1VQPV

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqpV00
4WCEV 2OTLV 3CCVV 1YITV 1YHQV 5DM6V 1VQKV 1VQ5V 1YI2V 1VQNV 3CCSV 1K8AW 1KQSU 1QVFU 3CPWU 3CMAV 2D3OW 1NJIW 1N8RW 3G71V 1Q86W 3I56V 3G6EV 1K9MW 4WFBV 3CCLV 3CCRV 1VQ7V 1M90W 1VQ9V 3G4SV 3CCEV 4WFAV 3CXCU 3CC7V 1VQMV 1YJ9V 1YIJV 1Q7YW 1R73A 2QA4V 3CCMV 3CC4V 1KD1W 3CD6V 2OTJV 1VQOV 4WF9V 3OW2U 1YJNV 1JJ2U 1Q81W 1VQ4V 3CC2V 1QVGU 1VQ6V 1VQPV 1YJWV 1VQLV 3CCUV 1VQ8V 1K73W 2QEXV 3CMEV 1M1KW 1KC8W 3CCJV 3I55V 1Q82W 1W2BU 3CCQV 1S72V
chains in the Genus database with same CATH superfamily
2EZOA 3T1HO 2GUZA 4UB6Z 2RJZA 3K03A 2EIKB 4H0LB 4NTWA 3SYPA 1KMIZ 1G8MA 1ZX3A 3L70H 3STLC 1Z2GA 2JJ2G 1XMOB 4I55B 3T4DA 2Q9LA 2YXYA 4U3JB 1WA8B 3CX5F 4BAYA 4DV7B 2YUAA 3Q4HB 1N34B 2ZDIA 2OIEA 4IL6Z 4NTXA 2VRZA 1KC8W 4JYAO 2ILMA 2ZKOA 4QGPA 2ZIOA 1V54C 1W59A 1N33B 4I50B 1AR5A 3RYFA 1SQVH 4LF9B 1GM8A 1CEZA 2E5LB 3CXCU 1V54B 2JVDA 3UKMA 4YHHB 1KB9F 1US6A 2QGNA 3B4SA 1E79G 4Z1VA 2ZNIA 4LFCO 2ZD9A 3JSNA 1RPOA 4MVZA 5K1PA 1YDXA 4N21A 3BVOA 1V9PA 3M7MX 1L0NH 2CK3G 1NTKH 2PYLA 2EIMB 1DK1A 3K79A 4DR1B 4J42A 1XMQO 3TXSA 2X6BA 3CEIA 3ETDA 2LQTA 5IY5C 4GX0A 5EZYB 5KX5B 5LMNB 5KA6A 2LP7A 4GX1A 3JD2A 1N34O 4UCRA 2ZR2A 1AI4A 1XNQB 3N2GA 4CH5A 1K97A 4D6TH 1BQ0A 1NI8A 4DO2A 4FLYA 2FTKA 4ASUG 1K33A 2DW4A 2DYSC 5JQGA 5EYPA 2GSMB 2P5OA 3TETA 1PP9H 3IC7A 3OT7A 3CRRA 4JI1O 2DYRB 1FFXA 3T4ZA 1ZL8B 2N05A 5KHIA 1GM7A 5LGUA 4F4LA 4BIUA 2QWRB 3CD6V 5D5PA 4CH4A 1Q81W 4LFAB 3JYCA 4FFKA 4X20A 2ZXWB 3JD0A 4ZHQA 2ZNJA 4W4LA 2UXBO 3S3XA 2C2AA 3DTUB 3T1YB 1HR0O 5EBMC 3HPLC 2AGAA 5E1AC 1MG1A 2RQ6A 4LF6O 3AK2A 1E1RG 3LNNA 4XDLA 1K9MW 1XNQO 3BFRA 4F6RA 2ZCEA 4PV1B 3RYIA 1D5NA 4DW1A 1TVKA 2HKOA 2UUCB 3JSLA 2L35A 2LFSA 2A0LA 1K73W 1OZ0A 4O4IA 5IYZB 3ASOC 4PELA 1XOUA 1OCCC 1Y76A 4QNHB 3RYHB 4L87A 2WPDG 4KUMA 3CC7V 3QO8A 4X20B 3ASOB 1NTZH 1YTFD 2PZSA 4FLUA 1G1XB 1BE3H 3PJSK 1K92A 4TUYA 4I9QA 5JQGB 5ITZB 2D2CB 4UCUA 4LFAO 1M1KW 4MVRA 2P4KA 3FB5C 1F4NA 3K06A 5LYJB 1IX9A 1AR4A 2PY5A 4DR2O 3STZC 3M99B 1N36B 4NVPA 3H1IH 2OCHA 1YJ9V 1H2LA 3DC6A 5LP6A 2E76B 5AG2A 2GBOA 1ENVA 3UT5A 5JVDA 1M5IA 2XOKG 4MVSA 1H2GA 1QLEB 4L8JA 1M93A 4X66O 2A7WA 3K08A 3QF7A 4GZRB 2HVKC 1BGYH 2OTLV 4O2BA 2QJ1A 3LDCA 4JAVA 2EIJC 4JPRA 1FD9A 2CH7B 1JR9A 3RT3C 4NR1A 1OCOB 3ZRXA 5BMVB 2DQ3A 3CXHF 2OWOA 5LOVA 4IYHA 4YJ2B 3E8GA 1Q6IA 3AG2B 1JVMA 1NTMH 4G2KA 3ZHRA 5IDJA 5FPOA 5IT9N 3ABMC 5GW7A 5EYPB 1P4RA 4YY3O 3JD1A 2JK5C 1R3LC 2EINB 3B8NA 2N04A 1HNXB 2MK3A 1UFIA 3BA8A 2X7RB 3X2QC 2JS3A 1EBOA 1SQQH 5KHHA 2W0XA 4UFZA 4UVCA 2OT5A 2ITDC 4OX9O 4MVUA 5CA0A 2E75B 1MZEA 2LGWA 3E2EA 2WLLB 3CCJV 3BABA 3RGBA 1FKAO 1HWYA 2YICA 3OR6C 2OYQA 4FLWA 2YXHA 2VQEO 2A06H 4WFAV 3AK1A 3S3WA 1P7BA 3UT5B 5L3GA 2CTWA 5BZBA 4BW5A 4JAUA 3L71H 4LFBO 5HFLA 3AG4B 1IXBA 4ZOLB 3HB3B 3I56V 2GV9A 2QM8A 1HNWO 2B1IA 2WLIA 3NR7A 1W0JG 1BL8A 4FM1A 4X8AA 3ASNC 4LH6A 2UUAO 2XNDG 1VIBA 4JI2B 1HDJA 5BR8B 4JYYA 1Q6UA 4R8CA 3WU2Z 1HNZO 1MABG 1PV0A 4J7KA 3CRMA 1GO3F 2R70A 4P2ZA 1AI7A 4B3MO 1SQGA 3TXQA 4O4HA 3E22A 4TV8A 1N36O 2DE0X 2OCCB 3W7WA 4B3RO 1S5HC 3ABKB 3K5NA 4TQDA 1OCZC 1SESA 3L72H 2LW7A 5EIBC 2ZE7A 4UCTA 4DR4O 3UO3A 3B2EE 4CC6A 4EKWA 4LF7B 4G28B 4DRXA 1R6NA 4EB6A 2L6LA 4KP4A 2F1MA 4B3TB 1N33O 1XHXA 2QSAA 1R1BA 4UUJC 3U10A 4ZHQB 3AK3A 1FXVA 1NR1A 2UXBB 4DV7O 2HEPA 2DWEC 4LWSB 2IW5A 4WCEV 3R66A 2QTOA 1DF4A 5A2QN 1VQ9V 3DC5A 1EM1A 4J11A 3ZEDA 3SPIA 4JYBA 1TUBA 3THOA 1NBMG 1YJWV 1NS1A 2ZDIC 5DEDA 4ZIBA 1IBMO 4Z1MG 5BY1A 3HKCB 1Y76B 1YI2V 1K5QA 2M7WA 3ZIAG 1XEQA 4QIWF 1AI6A 1VQMV 1B04A 2PGGA 2A9HA 2FKXA 5LP6C 4JI7O 4BR6A 1VQPV 3H1JH 2HVJC 5KUMA 4DV1O 4JI6O 3HR0A 3I55V 4B3SB 2IJHA 2UUCO 1FYJA 1ZUQA 4J9YB 4PA9A 1NQTA 3ZHVA 5BMVA 3RWRD 2BCCH 1Y74A 3ZCCA 4LF6B 3SJBC 1Y74B 3AG2C 1AI5A 4MSWC 3JCZA 2ZE8A 1PL4A 1XUQA 2ZXWC 4B7KA 4DUYB 2JS5A 5BR8O 1OCRC 3E35A 3ZMUA 4PDRA 2YIBD 4UVAA 3C90A 3EXAA 1BCCH 5IWAO 5IYZA 3G6BA 4MT8A 3JAWB 1LNQA 2Q68A 3G71V 4MVQA 3QG5A 5LGTA 1ZLZA 3SPGA 2HJDA 3JALB 1WA8A 3JATA 4OX9B 3WG7C 5KHKA 4DV2O 2R9AA 4JYCA 5H9CA 4DK0A 4AQYO 3H01A 3T2MA 1W0KG 3FD9A 3CCEV 2N74A 3FKSG 4YY3B 4P30A 5JH7A 4X64B 4RO2A 4JI4O 4PI0A 2IU3A 3WB2A 2CGNA 1VQ8V 2Z3YA 3H1KH 3K5MA 2K9PA 1GK9A 2EJ7A 2GTSA 5KLVH 1WB7A 1BSMA 2NLJC 3QTCA 3W7SA 2IH3C 3CCSV 3MDSA 4QJFB 2IJJA 2PF4E 2A79B 1L0LH 1U96A 1GN4A 2XAQA 3OUSA 2UU9B 1SQBH 4UCSA 4B3MB 2F95B 5H5NA 5KUKA 1HR0B 1FXKA 5L3BA 3BRCA 1QNMA 1O9GA 1SZXA 1GM9A 5CMUA 1K34A 2EZPA 3MHSC 3ZX6A 1TAEA 3T1YO 2Q7GA 4ABMA 3MAQA 3HKCA 1QVFU 2D3OW 3P3PA 2B9ZA 3CCLV 1BHAA 5HFMA 4FM0A 1IURA 1YIJV 1TUBB 2LO1A 3B8MA 1EN6A 2EBOA 2AHYA 2AXTZ 1J5EB 4JTDB 4LF4B 3RW0A 3AG1C 4R6ZA 1PNLA 2A3QA 4LWSA 1GAXA 1VQNV 1NVPD 3IJ4A 4MW3A 3K5OA 3AG1B 2WLHA 1RSOA 2Q4PA 2WLIB 1JX9A 5IE9A 1L8DA 5LGNA 2FYUH 2YIDA 2YI8A 4LP8A 4CS4A 3GVMA 3C3TA 3ZMZA 1F23A 4BIZA 2FL4A 4TV9A 3ZHTA 5FLXN 1M4UA 1L1FA 2AHZA 5JCOC 4GX5A 1I5XA 3E8BA 3E89A 4X65B 5FPRA 2EIMC 3N2KB 3U0ZA 3A8TA 2F93B 1S3JA 4J10A 4JI5B 1Y67A 3IFXA 1HNZB 4K3AA 3JD3A 2UXNA 4I4TA 3W7UA 1YITV 1N0NA 1DLBA 1KKDA 5LYJA 2F4VO 3APOA 2WA3A 4O4JA 2CTPA 2Y0PA 1JQ0A 5ITZA 3AG4C 2GTAA 4X66B 5D5QA 3O9OA 4OPHA 2Q6AA 1Q90D 2LJ2A 2JGDA 3CCQV 1VF6A 5H6RA 3WB1A 4GUNA 2QDOA 2ETNA 1F7YA 4O2BB 4NXNB 3SYOA 2KG7A 2Y4TA 4KHPB 3H9VA 5B1BC 5GONA 1RPRA 1BHBA 4JI5O 3D8CA 3P30A 4JASA 1PNKA 1OCCB 1R3IC 1PM9A 3PN1A 4C7UA 1QR9A 5CA0B 4K8ZA 4DR3O 4W4KA 3JALA 3UO2A 3P3NA 3SYCA 1AJQA 1YZBA 4P9OA 1LUVA 1AROP 1EN5A 3ASNB 1IBKB 1UJWB 1QLNA 4YIOA 1J5EO 1B06A 4U3FH 4MW8A 3RFRA 2WLNA 1CXZB 3ABUA 4BW9A 1H8HG 2Y48A 2QKSA 5EC2C 1K4CC 2P6JA 1HNWB 1Z5VA 5FNVA 2HHHO 5EBLC 1W2BU 4OGQB 1QLEC 4WFEA 3K57A 1QQCA 1YCIA 2Q7EA 2NNUA 3CCVV 1JOYA 1RP3B 1FPOA 3D3IA 1GMGA 4F6EA 4DV3O 5BXZA 2KQXA 1PL0A 5IJ0A 1NR7A 3OAAG 1MNGA 2PTMA 3LNMB 4H44B 1M56B 4RUFA 2IJIA 3B09A 1Q3EA 2ADPA 1MA1A 1DTOA 4R50A 3R65A 1H2KA 4LCUC 1WLEA 3CS5A 3A2FA 1SZTA 3TCUA 2VQFO 3DXRB 1Q8IA 4DV2B 2ZR3A 4JZGA 3CHXA 1Y4MA 2CUGA 4JI7B 4ZKIA 4QPKA 5A9GA 2PUSA 2GHYA 1RSOB 5CB4B 4JI6B 1N0JA 1GN3A 4Z2WA 1SKVA 4I50A 4LNUA 4PA6A 3VOUA 3J7AU 3EVKA 3ZMVA 4PHZA 1Q7YW 5B1BB 2G38A 2XTAA 1JA8A 1SQXH 3G67A 1PPJH 4WBNB 1YEWA 3CCUV 4XBFA 3JAWA 5EZYA 1KP3A 2WLKA 5KX5A 3BAAA 1XBLA 3ZS8C 1OV9A 4N23A 3N2KA 1KQSU 2HFEC 4JV5O 5IWAB 4LC1A 1EZVH 4JYAB 2JJ1G 4TOIA 3MHHC 2DYRC 2W6JG 1XNRB 1WNSA 2BOBC 1SQPH 2P22C 2EILC 4Q6GA 2RMKB 1XL4A 3LSSA 1VF5B 5F2VO 4DXWA 3CJHB 3G4SV 2V4DA 2XAFA 2RCVA 1IVSA 4HBNA 5LHHA 3CYOA 2NR5A 3SR2C 3ZHUA 3VBBA 1MOFA 5DN6G 1MSWD 3K59A 3N2GB 1M9NA 4MTFA 5LXTA 4ZOLA 2QEXV 1FXHA 2Y69B 4G27B 3ABLC 3SJCC 4LH7A 2X0LA 1XMQB 1K5SA 1N8RW 3K5LA 1P7GA 2KG7B 4UCVA 1GKFA 3TGUH 2F66C 3OTOO 1AR1B 3OMNB 4O4IB 1QU7A 2X6AA 3QNEA 3VQWA 1BQZA 4PD4F 1PD3A 3DSQA 3GWKC 1VMGA 2ZE6A 1YSCA 3K04A 5CA3A 4CH3A 3CMEV 2JGDB 2UXXA 1ZWIC 3T1CA 1JPXA 3FFQA 4MTOA 1RM1C 2UUAB 5GTHZ 4JI2O 4IHJB 4IGGA 1U97A 1SETA 1PKXA 5KHJA 5LOVB 1VP7A 4X1KA 1NH2D 1EZJA 3IC9A 4DRXB 5J2UA 3MD0A 1WB8A 3HKEB 4FZ0A 1NVPB 2ZQMA 1P49A 5B3SC 1M90W 3NXSA 2Z0AA 3F7VC 1S77D 3D3QA 3WB0A 5IJ9A 4YJ3A 2M6YA 1WN7A 4PA7A 3P32A 3FB8C 2AW9A 4DR4B 1M57C 5IY5B 4P9PA 2Q0OC 1KYOF 2B5UA 4WBNA 3UM7A 2YEVA 1Q86W 4JTAB 3A0BZ 3E8HA 5EBWC 5L3EA 4IT5A 1IDSA 2B1GA 1YJNV 1X59A 5JJEB 2AZ2A 4I5SA 4TWKA 1VARA 2DN9A 3N27A 5LA6A 2R9IA 2E74B 1Z5WA 4WFGA 4FVMA 3DXRA 2UUBO 3ZHSA 1WAZA 1JJOA 2JDIG 3TJTA 1XILA 4CS2A 3CC4V 2BSKA 1I94B 1AP5A 1J95A 2QA4V 2E5LO 1GH6A 2WSSG 5KMGB 3K9SA 1SRYA 1G4YB 5EK0A 2ZM6O 2QM7A 1Q82W 3B40A 4F6RB 4UXNA 4FM2A 4PA4A 2WLLA 3FB7C 4HNAA 4JF3A 4JI8B 3HKDB 1COWG 1N4CA 4H13B 3SDLA 1FJGB 3J81N 1S76D 4Q20A 3RBZA 4O2AA 1R6TA 2YSUB 3L74H 2Q5ZA 3ZBHA 2Q73A 5LMNO 4QPJA 3AEIA 4CZZA 5LHGA 5B1AC 1R6KA 2ARHA 4NTYA 5CN0A 3LSUA 2PI4A 3OR7C 5IYDO 2EULA 1QHTA 3UQ8A 2BE3A 4PA3A 3AG3C 2P4VA 5IYCO 3FB6C 1VEWA 3L9DA 3OFNG 4U7NA 3ZMTA 1A32A 3LDEA 1JFFA 5L3CA 2WLMA 1AJNA 3JASB 3CSXA 3WFVA 2F4VB 4EB6B 1ORQC 1H2MA 2KB1A 1JMKC 3SJQC 4PI2A 1CPYA 3K0GA 3RN4A 2CTRA 2JIZG 4DR7B 4LFBB 1KBHA 3H1HH 3L73H 3JASA 4GKJB 3OM3B 3KCYA 1JFFB 5H6QA 3F5TA 1K8AW 2DYSB 1S5LZ 2JEUA 2XASA 4JI1B 2QWNB 4X1IA 5C8YB 3OTOB 1VQOV 1VQ4V 4D7TA 4X1KB 2P06A 1XI1A 1RFYA 1FFTB 4E2LA 1IBKO 1E1QG 4IHJA 2RNBA 2YIBA 5IYBO 4I0XA 4B3TO 2XAHA 3I5DA 3LUTB 1ZSPA 2UXDB 1DF5A 4FK5C 4YIPA 1TUEB 4LF5O 1K7DA 4K0KO 4O4LB 4ZI7A 1K3EA 1BZKA 4BIOA 4FMTA 2LW1A 3A0HZ 5E79Z 2HR3A 4FZ1A 1IBLB 3OGIB 2ITCC 5TISZ 2IBZH 4MVOA 3SJAC 2QE7G 4A5UB 4DYLA 3WG7B 5JJNB 1I0HA 2XAJA 3OTFA 5LXTB 3JAKA 1H38A 4I7ZB 5JVDB 1FXKB 2QR4A 2BOCC 2BSKB 2H94A 2Q69A 1YXBA 4NB5A 2CAZC 2X6CA 3ETEA 4DR7O 4J7JA 1YF2A 1RM1B 1GN6A 1I7FA 5J2TA 1XNRO 4X65O 4DV0O 3RYCB 4O4LA 4DV3B 2UUBB 4DV4B 1KP2A 2QKAA 2XT9A 1KD1W 1FS0G 5EC1C 2HP8A 3IGAC 3CB2A 3SGIA 4EFBA 2HLDG 2UU9O 2Y0IA 2BTQB 4CS3A 3HKBA 3QVNA 1BS3A 3W7XA 1N32B 3SYAA 2ZINA 1ZAUA 1SC5B 2VS0A 4I9WA 3JCUZ 3BCCH 5FL7G 4FLXA 2QWOB 2KSDA 4EFEA 5LL6Y 2BTQA 4LF8B 2QKCA 1M56C 2QTSA 5L3DA 5LP6B 3VQYA 3E8FA 2XUMA 1MSDA 4XDKA 5J2UB 1Y6XA 3JD4A 4WFBV 1OCOC 1GRJA 1VF7A 1FJGO 1R73A 3GWOA 4K35A 1MZFA 3DGEA 4CC5A 5KHGA 4NYKA 1DGSA 2EILB 3ZN1A 5JH7B 1H2SB 5CB4A 1SQFA 2YC0A 4NXNO 1AJPA 2ODMA 1QBZA 2R9RB 2VWKA 1NT2B 1QR8A 2YXLA 4UV9A 1THZA 3M8AA 2DJVA 4X62B 5EIBD 4LF8O 4GX2A 2CDYA 3A0RA 3JATB 4B3RB 4UV8A 1HP8A 5L3FA 4OPAA 3CRAA 1D2DA 3D36C 4AI8A 2F23A 2HJFC 4X89A 1IXMA 2Z5UA 3CCMV 5C93A 3HKDA 1WJZA 3T1HB 3ML0A 3CJHA 1YTFB 3FYEB 4JTCB 3SPJA 4U7OA 1AILA 4CH6A 3KZIZ 2BTOA 3CCRV 4RUEA 4WFFA 5CA1A 2Q67A 1YVWA 5CBGA 4GT1A 4LR3A 4JI8O 5K1XA 1H8EG 2CH7A 4B7EA 4TSFG 2Q8VA 4WFHA 4RQFA 4KXRA 1S5JA 1Q43A 3ZMSA 1SF9A 3BHPA 3ETGA 3OMAB 4FJCC 3FAVA 4UCOA 1XMOO 2QWPB 4DR2B 1VQ7V 3OEEG 4LF9O 1OCRB 4RAIA 2QWQB 1I94O 1VQ6V 3D36A 2EX3A 4IIJA 4JGSA 1O9HA 4DV5B 2CE4A 4GLXA 3FAVB 4LF4O 1H2NA 5B1NA 4RQEA 1QCEA 4DV6O 3FYIB 1FXKC 4J80A 4FPPA 4YJ3B 1PNMA 2KKWA 3ZRVA 2H3OA 4H37A 3AG3B 5LMUO 2Y4UA 3SYQA 4B3SO 3E83A 1TGOA 4FLZA 4O4JB 5B5EZ 2LFRA 4DW0A 4PDMA 5B1OA 4GKKO 1T5EA 1LR1A 5B3SB 4OXSA 5CBFA 4I0XB 4AQYB 1B3QA 1XL6A 3EFFK 2ZM6B 1FAFA 1URFA 4JI0B 2R72A 1NH2B 3B77A 5J9PC 3BPZA 1Q6HA 4I4TB 4X62O 2XHBA 3ZHQA 2W6IG 1S0VA 3Q4HA 5DM6V 4TV9B 1KUQA 5KMGA 5FNVB 2EIJB 4UB8Z 1R3JC 2VQEB 1AVMA 2JGUA 2W0FC 2WAMA 1BT8A 4H33A 1JJ2U 1WP8A 3HKBB 4AHCA 1F51A 4K8XA 1V55B 3LSQA 1SA0A 2Q0AA 1XHZA 2ADQB 3ZRWB 2IM9A 4MTXA 4DUYO 4MVMA 2CTQA 5KA5A 1VQ5V 1V55C 4E4EA 2ATKC 2WA4A 5LBQA 2UXCO 3BA9A 2EINC 3CE2A 3VQXA 4X9QA 4IYIA 3SPCA 4GKKB 5J2TB 4MTGA 4KFMA 2OTJV 4J9ZB 4HZ3A 1KU9A 3OEHG 3J80N 4TQFA 1XQ8A 1ROPA 4PJ0Z 1OHHG 2V7QG 5LMUB 4K0KB 3H1LH 2DMXA 4FFBB 1YHQV 4DR3B 1M57B 4X1YA 5H2FZ 4UVBA 4DR5B 3G6EV 3IAYA 3GB7C 2P67A 1NU1H 2DQ0A 1OCZB 2V1DA 3ZN0A 3E22B 3G80A 4JZ2A 1AP6A 3F7YC 1G6UA 3U11A 4B08A 1MMMA 4FFBA 4IIJB 4ICGA 3RYIB 1IBMB 3CPWU 1I08A 1NKDA 4HAMA 1WPBA 4LNUB 1QVGU 4J7ZA 3LDDA 4YJ2A 3K3WA 3RYCA 2O57A 1CP9A 4QE9A 5GTIZ 3CC2V 1HW7A 2PI5A 5C8YA 4LF5B 4DUZO 4DR6B 2YDEA 1FFXB 3KKYA 3FX7A 4CBCA 4LBEC 1I5YA 3RVYA 4EEQA 4J41A 3BY6A 3ICXA 2Q7HA 1IBLO 5KAIZ 2NN4A 4O2AB 4NXMB 4X1YB 4MS2A 4FLVA 4PDLA 5B1AB 4BWAA 1NJIW 5JCOA 3ABKC 2UXDO 5IJ0B 2OCCC 1HNXO 1D5AA 4JAAA 3JARB 3VQVA 2VQFB 1N32O 1KKCA 4DK1A 4FLTA 3L75H 2H8PC 1R3KC 1LUWA 1UPGA 2RN9A 1Y66A 4JI4B 3CRCA 3EHBB 1AB3A 5JWPA 3CRQA 1VQKV 2K1EA 3C3SA 3E86A 2ZT9B 1WPXA 2JRIA 1XDCA 2CGOA 4JI3B 4TT3G 2FB5A 1IZ3A 4DUZB 1GN2A 4DR6O 4DV4O 2P90A 3KG2A 3KCXA 5JJJB 1SS3A 3OMIB 4FIPC 3W7TA 3RYHA 3F5WC 4D7SA 4NXMO 1NZ6A 3OE7G 2RDCA 2IJKA 4KHPO 3JARA 5B66Z 2WWWA 4KL1A 3ZJZA 3QO7A 1TVKB 2EIKC 4RWUA 4NKGB 3ABLB 2GDSA 3JAMN 4DV0B 1KECA 1GTOA 2FMLA 2JEXA 3K9AA 4JV5B 2DWDC 4ZBMA 5GONB 4HNAB 2XAGA 3OUFA 3BEHA 2F43G 3OW2U 2HHHB 1K4DC 2YIAA 2PYJA 4GYCB 4TV8B 1ZTEA 4DR1O 2ZIMA 4PDVA 3CWBH 3OGCC 2LGQA 2E3CA 4TUYB 3X2QB 1ZL8A 4YXWG 4QE7A 2OIGA 2WLJA 3K58A 1VQLV 2IU0A 3SPHA 4LF7O 2P7TC 3OD4A 4GCZA 4X64O 4DV5O 3K0DA 2YI9A 3RYFB 1P84F 3CMAV 1XREA 4DV6B 4XDJA 4DR5O 3TK1A 1B6QA 1SA0B 4R7CA 2IH1C 4GKJO 2YEVB 4X1IB 4I55A 1F4MA 1S72V 4O4HB 3JAKB 4JI0O 3QO5A 2ZE5A 1BMFG 4YHHO 2EJRA 3AG7A 2GUZB 5IJ9B 2UXCB 1SERA 1JCHA 3HKEA 4AILC 2MW2B 1OJHA 5CA1B 5CBHA 2AZ0A 4ZI7B 4HYOA 1TA8A 1Q5OA 3CP1A 3ETQA 5LHIA 1VF6C 5LA6B 3ABTA 2YS8A 3ABMB 3ZRSA 2DOSA 5DECA 3UCSC 1X4TA 3O65A 2Y69C 2HG5C 1EFRG 4WF9V 4JI3O 4X88A 1EN4A 3ZRWA 4LFCB 3RVZA 5KAFZ 2VWJA 3APQA 4U3JA 4DV1B 2QM4A 1WP7A
chains in the Genus database with same CATH topology
2EZOA 3ABLC 3K03A 2EIKB 4J9YB 3SYPA 1G8MA 4PA9A 2X0LA 3STLC 1K5SA 1NQTA 1N8RW 3CCRV 4RUEA 1GKFA 4WFFA 2Q67A 3ZCCA 5CBGA 4GT1A 1AR1B 2JJ2G 3OMNB 2X6AA 3QNEA 1H8EG 3AG2C 3T4DA 1AI5A 4MSWC 1PD3A 4TSFG 4WFHA 4BAYA 4RQFA 3JCZA 2ZDIA 2ZXWC 1YSCA 3K04A 5CA3A 3ZMSA 3CMEV 1KC8W 2UXXA 1OCRC 1ZWIC 3ETGA 1JPXA 3T1CA 3E35A 3OMAB 3ZMUA 4PDRA 4UVAA 4FJCC 1V54C 4MT8A 4MTOA 1LNQA 2Q68A 3G71V 1GM8A 1RM1C 1CEZA 1VQ7V 3OEEG 4MVQA 3CXCU 1V54B 1OCRB 4RAIA 5LGTA 3UKMA 1SETA 3SPGA 1PKXA 1VQ6V 3D36A 4JGSA 1NH2D 1EZJA 1E79G 3MD0A 3WG7C 2ZD9A 1RPOA 5B1NA 4MVZA 4RQEA 1QCEA 1NVPB 4N21A 3FYIB 2ZQMA 1FXKC 4JYCA 5H9CA 5B3SC 3H01A 1M90W 4FPPA 2CK3G 3NXSA 3T2MA 1W0KG 1PNMA 3CCEV 3F7VC 1S77D 2EIMB 3FKSG 4P30A 3K79A 3ZRVA 2X6BA 4H37A 3AG3B 3ETDA 4PA7A 4RO2A 4GX0A 5IY5C 3P32A 3FB8C 3SYQA 3E83A 2IU3A 5KA6A 2LP7A 1VQ8V 2Z3YA 2LFRA 1M57C 4GX1A 3JD2A 5IY5B 4P9PA 1GK9A 4PDMA 4G27B 2B5UA 2NLJC 5B1OA 3W7SA 2ZR2A 3UM7A 2YEVA 2IH3C 1AI4A 3CCSV 4QJFB 2IJJA 2A79B 1Q86W 5B3SB 5CBFA 4OXSA 1K97A 2XAQA 3OUSA 4DO2A 4JTAB 2FTKA 3E8HA 5EBWC 5L3EA 4ASUG 2B1GA 1XL6A 1YJNV 5KUKA 1K33A 3EFFK 2DW4A 1FXKA 5L3BA 2DYSC 4I5SA 1NH2B 4TWKA 2GSMB 3B77A 5J9PC 1GM9A 5CMUA 1K34A 2R9IA 3TETA 2EZPA 3IC7A 2W6IG 3MHSC 4WFGA 1S0VA 2DYRB 5DM6V 1QVFU 2JDIG 2D3OW 3T4ZA 3CC4V 3CCLV 2EIJB 1BHAA 5HFMA 1R3JC 1J95A 1YIJV 1GM7A 5LGUA 2W0FC 2WAMA 4BIUA 3B8MA 2EBOA 4F4LA 2QA4V 3CD6V 4H33A 1JJ2U 2WSSG 2AHYA 1Q81W 3JYCA 1F51A 1V55B 2ZXWB 3JD0A 3LSQA 4JTDB 1SRYA 3RW0A 3AG1C 4R6ZA 1G4YB 2C2AA 3DTUB 5EK0A 1PNLA 2QM7A 3ZRWB 5EBMC 3HPLC 4MTXA 1Q82W 4UXNA 5E1AC 4MVMA 4PA4A 1VQNV 2WLLA 1MG1A 3FB7C 5KA5A 1V55C 1NVPD 1VQ5V 4JF3A 4MW3A 2ATKC 1E1RG 3AG1B 2WLHA 1COWG 4XDLA 5LBQA 2EINC 1K9MW 3SPCA 1S76D 2WLIB 4MTGA 1JX9A 4KFMA 4Q20A 3RBZA 2OTJV 4J9ZB 4HZ3A 5LGNA 3OEHG 2HKOA 2YSUB 2LFSA 1ROPA 1OHHG 2A0LA 4LP8A 1OZ0A 2V7QG 1K73W 4QPJA 3AEIA 3ASOC 4PELA 4CZZA 5LHGA 1OCCC 1R6KA 5B1AC 4QNHB 3ZMZA 1F23A 4BIZA 4L87A 1YHQV 2WPDG 5CN0A 1M57B 4UVBA 1L1FA 2AHZA 3G6EV 2PI4A 3GB7C 2P67A 4GX5A 4KUMA 2DQ0A 3OR7C 3CC7V 3QO8A 1YTFD 3ASOB 1I5XA 1OCZB 2V1DA 3E8BA 3E89A 5IYDO 2EIMC 3PJSK 1K92A 3ZN0A 4PA3A 3F7YC 3AG3C 5IYCO 1S3JA 3FB6C 3OFNG 4U7NA 3ZMTA 1M1KW 3IFXA 4MVRA 3K06A 3FB5C 1F4NA 3JD3A 3LDEA 5L3CA 2WLMA 2UXNA 3W7UA 1YITV 1AJNA 1DLBA 3STZC 3CPWU 3M99B 3WFVA 1KKDA 1ORQC 1YJ9V 1NKDA 2KB1A 4HAMA 3SJQC 1CPYA 3K0GA 1QVGU 1ENVA 2JIZG 1JQ0A 3LDDA 3AG4C 2XOKG 3K3WA 4MVSA 1CP9A 1H2GA 1QLEB 4QE9A 2Q6AA 3CCQV 3K08A 3OM3B 3CC2V 2PI5A 2HVKC 2OTLV 5H6QA 3LDCA 4JAVA 5H6RA 1K8AW 2EIJC 4JPRA 4CBCA 2DYSB 4LBEC 2JEUA 1I5YA 2XASA 3RVYA 1OCOB 3SYOA 3ZRXA 1VQOV 3BY6A 1VQ4V 2DQ3A 3E8GA 1FFTB 3AG2B 4E2LA 5B1BC 1JVMA 1RPRA 1BHBA 4G2KA 5IDJA 3P30A 4MS2A 1E1QG 4JASA 3ABMC 1PNKA 4PDLA 5GW7A 1P4RA 1OCCB 3JD1A 2JK5C 1R3IC 5B1AB 1R3LC 2EINB 5IYBO 1NJIW 3B8NA 3ABKC 2XAHA 2MK3A 1QR9A 2X7RB 3LUTB 2OCCC 3X2QC 1EBOA 1DF5A 4FK5C 1TUEB 3SYCA 4UVCA 2OT5A 1K7DA 2ITDC 1AJQA 1K3EA 2H8PC 4MVUA 4FMTA 1R3KC 4P9OA 1AROP 3ASNB 1Y66A 3E2EA 2HR3A 2WLLB 1UJWB 3CCJV 1QLNA 3EHBB 1HWYA 4MW8A 3OR6C 2ITCC 2WLNA 1VQKV 2K1EA 3E86A 3ABUA 1WPXA 4MVOA 2QE7G 1H8HG 2Y48A 2QKSA 5EC2C 4TT3G 4WFAV 3WG7B 2XAJA 1K4CC 2P6JA 1H38A 2P90A 3KG2A 1P7BA 5L3GA 1FXKB 2BOCC 3OMIB 5BZBA 4FIPC 3W7TA 2H94A 2Q69A 4BW5A 3F5WC 4JAUA 2X6CA 5HFLA 5EBLC 3OE7G 3ETEA 1W2BU 2IJKA 1QLEC 4WFEA 1RM1B 2NNUA 3CCVV 2WWWA 3AG4B 1JOYA 3ZJZA 3QO7A 2EIKC 3D3IA 3HB3B 3I56V 1GMGA 2QM8A 2B1IA 2WLIA 1KP2A 3ABLB 1W0JG 1BL8A 4X8AA 1KD1W 1FS0G 1KECA 3ASNC 1GTOA 1PL0A 2JEXA 3K9AA 5EC1C 2XNDG 2DWDC 1NR7A 3OAAG 4ZBMA 3LNMB 3IGAC 2XAGA 4R8CA 1M56B 4RUFA 1MABG 3OUFA 2IJIA 3BEHA 2HLDG 2F43G 3OW2U 1GO3F 1K4DC 4P2ZA 1DTOA 4R50A 3R65A 4LCUC 1WLEA 4PDVA 1AI7A 1SZTA 3W7XA 3OGCC 3TCUA 3SYAA 4I9WA 2OCCB 2ZR3A 5FL7G 3X2QB 3W7WA 4YXWG 4QE7A 1S5HC 3ABKB 1OCZC 1SESA 2WLJA 1Y4MA 1VQLV 1M56C 2IU0A 3SPHA 5L3DA 2P7TC 4GCZA 4ZKIA 4QPKA 2GHYA 3K0DA 3E8FA 4EKWA 4XDKA 4G28B 1R6NA 3JD4A 3CMAV 4PA6A 3VOUA 4WFBV 4KP4A 1OCOC 3ZMVA 1Q7YW 4XDJA 1R73A 5B1BB 3GWOA 3TK1A 3DGEA 1B6QA 4UUJC 4R7CA 2IH1C 1FXVA 1NR1A 2YEVB 3CCUV 4XBFA 1F4MA 1KP3A 2WLKA 2EILB 3ZN1A 1S72V 2DWEC 2IW5A 4WCEV 3QO5A 2QTOA 1BMFG 4N23A 1DF4A 2EJRA 1KQSU 2HFEC 1VQ9V 4LC1A 1AJPA 1SERA 3SPIA 1JCHA 1QBZA 2R9RB 4JYBA 2JJ1G 1QR8A 4UV9A 1THZA 1NBMG 3MHHC 1YJWV 5CBHA 2DYRC 2W6JG 2ZDIC 4GX2A 4Z1MG 3A0RA 2BOBC 4UV8A 1YI2V 2EILC 5L3FA 4HYOA 1K5QA 3CP1A 5LHIA 2M7WA 1XL4A 3ZIAG 3LSSA 3ABTA 3ABMB 2HJFC 1IXMA 2Z5UA 4QIWF 4X89A 3ZRSA 1AI6A 4DXWA 3G4SV 2XAFA 1VQMV 2A9HA 2Y69C 2HG5C 5LHHA 3CYOA 3CCMV 1EFRG 5C93A 4WF9V 4X88A 3VBBA 1MOFA 5DN6G 3ZRWA 1VQPV 3ML0A 3RVZA 1YTFB 1MSWD 2HVJC 5KUMA 1M9NA 3FYEB 4JTCB 4MTFA 3SPJA 2QEXV 4U7OA 1FXHA 2Y69B 3I55V 2IJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE V;  2OTL V;  3CCV V;  1YIT V;  1YHQ V;  5DM6 V;  1VQK V;  1VQ5 V;  1YI2 V;  1VQN V;  3CCS V;  1K8A W;  1KQS U;  1QVF U;  3CPW U;  3CMA V;  2D3O W;  1NJI W;  1N8R W;  3G71 V;  1Q86 W;  3I56 V;  3G6E V;  1K9M W;  4WFB V;  3CCL V;  3CCR V;  1VQ7 V;  1M90 W;  1VQ9 V;  3G4S V;  3CCE V;  4WFA V;  3CXC U;  3CC7 V;  1VQM V;  1YJ9 V;  1YIJ V;  1Q7Y W;  1R73 A;  2QA4 V;  3CCM V;  3CC4 V;  1KD1 W;  3CD6 V;  2OTJ V;  1VQO V;  4WF9 V;  3OW2 U;  1YJN V;  1JJ2 U;  1Q81 W;  1VQ4 V;  3CC2 V;  1QVG U;  1VQ6 V;  1VQP V;  1YJW V;  1VQL V;  3CCU V;  1VQ8 V;  1K73 W;  2QEX V;  3CME V;  1M1K W;  1KC8 W;  3CCJ V;  3I55 V;  1Q82 W;  1W2B U;  3CCQ V;  1S72 V; 
#chains in the Genus database with same CATH topology
 2EZO A;  3T1H O;  2GUZ A;  4UB6 Z;  2RJZ A;  3K03 A;  2EIK B;  4H0L B;  4NTW A;  3SYP A;  1KMI Z;  1G8M A;  1ZX3 A;  3L70 H;  3STL C;  1Z2G A;  2JJ2 G;  1XMO B;  4I55 B;  3T4D A;  2Q9L A;  2YXY A;  4U3J B;  1WA8 B;  3CX5 F;  4BAY A;  4DV7 B;  2YUA A;  3Q4H B;  1N34 B;  2ZDI A;  2OIE A;  4IL6 Z;  4NTX A;  2VRZ A;  1KC8 W;  4JYA O;  2ILM A;  2ZKO A;  4QGP A;  2ZIO A;  1V54 C;  1W59 A;  1N33 B;  4I50 B;  1AR5 A;  3RYF A;  1SQV H;  4LF9 B;  1GM8 A;  1CEZ A;  2E5L B;  3CXC U;  1V54 B;  2JVD A;  3UKM A;  4YHH B;  1KB9 F;  1US6 A;  2QGN A;  3B4S A;  1E79 G;  4Z1V A;  2ZNI A;  4LFC O;  2ZD9 A;  3JSN A;  1RPO A;  4MVZ A;  5K1P A;  1YDX A;  4N21 A;  3BVO A;  1V9P A;  3M7M X;  1L0N H;  2CK3 G;  1NTK H;  2PYL A;  2EIM B;  1DK1 A;  3K79 A;  4DR1 B;  4J42 A;  1XMQ O;  3TXS A;  2X6B A;  3CEI A;  3ETD A;  2LQT A;  5IY5 C;  4GX0 A;  5EZY B;  5KX5 B;  5LMN B;  5KA6 A;  2LP7 A;  4GX1 A;  3JD2 A;  1N34 O;  4UCR A;  2ZR2 A;  1AI4 A;  1XNQ B;  3N2G A;  4CH5 A;  1K97 A;  4D6T H;  1BQ0 A;  1NI8 A;  4DO2 A;  4FLY A;  2FTK A;  4ASU G;  1K33 A;  2DW4 A;  2DYS C;  5JQG A;  5EYP A;  2GSM B;  2P5O A;  3TET A;  1PP9 H;  3IC7 A;  3OT7 A;  3CRR A;  4JI1 O;  2DYR B;  1FFX A;  3T4Z A;  1ZL8 B;  2N05 A;  5KHI A;  1GM7 A;  5LGU A;  4F4L A;  4BIU A;  2QWR B;  3CD6 V;  5D5P A;  4CH4 A;  1Q81 W;  4LFA B;  3JYC A;  4FFK A;  4X20 A;  2ZXW B;  3JD0 A;  4ZHQ A;  2ZNJ A;  4W4L A;  2UXB O;  3S3X A;  2C2A A;  3DTU B;  3T1Y B;  1HR0 O;  5EBM C;  3HPL C;  2AGA A;  5E1A C;  1MG1 A;  2RQ6 A;  4LF6 O;  3AK2 A;  1E1R G;  3LNN A;  4XDL A;  1K9M W;  1XNQ O;  3BFR A;  4F6R A;  2ZCE A;  4PV1 B;  3RYI A;  1D5N A;  4DW1 A;  1TVK A;  2HKO A;  2UUC B;  3JSL A;  2L35 A;  2LFS A;  2A0L A;  1K73 W;  1OZ0 A;  4O4I A;  5IYZ B;  3ASO C;  4PEL A;  1XOU A;  1OCC C;  1Y76 A;  4QNH B;  3RYH B;  4L87 A;  2WPD G;  4KUM A;  3CC7 V;  3QO8 A;  4X20 B;  3ASO B;  1NTZ H;  1YTF D;  2PZS A;  4FLU A;  1G1X B;  1BE3 H;  3PJS K;  1K92 A;  4TUY A;  4I9Q A;  5JQG B;  5ITZ B;  2D2C B;  4UCU A;  4LFA O;  1M1K W;  4MVR A;  2P4K A;  3FB5 C;  1F4N A;  3K06 A;  5LYJ B;  1IX9 A;  1AR4 A;  2PY5 A;  4DR2 O;  3STZ C;  3M99 B;  1N36 B;  4NVP A;  3H1I H;  2OCH A;  1YJ9 V;  1H2L A;  3DC6 A;  5LP6 A;  2E76 B;  5AG2 A;  2GBO A;  1ENV A;  3UT5 A;  5JVD A;  1M5I A;  2XOK G;  4MVS A;  1H2G A;  1QLE B;  4L8J A;  1M93 A;  4X66 O;  2A7W A;  3K08 A;  3QF7 A;  4GZR B;  2HVK C;  1BGY H;  2OTL V;  4O2B A;  2QJ1 A;  3LDC A;  4JAV A;  2EIJ C;  4JPR A;  1FD9 A;  2CH7 B;  1JR9 A;  3RT3 C;  4NR1 A;  1OCO B;  3ZRX A;  5BMV B;  2DQ3 A;  3CXH F;  2OWO A;  5LOV A;  4IYH A;  4YJ2 B;  3E8G A;  1Q6I A;  3AG2 B;  1JVM A;  1NTM H;  4G2K A;  3ZHR A;  5IDJ A;  5FPO A;  5IT9 N;  3ABM C;  5GW7 A;  5EYP B;  1P4R A;  4YY3 O;  3JD1 A;  2JK5 C;  1R3L C;  2EIN B;  3B8N A;  2N04 A;  1HNX B;  2MK3 A;  1UFI A;  3BA8 A;  2X7R B;  3X2Q C;  2JS3 A;  1EBO A;  1SQQ H;  5KHH A;  2W0X A;  4UFZ A;  4UVC A;  2OT5 A;  2ITD C;  4OX9 O;  4MVU A;  5CA0 A;  2E75 B;  1MZE A;  2LGW A;  3E2E A;  2WLL B;  3CCJ V;  3BAB A;  3RGB A;  1FKA O;  1HWY A;  2YIC A;  3OR6 C;  2OYQ A;  4FLW A;  2YXH A;  2VQE O;  2A06 H;  4WFA V;  3AK1 A;  3S3W A;  1P7B A;  3UT5 B;  5L3G A;  2CTW A;  5BZB A;  4BW5 A;  4JAU A;  3L71 H;  4LFB O;  5HFL A;  3AG4 B;  1IXB A;  4ZOL B;  3HB3 B;  3I56 V;  2GV9 A;  2QM8 A;  1HNW O;  2B1I A;  2WLI A;  3NR7 A;  1W0J G;  1BL8 A;  4FM1 A;  4X8A A;  3ASN C;  4LH6 A;  2UUA O;  2XND G;  1VIB A;  4JI2 B;  1HDJ A;  5BR8 B;  4JYY A;  1Q6U A;  4R8C A;  3WU2 Z;  1HNZ O;  1MAB G;  1PV0 A;  4J7K A;  3CRM A;  1GO3 F;  2R70 A;  4P2Z A;  1AI7 A;  4B3M O;  1SQG A;  3TXQ A;  4O4H A;  3E22 A;  4TV8 A;  1N36 O;  2DE0 X;  2OCC B;  3W7W A;  4B3R O;  1S5H C;  3ABK B;  3K5N A;  4TQD A;  1OCZ C;  1SES A;  3L72 H;  2LW7 A;  5EIB C;  2ZE7 A;  4UCT A;  4DR4 O;  3UO3 A;  3B2E E;  4CC6 A;  4EKW A;  4LF7 B;  4G28 B;  4DRX A;  1R6N A;  4EB6 A;  2L6L A;  4KP4 A;  2F1M A;  4B3T B;  1N33 O;  1XHX A;  2QSA A;  1R1B A;  4UUJ C;  3U10 A;  4ZHQ B;  3AK3 A;  1FXV A;  1NR1 A;  2UXB B;  4DV7 O;  2HEP A;  2DWE C;  4LWS B;  2IW5 A;  4WCE V;  3R66 A;  2QTO A;  1DF4 A;  5A2Q N;  1VQ9 V;  3DC5 A;  1EM1 A;  4J11 A;  3ZED A;  3SPI A;  4JYB A;  1TUB A;  3THO A;  1NBM G;  1YJW V;  1NS1 A;  2ZDI C;  5DED A;  4ZIB A;  1IBM O;  4Z1M G;  5BY1 A;  3HKC B;  1Y76 B;  1YI2 V;  1K5Q A;  2M7W A;  3ZIA G;  1XEQ A;  4QIW F;  1AI6 A;  1VQM V;  1B04 A;  2PGG A;  2A9H A;  2FKX A;  5LP6 C;  4JI7 O;  4BR6 A;  1VQP V;  3H1J H;  2HVJ C;  5KUM A;  4DV1 O;  4JI6 O;  3HR0 A;  3I55 V;  4B3S B;  2IJH A;  2UUC O;  1FYJ A;  1ZUQ A;  4J9Y B;  4PA9 A;  1NQT A;  3ZHV A;  5BMV A;  3RWR D;  2BCC H;  1Y74 A;  3ZCC A;  4LF6 B;  3SJB C;  1Y74 B;  3AG2 C;  1AI5 A;  4MSW C;  3JCZ A;  2ZE8 A;  1PL4 A;  1XUQ A;  2ZXW C;  4B7K A;  4DUY B;  2JS5 A;  5BR8 O;  1OCR C;  3E35 A;  3ZMU A;  4PDR A;  2YIB D;  4UVA A;  3C90 A;  3EXA A;  1BCC H;  5IWA O;  5IYZ A;  3G6B A;  4MT8 A;  3JAW B;  1LNQ A;  2Q68 A;  3G71 V;  4MVQ A;  3QG5 A;  5LGT A;  1ZLZ A;  3SPG A;  2HJD A;  3JAL B;  1WA8 A;  3JAT A;  4OX9 B;  3WG7 C;  5KHK A;  4DV2 O;  2R9A A;  4JYC A;  5H9C A;  4DK0 A;  4AQY O;  3H01 A;  3T2M A;  1W0K G;  3FD9 A;  3CCE V;  2N74 A;  3FKS G;  4YY3 B;  4P30 A;  5JH7 A;  4X64 B;  4RO2 A;  4JI4 O;  4PI0 A;  2IU3 A;  3WB2 A;  2CGN A;  1VQ8 V;  2Z3Y A;  3H1K H;  3K5M A;  2K9P A;  1GK9 A;  2EJ7 A;  2GTS A;  5KLV H;  1WB7 A;  1BSM A;  2NLJ C;  3QTC A;  3W7S A;  2IH3 C;  3CCS V;  3MDS A;  4QJF B;  2IJJ A;  2PF4 E;  2A79 B;  1L0L H;  1U96 A;  1GN4 A;  2XAQ A;  3OUS A;  2UU9 B;  1SQB H;  4UCS A;  4B3M B;  2F95 B;  5H5N A;  5KUK A;  1HR0 B;  1FXK A;  5L3B A;  3BRC A;  1QNM A;  1O9G A;  1SZX A;  1GM9 A;  5CMU A;  1K34 A;  2EZP A;  3MHS C;  3ZX6 A;  1TAE A;  3T1Y O;  2Q7G A;  4ABM A;  3MAQ A;  3HKC A;  1QVF U;  2D3O W;  3P3P A;  2B9Z A;  3CCL V;  1BHA A;  5HFM A;  4FM0 A;  1IUR A;  1YIJ V;  1TUB B;  2LO1 A;  3B8M A;  1EN6 A;  2EBO A;  2AHY A;  2AXT Z;  1J5E B;  4JTD B;  4LF4 B;  3RW0 A;  3AG1 C;  4R6Z A;  1PNL A;  2A3Q A;  4LWS A;  1GAX A;  1VQN V;  1NVP D;  3IJ4 A;  4MW3 A;  3K5O A;  3AG1 B;  2WLH A;  1RSO A;  2Q4P A;  2WLI B;  1JX9 A;  5IE9 A;  1L8D A;  5LGN A;  2FYU H;  2YID A;  2YI8 A;  4LP8 A;  4CS4 A;  3GVM A;  3C3T A;  3ZMZ A;  1F23 A;  4BIZ A;  2FL4 A;  4TV9 A;  3ZHT A;  5FLX N;  1M4U A;  1L1F A;  2AHZ A;  5JCO C;  4GX5 A;  1I5X A;  3E8B A;  3E89 A;  4X65 B;  5FPR A;  2EIM C;  3N2K B;  3U0Z A;  3A8T A;  2F93 B;  1S3J A;  4J10 A;  4JI5 B;  1Y67 A;  3IFX A;  1HNZ B;  4K3A A;  3JD3 A;  2UXN A;  4I4T A;  3W7U A;  1YIT V;  1N0N A;  1DLB A;  1KKD A;  5LYJ A;  2F4V O;  3APO A;  2WA3 A;  4O4J A;  2CTP A;  2Y0P A;  1JQ0 A;  5ITZ A;  3AG4 C;  2GTA A;  4X66 B;  5D5Q A;  3O9O A;  4OPH A;  2Q6A A;  1Q90 D;  2LJ2 A;  2JGD A;  3CCQ V;  1VF6 A;  5H6R A;  3WB1 A;  4GUN A;  2QDO A;  2ETN A;  1F7Y A;  4O2B B;  4NXN B;  3SYO A;  2KG7 A;  2Y4T A;  4KHP B;  3H9V A;  5B1B C;  5GON A;  1RPR A;  1BHB A;  4JI5 O;  3D8C A;  3P30 A;  4JAS A;  1PNK A;  1OCC B;  1R3I C;  1PM9 A;  3PN1 A;  4C7U A;  1QR9 A;  5CA0 B;  4K8Z A;  4DR3 O;  4W4K A;  3JAL A;  3UO2 A;  3P3N A;  3SYC A;  1AJQ A;  1YZB A;  4P9O A;  1LUV A;  1ARO P;  1EN5 A;  3ASN B;  1IBK B;  1UJW B;  1QLN A;  4YIO A;  1J5E O;  1B06 A;  4U3F H;  4MW8 A;  3RFR A;  2WLN A;  1CXZ B;  3ABU A;  4BW9 A;  1H8H G;  2Y48 A;  2QKS A;  5EC2 C;  1K4C C;  2P6J A;  1HNW B;  1Z5V A;  5FNV A;  2HHH O;  5EBL C;  1W2B U;  4OGQ B;  1QLE C;  4WFE A;  3K57 A;  1QQC A;  1YCI A;  2Q7E A;  2NNU A;  3CCV V;  1JOY A;  1RP3 B;  1FPO A;  3D3I A;  1GMG A;  4F6E A;  4DV3 O;  5BXZ A;  2KQX A;  1PL0 A;  5IJ0 A;  1NR7 A;  3OAA G;  1MNG A;  2PTM A;  3LNM B;  4H44 B;  1M56 B;  4RUF A;  2IJI A;  3B09 A;  1Q3E A;  2ADP A;  1MA1 A;  1DTO A;  4R50 A;  3R65 A;  1H2K A;  4LCU C;  1WLE A;  3CS5 A;  3A2F A;  1SZT A;  3TCU A;  2VQF O;  3DXR B;  1Q8I A;  4DV2 B;  2ZR3 A;  4JZG A;  3CHX A;  1Y4M A;  2CUG A;  4JI7 B;  4ZKI A;  4QPK A;  5A9G A;  2PUS A;  2GHY A;  1RSO B;  5CB4 B;  4JI6 B;  1N0J A;  1GN3 A;  4Z2W A;  1SKV A;  4I50 A;  4LNU A;  4PA6 A;  3VOU A;  3J7A U;  3EVK A;  3ZMV A;  4PHZ A;  1Q7Y W;  5B1B B;  2G38 A;  2XTA A;  1JA8 A;  1SQX H;  3G67 A;  1PPJ H;  4WBN B;  1YEW A;  3CCU V;  4XBF A;  3JAW A;  5EZY A;  1KP3 A;  2WLK A;  5KX5 A;  3BAA A;  1XBL A;  3ZS8 C;  1OV9 A;  4N23 A;  3N2K A;  1KQS U;  2HFE C;  4JV5 O;  5IWA B;  4LC1 A;  1EZV H;  4JYA B;  2JJ1 G;  4TOI A;  3MHH C;  2DYR C;  2W6J G;  1XNR B;  1WNS A;  2BOB C;  1SQP H;  2P22 C;  2EIL C;  4Q6G A;  2RMK B;  1XL4 A;  3LSS A;  1VF5 B;  5F2V O;  4DXW A;  3CJH B;  3G4S V;  2V4D A;  2XAF A;  2RCV A;  1IVS A;  4HBN A;  5LHH A;  3CYO A;  2NR5 A;  3SR2 C;  3ZHU A;  3VBB A;  1MOF A;  5DN6 G;  1MSW D;  3K59 A;  3N2G B;  1M9N A;  4MTF A;  5LXT A;  4ZOL A;  2QEX V;  1FXH A;  2Y69 B;  4G27 B;  3ABL C;  3SJC C;  4LH7 A;  2X0L A;  1XMQ B;  1K5S A;  1N8R W;  3K5L A;  1P7G A;  2KG7 B;  4UCV A;  1GKF A;  3TGU H;  2F66 C;  3OTO O;  1AR1 B;  3OMN B;  4O4I B;  1QU7 A;  2X6A A;  3QNE A;  3VQW A;  1BQZ A;  4PD4 F;  1PD3 A;  3DSQ A;  3GWK C;  1VMG A;  2ZE6 A;  1YSC A;  3K04 A;  5CA3 A;  4CH3 A;  3CME V;  2JGD B;  2UXX A;  1ZWI C;  3T1C A;  1JPX A;  3FFQ A;  4MTO A;  1RM1 C;  2UUA B;  5GTH Z;  4JI2 O;  4IHJ B;  4IGG A;  1U97 A;  1SET A;  1PKX A;  5KHJ A;  5LOV B;  1VP7 A;  4X1K A;  1NH2 D;  1EZJ A;  3IC9 A;  4DRX B;  5J2U A;  3MD0 A;  1WB8 A;  3HKE B;  4FZ0 A;  1NVP B;  2ZQM A;  1P49 A;  5B3S C;  1M90 W;  3NXS A;  2Z0A A;  3F7V C;  1S77 D;  3D3Q A;  3WB0 A;  5IJ9 A;  4YJ3 A;  2M6Y A;  1WN7 A;  4PA7 A;  3P32 A;  3FB8 C;  2AW9 A;  4DR4 B;  1M57 C;  5IY5 B;  4P9P A;  2Q0O C;  1KYO F;  2B5U A;  4WBN A;  3UM7 A;  2YEV A;  1Q86 W;  4JTA B;  3A0B Z;  3E8H A;  5EBW C;  5L3E A;  4IT5 A;  1IDS A;  2B1G A;  1YJN V;  1X59 A;  5JJE B;  2AZ2 A;  4I5S A;  4TWK A;  1VAR A;  2DN9 A;  3N27 A;  5LA6 A;  2R9I A;  2E74 B;  1Z5W A;  4WFG A;  4FVM A;  3DXR A;  2UUB O;  3ZHS A;  1WAZ A;  1JJO A;  2JDI G;  3TJT A;  1XIL A;  4CS2 A;  3CC4 V;  2BSK A;  1I94 B;  1AP5 A;  1J95 A;  2QA4 V;  2E5L O;  1GH6 A;  2WSS G;  5KMG B;  3K9S A;  1SRY A;  1G4Y B;  5EK0 A;  2ZM6 O;  2QM7 A;  1Q82 W;  3B40 A;  4F6R B;  4UXN A;  4FM2 A;  4PA4 A;  2WLL A;  3FB7 C;  4HNA A;  4JF3 A;  4JI8 B;  3HKD B;  1COW G;  1N4C A;  4H13 B;  3SDL A;  1FJG B;  3J81 N;  1S76 D;  4Q20 A;  3RBZ A;  4O2A A;  1R6T A;  2YSU B;  3L74 H;  2Q5Z A;  3ZBH A;  2Q73 A;  5LMN O;  4QPJ A;  3AEI A;  4CZZ A;  5LHG A;  5B1A C;  1R6K A;  2ARH A;  4NTY A;  5CN0 A;  3LSU A;  2PI4 A;  3OR7 C;  5IYD O;  2EUL A;  1QHT A;  3UQ8 A;  2BE3 A;  4PA3 A;  3AG3 C;  2P4V A;  5IYC O;  3FB6 C;  1VEW A;  3L9D A;  3OFN G;  4U7N A;  3ZMT A;  1A32 A;  3LDE A;  1JFF A;  5L3C A;  2WLM A;  1AJN A;  3JAS B;  3CSX A;  3WFV A;  2F4V B;  4EB6 B;  1ORQ C;  1H2M A;  2KB1 A;  1JMK C;  3SJQ C;  4PI2 A;  1CPY A;  3K0G A;  3RN4 A;  2CTR A;  2JIZ G;  4DR7 B;  4LFB B;  1KBH A;  3H1H H;  3L73 H;  3JAS A;  4GKJ B;  3OM3 B;  3KCY A;  1JFF B;  5H6Q A;  3F5T A;  1K8A W;  2DYS B;  1S5L Z;  2JEU A;  2XAS A;  4JI1 B;  2QWN B;  4X1I A;  5C8Y B;  3OTO B;  1VQO V;  1VQ4 V;  4D7T A;  4X1K B;  2P06 A;  1XI1 A;  1RFY A;  1FFT B;  4E2L A;  1IBK O;  1E1Q G;  4IHJ A;  2RNB A;  2YIB A;  5IYB O;  4I0X A;  4B3T O;  2XAH A;  3I5D A;  3LUT B;  1ZSP A;  2UXD B;  1DF5 A;  4FK5 C;  4YIP A;  1TUE B;  4LF5 O;  1K7D A;  4K0K O;  4O4L B;  4ZI7 A;  1K3E A;  1BZK A;  4BIO A;  4FMT A;  2LW1 A;  3A0H Z;  5E79 Z;  2HR3 A;  4FZ1 A;  1IBL B;  3OGI B;  2ITC C;  5TIS Z;  2IBZ H;  4MVO A;  3SJA C;  2QE7 G;  4A5U B;  4DYL A;  3WG7 B;  5JJN B;  1I0H A;  2XAJ A;  3OTF A;  5LXT B;  3JAK A;  1H38 A;  4I7Z B;  5JVD B;  1FXK B;  2QR4 A;  2BOC C;  2BSK B;  2H94 A;  2Q69 A;  1YXB A;  4NB5 A;  2CAZ C;  2X6C A;  3ETE A;  4DR7 O;  4J7J A;  1YF2 A;  1RM1 B;  1GN6 A;  1I7F A;  5J2T A;  1XNR O;  4X65 O;  4DV0 O;  3RYC B;  4O4L A;  4DV3 B;  2UUB B;  4DV4 B;  1KP2 A;  2QKA A;  2XT9 A;  1KD1 W;  1FS0 G;  5EC1 C;  2HP8 A;  3IGA C;  3CB2 A;  3SGI A;  4EFB A;  2HLD G;  2UU9 O;  2Y0I A;  2BTQ B;  4CS3 A;  3HKB A;  3QVN A;  1BS3 A;  3W7X A;  1N32 B;  3SYA A;  2ZIN A;  1ZAU A;  1SC5 B;  2VS0 A;  4I9W A;  3JCU Z;  3BCC H;  5FL7 G;  4FLX A;  2QWO B;  2KSD A;  4EFE A;  5LL6 Y;  2BTQ A;  4LF8 B;  2QKC A;  1M56 C;  2QTS A;  5L3D A;  5LP6 B;  3VQY A;  3E8F A;  2XUM A;  1MSD A;  4XDK A;  5J2U B;  1Y6X A;  3JD4 A;  4WFB V;  1OCO C;  1GRJ A;  1VF7 A;  1FJG O;  1R73 A;  3GWO A;  4K35 A;  1MZF A;  3DGE A;  4CC5 A;  5KHG A;  4NYK A;  1DGS A;  2EIL B;  3ZN1 A;  5JH7 B;  1H2S B;  5CB4 A;  1SQF A;  2YC0 A;  4NXN O;  1AJP A;  2ODM A;  1QBZ A;  2R9R B;  2VWK A;  1NT2 B;  1QR8 A;  2YXL A;  4UV9 A;  1THZ A;  3M8A A;  2DJV A;  4X62 B;  5EIB D;  4LF8 O;  4GX2 A;  2CDY A;  3A0R A;  3JAT B;  4B3R B;  4UV8 A;  1HP8 A;  5L3F A;  4OPA A;  3CRA A;  1D2D A;  3D36 C;  4AI8 A;  2F23 A;  2HJF C;  4X89 A;  1IXM A;  2Z5U A;  3CCM V;  5C93 A;  3HKD A;  1WJZ A;  3T1H B;  3ML0 A;  3CJH A;  1YTF B;  3FYE B;  4JTC B;  3SPJ A;  4U7O A;  1AIL A;  4CH6 A;  3KZI Z;  2BTO A;  3CCR V;  4RUE A;  4WFF A;  5CA1 A;  2Q67 A;  1YVW A;  5CBG A;  4GT1 A;  4LR3 A;  4JI8 O;  5K1X A;  1H8E G;  2CH7 A;  4B7E A;  4TSF G;  2Q8V A;  4WFH A;  4RQF A;  4KXR A;  1S5J A;  1Q43 A;  3ZMS A;  1SF9 A;  3BHP A;  3ETG A;  3OMA B;  4FJC C;  3FAV A;  4UCO A;  1XMO O;  2QWP B;  4DR2 B;  1VQ7 V;  3OEE G;  4LF9 O;  1OCR B;  4RAI A;  2QWQ B;  1I94 O;  1VQ6 V;  3D36 A;  2EX3 A;  4IIJ A;  4JGS A;  1O9H A;  4DV5 B;  2CE4 A;  4GLX A;  3FAV B;  4LF4 O;  1H2N A;  5B1N A;  4RQE A;  1QCE A;  4DV6 O;  3FYI B;  1FXK C;  4J80 A;  4FPP A;  4YJ3 B;  1PNM A;  2KKW A;  3ZRV A;  2H3O A;  4H37 A;  3AG3 B;  5LMU O;  2Y4U A;  3SYQ A;  4B3S O;  3E83 A;  1TGO A;  4FLZ A;  4O4J B;  5B5E Z;  2LFR A;  4DW0 A;  4PDM A;  5B1O A;  4GKK O;  1T5E A;  1LR1 A;  5B3S B;  4OXS A;  5CBF A;  4I0X B;  4AQY B;  1B3Q A;  1XL6 A;  3EFF K;  2ZM6 B;  1FAF A;  1URF A;  4JI0 B;  2R72 A;  1NH2 B;  3B77 A;  5J9P C;  3BPZ A;  1Q6H A;  4I4T B;  4X62 O;  2XHB A;  3ZHQ A;  2W6I G;  1S0V A;  3Q4H A;  5DM6 V;  4TV9 B;  1KUQ A;  5KMG A;  5FNV B;  2EIJ B;  4UB8 Z;  1R3J C;  2VQE B;  1AVM A;  2JGU A;  2W0F C;  2WAM A;  1BT8 A;  4H33 A;  1JJ2 U;  1WP8 A;  3HKB B;  4AHC A;  1F51 A;  4K8X A;  1V55 B;  3LSQ A;  1SA0 A;  2Q0A A;  1XHZ A;  2ADQ B;  3ZRW B;  2IM9 A;  4MTX A;  4DUY O;  4MVM A;  2CTQ A;  5KA5 A;  1VQ5 V;  1V55 C;  4E4E A;  2ATK C;  2WA4 A;  5LBQ A;  2UXC O;  3BA9 A;  2EIN C;  3CE2 A;  3VQX A;  4X9Q A;  4IYI A;  3SPC A;  4GKK B;  5J2T B;  4MTG A;  4KFM A;  2OTJ V;  4J9Z B;  4HZ3 A;  1KU9 A;  3OEH G;  3J80 N;  4TQF A;  1XQ8 A;  1ROP A;  4PJ0 Z;  1OHH G;  2V7Q G;  5LMU B;  4K0K B;  3H1L H;  2DMX A;  4FFB B;  1YHQ V;  4DR3 B;  1M57 B;  4X1Y A;  5H2F Z;  4UVB A;  4DR5 B;  3G6E V;  3IAY A;  3GB7 C;  2P67 A;  1NU1 H;  2DQ0 A;  1OCZ B;  2V1D A;  3ZN0 A;  3E22 B;  3G80 A;  4JZ2 A;  1AP6 A;  3F7Y C;  1G6U A;  3U11 A;  4B08 A;  1MMM A;  4FFB A;  4IIJ B;  4ICG A;  3RYI B;  1IBM B;  3CPW U;  1I08 A;  1NKD A;  4HAM A;  1WPB A;  4LNU B;  1QVG U;  4J7Z A;  3LDD A;  4YJ2 A;  3K3W A;  3RYC A;  2O57 A;  1CP9 A;  4QE9 A;  5GTI Z;  3CC2 V;  1HW7 A;  2PI5 A;  5C8Y A;  4LF5 B;  4DUZ O;  4DR6 B;  2YDE A;  1FFX B;  3KKY A;  3FX7 A;  4CBC A;  4LBE C;  1I5Y A;  3RVY A;  4EEQ A;  4J41 A;  3BY6 A;  3ICX A;  2Q7H A;  1IBL O;  5KAI Z;  2NN4 A;  4O2A B;  4NXM B;  4X1Y B;  4MS2 A;  4FLV A;  4PDL A;  5B1A B;  4BWA A;  1NJI W;  5JCO A;  3ABK C;  2UXD O;  5IJ0 B;  2OCC C;  1HNX O;  1D5A A;  4JAA A;  3JAR B;  3VQV A;  2VQF B;  1N32 O;  1KKC A;  4DK1 A;  4FLT A;  3L75 H;  2H8P C;  1R3K C;  1LUW A;  1UPG A;  2RN9 A;  1Y66 A;  4JI4 B;  3CRC A;  3EHB B;  1AB3 A;  5JWP A;  3CRQ A;  1VQK V;  2K1E A;  3C3S A;  3E86 A;  2ZT9 B;  1WPX A;  2JRI A;  1XDC A;  2CGO A;  4JI3 B;  4TT3 G;  2FB5 A;  1IZ3 A;  4DUZ B;  1GN2 A;  4DR6 O;  4DV4 O;  2P90 A;  3KG2 A;  3KCX A;  5JJJ B;  1SS3 A;  3OMI B;  4FIP C;  3W7T A;  3RYH A;  3F5W C;  4D7S A;  4NXM O;  1NZ6 A;  3OE7 G;  2RDC A;  2IJK A;  4KHP O;  3JAR A;  5B66 Z;  2WWW A;  4KL1 A;  3ZJZ A;  3QO7 A;  1TVK B;  2EIK C;  4RWU A;  4NKG B;  3ABL B;  2GDS A;  3JAM N;  4DV0 B;  1KEC A;  1GTO A;  2FML A;  2JEX A;  3K9A A;  4JV5 B;  2DWD C;  4ZBM A;  5GON B;  4HNA B;  2XAG A;  3OUF A;  3BEH A;  2F43 G;  3OW2 U;  2HHH B;  1K4D C;  2YIA A;  2PYJ A;  4GYC B;  4TV8 B;  1ZTE A;  4DR1 O;  2ZIM A;  4PDV A;  3CWB H;  3OGC C;  2LGQ A;  2E3C A;  4TUY B;  3X2Q B;  1ZL8 A;  4YXW G;  4QE7 A;  2OIG A;  2WLJ A;  3K58 A;  1VQL V;  2IU0 A;  3SPH A;  4LF7 O;  2P7T C;  3OD4 A;  4GCZ A;  4X64 O;  4DV5 O;  3K0D A;  2YI9 A;  3RYF B;  1P84 F;  3CMA V;  1XRE A;  4DV6 B;  4XDJ A;  4DR5 O;  3TK1 A;  1B6Q A;  1SA0 B;  4R7C A;  2IH1 C;  4GKJ O;  2YEV B;  4X1I B;  4I55 A;  1F4M A;  1S72 V;  4O4H B;  3JAK B;  4JI0 O;  3QO5 A;  2ZE5 A;  1BMF G;  4YHH O;  2EJR A;  3AG7 A;  2GUZ B;  5IJ9 B;  2UXC B;  1SER A;  1JCH A;  3HKE A;  4AIL C;  2MW2 B;  1OJH A;  5CA1 B;  5CBH A;  2AZ0 A;  4ZI7 B;  4HYO A;  1TA8 A;  1Q5O A;  3CP1 A;  3ETQ A;  5LHI A;  1VF6 C;  5LA6 B;  3ABT A;  2YS8 A;  3ABM B;  3ZRS A;  2DOS A;  5DEC A;  3UCS C;  1X4T A;  3O65 A;  2Y69 C;  2HG5 C;  1EFR G;  4WF9 V;  4JI3 O;  4X88 A;  1EN4 A;  3ZRW A;  4LFC B;  3RVZ A;  5KAF Z;  2VWJ A;  3APQ A;  4U3J A;  4DV1 B;  2QM4 A;  1WP7 A; 
#chains in the Genus database with same CATH homology
 2EZO A;  3ABL C;  3K03 A;  2EIK B;  4J9Y B;  3SYP A;  1G8M A;  4PA9 A;  2X0L A;  3STL C;  1K5S A;  1NQT A;  1N8R W;  3CCR V;  4RUE A;  1GKF A;  4WFF A;  2Q67 A;  3ZCC A;  5CBG A;  4GT1 A;  1AR1 B;  2JJ2 G;  3OMN B;  2X6A A;  3QNE A;  1H8E G;  3AG2 C;  3T4D A;  1AI5 A;  4MSW C;  1PD3 A;  4TSF G;  4WFH A;  4BAY A;  4RQF A;  3JCZ A;  2ZDI A;  2ZXW C;  1YSC A;  3K04 A;  5CA3 A;  3ZMS A;  3CME V;  1KC8 W;  2UXX A;  1OCR C;  1ZWI C;  3ETG A;  1JPX A;  3T1C A;  3E35 A;  3OMA B;  3ZMU A;  4PDR A;  4UVA A;  4FJC C;  1V54 C;  4MT8 A;  4MTO A;  1LNQ A;  2Q68 A;  3G71 V;  1GM8 A;  1RM1 C;  1CEZ A;  1VQ7 V;  3OEE G;  4MVQ A;  3CXC U;  1V54 B;  1OCR B;  4RAI A;  5LGT A;  3UKM A;  1SET A;  3SPG A;  1PKX A;  1VQ6 V;  3D36 A;  4JGS A;  1NH2 D;  1EZJ A;  1E79 G;  3MD0 A;  3WG7 C;  2ZD9 A;  1RPO A;  5B1N A;  4MVZ A;  4RQE A;  1QCE A;  1NVP B;  4N21 A;  3FYI B;  2ZQM A;  1FXK C;  4JYC A;  5H9C A;  5B3S C;  3H01 A;  1M90 W;  4FPP A;  2CK3 G;  3NXS A;  3T2M A;  1W0K G;  1PNM A;  3CCE V;  3F7V C;  1S77 D;  2EIM B;  3FKS G;  4P30 A;  3K79 A;  3ZRV A;  2X6B A;  4H37 A;  3AG3 B;  3ETD A;  4PA7 A;  4RO2 A;  4GX0 A;  5IY5 C;  3P32 A;  3FB8 C;  3SYQ A;  3E83 A;  2IU3 A;  5KA6 A;  2LP7 A;  1VQ8 V;  2Z3Y A;  2LFR A;  1M57 C;  4GX1 A;  3JD2 A;  5IY5 B;  4P9P A;  1GK9 A;  4PDM A;  4G27 B;  2B5U A;  2NLJ C;  5B1O A;  3W7S A;  2ZR2 A;  3UM7 A;  2YEV A;  2IH3 C;  1AI4 A;  3CCS V;  4QJF B;  2IJJ A;  2A79 B;  1Q86 W;  5B3S B;  5CBF A;  4OXS A;  1K97 A;  2XAQ A;  3OUS A;  4DO2 A;  4JTA B;  2FTK A;  3E8H A;  5EBW C;  5L3E A;  4ASU G;  2B1G A;  1XL6 A;  1YJN V;  5KUK A;  1K33 A;  3EFF K;  2DW4 A;  1FXK A;  5L3B A;  2DYS C;  4I5S A;  1NH2 B;  4TWK A;  2GSM B;  3B77 A;  5J9P C;  1GM9 A;  5CMU A;  1K34 A;  2R9I A;  3TET A;  2EZP A;  3IC7 A;  2W6I G;  3MHS C;  4WFG A;  1S0V A;  2DYR B;  5DM6 V;  1QVF U;  2JDI G;  2D3O W;  3T4Z A;  3CC4 V;  3CCL V;  2EIJ B;  1BHA A;  5HFM A;  1R3J C;  1J95 A;  1YIJ V;  1GM7 A;  5LGU A;  2W0F C;  2WAM A;  4BIU A;  3B8M A;  2EBO A;  4F4L A;  2QA4 V;  3CD6 V;  4H33 A;  1JJ2 U;  2WSS G;  2AHY A;  1Q81 W;  3JYC A;  1F51 A;  1V55 B;  2ZXW B;  3JD0 A;  3LSQ A;  4JTD B;  1SRY A;  3RW0 A;  3AG1 C;  4R6Z A;  1G4Y B;  2C2A A;  3DTU B;  5EK0 A;  1PNL A;  2QM7 A;  3ZRW B;  5EBM C;  3HPL C;  4MTX A;  1Q82 W;  4UXN A;  5E1A C;  4MVM A;  4PA4 A;  1VQN V;  2WLL A;  1MG1 A;  3FB7 C;  5KA5 A;  1V55 C;  1NVP D;  1VQ5 V;  4JF3 A;  4MW3 A;  2ATK C;  1E1R G;  3AG1 B;  2WLH A;  1COW G;  4XDL A;  5LBQ A;  2EIN C;  1K9M W;  3SPC A;  1S76 D;  2WLI B;  4MTG A;  1JX9 A;  4KFM A;  4Q20 A;  3RBZ A;  2OTJ V;  4J9Z B;  4HZ3 A;  5LGN A;  3OEH G;  2HKO A;  2YSU B;  2LFS A;  1ROP A;  1OHH G;  2A0L A;  4LP8 A;  1OZ0 A;  2V7Q G;  1K73 W;  4QPJ A;  3AEI A;  3ASO C;  4PEL A;  4CZZ A;  5LHG A;  1OCC C;  1R6K A;  5B1A C;  4QNH B;  3ZMZ A;  1F23 A;  4BIZ A;  4L87 A;  1YHQ V;  2WPD G;  5CN0 A;  1M57 B;  4UVB A;  1L1F A;  2AHZ A;  3G6E V;  2PI4 A;  3GB7 C;  2P67 A;  4GX5 A;  4KUM A;  2DQ0 A;  3OR7 C;  3CC7 V;  3QO8 A;  1YTF D;  3ASO B;  1I5X A;  1OCZ B;  2V1D A;  3E8B A;  3E89 A;  5IYD O;  2EIM C;  3PJS K;  1K92 A;  3ZN0 A;  4PA3 A;  3F7Y C;  3AG3 C;  5IYC O;  1S3J A;  3FB6 C;  3OFN G;  4U7N A;  3ZMT A;  1M1K W;  3IFX A;  4MVR A;  3K06 A;  3FB5 C;  1F4N A;  3JD3 A;  3LDE A;  5L3C A;  2WLM A;  2UXN A;  3W7U A;  1YIT V;  1AJN A;  1DLB A;  3STZ C;  3CPW U;  3M99 B;  3WFV A;  1KKD A;  1ORQ C;  1YJ9 V;  1NKD A;  2KB1 A;  4HAM A;  3SJQ C;  1CPY A;  3K0G A;  1QVG U;  1ENV A;  2JIZ G;  1JQ0 A;  3LDD A;  3AG4 C;  2XOK G;  3K3W A;  4MVS A;  1CP9 A;  1H2G A;  1QLE B;  4QE9 A;  2Q6A A;  3CCQ V;  3K08 A;  3OM3 B;  3CC2 V;  2PI5 A;  2HVK C;  2OTL V;  5H6Q A;  3LDC A;  4JAV A;  5H6R A;  1K8A W;  2EIJ C;  4JPR A;  4CBC A;  2DYS B;  4LBE C;  2JEU A;  1I5Y A;  2XAS A;  3RVY A;  1OCO B;  3SYO A;  3ZRX A;  1VQO V;  3BY6 A;  1VQ4 V;  2DQ3 A;  3E8G A;  1FFT B;  3AG2 B;  4E2L A;  5B1B C;  1JVM A;  1RPR A;  1BHB A;  4G2K A;  5IDJ A;  3P30 A;  4MS2 A;  1E1Q G;  4JAS A;  3ABM C;  1PNK A;  4PDL A;  5GW7 A;  1P4R A;  1OCC B;  3JD1 A;  2JK5 C;  1R3I C;  5B1A B;  1R3L C;  2EIN B;  5IYB O;  1NJI W;  3B8N A;  3ABK C;  2XAH A;  2MK3 A;  1QR9 A;  2X7R B;  3LUT B;  2OCC C;  3X2Q C;  1EBO A;  1DF5 A;  4FK5 C;  1TUE B;  3SYC A;  4UVC A;  2OT5 A;  1K7D A;  2ITD C;  1AJQ A;  1K3E A;  2H8P C;  4MVU A;  4FMT A;  1R3K C;  4P9O A;  1ARO P;  3ASN B;  1Y66 A;  3E2E A;  2HR3 A;  2WLL B;  1UJW B;  3CCJ V;  1QLN A;  3EHB B;  1HWY A;  4MW8 A;  3OR6 C;  2ITC C;  2WLN A;  1VQK V;  2K1E A;  3E86 A;  3ABU A;  1WPX A;  4MVO A;  2QE7 G;  1H8H G;  2Y48 A;  2QKS A;  5EC2 C;  4TT3 G;  4WFA V;  3WG7 B;  2XAJ A;  1K4C C;  2P6J A;  1H38 A;  2P90 A;  3KG2 A;  1P7B A;  5L3G A;  1FXK B;  2BOC C;  3OMI B;  5BZB A;  4FIP C;  3W7T A;  2H94 A;  2Q69 A;  4BW5 A;  3F5W C;  4JAU A;  2X6C A;  5HFL A;  5EBL C;  3OE7 G;  3ETE A;  1W2B U;  2IJK A;  1QLE C;  4WFE A;  1RM1 B;  2NNU A;  3CCV V;  2WWW A;  3AG4 B;  1JOY A;  3ZJZ A;  3QO7 A;  2EIK C;  3D3I A;  3HB3 B;  3I56 V;  1GMG A;  2QM8 A;  2B1I A;  2WLI A;  1KP2 A;  3ABL B;  1W0J G;  1BL8 A;  4X8A A;  1KD1 W;  1FS0 G;  1KEC A;  3ASN C;  1GTO A;  1PL0 A;  2JEX A;  3K9A A;  5EC1 C;  2XND G;  2DWD C;  1NR7 A;  3OAA G;  4ZBM A;  3LNM B;  3IGA C;  2XAG A;  4R8C A;  1M56 B;  4RUF A;  1MAB G;  3OUF A;  2IJI A;  3BEH A;  2HLD G;  2F43 G;  3OW2 U;  1GO3 F;  1K4D C;  4P2Z A;  1DTO A;  4R50 A;  3R65 A;  4LCU C;  1WLE A;  4PDV A;  1AI7 A;  1SZT A;  3W7X A;  3OGC C;  3TCU A;  3SYA A;  4I9W A;  2OCC B;  2ZR3 A;  5FL7 G;  3X2Q B;  3W7W A;  4YXW G;  4QE7 A;  1S5H C;  3ABK B;  1OCZ C;  1SES A;  2WLJ A;  1Y4M A;  1VQL V;  1M56 C;  2IU0 A;  3SPH A;  5L3D A;  2P7T C;  4GCZ A;  4ZKI A;  4QPK A;  2GHY A;  3K0D A;  3E8F A;  4EKW A;  4XDK A;  4G28 B;  1R6N A;  3JD4 A;  3CMA V;  4PA6 A;  3VOU A;  4WFB V;  4KP4 A;  1OCO C;  3ZMV A;  1Q7Y W;  4XDJ A;  1R73 A;  5B1B B;  3GWO A;  3TK1 A;  3DGE A;  1B6Q A;  4UUJ C;  4R7C A;  2IH1 C;  1FXV A;  1NR1 A;  2YEV B;  3CCU V;  4XBF A;  1F4M A;  1KP3 A;  2WLK A;  2EIL B;  3ZN1 A;  1S72 V;  2DWE C;  2IW5 A;  4WCE V;  3QO5 A;  2QTO A;  1BMF G;  4N23 A;  1DF4 A;  2EJR A;  1KQS U;  2HFE C;  1VQ9 V;  4LC1 A;  1AJP A;  1SER A;  3SPI A;  1JCH A;  1QBZ A;  2R9R B;  4JYB A;  2JJ1 G;  1QR8 A;  4UV9 A;  1THZ A;  1NBM G;  3MHH C;  1YJW V;  5CBH A;  2DYR C;  2W6J G;  2ZDI C;  4GX2 A;  4Z1M G;  3A0R A;  2BOB C;  4UV8 A;  1YI2 V;  2EIL C;  5L3F A;  4HYO A;  1K5Q A;  3CP1 A;  5LHI A;  2M7W A;  1XL4 A;  3ZIA G;  3LSS A;  3ABT A;  3ABM B;  2HJF C;  1IXM A;  2Z5U A;  4QIW F;  4X89 A;  3ZRS A;  1AI6 A;  4DXW A;  3G4S V;  2XAF A;  1VQM V;  2A9H A;  2Y69 C;  2HG5 C;  5LHH A;  3CYO A;  3CCM V;  1EFR G;  5C93 A;  4WF9 V;  4X88 A;  3VBB A;  1MOF A;  5DN6 G;  3ZRW A;  1VQP V;  3ML0 A;  3RVZ A;  1YTF B;  1MSW D;  2HVJ C;  5KUM A;  1M9N A;  3FYE B;  4JTC B;  4MTF A;  3SPJ A;  2QEX V;  4U7O A;  1FXH A;  2Y69 B;  3I55 V;  2IJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...