1JVMA

Kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic optimization of ion conduction rate by the K+ selectivity filter.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
total genus 34
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jvmA00
4EKWA 2WLHA 2HG5C 3TETA 3K0GA 1XL4A 4MVQA 1P7BA 3BEHA 1QLEC 4CBCA 2DWDC 3FB7C 3TCUA 2ZXWC 2A79B 4R8CA 4PA3A 3OUFA 4KFMA 3F7VC 2Q68A 3T4DA 2WLMA 3SPJA 2DYSC 3RBZA 3E8HA 4WFGA 2X6CA 5E1AC 3SPIA 2ITCC 2K1EA 4X89A 5CBGA 4BW5A 4HZ3A 3SYAA 2AHYA 4RUFA 2P7TC 3OR6C 4XDLA 3SPHA 2OCCC 3GB7C 4OXSA 3LDEA 2WLKA 1J95A 4LBEC 4R7CA 4PA6A 4TWKA 4WFHA 3SYPA 3ZJZA 4MVMA 4R6ZA 1KKDA 2HVJC 4LP8A 3F5WC 1G4YB 2JK5C 2KB1A 4RUEA 3F7YC 4MS2A 4GX1A 1V55C 3LDDA 2DYRC 3AG1C 5J9PC 4GX0A 1ZWIC 3ASNC 4P30A 4R50A 2YEVA 4XDJA 5CBHA 2Y69C 3K0DA 3E86A 4MW8A 3IGAC 2EIKC 5CBFA 4HYOA 4MSWC 4XDKA 3WG7C 3LUTB 1OCOC 2WLIA 3FB5C 1ORQC 3VOUA 4MVZA 3E8GA 3JYCA 2QKSA 3ABKC 5EBWC 3AG4C 4DXWA 3SYQA 4I9WA 5EC1C 3K06A 1M57C 3SPGA 5KUMA 2NLJC 2IH1C 3ABMC 3EFFK 3OUSA 4JTCB 4P2ZA 4GX5A 3RVZA 3SPCA 3SYOA 3K03A 1LNQA 4WFFA 5B1AC 3T1CA 2IH3C 3RW0A 4PDMA 1R3LC 5KUKA 4LCUC 4QE7A 3SJQC 3UM7A 3ZRSA 3ABLC 2WLLA 2WLJA 3R65A 4MTOA 4P9PA 4MVSA 3UKMA 5IY5C 4MW3A 3ASOC 4H37A 2ITDC 3X2QC 4JTAB 4ZBMA 1V54C 3OGCC 1OCZC 1BL8A 4H33A 3T4ZA 2HFEC 3AG2C 5EBMC 4J9ZB 3LDCA 2BOBC 2H8PC 2QTOA 2WLLB 1R3JC 3OR7C 1K4CC 3E8BA 4PA7A 3SYCA 3K08A 4PDLA 2EIMC 5BZBA 3PJSK 2X6AA 3K04A 4JTDB 1K4DC 2A0LA 3LNMB 3RVYA 4MTGA 4F4LA 1OCCC 4G28B 2W0FC 3AG3C 5EBLC 4PDRA 2EILC 2Q69A 4QNHB 1S5HC 2EIJC 5EC2C 2ATKC 4J9YB 1OCRC 2Q67A 3IFXA 3STLC 4MVRA 2AHZA 5B3SC 4MVUA 5EK0A 1M56C 2DWEC 3T2MA 2X6BA 4RO2A 4X88A 4MVOA 2EINC 3E89A 4PDVA 4GX2A 3STZC 4RAIA 2WLIB 2BOCC 4PA4A 4QE9A 1R3KC 3E8FA 4G27B 4P9OA 3HPLC 4MTFA 3KG2A 2ZD9A 5B1BC 3E83A 2R9RB 2Q6AA 2HJFC 2HVKC 4WFEA 3FB6C 4UUJC 4PA9A 1JVMA 1XL6A 4X8AA 3FB8C 1R3IC 2A9HA 2WLNA
chains in the Genus database with same CATH superfamily
4DV5B 4O4IB 4D7SA 3UO2A 1YF2A 1MMMA 4ICGA 4PA3A 2RQ6A 2YIBD 4JI4O 4I0XA 2CK3G 2LQTA 1MZFA 3T1HB 4ABMA 1WJZA 2N04A 3AG3B 4YIPA 4JI4B 4OXSA 5FPOA 3LDEA 1AR1B 4X9QA 3K59A 2VQFO 4YY3O 3IJ4A 1AJPA 5GW7A 1WB7A 4O4JA 3U11A 3CPWU 3O9OA 5LP6C 3LDDA 4UVAA 3ZRXA 5LOVB 4KHPB 2YDEA 2HJDA 1K34A 3RYIB 4IIJB 5LMUO 4WF9V 1NTZH 4LFBO 1Q7YW 2YIDA 4WBNA 3K06A 1G6UA 1PKXA 4DV2O 4IL6Z 1OCOB 2KQXA 1L0LH 2Y0IA 4LCUC 4QE7A 1W0KG 4FMTA 4LH6A 4JI3O 4DV7B 5LP6B 1VF6A 4TV8A 5J2UB 3M7MX 3U0ZA 3OR7C 5BR8B 3E8BA 3IAYA 5K1XA 4PA7A 5LMNB 3H01A 3LNMB 1CPYA 3SJAC 1SZXA 1Y74A 5EC2C 3OFNG 2P6JA 4DW1A 2DWEC 1PP9H 3N2GB 4IYIA 3K58A 1OCRB 3E8FA 1GN4A 1G8MA 1Q8IA 3HPLC 3W7WA 2CE4A 2V4DA 2IJIA 3E22A 4J80A 2DOSA 5KHIA 5IYDO 4R8CA 4WFBV 2XOKG 4FK5C 1IDSA 1VF7A 3HKCB 2O57A 3KKYA 1H38A 4DUZB 3W7XA 1BQZA 1KB9F 3ZHQA 2BSKA 2WA4A 1N0JA 4HNAB 4LF6B 1GN6A 2QDOA 4U3JA 1D2DA 3OGIB 4GZRB 4LC1A 1FKAO 3ETDA 1IX9A 4BIUA 1NR1A 5DN6G 1TVKB 3FB5C 1QQCA 4FJCC 5IYZB 3QF7A 4P2ZA 4JI8B 3W7TA 3HKEB 4DRXA 4F6RB 5CA0B 2N74A 3H1LH 1XEQA 4JV5B 4BIOA 1PNMA 4I4TA 3T4ZA 5EBMC 3LDCA 2EINB 1SESA 2CGOA 3HB3B 4LFAO 3P3NA 3S3WA 1OCCC 2LP7A 3AG3C 4OX9B 1AILA 1I7FA 3J7AU 4H13B 5BR8O 1X4TA 2UXDB 1FD9A 2CGNA 1I5XA 3T2MA 3CX5F 4RQFA 3WB0A 3D36A 2YI9A 5B1BC 4UV9A 3ZMTA 4UUJC 4UCVA 1NKDA 1VIBA 3PN1A 4DUYO 2ADPA 4CS3A 3TETA 2XHBA 4AQYB 3DXRA 1QLEC 3CD6V 3QO5A 5LHGA 4ZOLA 1URFA 3AG7A 3H1IH 4OGQB 5IJ0A 1KYOF 4GT1A 3CRAA 2K1EA 4U3FH 2QEXV 5BMVA 4LF7B 4GKKO 4IHJA 2PTMA 5B1BB 4R7CA 3A8TA 4WFHA 1WPBA 3ABKB 4FPPA 3QO7A 4BWAA 2DQ3A 3RN4A 1BE3H 3BVOA 3BA8A 3ZS8C 5IE9A 4TV9A 4B3SO 2UU9B 1NJIW 1ZWIC 3AK3A 1WP7A 4FFBB 3NR7A 2MW2B 3SGIA 3ZHVA 3LUTB 1S5LZ 2F43G 4JI7B 3VOUA 3CS5A 4EFBA 5C8YA 1J5EB 1MOFA 2FKXA 1O9HA 5LXTA 3E22B 4KUMA 1RM1B 2CTWA 2OIGA 3UM7A 2ZIMA 4DV6O 4ZKIA 2YIBA 3K79A 3T1HO 2UU9O 4GLXA 1TGOA 3B2EE 1NVPB 2LFSA 1S3JA 2YIAA 5CA0A 2WLLB 1KUQA 4D6TH 1M4UA 3CJHA 3JD2A 4I50A 2BSKB 1B6QA 1XMOB 3JASB 3A0HZ 1SQBH 2W0FC 1AI5A 1YXBA 2RJZA 1O9GA 3D3IA 5B3SC 1WPXA 3AK1A 1AJNA 4MVOA 4EB6B 1VARA 3A0BZ 2BOCC 1I08A 2Q6AA 4DK1A 2Q7EA 1WNSA 3L73H 2RNBA 3BY6A 4ZIBA 4DUYB 4FZ0A 1FPOA 1IBKB 3CRMA 3K0GA 4CH4A 1GH6A 4JI7O 3DTUB 1N0NA 4JI2O 1QLNA 2FTKA 1I94B 1N36O 3RBZA 4JYAB 2X6CA 3VQXA 2KG7A 1L0NH 4DK0A 1QR9A 2QM8A 1K92A 4K35A 4D7TA 2UUCB 3DSQA 4LF8O 5JCOC 4I55B 2RMKB 4X1KB 2B9ZA 4N23A 2ZE8A 2JEXA 3D3QA 1E1QG 1NTMH 3F5WC 3I55V 4RUEA 4K8XA 1IBMB 1EN4A 1K5SA 1QU7A 2X7RB 4XBFA 2IW5A 2WAMA 2ZKOA 1HNXB 1WA8B 2EIKC 1DF4A 1UPGA 1BGYH 3G71V 3OD4A 5JQGB 3D36C 3BA9A 4DXWA 3SYQA 3THOA 1ZSPA 4PD4F 4JAVA 4GX5A 4NXMB 3K03A 2UXBB 2Z3YA 2ZCEA 1PV0A 1TVKA 3UKMA 1Q3EA 4AI8A 4DV0O 3JATA 3MD0A 3LSQA 3AG2C 2LW7A 3AG2B 1RSOA 1SS3A 1R3JC 2ODMA 4IYHA 5KLVH 3ZHSA 2VS0A 4PDRA 2Q69A 2G38A 1HNZO 1IURA 3CC4V 2X6BA 4RO2A 4LNUA 4GX2A 5JH7A 2JGDA 5GTHZ 5JVDA 3OW2U 3CE2A 2ZNJA 1GM7A 3E83A 2Z0AA 1H2MA 1JVMA 3VQVA 3CRRA 3K3WA 1QHTA 3BFRA 3ZX6A 1N4CA 2HG5C 3FX7A 4MVQA 3QNEA 1WP8A 5HFLA 3CC7V 4QIWF 1GRJA 2IJJA 2Q68A 3UT5A 4F6RA 4JI6O 1FXVA 4MTXA 4X89A 1AR4A 2QWNB 3SR2C 4UFZA 1AVMA 2IBZH 1AP5A 4DV4B 3G80A 2PGGA 3M99B 3JAWB 4NB5A 1I0HA 4QGPA 2AGAA 4DR4O 1FJGB 1V55C 2QWRB 4L8JA 1HR0O 2ZNIA 5B3SB 4DV0B 2OT5A 4NR1A 4PJ0Z 4MW8A 1PL4A 3IGAC 3DC5A 3L70H 3ZIAG 4O4HA 5KX5A 3E8GA 1WLEA 3ZRWB 3ETGA 1XHZA 3L71H 1LNQA 2DYRB 3RYFB 5KHGA 3IC9A 4NYKA 1F7YA 3SJBC 3B09A 2E74B 1FFXA 3WB2A 5D5PA 1W0JG 5CA1A 2JJ2G 2Q73A 1GTOA 3EVKA 1ZTEA 2WA3A 1Q6IA 3TK1A 4PDLA 3N27A 1HP8A 2A0LA 3O65A 5J2TB 2B1GA 3RVYA 5J2TA 3DGEA 1PM9A 3HKBA 2ATKC 4MVRA 2E5LO 4CZZA 4Q6GA 1Z2GA 2XASA 3C3TA 2P22C 4DV7O 2Q9LA 1EN6A 4MTFA 2AW9A 3ICXA 1KECA 4X62O 3FB6C 2EJRA 3TGUH 1XL6A 3JSLA 1CP9A 1BMFG 3ZCCA 4JPRA 3B8NA 2BCCH 1FFXB 1S72V 5B1AB 3RYHA 2QKAA 4A5UB 2YC0A 5IJ0B 2OCCB 4DR5B 5ITZA 3OM3B 3JAKA 1QR8A 3CCUV 3AK2A 1SKVA 3J81N 5ITZB 3ABTA 1S5JA 2UXCB 2P7TC 3ZHRA 4WBNB 3OTOB 1KD1W 5IDJA 1VQKV 4R6ZA 5GONB 1NU1H 1H8HG 2JK5C 4HBNA 1VQMV 1D5AA 2Q7GA 2XAQA 4GX0A 3UCSC 2BTQA 2ILMA 2YXYA 3VBBA 4CC5A 1QNMA 2UXNA 1BS3A 1QLEB 2EX3A 3HKBB 3AG4C 4CH6A 2NNUA 2XAFA 3OMAB 4JI6B 3K5OA 3SPCA 3JARA 1PNKA 5H5NA 2F23A 1IBLO 4IIJA 4JI5O 1JFFA 3EXAA 1N36B 3CMEV 5IWAO 1I94O 1RM1C 4L87A 2DN9A 1VQ4V 3X2QC 4H0LB 3TXSA 3KCXA 2Y69B 4U7NA 4DR7O 1GKFA 5BXZA 4JTDB 2IM9A 3H9VA 2YS8A 4F4LA 1NI8A 4G28B 2Y0PA 5LP6A 5DM6V 3RGBA 1YHQV 1FJGO 4TQDA 2YEVB 3U10A 4PA4A 3FFQA 4FLZA 1QVFU 1CXZB 1R6NA 3OTOO 4DR3B 1QBZA 3TJTA 1XL4A 2R9AA 2QJ1A 2ZXWC 3P32A 1AROP 1L1FA 5E1AC 4CH5A 5CBGA 2P06A 4UVBA 1IBLB 3Q4HB 3MHHC 1SA0B 1HNWB 1FYJA 1J95A 1JFFB 2HR3A 4LFAB 3M8AA 1KP2A 4PA6A 1Q5OA 4TWKA 2MK3A 1NBMG 1UJWB 4JI1B 3CRQA 3ABLB 3GVMA 2OCHA 5LHIA 1Q81W 4Z2WA 3F7YC 4UCUA 2DYRC 4LR3A 3UO3A 4W4LA 2YI8A 1U96A 1VP7A 5D5QA 5DEDA 2VQEO 4CS4A 5KMGB 5KHJA 4UXNA 1ORQC 1M56B 2VWKA 4JYAO 1EN5A 3WU2Z 4UV8A 4JI2B 5FNVA 4KL1A 1VQOV 3S3XA 3J80N 4JGSA 3C3SA 4I9QA 2HEPA 3RWRD 1ZX3A 2ZIOA 4K0KO 3OGCC 4O4LB 4YHHO 4JF3A 5L3GA 4AQYO 4J11A 4TQFA 2H8PC 1K4CC 2W6JG 5EYPA 1H2NA 3CC2V 3OE7G 1Z5WA 4I4TB 3L9DA 3E2EA 2LGQA 3G6EV 2F93B 3TXQA 3Q4HA 5EK0A 4O2AB 1E1RG 2VQFB 4UB8Z 4PDVA 1F4MA 3WFVA 2WLIB 3OAAG 4QE9A 4EB6A 4G27B 3ASOB 1H2SB 2GUZA 1GMGA 1X59A 2AZ2A 4ASUG 2VWJA 1R3IC 5EZYA 4GKJB 1YCIA 4WFAV 3FB7C 3TCUA 4KFMA 3T4DA 1KQSU 3E8HA 3RYFA 4PI2A 3KCYA 1IBKO 3SPIA 1XNRO 4HZ3A 2RDCA 5CA1B 2ZR3A 2JRIA 1VQ9V 4MT8A 5K1PA 4Z1MG 1OJHA 4XDLA 2DYSB 2CH7A 1FAFA 3CCSV 3RYIA 1YITV 1P49A 4BR6A 4HAMA 4I5SA 3K5MA 4TSFG 1YTFD 1Q6HA 3B8MA 3FYEB 4DR3O 3CSXA 1OV9A 1WB8A 4JI3B 3ASNC 1HR0B 2LO1A 2QR4A 2V1DA 2ZR2A 2QM7A 4NTXA 1V55B 4HYOA 2KG7B 2ZT9B 1XNQO 2GV9A 3CB2A 2KSDA 2LW1A 2QKSA 3CXHF 5B66Z 3ZMSA 4I9WA 3ABMC 3OMNB 3OUSA 5B1NA 1H8EG 2E75B 1F51A 1WAZA 4DR1O 3ZMUA 5C93A 2Q0AA 5FNVB 4BIZA 4X20B 2L35A 1OCZB 2BOBC 2GTAA 1CEZA 2ADQB 1K8AW 2B5UA 2YUAA 4LF4B 4Q20A 3EHBB 3APOA 2QTSA 2VQEB 3HR0A 4E4EA 3GWOA 3LSUA 1GO3F 1IBMO 3RT3C 3IFXA 3CCQV 3CJHB 2Q7HA 3ZEDA 2ZDIC 4PV1B 2EBOA 2M7WA 4LWSA 3A2FA 4DW0A 1JPXA 2HVKC 1XQ8A 1N33O 4CS2A 4JYCA 2JIZG 1K3EA 5LMNO 4EKWA 3LNNA 2KKWA 4J7ZA 3SDLA 2R70A 3H1KH 5CB4B 2GBOA 2HHHO 3CYOA 2A7WA 1Q82W 1B04A 1SQFA 2ITCC 2UXCO 5IYCO 4NTWA 4NXMO 3VQWA 1P84F 2OCCC 5LYJA 4DR1B 5DECA 1SQXH 5LXTB 4N21A 2ETNA 4MVMA 2PZSA 4DR6O 2EJ7A 4NXNO 1XDCA 2HVJC 2QKCA 4LP8A 4GX1A 2EIKB 3JATB 1Z5VA 1SZTA 1XREA 2PF4E 4R50A 2YEVA 2CUGA 5BMVB 1AB3A 5CBFA 1VQ6V 3WG7C 2WLIA 2GDSA 3ABKC 4DR7B 1JJ2U 4B3RB 3RFRA 2F4VO 1XMQB 2M6YA 4YJ3B 1Q43A 1HDJA 1Y74B 4UCRA 1EZJA 1UFIA 4KXRA 5A9GA 3ZRSA 3SJQC 1VQ5V 4YJ2B 4FIPC 4JI5B 1VQLV 1MA1A 1JA8A 1Y6XA 1V54C 2NN4A 3A0RA 4J7JA 1AP6A 1J5EO 3K08A 1SQQH 3G6BA 3CMAV 3JALA 4B7EA 2ZM6B 1DTOA 4O2AA 3K5LA 4B3SB 2UUAO 2Q67A 1BHBA 2FL4A 3BABA 1QVGU 4RAIA 3ZHTA 3ZHUA 1NT2B 5TISZ 3JASA 1H2GA 3JAWA 2R9IA 3KG2A 5L3BA 4I50B 4WFEA 2A9HA 5J2UA 1Y4MA 1BHAA 4TOIA 2AXTZ 3RYCA 4FFKA 2A3QA 3OUFA 3CCMV 1RPOA 4GYCB 1V9PA 2ZE6A 2UUBO 2GSMB 1K73W 1FXHA 2L6LA 3CCLV 1ENVA 3OR6C 3SPHA 2YXLA 1M5IA 2WLKA 1W59A 2AZ0A 1HWYA 3QO8A 4X66B 3JSNA 3CCRV 2F66C 4AHCA 2XAGA 2KB1A 4YY3B 5LGUA 1ZUQA 4JAAA 3IC7A 2OYQA 1GAXA 2V7QG 5L3FA 1R6KA 4P30A 4XDJA 3R66A 1SA0A 4B3TB 1PNLA 1KKCA 4IHJB 3L74H 4X1IB 3ML0A 4J42A 1M57C 3L72H 2IH1C 4JTCB 3RVZA 1Q90D 4JV5O 1HNWO 5IY5C 3ZRWA 3VQYA 4DV1O 1WA8A 1S77D 4CH3A 3CCJV 5JCOA 4YHHB 4X64O 4K0KB 4YJ2A 2JVDA 1K9MW 4OPAA 2PYJA 4ZOLB 1R1BA 3CP1A 1NH2D 1ROPA 4C7UA 2EILB 4O4IA 2EILC 4FM0A 1XILA 2CH7B 4B7KA 3KZIZ 4OPHA 1PPJH 3MHSC 1M56C 4LFCB 5GTIZ 4BAYA 3HKCA 3OTFA 1JMKC 2PI4A 1K5QA 2UUAB 1H2KA 3OEEG 4X1YA 2WLNA 2ZM6O 1MNGA 1M9NA 1Y76A 4J41A 3CRCA 4YJ3A 5JVDB 1KBHA 5FL7G 2JS5A 2A79B 2CTPA 1JJOA 2D2CB 4FLUA 4JZ2A 4FLVA 4DV5O 1F4NA 1YIJV 4BW5A 2AHYA 4GCZA 4K8ZA 4RUFA 4J10A 4DYLA 4DRXB 1WN7A 4DR2B 1YJNV 1G4YB 4EFEA 1HNZB 2DMXA 1JR9A 2A06H 1KC8W 4UCTA 1R6TA 3DC6A 3K9SA 4JASA 3JCUZ 4O2BB 1XI1A 1JCHA 1ZAUA 3AEIA 1XHXA 1U97A 3B4SA 3BPZA 3OT7A 3F5TA 2OIEA 1F23A 4FVMA 1US6A 4WFFA 3X2QB 1N33B 2CDYA 4RWUA 4ZI7A 1SETA 3R65A 2WLJA 4FM2A 1MSDA 4QPJA 2ITDC 1RPRA 3I5DA 2JGUA 5CB4A 4HNAA 1VQNV 2HHHB 4E2LA 2P5OA 5A2QN 1L8DA 2QSAA 2R72A 2X6AA 3JAMN 4H44B 5FLXN 4NVPA 5E79Z 2B1IA 1M1KW 3ZN1A 2XAJA 2QE7G 5LYJB 4X62B 4W4KA 4NTYA 4TV8B 4X65O 1QCEA 5LA6B 4FLWA 5L3DA 3E89A 5HFMA 4J7KA 3JALB 1BT8A 2ZD9A 2PUSA 1VQPV 1VQ7V 4U7OA 2NR5A 5H9CA 4YIOA 2EIJB 1BZKA 1Q6UA 1GN3A 3JARB 4PI0A 1M57B 5KMGA 4JAUA 2QWQB 1LUWA 4LFCO 4K3AA 4ZHQB 3W7UA 1LR1A 3FYIB 4LNUB 5B5EZ 2BTQB 3JD4A 3JD3A 2JDIG 5JJEB 4DR5O 2N05A 3G4SV 3ZJZA 4NKGB 3ABUA 3CCEV 2CAZC 1XNQB 4IGGA 3N2GA 1MZEA 3E86A 3ZRVA 5AG2A 4B08A 2XT9A 1SQPH 5EBWC 5IJ9A 3P3PA 3CXCU 3D8CA 5CMUA 3EFFK 3WG7B 5B1AC 3FD9A 4B3TO 1R3LC 3WB1A 2QM4A 4MTOA 1YZBA 3MAQA 1VEWA 1ZL8B 4JZGA 4H37A 1OZ0A 4O4JB 4H33A 5KX5B 3P30A 4J9ZB 2CTRA 2ZINA 1HW7A 3T1YO 3ETQA 3OMIB 5JJJB 3SYCA 2LJ2A 5JQGA 5L3CA 2QA4V 4MTGA 1MABG 1DLBA 2YICA 3HKDB 4QNHB 4I0XB 5LHHA 4X20A 3STZC 2EZOA 1N8RW 3B40A 2HJFC 1EBOA 2QGNA 3GWKC 4PA9A 4O2BA 1THZA 4X8AA 4EEQA 3BRCA 4JYYA 2CTQA 1YDXA 1P7BA 2DWDC 2Q5ZA 4AILC 2F1MA 4CC6A 2DYSC 1NH2B 1I5YA 4X1YB 1VF5B 4DUZO 1Q86W 3SYAA 4BW9A 3CWBH 1EZVH 2JEUA 1P7GA 1LUVA 2WWWA 3APQA 4DV3B 2BTOA 4X66O 3T1YB 2QWOB 4LH7A 2F95B 1AI7A 1IZ3A 2IU0A 3K5NA 2UXDO 1TUBB 5LGTA 1VQ8V 3BHPA 3AG1C 2YSUB 2UUBB 1N34B 4WCEV 2GHYA 3W7SA 3K57A 1GK9A 3QTCA 2FB5A 4JI0B 2ZXWB 5CN0A 2HP8A 1COWG 1T5EA 5EIBC 4TV9B 5KUKA 4LF8B 3ZMVA 2UUCO 3FAVB 4P9PA 1S76D 4MW3A 1TAEA 1A32A 4JI8O 1AI6A 1TUEB 1ZL8A 1BL8A 4DO2A 2DQ0A 4QJFB 1AR5A 1FXKB 2RN9A 5B1OA 4UB6Z 2GUZB 1K7DA 1TUBA 3K04A 1N32B 3ETEA 2UXBO 2DJVA 2EIJC 4J9YB 1NS1A 4MVUA 3HKEA 3FKSG 4DR2O 3JD0A 3UQ8A 4LFBB 1R3KC 4UCOA 3C90A 2HLDG 5IJ9B 3MDSA 3FB8C 5LGNA 1H2LA 4X1KA 1GN2A 1M93A 4B3RO 1SC5B 4LWSB 2WPDG 2WLMA 2D3OW 4X65B 2X0LA 2C2AA 2P4VA 5KAFZ 4PELA 1M90W 1B3QA 3GB7C 1NZ6A 4KP4A 3UT5B 2W6IG 4DR6B 2P67A 4ZHQA 3JD1A 2PI5A 4F6EA 4MS2A 3ZN0A 5J9PC 5KAIZ 4DV3O 2DW4A 2PYLA 1YVWA 2OWOA 2H94A 1TA8A 2Y69C 5LA6A 3N2KB 1K97A 1BCCH 4XDKA 3G67A 5IYZA 1OCOC 1FS0G 3QVNA 3SPGA 2Y4UA 2XAHA 4DV1B 3SYOA 5JJNB 1GM8A 4ZI7B 3RW0A 1EM1A 3B77A 2Z5UA 4GKKB 4LF7O 2WLLA 4IT5A 4MVSA 3H1HH 2P4KA 4DV2B 2HFEC 1SRYA 1AI4A 2EULA 1SQVH 1VMGA 2EIMC 3H1JH 4U3JB 4DV6B 1K4DC 1KMIZ 2JGDB 1N34O 4LF9O 2XNDG 3LSSA 2ZE7A 5LOVA 2XUMA 5L3EA 3BCCH 4UCSA 4KHPO 2Y48A 4G2KA 1S5HC 5C8YB 1XNRB 1KU9A 1OCRC 3STLC 1YSCA 3HKDA 1AJQA 2DE0X 4X88A 5BY1A 2E5LB 4P9OA 2Q8VA 1YTFB 2R9RB 4LF9B 4GKJO 2WLHA 5EYPB 1SERA 2EIMB 4CBCA 5LBQA 2ZDIA 2FYUH 1Y76B 2QWPB 3F7VC 4QPKA 3SPJA 2Q0OC 2Q4PA 2RCVA 3FAVA 4WFGA 3RYCB 1DK1A 3AG1B 4JYBA 5IYBO 4X1IA 4B3MB 1FXKC 2HKOA 1FFTB 4LBEC 1BQ0A 1BSMA 5JWPA 1KKDA 1NVPD 2FMLA 1G1XB 2OTLV 2WSSG 4DV4O 4FZ1A 1DGSA 2JS3A 2GTSA 1OHHG 5H6QA 2ARHA 3L75H 1S0VA 3K0DA 4B3MO 2IJKA 3ZMZA 3RYHB 5CA3A 3JYCA 4DR4B 1IVSA 2YXHA 5H6RA 3SJCC 2NLJC 1Y66A 5IY5B 3T1CA 4OX9O 4GUNA 4PDMA 5H2FZ 1VF6C 5KHKA 1SF9A 4I55A 2E3CA 2E76B 2K9PA 3ABLC 1RSOB 1P4RA 1JOYA 5EIBD 3E35A 3ASOC 1XMQO 1NQTA 4ZBMA 2VRZA 1OCCB 1YJ9V 5GONA 1E79G 3PJSK 5KA5A 3BAAA 2IJHA 2ZE5A 1GM9A 4LF5O 1R73A 2AHZA 4NXNB 2UXXA 3I56V 5F2VO 4TUYB 2XTAA 2JJ1G 1MSWD 2H3OA 4RQEA 1Y67A 1N32O 1PD3A 3CHXA 4O4LA 4UVCA 4LF6O 3BEHA 4X64B 1K33A 2P90A 5KA6A 1V54B 3CEIA 1XUQA 3QG5A 4FM1A 3JCZA 1W2BU 1HNXO 1XOUA 2LGWA 2W0XA 3CCVV 4TT3G 1DF5A 1XBLA 4JI0O 1RP3B 3SYPA 4JI1O 5EZYB 1FXKA 3AG4B 1ZLZA 2IU3A 3N2KA 4LF5B 1MG1A 4FLXA 4O4HB 3ASNB 5LMUB 2ZQMA 1JQ0A 5IWAB 5CBHA 1NTKH 4FFBA 4MSWC 4LF4O 2Y4TA 3OEHG 2PY5A 4MVZA 3DXRB 2F4VB 5EC1C 5KUMA 4I7ZB 1PL0A 2IH3C 3ZBHA 1KP3A 4FLYA 5FPRA 3JAKB 5JH7B 1YJWV 1IXMA 4JTAB 1YI2V 1OCZC 1JX9A 2EZPA 2QTOA 5BZBA 2OTJV 1B06A 3K9AA 1YEWA 1XMOO 5EBLC 4Z1VA 1RFYA 5LL6Y 4PHZA 3ABMB 4YXWG 1IXBA 4FLTA 1SQGA 1D5NA 5IT9N 1EFRG 2EINC 2BE3A 2LFRA 1NR7A 4TUYA 3NXSA 5KHHA
chains in the Genus database with same CATH topology
3K3WA 4EKWA 2HG5C 4MVQA 3QNEA 1P7BA 5HFLA 2DWDC 3CC7V 4QIWF 4PA3A 2IJJA 2Q68A 2DYSC 1NH2B 3CYOA 2CK3G 1FXVA 1I5YA 1Q82W 4MTXA 2ITCC 4X89A 5IYCO 1Q86W 3SYAA 3AG3B 2JEUA 2OCCC 4OXSA 3LDEA 2WWWA 1AR1B 3M99B 4N21A 4MVMA 2HVJC 1AJPA 4LP8A 1AI7A 5GW7A 2IU0A 3CPWU 5LGTA 4GX1A 1V55C 2EIKB 3LDDA 4UVAA 1VQ8V 3ZRXA 3AG1C 1SZTA 5B3SB 2YSUB 2OT5A 4R50A 2YEVA 1K34A 4MW8A 4WCEV 3IGAC 5CBFA 4WF9V 1VQ6V 3WG7C 2GHYA 2WLIA 3ZIAG 3W7SA 1Q7YW 3E8GA 3ABKC 1GK9A 1JJ2U 2ZXWB 5CN0A 3K06A 1COWG 1WLEA 3ZRWB 3ETGA 1PKXA 1LNQA 2DYRB 1OCOB 1EZJA 5KUKA 4LCUC 4QE7A 3SJQC 3ZRSA 3ZMVA 1VQ5V 1W0KG 4FMTA 4FIPC 1VQLV 4P9PA 1S76D 4MW3A 1W0JG 2JJ2G 1AI6A 1TUEB 1V54C 1BL8A 4DO2A 1GTOA 3A0RA 2DQ0A 4QJFB 1FXKB 3OR7C 5B1OA 3E8BA 3TK1A 4PA7A 3K08A 4PDLA 1K7DA 3K04A 3CMAV 2A0LA 3H01A 2B1GA 3LNMB 1CPYA 3ETEA 3RVYA 1DTOA 3DGEA 2EIJC 5EC2C 2ATKC 3OFNG 4J9YB 2Q67A 2P6JA 4MVRA 1BHBA 4MVUA 2DWEC 3FKSG 4CZZA 2XASA 1QVGU 3JD0A 4RAIA 1OCRB 1R3KC 1H2GA 3E8FA 1G8MA 3HPLC 2HLDG 2R9IA 3KG2A 4MTFA 5L3BA 1KECA 4WFEA 3FB6C 2EJRA 3W7WA 1XL6A 3FB8C 1CP9A 2A9HA 2IJIA 1BMFG 1Y4MA 4JPRA 3B8NA 3ZCCA 5LGNA 1BHAA 1S72V 5B1AB 5IYDO 4R8CA 3OUFA 4WFBV 3CCMV 2WPDG 2XOKG 4FK5C 1RPOA 2WLMA 2D3OW 2OCCB 2X0LA 3OM3B 3CCUV 1QR8A 2C2AA 2GSMB 3ABTA 1K73W 1FXHA 3CCLV 1H38A 4PELA 3W7XA 2P7TC 1K3EA 1M90W 1ENVA 3OR6C 3SPHA 1KD1W 3GB7C 2WLKA 4KP4A 1HWYA 3QO8A 5IDJA 1VQKV 2W6IG 4R6ZA 2P67A 3CCRV 2XAGA 3JD1A 2KB1A 1H8HG 2JK5C 1VQMV 5LGUA 2PI5A 4MS2A 3ZN0A 3IC7A 4LC1A 2XAQA 5J9PC 2DW4A 4GX0A 2V7QG 5L3FA 1R6KA 2H94A 4P30A 4XDJA 3ETDA 2Y69C 1K97A 4XDKA 3VBBA 1NR1A 4BIUA 5DN6G 1OCOC 2UXNA 1PNLA 3FB5C 1QLEB 4FJCC 1FS0G 3AG4C 3ML0A 2NNUA 2XAFA 3OMAB 1M57C 3SPGA 2XAHA 2IH1C 4JTCB 3RVZA 4P2ZA 3SPCA 3W7TA 1PNKA 3SYOA 1GM8A 3RW0A 3B77A 2Z5UA 2WLLA 3CMEV 5IY5C 3ZRWA 4MVSA 1RM1C 4L87A 1VQ4V 3X2QC 1PNMA 1S77D 3CCJV 3T4ZA 2HFEC 5EBMC 3LDCA 1SRYA 1AI4A 2EINB 1SESA 2Y69B 4U7NA 1K9MW 2EIMC 1GKFA 4JTDB 1K4DC 3CP1A 2XNDG 3LSSA 1ROPA 3HB3B 4F4LA 1NH2D 1OCCC 5L3EA 2LP7A 4G28B 3AG3C 2EILB 2Y48A 4G2KA 5DM6V 2EILC 1S5HC 4X8AA 1YHQV 1OCRC 3STLC 3MHSC 1YSCA 2YEVB 1M56C 1AJQA 1I5XA 3T2MA 4X88A 4BAYA 4RQFA 4PA4A 3D36A 4P9OA 1QVFU 5B1BC 1R6NA 4UV9A 1YTFB 1K5QA 2R9RB 2PI4A 3ZMTA 4UUJC 3OEEG 2WLNA 1NKDA 1QBZA 2WLHA 1SERA 2EIMB 3TETA 1XL4A 1M9NA 1QLEC 4CBCA 3CD6V 5LBQA 3QO5A 5FL7G 2ZDIA 2ZXWC 5LHGA 2A79B 3F7VC 4QPKA 3P32A 3SPJA 1AROP 1L1FA 4GT1A 4WFGA 5E1AC 3AG1B 5CBGA 2K1EA 1F4NA 4JYBA 4BW5A 1YIJV 2QEXV 4UVBA 2AHYA 4GCZA 5IYBO 4RUFA 3MHHC 1FXKC 2HKOA 1FFTB 1J95A 2HR3A 4LBEC 5B1BB 4R7CA 1KP2A 4PA6A 4TWKA 4WFHA 2MK3A 1NBMG 1UJWB 3ABKB 1KKDA 4FPPA 1NVPD 3ABLB 3QO7A 2DQ3A 1YJNV 2OTLV 1G4YB 2WSSG 5LHIA 1Q81W 3F7YC 1OHHG 2DYRC 1KC8W 5H6QA 1NJIW 1ZWIC 1S0VA 3K0DA 2IJKA 4JASA 3LUTB 2F43G 4UXNA 3ZMZA 1ORQC 3VOUA 5CA3A 3JYCA 1JCHA 1M56B 1MOFA 3AEIA 4UV8A 4KUMA 5H6RA 2NLJC 1RM1B 1Y66A 1F23A 5IY5B 1VQOV 4WFFA 3T1CA 3X2QB 4PDMA 3UM7A 1SETA 4JGSA 3ABLC 3R65A 1P4RA 2WLJA 1JOYA 4ZKIA 3E35A 3ASOC 3K79A 4QPJA 2ITDC 1RPRA 1NQTA 4ZBMA 3OGCC 1NVPB 1OCCB 1S3JA 2LFSA 4JF3A 5L3GA 1YJ9V 2H8PC 1VQNV 2WLLB 1K4CC 4E2LA 3JD2A 2W6JG 1E79G 3PJSK 2X6AA 5KA5A 1B6QA 3OE7G 3CC2V 3E2EA 2IJHA 2B1IA 2W0FC 3G6EV 3ZN1A 1AI5A 1M1KW 1GM9A 2XAJA 2QE7G 3D3IA 1R73A 5B3SC 1WPXA 2AHZA 5EK0A 1QCEA 1AJNA 1E1RG 4MVOA 5L3DA 3E89A 4PDVA 2UXXA 1F4MA 5HFMA 3WFVA 2WLIB 2BOCC 3OAAG 4QE9A 3I56V 4G27B 3ASOB 2ZD9A 2JJ1G 1GMGA 1MSWD 2Q6AA 4RQEA 1VQPV 4ASUG 1VQ7V 1PD3A 3BY6A 1R3IC 4U7OA 5H9CA 2EIJB 4WFAV 4UVCA 3K0GA 3BEHA 1K33A 2P90A 3FB7C 3TCUA 5KA6A 1V54B 1M57B 4KFMA 4JAUA 3DTUB 3T4DA 1KQSU 1QLNA 2FTKA 3JCZA 1W2BU 3RBZA 3E8HA 3W7UA 3CCVV 2X6CA 3FYIB 3SPIA 1QR9A 4HZ3A 2ZR3A 3JD4A 2QM8A 1K92A 1VQ9V 4TT3G 1DF5A 4MT8A 3JD3A 2JDIG 4Z1MG 4XDLA 2DYSB 3G4SV 3CCSV 3ZJZA 1YITV 3SYPA 3ABUA 3CCEV 1FXKA 3AG4B 4N23A 4HAMA 2JEXA 4I5SA 1E1QG 3F5WC 2IU3A 4TSFG 3I55V 1YTFD 4RUEA 1MG1A 3B8MA 3FYEB 3ASNB 1K5SA 3ASNC 2X7RB 2ZQMA 1JQ0A 2V1DA 4XBFA 2ZR2A 2IW5A 2WAMA 5CBHA 2QM7A 3E86A 3ZRVA 1V55B 2EIKC 1DF4A 4HYOA 4MSWC 3G71V 3OEHG 4MVZA 2QKSA 5EBWC 3ZMSA 4DXWA 3SYQA 3CXCU 4I9WA 5EC1C 5CMUA 5KUMA 3EFFK 1PL0A 3ABMC 3OMNB 3OUSA 4JAVA 4GX5A 5B1NA 3WG7B 3K03A 5B1AC 1H8EG 2IH3C 1F51A 2Z3YA 1KP3A 1R3LC 3ZMUA 5C93A 4MTOA 3UKMA 4BIZA 1YJWV 3MD0A 1IXMA 4H37A 3LSQA 1OZ0A 4JTAB 1YI2V 4H33A 1OCZC 1OCZB 3AG2C 1JX9A 3P30A 4J9ZB 3AG2B 2BOBC 2EZPA 2QTOA 1CEZA 1R3JC 1K8AW 2B5UA 3OMIB 3SYCA 5BZBA 2OTJV 4Q20A 3EHBB 5L3CA 2QA4V 4MTGA 1MABG 1DLBA 3K9AA 3GWOA 5EBLC 4PDRA 2Q69A 4QNHB 1GO3F 3ABMB 4YXWG 3IFXA 5LHHA 3CCQV 3CC4V 2X6BA 4RO2A 1EFRG 2EINC 4GX2A 3STZC 2EZOA 2ZDIC 3OW2U 1N8RW 2EBOA 2LFRA 2M7WA 1NR7A 1GM7A 3E83A 1JPXA 2HJFC 2HVKC 1EBOA 3NXSA 4PA9A 1JVMA 1THZA 4JYCA 2JIZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKW A;  2WLH A;  2HG5 C;  3TET A;  3K0G A;  1XL4 A;  4MVQ A;  1P7B A;  3BEH A;  1QLE C;  4CBC A;  2DWD C;  3FB7 C;  3TCU A;  2ZXW C;  2A79 B;  4R8C A;  4PA3 A;  3OUF A;  4KFM A;  3F7V C;  2Q68 A;  3T4D A;  2WLM A;  3SPJ A;  2DYS C;  3RBZ A;  3E8H A;  4WFG A;  2X6C A;  5E1A C;  3SPI A;  2ITC C;  2K1E A;  4X89 A;  5CBG A;  4BW5 A;  4HZ3 A;  3SYA A;  2AHY A;  4RUF A;  2P7T C;  3OR6 C;  4XDL A;  3SPH A;  2OCC C;  3GB7 C;  4OXS A;  3LDE A;  2WLK A;  1J95 A;  4LBE C;  4R7C A;  4PA6 A;  4TWK A;  4WFH A;  3SYP A;  3ZJZ A;  4MVM A;  4R6Z A;  1KKD A;  2HVJ C;  4LP8 A;  3F5W C;  1G4Y B;  2JK5 C;  2KB1 A;  4RUE A;  3F7Y C;  4MS2 A;  4GX1 A;  1V55 C;  3LDD A;  2DYR C;  3AG1 C;  5J9P C;  4GX0 A;  1ZWI C;  3ASN C;  4P30 A;  4R50 A;  2YEV A;  4XDJ A;  5CBH A;  2Y69 C;  3K0D A;  3E86 A;  4MW8 A;  3IGA C;  2EIK C;  5CBF A;  4HYO A;  4MSW C;  4XDK A;  3WG7 C;  3LUT B;  1OCO C;  2WLI A;  3FB5 C;  1ORQ C;  3VOU A;  4MVZ A;  3E8G A;  3JYC A;  2QKS A;  3ABK C;  5EBW C;  3AG4 C;  4DXW A;  3SYQ A;  4I9W A;  5EC1 C;  3K06 A;  1M57 C;  3SPG A;  5KUM A;  2NLJ C;  2IH1 C;  3ABM C;  3EFF K;  3OUS A;  4JTC B;  4P2Z A;  4GX5 A;  3RVZ A;  3SPC A;  3SYO A;  3K03 A;  1LNQ A;  4WFF A;  5B1A C;  3T1C A;  2IH3 C;  3RW0 A;  4PDM A;  1R3L C;  5KUK A;  4LCU C;  4QE7 A;  3SJQ C;  3UM7 A;  3ZRS A;  3ABL C;  2WLL A;  2WLJ A;  3R65 A;  4MTO A;  4P9P A;  4MVS A;  3UKM A;  5IY5 C;  4MW3 A;  3ASO C;  4H37 A;  2ITD C;  3X2Q C;  4JTA B;  4ZBM A;  1V54 C;  3OGC C;  1OCZ C;  1BL8 A;  4H33 A;  3T4Z A;  2HFE C;  3AG2 C;  5EBM C;  4J9Z B;  3LDC A;  2BOB C;  2H8P C;  2QTO A;  2WLL B;  1R3J C;  3OR7 C;  1K4C C;  3E8B A;  4PA7 A;  3SYC A;  3K08 A;  4PDL A;  2EIM C;  5BZB A;  3PJS K;  2X6A A;  3K04 A;  4JTD B;  1K4D C;  2A0L A;  3LNM B;  3RVY A;  4MTG A;  4F4L A;  1OCC C;  4G28 B;  2W0F C;  3AG3 C;  5EBL C;  4PDR A;  2EIL C;  2Q69 A;  4QNH B;  1S5H C;  2EIJ C;  5EC2 C;  2ATK C;  4J9Y B;  1OCR C;  2Q67 A;  3IFX A;  3STL C;  4MVR A;  2AHZ A;  5B3S C;  4MVU A;  5EK0 A;  1M56 C;  2DWE C;  3T2M A;  2X6B A;  4RO2 A;  4X88 A;  4MVO A;  2EIN C;  3E89 A;  4PDV A;  4GX2 A;  3STZ C;  4RAI A;  2WLI B;  2BOC C;  4PA4 A;  4QE9 A;  1R3K C;  3E8F A;  4G27 B;  4P9O A;  3HPL C;  4MTF A;  3KG2 A;  2ZD9 A;  5B1B C;  3E83 A;  2R9R B;  2Q6A A;  2HJF C;  2HVK C;  4WFE A;  3FB6 C;  4UUJ C;  4PA9 A;  1JVM A;  1XL6 A;  4X8A A;  3FB8 C;  1R3I C;  2A9H A;  2WLN A; 
#chains in the Genus database with same CATH topology
 4DV5 B;  4O4I B;  4D7S A;  3UO2 A;  1YF2 A;  1MMM A;  4ICG A;  4PA3 A;  2RQ6 A;  2YIB D;  4JI4 O;  4I0X A;  2CK3 G;  2LQT A;  1MZF A;  3T1H B;  4ABM A;  1WJZ A;  2N04 A;  3AG3 B;  4YIP A;  4JI4 B;  4OXS A;  5FPO A;  3LDE A;  1AR1 B;  4X9Q A;  3K59 A;  2VQF O;  4YY3 O;  3IJ4 A;  1AJP A;  5GW7 A;  1WB7 A;  4O4J A;  3U11 A;  3CPW U;  3O9O A;  5LP6 C;  3LDD A;  4UVA A;  3ZRX A;  5LOV B;  4KHP B;  2YDE A;  2HJD A;  1K34 A;  3RYI B;  4IIJ B;  5LMU O;  4WF9 V;  1NTZ H;  4LFB O;  1Q7Y W;  2YID A;  4WBN A;  3K06 A;  1G6U A;  1PKX A;  4DV2 O;  4IL6 Z;  1OCO B;  2KQX A;  1L0L H;  2Y0I A;  4LCU C;  4QE7 A;  1W0K G;  4FMT A;  4LH6 A;  4JI3 O;  4DV7 B;  5LP6 B;  1VF6 A;  4TV8 A;  5J2U B;  3M7M X;  3U0Z A;  3OR7 C;  5BR8 B;  3E8B A;  3IAY A;  5K1X A;  4PA7 A;  5LMN B;  3H01 A;  3LNM B;  1CPY A;  3SJA C;  1SZX A;  1Y74 A;  5EC2 C;  3OFN G;  2P6J A;  4DW1 A;  2DWE C;  1PP9 H;  3N2G B;  4IYI A;  3K58 A;  1OCR B;  3E8F A;  1GN4 A;  1G8M A;  1Q8I A;  3HPL C;  3W7W A;  2CE4 A;  2V4D A;  2IJI A;  3E22 A;  4J80 A;  2DOS A;  5KHI A;  5IYD O;  4R8C A;  4WFB V;  2XOK G;  4FK5 C;  1IDS A;  1VF7 A;  3HKC B;  2O57 A;  3KKY A;  1H38 A;  4DUZ B;  3W7X A;  1BQZ A;  1KB9 F;  3ZHQ A;  2BSK A;  2WA4 A;  1N0J A;  4HNA B;  4LF6 B;  1GN6 A;  2QDO A;  4U3J A;  1D2D A;  3OGI B;  4GZR B;  4LC1 A;  1FKA O;  3ETD A;  1IX9 A;  4BIU A;  1NR1 A;  5DN6 G;  1TVK B;  3FB5 C;  1QQC A;  4FJC C;  5IYZ B;  3QF7 A;  4P2Z A;  4JI8 B;  3W7T A;  3HKE B;  4DRX A;  4F6R B;  5CA0 B;  2N74 A;  3H1L H;  1XEQ A;  4JV5 B;  4BIO A;  1PNM A;  4I4T A;  3T4Z A;  5EBM C;  3LDC A;  2EIN B;  1SES A;  2CGO A;  3HB3 B;  4LFA O;  3P3N A;  3S3W A;  1OCC C;  2LP7 A;  3AG3 C;  4OX9 B;  1AIL A;  1I7F A;  3J7A U;  4H13 B;  5BR8 O;  1X4T A;  2UXD B;  1FD9 A;  2CGN A;  1I5X A;  3T2M A;  3CX5 F;  4RQF A;  3WB0 A;  3D36 A;  2YI9 A;  5B1B C;  4UV9 A;  3ZMT A;  4UUJ C;  4UCV A;  1NKD A;  1VIB A;  3PN1 A;  4DUY O;  2ADP A;  4CS3 A;  3TET A;  2XHB A;  4AQY B;  3DXR A;  1QLE C;  3CD6 V;  3QO5 A;  5LHG A;  4ZOL A;  1URF A;  3AG7 A;  3H1I H;  4OGQ B;  5IJ0 A;  1KYO F;  4GT1 A;  3CRA A;  2K1E A;  4U3F H;  2QEX V;  5BMV A;  4LF7 B;  4GKK O;  4IHJ A;  2PTM A;  5B1B B;  4R7C A;  3A8T A;  4WFH A;  1WPB A;  3ABK B;  4FPP A;  3QO7 A;  4BWA A;  2DQ3 A;  3RN4 A;  1BE3 H;  3BVO A;  3BA8 A;  3ZS8 C;  5IE9 A;  4TV9 A;  4B3S O;  2UU9 B;  1NJI W;  1ZWI C;  3AK3 A;  1WP7 A;  4FFB B;  3NR7 A;  2MW2 B;  3SGI A;  3ZHV A;  3LUT B;  1S5L Z;  2F43 G;  4JI7 B;  3VOU A;  3CS5 A;  4EFB A;  5C8Y A;  1J5E B;  1MOF A;  2FKX A;  1O9H A;  5LXT A;  3E22 B;  4KUM A;  1RM1 B;  2CTW A;  2OIG A;  3UM7 A;  2ZIM A;  4DV6 O;  4ZKI A;  2YIB A;  3K79 A;  3T1H O;  2UU9 O;  4GLX A;  1TGO A;  3B2E E;  1NVP B;  2LFS A;  1S3J A;  2YIA A;  5CA0 A;  2WLL B;  1KUQ A;  4D6T H;  1M4U A;  3CJH A;  3JD2 A;  4I50 A;  2BSK B;  1B6Q A;  1XMO B;  3JAS B;  3A0H Z;  1SQB H;  2W0F C;  1AI5 A;  1YXB A;  2RJZ A;  1O9G A;  3D3I A;  5B3S C;  1WPX A;  3AK1 A;  1AJN A;  4MVO A;  4EB6 B;  1VAR A;  3A0B Z;  2BOC C;  1I08 A;  2Q6A A;  4DK1 A;  2Q7E A;  1WNS A;  3L73 H;  2RNB A;  3BY6 A;  4ZIB A;  4DUY B;  4FZ0 A;  1FPO A;  1IBK B;  3CRM A;  3K0G A;  4CH4 A;  1GH6 A;  4JI7 O;  3DTU B;  1N0N A;  4JI2 O;  1QLN A;  2FTK A;  1I94 B;  1N36 O;  3RBZ A;  4JYA B;  2X6C A;  3VQX A;  2KG7 A;  1L0N H;  4DK0 A;  1QR9 A;  2QM8 A;  1K92 A;  4K35 A;  4D7T A;  2UUC B;  3DSQ A;  4LF8 O;  5JCO C;  4I55 B;  2RMK B;  4X1K B;  2B9Z A;  4N23 A;  2ZE8 A;  2JEX A;  3D3Q A;  1E1Q G;  1NTM H;  3F5W C;  3I55 V;  4RUE A;  4K8X A;  1IBM B;  1EN4 A;  1K5S A;  1QU7 A;  2X7R B;  4XBF A;  2IW5 A;  2WAM A;  2ZKO A;  1HNX B;  1WA8 B;  2EIK C;  1DF4 A;  1UPG A;  1BGY H;  3G71 V;  3OD4 A;  5JQG B;  3D36 C;  3BA9 A;  4DXW A;  3SYQ A;  3THO A;  1ZSP A;  4PD4 F;  4JAV A;  4GX5 A;  4NXM B;  3K03 A;  2UXB B;  2Z3Y A;  2ZCE A;  1PV0 A;  1TVK A;  3UKM A;  1Q3E A;  4AI8 A;  4DV0 O;  3JAT A;  3MD0 A;  3LSQ A;  3AG2 C;  2LW7 A;  3AG2 B;  1RSO A;  1SS3 A;  1R3J C;  2ODM A;  4IYH A;  5KLV H;  3ZHS A;  2VS0 A;  4PDR A;  2Q69 A;  2G38 A;  1HNZ O;  1IUR A;  3CC4 V;  2X6B A;  4RO2 A;  4LNU A;  4GX2 A;  5JH7 A;  2JGD A;  5GTH Z;  5JVD A;  3OW2 U;  3CE2 A;  2ZNJ A;  1GM7 A;  3E83 A;  2Z0A A;  1H2M A;  1JVM A;  3VQV A;  3CRR A;  3K3W A;  1QHT A;  3BFR A;  3ZX6 A;  1N4C A;  2HG5 C;  3FX7 A;  4MVQ A;  3QNE A;  1WP8 A;  5HFL A;  3CC7 V;  4QIW F;  1GRJ A;  2IJJ A;  2Q68 A;  3UT5 A;  4F6R A;  4JI6 O;  1FXV A;  4MTX A;  4X89 A;  1AR4 A;  2QWN B;  3SR2 C;  4UFZ A;  1AVM A;  2IBZ H;  1AP5 A;  4DV4 B;  3G80 A;  2PGG A;  3M99 B;  3JAW B;  4NB5 A;  1I0H A;  4QGP A;  2AGA A;  4DR4 O;  1FJG B;  1V55 C;  2QWR B;  4L8J A;  1HR0 O;  2ZNI A;  5B3S B;  4DV0 B;  2OT5 A;  4NR1 A;  4PJ0 Z;  4MW8 A;  1PL4 A;  3IGA C;  3DC5 A;  3L70 H;  3ZIA G;  4O4H A;  5KX5 A;  3E8G A;  1WLE A;  3ZRW B;  3ETG A;  1XHZ A;  3L71 H;  1LNQ A;  2DYR B;  3RYF B;  5KHG A;  3IC9 A;  4NYK A;  1F7Y A;  3SJB C;  3B09 A;  2E74 B;  1FFX A;  3WB2 A;  5D5P A;  1W0J G;  5CA1 A;  2JJ2 G;  2Q73 A;  1GTO A;  3EVK A;  1ZTE A;  2WA3 A;  1Q6I A;  3TK1 A;  4PDL A;  3N27 A;  1HP8 A;  2A0L A;  3O65 A;  5J2T B;  2B1G A;  3RVY A;  5J2T A;  3DGE A;  1PM9 A;  3HKB A;  2ATK C;  4MVR A;  2E5L O;  4CZZ A;  4Q6G A;  1Z2G A;  2XAS A;  3C3T A;  2P22 C;  4DV7 O;  2Q9L A;  1EN6 A;  4MTF A;  2AW9 A;  3ICX A;  1KEC A;  4X62 O;  3FB6 C;  2EJR A;  3TGU H;  1XL6 A;  3JSL A;  1CP9 A;  1BMF G;  3ZCC A;  4JPR A;  3B8N A;  2BCC H;  1FFX B;  1S72 V;  5B1A B;  3RYH A;  2QKA A;  4A5U B;  2YC0 A;  5IJ0 B;  2OCC B;  4DR5 B;  5ITZ A;  3OM3 B;  3JAK A;  1QR8 A;  3CCU V;  3AK2 A;  1SKV A;  3J81 N;  5ITZ B;  3ABT A;  1S5J A;  2UXC B;  2P7T C;  3ZHR A;  4WBN B;  3OTO B;  1KD1 W;  5IDJ A;  1VQK V;  4R6Z A;  5GON B;  1NU1 H;  1H8H G;  2JK5 C;  4HBN A;  1VQM V;  1D5A A;  2Q7G A;  2XAQ A;  4GX0 A;  3UCS C;  2BTQ A;  2ILM A;  2YXY A;  3VBB A;  4CC5 A;  1QNM A;  2UXN A;  1BS3 A;  1QLE B;  2EX3 A;  3HKB B;  3AG4 C;  4CH6 A;  2NNU A;  2XAF A;  3OMA B;  4JI6 B;  3K5O A;  3SPC A;  3JAR A;  1PNK A;  5H5N A;  2F23 A;  1IBL O;  4IIJ A;  4JI5 O;  1JFF A;  3EXA A;  1N36 B;  3CME V;  5IWA O;  1I94 O;  1RM1 C;  4L87 A;  2DN9 A;  1VQ4 V;  3X2Q C;  4H0L B;  3TXS A;  3KCX A;  2Y69 B;  4U7N A;  4DR7 O;  1GKF A;  5BXZ A;  4JTD B;  2IM9 A;  3H9V A;  2YS8 A;  4F4L A;  1NI8 A;  4G28 B;  2Y0P A;  5LP6 A;  5DM6 V;  3RGB A;  1YHQ V;  1FJG O;  4TQD A;  2YEV B;  3U10 A;  4PA4 A;  3FFQ A;  4FLZ A;  1QVF U;  1CXZ B;  1R6N A;  3OTO O;  4DR3 B;  1QBZ A;  3TJT A;  1XL4 A;  2R9A A;  2QJ1 A;  2ZXW C;  3P32 A;  1ARO P;  1L1F A;  5E1A C;  4CH5 A;  5CBG A;  2P06 A;  4UVB A;  1IBL B;  3Q4H B;  3MHH C;  1SA0 B;  1HNW B;  1FYJ A;  1J95 A;  1JFF B;  2HR3 A;  4LFA B;  3M8A A;  1KP2 A;  4PA6 A;  1Q5O A;  4TWK A;  2MK3 A;  1NBM G;  1UJW B;  4JI1 B;  3CRQ A;  3ABL B;  3GVM A;  2OCH A;  5LHI A;  1Q81 W;  4Z2W A;  3F7Y C;  4UCU A;  2DYR C;  4LR3 A;  3UO3 A;  4W4L A;  2YI8 A;  1U96 A;  1VP7 A;  5D5Q A;  5DED A;  2VQE O;  4CS4 A;  5KMG B;  5KHJ A;  4UXN A;  1ORQ C;  1M56 B;  2VWK A;  4JYA O;  1EN5 A;  3WU2 Z;  4UV8 A;  4JI2 B;  5FNV A;  4KL1 A;  1VQO V;  3S3X A;  3J80 N;  4JGS A;  3C3S A;  4I9Q A;  2HEP A;  3RWR D;  1ZX3 A;  2ZIO A;  4K0K O;  3OGC C;  4O4L B;  4YHH O;  4JF3 A;  5L3G A;  4AQY O;  4J11 A;  4TQF A;  2H8P C;  1K4C C;  2W6J G;  5EYP A;  1H2N A;  3CC2 V;  3OE7 G;  1Z5W A;  4I4T B;  3L9D A;  3E2E A;  2LGQ A;  3G6E V;  2F93 B;  3TXQ A;  3Q4H A;  5EK0 A;  4O2A B;  1E1R G;  2VQF B;  4UB8 Z;  4PDV A;  1F4M A;  3WFV A;  2WLI B;  3OAA G;  4QE9 A;  4EB6 A;  4G27 B;  3ASO B;  1H2S B;  2GUZ A;  1GMG A;  1X59 A;  2AZ2 A;  4ASU G;  2VWJ A;  1R3I C;  5EZY A;  4GKJ B;  1YCI A;  4WFA V;  3FB7 C;  3TCU A;  4KFM A;  3T4D A;  1KQS U;  3E8H A;  3RYF A;  4PI2 A;  3KCY A;  1IBK O;  3SPI A;  1XNR O;  4HZ3 A;  2RDC A;  5CA1 B;  2ZR3 A;  2JRI A;  1VQ9 V;  4MT8 A;  5K1P A;  4Z1M G;  1OJH A;  4XDL A;  2DYS B;  2CH7 A;  1FAF A;  3CCS V;  3RYI A;  1YIT V;  1P49 A;  4BR6 A;  4HAM A;  4I5S A;  3K5M A;  4TSF G;  1YTF D;  1Q6H A;  3B8M A;  3FYE B;  4DR3 O;  3CSX A;  1OV9 A;  1WB8 A;  4JI3 B;  3ASN C;  1HR0 B;  2LO1 A;  2QR4 A;  2V1D A;  2ZR2 A;  2QM7 A;  4NTX A;  1V55 B;  4HYO A;  2KG7 B;  2ZT9 B;  1XNQ O;  2GV9 A;  3CB2 A;  2KSD A;  2LW1 A;  2QKS A;  3CXH F;  5B66 Z;  3ZMS A;  4I9W A;  3ABM C;  3OMN B;  3OUS A;  5B1N A;  1H8E G;  2E75 B;  1F51 A;  1WAZ A;  4DR1 O;  3ZMU A;  5C93 A;  2Q0A A;  5FNV B;  4BIZ A;  4X20 B;  2L35 A;  1OCZ B;  2BOB C;  2GTA A;  1CEZ A;  2ADQ B;  1K8A W;  2B5U A;  2YUA A;  4LF4 B;  4Q20 A;  3EHB B;  3APO A;  2QTS A;  2VQE B;  3HR0 A;  4E4E A;  3GWO A;  3LSU A;  1GO3 F;  1IBM O;  3RT3 C;  3IFX A;  3CCQ V;  3CJH B;  2Q7H A;  3ZED A;  2ZDI C;  4PV1 B;  2EBO A;  2M7W A;  4LWS A;  3A2F A;  4DW0 A;  1JPX A;  2HVK C;  1XQ8 A;  1N33 O;  4CS2 A;  4JYC A;  2JIZ G;  1K3E A;  5LMN O;  4EKW A;  3LNN A;  2KKW A;  4J7Z A;  3SDL A;  2R70 A;  3H1K H;  5CB4 B;  2GBO A;  2HHH O;  3CYO A;  2A7W A;  1Q82 W;  1B04 A;  1SQF A;  2ITC C;  2UXC O;  5IYC O;  4NTW A;  4NXM O;  3VQW A;  1P84 F;  2OCC C;  5LYJ A;  4DR1 B;  5DEC A;  1SQX H;  5LXT B;  4N21 A;  2ETN A;  4MVM A;  2PZS A;  4DR6 O;  2EJ7 A;  4NXN O;  1XDC A;  2HVJ C;  2QKC A;  4LP8 A;  4GX1 A;  2EIK B;  3JAT B;  1Z5V A;  1SZT A;  1XRE A;  2PF4 E;  4R50 A;  2YEV A;  2CUG A;  5BMV B;  1AB3 A;  5CBF A;  1VQ6 V;  3WG7 C;  2WLI A;  2GDS A;  3ABK C;  4DR7 B;  1JJ2 U;  4B3R B;  3RFR A;  2F4V O;  1XMQ B;  2M6Y A;  4YJ3 B;  1Q43 A;  1HDJ A;  1Y74 B;  4UCR A;  1EZJ A;  1UFI A;  4KXR A;  5A9G A;  3ZRS A;  3SJQ C;  1VQ5 V;  4YJ2 B;  4FIP C;  4JI5 B;  1VQL V;  1MA1 A;  1JA8 A;  1Y6X A;  1V54 C;  2NN4 A;  3A0R A;  4J7J A;  1AP6 A;  1J5E O;  3K08 A;  1SQQ H;  3G6B A;  3CMA V;  3JAL A;  4B7E A;  2ZM6 B;  1DTO A;  4O2A A;  3K5L A;  4B3S B;  2UUA O;  2Q67 A;  1BHB A;  2FL4 A;  3BAB A;  1QVG U;  4RAI A;  3ZHT A;  3ZHU A;  1NT2 B;  5TIS Z;  3JAS A;  1H2G A;  3JAW A;  2R9I A;  3KG2 A;  5L3B A;  4I50 B;  4WFE A;  2A9H A;  5J2U A;  1Y4M A;  1BHA A;  4TOI A;  2AXT Z;  3RYC A;  4FFK A;  2A3Q A;  3OUF A;  3CCM V;  1RPO A;  4GYC B;  1V9P A;  2ZE6 A;  2UUB O;  2GSM B;  1K73 W;  1FXH A;  2L6L A;  3CCL V;  1ENV A;  3OR6 C;  3SPH A;  2YXL A;  1M5I A;  2WLK A;  1W59 A;  2AZ0 A;  1HWY A;  3QO8 A;  4X66 B;  3JSN A;  3CCR V;  2F66 C;  4AHC A;  2XAG A;  2KB1 A;  4YY3 B;  5LGU A;  1ZUQ A;  4JAA A;  3IC7 A;  2OYQ A;  1GAX A;  2V7Q G;  5L3F A;  1R6K A;  4P30 A;  4XDJ A;  3R66 A;  1SA0 A;  4B3T B;  1PNL A;  1KKC A;  4IHJ B;  3L74 H;  4X1I B;  3ML0 A;  4J42 A;  1M57 C;  3L72 H;  2IH1 C;  4JTC B;  3RVZ A;  1Q90 D;  4JV5 O;  1HNW O;  5IY5 C;  3ZRW A;  3VQY A;  4DV1 O;  1WA8 A;  1S77 D;  4CH3 A;  3CCJ V;  5JCO A;  4YHH B;  4X64 O;  4K0K B;  4YJ2 A;  2JVD A;  1K9M W;  4OPA A;  2PYJ A;  4ZOL B;  1R1B A;  3CP1 A;  1NH2 D;  1ROP A;  4C7U A;  2EIL B;  4O4I A;  2EIL C;  4FM0 A;  1XIL A;  2CH7 B;  4B7K A;  3KZI Z;  4OPH A;  1PPJ H;  3MHS C;  1M56 C;  4LFC B;  5GTI Z;  4BAY A;  3HKC A;  3OTF A;  1JMK C;  2PI4 A;  1K5Q A;  2UUA B;  1H2K A;  3OEE G;  4X1Y A;  2WLN A;  2ZM6 O;  1MNG A;  1M9N A;  1Y76 A;  4J41 A;  3CRC A;  4YJ3 A;  5JVD B;  1KBH A;  5FL7 G;  2JS5 A;  2A79 B;  2CTP A;  1JJO A;  2D2C B;  4FLU A;  4JZ2 A;  4FLV A;  4DV5 O;  1F4N A;  1YIJ V;  4BW5 A;  2AHY A;  4GCZ A;  4K8Z A;  4RUF A;  4J10 A;  4DYL A;  4DRX B;  1WN7 A;  4DR2 B;  1YJN V;  1G4Y B;  4EFE A;  1HNZ B;  2DMX A;  1JR9 A;  2A06 H;  1KC8 W;  4UCT A;  1R6T A;  3DC6 A;  3K9S A;  4JAS A;  3JCU Z;  4O2B B;  1XI1 A;  1JCH A;  1ZAU A;  3AEI A;  1XHX A;  1U97 A;  3B4S A;  3BPZ A;  3OT7 A;  3F5T A;  2OIE A;  1F23 A;  4FVM A;  1US6 A;  4WFF A;  3X2Q B;  1N33 B;  2CDY A;  4RWU A;  4ZI7 A;  1SET A;  3R65 A;  2WLJ A;  4FM2 A;  1MSD A;  4QPJ A;  2ITD C;  1RPR A;  3I5D A;  2JGU A;  5CB4 A;  4HNA A;  1VQN V;  2HHH B;  4E2L A;  2P5O A;  5A2Q N;  1L8D A;  2QSA A;  2R72 A;  2X6A A;  3JAM N;  4H44 B;  5FLX N;  4NVP A;  5E79 Z;  2B1I A;  1M1K W;  3ZN1 A;  2XAJ A;  2QE7 G;  5LYJ B;  4X62 B;  4W4K A;  4NTY A;  4TV8 B;  4X65 O;  1QCE A;  5LA6 B;  4FLW A;  5L3D A;  3E89 A;  5HFM A;  4J7K A;  3JAL B;  1BT8 A;  2ZD9 A;  2PUS A;  1VQP V;  1VQ7 V;  4U7O A;  2NR5 A;  5H9C A;  4YIO A;  2EIJ B;  1BZK A;  1Q6U A;  1GN3 A;  3JAR B;  4PI0 A;  1M57 B;  5KMG A;  4JAU A;  2QWQ B;  1LUW A;  4LFC O;  4K3A A;  4ZHQ B;  3W7U A;  1LR1 A;  3FYI B;  4LNU B;  5B5E Z;  2BTQ B;  3JD4 A;  3JD3 A;  2JDI G;  5JJE B;  4DR5 O;  2N05 A;  3G4S V;  3ZJZ A;  4NKG B;  3ABU A;  3CCE V;  2CAZ C;  1XNQ B;  4IGG A;  3N2G A;  1MZE A;  3E86 A;  3ZRV A;  5AG2 A;  4B08 A;  2XT9 A;  1SQP H;  5EBW C;  5IJ9 A;  3P3P A;  3CXC U;  3D8C A;  5CMU A;  3EFF K;  3WG7 B;  5B1A C;  3FD9 A;  4B3T O;  1R3L C;  3WB1 A;  2QM4 A;  4MTO A;  1YZB A;  3MAQ A;  1VEW A;  1ZL8 B;  4JZG A;  4H37 A;  1OZ0 A;  4O4J B;  4H33 A;  5KX5 B;  3P30 A;  4J9Z B;  2CTR A;  2ZIN A;  1HW7 A;  3T1Y O;  3ETQ A;  3OMI B;  5JJJ B;  3SYC A;  2LJ2 A;  5JQG A;  5L3C A;  2QA4 V;  4MTG A;  1MAB G;  1DLB A;  2YIC A;  3HKD B;  4QNH B;  4I0X B;  5LHH A;  4X20 A;  3STZ C;  2EZO A;  1N8R W;  3B40 A;  2HJF C;  1EBO A;  2QGN A;  3GWK C;  4PA9 A;  4O2B A;  1THZ A;  4X8A A;  4EEQ A;  3BRC A;  4JYY A;  2CTQ A;  1YDX A;  1P7B A;  2DWD C;  2Q5Z A;  4AIL C;  2F1M A;  4CC6 A;  2DYS C;  1NH2 B;  1I5Y A;  4X1Y B;  1VF5 B;  4DUZ O;  1Q86 W;  3SYA A;  4BW9 A;  3CWB H;  1EZV H;  2JEU A;  1P7G A;  1LUV A;  2WWW A;  3APQ A;  4DV3 B;  2BTO A;  4X66 O;  3T1Y B;  2QWO B;  4LH7 A;  2F95 B;  1AI7 A;  1IZ3 A;  2IU0 A;  3K5N A;  2UXD O;  1TUB B;  5LGT A;  1VQ8 V;  3BHP A;  3AG1 C;  2YSU B;  2UUB B;  1N34 B;  4WCE V;  2GHY A;  3W7S A;  3K57 A;  1GK9 A;  3QTC A;  2FB5 A;  4JI0 B;  2ZXW B;  5CN0 A;  2HP8 A;  1COW G;  1T5E A;  5EIB C;  4TV9 B;  5KUK A;  4LF8 B;  3ZMV A;  2UUC O;  3FAV B;  4P9P A;  1S76 D;  4MW3 A;  1TAE A;  1A32 A;  4JI8 O;  1AI6 A;  1TUE B;  1ZL8 A;  1BL8 A;  4DO2 A;  2DQ0 A;  4QJF B;  1AR5 A;  1FXK B;  2RN9 A;  5B1O A;  4UB6 Z;  2GUZ B;  1K7D A;  1TUB A;  3K04 A;  1N32 B;  3ETE A;  2UXB O;  2DJV A;  2EIJ C;  4J9Y B;  1NS1 A;  4MVU A;  3HKE A;  3FKS G;  4DR2 O;  3JD0 A;  3UQ8 A;  4LFB B;  1R3K C;  4UCO A;  3C90 A;  2HLD G;  5IJ9 B;  3MDS A;  3FB8 C;  5LGN A;  1H2L A;  4X1K A;  1GN2 A;  1M93 A;  4B3R O;  1SC5 B;  4LWS B;  2WPD G;  2WLM A;  2D3O W;  4X65 B;  2X0L A;  2C2A A;  2P4V A;  5KAF Z;  4PEL A;  1M90 W;  1B3Q A;  3GB7 C;  1NZ6 A;  4KP4 A;  3UT5 B;  2W6I G;  4DR6 B;  2P67 A;  4ZHQ A;  3JD1 A;  2PI5 A;  4F6E A;  4MS2 A;  3ZN0 A;  5J9P C;  5KAI Z;  4DV3 O;  2DW4 A;  2PYL A;  1YVW A;  2OWO A;  2H94 A;  1TA8 A;  2Y69 C;  5LA6 A;  3N2K B;  1K97 A;  1BCC H;  4XDK A;  3G67 A;  5IYZ A;  1OCO C;  1FS0 G;  3QVN A;  3SPG A;  2Y4U A;  2XAH A;  4DV1 B;  3SYO A;  5JJN B;  1GM8 A;  4ZI7 B;  3RW0 A;  1EM1 A;  3B77 A;  2Z5U A;  4GKK B;  4LF7 O;  2WLL A;  4IT5 A;  4MVS A;  3H1H H;  2P4K A;  4DV2 B;  2HFE C;  1SRY A;  1AI4 A;  2EUL A;  1SQV H;  1VMG A;  2EIM C;  3H1J H;  4U3J B;  4DV6 B;  1K4D C;  1KMI Z;  2JGD B;  1N34 O;  4LF9 O;  2XND G;  3LSS A;  2ZE7 A;  5LOV A;  2XUM A;  5L3E A;  3BCC H;  4UCS A;  4KHP O;  2Y48 A;  4G2K A;  1S5H C;  5C8Y B;  1XNR B;  1KU9 A;  1OCR C;  3STL C;  1YSC A;  3HKD A;  1AJQ A;  2DE0 X;  4X88 A;  5BY1 A;  2E5L B;  4P9O A;  2Q8V A;  1YTF B;  2R9R B;  4LF9 B;  4GKJ O;  2WLH A;  5EYP B;  1SER A;  2EIM B;  4CBC A;  5LBQ A;  2ZDI A;  2FYU H;  1Y76 B;  2QWP B;  3F7V C;  4QPK A;  3SPJ A;  2Q0O C;  2Q4P A;  2RCV A;  3FAV A;  4WFG A;  3RYC B;  1DK1 A;  3AG1 B;  4JYB A;  5IYB O;  4X1I A;  4B3M B;  1FXK C;  2HKO A;  1FFT B;  4LBE C;  1BQ0 A;  1BSM A;  5JWP A;  1KKD A;  1NVP D;  2FML A;  1G1X B;  2OTL V;  2WSS G;  4DV4 O;  4FZ1 A;  1DGS A;  2JS3 A;  2GTS A;  1OHH G;  5H6Q A;  2ARH A;  3L75 H;  1S0V A;  3K0D A;  4B3M O;  2IJK A;  3ZMZ A;  3RYH B;  5CA3 A;  3JYC A;  4DR4 B;  1IVS A;  2YXH A;  5H6R A;  3SJC C;  2NLJ C;  1Y66 A;  5IY5 B;  3T1C A;  4OX9 O;  4GUN A;  4PDM A;  5H2F Z;  1VF6 C;  5KHK A;  1SF9 A;  4I55 A;  2E3C A;  2E76 B;  2K9P A;  3ABL C;  1RSO B;  1P4R A;  1JOY A;  5EIB D;  3E35 A;  3ASO C;  1XMQ O;  1NQT A;  4ZBM A;  2VRZ A;  1OCC B;  1YJ9 V;  5GON A;  1E79 G;  3PJS K;  5KA5 A;  3BAA A;  2IJH A;  2ZE5 A;  1GM9 A;  4LF5 O;  1R73 A;  2AHZ A;  4NXN B;  2UXX A;  3I56 V;  5F2V O;  4TUY B;  2XTA A;  2JJ1 G;  1MSW D;  2H3O A;  4RQE A;  1Y67 A;  1N32 O;  1PD3 A;  3CHX A;  4O4L A;  4UVC A;  4LF6 O;  3BEH A;  4X64 B;  1K33 A;  2P90 A;  5KA6 A;  1V54 B;  3CEI A;  1XUQ A;  3QG5 A;  4FM1 A;  3JCZ A;  1W2B U;  1HNX O;  1XOU A;  2LGW A;  2W0X A;  3CCV V;  4TT3 G;  1DF5 A;  1XBL A;  4JI0 O;  1RP3 B;  3SYP A;  4JI1 O;  5EZY B;  1FXK A;  3AG4 B;  1ZLZ A;  2IU3 A;  3N2K A;  4LF5 B;  1MG1 A;  4FLX A;  4O4H B;  3ASN B;  5LMU B;  2ZQM A;  1JQ0 A;  5IWA B;  5CBH A;  1NTK H;  4FFB A;  4MSW C;  4LF4 O;  2Y4T A;  3OEH G;  2PY5 A;  4MVZ A;  3DXR B;  2F4V B;  5EC1 C;  5KUM A;  4I7Z B;  1PL0 A;  2IH3 C;  3ZBH A;  1KP3 A;  4FLY A;  5FPR A;  3JAK B;  5JH7 B;  1YJW V;  1IXM A;  4JTA B;  1YI2 V;  1OCZ C;  1JX9 A;  2EZP A;  2QTO A;  5BZB A;  2OTJ V;  1B06 A;  3K9A A;  1YEW A;  1XMO O;  5EBL C;  4Z1V A;  1RFY A;  5LL6 Y;  4PHZ A;  3ABM B;  4YXW G;  1IXB A;  4FLT A;  1SQG A;  1D5N A;  5IT9 N;  1EFR G;  2EIN C;  2BE3 A;  2LFR A;  1NR7 A;  4TUY A;  3NXS A;  5KHH A; 
#chains in the Genus database with same CATH homology
 3K3W A;  4EKW A;  2HG5 C;  4MVQ A;  3QNE A;  1P7B A;  5HFL A;  2DWD C;  3CC7 V;  4QIW F;  4PA3 A;  2IJJ A;  2Q68 A;  2DYS C;  1NH2 B;  3CYO A;  2CK3 G;  1FXV A;  1I5Y A;  1Q82 W;  4MTX A;  2ITC C;  4X89 A;  5IYC O;  1Q86 W;  3SYA A;  3AG3 B;  2JEU A;  2OCC C;  4OXS A;  3LDE A;  2WWW A;  1AR1 B;  3M99 B;  4N21 A;  4MVM A;  2HVJ C;  1AJP A;  4LP8 A;  1AI7 A;  5GW7 A;  2IU0 A;  3CPW U;  5LGT A;  4GX1 A;  1V55 C;  2EIK B;  3LDD A;  4UVA A;  1VQ8 V;  3ZRX A;  3AG1 C;  1SZT A;  5B3S B;  2YSU B;  2OT5 A;  4R50 A;  2YEV A;  1K34 A;  4MW8 A;  4WCE V;  3IGA C;  5CBF A;  4WF9 V;  1VQ6 V;  3WG7 C;  2GHY A;  2WLI A;  3ZIA G;  3W7S A;  1Q7Y W;  3E8G A;  3ABK C;  1GK9 A;  1JJ2 U;  2ZXW B;  5CN0 A;  3K06 A;  1COW G;  1WLE A;  3ZRW B;  3ETG A;  1PKX A;  1LNQ A;  2DYR B;  1OCO B;  1EZJ A;  5KUK A;  4LCU C;  4QE7 A;  3SJQ C;  3ZRS A;  3ZMV A;  1VQ5 V;  1W0K G;  4FMT A;  4FIP C;  1VQL V;  4P9P A;  1S76 D;  4MW3 A;  1W0J G;  2JJ2 G;  1AI6 A;  1TUE B;  1V54 C;  1BL8 A;  4DO2 A;  1GTO A;  3A0R A;  2DQ0 A;  4QJF B;  1FXK B;  3OR7 C;  5B1O A;  3E8B A;  3TK1 A;  4PA7 A;  3K08 A;  4PDL A;  1K7D A;  3K04 A;  3CMA V;  2A0L A;  3H01 A;  2B1G A;  3LNM B;  1CPY A;  3ETE A;  3RVY A;  1DTO A;  3DGE A;  2EIJ C;  5EC2 C;  2ATK C;  3OFN G;  4J9Y B;  2Q67 A;  2P6J A;  4MVR A;  1BHB A;  4MVU A;  2DWE C;  3FKS G;  4CZZ A;  2XAS A;  1QVG U;  3JD0 A;  4RAI A;  1OCR B;  1R3K C;  1H2G A;  3E8F A;  1G8M A;  3HPL C;  2HLD G;  2R9I A;  3KG2 A;  4MTF A;  5L3B A;  1KEC A;  4WFE A;  3FB6 C;  2EJR A;  3W7W A;  1XL6 A;  3FB8 C;  1CP9 A;  2A9H A;  2IJI A;  1BMF G;  1Y4M A;  4JPR A;  3B8N A;  3ZCC A;  5LGN A;  1BHA A;  1S72 V;  5B1A B;  5IYD O;  4R8C A;  3OUF A;  4WFB V;  3CCM V;  2WPD G;  2XOK G;  4FK5 C;  1RPO A;  2WLM A;  2D3O W;  2OCC B;  2X0L A;  3OM3 B;  3CCU V;  1QR8 A;  2C2A A;  2GSM B;  3ABT A;  1K73 W;  1FXH A;  3CCL V;  1H38 A;  4PEL A;  3W7X A;  2P7T C;  1K3E A;  1M90 W;  1ENV A;  3OR6 C;  3SPH A;  1KD1 W;  3GB7 C;  2WLK A;  4KP4 A;  1HWY A;  3QO8 A;  5IDJ A;  1VQK V;  2W6I G;  4R6Z A;  2P67 A;  3CCR V;  2XAG A;  3JD1 A;  2KB1 A;  1H8H G;  2JK5 C;  1VQM V;  5LGU A;  2PI5 A;  4MS2 A;  3ZN0 A;  3IC7 A;  4LC1 A;  2XAQ A;  5J9P C;  2DW4 A;  4GX0 A;  2V7Q G;  5L3F A;  1R6K A;  2H94 A;  4P30 A;  4XDJ A;  3ETD A;  2Y69 C;  1K97 A;  4XDK A;  3VBB A;  1NR1 A;  4BIU A;  5DN6 G;  1OCO C;  2UXN A;  1PNL A;  3FB5 C;  1QLE B;  4FJC C;  1FS0 G;  3AG4 C;  3ML0 A;  2NNU A;  2XAF A;  3OMA B;  1M57 C;  3SPG A;  2XAH A;  2IH1 C;  4JTC B;  3RVZ A;  4P2Z A;  3SPC A;  3W7T A;  1PNK A;  3SYO A;  1GM8 A;  3RW0 A;  3B77 A;  2Z5U A;  2WLL A;  3CME V;  5IY5 C;  3ZRW A;  4MVS A;  1RM1 C;  4L87 A;  1VQ4 V;  3X2Q C;  1PNM A;  1S77 D;  3CCJ V;  3T4Z A;  2HFE C;  5EBM C;  3LDC A;  1SRY A;  1AI4 A;  2EIN B;  1SES A;  2Y69 B;  4U7N A;  1K9M W;  2EIM C;  1GKF A;  4JTD B;  1K4D C;  3CP1 A;  2XND G;  3LSS A;  1ROP A;  3HB3 B;  4F4L A;  1NH2 D;  1OCC C;  5L3E A;  2LP7 A;  4G28 B;  3AG3 C;  2EIL B;  2Y48 A;  4G2K A;  5DM6 V;  2EIL C;  1S5H C;  4X8A A;  1YHQ V;  1OCR C;  3STL C;  3MHS C;  1YSC A;  2YEV B;  1M56 C;  1AJQ A;  1I5X A;  3T2M A;  4X88 A;  4BAY A;  4RQF A;  4PA4 A;  3D36 A;  4P9O A;  1QVF U;  5B1B C;  1R6N A;  4UV9 A;  1YTF B;  1K5Q A;  2R9R B;  2PI4 A;  3ZMT A;  4UUJ C;  3OEE G;  2WLN A;  1NKD A;  1QBZ A;  2WLH A;  1SER A;  2EIM B;  3TET A;  1XL4 A;  1M9N A;  1QLE C;  4CBC A;  3CD6 V;  5LBQ A;  3QO5 A;  5FL7 G;  2ZDI A;  2ZXW C;  5LHG A;  2A79 B;  3F7V C;  4QPK A;  3P32 A;  3SPJ A;  1ARO P;  1L1F A;  4GT1 A;  4WFG A;  5E1A C;  3AG1 B;  5CBG A;  2K1E A;  1F4N A;  4JYB A;  4BW5 A;  1YIJ V;  2QEX V;  4UVB A;  2AHY A;  4GCZ A;  5IYB O;  4RUF A;  3MHH C;  1FXK C;  2HKO A;  1FFT B;  1J95 A;  2HR3 A;  4LBE C;  5B1B B;  4R7C A;  1KP2 A;  4PA6 A;  4TWK A;  4WFH A;  2MK3 A;  1NBM G;  1UJW B;  3ABK B;  1KKD A;  4FPP A;  1NVP D;  3ABL B;  3QO7 A;  2DQ3 A;  1YJN V;  2OTL V;  1G4Y B;  2WSS G;  5LHI A;  1Q81 W;  3F7Y C;  1OHH G;  2DYR C;  1KC8 W;  5H6Q A;  1NJI W;  1ZWI C;  1S0V A;  3K0D A;  2IJK A;  4JAS A;  3LUT B;  2F43 G;  4UXN A;  3ZMZ A;  1ORQ C;  3VOU A;  5CA3 A;  3JYC A;  1JCH A;  1M56 B;  1MOF A;  3AEI A;  4UV8 A;  4KUM A;  5H6R A;  2NLJ C;  1RM1 B;  1Y66 A;  1F23 A;  5IY5 B;  1VQO V;  4WFF A;  3T1C A;  3X2Q B;  4PDM A;  3UM7 A;  1SET A;  4JGS A;  3ABL C;  3R65 A;  1P4R A;  2WLJ A;  1JOY A;  4ZKI A;  3E35 A;  3ASO C;  3K79 A;  4QPJ A;  2ITD C;  1RPR A;  1NQT A;  4ZBM A;  3OGC C;  1NVP B;  1OCC B;  1S3J A;  2LFS A;  4JF3 A;  5L3G A;  1YJ9 V;  2H8P C;  1VQN V;  2WLL B;  1K4C C;  4E2L A;  3JD2 A;  2W6J G;  1E79 G;  3PJS K;  2X6A A;  5KA5 A;  1B6Q A;  3OE7 G;  3CC2 V;  3E2E A;  2IJH A;  2B1I A;  2W0F C;  3G6E V;  3ZN1 A;  1AI5 A;  1M1K W;  1GM9 A;  2XAJ A;  2QE7 G;  3D3I A;  1R73 A;  5B3S C;  1WPX A;  2AHZ A;  5EK0 A;  1QCE A;  1AJN A;  1E1R G;  4MVO A;  5L3D A;  3E89 A;  4PDV A;  2UXX A;  1F4M A;  5HFM A;  3WFV A;  2WLI B;  2BOC C;  3OAA G;  4QE9 A;  3I56 V;  4G27 B;  3ASO B;  2ZD9 A;  2JJ1 G;  1GMG A;  1MSW D;  2Q6A A;  4RQE A;  1VQP V;  4ASU G;  1VQ7 V;  1PD3 A;  3BY6 A;  1R3I C;  4U7O A;  5H9C A;  2EIJ B;  4WFA V;  4UVC A;  3K0G A;  3BEH A;  1K33 A;  2P90 A;  3FB7 C;  3TCU A;  5KA6 A;  1V54 B;  1M57 B;  4KFM A;  4JAU A;  3DTU B;  3T4D A;  1KQS U;  1QLN A;  2FTK A;  3JCZ A;  1W2B U;  3RBZ A;  3E8H A;  3W7U A;  3CCV V;  2X6C A;  3FYI B;  3SPI A;  1QR9 A;  4HZ3 A;  2ZR3 A;  3JD4 A;  2QM8 A;  1K92 A;  1VQ9 V;  4TT3 G;  1DF5 A;  4MT8 A;  3JD3 A;  2JDI G;  4Z1M G;  4XDL A;  2DYS B;  3G4S V;  3CCS V;  3ZJZ A;  1YIT V;  3SYP A;  3ABU A;  3CCE V;  1FXK A;  3AG4 B;  4N23 A;  4HAM A;  2JEX A;  4I5S A;  1E1Q G;  3F5W C;  2IU3 A;  4TSF G;  3I55 V;  1YTF D;  4RUE A;  1MG1 A;  3B8M A;  3FYE B;  3ASN B;  1K5S A;  3ASN C;  2X7R B;  2ZQM A;  1JQ0 A;  2V1D A;  4XBF A;  2ZR2 A;  2IW5 A;  2WAM A;  5CBH A;  2QM7 A;  3E86 A;  3ZRV A;  1V55 B;  2EIK C;  1DF4 A;  4HYO A;  4MSW C;  3G71 V;  3OEH G;  4MVZ A;  2QKS A;  5EBW C;  3ZMS A;  4DXW A;  3SYQ A;  3CXC U;  4I9W A;  5EC1 C;  5CMU A;  5KUM A;  3EFF K;  1PL0 A;  3ABM C;  3OMN B;  3OUS A;  4JAV A;  4GX5 A;  5B1N A;  3WG7 B;  3K03 A;  5B1A C;  1H8E G;  2IH3 C;  1F51 A;  2Z3Y A;  1KP3 A;  1R3L C;  3ZMU A;  5C93 A;  4MTO A;  3UKM A;  4BIZ A;  1YJW V;  3MD0 A;  1IXM A;  4H37 A;  3LSQ A;  1OZ0 A;  4JTA B;  1YI2 V;  4H33 A;  1OCZ C;  1OCZ B;  3AG2 C;  1JX9 A;  3P30 A;  4J9Z B;  3AG2 B;  2BOB C;  2EZP A;  2QTO A;  1CEZ A;  1R3J C;  1K8A W;  2B5U A;  3OMI B;  3SYC A;  5BZB A;  2OTJ V;  4Q20 A;  3EHB B;  5L3C A;  2QA4 V;  4MTG A;  1MAB G;  1DLB A;  3K9A A;  3GWO A;  5EBL C;  4PDR A;  2Q69 A;  4QNH B;  1GO3 F;  3ABM B;  4YXW G;  3IFX A;  5LHH A;  3CCQ V;  3CC4 V;  2X6B A;  4RO2 A;  1EFR G;  2EIN C;  4GX2 A;  3STZ C;  2EZO A;  2ZDI C;  3OW2 U;  1N8R W;  2EBO A;  2LFR A;  2M7W A;  1NR7 A;  1GM7 A;  3E83 A;  1JPX A;  2HJF C;  2HVK C;  1EBO A;  3NXS A;  4PA9 A;  1JVM A;  1THZ A;  4JYC A;  2JIZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...