1PP9H

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1pp9H00
3H1IH 1SQVH 3BCCH 1PPJH 1SQXH 2FYUH 3CX5F 1SQQH 1NU1H 3H1HH 1SQPH 1PP9H 1EZVH 3CWBH 1P84F 1SQBH 1BGYH 1NTZH 1KB9F 1NTMH 3L74H 3L72H 1KYOF 3TGUH 3L75H 3L73H 3H1LH 4D6TH 1NTKH 1L0LH 3H1JH 3H1KH 1BE3H 1L0NH 3CXHF 2A06H 3L71H 4PD4F 2BCCH 5KLVH 3L70H 1BCCH 4U3FH 2IBZH
chains in the Genus database with same CATH superfamily
4LH6A 3OTFA 2FYUH 4I55A 4O4JA 2QR4A 1FKAO 5EBLC 1V55C 1WLEA 1IVSA 2OT5A 5KAFZ 5LHHA 3UT5B 4X65O 3H1KH 2ARHA 3OEHG 4B3TB 1N33O 2JGUA 4FLYA 1SQVH 5LMNB 2ZR2A 1IBMB 2Q69A 1ZL8A 3ZMVA 2UXNA 2V7QG 1WA8B 1MG1A 4O4IA 1HR0O 1NR1A 4JI8O 1OCCB 1NTMH 2IJIA 5C93A 4FK5C 3G80A 4BAYA 3VOUA 2ZE8A 5LMUB 1WP8A 1URFA 5B1BC 1IBLO 5FL7G 1EM1A 5LA6B 2NNUA 4FIPC 1US6A 3CRQA 3CC7V 4JZ2A 1FFXA 3QF7A 1BZKA 4EFEA 3AK2A 1VF6A 4X20A 3JD2A 2WA4A 4DR4O 2DJVA 4K3AA 4QIWF 4GKKB 1ZAUA 1TA8A 2ZCEA 3CCRV 1N36B 2AGAA 2BTOA 4JTAB 3DC5A 3AK1A 1H2KA 1AJQA 3CPWU 2RCVA 4DV0B 1I94O 3TJTA 3OTOB 2LW1A 5EBWC 1H2MA 2YC0A 4CH4A 2GBOA 3N2GA 2WLHA 2LQTA 2HLDG 1ZSPA 4LF6B 4OGQB 2WLNA 2CDYA 5B1OA 4FVMA 3RYCB 2M7WA 3OE7G 3AG4B 5IY5B 1Y4MA 4DR3B 1XUQA 4RUFA 1Y74B 4WBNB 3AG7A 5K1XA 3OMIB 1YEWA 4ASUG 1EBOA 5CA0A 4HNAA 1PM9A 3APQA 3AEIA 3IGAC 1V55B 5LOVA 4DR6B 4XDLA 1K8AW 1ZTEA 4X1YB 5GTIZ 2BTQB 4XDJA 5HFMA 2RMKB 4JASA 3RYHA 4LFAO 4PHZA 4GKJB 5J2UA 4KP4A 4I9WA 1VQMV 5LP6C 5EYPA 2HP8A 4LFBB 1G6UA 3SYCA 2VWJA 4C7UA 4DV7B 3G71V 1BQZA 5LGUA 4YY3B 1XHXA 1EZVH 2WPDG 3CCSV 3W7SA 5F2VO 5ITZB 2AZ2A 1NBMG 3CCJV 1L0LH 5B1BB 3FYEB 1LUVA 5EZYB 5FNVA 3DGEA 1KKDA 4WFBV 1BT8A 1HNWO 2IJKA 3ETEA 3E8HA 5JH7B 4PA6A 4DV6O 1SQPH 2KKWA 2WLMA 2W6JG 3K9AA 3SGIA 3QO8A 2ZM6O 1R73A 1Q7YW 4EB6B 2A3QA 4ZHQB 1ZUQA 2UU9O 1YJWV 4JI1O 1ZX3A 1GN4A 1R3JC 2E5LB 4MTGA 1PNLA 1YITV 2RDCA 2Q68A 4I4TB 2B9ZA 4FZ1A 3JALB 4PDRA 2W0FC 3TXSA 2GDSA 4RUEA 4FLUA 3U10A 2OYQA 3IJ4A 2Q67A 5L3GA 2EIMC 5HFLA 2RNBA 4DK0A 5BXZA 2QTOA 2ZXWC 1UJWB 5KHGA 1IURA 1VQLV 3D3IA 2P67A 4DV5B 1OHHG 4UCRA 4JYAO 1VQOV 1R3LC 2MK3A 1VF6C 3JAKB 1LUWA 1NQTA 3JATB 3ZEDA 3LSQA 2WSSG 1S72V 2XOKG 2ITDC 2ZINA 4K0KO 1XMOO 3JD1A 2GUZB 4LC1A 3SPJA 1VQNV 4FM0A 4JAUA 3WG7C 4NTXA 3F5TA 1RSOB 4UXNA 2G38A 2PZSA 5IYBO 1YTFB 3FB8C 1YIJV 4BWAA 5IJ9A 5KLVH 4LFCO 4YJ3B 1GH6A 3A0HZ 5LP6B 4MVOA 1QHTA 5EBMC 5CA1B 2YEVA 2PTMA 4JI6O 2HG5C 5LMNO 2Q0AA 4TV9A 2EILC 3L74H 1VEWA 1XILA 1FFTB 3CCLV 1N33B 3E8BA 1N34B 4O4LB 3P3NA 2KQXA 3JASB 5DM6V 2IH3C 2R9IA 4DO2A 4JTCB 5TISZ 4IT5A 1HWYA 4I55B 4O4JB 5LMUO 3A2FA 3K58A 3BAAA 4DRXB 2ZIOA 2ZIMA 1S5HC 2LO1A 1YF2A 4NKGB 3LSUA 2X0LA 3T1CA 1AI6A 2NR5A 2P90A 1IBLB 3EVKA 2QDOA 5JVDB 1QBZA 3E83A 4E4EA 2QE7G 4EFBA 3PN1A 4O4IB 3O9OA 2A79B 3FD9A 3RBZA 2VQFO 2CTWA 3IC9A 4FM2A 3EXAA 1M90W 3F7VC 1N36O 3W7XA 4IHJA 4DW1A 2EJ7A 4DV0O 2IW5A 1WJZA 5GW7A 4CZZA 2XHBA 2EIMB 2WAMA 1ZWIC 3K3WA 1JMKC 2EINC 2ZXWB 1L1FA 1Y74A 1FFXB 1I94B 3ZMTA 2E75B 1R6NA 2P6JA 4JI0O 4ICGA 2ZDIA 5CBFA 1MSWD 4J10A 1AR1B 3TETA 4X20B 3ABKC 1Q5OA 2JK5C 5IT9N 1QNMA 1YCIA 4FJCC 3K59A 4UCOA 5KX5A 1SKVA 1VARA 2EBOA 2XAQA 2EULA 1S5LZ 2XAHA 3J7AU 5B3SC 1Q3EA 2QKAA 4DK1A 3ZHVA 2HJFC 1EZJA 4DR3O 3WG7B 1KB9F 4F6RA 2P5OA 4IYHA 2ZR3A 3TCUA 4DR6O 2DE0X 3ZN1A 2ADQB 3B8MA 5ITZA 4D7SA 4H33A 4PA3A 4OX9O 5FPRA 4ZBMA 2OCCC 3G6EV 4NVPA 4LF4B 4GKJO 1MA1A 2EILB 4LFBO 5CBGA 4LFAB 1S3JA 4DV7O 1H8EG 4UB8Z 3FFQA 3RFRA 3WB1A 5CA0B 4HNAB 1BS3A 5L3DA 3C3SA 4YXWG 4U3JA 1NKDA 2NN4A 4JV5B 3JSNA 5LOVB 1YTFD 5EIBC 2R72A 3VQXA 3H9VA 1W0KG 2LJ2A 1K5SA 3NR7A 4B3SB 3M8AA 4OXSA 3RYHB 3JALA 3ZRVA 1KD1W 3CCEV 5J2UB 3DTUB 1N8RW 3W7WA 5EYPB 4U3FH 3BA8A 2JRIA 3OGCC 4DV6B 4MVQA 2BOCC 4DW0A 3K06A 3LDCA 3CXCU 5H5NA 5H9CA 2ZM6B 4FPPA 3K5OA 4UVCA 3CD6V 2CTQA 2Q4PA 2F66C 5FNVB 3JAKA 1DTOA 4J42A 2F43G 3JATA 3A0BZ 3QTCA 1P7BA 2EINB 3H1IH 5CB4A 3KG2A 2CGOA 2RQ6A 1U97A 1QVGU 3CYOA 3ZMSA 4FFKA 3ABKB 4TOIA 2P7TC 2QSAA 4RQFA 1SQGA 4DV5O 4NR1A 1THZA 4BIOA 5B3SB 2CTRA 2ILMA 5GTHZ 1XMQO 5BY1A 1XNRB 1YVWA 3OEEG 1CPYA 2HKOA 3LUTB 4JYAB 5LP6A 1AROP 3QO5A 4F4LA 1AJNA 1U96A 2DMXA 2LGQA 3O65A 4DR1B 3CCMV 1OCRC 5AG2A 3ZHTA 1PD3A 2KB1A 2UXBO 2PY5A 4K0KB 5H6QA 1XMOB 2F95B 4O4LA 3AG2C 4X1IB 5CN0A 1I0HA 5LL6Y 1XQ8A 2OCCB 1ZLZA 3STZC 3CRAA 4CH5A 3K57A 1O9GA 3IAYA 4ZIBA 2ZDIC 4DRXA 1BMFG 4QGPA 4JI4O 4LFCB 3OGIB 1TAEA 1Z2GA 1OZ0A 4LH7A 2D3OW 4B3RO 1RFYA 1N4CA 3FB6C 5JVDA 4JI6B 4NXMO 4G2KA 4R50A 1N34O 4KHPB 5CA3A 3OR7C 1NU1H 3ZRXA 2QEXV 3THOA 1D5AA 2GV9A 3T1YB 4EEQA 3JCUZ 2EJRA 2Z0AA 2L35A 1NJIW 1EN6A 5IJ9B 2JIZG 2WLKA 3BVOA 3HKEA 4A5UB 2N04A 2M6YA 3U11A 2YEVB 3FAVA 4NYKA 2PYJA 4MVRA 4HBNA 1D2DA 4TV9B 4LF5O 2UUAB 3HR0A 4QJFB 2UUBB 2NLJC 3GVMA 2C2AA 4LP8A 5B66Z 4XBFA 4DR2B 2QGNA 4K35A 2VQFB 3N27A 2OCHA 3SJQC 1EFRG 1RP3B 4WF9V 3UQ8A 3LDDA 2JS5A 4TSFG 2PGGA 3NXSA 3OR6C 5BR8O 1IBKB 2P4KA 3UO3A 1CEZA 1EN4A 1NT2B 1P49A 4H37A 4JI0B 1IZ3A 4DV4O 4JZGA 2Q8VA 2E74B 4EKWA 1QLNA 4NXNO 3EHBB 1OCRB 4PI0A 2XTAA 1S0VA 1HP8A 4AHCA 4IHJB 3OD4A 3CCVV 1KU9A 1JJ2U 3Q4HA 1NR7A 3AG2B 4B08A 4O4HA 3KKYA 4HYOA 5DECA 4YIOA 3DC6A 2EX3A 3JCZA 3BRCA 4LF4O 4OX9B 5KX5B 1AI4A 4ZI7A 1MZEA 4CH3A 5IYDO 3A0RA 2YUAA 4CC5A 1G8MA 1M1KW 2D2CB 1L8DA 1XREA 1HNZB 2PUSA 4AILC 2HJDA 3K0DA 2Z3YA 4F6RB 1OCOC 3JYCA 4JV5O 1SS3A 4GX5A 1VQ6V 2HFEC 4X89A 2F1MA 3B77A 1GTOA 1K92A 1VF7A 4B3SO 3ZHUA 1N0NA 2KG7A 2DQ3A 4UCUA 4U7NA 4K8XA 4DUZO 2X6BA 3T4DA 3TGUH 2DOSA 2Q0OC 3GWOA 1NTKH 1OV9A 5EIBD 3DXRB 3P30A 1FPOA 2QJ1A 1RPOA 4U3JB 1G1XB 4UB6Z 4CC6A 1FS0G 5KAIZ 2JEUA 4YIPA 2QWOB 3LNNA 3ZMZA 2AHZA 3J81N 2ZKOA 4AI8A 1KP2A 3WU2Z 1GO3F 1WAZA 1XHZA 1QR8A 5LGNA 4YHHO 2EIJC 2WLJA 1M57C 3T4ZA 1VQ9V 2XT9A 1GN2A 4L87A 4GX1A 3LNMB 1SF9A 3CC4V 1NI8A 1TUEB 4X1IA 1N32B 4J80A 3STLC 5BMVA 1XNRO 4JYBA 3BY6A 4FLZA 2JVDA 1RPRA 2X6AA 2HEPA 3X2QC 1QLEC 1XMQB 4NTYA 4DR1O 3OMAB 5CB4B 2X6CA 3ABTA 4F6EA 1R6TA 3ML0A 1B6QA 1VQ4V 1D5NA 1PKXA 1Y6XA 2EZPA 2WLIB 2UXBB 1TUBA 3R66A 1VP7A 1MNGA 3SJCC 4JI2B 4BIUA 1UFIA 1Y66A 3CXHF 2ZE7A 5IYZA 2RJZA 4BW9A 2CTPA 5LHIA 1AB3A 3GWKC 1KP3A 2DQ0A 1IXBA 2F4VB 1Q43A 5LBQA 3B40A 5JWPA 1OJHA 3DSQA 4JI4B 1OCOB 4MTOA 4KHPO 4IIJA 5A2QN 1K5QA 2O57A 5L3CA 4B3RB 1JX9A 3ICXA 5KA5A 1AVMA 3T1YO 4NXMB 3N2KA 3PJSK 4CS4A 1YXBA 1T5EA 2P22C 3OM3B 3K03A 2LFRA 5LHGA 3JD3A 1G4YB 4DUYO 3OT7A 2R9RB 4RAIA 5C8YA 3ZCCA 1FD9A 4ZOLA 1GM7A 2UUAO 2UUBO 4O2AA 2LW7A 1V54C 4LF5B 1SC5B 4WFHA 1NH2B 5E79Z 2MW2B 1BL8A 4DR2O 2QM8A 4I5SA 3K5NA 2OTLV 1H2GA 2R9AA 3B09A 4PV1B 2EIJB 5DN6G 3ZX6A 3HKEB 4X9QA 1M57B 4J7ZA 3H1LH 2YIBD 3FAVB 1W59A 1J95A 4PI2A 2HHHB 3CP1A 1XEQA 1IXMA 1P4RA 5E1AC 3UM7A 1IBKO 4PA4A 2ZNIA 4GX2A 3FB5C 1Q6IA 3RYIA 1R1BA 5BR8B 3CSXA 4Q20A 4JI5O 1AR4A 1QLEB 2CK3G 3X2QB 4FLWA 1N0JA 4B7EA 1HDJA 1B3QA 4MVUA 4DV4B 2UXDB 3L70H 3K0GA 4X64B 3W7UA 4RWUA 5IE9A 5JQGA 4NXNB 1PPJH 3E22B 1WB8A 2XNDG 3HKBA 2CH7B 5EC2C 2A0LA 4HZ3A 4UV8A 1KMIZ 1IDSA 4WFFA 1TVKA 2GSMB 3CEIA 4BIZA 2VQEO 2FB5A 1OCZC 2A06H 5EK0A 2FTKA 2IH1C 3OFNG 3ASNC 4B7KA 4MVMA 3RN4A 3JARA 4P30A 3KCXA 2YIBA 1JCHA 1KUQA 3R65A 2HVJC 1Y67A 1H2NA 2CAZC 3AK3A 2ZT9B 1HNZO 3BPZA 3Q4HB 1I08A 1VQ8V 4LNUA 4P9PA 3CCUV 5KUMA 2ZE5A 3JD4A 4O4HB 4TV8A 2P4VA 3DXRA 2HR3A 4KL1A 1HW7A 4R7CA 3QNEA 3QG5A 2QTSA 3BA9A 1W2BU 2UXXA 4FMTA 2Q5ZA 4R6ZA 5B1NA 2PYLA 3G4SV 2UUCO 1M5IA 5JJJB 2A9HA 4FLTA 4ZI7B 3H1JH 3JD0A 4AQYO 4GUNA 4JI7O 3D3QA 4UVBA 2F93B 1V54B 3CHXA 3OUSA 5KHKA 1Q90D 1R3IC 4DUZB 4PELA 1AP6A 2Q7GA 5J2TA 3B8NA 1O9HA 5KHHA 1S5JA 3L72H 4Q6GA 1DLBA 2Q9LA 3CMAV 1M9NA 3MDSA 1W0JG 4L8JA 4TQFA 3VBBA 3ETGA 2KG7B 4UVAA 2ZE6A 2BE3A 3C3TA 5H6RA 1SQQH 1JPXA 2BOBC 3E35A 1JOYA 2QWNB 4YHHB 1X59A 3FKSG 4PDLA 4J7JA 1SA0B 4GT1A 1BHBA 3K04A 1XL6A 2EIKC 2AHYA 2K9PA 2OTJV 2WLIA 2JS3A 3H01A 1N32O 3ZHSA 4OPAA 4X1KA 5JCOA 1NH2D 1GRJA 4LWSB 3VQWA 1SZTA 3RT3C 4U7OA 3G6BA 5IWAB 2LFSA 2F23A 4WFEA 4DR7O 1F51A 5K1PA 3SYPA 2ZQMA 3GB7C 4N21A 1SRYA 2LP7A 2WLLA 4H44B 5B1AC 4KUMA 1OCZB 2GTSA 4QE9A 2IM9A 3ABUA 1BE3H 1GN3A 1UPGA 3LSSA 4WCEV 3ASNB 2Y69C 1FYJA 3E8FA 4NB5A 4JI2O 4BW5A 1DGSA 1KECA 3WFVA 5BMVB 5L3EA 1H8HG 5GONA 1S76D 3IFXA 2AZ0A 2E3CA 3ZS8C 1AJPA 2JGDB 2F4VO 3TK1A 2XUMA 1KBHA 1XDCA 4D6TH 5KHIA 1K4CC 3HKCA 1H38A 4ABMA 2Q73A 1FXKA 3SJBC 1LNQA 1DF5A 1JR9A 1TUBB 3CJHA 1KC8W 1BGYH 5IJ0B 1Y76B 3A8TA 3F5WC 2OWOA 1I5XA 5IYZB 1QU7A 4UV9A 4MVZA 1JJOA 1VQPV 1JFFA 2Y48A 4DUYB 1MABG 4DV3B 2QKSA 4RQEA 1VQ7V 3WB0A 4IIJB 3SDLA 4LF7O 3ZMUA 2KSDA 4TUYB 2H3OA 1R3KC 1FXHA 4B3MO 3SPHA 2IJJA 3N2KB 2DWEC 1HNXO 5DEDA 3SPIA 3SYOA 5KHJA 2IBZH 3I55V 2UXCB 1J5EO 1AI7A 4PJ0Z 3K5LA 1M4UA 4Z1MG 4N23A 4O2BA 4JTDB 2HHHO 3FX7A 2EZOA 4TQDA 5C8YB 3E22A 2EIKB 2CH7A 5EC1C 3RWRD 4GX0A 2Q7HA 4ZOLB 3SYAA 3CC2V 1R6KA 4NTWA 5KMGA 3W7TA 4O2AB 3MHSC 1F23A 1GKFA 3ETQA 1AP5A 1YZBA 1E79G 2UXDO 3JSLA 4JI5B 3OMNB 4X64O 3ZIAG 4FM1A 5LYJA 2K1EA 3SJAC 5B1AB 1NVPB 1XOUA 1Q6UA 3CB2A 3OUFA 5FLXN 4PD4F 4HAMA 2Y69B 1H2SB 2JJ2G 2XAJA 4DV2O 3RYIB 3E2EA 5B5EZ 3AG1C 4OPHA 1B06A 1FJGB 4W4KA 2VQEB 3D36C 3T2MA 4LR3A 5D5PA 2YIDA 4UCSA 1I7FA 3SR2C 3QVNA 2VWKA 3ZHRA 3ZRWA 5JCOC 1ROPA 2E76B 3L71H 5JQGB 3F7YC 2DYSC 4MT8A 1PNMA 3HKBB 1XI1A 4I7ZB 5IDJA 3CRMA 1K4DC 2PI4A 3JAWA 2YIAA 3B4SA 3ASOC 1TVKB 1VQ5V 4P9OA 1Q6HA 4CS2A 3M99B 1NS1A 5D5QA 1AR5A 3OAAG 5LXTB 4JI3B 4X66B 3SYQA 4LF8O 1ENVA 3C90A 4DV1O 3JARB 3T1HO 3CCQV 3BCCH 1K9MW 3RVYA 2UUCB 1VF5B 2IU3A 5L3FA 4UFZA 4IGGA 3RYFA 2YXYA 4AQYB 4LF9B 4X62B 4JI7B 4LNUB 4H13B 1SA0A 4TV8B 2JJ1G 1FXKC 4W4LA 3HKDA 3ABMC 4MS2A 4LWSA 2N74A 1ORQC 1PNKA 2YXLA 2N05A 3UCSC 1I5YA 4QPKA 3CS5A 3OW2U 2Z5UA 2WWWA 4FLXA 2Q6AA 3HB3B 1XNQB 1TGOA 2IU0A 4LCUC 1SESA 1IX9A 2YI9A 4MSWC 2VS0A 3APOA 3AG3C 3RW0A 4YJ2A 2ZNJA 4FFBA 5J2TB 4DYLA 5CMUA 4IL6Z 1SERA 4I0XA 2B1GA 1SETA 3H1HH 5L3BA 3E89A 2JEXA 4FZ0A 5IWAO 3ZRSA 1SZXA 5LGTA 2CGNA 4I50A 2JGDA 4JAVA 2YS8A 3VQVA 1YI2V 4BR6A 3P3PA 1BCCH 1QR9A 3AG1B 4DR7B 4PDMA 2RN9A 2QWPB 4WFAV 4GYCB 1PV0A 2GTAA 2B5UA 4GCZA 4UUJC 5IYCO 1VIBA 4DR5O 1P84F 4X1KB 4CBCA 3IC7A 1E1RG 1GMGA 3VQYA 5IJ0A 1Y76A 1M56C 2DYSB 3UT5A 1YJ9V 2AXTZ 2Q7EA 4CS3A 3RVZA 5CBHA 1KQSU 3WB2A 4UCTA 3LDEA 1NVPD 3ABLC 3CRCA 1BSMA 3ASOB 2P06A 1Q8IA 1V9PA 4JF3A 5JJEB 2WLLB 1WB7A 1SQBH 1WA8A 4GZRB 2GHYA 3L75H 3L73H 1K7DA 4TUYA 1BQ0A 4JPRA 1L0NH 1B04A 1X4TA 4PDVA 4G27B 5FPOA 3E86A 4QE7A 1PL0A 4RO2A 3TXQA 1AILA 5GONB 1JVMA 3E8GA 3K9SA 4TWKA 5LA6A 4B3TO 3EFFK 2B1IA 3S3WA 1IBMO 4X65B 4DV3O 2H8PC 4Z1VA 1NTZH 1MOFA 2Y4TA 2YXHA 4I9QA 1KYOF 3HKCB 1K97A 1RM1C 1FXKB 2BSKB 1JQ0A 3K79A 1VMGA 2BCCH 1MMMA 2Y4UA 3ABMB 1K73W 2V1DA 2YICA 2YSUB 4K8ZA 4DXWA 4XDKA 1HR0B 4JI8B 4LF7B 4TT3G 4GLXA 4QPJA 3U0ZA 3CJHB 2UXCO 2PF4E 4B3MB 2ZD9A 1MSDA 4R8CA 2DWDC 3SPGA 1HNXB 2YI8A 2AW9A 1GM8A 1J5EB 1JFFB 2QM4A 3AG3B 2ITCC 1YSCA 2DN9A 1ZL8B 2DW4A 2FKXA 3CX5F 2FMLA 3D8CA 2PI5A 4GKKO 3M7MX 1K33A 4DR4B 1F4MA 1GM9A 3FB7C 4FLVA 1K34A 1QQCA 3RYCA 1YJNV 3OTOO 4LBEC 2JDIG 2W6IG 4G28B 3MHHC 3BFRA 4J9YB 4WFGA 4O2BB 3S3XA 4Z2WA 4WBNA 2ADPA 3BHPA 2XASA 1Q81W 4ZKIA 3SPCA 1NZ6A 4LF6O 1PP9H 5KMGB 1COWG 1QVFU 1GK9A 1FJGO 4DV2B 1M56B 1GAXA 5JJNB 4X1YA 1VQKV 2BTQA 5LXTA 1E1QG 1QCEA 4J41A 4MW8A 3ABLB 5LYJB 1A32A 2QA4V 3MAQA 2WA3A 3CWBH 5BZBA 1K3EA 1P7GA 3N2GB 1GN6A 2FL4A 1XBLA 1S77D 1BHAA 2DYRC 2QWRB 4PA7A 2IJHA 1F4NA 3KZIZ 1XL4A 2Y0IA 3P32A 5EZYA 3MD0A 5J9PC 1SQXH 4JI3O 3L9DA 4X66O 2CE4A 3KCYA 1JA8A 5JH7A 2X7RB 2Y0PA 4JGSA 3ZRWB 1CXZB 1RM1B 4LF8B 4DV1B 3T1HB 4YY3O 1DF4A 3FYIB 4LF9O 4X62O 2R70A 2HVKC 4EB6A 4ZHQA 1WN7A 1LR1A 3JAWB 4E2LA 5A9GA 1AI5A 4JAAA 3K5MA 4I4TA 2H94A 1OCCC 1PL4A 4KXRA 1DK1A 4UCVA 2YDEA 1SQFA 3I5DA 1HNWB 3J80N 3BABA 1Q86W 1MZFA 2ETNA 1XNQO 3B2EE 2VRZA 4H0LB 3CRRA 3ETDA 4J9ZB 3ZHQA 4X88A 3RYFB 3CE2A 4P2ZA 1FAFA 3ZJZA 4D7TA 2E5LO 3D36A 5KUKA 2LGWA 1WNSA 2UU9B 4JI1B 2QKCA 2QWQB 1KKCA 2OIGA 3HKDB 3RGBA 2QM7A 4PA9A 1YHQV 2W0XA 3QO7A 3ZN0A 2XAFA 1Q82W 1CP9A 4CH6A 3ZBHA 4MVSA 2GUZA 4J7KA 3JAMN 3UKMA 4MTXA 4MW3A 1Z5VA 2ODMA 3I56V 3HPLC 1RSOA 2V4DA 3BEHA 4YJ2B 2XAGA 4JYYA 4X8AA 1WPXA 2CUGA 4FFBB 4IYIA 1WPBA 3K08A 2L6LA 4YJ3A 4DR5B 4I0XB 5CA1A 1FXVA 1H2LA 5KA6A 3G67A 4QNHB 4I50B 1M93A 4MTFA 2A7WA 3UO2A 2DYRB 2OIEA 1Z5WA 4JYCA 3CMEV 2ATKC 5H2FZ 4J11A 1EN5A 3AG4C 1YDXA 5IY5C 3JASA 1WP7A 1F7YA 2BSKA 4KFMA
chains in the Genus database with same CATH topology
3H1IH 1SQVH 3BCCH 1PPJH 1SQXH 2FYUH 3CX5F 1SQQH 1NU1H 3H1HH 1SQPH 1PP9H 1EZVH 3CWBH 1P84F 1SQBH 1BGYH 1NTZH 1KB9F 1NTMH 3L74H 3L72H 1KYOF 3TGUH 3L75H 3L73H 3H1LH 4D6TH 1NTKH 1L0LH 3H1JH 3H1KH 1BE3H 1L0NH 3CXHF 2A06H 3L71H 4PD4F 2BCCH 5KLVH 3L70H 1BCCH 4U3FH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I H;  1SQV H;  3BCC H;  1PPJ H;  1SQX H;  2FYU H;  3CX5 F;  1SQQ H;  1NU1 H;  3H1H H;  1SQP H;  1PP9 H;  1EZV H;  3CWB H;  1P84 F;  1SQB H;  1BGY H;  1NTZ H;  1KB9 F;  1NTM H;  3L74 H;  3L72 H;  1KYO F;  3TGU H;  3L75 H;  3L73 H;  3H1L H;  4D6T H;  1NTK H;  1L0L H;  3H1J H;  3H1K H;  1BE3 H;  1L0N H;  3CXH F;  2A06 H;  3L71 H;  4PD4 F;  2BCC H;  5KLV H;  3L70 H;  1BCC H;  4U3F H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 4LH6 A;  3OTF A;  2FYU H;  4I55 A;  4O4J A;  2QR4 A;  1FKA O;  5EBL C;  1V55 C;  1WLE A;  1IVS A;  2OT5 A;  5KAF Z;  5LHH A;  3UT5 B;  4X65 O;  3H1K H;  2ARH A;  3OEH G;  4B3T B;  1N33 O;  2JGU A;  4FLY A;  1SQV H;  5LMN B;  2ZR2 A;  1IBM B;  2Q69 A;  1ZL8 A;  3ZMV A;  2UXN A;  2V7Q G;  1WA8 B;  1MG1 A;  4O4I A;  1HR0 O;  1NR1 A;  4JI8 O;  1OCC B;  1NTM H;  2IJI A;  5C93 A;  4FK5 C;  3G80 A;  4BAY A;  3VOU A;  2ZE8 A;  5LMU B;  1WP8 A;  1URF A;  5B1B C;  1IBL O;  5FL7 G;  1EM1 A;  5LA6 B;  2NNU A;  4FIP C;  1US6 A;  3CRQ A;  3CC7 V;  4JZ2 A;  1FFX A;  3QF7 A;  1BZK A;  4EFE A;  3AK2 A;  1VF6 A;  4X20 A;  3JD2 A;  2WA4 A;  4DR4 O;  2DJV A;  4K3A A;  4QIW F;  4GKK B;  1ZAU A;  1TA8 A;  2ZCE A;  3CCR V;  1N36 B;  2AGA A;  2BTO A;  4JTA B;  3DC5 A;  3AK1 A;  1H2K A;  1AJQ A;  3CPW U;  2RCV A;  4DV0 B;  1I94 O;  3TJT A;  3OTO B;  2LW1 A;  5EBW C;  1H2M A;  2YC0 A;  4CH4 A;  2GBO A;  3N2G A;  2WLH A;  2LQT A;  2HLD G;  1ZSP A;  4LF6 B;  4OGQ B;  2WLN A;  2CDY A;  5B1O A;  4FVM A;  3RYC B;  2M7W A;  3OE7 G;  3AG4 B;  5IY5 B;  1Y4M A;  4DR3 B;  1XUQ A;  4RUF A;  1Y74 B;  4WBN B;  3AG7 A;  5K1X A;  3OMI B;  1YEW A;  4ASU G;  1EBO A;  5CA0 A;  4HNA A;  1PM9 A;  3APQ A;  3AEI A;  3IGA C;  1V55 B;  5LOV A;  4DR6 B;  4XDL A;  1K8A W;  1ZTE A;  4X1Y B;  5GTI Z;  2BTQ B;  4XDJ A;  5HFM A;  2RMK B;  4JAS A;  3RYH A;  4LFA O;  4PHZ A;  4GKJ B;  5J2U A;  4KP4 A;  4I9W A;  1VQM V;  5LP6 C;  5EYP A;  2HP8 A;  4LFB B;  1G6U A;  3SYC A;  2VWJ A;  4C7U A;  4DV7 B;  3G71 V;  1BQZ A;  5LGU A;  4YY3 B;  1XHX A;  1EZV H;  2WPD G;  3CCS V;  3W7S A;  5F2V O;  5ITZ B;  2AZ2 A;  1NBM G;  3CCJ V;  1L0L H;  5B1B B;  3FYE B;  1LUV A;  5EZY B;  5FNV A;  3DGE A;  1KKD A;  4WFB V;  1BT8 A;  1HNW O;  2IJK A;  3ETE A;  3E8H A;  5JH7 B;  4PA6 A;  4DV6 O;  1SQP H;  2KKW A;  2WLM A;  2W6J G;  3K9A A;  3SGI A;  3QO8 A;  2ZM6 O;  1R73 A;  1Q7Y W;  4EB6 B;  2A3Q A;  4ZHQ B;  1ZUQ A;  2UU9 O;  1YJW V;  4JI1 O;  1ZX3 A;  1GN4 A;  1R3J C;  2E5L B;  4MTG A;  1PNL A;  1YIT V;  2RDC A;  2Q68 A;  4I4T B;  2B9Z A;  4FZ1 A;  3JAL B;  4PDR A;  2W0F C;  3TXS A;  2GDS A;  4RUE A;  4FLU A;  3U10 A;  2OYQ A;  3IJ4 A;  2Q67 A;  5L3G A;  2EIM C;  5HFL A;  2RNB A;  4DK0 A;  5BXZ A;  2QTO A;  2ZXW C;  1UJW B;  5KHG A;  1IUR A;  1VQL V;  3D3I A;  2P67 A;  4DV5 B;  1OHH G;  4UCR A;  4JYA O;  1VQO V;  1R3L C;  2MK3 A;  1VF6 C;  3JAK B;  1LUW A;  1NQT A;  3JAT B;  3ZED A;  3LSQ A;  2WSS G;  1S72 V;  2XOK G;  2ITD C;  2ZIN A;  4K0K O;  1XMO O;  3JD1 A;  2GUZ B;  4LC1 A;  3SPJ A;  1VQN V;  4FM0 A;  4JAU A;  3WG7 C;  4NTX A;  3F5T A;  1RSO B;  4UXN A;  2G38 A;  2PZS A;  5IYB O;  1YTF B;  3FB8 C;  1YIJ V;  4BWA A;  5IJ9 A;  5KLV H;  4LFC O;  4YJ3 B;  1GH6 A;  3A0H Z;  5LP6 B;  4MVO A;  1QHT A;  5EBM C;  5CA1 B;  2YEV A;  2PTM A;  4JI6 O;  2HG5 C;  5LMN O;  2Q0A A;  4TV9 A;  2EIL C;  3L74 H;  1VEW A;  1XIL A;  1FFT B;  3CCL V;  1N33 B;  3E8B A;  1N34 B;  4O4L B;  3P3N A;  2KQX A;  3JAS B;  5DM6 V;  2IH3 C;  2R9I A;  4DO2 A;  4JTC B;  5TIS Z;  4IT5 A;  1HWY A;  4I55 B;  4O4J B;  5LMU O;  3A2F A;  3K58 A;  3BAA A;  4DRX B;  2ZIO A;  2ZIM A;  1S5H C;  2LO1 A;  1YF2 A;  4NKG B;  3LSU A;  2X0L A;  3T1C A;  1AI6 A;  2NR5 A;  2P90 A;  1IBL B;  3EVK A;  2QDO A;  5JVD B;  1QBZ A;  3E83 A;  4E4E A;  2QE7 G;  4EFB A;  3PN1 A;  4O4I B;  3O9O A;  2A79 B;  3FD9 A;  3RBZ A;  2VQF O;  2CTW A;  3IC9 A;  4FM2 A;  3EXA A;  1M90 W;  3F7V C;  1N36 O;  3W7X A;  4IHJ A;  4DW1 A;  2EJ7 A;  4DV0 O;  2IW5 A;  1WJZ A;  5GW7 A;  4CZZ A;  2XHB A;  2EIM B;  2WAM A;  1ZWI C;  3K3W A;  1JMK C;  2EIN C;  2ZXW B;  1L1F A;  1Y74 A;  1FFX B;  1I94 B;  3ZMT A;  2E75 B;  1R6N A;  2P6J A;  4JI0 O;  4ICG A;  2ZDI A;  5CBF A;  1MSW D;  4J10 A;  1AR1 B;  3TET A;  4X20 B;  3ABK C;  1Q5O A;  2JK5 C;  5IT9 N;  1QNM A;  1YCI A;  4FJC C;  3K59 A;  4UCO A;  5KX5 A;  1SKV A;  1VAR A;  2EBO A;  2XAQ A;  2EUL A;  1S5L Z;  2XAH A;  3J7A U;  5B3S C;  1Q3E A;  2QKA A;  4DK1 A;  3ZHV A;  2HJF C;  1EZJ A;  4DR3 O;  3WG7 B;  1KB9 F;  4F6R A;  2P5O A;  4IYH A;  2ZR3 A;  3TCU A;  4DR6 O;  2DE0 X;  3ZN1 A;  2ADQ B;  3B8M A;  5ITZ A;  4D7S A;  4H33 A;  4PA3 A;  4OX9 O;  5FPR A;  4ZBM A;  2OCC C;  3G6E V;  4NVP A;  4LF4 B;  4GKJ O;  1MA1 A;  2EIL B;  4LFB O;  5CBG A;  4LFA B;  1S3J A;  4DV7 O;  1H8E G;  4UB8 Z;  3FFQ A;  3RFR A;  3WB1 A;  5CA0 B;  4HNA B;  1BS3 A;  5L3D A;  3C3S A;  4YXW G;  4U3J A;  1NKD A;  2NN4 A;  4JV5 B;  3JSN A;  5LOV B;  1YTF D;  5EIB C;  2R72 A;  3VQX A;  3H9V A;  1W0K G;  2LJ2 A;  1K5S A;  3NR7 A;  4B3S B;  3M8A A;  4OXS A;  3RYH B;  3JAL A;  3ZRV A;  1KD1 W;  3CCE V;  5J2U B;  3DTU B;  1N8R W;  3W7W A;  5EYP B;  4U3F H;  3BA8 A;  2JRI A;  3OGC C;  4DV6 B;  4MVQ A;  2BOC C;  4DW0 A;  3K06 A;  3LDC A;  3CXC U;  5H5N A;  5H9C A;  2ZM6 B;  4FPP A;  3K5O A;  4UVC A;  3CD6 V;  2CTQ A;  2Q4P A;  2F66 C;  5FNV B;  3JAK A;  1DTO A;  4J42 A;  2F43 G;  3JAT A;  3A0B Z;  3QTC A;  1P7B A;  2EIN B;  3H1I H;  5CB4 A;  3KG2 A;  2CGO A;  2RQ6 A;  1U97 A;  1QVG U;  3CYO A;  3ZMS A;  4FFK A;  3ABK B;  4TOI A;  2P7T C;  2QSA A;  4RQF A;  1SQG A;  4DV5 O;  4NR1 A;  1THZ A;  4BIO A;  5B3S B;  2CTR A;  2ILM A;  5GTH Z;  1XMQ O;  5BY1 A;  1XNR B;  1YVW A;  3OEE G;  1CPY A;  2HKO A;  3LUT B;  4JYA B;  5LP6 A;  1ARO P;  3QO5 A;  4F4L A;  1AJN A;  1U96 A;  2DMX A;  2LGQ A;  3O65 A;  4DR1 B;  3CCM V;  1OCR C;  5AG2 A;  3ZHT A;  1PD3 A;  2KB1 A;  2UXB O;  2PY5 A;  4K0K B;  5H6Q A;  1XMO B;  2F95 B;  4O4L A;  3AG2 C;  4X1I B;  5CN0 A;  1I0H A;  5LL6 Y;  1XQ8 A;  2OCC B;  1ZLZ A;  3STZ C;  3CRA A;  4CH5 A;  3K57 A;  1O9G A;  3IAY A;  4ZIB A;  2ZDI C;  4DRX A;  1BMF G;  4QGP A;  4JI4 O;  4LFC B;  3OGI B;  1TAE A;  1Z2G A;  1OZ0 A;  4LH7 A;  2D3O W;  4B3R O;  1RFY A;  1N4C A;  3FB6 C;  5JVD A;  4JI6 B;  4NXM O;  4G2K A;  4R50 A;  1N34 O;  4KHP B;  5CA3 A;  3OR7 C;  1NU1 H;  3ZRX A;  2QEX V;  3THO A;  1D5A A;  2GV9 A;  3T1Y B;  4EEQ A;  3JCU Z;  2EJR A;  2Z0A A;  2L35 A;  1NJI W;  1EN6 A;  5IJ9 B;  2JIZ G;  2WLK A;  3BVO A;  3HKE A;  4A5U B;  2N04 A;  2M6Y A;  3U11 A;  2YEV B;  3FAV A;  4NYK A;  2PYJ A;  4MVR A;  4HBN A;  1D2D A;  4TV9 B;  4LF5 O;  2UUA B;  3HR0 A;  4QJF B;  2UUB B;  2NLJ C;  3GVM A;  2C2A A;  4LP8 A;  5B66 Z;  4XBF A;  4DR2 B;  2QGN A;  4K35 A;  2VQF B;  3N27 A;  2OCH A;  3SJQ C;  1EFR G;  1RP3 B;  4WF9 V;  3UQ8 A;  3LDD A;  2JS5 A;  4TSF G;  2PGG A;  3NXS A;  3OR6 C;  5BR8 O;  1IBK B;  2P4K A;  3UO3 A;  1CEZ A;  1EN4 A;  1NT2 B;  1P49 A;  4H37 A;  4JI0 B;  1IZ3 A;  4DV4 O;  4JZG A;  2Q8V A;  2E74 B;  4EKW A;  1QLN A;  4NXN O;  3EHB B;  1OCR B;  4PI0 A;  2XTA A;  1S0V A;  1HP8 A;  4AHC A;  4IHJ B;  3OD4 A;  3CCV V;  1KU9 A;  1JJ2 U;  3Q4H A;  1NR7 A;  3AG2 B;  4B08 A;  4O4H A;  3KKY A;  4HYO A;  5DEC A;  4YIO A;  3DC6 A;  2EX3 A;  3JCZ A;  3BRC A;  4LF4 O;  4OX9 B;  5KX5 B;  1AI4 A;  4ZI7 A;  1MZE A;  4CH3 A;  5IYD O;  3A0R A;  2YUA A;  4CC5 A;  1G8M A;  1M1K W;  2D2C B;  1L8D A;  1XRE A;  1HNZ B;  2PUS A;  4AIL C;  2HJD A;  3K0D A;  2Z3Y A;  4F6R B;  1OCO C;  3JYC A;  4JV5 O;  1SS3 A;  4GX5 A;  1VQ6 V;  2HFE C;  4X89 A;  2F1M A;  3B77 A;  1GTO A;  1K92 A;  1VF7 A;  4B3S O;  3ZHU A;  1N0N A;  2KG7 A;  2DQ3 A;  4UCU A;  4U7N A;  4K8X A;  4DUZ O;  2X6B A;  3T4D A;  3TGU H;  2DOS A;  2Q0O C;  3GWO A;  1NTK H;  1OV9 A;  5EIB D;  3DXR B;  3P30 A;  1FPO A;  2QJ1 A;  1RPO A;  4U3J B;  1G1X B;  4UB6 Z;  4CC6 A;  1FS0 G;  5KAI Z;  2JEU A;  4YIP A;  2QWO B;  3LNN A;  3ZMZ A;  2AHZ A;  3J81 N;  2ZKO A;  4AI8 A;  1KP2 A;  3WU2 Z;  1GO3 F;  1WAZ A;  1XHZ A;  1QR8 A;  5LGN A;  4YHH O;  2EIJ C;  2WLJ A;  1M57 C;  3T4Z A;  1VQ9 V;  2XT9 A;  1GN2 A;  4L87 A;  4GX1 A;  3LNM B;  1SF9 A;  3CC4 V;  1NI8 A;  1TUE B;  4X1I A;  1N32 B;  4J80 A;  3STL C;  5BMV A;  1XNR O;  4JYB A;  3BY6 A;  4FLZ A;  2JVD A;  1RPR A;  2X6A A;  2HEP A;  3X2Q C;  1QLE C;  1XMQ B;  4NTY A;  4DR1 O;  3OMA B;  5CB4 B;  2X6C A;  3ABT A;  4F6E A;  1R6T A;  3ML0 A;  1B6Q A;  1VQ4 V;  1D5N A;  1PKX A;  1Y6X A;  2EZP A;  2WLI B;  2UXB B;  1TUB A;  3R66 A;  1VP7 A;  1MNG A;  3SJC C;  4JI2 B;  4BIU A;  1UFI A;  1Y66 A;  3CXH F;  2ZE7 A;  5IYZ A;  2RJZ A;  4BW9 A;  2CTP A;  5LHI A;  1AB3 A;  3GWK C;  1KP3 A;  2DQ0 A;  1IXB A;  2F4V B;  1Q43 A;  5LBQ A;  3B40 A;  5JWP A;  1OJH A;  3DSQ A;  4JI4 B;  1OCO B;  4MTO A;  4KHP O;  4IIJ A;  5A2Q N;  1K5Q A;  2O57 A;  5L3C A;  4B3R B;  1JX9 A;  3ICX A;  5KA5 A;  1AVM A;  3T1Y O;  4NXM B;  3N2K A;  3PJS K;  4CS4 A;  1YXB A;  1T5E A;  2P22 C;  3OM3 B;  3K03 A;  2LFR A;  5LHG A;  3JD3 A;  1G4Y B;  4DUY O;  3OT7 A;  2R9R B;  4RAI A;  5C8Y A;  3ZCC A;  1FD9 A;  4ZOL A;  1GM7 A;  2UUA O;  2UUB O;  4O2A A;  2LW7 A;  1V54 C;  4LF5 B;  1SC5 B;  4WFH A;  1NH2 B;  5E79 Z;  2MW2 B;  1BL8 A;  4DR2 O;  2QM8 A;  4I5S A;  3K5N A;  2OTL V;  1H2G A;  2R9A A;  3B09 A;  4PV1 B;  2EIJ B;  5DN6 G;  3ZX6 A;  3HKE B;  4X9Q A;  1M57 B;  4J7Z A;  3H1L H;  2YIB D;  3FAV B;  1W59 A;  1J95 A;  4PI2 A;  2HHH B;  3CP1 A;  1XEQ A;  1IXM A;  1P4R A;  5E1A C;  3UM7 A;  1IBK O;  4PA4 A;  2ZNI A;  4GX2 A;  3FB5 C;  1Q6I A;  3RYI A;  1R1B A;  5BR8 B;  3CSX A;  4Q20 A;  4JI5 O;  1AR4 A;  1QLE B;  2CK3 G;  3X2Q B;  4FLW A;  1N0J A;  4B7E A;  1HDJ A;  1B3Q A;  4MVU A;  4DV4 B;  2UXD B;  3L70 H;  3K0G A;  4X64 B;  3W7U A;  4RWU A;  5IE9 A;  5JQG A;  4NXN B;  1PPJ H;  3E22 B;  1WB8 A;  2XND G;  3HKB A;  2CH7 B;  5EC2 C;  2A0L A;  4HZ3 A;  4UV8 A;  1KMI Z;  1IDS A;  4WFF A;  1TVK A;  2GSM B;  3CEI A;  4BIZ A;  2VQE O;  2FB5 A;  1OCZ C;  2A06 H;  5EK0 A;  2FTK A;  2IH1 C;  3OFN G;  3ASN C;  4B7K A;  4MVM A;  3RN4 A;  3JAR A;  4P30 A;  3KCX A;  2YIB A;  1JCH A;  1KUQ A;  3R65 A;  2HVJ C;  1Y67 A;  1H2N A;  2CAZ C;  3AK3 A;  2ZT9 B;  1HNZ O;  3BPZ A;  3Q4H B;  1I08 A;  1VQ8 V;  4LNU A;  4P9P A;  3CCU V;  5KUM A;  2ZE5 A;  3JD4 A;  4O4H B;  4TV8 A;  2P4V A;  3DXR A;  2HR3 A;  4KL1 A;  1HW7 A;  4R7C A;  3QNE A;  3QG5 A;  2QTS A;  3BA9 A;  1W2B U;  2UXX A;  4FMT A;  2Q5Z A;  4R6Z A;  5B1N A;  2PYL A;  3G4S V;  2UUC O;  1M5I A;  5JJJ B;  2A9H A;  4FLT A;  4ZI7 B;  3H1J H;  3JD0 A;  4AQY O;  4GUN A;  4JI7 O;  3D3Q A;  4UVB A;  2F93 B;  1V54 B;  3CHX A;  3OUS A;  5KHK A;  1Q90 D;  1R3I C;  4DUZ B;  4PEL A;  1AP6 A;  2Q7G A;  5J2T A;  3B8N A;  1O9H A;  5KHH A;  1S5J A;  3L72 H;  4Q6G A;  1DLB A;  2Q9L A;  3CMA V;  1M9N A;  3MDS A;  1W0J G;  4L8J A;  4TQF A;  3VBB A;  3ETG A;  2KG7 B;  4UVA A;  2ZE6 A;  2BE3 A;  3C3T A;  5H6R A;  1SQQ H;  1JPX A;  2BOB C;  3E35 A;  1JOY A;  2QWN B;  4YHH B;  1X59 A;  3FKS G;  4PDL A;  4J7J A;  1SA0 B;  4GT1 A;  1BHB A;  3K04 A;  1XL6 A;  2EIK C;  2AHY A;  2K9P A;  2OTJ V;  2WLI A;  2JS3 A;  3H01 A;  1N32 O;  3ZHS A;  4OPA A;  4X1K A;  5JCO A;  1NH2 D;  1GRJ A;  4LWS B;  3VQW A;  1SZT A;  3RT3 C;  4U7O A;  3G6B A;  5IWA B;  2LFS A;  2F23 A;  4WFE A;  4DR7 O;  1F51 A;  5K1P A;  3SYP A;  2ZQM A;  3GB7 C;  4N21 A;  1SRY A;  2LP7 A;  2WLL A;  4H44 B;  5B1A C;  4KUM A;  1OCZ B;  2GTS A;  4QE9 A;  2IM9 A;  3ABU A;  1BE3 H;  1GN3 A;  1UPG A;  3LSS A;  4WCE V;  3ASN B;  2Y69 C;  1FYJ A;  3E8F A;  4NB5 A;  4JI2 O;  4BW5 A;  1DGS A;  1KEC A;  3WFV A;  5BMV B;  5L3E A;  1H8H G;  5GON A;  1S76 D;  3IFX A;  2AZ0 A;  2E3C A;  3ZS8 C;  1AJP A;  2JGD B;  2F4V O;  3TK1 A;  2XUM A;  1KBH A;  1XDC A;  4D6T H;  5KHI A;  1K4C C;  3HKC A;  1H38 A;  4ABM A;  2Q73 A;  1FXK A;  3SJB C;  1LNQ A;  1DF5 A;  1JR9 A;  1TUB B;  3CJH A;  1KC8 W;  1BGY H;  5IJ0 B;  1Y76 B;  3A8T A;  3F5W C;  2OWO A;  1I5X A;  5IYZ B;  1QU7 A;  4UV9 A;  4MVZ A;  1JJO A;  1VQP V;  1JFF A;  2Y48 A;  4DUY B;  1MAB G;  4DV3 B;  2QKS A;  4RQE A;  1VQ7 V;  3WB0 A;  4IIJ B;  3SDL A;  4LF7 O;  3ZMU A;  2KSD A;  4TUY B;  2H3O A;  1R3K C;  1FXH A;  4B3M O;  3SPH A;  2IJJ A;  3N2K B;  2DWE C;  1HNX O;  5DED A;  3SPI A;  3SYO A;  5KHJ A;  2IBZ H;  3I55 V;  2UXC B;  1J5E O;  1AI7 A;  4PJ0 Z;  3K5L A;  1M4U A;  4Z1M G;  4N23 A;  4O2B A;  4JTD B;  2HHH O;  3FX7 A;  2EZO A;  4TQD A;  5C8Y B;  3E22 A;  2EIK B;  2CH7 A;  5EC1 C;  3RWR D;  4GX0 A;  2Q7H A;  4ZOL B;  3SYA A;  3CC2 V;  1R6K A;  4NTW A;  5KMG A;  3W7T A;  4O2A B;  3MHS C;  1F23 A;  1GKF A;  3ETQ A;  1AP5 A;  1YZB A;  1E79 G;  2UXD O;  3JSL A;  4JI5 B;  3OMN B;  4X64 O;  3ZIA G;  4FM1 A;  5LYJ A;  2K1E A;  3SJA C;  5B1A B;  1NVP B;  1XOU A;  1Q6U A;  3CB2 A;  3OUF A;  5FLX N;  4PD4 F;  4HAM A;  2Y69 B;  1H2S B;  2JJ2 G;  2XAJ A;  4DV2 O;  3RYI B;  3E2E A;  5B5E Z;  3AG1 C;  4OPH A;  1B06 A;  1FJG B;  4W4K A;  2VQE B;  3D36 C;  3T2M A;  4LR3 A;  5D5P A;  2YID A;  4UCS A;  1I7F A;  3SR2 C;  3QVN A;  2VWK A;  3ZHR A;  3ZRW A;  5JCO C;  1ROP A;  2E76 B;  3L71 H;  5JQG B;  3F7Y C;  2DYS C;  4MT8 A;  1PNM A;  3HKB B;  1XI1 A;  4I7Z B;  5IDJ A;  3CRM A;  1K4D C;  2PI4 A;  3JAW A;  2YIA A;  3B4S A;  3ASO C;  1TVK B;  1VQ5 V;  4P9O A;  1Q6H A;  4CS2 A;  3M99 B;  1NS1 A;  5D5Q A;  1AR5 A;  3OAA G;  5LXT B;  4JI3 B;  4X66 B;  3SYQ A;  4LF8 O;  1ENV A;  3C90 A;  4DV1 O;  3JAR B;  3T1H O;  3CCQ V;  3BCC H;  1K9M W;  3RVY A;  2UUC B;  1VF5 B;  2IU3 A;  5L3F A;  4UFZ A;  4IGG A;  3RYF A;  2YXY A;  4AQY B;  4LF9 B;  4X62 B;  4JI7 B;  4LNU B;  4H13 B;  1SA0 A;  4TV8 B;  2JJ1 G;  1FXK C;  4W4L A;  3HKD A;  3ABM C;  4MS2 A;  4LWS A;  2N74 A;  1ORQ C;  1PNK A;  2YXL A;  2N05 A;  3UCS C;  1I5Y A;  4QPK A;  3CS5 A;  3OW2 U;  2Z5U A;  2WWW A;  4FLX A;  2Q6A A;  3HB3 B;  1XNQ B;  1TGO A;  2IU0 A;  4LCU C;  1SES A;  1IX9 A;  2YI9 A;  4MSW C;  2VS0 A;  3APO A;  3AG3 C;  3RW0 A;  4YJ2 A;  2ZNJ A;  4FFB A;  5J2T B;  4DYL A;  5CMU A;  4IL6 Z;  1SER A;  4I0X A;  2B1G A;  1SET A;  3H1H H;  5L3B A;  3E89 A;  2JEX A;  4FZ0 A;  5IWA O;  3ZRS A;  1SZX A;  5LGT A;  2CGN A;  4I50 A;  2JGD A;  4JAV A;  2YS8 A;  3VQV A;  1YI2 V;  4BR6 A;  3P3P A;  1BCC H;  1QR9 A;  3AG1 B;  4DR7 B;  4PDM A;  2RN9 A;  2QWP B;  4WFA V;  4GYC B;  1PV0 A;  2GTA A;  2B5U A;  4GCZ A;  4UUJ C;  5IYC O;  1VIB A;  4DR5 O;  1P84 F;  4X1K B;  4CBC A;  3IC7 A;  1E1R G;  1GMG A;  3VQY A;  5IJ0 A;  1Y76 A;  1M56 C;  2DYS B;  3UT5 A;  1YJ9 V;  2AXT Z;  2Q7E A;  4CS3 A;  3RVZ A;  5CBH A;  1KQS U;  3WB2 A;  4UCT A;  3LDE A;  1NVP D;  3ABL C;  3CRC A;  1BSM A;  3ASO B;  2P06 A;  1Q8I A;  1V9P A;  4JF3 A;  5JJE B;  2WLL B;  1WB7 A;  1SQB H;  1WA8 A;  4GZR B;  2GHY A;  3L75 H;  3L73 H;  1K7D A;  4TUY A;  1BQ0 A;  4JPR A;  1L0N H;  1B04 A;  1X4T A;  4PDV A;  4G27 B;  5FPO A;  3E86 A;  4QE7 A;  1PL0 A;  4RO2 A;  3TXQ A;  1AIL A;  5GON B;  1JVM A;  3E8G A;  3K9S A;  4TWK A;  5LA6 A;  4B3T O;  3EFF K;  2B1I A;  3S3W A;  1IBM O;  4X65 B;  4DV3 O;  2H8P C;  4Z1V A;  1NTZ H;  1MOF A;  2Y4T A;  2YXH A;  4I9Q A;  1KYO F;  3HKC B;  1K97 A;  1RM1 C;  1FXK B;  2BSK B;  1JQ0 A;  3K79 A;  1VMG A;  2BCC H;  1MMM A;  2Y4U A;  3ABM B;  1K73 W;  2V1D A;  2YIC A;  2YSU B;  4K8Z A;  4DXW A;  4XDK A;  1HR0 B;  4JI8 B;  4LF7 B;  4TT3 G;  4GLX A;  4QPJ A;  3U0Z A;  3CJH B;  2UXC O;  2PF4 E;  4B3M B;  2ZD9 A;  1MSD A;  4R8C A;  2DWD C;  3SPG A;  1HNX B;  2YI8 A;  2AW9 A;  1GM8 A;  1J5E B;  1JFF B;  2QM4 A;  3AG3 B;  2ITC C;  1YSC A;  2DN9 A;  1ZL8 B;  2DW4 A;  2FKX A;  3CX5 F;  2FML A;  3D8C A;  2PI5 A;  4GKK O;  3M7M X;  1K33 A;  4DR4 B;  1F4M A;  1GM9 A;  3FB7 C;  4FLV A;  1K34 A;  1QQC A;  3RYC A;  1YJN V;  3OTO O;  4LBE C;  2JDI G;  2W6I G;  4G28 B;  3MHH C;  3BFR A;  4J9Y B;  4WFG A;  4O2B B;  3S3X A;  4Z2W A;  4WBN A;  2ADP A;  3BHP A;  2XAS A;  1Q81 W;  4ZKI A;  3SPC A;  1NZ6 A;  4LF6 O;  1PP9 H;  5KMG B;  1COW G;  1QVF U;  1GK9 A;  1FJG O;  4DV2 B;  1M56 B;  1GAX A;  5JJN B;  4X1Y A;  1VQK V;  2BTQ A;  5LXT A;  1E1Q G;  1QCE A;  4J41 A;  4MW8 A;  3ABL B;  5LYJ B;  1A32 A;  2QA4 V;  3MAQ A;  2WA3 A;  3CWB H;  5BZB A;  1K3E A;  1P7G A;  3N2G B;  1GN6 A;  2FL4 A;  1XBL A;  1S77 D;  1BHA A;  2DYR C;  2QWR B;  4PA7 A;  2IJH A;  1F4N A;  3KZI Z;  1XL4 A;  2Y0I A;  3P32 A;  5EZY A;  3MD0 A;  5J9P C;  1SQX H;  4JI3 O;  3L9D A;  4X66 O;  2CE4 A;  3KCY A;  1JA8 A;  5JH7 A;  2X7R B;  2Y0P A;  4JGS A;  3ZRW B;  1CXZ B;  1RM1 B;  4LF8 B;  4DV1 B;  3T1H B;  4YY3 O;  1DF4 A;  3FYI B;  4LF9 O;  4X62 O;  2R70 A;  2HVK C;  4EB6 A;  4ZHQ A;  1WN7 A;  1LR1 A;  3JAW B;  4E2L A;  5A9G A;  1AI5 A;  4JAA A;  3K5M A;  4I4T A;  2H94 A;  1OCC C;  1PL4 A;  4KXR A;  1DK1 A;  4UCV A;  2YDE A;  1SQF A;  3I5D A;  1HNW B;  3J80 N;  3BAB A;  1Q86 W;  1MZF A;  2ETN A;  1XNQ O;  3B2E E;  2VRZ A;  4H0L B;  3CRR A;  3ETD A;  4J9Z B;  3ZHQ A;  4X88 A;  3RYF B;  3CE2 A;  4P2Z A;  1FAF A;  3ZJZ A;  4D7T A;  2E5L O;  3D36 A;  5KUK A;  2LGW A;  1WNS A;  2UU9 B;  4JI1 B;  2QKC A;  2QWQ B;  1KKC A;  2OIG A;  3HKD B;  3RGB A;  2QM7 A;  4PA9 A;  1YHQ V;  2W0X A;  3QO7 A;  3ZN0 A;  2XAF A;  1Q82 W;  1CP9 A;  4CH6 A;  3ZBH A;  4MVS A;  2GUZ A;  4J7K A;  3JAM N;  3UKM A;  4MTX A;  4MW3 A;  1Z5V A;  2ODM A;  3I56 V;  3HPL C;  1RSO A;  2V4D A;  3BEH A;  4YJ2 B;  2XAG A;  4JYY A;  4X8A A;  1WPX A;  2CUG A;  4FFB B;  4IYI A;  1WPB A;  3K08 A;  2L6L A;  4YJ3 A;  4DR5 B;  4I0X B;  5CA1 A;  1FXV A;  1H2L A;  5KA6 A;  3G67 A;  4QNH B;  4I50 B;  1M93 A;  4MTF A;  2A7W A;  3UO2 A;  2DYR B;  2OIE A;  1Z5W A;  4JYC A;  3CME V;  2ATK C;  5H2F Z;  4J11 A;  1EN5 A;  3AG4 C;  1YDX A;  5IY5 C;  3JAS A;  1WP7 A;  1F7Y A;  2BSK A;  4KFM A; 
#chains in the Genus database with same CATH homology
 3H1I H;  1SQV H;  3BCC H;  1PPJ H;  1SQX H;  2FYU H;  3CX5 F;  1SQQ H;  1NU1 H;  3H1H H;  1SQP H;  1PP9 H;  1EZV H;  3CWB H;  1P84 F;  1SQB H;  1BGY H;  1NTZ H;  1KB9 F;  1NTM H;  3L74 H;  3L72 H;  1KYO F;  3TGU H;  3L75 H;  3L73 H;  3H1L H;  4D6T H;  1NTK H;  1L0L H;  3H1J H;  3H1K H;  1BE3 H;  1L0N H;  3CXH F;  2A06 H;  3L71 H;  4PD4 F;  2BCC H;  5KLV H;  3L70 H;  1BCC H;  4U3F H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...