1JVMA

Kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
publication title Energetic optimization of ion conduction rate by the K+ selectivity filter.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 34
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jvmA00
4GX2A 4MTOA 2R9RB 4PDMA 3SPHA 4RUFA 4JTAB 3UKMA 3PJSK 4H33A 5J9PC 4HYOA 3SYCA 4GX1A 3LDCA 4XDJA 4P9OA 2HVJC 5B1BC 2EIKC 2ITCC 4MVRA 2Q69A 4MW8A 3WG7C 3E86A 3F7VC 3FB8C 4R7CA 1V54C 4P2ZA 4MVMA 5CBGA 1R3LC 1M56C 3E8FA 4J9YB 2AHYA 4PA7A 2P7TC 4QE9A 2WLLA 4QNHB 1QLEC 3K0GA 2X6AA 5EBMC 2HFEC 1OCRC 2WLMA 3E89A 4H37A 4HZ3A 2A79B 4PDRA 2OCCC 2Q67A 2QTOA 3IGAC 4DXWA 2EILC 2A9HA 5B1AC 1OCOC 5E1AC 4MSWC 3K03A 3OUSA 4KFMA 4R50A 3RBZA 3STZC 5B3SC 3RVZA 3BEHA 4MVQA 2EIJC 3LDEA 5KUKA 1R3KC 3JYCA 4ZBMA 3GB7C 1ORQC 3OGCC 1V55C 2KB1A 3FB7C 4I9WA 1XL4A 2WLHA 3KG2A 1LNQA 2DWDC 4X89A 3SJQC 4R6ZA 2HJFC 3K08A 4G27B 4EKWA 2DWEC 3LUTB 3T4ZA 5EBLC 3FB6C 3K0DA 5EBWC 2ITDC 3ASOC 4XDKA 3F5WC 3T1CA 2K1EA 1G4YB 1J95A 3RVYA 1XL6A 3AG4C 3ASNC 2BOBC 3T2MA 4MVSA 3IFXA 4RAIA 2JK5C 3AG3C 2HG5C 3K06A 2EIMC 2WLIB 3ZJZA 2X6BA 4MVZA 2QKSA 2WLIA 3LDDA 4MW3A 4PDLA 5KUMA 4CBCA 3LNMB 3SYQA 4PA3A 2WLJA 2Q6AA 5CBFA 4G28B 4LCUC 1R3JC 4MVOA 2DYSC 3SPGA 4WFFA 3ABMC 3R65A 5IY5C 2W0FC 3AG1C 4WFGA 3ZRSA 4RUEA 3HPLC 4P9PA 2NLJC 4TWKA 3ABKC 5BZBA 4PA4A 1P7BA 2Q68A 2H8PC 4MS2A 3ABLC 4MTFA 3SYOA 2BOCC 1JVMA 3OR6C 2DYRC 3SPCA 2ZD9A 3E8BA 3UM7A 1OCZC 3K04A 4OXSA 4PDVA 4R8CA 1S5HC 4LP8A 2A0LA 3STLC 4X8AA 4LBEC 2EINC 4JTDB 4J9ZB 2Y69C 3F7YC 3E83A 2WLNA 3AG2C 4UUJC 3TETA 3TCUA 3OR7C 5CBHA 2WLKA 4WFEA 3X2QC 3FB5C 4GX5A 3SPJA 2HVKC 3E8GA 1K4DC 1ZWIC 4RO2A 1KKDA 3RW0A 1K4CC 4GX0A 4WFHA 4PA6A 1OCCC 2X6CA 4F4LA 3EFFK 2IH1C 4XDLA 4QE7A 5EK0A 2WLLB 4P30A 2AHZA 1BL8A 5EC1C 3OUFA 4PA9A 3T4DA 4MVUA 3SYAA 3SYPA 4BW5A 1M57C 4JTCB 4X88A 2ATKC 4MTGA 2IH3C 2YEVA 5EC2C 3E8HA 3VOUA 3SPIA 1R3IC 2ZXWC
chains in the Genus database with same CATH superfamily
4DV3O 3ZN1A 3BAAA 4H33A 2ZE5A 3E22B 5D5PA 2Y48A 3CCUV 4B3MO 2PUSA 1JX9A 2EX3A 3HKDB 5IYBO 4B3SB 4MW8A 4ASUG 4R7CA 4P2ZA 2X7RB 4KP4A 3E8FA 4PA7A 3OTOO 2QKCA 1G1XB 3IGAC 4U7OA 5B1AC 4PV1B 4IYHA 2YIDA 1VQ9V 1Z2GA 4ZI7B 2ZIMA 4ZBMA 4WFBV 1VEWA 5IYZB 4FIPC 3VBBA 3H1JH 2RCVA 5KHJA 2DWDC 4JYAO 1DGSA 3CE2A 5E79Z 3JD3A 5KHIA 3OE7G 5L3CA 3CXCU 1HNXO 1ZL8B 5JH7A 4PELA 1JQ0A 1JCHA 2QKSA 5LP6A 1TUBA 3TK1A 2Q6AA 1Q81W 2P4VA 4YHHB 3R65A 3E2EA 2NLJC 1PNMA 1IBMO 4X65O 1VARA 2P06A 5A2QN 2OCCB 1JVMA 3L74H 4FLWA 3NR7A 1K73W 3HKCA 3JD4A 4LP8A 2A0LA 1GM9A 1ROPA 1I5YA 3CCEV 1BS3A 4I4TA 1DTOA 1B3QA 2QWRB 2YS8A 4TV9B 4YIPA 1K5SA 3F5TA 3LSSA 1KKDA 3ZRWB 1AI6A 3HKEA 1HNZB 1QVGU 5L3EA 3RGBA 3P3NA 1L8DA 3M99B 2IH1C 1NTZH 2WLLB 2M6YA 5ITZA 4WFAV 1AI4A 3JATA 4DUZB 4CH3A 2UUAB 2UUAO 4MTOA 5KHKA 3ABUA 1NBMG 3LDCA 2OYQA 5H6RA 3MHHC 4IGGA 1BE3H 4JI4B 4LF6B 1IDSA 4LF6O 1M56C 2RNBA 3TXQA 2XUMA 4QE9A 5LXTB 1QR9A 2GHYA 1N0JA 2HFEC 4B3TB 1VQNV 4LNUB 4O4IA 3OAAG 3ETEA 1VQ8V 5LHIA 1Y74A 1CEZA 4C7UA 4OX9O 2YIBD 3ETQA 4LF4B 2DWEC 1W59A 2QWPB 5GTHZ 4JI2O 4WF9V 3Q4HA 2Z0AA 3BCCH 2UU9O 1XI1A 3OD4A 1N33B 3LDDA 3U11A 3I56V 3CS5A 1M90W 4P9PA 2PGGA 4GKKB 1LUVA 4GKKO 3RT3C 4J7JA 5KAFZ 2DYRC 2VQEB 2VQEO 1VQKV 4DV2B 4DV2O 4UCSA 2EIJB 1K33A 4AI8A 2ZE8A 2ZT9B 1Q90D 4BIOA 2QKAA 4I50A 3AG4B 5KMGB 1NZ6A 1OCCC 4TV8A 3FYIB 1EZVH 1FXHA 4UCVA 3K5NA 3ZRXA 4ZIBA 3OUFA 4JV5O 4X88A 4FPPA 1RPRA 2YI8A 4HBNA 3T1YB 1KBHA 3T1YO 3RYHB 2GUZA 1AI5A 1Z5VA 3D8CA 1TGOA 3QVNA 1NKDA 5J9PC 1WPXA 4GX1A 5LYJA 2AW9A 1QNMA 1YDXA 4W4KA 2PF4E 2Q9LA 1V9PA 5EZYA 2EINB 4QNHB 2X6AA 3JSLA 4I5SA 3N2GB 3OMAB 1GN6A 3DXRB 2PI4A 2VRZA 1RSOA 2V4DA 4I0XA 1YTFB 2WLHA 1NR1A 1N8RW 1KYOF 1XDCA 2E74B 3GVMA 3F5WC 1IBLO 1XMQO 4DV1O 3K06A 1PP9H 3BRCA 3G71V 4ZHQA 4LCUC 2IJIA 1FXKB 3CWBH 4JYYA 2A7WA 4PA4A 1XNQO 1PD3A 2P5OA 5IJ9B 3B09A 2F66C 4X20B 1AROP 4PI0A 5EYPB 3SPCA 2H3OA 4IHJA 4CS3A 1EN5A 5K1XA 2JEXA 1BZKA 5KX5B 2L35A 4WFEA 2EZPA 2ILMA 3CJHA 3OTFA 2XHBA 3BY6A 1MSWD 1URFA 1WP7A 1WPBA 2AZ2A 4U3JA 2V7QG 4X1KB 5LGUA 1H2LA 3SYPA 3CP1A 1KKCA 1JPXA 1IX9A 2DYSB 1FS0G 1DK1A 3NXSA 1X59A 3SPIA 4WBNA 1E1QG 1L1FA 2GSMB 3PJSK 4DR6O 2W0XA 1XUQA 1GN2A 5GONA 3F7VC 4DR3B 1F23A 5KHGA 3K57A 1YEWA 4FM0A 2MK3A 1AJPA 3RYFB 4EEQA 2JRIA 2HJDA 1WP8A 3JARA 5JJNB 2UXDB 1OCOC 5E1AC 4MSWC 4PJ0Z 4X1IB 2RJZA 4LF7O 4DK0A 2ZQMA 1ORQC 2YUAA 3GB7C 1RFYA 5FLXN 3AG7A 4E4EA 1VP7A 2XOKG 1M93A 1QLEB 3E35A 1ENVA 2P4KA 3B40A 2KG7A 1YSCA 1RP3B 3SJQC 5KA5A 3H01A 2IJKA 5BXZA 3T1CA 4DV4O 4RAIA 3J80N 3JAKA 2EIMC 1ZX3A 2YSUB 3WG7B 1KECA 4NTYA 1R3JC 3ZHSA 2QSAA 2VS0A 3B8MA 1I7FA 1AR5A 3MHSC 5JJEB 1HNWB 4FFBA 4MS2A 3SYOA 4FM2A 1HR0B 4JI8B 5LOVB 1XNRO 3JD0A 3SJCC 1ZAUA 5JWPA 1BMFG 5FNVA 2PYLA 3ZCCA 2QDOA 3JD1A 3JSNA 1MNGA 4LF8O 3ASOB 1K4CC 3ASNB 4X66O 2X6CA 3CRQA 4Z1MG 1FYJA 1WA8A 1PL0A 4JYCA 4DW0A 4O2AA 4MT8A 3ZHTA 1H2SB 3TGUH 4IL6Z 4EFEA 4LH6A 1BGYH 2ETNA 3CCQV 5DM6V 4FLUA 3I55V 4CH4A 2ITCC 2ADQB 4QPJA 2LW7A 5LMUO 1GAXA 1JA8A 4J9YB 1NS1A 1AP5A 5DEDA 1QLEC 3ZBHA 1SESA 1SQVH 1YTFD 1ZTEA 2F43G 2A79B 1DLBA 4OPAA 1J5EO 2EILC 2Q0OC 4YJ3B 5JVDB 2QJ1A 4O2BA 1V55C 5JQGB 1S76D 3CCJV 3FKSG 4K0KB 4NB5A 5EBWC 1QU7A 1WAZA 1A32A 3SDLA 1TA8A 3ETGA 2QTSA 3IFXA 2JK5C 2YIBA 3AG3C 4ZKIA 3OGIB 3ML0A 4TUYB 4MVZA 2YXHA 3G80A 2WLJA 3UO3A 4BWAA 4MVOA 3SPGA 3ABMC 2A06H 2CTQA 4L87A 3RYCA 1SQGA 2QEXV 1IXBA 5LHGA 2UXCB 2UXCO 3RYIA 3CPWU 5B1AB 3CCRV 2ZD9A 1S0VA 4LH7A 3LSUA 5KAIZ 1HW7A 3K04A 4OXSA 4PDVA 4O4LA 4ZOLA 2OIGA 3B4SA 1P4RA 2JGDB 2JIZG 2WLNA 2IW5A 3HKBA 3TCUA 2BE3A 2A3QA 2WA3A 2Q7HA 1XMOB 4RO2A 3RW0A 2W6IG 3HR0A 4B7EA 2Y0PA 1RM1C 2IJHA 1Q6IA 3QNEA 1OZ0A 1NT2B 3THOA 3ZEDA 3SYAA 3AEIA 1JR9A 1D5AA 1SQFA 2F1MA 1SRYA 1Q3EA 2NR5A 2IBZH 2Z5UA 4IIJB 5GTIZ 3ABTA 4O4HB 4HYOA 2H94A 3E22A 4I55A 3HKDA 3CCVV 3CCMV 1V54C 2GBOA 2P6JA 2UXXA 4NXMO 4NXMB 2P7TC 4A5UB 2Q5ZA 1Q86W 4KHPO 4UVAA 1K34A 2F4VB 2F4VO 1SKVA 4R50A 4NXNO 4DV3B 4UVCA 3ZMZA 4ZI7A 1PKXA 3OGCC 2RDCA 5IYZA 4B3MB 2CH7B 1FFTB 4JGSA 1SA0B 1J95A 4FJCC 1XL6A 4W4LA 1DF5A 1XEQA 3OTOB 5EIBC 3S3XA 1EN6A 4DRXA 4UB6Z 1NQTA 2X6BA 3L73H 4CBCA 5KUMA 3ZHQA 3C90A 4G28B 2FTKA 2DW4A 1QBZA 1M56B 3AG1C 2JGUA 4WFGA 1SQPH 1JJOA 2ZIOA 1VF6A 4BIUA 5LGNA 3CC4V 4X1YA 5DECA 4PI2A 4UCUA 3OR6C 4JYAB 3IC9A 3E8BA 1JFFB 1S5HC 2M7WA 1HNXB 2ADPA 2Y69C 4UV9A 3ABLB 4GX5A 5IWAO 2PYJA 4DV5O 4JI6O 4TV9A 5IYCO 3OEEG 2K9PA 4DV6B 4DV6O 3ZRWA 3BPZA 1IBMB 4X65B 4XDLA 4FLVA 2GTAA 3KZIZ 5EC1C 3DGEA 3T4DA 4FZ1A 4E2LA 2R9AA 5EC2C 1D5NA 1WJZA 4NKGB 4GX2A 3SPHA 1WB8A 5LA6A 2DYRB 3L72H 5B66Z 4MVRA 4RQEA 4H44B 3VQWA 1VQLV 3ETDA 2CGOA 5LXTA 1TVKB 5L3DA 1H8EG 3CC2V 4LNUA 1S5LZ 1OCCB 1HP8A 3BVOA 3JYCA 1AI7A 3KG2A 3CMEV 2HJFC 4QPKA 4UFZA 4CZZA 3CX5F 4XDKA 4YY3O 1CP9A 3MAQA 3CYOA 1E79G 1PM9A 5B1NA 2OTLV 2QR4A 3LNMB 4QJFB 5IJ0B 1FKAO 2LGQA 1FPOA 4OX9B 1L0NH 1B04A 1YITV 3QO7A 2ZR3A 3ABLC 5ITZB 4JI2B 2FL4A 1WLEA 1SERA 4LWSB 5LHHA 2UU9B 3VQYA 1W2BU 3X2QC 2HVKC 1ZWIC 1Y67A 4GX0A 4PA6A 5KMGA 1XHZA 3W7TA 2QM8A 3EFFK 1N36B 1N36O 3AK3A 4G2KA 4PA9A 4DR7O 3ZHUA 4BW5A 2ATKC 2IH3C 1Z5WA 2JDIG 3VQXA 5CB4A 3OEHG 3FYEB 3J7AU 2ZDIA 3CRRA 5LP6C 1K9MW 2HLDG 4MVMA 5CBGA 1GTOA 4LF9O 4JV5B 2EIKB 3N2GA 2ZE6A 3K03A 1FFXB 1KP3A 1BHAA 3RVZA 1MA1A 3N2KA 5KLVH 1LNQA 4X89A 1KMIZ 3J81N 2QA4V 4GT1A 1QQCA 5EBLC 2CGNA 1XHXA 5L3FA 1NTMH 2K1EA 1G4YB 3RVYA 1XOUA 5H5NA 3CCLV 2UUBO 3B77A 2HHHB 2HHHO 3L75H 3CEIA 4MW3A 4PDLA 1F7YA 3DC5A 3K58A 4I50B 1FXKA 2W0FC 1MZFA 3ABKC 3A0RA 4JAAA 5KHHA 3GWKC 4JZGA 1YJWV 3B2EE 3BA9A 4JF3A 5IJ9A 5H2FZ 1OCOB 4X20A 3M8AA 5EYPA 1IBLB 4GYCB 4WCEV 4JI5O 1XMQB 4DV1B 4X8AA 4JI1B 4JI1O 4UV8A 1LR1A 3T1HO 4DR5O 3E83A 5KX5A 3BABA 1VQ5V 2WLKA 3I5DA 2X0LA 2LW1A 4WFHA 5J2TA 3ZN0A 1YJNV 1XNQB 1K5QA 2EIMB 3H1KH 4Q6GA 1I08A 4X1KA 4MVUA 1G6UA 4J7ZA 4GZRB 3C3SA 1NR7A 1P49A 1VF7A 2CTWA 1RSOB 1GN3A 3CB2A 5B1BC 2EIKC 2CTRA 1YIJV 1BHBA 1E1RG 3WB2A 3K59A 3QO5A 4HNAA 4LC1A 1S72V 3L70H 1GM8A 3RYFA 3JALA 2XAHA 2ZKOA 1Y76B 2PY5A 3O9OA 2LO1A 3FAVA 1MABG 3STZC 3OUSA 4LF5O 5IT9N 1R3KC 4DR6B 4UCRA 2ZR2A 2LGWA 3APQA 4DR2O 2UXNA 4H13B 4R6ZA 1UPGA 1VQMV 2DJVA 5JCOA 3APOA 4D6TH 2NN4A 2YI9A 4J7KA 1Q6UA 2JEUA 1MSDA 2DE0X 2WLIB 4JI3O 5HFMA 4LF7B 5CA0B 3CJHB 3C3TA 4YJ2B 3W7XA 4NTXA 3BHPA 2UUCB 2UUCO 2DN9A 2EILB 5AG2A 2ZM6B 4IT5A 2ZM6O 4DV4B 3ZHVA 1F4MA 5DN6G 2FYUH 1V55B 3G4SV 2XTAA 4UUJC 5TISZ 1F51A 1EM1A 2LJ2A 3SPJA 4UCOA 5H9CA 1OCZB 1YJ9V 4J10A 1FJGO 2OT5A 4F4LA 3AG3B 5EK0A 4QE7A 2YXLA 4KUMA 4RQFA 3D3QA 1XNRB 1BT8A 1M57C 4JI0O 3JARB 4MTGA 3U0ZA 1H2MA 3ABMB 1IXMA 1R3IC 4LFAO 4PDMA 2YIAA 4JPRA 4PHZA 3KKYA 4DR1O 2AXTZ 4XDJA 4PD4F 4LF8B 2KG7B 4O4JB 2D2CB 2Q69A 1VF5B 2BTQB 3E86A 4EB6B 2BSKB 4X66B 1R3LC 5IDJA 4JI7B 4JI7O 2AHYA 2WPDG 5BY1A 1OV9A 1IBKO 4H37A 2WLMA 3E89A 1LUWA 2DQ3A 2QTOA 4FZ0A 1RM1B 3HB3B 1EZJA 2P22C 5L3GA 5JVDA 1ZSPA 5L3BA 1TUEB 1IURA 1GK9A 5JQGA 1GN4A 3H1LH 1H8HG 1D2DA 4FFBB 1Q5OA 3BA8A 5LMUB 3T4ZA 1AVMA 1R1BA 2R70A 1HWYA 5BMVA 1W0JG 3EVKA 3JAWB 1K8AW 1P84F 3B8NA 2AZ0A 2F93B 1THZA 1J5EB 4CH6A 4L8JA 4TUYA 2IU0A 3SYQA 3ICXA 4PA3A 1V54B 3CHXA 1YF2A 3KCXA 4FMTA 3UT5B 2YDEA 5IY5C 1NH2B 2WAMA 1AJNA 4K3AA 5BZBA 4J11A 1F4NA 2WSSG 4GKJO 2XAQA 5CA1B 1OHHG 2RMKB 4O2AB 1OCZC 2B1GA 1S5JA 1O9HA 3JD2A 4TOIA 3AG2C 3G6BA 5CBHA 1EBOA 2IM9A 4I7ZB 1M4UA 3A0HZ 3ZIAG 2EULA 4UXNA 4DV7O 4K8ZA 5LMNO 1YCIA 2MW2B 2CUGA 5CMUA 4P30A 1N0NA 3VQVA 4F6RB 4DR4O 1VQ6V 4D7SA 3E8HA 2DOSA 2QE7G 3AG1B 5J2UB 1IVSA 4JTAB 4MTXA 4O4HA 4NR1A 3EHBB 1FD9A 3FB8C 1EN4A 1QVFU 2Y69B 2YXYA 1AJQA 1VQ4V 1SS3A 2Q67A 1XREA 1VQ7V 5IE9A 1R73A 3BEHA 4U3FH 3LDEA 1KB9F 2JS3A 3P3PA 2KB1A 3UQ8A 1PL4A 2Y4TA 3RYCB 2CH7A 1N34O 1M9NA 1SA0A 3S3WA 2LQTA 2Q7EA 2FKXA 2BOBC 4EFBA 2EJ7A 3T2MA 2JJ2G 4O4LB 4KHPB 3GWOA 4OPHA 1R6TA 3ZJZA 4CS4A 2KKWA 3L9DA 3AK1A 4NXNB 5C93A 3JASB 4X62O 2Z3YA 4GLXA 1R6KA 2QWQB 2YICA 1N32O 3DTUB 5LGTA 1PNLA 2N74A 4N23A 1FXVA 1KP2A 1JFFA 3K9AA 2RQ6A 2PTMA 1TAEA 1XILA 1ZL8A 3CXHF 2JVDA 4NVPA 4BR6A 2DMXA 1QR8A 1SF9A 1SZTA 3FB5C 2WWWA 1NI8A 4N21A 4I55B 2UXBB 2B1IA 2UXBO 4B3SO 1Q82W 2HEPA 2L6LA 2YC0A 1K97A 1VIBA 4JASA 1WN7A 4HAMA 2VWJA 4GUNA 4X9QA 4LFBB 4LFBO 2AHZA 3L71H 1NJIW 1HDJA 3A2FA 3W7UA 3QG5A 5C8YB 4DUYB 4DUYO 2YEVB 2GV9A 4JAVA 4OGQB 5K1PA 4TQFA 4NYKA 2AGAA 5IWAB 2B5UA 4P9OA 4DV5B 2HVJC 4JI6B 1NVPB 4RWUA 2Q4PA 1YHQV 1VQOV 2ARHA 2WLLA 3K0GA 4DRXB 1OCRC 1TVKA 3X2QB 2EBOA 4JZ2A 3CRCA 1SQXH 4K35A 3K5LA 5BR8B 5BR8O 5B3SC 3LSQA 4DV0B 4DV0O 4YHHO 3IAYA 1YI2V 4IYIA 4BW9A 1COWG 4BIZA 3D3IA 4X1YB 4G27B 3ZMUA 1U96A 2Q8VA 1X4TA 3CMAV 1OJHA 1MMMA 2QWNB 1KQSU 4MVSA 3OM3B 1NH2D 5JH7B 5LP6B 4AILC 3RN4A 1TUBB 5IJ0A 4WFFA 1KUQA 1HNZO 2Q7GA 1MG1A 1U97A 2ODMA 1P7BA 3P30A 4QIWF 1SQBH 2OWOA 4GCZA 1GH6A 4YY3B 3HKCB 4DUZO 4FM1A 4R8CA 4LWSA 3MDSA 1W0KG 1YZBA 5EIBD 4H0LB 4I4TB 5LA6B 1Q6HA 3E8GA 3N27A 1H38A 3HKEB 2XAFA 1PNKA 1Q8IA 4JI4O 3OFNG 2HP8A 4FFKA 1BSMA 1BL8A 2XT9A 3JATB 4XBFA 4B3TO 1B6QA 1JOYA 1T5EA 4D7TA 1BQ0A 3D36A 3VOUA 1SC5B 1FAFA 4UB8Z 1I5XA 4I9QA 3ABKB 4DW1A 1MZEA 2QGNA 1AR4A 1BQZA 1QCEA 1US6A 1I0HA 3JCUZ 4LF4O 3O65A 3MD0A 2ZXWB 1VF6C 4DR7B 4J41A 2N05A 4J42A 2OCCC 4O4IB 3U10A 1N33O 1FFXA 4MVQA 3RYHA 1Y74B 4B08A 1YVWA 4CC5A 3K08A 4UCTA 3SR2C 3K0DA 1JJ2U 1SQQH 2ITDC 1M1KW 1Y66A 4FLXA 3Q4HB 4QGPA 3W7SA 2Y4UA 4FLYA 4LF9B 2C2AA 2N04A 1WB7A 1Q43A 3WB0A 5B1BB 1N4CA 4FLZA 3FFQA 2HR3A 5IYDO 1EFRG 3DXRA 3EXAA 2G38A 2LFRA 5CBFA 3A0BZ 3QTCA 2B9ZA 1K3EA 2Q73A 3UCSC 3ZRVA 5H6QA 4LFCB 4LFCO 3IJ4A 4U7NA 2UUBB 3STLC 5CB4B 3BFRA 1WNSA 4JTDB 2PI5A 4DK1A 3ZMVA 4UVBA 4FK5C 3G67A 1Y6XA 5LBQA 1Q7YW 3ZMSA 3CC7V 2BTOA 4TV8B 3ZX6A 5B1OA 1AR1B 3ZHRA 1KD1W 4JI5B 1NVPD 4TSFG 2ZXWC 5GW7A 3K3WA 2GUZB 2LP7A 3T1HB 4DR5B 3FD9A 4RUFA 3UKMA 1RPOA 3SYCA 5LYJB 1R6NA 3N2KB 3ZS8C 5EZYB 5D5QA 3R66A 1GRJA 5EBMC 1Y76A 4KXRA 4HZ3A 4CC6A 5JJJB 2D3OW 4Z1VA 5FPOA 3D36C 2EIJC 3CRAA 4I0XB 2Q0AA 3FB7C 1P7GA 4TT3G 3QF7A 5CN0A 2ZCEA 1M57B 2FMLA 3LUTB 2ZE7A 2E75B 4ABMA 2RN9A 1VQPV 3AG4C 1S3JA 3M7MX 2JS5A 4KL1A 4Z2WA 1PV0A 5FL7G 2CAZC 2WLIA 3K5OA 4LF5B 1H2KA 4ZHQB 4X1IA 5CA0A 4CS2A 3OT7A 1CPYA 4YJ2A 5J2TB 1SZXA 4DR2B 2Q68A 2H8PC 1O9GA 2ZDIC 2CTPA 2QM4A 1QLNA 2DQ0A 3SJBC 1B06A 2R9IA 4IHJB 1AP6A 2KQXA 2ZNIA 4LBEC 2EINC 4J9ZB 2IJJA 4JI3B 2QWOB 4X64B 4X64O 5HFLA 1K4DC 2IU3A 4DR3O 4Q20A 3H1HH 4HNAB 3TXSA 3KCYA 1G8MA 2E5LB 2E5LO 4U3JB 3JALB 2VQFB 2VQFO 2F23A 1DF4A 4NTWA 5LOVA 3OW2U 1H2GA 2BCCH 3FAVB 2UXDO 5IY5B 4WBNB 5B5EZ 1SETA 1AILA 4O4JA 2EZOA 5GONB 2BTQA 1FJGB 4EB6A 2BSKA 1GKFA 2NNUA 2KSDA 1FXKC 1VMGA 2ZINA 1L0LH 2XAGA 1JMKC 3QO8A 3AG2B 3A8TA 4JI0B 4PDRA 2A9HA 1KU9A 1UJWB 4LFAB 4TQDA 4DR1B 1XL4A 1M5IA 1HNWO 2F95B 2VWKA 4EKWA 3FB6C 1HR0O 4JI8O 1YXBA 1CXZB 3JAWA 3JAMN 3JAKB 1IBKB 3H1IH 1ZUQA 2WA4A 3RWRD 4J80A 3P32A 4YJ3A 1IZ3A 2DYSC 1XQ8A 2FB5A 3UT5A 3ZRSA 4RUEA 3HPLC 4TWKA 2EJRA 4BAYA 1I94B 1I94O 4MTFA 1KC8W 2CE4A 3AK2A 1NTKH 5CA1A 3UM7A 1Y4MA 5FNVB 3CCSV 1XBLA 5CA3A 5FPRA 3TETA 3W7WA 2OCHA 2CK3G 3WB1A 4LR3A 3ZMTA 1S77D 3OMIB 2E3CA 4B7KA 4GKJB 1WA8B 2XNDG 3CD6V 4FVMA 4CH5A 4AQYB 4AQYO 2W6JG 3WU2Z 4F6RA 5JCOC 5J2UA 2R9RB 3LNNA 2JGDA 3SGIA 2E76B 3DC6A 4K0KO 3WG7C 1MOFA 1BCCH 1AB3A 4DV7B 5LMNB 5BMVB 2CDYA 3WFVA 4DR4B 2Y0IA 4DXWA 5KA6A 3RBZA 4KFMA 4O2BB 4IIJA 3DSQA 2P90A 5KUKA 2OTJV 2XASA 2PZSA 2LFSA 4I9WA 3SJAC 1UFIA 3OMNB 3ASOC 1K92A 2O57A 3ASNC 3FX7A 4FLTA 2JJ1G 2R72A 5F2VO 2HG5C 5LL6Y 3TJTA 3JASA 4B3RB 4B3RO 1XMOO 2V1DA 4ICGA 4F6EA 2ZNJA 4YIOA 3K79A 1OCRB 1N34B 1PPJH 1K7DA 3RYIB 2BOCC 3PN1A 4JYBA 1GM7A 3H9VA 5B3SB 4DO2A 3IC7A 2GTSA 2XAJA 3UO2A 4ZOLB 3CRMA 3K9SA 3K5MA 5A9GA 2GDSA 3F7YC 3HKBB 3G6EV 4DYLA 3OR7C 2QM7A 3CSXA 2HKOA 4X62B 4AHCA 4JAUA 1N32B 1GMGA 1GO3F 4YXWG 1ZLZA 2OIEA 1NU1H 2P67A 4JTCB 5C8YA 3RFRA 4K8XA 3JCZA 2YEVA 1H2NA 1QHTA
chains in the Genus database with same CATH topology
3ABKB 3ZN1A 4H33A 3CCQV 1QCEA 5DM6V 2Y48A 5B1BC 3I55V 2EIKC 3CCUV 2ITCC 1JX9A 5IYBO 4QPJA 4MW8A 4ASUG 1YIJV 1BHBA 1E1RG 4R7CA 4P2ZA 2X7RB 4KP4A 3MD0A 3QO5A 3E8FA 2ZXWB 4J9YB 4LC1A 1S72V 4PA7A 1GM8A 1QLEC 2XAHA 1SESA 1YTFD 2F43G 2A79B 1DLBA 2OCCC 3IGAC 4U7OA 2EILC 5B1AC 1MABG 3STZC 3OUSA 1VQ9V 4MVQA 1R3KC 4ZBMA 4WFBV 1V55C 1S76D 2ZR2A 3CCJV 3FKSG 4FIPC 3VBBA 2UXNA 2DWDC 4R6ZA 3K08A 3K0DA 5EBWC 1VQMV 1JJ2U 2ITDC 1M1KW 1Y66A 3W7SA 3JD3A 3ETGA 2C2AA 3OE7G 3IFXA 5L3CA 3CXCU 2JK5C 3AG3C 4ZKIA 5B1BB 4PELA 2JEUA 1JQ0A 1JCHA 2WLIB 3ML0A 4MVZA 2QKSA 5HFMA 2HR3A 5IYDO 1EFRG 2WLJA 3TK1A 2LFRA 2Q6AA 4MVOA 5CBFA 3SPGA 1Q81W 3ABMC 3R65A 3E2EA 4L87A 1K3EA 3W7XA 2NLJC 1PNMA 3ZRVA 2QEXV 5LHGA 2OCCB 1JVMA 5H6QA 2EILB 5B1AB 3CPWU 3CCRV 2ZD9A 1S0VA 1K73W 4U7NA 3K04A 4OXSA 1F4MA 4PDVA 5DN6G 3JD4A 4LP8A 1V55B 2A0LA 3STLC 1GM9A 3G4SV 1ROPA 1P4RA 1I5YA 4JTDB 3CCEV 2PI5A 2JIZG 2WLNA 3ZMVA 4UUJC 2IW5A 3TCUA 1F51A 4UVBA 1DTOA 4FK5C 3SPJA 1K5SA 5LBQA 5H9CA 1Q7YW 3LSSA 4RO2A 1KKDA 3RW0A 2W6IG 1OCZB 3ZRWB 3ZMSA 3CC7V 1RM1C 1AI6A 1YJ9V 2IJHA 1QVGU 2OT5A 5L3EA 3QNEA 1OZ0A 5B1OA 4F4LA 3M99B 1AR1B 3AG3B 2IH1C 5EK0A 4QE7A 4KUMA 2WLLB 4WFAV 4RQFA 1AI4A 1KD1W 3SYAA 3AEIA 1M57C 4MTGA 1NVPD 3ABMB 1IXMA 1SRYA 4TSFG 2Z5UA 1R3IC 2ZXWC 5GW7A 3K3WA 4MTOA 2LP7A 3ABUA 4PDMA 4RUFA 3UKMA 3ABTA 4JPRA 1RPOA 2H94A 4HYOA 3SYCA 1NBMG 3LDCA 4XDJA 1R6NA 5H6RA 2Q69A 3CCVV 3E86A 3CCMV 1V54C 3MHHC 2P6JA 1R3LC 2UXXA 5IDJA 1M56C 2AHYA 4QE9A 2P7TC 2WPDG 1QR9A 2GHYA 5EBMC 2HFEC 2WLMA 3E89A 4H37A 1Q86W 1VQNV 4UVAA 2DQ3A 1K34A 4HZ3A 2QTOA 1RM1B 2D3OW 4R50A 3HB3B 1EZJA 5L3GA 4UVCA 5L3BA 3OAAG 3ZMZA 3ETEA 2EIJC 1VQ8V 5LHIA 1TUEB 1CEZA 1PKXA 3OGCC 3FB7C 4TT3G 1GK9A 1H8HG 5CN0A 1M57B 1FFTB 4JGSA 2DWEC 3LUTB 3T4ZA 1HWYA 4WF9V 1J95A 4FJCC 1VQPV 1XL6A 1S3JA 1DF5A 1W0JG 3AG4C 1K8AW 3B8NA 1NQTA 1THZA 2X6BA 5FL7G 3LDDA 2WLIA 4CBCA 5KUMA 2IU0A 3SYQA 4PA3A 3I56V 1V54B 4G28B 2FTKA 2DW4A 1QBZA 1M56B 4FMTA 5IY5C 1CPYA 1NH2B 3AG1C 4WFGA 1M90W 2WAMA 4P9PA 1AJNA 5BZBA 1F4NA 2WSSG 2Q68A 2H8PC 4BIUA 5LGNA 3CC4V 2XAQA 2ZDIC 3OR6C 2DYRC 1OHHG 2DQ0A 1VQKV 1QLNA 3E8BA 2R9IA 1OCZC 2B1GA 2EIJB 3JD2A 1S5HC 2M7WA 1K33A 4LBEC 2EINC 4J9ZB 2Y69C 3AG2C 2IJJA 4UV9A 5CBHA 3ABLB 4GX5A 1EBOA 5HFLA 5IYCO 1K4DC 3OEEG 2IU3A 3AG4B 3ZRWA 3ZIAG 4Q20A 1OCCC 4UXNA 1G8MA 4XDLA 3FYIB 5CMUA 1FXHA 4P30A 3ZRXA 5EC1C 3OUFA 3DGEA 3T4DA 1DF4A 4E2LA 3OW2U 4X88A 5EC2C 1VQ6V 4FPPA 1RPRA 3E8HA 1H2GA 2QE7G 5IY5B 3AG1B 4GX2A 1AI5A 3SPHA 4JTAB 1NKDA 4MTXA 5J9PC 1SETA 1WPXA 4GX1A 3EHBB 2DYRB 4MVRA 2EZOA 4RQEA 3FB8C 1GKFA 2NNUA 1VQLV 1FXKC 2XAGA 2EINB 1QVFU 2Y69B 3QO8A 3ETDA 4QNHB 3AG2B 1AJQA 2X6AA 5L3DA 1VQ4V 4I5SA 1H8EG 4PDRA 2Q67A 2A9HA 3OMAB 1UJWB 3CC2V 1VQ7V 2PI4A 1R73A 3BEHA 1OCCB 3LDEA 3JYCA 1AI7A 2KB1A 1YTFB 1XL4A 2WLHA 3KG2A 1NR1A 3CMEV 2HJFC 4QPKA 4EKWA 1N8RW 1M9NA 3FB6C 4CZZA 4XDKA 3F5WC 1CP9A 3CYOA 1E79G 2BOBC 3T2MA 2JJ2G 5B1NA 3K06A 3GWOA 3ZJZA 2OTLV 3LNMB 4QJFB 3P32A 3G71V 5C93A 4LCUC 2IJIA 2DYSC 1FXKB 2Z3YA 1R6KA 3ZRSA 4RUEA 3HPLC 4TWKA 2EJRA 3DTUB 4PA4A 4BAYA 5LGTA 1YITV 1PD3A 1PNLA 2ZR3A 3ABLC 3QO7A 4MTFA 1KC8W 4N23A 1FXVA 1KP2A 1AROP 3SPCA 3UM7A 3K9AA 1WLEA 1Y4MA 3CCSV 1SERA 5LHHA 1W2BU 2JEXA 5CA3A 3TETA 3W7WA 1QR8A 1SZTA 4WFEA 3X2QC 3FB5C 2EZPA 2WWWA 2CK3G 4N21A 2HVKC 2B1IA 1ZWIC 3ZMTA 4GX0A 1Q82W 4PA6A 3BY6A 1K97A 1S77D 3OMIB 1MSWD 4JASA 3W7TA 2QM8A 3EFFK 4HAMA 2XNDG 3CD6V 2AHZA 2V7QG 1NJIW 4G2KA 4PA9A 5LGUA 3W7UA 3SYPA 3CP1A 4BW5A 1JPXA 2W6JG 2YEVB 2ATKC 2IH3C 4JAVA 2DYSB 1FS0G 2JDIG 3NXSA 3SPIA 3OEHG 2R9RB 1E1QG 3FYEB 1L1FA 2GSMB 3PJSK 2B5UA 4P9OA 2HVJC 2ZDIA 1NVPB 1K9MW 2HLDG 3WG7C 3F7VC 1MOFA 1F23A 1YHQV 4MVMA 5CBGA 1GTOA 1VQOV 2MK3A 1AJPA 2WLLA 3K0GA 1OCRC 3X2QB 2EBOA 3WFVA 2EIKB 4DXWA 5KA6A 1OCOC 5E1AC 4MSWC 3K03A 3RBZA 1KP3A 4KFMA 1BHAA 5B3SC 3RVZA 3LSQA 2P90A 5KUKA 2OTJV 2ZQMA 1ORQC 2XASA 3GB7C 2LFSA 1YI2V 4I9WA 2XOKG 1COWG 1QLEB 3E35A 4BIZA 1ENVA 3D3IA 5KA5A 1LNQA 1YSCA 4X89A 3SJQC 2QA4V 4G27B 4GT1A 3ZMUA 5EBLC 3OMNB 3H01A 2IJKA 5L3FA 3ASOC 3CMAV 3T1CA 2K1EA 1G4YB 1K92A 3RVYA 3ASNC 1KQSU 4MVSA 3OM3B 2JJ1G 4RAIA 3CCLV 1NH2D 3B77A 2HG5C 2EIMC 2YSUB 4MW3A 4PDLA 3WG7B 1KECA 1R3JC 4WFFA 1FXKA 2V1DA 2W0FC 3B8MA 3MHSC 3ABKC 3A0RA 1MG1A 1YJWV 1P7BA 3K79A 3P30A 1OCRB 4MS2A 4QIWF 3SYOA 1K7DA 4JF3A 2BOCC 4GCZA 4JYBA 1GM7A 1OCOB 3JD0A 5B3SB 4DO2A 4WCEV 1BMFG 3IC7A 4R8CA 2XAJA 4X8AA 1W0KG 4UV8A 3ZCCA 3F7YC 3E83A 3JD1A 3G6EV 3OR7C 1VQ5V 2WLKA 2QM7A 2X0LA 3ASOB 2HKOA 3E8GA 1H38A 2XAFA 1K4CC 3ASNB 4WFHA 4JAUA 3ZN0A 1PNKA 1YJNV 1GMGA 1GO3F 3OFNG 2X6CA 4Z1MG 1K5QA 4YXWG 2EIMB 1PL0A 1BL8A 4MVUA 2P67A 4JYCA 4XBFA 4JTCB 1B6QA 1JOYA 4MT8A 3JCZA 2YEVA 3D36A 3VOUA 1NR7A 1I5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX2 A;  4MTO A;  2R9R B;  4PDM A;  3SPH A;  4RUF A;  4JTA B;  3UKM A;  3PJS K;  4H33 A;  5J9P C;  4HYO A;  3SYC A;  4GX1 A;  3LDC A;  4XDJ A;  4P9O A;  2HVJ C;  5B1B C;  2EIK C;  2ITC C;  4MVR A;  2Q69 A;  4MW8 A;  3WG7 C;  3E86 A;  3F7V C;  3FB8 C;  4R7C A;  1V54 C;  4P2Z A;  4MVM A;  5CBG A;  1R3L C;  1M56 C;  3E8F A;  4J9Y B;  2AHY A;  4PA7 A;  2P7T C;  4QE9 A;  2WLL A;  4QNH B;  1QLE C;  3K0G A;  2X6A A;  5EBM C;  2HFE C;  1OCR C;  2WLM A;  3E89 A;  4H37 A;  4HZ3 A;  2A79 B;  4PDR A;  2OCC C;  2Q67 A;  2QTO A;  3IGA C;  4DXW A;  2EIL C;  2A9H A;  5B1A C;  1OCO C;  5E1A C;  4MSW C;  3K03 A;  3OUS A;  4KFM A;  4R50 A;  3RBZ A;  3STZ C;  5B3S C;  3RVZ A;  3BEH A;  4MVQ A;  2EIJ C;  3LDE A;  5KUK A;  1R3K C;  3JYC A;  4ZBM A;  3GB7 C;  1ORQ C;  3OGC C;  1V55 C;  2KB1 A;  3FB7 C;  4I9W A;  1XL4 A;  2WLH A;  3KG2 A;  1LNQ A;  2DWD C;  4X89 A;  3SJQ C;  4R6Z A;  2HJF C;  3K08 A;  4G27 B;  4EKW A;  2DWE C;  3LUT B;  3T4Z A;  5EBL C;  3FB6 C;  3K0D A;  5EBW C;  2ITD C;  3ASO C;  4XDK A;  3F5W C;  3T1C A;  2K1E A;  1G4Y B;  1J95 A;  3RVY A;  1XL6 A;  3AG4 C;  3ASN C;  2BOB C;  3T2M A;  4MVS A;  3IFX A;  4RAI A;  2JK5 C;  3AG3 C;  2HG5 C;  3K06 A;  2EIM C;  2WLI B;  3ZJZ A;  2X6B A;  4MVZ A;  2QKS A;  2WLI A;  3LDD A;  4MW3 A;  4PDL A;  5KUM A;  4CBC A;  3LNM B;  3SYQ A;  4PA3 A;  2WLJ A;  2Q6A A;  5CBF A;  4G28 B;  4LCU C;  1R3J C;  4MVO A;  2DYS C;  3SPG A;  4WFF A;  3ABM C;  3R65 A;  5IY5 C;  2W0F C;  3AG1 C;  4WFG A;  3ZRS A;  4RUE A;  3HPL C;  4P9P A;  2NLJ C;  4TWK A;  3ABK C;  5BZB A;  4PA4 A;  1P7B A;  2Q68 A;  2H8P C;  4MS2 A;  3ABL C;  4MTF A;  3SYO A;  2BOC C;  1JVM A;  3OR6 C;  2DYR C;  3SPC A;  2ZD9 A;  3E8B A;  3UM7 A;  1OCZ C;  3K04 A;  4OXS A;  4PDV A;  4R8C A;  1S5H C;  4LP8 A;  2A0L A;  3STL C;  4X8A A;  4LBE C;  2EIN C;  4JTD B;  4J9Z B;  2Y69 C;  3F7Y C;  3E83 A;  2WLN A;  3AG2 C;  4UUJ C;  3TET A;  3TCU A;  3OR7 C;  5CBH A;  2WLK A;  4WFE A;  3X2Q C;  3FB5 C;  4GX5 A;  3SPJ A;  2HVK C;  3E8G A;  1K4D C;  1ZWI C;  4RO2 A;  1KKD A;  3RW0 A;  1K4C C;  4GX0 A;  4WFH A;  4PA6 A;  1OCC C;  2X6C A;  4F4L A;  3EFF K;  2IH1 C;  4XDL A;  4QE7 A;  5EK0 A;  2WLL B;  4P30 A;  2AHZ A;  1BL8 A;  5EC1 C;  3OUF A;  4PA9 A;  3T4D A;  4MVU A;  3SYA A;  3SYP A;  4BW5 A;  1M57 C;  4JTC B;  4X88 A;  2ATK C;  4MTG A;  2IH3 C;  2YEV A;  5EC2 C;  3E8H A;  3VOU A;  3SPI A;  1R3I C;  2ZXW C; 
#chains in the Genus database with same CATH topology
 4DV3 O;  3ZN1 A;  3BAA A;  4H33 A;  2ZE5 A;  3E22 B;  5D5P A;  2Y48 A;  3CCU V;  4B3M O;  2PUS A;  1JX9 A;  2EX3 A;  3HKD B;  5IYB O;  4B3S B;  4MW8 A;  4ASU G;  4R7C A;  4P2Z A;  2X7R B;  4KP4 A;  3E8F A;  4PA7 A;  3OTO O;  2QKC A;  1G1X B;  3IGA C;  4U7O A;  5B1A C;  4PV1 B;  4IYH A;  2YID A;  1VQ9 V;  1Z2G A;  4ZI7 B;  2ZIM A;  4ZBM A;  4WFB V;  1VEW A;  5IYZ B;  4FIP C;  3VBB A;  3H1J H;  2RCV A;  5KHJ A;  2DWD C;  4JYA O;  1DGS A;  3CE2 A;  5E79 Z;  3JD3 A;  5KHI A;  3OE7 G;  5L3C A;  3CXC U;  1HNX O;  1ZL8 B;  5JH7 A;  4PEL A;  1JQ0 A;  1JCH A;  2QKS A;  5LP6 A;  1TUB A;  3TK1 A;  2Q6A A;  1Q81 W;  2P4V A;  4YHH B;  3R65 A;  3E2E A;  2NLJ C;  1PNM A;  1IBM O;  4X65 O;  1VAR A;  2P06 A;  5A2Q N;  2OCC B;  1JVM A;  3L74 H;  4FLW A;  3NR7 A;  1K73 W;  3HKC A;  3JD4 A;  4LP8 A;  2A0L A;  1GM9 A;  1ROP A;  1I5Y A;  3CCE V;  1BS3 A;  4I4T A;  1DTO A;  1B3Q A;  2QWR B;  2YS8 A;  4TV9 B;  4YIP A;  1K5S A;  3F5T A;  3LSS A;  1KKD A;  3ZRW B;  1AI6 A;  3HKE A;  1HNZ B;  1QVG U;  5L3E A;  3RGB A;  3P3N A;  1L8D A;  3M99 B;  2IH1 C;  1NTZ H;  2WLL B;  2M6Y A;  5ITZ A;  4WFA V;  1AI4 A;  3JAT A;  4DUZ B;  4CH3 A;  2UUA B;  2UUA O;  4MTO A;  5KHK A;  3ABU A;  1NBM G;  3LDC A;  2OYQ A;  5H6R A;  3MHH C;  4IGG A;  1BE3 H;  4JI4 B;  4LF6 B;  1IDS A;  4LF6 O;  1M56 C;  2RNB A;  3TXQ A;  2XUM A;  4QE9 A;  5LXT B;  1QR9 A;  2GHY A;  1N0J A;  2HFE C;  4B3T B;  1VQN V;  4LNU B;  4O4I A;  3OAA G;  3ETE A;  1VQ8 V;  5LHI A;  1Y74 A;  1CEZ A;  4C7U A;  4OX9 O;  2YIB D;  3ETQ A;  4LF4 B;  2DWE C;  1W59 A;  2QWP B;  5GTH Z;  4JI2 O;  4WF9 V;  3Q4H A;  2Z0A A;  3BCC H;  2UU9 O;  1XI1 A;  3OD4 A;  1N33 B;  3LDD A;  3U11 A;  3I56 V;  3CS5 A;  1M90 W;  4P9P A;  2PGG A;  4GKK B;  1LUV A;  4GKK O;  3RT3 C;  4J7J A;  5KAF Z;  2DYR C;  2VQE B;  2VQE O;  1VQK V;  4DV2 B;  4DV2 O;  4UCS A;  2EIJ B;  1K33 A;  4AI8 A;  2ZE8 A;  2ZT9 B;  1Q90 D;  4BIO A;  2QKA A;  4I50 A;  3AG4 B;  5KMG B;  1NZ6 A;  1OCC C;  4TV8 A;  3FYI B;  1EZV H;  1FXH A;  4UCV A;  3K5N A;  3ZRX A;  4ZIB A;  3OUF A;  4JV5 O;  4X88 A;  4FPP A;  1RPR A;  2YI8 A;  4HBN A;  3T1Y B;  1KBH A;  3T1Y O;  3RYH B;  2GUZ A;  1AI5 A;  1Z5V A;  3D8C A;  1TGO A;  3QVN A;  1NKD A;  5J9P C;  1WPX A;  4GX1 A;  5LYJ A;  2AW9 A;  1QNM A;  1YDX A;  4W4K A;  2PF4 E;  2Q9L A;  1V9P A;  5EZY A;  2EIN B;  4QNH B;  2X6A A;  3JSL A;  4I5S A;  3N2G B;  3OMA B;  1GN6 A;  3DXR B;  2PI4 A;  2VRZ A;  1RSO A;  2V4D A;  4I0X A;  1YTF B;  2WLH A;  1NR1 A;  1N8R W;  1KYO F;  1XDC A;  2E74 B;  3GVM A;  3F5W C;  1IBL O;  1XMQ O;  4DV1 O;  3K06 A;  1PP9 H;  3BRC A;  3G71 V;  4ZHQ A;  4LCU C;  2IJI A;  1FXK B;  3CWB H;  4JYY A;  2A7W A;  4PA4 A;  1XNQ O;  1PD3 A;  2P5O A;  5IJ9 B;  3B09 A;  2F66 C;  4X20 B;  1ARO P;  4PI0 A;  5EYP B;  3SPC A;  2H3O A;  4IHJ A;  4CS3 A;  1EN5 A;  5K1X A;  2JEX A;  1BZK A;  5KX5 B;  2L35 A;  4WFE A;  2EZP A;  2ILM A;  3CJH A;  3OTF A;  2XHB A;  3BY6 A;  1MSW D;  1URF A;  1WP7 A;  1WPB A;  2AZ2 A;  4U3J A;  2V7Q G;  4X1K B;  5LGU A;  1H2L A;  3SYP A;  3CP1 A;  1KKC A;  1JPX A;  1IX9 A;  2DYS B;  1FS0 G;  1DK1 A;  3NXS A;  1X59 A;  3SPI A;  4WBN A;  1E1Q G;  1L1F A;  2GSM B;  3PJS K;  4DR6 O;  2W0X A;  1XUQ A;  1GN2 A;  5GON A;  3F7V C;  4DR3 B;  1F23 A;  5KHG A;  3K57 A;  1YEW A;  4FM0 A;  2MK3 A;  1AJP A;  3RYF B;  4EEQ A;  2JRI A;  2HJD A;  1WP8 A;  3JAR A;  5JJN B;  2UXD B;  1OCO C;  5E1A C;  4MSW C;  4PJ0 Z;  4X1I B;  2RJZ A;  4LF7 O;  4DK0 A;  2ZQM A;  1ORQ C;  2YUA A;  3GB7 C;  1RFY A;  5FLX N;  3AG7 A;  4E4E A;  1VP7 A;  2XOK G;  1M93 A;  1QLE B;  3E35 A;  1ENV A;  2P4K A;  3B40 A;  2KG7 A;  1YSC A;  1RP3 B;  3SJQ C;  5KA5 A;  3H01 A;  2IJK A;  5BXZ A;  3T1C A;  4DV4 O;  4RAI A;  3J80 N;  3JAK A;  2EIM C;  1ZX3 A;  2YSU B;  3WG7 B;  1KEC A;  4NTY A;  1R3J C;  3ZHS A;  2QSA A;  2VS0 A;  3B8M A;  1I7F A;  1AR5 A;  3MHS C;  5JJE B;  1HNW B;  4FFB A;  4MS2 A;  3SYO A;  4FM2 A;  1HR0 B;  4JI8 B;  5LOV B;  1XNR O;  3JD0 A;  3SJC C;  1ZAU A;  5JWP A;  1BMF G;  5FNV A;  2PYL A;  3ZCC A;  2QDO A;  3JD1 A;  3JSN A;  1MNG A;  4LF8 O;  3ASO B;  1K4C C;  3ASN B;  4X66 O;  2X6C A;  3CRQ A;  4Z1M G;  1FYJ A;  1WA8 A;  1PL0 A;  4JYC A;  4DW0 A;  4O2A A;  4MT8 A;  3ZHT A;  1H2S B;  3TGU H;  4IL6 Z;  4EFE A;  4LH6 A;  1BGY H;  2ETN A;  3CCQ V;  5DM6 V;  4FLU A;  3I55 V;  4CH4 A;  2ITC C;  2ADQ B;  4QPJ A;  2LW7 A;  5LMU O;  1GAX A;  1JA8 A;  4J9Y B;  1NS1 A;  1AP5 A;  5DED A;  1QLE C;  3ZBH A;  1SES A;  1SQV H;  1YTF D;  1ZTE A;  2F43 G;  2A79 B;  1DLB A;  4OPA A;  1J5E O;  2EIL C;  2Q0O C;  4YJ3 B;  5JVD B;  2QJ1 A;  4O2B A;  1V55 C;  5JQG B;  1S76 D;  3CCJ V;  3FKS G;  4K0K B;  4NB5 A;  5EBW C;  1QU7 A;  1WAZ A;  1A32 A;  3SDL A;  1TA8 A;  3ETG A;  2QTS A;  3IFX A;  2JK5 C;  2YIB A;  3AG3 C;  4ZKI A;  3OGI B;  3ML0 A;  4TUY B;  4MVZ A;  2YXH A;  3G80 A;  2WLJ A;  3UO3 A;  4BWA A;  4MVO A;  3SPG A;  3ABM C;  2A06 H;  2CTQ A;  4L87 A;  3RYC A;  1SQG A;  2QEX V;  1IXB A;  5LHG A;  2UXC B;  2UXC O;  3RYI A;  3CPW U;  5B1A B;  3CCR V;  2ZD9 A;  1S0V A;  4LH7 A;  3LSU A;  5KAI Z;  1HW7 A;  3K04 A;  4OXS A;  4PDV A;  4O4L A;  4ZOL A;  2OIG A;  3B4S A;  1P4R A;  2JGD B;  2JIZ G;  2WLN A;  2IW5 A;  3HKB A;  3TCU A;  2BE3 A;  2A3Q A;  2WA3 A;  2Q7H A;  1XMO B;  4RO2 A;  3RW0 A;  2W6I G;  3HR0 A;  4B7E A;  2Y0P A;  1RM1 C;  2IJH A;  1Q6I A;  3QNE A;  1OZ0 A;  1NT2 B;  3THO A;  3ZED A;  3SYA A;  3AEI A;  1JR9 A;  1D5A A;  1SQF A;  2F1M A;  1SRY A;  1Q3E A;  2NR5 A;  2IBZ H;  2Z5U A;  4IIJ B;  5GTI Z;  3ABT A;  4O4H B;  4HYO A;  2H94 A;  3E22 A;  4I55 A;  3HKD A;  3CCV V;  3CCM V;  1V54 C;  2GBO A;  2P6J A;  2UXX A;  4NXM O;  4NXM B;  2P7T C;  4A5U B;  2Q5Z A;  1Q86 W;  4KHP O;  4UVA A;  1K34 A;  2F4V B;  2F4V O;  1SKV A;  4R50 A;  4NXN O;  4DV3 B;  4UVC A;  3ZMZ A;  4ZI7 A;  1PKX A;  3OGC C;  2RDC A;  5IYZ A;  4B3M B;  2CH7 B;  1FFT B;  4JGS A;  1SA0 B;  1J95 A;  4FJC C;  1XL6 A;  4W4L A;  1DF5 A;  1XEQ A;  3OTO B;  5EIB C;  3S3X A;  1EN6 A;  4DRX A;  4UB6 Z;  1NQT A;  2X6B A;  3L73 H;  4CBC A;  5KUM A;  3ZHQ A;  3C90 A;  4G28 B;  2FTK A;  2DW4 A;  1QBZ A;  1M56 B;  3AG1 C;  2JGU A;  4WFG A;  1SQP H;  1JJO A;  2ZIO A;  1VF6 A;  4BIU A;  5LGN A;  3CC4 V;  4X1Y A;  5DEC A;  4PI2 A;  4UCU A;  3OR6 C;  4JYA B;  3IC9 A;  3E8B A;  1JFF B;  1S5H C;  2M7W A;  1HNX B;  2ADP A;  2Y69 C;  4UV9 A;  3ABL B;  4GX5 A;  5IWA O;  2PYJ A;  4DV5 O;  4JI6 O;  4TV9 A;  5IYC O;  3OEE G;  2K9P A;  4DV6 B;  4DV6 O;  3ZRW A;  3BPZ A;  1IBM B;  4X65 B;  4XDL A;  4FLV A;  2GTA A;  3KZI Z;  5EC1 C;  3DGE A;  3T4D A;  4FZ1 A;  4E2L A;  2R9A A;  5EC2 C;  1D5N A;  1WJZ A;  4NKG B;  4GX2 A;  3SPH A;  1WB8 A;  5LA6 A;  2DYR B;  3L72 H;  5B66 Z;  4MVR A;  4RQE A;  4H44 B;  3VQW A;  1VQL V;  3ETD A;  2CGO A;  5LXT A;  1TVK B;  5L3D A;  1H8E G;  3CC2 V;  4LNU A;  1S5L Z;  1OCC B;  1HP8 A;  3BVO A;  3JYC A;  1AI7 A;  3KG2 A;  3CME V;  2HJF C;  4QPK A;  4UFZ A;  4CZZ A;  3CX5 F;  4XDK A;  4YY3 O;  1CP9 A;  3MAQ A;  3CYO A;  1E79 G;  1PM9 A;  5B1N A;  2OTL V;  2QR4 A;  3LNM B;  4QJF B;  5IJ0 B;  1FKA O;  2LGQ A;  1FPO A;  4OX9 B;  1L0N H;  1B04 A;  1YIT V;  3QO7 A;  2ZR3 A;  3ABL C;  5ITZ B;  4JI2 B;  2FL4 A;  1WLE A;  1SER A;  4LWS B;  5LHH A;  2UU9 B;  3VQY A;  1W2B U;  3X2Q C;  2HVK C;  1ZWI C;  1Y67 A;  4GX0 A;  4PA6 A;  5KMG A;  1XHZ A;  3W7T A;  2QM8 A;  3EFF K;  1N36 B;  1N36 O;  3AK3 A;  4G2K A;  4PA9 A;  4DR7 O;  3ZHU A;  4BW5 A;  2ATK C;  2IH3 C;  1Z5W A;  2JDI G;  3VQX A;  5CB4 A;  3OEH G;  3FYE B;  3J7A U;  2ZDI A;  3CRR A;  5LP6 C;  1K9M W;  2HLD G;  4MVM A;  5CBG A;  1GTO A;  4LF9 O;  4JV5 B;  2EIK B;  3N2G A;  2ZE6 A;  3K03 A;  1FFX B;  1KP3 A;  1BHA A;  3RVZ A;  1MA1 A;  3N2K A;  5KLV H;  1LNQ A;  4X89 A;  1KMI Z;  3J81 N;  2QA4 V;  4GT1 A;  1QQC A;  5EBL C;  2CGN A;  1XHX A;  5L3F A;  1NTM H;  2K1E A;  1G4Y B;  3RVY A;  1XOU A;  5H5N A;  3CCL V;  2UUB O;  3B77 A;  2HHH B;  2HHH O;  3L75 H;  3CEI A;  4MW3 A;  4PDL A;  1F7Y A;  3DC5 A;  3K58 A;  4I50 B;  1FXK A;  2W0F C;  1MZF A;  3ABK C;  3A0R A;  4JAA A;  5KHH A;  3GWK C;  4JZG A;  1YJW V;  3B2E E;  3BA9 A;  4JF3 A;  5IJ9 A;  5H2F Z;  1OCO B;  4X20 A;  3M8A A;  5EYP A;  1IBL B;  4GYC B;  4WCE V;  4JI5 O;  1XMQ B;  4DV1 B;  4X8A A;  4JI1 B;  4JI1 O;  4UV8 A;  1LR1 A;  3T1H O;  4DR5 O;  3E83 A;  5KX5 A;  3BAB A;  1VQ5 V;  2WLK A;  3I5D A;  2X0L A;  2LW1 A;  4WFH A;  5J2T A;  3ZN0 A;  1YJN V;  1XNQ B;  1K5Q A;  2EIM B;  3H1K H;  4Q6G A;  1I08 A;  4X1K A;  4MVU A;  1G6U A;  4J7Z A;  4GZR B;  3C3S A;  1NR7 A;  1P49 A;  1VF7 A;  2CTW A;  1RSO B;  1GN3 A;  3CB2 A;  5B1B C;  2EIK C;  2CTR A;  1YIJ V;  1BHB A;  1E1R G;  3WB2 A;  3K59 A;  3QO5 A;  4HNA A;  4LC1 A;  1S72 V;  3L70 H;  1GM8 A;  3RYF A;  3JAL A;  2XAH A;  2ZKO A;  1Y76 B;  2PY5 A;  3O9O A;  2LO1 A;  3FAV A;  1MAB G;  3STZ C;  3OUS A;  4LF5 O;  5IT9 N;  1R3K C;  4DR6 B;  4UCR A;  2ZR2 A;  2LGW A;  3APQ A;  4DR2 O;  2UXN A;  4H13 B;  4R6Z A;  1UPG A;  1VQM V;  2DJV A;  5JCO A;  3APO A;  4D6T H;  2NN4 A;  2YI9 A;  4J7K A;  1Q6U A;  2JEU A;  1MSD A;  2DE0 X;  2WLI B;  4JI3 O;  5HFM A;  4LF7 B;  5CA0 B;  3CJH B;  3C3T A;  4YJ2 B;  3W7X A;  4NTX A;  3BHP A;  2UUC B;  2UUC O;  2DN9 A;  2EIL B;  5AG2 A;  2ZM6 B;  4IT5 A;  2ZM6 O;  4DV4 B;  3ZHV A;  1F4M A;  5DN6 G;  2FYU H;  1V55 B;  3G4S V;  2XTA A;  4UUJ C;  5TIS Z;  1F51 A;  1EM1 A;  2LJ2 A;  3SPJ A;  4UCO A;  5H9C A;  1OCZ B;  1YJ9 V;  4J10 A;  1FJG O;  2OT5 A;  4F4L A;  3AG3 B;  5EK0 A;  4QE7 A;  2YXL A;  4KUM A;  4RQF A;  3D3Q A;  1XNR B;  1BT8 A;  1M57 C;  4JI0 O;  3JAR B;  4MTG A;  3U0Z A;  1H2M A;  3ABM B;  1IXM A;  1R3I C;  4LFA O;  4PDM A;  2YIA A;  4JPR A;  4PHZ A;  3KKY A;  4DR1 O;  2AXT Z;  4XDJ A;  4PD4 F;  4LF8 B;  2KG7 B;  4O4J B;  2D2C B;  2Q69 A;  1VF5 B;  2BTQ B;  3E86 A;  4EB6 B;  2BSK B;  4X66 B;  1R3L C;  5IDJ A;  4JI7 B;  4JI7 O;  2AHY A;  2WPD G;  5BY1 A;  1OV9 A;  1IBK O;  4H37 A;  2WLM A;  3E89 A;  1LUW A;  2DQ3 A;  2QTO A;  4FZ0 A;  1RM1 B;  3HB3 B;  1EZJ A;  2P22 C;  5L3G A;  5JVD A;  1ZSP A;  5L3B A;  1TUE B;  1IUR A;  1GK9 A;  5JQG A;  1GN4 A;  3H1L H;  1H8H G;  1D2D A;  4FFB B;  1Q5O A;  3BA8 A;  5LMU B;  3T4Z A;  1AVM A;  1R1B A;  2R70 A;  1HWY A;  5BMV A;  1W0J G;  3EVK A;  3JAW B;  1K8A W;  1P84 F;  3B8N A;  2AZ0 A;  2F93 B;  1THZ A;  1J5E B;  4CH6 A;  4L8J A;  4TUY A;  2IU0 A;  3SYQ A;  3ICX A;  4PA3 A;  1V54 B;  3CHX A;  1YF2 A;  3KCX A;  4FMT A;  3UT5 B;  2YDE A;  5IY5 C;  1NH2 B;  2WAM A;  1AJN A;  4K3A A;  5BZB A;  4J11 A;  1F4N A;  2WSS G;  4GKJ O;  2XAQ A;  5CA1 B;  1OHH G;  2RMK B;  4O2A B;  1OCZ C;  2B1G A;  1S5J A;  1O9H A;  3JD2 A;  4TOI A;  3AG2 C;  3G6B A;  5CBH A;  1EBO A;  2IM9 A;  4I7Z B;  1M4U A;  3A0H Z;  3ZIA G;  2EUL A;  4UXN A;  4DV7 O;  4K8Z A;  5LMN O;  1YCI A;  2MW2 B;  2CUG A;  5CMU A;  4P30 A;  1N0N A;  3VQV A;  4F6R B;  4DR4 O;  1VQ6 V;  4D7S A;  3E8H A;  2DOS A;  2QE7 G;  3AG1 B;  5J2U B;  1IVS A;  4JTA B;  4MTX A;  4O4H A;  4NR1 A;  3EHB B;  1FD9 A;  3FB8 C;  1EN4 A;  1QVF U;  2Y69 B;  2YXY A;  1AJQ A;  1VQ4 V;  1SS3 A;  2Q67 A;  1XRE A;  1VQ7 V;  5IE9 A;  1R73 A;  3BEH A;  4U3F H;  3LDE A;  1KB9 F;  2JS3 A;  3P3P A;  2KB1 A;  3UQ8 A;  1PL4 A;  2Y4T A;  3RYC B;  2CH7 A;  1N34 O;  1M9N A;  1SA0 A;  3S3W A;  2LQT A;  2Q7E A;  2FKX A;  2BOB C;  4EFB A;  2EJ7 A;  3T2M A;  2JJ2 G;  4O4L B;  4KHP B;  3GWO A;  4OPH A;  1R6T A;  3ZJZ A;  4CS4 A;  2KKW A;  3L9D A;  3AK1 A;  4NXN B;  5C93 A;  3JAS B;  4X62 O;  2Z3Y A;  4GLX A;  1R6K A;  2QWQ B;  2YIC A;  1N32 O;  3DTU B;  5LGT A;  1PNL A;  2N74 A;  4N23 A;  1FXV A;  1KP2 A;  1JFF A;  3K9A A;  2RQ6 A;  2PTM A;  1TAE A;  1XIL A;  1ZL8 A;  3CXH F;  2JVD A;  4NVP A;  4BR6 A;  2DMX A;  1QR8 A;  1SF9 A;  1SZT A;  3FB5 C;  2WWW A;  1NI8 A;  4N21 A;  4I55 B;  2UXB B;  2B1I A;  2UXB O;  4B3S O;  1Q82 W;  2HEP A;  2L6L A;  2YC0 A;  1K97 A;  1VIB A;  4JAS A;  1WN7 A;  4HAM A;  2VWJ A;  4GUN A;  4X9Q A;  4LFB B;  4LFB O;  2AHZ A;  3L71 H;  1NJI W;  1HDJ A;  3A2F A;  3W7U A;  3QG5 A;  5C8Y B;  4DUY B;  4DUY O;  2YEV B;  2GV9 A;  4JAV A;  4OGQ B;  5K1P A;  4TQF A;  4NYK A;  2AGA A;  5IWA B;  2B5U A;  4P9O A;  4DV5 B;  2HVJ C;  4JI6 B;  1NVP B;  4RWU A;  2Q4P A;  1YHQ V;  1VQO V;  2ARH A;  2WLL A;  3K0G A;  4DRX B;  1OCR C;  1TVK A;  3X2Q B;  2EBO A;  4JZ2 A;  3CRC A;  1SQX H;  4K35 A;  3K5L A;  5BR8 B;  5BR8 O;  5B3S C;  3LSQ A;  4DV0 B;  4DV0 O;  4YHH O;  3IAY A;  1YI2 V;  4IYI A;  4BW9 A;  1COW G;  4BIZ A;  3D3I A;  4X1Y B;  4G27 B;  3ZMU A;  1U96 A;  2Q8V A;  1X4T A;  3CMA V;  1OJH A;  1MMM A;  2QWN B;  1KQS U;  4MVS A;  3OM3 B;  1NH2 D;  5JH7 B;  5LP6 B;  4AIL C;  3RN4 A;  1TUB B;  5IJ0 A;  4WFF A;  1KUQ A;  1HNZ O;  2Q7G A;  1MG1 A;  1U97 A;  2ODM A;  1P7B A;  3P30 A;  4QIW F;  1SQB H;  2OWO A;  4GCZ A;  1GH6 A;  4YY3 B;  3HKC B;  4DUZ O;  4FM1 A;  4R8C A;  4LWS A;  3MDS A;  1W0K G;  1YZB A;  5EIB D;  4H0L B;  4I4T B;  5LA6 B;  1Q6H A;  3E8G A;  3N27 A;  1H38 A;  3HKE B;  2XAF A;  1PNK A;  1Q8I A;  4JI4 O;  3OFN G;  2HP8 A;  4FFK A;  1BSM A;  1BL8 A;  2XT9 A;  3JAT B;  4XBF A;  4B3T O;  1B6Q A;  1JOY A;  1T5E A;  4D7T A;  1BQ0 A;  3D36 A;  3VOU A;  1SC5 B;  1FAF A;  4UB8 Z;  1I5X A;  4I9Q A;  3ABK B;  4DW1 A;  1MZE A;  2QGN A;  1AR4 A;  1BQZ A;  1QCE A;  1US6 A;  1I0H A;  3JCU Z;  4LF4 O;  3O65 A;  3MD0 A;  2ZXW B;  1VF6 C;  4DR7 B;  4J41 A;  2N05 A;  4J42 A;  2OCC C;  4O4I B;  3U10 A;  1N33 O;  1FFX A;  4MVQ A;  3RYH A;  1Y74 B;  4B08 A;  1YVW A;  4CC5 A;  3K08 A;  4UCT A;  3SR2 C;  3K0D A;  1JJ2 U;  1SQQ H;  2ITD C;  1M1K W;  1Y66 A;  4FLX A;  3Q4H B;  4QGP A;  3W7S A;  2Y4U A;  4FLY A;  4LF9 B;  2C2A A;  2N04 A;  1WB7 A;  1Q43 A;  3WB0 A;  5B1B B;  1N4C A;  4FLZ A;  3FFQ A;  2HR3 A;  5IYD O;  1EFR G;  3DXR A;  3EXA A;  2G38 A;  2LFR A;  5CBF A;  3A0B Z;  3QTC A;  2B9Z A;  1K3E A;  2Q73 A;  3UCS C;  3ZRV A;  5H6Q A;  4LFC B;  4LFC O;  3IJ4 A;  4U7N A;  2UUB B;  3STL C;  5CB4 B;  3BFR A;  1WNS A;  4JTD B;  2PI5 A;  4DK1 A;  3ZMV A;  4UVB A;  4FK5 C;  3G67 A;  1Y6X A;  5LBQ A;  1Q7Y W;  3ZMS A;  3CC7 V;  2BTO A;  4TV8 B;  3ZX6 A;  5B1O A;  1AR1 B;  3ZHR A;  1KD1 W;  4JI5 B;  1NVP D;  4TSF G;  2ZXW C;  5GW7 A;  3K3W A;  2GUZ B;  2LP7 A;  3T1H B;  4DR5 B;  3FD9 A;  4RUF A;  3UKM A;  1RPO A;  3SYC A;  5LYJ B;  1R6N A;  3N2K B;  3ZS8 C;  5EZY B;  5D5Q A;  3R66 A;  1GRJ A;  5EBM C;  1Y76 A;  4KXR A;  4HZ3 A;  4CC6 A;  5JJJ B;  2D3O W;  4Z1V A;  5FPO A;  3D36 C;  2EIJ C;  3CRA A;  4I0X B;  2Q0A A;  3FB7 C;  1P7G A;  4TT3 G;  3QF7 A;  5CN0 A;  2ZCE A;  1M57 B;  2FML A;  3LUT B;  2ZE7 A;  2E75 B;  4ABM A;  2RN9 A;  1VQP V;  3AG4 C;  1S3J A;  3M7M X;  2JS5 A;  4KL1 A;  4Z2W A;  1PV0 A;  5FL7 G;  2CAZ C;  2WLI A;  3K5O A;  4LF5 B;  1H2K A;  4ZHQ B;  4X1I A;  5CA0 A;  4CS2 A;  3OT7 A;  1CPY A;  4YJ2 A;  5J2T B;  1SZX A;  4DR2 B;  2Q68 A;  2H8P C;  1O9G A;  2ZDI C;  2CTP A;  2QM4 A;  1QLN A;  2DQ0 A;  3SJB C;  1B06 A;  2R9I A;  4IHJ B;  1AP6 A;  2KQX A;  2ZNI A;  4LBE C;  2EIN C;  4J9Z B;  2IJJ A;  4JI3 B;  2QWO B;  4X64 B;  4X64 O;  5HFL A;  1K4D C;  2IU3 A;  4DR3 O;  4Q20 A;  3H1H H;  4HNA B;  3TXS A;  3KCY A;  1G8M A;  2E5L B;  2E5L O;  4U3J B;  3JAL B;  2VQF B;  2VQF O;  2F23 A;  1DF4 A;  4NTW A;  5LOV A;  3OW2 U;  1H2G A;  2BCC H;  3FAV B;  2UXD O;  5IY5 B;  4WBN B;  5B5E Z;  1SET A;  1AIL A;  4O4J A;  2EZO A;  5GON B;  2BTQ A;  1FJG B;  4EB6 A;  2BSK A;  1GKF A;  2NNU A;  2KSD A;  1FXK C;  1VMG A;  2ZIN A;  1L0L H;  2XAG A;  1JMK C;  3QO8 A;  3AG2 B;  3A8T A;  4JI0 B;  4PDR A;  2A9H A;  1KU9 A;  1UJW B;  4LFA B;  4TQD A;  4DR1 B;  1XL4 A;  1M5I A;  1HNW O;  2F95 B;  2VWK A;  4EKW A;  3FB6 C;  1HR0 O;  4JI8 O;  1YXB A;  1CXZ B;  3JAW A;  3JAM N;  3JAK B;  1IBK B;  3H1I H;  1ZUQ A;  2WA4 A;  3RWR D;  4J80 A;  3P32 A;  4YJ3 A;  1IZ3 A;  2DYS C;  1XQ8 A;  2FB5 A;  3UT5 A;  3ZRS A;  4RUE A;  3HPL C;  4TWK A;  2EJR A;  4BAY A;  1I94 B;  1I94 O;  4MTF A;  1KC8 W;  2CE4 A;  3AK2 A;  1NTK H;  5CA1 A;  3UM7 A;  1Y4M A;  5FNV B;  3CCS V;  1XBL A;  5CA3 A;  5FPR A;  3TET A;  3W7W A;  2OCH A;  2CK3 G;  3WB1 A;  4LR3 A;  3ZMT A;  1S77 D;  3OMI B;  2E3C A;  4B7K A;  4GKJ B;  1WA8 B;  2XND G;  3CD6 V;  4FVM A;  4CH5 A;  4AQY B;  4AQY O;  2W6J G;  3WU2 Z;  4F6R A;  5JCO C;  5J2U A;  2R9R B;  3LNN A;  2JGD A;  3SGI A;  2E76 B;  3DC6 A;  4K0K O;  3WG7 C;  1MOF A;  1BCC H;  1AB3 A;  4DV7 B;  5LMN B;  5BMV B;  2CDY A;  3WFV A;  4DR4 B;  2Y0I A;  4DXW A;  5KA6 A;  3RBZ A;  4KFM A;  4O2B B;  4IIJ A;  3DSQ A;  2P90 A;  5KUK A;  2OTJ V;  2XAS A;  2PZS A;  2LFS A;  4I9W A;  3SJA C;  1UFI A;  3OMN B;  3ASO C;  1K92 A;  2O57 A;  3ASN C;  3FX7 A;  4FLT A;  2JJ1 G;  2R72 A;  5F2V O;  2HG5 C;  5LL6 Y;  3TJT A;  3JAS A;  4B3R B;  4B3R O;  1XMO O;  2V1D A;  4ICG A;  4F6E A;  2ZNJ A;  4YIO A;  3K79 A;  1OCR B;  1N34 B;  1PPJ H;  1K7D A;  3RYI B;  2BOC C;  3PN1 A;  4JYB A;  1GM7 A;  3H9V A;  5B3S B;  4DO2 A;  3IC7 A;  2GTS A;  2XAJ A;  3UO2 A;  4ZOL B;  3CRM A;  3K9S A;  3K5M A;  5A9G A;  2GDS A;  3F7Y C;  3HKB B;  3G6E V;  4DYL A;  3OR7 C;  2QM7 A;  3CSX A;  2HKO A;  4X62 B;  4AHC A;  4JAU A;  1N32 B;  1GMG A;  1GO3 F;  4YXW G;  1ZLZ A;  2OIE A;  1NU1 H;  2P67 A;  4JTC B;  5C8Y A;  3RFR A;  4K8X A;  3JCZ A;  2YEV A;  1H2N A;  1QHT A; 
#chains in the Genus database with same CATH homology
 3ABK B;  3ZN1 A;  4H33 A;  3CCQ V;  1QCE A;  5DM6 V;  2Y48 A;  5B1B C;  3I55 V;  2EIK C;  3CCU V;  2ITC C;  1JX9 A;  5IYB O;  4QPJ A;  4MW8 A;  4ASU G;  1YIJ V;  1BHB A;  1E1R G;  4R7C A;  4P2Z A;  2X7R B;  4KP4 A;  3MD0 A;  3QO5 A;  3E8F A;  2ZXW B;  4J9Y B;  4LC1 A;  1S72 V;  4PA7 A;  1GM8 A;  1QLE C;  2XAH A;  1SES A;  1YTF D;  2F43 G;  2A79 B;  1DLB A;  2OCC C;  3IGA C;  4U7O A;  2EIL C;  5B1A C;  1MAB G;  3STZ C;  3OUS A;  1VQ9 V;  4MVQ A;  1R3K C;  4ZBM A;  4WFB V;  1V55 C;  1S76 D;  2ZR2 A;  3CCJ V;  3FKS G;  4FIP C;  3VBB A;  2UXN A;  2DWD C;  4R6Z A;  3K08 A;  3K0D A;  5EBW C;  1VQM V;  1JJ2 U;  2ITD C;  1M1K W;  1Y66 A;  3W7S A;  3JD3 A;  3ETG A;  2C2A A;  3OE7 G;  3IFX A;  5L3C A;  3CXC U;  2JK5 C;  3AG3 C;  4ZKI A;  5B1B B;  4PEL A;  2JEU A;  1JQ0 A;  1JCH A;  2WLI B;  3ML0 A;  4MVZ A;  2QKS A;  5HFM A;  2HR3 A;  5IYD O;  1EFR G;  2WLJ A;  3TK1 A;  2LFR A;  2Q6A A;  4MVO A;  5CBF A;  3SPG A;  1Q81 W;  3ABM C;  3R65 A;  3E2E A;  4L87 A;  1K3E A;  3W7X A;  2NLJ C;  1PNM A;  3ZRV A;  2QEX V;  5LHG A;  2OCC B;  1JVM A;  5H6Q A;  2EIL B;  5B1A B;  3CPW U;  3CCR V;  2ZD9 A;  1S0V A;  1K73 W;  4U7N A;  3K04 A;  4OXS A;  1F4M A;  4PDV A;  5DN6 G;  3JD4 A;  4LP8 A;  1V55 B;  2A0L A;  3STL C;  1GM9 A;  3G4S V;  1ROP A;  1P4R A;  1I5Y A;  4JTD B;  3CCE V;  2PI5 A;  2JIZ G;  2WLN A;  3ZMV A;  4UUJ C;  2IW5 A;  3TCU A;  1F51 A;  4UVB A;  1DTO A;  4FK5 C;  3SPJ A;  1K5S A;  5LBQ A;  5H9C A;  1Q7Y W;  3LSS A;  4RO2 A;  1KKD A;  3RW0 A;  2W6I G;  1OCZ B;  3ZRW B;  3ZMS A;  3CC7 V;  1RM1 C;  1AI6 A;  1YJ9 V;  2IJH A;  1QVG U;  2OT5 A;  5L3E A;  3QNE A;  1OZ0 A;  5B1O A;  4F4L A;  3M99 B;  1AR1 B;  3AG3 B;  2IH1 C;  5EK0 A;  4QE7 A;  4KUM A;  2WLL B;  4WFA V;  4RQF A;  1AI4 A;  1KD1 W;  3SYA A;  3AEI A;  1M57 C;  4MTG A;  1NVP D;  3ABM B;  1IXM A;  1SRY A;  4TSF G;  2Z5U A;  1R3I C;  2ZXW C;  5GW7 A;  3K3W A;  4MTO A;  2LP7 A;  3ABU A;  4PDM A;  4RUF A;  3UKM A;  3ABT A;  4JPR A;  1RPO A;  2H94 A;  4HYO A;  3SYC A;  1NBM G;  3LDC A;  4XDJ A;  1R6N A;  5H6R A;  2Q69 A;  3CCV V;  3E86 A;  3CCM V;  1V54 C;  3MHH C;  2P6J A;  1R3L C;  2UXX A;  5IDJ A;  1M56 C;  2AHY A;  4QE9 A;  2P7T C;  2WPD G;  1QR9 A;  2GHY A;  5EBM C;  2HFE C;  2WLM A;  3E89 A;  4H37 A;  1Q86 W;  1VQN V;  4UVA A;  2DQ3 A;  1K34 A;  4HZ3 A;  2QTO A;  1RM1 B;  2D3O W;  4R50 A;  3HB3 B;  1EZJ A;  5L3G A;  4UVC A;  5L3B A;  3OAA G;  3ZMZ A;  3ETE A;  2EIJ C;  1VQ8 V;  5LHI A;  1TUE B;  1CEZ A;  1PKX A;  3OGC C;  3FB7 C;  4TT3 G;  1GK9 A;  1H8H G;  5CN0 A;  1M57 B;  1FFT B;  4JGS A;  2DWE C;  3LUT B;  3T4Z A;  1HWY A;  4WF9 V;  1J95 A;  4FJC C;  1VQP V;  1XL6 A;  1S3J A;  1DF5 A;  1W0J G;  3AG4 C;  1K8A W;  3B8N A;  1NQT A;  1THZ A;  2X6B A;  5FL7 G;  3LDD A;  2WLI A;  4CBC A;  5KUM A;  2IU0 A;  3SYQ A;  4PA3 A;  3I56 V;  1V54 B;  4G28 B;  2FTK A;  2DW4 A;  1QBZ A;  1M56 B;  4FMT A;  5IY5 C;  1CPY A;  1NH2 B;  3AG1 C;  4WFG A;  1M90 W;  2WAM A;  4P9P A;  1AJN A;  5BZB A;  1F4N A;  2WSS G;  2Q68 A;  2H8P C;  4BIU A;  5LGN A;  3CC4 V;  2XAQ A;  2ZDI C;  3OR6 C;  2DYR C;  1OHH G;  2DQ0 A;  1VQK V;  1QLN A;  3E8B A;  2R9I A;  1OCZ C;  2B1G A;  2EIJ B;  3JD2 A;  1S5H C;  2M7W A;  1K33 A;  4LBE C;  2EIN C;  4J9Z B;  2Y69 C;  3AG2 C;  2IJJ A;  4UV9 A;  5CBH A;  3ABL B;  4GX5 A;  1EBO A;  5HFL A;  5IYC O;  1K4D C;  3OEE G;  2IU3 A;  3AG4 B;  3ZRW A;  3ZIA G;  4Q20 A;  1OCC C;  4UXN A;  1G8M A;  4XDL A;  3FYI B;  5CMU A;  1FXH A;  4P30 A;  3ZRX A;  5EC1 C;  3OUF A;  3DGE A;  3T4D A;  1DF4 A;  4E2L A;  3OW2 U;  4X88 A;  5EC2 C;  1VQ6 V;  4FPP A;  1RPR A;  3E8H A;  1H2G A;  2QE7 G;  5IY5 B;  3AG1 B;  4GX2 A;  1AI5 A;  3SPH A;  4JTA B;  1NKD A;  4MTX A;  5J9P C;  1SET A;  1WPX A;  4GX1 A;  3EHB B;  2DYR B;  4MVR A;  2EZO A;  4RQE A;  3FB8 C;  1GKF A;  2NNU A;  1VQL V;  1FXK C;  2XAG A;  2EIN B;  1QVF U;  2Y69 B;  3QO8 A;  3ETD A;  4QNH B;  3AG2 B;  1AJQ A;  2X6A A;  5L3D A;  1VQ4 V;  4I5S A;  1H8E G;  4PDR A;  2Q67 A;  2A9H A;  3OMA B;  1UJW B;  3CC2 V;  1VQ7 V;  2PI4 A;  1R73 A;  3BEH A;  1OCC B;  3LDE A;  3JYC A;  1AI7 A;  2KB1 A;  1YTF B;  1XL4 A;  2WLH A;  3KG2 A;  1NR1 A;  3CME V;  2HJF C;  4QPK A;  4EKW A;  1N8R W;  1M9N A;  3FB6 C;  4CZZ A;  4XDK A;  3F5W C;  1CP9 A;  3CYO A;  1E79 G;  2BOB C;  3T2M A;  2JJ2 G;  5B1N A;  3K06 A;  3GWO A;  3ZJZ A;  2OTL V;  3LNM B;  4QJF B;  3P32 A;  3G71 V;  5C93 A;  4LCU C;  2IJI A;  2DYS C;  1FXK B;  2Z3Y A;  1R6K A;  3ZRS A;  4RUE A;  3HPL C;  4TWK A;  2EJR A;  3DTU B;  4PA4 A;  4BAY A;  5LGT A;  1YIT V;  1PD3 A;  1PNL A;  2ZR3 A;  3ABL C;  3QO7 A;  4MTF A;  1KC8 W;  4N23 A;  1FXV A;  1KP2 A;  1ARO P;  3SPC A;  3UM7 A;  3K9A A;  1WLE A;  1Y4M A;  3CCS V;  1SER A;  5LHH A;  1W2B U;  2JEX A;  5CA3 A;  3TET A;  3W7W A;  1QR8 A;  1SZT A;  4WFE A;  3X2Q C;  3FB5 C;  2EZP A;  2WWW A;  2CK3 G;  4N21 A;  2HVK C;  2B1I A;  1ZWI C;  3ZMT A;  4GX0 A;  1Q82 W;  4PA6 A;  3BY6 A;  1K97 A;  1S77 D;  3OMI B;  1MSW D;  4JAS A;  3W7T A;  2QM8 A;  3EFF K;  4HAM A;  2XND G;  3CD6 V;  2AHZ A;  2V7Q G;  1NJI W;  4G2K A;  4PA9 A;  5LGU A;  3W7U A;  3SYP A;  3CP1 A;  4BW5 A;  1JPX A;  2W6J G;  2YEV B;  2ATK C;  2IH3 C;  4JAV A;  2DYS B;  1FS0 G;  2JDI G;  3NXS A;  3SPI A;  3OEH G;  2R9R B;  1E1Q G;  3FYE B;  1L1F A;  2GSM B;  3PJS K;  2B5U A;  4P9O A;  2HVJ C;  2ZDI A;  1NVP B;  1K9M W;  2HLD G;  3WG7 C;  3F7V C;  1MOF A;  1F23 A;  1YHQ V;  4MVM A;  5CBG A;  1GTO A;  1VQO V;  2MK3 A;  1AJP A;  2WLL A;  3K0G A;  1OCR C;  3X2Q B;  2EBO A;  3WFV A;  2EIK B;  4DXW A;  5KA6 A;  1OCO C;  5E1A C;  4MSW C;  3K03 A;  3RBZ A;  1KP3 A;  4KFM A;  1BHA A;  5B3S C;  3RVZ A;  3LSQ A;  2P90 A;  5KUK A;  2OTJ V;  2ZQM A;  1ORQ C;  2XAS A;  3GB7 C;  2LFS A;  1YI2 V;  4I9W A;  2XOK G;  1COW G;  1QLE B;  3E35 A;  4BIZ A;  1ENV A;  3D3I A;  5KA5 A;  1LNQ A;  1YSC A;  4X89 A;  3SJQ C;  2QA4 V;  4G27 B;  4GT1 A;  3ZMU A;  5EBL C;  3OMN B;  3H01 A;  2IJK A;  5L3F A;  3ASO C;  3CMA V;  3T1C A;  2K1E A;  1G4Y B;  1K92 A;  3RVY A;  3ASN C;  1KQS U;  4MVS A;  3OM3 B;  2JJ1 G;  4RAI A;  3CCL V;  1NH2 D;  3B77 A;  2HG5 C;  2EIM C;  2YSU B;  4MW3 A;  4PDL A;  3WG7 B;  1KEC A;  1R3J C;  4WFF A;  1FXK A;  2V1D A;  2W0F C;  3B8M A;  3MHS C;  3ABK C;  3A0R A;  1MG1 A;  1YJW V;  1P7B A;  3K79 A;  3P30 A;  1OCR B;  4MS2 A;  4QIW F;  3SYO A;  1K7D A;  4JF3 A;  2BOC C;  4GCZ A;  4JYB A;  1GM7 A;  1OCO B;  3JD0 A;  5B3S B;  4DO2 A;  4WCE V;  1BMF G;  3IC7 A;  4R8C A;  2XAJ A;  4X8A A;  1W0K G;  4UV8 A;  3ZCC A;  3F7Y C;  3E83 A;  3JD1 A;  3G6E V;  3OR7 C;  1VQ5 V;  2WLK A;  2QM7 A;  2X0L A;  3ASO B;  2HKO A;  3E8G A;  1H38 A;  2XAF A;  1K4C C;  3ASN B;  4WFH A;  4JAU A;  3ZN0 A;  1PNK A;  1YJN V;  1GMG A;  1GO3 F;  3OFN G;  2X6C A;  4Z1M G;  1K5Q A;  4YXW G;  2EIM B;  1PL0 A;  1BL8 A;  4MVU A;  2P67 A;  4JYC A;  4XBF A;  4JTC B;  1B6Q A;  1JOY A;  4MT8 A;  3JCZ A;  2YEV A;  3D36 A;  3VOU A;  1NR7 A;  1I5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...