1PP9H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1pp9H00
1PPJH 4U3FH 5KLVH 3BCCH 1SQXH 3L73H 1NTZH 3L75H 1NTKH 1L0NH 3H1IH 1NU1H 1SQPH 1BCCH 1BGYH 3H1KH 1KB9F 2FYUH 2IBZH 1L0LH 3L74H 1KYOF 3CX5F 1EZVH 1NTMH 3L70H 4D6TH 1SQQH 3H1HH 3L71H 3TGUH 4PD4F 2A06H 3H1LH 1P84F 1BE3H 2BCCH 3CWBH 1PP9H 3CXHF 1SQBH 3H1JH 1SQVH 3L72H
chains in the Genus database with same CATH superfamily
4PI2A 4QPJA 1SQXH 2WLLB 1FAFA 4ZOLB 3SYAA 1N32O 3WG7C 4DV2B 4LF8B 1VEWA 3UO2A 3B4SA 5J2TB 3RVZA 1KB9F 1Q8IA 5LHHA 1YTFD 2RNBA 3TETA 4CH3A 3G67A 4DO2A 3AK2A 1QR9A 1VF6C 5LOVA 4PDVA 4DR7B 4J10A 3HKCA 4LWSA 1F51A 4DV2O 2HR3A 3ZRWA 2P5OA 3JASB 3WFVA 2E5LO 2DQ0A 1HR0O 1BCCH 4GZRB 2HG5C 4MS2A 1KYOF 3D8CA 2Y69B 4J7KA 2R72A 3OMAB 3E89A 3U0ZA 3N2GB 4JYAO 3SYCA 2ZE6A 1XNQO 3DC6A 4YHHO 2P06A 1CP9A 4E4EA 4HNAB 1IBMB 1Q6HA 1QU7A 1EN5A 3BVOA 4XBFA 5FNVA 4X65O 4D6TH 2Z3YA 3SJAC 3VQXA 3K5LA 1JR9A 3H1LH 3JAWB 1BE3H 1YDXA 3A2FA 1S77D 3B40A 1W59A 4DW0A 1MMMA 1QCEA 3SPHA 1H2LA 5B3SB 1Q86W 2QM7A 3DSQA 2HLDG 1HP8A 1V9PA 4FLXA 2EZOA 3CCUV 3K9SA 2ZR3A 1XHZA 4BW9A 3RYIB 1BHBA 2HP8A 4DR3B 2PUSA 3SGIA 1JMKC 2X6AA 3FD9A 3AG2B 2VQFB 3AEIA 4FLWA 3E86A 2R9IA 2UXDO 4DYLA 3CP1A 2P90A 5CA0B 4X1IA 2O57A 1JJOA 4FVMA 4DV0B 3ICXA 3CS5A 5KHGA 4JI7B 5EIBD 2ZE7A 1K5QA 4DV7O 4F6RA 1WAZA 3CHXA 4Z1VA 1DK1A 4JAUA 4X64B 4K8ZA 2UUCB 3CCJV 1R3IC 3EHBB 1HNZB 4I5SA 1FFTB 3BA8A 3CC2V 2QKSA 3UKMA 2A0LA 4FJCC 2YC0A 2QJ1A 1R3JC 1R6NA 3A0HZ 4JAVA 3K03A 1WP8A 4TWKA 4B3MB 1V54B 4MVOA 4NVPA 3CYOA 1W2BU 1UFIA 3T2MA 4NTXA 1KU9A 3OT7A 3S3WA 4R7CA 1JQ0A 3UT5A 2F66C 1VQLV 1U97A 3VBBA 2P4KA 2EIKC 2LJ2A 2XAFA 2NR5A 3JAMN 4LH7A 2LO1A 4X62O 2XNDG 1H2NA 4BIZA 4X9QA 3X2QC 3OAAG 1SESA 3FKSG 4JYYA 1KQSU 4I7ZB 1HNXO 2QDOA 4X1IB 3L73H 2R70A 3E35A 3L75H 1N0NA 1AI7A 4YJ3A 1HNZO 1VQNV 1WLEA 4J7JA 4X64O 1NQTA 3D3QA 4MVUA 2IJJA 4JV5B 1N36B 5HFLA 3KKYA 1K73W 1U96A 4DV7B 4MTGA 1M57C 3SJQC 1NH2D 5JH7A 4MVMA 1BS3A 3BY6A 2M6YA 1RFYA 5KHKA 3CCEV 3HKDA 4IGGA 1FFXB 1BZKA 1TAEA 3AG7A 4JPRA 3CMAV 2B1GA 2DMXA 2PI5A 1OCOB 1Q43A 4JI2O 2VQEO 4PA3A 1KBHA 1ZAUA 3ZRWB 3TXQA 2RDCA 3BHPA 4FLUA 2ODMA 4ZOLA 5L3EA 3JD1A 3HKCB 2WAMA 4LFBB 4U3FH 5CBFA 2ZNJA 5L3GA 4I0XB 3ZJZA 2C2AA 3SR2C 1NU1H 3E2EA 3IJ4A 3DXRB 4CS3A 4R6ZA 3E22B 1PD3A 2QTOA 3N2GA 4I50B 3RT3C 4ZHQA 2WLHA 4HNAA 2ZINA 1SC5B 4UV8A 2IH1C 4GX0A 4LCUC 1N33B 1WNSA 3ABTA 3HKEB 2OT5A 4BAYA 4CC5A 1RSOB 1M56B 1KUQA 4JI2B 1WP7A 1M56C 4J41A 1DTOA 2Y69C 3K79A 2K9PA 2WPDG 4TV8A 1K33A 1EZJA 4YY3O 2ZQMA 4KXRA 5LHGA 4AILC 4BWAA 4LFBO 2ETNA 1GTOA 1AB3A 4DUZO 3OTFA 3F7YC 1YTFB 3ABLB 3T1HB 3RGBA 2E5LB 4K3AA 2EIMC 4B3RB 2PZSA 3K3WA 2VS0A 2OCCB 3BAAA 5H5NA 3JARA 2ZNIA 1VARA 2NN4A 2EIJC 3KZIZ 4WFGA 1NBMG 1AI6A 4CBCA 2UUAO 4MW3A 3Q4HA 4JTAB 4DR2B 4LFCB 4JI3O 4TV9A 1B3QA 4JI0B 1LUWA 1YIJV 1Y76B 4XDKA 1IZ3A 5LP6B 4X65B 3OUSA 1NR7A 5CBGA 3I55V 3B09A 3E8GA 5DM6V 1N4CA 5B1NA 3VQVA 1YHQV 4U3JB 2JJ1G 3K58A 4QGPA 2CAZC 4MVRA 1D5NA 1GRJA 4LFCO 4DV6B 1SERA 4WFFA 4DR5O 4DV5B 3M7MX 4O2BA 4IYHA 1K5SA 3C90A 2Q7HA 1VQOV 5B1AB 4DK0A 3JCUZ 3MHHC 3JSLA 1G6UA 4DR2O 5ITZB 1CEZA 2FMLA 1XL6A 3CD6V 2XAQA 4OXSA 3TJTA 3DTUB 1IX9A 5GONB 1JJ2U 1ORQC 2ZIMA 3OMIB 1WA8A 3TK1A 3ZEDA 5TISZ 3ZMTA 4GYCB 3WB2A 3E83A 3DGEA 1NVPD 1N32B 4HBNA 2JS3A 5LXTB 3W7WA 1IBLO 4JI8O 3OTOO 4RO2A 2D2CB 4LF4B 3K0DA 3G6EV 3RYFB 2Q0OC 2JRIA 3ZRSA 2B1IA 3P30A 2PI4A 2DYRC 2EIJB 4BIOA 3TGUH 5L3BA 2P67A 1FD9A 2L35A 1ZUQA 3GWOA 1SQBH 2QWPB 2A3QA 4ZI7A 1LUVA 4Z1MG 2WLLA 3STZC 1ZLZA 2RCVA 5LA6B 1S0VA 5EIBC 1Z2GA 2QTSA 1XREA 4UV9A 4DUYO 1GO3F 4JI3B 1P49A 1H8HG 1SS3A 2UXDB 1M90W 1EFRG 3BRCA 2BSKA 3A0BZ 3OE7G 1R73A 1F23A 5KLVH 3FYIB 3ETEA 2F23A 2JJ2G 3FB7C 1WPBA 2E75B 3G80A 5CA1B 3H1IH 4JV5O 4MVSA 2ZXWC 1OCOC 4MTFA 5DEDA 4I50A 2FB5A 3BABA 4RWUA 4J9YB 1N34O 2UU9B 2F93B 1XMOB 1NR1A 3DC5A 4G27B 3LSSA 3QG5A 2ZT9B 4RQEA 3ASNB 3L9DA 3FX7A 3VOUA 1GAXA 3ABMC 5BR8B 3QO7A 4DV3B 1FPOA 4DRXA 3IAYA 3HPLC 5B66Z 5FNVB 2UXBB 1JOYA 1NZ6A 4LF9O 3UT5B 2M7WA 3ML0A 4UCSA 1FXKC 1I94B 4XDJA 5CB4B 2LFSA 2A7WA 3ZHVA 2OIGA 5LL6Y 4FIPC 1BMFG 2LFRA 2A9HA 4FLTA 4RAIA 1KD1W 1IXBA 3RYIA 5JCOC 1BQZA 2IH3C 4TV9B 4RQFA 3BCCH 1M93A 4YJ3B 1J5EO 4FM0A 2JS5A 3OD4A 2HHHO 4UVAA 2WLIA 3NR7A 1XDCA 5EC1C 4LF5O 2PF4E 3L74H 1OV9A 4CH6A 2X7RB 3DXRA 2VWKA 1VQ7V 2AHZA 5BMVA 1P84F 3JD0A 2Y0PA 1XL4A 1Y76A 4KFMA 2YDEA 4GKKB 3TCUA 3C3SA 4F6RB 3MDSA 1HNWB 1IURA 1MABG 2X0LA 2EILC 4NTWA 1MOFA 2XAHA 3N2KB 3SPCA 5JJEB 5CB4A 2P22C 3R66A 5EYPA 4ZKIA 2HVJC 3CJHB 4JI1B 1TUBA 4J9ZB 5FLXN 1VQ5V 1R1BA 4UB6Z 3I56V 2MW2B 3E8FA 3H01A 3D3IA 1K9MW 1ROPA 3H1JH 3L72H 4X89A 5EK0A 3RYCB 4J11A 1COWG 1XMQB 4MTXA 2JGDA 1AILA 1L1FA 3A0RA 3ASOB 4H44B 2KG7B 1MNGA 2PTMA 5KAIZ 2JDIG 3ASOC 4JZ2A 4UVBA 1CXZB 2VQEB 1NKDA 4LWSB 4PD4F 1PM9A 4JI6O 4QE9A 2CTPA 4MVZA 3SYQA 1HWYA 2B5UA 3W7SA 2HFEC 3HKEA 4H0LB 3D36A 1HNWO 2NNUA 4JTDB 3O9OA 2GUZA 1VQKV 2V1DA 3AG3B 1FYJA 1HR0B 4HYOA 3KCXA 1A32A 4D7TA 5L3FA 1V55C 2Q4PA 4TSFG 1JPXA 2DYRB 2JIZG 1YI2V 2Q67A 1MG1A 5B1OA 3APOA 1HNXB 3CSXA 2QGNA 4KL1A 1VQ4V 2EZPA 3C3TA 3OMNB 4AHCA 1QVGU 2Q5ZA 5IDJA 3G4SV 4UFZA 5KMGB 2JGDB 2LQTA 4EB6A 1YSCA 3NXSA 2XAGA 3APQA 3J81N 4LBEC 4FMTA 5A9GA 4WFEA 1J95A 4PI0A 5DECA 1YXBA 5D5PA 2QR4A 3U10A 1R3LC 1RPOA 1M1KW 2CGNA 1X4TA 3ZBHA 3W7UA 3OGCC 5GTHZ 5IJ9B 1OCZC 1GM9A 1ZTEA 3ETDA 1XBLA 2R9AA 2E3CA 2GUZB 4JI5O 3H9VA 1I0HA 4MTOA 3RYFA 3JD4A 3K57A 1QLNA 4KP4A 1SA0B 1YITV 2GDSA 1NJIW 3K08A 1KKCA 5KMGA 2VWJA 2JEUA 5IYZB 4DRXB 5KAFZ 3MD0A 5FPRA 1HW7A 2Q7EA 5LMUO 1F4NA 3RN4A 1B04A 2RQ6A 3OR6C 3JASA 2CUGA 3SYOA 4DV6O 1YJWV 4MSWC 1H2SB 3IGAC 3JARB 1RPRA 3I5DA 3A8TA 1I7FA 4NYKA 4DUYB 1THZA 4X1YB 2ARHA 3ZMUA 4O4IA 4LNUA 5LMNO 1AP5A 2WLKA 1ZWIC 4FFBA 4OPHA 1DGSA 2QM8A 3SPIA 1K4DC 2BE3A 3OR7C 1E79G 3AG1B 5KUMA 5KA5A 4X88A 1XNQB 3LNMB 2BOBC 5EYPB 1TGOA 2YICA 3MHSC 3ZHSA 3ETGA 1Q81W 1X59A 4LR3A 1Y74A 1UJWB 1O9GA 5HFMA 2EBOA 4EFBA 1AJPA 1R6TA 2W0FC 4CS2A 5BXZA 1G4YB 4BW5A 4JASA 4WBNB 2Q68A 1ENVA 3D36C 4JZGA 2HJDA 4IIJB 2V7QG 3ABKC 1BSMA 1TUBB 1TUEB 4B7KA 4DR5B 4UCOA 1IBKB 4B3TO 2YIDA 1K92A 3L71H 2CTQA 4LNUB 5IY5C 5JWPA 5J2UA 3CCRV 2YI9A 4WCEV 1H8EG 1JFFA 3RYHA 2EX3A 1RM1C 1SRYA 4UCUA 4K8XA 1OHHG 4X1KB 5KHHA 3ZX6A 2KKWA 4KUMA 1GN4A 4UCVA 1SQQH 1Y4MA 4LF4O 2YEVB 4ABMA 4CC6A 3LUTB 2ZIOA 4PDLA 4ZI7B 4FLVA 2IU0A 1IBMO 4QIWF 3JSNA 1Q90D 2Q0AA 2Q9LA 2PGGA 4H13B 2GTAA 3K59A 3CB2A 3F7VC 3T4ZA 1XEQA 1IBKO 3H1HH 1Y67A 2ZE8A 2UU9O 1XMOO 1S5HC 2HHHB 1GH6A 2JGUA 2NLJC 3QO5A 1BQ0A 1J5EB 4LF7O 1SETA 4PHZA 1H2KA 2Y48A 2N05A 3ZHTA 4IHJA 1JFFB 1S76D 4EB6B 2AXTZ 1MZFA 3JCZA 1P7BA 2ZM6O 4D7SA 2IM9A 2DYSB 3JATB 2P4VA 3QNEA 5KHIA 1FS0G 4JI5B 2WSSG 1DF5A 5DN6G 2YEVA 3CE2A 1JX9A 1SA0A 1Z5WA 4RUFA 2DW4A 4CH5A 3FAVA 2KSDA 4PV1B 2EULA 3LDCA 3CXCU 1Q3EA 3CEIA 2JVDA 4DR1O 5IYZA 5GW7A 1N33O 3RFRA 4DR1B 5BR8O 4IYIA 3OM3B 5IYDO 4OX9B 2Y0IA 5C8YA 1K4CC 2X6BA 1WN7A 4GKJO 1MA1A 1QLEC 3CJHA 3JAWA 5BY1A 1KP2A 5KUKA 3G71V 2ZM6B 4H33A 4OGQB 1WB8A 3T1HO 4QPKA 1Y66A 1QR8A 1M9NA 4DUZB 3KCYA 3JYCA 1K97A 3CC7V 1V54C 4IT5A 2N74A 3R65A 4I4TA 1BGYH 2IBZH 2YUAA 4JYAB 3JD2A 2DWDC 4DW1A 1RSOA 1R6KA 4L87A 4U7OA 3TXSA 4PA4A 1Y74B 1N36O 5JVDA 3B8MA 3ZCCA 2QWQB 2UXXA 1WJZA 4PDMA 3AG2C 2K1EA 2IU3A 2BTQB 2QWRB 2D3OW 3FAVB 1AR5A 5AG2A 4FFKA 2BOCC 2N04A 4TV8B 4ICGA 1PL4A 3PN1A 1AVMA 2GBOA 1V55B 4O4LA 5EZYA 3CRMA 2VRZA 3BEHA 5B1BB 3W7XA 1ZL8B 2Y4TA 1QLEB 5LMUB 4K0KB 3ZMZA 2ZKOA 5LMNB 3AG3C 1AJQA 1DLBA 2ATKC 4JI0O 2ZXWB 2FYUH 2EJRA 3L70H 4WFAV 3ZN0A 4R8CA 1I94O 3M99B 4B08A 1YJ9V 3P3NA 4N23A 3RVYA 1OCRB 4P30A 1MZEA 5CMUA 3FB6C 1EBOA 4F6EA 1GKFA 2V4DA 4GCZA 3UO3A 1NVPB 1H2MA 1SQGA 3ZS8C 4UCTA 1H38A 3CCVV 1IXMA 1KP3A 5LYJB 1YF2A 5JJNB 5IJ9A 1S5JA 5D5QA 2IJKA 3CXHF 4DV5O 1QVFU 1N34B 3GB7C 1FFXA 3G6BA 4CH4A 1W0JG 1Q5OA 4OPAA 4CZZA 5LA6A 1M4UA 1PKXA 3T4DA 2JEXA 2EINC 1E1RG 1NTMH 1F4MA 5LGNA 2PY5A 4NXNO 4A5UB 3T1YO 3T1CA 2ILMA 3QO8A 2QA4V 4LH6A 4IL6Z 4RUEA 1VIBA 1SQVH 1K8AW 1XILA 4O2AB 2QWNB 2PYLA 5EBLC 1NT2B 1QHTA 4I0XA 1SF9A 1HDJA 4JI1O 4G28B 1JCHA 1MSDA 4GT1A 4LF9B 4ASUG 4LF8O 2QE7G 4PA6A 3FB5C 4DV1O 4FM1A 1DF4A 5IWAB 3JATA 4DR4O 4XDLA 2UUCO 1SZXA 5J2UB 4W4LA 2IW5A 2IJHA 5LXTA 4MT8A 4PA7A 2QSAA 4TQFA 4FPPA 1WB7A 3U11A 2RMKB 1TVKA 4B3MO 4DV0O 4PJ0Z 2ZR2A 3E8BA 4BR6A 4GX5A 2Q8VA 2CTWA 4LC1A 1OZ0A 5E79Z 1N8RW 5C8YB 4B3SO 4WBNA 2WLNA 4DR6O 1NH2B 3WG7B 4DR3O 2AZ0A 4YIPA 3ABMB 2XASA 5F2VO 2AW9A 4YXWG 3ASNC 1Q82W 2EINB 3K5OA 3J7AU 1K3EA 4N21A 2P7TC 2WLJA 3FFQA 4O4JB 4I55A 2BCCH 3CWBH 4O4HA 4GX1A 1IDSA 1M57B 1XHXA 4O2AA 2Z5UA 2EJ7A 2ITDC 1NTKH 1PL0A 5H9CA 3K0GA 4IHJB 4UCRA 3FYEB 4G2KA 3H1KH 1EN4A 5IJ0A 5IWAO 4Q6GA 3ABKB 3Q4HB 4X20B 3ABUA 1YCIA 4NTYA 1URFA 2A06H 4O2BB 5JVDB 4DV4B 4MW8A 1BT8A 1VQ6V 1VMGA 4YJ2A 1XUQA 1ZX3A 4ZIBA 4FZ0A 3ABLC 3HKBA 4K35A 3FB8C 1FJGO 3QF7A 5FPOA 2QM4A 4JI4O 3VQWA 1VQMV 4QNHB 1OCCC 1D2DA 3JALA 2YIAA 4L8JA 3RYCA 1NI8A 1WA8B 1IVSA 1QNMA 1KECA 2W6IG 4O4HB 4HZ3A 2F4VO 3VQYA 1SQPH 3WB0A 4J42A 3N27A 1VQPV 1XNRB 4OX9O 2ITCC 5ITZA 3K5NA 4JGSA 4DV4O 1LNQA 3ZHUA 3WB1A 1P7GA 3RBZA 5IJ0B 3HR0A 3SJCC 3RW0A 2CE4A 3RYHB 5GONA 2UXNA 2YXHA 1L0NH 4Z2WA 1WPXA 2XOKG 4ZHQB 5IYBO 1FXKA 4GUNA 1T5EA 2XUMA 4X1KA 4LF5B 1GN2A 1KMIZ 2ZDIC 5JCOA 3ZMSA 2L6LA 3WU2Z 3JAKA 3CCMV 2H94A 1FXHA 2E76B 4WFHA 2Q7GA 5B1BC 1VF5B 1OJHA 2UXBO 2FL4A 5IE9A 1ZSPA 3W7TA 4B7EA 2FKXA 2LGWA 1SKVA 3CPWU 4DV3O 2ZDIA 3QVNA 1NS1A 3HKBB 3ZN1A 2ZE5A 2UUAB 1AI4A 5LP6C 3GVMA 2OYQA 3N2KA 2UUBB 2GTSA 5J9PC 1UPGA 2YIBA 4LF6B 1GM7A 2RJZA 2W6JG 4P2ZA 4JAAA 2DJVA 5CA1A 1NTZH 1AP6A 2OTLV 3CCSV 3CCQV 5LP6A 4UB8Z 4ZBMA 4QJFB 5KA6A 1L0LH 2OIEA 3CMEV 2RN9A 2WA3A 3AG4B 3E22A 3O65A 2LW7A 2F43G 1VQ9V 4W4KA 5LGUA 3SYPA 2XHBA 1QQCA 2BTQA 4JI6B 1K7DA 5BZBA 3CC4V 3SDLA 4AI8A 1TVKB 1G1XB 3SPJA 2QEXV 5JQGB 1H2GA 4P9PA 4MVQA 2X6CA 5L3DA 5LYJA 1PNLA 2E74B 4O4LB 5CA3A 2R9RB 5CN0A 4DXWA 4YHHB 3B8NA 1JA8A 3JAKB 1YEWA 3QTCA 1XNRO 4I9WA 4K0KO 5GTIZ 2MK3A 4TUYA 4TOIA 5LOVB 1MSWD 2BTOA 5IYCO 4YIOA 2B9ZA 2G38A 2AHYA 5L3CA 2KB1A 4R50A 2DN9A 3OTOB 3K9AA 3ETQA 4PELA 1PPJH 2YI8A 1E1QG 1S5LZ 4X1YA 4DR7O 4YY3B 5H6RA 1AJNA 2OWOA 2KQXA 4AQYO 1VF7A 2Z0AA 4FK5C 4I55B 2WLIB 2PYJA 1GN6A 5CA0A 5EBMC 3AG4C 1CPYA 2HVKC 1KC8W 5KX5A 1S3JA 4KHPO 4U3JA 4YJ2B 3K5MA 3CCLV 4BIUA 3OEEG 4KHPB 1I08A 3JALB 4X20A 5EZYB 3S3XA 4E2LA 4LF6O 5E1AC 1VQ8V 2Y4UA 4TUYB 3CX5F 3B77A 3ZRVA 1I5YA 1YZBA 2BSKB 2YXLA 1GN3A 1Y6XA 1PP9H 1OCRC 2HKOA 1OCZB 1W0KG 5KHJA 2OCHA 3IC7A 3LSQA 3UM7A 2HJFC 1B6QA 4FLZA 2GHYA 2XAJA 4DK1A 2CH7B 3GWKC 4DR4B 1Q6IA 2CDYA 1YJNV 4Q20A 4JI7O 1K34A 3UQ8A 5H6QA 2YSUB 4FZ1A 3X2QB 3CRCA 3LNNA 4NXMO 2KG7A 4AQYB 1XOUA 2UXCO 2EIKB 1FXKB 1YVWA 2Q6AA 3OFNG 4TQDA 3AK1A 5B5EZ 3E8HA 2CTRA 3PJSK 1FJGB 1Z5VA 3THOA 2AZ2A 4LF7B 4B3SB 4B3TB 2DQ3A 1I5XA 5FL7G 3SPGA 4NXMB 2H8PC 2F4VB 4EFEA 2ZCEA 3ZMVA 2QWOB 3BFRA 2GV9A 4EEQA 3SJBC 2VQFO 3LDEA 1AR1B 1EZVH 1TA8A 5LHIA 5B1AC 1L8DA 2CK3G 4UVCA 1Q6UA 1GMGA 3M8AA 1KKDA 2DWEC 1XMQO 1M5IA 4DV1B 4NKGB 2UXCB 4UXNA 2HEPA 1D5AA 2QKAA 1JVMA 3F5TA 2YIBD 1O9HA 2EILB 1VF6A 4X62B 5IY5B 1GK9A 1N0JA 3OUFA 4X66O 3K04A 1BHAA 1VP7A 1B06A 3IC9A 3ZHQA 4HAMA 2JK5C 4NXNB 5CBHA 1S72V 3K06A 1FKAO 3LDDA 1XI1A 2ADQB 3EFFK 5LBQA 2DOSA 3CRQA 5JQGA 5B3SC 4JF3A 3F5WC 2LP7A 2WLMA 1OCCB 2ADPA 3LSUA 4J7ZA 2UUBO 1F7YA 5H2FZ 1BL8A 2WA4A 4GLXA 2LGQA 5JH7B 4O4JA 2H3OA 5IT9N 3BPZA 2DE0X 4DR6B 1PV0A 4P9OA 4F4LA 5JJJB 2AGAA 1LR1A 4I9QA 1ZL8A 4JTCB 3AG1C 3ZRXA 1RP3B 2IJIA 5A2QN 4WF9V 3ZHRA 1AI5A 2WWWA 4X8AA 2CGOA 2P6JA 3P3PA 2ZD9A 4O4IB 4C7UA 3T1YB 4PA9A 2XTAA 4NR1A 2Q73A 4U7NA 4GKKO 3JD3A 4X66B 4FFBB 2F1MA 5KX5B 1QBZA 3OGIB 2OCCC 4WFBV 2DYSC 2LW1A 1SZTA 5EC2C 3STLC 2Q69A 3BA9A 3RWRD 2OTJV 5C93A 2W0XA 4LFAB 2QKCA 5J2TA 4B3RO 1XQ8A 4UUJC 4PDRA 1RM1B 3EVKA 3P32A 1G8MA 4J80A 2F95B 3HB3B 1GM8A 4JYCA 1IBLB 4JI8B 3OEHG 2CH7A 3ZIAG 5K1PA 3CRRA 3MAQA 4TT3G 4JI4B 4NB5A 3EXAA 1AROP 2YS8A 2FTKA 2GSMB 1AR4A 4GKJB 3B2EE 1PNMA 2EIMB 3OW2U 5K1XA 1Q7YW 1R3KC 3CRAA 3KG2A 2YXYA 1EN6A 4IIJA 3AK3A 5BMVB 5EBWC 1US6A 4LP8A 4LFAO 2A79B 1FXVA 3IFXA 4GX2A 4FM2A 1P4RA 4I4TB 1EM1A 2XT9A 3HKDB 4EKWA 4QE7A 4CS4A 4FLYA 4JYBA 5LGTA 4H37A 1SQFA 3UCSC 1PNKA 3J80N
chains in the Genus database with same CATH topology
1PPJH 4U3FH 5KLVH 3BCCH 1SQXH 3L73H 1NTZH 3L75H 1NTKH 1L0NH 3H1IH 1NU1H 1SQPH 1BCCH 1BGYH 3H1KH 1KB9F 2FYUH 2IBZH 1L0LH 3L74H 1KYOF 3CX5F 1EZVH 1NTMH 3L70H 4D6TH 1SQQH 3H1HH 3L71H 3TGUH 4PD4F 2A06H 3H1LH 1P84F 1BE3H 2BCCH 3CWBH 1PP9H 3CXHF 1SQBH 3H1JH 1SQVH 3L72H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  4U3F H;  5KLV H;  3BCC H;  1SQX H;  3L73 H;  1NTZ H;  3L75 H;  1NTK H;  1L0N H;  3H1I H;  1NU1 H;  1SQP H;  1BCC H;  1BGY H;  3H1K H;  1KB9 F;  2FYU H;  2IBZ H;  1L0L H;  3L74 H;  1KYO F;  3CX5 F;  1EZV H;  1NTM H;  3L70 H;  4D6T H;  1SQQ H;  3H1H H;  3L71 H;  3TGU H;  4PD4 F;  2A06 H;  3H1L H;  1P84 F;  1BE3 H;  2BCC H;  3CWB H;  1PP9 H;  3CXH F;  1SQB H;  3H1J H;  1SQV H;  3L72 H; 
#chains in the Genus database with same CATH topology
 4PI2 A;  4QPJ A;  1SQX H;  2WLL B;  1FAF A;  4ZOL B;  3SYA A;  1N32 O;  3WG7 C;  4DV2 B;  4LF8 B;  1VEW A;  3UO2 A;  3B4S A;  5J2T B;  3RVZ A;  1KB9 F;  1Q8I A;  5LHH A;  1YTF D;  2RNB A;  3TET A;  4CH3 A;  3G67 A;  4DO2 A;  3AK2 A;  1QR9 A;  1VF6 C;  5LOV A;  4PDV A;  4DR7 B;  4J10 A;  3HKC A;  4LWS A;  1F51 A;  4DV2 O;  2HR3 A;  3ZRW A;  2P5O A;  3JAS B;  3WFV A;  2E5L O;  2DQ0 A;  1HR0 O;  1BCC H;  4GZR B;  2HG5 C;  4MS2 A;  1KYO F;  3D8C A;  2Y69 B;  4J7K A;  2R72 A;  3OMA B;  3E89 A;  3U0Z A;  3N2G B;  4JYA O;  3SYC A;  2ZE6 A;  1XNQ O;  3DC6 A;  4YHH O;  2P06 A;  1CP9 A;  4E4E A;  4HNA B;  1IBM B;  1Q6H A;  1QU7 A;  1EN5 A;  3BVO A;  4XBF A;  5FNV A;  4X65 O;  4D6T H;  2Z3Y A;  3SJA C;  3VQX A;  3K5L A;  1JR9 A;  3H1L H;  3JAW B;  1BE3 H;  1YDX A;  3A2F A;  1S77 D;  3B40 A;  1W59 A;  4DW0 A;  1MMM A;  1QCE A;  3SPH A;  1H2L A;  5B3S B;  1Q86 W;  2QM7 A;  3DSQ A;  2HLD G;  1HP8 A;  1V9P A;  4FLX A;  2EZO A;  3CCU V;  3K9S A;  2ZR3 A;  1XHZ A;  4BW9 A;  3RYI B;  1BHB A;  2HP8 A;  4DR3 B;  2PUS A;  3SGI A;  1JMK C;  2X6A A;  3FD9 A;  3AG2 B;  2VQF B;  3AEI A;  4FLW A;  3E86 A;  2R9I A;  2UXD O;  4DYL A;  3CP1 A;  2P90 A;  5CA0 B;  4X1I A;  2O57 A;  1JJO A;  4FVM A;  4DV0 B;  3ICX A;  3CS5 A;  5KHG A;  4JI7 B;  5EIB D;  2ZE7 A;  1K5Q A;  4DV7 O;  4F6R A;  1WAZ A;  3CHX A;  4Z1V A;  1DK1 A;  4JAU A;  4X64 B;  4K8Z A;  2UUC B;  3CCJ V;  1R3I C;  3EHB B;  1HNZ B;  4I5S A;  1FFT B;  3BA8 A;  3CC2 V;  2QKS A;  3UKM A;  2A0L A;  4FJC C;  2YC0 A;  2QJ1 A;  1R3J C;  1R6N A;  3A0H Z;  4JAV A;  3K03 A;  1WP8 A;  4TWK A;  4B3M B;  1V54 B;  4MVO A;  4NVP A;  3CYO A;  1W2B U;  1UFI A;  3T2M A;  4NTX A;  1KU9 A;  3OT7 A;  3S3W A;  4R7C A;  1JQ0 A;  3UT5 A;  2F66 C;  1VQL V;  1U97 A;  3VBB A;  2P4K A;  2EIK C;  2LJ2 A;  2XAF A;  2NR5 A;  3JAM N;  4LH7 A;  2LO1 A;  4X62 O;  2XND G;  1H2N A;  4BIZ A;  4X9Q A;  3X2Q C;  3OAA G;  1SES A;  3FKS G;  4JYY A;  1KQS U;  4I7Z B;  1HNX O;  2QDO A;  4X1I B;  3L73 H;  2R70 A;  3E35 A;  3L75 H;  1N0N A;  1AI7 A;  4YJ3 A;  1HNZ O;  1VQN V;  1WLE A;  4J7J A;  4X64 O;  1NQT A;  3D3Q A;  4MVU A;  2IJJ A;  4JV5 B;  1N36 B;  5HFL A;  3KKY A;  1K73 W;  1U96 A;  4DV7 B;  4MTG A;  1M57 C;  3SJQ C;  1NH2 D;  5JH7 A;  4MVM A;  1BS3 A;  3BY6 A;  2M6Y A;  1RFY A;  5KHK A;  3CCE V;  3HKD A;  4IGG A;  1FFX B;  1BZK A;  1TAE A;  3AG7 A;  4JPR A;  3CMA V;  2B1G A;  2DMX A;  2PI5 A;  1OCO B;  1Q43 A;  4JI2 O;  2VQE O;  4PA3 A;  1KBH A;  1ZAU A;  3ZRW B;  3TXQ A;  2RDC A;  3BHP A;  4FLU A;  2ODM A;  4ZOL A;  5L3E A;  3JD1 A;  3HKC B;  2WAM A;  4LFB B;  4U3F H;  5CBF A;  2ZNJ A;  5L3G A;  4I0X B;  3ZJZ A;  2C2A A;  3SR2 C;  1NU1 H;  3E2E A;  3IJ4 A;  3DXR B;  4CS3 A;  4R6Z A;  3E22 B;  1PD3 A;  2QTO A;  3N2G A;  4I50 B;  3RT3 C;  4ZHQ A;  2WLH A;  4HNA A;  2ZIN A;  1SC5 B;  4UV8 A;  2IH1 C;  4GX0 A;  4LCU C;  1N33 B;  1WNS A;  3ABT A;  3HKE B;  2OT5 A;  4BAY A;  4CC5 A;  1RSO B;  1M56 B;  1KUQ A;  4JI2 B;  1WP7 A;  1M56 C;  4J41 A;  1DTO A;  2Y69 C;  3K79 A;  2K9P A;  2WPD G;  4TV8 A;  1K33 A;  1EZJ A;  4YY3 O;  2ZQM A;  4KXR A;  5LHG A;  4AIL C;  4BWA A;  4LFB O;  2ETN A;  1GTO A;  1AB3 A;  4DUZ O;  3OTF A;  3F7Y C;  1YTF B;  3ABL B;  3T1H B;  3RGB A;  2E5L B;  4K3A A;  2EIM C;  4B3R B;  2PZS A;  3K3W A;  2VS0 A;  2OCC B;  3BAA A;  5H5N A;  3JAR A;  2ZNI A;  1VAR A;  2NN4 A;  2EIJ C;  3KZI Z;  4WFG A;  1NBM G;  1AI6 A;  4CBC A;  2UUA O;  4MW3 A;  3Q4H A;  4JTA B;  4DR2 B;  4LFC B;  4JI3 O;  4TV9 A;  1B3Q A;  4JI0 B;  1LUW A;  1YIJ V;  1Y76 B;  4XDK A;  1IZ3 A;  5LP6 B;  4X65 B;  3OUS A;  1NR7 A;  5CBG A;  3I55 V;  3B09 A;  3E8G A;  5DM6 V;  1N4C A;  5B1N A;  3VQV A;  1YHQ V;  4U3J B;  2JJ1 G;  3K58 A;  4QGP A;  2CAZ C;  4MVR A;  1D5N A;  1GRJ A;  4LFC O;  4DV6 B;  1SER A;  4WFF A;  4DR5 O;  4DV5 B;  3M7M X;  4O2B A;  4IYH A;  1K5S A;  3C90 A;  2Q7H A;  1VQO V;  5B1A B;  4DK0 A;  3JCU Z;  3MHH C;  3JSL A;  1G6U A;  4DR2 O;  5ITZ B;  1CEZ A;  2FML A;  1XL6 A;  3CD6 V;  2XAQ A;  4OXS A;  3TJT A;  3DTU B;  1IX9 A;  5GON B;  1JJ2 U;  1ORQ C;  2ZIM A;  3OMI B;  1WA8 A;  3TK1 A;  3ZED A;  5TIS Z;  3ZMT A;  4GYC B;  3WB2 A;  3E83 A;  3DGE A;  1NVP D;  1N32 B;  4HBN A;  2JS3 A;  5LXT B;  3W7W A;  1IBL O;  4JI8 O;  3OTO O;  4RO2 A;  2D2C B;  4LF4 B;  3K0D A;  3G6E V;  3RYF B;  2Q0O C;  2JRI A;  3ZRS A;  2B1I A;  3P30 A;  2PI4 A;  2DYR C;  2EIJ B;  4BIO A;  3TGU H;  5L3B A;  2P67 A;  1FD9 A;  2L35 A;  1ZUQ A;  3GWO A;  1SQB H;  2QWP B;  2A3Q A;  4ZI7 A;  1LUV A;  4Z1M G;  2WLL A;  3STZ C;  1ZLZ A;  2RCV A;  5LA6 B;  1S0V A;  5EIB C;  1Z2G A;  2QTS A;  1XRE A;  4UV9 A;  4DUY O;  1GO3 F;  4JI3 B;  1P49 A;  1H8H G;  1SS3 A;  2UXD B;  1M90 W;  1EFR G;  3BRC A;  2BSK A;  3A0B Z;  3OE7 G;  1R73 A;  1F23 A;  5KLV H;  3FYI B;  3ETE A;  2F23 A;  2JJ2 G;  3FB7 C;  1WPB A;  2E75 B;  3G80 A;  5CA1 B;  3H1I H;  4JV5 O;  4MVS A;  2ZXW C;  1OCO C;  4MTF A;  5DED A;  4I50 A;  2FB5 A;  3BAB A;  4RWU A;  4J9Y B;  1N34 O;  2UU9 B;  2F93 B;  1XMO B;  1NR1 A;  3DC5 A;  4G27 B;  3LSS A;  3QG5 A;  2ZT9 B;  4RQE A;  3ASN B;  3L9D A;  3FX7 A;  3VOU A;  1GAX A;  3ABM C;  5BR8 B;  3QO7 A;  4DV3 B;  1FPO A;  4DRX A;  3IAY A;  3HPL C;  5B66 Z;  5FNV B;  2UXB B;  1JOY A;  1NZ6 A;  4LF9 O;  3UT5 B;  2M7W A;  3ML0 A;  4UCS A;  1FXK C;  1I94 B;  4XDJ A;  5CB4 B;  2LFS A;  2A7W A;  3ZHV A;  2OIG A;  5LL6 Y;  4FIP C;  1BMF G;  2LFR A;  2A9H A;  4FLT A;  4RAI A;  1KD1 W;  1IXB A;  3RYI A;  5JCO C;  1BQZ A;  2IH3 C;  4TV9 B;  4RQF A;  3BCC H;  1M93 A;  4YJ3 B;  1J5E O;  4FM0 A;  2JS5 A;  3OD4 A;  2HHH O;  4UVA A;  2WLI A;  3NR7 A;  1XDC A;  5EC1 C;  4LF5 O;  2PF4 E;  3L74 H;  1OV9 A;  4CH6 A;  2X7R B;  3DXR A;  2VWK A;  1VQ7 V;  2AHZ A;  5BMV A;  1P84 F;  3JD0 A;  2Y0P A;  1XL4 A;  1Y76 A;  4KFM A;  2YDE A;  4GKK B;  3TCU A;  3C3S A;  4F6R B;  3MDS A;  1HNW B;  1IUR A;  1MAB G;  2X0L A;  2EIL C;  4NTW A;  1MOF A;  2XAH A;  3N2K B;  3SPC A;  5JJE B;  5CB4 A;  2P22 C;  3R66 A;  5EYP A;  4ZKI A;  2HVJ C;  3CJH B;  4JI1 B;  1TUB A;  4J9Z B;  5FLX N;  1VQ5 V;  1R1B A;  4UB6 Z;  3I56 V;  2MW2 B;  3E8F A;  3H01 A;  3D3I A;  1K9M W;  1ROP A;  3H1J H;  3L72 H;  4X89 A;  5EK0 A;  3RYC B;  4J11 A;  1COW G;  1XMQ B;  4MTX A;  2JGD A;  1AIL A;  1L1F A;  3A0R A;  3ASO B;  4H44 B;  2KG7 B;  1MNG A;  2PTM A;  5KAI Z;  2JDI G;  3ASO C;  4JZ2 A;  4UVB A;  1CXZ B;  2VQE B;  1NKD A;  4LWS B;  4PD4 F;  1PM9 A;  4JI6 O;  4QE9 A;  2CTP A;  4MVZ A;  3SYQ A;  1HWY A;  2B5U A;  3W7S A;  2HFE C;  3HKE A;  4H0L B;  3D36 A;  1HNW O;  2NNU A;  4JTD B;  3O9O A;  2GUZ A;  1VQK V;  2V1D A;  3AG3 B;  1FYJ A;  1HR0 B;  4HYO A;  3KCX A;  1A32 A;  4D7T A;  5L3F A;  1V55 C;  2Q4P A;  4TSF G;  1JPX A;  2DYR B;  2JIZ G;  1YI2 V;  2Q67 A;  1MG1 A;  5B1O A;  3APO A;  1HNX B;  3CSX A;  2QGN A;  4KL1 A;  1VQ4 V;  2EZP A;  3C3T A;  3OMN B;  4AHC A;  1QVG U;  2Q5Z A;  5IDJ A;  3G4S V;  4UFZ A;  5KMG B;  2JGD B;  2LQT A;  4EB6 A;  1YSC A;  3NXS A;  2XAG A;  3APQ A;  3J81 N;  4LBE C;  4FMT A;  5A9G A;  4WFE A;  1J95 A;  4PI0 A;  5DEC A;  1YXB A;  5D5P A;  2QR4 A;  3U10 A;  1R3L C;  1RPO A;  1M1K W;  2CGN A;  1X4T A;  3ZBH A;  3W7U A;  3OGC C;  5GTH Z;  5IJ9 B;  1OCZ C;  1GM9 A;  1ZTE A;  3ETD A;  1XBL A;  2R9A A;  2E3C A;  2GUZ B;  4JI5 O;  3H9V A;  1I0H A;  4MTO A;  3RYF A;  3JD4 A;  3K57 A;  1QLN A;  4KP4 A;  1SA0 B;  1YIT V;  2GDS A;  1NJI W;  3K08 A;  1KKC A;  5KMG A;  2VWJ A;  2JEU A;  5IYZ B;  4DRX B;  5KAF Z;  3MD0 A;  5FPR A;  1HW7 A;  2Q7E A;  5LMU O;  1F4N A;  3RN4 A;  1B04 A;  2RQ6 A;  3OR6 C;  3JAS A;  2CUG A;  3SYO A;  4DV6 O;  1YJW V;  4MSW C;  1H2S B;  3IGA C;  3JAR B;  1RPR A;  3I5D A;  3A8T A;  1I7F A;  4NYK A;  4DUY B;  1THZ A;  4X1Y B;  2ARH A;  3ZMU A;  4O4I A;  4LNU A;  5LMN O;  1AP5 A;  2WLK A;  1ZWI C;  4FFB A;  4OPH A;  1DGS A;  2QM8 A;  3SPI A;  1K4D C;  2BE3 A;  3OR7 C;  1E79 G;  3AG1 B;  5KUM A;  5KA5 A;  4X88 A;  1XNQ B;  3LNM B;  2BOB C;  5EYP B;  1TGO A;  2YIC A;  3MHS C;  3ZHS A;  3ETG A;  1Q81 W;  1X59 A;  4LR3 A;  1Y74 A;  1UJW B;  1O9G A;  5HFM A;  2EBO A;  4EFB A;  1AJP A;  1R6T A;  2W0F C;  4CS2 A;  5BXZ A;  1G4Y B;  4BW5 A;  4JAS A;  4WBN B;  2Q68 A;  1ENV A;  3D36 C;  4JZG A;  2HJD A;  4IIJ B;  2V7Q G;  3ABK C;  1BSM A;  1TUB B;  1TUE B;  4B7K A;  4DR5 B;  4UCO A;  1IBK B;  4B3T O;  2YID A;  1K92 A;  3L71 H;  2CTQ A;  4LNU B;  5IY5 C;  5JWP A;  5J2U A;  3CCR V;  2YI9 A;  4WCE V;  1H8E G;  1JFF A;  3RYH A;  2EX3 A;  1RM1 C;  1SRY A;  4UCU A;  4K8X A;  1OHH G;  4X1K B;  5KHH A;  3ZX6 A;  2KKW A;  4KUM A;  1GN4 A;  4UCV A;  1SQQ H;  1Y4M A;  4LF4 O;  2YEV B;  4ABM A;  4CC6 A;  3LUT B;  2ZIO A;  4PDL A;  4ZI7 B;  4FLV A;  2IU0 A;  1IBM O;  4QIW F;  3JSN A;  1Q90 D;  2Q0A A;  2Q9L A;  2PGG A;  4H13 B;  2GTA A;  3K59 A;  3CB2 A;  3F7V C;  3T4Z A;  1XEQ A;  1IBK O;  3H1H H;  1Y67 A;  2ZE8 A;  2UU9 O;  1XMO O;  1S5H C;  2HHH B;  1GH6 A;  2JGU A;  2NLJ C;  3QO5 A;  1BQ0 A;  1J5E B;  4LF7 O;  1SET A;  4PHZ A;  1H2K A;  2Y48 A;  2N05 A;  3ZHT A;  4IHJ A;  1JFF B;  1S76 D;  4EB6 B;  2AXT Z;  1MZF A;  3JCZ A;  1P7B A;  2ZM6 O;  4D7S A;  2IM9 A;  2DYS B;  3JAT B;  2P4V A;  3QNE A;  5KHI A;  1FS0 G;  4JI5 B;  2WSS G;  1DF5 A;  5DN6 G;  2YEV A;  3CE2 A;  1JX9 A;  1SA0 A;  1Z5W A;  4RUF A;  2DW4 A;  4CH5 A;  3FAV A;  2KSD A;  4PV1 B;  2EUL A;  3LDC A;  3CXC U;  1Q3E A;  3CEI A;  2JVD A;  4DR1 O;  5IYZ A;  5GW7 A;  1N33 O;  3RFR A;  4DR1 B;  5BR8 O;  4IYI A;  3OM3 B;  5IYD O;  4OX9 B;  2Y0I A;  5C8Y A;  1K4C C;  2X6B A;  1WN7 A;  4GKJ O;  1MA1 A;  1QLE C;  3CJH A;  3JAW A;  5BY1 A;  1KP2 A;  5KUK A;  3G71 V;  2ZM6 B;  4H33 A;  4OGQ B;  1WB8 A;  3T1H O;  4QPK A;  1Y66 A;  1QR8 A;  1M9N A;  4DUZ B;  3KCY A;  3JYC A;  1K97 A;  3CC7 V;  1V54 C;  4IT5 A;  2N74 A;  3R65 A;  4I4T A;  1BGY H;  2IBZ H;  2YUA A;  4JYA B;  3JD2 A;  2DWD C;  4DW1 A;  1RSO A;  1R6K A;  4L87 A;  4U7O A;  3TXS A;  4PA4 A;  1Y74 B;  1N36 O;  5JVD A;  3B8M A;  3ZCC A;  2QWQ B;  2UXX A;  1WJZ A;  4PDM A;  3AG2 C;  2K1E A;  2IU3 A;  2BTQ B;  2QWR B;  2D3O W;  3FAV B;  1AR5 A;  5AG2 A;  4FFK A;  2BOC C;  2N04 A;  4TV8 B;  4ICG A;  1PL4 A;  3PN1 A;  1AVM A;  2GBO A;  1V55 B;  4O4L A;  5EZY A;  3CRM A;  2VRZ A;  3BEH A;  5B1B B;  3W7X A;  1ZL8 B;  2Y4T A;  1QLE B;  5LMU B;  4K0K B;  3ZMZ A;  2ZKO A;  5LMN B;  3AG3 C;  1AJQ A;  1DLB A;  2ATK C;  4JI0 O;  2ZXW B;  2FYU H;  2EJR A;  3L70 H;  4WFA V;  3ZN0 A;  4R8C A;  1I94 O;  3M99 B;  4B08 A;  1YJ9 V;  3P3N A;  4N23 A;  3RVY A;  1OCR B;  4P30 A;  1MZE A;  5CMU A;  3FB6 C;  1EBO A;  4F6E A;  1GKF A;  2V4D A;  4GCZ A;  3UO3 A;  1NVP B;  1H2M A;  1SQG A;  3ZS8 C;  4UCT A;  1H38 A;  3CCV V;  1IXM A;  1KP3 A;  5LYJ B;  1YF2 A;  5JJN B;  5IJ9 A;  1S5J A;  5D5Q A;  2IJK A;  3CXH F;  4DV5 O;  1QVF U;  1N34 B;  3GB7 C;  1FFX A;  3G6B A;  4CH4 A;  1W0J G;  1Q5O A;  4OPA A;  4CZZ A;  5LA6 A;  1M4U A;  1PKX A;  3T4D A;  2JEX A;  2EIN C;  1E1R G;  1NTM H;  1F4M A;  5LGN A;  2PY5 A;  4NXN O;  4A5U B;  3T1Y O;  3T1C A;  2ILM A;  3QO8 A;  2QA4 V;  4LH6 A;  4IL6 Z;  4RUE A;  1VIB A;  1SQV H;  1K8A W;  1XIL A;  4O2A B;  2QWN B;  2PYL A;  5EBL C;  1NT2 B;  1QHT A;  4I0X A;  1SF9 A;  1HDJ A;  4JI1 O;  4G28 B;  1JCH A;  1MSD A;  4GT1 A;  4LF9 B;  4ASU G;  4LF8 O;  2QE7 G;  4PA6 A;  3FB5 C;  4DV1 O;  4FM1 A;  1DF4 A;  5IWA B;  3JAT A;  4DR4 O;  4XDL A;  2UUC O;  1SZX A;  5J2U B;  4W4L A;  2IW5 A;  2IJH A;  5LXT A;  4MT8 A;  4PA7 A;  2QSA A;  4TQF A;  4FPP A;  1WB7 A;  3U11 A;  2RMK B;  1TVK A;  4B3M O;  4DV0 O;  4PJ0 Z;  2ZR2 A;  3E8B A;  4BR6 A;  4GX5 A;  2Q8V A;  2CTW A;  4LC1 A;  1OZ0 A;  5E79 Z;  1N8R W;  5C8Y B;  4B3S O;  4WBN A;  2WLN A;  4DR6 O;  1NH2 B;  3WG7 B;  4DR3 O;  2AZ0 A;  4YIP A;  3ABM B;  2XAS A;  5F2V O;  2AW9 A;  4YXW G;  3ASN C;  1Q82 W;  2EIN B;  3K5O A;  3J7A U;  1K3E A;  4N21 A;  2P7T C;  2WLJ A;  3FFQ A;  4O4J B;  4I55 A;  2BCC H;  3CWB H;  4O4H A;  4GX1 A;  1IDS A;  1M57 B;  1XHX A;  4O2A A;  2Z5U A;  2EJ7 A;  2ITD C;  1NTK H;  1PL0 A;  5H9C A;  3K0G A;  4IHJ B;  4UCR A;  3FYE B;  4G2K A;  3H1K H;  1EN4 A;  5IJ0 A;  5IWA O;  4Q6G A;  3ABK B;  3Q4H B;  4X20 B;  3ABU A;  1YCI A;  4NTY A;  1URF A;  2A06 H;  4O2B B;  5JVD B;  4DV4 B;  4MW8 A;  1BT8 A;  1VQ6 V;  1VMG A;  4YJ2 A;  1XUQ A;  1ZX3 A;  4ZIB A;  4FZ0 A;  3ABL C;  3HKB A;  4K35 A;  3FB8 C;  1FJG O;  3QF7 A;  5FPO A;  2QM4 A;  4JI4 O;  3VQW A;  1VQM V;  4QNH B;  1OCC C;  1D2D A;  3JAL A;  2YIA A;  4L8J A;  3RYC A;  1NI8 A;  1WA8 B;  1IVS A;  1QNM A;  1KEC A;  2W6I G;  4O4H B;  4HZ3 A;  2F4V O;  3VQY A;  1SQP H;  3WB0 A;  4J42 A;  3N27 A;  1VQP V;  1XNR B;  4OX9 O;  2ITC C;  5ITZ A;  3K5N A;  4JGS A;  4DV4 O;  1LNQ A;  3ZHU A;  3WB1 A;  1P7G A;  3RBZ A;  5IJ0 B;  3HR0 A;  3SJC C;  3RW0 A;  2CE4 A;  3RYH B;  5GON A;  2UXN A;  2YXH A;  1L0N H;  4Z2W A;  1WPX A;  2XOK G;  4ZHQ B;  5IYB O;  1FXK A;  4GUN A;  1T5E A;  2XUM A;  4X1K A;  4LF5 B;  1GN2 A;  1KMI Z;  2ZDI C;  5JCO A;  3ZMS A;  2L6L A;  3WU2 Z;  3JAK A;  3CCM V;  2H94 A;  1FXH A;  2E76 B;  4WFH A;  2Q7G A;  5B1B C;  1VF5 B;  1OJH A;  2UXB O;  2FL4 A;  5IE9 A;  1ZSP A;  3W7T A;  4B7E A;  2FKX A;  2LGW A;  1SKV A;  3CPW U;  4DV3 O;  2ZDI A;  3QVN A;  1NS1 A;  3HKB B;  3ZN1 A;  2ZE5 A;  2UUA B;  1AI4 A;  5LP6 C;  3GVM A;  2OYQ A;  3N2K A;  2UUB B;  2GTS A;  5J9P C;  1UPG A;  2YIB A;  4LF6 B;  1GM7 A;  2RJZ A;  2W6J G;  4P2Z A;  4JAA A;  2DJV A;  5CA1 A;  1NTZ H;  1AP6 A;  2OTL V;  3CCS V;  3CCQ V;  5LP6 A;  4UB8 Z;  4ZBM A;  4QJF B;  5KA6 A;  1L0L H;  2OIE A;  3CME V;  2RN9 A;  2WA3 A;  3AG4 B;  3E22 A;  3O65 A;  2LW7 A;  2F43 G;  1VQ9 V;  4W4K A;  5LGU A;  3SYP A;  2XHB A;  1QQC A;  2BTQ A;  4JI6 B;  1K7D A;  5BZB A;  3CC4 V;  3SDL A;  4AI8 A;  1TVK B;  1G1X B;  3SPJ A;  2QEX V;  5JQG B;  1H2G A;  4P9P A;  4MVQ A;  2X6C A;  5L3D A;  5LYJ A;  1PNL A;  2E74 B;  4O4L B;  5CA3 A;  2R9R B;  5CN0 A;  4DXW A;  4YHH B;  3B8N A;  1JA8 A;  3JAK B;  1YEW A;  3QTC A;  1XNR O;  4I9W A;  4K0K O;  5GTI Z;  2MK3 A;  4TUY A;  4TOI A;  5LOV B;  1MSW D;  2BTO A;  5IYC O;  4YIO A;  2B9Z A;  2G38 A;  2AHY A;  5L3C A;  2KB1 A;  4R50 A;  2DN9 A;  3OTO B;  3K9A A;  3ETQ A;  4PEL A;  1PPJ H;  2YI8 A;  1E1Q G;  1S5L Z;  4X1Y A;  4DR7 O;  4YY3 B;  5H6R A;  1AJN A;  2OWO A;  2KQX A;  4AQY O;  1VF7 A;  2Z0A A;  4FK5 C;  4I55 B;  2WLI B;  2PYJ A;  1GN6 A;  5CA0 A;  5EBM C;  3AG4 C;  1CPY A;  2HVK C;  1KC8 W;  5KX5 A;  1S3J A;  4KHP O;  4U3J A;  4YJ2 B;  3K5M A;  3CCL V;  4BIU A;  3OEE G;  4KHP B;  1I08 A;  3JAL B;  4X20 A;  5EZY B;  3S3X A;  4E2L A;  4LF6 O;  5E1A C;  1VQ8 V;  2Y4U A;  4TUY B;  3CX5 F;  3B77 A;  3ZRV A;  1I5Y A;  1YZB A;  2BSK B;  2YXL A;  1GN3 A;  1Y6X A;  1PP9 H;  1OCR C;  2HKO A;  1OCZ B;  1W0K G;  5KHJ A;  2OCH A;  3IC7 A;  3LSQ A;  3UM7 A;  2HJF C;  1B6Q A;  4FLZ A;  2GHY A;  2XAJ A;  4DK1 A;  2CH7 B;  3GWK C;  4DR4 B;  1Q6I A;  2CDY A;  1YJN V;  4Q20 A;  4JI7 O;  1K34 A;  3UQ8 A;  5H6Q A;  2YSU B;  4FZ1 A;  3X2Q B;  3CRC A;  3LNN A;  4NXM O;  2KG7 A;  4AQY B;  1XOU A;  2UXC O;  2EIK B;  1FXK B;  1YVW A;  2Q6A A;  3OFN G;  4TQD A;  3AK1 A;  5B5E Z;  3E8H A;  2CTR A;  3PJS K;  1FJG B;  1Z5V A;  3THO A;  2AZ2 A;  4LF7 B;  4B3S B;  4B3T B;  2DQ3 A;  1I5X A;  5FL7 G;  3SPG A;  4NXM B;  2H8P C;  2F4V B;  4EFE A;  2ZCE A;  3ZMV A;  2QWO B;  3BFR A;  2GV9 A;  4EEQ A;  3SJB C;  2VQF O;  3LDE A;  1AR1 B;  1EZV H;  1TA8 A;  5LHI A;  5B1A C;  1L8D A;  2CK3 G;  4UVC A;  1Q6U A;  1GMG A;  3M8A A;  1KKD A;  2DWE C;  1XMQ O;  1M5I A;  4DV1 B;  4NKG B;  2UXC B;  4UXN A;  2HEP A;  1D5A A;  2QKA A;  1JVM A;  3F5T A;  2YIB D;  1O9H A;  2EIL B;  1VF6 A;  4X62 B;  5IY5 B;  1GK9 A;  1N0J A;  3OUF A;  4X66 O;  3K04 A;  1BHA A;  1VP7 A;  1B06 A;  3IC9 A;  3ZHQ A;  4HAM A;  2JK5 C;  4NXN B;  5CBH A;  1S72 V;  3K06 A;  1FKA O;  3LDD A;  1XI1 A;  2ADQ B;  3EFF K;  5LBQ A;  2DOS A;  3CRQ A;  5JQG A;  5B3S C;  4JF3 A;  3F5W C;  2LP7 A;  2WLM A;  1OCC B;  2ADP A;  3LSU A;  4J7Z A;  2UUB O;  1F7Y A;  5H2F Z;  1BL8 A;  2WA4 A;  4GLX A;  2LGQ A;  5JH7 B;  4O4J A;  2H3O A;  5IT9 N;  3BPZ A;  2DE0 X;  4DR6 B;  1PV0 A;  4P9O A;  4F4L A;  5JJJ B;  2AGA A;  1LR1 A;  4I9Q A;  1ZL8 A;  4JTC B;  3AG1 C;  3ZRX A;  1RP3 B;  2IJI A;  5A2Q N;  4WF9 V;  3ZHR A;  1AI5 A;  2WWW A;  4X8A A;  2CGO A;  2P6J A;  3P3P A;  2ZD9 A;  4O4I B;  4C7U A;  3T1Y B;  4PA9 A;  2XTA A;  4NR1 A;  2Q73 A;  4U7N A;  4GKK O;  3JD3 A;  4X66 B;  4FFB B;  2F1M A;  5KX5 B;  1QBZ A;  3OGI B;  2OCC C;  4WFB V;  2DYS C;  2LW1 A;  1SZT A;  5EC2 C;  3STL C;  2Q69 A;  3BA9 A;  3RWR D;  2OTJ V;  5C93 A;  2W0X A;  4LFA B;  2QKC A;  5J2T A;  4B3R O;  1XQ8 A;  4UUJ C;  4PDR A;  1RM1 B;  3EVK A;  3P32 A;  1G8M A;  4J80 A;  2F95 B;  3HB3 B;  1GM8 A;  4JYC A;  1IBL B;  4JI8 B;  3OEH G;  2CH7 A;  3ZIA G;  5K1P A;  3CRR A;  3MAQ A;  4TT3 G;  4JI4 B;  4NB5 A;  3EXA A;  1ARO P;  2YS8 A;  2FTK A;  2GSM B;  1AR4 A;  4GKJ B;  3B2E E;  1PNM A;  2EIM B;  3OW2 U;  5K1X A;  1Q7Y W;  1R3K C;  3CRA A;  3KG2 A;  2YXY A;  1EN6 A;  4IIJ A;  3AK3 A;  5BMV B;  5EBW C;  1US6 A;  4LP8 A;  4LFA O;  2A79 B;  1FXV A;  3IFX A;  4GX2 A;  4FM2 A;  1P4R A;  4I4T B;  1EM1 A;  2XT9 A;  3HKD B;  4EKW A;  4QE7 A;  4CS4 A;  4FLY A;  4JYB A;  5LGT A;  4H37 A;  1SQF A;  3UCS C;  1PNK A;  3J80 N; 
#chains in the Genus database with same CATH homology
 1PPJ H;  4U3F H;  5KLV H;  3BCC H;  1SQX H;  3L73 H;  1NTZ H;  3L75 H;  1NTK H;  1L0N H;  3H1I H;  1NU1 H;  1SQP H;  1BCC H;  1BGY H;  3H1K H;  1KB9 F;  2FYU H;  2IBZ H;  1L0L H;  3L74 H;  1KYO F;  3CX5 F;  1EZV H;  1NTM H;  3L70 H;  4D6T H;  1SQQ H;  3H1H H;  3L71 H;  3TGU H;  4PD4 F;  2A06 H;  3H1L H;  1P84 F;  1BE3 H;  2BCC H;  3CWB H;  1PP9 H;  3CXH F;  1SQB H;  3H1J H;  1SQV H;  3L72 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...