SR2C 3IAYA 4X9QA 3VQVA 4LCUC 3K79A 4NR1A 4DW0A 4JI1O 2P4VA 2B5UA 2A06H 3OR6C 2IU0A 2AXTZ 1M90W 2EIJB 3ZHTA 3ZHQA 1VQ5V 2UUAB 2E74B 4X66O 4DV6O 1VQ6V 4JZGA 4H0LB 3WG7B 4N23A 4O4LA 3FD9A 2XAGA 3SJQC 1GRJA 3SYCA 3JCZA 4FM1A 2XOKG 4WBNB 3ABKC 1M9NA 1FXKB 4MVOA 2FMLA 4ZHQB 1F7YA 2R70A 2EIMB 2ODMA 3I5DA 4XBFA 2FB5A 2P7TC 5TISZ 4C7UA 4LC1A 4W4LA 2QTSA 3AG2C 4O2BB 1GH6A 3S3XA 4MTXA 1Z5WA 2V7QG 2UXBB 1WP7A 1DK1A 4FLVA 4GKJO 2XUMA 1DF4A 1B3QA 5B1AB 3B09A 5IJ9B 3K59A 3LDDA 5A2QN 4R6ZA 5EIBC 3ZRWB 4BAYA 4J7JA 3SJBC 1MSDA 1VP7A 3DXRB 4NXMO 2K1EA 1W2BU 2OIGA 4JI3B 3JAMN 3ZHVA 1N32O 4PELA 1E1QG 1OV9A 2H3OA 2XHBA 3PJSK 1N34B 5LHIA 4FLXA 3FYIB 3J7AU 1JFFA 5FPOA 2GV9A 3CCEV 4O2BA 3BPZA 5GW7A 3SYOA 1P4RA 1HWYA 4R8CA 2B1IA 2YEVA 1PNLA 5DECA 2UXCB 1HNWB 3ABTA 3K5MA 3Q4HB 2CE4A 4LF7O 1R1BA 1FD9A 4OX9O 4J11A 4MTOA 1NBMG 4XDLA 2DOSA 5FL7G 5H2FZ 1ZTEA 3E2EA 3K04A 2JS5A 3ZRSA 5LA6B 3STLC 2UXDO 5B5EZ 5IE9A 1WA8B 4X1IA 2W6JG 1IBMO 4FZ1A 1S77D 3VBBA 3CMAV 3A0HZ 2UUBB 4PDLA 4JAUA 1AR1B 1BZKA 2Q67A 4ZI7B 1PV0A 1SERA 4BIOA 2Y48A 2QSAA 4HBNA 2Y4TA 3K57A 4DRXB 3CCRV 4JPRA 1UFIA 1DGSA 2YS8A 3RYIB 3QF7A 4MVMA 3ASOC 3EVKA 4I0XA 1R3KC 5EIBD 2VQFO 1QLNA 2BTQA 5EYPA 2E3CA 3BA9A 3IFXA 1YHQV 3IGAC 1TAEA 1FXHA 2UUCB 1H2SB 4O4JB 3CSXA 4GUNA 3D36A 4GYCB 4Q6GA 1XMOO 4ZOLB 5HFLA 1WA8A 2JIZG 1AB3A 2EIKC 2WAMA 4AILC 2JVDA 1M1KW 3X2QB 2QWPB 4BW9A 1K7DA 1XILA 4TT3G 4DV0O 3E86A 4NTXA 1YCIA 3ZHSA 5BZBA 3ABLC 4CS3A 4UV9A 2Z5UA 1Y76A 4MVRA 2R9AA 1S0VA 4JI6B 2HHHB 3N27A 2L35A 1ZSPA 2Y0IA 5EBLC 4NKGB 2IJKA 1GM7A 1DF5A 2JJ1G 2Z0AA 5LHHA 4IIJB 2WLNA 3U11A 1KP3A 2XAQA 2LP7A 3AK1A 3ZJZA 3H9VA 4F4LA 5L3FA 4B3RB 3TCUA 1MNGA 4JI2B 4YIOA 4FFKA 2IJIA 3BFRA 3S3WA 4UVCA 3UKMA 1IVSA 1VQ9V 4OGQB 3STZC 1OCCC 1D5NA 3JD0A 2GSMB 3HKDA 3BVOA 1KB9F 2KG7A 4GX5A 2LW1A 1JPXA 2PI5A 3N2KB 3BHPA 3L9DA 5EBWC 4AQYB 5L3DA 2ZIMA 4G27B 4JI7B 1B04A 2AW9A 1U97A 2AHYA 2UXBO 4F6EA 4DO2A 3E8GA 1FJGO 3CC7V 3EHBB 4YHHO 4LP8A 3CYOA 1VF6A 2DYSC 1NTKH 2CAZC 5KHHA 4PI2A 1H2KA 3GWOA 3I55V 2BCCH 1NU1H 3ZN0A 3NR7A 5CB4A 5E79Z 3DTUB 2Q7HA 5C8YB 2PY5A 3E22A 4JI3O 2FYUH 2P22C 3CHXA 3QO8A 1VIBA 2YXHA 2F23A 3ABUA 2QWRB 4PV1B 2OYQA 4JTAB 2QWQB 4RUFA 3SYAA 1N34O 2WLHA 2EINB 1FFTB 5ITZA 4B3MB 4P30A 2D2CB 4WFFA 2BSKB 5B3SC 1NH2D 3OEHG 2UXCO 2WLIB 3HKCB 3ZRXA 3RGBA 4L87A 1DLBA 2RJZA 1K5QA 4MS2A 4XDJA 4X66B 4DV6B 3A2FA 4OPAA 1NQTA 1K5SA 2VS0A 4F6RB 5IY5C 1ZLZA 2QKSA 5C8YA 2HG5C 1S76D 1EN6A 4J7KA 1MOFA 3FAVA 4RUEA 1F23A 4UCOA 2UUBO 5CA0B 5K1PA 2LFRA 2X7RB 3ZX6A 1SETA 4RQFA 3VQWA 4IYHA 4FMTA 2PUSA 4B08A 2BSKA 1GN2A 5JH7B 3T1YB 2P4KA 1AJPA 1JMKC 5JQGB 1NVPB 4DR5O 3FFQA 4XDKA 2F93B 1GKFA 1EM1A 4CH5A 4MTFA 3P3NA 3K5NA 1RM1B 4FLTA 3L75H 4D6TH 5EZYA 1AVMA 1BQZA 3CXHF 1F4MA 2UUCO 1M57C 4MTGA 1NI8A 1KP2A 2PTMA 4FM2A 4G2KA 4Z2WA 1VQMV 1YVWA 3MHSC 4NXMB 3RYHA 1L8DA 1LNQA 2Y69B 1N32B 4YY3B 1K92A 5GTHZ 2YI8A 3OTOO 4DR3O 4TV9A 4EEQA 4UFZA 1CPYA 3F7YC 4PA3A 4K8ZA 2MW2B 5LOVB 4JTDB 1JJOA 3OAAG 3LSQA 2ZE7A 4FPPA 3LSUA 3OGCC 2HHHO 1Y4MA 3JASB 1JX9A 5FPRA 3MHHC 1OCZC 1SZXA 3P32A 3A0BZ 4LF7B 3K03A 1PNMA 1V55B 1L0LH 1HNXO 4QJFB 4OX9B 1T5EA 1KKDA 2WLLA 3K0DA 4TWKA 5H9CA 3OFNG 1EN4A 4B3RO 4BIUA 3JARA 1SESA 1WPXA 1TUBA 2AHZA 2P67A 2E5LB 1IBMB 4FIPC 1L0NH 3AG4B 2F4VB 2DWDC 4U7OA 4LWSB 3BRCA 4K0KB 2VRZA 1SA0B 4E2LA 1YEWA 4MVZA 2M7WA 1W0KG 1Q6UA 1BS3A 3AG1C 2WLKA 1W0JG 2X6BA 4TSFG 2B9ZA 1MMMA 2ZD9A 3LDEA 2YXLA 2IM9A 1ZL8A 3K08A 3JSNA 3CX5F 3W7TA 4YJ2B 4ZIBA 2C2AA 1Q5OA 3JATA 1COWG 2PF4E 4BIZA 3FB5C 2LO1A 3QG5A 1XL4A 1XMQB 1WN7A 3HR0A 2EILC 2W6IG 3SYQA 4A5UB 4KXRA 2P90A 3FKSG 1QCEA 3UM7A 2EZOA 3E89A 5L3GA 1IBLO 3C3SA 1WB8A 3TXQA 3EXAA 5KAFZ 4UB6Z 2YICA 2FTKA 1SA0A 3ZN1A 3WG7C 1SS3A 2DJVA 5FLXN 1L1FA 4JV5O 4U3JB 4B3MO 3CMEV 1MSWD 2DYRB 4TQFA 1H8HG 5JJEB 3LSSA 4YJ2A 1TGOA 3E83A 3GWKC 5KA6A 5CBFA 1EBOA 1HP8A 1JR9A 1BGYH 2QM8A 2DQ0A 2RMKB 1LR1A 2OIEA 4UVBA 4ZKIA 3O9OA 4J42A 4LF9O 1WJZA 2QWNB 4X1KA 1OCRB 1KMIZ 1XREA 4I55A 4K3AA 2M6YA 4GX1A 4H37A 2NLJC 3ETQA 3PN1A 1VARA 1V54C 2QKAA 1UJWB 3OMIB 3CRAA 3ZEDA 3CE2A 4J41A 1RPRA 1Y67A 4UCTA 4DR7B 5B1AC 4DYLA 4IHJA 2V1DA 4U3JA 5LGUA 3CWBH 4KUMA 1JFFB 5CBGA 3T1YO 1NT2B 1OHHG 2WA3A 1GO3F 4KFMA 4QPKA 3G80A 1AI4A 2YEVB 2ZR3A 3I56V 1FJGB 1G8MA 4J9ZB 2Y4UA 4YHHB 1QR9A 4J7ZA 4JZ2A 5D5QA 4DR6O 2CH7A 2A9HA 3OR7C 3SGIA 1PL4A 3ABKB 3E8BA 3JD2A 5LMNO 4KL1A 5B1OA 4J80A 1EFRG 5J2UB 4FZ0A 4X1IB 4UB8Z 3CCVV 2YIDA 1J5EO 3W7SA 4YY3O 1FXVA 4H33A 1R3LC 3AG2B 1PPJH 5B1NA 1BL8A 1GN3A 2EJ7A 2ZNJA 4B7EA 3W7WA 4JI8O 3QNEA 3BY6A 4B3TO 1WNSA 1BHBA 1YXBA 4NXNB 1XHXA 4HNAA 1JOYA 4I0XB 1K4CC 2A3QA 2BTQB 3P3PA 5EYPB 2PZSA 4LF5B 3SPCA 4LF6O 4I4TA 3ZS8C 2YXYA 5J2UA 3NXSA 5K1XA 4B3SB 3CEIA 5F2VO 1BE3H 1S5LZ 1FPOA 2E5LO 4PD4F 2F4VO 1EZVH 1Z5VA 3ML0A 4K0KO 1SKVA 2R9IA 3ABMC 1P84F 3G6EV 2Q0OC 2IJJA 1NTMH 3RYCB 2XASA 2Q69A 1DTOA 1Y76B 1AR5A 4DR5B 3DGEA 2VWJA 1N0JA 4IYIA 2AGAA 4I7ZB 5KHIA 5GTIZ 1SQBH 1U96A 1N33O 1GAXA 2RN9A 4MT8A 4QGPA 2X6CA 2LGQA 2ZIOA 4HZ3A 2N74A 1XMQO 5KX5A 4NYKA 4I9QA 1KC8W 3BA8A 3FB6C 2GBOA 1IZ3A 3QO7A 1KYOF 4DK1A 1VQ4V 5KUMA 5EBMC 1I7FA 1QBZA 5IYZB 3T4ZA 3U10A 2UXXA 4X64B 4QIWF 2ZT9B 4DR3B 3OTOB 4QNHB 1F4NA 1JQ0A 3HKDB 3H1HH 1SC5B 2KG7B 3K9SA 3RYCA 3ASOB 3W7XA 3CD6V 3KCYA 2N04A 2A0LA 1AP5A 2JGUA 2OCCC 2YSUB 1HNXB 1I0HA 1YSCA 3BCCH 4UCRA 2XAJA 3JAWB 4I9WA 1M56B 2EIKB 5IDJA 2XAHA 4TOIA 1OCOB 3UCSC 2A79B 1Q86W 2PYJA 5H6QA 1IXMA 5CB4B 4W4KA 1Q7YW 5IYZA 1XI1A 4I50A 5JCOC 3E22B 3B2EE 2F43G 5L3EA 3AK2A 3ABLB 4LF4B 5LXTA 2KB1A 1FFXA 5D5PA 2QGNA 4DR7O 4O4IB 4I5SA 3U0ZA 3OUSA 1HR0O 1SQPH 2YI9A 5ITZB 3T4DA 4DV7O 4FLWA 2P06A 1URFA 1O9HA 2GHYA 1XHZA 2PYLA 5J9PC 2ZQMA 1QLEC 4YXWG 4BR6A 3L74H 1ZX3A 4DR4B 4KP4A 3OW2U 2UU9B 1NH2B 2QM4A 5IJ0A 2PI4A 1WLEA 3JAWA 1FAFA 4CH3A 3E35A 1VF5B 1WB7A 2Q5ZA 2VQEB 1YF2A 5CA3A 3K06A 3OTFA 2ZXWB 2YIAA 4P9PA 1FYJA 4Z1VA 4CS2A 3ZHUA 2BOBC 4ABMA 4GKKO 1IBLB 3TJTA 3FAVB 2RNBA 5CBHA 4O4IA 2IH1C 1GN4A 1JCHA 2JRIA 3K5OA 1NS1A 4JV5B 1UPGA 4DV3B 3GB7C 3ICXA 4QE9A 3UO2A 4DR2O 4L8JA 1IX9A 4PJ0Z 1A32A 1Y66A 1BSMA 1P49A 4NXNO 5CA1A 2JK5C 5LP6C 2DYSB 1Q82W 1YZBA 1D5AA 1D2DA 1Q3EA 1S3JA 3CRMA 1R6KA 3ASNC 4JGSA 5EZYB 4LF5O 1JVMA 1AJNA 4X89A 4LF9B 5JCOA 2DMXA 2JS3A 4B3SO 5H6RA 3RYHB 3CP1A 1X4TA 1B6QA 1S5HC 2ZM6O 1Y6XA 1K34A 2DE0X 2ITDC 1SQGA 1YDXA 4TV9B 5BY1A 2PGGA 3R65A 5HFMA 5B3SB 4J10A 1I08A 1P7GA 5FNVA 5J2TB 2AZ2A 2Y69C 3RW0A 5JVDA 3JALA 4CH4A 2CDYA 4JI0B 3DC6A 3ZRVA 4DR6B 2WLLB 2XTAA 2EULA 1QNMA 4GT1A 4LH7A 5LMNB 4K35A 3JARB 4NTYA 4JI4O 3JSLA 5GONB 2ZKOA 4JAAA 3JD1A 3CCQV 1TUBB 1QU7A 1IDSA 4X64O 3BABA 1J5EB 3O65A 2NR5A 4X8AA 1V55C 1TVKB 2QTOA 4NVPA 3K5LA 4CC5A 3A8TA 4Q20A 2CUGA 4JI8B 3BEHA 2GUZA 3OEEG 5KMGA 4LNUA 4WFGA 1CP9A 2ADQB 1IXBA 5J2TA 1M4UA 4B3TB 1ZL8B 4O4HA 3QVNA 2X0LA 1MABG 1VQ8V 3AK3A 3JATB 5IT9N 1AROP 1RP3B 3WB2A 4FM0A 1M57B 1K97A 4BWAA 4LH6A 2ZR2A 2HVJC 4MW3A 4DR1B 2YC0A 2E76B 1IBKB 1GK9A 1TUEB 4LF6B 4GX0A 1RPOA 4JF3A 1THZA 2Q4PA 2EBOA 2CGNA 2R72A 5GONA 4X65B 1I5XA 5B1BC 4K8XA 1PNKA 4LFCO 3MDSA 3ZMSA 2HEPA 3CCUV 3TXSA 2IJHA 3CC4V 3H1JH 1H2MA 4PDRA 2DW4A 2QEXV 4LF4O 1TVKA 3JD4A 3KG2A 3MD0A 2CTPA 2ETNA 2WLJA 2ILMA 1N8RW 2OTJV 1VQNV 3F5TA 1R73A 4DK0A 4D7TA 1R3JC 4X1YB 1O9GA 4WFBV 1AI6A 4R50A 3ZHRA 1OCZB 4DUYO 3CRRA 3AG3C 2KKWA 3OMAB 4DR4O 2UU9O 4RO2A 1N33B 3FX7A 3CRCA 3N2GA 2CTRA 5KHKA 4GX2A 4CC6A 3CCJV 3E8FA 2EX3A 4OXSA 4EKWA 1H2NA 1YTFD 2VQEO 1XNRO 5BR8B 3RYFA 2EZPA 3OUFA 3WU2Z 2IW5A 2WSSG 4X1KB 4IT5A 1OJHA 1H2LA 4I55B 3SJAC 1HDJA 4DUZB 4IL6Z 1N0NA 4O2AB 5A9GA 1Q81W 4MVUA 4RWUA 3VOUA 2EIJC 2F1MA 1NJIW 3HKBA 1FKAO 4FK5C 1H38A 4TUYA 1J95A 3H1IH 1YJNV 4DV1B 1SZTA 1GN6A 4PI0A 3ETEA 2O57A 4IHJB 4X1YA 4DV3O 4HYOA 4YJ3A 1N36O 3CRQA 1PD3A 4EFBA 1Y74A 3T1HB 4TV8A 3HPLC 1K4DC 2ZCEA 3QTCA 2N05A 1FXKC 3HB3B 2OCHA 3SJCC 1IURA 1HW7A 4E4EA 2EIMC 2Y0PA 2EILB 4JI5B 3SPIA 2CH7B 4LFBO 3SYPA 4X62O 1XL6A 1M93A 1SRYA 3KCXA 4NB5A 3ZMVA 5BMVA 4O2AA 2QM7A 1R6NA 1AILA 2MK3A 3KKYA 1ZAUA 4X88A 4GZRB 4FVMA 1KD1W 3T2MA 4CS4A 1LUVA 2BOCC 1HR0B 1TA8A 4WFHA 4DV7B 1US6A 5LYJA 4FLUA 1GMGA 1I5YA 3HKEA 3L73H 4MVSA 1RSOB 1N4CA 4B7KA 2QJ1A 5LHGA 1SQXH 1Q43A 1H2GA 3ZIAG 3SPJA 5DM6V 3P30A 1XBLA 2Q7GA 1M5IA 2IBZH 3VQYA 3CB2A 4HNAB 4JI0O 4LF8B 2HP8A 4H44B 3C90A 1EZJA 2Q0AA 4DV5O 2H94A 2HKOA 1KBHA 1XNQO 4I4TB 3APQA 2XT9A 3RVYA 1V54B 4GCZA 3TK1A 2Q6AA 2LW7A 1X59A 3G67A 4EB6B 3APOA 1E79G 4GKKB 2OTLV 5LMUB 1NR1A 5CN0A 1AP6A 1MA1A 5JWPA 4WBNA 1FXKA 3D36C 1NR7A 1RSOA 4ZHQA 4DR2B 4LFAB 3K3WA 4UCSA 3WB0A 3OGIB 2EJRA 4FJCC 3B4SA 4ASUG 3W7UA 1AJQA 4DR1O 1IBKO 1QVFU 3WFVA 1VQ7V 5KX5B 3RT3C 2F66C 3JYCA 2LJ2A 3UQ8A 5LGNA 4LR3A 4X65O 2E75B 3ZBHA 3QO5A 4X20B 2DN9A 4WCEV 1ROPA 4EB6A 1I94B 4P2ZA 2RQ6A 1PL0A 1SQQH 5IJ9A 1ZUQA 1GM9A 2ZM6B 3ZCCA 2WWWA 1QVGU 5IYCO 3A0RA 2YDEA 5E1AC 1MZFA 3ZRWA 4KHPB 3K9AA 4CZZA 2ADPA 3CJHB 3DXRA 1S5JA 3CPWU 4GLXA 1HNZB 2VWKA 4U3FH 3ETGA 1XUQA 1NKDA 1H8EG 4EFEA 3X2QC 3E8HA 2FL4A 1RFYA 3H1LH 2RDCA 1VQOV 3IC9A 1QHTA 1VQLV 1K33A 4PA6A 1AI7A 5BR8O 2ZDIC 3VQXA 3LNNA 5IWAB 1SQFA 1FS0G 4JYYA 4JI4B 4X20A 3Q4HA 4DUZO 2NNUA 1XEQA 2QA4V 3B8MA 1AR4A 4DV4O 4I50B 3ABMB 4RQEA 4P9OA 4R7CA 1YIJV 2IU3A 3JAKB 2HJFC 5LXTB 4JYAB 1FFXB 4DV1O 3L72H 1VF6C 5LA6A 3CJHA 2GDSA 1M56C 2Z3YA 2AZ0A 2LQTA 1OCOC 3T1HO 5KUKA 1B06A 1BQ0A 4D7SA 4NTWA 1Q8IA 2CK3G 1JA8A 4ZI7A 1S72V 3M7MX 3RBZA 1MG1A 4PA7A 5IJ0B 4PA4A 3GVMA 4JI5O 4DRXA 5LGTA 3WB1A 1G6UA 2UXNA 3B77A 2V4DA 3RYIA 3UO3A
chains in the Genus database with same CATH topology
4PELA 3R65A 5HFMA 2ATKC 5B3SB 1E1QG 1XL4A 1F51A 1YJ9V 4UV8A 3PJSK 2EILC 2W6IG 5LHIA 3SYQA 3FYIB 2P90A 5KA5A 3FKSG 3CCEV 1QCEA 4WF9V 2Y69C 3RW0A 3UM7A 1R3IC 3CCMV 2EZOA 5GW7A 1P4RA 3SYOA 1HWYA 3E89A 4R8CA 3RVZA 2B1IA 5L3GA 2YEVA 3ZRVA 1PNLA 2WLLB 4DXWA 3ABTA 3ETDA 1KECA 2FTKA 3ZN1A 4GT1A 2OCCB 3WG7C 4PDMA 2ZXWC 2W0FC 3SPGA 4MTOA 1NBMG 4PA9A 4XDLA 1L1FA 3ZMZA 3T1CA 4MSWC 5FL7G 5DN6G 3E2EA 3CMEV 3K04A 3K0GA 1MSWD 3JD1A 2DYRB 3CCQV 1H8HG 3ZRSA 2ZDIA 3LSSA 3STLC 4X8AA 2WPDG 1V55C 3E83A 5KA6A 5CBFA 1EBOA 2QTOA 2W6JG 5EK0A 2EINC 4PDVA 3OMNB 5C93A 1S77D 4Z1MG 2QM8A 2DQ0A 3VBBA 3CMAV 4Q20A 4UVBA 3BEHA 3OEEG 4PDLA 4JAUA 1AR1B 3AEIA 2Q67A 4WFGA 4ZKIA 1CP9A 1SERA 1OCRB 2X0LA 1OCCB 1MABG 2DWEC 2Y48A 4GX1A 3CXCU 1YJWV 3OE7G 1VQ8V 4H37A 2NLJC 1K8AW 3CCRV 4JPRA 5LBQA 1AROP 1V54C 1M57B 1K97A 1UJWB 4MVMA 3OMIB 2ZR2A 2HVJC 3ASOC 4MW3A 1QLEB 1RPRA 1GK9A 1R3KC 1TUEB 4LBEC 5B1AC 4GX0A 1QLNA 1RPOA 2V1DA 4JF3A 4U7NA 1THZA 3FB8C 2EBOA 5LGUA 4KUMA 3IFXA 1YHQV 4CBCA 3IGAC 5CBGA 1FXHA 1I5XA 3F5WC 5B1BC 1PNKA 1OHHG 1GO3F 4KFMA 3D36A 1ORQC 4QPKA 3ZMSA 3CCUV 2IJHA 3CC4V 5HFLA 1AI4A 2JIZG 2DW4A 4PDRA 2QEXV 3JD4A 3KG2A 2YEVB 2WAMA 2EIKC 2ZR3A 3MD0A 3I56V 1M1KW 3X2QB 1G8MA 1K7DA 4J9ZB 2WLJA 4TT3G 1QR9A 1YI2V 1N8RW 2OTJV 1VQNV 1R73A 5L3BA 3E86A 1R3JC 4WFBV 1AI6A 2A9HA 3OR7C 4R50A 4WFEA 3F7VC 2JEUA 1OCZB 5BZBA 3ABKB 3ABLC 3E8BA 3JD2A 3AG3C 2H8PC 2HVKC 3OMAB 5B1OA 1EFRG 4BW5A 1RM1C 4UV9A 4RO2A 2Z5UA 5L3CA 1CEZA 3CCVV 4MVRA 1S0VA 3W7SA 5IYBO 1FXVA 4GX2A 3CCJV 1VQPV 3E8FA 4H33A 5EBLC 1JJ2U 4OXSA 2IJKA 2OT5A 1GM7A 4QE7A 4EKWA 1DF5A 1YTFD 1R3LC 2JJ1G 3AG2B 5LHHA 2EZPA 3OUFA 5B1NA 1BL8A 2B1GA 1P7BA 2XNDG 2WLNA 4G28B 2IW5A 1KP3A 3W7WA 2WSSG 2XAQA 2LP7A 3ZJZA 4F4LA 5L3FA 3QNEA 4HAMA 1Q81W 3IC7A 3BY6A 1GM8A 3ASNB 3TCUA 4MVUA 3VOUA 2EIJC 1NJIW 1BHBA 5CMUA 5IY5B 4FK5C 1H38A 1J95A 2JDIG 3D3IA 1JOYA 2IJIA 4MVQA 1SZTA 3JD3A 1YJNV 4UVCA 1K4CC 3ETEA 3UKMA 2JEXA 3LNMB 2WLIA 2R9RB 4HYOA 2Q68A 1VQ9V 1E1RG 3LDCA 1PD3A 3SPCA 3STZC 1OCCC 3G4SV 3JD0A 2GSMB 3HPLC 1K4DC 2X6AA 4GX5A 2ITCC 3NXSA 1JPXA 3HB3B 1FXKC 2PI5A 4N21A 2HLDG 5EBWC 1VQKV 4RAIA 1YITV 1AI5A 2EIMC 3TETA 5L3DA 1BMFG 4G27B 4UUJC 2EILB 1KQSU 1OZ0A 2AHYA 3SPIA 4DO2A 3LUTB 3E8GA 3ML0A 3SYPA 4WFAV 3CC7V 1XL6A 2R9IA 3ABMC 3EHBB 3G6EV 1SRYA 3CYOA 4LP8A 3ZMVA 3CC2V 2DYSC 2IJJA 2QM7A 1R6NA 2MK3A 2XASA 3AG4C 3ZMUA 2Q69A 1DTOA 3GWOA 3I55V 1BHAA 3CCLV 3DGEA 3ZN0A 4JYBA 4X88A 1G4YB 3DTUB 4JYCA 1NVPD 1KD1W 3T2MA 3FB7C 3OM3B 2QE7G 2BOCC 1YTFB 4WFHA 3QO8A 4MT8A 3ABUA 2X6CA 4ZBMA 1GMGA 4HZ3A 1I5YA 4JTAB 4MVSA 4RUFA 1ENVA 3SYAA 2WLHA 1KC8W 3FB6C 5LHGA 3M99B 2EINB 1FFTB 2P6JA 3QO7A 1H2GA 3ZIAG 3SPJA 4UVAA 1VQ4V 5DM6V 5KUMA 4P30A 3P30A 4WFFA 5EBMC 3SPHA 4JAVA 1QR8A 4JASA 1QBZA 1GTOA 3T4ZA 2JJ2G 5B3SC 1EZJA 2UXXA 1ZWIC 4QIWF 1NH2D 3OEHG 3CCSV 2WLIB 3ZRXA 2HR3A 3ZMTA 2H94A 4L87A 1DLBA 4QNHB 1K5QA 2HKOA 2IH3C 4MS2A 4XDJA 1F4NA 1JQ0A 2LFSA 3RVYA 1V54B 4GCZA 4QPJA 3TK1A 2Q6AA 1NQTA 1K5SA 3ASOB 3W7XA 3CD6V 1E79G 4JTCB 5IY5C 3H01A 2A0LA 1K3EA 2QKSA 5EC2C 4UXNA 2OTLV 2OCCC 1NR1A 2YSUB 5CN0A 2HG5C 1S76D 5IYDO 1YSCA 5B1BB 1MOFA 4RUEA 2XAJA 3G71V 1F23A 2WLMA 2DYRC 1K9MW 2LFRA 1FXKA 2X7RB 2DQ3A 4I9WA 1SETA 1K73W 1NR7A 2D3OW 1M56B 2EIKB 5IDJA 4RQFA 2XAHA 3K3WA 1OCOB 4FMTA 2A79B 1Q86W 1PKXA 5H6QA 1IXMA 4MW8A 3B8NA 1Q7YW 2EJRA 4FJCC 3AG1B 1AJPA 4ASUG 3W7UA 1NVPB 1AJQA 2F43G 4XDKA 5L3EA 3ABLB 3AG3B 1GKFA 1QVFU 2KB1A 3WFVA 1VQ7V 3FYEB 1OCRC 4MTFA 4I5SA 3OUSA 3EFFK 3JYCA 4J9YB 1RM1B 2XAFA 5LGNA 3T4DA 5EC1C 3QO5A 4WCEV 1F4MA 2GHYA 1M57C 1ROPA 4MTGA 2HFEC 1KP2A 4P2ZA 5J9PC 2ZQMA 1QLEC 4YXWG 1PL0A 4G2KA 1VQMV 4LCUC 3K79A 1GM9A 4KP4A 3OW2U 3MHSC 3ZCCA 2WWWA 1QVGU 5IYCO 3A0RA 1NH2B 1LNQA 2Y69B 5E1AC 2PI4A 3ZRWA 2B5UA 1WLEA 3K9AA 3OR6C 4CZZA 3E35A 2IU0A 1M90W 2EIJB 1K92A 3CPWU 1VQ5V 5CA3A 3K06A 1VQ6V 3ETGA 1CPYA 1NKDA 1H8EG 3F7YC 3WG7B 4N23A 3X2QC 3E8HA 2ZXWB 4PA3A 4P9PA 1VQOV 4JTDB 2XAGA 3OAAG 3SJQC 3SYCA 3JCZA 3LSQA 4FPPA 3OGCC 2BOBC 1Y4MA 1VQLV 1JX9A 2XOKG 1K33A 3MHHC 1OCZC 4PA6A 1AI7A 3ABKC 1M9NA 3P32A 5CBHA 2IH1C 3K03A 1FXKB 1PNMA 1V55B 2ZDIC 4MVOA 4QJFB 1JCHA 1FS0G 1KKDA 2WLLA 3K0DA 4TWKA 2EIMB 3GB7C 5H9CA 2NNUA 3OFNG 4QE9A 2QA4V 3B8MA 4XBFA 4BIUA 2P7TC 1SESA 3ABMB 1Y66A 4P9OA 4R7CA 4RQEA 2IU3A 1YIJV 4LC1A 1WPXA 3AG2C 2HJFC 2JK5C 2AHZA 2DYSB 2P67A 1Q82W 4MTXA 4FIPC 1S3JA 3AG4B 2V7QG 2DWDC 4U7OA 1R6KA 1M56C 3ASNC 4JGSA 2Z3YA 1OCOC 1JVMA 1AJNA 4X89A 1DF4A 4E2LA 5KUKA 4MVZA 2M7WA 5B1AB 1W0KG 3AG1C 2WLKA 1W0JG 2X6BA 2CK3G 4TSFG 3LDDA 2ZD9A 1S72V 3LDEA 4R6ZA 5H6RA 3RBZA 1MG1A 4PA7A 3CP1A 3K08A 1B6QA 3ZRWB 4PA4A 4BAYA 3W7TA 1S5HC 2C2AA 1K34A 5LGTA 2K1EA 1W2BU 2ITDC 2UXNA 3B77A 1COWG 4BIZA 3FB5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K W;  4WCE V;  1VQ6 V;  3CCL V;  3CD6 V;  1Q86 W;  1VQK V;  1YIT V;  3CMA V;  2QA4 V;  1YI2 V;  3CCJ V;  1N8R W;  2OTJ V;  1VQP V;  1YJN V;  1VQN V;  1Q7Y W;  1JJ2 U;  1KQS U;  2OTL V;  1KD1 W;  1VQO V;  1R73 A;  1VQM V;  1YJ9 V;  1YIJ V;  4WFB V;  3OW2 U;  3CCS V;  1S72 V;  1QVG U;  4WFA V;  3CC7 V;  3CME V;  1VQ9 V;  1YHQ V;  3CCE V;  3G6E V;  1VQL V;  1QVF U;  1VQ7 V;  4WF9 V;  3CCQ V;  3CXC U;  3G71 V;  1YJW V;  1Q82 W;  3G4S V;  3CCM V;  1VQ8 V;  3CC2 V;  3I55 V;  1K9M W;  1K8A W;  3CCU V;  1Q81 W;  1M90 W;  3CC4 V;  3CCR V;  1K73 W;  1W2B U;  2D3O W;  1KC8 W;  3CPW U;  2QEX V;  1VQ5 V;  1VQ4 V;  1NJI W;  3CCV V;  5DM6 V;  3I56 V; 
#chains in the Genus database with same CATH topology
 3AG7 A;  2ATK C;  2QDO A;  1F51 A;  1YJ9 V;  4UV8 A;  2UUA O;  4LFC B;  3RFR A;  2W0X A;  3JCU Z;  5KAI Z;  5KA5 A;  4CH6 A;  3JAK A;  4WF9 V;  1R3I C;  4O4J A;  3CCM V;  5LL6 Y;  3RVZ A;  4ZOL A;  4DXW A;  4TQD A;  3ETD A;  1KEC A;  2Q7E A;  1BCC H;  2G38 A;  2OCC B;  4DUY B;  4PDM A;  2ZXW C;  2W0F C;  3SPG A;  4PA9 A;  3ZMZ A;  3T1C A;  4MSW C;  4DW1 A;  5DN6 G;  5CA1 B;  3K0G A;  2CTW A;  4DV2 B;  4LF8 O;  4OPH A;  2ZDI A;  2OWO A;  4FFB B;  4PHZ A;  2LGW A;  1VEW A;  1XDC A;  4UCV A;  2WPD G;  1XNR B;  5EK0 A;  1Q6H A;  2EIN C;  4PDV A;  3OMN B;  5C93 A;  4Z1M G;  2GTS A;  1SF9 A;  5JJJ B;  3R66 A;  4IGG A;  4UCU A;  3AEI A;  4IIJ A;  2BE3 A;  1OCC B;  2DWE C;  3CXC U;  1YJW V;  3OE7 G;  5LMU O;  2QR4 A;  1K8A W;  5KHG A;  5LBQ A;  1KUQ A;  4H13 B;  1QLE B;  1N36 B;  1PP9 H;  4LBE C;  4LFA O;  4U7N A;  3FB8 C;  5FNV B;  1KU9 A;  1NZ6 A;  4CBC A;  2QWO B;  3F5W C;  3L71 H;  5JVD B;  3JAL B;  2GTA A;  1ORQ C;  4FFB A;  3CS5 A;  2FKX A;  3N2K A;  3OT7 A;  4LFB B;  4JI1 B;  4X62 B;  1YI2 V;  1R6T A;  5H5N A;  3RN4 A;  2L6L A;  5L3B A;  1HNW O;  3RWR D;  1I94 O;  4WFE A;  3F7V C;  2JEU A;  1NTZ H;  1EN5 A;  3L70 H;  2H8P C;  3M8A A;  2HVK C;  1XQ8 A;  5AG2 A;  4BW5 A;  1RM1 C;  5L3C A;  1CEZ A;  4KHP O;  5IYB O;  5JJN B;  2QKC A;  1VQP V;  3D3Q A;  1JJ2 U;  4QE7 A;  2OT5 A;  5KMG B;  2GUZ B;  1HNZ O;  4LNU B;  2B1G A;  1P7B A;  2XND G;  5LP6 B;  4G28 B;  4O4H B;  1WPB A;  2K9P A;  5BXZ A;  4HAM A;  3IC7 A;  1GM8 A;  3ASN B;  2ZE8 A;  2YUA A;  5CMU A;  5IY5 B;  4DV5 B;  3B40 A;  2JDI G;  3D3I A;  2P5O A;  2ZE5 A;  4MVQ A;  3JD3 A;  5IWA O;  1XNQ B;  4FLY A;  2JEX A;  3LNM B;  2WLI A;  1BT8 A;  3HKC A;  1V9P A;  2R9R B;  2Q68 A;  3K58 A;  1E1R G;  3LDC A;  5DED A;  3G4S V;  4GKJ B;  2KQX A;  3KZI Z;  4FLZ A;  2X6A A;  4AHC A;  1G1X B;  2ITC C;  4F6R A;  4JYA O;  2ZNI A;  4N21 A;  3TGU H;  2HLD G;  1LUW A;  1VQK V;  4RAI A;  2NN4 A;  1AI5 A;  1YIT V;  3TET A;  1BMF G;  2YIB D;  4UUJ C;  1KQS U;  1OZ0 A;  3SDL A;  2YIB A;  3LUT B;  4WFA V;  1KKC A;  2CTQ A;  5LP6 A;  2F95 B;  3CC2 V;  5CA0 A;  2RCV A;  1VF7 A;  3AG4 C;  3ZMU A;  1W59 A;  3DC5 A;  1BHA A;  1SQV H;  3CCL V;  4JYB A;  5JH7 A;  3N2G B;  2HJD A;  1Q6I A;  1G4Y B;  4JYC A;  1NVP D;  3FB7 C;  3OD4 A;  2QE7 G;  3OM3 B;  5JQG A;  3RYF B;  1YTF B;  4JI6 O;  5B66 Z;  4ZBM A;  2WA4 A;  1VMG A;  3MAQ A;  1ENV A;  3M99 B;  2P6J A;  4UVA A;  3HKB B;  3SPH A;  2CGO A;  4JAV A;  1QR8 A;  4TUY B;  4AI8 A;  4JAS A;  1GTO A;  2JGD B;  2Q9L A;  4ICG A;  1Q90 D;  2JJ2 G;  2BTO A;  1ZWI C;  2ZE6 A;  3C3T A;  2UXD B;  4JI2 O;  3CCS V;  4YJ3 B;  2HR3 A;  3ZMT A;  1WP8 A;  2IH3 C;  1WAZ A;  1Y74 B;  5KHJ A;  1MZE A;  4TV8 B;  2LFS A;  1XOU A;  4QPJ A;  2KSD A;  3UT5 B;  3J81 N;  4DV2 O;  3THO A;  4YIP A;  4JTC B;  3H1K H;  3H01 A;  3DSQ A;  1K3E A;  5EC2 C;  4UXN A;  2ARH A;  5LOV A;  3IJ4 A;  5IYD O;  4AQY O;  5B1B B;  4JI7 O;  3JAS A;  3G71 V;  1CXZ B;  2WLM A;  1Z2G A;  2DYR C;  2Q73 A;  1K9M W;  2Q8V A;  5BMV B;  2DQ3 A;  1K73 W;  2D3O W;  1PM9 A;  2VQF B;  4DV4 B;  5KLV H;  4O4L B;  1PKX A;  4MW8 A;  2ZIN A;  3B8N A;  3J80 N;  2JGD A;  3AG1 B;  1XMO B;  3D8C A;  2A7W A;  3AG3 B;  3FYE B;  5LYJ B;  1OCR C;  3HKE B;  3BAA A;  3EFF K;  4J9Y B;  2XAF A;  4DV0 B;  3UT5 A;  5EC1 C;  4LWS A;  3G6B A;  1QQC A;  2HFE C;  3SR2 C;  3IAY A;  4X9Q A;  3VQV A;  4LCU C;  3K79 A;  4NR1 A;  4DW0 A;  4JI1 O;  2P4V A;  2B5U A;  2A06 H;  3OR6 C;  2IU0 A;  2AXT Z;  1M90 W;  2EIJ B;  3ZHT A;  3ZHQ A;  1VQ5 V;  2UUA B;  2E74 B;  4X66 O;  4DV6 O;  1VQ6 V;  4JZG A;  4H0L B;  3WG7 B;  4N23 A;  4O4L A;  3FD9 A;  2XAG A;  3SJQ C;  1GRJ A;  3SYC A;  3JCZ A;  4FM1 A;  2XOK G;  4WBN B;  3ABK C;  1M9N A;  1FXK B;  4MVO A;  2FML A;  4ZHQ B;  1F7Y A;  2R70 A;  2EIM B;  2ODM A;  3I5D A;  4XBF A;  2FB5 A;  2P7T C;  5TIS Z;  4C7U A;  4LC1 A;  4W4L A;  2QTS A;  3AG2 C;  4O2B B;  1GH6 A;  3S3X A;  4MTX A;  1Z5W A;  2V7Q G;  2UXB B;  1WP7 A;  1DK1 A;  4FLV A;  4GKJ O;  2XUM A;  1DF4 A;  1B3Q A;  5B1A B;  3B09 A;  5IJ9 B;  3K59 A;  3LDD A;  5A2Q N;  4R6Z A;  5EIB C;  3ZRW B;  4BAY A;  4J7J A;  3SJB C;  1MSD A;  1VP7 A;  3DXR B;  4NXM O;  2K1E A;  1W2B U;  2OIG A;  4JI3 B;  3JAM N;  3ZHV A;  1N32 O;  4PEL A;  1E1Q G;  1OV9 A;  2H3O A;  2XHB A;  3PJS K;  1N34 B;  5LHI A;  4FLX A;  3FYI B;  3J7A U;  1JFF A;  5FPO A;  2GV9 A;  3CCE V;  4O2B A;  3BPZ A;  5GW7 A;  3SYO A;  1P4R A;  1HWY A;  4R8C A;  2B1I A;  2YEV A;  1PNL A;  5DEC A;  2UXC B;  1HNW B;  3ABT A;  3K5M A;  3Q4H B;  2CE4 A;  4LF7 O;  1R1B A;  1FD9 A;  4OX9 O;  4J11 A;  4MTO A;  1NBM G;  4XDL A;  2DOS A;  5FL7 G;  5H2F Z;  1ZTE A;  3E2E A;  3K04 A;  2JS5 A;  3ZRS A;  5LA6 B;  3STL C;  2UXD O;  5B5E Z;  5IE9 A;  1WA8 B;  4X1I A;  2W6J G;  1IBM O;  4FZ1 A;  1S77 D;  3VBB A;  3CMA V;  3A0H Z;  2UUB B;  4PDL A;  4JAU A;  1AR1 B;  1BZK A;  2Q67 A;  4ZI7 B;  1PV0 A;  1SER A;  4BIO A;  2Y48 A;  2QSA A;  4HBN A;  2Y4T A;  3K57 A;  4DRX B;  3CCR V;  4JPR A;  1UFI A;  1DGS A;  2YS8 A;  3RYI B;  3QF7 A;  4MVM A;  3ASO C;  3EVK A;  4I0X A;  1R3K C;  5EIB D;  2VQF O;  1QLN A;  2BTQ A;  5EYP A;  2E3C A;  3BA9 A;  3IFX A;  1YHQ V;  3IGA C;  1TAE A;  1FXH A;  2UUC B;  1H2S B;  4O4J B;  3CSX A;  4GUN A;  3D36 A;  4GYC B;  4Q6G A;  1XMO O;  4ZOL B;  5HFL A;  1WA8 A;  2JIZ G;  1AB3 A;  2EIK C;  2WAM A;  4AIL C;  2JVD A;  1M1K W;  3X2Q B;  2QWP B;  4BW9 A;  1K7D A;  1XIL A;  4TT3 G;  4DV0 O;  3E86 A;  4NTX A;  1YCI A;  3ZHS A;  5BZB A;  3ABL C;  4CS3 A;  4UV9 A;  2Z5U A;  1Y76 A;  4MVR A;  2R9A A;  1S0V A;  4JI6 B;  2HHH B;  3N27 A;  2L35 A;  1ZSP A;  2Y0I A;  5EBL C;  4NKG B;  2IJK A;  1GM7 A;  1DF5 A;  2JJ1 G;  2Z0A A;  5LHH A;  4IIJ B;  2WLN A;  3U11 A;  1KP3 A;  2XAQ A;  2LP7 A;  3AK1 A;  3ZJZ A;  3H9V A;  4F4L A;  5L3F A;  4B3R B;  3TCU A;  1MNG A;  4JI2 B;  4YIO A;  4FFK A;  2IJI A;  3BFR A;  3S3W A;  4UVC A;  3UKM A;  1IVS A;  1VQ9 V;  4OGQ B;  3STZ C;  1OCC C;  1D5N A;  3JD0 A;  2GSM B;  3HKD A;  3BVO A;  1KB9 F;  2KG7 A;  4GX5 A;  2LW1 A;  1JPX A;  2PI5 A;  3N2K B;  3BHP A;  3L9D A;  5EBW C;  4AQY B;  5L3D A;  2ZIM A;  4G27 B;  4JI7 B;  1B04 A;  2AW9 A;  1U97 A;  2AHY A;  2UXB O;  4F6E A;  4DO2 A;  3E8G A;  1FJG O;  3CC7 V;  3EHB B;  4YHH O;  4LP8 A;  3CYO A;  1VF6 A;  2DYS C;  1NTK H;  2CAZ C;  5KHH A;  4PI2 A;  1H2K A;  3GWO A;  3I55 V;  2BCC H;  1NU1 H;  3ZN0 A;  3NR7 A;  5CB4 A;  5E79 Z;  3DTU B;  2Q7H A;  5C8Y B;  2PY5 A;  3E22 A;  4JI3 O;  2FYU H;  2P22 C;  3CHX A;  3QO8 A;  1VIB A;  2YXH A;  2F23 A;  3ABU A;  2QWR B;  4PV1 B;  2OYQ A;  4JTA B;  2QWQ B;  4RUF A;  3SYA A;  1N34 O;  2WLH A;  2EIN B;  1FFT B;  5ITZ A;  4B3M B;  4P30 A;  2D2C B;  4WFF A;  2BSK B;  5B3S C;  1NH2 D;  3OEH G;  2UXC O;  2WLI B;  3HKC B;  3ZRX A;  3RGB A;  4L87 A;  1DLB A;  2RJZ A;  1K5Q A;  4MS2 A;  4XDJ A;  4X66 B;  4DV6 B;  3A2F A;  4OPA A;  1NQT A;  1K5S A;  2VS0 A;  4F6R B;  5IY5 C;  1ZLZ A;  2QKS A;  5C8Y A;  2HG5 C;  1S76 D;  1EN6 A;  4J7K A;  1MOF A;  3FAV A;  4RUE A;  1F23 A;  4UCO A;  2UUB O;  5CA0 B;  5K1P A;  2LFR A;  2X7R B;  3ZX6 A;  1SET A;  4RQF A;  3VQW A;  4IYH A;  4FMT A;  2PUS A;  4B08 A;  2BSK A;  1GN2 A;  5JH7 B;  3T1Y B;  2P4K A;  1AJP A;  1JMK C;  5JQG B;  1NVP B;  4DR5 O;  3FFQ A;  4XDK A;  2F93 B;  1GKF A;  1EM1 A;  4CH5 A;  4MTF A;  3P3N A;  3K5N A;  1RM1 B;  4FLT A;  3L75 H;  4D6T H;  5EZY A;  1AVM A;  1BQZ A;  3CXH F;  1F4M A;  2UUC O;  1M57 C;  4MTG A;  1NI8 A;  1KP2 A;  2PTM A;  4FM2 A;  4G2K A;  4Z2W A;  1VQM V;  1YVW A;  3MHS C;  4NXM B;  3RYH A;  1L8D A;  1LNQ A;  2Y69 B;  1N32 B;  4YY3 B;  1K92 A;  5GTH Z;  2YI8 A;  3OTO O;  4DR3 O;  4TV9 A;  4EEQ A;  4UFZ A;  1CPY A;  3F7Y C;  4PA3 A;  4K8Z A;  2MW2 B;  5LOV B;  4JTD B;  1JJO A;  3OAA G;  3LSQ A;  2ZE7 A;  4FPP A;  3LSU A;  3OGC C;  2HHH O;  1Y4M A;  3JAS B;  1JX9 A;  5FPR A;  3MHH C;  1OCZ C;  1SZX A;  3P32 A;  3A0B Z;  4LF7 B;  3K03 A;  1PNM A;  1V55 B;  1L0L H;  1HNX O;  4QJF B;  4OX9 B;  1T5E A;  1KKD A;  2WLL A;  3K0D A;  4TWK A;  5H9C A;  3OFN G;  1EN4 A;  4B3R O;  4BIU A;  3JAR A;  1SES A;  1WPX A;  1TUB A;  2AHZ A;  2P67 A;  2E5L B;  1IBM B;  4FIP C;  1L0N H;  3AG4 B;  2F4V B;  2DWD C;  4U7O A;  4LWS B;  3BRC A;  4K0K B;  2VRZ A;  1SA0 B;  4E2L A;  1YEW A;  4MVZ A;  2M7W A;  1W0K G;  1Q6U A;  1BS3 A;  3AG1 C;  2WLK A;  1W0J G;  2X6B A;  4TSF G;  2B9Z A;  1MMM A;  2ZD9 A;  3LDE A;  2YXL A;  2IM9 A;  1ZL8 A;  3K08 A;  3JSN A;  3CX5 F;  3W7T A;  4YJ2 B;  4ZIB A;  2C2A A;  1Q5O A;  3JAT A;  1COW G;  2PF4 E;  4BIZ A;  3FB5 C;  2LO1 A;  3QG5 A;  1XL4 A;  1XMQ B;  1WN7 A;  3HR0 A;  2EIL C;  2W6I G;  3SYQ A;  4A5U B;  4KXR A;  2P90 A;  3FKS G;  1QCE A;  3UM7 A;  2EZO A;  3E89 A;  5L3G A;  1IBL O;  3C3S A;  1WB8 A;  3TXQ A;  3EXA A;  5KAF Z;  4UB6 Z;  2YIC A;  2FTK A;  1SA0 A;  3ZN1 A;  3WG7 C;  1SS3 A;  2DJV A;  5FLX N;  1L1F A;  4JV5 O;  4U3J B;  4B3M O;  3CME V;  1MSW D;  2DYR B;  4TQF A;  1H8H G;  5JJE B;  3LSS A;  4YJ2 A;  1TGO A;  3E83 A;  3GWK C;  5KA6 A;  5CBF A;  1EBO A;  1HP8 A;  1JR9 A;  1BGY H;  2QM8 A;  2DQ0 A;  2RMK B;  1LR1 A;  2OIE A;  4UVB A;  4ZKI A;  3O9O A;  4J42 A;  4LF9 O;  1WJZ A;  2QWN B;  4X1K A;  1OCR B;  1KMI Z;  1XRE A;  4I55 A;  4K3A A;  2M6Y A;  4GX1 A;  4H37 A;  2NLJ C;  3ETQ A;  3PN1 A;  1VAR A;  1V54 C;  2QKA A;  1UJW B;  3OMI B;  3CRA A;  3ZED A;  3CE2 A;  4J41 A;  1RPR A;  1Y67 A;  4UCT A;  4DR7 B;  5B1A C;  4DYL A;  4IHJ A;  2V1D A;  4U3J A;  5LGU A;  3CWB H;  4KUM A;  1JFF B;  5CBG A;  3T1Y O;  1NT2 B;  1OHH G;  2WA3 A;  1GO3 F;  4KFM A;  4QPK A;  3G80 A;  1AI4 A;  2YEV B;  2ZR3 A;  3I56 V;  1FJG B;  1G8M A;  4J9Z B;  2Y4U A;  4YHH B;  1QR9 A;  4J7Z A;  4JZ2 A;  5D5Q A;  4DR6 O;  2CH7 A;  2A9H A;  3OR7 C;  3SGI A;  1PL4 A;  3ABK B;  3E8B A;  3JD2 A;  5LMN O;  4KL1 A;  5B1O A;  4J80 A;  1EFR G;  5J2U B;  4FZ0 A;  4X1I B;  4UB8 Z;  3CCV V;  2YID A;  1J5E O;  3W7S A;  4YY3 O;  1FXV A;  4H33 A;  1R3L C;  3AG2 B;  1PPJ H;  5B1N A;  1BL8 A;  1GN3 A;  2EJ7 A;  2ZNJ A;  4B7E A;  3W7W A;  4JI8 O;  3QNE A;  3BY6 A;  4B3T O;  1WNS A;  1BHB A;  1YXB A;  4NXN B;  1XHX A;  4HNA A;  1JOY A;  4I0X B;  1K4C C;  2A3Q A;  2BTQ B;  3P3P A;  5EYP B;  2PZS A;  4LF5 B;  3SPC A;  4LF6 O;  4I4T A;  3ZS8 C;  2YXY A;  5J2U A;  3NXS A;  5K1X A;  4B3S B;  3CEI A;  5F2V O;  1BE3 H;  1S5L Z;  1FPO A;  2E5L O;  4PD4 F;  2F4V O;  1EZV H;  1Z5V A;  3ML0 A;  4K0K O;  1SKV A;  2R9I A;  3ABM C;  1P84 F;  3G6E V;  2Q0O C;  2IJJ A;  1NTM H;  3RYC B;  2XAS A;  2Q69 A;  1DTO A;  1Y76 B;  1AR5 A;  4DR5 B;  3DGE A;  2VWJ A;  1N0J A;  4IYI A;  2AGA A;  4I7Z B;  5KHI A;  5GTI Z;  1SQB H;  1U96 A;  1N33 O;  1GAX A;  2RN9 A;  4MT8 A;  4QGP A;  2X6C A;  2LGQ A;  2ZIO A;  4HZ3 A;  2N74 A;  1XMQ O;  5KX5 A;  4NYK A;  4I9Q A;  1KC8 W;  3BA8 A;  3FB6 C;  2GBO A;  1IZ3 A;  3QO7 A;  1KYO F;  4DK1 A;  1VQ4 V;  5KUM A;  5EBM C;  1I7F A;  1QBZ A;  5IYZ B;  3T4Z A;  3U10 A;  2UXX A;  4X64 B;  4QIW F;  2ZT9 B;  4DR3 B;  3OTO B;  4QNH B;  1F4N A;  1JQ0 A;  3HKD B;  3H1H H;  1SC5 B;  2KG7 B;  3K9S A;  3RYC A;  3ASO B;  3W7X A;  3CD6 V;  3KCY A;  2N04 A;  2A0L A;  1AP5 A;  2JGU A;  2OCC C;  2YSU B;  1HNX B;  1I0H A;  1YSC A;  3BCC H;  4UCR A;  2XAJ A;  3JAW B;  4I9W A;  1M56 B;  2EIK B;  5IDJ A;  2XAH A;  4TOI A;  1OCO B;  3UCS C;  2A79 B;  1Q86 W;  2PYJ A;  5H6Q A;  1IXM A;  5CB4 B;  4W4K A;  1Q7Y W;  5IYZ A;  1XI1 A;  4I50 A;  5JCO C;  3E22 B;  3B2E E;  2F43 G;  5L3E A;  3AK2 A;  3ABL B;  4LF4 B;  5LXT A;  2KB1 A;  1FFX A;  5D5P A;  2QGN A;  4DR7 O;  4O4I B;  4I5S A;  3U0Z A;  3OUS A;  1HR0 O;  1SQP H;  2YI9 A;  5ITZ B;  3T4D A;  4DV7 O;  4FLW A;  2P06 A;  1URF A;  1O9H A;  2GHY A;  1XHZ A;  2PYL A;  5J9P C;  2ZQM A;  1QLE C;  4YXW G;  4BR6 A;  3L74 H;  1ZX3 A;  4DR4 B;  4KP4 A;  3OW2 U;  2UU9 B;  1NH2 B;  2QM4 A;  5IJ0 A;  2PI4 A;  1WLE A;  3JAW A;  1FAF A;  4CH3 A;  3E35 A;  1VF5 B;  1WB7 A;  2Q5Z A;  2VQE B;  1YF2 A;  5CA3 A;  3K06 A;  3OTF A;  2ZXW B;  2YIA A;  4P9P A;  1FYJ A;  4Z1V A;  4CS2 A;  3ZHU A;  2BOB C;  4ABM A;  4GKK O;  1IBL B;  3TJT A;  3FAV B;  2RNB A;  5CBH A;  4O4I A;  2IH1 C;  1GN4 A;  1JCH A;  2JRI A;  3K5O A;  1NS1 A;  4JV5 B;  1UPG A;  4DV3 B;  3GB7 C;  3ICX A;  4QE9 A;  3UO2 A;  4DR2 O;  4L8J A;  1IX9 A;  4PJ0 Z;  1A32 A;  1Y66 A;  1BSM A;  1P49 A;  4NXN O;  5CA1 A;  2JK5 C;  5LP6 C;  2DYS B;  1Q82 W;  1YZB A;  1D5A A;  1D2D A;  1Q3E A;  1S3J A;  3CRM A;  1R6K A;  3ASN C;  4JGS A;  5EZY B;  4LF5 O;  1JVM A;  1AJN A;  4X89 A;  4LF9 B;  5JCO A;  2DMX A;  2JS3 A;  4B3S O;  5H6R A;  3RYH B;  3CP1 A;  1X4T A;  1B6Q A;  1S5H C;  2ZM6 O;  1Y6X A;  1K34 A;  2DE0 X;  2ITD C;  1SQG A;  1YDX A;  4TV9 B;  5BY1 A;  2PGG A;  3R65 A;  5HFM A;  5B3S B;  4J10 A;  1I08 A;  1P7G A;  5FNV A;  5J2T B;  2AZ2 A;  2Y69 C;  3RW0 A;  5JVD A;  3JAL A;  4CH4 A;  2CDY A;  4JI0 B;  3DC6 A;  3ZRV A;  4DR6 B;  2WLL B;  2XTA A;  2EUL A;  1QNM A;  4GT1 A;  4LH7 A;  5LMN B;  4K35 A;  3JAR B;  4NTY A;  4JI4 O;  3JSL A;  5GON B;  2ZKO A;  4JAA A;  3JD1 A;  3CCQ V;  1TUB B;  1QU7 A;  1IDS A;  4X64 O;  3BAB A;  1J5E B;  3O65 A;  2NR5 A;  4X8A A;  1V55 C;  1TVK B;  2QTO A;  4NVP A;  3K5L A;  4CC5 A;  3A8T A;  4Q20 A;  2CUG A;  4JI8 B;  3BEH A;  2GUZ A;  3OEE G;  5KMG A;  4LNU A;  4WFG A;  1CP9 A;  2ADQ B;  1IXB A;  5J2T A;  1M4U A;  4B3T B;  1ZL8 B;  4O4H A;  3QVN A;  2X0L A;  1MAB G;  1VQ8 V;  3AK3 A;  3JAT B;  5IT9 N;  1ARO P;  1RP3 B;  3WB2 A;  4FM0 A;  1M57 B;  1K97 A;  4BWA A;  4LH6 A;  2ZR2 A;  2HVJ C;  4MW3 A;  4DR1 B;  2YC0 A;  2E76 B;  1IBK B;  1GK9 A;  1TUE B;  4LF6 B;  4GX0 A;  1RPO A;  4JF3 A;  1THZ A;  2Q4P A;  2EBO A;  2CGN A;  2R72 A;  5GON A;  4X65 B;  1I5X A;  5B1B C;  4K8X A;  1PNK A;  4LFC O;  3MDS A;  3ZMS A;  2HEP A;  3CCU V;  3TXS A;  2IJH A;  3CC4 V;  3H1J H;  1H2M A;  4PDR A;  2DW4 A;  2QEX V;  4LF4 O;  1TVK A;  3JD4 A;  3KG2 A;  3MD0 A;  2CTP A;  2ETN A;  2WLJ A;  2ILM A;  1N8R W;  2OTJ V;  1VQN V;  3F5T A;  1R73 A;  4DK0 A;  4D7T A;  1R3J C;  4X1Y B;  1O9G A;  4WFB V;  1AI6 A;  4R50 A;  3ZHR A;  1OCZ B;  4DUY O;  3CRR A;  3AG3 C;  2KKW A;  3OMA B;  4DR4 O;  2UU9 O;  4RO2 A;  1N33 B;  3FX7 A;  3CRC A;  3N2G A;  2CTR A;  5KHK A;  4GX2 A;  4CC6 A;  3CCJ V;  3E8F A;  2EX3 A;  4OXS A;  4EKW A;  1H2N A;  1YTF D;  2VQE O;  1XNR O;  5BR8 B;  3RYF A;  2EZP A;  3OUF A;  3WU2 Z;  2IW5 A;  2WSS G;  4X1K B;  4IT5 A;  1OJH A;  1H2L A;  4I55 B;  3SJA C;  1HDJ A;  4DUZ B;  4IL6 Z;  1N0N A;  4O2A B;  5A9G A;  1Q81 W;  4MVU A;  4RWU A;  3VOU A;  2EIJ C;  2F1M A;  1NJI W;  3HKB A;  1FKA O;  4FK5 C;  1H38 A;  4TUY A;  1J95 A;  3H1I H;  1YJN V;  4DV1 B;  1SZT A;  1GN6 A;  4PI0 A;  3ETE A;  2O57 A;  4IHJ B;  4X1Y A;  4DV3 O;  4HYO A;  4YJ3 A;  1N36 O;  3CRQ A;  1PD3 A;  4EFB A;  1Y74 A;  3T1H B;  4TV8 A;  3HPL C;  1K4D C;  2ZCE A;  3QTC A;  2N05 A;  1FXK C;  3HB3 B;  2OCH A;  3SJC C;  1IUR A;  1HW7 A;  4E4E A;  2EIM C;  2Y0P A;  2EIL B;  4JI5 B;  3SPI A;  2CH7 B;  4LFB O;  3SYP A;  4X62 O;  1XL6 A;  1M93 A;  1SRY A;  3KCX A;  4NB5 A;  3ZMV A;  5BMV A;  4O2A A;  2QM7 A;  1R6N A;  1AIL A;  2MK3 A;  3KKY A;  1ZAU A;  4X88 A;  4GZR B;  4FVM A;  1KD1 W;  3T2M A;  4CS4 A;  1LUV A;  2BOC C;  1HR0 B;  1TA8 A;  4WFH A;  4DV7 B;  1US6 A;  5LYJ A;  4FLU A;  1GMG A;  1I5Y A;  3HKE A;  3L73 H;  4MVS A;  1RSO B;  1N4C A;  4B7K A;  2QJ1 A;  5LHG A;  1SQX H;  1Q43 A;  1H2G A;  3ZIA G;  3SPJ A;  5DM6 V;  3P30 A;  1XBL A;  2Q7G A;  1M5I A;  2IBZ H;  3VQY A;  3CB2 A;  4HNA B;  4JI0 O;  4LF8 B;  2HP8 A;  4H44 B;  3C90 A;  1EZJ A;  2Q0A A;  4DV5 O;  2H94 A;  2HKO A;  1KBH A;  1XNQ O;  4I4T B;  3APQ A;  2XT9 A;  3RVY A;  1V54 B;  4GCZ A;  3TK1 A;  2Q6A A;  2LW7 A;  1X59 A;  3G67 A;  4EB6 B;  3APO A;  1E79 G;  4GKK B;  2OTL V;  5LMU B;  1NR1 A;  5CN0 A;  1AP6 A;  1MA1 A;  5JWP A;  4WBN A;  1FXK A;  3D36 C;  1NR7 A;  1RSO A;  4ZHQ A;  4DR2 B;  4LFA B;  3K3W A;  4UCS A;  3WB0 A;  3OGI B;  2EJR A;  4FJC C;  3B4S A;  4ASU G;  3W7U A;  1AJQ A;  4DR1 O;  1IBK O;  1QVF U;  3WFV A;  1VQ7 V;  5KX5 B;  3RT3 C;  2F66 C;  3JYC A;  2LJ2 A;  3UQ8 A;  5LGN A;  4LR3 A;  4X65 O;  2E75 B;  3ZBH A;  3QO5 A;  4X20 B;  2DN9 A;  4WCE V;  1ROP A;  4EB6 A;  1I94 B;  4P2Z A;  2RQ6 A;  1PL0 A;  1SQQ H;  5IJ9 A;  1ZUQ A;  1GM9 A;  2ZM6 B;  3ZCC A;  2WWW A;  1QVG U;  5IYC O;  3A0R A;  2YDE A;  5E1A C;  1MZF A;  3ZRW A;  4KHP B;  3K9A A;  4CZZ A;  2ADP A;  3CJH B;  3DXR A;  1S5J A;  3CPW U;  4GLX A;  1HNZ B;  2VWK A;  4U3F H;  3ETG A;  1XUQ A;  1NKD A;  1H8E G;  4EFE A;  3X2Q C;  3E8H A;  2FL4 A;  1RFY A;  3H1L H;  2RDC A;  1VQO V;  3IC9 A;  1QHT A;  1VQL V;  1K33 A;  4PA6 A;  1AI7 A;  5BR8 O;  2ZDI C;  3VQX A;  3LNN A;  5IWA B;  1SQF A;  1FS0 G;  4JYY A;  4JI4 B;  4X20 A;  3Q4H A;  4DUZ O;  2NNU A;  1XEQ A;  2QA4 V;  3B8M A;  1AR4 A;  4DV4 O;  4I50 B;  3ABM B;  4RQE A;  4P9O A;  4R7C A;  1YIJ V;  2IU3 A;  3JAK B;  2HJF C;  5LXT B;  4JYA B;  1FFX B;  4DV1 O;  3L72 H;  1VF6 C;  5LA6 A;  3CJH A;  2GDS A;  1M56 C;  2Z3Y A;  2AZ0 A;  2LQT A;  1OCO C;  3T1H O;  5KUK A;  1B06 A;  1BQ0 A;  4D7S A;  4NTW A;  1Q8I A;  2CK3 G;  1JA8 A;  4ZI7 A;  1S72 V;  3M7M X;  3RBZ A;  1MG1 A;  4PA7 A;  5IJ0 B;  4PA4 A;  3GVM A;  4JI5 O;  4DRX A;  5LGT A;  3WB1 A;  1G6U A;  2UXN A;  3B77 A;  2V4D A;  3RYI A;  3UO3 A; 
#chains in the Genus database with same CATH homology
 4PEL A;  3R65 A;  5HFM A;  2ATK C;  5B3S B;  1E1Q G;  1XL4 A;  1F51 A;  1YJ9 V;  4UV8 A;  3PJS K;  2EIL C;  2W6I G;  5LHI A;  3SYQ A;  3FYI B;  2P90 A;  5KA5 A;  3FKS G;  3CCE V;  1QCE A;  4WF9 V;  2Y69 C;  3RW0 A;  3UM7 A;  1R3I C;  3CCM V;  2EZO A;  5GW7 A;  1P4R A;  3SYO A;  1HWY A;  3E89 A;  4R8C A;  3RVZ A;  2B1I A;  5L3G A;  2YEV A;  3ZRV A;  1PNL A;  2WLL B;  4DXW A;  3ABT A;  3ETD A;  1KEC A;  2FTK A;  3ZN1 A;  4GT1 A;  2OCC B;  3WG7 C;  4PDM A;  2ZXW C;  2W0F C;  3SPG A;  4MTO A;  1NBM G;  4PA9 A;  4XDL A;  1L1F A;  3ZMZ A;  3T1C A;  4MSW C;  5FL7 G;  5DN6 G;  3E2E A;  3CME V;  3K04 A;  3K0G A;  1MSW D;  3JD1 A;  2DYR B;  3CCQ V;  1H8H G;  3ZRS A;  2ZDI A;  3LSS A;  3STL C;  4X8A A;  2WPD G;  1V55 C;  3E83 A;  5KA6 A;  5CBF A;  1EBO A;  2QTO A;  2W6J G;  5EK0 A;  2EIN C;  4PDV A;  3OMN B;  5C93 A;  1S77 D;  4Z1M G;  2QM8 A;  2DQ0 A;  3VBB A;  3CMA V;  4Q20 A;  4UVB A;  3BEH A;  3OEE G;  4PDL A;  4JAU A;  1AR1 B;  3AEI A;  2Q67 A;  4WFG A;  4ZKI A;  1CP9 A;  1SER A;  1OCR B;  2X0L A;  1OCC B;  1MAB G;  2DWE C;  2Y48 A;  4GX1 A;  3CXC U;  1YJW V;  3OE7 G;  1VQ8 V;  4H37 A;  2NLJ C;  1K8A W;  3CCR V;  4JPR A;  5LBQ A;  1ARO P;  1V54 C;  1M57 B;  1K97 A;  1UJW B;  4MVM A;  3OMI B;  2ZR2 A;  2HVJ C;  3ASO C;  4MW3 A;  1QLE B;  1RPR A;  1GK9 A;  1R3K C;  1TUE B;  4LBE C;  5B1A C;  4GX0 A;  1QLN A;  1RPO A;  2V1D A;  4JF3 A;  4U7N A;  1THZ A;  3FB8 C;  2EBO A;  5LGU A;  4KUM A;  3IFX A;  1YHQ V;  4CBC A;  3IGA C;  5CBG A;  1FXH A;  1I5X A;  3F5W C;  5B1B C;  1PNK A;  1OHH G;  1GO3 F;  4KFM A;  3D36 A;  1ORQ C;  4QPK A;  3ZMS A;  3CCU V;  2IJH A;  3CC4 V;  5HFL A;  1AI4 A;  2JIZ G;  2DW4 A;  4PDR A;  2QEX V;  3JD4 A;  3KG2 A;  2YEV B;  2WAM A;  2EIK C;  2ZR3 A;  3MD0 A;  3I56 V;  1M1K W;  3X2Q B;  1G8M A;  1K7D A;  4J9Z B;  2WLJ A;  4TT3 G;  1QR9 A;  1YI2 V;  1N8R W;  2OTJ V;  1VQN V;  1R73 A;  5L3B A;  3E86 A;  1R3J C;  4WFB V;  1AI6 A;  2A9H A;  3OR7 C;  4R50 A;  4WFE A;  3F7V C;  2JEU A;  1OCZ B;  5BZB A;  3ABK B;  3ABL C;  3E8B A;  3JD2 A;  3AG3 C;  2H8P C;  2HVK C;  3OMA B;  5B1O A;  1EFR G;  4BW5 A;  1RM1 C;  4UV9 A;  4RO2 A;  2Z5U A;  5L3C A;  1CEZ A;  3CCV V;  4MVR A;  1S0V A;  3W7S A;  5IYB O;  1FXV A;  4GX2 A;  3CCJ V;  1VQP V;  3E8F A;  4H33 A;  5EBL C;  1JJ2 U;  4OXS A;  2IJK A;  2OT5 A;  1GM7 A;  4QE7 A;  4EKW A;  1DF5 A;  1YTF D;  1R3L C;  2JJ1 G;  3AG2 B;  5LHH A;  2EZP A;  3OUF A;  5B1N A;  1BL8 A;  2B1G A;  1P7B A;  2XND G;  2WLN A;  4G28 B;  2IW5 A;  1KP3 A;  3W7W A;  2WSS G;  2XAQ A;  2LP7 A;  3ZJZ A;  4F4L A;  5L3F A;  3QNE A;  4HAM A;  1Q81 W;  3IC7 A;  3BY6 A;  1GM8 A;  3ASN B;  3TCU A;  4MVU A;  3VOU A;  2EIJ C;  1NJI W;  1BHB A;  5CMU A;  5IY5 B;  4FK5 C;  1H38 A;  1J95 A;  2JDI G;  3D3I A;  1JOY A;  2IJI A;  4MVQ A;  1SZT A;  3JD3 A;  1YJN V;  4UVC A;  1K4C C;  3ETE A;  3UKM A;  2JEX A;  3LNM B;  2WLI A;  2R9R B;  4HYO A;  2Q68 A;  1VQ9 V;  1E1R G;  3LDC A;  1PD3 A;  3SPC A;  3STZ C;  1OCC C;  3G4S V;  3JD0 A;  2GSM B;  3HPL C;  1K4D C;  2X6A A;  4GX5 A;  2ITC C;  3NXS A;  1JPX A;  3HB3 B;  1FXK C;  2PI5 A;  4N21 A;  2HLD G;  5EBW C;  1VQK V;  4RAI A;  1YIT V;  1AI5 A;  2EIM C;  3TET A;  5L3D A;  1BMF G;  4G27 B;  4UUJ C;  2EIL B;  1KQS U;  1OZ0 A;  2AHY A;  3SPI A;  4DO2 A;  3LUT B;  3E8G A;  3ML0 A;  3SYP A;  4WFA V;  3CC7 V;  1XL6 A;  2R9I A;  3ABM C;  3EHB B;  3G6E V;  1SRY A;  3CYO A;  4LP8 A;  3ZMV A;  3CC2 V;  2DYS C;  2IJJ A;  2QM7 A;  1R6N A;  2MK3 A;  2XAS A;  3AG4 C;  3ZMU A;  2Q69 A;  1DTO A;  3GWO A;  3I55 V;  1BHA A;  3CCL V;  3DGE A;  3ZN0 A;  4JYB A;  4X88 A;  1G4Y B;  3DTU B;  4JYC A;  1NVP D;  1KD1 W;  3T2M A;  3FB7 C;  3OM3 B;  2QE7 G;  2BOC C;  1YTF B;  4WFH A;  3QO8 A;  4MT8 A;  3ABU A;  2X6C A;  4ZBM A;  1GMG A;  4HZ3 A;  1I5Y A;  4JTA B;  4MVS A;  4RUF A;  1ENV A;  3SYA A;  2WLH A;  1KC8 W;  3FB6 C;  5LHG A;  3M99 B;  2EIN B;  1FFT B;  2P6J A;  3QO7 A;  1H2G A;  3ZIA G;  3SPJ A;  4UVA A;  1VQ4 V;  5DM6 V;  5KUM A;  4P30 A;  3P30 A;  4WFF A;  5EBM C;  3SPH A;  4JAV A;  1QR8 A;  4JAS A;  1QBZ A;  1GTO A;  3T4Z A;  2JJ2 G;  5B3S C;  1EZJ A;  2UXX A;  1ZWI C;  4QIW F;  1NH2 D;  3OEH G;  3CCS V;  2WLI B;  3ZRX A;  2HR3 A;  3ZMT A;  2H94 A;  4L87 A;  1DLB A;  4QNH B;  1K5Q A;  2HKO A;  2IH3 C;  4MS2 A;  4XDJ A;  1F4N A;  1JQ0 A;  2LFS A;  3RVY A;  1V54 B;  4GCZ A;  4QPJ A;  3TK1 A;  2Q6A A;  1NQT A;  1K5S A;  3ASO B;  3W7X A;  3CD6 V;  1E79 G;  4JTC B;  5IY5 C;  3H01 A;  2A0L A;  1K3E A;  2QKS A;  5EC2 C;  4UXN A;  2OTL V;  2OCC C;  1NR1 A;  2YSU B;  5CN0 A;  2HG5 C;  1S76 D;  5IYD O;  1YSC A;  5B1B B;  1MOF A;  4RUE A;  2XAJ A;  3G71 V;  1F23 A;  2WLM A;  2DYR C;  1K9M W;  2LFR A;  1FXK A;  2X7R B;  2DQ3 A;  4I9W A;  1SET A;  1K73 W;  1NR7 A;  2D3O W;  1M56 B;  2EIK B;  5IDJ A;  4RQF A;  2XAH A;  3K3W A;  1OCO B;  4FMT A;  2A79 B;  1Q86 W;  1PKX A;  5H6Q A;  1IXM A;  4MW8 A;  3B8N A;  1Q7Y W;  2EJR A;  4FJC C;  3AG1 B;  1AJP A;  4ASU G;  3W7U A;  1NVP B;  1AJQ A;  2F43 G;  4XDK A;  5L3E A;  3ABL B;  3AG3 B;  1GKF A;  1QVF U;  2KB1 A;  3WFV A;  1VQ7 V;  3FYE B;  1OCR C;  4MTF A;  4I5S A;  3OUS A;  3EFF K;  3JYC A;  4J9Y B;  1RM1 B;  2XAF A;  5LGN A;  3T4D A;  5EC1 C;  3QO5 A;  4WCE V;  1F4M A;  2GHY A;  1M57 C;  1ROP A;  4MTG A;  2HFE C;  1KP2 A;  4P2Z A;  5J9P C;  2ZQM A;  1QLE C;  4YXW G;  1PL0 A;  4G2K A;  1VQM V;  4LCU C;  3K79 A;  1GM9 A;  4KP4 A;  3OW2 U;  3MHS C;  3ZCC A;  2WWW A;  1QVG U;  5IYC O;  3A0R A;  1NH2 B;  1LNQ A;  2Y69 B;  5E1A C;  2PI4 A;  3ZRW A;  2B5U A;  1WLE A;  3K9A A;  3OR6 C;  4CZZ A;  3E35 A;  2IU0 A;  1M90 W;  2EIJ B;  1K92 A;  3CPW U;  1VQ5 V;  5CA3 A;  3K06 A;  1VQ6 V;  3ETG A;  1CPY A;  1NKD A;  1H8E G;  3F7Y C;  3WG7 B;  4N23 A;  3X2Q C;  3E8H A;  2ZXW B;  4PA3 A;  4P9P A;  1VQO V;  4JTD B;  2XAG A;  3OAA G;  3SJQ C;  3SYC A;  3JCZ A;  3LSQ A;  4FPP A;  3OGC C;  2BOB C;  1Y4M A;  1VQL V;  1JX9 A;  2XOK G;  1K33 A;  3MHH C;  1OCZ C;  4PA6 A;  1AI7 A;  3ABK C;  1M9N A;  3P32 A;  5CBH A;  2IH1 C;  3K03 A;  1FXK B;  1PNM A;  1V55 B;  2ZDI C;  4MVO A;  4QJF B;  1JCH A;  1FS0 G;  1KKD A;  2WLL A;  3K0D A;  4TWK A;  2EIM B;  3GB7 C;  5H9C A;  2NNU A;  3OFN G;  4QE9 A;  2QA4 V;  3B8M A;  4XBF A;  4BIU A;  2P7T C;  1SES A;  3ABM B;  1Y66 A;  4P9O A;  4R7C A;  4RQE A;  2IU3 A;  1YIJ V;  4LC1 A;  1WPX A;  3AG2 C;  2HJF C;  2JK5 C;  2AHZ A;  2DYS B;  2P67 A;  1Q82 W;  4MTX A;  4FIP C;  1S3J A;  3AG4 B;  2V7Q G;  2DWD C;  4U7O A;  1R6K A;  1M56 C;  3ASN C;  4JGS A;  2Z3Y A;  1OCO C;  1JVM A;  1AJN A;  4X89 A;  1DF4 A;  4E2L A;  5KUK A;  4MVZ A;  2M7W A;  5B1A B;  1W0K G;  3AG1 C;  2WLK A;  1W0J G;  2X6B A;  2CK3 G;  4TSF G;  3LDD A;  2ZD9 A;  1S72 V;  3LDE A;  4R6Z A;  5H6R A;  3RBZ A;  1MG1 A;  4PA7 A;  3CP1 A;  3K08 A;  1B6Q A;  3ZRW B;  4PA4 A;  4BAY A;  3W7T A;  1S5H C;  2C2A A;  1K34 A;  5LGT A;  2K1E A;  1W2B U;  2ITD C;  2UXN A;  3B77 A;  1COW G;  4BIZ A;  3FB5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...