1PP9H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1pp9H00
3CX5F 1SQVH 4U3FH 3TGUH 1BCCH 3H1KH 4PD4F 2BCCH 1BGYH 5KLVH 1L0LH 1PP9H 3H1JH 3L74H 1SQQH 3L72H 1EZVH 1P84F 4D6TH 3CWBH 1SQBH 1PPJH 2FYUH 1SQXH 3H1LH 3H1HH 3H1IH 1KB9F 1SQPH 1BE3H 1NU1H 3BCCH 3L75H 2A06H 1KYOF 1NTZH 3L73H 1NTMH 3L71H 3L70H 3CXHF 1NTKH 2IBZH 1L0NH
chains in the Genus database with same CATH superfamily
3D36A 2Q6AA 3MHSC 3SJAC 3H1JH 4AHCA 2Q7GA 1QLNA 1F4MA 3ML0A 4NXMB 1Y6XA 1SQBH 2FYUH 2IM9A 2Y0PA 3A0HZ 4ICGA 4HYOA 4O4HA 1ROPA 2ZDIC 4MVUA 1YF2A 2P5OA 2ZT9B 5L3BA 2Y69C 2JK5C 3QNEA 1VEWA 3QTCA 3APQA 1I5YA 4AILC 1AP6A 2DQ0A 3B8MA 1YJ9V 3CCUV 2JIZG 4LC1A 4W4KA 4QE9A 1P4RA 3F7VC 4HNAA 1E79G 2EIKB 2YI9A 2R72A 2R70A 1WLEA 4LF4O 1NVPB 3B8NA 2ADQB 3SYPA 4BR6A 3ZHRA 2EBOA 1OCRC 4MW8A 3FX7A 3JSNA 1R6TA 4MVZA 4X20B 4H0LB 5ITZA 5IDJA 1W0JG 3BHPA 4X62O 1PNKA 2EZOA 1HNZO 2HKOA 1AR1B 4I0XB 4BIUA 2YS8A 3G6EV 4J42A 5BR8B 1M56C 5KHHA 3JAMN 4F6RA 2LO1A 2YXYA 3HKBA 5CA0B 5LL6Y 2HVJC 2D2CB 2XAJA 5CN0A 1EN4A 4DK1A 4DR6O 3E22A 4GX0A 2ZIOA 3CSXA 4BIZA 3D3QA 4GKJO 2UXCB 1IXBA 3L74H 2BTOA 5GTIZ 1AVMA 5LMNB 2OYQA 1VQPV 1OHHG 1N32O 3M99B 2D3OW 3CHXA 2YC0A 1TVKB 4LF8O 2L35A 2WLIA 5EK0A 3RYFB 3QO8A 1VQ7V 3VQVA 1WPBA 4I4TB 3K58A 1KQSU 1K5SA 3CRRA 2ZXWC 5HFMA 4LH7A 1L8DA 2GSMB 2X6BA 1GN3A 5H2FZ 3SR2C 1DTOA 2HR3A 3OGCC 4MS2A 4X1IB 4QGPA 3CJHB 4O2AB 2FB5A 1V55C 3ZMZA 1KP2A 5LA6A 4LF9B 1XREA 1SC5B 2DE0X 3C90A 1RPRA 3OUFA 4DV3B 2HFEC 2UUAB 3CB2A 1F7YA 4DV1O 3ZCCA 1A32A 4OXSA 1KC8W 1N34B 4B3MB 4IIJB 1SQFA 3DC5A 1ORQC 2E76B 1Y4MA 2B5UA 4UCOA 1L0LH 4JTAB 4WFEA 4CS2A 4U3JA 2DYRB 1Q90D 1K34A 1KKCA 2QEXV 3T1YO 2IJIA 2ZQMA 4X1YB 1MA1A 1J5EO 1PV0A 1XI1A 3THOA 4X66B 1UJWB 3W7XA 2A9HA 4YJ2A 2NN4A 5LXTA 2Y4TA 5GW7A 3K5LA 3D8CA 4U3FH 2A7WA 1YCIA 5EIBC 4KP4A 4TUYB 2OCHA 1F23A 3RN4A 2ZNJA 1P7BA 1SERA 3AG7A 4RUEA 4J7JA 3K08A 4MVOA 3P3NA 4CBCA 4IT5A 3HKEB 4P30A 2Q0AA 2Q0OC 5IYCO 2G38A 2GHYA 3RYIA 3ZBHA 1W2BU 2CUGA 3E83A 3O9OA 3JAWB 1DF4A 3CYOA 4R6ZA 1L1FA 2QTOA 4NTXA 2C2AA 4Q6GA 1K92A 1Q81W 1I94O 2B1GA 2GTAA 1FXHA 1QHTA 3FAVA 3OMAB 1YTFD 3N2GA 1AI6A 1SF9A 4FLUA 1YIJV 4G28B 2N04A 3B4SA 4Z1MG 4X64O 2RDCA 2A0LA 2XT9A 2BE3A 5J2UB 2OTLV 1CXZB 4K8ZA 3ZHSA 1VARA 3T4DA 4JI3O 1VQ8V 1MNGA 5GONA 4TV9B 4DV0O 1GAXA 3TK1A 2W6IG 3STZC 3BA9A 4CH3A 1CP9A 1X59A 5FLXN 4K3AA 1BL8A 3ZMVA 3UCSC 4I9QA 1QQCA 3WB0A 4QJFB 2AGAA 3CXCU 3OTFA 4F6EA 2UXDB 5J2TA 5D5PA 1IBKB 1KUQA 5JCOA 3OR6C 4DO2A 4OGQB 3RWRD 3TXQA 5FPRA 5B1OA 4P9OA 2OCCB 5DN6G 1SZTA 2HP8A 5EZYA 2AZ0A 1XUQA 1AJPA 3LDCA 2ZNIA 1M4UA 1ZTEA 2ZR3A 3OMNB 2A3QA 1YDXA 2EIMB 2E5LO 2VWJA 2IU0A 5IJ0B 4PHZA 5IYDO 1MSWD 4FFKA 1PP9H 4LF8B 2LW1A 4KHPO 3K9SA 5LP6A 1Y74B 4YHHB 3AK3A 5LOVB 1MZFA 1NT2B 2GUZA 2P6JA 3HKCA 4ZBMA 1Q8IA 2WAMA 2Q7EA 3B09A 5HFLA 5BMVB 3ZN0A 4LF5B 1US6A 2L6LA 4JYAB 1QNMA 1V54B 1AR5A 4NKGB 4MW3A 4FM2A 5E79Z 3VQWA 1HWYA 4QPJA 2OIEA 1IBMO 2KG7B 1JVMA 1FXKB 1PL4A 3FD9A 1SQPH 4FPPA 4D7SA 3G67A 1KD1W 1WP8A 3T1HB 3DSQA 5B66Z 2WLLB 1AJQA 1RSOB 2ITCC 1Q3EA 3AG2B 4DUYB 3ASOC 3TCUA 3ABTA 3AK2A 3K5MA 4DR7B 5EBWC 2KSDA 3IFXA 1BHAA 1FKAO 4UXNA 1Q82W 2F43G 4MVQA 1NJIW 5FNVA 2CDYA 4LWSA 5TISZ 4J11A 3T1YB 2XAFA 1NTKH 1S5JA 5IWAO 1XILA 1M5IA 4I50B 3LDEA 2XASA 3GWKC 3OFNG 4BIOA 1VQOV 2LGQA 4RQEA 5D5QA 3N2KA 3SPGA 4X88A 4DRXA 2DWDC 5H6RA 2OCCC 4MTOA 5AG2A 1R3KC 2AXTZ 4JI2B 4GKKO 1PNLA 3LSSA 5H9CA 4PA7A 2EIMC 4Z2WA 2EIJC 3ASNC 4DV5B 1THZA 1IBLO 3ZRWA 1HR0B 1H2LA 1Q86W 3JALB 3CMEV 3K9AA 2ETNA 1NU1H 1BE3H 4GYCB 5IYZA 2UU9O 3DXRB 2B9ZA 2NR5A 5BXZA 1KYOF 1N0NA 2FMLA 2DYSB 3OT7A 3E8BA 4LFBB 1R3JC 4TT3G 1FFXB 1S5LZ 3H01A 4B08A 4MTGA 3E8GA 4UCTA 2UUCB 1XQ8A 1V54C 4B7EA 1R3IC 5CBHA 2UXBB 3ICXA 1QBZA 4H44B 1HNWO 5KHKA 4X64B 3LDDA 5KLVH 3P30A 3AG2C 3HB3B 4L8JA 4DV2O 4LNUA 1MSDA 1FS0G 4Q20A 1IX9A 4X89A 3MDSA 4YY3O 3SDLA 4GZRB 4P9PA 2YDEA 5LMUB 1SQGA 3BFRA 1NVPD 1VF5B 4X20A 1CPYA 4J7KA 4LF6O 4AQYO 1GM9A 5EYPB 1VIBA 3T4ZA 4FM1A 2V4DA 1IDSA 3E8FA 2FL4A 4EKWA 4OPAA 2DQ3A 2ZR2A 1QR8A 5IJ9B 1Q6IA 2BTQB 4ZI7B 4FLZA 3JAKA 3JD3A 2X0LA 3E8HA 5LGNA 2JS5A 3WU2Z 4DR1B 4RWUA 2DWEC 4E2LA 1EM1A 1F51A 1VQ9V 1F4NA 2B1IA 2EILC 2E75B 3BA8A 5EIBD 2WLJA 1XNRB 1OCCC 2IH3C 2X7RB 2LFSA 3HKDA 5B1AB 1NI8A 2M6YA 1YXBA 4NXNO 3L71H 4DR4O 1EFRG 4G27B 4HBNA 2W6JG 3NXSA 2ZXWB 2VQFB 2DYSC 2RJZA 4DR5O 1XEQA 4E4EA 3AG4C 3TETA 3RYFA 2P90A 4PI0A 3K04A 1JR9A 4UVBA 4PDLA 3DGEA 3W7TA 2PYLA 2EZPA 4DXWA 1V55B 2CH7A 2QSAA 3CCSV 4JI6O 3FB7C 3ZN1A 3K03A 4NYKA 5KHGA 2YIAA 1S76D 1IZ3A 5B1BC 1GN2A 5JQGA 1JMKC 3L72H 4X1IA 3A8TA 5KUKA 1XMOO 1TAEA 4O2AA 3UT5B 4QIWF 3GB7C 3E2EA 1URFA 5LHGA 3J7AU 4JAUA 2RMKB 3RYHB 1NTZH 1SA0B 4GUNA 1GKFA 3H1KH 2BCCH 4DV7O 2K1EA 4IIJA 1D2DA 2Y48A 2AHYA 4GCZA 5IWAB 2Q69A 2Q7HA 1K73W 2E74B 4LBEC 2AW9A 3AK1A 1KB9F 2PY5A 4JI4O 3CCMV 3K0GA 4PELA 5EBLC 3AG1C 3UM7A 4K0KB 4X1YA 4O2BB 1K4CC 4DW0A 3CC7V 4DV6O 5JJJB 2CTQA 5KAIZ 3J81N 3F5WC 1Y66A 5BZBA 4TSFG 3JASA 1R1BA 1Q6HA 4TV8B 4JI5B 4AI8A 2HHHO 4H37A 3NR7A 5L3GA 2YUAA 2JS3A 4XDLA 1ZUQA 2A06H 1NKDA 3G4SV 3CX5F 5B1AC 1Y76A 2LJ2A 5KX5B 1GO3F 4JI0O 4ZHQB 4BWAA 3ABUA 5K1XA 2WLNA 2QE7G 3WB1A 3ZJZA 3O65A 5JH7B 4FJCC 2Q8VA 2OTJV 2GTSA 1Z5WA 3OTOB 3ZRSA 3CCEV 4JI7B 1FJGB 1BMFG 5IE9A 1J95A 1H38A 5EBMC 3JAWA 4B3SO 1VF6C 1GTOA 2RQ6A 4N21A 3CPWU 3DTUB 4D6TH 1WB7A 4HNAB 1Q6UA 2E3CA 5CA1B 4NTYA 1U97A 4KL1A 4DV2B 4FLYA 2YEVA 1H2KA 2AHZA 5KA6A 3JATA 4OX9O 4J80A 2KKWA 2F23A 5J2UA 5ITZB 5H5NA 3F7YC 3QG5A 3JD0A 3TJTA 2CE4A 4O4IA 4FK5C 4CS3A 3R65A 4O4LA 5J9PC 1Z2GA 4MTXA 2PGGA 1XMQO 4LF6B 4LF7B 3CD6V 1N0JA 1D5AA 4WBNB 2OIGA 5KMGB 2NNUA 1B04A 4LFAO 3K5NA 3A0RA 1RM1B 1E1RG 2ZINA 4I55A 4F6RB 1O9GA 4DR2O 1GH6A 5JWPA 4JASA 4J9YB 4KUMA 1OZ0A 1QLEC 1IXMA 2QKCA 4IHJB 2HVKC 3R66A 3D36C 1XBLA 4GX5A 3FB8C 3JCZA 4J9ZB 3CRCA 3Q4HB 1HW7A 4NVPA 3PJSK 4X1KA 1GM7A 4UCRA 3SPIA 4TOIA 2VWKA 2LQTA 3FYEB 3MHHC 3RYCA 4EFEA 1EZJA 3ETDA 1HP8A 1TA8A 2OT5A 1ZLZA 1WJZA 1FFTB 2ZE8A 1N33O 1Y74A 1PD3A 4DUZO 1S0VA 2QWOB 4JI8O 2Q5ZA 4JV5O 2UUBO 2R9IA 4CH6A 2MW2B 1NZ6A 4B3TO 5BMVA 4X65O 3JD4A 5CB4B 1WP7A 1LR1A 2PTMA 4B7KA 3K3WA 2PF4E 3AG3C 5C93A 1S77D 5A9GA 4JF3A 3ASOB 4LF4B 2JVDA 1R6NA 3LNMB 1FXKA 3K79A 1N36O 1FAFA 2RN9A 4JGSA 4FIPC 4IYHA 2IW5A 2QKAA 4UCSA 1JJ2U 2WLLA 3W7WA 3QO7A 1YZBA 1H2NA 4X62B 1BQZA 2F4VO 5C8YA 3CCRV 2WSSG 2QWQB 2EINC 2HJDA 2VS0A 3EFFK 5F2VO 1HNZB 3U10A 3SPHA 4NTWA 1TUBB 1RP3B 1RM1C 4YJ2B 5LBQA 4DR3O 3OD4A 4DR6B 4GKJB 4JPRA 4MVMA 1WA8B 4DV6B 4JI1O 3RT3C 4DV4O 5L3FA 2ARHA 3D3IA 5DEDA 4RUFA 1N32B 1WN7A 2YXHA 3OGIB 4FM0A 5KAFZ 3W7SA 2EIJB 3ABKC 4JAAA 3ASNB 3OW2U 1S3JA 3SJQC 3BAAA 2XNDG 1ZWIC 4WF9V 2Z5UA 1XNQO 3K0DA 1ZL8B 3H1LH 2LP7A 3RYIB 4J7ZA 2WLKA 4UV8A 3K5OA 5L3DA 3K59A 4NXMO 4QNHB 3KCXA 2ZE5A 2ZDIA 1M9NA 3PN1A 4GT1A 3DXRA 2QM4A 1RFYA 2QWNB 3FAVB 3HPLC 4FLTA 1DGSA 5H6QA 3SPCA 2JGDB 1FPOA 2QWPB 1GN6A 3T2MA 1NQTA 1SQVH 1IVSA 4DV1B 2A79B 5K1PA 5CBGA 1P84F 2IJHA 5IYBO 2Y0IA 4QE7A 4FVMA 2ZM6O 4B3RO 1OCOC 1WPXA 1JPXA 5B3SB 1DF5A 3STLC 1KECA 3G6BA 1KBHA 4CC5A 4PDVA 1NR1A 3E86A 1XOUA 1J5EB 4ABMA 1EZVH 4LFAB 1NBMG 4UV9A 1GN4A 1VQLV 1W0KG 2QGNA 4JYCA 4GLXA 2JEUA 3TXSA 4KXRA 2XAQA 2CGOA 4QPKA 2ATKC 2IBZH 4X8AA 4ZOLA 5LHIA 3EHBB 2NLJC 1M93A 1JFFB 5BR8O 3A0BZ 1I0HA 2EILB 5IJ9A 4Z1VA 1BS3A 2QM7A 4FFBA 4ZI7A 1QCEA 2P4KA 1OCCB 4DK0A 3SYOA 4EEQA 4PA9A 3UO2A 4YIPA 2YIBA 3ZHQA 2UXCO 4MTFA 4WFHA 1AI7A 2LFRA 1AB3A 2JGUA 5LMNO 4UB6Z 2Z0AA 5EC1C 2FTKA 3L73H 2YIBD 2BOBC 3ZHUA 2QTSA 4F4LA 3AEIA 2GUZB 3AG4B 2BSKB 2Y4UA 3LSQA 3P3PA 3J80N 1ENVA 2CAZC 1PM9A 1I94B 3DC6A 1JX9A 1M1KW 3JARB 1PPJH 3KZIZ 4HAMA 1H8HG 2R9RB 2ZKOA 1B3QA 3ETEA 2XAHA 2XTAA 5B1BB 1JCHA 5JVDB 3RBZA 2JRIA 3CRAA 3CMAV 3UQ8A 2CTPA 4X9QA 4XDKA 3VQXA 4OPHA 4JI3B 1NR7A 4JTDB 4DV0B 1SETA 4LF9O 4WFBV 1AR4A 4W4LA 3UT5A 3ZRXA 5B3SC 3APOA 4DV3O 2XHBA 1QVGU 4I5SA 2XUMA 4H13B 2GV9A 4NR1A 4RAIA 1N34O 2WLMA 3RYHA 4B3MO 2P06A 4LWSB 3WFVA 2H3OA 1EN6A 1YI2V 4LCUC 1PNMA 1YITV 1CEZA 1H2GA 3IAYA 3AG1B 3ETGA 3OEHG 2YICA 4PA6A 4DR3B 4RQFA 4LFCO 4DRXB 4I0XA 3BVOA 3OUSA 2VQEO 1OJHA 4X66O 3S3XA 4GX2A 1NH2B 5CA0A 2E5LB 3ABLB 3SPJA 4BW9A 1BQ0A 4O2BA 2HEPA 1R73A 3FB5C 2O57A 4NB5A 2MK3A 5JJEB 4KHPB 1LNQA 1JJOA 4LH6A 4R8CA 5LYJB 1AI4A 4TV8A 5LP6C 2ZD9A 1TVKA 5IYZB 4UVAA 4XDJA 3CS5A 2KQXA 4YXWG 1ZSPA 3FKSG 4CC6A 2WA3A 5KX5A 4ZIBA 4JTCB 4ZHQA 1K9MW 3RW0A 4I4TA 3CRQA 1MZEA 1IURA 3ZIAG 4O4JB 5JH7A 2Z3YA 4YJ3B 5KHIA 1IBMB 2UXXA 5FPOA 1U96A 3CEIA 2GBOA 1VQ6V 4EB6B 5FL7G 3ZS8C 1O9HA 1AI5A 1Q5OA 1TUEB 4K8XA 1EN5A 2LGWA 3CJHA 4BW5A 4LP8A 3FFQA 1R6KA 4FMTA 1GRJA 3B77A 2ADPA 2ZM6B 4LNUB 4B3RB 4UVCA 5LHHA 5IT9N 2GDSA 4G2KA 5CA1A 5L3CA 4I9WA 4UCUA 3BY6A 2DN9A 3OE7G 1T5EA 3W7UA 3WG7B 3ETQA 3BABA 3B40A 1XL4A 2PI5A 1MOFA 1UPGA 4MVRA 1VQ4V 1AJNA 2QJ1A 3CXHF 5KHJA 3JD1A 2WLHA 2Q68A 2RCVA 1SQQH 4GKKB 3CCJV 3OMIB 4WBNA 1QLEB 1V9PA 5KMGA 2UXDO 3JAKB 1IBKO 1AILA 3F5TA 2IU3A 4TUYA 1B06A 3ABLC 3ZMTA 4PDRA 1IBLB 3L70H 1Y67A 2F66C 3I55V 4PA4A 4BAYA 4JYBA 3RVZA 4IHJA 4MSWC 1VQMV 3HKDB 2UU9B 1H8EG 3HKEA 3SYAA 2ODMA 1BHBA 4O4HB 3I5DA 2ZE6A 5IY5B 2Q73A 1SRYA 3Q4HA 4WFFA 1H2SB 1TGOA 1HNXO 3IJ4A 1ZX3A 3QF7A 2BOCC 3A2FA 4YHHO 1X4TA 3OM3B 1XHZA 4IGGA 2JJ1G 4GX1A 4TQDA 3ZHVA 2W0FC 1KU9A 1K33A 2PYJA 1QVFU 1EBOA 2CH7B 4LF5O 3U0ZA 1HNWB 2EJ7A 3AG3B 5KA5A 1FD9A 1XHXA 1JQ0A 3IGAC 4JYAO 3H1HH 2XOKG 5JQGB 3L9DA 2WPDG 2HJFC 2H94A 3B2EE 5CB4A 1OCZB 3M8AA 2DOSA 4YY3B 3T1HO 2EIKC 4XBFA 2UXNA 4R7CA 4I7ZB 3S3WA 2N05A 1Q7YW 4DUYO 2EINB 2VRZA 2PZSA 2YI8A 3H1IH 4TV9A 2PUSA 3KG2A 4DR7O 3WG7C 4AQYB 2JDIG 3RFRA 1VMGA 3M7MX 1WB8A 2P4VA 1MG1A 5DECA 2EJRA 3SJBC 1GMGA 3TGUH 1QU7A 1E1QG 5L3EA 5BY1A 1S5HC 2IH1C 3HKBB 4LFCB 2H8PC 1TUBA 3JD2A 2IJJA 3E22B 4H33A 2VQEB 2ITDC 2DW4A 1SS3A 2YSUB 3ABKB 1BZKA 3E35A 1L0NH 3JASB 1WA8A 1YJWV 2V1DA 3OAAG 3UKMA 4PV1B 4JI2O 2CTRA 4ASUG 2WLIB 4NXNB 3ZX6A 4DR4B 2HG5C 4UUJC 5CMUA 5IJ0A 1VQ5V 1SQXH 1Y76B 3CCQV 1PKXA 1K5QA 5IY5C 4DR5B 3MAQA 2EX3A 4TWKA 4DV5O 1HR0O 3CC2V 5LOVA 2V7QG 1ZL8A 1G8MA 4PD4F 4ZKIA 1NS1A 2X6CA 1YJNV 2QM8A 2CTWA 4PDMA 4JI6B 4LFBO 1G4YB 3QO5A 3I56V 1FYJA 1ZAUA 3LNNA 5LA6B 2UUCO 3BPZA 1SESA 1XMOB 2KG7A 4CH4A 3FYIB 3RGBA 4JZ2A 1UFIA 4HZ3A 3WB2A 2UXBO 1OCZC 1OCOB 2X6AA 1BSMA 1I5XA 1MABG 2FKXA 2JGDA 4IYIA 3RVYA 2F1MA 1RSOA 2YEVB 3CWBH 4EFBA 1YHQV 3JATB 5CBFA 4DV7B 3HR0A 2ILMA 4JYYA 2QKSA 4U3JB 2P22C 4O4IB 2RNBA 1Q43A 1DLBA 1BT8A 3JSLA 2ZIMA 4O4LB 4FLVA 1P49A 1H2MA 4LR3A 4WFGA 4U7NA 1SZXA 4JI4B 3C3SA 1GK9A 5LMUO 4YIOA 2CGNA 2YIDA 5LXTB 2DYRC 1VQKV 1K4DC 4UFZA 4I50A 1G1XB 4I55B 3ZEDA 4FZ0A 4J41A 1YSCA 1GM8A 3OR7C 3FB6C 3ZRVA 1BCCH 1YEWA 3SGIA 2HHHB 1HDJA 4PI2A 1AP5A 3LUTB 1MMMA 1WNSA 3P32A 1JFFA 4JI0B 1QR9A 4DR1O 4PA3A 3ABMB 4X1KB 3ZMUA 2M7WA 4N23A 3SYQA 3RYCB 5B1NA 1M57B 2XAGA 2P67A 2K9PA 1HNXB 3JALA 1XNRO 3LSUA 1COWG 3G71V 2DMXA 3C3TA 1VP7A 2PI4A 4MVSA 1RPOA 3BRCA 2AZ2A 1K8AW 4B3SB 1YTFB 2BSKA 1FFXA 1VQNV 3CP1A 2VQFO 3SJCC 2DJVA 1W59A 3N27A 2P7TC 4DYLA 3N2GB 2QR4A 3JARA 2JEXA 1AROP 4KFMA 3U11A 2CK3G 3SYCA 2QWRB 5EC2C 2Q4PA 3X2QB 3VQYA 4FZ1A 1LUWA 1OV9A 5GONB 4R50A 5JVDA 4OX9B 2F93B 4WCEV 1I08A 1R3LC 2IJKA 5C8YB 1XMQB 1BGYH 3E89A 2JJ2G 4IL6Z 3CCLV 2YXLA 5J2TB 4UCVA 3GWOA 5CA3A 4WFAV 1KP3A 3QVNA 4FLWA 1WAZA 4L87A 1N8RW 4DR2B 3CC4V 1LUVA 5EYPA 4PJ0Z 4UB8Z 3G80A 3ZHTA 5EZYB 4CH5A 2Q9LA 3IC9A 5A2QN 2LW7A 5LGTA 2BTQA 3MD0A 4K0KO 4K35A 1PL0A 5LP6B 2ZCEA 1NTMH 1S72V 3K06A 2QDOA 1K7DA 3ZMSA 3ABMC 3EVKA 1SKVA 1NH2D 4JI5O 2W0XA 3HKCB 5E1AC 1M57C 4J10A 5JJNB 1N33B 5LYJA 4DUZB 2OWOA 1K3EA 1Z5VA 4JI8B 4DW1A 2Q67A 4JV5B 2R9AA 2F95B 3BCCH 2UUBB 4B3TB 4TQFA 3EXAA 4X65B 5B5EZ 2Y69B 1K97A 4A5UB 1KMIZ 4CS4A 3K57A 3VBBA 3OTOO 2HLDG 3KKYA 4JI7O 1FJGO 3CCVV 4O4JA 1VF6A 4YJ3A 2ZE7A 1N36B 3VOUA 3H9VA 2N74A 2EULA 1G6UA 1B6QA 4JAVA 5LGUA 4MT8A 1YVWA 4EB6A 1FXKC 3CE2A 3X2QC 1DK1A 5GTHZ 1N4CA 3CRMA 4P2ZA 2KB1A 3KCYA 2F4VB 2UUAO 4C7UA 1JA8A 5FNVB 1KKDA 1OCRB 1SA0A 2QA4V 4U7OA 3JYCA 3IC7A 5KUMA 2WA4A 1XDCA 5JCOC 3OEEG 1FXVA 2WWWA 1P7GA 3N2KB 3BEHA 3GVMA 4JI1B 3UO3A 1XL6A 1I7FA 4DV4B 5DM6V 4LF7O 4JZGA 4CZZA 3T1CA 1M56B 4ZOLB 1JOYA 4RO2A 1D5NA 1VF7A 4D7TA 4FLXA 4FFBB 3JCUZ 1XNQB 1M90W 3ZRWB 3L75H
chains in the Genus database with same CATH topology
3CX5F 1SQVH 4U3FH 3TGUH 1BCCH 3H1KH 4PD4F 2BCCH 1BGYH 5KLVH 1L0LH 1PP9H 3H1JH 3L74H 1SQQH 3L72H 1EZVH 1P84F 4D6TH 3CWBH 1SQBH 1PPJH 2FYUH 1SQXH 3H1LH 3H1HH 3H1IH 1KB9F 1SQPH 1BE3H 1NU1H 3BCCH 3L75H 2A06H 1KYOF 1NTZH 3L73H 1NTMH 3L71H 3L70H 3CXHF 1NTKH 2IBZH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 F;  1SQV H;  4U3F H;  3TGU H;  1BCC H;  3H1K H;  4PD4 F;  2BCC H;  1BGY H;  5KLV H;  1L0L H;  1PP9 H;  3H1J H;  3L74 H;  1SQQ H;  3L72 H;  1EZV H;  1P84 F;  4D6T H;  3CWB H;  1SQB H;  1PPJ H;  2FYU H;  1SQX H;  3H1L H;  3H1H H;  3H1I H;  1KB9 F;  1SQP H;  1BE3 H;  1NU1 H;  3BCC H;  3L75 H;  2A06 H;  1KYO F;  1NTZ H;  3L73 H;  1NTM H;  3L71 H;  3L70 H;  3CXH F;  1NTK H;  2IBZ H;  1L0N H; 
#chains in the Genus database with same CATH topology
 3D36 A;  2Q6A A;  3MHS C;  3SJA C;  3H1J H;  4AHC A;  2Q7G A;  1QLN A;  1F4M A;  3ML0 A;  4NXM B;  1Y6X A;  1SQB H;  2FYU H;  2IM9 A;  2Y0P A;  3A0H Z;  4ICG A;  4HYO A;  4O4H A;  1ROP A;  2ZDI C;  4MVU A;  1YF2 A;  2P5O A;  2ZT9 B;  5L3B A;  2Y69 C;  2JK5 C;  3QNE A;  1VEW A;  3QTC A;  3APQ A;  1I5Y A;  4AIL C;  1AP6 A;  2DQ0 A;  3B8M A;  1YJ9 V;  3CCU V;  2JIZ G;  4LC1 A;  4W4K A;  4QE9 A;  1P4R A;  3F7V C;  4HNA A;  1E79 G;  2EIK B;  2YI9 A;  2R72 A;  2R70 A;  1WLE A;  4LF4 O;  1NVP B;  3B8N A;  2ADQ B;  3SYP A;  4BR6 A;  3ZHR A;  2EBO A;  1OCR C;  4MW8 A;  3FX7 A;  3JSN A;  1R6T A;  4MVZ A;  4X20 B;  4H0L B;  5ITZ A;  5IDJ A;  1W0J G;  3BHP A;  4X62 O;  1PNK A;  2EZO A;  1HNZ O;  2HKO A;  1AR1 B;  4I0X B;  4BIU A;  2YS8 A;  3G6E V;  4J42 A;  5BR8 B;  1M56 C;  5KHH A;  3JAM N;  4F6R A;  2LO1 A;  2YXY A;  3HKB A;  5CA0 B;  5LL6 Y;  2HVJ C;  2D2C B;  2XAJ A;  5CN0 A;  1EN4 A;  4DK1 A;  4DR6 O;  3E22 A;  4GX0 A;  2ZIO A;  3CSX A;  4BIZ A;  3D3Q A;  4GKJ O;  2UXC B;  1IXB A;  3L74 H;  2BTO A;  5GTI Z;  1AVM A;  5LMN B;  2OYQ A;  1VQP V;  1OHH G;  1N32 O;  3M99 B;  2D3O W;  3CHX A;  2YC0 A;  1TVK B;  4LF8 O;  2L35 A;  2WLI A;  5EK0 A;  3RYF B;  3QO8 A;  1VQ7 V;  3VQV A;  1WPB A;  4I4T B;  3K58 A;  1KQS U;  1K5S A;  3CRR A;  2ZXW C;  5HFM A;  4LH7 A;  1L8D A;  2GSM B;  2X6B A;  1GN3 A;  5H2F Z;  3SR2 C;  1DTO A;  2HR3 A;  3OGC C;  4MS2 A;  4X1I B;  4QGP A;  3CJH B;  4O2A B;  2FB5 A;  1V55 C;  3ZMZ A;  1KP2 A;  5LA6 A;  4LF9 B;  1XRE A;  1SC5 B;  2DE0 X;  3C90 A;  1RPR A;  3OUF A;  4DV3 B;  2HFE C;  2UUA B;  3CB2 A;  1F7Y A;  4DV1 O;  3ZCC A;  1A32 A;  4OXS A;  1KC8 W;  1N34 B;  4B3M B;  4IIJ B;  1SQF A;  3DC5 A;  1ORQ C;  2E76 B;  1Y4M A;  2B5U A;  4UCO A;  1L0L H;  4JTA B;  4WFE A;  4CS2 A;  4U3J A;  2DYR B;  1Q90 D;  1K34 A;  1KKC A;  2QEX V;  3T1Y O;  2IJI A;  2ZQM A;  4X1Y B;  1MA1 A;  1J5E O;  1PV0 A;  1XI1 A;  3THO A;  4X66 B;  1UJW B;  3W7X A;  2A9H A;  4YJ2 A;  2NN4 A;  5LXT A;  2Y4T A;  5GW7 A;  3K5L A;  3D8C A;  4U3F H;  2A7W A;  1YCI A;  5EIB C;  4KP4 A;  4TUY B;  2OCH A;  1F23 A;  3RN4 A;  2ZNJ A;  1P7B A;  1SER A;  3AG7 A;  4RUE A;  4J7J A;  3K08 A;  4MVO A;  3P3N A;  4CBC A;  4IT5 A;  3HKE B;  4P30 A;  2Q0A A;  2Q0O C;  5IYC O;  2G38 A;  2GHY A;  3RYI A;  3ZBH A;  1W2B U;  2CUG A;  3E83 A;  3O9O A;  3JAW B;  1DF4 A;  3CYO A;  4R6Z A;  1L1F A;  2QTO A;  4NTX A;  2C2A A;  4Q6G A;  1K92 A;  1Q81 W;  1I94 O;  2B1G A;  2GTA A;  1FXH A;  1QHT A;  3FAV A;  3OMA B;  1YTF D;  3N2G A;  1AI6 A;  1SF9 A;  4FLU A;  1YIJ V;  4G28 B;  2N04 A;  3B4S A;  4Z1M G;  4X64 O;  2RDC A;  2A0L A;  2XT9 A;  2BE3 A;  5J2U B;  2OTL V;  1CXZ B;  4K8Z A;  3ZHS A;  1VAR A;  3T4D A;  4JI3 O;  1VQ8 V;  1MNG A;  5GON A;  4TV9 B;  4DV0 O;  1GAX A;  3TK1 A;  2W6I G;  3STZ C;  3BA9 A;  4CH3 A;  1CP9 A;  1X59 A;  5FLX N;  4K3A A;  1BL8 A;  3ZMV A;  3UCS C;  4I9Q A;  1QQC A;  3WB0 A;  4QJF B;  2AGA A;  3CXC U;  3OTF A;  4F6E A;  2UXD B;  5J2T A;  5D5P A;  1IBK B;  1KUQ A;  5JCO A;  3OR6 C;  4DO2 A;  4OGQ B;  3RWR D;  3TXQ A;  5FPR A;  5B1O A;  4P9O A;  2OCC B;  5DN6 G;  1SZT A;  2HP8 A;  5EZY A;  2AZ0 A;  1XUQ A;  1AJP A;  3LDC A;  2ZNI A;  1M4U A;  1ZTE A;  2ZR3 A;  3OMN B;  2A3Q A;  1YDX A;  2EIM B;  2E5L O;  2VWJ A;  2IU0 A;  5IJ0 B;  4PHZ A;  5IYD O;  1MSW D;  4FFK A;  1PP9 H;  4LF8 B;  2LW1 A;  4KHP O;  3K9S A;  5LP6 A;  1Y74 B;  4YHH B;  3AK3 A;  5LOV B;  1MZF A;  1NT2 B;  2GUZ A;  2P6J A;  3HKC A;  4ZBM A;  1Q8I A;  2WAM A;  2Q7E A;  3B09 A;  5HFL A;  5BMV B;  3ZN0 A;  4LF5 B;  1US6 A;  2L6L A;  4JYA B;  1QNM A;  1V54 B;  1AR5 A;  4NKG B;  4MW3 A;  4FM2 A;  5E79 Z;  3VQW A;  1HWY A;  4QPJ A;  2OIE A;  1IBM O;  2KG7 B;  1JVM A;  1FXK B;  1PL4 A;  3FD9 A;  1SQP H;  4FPP A;  4D7S A;  3G67 A;  1KD1 W;  1WP8 A;  3T1H B;  3DSQ A;  5B66 Z;  2WLL B;  1AJQ A;  1RSO B;  2ITC C;  1Q3E A;  3AG2 B;  4DUY B;  3ASO C;  3TCU A;  3ABT A;  3AK2 A;  3K5M A;  4DR7 B;  5EBW C;  2KSD A;  3IFX A;  1BHA A;  1FKA O;  4UXN A;  1Q82 W;  2F43 G;  4MVQ A;  1NJI W;  5FNV A;  2CDY A;  4LWS A;  5TIS Z;  4J11 A;  3T1Y B;  2XAF A;  1NTK H;  1S5J A;  5IWA O;  1XIL A;  1M5I A;  4I50 B;  3LDE A;  2XAS A;  3GWK C;  3OFN G;  4BIO A;  1VQO V;  2LGQ A;  4RQE A;  5D5Q A;  3N2K A;  3SPG A;  4X88 A;  4DRX A;  2DWD C;  5H6R A;  2OCC C;  4MTO A;  5AG2 A;  1R3K C;  2AXT Z;  4JI2 B;  4GKK O;  1PNL A;  3LSS A;  5H9C A;  4PA7 A;  2EIM C;  4Z2W A;  2EIJ C;  3ASN C;  4DV5 B;  1THZ A;  1IBL O;  3ZRW A;  1HR0 B;  1H2L A;  1Q86 W;  3JAL B;  3CME V;  3K9A A;  2ETN A;  1NU1 H;  1BE3 H;  4GYC B;  5IYZ A;  2UU9 O;  3DXR B;  2B9Z A;  2NR5 A;  5BXZ A;  1KYO F;  1N0N A;  2FML A;  2DYS B;  3OT7 A;  3E8B A;  4LFB B;  1R3J C;  4TT3 G;  1FFX B;  1S5L Z;  3H01 A;  4B08 A;  4MTG A;  3E8G A;  4UCT A;  2UUC B;  1XQ8 A;  1V54 C;  4B7E A;  1R3I C;  5CBH A;  2UXB B;  3ICX A;  1QBZ A;  4H44 B;  1HNW O;  5KHK A;  4X64 B;  3LDD A;  5KLV H;  3P30 A;  3AG2 C;  3HB3 B;  4L8J A;  4DV2 O;  4LNU A;  1MSD A;  1FS0 G;  4Q20 A;  1IX9 A;  4X89 A;  3MDS A;  4YY3 O;  3SDL A;  4GZR B;  4P9P A;  2YDE A;  5LMU B;  1SQG A;  3BFR A;  1NVP D;  1VF5 B;  4X20 A;  1CPY A;  4J7K A;  4LF6 O;  4AQY O;  1GM9 A;  5EYP B;  1VIB A;  3T4Z A;  4FM1 A;  2V4D A;  1IDS A;  3E8F A;  2FL4 A;  4EKW A;  4OPA A;  2DQ3 A;  2ZR2 A;  1QR8 A;  5IJ9 B;  1Q6I A;  2BTQ B;  4ZI7 B;  4FLZ A;  3JAK A;  3JD3 A;  2X0L A;  3E8H A;  5LGN A;  2JS5 A;  3WU2 Z;  4DR1 B;  4RWU A;  2DWE C;  4E2L A;  1EM1 A;  1F51 A;  1VQ9 V;  1F4N A;  2B1I A;  2EIL C;  2E75 B;  3BA8 A;  5EIB D;  2WLJ A;  1XNR B;  1OCC C;  2IH3 C;  2X7R B;  2LFS A;  3HKD A;  5B1A B;  1NI8 A;  2M6Y A;  1YXB A;  4NXN O;  3L71 H;  4DR4 O;  1EFR G;  4G27 B;  4HBN A;  2W6J G;  3NXS A;  2ZXW B;  2VQF B;  2DYS C;  2RJZ A;  4DR5 O;  1XEQ A;  4E4E A;  3AG4 C;  3TET A;  3RYF A;  2P90 A;  4PI0 A;  3K04 A;  1JR9 A;  4UVB A;  4PDL A;  3DGE A;  3W7T A;  2PYL A;  2EZP A;  4DXW A;  1V55 B;  2CH7 A;  2QSA A;  3CCS V;  4JI6 O;  3FB7 C;  3ZN1 A;  3K03 A;  4NYK A;  5KHG A;  2YIA A;  1S76 D;  1IZ3 A;  5B1B C;  1GN2 A;  5JQG A;  1JMK C;  3L72 H;  4X1I A;  3A8T A;  5KUK A;  1XMO O;  1TAE A;  4O2A A;  3UT5 B;  4QIW F;  3GB7 C;  3E2E A;  1URF A;  5LHG A;  3J7A U;  4JAU A;  2RMK B;  3RYH B;  1NTZ H;  1SA0 B;  4GUN A;  1GKF A;  3H1K H;  2BCC H;  4DV7 O;  2K1E A;  4IIJ A;  1D2D A;  2Y48 A;  2AHY A;  4GCZ A;  5IWA B;  2Q69 A;  2Q7H A;  1K73 W;  2E74 B;  4LBE C;  2AW9 A;  3AK1 A;  1KB9 F;  2PY5 A;  4JI4 O;  3CCM V;  3K0G A;  4PEL A;  5EBL C;  3AG1 C;  3UM7 A;  4K0K B;  4X1Y A;  4O2B B;  1K4C C;  4DW0 A;  3CC7 V;  4DV6 O;  5JJJ B;  2CTQ A;  5KAI Z;  3J81 N;  3F5W C;  1Y66 A;  5BZB A;  4TSF G;  3JAS A;  1R1B A;  1Q6H A;  4TV8 B;  4JI5 B;  4AI8 A;  2HHH O;  4H37 A;  3NR7 A;  5L3G A;  2YUA A;  2JS3 A;  4XDL A;  1ZUQ A;  2A06 H;  1NKD A;  3G4S V;  3CX5 F;  5B1A C;  1Y76 A;  2LJ2 A;  5KX5 B;  1GO3 F;  4JI0 O;  4ZHQ B;  4BWA A;  3ABU A;  5K1X A;  2WLN A;  2QE7 G;  3WB1 A;  3ZJZ A;  3O65 A;  5JH7 B;  4FJC C;  2Q8V A;  2OTJ V;  2GTS A;  1Z5W A;  3OTO B;  3ZRS A;  3CCE V;  4JI7 B;  1FJG B;  1BMF G;  5IE9 A;  1J95 A;  1H38 A;  5EBM C;  3JAW A;  4B3S O;  1VF6 C;  1GTO A;  2RQ6 A;  4N21 A;  3CPW U;  3DTU B;  4D6T H;  1WB7 A;  4HNA B;  1Q6U A;  2E3C A;  5CA1 B;  4NTY A;  1U97 A;  4KL1 A;  4DV2 B;  4FLY A;  2YEV A;  1H2K A;  2AHZ A;  5KA6 A;  3JAT A;  4OX9 O;  4J80 A;  2KKW A;  2F23 A;  5J2U A;  5ITZ B;  5H5N A;  3F7Y C;  3QG5 A;  3JD0 A;  3TJT A;  2CE4 A;  4O4I A;  4FK5 C;  4CS3 A;  3R65 A;  4O4L A;  5J9P C;  1Z2G A;  4MTX A;  2PGG A;  1XMQ O;  4LF6 B;  4LF7 B;  3CD6 V;  1N0J A;  1D5A A;  4WBN B;  2OIG A;  5KMG B;  2NNU A;  1B04 A;  4LFA O;  3K5N A;  3A0R A;  1RM1 B;  1E1R G;  2ZIN A;  4I55 A;  4F6R B;  1O9G A;  4DR2 O;  1GH6 A;  5JWP A;  4JAS A;  4J9Y B;  4KUM A;  1OZ0 A;  1QLE C;  1IXM A;  2QKC A;  4IHJ B;  2HVK C;  3R66 A;  3D36 C;  1XBL A;  4GX5 A;  3FB8 C;  3JCZ A;  4J9Z B;  3CRC A;  3Q4H B;  1HW7 A;  4NVP A;  3PJS K;  4X1K A;  1GM7 A;  4UCR A;  3SPI A;  4TOI A;  2VWK A;  2LQT A;  3FYE B;  3MHH C;  3RYC A;  4EFE A;  1EZJ A;  3ETD A;  1HP8 A;  1TA8 A;  2OT5 A;  1ZLZ A;  1WJZ A;  1FFT B;  2ZE8 A;  1N33 O;  1Y74 A;  1PD3 A;  4DUZ O;  1S0V A;  2QWO B;  4JI8 O;  2Q5Z A;  4JV5 O;  2UUB O;  2R9I A;  4CH6 A;  2MW2 B;  1NZ6 A;  4B3T O;  5BMV A;  4X65 O;  3JD4 A;  5CB4 B;  1WP7 A;  1LR1 A;  2PTM A;  4B7K A;  3K3W A;  2PF4 E;  3AG3 C;  5C93 A;  1S77 D;  5A9G A;  4JF3 A;  3ASO B;  4LF4 B;  2JVD A;  1R6N A;  3LNM B;  1FXK A;  3K79 A;  1N36 O;  1FAF A;  2RN9 A;  4JGS A;  4FIP C;  4IYH A;  2IW5 A;  2QKA A;  4UCS A;  1JJ2 U;  2WLL A;  3W7W A;  3QO7 A;  1YZB A;  1H2N A;  4X62 B;  1BQZ A;  2F4V O;  5C8Y A;  3CCR V;  2WSS G;  2QWQ B;  2EIN C;  2HJD A;  2VS0 A;  3EFF K;  5F2V O;  1HNZ B;  3U10 A;  3SPH A;  4NTW A;  1TUB B;  1RP3 B;  1RM1 C;  4YJ2 B;  5LBQ A;  4DR3 O;  3OD4 A;  4DR6 B;  4GKJ B;  4JPR A;  4MVM A;  1WA8 B;  4DV6 B;  4JI1 O;  3RT3 C;  4DV4 O;  5L3F A;  2ARH A;  3D3I A;  5DED A;  4RUF A;  1N32 B;  1WN7 A;  2YXH A;  3OGI B;  4FM0 A;  5KAF Z;  3W7S A;  2EIJ B;  3ABK C;  4JAA A;  3ASN B;  3OW2 U;  1S3J A;  3SJQ C;  3BAA A;  2XND G;  1ZWI C;  4WF9 V;  2Z5U A;  1XNQ O;  3K0D A;  1ZL8 B;  3H1L H;  2LP7 A;  3RYI B;  4J7Z A;  2WLK A;  4UV8 A;  3K5O A;  5L3D A;  3K59 A;  4NXM O;  4QNH B;  3KCX A;  2ZE5 A;  2ZDI A;  1M9N A;  3PN1 A;  4GT1 A;  3DXR A;  2QM4 A;  1RFY A;  2QWN B;  3FAV B;  3HPL C;  4FLT A;  1DGS A;  5H6Q A;  3SPC A;  2JGD B;  1FPO A;  2QWP B;  1GN6 A;  3T2M A;  1NQT A;  1SQV H;  1IVS A;  4DV1 B;  2A79 B;  5K1P A;  5CBG A;  1P84 F;  2IJH A;  5IYB O;  2Y0I A;  4QE7 A;  4FVM A;  2ZM6 O;  4B3R O;  1OCO C;  1WPX A;  1JPX A;  5B3S B;  1DF5 A;  3STL C;  1KEC A;  3G6B A;  1KBH A;  4CC5 A;  4PDV A;  1NR1 A;  3E86 A;  1XOU A;  1J5E B;  4ABM A;  1EZV H;  4LFA B;  1NBM G;  4UV9 A;  1GN4 A;  1VQL V;  1W0K G;  2QGN A;  4JYC A;  4GLX A;  2JEU A;  3TXS A;  4KXR A;  2XAQ A;  2CGO A;  4QPK A;  2ATK C;  2IBZ H;  4X8A A;  4ZOL A;  5LHI A;  3EHB B;  2NLJ C;  1M93 A;  1JFF B;  5BR8 O;  3A0B Z;  1I0H A;  2EIL B;  5IJ9 A;  4Z1V A;  1BS3 A;  2QM7 A;  4FFB A;  4ZI7 A;  1QCE A;  2P4K A;  1OCC B;  4DK0 A;  3SYO A;  4EEQ A;  4PA9 A;  3UO2 A;  4YIP A;  2YIB A;  3ZHQ A;  2UXC O;  4MTF A;  4WFH A;  1AI7 A;  2LFR A;  1AB3 A;  2JGU A;  5LMN O;  4UB6 Z;  2Z0A A;  5EC1 C;  2FTK A;  3L73 H;  2YIB D;  2BOB C;  3ZHU A;  2QTS A;  4F4L A;  3AEI A;  2GUZ B;  3AG4 B;  2BSK B;  2Y4U A;  3LSQ A;  3P3P A;  3J80 N;  1ENV A;  2CAZ C;  1PM9 A;  1I94 B;  3DC6 A;  1JX9 A;  1M1K W;  3JAR B;  1PPJ H;  3KZI Z;  4HAM A;  1H8H G;  2R9R B;  2ZKO A;  1B3Q A;  3ETE A;  2XAH A;  2XTA A;  5B1B B;  1JCH A;  5JVD B;  3RBZ A;  2JRI A;  3CRA A;  3CMA V;  3UQ8 A;  2CTP A;  4X9Q A;  4XDK A;  3VQX A;  4OPH A;  4JI3 B;  1NR7 A;  4JTD B;  4DV0 B;  1SET A;  4LF9 O;  4WFB V;  1AR4 A;  4W4L A;  3UT5 A;  3ZRX A;  5B3S C;  3APO A;  4DV3 O;  2XHB A;  1QVG U;  4I5S A;  2XUM A;  4H13 B;  2GV9 A;  4NR1 A;  4RAI A;  1N34 O;  2WLM A;  3RYH A;  4B3M O;  2P06 A;  4LWS B;  3WFV A;  2H3O A;  1EN6 A;  1YI2 V;  4LCU C;  1PNM A;  1YIT V;  1CEZ A;  1H2G A;  3IAY A;  3AG1 B;  3ETG A;  3OEH G;  2YIC A;  4PA6 A;  4DR3 B;  4RQF A;  4LFC O;  4DRX B;  4I0X A;  3BVO A;  3OUS A;  2VQE O;  1OJH A;  4X66 O;  3S3X A;  4GX2 A;  1NH2 B;  5CA0 A;  2E5L B;  3ABL B;  3SPJ A;  4BW9 A;  1BQ0 A;  4O2B A;  2HEP A;  1R73 A;  3FB5 C;  2O57 A;  4NB5 A;  2MK3 A;  5JJE B;  4KHP B;  1LNQ A;  1JJO A;  4LH6 A;  4R8C A;  5LYJ B;  1AI4 A;  4TV8 A;  5LP6 C;  2ZD9 A;  1TVK A;  5IYZ B;  4UVA A;  4XDJ A;  3CS5 A;  2KQX A;  4YXW G;  1ZSP A;  3FKS G;  4CC6 A;  2WA3 A;  5KX5 A;  4ZIB A;  4JTC B;  4ZHQ A;  1K9M W;  3RW0 A;  4I4T A;  3CRQ A;  1MZE A;  1IUR A;  3ZIA G;  4O4J B;  5JH7 A;  2Z3Y A;  4YJ3 B;  5KHI A;  1IBM B;  2UXX A;  5FPO A;  1U96 A;  3CEI A;  2GBO A;  1VQ6 V;  4EB6 B;  5FL7 G;  3ZS8 C;  1O9H A;  1AI5 A;  1Q5O A;  1TUE B;  4K8X A;  1EN5 A;  2LGW A;  3CJH A;  4BW5 A;  4LP8 A;  3FFQ A;  1R6K A;  4FMT A;  1GRJ A;  3B77 A;  2ADP A;  2ZM6 B;  4LNU B;  4B3R B;  4UVC A;  5LHH A;  5IT9 N;  2GDS A;  4G2K A;  5CA1 A;  5L3C A;  4I9W A;  4UCU A;  3BY6 A;  2DN9 A;  3OE7 G;  1T5E A;  3W7U A;  3WG7 B;  3ETQ A;  3BAB A;  3B40 A;  1XL4 A;  2PI5 A;  1MOF A;  1UPG A;  4MVR A;  1VQ4 V;  1AJN A;  2QJ1 A;  3CXH F;  5KHJ A;  3JD1 A;  2WLH A;  2Q68 A;  2RCV A;  1SQQ H;  4GKK B;  3CCJ V;  3OMI B;  4WBN A;  1QLE B;  1V9P A;  5KMG A;  2UXD O;  3JAK B;  1IBK O;  1AIL A;  3F5T A;  2IU3 A;  4TUY A;  1B06 A;  3ABL C;  3ZMT A;  4PDR A;  1IBL B;  3L70 H;  1Y67 A;  2F66 C;  3I55 V;  4PA4 A;  4BAY A;  4JYB A;  3RVZ A;  4IHJ A;  4MSW C;  1VQM V;  3HKD B;  2UU9 B;  1H8E G;  3HKE A;  3SYA A;  2ODM A;  1BHB A;  4O4H B;  3I5D A;  2ZE6 A;  5IY5 B;  2Q73 A;  1SRY A;  3Q4H A;  4WFF A;  1H2S B;  1TGO A;  1HNX O;  3IJ4 A;  1ZX3 A;  3QF7 A;  2BOC C;  3A2F A;  4YHH O;  1X4T A;  3OM3 B;  1XHZ A;  4IGG A;  2JJ1 G;  4GX1 A;  4TQD A;  3ZHV A;  2W0F C;  1KU9 A;  1K33 A;  2PYJ A;  1QVF U;  1EBO A;  2CH7 B;  4LF5 O;  3U0Z A;  1HNW B;  2EJ7 A;  3AG3 B;  5KA5 A;  1FD9 A;  1XHX A;  1JQ0 A;  3IGA C;  4JYA O;  3H1H H;  2XOK G;  5JQG B;  3L9D A;  2WPD G;  2HJF C;  2H94 A;  3B2E E;  5CB4 A;  1OCZ B;  3M8A A;  2DOS A;  4YY3 B;  3T1H O;  2EIK C;  4XBF A;  2UXN A;  4R7C A;  4I7Z B;  3S3W A;  2N05 A;  1Q7Y W;  4DUY O;  2EIN B;  2VRZ A;  2PZS A;  2YI8 A;  3H1I H;  4TV9 A;  2PUS A;  3KG2 A;  4DR7 O;  3WG7 C;  4AQY B;  2JDI G;  3RFR A;  1VMG A;  3M7M X;  1WB8 A;  2P4V A;  1MG1 A;  5DEC A;  2EJR A;  3SJB C;  1GMG A;  3TGU H;  1QU7 A;  1E1Q G;  5L3E A;  5BY1 A;  1S5H C;  2IH1 C;  3HKB B;  4LFC B;  2H8P C;  1TUB A;  3JD2 A;  2IJJ A;  3E22 B;  4H33 A;  2VQE B;  2ITD C;  2DW4 A;  1SS3 A;  2YSU B;  3ABK B;  1BZK A;  3E35 A;  1L0N H;  3JAS B;  1WA8 A;  1YJW V;  2V1D A;  3OAA G;  3UKM A;  4PV1 B;  4JI2 O;  2CTR A;  4ASU G;  2WLI B;  4NXN B;  3ZX6 A;  4DR4 B;  2HG5 C;  4UUJ C;  5CMU A;  5IJ0 A;  1VQ5 V;  1SQX H;  1Y76 B;  3CCQ V;  1PKX A;  1K5Q A;  5IY5 C;  4DR5 B;  3MAQ A;  2EX3 A;  4TWK A;  4DV5 O;  1HR0 O;  3CC2 V;  5LOV A;  2V7Q G;  1ZL8 A;  1G8M A;  4PD4 F;  4ZKI A;  1NS1 A;  2X6C A;  1YJN V;  2QM8 A;  2CTW A;  4PDM A;  4JI6 B;  4LFB O;  1G4Y B;  3QO5 A;  3I56 V;  1FYJ A;  1ZAU A;  3LNN A;  5LA6 B;  2UUC O;  3BPZ A;  1SES A;  1XMO B;  2KG7 A;  4CH4 A;  3FYI B;  3RGB A;  4JZ2 A;  1UFI A;  4HZ3 A;  3WB2 A;  2UXB O;  1OCZ C;  1OCO B;  2X6A A;  1BSM A;  1I5X A;  1MAB G;  2FKX A;  2JGD A;  4IYI A;  3RVY A;  2F1M A;  1RSO A;  2YEV B;  3CWB H;  4EFB A;  1YHQ V;  3JAT B;  5CBF A;  4DV7 B;  3HR0 A;  2ILM A;  4JYY A;  2QKS A;  4U3J B;  2P22 C;  4O4I B;  2RNB A;  1Q43 A;  1DLB A;  1BT8 A;  3JSL A;  2ZIM A;  4O4L B;  4FLV A;  1P49 A;  1H2M A;  4LR3 A;  4WFG A;  4U7N A;  1SZX A;  4JI4 B;  3C3S A;  1GK9 A;  5LMU O;  4YIO A;  2CGN A;  2YID A;  5LXT B;  2DYR C;  1VQK V;  1K4D C;  4UFZ A;  4I50 A;  1G1X B;  4I55 B;  3ZED A;  4FZ0 A;  4J41 A;  1YSC A;  1GM8 A;  3OR7 C;  3FB6 C;  3ZRV A;  1BCC H;  1YEW A;  3SGI A;  2HHH B;  1HDJ A;  4PI2 A;  1AP5 A;  3LUT B;  1MMM A;  1WNS A;  3P32 A;  1JFF A;  4JI0 B;  1QR9 A;  4DR1 O;  4PA3 A;  3ABM B;  4X1K B;  3ZMU A;  2M7W A;  4N23 A;  3SYQ A;  3RYC B;  5B1N A;  1M57 B;  2XAG A;  2P67 A;  2K9P A;  1HNX B;  3JAL A;  1XNR O;  3LSU A;  1COW G;  3G71 V;  2DMX A;  3C3T A;  1VP7 A;  2PI4 A;  4MVS A;  1RPO A;  3BRC A;  2AZ2 A;  1K8A W;  4B3S B;  1YTF B;  2BSK A;  1FFX A;  1VQN V;  3CP1 A;  2VQF O;  3SJC C;  2DJV A;  1W59 A;  3N27 A;  2P7T C;  4DYL A;  3N2G B;  2QR4 A;  3JAR A;  2JEX A;  1ARO P;  4KFM A;  3U11 A;  2CK3 G;  3SYC A;  2QWR B;  5EC2 C;  2Q4P A;  3X2Q B;  3VQY A;  4FZ1 A;  1LUW A;  1OV9 A;  5GON B;  4R50 A;  5JVD A;  4OX9 B;  2F93 B;  4WCE V;  1I08 A;  1R3L C;  2IJK A;  5C8Y B;  1XMQ B;  1BGY H;  3E89 A;  2JJ2 G;  4IL6 Z;  3CCL V;  2YXL A;  5J2T B;  4UCV A;  3GWO A;  5CA3 A;  4WFA V;  1KP3 A;  3QVN A;  4FLW A;  1WAZ A;  4L87 A;  1N8R W;  4DR2 B;  3CC4 V;  1LUV A;  5EYP A;  4PJ0 Z;  4UB8 Z;  3G80 A;  3ZHT A;  5EZY B;  4CH5 A;  2Q9L A;  3IC9 A;  5A2Q N;  2LW7 A;  5LGT A;  2BTQ A;  3MD0 A;  4K0K O;  4K35 A;  1PL0 A;  5LP6 B;  2ZCE A;  1NTM H;  1S72 V;  3K06 A;  2QDO A;  1K7D A;  3ZMS A;  3ABM C;  3EVK A;  1SKV A;  1NH2 D;  4JI5 O;  2W0X A;  3HKC B;  5E1A C;  1M57 C;  4J10 A;  5JJN B;  1N33 B;  5LYJ A;  4DUZ B;  2OWO A;  1K3E A;  1Z5V A;  4JI8 B;  4DW1 A;  2Q67 A;  4JV5 B;  2R9A A;  2F95 B;  3BCC H;  2UUB B;  4B3T B;  4TQF A;  3EXA A;  4X65 B;  5B5E Z;  2Y69 B;  1K97 A;  4A5U B;  1KMI Z;  4CS4 A;  3K57 A;  3VBB A;  3OTO O;  2HLD G;  3KKY A;  4JI7 O;  1FJG O;  3CCV V;  4O4J A;  1VF6 A;  4YJ3 A;  2ZE7 A;  1N36 B;  3VOU A;  3H9V A;  2N74 A;  2EUL A;  1G6U A;  1B6Q A;  4JAV A;  5LGU A;  4MT8 A;  1YVW A;  4EB6 A;  1FXK C;  3CE2 A;  3X2Q C;  1DK1 A;  5GTH Z;  1N4C A;  3CRM A;  4P2Z A;  2KB1 A;  3KCY A;  2F4V B;  2UUA O;  4C7U A;  1JA8 A;  5FNV B;  1KKD A;  1OCR B;  1SA0 A;  2QA4 V;  4U7O A;  3JYC A;  3IC7 A;  5KUM A;  2WA4 A;  1XDC A;  5JCO C;  3OEE G;  1FXV A;  2WWW A;  1P7G A;  3N2K B;  3BEH A;  3GVM A;  4JI1 B;  3UO3 A;  1XL6 A;  1I7F A;  4DV4 B;  5DM6 V;  4LF7 O;  4JZG A;  4CZZ A;  3T1C A;  1M56 B;  4ZOL B;  1JOY A;  4RO2 A;  1D5N A;  1VF7 A;  4D7T A;  4FLX A;  4FFB B;  3JCU Z;  1XNQ B;  1M90 W;  3ZRW B;  3L75 H; 
#chains in the Genus database with same CATH homology
 3CX5 F;  1SQV H;  4U3F H;  3TGU H;  1BCC H;  3H1K H;  4PD4 F;  2BCC H;  1BGY H;  5KLV H;  1L0L H;  1PP9 H;  3H1J H;  3L74 H;  1SQQ H;  3L72 H;  1EZV H;  1P84 F;  4D6T H;  3CWB H;  1SQB H;  1PPJ H;  2FYU H;  1SQX H;  3H1L H;  3H1H H;  3H1I H;  1KB9 F;  1SQP H;  1BE3 H;  1NU1 H;  3BCC H;  3L75 H;  2A06 H;  1KYO F;  1NTZ H;  3L73 H;  1NTM H;  3L71 H;  3L70 H;  3CXH F;  1NTK H;  2IBZ H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...