1JVMA

Kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic optimization of ion conduction rate by the K+ selectivity filter.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
total genus 34
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jvmA00
2WLLB 4JTDB 4R6ZA 2K1EA 2OCCC 2EILC 2WLLA 2WLKA 2WLJA 2X6CA 3F7YC 4MS2A 2HVJC 4X88A 4EKWA 2IH1C 1OCZC 4F4LA 3LDDA 3RVYA 3AG1C 3FB5C 3AG2C 3FB6C 3K0GA 4MVZA 4MVMA 4PA6A 3F5WC 3E8GA 4ZBMA 3T2MA 3SYQA 2NLJC 3VOUA 2X6BA 4MVQA 4J9YB 4PA4A 2HG5C 2Q6AA 4R8CA 3T4ZA 3UKMA 3LDEA 3IFXA 2EIMC 3GB7C 4GX2A 4WFEA 2BOCC 4HZ3A 5KUKA 3SPGA 3E86A 3K08A 4MW3A 3JYCA 4P9PA 5B1BC 4RUFA 1LNQA 3SPHA 2HJFC 5CBFA 1ORQC 2EIKC 2EIJC 3E89A 4RAIA 4KFMA 3ZJZA 3SYPA 4MVOA 3LUTB 4PA3A 5J9PC 2YEVA 3K06A 4LBEC 3OGCC 4HYOA 3EFFK 3RW0A 3E83A 4OXSA 3SYOA 5E1AC 5EK0A 3AG4C 2ZD9A 2DYRC 5B3SC 5EBWC 4WFHA 2A79B 2IH3C 5BZBA 4RUEA 4WFGA 2QTOA 4P9OA 2EINC 5IY5C 2KB1A 4BW5A 5EC2C 4R7CA 4JTCB 2W0FC 2WLMA 2ZXWC 2Q68A 3PJSK 3ASOC 4LCUC 4MTGA 4PDLA 5EC1C 3RVZA 1KKDA 3OR7C 2H8PC 5CBGA 1OCCC 1ZWIC 5EBLC 1S5HC 2A0LA 3IGAC 1JVMA 3AG3C 1R3LC 1XL4A 3OUSA 4XDJA 3E8HA 1R3IC 4MW8A 4PDMA 2AHZA 2JK5C 4GX1A 2QKSA 3ASNC 2DWEC 3SYAA 3ZRSA 1P7BA 4MVSA 4MVUA 4X8AA 1OCOC 3R65A 1QLEC 2DWDC 1R3KC 2HFEC 2WLNA 2WLIA 3BEHA 3SPJA 4QNHB 4MTOA 2Q69A 5EBMC 4DXWA 1G4YB 2A9HA 4I9WA 1K4CC 1J95A 5KUMA 2AHYA 2P7TC 2R9RB 3STZC 4PA9A 4MTFA 4XDKA 3FB8C 3TCUA 3X2QC 3LDCA 4WFFA 4TWKA 3SPIA 2ITDC 4UUJC 4G27B 3ABKC 4LP8A 4G28B 3K0DA 3K04A 1V54C 3HPLC 5B1AC 3LNMB 4RO2A 3SYCA 4X89A 1V55C 4XDLA 2Q67A 4GX0A 2WLHA 3ABMC 2DYSC 2ITCC 3RBZA 4QE9A 4CBCA 2BOBC 3STLC 2WLIB 4PA7A 3T4DA 3OUFA 1XL6A 3T1CA 3KG2A 5CBHA 1K4DC 4GX5A 4MVRA 2Y69C 3UM7A 2ATKC 3E8BA 1OCRC 3K03A 4QE7A 4J9ZB 1M57C 3E8FA 3FB7C 3WG7C 1R3JC 4PDRA 4H33A 1M56C 3OR6C 3TETA 3SPCA 4JTAB 2HVKC 4PDVA 4R50A 3F7VC 4H37A 3SJQC 4MSWC 1BL8A 3ABLC 4P30A 4P2ZA 2X6AA
chains in the Genus database with same CATH superfamily
2YC0A 1MOFA 2E75B 2R9AA 2HVJC 4FK5C 1R1BA 3ZIAG 4EFBA 3ETGA 3AG1C 4LF4B 4X62O 1XREA 2BTQA 3RYFB 3K57A 1FXKC 2YXHA 3JD2A 2YUAA 1PL0A 1BGYH 4UCRA 2N05A 4RAIA 1IBKO 1VF6C 5HFLA 1QLEB 2YS8A 1WAZA 4Z1VA 3NXSA 1XBLA 2JDIG 5JVDA 1YITV 4JTCB 2ZXWC 2JJ1G 2P90A 4UCTA 1EN6A 5EBLC 4MW8A 3CB2A 1Z2GA 1GAXA 5L3EA 1S5JA 1KP2A 4K0KO 1LUWA 2JGUA 3OE7G 3RT3C 2WLIA 3BABA 1GM7A 2C2AA 1HR0B 2QE7G 2PI5A 3ZN0A 3AK1A 3STZC 5B5EZ 1Y66A 1PV0A 5EZYA 5LHGA 3K04A 4TV8A 2EULA 4D7TA 1J5EO 4LF6B 1S0VA 1HDJA 2F1MA 3A0HZ 4QE9A 5LP6A 1XUQA 3T4DA 3T1CA 4U3JB 1SRYA 3AG7A 2CH7A 3RYFA 2ATKC 2RNBA 3L70H 1M4UA 3JAMN 4JI6B 1OCZB 5LMNB 2WWWA 1PPJH 2G38A 2FMLA 4PDVA 4H37A 4J7JA 4R50A 3OTOO 1N34B 2UXBB 4GKJB 2X6AA 3UT5B 2FTKA 2D3OW 4DV6O 3JASA 2ILMA 2X6CA 4UB6Z 4EKWA 1U96A 4WCEV 3MAQA 1NZ6A 3JD0A 4GYCB 1DLBA 1I5YA 2QGNA 4YJ3A 2EBOA 2R70A 1FKAO 2UUCO 4WF9V 3JCUZ 4JI3O 3UKMA 4GX2A 1H2LA 4HZ3A 1OV9A 2M7WA 4JF3A 1Z5WA 1M9NA 3ICXA 2GTAA 1K5QA 2CGNA 2DN9A 1P84F 1VF6A 2ZD9A 2DYRC 2KQXA 1IZ3A 1VQ9V 1WLEA 4DV1B 4O2AA 1IBKB 1NVPB 4IHJA 3EHBB 3TK1A 2IU0A 4TT3G 4B3RO 1Q86W 1I08A 2UXXA 1Q90D 2KG7A 2Q9LA 3MDSA 4WBNA 3I55V 1AJPA 2FB5A 4I50B 5JWPA 1Y4MA 2P67A 3CWBH 4QNHB 2QWNB 1NTKH 1V54B 3ZMUA 2P7TC 1Q43A 3SPIA 4EB6B 3LNMB 4CS2A 3UT5A 3D36C 1RSOB 4H0LB 1K97A 4DW1A 4FM0A 1BE3H 3RBZA 1Q6IA 4Z1MG 2WA4A 4FM2A 4LWSB 4QE7A 3K03A 4ICGA 3E35A 3ZN1A 3WG7C 1M90W 3KKYA 2XAGA 2CTQA 2VQFO 5BR8B 4K35A 4I9QA 1YCIA 4GKKB 2WLLA 4X88A 3BPZA 1BHAA 5C8YB 3ABKB 3N27A 2XNDG 1YIJV 4DR5O 4JI0B 3E8GA 3ZHRA 3QO8A 4X66O 1CP9A 4AHCA 2EIKB 2EIMC 3MHSC 4FIPC 3CCMV 5LP6C 3VQXA 2HLDG 1YJWV 2IW5A 4DK0A 4YHHO 3SYPA 3FAVB 3GWOA 1SESA 4DV4O 5KHJA 4HYOA 2QM7A 4OXSA 1FAFA 5IE9A 3ZS8C 3RYCB 1H2KA 1T5EA 3IJ4A 5KMGA 4LFAB 3AG1B 4N21A 4FFBA 3CCUV 4X20B 3BHPA 1HW7A 1OCRB 5LGTA 1XQ8A 1H2SB 3OUSA 1IBLO 4UVCA 4NTXA 3CC7V 1P7BA 4JAUA 1NQTA 2JIZG 3SPJA 1TA8A 5J2TA 4PHZA 1Q81W 1QNMA 1JJOA 2AZ0A 3IAYA 4G27B 3ABKC 5IT9N 3JAWB 2GUZB 1BQZA 3S3WA 4GX0A 1AVMA 2PTMA 5JJJB 4F6RB 1GN4A 4JI4O 2Y69C 3UM7A 3E8BA 3ZBHA 3I5DA 3OR6C 2PF4E 3QF7A 3B09A 3DC6A 3WB0A 1PNMA 4CS3A 2CTWA 4U7NA 4NXNO 4CH4A 4UB8Z 4LF9B 2EILC 1L8DA 1JFFA 3J7AU 2R72A 4TV9A 4U3JA 5LMUO 1SERA 4LC1A 5JH7A 1R6TA 1KMIZ 2ZE8A 2ZT9B 1N4CA 1RFYA 1XMQB 4IHJB 4NYKA 1IXMA 3H1KH 4FLTA 3ZJZA 5JCOA 1D2DA 2RDCA 3LUTB 3J80N 1WP8A 4JI2O 4DR4O 3CPWU 2ETNA 3SYOA 4YJ3B 3AG4C 3L71H 5B3SC 4IYIA 5FPRA 4DR2B 4YJ2B 4DR6B 3P3PA 2ZR2A 2XASA 2W0FC 3B40A 2N74A 4FLUA 3QVNA 4UFZA 3U11A 1XNQO 3THOA 3QNEA 2DWEC 3JD4A 4JASA 4X8AA 1OCOC 4GCZA 2DWDC 1AR5A 4JYAO 4OPHA 2A9HA 2AGAA 1J95A 4X1IB 2QJ1A 3U10A 1DF5A 4WBNB 4DV4B 3OGIB 4JYCA 4TQDA 2Y0PA 3LSSA 1NJIW 1WN7A 4DRXB 4DW0A 4IT5A 4CBCA 3STLC 1VQ6V 1W59A 3CCSV 5JJEB 1WB8A 5FPOA 4CH3A 2E3CA 4E4EA 4G2KA 3D3IA 4MSWC 1YJNV 2HP8A 2WLKA 1M5IA 3F7YC 5B3SB 4JPRA 2QTSA 1OCZC 3C90A 3B8MA 1HNWO 3N2KA 2P4VA 1N34O 3VOUA 3K58A 1FFXA 5LMNO 2HKOA 4J9YB 1MG1A 2IU3A 2CTRA 5JQGA 3ZCCA 3SPGA 3HKDB 3T1YB 1I5XA 3GWKC 4OGQB 4HNAA 1NVPD 2ADPA 3H1LH 4DV3O 1FXVA 1J5EB 1VARA 3W7WA 2MK3A 3ZRVA 3ASOB 1SS3A 1HNZB 4LCUC 1US6A 3CSXA 4LF7B 4O4HB 4K0KB 1URFA 3ZMTA 1TUEB 1N8RW 3E2EA 1LUVA 2F43G 1NTZH 4W4KA 1RPRA 5LA6A 1R73A 3DTUB 4IIJB 2LGQA 4LNUB 3SJCC 3ZHQA 4MTOA 2W6IG 3B77A 3G71V 1KC8W 4PA9A 4TV8B 2X7RB 4G28B 1GN2A 5GONB 1FYJA 3CJHB 4ZIBA 1F4MA 3RYHA 3ZRWA 1KECA 3KZIZ 4X89A 1QU7A 5LP6B 4ZI7A 2BOBC 3CRQA 1SQFA 3TXSA 1M56B 3RN4A 1YSCA 2CH7B 2PI4A 2WAMA 3ZHTA 4UCSA 2UXCO 1YHQV 1H38A 1ZTEA 4YIPA 4B3SO 3RYIB 3AK3A 2QA4V 4P30A 3ZMZA 1IBLB 2B1GA 1EBOA 1IURA 2ZR3A 1ZUQA 3HB3B 1COWG 4PD4F 3WG7B 3FB5C 3K0GA 4MVMA 4LFAO 1K3EA 3UQ8A 3DGEA 4FJCC 4MVQA 2HG5C 3IFXA 5HFMA 2ZIOA 3GB7C 2OCHA 1M1KW 4LR3A 3JYCA 1G6UA 4ZKIA 1AI5A 1ORQC 3IC7A 1S5LZ 4LF7O 2GV9A 1QHTA 2QKCA 5A9GA 3L9DA 4LFCB 3TJTA 2ZM6O 1KUQA 4UV8A 1SQVH 4JI5O 5KLVH 5KMGB 4OX9B 1SC5B 4O2AB 4WFGA 3QO5A 3CCRV 2PUSA 1DF4A 1VQ4V 4B7EA 5KHKA 3IGAC 4BIOA 3CJHA 2H3OA 3PN1A 3OMIB 5KAFZ 3BRCA 1IX9A 4DO2A 1L0NH 3RWRD 2B9ZA 5CA1B 5GTIZ 4E2LA 2EIJB 3MD0A 4FFBB 2CE4A 1GMGA 3RGBA 2H94A 2NNUA 4DV3B 4UUJC 1N36B 3HKBA 1QR9A 4XDLA 2Y48A 1YTFB 3JASB 2ITCC 2P6JA 3OT7A 1AR1B 3MHHC 4NVPA 1M57C 3BA9A 4LWSA 5IDJA 1YXBA 2F66C 4IYHA 1OZ0A 4F6EA 2UU9B 4BWAA 2UUBB 4MS2A 2QM4A 2Y0IA 3FYEB 2HR3A 2LO1A 2JS3A 1WB7A 3SR2C 3P3NA 2RQ6A 1IXBA 1EM1A 1YEWA 2IJHA 1AJNA 5B66Z 1KQSU 4JI4B 2GTSA 5KUKA 4DK1A 1SQPH 4ZOLA 2O57A 1BQ0A 5EYPA 2IM9A 2EIJC 1D5NA 5EYPB 3F5TA 2YEVA 1P49A 1WA8A 4JI1O 4DV2O 1XMOO 5CA1A 2Q5ZA 2VWKA 2RCVA 5IY5C 1KP3A 2LFSA 5F2VO 4DR4B 1WNSA 4PDLA 1XNQB 5EC1C 1FD9A 2GHYA 4J42A 4DUZO 2AXTZ 3ETDA 2A0LA 4TUYA 4YY3B 3K5LA 2AW9A 2QKSA 4I0XA 4MVUA 2LFRA 2QEXV 3UCSC 4I0XB 1Z5VA 1QVFU 4O4IA 5LMUB 1XDCA 1SQXH 3Q4HB 4X65O 1EN4A 4XBFA 1AP5A 2VWJA 3QO7A 1NT2B 3C3TA 2MW2B 4EB6A 4B7KA 2Q67A 1HNZO 1HP8A 3DXRA 2DYSC 1XMQO 1WPBA 1AB3A 1MA1A 3CCVV 4OX9O 2QDOA 3JSLA 3CMAV 1I7FA 4LFBB 3U0ZA 4JI5B 1YTFD 2YIDA 4DV5O 1SETA 2BSKA 3AG2B 5GTHZ 2LQTA 1NKDA 4WFEA 3RYHB 3ZRWB 2A06H 1IVSA 4KL1A 3RFRA 3CP1A 1KYOF 1S77D 1MABG 1DTOA 3LDDA 1SZXA 4MVZA 1DGSA 1WA8B 2NLJC 5IYBO 4PA4A 4GZRB 5B1AB 5IYCO 2ZNIA 4D6TH 1QLNA 3G4SV 2XAJA 1B04A 5DEDA 3SPHA 5H6RA 5IYDO 2Q7HA 2JRIA 3A0BZ 4X64O 1QQCA 2YXLA 2GDSA 3FAVA 1NTMH 1XHXA 2YEVB 1RM1C 1H2NA 3K9SA 1PD3A 1JMKC 2OIEA 3CCJV 3OEHG 2YICA 5FLXN 4O4JA 2QTOA 2HHHB 4P9OA 4QIWF 4JI1B 4X62B 4DV2B 1XMOB 3JALA 2XTAA 2DYSB 3ASOC 1QBZA 2L35A 4AILC 1R3LC 2R9IA 2RN9A 4GX1A 1ENVA 4FZ0A 3ZRSA 5K1PA 4FPPA 2Q4PA 4LNUA 5L3DA 2B5UA 2WLNA 3ML0A 1G1XB 1GK9A 5GONA 2WPDG 3JD1A 1Y74B 4LP8A 3CRAA 2OIGA 3BY6A 1V54C 1TVKA 2P5OA 3SYCA 4CS4A 4DR1B 4IIJA 3OM3B 4DR6O 1L0LH 1PNKA 5CBHA 2E74B 4FMTA 4GX5A 4J10A 3W7XA 1PM9A 5IWAB 3E8FA 3HKCA 1VQPV 2VQEO 1N36O 5H9CA 4DR3O 1YJ9V 4FM1A 4UVAA 1H8EG 5IYZA 5GW7A 1DK1A 2OTLV 1GO3F 1AR4A 4Z2WA 5IYZB 5BR8O 2GBOA 2RJZA 1Y67A 3EVKA 5IJ9A 2BTQB 3RVYA 3AG2C 5DN6G 1FXKB 3K5MA 4JI7B 4R8CA 2FKXA 5IJ0B 3QTCA 1K7DA 1VF7A 4TOIA 5IJ0A 3WU2Z 4MW3A 5CN0A 2EIKC 2VQEB 1SA0A 4KFMA 5CB4B 3K06A 4B3RB 1EZVH 4KHPO 2KKWA 2KSDA 5LGUA 4DV5B 2F23A 2ZE6A 3I56V 4LFCO 2EINC 1BCCH 2VRZA 1HR0O 1M93A 4D7SA 4LF5O 3Q4HA 3RVZA 5BMVB 2H8PC 5CBGA 3N2GB 1IDSA 1S5HC 3CMEV 1XL4A 1RM1B 3KCYA 1KBHA 4X1YB 1YZBA 1G4YB 4QJFB 4IL6Z 1YDXA 4XDKA 1GRJA 4X1IA 1BT8A 3BA8A 4UCVA 3HPLC 2Y4UA 3A0RA 1RSOA 5KAIZ 1B6QA 4Q6GA 3LSUA 3KG2A 2Q73A 1W2BU 4MVRA 2K9PA 1VQKV 3FB7C 2DQ0A 4H33A 4DR7O 3SPCA 4H13B 3FYIB 1M57B 2GUZA 4CC5A 2WLLB 2YXYA 3AK2A 1NR7A 1WP7A 1JQ0A 1SA0B 1SQQH 2JEXA 2UXBO 5CA3A 2YIAA 3FB6C 1AI4A 1N33B 4BAYA 2LGWA 2ZQMA 4DR5B 1R6KA 2DMXA 4DYLA 3CEIA 5JVDB 1JX9A 3HR0A 2LJ2A 4LF9O 3K08A 1H8HG 1ZSPA 4GKKO 1IBMO 3L72H 2CK3G 3N2GA 4I4TA 3J81N 4CC6A 4YXWG 4HNAB 3T1HO 3L75H 2A79B 5BZBA 1OCCB 2RMKB 1Q8IA 1SQGA 1V9PA 2DW4A 3H9VA 5EC2C 4R7CA 4DV0O 2ADQB 1ZLZA 2V4DA 5H2FZ 4JGSA 2IJIA 5LBQA 1OCCC 1ZWIC 5LHHA 4UCUA 4C7UA 3SDLA 2JK5C 3ASNC 4JI7O 3DC5A 5LA6B 5LYJA 1V55B 3WB2A 4KP4A 2FYUH 1S76D 3VBBA 1AROP 1JPXA 1XNRB 1FPOA 5FL7G 4B08A 4GUNA 1NBMG 1N32B 4JZGA 4PELA 1MSWD 2OYQA 2ODMA 2ZXWB 4F6RA 5KX5A 4PA7A 5LL6Y 3FX7A 1K4DC 5KA6A 4QPJA 4TSFG 4ASUG 1UJWB 2HVKC 3JAWA 3HKDA 2UXDB 1TAEA 3CRCA 3SGIA 3H01A 4R6ZA 3CE2A 4BIUA 2HEPA 4FFKA 4QPKA 3OD4A 5C8YA 3APOA 3SJAC 2EIMB 2JS5A 1ROPA 4CH6A 1KD1W 3A8TA 1UFIA 4A5UB 4TQFA 5EIBC 5B1BC 5H5NA 2HJFC 5L3GA 2XUMA 2VQFB 2PY5A 2XT9A 4TV9B 1IBMB 3G6BA 3C3SA 3RYCA 3FD9A 4KUMA 3WB1A 5EBWC 3R66A 4X9QA 1NI8A 4DV7B 1NH2D 4UV9A 3OEEG 4DUYO 1LR1A 3CYOA 3OW2U 2QWQB 3CXCU 4XDJA 3BCCH 4GKJO 1XHZA 3ETEA 5J2TB 1AI7A 1PKXA 2BE3A 3JALB 5L3BA 5LYJB 3K5OA 3W7SA 1K8AW 3X2QC 1N0JA 3OMAB 3FB8C 4U7OA 1GTOA 3RYIA 4L87A 2WSSG 3G67A 5B1AC 1AJQA 1ZL8B 1V55C 4CH5A 5FNVA 1NR1A 4FLWA 3ZEDA 3IC9A 5L3FA 4JV5B 2WLIB 1JCHA 1S3JA 2EZPA 1TGOA 2BSKB 5KHHA 4J7ZA 4K8XA 2D2CB 4OPAA 2CTPA 3KCXA 5H6QA 4GLXA 3F7VC 1PL4A 1L1FA 1EZJA 4AI8A 4X65B 1RPOA 4FLVA 3H1IH 3T1YO 1JJ2U 2L6LA 3G80A 3N2KB 1FXKA 2YIBA 3K9AA 3F5WC 1GN6A 3CCEV 2CGOA 2E5LB 2YSUB 2E76B 4MT8A 2BOCC 3W7UA 4PI0A 3E86A 4EEQA 2DJVA 2B1IA 3ZMSA 1CXZB 2AZ2A 3ZHUA 4EFEA 3JCZA 2ZCEA 5BXZA 2UUAO 1KKCA 3RW0A 2IH3C 4RUEA 1VQ7V 1W0JG 3QG5A 1EN5A 1WJZA 4UVBA 4X1KB 4YHHB 3APQA 4O4HA 2QWPB 2Q68A 5IY5B 1UPGA 5J2UA 1Q6HA 3HKEA 3P32A 1NH2B 1BMFG 4FLXA 4TUYB 2NR5A 2P22C 3SYAA 1XI1A 1SF9A 1R3KC 5KX5B 4DV0B 2Q69A 4WFBV 4AQYB 4I9WA 1GM9A 4JI0O 1K4CC 2ZE5A 5CMUA 2UUBO 4TWKA 2QSAA 3BFRA 3L73H 1VMGA 3K0DA 1BZKA 2IJKA 1X4TA 2F93B 1O9GA 2JVDA 1MZEA 3FFQA 5DM6V 3ZMVA 1SKVA 2WA3A 4QGPA 2QWOB 3O65A 1XL6A 2XHBA 4DR2O 2F95B 3L74H 2Q7GA 1OJHA 3W7TA 4AQYO 2QWRB 4JYYA 4JI2B 3ABLC 3BVOA 1OHHG 2CAZC 3DSQA 1FJGO 4ZOLB 1VEWA 4LF8B 5A2QN 2DOSA 4ZHQA 4NXMO 5D5QA 1VIBA 4RQEA 3CCQV 1AI6A 4PA6A 1JFFB 3K79A 4JAVA 3CHXA 2JEUA 4O4JB 3FKSG 3ABMB 5K1XA 2F4VO 4Q20A 1X59A 1LNQA 1VQNV 1NS1A 2EJRA 1TUBB 2UUAB 5LXTA 3OGCC 4J80A 3EFFK 4K8ZA 1N0NA 3AEIA 5JCOC 4DV1O 4NTYA 4B3TO 3G6EV 2LP7A 4BIZA 2XAQA 2YI9A 2E5LO 3CXHF 3NR7A 1QVGU 5BMVA 2WLMA 3CC2V 1TVKB 1JVMA 3AG3C 4HAMA 3E8HA 5B1BB 1B3QA 2AHZA 4CZZA 1BSMA 4MVSA 4X1YA 2EINB 4JI3B 2HFEC 1S72V 1F51A 3H1HH 5KUMA 3M7MX 3ASNB 4DV6B 4LFBO 1U97A 4FVMA 1ZAUA 3HKBB 5LHIA 2M6YA 4JV5O 3OTOB 2UXNA 4KHPB 2OCCB 4JI6O 3O9OA 4J7KA 2Z0AA 2UXCB 2FL4A 2ZE7A 4LH7A 1SZTA 1NU1H 3K3WA 4NKGB 2ZIMA 1OCRC 1Y6XA 5JH7B 2IBZH 4LF6O 3OMNB 3SJQC 1Q3EA 3UO2A 4JTDB 5FNVB 1A32A 1VF5B 2IJJA 2PGGA 4NB5A 2LW7A 4U3FH 1JOYA 4LF8O 1K33A 5LGNA 3JATA 4ZBMA 3SYQA 1I0HA 1AP6A 3JATB 3T4ZA 2DYRB 3CCLV 3AG4B 4PV1B 1R6NA 3ABTA 2JJ2G 4NXNB 4P9PA 1HNXB 1YI2V 4DR1O 2EJ7A 4MVOA 4PA3A 4H44B 4LBEC 5LXTB 4I4TB 3JARA 4JAAA 2Y69B 1FXHA 4X20A 4YIOA 2OWOA 1VQ8V 2A7WA 5KHIA 2KG7B 4MTGA 3JAKA 1O9HA 4B3MO 1Y74A 3VQWA 2F4VB 1AILA 1QR8A 4LF5B 2UXDO 2Z3YA 1GM8A 5EIBD 2A3QA 4YJ2A 3BEHA 4O4IB 1HNWB 3D36A 2YDEA 5EBMC 5L3CA 1VP7A 5ITZA 4I55A 3GVMA 2LW1A 5ITZB 2PYJA 3LDCA 5LOVB 2YIBD 3D3QA 2ITDC 2EX3A 4NXMB 5DECA 3HKEB 5AG2A 4KXRA 3TGUH 4ZHQB 1F4NA 4X64B 4O4LA 3OUFA 1XNRO 1W0KG 1K34A 1F23A 3CC4V 1H2GA 3LNNA 1R3JC 1M56C 1K5SA 3TETA 4UCOA 4UXNA 1MMMA 3B4SA 2OCCC 2WLJA 4DRXA 1HNXO 1G8MA 4FZ1A 4B3MB 2Z5UA 1Y76A 2PZSA 2Q7EA 4DR3B 2IH1C 4LH6A 1Y76B 3SJBC 4JZ2A 2Q0AA 4F4LA 5C93A 2CDYA 3TXQA 3JARB 5JJNB 1D5AA 2X6BA 3ETQA 1VQOV 3T1HB 4RWUA 1SQBH 5CBFA 2ZM6B 3E89A 2X0LA 5KHGA 1P7GA 3ABLB 4I50A 1BHBA 2XAFA 2JGDB 4IGGA 3ZX6A 1K92A 5CA0B 2JGDA 4WFHA 1YVWA 5CA0A 4WFAV 3B8NA 4NR1A 1F7YA 4X1KA 1N33O 4I7ZB 4I55B 1E1RG 2XAHA 5KA5A 1TUBA 3ZRXA 3VQVA 2GSMB 4RQFA 2V1DA 3K59A 2CUGA 3JAKB 1GH6A 1WPXA 4PDMA 4BW9A 2DQ3A 4DUZB 3OTFA 3D8CA 4O4LB 2HHHO 4GT1A 4DR7B 4MTXA 4B3SB 3OFNG 2R9RB 4MTFA 4N23A 3CD6V 1PP9H 4WFFA 2PYLA 3EXAA 1HWYA 1H2MA 5J2UB 1EFRG 5LOVA 4RO2A 1MNGA 2ZDIC 3ABMC 2Q0OC 1ZL8A 3JD3A 4K3AA 1I94O 4FLZA 1PNLA 1RP3B 3AG3B 2QM8A 3CRRA 1GN3A 1Q6UA 1K73W 1I94B 2Q8VA 2ARHA 1MSDA 4J9ZB 2OT5A 5EZYB 3E22A 4L8JA 4P2ZA 1KB9F 4HBNA 3T2MA 2K1EA 1YF2A 2N04A 1Q7YW 1QCEA 5B1NA 5IJ9B 3LSQA 4ABMA 1XEQA 3CRMA 1VQMV 2UU9O 2UUCB 1THZA 3ABUA 4JYBA 1JA8A 1B06A 3M99B 2Q6AA 3LDEA 4PI2A 4LF4O 2BTOA 4B3TB 2Y4TA 1JR9A 2XOKG 4RUFA 4I5SA 1CEZA 1ZX3A 2ZINA 3A2FA 2YI8A 5J9PC 2NN4A 1K9MW 5B1OA 1E79G 1N32O 2EZOA 1P4RA 3E83A 5E1AC 5EK0A 1FFXB 3CX5F 5E79Z 1Q5OA 4J41A 3ZHSA 4JI8B 2BCCH 2EILB 2P06A 2HJDA 5D5PA 5JQGB 1OCOB 4J11A 1E1QG 2KB1A 4BW5A 4FLYA 1XOUA 3WFVA 2OTJV 3PJSK 3UO3A 4YY3O 1KKDA 3OR7C 5CB4A 2DE0X 1CPYA 1FJGB 1R3IC 4DUYB 1BS3A 4X66B 3P30A 2VS0A 3R65A 1QLEC 5IWAO 4DV7O 4BR6A 4W4LA 4DXWA 1KU9A 3OAAG 1GKFA 3H1JH 2ZKOA 2AHYA 3TCUA 3ZHVA 1XILA 2P4KA 2W0XA 3BAAA 3X2QB 3E22B 5TISZ 2V7QG 4O2BB 4ZI7B 4O2BA 2WLHA 3K5NA 3S3XA 3JSNA 3VQYA 3DXRB 5BY1A 1VQ5V 1MZFA 2ZDIA 1FFTB 2QR4A 3M8AA 3CS5A 3HKCB 3B2EE 1FS0G 2W6JG 2QKAA 4JI8O 4PJ0Z 4PDRA 4NTWA 4JYAB 4JTAB 1VQLV 1BL8A 2ZNJA 1Q82W
chains in the Genus database with same CATH topology
1OHHG 1YJ9V 4UVAA 1H8EG 2WLKA 5GW7A 3F7YC 1MOFA 5B3SB 1GO3F 2HVJC 4FK5C 2OTLV 4JPRA 4RQEA 3ZIAG 1OCZC 3CCQV 1AI6A 3RVYA 3ETGA 3B8MA 3AG1C 3AG2C 4PA6A 5DN6G 3VOUA 1FXKB 3K79A 2HKOA 4JAVA 4J9YB 4R8CA 1MG1A 1FXKC 2JEUA 3JD2A 2IU3A 1K7DA 3ZCCA 1PL0A 3FKSG 3SPGA 3ABMB 4MW3A 5CN0A 4Q20A 1I5XA 1LNQA 1VQNV 2EJRA 2EIKC 4RAIA 4KFMA 5HFLA 1QLEB 3K06A 3OGCC 1NVPD 1FXVA 3EFFK 3NXSA 3AEIA 3G6EV 5LGUA 2LP7A 4BIZA 2XAQA 3W7WA 2MK3A 2JDIG 3I56V 1QVGU 2EINC 3ZRVA 3ASOB 1YITV 4JTCB 2WLMA 2ZXWC 2JJ1G 3CC2V 2P90A 4LCUC 3RVZA 2H8PC 5CBGA 5EBLC 3ZMTA 1S5HC 1TUEB 3CMEV 1N8RW 1JVMA 3AG3C 4HAMA 1XL4A 3E8HA 4MW8A 5B1BB 3E2EA 5L3EA 2AHZA 2F43G 1KP2A 1RPRA 4CZZA 1RM1B 4MVSA 3OE7G 1R73A 2EINB 3DTUB 2WLIA 2HFEC 1GM7A 2C2AA 4MTOA 1F51A 1S72V 2W6IG 3B77A 2QE7G 3G71V 1G4YB 1KC8W 4QJFB 2PI5A 3ZN0A 5KUMA 3STZC 4PA9A 4XDKA 1Y66A 3ASNB 2X7RB 5LHIA 4G28B 5LHGA 3K04A 3HPLC 2UXNA 2OCCB 1F4MA 3ZRWA 3A0RA 1KECA 4X89A 1S0VA 1B6QA 4QE9A 2BOBC 1M56B 3T4DA 1YSCA 3T1CA 2PI4A 2WAMA 3KG2A 1SZTA 1SRYA 3K3WA 1W2BU 4MVRA 2ATKC 1OCRC 1YHQV 1VQKV 1H38A 3FB7C 2DQ0A 4H33A 1OCZB 3SPCA 2WWWA 4PDVA 4R50A 4H37A 3OMNB 3SJQC 3FYIB 1M57B 2QA4V 1Q82W 4P30A 2X6AA 3ZMZA 2B1GA 2WLLB 1EBOA 2FTKA 4JTDB 2D3OW 2ZR3A 2X6CA 1NR7A 2IJJA 1JQ0A 2JEXA 4EKWA 3HB3B 1JOYA 4WCEV 5CA3A 1COWG 1K33A 3WG7B 5LGNA 3JD0A 3FB5C 3FB6C 3K0GA 1DLBA 4MVMA 1AI4A 1I5YA 4ZBMA 1K3EA 3SYQA 2EBOA 4BAYA 3DGEA 4FJCC 4MVQA 3T4ZA 2HG5C 4WF9V 2ZQMA 2DYRB 3UKMA 1R6KA 3IFXA 3CCLV 3AG4B 5HFMA 3GB7C 4GX2A 1JX9A 1R6NA 4HZ3A 3ABTA 2JJ2G 3K08A 1M1KW 3JYCA 1H8HG 4P9PA 4ZKIA 1AI5A 2M7WA 1YI2V 4JF3A 1ORQC 2CK3G 1M9NA 3IC7A 4MVOA 4PA3A 1K5QA 4LBEC 4YXWG 4UV8A 2ZD9A 2DYRC 2A79B 5BZBA 1OCCB 2Y69B 1FXHA 4WFGA 1VQ9V 1WLEA 2DW4A 3QO5A 3CCRV 1VQ8V 1NVPB 1DF4A 5EC2C 3EHBB 4R7CA 3TK1A 2IU0A 4TT3G 4JGSA 4MTGA 1Q86W 2UXXA 2IJIA 5LBQA 1VQ4V 1OCCC 1ZWIC 3I55V 5LHHA 3IGAC 1AJPA 1QR8A 3OMIB 1Y4MA 2JK5C 3ASNC 4DO2A 2P67A 2Z3YA 1GM8A 4QNHB 3BEHA 1V55B 4E2LA 3D36A 5EBMC 5L3CA 4KP4A 1V54B 2EIJB 3MD0A 3VBBA 1S76D 1AROP 1JPXA 3ZMUA 2P7TC 1GMGA 5FL7G 2H94A 2NNUA 3LDCA 3SPIA 2ITDC 4UUJC 1NBMG 3LNMB 1QR9A 4PELA 1MSWD 4XDLA 2Y48A 1YTFB 1K97A 2ITCC 3RBZA 2ZXWB 1F4NA 4PA7A 4Z1MG 3OUFA 2P6JA 1W0KG 1F23A 1K34A 3CC4V 1K4DC 5KA6A 4QPJA 4TSFG 1AR1B 3MHHC 1H2GA 4QE7A 3K03A 4ASUG 1M57C 3E35A 3ZN1A 3WG7C 1M90W 1R3JC 1M56C 1K5SA 5IDJA 2XAGA 3TETA 1UJWB 2HVKC 1OZ0A 4UXNA 3H01A 4R6ZA 2OCCC 2WLJA 2WLLA 4X88A 1BHAA 1G8MA 4MS2A 4BIUA 2Z5UA 3ABKB 4QPKA 2IH1C 3FYEB 2HR3A 4F4LA 2XNDG 5C93A 1YIJV 2EIMB 3E8GA 2X6BA 1VQOV 3QO8A 1CP9A 1ROPA 2EIKB 1KD1W 2IJHA 1AJNA 2EIMC 3MHSC 1KQSU 5KUKA 4FIPC 3CCMV 2HLDG 5B1BC 1YJWV 2HJFC 5L3GA 5CBFA 2EIJC 3E89A 2IW5A 3SYPA 2X0LA 3GWOA 2YEVA 1SESA 3ABLB 4HYOA 2QM7A 1BHBA 2XAFA 4OXSA 1K92A 4KUMA 5EBWC 4WFHA 4WFAV 3B8NA 1NH2D 3AG1B 4N21A 4UV9A 3OEEG 5IY5C 3CCUV 1KP3A 1E1RG 2LFSA 2XAHA 5KA5A 3ZRXA 4PDLA 2GSMB 1OCRB 5EC1C 2GHYA 4RQFA 5LGTA 3CYOA 2V1DA 3ETDA 3OW2U 2A0LA 3CXCU 1WPXA 3OUSA 4XDJA 4PDMA 4UVCA 2DQ3A 2QKSA 3ETEA 3CC7V 1P7BA 4MVUA 2LFRA 4JAUA 1NQTA 2JIZG 2QEXV 3SPJA 1AI7A 4GT1A 1PKXA 4MTXA 1QVFU 5L3BA 1Q81W 3OFNG 3W7SA 1K8AW 2R9RB 3X2QC 4MTFA 3OMAB 3FB8C 4N23A 3CD6V 4U7OA 4WFFA 4XBFA 1GTOA 1HWYA 3QO7A 4G27B 3ABKC 4L87A 1EFRG 2WSSG 5B1AC 4RO2A 1AJQA 1V55C 2ZDIC 2Q67A 4GX0A 1NR1A 3ABMC 2DYSC 3JD3A 5L3FA 3CCVV 2WLIB 1JCHA 1PNLA 3AG3B 1S3JA 3CMAV 2EZPA 2QM8A 1YTFD 1K73W 2Y69C 3UM7A 3E8BA 1SETA 3AG2B 4J9ZB 2OT5A 3OR6C 5H6QA 3F7VC 1NKDA 1PNMA 4WFEA 4P2ZA 3ZRWB 1L1FA 1EZJA 4U7NA 3CP1A 3T2MA 2K1EA 2EILC 1RPOA 1Q7YW 1S77D 1MABG 1QCEA 5B1NA 1JJ2U 1DTOA 3LSQA 1VQMV 3LDDA 1FXKA 1THZA 3ABUA 4JYBA 4MVZA 3K9AA 3F5WC 2NLJC 3M99B 5IYBO 1SERA 4LC1A 3CCEV 4PA4A 2Q6AA 5B1AB 2YSUB 3LDEA 5IYCO 4MT8A 1QLNA 2BOCC 3G4SV 3W7UA 3E86A 2XAJA 2XOKG 2B1IA 4RUFA 3ZMSA 4I5SA 1CEZA 3SPHA 5H6RA 1IXMA 5IYDO 3ZJZA 3LUTB 5J9PC 1K9MW 5B1OA 1E79G 3CPWU 3JCZA 2YEVB 3RW0A 2EZOA 1P4RA 3E83A 5E1AC 3SYOA 5EK0A 1RM1C 3AG4C 5B3SC 1PD3A 3CCJV 2IH3C 2EILB 3OEHG 4RUEA 1W0JG 1VQ7V 2QTOA 4P9OA 4QIWF 1OCOB 4UVBA 1E1QG 2KB1A 4BW5A 2ZR2A 2XASA 2W0FC 3WFVA 2OTJV 2Q68A 5IY5B 3PJSK 2DYSB 3ASOC 1QBZA 1KKDA 3OR7C 1CPYA 1R3LC 2R9IA 3P32A 1R3IC 1NH2B 1BMFG 3QNEA 1ENVA 4GX1A 2DWEC 3JD4A 3SYAA 3ZRSA 4FPPA 3P30A 4JASA 4X8AA 1OCOC 5L3DA 3R65A 2B5UA 1QLEC 2DWDC 1R3KC 4GCZA 2WLNA 2Q69A 4DXWA 4WFBV 3ML0A 2A9HA 1GKFA 3OAAG 4I9WA 1GM9A 1J95A 1K4CC 2AHYA 3TCUA 1GK9A 5CMUA 4TWKA 1DF5A 2WPDG 3JD1A 3X2QB 4LP8A 3K0DA 4JYCA 3BY6A 1V54C 2V7QG 2IJKA 3SYCA 3LSSA 2WLHA 1NJIW 5DM6V 3ZMVA 4CBCA 3STLC 3OM3B 1VQ5V 1VQ6V 2ZDIA 1XL6A 3CCSV 1FFTB 1PNKA 5CBHA 4FMTA 4GX5A 3W7XA 1FS0G 2W6JG 3E8FA 4PDRA 3W7TA 1VQPV 4G2KA 3D3IA 4JTAB 5H9CA 1VQLV 4MSWC 1BL8A 3ABLC 1YJNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLL B;  4JTD B;  4R6Z A;  2K1E A;  2OCC C;  2EIL C;  2WLL A;  2WLK A;  2WLJ A;  2X6C A;  3F7Y C;  4MS2 A;  2HVJ C;  4X88 A;  4EKW A;  2IH1 C;  1OCZ C;  4F4L A;  3LDD A;  3RVY A;  3AG1 C;  3FB5 C;  3AG2 C;  3FB6 C;  3K0G A;  4MVZ A;  4MVM A;  4PA6 A;  3F5W C;  3E8G A;  4ZBM A;  3T2M A;  3SYQ A;  2NLJ C;  3VOU A;  2X6B A;  4MVQ A;  4J9Y B;  4PA4 A;  2HG5 C;  2Q6A A;  4R8C A;  3T4Z A;  3UKM A;  3LDE A;  3IFX A;  2EIM C;  3GB7 C;  4GX2 A;  4WFE A;  2BOC C;  4HZ3 A;  5KUK A;  3SPG A;  3E86 A;  3K08 A;  4MW3 A;  3JYC A;  4P9P A;  5B1B C;  4RUF A;  1LNQ A;  3SPH A;  2HJF C;  5CBF A;  1ORQ C;  2EIK C;  2EIJ C;  3E89 A;  4RAI A;  4KFM A;  3ZJZ A;  3SYP A;  4MVO A;  3LUT B;  4PA3 A;  5J9P C;  2YEV A;  3K06 A;  4LBE C;  3OGC C;  4HYO A;  3EFF K;  3RW0 A;  3E83 A;  4OXS A;  3SYO A;  5E1A C;  5EK0 A;  3AG4 C;  2ZD9 A;  2DYR C;  5B3S C;  5EBW C;  4WFH A;  2A79 B;  2IH3 C;  5BZB A;  4RUE A;  4WFG A;  2QTO A;  4P9O A;  2EIN C;  5IY5 C;  2KB1 A;  4BW5 A;  5EC2 C;  4R7C A;  4JTC B;  2W0F C;  2WLM A;  2ZXW C;  2Q68 A;  3PJS K;  3ASO C;  4LCU C;  4MTG A;  4PDL A;  5EC1 C;  3RVZ A;  1KKD A;  3OR7 C;  2H8P C;  5CBG A;  1OCC C;  1ZWI C;  5EBL C;  1S5H C;  2A0L A;  3IGA C;  1JVM A;  3AG3 C;  1R3L C;  1XL4 A;  3OUS A;  4XDJ A;  3E8H A;  1R3I C;  4MW8 A;  4PDM A;  2AHZ A;  2JK5 C;  4GX1 A;  2QKS A;  3ASN C;  2DWE C;  3SYA A;  3ZRS A;  1P7B A;  4MVS A;  4MVU A;  4X8A A;  1OCO C;  3R65 A;  1QLE C;  2DWD C;  1R3K C;  2HFE C;  2WLN A;  2WLI A;  3BEH A;  3SPJ A;  4QNH B;  4MTO A;  2Q69 A;  5EBM C;  4DXW A;  1G4Y B;  2A9H A;  4I9W A;  1K4C C;  1J95 A;  5KUM A;  2AHY A;  2P7T C;  2R9R B;  3STZ C;  4PA9 A;  4MTF A;  4XDK A;  3FB8 C;  3TCU A;  3X2Q C;  3LDC A;  4WFF A;  4TWK A;  3SPI A;  2ITD C;  4UUJ C;  4G27 B;  3ABK C;  4LP8 A;  4G28 B;  3K0D A;  3K04 A;  1V54 C;  3HPL C;  5B1A C;  3LNM B;  4RO2 A;  3SYC A;  4X89 A;  1V55 C;  4XDL A;  2Q67 A;  4GX0 A;  2WLH A;  3ABM C;  2DYS C;  2ITC C;  3RBZ A;  4QE9 A;  4CBC A;  2BOB C;  3STL C;  2WLI B;  4PA7 A;  3T4D A;  3OUF A;  1XL6 A;  3T1C A;  3KG2 A;  5CBH A;  1K4D C;  4GX5 A;  4MVR A;  2Y69 C;  3UM7 A;  2ATK C;  3E8B A;  1OCR C;  3K03 A;  4QE7 A;  4J9Z B;  1M57 C;  3E8F A;  3FB7 C;  3WG7 C;  1R3J C;  4PDR A;  4H33 A;  1M56 C;  3OR6 C;  3TET A;  3SPC A;  4JTA B;  2HVK C;  4PDV A;  4R50 A;  3F7V C;  4H37 A;  3SJQ C;  4MSW C;  1BL8 A;  3ABL C;  4P30 A;  4P2Z A;  2X6A A; 
#chains in the Genus database with same CATH topology
 2YC0 A;  1MOF A;  2E75 B;  2R9A A;  2HVJ C;  4FK5 C;  1R1B A;  3ZIA G;  4EFB A;  3ETG A;  3AG1 C;  4LF4 B;  4X62 O;  1XRE A;  2BTQ A;  3RYF B;  3K57 A;  1FXK C;  2YXH A;  3JD2 A;  2YUA A;  1PL0 A;  1BGY H;  4UCR A;  2N05 A;  4RAI A;  1IBK O;  1VF6 C;  5HFL A;  1QLE B;  2YS8 A;  1WAZ A;  4Z1V A;  3NXS A;  1XBL A;  2JDI G;  5JVD A;  1YIT V;  4JTC B;  2ZXW C;  2JJ1 G;  2P90 A;  4UCT A;  1EN6 A;  5EBL C;  4MW8 A;  3CB2 A;  1Z2G A;  1GAX A;  5L3E A;  1S5J A;  1KP2 A;  4K0K O;  1LUW A;  2JGU A;  3OE7 G;  3RT3 C;  2WLI A;  3BAB A;  1GM7 A;  2C2A A;  1HR0 B;  2QE7 G;  2PI5 A;  3ZN0 A;  3AK1 A;  3STZ C;  5B5E Z;  1Y66 A;  1PV0 A;  5EZY A;  5LHG A;  3K04 A;  4TV8 A;  2EUL A;  4D7T A;  1J5E O;  4LF6 B;  1S0V A;  1HDJ A;  2F1M A;  3A0H Z;  4QE9 A;  5LP6 A;  1XUQ A;  3T4D A;  3T1C A;  4U3J B;  1SRY A;  3AG7 A;  2CH7 A;  3RYF A;  2ATK C;  2RNB A;  3L70 H;  1M4U A;  3JAM N;  4JI6 B;  1OCZ B;  5LMN B;  2WWW A;  1PPJ H;  2G38 A;  2FML A;  4PDV A;  4H37 A;  4J7J A;  4R50 A;  3OTO O;  1N34 B;  2UXB B;  4GKJ B;  2X6A A;  3UT5 B;  2FTK A;  2D3O W;  4DV6 O;  3JAS A;  2ILM A;  2X6C A;  4UB6 Z;  4EKW A;  1U96 A;  4WCE V;  3MAQ A;  1NZ6 A;  3JD0 A;  4GYC B;  1DLB A;  1I5Y A;  2QGN A;  4YJ3 A;  2EBO A;  2R70 A;  1FKA O;  2UUC O;  4WF9 V;  3JCU Z;  4JI3 O;  3UKM A;  4GX2 A;  1H2L A;  4HZ3 A;  1OV9 A;  2M7W A;  4JF3 A;  1Z5W A;  1M9N A;  3ICX A;  2GTA A;  1K5Q A;  2CGN A;  2DN9 A;  1P84 F;  1VF6 A;  2ZD9 A;  2DYR C;  2KQX A;  1IZ3 A;  1VQ9 V;  1WLE A;  4DV1 B;  4O2A A;  1IBK B;  1NVP B;  4IHJ A;  3EHB B;  3TK1 A;  2IU0 A;  4TT3 G;  4B3R O;  1Q86 W;  1I08 A;  2UXX A;  1Q90 D;  2KG7 A;  2Q9L A;  3MDS A;  4WBN A;  3I55 V;  1AJP A;  2FB5 A;  4I50 B;  5JWP A;  1Y4M A;  2P67 A;  3CWB H;  4QNH B;  2QWN B;  1NTK H;  1V54 B;  3ZMU A;  2P7T C;  1Q43 A;  3SPI A;  4EB6 B;  3LNM B;  4CS2 A;  3UT5 A;  3D36 C;  1RSO B;  4H0L B;  1K97 A;  4DW1 A;  4FM0 A;  1BE3 H;  3RBZ A;  1Q6I A;  4Z1M G;  2WA4 A;  4FM2 A;  4LWS B;  4QE7 A;  3K03 A;  4ICG A;  3E35 A;  3ZN1 A;  3WG7 C;  1M90 W;  3KKY A;  2XAG A;  2CTQ A;  2VQF O;  5BR8 B;  4K35 A;  4I9Q A;  1YCI A;  4GKK B;  2WLL A;  4X88 A;  3BPZ A;  1BHA A;  5C8Y B;  3ABK B;  3N27 A;  2XND G;  1YIJ V;  4DR5 O;  4JI0 B;  3E8G A;  3ZHR A;  3QO8 A;  4X66 O;  1CP9 A;  4AHC A;  2EIK B;  2EIM C;  3MHS C;  4FIP C;  3CCM V;  5LP6 C;  3VQX A;  2HLD G;  1YJW V;  2IW5 A;  4DK0 A;  4YHH O;  3SYP A;  3FAV B;  3GWO A;  1SES A;  4DV4 O;  5KHJ A;  4HYO A;  2QM7 A;  4OXS A;  1FAF A;  5IE9 A;  3ZS8 C;  3RYC B;  1H2K A;  1T5E A;  3IJ4 A;  5KMG A;  4LFA B;  3AG1 B;  4N21 A;  4FFB A;  3CCU V;  4X20 B;  3BHP A;  1HW7 A;  1OCR B;  5LGT A;  1XQ8 A;  1H2S B;  3OUS A;  1IBL O;  4UVC A;  4NTX A;  3CC7 V;  1P7B A;  4JAU A;  1NQT A;  2JIZ G;  3SPJ A;  1TA8 A;  5J2T A;  4PHZ A;  1Q81 W;  1QNM A;  1JJO A;  2AZ0 A;  3IAY A;  4G27 B;  3ABK C;  5IT9 N;  3JAW B;  2GUZ B;  1BQZ A;  3S3W A;  4GX0 A;  1AVM A;  2PTM A;  5JJJ B;  4F6R B;  1GN4 A;  4JI4 O;  2Y69 C;  3UM7 A;  3E8B A;  3ZBH A;  3I5D A;  3OR6 C;  2PF4 E;  3QF7 A;  3B09 A;  3DC6 A;  3WB0 A;  1PNM A;  4CS3 A;  2CTW A;  4U7N A;  4NXN O;  4CH4 A;  4UB8 Z;  4LF9 B;  2EIL C;  1L8D A;  1JFF A;  3J7A U;  2R72 A;  4TV9 A;  4U3J A;  5LMU O;  1SER A;  4LC1 A;  5JH7 A;  1R6T A;  1KMI Z;  2ZE8 A;  2ZT9 B;  1N4C A;  1RFY A;  1XMQ B;  4IHJ B;  4NYK A;  1IXM A;  3H1K H;  4FLT A;  3ZJZ A;  5JCO A;  1D2D A;  2RDC A;  3LUT B;  3J80 N;  1WP8 A;  4JI2 O;  4DR4 O;  3CPW U;  2ETN A;  3SYO A;  4YJ3 B;  3AG4 C;  3L71 H;  5B3S C;  4IYI A;  5FPR A;  4DR2 B;  4YJ2 B;  4DR6 B;  3P3P A;  2ZR2 A;  2XAS A;  2W0F C;  3B40 A;  2N74 A;  4FLU A;  3QVN A;  4UFZ A;  3U11 A;  1XNQ O;  3THO A;  3QNE A;  2DWE C;  3JD4 A;  4JAS A;  4X8A A;  1OCO C;  4GCZ A;  2DWD C;  1AR5 A;  4JYA O;  4OPH A;  2A9H A;  2AGA A;  1J95 A;  4X1I B;  2QJ1 A;  3U10 A;  1DF5 A;  4WBN B;  4DV4 B;  3OGI B;  4JYC A;  4TQD A;  2Y0P A;  3LSS A;  1NJI W;  1WN7 A;  4DRX B;  4DW0 A;  4IT5 A;  4CBC A;  3STL C;  1VQ6 V;  1W59 A;  3CCS V;  5JJE B;  1WB8 A;  5FPO A;  4CH3 A;  2E3C A;  4E4E A;  4G2K A;  3D3I A;  4MSW C;  1YJN V;  2HP8 A;  2WLK A;  1M5I A;  3F7Y C;  5B3S B;  4JPR A;  2QTS A;  1OCZ C;  3C90 A;  3B8M A;  1HNW O;  3N2K A;  2P4V A;  1N34 O;  3VOU A;  3K58 A;  1FFX A;  5LMN O;  2HKO A;  4J9Y B;  1MG1 A;  2IU3 A;  2CTR A;  5JQG A;  3ZCC A;  3SPG A;  3HKD B;  3T1Y B;  1I5X A;  3GWK C;  4OGQ B;  4HNA A;  1NVP D;  2ADP A;  3H1L H;  4DV3 O;  1FXV A;  1J5E B;  1VAR A;  3W7W A;  2MK3 A;  3ZRV A;  3ASO B;  1SS3 A;  1HNZ B;  4LCU C;  1US6 A;  3CSX A;  4LF7 B;  4O4H B;  4K0K B;  1URF A;  3ZMT A;  1TUE B;  1N8R W;  3E2E A;  1LUV A;  2F43 G;  1NTZ H;  4W4K A;  1RPR A;  5LA6 A;  1R73 A;  3DTU B;  4IIJ B;  2LGQ A;  4LNU B;  3SJC C;  3ZHQ A;  4MTO A;  2W6I G;  3B77 A;  3G71 V;  1KC8 W;  4PA9 A;  4TV8 B;  2X7R B;  4G28 B;  1GN2 A;  5GON B;  1FYJ A;  3CJH B;  4ZIB A;  1F4M A;  3RYH A;  3ZRW A;  1KEC A;  3KZI Z;  4X89 A;  1QU7 A;  5LP6 B;  4ZI7 A;  2BOB C;  3CRQ A;  1SQF A;  3TXS A;  1M56 B;  3RN4 A;  1YSC A;  2CH7 B;  2PI4 A;  2WAM A;  3ZHT A;  4UCS A;  2UXC O;  1YHQ V;  1H38 A;  1ZTE A;  4YIP A;  4B3S O;  3RYI B;  3AK3 A;  2QA4 V;  4P30 A;  3ZMZ A;  1IBL B;  2B1G A;  1EBO A;  1IUR A;  2ZR3 A;  1ZUQ A;  3HB3 B;  1COW G;  4PD4 F;  3WG7 B;  3FB5 C;  3K0G A;  4MVM A;  4LFA O;  1K3E A;  3UQ8 A;  3DGE A;  4FJC C;  4MVQ A;  2HG5 C;  3IFX A;  5HFM A;  2ZIO A;  3GB7 C;  2OCH A;  1M1K W;  4LR3 A;  3JYC A;  1G6U A;  4ZKI A;  1AI5 A;  1ORQ C;  3IC7 A;  1S5L Z;  4LF7 O;  2GV9 A;  1QHT A;  2QKC A;  5A9G A;  3L9D A;  4LFC B;  3TJT A;  2ZM6 O;  1KUQ A;  4UV8 A;  1SQV H;  4JI5 O;  5KLV H;  5KMG B;  4OX9 B;  1SC5 B;  4O2A B;  4WFG A;  3QO5 A;  3CCR V;  2PUS A;  1DF4 A;  1VQ4 V;  4B7E A;  5KHK A;  3IGA C;  4BIO A;  3CJH A;  2H3O A;  3PN1 A;  3OMI B;  5KAF Z;  3BRC A;  1IX9 A;  4DO2 A;  1L0N H;  3RWR D;  2B9Z A;  5CA1 B;  5GTI Z;  4E2L A;  2EIJ B;  3MD0 A;  4FFB B;  2CE4 A;  1GMG A;  3RGB A;  2H94 A;  2NNU A;  4DV3 B;  4UUJ C;  1N36 B;  3HKB A;  1QR9 A;  4XDL A;  2Y48 A;  1YTF B;  3JAS B;  2ITC C;  2P6J A;  3OT7 A;  1AR1 B;  3MHH C;  4NVP A;  1M57 C;  3BA9 A;  4LWS A;  5IDJ A;  1YXB A;  2F66 C;  4IYH A;  1OZ0 A;  4F6E A;  2UU9 B;  4BWA A;  2UUB B;  4MS2 A;  2QM4 A;  2Y0I A;  3FYE B;  2HR3 A;  2LO1 A;  2JS3 A;  1WB7 A;  3SR2 C;  3P3N A;  2RQ6 A;  1IXB A;  1EM1 A;  1YEW A;  2IJH A;  1AJN A;  5B66 Z;  1KQS U;  4JI4 B;  2GTS A;  5KUK A;  4DK1 A;  1SQP H;  4ZOL A;  2O57 A;  1BQ0 A;  5EYP A;  2IM9 A;  2EIJ C;  1D5N A;  5EYP B;  3F5T A;  2YEV A;  1P49 A;  1WA8 A;  4JI1 O;  4DV2 O;  1XMO O;  5CA1 A;  2Q5Z A;  2VWK A;  2RCV A;  5IY5 C;  1KP3 A;  2LFS A;  5F2V O;  4DR4 B;  1WNS A;  4PDL A;  1XNQ B;  5EC1 C;  1FD9 A;  2GHY A;  4J42 A;  4DUZ O;  2AXT Z;  3ETD A;  2A0L A;  4TUY A;  4YY3 B;  3K5L A;  2AW9 A;  2QKS A;  4I0X A;  4MVU A;  2LFR A;  2QEX V;  3UCS C;  4I0X B;  1Z5V A;  1QVF U;  4O4I A;  5LMU B;  1XDC A;  1SQX H;  3Q4H B;  4X65 O;  1EN4 A;  4XBF A;  1AP5 A;  2VWJ A;  3QO7 A;  1NT2 B;  3C3T A;  2MW2 B;  4EB6 A;  4B7K A;  2Q67 A;  1HNZ O;  1HP8 A;  3DXR A;  2DYS C;  1XMQ O;  1WPB A;  1AB3 A;  1MA1 A;  3CCV V;  4OX9 O;  2QDO A;  3JSL A;  3CMA V;  1I7F A;  4LFB B;  3U0Z A;  4JI5 B;  1YTF D;  2YID A;  4DV5 O;  1SET A;  2BSK A;  3AG2 B;  5GTH Z;  2LQT A;  1NKD A;  4WFE A;  3RYH B;  3ZRW B;  2A06 H;  1IVS A;  4KL1 A;  3RFR A;  3CP1 A;  1KYO F;  1S77 D;  1MAB G;  1DTO A;  3LDD A;  1SZX A;  4MVZ A;  1DGS A;  1WA8 B;  2NLJ C;  5IYB O;  4PA4 A;  4GZR B;  5B1A B;  5IYC O;  2ZNI A;  4D6T H;  1QLN A;  3G4S V;  2XAJ A;  1B04 A;  5DED A;  3SPH A;  5H6R A;  5IYD O;  2Q7H A;  2JRI A;  3A0B Z;  4X64 O;  1QQC A;  2YXL A;  2GDS A;  3FAV A;  1NTM H;  1XHX A;  2YEV B;  1RM1 C;  1H2N A;  3K9S A;  1PD3 A;  1JMK C;  2OIE A;  3CCJ V;  3OEH G;  2YIC A;  5FLX N;  4O4J A;  2QTO A;  2HHH B;  4P9O A;  4QIW F;  4JI1 B;  4X62 B;  4DV2 B;  1XMO B;  3JAL A;  2XTA A;  2DYS B;  3ASO C;  1QBZ A;  2L35 A;  4AIL C;  1R3L C;  2R9I A;  2RN9 A;  4GX1 A;  1ENV A;  4FZ0 A;  3ZRS A;  5K1P A;  4FPP A;  2Q4P A;  4LNU A;  5L3D A;  2B5U A;  2WLN A;  3ML0 A;  1G1X B;  1GK9 A;  5GON A;  2WPD G;  3JD1 A;  1Y74 B;  4LP8 A;  3CRA A;  2OIG A;  3BY6 A;  1V54 C;  1TVK A;  2P5O A;  3SYC A;  4CS4 A;  4DR1 B;  4IIJ A;  3OM3 B;  4DR6 O;  1L0L H;  1PNK A;  5CBH A;  2E74 B;  4FMT A;  4GX5 A;  4J10 A;  3W7X A;  1PM9 A;  5IWA B;  3E8F A;  3HKC A;  1VQP V;  2VQE O;  1N36 O;  5H9C A;  4DR3 O;  1YJ9 V;  4FM1 A;  4UVA A;  1H8E G;  5IYZ A;  5GW7 A;  1DK1 A;  2OTL V;  1GO3 F;  1AR4 A;  4Z2W A;  5IYZ B;  5BR8 O;  2GBO A;  2RJZ A;  1Y67 A;  3EVK A;  5IJ9 A;  2BTQ B;  3RVY A;  3AG2 C;  5DN6 G;  1FXK B;  3K5M A;  4JI7 B;  4R8C A;  2FKX A;  5IJ0 B;  3QTC A;  1K7D A;  1VF7 A;  4TOI A;  5IJ0 A;  3WU2 Z;  4MW3 A;  5CN0 A;  2EIK C;  2VQE B;  1SA0 A;  4KFM A;  5CB4 B;  3K06 A;  4B3R B;  1EZV H;  4KHP O;  2KKW A;  2KSD A;  5LGU A;  4DV5 B;  2F23 A;  2ZE6 A;  3I56 V;  4LFC O;  2EIN C;  1BCC H;  2VRZ A;  1HR0 O;  1M93 A;  4D7S A;  4LF5 O;  3Q4H A;  3RVZ A;  5BMV B;  2H8P C;  5CBG A;  3N2G B;  1IDS A;  1S5H C;  3CME V;  1XL4 A;  1RM1 B;  3KCY A;  1KBH A;  4X1Y B;  1YZB A;  1G4Y B;  4QJF B;  4IL6 Z;  1YDX A;  4XDK A;  1GRJ A;  4X1I A;  1BT8 A;  3BA8 A;  4UCV A;  3HPL C;  2Y4U A;  3A0R A;  1RSO A;  5KAI Z;  1B6Q A;  4Q6G A;  3LSU A;  3KG2 A;  2Q73 A;  1W2B U;  4MVR A;  2K9P A;  1VQK V;  3FB7 C;  2DQ0 A;  4H33 A;  4DR7 O;  3SPC A;  4H13 B;  3FYI B;  1M57 B;  2GUZ A;  4CC5 A;  2WLL B;  2YXY A;  3AK2 A;  1NR7 A;  1WP7 A;  1JQ0 A;  1SA0 B;  1SQQ H;  2JEX A;  2UXB O;  5CA3 A;  2YIA A;  3FB6 C;  1AI4 A;  1N33 B;  4BAY A;  2LGW A;  2ZQM A;  4DR5 B;  1R6K A;  2DMX A;  4DYL A;  3CEI A;  5JVD B;  1JX9 A;  3HR0 A;  2LJ2 A;  4LF9 O;  3K08 A;  1H8H G;  1ZSP A;  4GKK O;  1IBM O;  3L72 H;  2CK3 G;  3N2G A;  4I4T A;  3J81 N;  4CC6 A;  4YXW G;  4HNA B;  3T1H O;  3L75 H;  2A79 B;  5BZB A;  1OCC B;  2RMK B;  1Q8I A;  1SQG A;  1V9P A;  2DW4 A;  3H9V A;  5EC2 C;  4R7C A;  4DV0 O;  2ADQ B;  1ZLZ A;  2V4D A;  5H2F Z;  4JGS A;  2IJI A;  5LBQ A;  1OCC C;  1ZWI C;  5LHH A;  4UCU A;  4C7U A;  3SDL A;  2JK5 C;  3ASN C;  4JI7 O;  3DC5 A;  5LA6 B;  5LYJ A;  1V55 B;  3WB2 A;  4KP4 A;  2FYU H;  1S76 D;  3VBB A;  1ARO P;  1JPX A;  1XNR B;  1FPO A;  5FL7 G;  4B08 A;  4GUN A;  1NBM G;  1N32 B;  4JZG A;  4PEL A;  1MSW D;  2OYQ A;  2ODM A;  2ZXW B;  4F6R A;  5KX5 A;  4PA7 A;  5LL6 Y;  3FX7 A;  1K4D C;  5KA6 A;  4QPJ A;  4TSF G;  4ASU G;  1UJW B;  2HVK C;  3JAW A;  3HKD A;  2UXD B;  1TAE A;  3CRC A;  3SGI A;  3H01 A;  4R6Z A;  3CE2 A;  4BIU A;  2HEP A;  4FFK A;  4QPK A;  3OD4 A;  5C8Y A;  3APO A;  3SJA C;  2EIM B;  2JS5 A;  1ROP A;  4CH6 A;  1KD1 W;  3A8T A;  1UFI A;  4A5U B;  4TQF A;  5EIB C;  5B1B C;  5H5N A;  2HJF C;  5L3G A;  2XUM A;  2VQF B;  2PY5 A;  2XT9 A;  4TV9 B;  1IBM B;  3G6B A;  3C3S A;  3RYC A;  3FD9 A;  4KUM A;  3WB1 A;  5EBW C;  3R66 A;  4X9Q A;  1NI8 A;  4DV7 B;  1NH2 D;  4UV9 A;  3OEE G;  4DUY O;  1LR1 A;  3CYO A;  3OW2 U;  2QWQ B;  3CXC U;  4XDJ A;  3BCC H;  4GKJ O;  1XHZ A;  3ETE A;  5J2T B;  1AI7 A;  1PKX A;  2BE3 A;  3JAL B;  5L3B A;  5LYJ B;  3K5O A;  3W7S A;  1K8A W;  3X2Q C;  1N0J A;  3OMA B;  3FB8 C;  4U7O A;  1GTO A;  3RYI A;  4L87 A;  2WSS G;  3G67 A;  5B1A C;  1AJQ A;  1ZL8 B;  1V55 C;  4CH5 A;  5FNV A;  1NR1 A;  4FLW A;  3ZED A;  3IC9 A;  5L3F A;  4JV5 B;  2WLI B;  1JCH A;  1S3J A;  2EZP A;  1TGO A;  2BSK B;  5KHH A;  4J7Z A;  4K8X A;  2D2C B;  4OPA A;  2CTP A;  3KCX A;  5H6Q A;  4GLX A;  3F7V C;  1PL4 A;  1L1F A;  1EZJ A;  4AI8 A;  4X65 B;  1RPO A;  4FLV A;  3H1I H;  3T1Y O;  1JJ2 U;  2L6L A;  3G80 A;  3N2K B;  1FXK A;  2YIB A;  3K9A A;  3F5W C;  1GN6 A;  3CCE V;  2CGO A;  2E5L B;  2YSU B;  2E76 B;  4MT8 A;  2BOC C;  3W7U A;  4PI0 A;  3E86 A;  4EEQ A;  2DJV A;  2B1I A;  3ZMS A;  1CXZ B;  2AZ2 A;  3ZHU A;  4EFE A;  3JCZ A;  2ZCE A;  5BXZ A;  2UUA O;  1KKC A;  3RW0 A;  2IH3 C;  4RUE A;  1VQ7 V;  1W0J G;  3QG5 A;  1EN5 A;  1WJZ A;  4UVB A;  4X1K B;  4YHH B;  3APQ A;  4O4H A;  2QWP B;  2Q68 A;  5IY5 B;  1UPG A;  5J2U A;  1Q6H A;  3HKE A;  3P32 A;  1NH2 B;  1BMF G;  4FLX A;  4TUY B;  2NR5 A;  2P22 C;  3SYA A;  1XI1 A;  1SF9 A;  1R3K C;  5KX5 B;  4DV0 B;  2Q69 A;  4WFB V;  4AQY B;  4I9W A;  1GM9 A;  4JI0 O;  1K4C C;  2ZE5 A;  5CMU A;  2UUB O;  4TWK A;  2QSA A;  3BFR A;  3L73 H;  1VMG A;  3K0D A;  1BZK A;  2IJK A;  1X4T A;  2F93 B;  1O9G A;  2JVD A;  1MZE A;  3FFQ A;  5DM6 V;  3ZMV A;  1SKV A;  2WA3 A;  4QGP A;  2QWO B;  3O65 A;  1XL6 A;  2XHB A;  4DR2 O;  2F95 B;  3L74 H;  2Q7G A;  1OJH A;  3W7T A;  4AQY O;  2QWR B;  4JYY A;  4JI2 B;  3ABL C;  3BVO A;  1OHH G;  2CAZ C;  3DSQ A;  1FJG O;  4ZOL B;  1VEW A;  4LF8 B;  5A2Q N;  2DOS A;  4ZHQ A;  4NXM O;  5D5Q A;  1VIB A;  4RQE A;  3CCQ V;  1AI6 A;  4PA6 A;  1JFF B;  3K79 A;  4JAV A;  3CHX A;  2JEU A;  4O4J B;  3FKS G;  3ABM B;  5K1X A;  2F4V O;  4Q20 A;  1X59 A;  1LNQ A;  1VQN V;  1NS1 A;  2EJR A;  1TUB B;  2UUA B;  5LXT A;  3OGC C;  4J80 A;  3EFF K;  4K8Z A;  1N0N A;  3AEI A;  5JCO C;  4DV1 O;  4NTY A;  4B3T O;  3G6E V;  2LP7 A;  4BIZ A;  2XAQ A;  2YI9 A;  2E5L O;  3CXH F;  3NR7 A;  1QVG U;  5BMV A;  2WLM A;  3CC2 V;  1TVK B;  1JVM A;  3AG3 C;  4HAM A;  3E8H A;  5B1B B;  1B3Q A;  2AHZ A;  4CZZ A;  1BSM A;  4MVS A;  4X1Y A;  2EIN B;  4JI3 B;  2HFE C;  1S72 V;  1F51 A;  3H1H H;  5KUM A;  3M7M X;  3ASN B;  4DV6 B;  4LFB O;  1U97 A;  4FVM A;  1ZAU A;  3HKB B;  5LHI A;  2M6Y A;  4JV5 O;  3OTO B;  2UXN A;  4KHP B;  2OCC B;  4JI6 O;  3O9O A;  4J7K A;  2Z0A A;  2UXC B;  2FL4 A;  2ZE7 A;  4LH7 A;  1SZT A;  1NU1 H;  3K3W A;  4NKG B;  2ZIM A;  1OCR C;  1Y6X A;  5JH7 B;  2IBZ H;  4LF6 O;  3OMN B;  3SJQ C;  1Q3E A;  3UO2 A;  4JTD B;  5FNV B;  1A32 A;  1VF5 B;  2IJJ A;  2PGG A;  4NB5 A;  2LW7 A;  4U3F H;  1JOY A;  4LF8 O;  1K33 A;  5LGN A;  3JAT A;  4ZBM A;  3SYQ A;  1I0H A;  1AP6 A;  3JAT B;  3T4Z A;  2DYR B;  3CCL V;  3AG4 B;  4PV1 B;  1R6N A;  3ABT A;  2JJ2 G;  4NXN B;  4P9P A;  1HNX B;  1YI2 V;  4DR1 O;  2EJ7 A;  4MVO A;  4PA3 A;  4H44 B;  4LBE C;  5LXT B;  4I4T B;  3JAR A;  4JAA A;  2Y69 B;  1FXH A;  4X20 A;  4YIO A;  2OWO A;  1VQ8 V;  2A7W A;  5KHI A;  2KG7 B;  4MTG A;  3JAK A;  1O9H A;  4B3M O;  1Y74 A;  3VQW A;  2F4V B;  1AIL A;  1QR8 A;  4LF5 B;  2UXD O;  2Z3Y A;  1GM8 A;  5EIB D;  2A3Q A;  4YJ2 A;  3BEH A;  4O4I B;  1HNW B;  3D36 A;  2YDE A;  5EBM C;  5L3C A;  1VP7 A;  5ITZ A;  4I55 A;  3GVM A;  2LW1 A;  5ITZ B;  2PYJ A;  3LDC A;  5LOV B;  2YIB D;  3D3Q A;  2ITD C;  2EX3 A;  4NXM B;  5DEC A;  3HKE B;  5AG2 A;  4KXR A;  3TGU H;  4ZHQ B;  1F4N A;  4X64 B;  4O4L A;  3OUF A;  1XNR O;  1W0K G;  1K34 A;  1F23 A;  3CC4 V;  1H2G A;  3LNN A;  1R3J C;  1M56 C;  1K5S A;  3TET A;  4UCO A;  4UXN A;  1MMM A;  3B4S A;  2OCC C;  2WLJ A;  4DRX A;  1HNX O;  1G8M A;  4FZ1 A;  4B3M B;  2Z5U A;  1Y76 A;  2PZS A;  2Q7E A;  4DR3 B;  2IH1 C;  4LH6 A;  1Y76 B;  3SJB C;  4JZ2 A;  2Q0A A;  4F4L A;  5C93 A;  2CDY A;  3TXQ A;  3JAR B;  5JJN B;  1D5A A;  2X6B A;  3ETQ A;  1VQO V;  3T1H B;  4RWU A;  1SQB H;  5CBF A;  2ZM6 B;  3E89 A;  2X0L A;  5KHG A;  1P7G A;  3ABL B;  4I50 A;  1BHB A;  2XAF A;  2JGD B;  4IGG A;  3ZX6 A;  1K92 A;  5CA0 B;  2JGD A;  4WFH A;  1YVW A;  5CA0 A;  4WFA V;  3B8N A;  4NR1 A;  1F7Y A;  4X1K A;  1N33 O;  4I7Z B;  4I55 B;  1E1R G;  2XAH A;  5KA5 A;  1TUB A;  3ZRX A;  3VQV A;  2GSM B;  4RQF A;  2V1D A;  3K59 A;  2CUG A;  3JAK B;  1GH6 A;  1WPX A;  4PDM A;  4BW9 A;  2DQ3 A;  4DUZ B;  3OTF A;  3D8C A;  4O4L B;  2HHH O;  4GT1 A;  4DR7 B;  4MTX A;  4B3S B;  3OFN G;  2R9R B;  4MTF A;  4N23 A;  3CD6 V;  1PP9 H;  4WFF A;  2PYL A;  3EXA A;  1HWY A;  1H2M A;  5J2U B;  1EFR G;  5LOV A;  4RO2 A;  1MNG A;  2ZDI C;  3ABM C;  2Q0O C;  1ZL8 A;  3JD3 A;  4K3A A;  1I94 O;  4FLZ A;  1PNL A;  1RP3 B;  3AG3 B;  2QM8 A;  3CRR A;  1GN3 A;  1Q6U A;  1K73 W;  1I94 B;  2Q8V A;  2ARH A;  1MSD A;  4J9Z B;  2OT5 A;  5EZY B;  3E22 A;  4L8J A;  4P2Z A;  1KB9 F;  4HBN A;  3T2M A;  2K1E A;  1YF2 A;  2N04 A;  1Q7Y W;  1QCE A;  5B1N A;  5IJ9 B;  3LSQ A;  4ABM A;  1XEQ A;  3CRM A;  1VQM V;  2UU9 O;  2UUC B;  1THZ A;  3ABU A;  4JYB A;  1JA8 A;  1B06 A;  3M99 B;  2Q6A A;  3LDE A;  4PI2 A;  4LF4 O;  2BTO A;  4B3T B;  2Y4T A;  1JR9 A;  2XOK G;  4RUF A;  4I5S A;  1CEZ A;  1ZX3 A;  2ZIN A;  3A2F A;  2YI8 A;  5J9P C;  2NN4 A;  1K9M W;  5B1O A;  1E79 G;  1N32 O;  2EZO A;  1P4R A;  3E83 A;  5E1A C;  5EK0 A;  1FFX B;  3CX5 F;  5E79 Z;  1Q5O A;  4J41 A;  3ZHS A;  4JI8 B;  2BCC H;  2EIL B;  2P06 A;  2HJD A;  5D5P A;  5JQG B;  1OCO B;  4J11 A;  1E1Q G;  2KB1 A;  4BW5 A;  4FLY A;  1XOU A;  3WFV A;  2OTJ V;  3PJS K;  3UO3 A;  4YY3 O;  1KKD A;  3OR7 C;  5CB4 A;  2DE0 X;  1CPY A;  1FJG B;  1R3I C;  4DUY B;  1BS3 A;  4X66 B;  3P30 A;  2VS0 A;  3R65 A;  1QLE C;  5IWA O;  4DV7 O;  4BR6 A;  4W4L A;  4DXW A;  1KU9 A;  3OAA G;  1GKF A;  3H1J H;  2ZKO A;  2AHY A;  3TCU A;  3ZHV A;  1XIL A;  2P4K A;  2W0X A;  3BAA A;  3X2Q B;  3E22 B;  5TIS Z;  2V7Q G;  4O2B B;  4ZI7 B;  4O2B A;  2WLH A;  3K5N A;  3S3X A;  3JSN A;  3VQY A;  3DXR B;  5BY1 A;  1VQ5 V;  1MZF A;  2ZDI A;  1FFT B;  2QR4 A;  3M8A A;  3CS5 A;  3HKC B;  3B2E E;  1FS0 G;  2W6J G;  2QKA A;  4JI8 O;  4PJ0 Z;  4PDR A;  4NTW A;  4JYA B;  4JTA B;  1VQL V;  1BL8 A;  2ZNJ A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 1OHH G;  1YJ9 V;  4UVA A;  1H8E G;  2WLK A;  5GW7 A;  3F7Y C;  1MOF A;  5B3S B;  1GO3 F;  2HVJ C;  4FK5 C;  2OTL V;  4JPR A;  4RQE A;  3ZIA G;  1OCZ C;  3CCQ V;  1AI6 A;  3RVY A;  3ETG A;  3B8M A;  3AG1 C;  3AG2 C;  4PA6 A;  5DN6 G;  3VOU A;  1FXK B;  3K79 A;  2HKO A;  4JAV A;  4J9Y B;  4R8C A;  1MG1 A;  1FXK C;  2JEU A;  3JD2 A;  2IU3 A;  1K7D A;  3ZCC A;  1PL0 A;  3FKS G;  3SPG A;  3ABM B;  4MW3 A;  5CN0 A;  4Q20 A;  1I5X A;  1LNQ A;  1VQN V;  2EJR A;  2EIK C;  4RAI A;  4KFM A;  5HFL A;  1QLE B;  3K06 A;  3OGC C;  1NVP D;  1FXV A;  3EFF K;  3NXS A;  3AEI A;  3G6E V;  5LGU A;  2LP7 A;  4BIZ A;  2XAQ A;  3W7W A;  2MK3 A;  2JDI G;  3I56 V;  1QVG U;  2EIN C;  3ZRV A;  3ASO B;  1YIT V;  4JTC B;  2WLM A;  2ZXW C;  2JJ1 G;  3CC2 V;  2P90 A;  4LCU C;  3RVZ A;  2H8P C;  5CBG A;  5EBL C;  3ZMT A;  1S5H C;  1TUE B;  3CME V;  1N8R W;  1JVM A;  3AG3 C;  4HAM A;  1XL4 A;  3E8H A;  4MW8 A;  5B1B B;  3E2E A;  5L3E A;  2AHZ A;  2F43 G;  1KP2 A;  1RPR A;  4CZZ A;  1RM1 B;  4MVS A;  3OE7 G;  1R73 A;  2EIN B;  3DTU B;  2WLI A;  2HFE C;  1GM7 A;  2C2A A;  4MTO A;  1F51 A;  1S72 V;  2W6I G;  3B77 A;  2QE7 G;  3G71 V;  1G4Y B;  1KC8 W;  4QJF B;  2PI5 A;  3ZN0 A;  5KUM A;  3STZ C;  4PA9 A;  4XDK A;  1Y66 A;  3ASN B;  2X7R B;  5LHI A;  4G28 B;  5LHG A;  3K04 A;  3HPL C;  2UXN A;  2OCC B;  1F4M A;  3ZRW A;  3A0R A;  1KEC A;  4X89 A;  1S0V A;  1B6Q A;  4QE9 A;  2BOB C;  1M56 B;  3T4D A;  1YSC A;  3T1C A;  2PI4 A;  2WAM A;  3KG2 A;  1SZT A;  1SRY A;  3K3W A;  1W2B U;  4MVR A;  2ATK C;  1OCR C;  1YHQ V;  1VQK V;  1H38 A;  3FB7 C;  2DQ0 A;  4H33 A;  1OCZ B;  3SPC A;  2WWW A;  4PDV A;  4R50 A;  4H37 A;  3OMN B;  3SJQ C;  3FYI B;  1M57 B;  2QA4 V;  1Q82 W;  4P30 A;  2X6A A;  3ZMZ A;  2B1G A;  2WLL B;  1EBO A;  2FTK A;  4JTD B;  2D3O W;  2ZR3 A;  2X6C A;  1NR7 A;  2IJJ A;  1JQ0 A;  2JEX A;  4EKW A;  3HB3 B;  1JOY A;  4WCE V;  5CA3 A;  1COW G;  1K33 A;  3WG7 B;  5LGN A;  3JD0 A;  3FB5 C;  3FB6 C;  3K0G A;  1DLB A;  4MVM A;  1AI4 A;  1I5Y A;  4ZBM A;  1K3E A;  3SYQ A;  2EBO A;  4BAY A;  3DGE A;  4FJC C;  4MVQ A;  3T4Z A;  2HG5 C;  4WF9 V;  2ZQM A;  2DYR B;  3UKM A;  1R6K A;  3IFX A;  3CCL V;  3AG4 B;  5HFM A;  3GB7 C;  4GX2 A;  1JX9 A;  1R6N A;  4HZ3 A;  3ABT A;  2JJ2 G;  3K08 A;  1M1K W;  3JYC A;  1H8H G;  4P9P A;  4ZKI A;  1AI5 A;  2M7W A;  1YI2 V;  4JF3 A;  1ORQ C;  2CK3 G;  1M9N A;  3IC7 A;  4MVO A;  4PA3 A;  1K5Q A;  4LBE C;  4YXW G;  4UV8 A;  2ZD9 A;  2DYR C;  2A79 B;  5BZB A;  1OCC B;  2Y69 B;  1FXH A;  4WFG A;  1VQ9 V;  1WLE A;  2DW4 A;  3QO5 A;  3CCR V;  1VQ8 V;  1NVP B;  1DF4 A;  5EC2 C;  3EHB B;  4R7C A;  3TK1 A;  2IU0 A;  4TT3 G;  4JGS A;  4MTG A;  1Q86 W;  2UXX A;  2IJI A;  5LBQ A;  1VQ4 V;  1OCC C;  1ZWI C;  3I55 V;  5LHH A;  3IGA C;  1AJP A;  1QR8 A;  3OMI B;  1Y4M A;  2JK5 C;  3ASN C;  4DO2 A;  2P67 A;  2Z3Y A;  1GM8 A;  4QNH B;  3BEH A;  1V55 B;  4E2L A;  3D36 A;  5EBM C;  5L3C A;  4KP4 A;  1V54 B;  2EIJ B;  3MD0 A;  3VBB A;  1S76 D;  1ARO P;  1JPX A;  3ZMU A;  2P7T C;  1GMG A;  5FL7 G;  2H94 A;  2NNU A;  3LDC A;  3SPI A;  2ITD C;  4UUJ C;  1NBM G;  3LNM B;  1QR9 A;  4PEL A;  1MSW D;  4XDL A;  2Y48 A;  1YTF B;  1K97 A;  2ITC C;  3RBZ A;  2ZXW B;  1F4N A;  4PA7 A;  4Z1M G;  3OUF A;  2P6J A;  1W0K G;  1F23 A;  1K34 A;  3CC4 V;  1K4D C;  5KA6 A;  4QPJ A;  4TSF G;  1AR1 B;  3MHH C;  1H2G A;  4QE7 A;  3K03 A;  4ASU G;  1M57 C;  3E35 A;  3ZN1 A;  3WG7 C;  1M90 W;  1R3J C;  1M56 C;  1K5S A;  5IDJ A;  2XAG A;  3TET A;  1UJW B;  2HVK C;  1OZ0 A;  4UXN A;  3H01 A;  4R6Z A;  2OCC C;  2WLJ A;  2WLL A;  4X88 A;  1BHA A;  1G8M A;  4MS2 A;  4BIU A;  2Z5U A;  3ABK B;  4QPK A;  2IH1 C;  3FYE B;  2HR3 A;  4F4L A;  2XND G;  5C93 A;  1YIJ V;  2EIM B;  3E8G A;  2X6B A;  1VQO V;  3QO8 A;  1CP9 A;  1ROP A;  2EIK B;  1KD1 W;  2IJH A;  1AJN A;  2EIM C;  3MHS C;  1KQS U;  5KUK A;  4FIP C;  3CCM V;  2HLD G;  5B1B C;  1YJW V;  2HJF C;  5L3G A;  5CBF A;  2EIJ C;  3E89 A;  2IW5 A;  3SYP A;  2X0L A;  3GWO A;  2YEV A;  1SES A;  3ABL B;  4HYO A;  2QM7 A;  1BHB A;  2XAF A;  4OXS A;  1K92 A;  4KUM A;  5EBW C;  4WFH A;  4WFA V;  3B8N A;  1NH2 D;  3AG1 B;  4N21 A;  4UV9 A;  3OEE G;  5IY5 C;  3CCU V;  1KP3 A;  1E1R G;  2LFS A;  2XAH A;  5KA5 A;  3ZRX A;  4PDL A;  2GSM B;  1OCR B;  5EC1 C;  2GHY A;  4RQF A;  5LGT A;  3CYO A;  2V1D A;  3ETD A;  3OW2 U;  2A0L A;  3CXC U;  1WPX A;  3OUS A;  4XDJ A;  4PDM A;  4UVC A;  2DQ3 A;  2QKS A;  3ETE A;  3CC7 V;  1P7B A;  4MVU A;  2LFR A;  4JAU A;  1NQT A;  2JIZ G;  2QEX V;  3SPJ A;  1AI7 A;  4GT1 A;  1PKX A;  4MTX A;  1QVF U;  5L3B A;  1Q81 W;  3OFN G;  3W7S A;  1K8A W;  2R9R B;  3X2Q C;  4MTF A;  3OMA B;  3FB8 C;  4N23 A;  3CD6 V;  4U7O A;  4WFF A;  4XBF A;  1GTO A;  1HWY A;  3QO7 A;  4G27 B;  3ABK C;  4L87 A;  1EFR G;  2WSS G;  5B1A C;  4RO2 A;  1AJQ A;  1V55 C;  2ZDI C;  2Q67 A;  4GX0 A;  1NR1 A;  3ABM C;  2DYS C;  3JD3 A;  5L3F A;  3CCV V;  2WLI B;  1JCH A;  1PNL A;  3AG3 B;  1S3J A;  3CMA V;  2EZP A;  2QM8 A;  1YTF D;  1K73 W;  2Y69 C;  3UM7 A;  3E8B A;  1SET A;  3AG2 B;  4J9Z B;  2OT5 A;  3OR6 C;  5H6Q A;  3F7V C;  1NKD A;  1PNM A;  4WFE A;  4P2Z A;  3ZRW B;  1L1F A;  1EZJ A;  4U7N A;  3CP1 A;  3T2M A;  2K1E A;  2EIL C;  1RPO A;  1Q7Y W;  1S77 D;  1MAB G;  1QCE A;  5B1N A;  1JJ2 U;  1DTO A;  3LSQ A;  1VQM V;  3LDD A;  1FXK A;  1THZ A;  3ABU A;  4JYB A;  4MVZ A;  3K9A A;  3F5W C;  2NLJ C;  3M99 B;  5IYB O;  1SER A;  4LC1 A;  3CCE V;  4PA4 A;  2Q6A A;  5B1A B;  2YSU B;  3LDE A;  5IYC O;  4MT8 A;  1QLN A;  2BOC C;  3G4S V;  3W7U A;  3E86 A;  2XAJ A;  2XOK G;  2B1I A;  4RUF A;  3ZMS A;  4I5S A;  1CEZ A;  3SPH A;  5H6R A;  1IXM A;  5IYD O;  3ZJZ A;  3LUT B;  5J9P C;  1K9M W;  5B1O A;  1E79 G;  3CPW U;  3JCZ A;  2YEV B;  3RW0 A;  2EZO A;  1P4R A;  3E83 A;  5E1A C;  3SYO A;  5EK0 A;  1RM1 C;  3AG4 C;  5B3S C;  1PD3 A;  3CCJ V;  2IH3 C;  2EIL B;  3OEH G;  4RUE A;  1W0J G;  1VQ7 V;  2QTO A;  4P9O A;  4QIW F;  1OCO B;  4UVB A;  1E1Q G;  2KB1 A;  4BW5 A;  2ZR2 A;  2XAS A;  2W0F C;  3WFV A;  2OTJ V;  2Q68 A;  5IY5 B;  3PJS K;  2DYS B;  3ASO C;  1QBZ A;  1KKD A;  3OR7 C;  1CPY A;  1R3L C;  2R9I A;  3P32 A;  1R3I C;  1NH2 B;  1BMF G;  3QNE A;  1ENV A;  4GX1 A;  2DWE C;  3JD4 A;  3SYA A;  3ZRS A;  4FPP A;  3P30 A;  4JAS A;  4X8A A;  1OCO C;  5L3D A;  3R65 A;  2B5U A;  1QLE C;  2DWD C;  1R3K C;  4GCZ A;  2WLN A;  2Q69 A;  4DXW A;  4WFB V;  3ML0 A;  2A9H A;  1GKF A;  3OAA G;  4I9W A;  1GM9 A;  1J95 A;  1K4C C;  2AHY A;  3TCU A;  1GK9 A;  5CMU A;  4TWK A;  1DF5 A;  2WPD G;  3JD1 A;  3X2Q B;  4LP8 A;  3K0D A;  4JYC A;  3BY6 A;  1V54 C;  2V7Q G;  2IJK A;  3SYC A;  3LSS A;  2WLH A;  1NJI W;  5DM6 V;  3ZMV A;  4CBC A;  3STL C;  3OM3 B;  1VQ5 V;  1VQ6 V;  2ZDI A;  1XL6 A;  3CCS V;  1FFT B;  1PNK A;  5CBH A;  4FMT A;  4GX5 A;  3W7X A;  1FS0 G;  2W6J G;  3E8F A;  4PDR A;  3W7T A;  1VQP V;  4G2K A;  3D3I A;  4JTA B;  5H9C A;  1VQL V;  4MSW C;  1BL8 A;  3ABL C;  1YJN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...