1PP9H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1pp9H00
1KB9F 1NTKH 1BGYH 1L0NH 3L73H 3L71H 3CX5F 1P84F 3CWBH 3H1LH 5KLVH 3CXHF 3L74H 1BE3H 4U3FH 3L72H 1NTZH 3H1IH 3TGUH 2A06H 1L0LH 3H1JH 3L70H 1SQQH 1BCCH 4D6TH 4PD4F 3L75H 1KYOF 1NU1H 3H1HH 1NTMH 1SQXH 2IBZH 1PPJH 1EZVH 1SQBH 1PP9H 1SQPH 2BCCH 3BCCH 2FYUH 1SQVH 3H1KH
chains in the Genus database with same CATH superfamily
4QIWF 5C93A 2JEUA 5B1OA 1Z5WA 3B40A 1XMOO 4O2BA 1VQPV 1NTZH 1JX9A 3JD4A 3SYQA 1YXBA 3CC4V 2ZCEA 4QJFB 4JI6B 1SQGA 2YUAA 3CHXA 1N33O 2ADPA 1HR0B 4PD4F 2NR5A 3FX7A 5JH7B 4D7SA 5EC1C 4I55B 1L0NH 4B7KA 4YXWG 3RT3C 1F23A 2AZ0A 1PL0A 2Q0AA 3OE7G 4X64B 4X62O 5E79Z 1GN4A 3SPHA 4DV0O 2BOCC 1S76D 4X66B 2IU3A 2AHYA 5KHGA 4RQFA 2YXHA 4K3AA 5FL7G 2XNDG 1WJZA 5CMUA 5KUKA 2F93B 3CJHA 4LFCB 3X2QB 4XBFA 4X1KB 2ARHA 1HNWO 1WPXA 1N32B 3DXRB 1BCCH 1KECA 1TUEB 1H2MA 5JQGA 4X20A 1ENVA 2UXBO 2ITDC 2EIKB 3KCYA 1B06A 2QM7A 3ETGA 4O2AA 2Y4TA 3OGIB 4DV5O 3CX5F 4B3TO 4B3SO 2M7WA 5DECA 1JPXA 1Y76A 1YZBA 4GX5A 3SPCA 4BIZA 1QLEC 2D3OW 2ZD9A 3FAVB 1M90W 2F1MA 4MW3A 3EXAA 3AG4B 1ZL8A 2EIMB 4B08A 4X1IA 2F23A 3JD1A 1XREA 2NLJC 4J42A 2ZDIA 3FFQA 3WB0A 1MA1A 3LSQA 4DUZO 4UB8Z 5JJEB 1S5HC 4TWKA 3IGAC 4IT5A 1THZA 3K3WA 2EINC 2W6JG 2KKWA 4HNAA 4I50A 1I7FA 2FTKA 2FYUH 3ZHQA 1FXKB 4MVUA 5ITZA 2GUZA 4F6EA 2IH3C 4PDRA 5EYPB 5LHIA 1IBMO 4FM1A 2DN9A 4I0XB 1XHXA 2F95B 3SYOA 3G71V 4YHHO 1DF4A 1W59A 4PA3A 4EFBA 2ZIMA 1OCZB 2XAFA 2KB1A 3I5DA 4JYAB 3MHSC 1QNMA 1Q43A 4FLYA 3MHHC 3CYOA 1AI5A 2WLIA 1OJHA 4EFEA 1SKVA 4U3JA 1M56B 3OR7C 5A2QN 5GTHZ 2ZDIC 2Y69C 1Y6XA 4IYHA 1JA8A 3OUSA 2EIJB 4IHJB 3FB8C 1AROP 3CRRA 3BCCH 4NXMB 4JV5O 5EZYA 2DYSB 1GN6A 1TUBB 2XAJA 3A8TA 4X1YB 3CXHF 4MVZA 2IM9A 2HVJC 4KHPB 2DE0X 4JI2O 2H94A 4EB6A 4DV7B 3LDCA 3BHPA 3O9OA 4LF7O 5EK0A 3JYCA 4G27B 4JTCB 3B77A 4DYLA 1PL4A 4CS3A 4K8ZA 2DOSA 1N33B 1NJIW 3U11A 2JGDA 4DR6B 4JTAB 3AG1C 3UO3A 1M57B 2LQTA 2WLMA 3ZJZA 3SYCA 2R9AA 2E3CA 3FYIB 3LSSA 1NH2B 4UB6Z 4X62B 3GVMA 4FZ1A 1O9HA 3SPGA 3FYEB 3K5NA 1IBKO 1Y74A 2ZR2A 4B7EA 5BY1A 3L9DA 1VARA 5IYCO 4TV8B 3EFFK 2OWOA 4DK1A 2DQ0A 4F6RB 3RVYA 2YSUB 3RYCB 2YIAA 3D36A 2VS0A 2IU0A 4O4IB 3ZMSA 1XHZA 3E8GA 4PDVA 2C2AA 4WBNB 1WPBA 1QBZA 2UXBB 3AK3A 4YIPA 3E8HA 5LP6B 5FPOA 4LC1A 1VQ6V 5IYZA 5FNVA 3UQ8A 1AP6A 4JI8O 2GTSA 3ZCCA 4FPPA 4OGQB 4QNHB 1PM9A 4H44B 4QGPA 2B5UA 1HNXO 1BQ0A 1OCOB 1IZ3A 3J7AU 2P06A 1XMQB 4J7KA 1MABG 1D5AA 3J80N 5LA6B 4DV6O 2CTPA 1GTOA 3P32A 4DUZB 4RAIA 1WB8A 1HNZO 2DQ3A 2PTMA 4K35A 3H1KH 5LYJA 3ZMZA 5IJ0B 1B04A 1RM1C 4NTYA 4DV2O 3ASNC 1P49A 1I94B 4YJ2B 3UKMA 3H1IH 2HG5C 4PELA 4QE9A 4GCZA 3C3SA 3I56V 5H9CA 1NKDA 4LH6A 2N74A 3D36C 4N23A 2AGAA 3CCUV 4DR7O 4XDLA 3OEEG 1LNQA 1NTMH 2QR4A 3E35A 2LW7A 2CH7A 3A0BZ 1I0HA 2ZQMA 3ZRVA 2FMLA 1ORQC 4TV9A 1NT2B 3CWBH 2QSAA 4PI2A 1JFFA 3VQVA 1FJGO 3G4SV 1K97A 1AILA 2LGWA 4JI5B 2Q7HA 3E86A 2UU9B 4FM0A 4HAMA 3JATA 5LHHA 2P4VA 5KMGB 2QKCA 5DEDA 4CC5A 1QLNA 1ZTEA 1HR0O 4CH5A 4YJ3B 1OCRC 2ZE6A 3K5MA 3ABLC 1X59A 3HKEB 1YCIA 1R6NA 4DR1B 1TVKB 2JJ1G 3OMNB 2P6JA 1T5EA 1PKXA 3GWKC 2ZNJA 2OYQA 2DWDC 5BMVB 4KP4A 4E2LA 1ROPA 2WA3A 1XBLA 4X66O 4JTDB 3CCEV 2ADQB 3LDDA 2FB5A 3AG3B 3JSNA 1MZEA 5GW7A 3CS5A 3ZX6A 1YF2A 2LFRA 3ZMTA 5TISZ 2PI5A 4GX0A 1Q3EA 1XI1A 3CCRV 2ZINA 3HKCB 5KA6A 2ETNA 4LFCO 4WFGA 1N32O 2QWQB 5B1BB 1SA0B 3OTOB 4CH4A 1L1FA 2WLKA 2CAZC 4IL6Z 3E8FA 2XUMA 4BW9A 5L3FA 1BE3H 4GX1A 4WFHA 1VQ5V 4TUYB 4LBEC 1RPOA 4TOIA 1SQQH 4JZ2A 4ICGA 3OFNG 3M99B 1Z2GA 4DK0A 2YEVB 3MDSA 2MK3A 2ZXWB 4JAVA 1BQZA 3OM3B 1SETA 5CA1A 1M93A 3F5TA 3P3NA 3QF7A 4BW5A 3K0GA 3PJSK 3K08A 3VBBA 2R72A 3OR6C 5LGTA 3SJAC 1AR1B 1WNSA 2HR3A 3HR0A 4IGGA 1XQ8A 4LNUA 4BIOA 3KZIZ 3BFRA 3CCLV 2XTAA 1PNLA 4RWUA 2WSSG 2UXCB 3TJTA 1CXZB 5KHJA 1SZXA 4DV4B 3F5WC 5C8YB 2Q68A 1V54B 1N0NA 2UUBB 1K33A 1Q86W 4LWSB 1HNXB 3I55V 4FFBB 1YITV 2PUSA 4JI7B 1VEWA 2WLLA 4ZKIA 1AJNA 1ZUQA 3FB7C 4DV6B 1D5NA 2B1GA 3ASOC 3FKSG 3TETA 1VQ7V 2PGGA 1W0KG 4XDKA 1VQMV 5CBFA 4HZ3A 1KBHA 4JYAO 3N2GB 3SR2C 4WCEV 1GMGA 2Q9LA 4GUNA 3UT5B 1E1RG 3QTCA 4DUYB 5LMNB 3ABKC 1NVPB 3TCUA 1FFTB 5L3CA 4X8AA 2R9RB 1NQTA 2BSKB 3JAWA 1MSDA 5J2UA 1IDSA 4FLUA 3M7MX 3JAKA 3WG7B 4UCRA 1LR1A 4UV8A 5KAFZ 3U0ZA 1Q8IA 3ZN1A 1OV9A 4DRXA 5EBMC 4W4KA 4W4LA 2QEXV 5IYDO 2QA4V 1SC5B 4C7UA 4DV7O 2PI4A 1GM8A 3GB7C 3VQWA 1WN7A 4MVSA 2PZSA 2K9PA 4RO2A 5JJJB 4MTGA 3OMAB 3C3TA 1EFRG 5LOVA 3MD0A 4TSFG 1GM9A 4X65O 4LF9B 4FLTA 1GK9A 5B1NA 5DN6G 4B3RB 5B66Z 1PPJH 2WLHA 2E5LO 1PNKA 2K1EA 4DR6O 1EN4A 4FVMA 4FLZA 1NTKH 4NKGB 3AG2B 5CN0A 3RYFB 2VQEO 4D7TA 4NVPA 2OCCB 2Z3YA 3L72H 1Z5VA 4ZBMA 5JCOA 3SYPA 3GWOA 2OTLV 5JH7A 5BR8B 1GM7A 1CEZA 3N2KB 1V55C 1WB7A 4I55A 5KHHA 2HHHB 2OIEA 2IBZH 5H6QA 1KP3A 3G80A 1EZVH 1R6KA 5LGNA 2WLJA 1QU7A 2UUCO 4J7JA 1YVWA 2P4KA 2R9IA 5BZBA 3H1LH 3ZRWB 4ZHQB 4OX9B 4BAYA 5B1AC 2KG7A 2D2CB 1VF7A 1NI8A 4MVRA 1R3LC 2F66C 3OUFA 1V9PA 4DR5B 1JOYA 3RWRD 4PDMA 4NTXA 4NYKA 4ABMA 4CBCA 5JQGB 4X1KA 1IBLO 4X20B 4JYCA 3SGIA 3CCMV 3T1CA 1QVGU 4FK5C 4I4TB 2BTQB 5EIBC 1M1KW 2OTJV 3MAQA 1ZLZA 1KKDA 4J80A 4JYYA 3ZHTA 5JCOC 4G28B 5LBQA 4BR6A 2BE3A 4LFAB 1VQOV 1XMQO 1QVFU 2L35A 2GSMB 3CRAA 4UV9A 1N34B 3FAVA 1QCEA 1SS3A 3ZHUA 4RQEA 4U7NA 5LMUO 4PA9A 4K8XA 5KHKA 2EULA 1QHTA 1RP3B 4MS2A 1OHHG 1X4TA 5FLXN 1I94O 1PV0A 2IJJA 1DLBA 1N8RW 4CS4A 3JALB 4R8CA 1S5JA 3C90A 4PA7A 1B3QA 5F2VO 2YICA 1YHQV 4TQDA 5IT9N 1CPYA 5LXTB 5L3EA 5ITZB 2GUZB 1L8DA 3X2QC 2LJ2A 4IYIA 1FXKA 1XDCA 3SJBC 2GTAA 2PYJA 5J2TB 2PY5A 1GRJA 5EYPA 3IFXA 1KB9F 2EIKC 1JQ0A 3L71H 4I0XA 1QR8A 3RN4A 3FB5C 4JI5O 3F7VC 4ZOLB 2UU9O 2QWOB 1B6QA 1BT8A 2PYLA 1R6TA 3THOA 2JIZG 1PNMA 2P22C 1RFYA 2LP7A 2X6BA 4WFFA 2YC0A 4UVBA 1FS0G 1FAFA 1Y67A 4U3JB 1DK1A 2YI8A 3AG4C 3ZBHA 2EIMC 3NXSA 4MVMA 1JCHA 1JR9A 4DR1O 3CCVV 3HKBA 1VQ4V 2R70A 2IJKA 3RYIB 4WF9V 5EZYB 5L3GA 3WFVA 3TGUH 1YSCA 3BA9A 1VMGA 4IHJA 3OTFA 1MOFA 2EX3A 1OZ0A 1VQKV 3ZMUA 4JASA 3T1YO 1TUBA 1NR1A 1WA8B 4FFKA 3CEIA 3TK1A 1DGSA 1YJWV 4MW8A 4X65B 2XAQA 1P7BA 1URFA 3HKDB 3WB2A 2UXDB 1FXKC 1D2DA 5GONB 4I9WA 2E5LB 1XNRB 2XAHA 3BABA 3G67A 2AZ2A 3E89A 3OTOO 3K57A 2RN9A 2VQEB 4J9YB 2JGDB 4K0KB 3APQA 3HPLC 2GDSA 5CBGA 4MVOA 5B3SB 1Q82W 1OCZC 2OT5A 4LF8O 2RDCA 1Q6UA 2HJDA 3F7YC 2DJVA 2P5OA 5IDJA 1AJQA 2Z0AA 2UUCB 2CGOA 2F43G 1ZAUA 2CE4A 3ZN0A 1RSOB 1N0JA 1M56C 4JI4O 1SQXH 1SQFA 1Q6IA 2EIJC 5KX5B 3TXQA 1U96A 2DYSC 2Q73A 3BPZA 3E8BA 2XHBA 5JJNB 5JVDB 2P67A 4TV8A 2A06H 1HW7A 4QPJA 2ZR3A 1EN6A 4F6RA 1YJ9V 2UXCO 2E76B 2CTWA 4XDJA 1IBLB 3RYCA 4OXSA 2QJ1A 1I5XA 4DV4O 1FXVA 2B9ZA 1YTFD 4AQYB 4WBNA 1P4RA 1Y66A 3FB6C 3QO7A 2UUBO 4GZRB 5IY5B 1IURA 2YXYA 4JI7O 2IW5A 1M57C 3JD2A 3E22B 5LMUB 1AJPA 3SDLA 1DTOA 3AK2A 1R3IC 4UXNA 5CB4B 3T4ZA 2ATKC 2NNUA 3RVZA 4I9QA 2A7WA 4IIJB 4BIUA 4DUYO 2YIDA 5D5PA 5LMNO 2JEXA 4YIOA 5J9PC 3T1HB 3QO8A 3CRMA 5IJ0A 1N4CA 2ZT9B 5KUMA 4I7ZB 4YJ2A 5HFMA 3UM7A 4Z1VA 1W2BU 5A9GA 2A79B 5LL6Y 1MMMA 4JI1B 2JVDA 5LHGA 3L70H 1H2SB 4X9QA 2EILB 1EN5A 2IJIA 3B09A 1FPOA 1UJWB 1DF5A 1JFFB 1NR7A 5LP6C 4LF5B 1H2LA 2VQFO 1SRYA 3P30A 4GKJB 1VP7A 5EC2C 5KA5A 4LF9O 2O57A 4B3RO 2DWEC 2Y48A 1EZJA 4JAAA 3QNEA 4FJCC 3BA8A 1OCOC 4P2ZA 4DR4O 5KMGA 2AXTZ 2YI9A 4KL1A 2Q8VA 1F51A 4PA6A 1G6UA 3IC9A 4PA4A 4YJ3A 4DV1O 3ZMVA 5BR8O 2X7RB 3RYHB 1UPGA 1WP8A 3AEIA 3B8MA 1Q90D 3HKEA 3S3XA 3T1YB 3ZHRA 1TVKA 2HHHO 2LO1A 1S3JA 3A0HZ 1FFXA 3NR7A 4N21A 4Z2WA 5DM6V 2YIBA 2QTOA 5BMVA 1YJNV 3L75H 4H37A 1MG1A 1AR5A 4RUEA 4O4HB 4OX9O 1I08A 1N36O 2WA4A 2EJRA 2Q7GA 4LF4B 2QTSA 4YY3B 3OAAG 4DR5O 3P3PA 1XL4A 1M4UA 2A3QA 3T4DA 4JAUA 1FD9A 2JDIG 2G38A 3HKCA 4NB5A 2JS5A 1M5IA 2H3OA 2AW9A 3LDEA 4LF8B 2XASA 1SA0A 3ABMB 4BWAA 2P7TC 1R1BA 4U7OA 1G4YB 3W7WA 2JJ2G 4TUYA 2QM8A 4MTFA 2UUAO 4Q20A 2XOKG 3L74H 1BS3A 5CA1B 1K3EA 1S0VA 4JI4B 3JAMN 1AVMA 3ZHVA 2YEVA 2VWKA 1OCCB 4LFAO 4TT3G 2DYRB 3APOA 1N34O 3Q4HB 4O4LB 1KQSU 1A32A 1SQBH 1IXMA 4CH3A 2Q6AA 1BMFG 5IJ9B 1S72V 1NH2D 3JARB 4J10A 3AG3C 5B5EZ 1EM1A 2QKAA 5IWAB 4FZ0A 5C8YA 2EZPA 2VWJA 3CMAV 3JASB 5KAIZ 1JJOA 1R73A 2QKSA 3E83A 5LGUA 2HJFC 2H8PC 2OCHA 5B1BC 4UVAA 3STLC 1WLEA 4CC6A 3K03A 4FFBA 3RW0A 4J41A 4QE7A 4JYBA 1YEWA 4H0LB 3H1HH 1F4NA 1ZWIC 3VQYA 5CA0B 2ZXWC 2V4DA 2CUGA 4NXNB 1K73W 2VRZA 2QWPB 1K4CC 3N2GA 2WPDG 4FM2A 1IVSA 3HB3B 3CXCU 3KCXA 1XNQO 4PV1B 2X6CA 3CCSV 4UCOA 4I5SA 1JMKC 4DO2A 3JAWB 4R50A 4J9ZB 3S3WA 2A9HA 5FPRA 4MVQA 1LUWA 4U3FH 1MNGA 4LF6B 1AP5A 4O4JB 1H2GA 4DRXB 2HEPA 2LGQA 3SYAA 4ZI7B 3K06A 2N05A 1FYJA 3E2EA 1TGOA 3ABUA 2VQFB 1H8EG 2PF4E 3OD4A 4UCVA 3RFRA 1V54C 4KXRA 1K34A 4O2BB 1FKAO 2YXLA 2UXDO 5LOVB 2Z5UA 1NBMG 2M6YA 4B3MB 1GN3A 1XNRO 5K1XA 1SERA 2RCVA 4DR4B 4CS2A 3JD0A 4DR3B 4G2KA 4K0KO 1W0JG 4LR3A 2P90A 1QLEB 2E74B 1R3KC 4MSWC 4DV1B 3PN1A 1AB3A 4JF3A 1US6A 5KHIA 1Q5OA 1Y4MA 3RYFA 4NR1A 3BAAA 1PP9H 4LCUC 3G6BA 3JSLA 3R66A 4X88A 3EVKA 3STZC 3N2KA 2GV9A 2N04A 5L3BA 3AK1A 3DSQA 3D8CA 4UFZA 3K04A 4FLWA 2EINB 2ITCC 1N36B 2QE7G 3SPIA 2KG7B 1YTFB 3CJHB 4DR2B 2FL4A 4P30A 4P9PA 3UO2A 3WG7C 1ZX3A 2X6AA 4ZHQA 3ZRWA 3CC2V 3BVOA 2YIBD 1MSWD 3L73H 3DXRA 2L6LA 2CDYA 2ZM6B 2Q0OC 4O2AB 4AQYO 1XL6A 2X0LA 2XT9A 3RBZA 1Y76B 2UUAB 4GX2A 1SZTA 1YIJV 1VIBA 1NU1H 2FKXA 2V1DA 4I4TA 2BTQA 4MT8A 2QWNB 1VQNV 3B4SA 2HKOA 3DC6A 1XILA 1ZL8B 2Y4UA 3AG2C 3ZHSA 4X1IB 5D5QA 4OPHA 1GKFA 4TQFA 1HWYA 2OCCC 5HFLA 2IJHA 1IXBA 4H13B 2Y69B 1COWG 3QO5A 3CMEV 3CE2A 4H33A 4AILC 4LP8A 2GHYA 2XAGA 3ZIAG 3OMIB 3T1HO 3KKYA 4HNAB 4J7ZA 4I50B 2JK5C 1KU9A 3CPWU 1XOUA 2DW4A 4JZGA 1JJ2U 2ZE7A 1YDXA 4JPRA 1FXHA 3JALA 2QDOA 4P9OA 4JI1O 3ETQA 3W7UA 5LXTA 3K5LA 1J5EO 3O65A 4JI0O 1AI7A 4LF5O 3G6EV 3AG1B 3DTUB 2QM4A 3CCQV 4DV3B 4GKJO 4ASUG 5J2TA 2MW2B 3CD6V 4JGSA 2WLIB 1IX9A 2RNBA 2CTQA 1ZSPA 5IE9A 4ZOLA 2W0FC 3CSXA 1XNQB 2RQ6A 3JCUZ 1AR4A 3IC7A 4GKKB 3VQXA 3HKBB 3UCSC 2QGNA 1VQLV 2F4VB 1KYOF 3RYIA 4EB6B 1SQPH 4X1YA 3SPJA 2RJZA 3CRQA 5L3DA 1GO3F 2CTRA 3QVNA 3AG7A 3H9VA 1NVPD 5KLVH 4LFBO 4FMTA 2JS3A 2Q4PA 3K9SA 3R65A 1WA8A 4LF4O 4YY3O 1XMOB 4KFMA 4NTWA 4HYOA 3HKDA 4MTOA 2EBOA 3ZS8C 1SESA 4LH7A 5GONA 3CB2A 4EEQA 1SQVH 4L8JA 4A5UB 4FLXA 2ZE5A 1VQ9V 5EIBD 2E75B 1L0LH 4F4LA 1Q81W 1HDJA 4JI3O 1JVMA 3D3QA 2CGNA 4WFEA 1P7GA 3WB1A 1KD1W 1Y74B 1TAEA 1Q6HA 1K92A 1KP2A 1RM1B 4UUJC 4DV0B 3ASNB 1VF5B 3D3IA 2WLNA 1F7YA 3J81N 5BXZA 1RSOA 4WFAV 1HP8A 2Y0IA 5IYBO 1Q7YW 3B2EE 3JD3A 3BEHA 5KX5A 1BL8A 5JVDA 4O4IA 1UFIA 5AG2A 1HNWB 5IYZB 4GT1A 5FNVB 4PHZA 2YDEA 1XUQA 3OT7A 1K5SA 2ZE8A 5LP6A 3W7XA 3B8NA 2A0LA 5CA3A 1K5QA 5IWAO 2ILMA 3OGCC 2ODMA 2ZKOA 4E4EA 1NZ6A 2DMXA 5K1PA 4DV5B 5H2FZ 4B3TB 4B3SB 3SJQC 2HVKC 5CBHA 2ZNIA 1J95A 1AI6A 3ABTA 1BGYH 4R6ZA 5B3SC 1OCRB 3A0RA 4MTXA 3ABLB 5LYJB 5EBLC 5LA6A 2HLDG 3E22A 1BSMA 2UXXA 4UVCA 4NXNO 5CB4A 1VQ8V 4IIJA 3SJCC 1YI2V 3W7TA 2CH7B 3IJ4A 1R3JC 1CP9A 1NS1A 3QG5A 4LF6O 4TV9B 3KG2A 3LSUA 1J5EB 4JI0B 2YS8A 1IBMB 1S5LZ 4WFBV 3DGEA 1MZFA 3JATB 4YHHB 4PJ0Z 2WWWA 3ZRXA 4B3MO 1VF6A 4AHCA 5IY5C 3ETEA 4GYCB 2AHZA 2BTOA 3BRCA 4DR3O 3IAYA 3FD9A 4UCSA 4JI6O 1KC8W 4FIPC 2OIGA 3K79A 1EBOA 4UCTA 4UCUA 2Q7EA 4HBNA 4JV5B 1KKCA 1QQCA 2Y0PA 4EKWA 4D6TH 4PI0A 3RYHA 3DC5A 2EJ7A 4DW0A 1FFXB 4R7CA 3K59A 4LFBB 1S77D 1XEQA 3M8AA 4X64O 4JI2B 1G8MA 1BZKA 4LF7B 1M9NA 1E79G 3ZRSA 1H2KA 1P84F 4DR2O 4O4HA 2GBOA 1WAZA 1KUQA 1H38A 2JGUA 3ETDA 3TXSA 2EILC 3ML0A 3T2MA 1O9GA 2ZM6O 1K9MW 3N27A 4DXWA 1G1XB 3K9AA 1VF6C 1GH6A 2JRIA 4JI3B 3LNNA 3ICXA 2B1IA 3OW2U 3ASOB 4Z1MG 3A2FA 1BHBA 2LFSA 2Q5ZA 2LW1A 5EBWC 5H6RA 2BOBC 5JWPA 3ABKB 1IBKB 4LNUB 5E1AC 1E1QG 3BY6A 2ZIOA 4GLXA 1GN2A 2KSDA 2RMKB 3Q4HA 3H1JH 4O4LA 1BHAA 4OPAA 3ZEDA 3K58A 4DW1A 5IJ9A 4AI8A 1LUVA 1I5YA 3VOUA 1K7DA 3JARA 3EHBB 1QR9A 1KMIZ 2HFEC 2Q69A 1RPRA 1AI4A 2WAMA 4QPKA 1K4DC 3K0DA 1K8AW 1WP7A 3LUTB 4L87A 4JI8B 1PD3A 2WLLB 3CC7V 4J11A 4LWSA 3U10A 3JASA 4PDLA 2Q67A 3OEHG 1H8HG 3W7SA 3H01A 5H5NA 4DV3O 2BCCH 3ABMC 4RUFA 2CK3G 2V7QG 4Q6GA 2QWRB 2UXNA 1HNZB 2W0XA 1V55B 5GTIZ 3UT5A 4KUMA 3CP1A 3K5OA 5CA0A 4CH6A 4DV2B 1OCCC 4ZIBA 1F4MA 5J2UB 2DYRC 4GKKO 1GAXA 3JAKB 1H2NA 3LNMB 2BSKA 2HP8A 4DR7B 2F4VO 5B1AB 3WU2Z 2NN4A 3CRCA 2IH1C 4FLVA 4X89A 4NXMO 2EZOA 3RGBA 3CCJV 2KQXA 4O4JA 4CZZA 1SF9A 2W6IG 4ZI7A 1FJGB 4KHPO 1TA8A 1U97A 3JCZA
chains in the Genus database with same CATH topology
1KB9F 1NTKH 1BGYH 1L0NH 3L73H 3L71H 3CX5F 1P84F 3CWBH 3H1LH 5KLVH 3CXHF 3L74H 1BE3H 4U3FH 3L72H 1NTZH 3H1IH 3TGUH 2A06H 1L0LH 3H1JH 3L70H 1SQQH 1BCCH 4D6TH 4PD4F 3L75H 1KYOF 1NU1H 3H1HH 1NTMH 1SQXH 2IBZH 1PPJH 1EZVH 1SQBH 1PP9H 1SQPH 2BCCH 3BCCH 2FYUH 1SQVH 3H1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 F;  1NTK H;  1BGY H;  1L0N H;  3L73 H;  3L71 H;  3CX5 F;  1P84 F;  3CWB H;  3H1L H;  5KLV H;  3CXH F;  3L74 H;  1BE3 H;  4U3F H;  3L72 H;  1NTZ H;  3H1I H;  3TGU H;  2A06 H;  1L0L H;  3H1J H;  3L70 H;  1SQQ H;  1BCC H;  4D6T H;  4PD4 F;  3L75 H;  1KYO F;  1NU1 H;  3H1H H;  1NTM H;  1SQX H;  2IBZ H;  1PPJ H;  1EZV H;  1SQB H;  1PP9 H;  1SQP H;  2BCC H;  3BCC H;  2FYU H;  1SQV H;  3H1K H; 
#chains in the Genus database with same CATH topology
 4QIW F;  5C93 A;  2JEU A;  5B1O A;  1Z5W A;  3B40 A;  1XMO O;  4O2B A;  1VQP V;  1NTZ H;  1JX9 A;  3JD4 A;  3SYQ A;  1YXB A;  3CC4 V;  2ZCE A;  4QJF B;  4JI6 B;  1SQG A;  2YUA A;  3CHX A;  1N33 O;  2ADP A;  1HR0 B;  4PD4 F;  2NR5 A;  3FX7 A;  5JH7 B;  4D7S A;  5EC1 C;  4I55 B;  1L0N H;  4B7K A;  4YXW G;  3RT3 C;  1F23 A;  2AZ0 A;  1PL0 A;  2Q0A A;  3OE7 G;  4X64 B;  4X62 O;  5E79 Z;  1GN4 A;  3SPH A;  4DV0 O;  2BOC C;  1S76 D;  4X66 B;  2IU3 A;  2AHY A;  5KHG A;  4RQF A;  2YXH A;  4K3A A;  5FL7 G;  2XND G;  1WJZ A;  5CMU A;  5KUK A;  2F93 B;  3CJH A;  4LFC B;  3X2Q B;  4XBF A;  4X1K B;  2ARH A;  1HNW O;  1WPX A;  1N32 B;  3DXR B;  1BCC H;  1KEC A;  1TUE B;  1H2M A;  5JQG A;  4X20 A;  1ENV A;  2UXB O;  2ITD C;  2EIK B;  3KCY A;  1B06 A;  2QM7 A;  3ETG A;  4O2A A;  2Y4T A;  3OGI B;  4DV5 O;  3CX5 F;  4B3T O;  4B3S O;  2M7W A;  5DEC A;  1JPX A;  1Y76 A;  1YZB A;  4GX5 A;  3SPC A;  4BIZ A;  1QLE C;  2D3O W;  2ZD9 A;  3FAV B;  1M90 W;  2F1M A;  4MW3 A;  3EXA A;  3AG4 B;  1ZL8 A;  2EIM B;  4B08 A;  4X1I A;  2F23 A;  3JD1 A;  1XRE A;  2NLJ C;  4J42 A;  2ZDI A;  3FFQ A;  3WB0 A;  1MA1 A;  3LSQ A;  4DUZ O;  4UB8 Z;  5JJE B;  1S5H C;  4TWK A;  3IGA C;  4IT5 A;  1THZ A;  3K3W A;  2EIN C;  2W6J G;  2KKW A;  4HNA A;  4I50 A;  1I7F A;  2FTK A;  2FYU H;  3ZHQ A;  1FXK B;  4MVU A;  5ITZ A;  2GUZ A;  4F6E A;  2IH3 C;  4PDR A;  5EYP B;  5LHI A;  1IBM O;  4FM1 A;  2DN9 A;  4I0X B;  1XHX A;  2F95 B;  3SYO A;  3G71 V;  4YHH O;  1DF4 A;  1W59 A;  4PA3 A;  4EFB A;  2ZIM A;  1OCZ B;  2XAF A;  2KB1 A;  3I5D A;  4JYA B;  3MHS C;  1QNM A;  1Q43 A;  4FLY A;  3MHH C;  3CYO A;  1AI5 A;  2WLI A;  1OJH A;  4EFE A;  1SKV A;  4U3J A;  1M56 B;  3OR7 C;  5A2Q N;  5GTH Z;  2ZDI C;  2Y69 C;  1Y6X A;  4IYH A;  1JA8 A;  3OUS A;  2EIJ B;  4IHJ B;  3FB8 C;  1ARO P;  3CRR A;  3BCC H;  4NXM B;  4JV5 O;  5EZY A;  2DYS B;  1GN6 A;  1TUB B;  2XAJ A;  3A8T A;  4X1Y B;  3CXH F;  4MVZ A;  2IM9 A;  2HVJ C;  4KHP B;  2DE0 X;  4JI2 O;  2H94 A;  4EB6 A;  4DV7 B;  3LDC A;  3BHP A;  3O9O A;  4LF7 O;  5EK0 A;  3JYC A;  4G27 B;  4JTC B;  3B77 A;  4DYL A;  1PL4 A;  4CS3 A;  4K8Z A;  2DOS A;  1N33 B;  1NJI W;  3U11 A;  2JGD A;  4DR6 B;  4JTA B;  3AG1 C;  3UO3 A;  1M57 B;  2LQT A;  2WLM A;  3ZJZ A;  3SYC A;  2R9A A;  2E3C A;  3FYI B;  3LSS A;  1NH2 B;  4UB6 Z;  4X62 B;  3GVM A;  4FZ1 A;  1O9H A;  3SPG A;  3FYE B;  3K5N A;  1IBK O;  1Y74 A;  2ZR2 A;  4B7E A;  5BY1 A;  3L9D A;  1VAR A;  5IYC O;  4TV8 B;  3EFF K;  2OWO A;  4DK1 A;  2DQ0 A;  4F6R B;  3RVY A;  2YSU B;  3RYC B;  2YIA A;  3D36 A;  2VS0 A;  2IU0 A;  4O4I B;  3ZMS A;  1XHZ A;  3E8G A;  4PDV A;  2C2A A;  4WBN B;  1WPB A;  1QBZ A;  2UXB B;  3AK3 A;  4YIP A;  3E8H A;  5LP6 B;  5FPO A;  4LC1 A;  1VQ6 V;  5IYZ A;  5FNV A;  3UQ8 A;  1AP6 A;  4JI8 O;  2GTS A;  3ZCC A;  4FPP A;  4OGQ B;  4QNH B;  1PM9 A;  4H44 B;  4QGP A;  2B5U A;  1HNX O;  1BQ0 A;  1OCO B;  1IZ3 A;  3J7A U;  2P06 A;  1XMQ B;  4J7K A;  1MAB G;  1D5A A;  3J80 N;  5LA6 B;  4DV6 O;  2CTP A;  1GTO A;  3P32 A;  4DUZ B;  4RAI A;  1WB8 A;  1HNZ O;  2DQ3 A;  2PTM A;  4K35 A;  3H1K H;  5LYJ A;  3ZMZ A;  5IJ0 B;  1B04 A;  1RM1 C;  4NTY A;  4DV2 O;  3ASN C;  1P49 A;  1I94 B;  4YJ2 B;  3UKM A;  3H1I H;  2HG5 C;  4PEL A;  4QE9 A;  4GCZ A;  3C3S A;  3I56 V;  5H9C A;  1NKD A;  4LH6 A;  2N74 A;  3D36 C;  4N23 A;  2AGA A;  3CCU V;  4DR7 O;  4XDL A;  3OEE G;  1LNQ A;  1NTM H;  2QR4 A;  3E35 A;  2LW7 A;  2CH7 A;  3A0B Z;  1I0H A;  2ZQM A;  3ZRV A;  2FML A;  1ORQ C;  4TV9 A;  1NT2 B;  3CWB H;  2QSA A;  4PI2 A;  1JFF A;  3VQV A;  1FJG O;  3G4S V;  1K97 A;  1AIL A;  2LGW A;  4JI5 B;  2Q7H A;  3E86 A;  2UU9 B;  4FM0 A;  4HAM A;  3JAT A;  5LHH A;  2P4V A;  5KMG B;  2QKC A;  5DED A;  4CC5 A;  1QLN A;  1ZTE A;  1HR0 O;  4CH5 A;  4YJ3 B;  1OCR C;  2ZE6 A;  3K5M A;  3ABL C;  1X59 A;  3HKE B;  1YCI A;  1R6N A;  4DR1 B;  1TVK B;  2JJ1 G;  3OMN B;  2P6J A;  1T5E A;  1PKX A;  3GWK C;  2ZNJ A;  2OYQ A;  2DWD C;  5BMV B;  4KP4 A;  4E2L A;  1ROP A;  2WA3 A;  1XBL A;  4X66 O;  4JTD B;  3CCE V;  2ADQ B;  3LDD A;  2FB5 A;  3AG3 B;  3JSN A;  1MZE A;  5GW7 A;  3CS5 A;  3ZX6 A;  1YF2 A;  2LFR A;  3ZMT A;  5TIS Z;  2PI5 A;  4GX0 A;  1Q3E A;  1XI1 A;  3CCR V;  2ZIN A;  3HKC B;  5KA6 A;  2ETN A;  4LFC O;  4WFG A;  1N32 O;  2QWQ B;  5B1B B;  1SA0 B;  3OTO B;  4CH4 A;  1L1F A;  2WLK A;  2CAZ C;  4IL6 Z;  3E8F A;  2XUM A;  4BW9 A;  5L3F A;  1BE3 H;  4GX1 A;  4WFH A;  1VQ5 V;  4TUY B;  4LBE C;  1RPO A;  4TOI A;  1SQQ H;  4JZ2 A;  4ICG A;  3OFN G;  3M99 B;  1Z2G A;  4DK0 A;  2YEV B;  3MDS A;  2MK3 A;  2ZXW B;  4JAV A;  1BQZ A;  3OM3 B;  1SET A;  5CA1 A;  1M93 A;  3F5T A;  3P3N A;  3QF7 A;  4BW5 A;  3K0G A;  3PJS K;  3K08 A;  3VBB A;  2R72 A;  3OR6 C;  5LGT A;  3SJA C;  1AR1 B;  1WNS A;  2HR3 A;  3HR0 A;  4IGG A;  1XQ8 A;  4LNU A;  4BIO A;  3KZI Z;  3BFR A;  3CCL V;  2XTA A;  1PNL A;  4RWU A;  2WSS G;  2UXC B;  3TJT A;  1CXZ B;  5KHJ A;  1SZX A;  4DV4 B;  3F5W C;  5C8Y B;  2Q68 A;  1V54 B;  1N0N A;  2UUB B;  1K33 A;  1Q86 W;  4LWS B;  1HNX B;  3I55 V;  4FFB B;  1YIT V;  2PUS A;  4JI7 B;  1VEW A;  2WLL A;  4ZKI A;  1AJN A;  1ZUQ A;  3FB7 C;  4DV6 B;  1D5N A;  2B1G A;  3ASO C;  3FKS G;  3TET A;  1VQ7 V;  2PGG A;  1W0K G;  4XDK A;  1VQM V;  5CBF A;  4HZ3 A;  1KBH A;  4JYA O;  3N2G B;  3SR2 C;  4WCE V;  1GMG A;  2Q9L A;  4GUN A;  3UT5 B;  1E1R G;  3QTC A;  4DUY B;  5LMN B;  3ABK C;  1NVP B;  3TCU A;  1FFT B;  5L3C A;  4X8A A;  2R9R B;  1NQT A;  2BSK B;  3JAW A;  1MSD A;  5J2U A;  1IDS A;  4FLU A;  3M7M X;  3JAK A;  3WG7 B;  4UCR A;  1LR1 A;  4UV8 A;  5KAF Z;  3U0Z A;  1Q8I A;  3ZN1 A;  1OV9 A;  4DRX A;  5EBM C;  4W4K A;  4W4L A;  2QEX V;  5IYD O;  2QA4 V;  1SC5 B;  4C7U A;  4DV7 O;  2PI4 A;  1GM8 A;  3GB7 C;  3VQW A;  1WN7 A;  4MVS A;  2PZS A;  2K9P A;  4RO2 A;  5JJJ B;  4MTG A;  3OMA B;  3C3T A;  1EFR G;  5LOV A;  3MD0 A;  4TSF G;  1GM9 A;  4X65 O;  4LF9 B;  4FLT A;  1GK9 A;  5B1N A;  5DN6 G;  4B3R B;  5B66 Z;  1PPJ H;  2WLH A;  2E5L O;  1PNK A;  2K1E A;  4DR6 O;  1EN4 A;  4FVM A;  4FLZ A;  1NTK H;  4NKG B;  3AG2 B;  5CN0 A;  3RYF B;  2VQE O;  4D7T A;  4NVP A;  2OCC B;  2Z3Y A;  3L72 H;  1Z5V A;  4ZBM A;  5JCO A;  3SYP A;  3GWO A;  2OTL V;  5JH7 A;  5BR8 B;  1GM7 A;  1CEZ A;  3N2K B;  1V55 C;  1WB7 A;  4I55 A;  5KHH A;  2HHH B;  2OIE A;  2IBZ H;  5H6Q A;  1KP3 A;  3G80 A;  1EZV H;  1R6K A;  5LGN A;  2WLJ A;  1QU7 A;  2UUC O;  4J7J A;  1YVW A;  2P4K A;  2R9I A;  5BZB A;  3H1L H;  3ZRW B;  4ZHQ B;  4OX9 B;  4BAY A;  5B1A C;  2KG7 A;  2D2C B;  1VF7 A;  1NI8 A;  4MVR A;  1R3L C;  2F66 C;  3OUF A;  1V9P A;  4DR5 B;  1JOY A;  3RWR D;  4PDM A;  4NTX A;  4NYK A;  4ABM A;  4CBC A;  5JQG B;  4X1K A;  1IBL O;  4X20 B;  4JYC A;  3SGI A;  3CCM V;  3T1C A;  1QVG U;  4FK5 C;  4I4T B;  2BTQ B;  5EIB C;  1M1K W;  2OTJ V;  3MAQ A;  1ZLZ A;  1KKD A;  4J80 A;  4JYY A;  3ZHT A;  5JCO C;  4G28 B;  5LBQ A;  4BR6 A;  2BE3 A;  4LFA B;  1VQO V;  1XMQ O;  1QVF U;  2L35 A;  2GSM B;  3CRA A;  4UV9 A;  1N34 B;  3FAV A;  1QCE A;  1SS3 A;  3ZHU A;  4RQE A;  4U7N A;  5LMU O;  4PA9 A;  4K8X A;  5KHK A;  2EUL A;  1QHT A;  1RP3 B;  4MS2 A;  1OHH G;  1X4T A;  5FLX N;  1I94 O;  1PV0 A;  2IJJ A;  1DLB A;  1N8R W;  4CS4 A;  3JAL B;  4R8C A;  1S5J A;  3C90 A;  4PA7 A;  1B3Q A;  5F2V O;  2YIC A;  1YHQ V;  4TQD A;  5IT9 N;  1CPY A;  5LXT B;  5L3E A;  5ITZ B;  2GUZ B;  1L8D A;  3X2Q C;  2LJ2 A;  4IYI A;  1FXK A;  1XDC A;  3SJB C;  2GTA A;  2PYJ A;  5J2T B;  2PY5 A;  1GRJ A;  5EYP A;  3IFX A;  1KB9 F;  2EIK C;  1JQ0 A;  3L71 H;  4I0X A;  1QR8 A;  3RN4 A;  3FB5 C;  4JI5 O;  3F7V C;  4ZOL B;  2UU9 O;  2QWO B;  1B6Q A;  1BT8 A;  2PYL A;  1R6T A;  3THO A;  2JIZ G;  1PNM A;  2P22 C;  1RFY A;  2LP7 A;  2X6B A;  4WFF A;  2YC0 A;  4UVB A;  1FS0 G;  1FAF A;  1Y67 A;  4U3J B;  1DK1 A;  2YI8 A;  3AG4 C;  3ZBH A;  2EIM C;  3NXS A;  4MVM A;  1JCH A;  1JR9 A;  4DR1 O;  3CCV V;  3HKB A;  1VQ4 V;  2R70 A;  2IJK A;  3RYI B;  4WF9 V;  5EZY B;  5L3G A;  3WFV A;  3TGU H;  1YSC A;  3BA9 A;  1VMG A;  4IHJ A;  3OTF A;  1MOF A;  2EX3 A;  1OZ0 A;  1VQK V;  3ZMU A;  4JAS A;  3T1Y O;  1TUB A;  1NR1 A;  1WA8 B;  4FFK A;  3CEI A;  3TK1 A;  1DGS A;  1YJW V;  4MW8 A;  4X65 B;  2XAQ A;  1P7B A;  1URF A;  3HKD B;  3WB2 A;  2UXD B;  1FXK C;  1D2D A;  5GON B;  4I9W A;  2E5L B;  1XNR B;  2XAH A;  3BAB A;  3G67 A;  2AZ2 A;  3E89 A;  3OTO O;  3K57 A;  2RN9 A;  2VQE B;  4J9Y B;  2JGD B;  4K0K B;  3APQ A;  3HPL C;  2GDS A;  5CBG A;  4MVO A;  5B3S B;  1Q82 W;  1OCZ C;  2OT5 A;  4LF8 O;  2RDC A;  1Q6U A;  2HJD A;  3F7Y C;  2DJV A;  2P5O A;  5IDJ A;  1AJQ A;  2Z0A A;  2UUC B;  2CGO A;  2F43 G;  1ZAU A;  2CE4 A;  3ZN0 A;  1RSO B;  1N0J A;  1M56 C;  4JI4 O;  1SQX H;  1SQF A;  1Q6I A;  2EIJ C;  5KX5 B;  3TXQ A;  1U96 A;  2DYS C;  2Q73 A;  3BPZ A;  3E8B A;  2XHB A;  5JJN B;  5JVD B;  2P67 A;  4TV8 A;  2A06 H;  1HW7 A;  4QPJ A;  2ZR3 A;  1EN6 A;  4F6R A;  1YJ9 V;  2UXC O;  2E76 B;  2CTW A;  4XDJ A;  1IBL B;  3RYC A;  4OXS A;  2QJ1 A;  1I5X A;  4DV4 O;  1FXV A;  2B9Z A;  1YTF D;  4AQY B;  4WBN A;  1P4R A;  1Y66 A;  3FB6 C;  3QO7 A;  2UUB O;  4GZR B;  5IY5 B;  1IUR A;  2YXY A;  4JI7 O;  2IW5 A;  1M57 C;  3JD2 A;  3E22 B;  5LMU B;  1AJP A;  3SDL A;  1DTO A;  3AK2 A;  1R3I C;  4UXN A;  5CB4 B;  3T4Z A;  2ATK C;  2NNU A;  3RVZ A;  4I9Q A;  2A7W A;  4IIJ B;  4BIU A;  4DUY O;  2YID A;  5D5P A;  5LMN O;  2JEX A;  4YIO A;  5J9P C;  3T1H B;  3QO8 A;  3CRM A;  5IJ0 A;  1N4C A;  2ZT9 B;  5KUM A;  4I7Z B;  4YJ2 A;  5HFM A;  3UM7 A;  4Z1V A;  1W2B U;  5A9G A;  2A79 B;  5LL6 Y;  1MMM A;  4JI1 B;  2JVD A;  5LHG A;  3L70 H;  1H2S B;  4X9Q A;  2EIL B;  1EN5 A;  2IJI A;  3B09 A;  1FPO A;  1UJW B;  1DF5 A;  1JFF B;  1NR7 A;  5LP6 C;  4LF5 B;  1H2L A;  2VQF O;  1SRY A;  3P30 A;  4GKJ B;  1VP7 A;  5EC2 C;  5KA5 A;  4LF9 O;  2O57 A;  4B3R O;  2DWE C;  2Y48 A;  1EZJ A;  4JAA A;  3QNE A;  4FJC C;  3BA8 A;  1OCO C;  4P2Z A;  4DR4 O;  5KMG A;  2AXT Z;  2YI9 A;  4KL1 A;  2Q8V A;  1F51 A;  4PA6 A;  1G6U A;  3IC9 A;  4PA4 A;  4YJ3 A;  4DV1 O;  3ZMV A;  5BR8 O;  2X7R B;  3RYH B;  1UPG A;  1WP8 A;  3AEI A;  3B8M A;  1Q90 D;  3HKE A;  3S3X A;  3T1Y B;  3ZHR A;  1TVK A;  2HHH O;  2LO1 A;  1S3J A;  3A0H Z;  1FFX A;  3NR7 A;  4N21 A;  4Z2W A;  5DM6 V;  2YIB A;  2QTO A;  5BMV A;  1YJN V;  3L75 H;  4H37 A;  1MG1 A;  1AR5 A;  4RUE A;  4O4H B;  4OX9 O;  1I08 A;  1N36 O;  2WA4 A;  2EJR A;  2Q7G A;  4LF4 B;  2QTS A;  4YY3 B;  3OAA G;  4DR5 O;  3P3P A;  1XL4 A;  1M4U A;  2A3Q A;  3T4D A;  4JAU A;  1FD9 A;  2JDI G;  2G38 A;  3HKC A;  4NB5 A;  2JS5 A;  1M5I A;  2H3O A;  2AW9 A;  3LDE A;  4LF8 B;  2XAS A;  1SA0 A;  3ABM B;  4BWA A;  2P7T C;  1R1B A;  4U7O A;  1G4Y B;  3W7W A;  2JJ2 G;  4TUY A;  2QM8 A;  4MTF A;  2UUA O;  4Q20 A;  2XOK G;  3L74 H;  1BS3 A;  5CA1 B;  1K3E A;  1S0V A;  4JI4 B;  3JAM N;  1AVM A;  3ZHV A;  2YEV A;  2VWK A;  1OCC B;  4LFA O;  4TT3 G;  2DYR B;  3APO A;  1N34 O;  3Q4H B;  4O4L B;  1KQS U;  1A32 A;  1SQB H;  1IXM A;  4CH3 A;  2Q6A A;  1BMF G;  5IJ9 B;  1S72 V;  1NH2 D;  3JAR B;  4J10 A;  3AG3 C;  5B5E Z;  1EM1 A;  2QKA A;  5IWA B;  4FZ0 A;  5C8Y A;  2EZP A;  2VWJ A;  3CMA V;  3JAS B;  5KAI Z;  1JJO A;  1R73 A;  2QKS A;  3E83 A;  5LGU A;  2HJF C;  2H8P C;  2OCH A;  5B1B C;  4UVA A;  3STL C;  1WLE A;  4CC6 A;  3K03 A;  4FFB A;  3RW0 A;  4J41 A;  4QE7 A;  4JYB A;  1YEW A;  4H0L B;  3H1H H;  1F4N A;  1ZWI C;  3VQY A;  5CA0 B;  2ZXW C;  2V4D A;  2CUG A;  4NXN B;  1K73 W;  2VRZ A;  2QWP B;  1K4C C;  3N2G A;  2WPD G;  4FM2 A;  1IVS A;  3HB3 B;  3CXC U;  3KCX A;  1XNQ O;  4PV1 B;  2X6C A;  3CCS V;  4UCO A;  4I5S A;  1JMK C;  4DO2 A;  3JAW B;  4R50 A;  4J9Z B;  3S3W A;  2A9H A;  5FPR A;  4MVQ A;  1LUW A;  4U3F H;  1MNG A;  4LF6 B;  1AP5 A;  4O4J B;  1H2G A;  4DRX B;  2HEP A;  2LGQ A;  3SYA A;  4ZI7 B;  3K06 A;  2N05 A;  1FYJ A;  3E2E A;  1TGO A;  3ABU A;  2VQF B;  1H8E G;  2PF4 E;  3OD4 A;  4UCV A;  3RFR A;  1V54 C;  4KXR A;  1K34 A;  4O2B B;  1FKA O;  2YXL A;  2UXD O;  5LOV B;  2Z5U A;  1NBM G;  2M6Y A;  4B3M B;  1GN3 A;  1XNR O;  5K1X A;  1SER A;  2RCV A;  4DR4 B;  4CS2 A;  3JD0 A;  4DR3 B;  4G2K A;  4K0K O;  1W0J G;  4LR3 A;  2P90 A;  1QLE B;  2E74 B;  1R3K C;  4MSW C;  4DV1 B;  3PN1 A;  1AB3 A;  4JF3 A;  1US6 A;  5KHI A;  1Q5O A;  1Y4M A;  3RYF A;  4NR1 A;  3BAA A;  1PP9 H;  4LCU C;  3G6B A;  3JSL A;  3R66 A;  4X88 A;  3EVK A;  3STZ C;  3N2K A;  2GV9 A;  2N04 A;  5L3B A;  3AK1 A;  3DSQ A;  3D8C A;  4UFZ A;  3K04 A;  4FLW A;  2EIN B;  2ITC C;  1N36 B;  2QE7 G;  3SPI A;  2KG7 B;  1YTF B;  3CJH B;  4DR2 B;  2FL4 A;  4P30 A;  4P9P A;  3UO2 A;  3WG7 C;  1ZX3 A;  2X6A A;  4ZHQ A;  3ZRW A;  3CC2 V;  3BVO A;  2YIB D;  1MSW D;  3L73 H;  3DXR A;  2L6L A;  2CDY A;  2ZM6 B;  2Q0O C;  4O2A B;  4AQY O;  1XL6 A;  2X0L A;  2XT9 A;  3RBZ A;  1Y76 B;  2UUA B;  4GX2 A;  1SZT A;  1YIJ V;  1VIB A;  1NU1 H;  2FKX A;  2V1D A;  4I4T A;  2BTQ A;  4MT8 A;  2QWN B;  1VQN V;  3B4S A;  2HKO A;  3DC6 A;  1XIL A;  1ZL8 B;  2Y4U A;  3AG2 C;  3ZHS A;  4X1I B;  5D5Q A;  4OPH A;  1GKF A;  4TQF A;  1HWY A;  2OCC C;  5HFL A;  2IJH A;  1IXB A;  4H13 B;  2Y69 B;  1COW G;  3QO5 A;  3CME V;  3CE2 A;  4H33 A;  4AIL C;  4LP8 A;  2GHY A;  2XAG A;  3ZIA G;  3OMI B;  3T1H O;  3KKY A;  4HNA B;  4J7Z A;  4I50 B;  2JK5 C;  1KU9 A;  3CPW U;  1XOU A;  2DW4 A;  4JZG A;  1JJ2 U;  2ZE7 A;  1YDX A;  4JPR A;  1FXH A;  3JAL A;  2QDO A;  4P9O A;  4JI1 O;  3ETQ A;  3W7U A;  5LXT A;  3K5L A;  1J5E O;  3O65 A;  4JI0 O;  1AI7 A;  4LF5 O;  3G6E V;  3AG1 B;  3DTU B;  2QM4 A;  3CCQ V;  4DV3 B;  4GKJ O;  4ASU G;  5J2T A;  2MW2 B;  3CD6 V;  4JGS A;  2WLI B;  1IX9 A;  2RNB A;  2CTQ A;  1ZSP A;  5IE9 A;  4ZOL A;  2W0F C;  3CSX A;  1XNQ B;  2RQ6 A;  3JCU Z;  1AR4 A;  3IC7 A;  4GKK B;  3VQX A;  3HKB B;  3UCS C;  2QGN A;  1VQL V;  2F4V B;  1KYO F;  3RYI A;  4EB6 B;  1SQP H;  4X1Y A;  3SPJ A;  2RJZ A;  3CRQ A;  5L3D A;  1GO3 F;  2CTR A;  3QVN A;  3AG7 A;  3H9V A;  1NVP D;  5KLV H;  4LFB O;  4FMT A;  2JS3 A;  2Q4P A;  3K9S A;  3R65 A;  1WA8 A;  4LF4 O;  4YY3 O;  1XMO B;  4KFM A;  4NTW A;  4HYO A;  3HKD A;  4MTO A;  2EBO A;  3ZS8 C;  1SES A;  4LH7 A;  5GON A;  3CB2 A;  4EEQ A;  1SQV H;  4L8J A;  4A5U B;  4FLX A;  2ZE5 A;  1VQ9 V;  5EIB D;  2E75 B;  1L0L H;  4F4L A;  1Q81 W;  1HDJ A;  4JI3 O;  1JVM A;  3D3Q A;  2CGN A;  4WFE A;  1P7G A;  3WB1 A;  1KD1 W;  1Y74 B;  1TAE A;  1Q6H A;  1K92 A;  1KP2 A;  1RM1 B;  4UUJ C;  4DV0 B;  3ASN B;  1VF5 B;  3D3I A;  2WLN A;  1F7Y A;  3J81 N;  5BXZ A;  1RSO A;  4WFA V;  1HP8 A;  2Y0I A;  5IYB O;  1Q7Y W;  3B2E E;  3JD3 A;  3BEH A;  5KX5 A;  1BL8 A;  5JVD A;  4O4I A;  1UFI A;  5AG2 A;  1HNW B;  5IYZ B;  4GT1 A;  5FNV B;  4PHZ A;  2YDE A;  1XUQ A;  3OT7 A;  1K5S A;  2ZE8 A;  5LP6 A;  3W7X A;  3B8N A;  2A0L A;  5CA3 A;  1K5Q A;  5IWA O;  2ILM A;  3OGC C;  2ODM A;  2ZKO A;  4E4E A;  1NZ6 A;  2DMX A;  5K1P A;  4DV5 B;  5H2F Z;  4B3T B;  4B3S B;  3SJQ C;  2HVK C;  5CBH A;  2ZNI A;  1J95 A;  1AI6 A;  3ABT A;  1BGY H;  4R6Z A;  5B3S C;  1OCR B;  3A0R A;  4MTX A;  3ABL B;  5LYJ B;  5EBL C;  5LA6 A;  2HLD G;  3E22 A;  1BSM A;  2UXX A;  4UVC A;  4NXN O;  5CB4 A;  1VQ8 V;  4IIJ A;  3SJC C;  1YI2 V;  3W7T A;  2CH7 B;  3IJ4 A;  1R3J C;  1CP9 A;  1NS1 A;  3QG5 A;  4LF6 O;  4TV9 B;  3KG2 A;  3LSU A;  1J5E B;  4JI0 B;  2YS8 A;  1IBM B;  1S5L Z;  4WFB V;  3DGE A;  1MZF A;  3JAT B;  4YHH B;  4PJ0 Z;  2WWW A;  3ZRX A;  4B3M O;  1VF6 A;  4AHC A;  5IY5 C;  3ETE A;  4GYC B;  2AHZ A;  2BTO A;  3BRC A;  4DR3 O;  3IAY A;  3FD9 A;  4UCS A;  4JI6 O;  1KC8 W;  4FIP C;  2OIG A;  3K79 A;  1EBO A;  4UCT A;  4UCU A;  2Q7E A;  4HBN A;  4JV5 B;  1KKC A;  1QQC A;  2Y0P A;  4EKW A;  4D6T H;  4PI0 A;  3RYH A;  3DC5 A;  2EJ7 A;  4DW0 A;  1FFX B;  4R7C A;  3K59 A;  4LFB B;  1S77 D;  1XEQ A;  3M8A A;  4X64 O;  4JI2 B;  1G8M A;  1BZK A;  4LF7 B;  1M9N A;  1E79 G;  3ZRS A;  1H2K A;  1P84 F;  4DR2 O;  4O4H A;  2GBO A;  1WAZ A;  1KUQ A;  1H38 A;  2JGU A;  3ETD A;  3TXS A;  2EIL C;  3ML0 A;  3T2M A;  1O9G A;  2ZM6 O;  1K9M W;  3N27 A;  4DXW A;  1G1X B;  3K9A A;  1VF6 C;  1GH6 A;  2JRI A;  4JI3 B;  3LNN A;  3ICX A;  2B1I A;  3OW2 U;  3ASO B;  4Z1M G;  3A2F A;  1BHB A;  2LFS A;  2Q5Z A;  2LW1 A;  5EBW C;  5H6R A;  2BOB C;  5JWP A;  3ABK B;  1IBK B;  4LNU B;  5E1A C;  1E1Q G;  3BY6 A;  2ZIO A;  4GLX A;  1GN2 A;  2KSD A;  2RMK B;  3Q4H A;  3H1J H;  4O4L A;  1BHA A;  4OPA A;  3ZED A;  3K58 A;  4DW1 A;  5IJ9 A;  4AI8 A;  1LUV A;  1I5Y A;  3VOU A;  1K7D A;  3JAR A;  3EHB B;  1QR9 A;  1KMI Z;  2HFE C;  2Q69 A;  1RPR A;  1AI4 A;  2WAM A;  4QPK A;  1K4D C;  3K0D A;  1K8A W;  1WP7 A;  3LUT B;  4L87 A;  4JI8 B;  1PD3 A;  2WLL B;  3CC7 V;  4J11 A;  4LWS A;  3U10 A;  3JAS A;  4PDL A;  2Q67 A;  3OEH G;  1H8H G;  3W7S A;  3H01 A;  5H5N A;  4DV3 O;  2BCC H;  3ABM C;  4RUF A;  2CK3 G;  2V7Q G;  4Q6G A;  2QWR B;  2UXN A;  1HNZ B;  2W0X A;  1V55 B;  5GTI Z;  3UT5 A;  4KUM A;  3CP1 A;  3K5O A;  5CA0 A;  4CH6 A;  4DV2 B;  1OCC C;  4ZIB A;  1F4M A;  5J2U B;  2DYR C;  4GKK O;  1GAX A;  3JAK B;  1H2N A;  3LNM B;  2BSK A;  2HP8 A;  4DR7 B;  2F4V O;  5B1A B;  3WU2 Z;  2NN4 A;  3CRC A;  2IH1 C;  4FLV A;  4X89 A;  4NXM O;  2EZO A;  3RGB A;  3CCJ V;  2KQX A;  4O4J A;  4CZZ A;  1SF9 A;  2W6I G;  4ZI7 A;  1FJG B;  4KHP O;  1TA8 A;  1U97 A;  3JCZ A; 
#chains in the Genus database with same CATH homology
 1KB9 F;  1NTK H;  1BGY H;  1L0N H;  3L73 H;  3L71 H;  3CX5 F;  1P84 F;  3CWB H;  3H1L H;  5KLV H;  3CXH F;  3L74 H;  1BE3 H;  4U3F H;  3L72 H;  1NTZ H;  3H1I H;  3TGU H;  2A06 H;  1L0L H;  3H1J H;  3L70 H;  1SQQ H;  1BCC H;  4D6T H;  4PD4 F;  3L75 H;  1KYO F;  1NU1 H;  3H1H H;  1NTM H;  1SQX H;  2IBZ H;  1PPJ H;  1EZV H;  1SQB H;  1PP9 H;  1SQP H;  2BCC H;  3BCC H;  2FYU H;  1SQV H;  3H1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...