1PP9H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1pp9H00
4PD4F 3TGUH 5KLVH 3L73H 1NTMH 1EZVH 3CXHF 1L0NH 1SQPH 3BCCH 3H1IH 1SQXH 1NTZH 1NTKH 3L74H 3L72H 1P84F 1L0LH 3CWBH 1SQQH 1SQBH 2A06H 1BCCH 1NU1H 2FYUH 2BCCH 3H1JH 1KB9F 3H1KH 1PPJH 1KYOF 1SQVH 2IBZH 3L75H 3H1HH 1PP9H 3H1LH 3L70H 4D6TH 4U3FH 3L71H 1BE3H 1BGYH 3CX5F
chains in the Genus database with same CATH superfamily
1K9MW 1SETA 2E74B 3EFFK 4I9WA 4BR6A 2Q68A 1SA0A 1E1RG 4DK1A 5IJ9B 4YJ2B 2X6AA 3N2GA 4MTXA 3SPIA 4CC5A 4G27B 3APOA 1W0KG 2R70A 3M8AA 1H2LA 1YSCA 1JCHA 3RYCA 1HW7A 4KHPO 1K34A 1D5NA 1MABG 3HKCA 1AP6A 2E5LB 3SYQA 4YY3O 4DRXB 3A0BZ 4QPJA 2JS3A 1AI4A 3RYHA 4X62B 3E86A 5IJ0B 5C8YA 1QLNA 4I4TB 2Y4TA 4GUNA 4LH6A 4JI8B 1KMIZ 2WA3A 4GT1A 4U3FH 4KFMA 1XHXA 5DECA 2Q4PA 4ZI7B 4DR2O 1OCOB 3B8MA 3W7WA 3PJSK 1NH2D 5CBHA 1JFFB 3DGEA 2Y0IA 2ZDIC 3CWBH 3A8TA 1XBLA 3UT5A 4G2KA 1EFRG 4HBNA 2DYSB 2DW4A 2W0FC 3H1KH 4O4JA 1B06A 2JGDB 1EN5A 1N33B 3EVKA 4B3RB 1EN4A 5CMUA 4PHZA 1IXMA 4DV3O 3DSQA 4RQFA 4WFBV 1OJHA 1EZVH 1VQ8V 1YEWA 1VARA 3SPHA 4K8ZA 2QKAA 2ETNA 4H0LB 2QKCA 4LWSA 2IJKA 2Q7HA 1XHZA 4JV5O 3SYCA 2BSKA 4JZGA 3F7YC 2R72A 5GONA 2LP7A 3P30A 3JD0A 1G8MA 2ARHA 3Q4HB 3L9DA 1JVMA 1KBHA 3K03A 4ZIBA 2FTKA 1FS0G 4W4KA 1GK9A 1N36B 4EEQA 3C3TA 2XT9A 4UFZA 2HFEC 3HKDB 5J2UA 4NKGB 2JRIA 1PKXA 4PD4F 1S5HC 2ZR2A 4B3TB 3K9SA 5LHHA 1IBLO 4F4LA 2UUBO 4I7ZB 3SYAA 4PJ0Z 1NZ6A 3FB5C 3P32A 1AJNA 4FZ0A 1GKFA 5B1OA 3CRMA 3FD9A 3UM7A 2ATKC 4I55A 4MTOA 3GWOA 2R9AA 3ETEA 4FM2A 4H44B 4U7OA 3AK2A 5EYPB 2ZE5A 4LF4O 1FKAO 1XNRO 1PL4A 2WLJA 2H3OA 1S0VA 1SQXH 4LF9O 1Y6XA 1F4NA 2DWDC 5L3EA 3ZEDA 5BR8O 2UXBB 1H2SB 3K79A 4X64O 4Z1VA 3U0ZA 2HVKC 2JVDA 4O2BA 2VQEB 1J5EO 1PL0A 1OCOC 4NTWA 3GB7C 4DV5B 5LMNB 1FXKB 2JIZG 1VMGA 1F4MA 2LW1A 3CRQA 3E8BA 1E1QG 2NLJC 3E8HA 4LFAO 2BTQA 1VQ6V 2DYSC 1H8EG 3LSSA 2GHYA 4LF7O 5HFMA 3OGIB 3DTUB 3FB6C 4J41A 3PN1A 2HP8A 3L71H 2DJVA 4J7JA 4X65O 4PA9A 2X0LA 4PA6A 3AK3A 1H8HG 3F5TA 4DUYO 3WB1A 4N21A 2PYJA 2XAFA 3THOA 4DO2A 1NI8A 2OTJV 1BCCH 3N27A 1PM9A 3CE2A 4I50A 1YHQV 1ZL8A 1Z5WA 1GH6A 1MSDA 4PV1B 4MVSA 4D7SA 3OEEG 3DC6A 4CS2A 5B1BB 5JH7A 1TVKB 1FD9A 1CXZB 1AJQA 2UXCB 3OTFA 1SRYA 2BCCH 2IM9A 3OGCC 4EB6B 3RVYA 3FFQA 3ZHRA 3B09A 3KZIZ 3FX7A 3RYIA 3ZRWB 4K0KB 2EJ7A 2OYQA 3H9VA 4LF6O 2KSDA 4JF3A 5JQGA 5A2QN 3QO7A 3T1YB 2M6YA 4PELA 4NXNO 2P90A 2UXXA 5A9GA 3LNNA 5B1NA 2YIBD 1YI2V 4NXMB 2QWOB 3BFRA 4CH3A 3JAKB 2DOSA 3FKSG 4K8XA 3T1HO 2Q7EA 1E79G 4HNAA 4DUZO 1OZ0A 3OMIB 2QKSA 3VQVA 4JI5B 1OCCB 3ZN1A 4GKJB 4DV7O 1PNLA 2OTLV 1ZSPA 4WF9V 4RO2A 3CX5F 4FJCC 2GDSA 3EXAA 2Z5UA 4O4HB 3ZX6A 1IVSA 1VQNV 2DQ3A 2ZM6O 4X20A 1WN7A 1VQ7V 1GMGA 2C2AA 1Y66A 5DM6V 1HWYA 4RUEA 2H8PC 5LA6B 1PPJH 1KECA 3L70H 4JGSA 1PNKA 3B4SA 1ROPA 1J95A 1NBMG 1YCIA 3CEIA 4AQYB 1TUBA 2CTRA 2WLKA 4P9OA 5K1PA 2HHHO 2Q67A 3JYCA 2YUAA 1VEWA 3SDLA 3IGAC 2AW9A 1OCZB 4WBNB 1BMFG 4EKWA 1RSOA 5L3GA 2WLLB 3ABLB 3H1LH 4UCRA 1Q82W 4O2AA 1CPYA 4KP4A 3C3SA 4DYLA 1OV9A 5B1BC 5LYJB 5IYBO 2P6JA 4CC6A 5B3SB 1P7GA 3JD1A 4GKKB 5FL7G 1DGSA 4YJ3B 4UVCA 5LP6B 4FLWA 3STLC 3RYFA 4JI4O 3ABTA 4TOIA 3CSXA 3SJBC 1G1XB 1H38A 2VQFO 3E22A 4JI6O 5IYDO 2RCVA 1Y76B 3K59A 3TXQA 4ASUG 1JOYA 2BOBC 3E83A 4RQEA 3L74H 1UFIA 3LDDA 3ABMB 1HNWO 4Z2WA 4RUFA 1N34O 3CP1A 1XEQA 1LNQA 3JAWA 2YXHA 1QU7A 2CTPA 1KKDA 5EZYB 4X89A 1K8AW 3S3WA 4JZ2A 1H2KA 5H2FZ 3BVOA 3DC5A 3CD6V 4OXSA 4UVBA 1H2NA 4Q20A 1IDSA 2YEVA 2PTMA 1D5AA 3GWKC 1IURA 2Q73A 5CBFA 4JYAB 2N05A 4TV8A 1OCCC 2Y0PA 1V55C 1WA8A 2UUAB 1NT2B 5LMUB 5JCOA 3FAVA 2GTSA 4GX0A 3G67A 5H5NA 3JASB 3BRCA 2P5OA 1K5SA 3CC2V 2B1GA 2YI9A 2Q0OC 1AROP 4QJFB 1GN2A 2YS8A 3BY6A 3CXCU 4BW9A 4FLTA 3OM3B 2CE4A 4DR4B 4K3AA 4IHJB 5BMVA 3E8GA 3AG7A 1GM8A 2JEXA 4BW5A 2NNUA 2Y69B 2XAHA 1R3KC 3B77A 3UO2A 1N32B 1OCZC 3D3IA 4DR3O 3K04A 3RYCB 3B2EE 1YXBA 2YSUB 4O4LA 4JTAB 4O4IA 2DWEC 4UCTA 3ABLC 1BT8A 3HKCB 1RM1C 2CTQA 2ZCEA 1JA8A 5KA6A 1K73W 2YXLA 3RYHB 5LOVA 3T2MA 3CCSV 5B3SC 3BCCH 4DR5O 3ZHSA 4L8JA 2EINB 1EM1A 1V9PA 3I55V 5LP6C 1R3JC 1VQ9V 4OX9O 1MMMA 5CB4A 2XOKG 1YF2A 4X1YA 3T4ZA 3MD0A 5FPOA 4C7UA 1VIBA 3JARB 4DR6O 4TT3G 1AJPA 2NN4A 3ETGA 4JI0O 3CMAV 1YJWV 2ZR3A 4DV6B 4YHHB 4DR7B 3CC7V 4OPHA 1BS3A 1VP7A 4UCOA 4X1IB 4ZHQA 3DXRB 5IYCO 1S76D 1Y67A 2WLHA 1BSMA 2XTAA 2F4VB 1BE3H 4DR1B 4Z1MG 4LWSB 1F51A 1JX9A 5IWAB 1FFXB 1MOFA 2CK3G 3BHPA 3N2KA 2K9PA 4UV8A 3OMAB 3JSNA 3VQWA 4JI8O 4GZRB 1YITV 3SPCA 3MHHC 4AHCA 4LNUA 2QDOA 5CA0A 4NB5A 1DTOA 5KLVH 2XHBA 2R9IA 1NKDA 4DV0B 1IBKO 5J2UB 2QWRB 4LR3A 3K57A 2WWWA 4B3RO 1Q7YW 4XDJA 1XMOB 1Q90D 4OGQB 3SJCC 1MZEA 2F1MA 4DXWA 3JALA 2DMXA 2ZDIA 2Y69C 4RWUA 5KX5B 4DV2O 2YDEA 3QTCA 1XILA 1IBMO 4FVMA 4I55B 2Q0AA 3ZHUA 1TGOA 4PI2A 2HR3A 2H94A 1NTKH 2N74A 3ZMVA 3ASOB 4I0XB 1LR1A 5D5PA 4TUYB 3K5MA 2AZ2A 1B6QA 4ICGA 3B8NA 1DF5A 1ORQC 2HKOA 1QR8A 2CH7A 3CCRV 2XAGA 2QE7G 4ZOLA 1I5XA 1GO3F 3L73H 4F6EA 2ZE6A 4U7NA 2EINC 4KHPB 1N36O 2YIDA 3RW0A 4KUMA 1RPRA 3X2QC 3OW2U 1VF6A 1O9HA 4YY3B 2EZOA 3KCXA 2PI5A 4B3TO 2ITCC 2ZD9A 3ICXA 2BTQB 2Q9LA 2QM7A 3JAMN 1N8RW 4X88A 4JYCA 1Q8IA 3WG7B 1X4TA 4HAMA 3ETQA 1S72V 1XI1A 4DR2B 3WU2Z 4LF5B 4FLUA 4P9PA 4LC1A 4NTXA 4F6RB 4IIJB 2IU0A 4AILC 3ZMTA 2YIBA 1PD3A 5IJ9A 1HNXB 3OTOO 2L35A 1I08A 3BEHA 4FMTA 2QWNB 2P7TC 3HKEA 1Q3EA 3K5LA 3A2FA 1JJOA 1ZUQA 2L6LA 2OWOA 3AG3B 5L3BA 5LXTB 1FXHA 1VQPV 5LGTA 4DV5O 3B40A 2Y4UA 3IFXA 3T4DA 1NS1A 4TQDA 2ZIOA 3SGIA 5EBMC 1YIJV 3CJHB 2QTOA 5LHGA 2HJFC 2O57A 4X66B 3CCEV 1QHTA 1YTFD 4H33A 4ZI7A 2WPDG 3VQYA 3CYOA 1KUQA 1DK1A 5KMGB 4OPAA 4IYIA 4B3SB 1SQFA 3L75H 2RNBA 2XASA 2QM4A 4CS4A 1R6KA 1DF4A 2JGDA 4DV1O 3J7AU 3ASOC 2XNDG 2Z3YA 5IY5B 3FB7C 2YC0A 3W7SA 2W6JG 4WFHA 3NXSA 4N23A 4DV4B 2ZNIA 2EIMB 2IH1C 3U10A 1WB7A 1FPOA 2UXDB 3WB0A 5JJNB 4JPRA 1X59A 4LFCB 4GX5A 2N04A 2B1IA 2UXCO 4IL6Z 4TV9B 2KB1A 1N0JA 3D36C 4JAUA 1WLEA 1KP3A 4ZKIA 1HP8A 1WJZA 1QCEA 4P30A 3HR0A 1VQOV 3H1JH 3VBBA 5BR8B 3GVMA 2P22C 5JWPA 4FLYA 3OFNG 1YVWA 3K08A 3WG7C 4Q6GA 1J5EB 3HKDA 4LF8O 3J80N 4FPPA 4NVPA 1NJIW 4PA3A 4PDMA 4NXMO 1H2GA 1TUBB 3IJ4A 4JI2O 1Y74A 3HKBB 4LFAB 4TSFG 4MVOA 1TAEA 3JCZA 2FB5A 4FLZA 1WP7A 3SJAC 2UXNA 1I5YA 5FNVB 4J11A 4X65B 1RSOB 1OCRC 1QVGU 2ZKOA 2RJZA 4R7CA 4JI5O 4MVUA 1FJGO 5EYPA 2EIJB 5JJJB 1JMKC 4DUYB 4I9QA 5GTHZ 2ZNJA 3AG3C 1Y4MA 1SERA 2A3QA 3RWRD 3AG1B 3TCUA 1R1BA 2GUZB 1QNMA 1ZAUA 2P67A 1L8DA 3P3PA 2G38A 1WNSA 1VQLV 4JTCB 3HPLC 2PUSA 1HNZB 4FFBB 3SR2C 2F66C 1I7FA 3UKMA 4JI1O 1BL8A 3BA9A 3CCLV 2XAJA 1FXKA 3OUFA 3LUTB 2Q6AA 1JJ2U 2VWJA 3R66A 1V55B 3JSLA 3ML0A 1AR1B 2QA4V 3LSQA 4CZZA 1VQMV 2WA4A 1IX9A 1XREA 3G71V 1F23A 2QWPB 5ITZB 5IY5C 4HYOA 4LF6B 1XNQO 3RBZA 4UVAA 2EIMC 3ZMZA 1RPOA 4NXNB 4UB8Z 2YEVB 2DQ0A 1H2MA 3J81N 4X1KA 1U97A 4GKKO 4J7ZA 2PGGA 2WLMA 2E75B 4TV8B 2WSSG 4MW8A 5LBQA 1QBZA 1WA8B 3VQXA 3ZJZA 4J7KA 4JI3B 2PI4A 2P06A 4L87A 5EBLC 3WFVA 4GLXA 3T1HB 3FAVB 1CEZA 3CCUV 1GAXA 5KAIZ 2OIEA 4DUZB 4WFFA 3ZS8C 1NH2B 5KHJA 3A0HZ 1TVKA 4PDRA 2AGAA 4UUJC 4R50A 2CAZC 3ZMSA 1RM1B 3QNEA 4PDVA 4XBFA 4EB6A 2WLIB 3CMEV 1QR9A 2NR5A 3ZRWA 1K97A 2FYUH 3W7UA 5GW7A 2ZM6B 3K9AA 2WAMA 4LCUC 4FK5C 1N0NA 3OUSA 2CTWA 2UU9B 3JATA 1Z2GA 2IW5A 1QVFU 3IAYA 1YZBA 4ABMA 4U3JA 2IJHA 2W6IG 2EIJC 3KCYA 3CRRA 5TISZ 3JAKA 2Y48A 2JEUA 1VF5B 3M99B 4J9YB 1AILA 5LMUO 3AG1C 2ZT9B 4CH5A 3AEIA 3ASNB 2FMLA 4FLVA 1R3IC 4LFBO 4AI8A 5KHGA 1WB8A 3CCJV 2V1DA 4CH4A 5GTIZ 4MSWC 2JJ1G 2Q5ZA 1PV0A 3IC9A 2YI8A 4IYHA 4O4HA 4WFEA 5IYZB 1IXBA 4B3MO 2DYRB 2IU3A 3IC7A 3SJQC 1SS3A 1P49A 4JI7O 2KG7B 1NQTA 5J2TB 3OT7A 4DK0A 2D2CB 1I94B 2VQFB 5JVDB 3ZHVA 1P7BA 2BOCC 5CA1B 1GM7A 1SQQH 1ZTEA 5KUMA 3CHXA 1FYJA 2EILB 3CRAA 1HNWB 5EBWC 1SA0B 2CDYA 2LJ2A 3N2GB 3LDEA 1R3LC 2GTAA 4FZ1A 3VOUA 2V7QG 3QO5A 1NTZH 2Q7GA 3SPJA 3QG5A 1HR0B 1BZKA 5B66Z 5DEDA 5LYJA 5IT9N 3CCVV 3MAQA 2W0XA 4YJ3A 3ZN0A 2UUCB 4IT5A 4DV6O 2XAQA 5LP6A 4YHHO 4FIPC 1M93A 4NTYA 3A0RA 1F7YA 1MZFA 5C8YB 2KQXA 4WCEV 1KC8W 3KKYA 2QWQB 5B5EZ 2ILMA 4WFGA 3X2QB 1RFYA 1M4UA 1DLBA 2X6BA 2CUGA 2EIKB 3UT5B 2V4DA 3AG4B 3E35A 1XOUA 3G4SV 4E4EA 3AG2B 4O4JB 5KAFZ 5L3CA 3ZRVA 2EX3A 4X9QA 1XMQB 5KHIA 1AP5A 1R6TA 4ZOLB 2JGUA 3BAAA 3ASNC 3ZHTA 2LGQA 3FB8C 4X8AA 3BPZA 2E5LO 3AK1A 5KA5A 3W7XA 4I5SA 4JAAA 5H9CA 4JYYA 4X62O 2BSKB 2LW7A 5BZBA 1COWG 3JASA 5IE9A 4DR5B 1G4YB 3ETDA 5GONB 1V54B 1KB9F 2WLNA 3K0GA 2DYRC 3LSUA 1SESA 3OE7G 4OX9B 3E89A 2EJRA 1Q6HA 3K58A 3UO3A 1UPGA 3FYIB 4IHJA 2EBOA 4MVQA 4DR6B 1MA1A 1R73A 4JI0B 1XL4A 1UJWB 1IZ3A 2PZSA 2EILC 1N33O 1M56B 4B08A 3HKEB 5HFLA 4FM1A 1JPXA 3MDSA 2OT5A 4QGPA 3TXSA 2JS5A 3K3WA 1KD1W 2F23A 5CBGA 1L0NH 4GCZA 4FFKA 3C90A 1W59A 2QSAA 4JTDB 5H6QA 2X7RB 3W7TA 5DN6G 2CGOA 1US6A 4PI0A 2VWKA 1Q6IA 1M9NA 1BGYH 5BXZA 4LF5O 1AI7A 2QR4A 3E2EA 1M5IA 3QVNA 2ADQB 1P4RA 5CN0A 1AR4A 4JYBA 5J9PC 4O2BB 5L3FA 3JARA 1IBKB 4CH6A 1ENVA 5E1AC 2HVJC 1HNXO 1GN6A 2Q8VA 4X1IA 4XDKA 1S5LZ 3NR7A 4H13B 3CB2A 3DXRA 2EIKC 3AG4C 3OR7C 5KHKA 3AG2C 4DV2B 1JR9A 2OCCB 2DE0X 1IBMB 3I5DA 1FFXA 1NR7A 3I56V 1QLEC 2JDIG 5B1AB 1EZJA 2PYLA 4X66O 4YJ2A 1VF6C 1AVMA 1NVPB 2EULA 2UXBO 1MNGA 4I50B 4DV3B 1NR1A 5LGNA 3L72H 2E3CA 1ZL8B 1OCRB 4BIZA 4B3SO 4UV9A 2PF4E 1V54C 1W2BU 2VQEO 4E2LA 3R65A 3E8FA 4DRXA 2QGNA 3EHBB 3SYOA 5LMNO 5JH7B 2P4KA 4JV5B 4QPKA 4MTGA 1BQZA 4BIUA 1NTMH 3CXHF 5IJ0A 5D5QA 1XL6A 1MG1A 2JJ2G 4I4TA 1Y74B 4QE9A 4DV4O 5KX5A 4J10A 2E76B 4YXWG 2UXDO 5LGUA 1M56C 3KG2A 2LGWA 3M7MX 1FXVA 1VQKV 4LFCO 3RYIB 1JFFA 4BWAA 2RQ6A 3UCSC 1Q81W 1PP9H 4I0XA 4QIWF 3F7VC 4TUYA 2CGNA 1TUEB 5JQGB 4MVZA 2Z0AA 1AI5A 1MSWD 4FM0A 4UCSA 1Q5OA 1S5JA 3OTOB 1G6UA 2RMKB 1XDCA 2B5UA 1IBLB 4UCUA 5H6RA 2ZIMA 4WFAV 5KHHA 2UUBB 1R6NA 2ITDC 4IGGA 2IBZH 3D36A 4LBEC 5EIBC 4HNAB 1KKCA 4BAYA 4EFEA 4KL1A 3TJTA 2KKWA 3K06A 3S3XA 3H01A 3CCQV 4LF4B 1ZLZA 1XNRB 3OR6C 2IH3C 4DW1A 4LF9B 1RP3B 1SKVA 1M90W 4KXRA 2HLDG 3CRCA 1KYOF 1L1FA 3Q4HA 3OMNB 3K5OA 4K0KO 2VS0A 4X64B 5L3DA 3JCUZ 5C93A 2OCHA 4F6RA 4X20B 4GX2A 4IIJA 3T1YO 3F5WC 5KUKA 1VQ5V 2A9HA 3HB3B 4P2ZA 4NR1A 2OCCC 1U96A 4UB6Z 1WAZA 3SYPA 2BE3A 1S3JA 4EFBA 4H37A 1LUVA 4TQFA 4DV1B 4X1KB 2A0LA 1GN3A 4GYCB 3TETA 3D8CA 5B1AC 2JK5C 1SZTA 4QE7A 1HNZO 3JD3A 4LP8A 3TK1A 1QQCA 5LXTA 2ADPA 1WP8A 4LF7B 4JASA 1EBOA 4XDLA 2RDCA 4O2AB 3CJHA 4GKJO 2X6CA 3CS5A 1JQ0A 3QO8A 5LL6Y 3RGBA 2PY5A 1A32A 1WPXA 2A7WA 4K35A 3U11A 5KMGA 2YXYA 3OAAG 3RYFB 1B04A 3STZC 1T5EA 3RT3C 1P84F 1B3QA 2A06H 3E22B 1AB3A 2LO1A 1NU1H 1I0HA 3JATB 4R6ZA 4LF8B 4GX1A 2ODMA 4JAVA 3LNMB 4U3JB 4MT8A 4YIOA 4AQYO 1K33A 4JI2B 3ZRXA 2HJDA 5IDJA 2GV9A 4JI3O 1KU9A 2QTSA 2QJ1A 2QEXV 1SQPH 5CA3A 3JAWB 4DW0A 1K92A 3K0DA 3G6BA 2AHYA 3CC4V 1FJGB 1YJNV 1ZX3A 4TV9A 1XQ8A 4LH7A 5EK0A 4D6TH 3CPWU 3D3QA 1FXKC 2AZ0A 5K1XA 1Q43A 2RN9A 4QNHB 2LFSA 3ZRSA 5EIBD 1D2DA 4MVRA 4JI1B 4UXNA 2UU9O 2IJIA 2F43G 3G80A 2ZXWB 1SF9A 1O9GA 1WPBA 1KQSU 5AG2A 3ABKB 4DV7B 3HKBA 5LHIA 3O9OA 1PNMA 1K7DA 3APQA 3ZCCA 2MK3A 2ZE8A 5BMVB 2M7WA 2A79B 3LDCA 2MW2B 1TA8A 5FNVA 5EC2C 1KP2A 1M57B 5F2VO 5FPRA 4B7KA 1XNQB 4PA7A 5JJEB 1GTOA 1BQ0A 3K5NA 4FLXA 2BTOA 2GUZA 4O4LB 4O4IB 1GN4A 4JYAO 3RFRA 4BIOA 3P3NA 1N4CA 4ZBMA 1K5QA 1BHAA 2Q69A 1GM9A 2FKXA 2HHHB 2ZE7A 2UUAO 1NVPD 2GBOA 5LOVB 1HDJA 4FFBA 1FAFA 1I94O 4PDLA 5E79Z 2ZINA 3WB2A 4RAIA 1AR5A 3JD2A 5FLXN 5CB4B 1BHBA 4CBCA 3MHSC 4X1YB 4D7TA 1SZXA 4DR4O 1EN6A 2HG5C 3ZIAG 1K4DC 3OEHG 3JD4A 5ITZA 1VQ4V 2EZPA 4MVMA 4JI4B 1ZWIC 4A5UB 1HR0O 1K4CC 4ZHQB 1N32O 5LA6A 1SQGA 1Q86W 4JI6B 1L0LH 3O65A 2UUCO 5EC1C 4B7EA 3BA8A 4CS3A 3ABUA 2B9ZA 1Q6UA 1XUQA 2HEPA 3N2KB 4MTFA 2QM8A 1N34B 1M1KW 1YTFB 3TGUH 1FFTB 4WBNA 3ZBHA 3QF7A 2K1EA 5BY1A 2WLLA 4W4LA 4LFBB 1GRJA 4LNUB 5JCOC 1K3EA 1VF7A 5CA0B 2FL4A 4YIPA 2OIGA 4NYKA 1YDXA 4UCVA 2D3OW 2WLIA 1SQVH 2ZXWC 2YIAA 3ABKC 3FYEB 4DR7O 4B3MB 1XMQO 2LQTA 1LUWA 2LFRA 2P4VA 4JI7B 1URFA 3JALB 1Y76A 1M57C 2R9RB 2F4VO 3ZHQA 4MS2A 4DR1O 4J42A 3H1HH 3RVZA 5IWAO 3SPGA 2IJJA 2F95B 3OD4A 3H1IH 4J9ZB 2GSMB 5EZYA 2ZQMA 3RN4A 1AI6A 2CH7B 3BABA 1Z5VA 1OHHG 1SQBH 2AXTZ 4DR3B 1SC5B 3T1CA 1QLEB 4J80A 3CCMV 2DN9A 2XUMA 1W0JG 4G28B 4DV0O 3G6EV 5IYZA 2F93B 3ABMC 4PA4A 1THZA 1CP9A 1XMOO 3UQ8A 4HZ3A 2KG7A 2VRZA 5J2TA 1S77D 5JVDA 4MW3A 5CA1A 2AHZA 3ZMUA 2YICA 4R8CA 4TWKA 1YJ9V
chains in the Genus database with same CATH topology
4PD4F 3TGUH 5KLVH 3L73H 1NTMH 1EZVH 3CXHF 1L0NH 1SQPH 3BCCH 3H1IH 1SQXH 1NTZH 1NTKH 3L74H 3L72H 1P84F 1L0LH 3CWBH 1SQQH 1SQBH 2A06H 1BCCH 1NU1H 2FYUH 2BCCH 3H1JH 1KB9F 3H1KH 1PPJH 1KYOF 1SQVH 2IBZH 3L75H 3H1HH 1PP9H 3H1LH 3L70H 4D6TH 4U3FH 3L71H 1BE3H 1BGYH 3CX5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 F;  3TGU H;  5KLV H;  3L73 H;  1NTM H;  1EZV H;  3CXH F;  1L0N H;  1SQP H;  3BCC H;  3H1I H;  1SQX H;  1NTZ H;  1NTK H;  3L74 H;  3L72 H;  1P84 F;  1L0L H;  3CWB H;  1SQQ H;  1SQB H;  2A06 H;  1BCC H;  1NU1 H;  2FYU H;  2BCC H;  3H1J H;  1KB9 F;  3H1K H;  1PPJ H;  1KYO F;  1SQV H;  2IBZ H;  3L75 H;  3H1H H;  1PP9 H;  3H1L H;  3L70 H;  4D6T H;  4U3F H;  3L71 H;  1BE3 H;  1BGY H;  3CX5 F; 
#chains in the Genus database with same CATH topology
 1K9M W;  1SET A;  2E74 B;  3EFF K;  4I9W A;  4BR6 A;  2Q68 A;  1SA0 A;  1E1R G;  4DK1 A;  5IJ9 B;  4YJ2 B;  2X6A A;  3N2G A;  4MTX A;  3SPI A;  4CC5 A;  4G27 B;  3APO A;  1W0K G;  2R70 A;  3M8A A;  1H2L A;  1YSC A;  1JCH A;  3RYC A;  1HW7 A;  4KHP O;  1K34 A;  1D5N A;  1MAB G;  3HKC A;  1AP6 A;  2E5L B;  3SYQ A;  4YY3 O;  4DRX B;  3A0B Z;  4QPJ A;  2JS3 A;  1AI4 A;  3RYH A;  4X62 B;  3E86 A;  5IJ0 B;  5C8Y A;  1QLN A;  4I4T B;  2Y4T A;  4GUN A;  4LH6 A;  4JI8 B;  1KMI Z;  2WA3 A;  4GT1 A;  4U3F H;  4KFM A;  1XHX A;  5DEC A;  2Q4P A;  4ZI7 B;  4DR2 O;  1OCO B;  3B8M A;  3W7W A;  3PJS K;  1NH2 D;  5CBH A;  1JFF B;  3DGE A;  2Y0I A;  2ZDI C;  3CWB H;  3A8T A;  1XBL A;  3UT5 A;  4G2K A;  1EFR G;  4HBN A;  2DYS B;  2DW4 A;  2W0F C;  3H1K H;  4O4J A;  1B06 A;  2JGD B;  1EN5 A;  1N33 B;  3EVK A;  4B3R B;  1EN4 A;  5CMU A;  4PHZ A;  1IXM A;  4DV3 O;  3DSQ A;  4RQF A;  4WFB V;  1OJH A;  1EZV H;  1VQ8 V;  1YEW A;  1VAR A;  3SPH A;  4K8Z A;  2QKA A;  2ETN A;  4H0L B;  2QKC A;  4LWS A;  2IJK A;  2Q7H A;  1XHZ A;  4JV5 O;  3SYC A;  2BSK A;  4JZG A;  3F7Y C;  2R72 A;  5GON A;  2LP7 A;  3P30 A;  3JD0 A;  1G8M A;  2ARH A;  3Q4H B;  3L9D A;  1JVM A;  1KBH A;  3K03 A;  4ZIB A;  2FTK A;  1FS0 G;  4W4K A;  1GK9 A;  1N36 B;  4EEQ A;  3C3T A;  2XT9 A;  4UFZ A;  2HFE C;  3HKD B;  5J2U A;  4NKG B;  2JRI A;  1PKX A;  4PD4 F;  1S5H C;  2ZR2 A;  4B3T B;  3K9S A;  5LHH A;  1IBL O;  4F4L A;  2UUB O;  4I7Z B;  3SYA A;  4PJ0 Z;  1NZ6 A;  3FB5 C;  3P32 A;  1AJN A;  4FZ0 A;  1GKF A;  5B1O A;  3CRM A;  3FD9 A;  3UM7 A;  2ATK C;  4I55 A;  4MTO A;  3GWO A;  2R9A A;  3ETE A;  4FM2 A;  4H44 B;  4U7O A;  3AK2 A;  5EYP B;  2ZE5 A;  4LF4 O;  1FKA O;  1XNR O;  1PL4 A;  2WLJ A;  2H3O A;  1S0V A;  1SQX H;  4LF9 O;  1Y6X A;  1F4N A;  2DWD C;  5L3E A;  3ZED A;  5BR8 O;  2UXB B;  1H2S B;  3K79 A;  4X64 O;  4Z1V A;  3U0Z A;  2HVK C;  2JVD A;  4O2B A;  2VQE B;  1J5E O;  1PL0 A;  1OCO C;  4NTW A;  3GB7 C;  4DV5 B;  5LMN B;  1FXK B;  2JIZ G;  1VMG A;  1F4M A;  2LW1 A;  3CRQ A;  3E8B A;  1E1Q G;  2NLJ C;  3E8H A;  4LFA O;  2BTQ A;  1VQ6 V;  2DYS C;  1H8E G;  3LSS A;  2GHY A;  4LF7 O;  5HFM A;  3OGI B;  3DTU B;  3FB6 C;  4J41 A;  3PN1 A;  2HP8 A;  3L71 H;  2DJV A;  4J7J A;  4X65 O;  4PA9 A;  2X0L A;  4PA6 A;  3AK3 A;  1H8H G;  3F5T A;  4DUY O;  3WB1 A;  4N21 A;  2PYJ A;  2XAF A;  3THO A;  4DO2 A;  1NI8 A;  2OTJ V;  1BCC H;  3N27 A;  1PM9 A;  3CE2 A;  4I50 A;  1YHQ V;  1ZL8 A;  1Z5W A;  1GH6 A;  1MSD A;  4PV1 B;  4MVS A;  4D7S A;  3OEE G;  3DC6 A;  4CS2 A;  5B1B B;  5JH7 A;  1TVK B;  1FD9 A;  1CXZ B;  1AJQ A;  2UXC B;  3OTF A;  1SRY A;  2BCC H;  2IM9 A;  3OGC C;  4EB6 B;  3RVY A;  3FFQ A;  3ZHR A;  3B09 A;  3KZI Z;  3FX7 A;  3RYI A;  3ZRW B;  4K0K B;  2EJ7 A;  2OYQ A;  3H9V A;  4LF6 O;  2KSD A;  4JF3 A;  5JQG A;  5A2Q N;  3QO7 A;  3T1Y B;  2M6Y A;  4PEL A;  4NXN O;  2P90 A;  2UXX A;  5A9G A;  3LNN A;  5B1N A;  2YIB D;  1YI2 V;  4NXM B;  2QWO B;  3BFR A;  4CH3 A;  3JAK B;  2DOS A;  3FKS G;  4K8X A;  3T1H O;  2Q7E A;  1E79 G;  4HNA A;  4DUZ O;  1OZ0 A;  3OMI B;  2QKS A;  3VQV A;  4JI5 B;  1OCC B;  3ZN1 A;  4GKJ B;  4DV7 O;  1PNL A;  2OTL V;  1ZSP A;  4WF9 V;  4RO2 A;  3CX5 F;  4FJC C;  2GDS A;  3EXA A;  2Z5U A;  4O4H B;  3ZX6 A;  1IVS A;  1VQN V;  2DQ3 A;  2ZM6 O;  4X20 A;  1WN7 A;  1VQ7 V;  1GMG A;  2C2A A;  1Y66 A;  5DM6 V;  1HWY A;  4RUE A;  2H8P C;  5LA6 B;  1PPJ H;  1KEC A;  3L70 H;  4JGS A;  1PNK A;  3B4S A;  1ROP A;  1J95 A;  1NBM G;  1YCI A;  3CEI A;  4AQY B;  1TUB A;  2CTR A;  2WLK A;  4P9O A;  5K1P A;  2HHH O;  2Q67 A;  3JYC A;  2YUA A;  1VEW A;  3SDL A;  3IGA C;  2AW9 A;  1OCZ B;  4WBN B;  1BMF G;  4EKW A;  1RSO A;  5L3G A;  2WLL B;  3ABL B;  3H1L H;  4UCR A;  1Q82 W;  4O2A A;  1CPY A;  4KP4 A;  3C3S A;  4DYL A;  1OV9 A;  5B1B C;  5LYJ B;  5IYB O;  2P6J A;  4CC6 A;  5B3S B;  1P7G A;  3JD1 A;  4GKK B;  5FL7 G;  1DGS A;  4YJ3 B;  4UVC A;  5LP6 B;  4FLW A;  3STL C;  3RYF A;  4JI4 O;  3ABT A;  4TOI A;  3CSX A;  3SJB C;  1G1X B;  1H38 A;  2VQF O;  3E22 A;  4JI6 O;  5IYD O;  2RCV A;  1Y76 B;  3K59 A;  3TXQ A;  4ASU G;  1JOY A;  2BOB C;  3E83 A;  4RQE A;  3L74 H;  1UFI A;  3LDD A;  3ABM B;  1HNW O;  4Z2W A;  4RUF A;  1N34 O;  3CP1 A;  1XEQ A;  1LNQ A;  3JAW A;  2YXH A;  1QU7 A;  2CTP A;  1KKD A;  5EZY B;  4X89 A;  1K8A W;  3S3W A;  4JZ2 A;  1H2K A;  5H2F Z;  3BVO A;  3DC5 A;  3CD6 V;  4OXS A;  4UVB A;  1H2N A;  4Q20 A;  1IDS A;  2YEV A;  2PTM A;  1D5A A;  3GWK C;  1IUR A;  2Q73 A;  5CBF A;  4JYA B;  2N05 A;  4TV8 A;  1OCC C;  2Y0P A;  1V55 C;  1WA8 A;  2UUA B;  1NT2 B;  5LMU B;  5JCO A;  3FAV A;  2GTS A;  4GX0 A;  3G67 A;  5H5N A;  3JAS B;  3BRC A;  2P5O A;  1K5S A;  3CC2 V;  2B1G A;  2YI9 A;  2Q0O C;  1ARO P;  4QJF B;  1GN2 A;  2YS8 A;  3BY6 A;  3CXC U;  4BW9 A;  4FLT A;  3OM3 B;  2CE4 A;  4DR4 B;  4K3A A;  4IHJ B;  5BMV A;  3E8G A;  3AG7 A;  1GM8 A;  2JEX A;  4BW5 A;  2NNU A;  2Y69 B;  2XAH A;  1R3K C;  3B77 A;  3UO2 A;  1N32 B;  1OCZ C;  3D3I A;  4DR3 O;  3K04 A;  3RYC B;  3B2E E;  1YXB A;  2YSU B;  4O4L A;  4JTA B;  4O4I A;  2DWE C;  4UCT A;  3ABL C;  1BT8 A;  3HKC B;  1RM1 C;  2CTQ A;  2ZCE A;  1JA8 A;  5KA6 A;  1K73 W;  2YXL A;  3RYH B;  5LOV A;  3T2M A;  3CCS V;  5B3S C;  3BCC H;  4DR5 O;  3ZHS A;  4L8J A;  2EIN B;  1EM1 A;  1V9P A;  3I55 V;  5LP6 C;  1R3J C;  1VQ9 V;  4OX9 O;  1MMM A;  5CB4 A;  2XOK G;  1YF2 A;  4X1Y A;  3T4Z A;  3MD0 A;  5FPO A;  4C7U A;  1VIB A;  3JAR B;  4DR6 O;  4TT3 G;  1AJP A;  2NN4 A;  3ETG A;  4JI0 O;  3CMA V;  1YJW V;  2ZR3 A;  4DV6 B;  4YHH B;  4DR7 B;  3CC7 V;  4OPH A;  1BS3 A;  1VP7 A;  4UCO A;  4X1I B;  4ZHQ A;  3DXR B;  5IYC O;  1S76 D;  1Y67 A;  2WLH A;  1BSM A;  2XTA A;  2F4V B;  1BE3 H;  4DR1 B;  4Z1M G;  4LWS B;  1F51 A;  1JX9 A;  5IWA B;  1FFX B;  1MOF A;  2CK3 G;  3BHP A;  3N2K A;  2K9P A;  4UV8 A;  3OMA B;  3JSN A;  3VQW A;  4JI8 O;  4GZR B;  1YIT V;  3SPC A;  3MHH C;  4AHC A;  4LNU A;  2QDO A;  5CA0 A;  4NB5 A;  1DTO A;  5KLV H;  2XHB A;  2R9I A;  1NKD A;  4DV0 B;  1IBK O;  5J2U B;  2QWR B;  4LR3 A;  3K57 A;  2WWW A;  4B3R O;  1Q7Y W;  4XDJ A;  1XMO B;  1Q90 D;  4OGQ B;  3SJC C;  1MZE A;  2F1M A;  4DXW A;  3JAL A;  2DMX A;  2ZDI A;  2Y69 C;  4RWU A;  5KX5 B;  4DV2 O;  2YDE A;  3QTC A;  1XIL A;  1IBM O;  4FVM A;  4I55 B;  2Q0A A;  3ZHU A;  1TGO A;  4PI2 A;  2HR3 A;  2H94 A;  1NTK H;  2N74 A;  3ZMV A;  3ASO B;  4I0X B;  1LR1 A;  5D5P A;  4TUY B;  3K5M A;  2AZ2 A;  1B6Q A;  4ICG A;  3B8N A;  1DF5 A;  1ORQ C;  2HKO A;  1QR8 A;  2CH7 A;  3CCR V;  2XAG A;  2QE7 G;  4ZOL A;  1I5X A;  1GO3 F;  3L73 H;  4F6E A;  2ZE6 A;  4U7N A;  2EIN C;  4KHP B;  1N36 O;  2YID A;  3RW0 A;  4KUM A;  1RPR A;  3X2Q C;  3OW2 U;  1VF6 A;  1O9H A;  4YY3 B;  2EZO A;  3KCX A;  2PI5 A;  4B3T O;  2ITC C;  2ZD9 A;  3ICX A;  2BTQ B;  2Q9L A;  2QM7 A;  3JAM N;  1N8R W;  4X88 A;  4JYC A;  1Q8I A;  3WG7 B;  1X4T A;  4HAM A;  3ETQ A;  1S72 V;  1XI1 A;  4DR2 B;  3WU2 Z;  4LF5 B;  4FLU A;  4P9P A;  4LC1 A;  4NTX A;  4F6R B;  4IIJ B;  2IU0 A;  4AIL C;  3ZMT A;  2YIB A;  1PD3 A;  5IJ9 A;  1HNX B;  3OTO O;  2L35 A;  1I08 A;  3BEH A;  4FMT A;  2QWN B;  2P7T C;  3HKE A;  1Q3E A;  3K5L A;  3A2F A;  1JJO A;  1ZUQ A;  2L6L A;  2OWO A;  3AG3 B;  5L3B A;  5LXT B;  1FXH A;  1VQP V;  5LGT A;  4DV5 O;  3B40 A;  2Y4U A;  3IFX A;  3T4D A;  1NS1 A;  4TQD A;  2ZIO A;  3SGI A;  5EBM C;  1YIJ V;  3CJH B;  2QTO A;  5LHG A;  2HJF C;  2O57 A;  4X66 B;  3CCE V;  1QHT A;  1YTF D;  4H33 A;  4ZI7 A;  2WPD G;  3VQY A;  3CYO A;  1KUQ A;  1DK1 A;  5KMG B;  4OPA A;  4IYI A;  4B3S B;  1SQF A;  3L75 H;  2RNB A;  2XAS A;  2QM4 A;  4CS4 A;  1R6K A;  1DF4 A;  2JGD A;  4DV1 O;  3J7A U;  3ASO C;  2XND G;  2Z3Y A;  5IY5 B;  3FB7 C;  2YC0 A;  3W7S A;  2W6J G;  4WFH A;  3NXS A;  4N23 A;  4DV4 B;  2ZNI A;  2EIM B;  2IH1 C;  3U10 A;  1WB7 A;  1FPO A;  2UXD B;  3WB0 A;  5JJN B;  4JPR A;  1X59 A;  4LFC B;  4GX5 A;  2N04 A;  2B1I A;  2UXC O;  4IL6 Z;  4TV9 B;  2KB1 A;  1N0J A;  3D36 C;  4JAU A;  1WLE A;  1KP3 A;  4ZKI A;  1HP8 A;  1WJZ A;  1QCE A;  4P30 A;  3HR0 A;  1VQO V;  3H1J H;  3VBB A;  5BR8 B;  3GVM A;  2P22 C;  5JWP A;  4FLY A;  3OFN G;  1YVW A;  3K08 A;  3WG7 C;  4Q6G A;  1J5E B;  3HKD A;  4LF8 O;  3J80 N;  4FPP A;  4NVP A;  1NJI W;  4PA3 A;  4PDM A;  4NXM O;  1H2G A;  1TUB B;  3IJ4 A;  4JI2 O;  1Y74 A;  3HKB B;  4LFA B;  4TSF G;  4MVO A;  1TAE A;  3JCZ A;  2FB5 A;  4FLZ A;  1WP7 A;  3SJA C;  2UXN A;  1I5Y A;  5FNV B;  4J11 A;  4X65 B;  1RSO B;  1OCR C;  1QVG U;  2ZKO A;  2RJZ A;  4R7C A;  4JI5 O;  4MVU A;  1FJG O;  5EYP A;  2EIJ B;  5JJJ B;  1JMK C;  4DUY B;  4I9Q A;  5GTH Z;  2ZNJ A;  3AG3 C;  1Y4M A;  1SER A;  2A3Q A;  3RWR D;  3AG1 B;  3TCU A;  1R1B A;  2GUZ B;  1QNM A;  1ZAU A;  2P67 A;  1L8D A;  3P3P A;  2G38 A;  1WNS A;  1VQL V;  4JTC B;  3HPL C;  2PUS A;  1HNZ B;  4FFB B;  3SR2 C;  2F66 C;  1I7F A;  3UKM A;  4JI1 O;  1BL8 A;  3BA9 A;  3CCL V;  2XAJ A;  1FXK A;  3OUF A;  3LUT B;  2Q6A A;  1JJ2 U;  2VWJ A;  3R66 A;  1V55 B;  3JSL A;  3ML0 A;  1AR1 B;  2QA4 V;  3LSQ A;  4CZZ A;  1VQM V;  2WA4 A;  1IX9 A;  1XRE A;  3G71 V;  1F23 A;  2QWP B;  5ITZ B;  5IY5 C;  4HYO A;  4LF6 B;  1XNQ O;  3RBZ A;  4UVA A;  2EIM C;  3ZMZ A;  1RPO A;  4NXN B;  4UB8 Z;  2YEV B;  2DQ0 A;  1H2M A;  3J81 N;  4X1K A;  1U97 A;  4GKK O;  4J7Z A;  2PGG A;  2WLM A;  2E75 B;  4TV8 B;  2WSS G;  4MW8 A;  5LBQ A;  1QBZ A;  1WA8 B;  3VQX A;  3ZJZ A;  4J7K A;  4JI3 B;  2PI4 A;  2P06 A;  4L87 A;  5EBL C;  3WFV A;  4GLX A;  3T1H B;  3FAV B;  1CEZ A;  3CCU V;  1GAX A;  5KAI Z;  2OIE A;  4DUZ B;  4WFF A;  3ZS8 C;  1NH2 B;  5KHJ A;  3A0H Z;  1TVK A;  4PDR A;  2AGA A;  4UUJ C;  4R50 A;  2CAZ C;  3ZMS A;  1RM1 B;  3QNE A;  4PDV A;  4XBF A;  4EB6 A;  2WLI B;  3CME V;  1QR9 A;  2NR5 A;  3ZRW A;  1K97 A;  2FYU H;  3W7U A;  5GW7 A;  2ZM6 B;  3K9A A;  2WAM A;  4LCU C;  4FK5 C;  1N0N A;  3OUS A;  2CTW A;  2UU9 B;  3JAT A;  1Z2G A;  2IW5 A;  1QVF U;  3IAY A;  1YZB A;  4ABM A;  4U3J A;  2IJH A;  2W6I G;  2EIJ C;  3KCY A;  3CRR A;  5TIS Z;  3JAK A;  2Y48 A;  2JEU A;  1VF5 B;  3M99 B;  4J9Y B;  1AIL A;  5LMU O;  3AG1 C;  2ZT9 B;  4CH5 A;  3AEI A;  3ASN B;  2FML A;  4FLV A;  1R3I C;  4LFB O;  4AI8 A;  5KHG A;  1WB8 A;  3CCJ V;  2V1D A;  4CH4 A;  5GTI Z;  4MSW C;  2JJ1 G;  2Q5Z A;  1PV0 A;  3IC9 A;  2YI8 A;  4IYH A;  4O4H A;  4WFE A;  5IYZ B;  1IXB A;  4B3M O;  2DYR B;  2IU3 A;  3IC7 A;  3SJQ C;  1SS3 A;  1P49 A;  4JI7 O;  2KG7 B;  1NQT A;  5J2T B;  3OT7 A;  4DK0 A;  2D2C B;  1I94 B;  2VQF B;  5JVD B;  3ZHV A;  1P7B A;  2BOC C;  5CA1 B;  1GM7 A;  1SQQ H;  1ZTE A;  5KUM A;  3CHX A;  1FYJ A;  2EIL B;  3CRA A;  1HNW B;  5EBW C;  1SA0 B;  2CDY A;  2LJ2 A;  3N2G B;  3LDE A;  1R3L C;  2GTA A;  4FZ1 A;  3VOU A;  2V7Q G;  3QO5 A;  1NTZ H;  2Q7G A;  3SPJ A;  3QG5 A;  1HR0 B;  1BZK A;  5B66 Z;  5DED A;  5LYJ A;  5IT9 N;  3CCV V;  3MAQ A;  2W0X A;  4YJ3 A;  3ZN0 A;  2UUC B;  4IT5 A;  4DV6 O;  2XAQ A;  5LP6 A;  4YHH O;  4FIP C;  1M93 A;  4NTY A;  3A0R A;  1F7Y A;  1MZF A;  5C8Y B;  2KQX A;  4WCE V;  1KC8 W;  3KKY A;  2QWQ B;  5B5E Z;  2ILM A;  4WFG A;  3X2Q B;  1RFY A;  1M4U A;  1DLB A;  2X6B A;  2CUG A;  2EIK B;  3UT5 B;  2V4D A;  3AG4 B;  3E35 A;  1XOU A;  3G4S V;  4E4E A;  3AG2 B;  4O4J B;  5KAF Z;  5L3C A;  3ZRV A;  2EX3 A;  4X9Q A;  1XMQ B;  5KHI A;  1AP5 A;  1R6T A;  4ZOL B;  2JGU A;  3BAA A;  3ASN C;  3ZHT A;  2LGQ A;  3FB8 C;  4X8A A;  3BPZ A;  2E5L O;  3AK1 A;  5KA5 A;  3W7X A;  4I5S A;  4JAA A;  5H9C A;  4JYY A;  4X62 O;  2BSK B;  2LW7 A;  5BZB A;  1COW G;  3JAS A;  5IE9 A;  4DR5 B;  1G4Y B;  3ETD A;  5GON B;  1V54 B;  1KB9 F;  2WLN A;  3K0G A;  2DYR C;  3LSU A;  1SES A;  3OE7 G;  4OX9 B;  3E89 A;  2EJR A;  1Q6H A;  3K58 A;  3UO3 A;  1UPG A;  3FYI B;  4IHJ A;  2EBO A;  4MVQ A;  4DR6 B;  1MA1 A;  1R73 A;  4JI0 B;  1XL4 A;  1UJW B;  1IZ3 A;  2PZS A;  2EIL C;  1N33 O;  1M56 B;  4B08 A;  3HKE B;  5HFL A;  4FM1 A;  1JPX A;  3MDS A;  2OT5 A;  4QGP A;  3TXS A;  2JS5 A;  3K3W A;  1KD1 W;  2F23 A;  5CBG A;  1L0N H;  4GCZ A;  4FFK A;  3C90 A;  1W59 A;  2QSA A;  4JTD B;  5H6Q A;  2X7R B;  3W7T A;  5DN6 G;  2CGO A;  1US6 A;  4PI0 A;  2VWK A;  1Q6I A;  1M9N A;  1BGY H;  5BXZ A;  4LF5 O;  1AI7 A;  2QR4 A;  3E2E A;  1M5I A;  3QVN A;  2ADQ B;  1P4R A;  5CN0 A;  1AR4 A;  4JYB A;  5J9P C;  4O2B B;  5L3F A;  3JAR A;  1IBK B;  4CH6 A;  1ENV A;  5E1A C;  2HVJ C;  1HNX O;  1GN6 A;  2Q8V A;  4X1I A;  4XDK A;  1S5L Z;  3NR7 A;  4H13 B;  3CB2 A;  3DXR A;  2EIK C;  3AG4 C;  3OR7 C;  5KHK A;  3AG2 C;  4DV2 B;  1JR9 A;  2OCC B;  2DE0 X;  1IBM B;  3I5D A;  1FFX A;  1NR7 A;  3I56 V;  1QLE C;  2JDI G;  5B1A B;  1EZJ A;  2PYL A;  4X66 O;  4YJ2 A;  1VF6 C;  1AVM A;  1NVP B;  2EUL A;  2UXB O;  1MNG A;  4I50 B;  4DV3 B;  1NR1 A;  5LGN A;  3L72 H;  2E3C A;  1ZL8 B;  1OCR B;  4BIZ A;  4B3S O;  4UV9 A;  2PF4 E;  1V54 C;  1W2B U;  2VQE O;  4E2L A;  3R65 A;  3E8F A;  4DRX A;  2QGN A;  3EHB B;  3SYO A;  5LMN O;  5JH7 B;  2P4K A;  4JV5 B;  4QPK A;  4MTG A;  1BQZ A;  4BIU A;  1NTM H;  3CXH F;  5IJ0 A;  5D5Q A;  1XL6 A;  1MG1 A;  2JJ2 G;  4I4T A;  1Y74 B;  4QE9 A;  4DV4 O;  5KX5 A;  4J10 A;  2E76 B;  4YXW G;  2UXD O;  5LGU A;  1M56 C;  3KG2 A;  2LGW A;  3M7M X;  1FXV A;  1VQK V;  4LFC O;  3RYI B;  1JFF A;  4BWA A;  2RQ6 A;  3UCS C;  1Q81 W;  1PP9 H;  4I0X A;  4QIW F;  3F7V C;  4TUY A;  2CGN A;  1TUE B;  5JQG B;  4MVZ A;  2Z0A A;  1AI5 A;  1MSW D;  4FM0 A;  4UCS A;  1Q5O A;  1S5J A;  3OTO B;  1G6U A;  2RMK B;  1XDC A;  2B5U A;  1IBL B;  4UCU A;  5H6R A;  2ZIM A;  4WFA V;  5KHH A;  2UUB B;  1R6N A;  2ITD C;  4IGG A;  2IBZ H;  3D36 A;  4LBE C;  5EIB C;  4HNA B;  1KKC A;  4BAY A;  4EFE A;  4KL1 A;  3TJT A;  2KKW A;  3K06 A;  3S3X A;  3H01 A;  3CCQ V;  4LF4 B;  1ZLZ A;  1XNR B;  3OR6 C;  2IH3 C;  4DW1 A;  4LF9 B;  1RP3 B;  1SKV A;  1M90 W;  4KXR A;  2HLD G;  3CRC A;  1KYO F;  1L1F A;  3Q4H A;  3OMN B;  3K5O A;  4K0K O;  2VS0 A;  4X64 B;  5L3D A;  3JCU Z;  5C93 A;  2OCH A;  4F6R A;  4X20 B;  4GX2 A;  4IIJ A;  3T1Y O;  3F5W C;  5KUK A;  1VQ5 V;  2A9H A;  3HB3 B;  4P2Z A;  4NR1 A;  2OCC C;  1U96 A;  4UB6 Z;  1WAZ A;  3SYP A;  2BE3 A;  1S3J A;  4EFB A;  4H37 A;  1LUV A;  4TQF A;  4DV1 B;  4X1K B;  2A0L A;  1GN3 A;  4GYC B;  3TET A;  3D8C A;  5B1A C;  2JK5 C;  1SZT A;  4QE7 A;  1HNZ O;  3JD3 A;  4LP8 A;  3TK1 A;  1QQC A;  5LXT A;  2ADP A;  1WP8 A;  4LF7 B;  4JAS A;  1EBO A;  4XDL A;  2RDC A;  4O2A B;  3CJH A;  4GKJ O;  2X6C A;  3CS5 A;  1JQ0 A;  3QO8 A;  5LL6 Y;  3RGB A;  2PY5 A;  1A32 A;  1WPX A;  2A7W A;  4K35 A;  3U11 A;  5KMG A;  2YXY A;  3OAA G;  3RYF B;  1B04 A;  3STZ C;  1T5E A;  3RT3 C;  1P84 F;  1B3Q A;  2A06 H;  3E22 B;  1AB3 A;  2LO1 A;  1NU1 H;  1I0H A;  3JAT B;  4R6Z A;  4LF8 B;  4GX1 A;  2ODM A;  4JAV A;  3LNM B;  4U3J B;  4MT8 A;  4YIO A;  4AQY O;  1K33 A;  4JI2 B;  3ZRX A;  2HJD A;  5IDJ A;  2GV9 A;  4JI3 O;  1KU9 A;  2QTS A;  2QJ1 A;  2QEX V;  1SQP H;  5CA3 A;  3JAW B;  4DW0 A;  1K92 A;  3K0D A;  3G6B A;  2AHY A;  3CC4 V;  1FJG B;  1YJN V;  1ZX3 A;  4TV9 A;  1XQ8 A;  4LH7 A;  5EK0 A;  4D6T H;  3CPW U;  3D3Q A;  1FXK C;  2AZ0 A;  5K1X A;  1Q43 A;  2RN9 A;  4QNH B;  2LFS A;  3ZRS A;  5EIB D;  1D2D A;  4MVR A;  4JI1 B;  4UXN A;  2UU9 O;  2IJI A;  2F43 G;  3G80 A;  2ZXW B;  1SF9 A;  1O9G A;  1WPB A;  1KQS U;  5AG2 A;  3ABK B;  4DV7 B;  3HKB A;  5LHI A;  3O9O A;  1PNM A;  1K7D A;  3APQ A;  3ZCC A;  2MK3 A;  2ZE8 A;  5BMV B;  2M7W A;  2A79 B;  3LDC A;  2MW2 B;  1TA8 A;  5FNV A;  5EC2 C;  1KP2 A;  1M57 B;  5F2V O;  5FPR A;  4B7K A;  1XNQ B;  4PA7 A;  5JJE B;  1GTO A;  1BQ0 A;  3K5N A;  4FLX A;  2BTO A;  2GUZ A;  4O4L B;  4O4I B;  1GN4 A;  4JYA O;  3RFR A;  4BIO A;  3P3N A;  1N4C A;  4ZBM A;  1K5Q A;  1BHA A;  2Q69 A;  1GM9 A;  2FKX A;  2HHH B;  2ZE7 A;  2UUA O;  1NVP D;  2GBO A;  5LOV B;  1HDJ A;  4FFB A;  1FAF A;  1I94 O;  4PDL A;  5E79 Z;  2ZIN A;  3WB2 A;  4RAI A;  1AR5 A;  3JD2 A;  5FLX N;  5CB4 B;  1BHB A;  4CBC A;  3MHS C;  4X1Y B;  4D7T A;  1SZX A;  4DR4 O;  1EN6 A;  2HG5 C;  3ZIA G;  1K4D C;  3OEH G;  3JD4 A;  5ITZ A;  1VQ4 V;  2EZP A;  4MVM A;  4JI4 B;  1ZWI C;  4A5U B;  1HR0 O;  1K4C C;  4ZHQ B;  1N32 O;  5LA6 A;  1SQG A;  1Q86 W;  4JI6 B;  1L0L H;  3O65 A;  2UUC O;  5EC1 C;  4B7E A;  3BA8 A;  4CS3 A;  3ABU A;  2B9Z A;  1Q6U A;  1XUQ A;  2HEP A;  3N2K B;  4MTF A;  2QM8 A;  1N34 B;  1M1K W;  1YTF B;  3TGU H;  1FFT B;  4WBN A;  3ZBH A;  3QF7 A;  2K1E A;  5BY1 A;  2WLL A;  4W4L A;  4LFB B;  1GRJ A;  4LNU B;  5JCO C;  1K3E A;  1VF7 A;  5CA0 B;  2FL4 A;  4YIP A;  2OIG A;  4NYK A;  1YDX A;  4UCV A;  2D3O W;  2WLI A;  1SQV H;  2ZXW C;  2YIA A;  3ABK C;  3FYE B;  4DR7 O;  4B3M B;  1XMQ O;  2LQT A;  1LUW A;  2LFR A;  2P4V A;  4JI7 B;  1URF A;  3JAL B;  1Y76 A;  1M57 C;  2R9R B;  2F4V O;  3ZHQ A;  4MS2 A;  4DR1 O;  4J42 A;  3H1H H;  3RVZ A;  5IWA O;  3SPG A;  2IJJ A;  2F95 B;  3OD4 A;  3H1I H;  4J9Z B;  2GSM B;  5EZY A;  2ZQM A;  3RN4 A;  1AI6 A;  2CH7 B;  3BAB A;  1Z5V A;  1OHH G;  1SQB H;  2AXT Z;  4DR3 B;  1SC5 B;  3T1C A;  1QLE B;  4J80 A;  3CCM V;  2DN9 A;  2XUM A;  1W0J G;  4G28 B;  4DV0 O;  3G6E V;  5IYZ A;  2F93 B;  3ABM C;  4PA4 A;  1THZ A;  1CP9 A;  1XMO O;  3UQ8 A;  4HZ3 A;  2KG7 A;  2VRZ A;  5J2T A;  1S77 D;  5JVD A;  4MW3 A;  5CA1 A;  2AHZ A;  3ZMU A;  2YIC A;  4R8C A;  4TWK A;  1YJ9 V; 
#chains in the Genus database with same CATH homology
 4PD4 F;  3TGU H;  5KLV H;  3L73 H;  1NTM H;  1EZV H;  3CXH F;  1L0N H;  1SQP H;  3BCC H;  3H1I H;  1SQX H;  1NTZ H;  1NTK H;  3L74 H;  3L72 H;  1P84 F;  1L0L H;  3CWB H;  1SQQ H;  1SQB H;  2A06 H;  1BCC H;  1NU1 H;  2FYU H;  2BCC H;  3H1J H;  1KB9 F;  3H1K H;  1PPJ H;  1KYO F;  1SQV H;  2IBZ H;  3L75 H;  3H1H H;  1PP9 H;  3H1L H;  3L70 H;  4D6T H;  4U3F H;  3L71 H;  1BE3 H;  1BGY H;  3CX5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...