1JVMA

Kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Energetic optimization of ion conduction rate by the K+ selectivity filter.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 34
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jvmA00
4P9PA 1QLEC 4PDRA 4WFFA 4GX2A 4PDVA 5IY5C 1S5HC 4PA7A 3WG7C 4DXWA 2DYSC 1J95A 3FB6C 3K08A 3SYAA 3SYQA 1ORQC 4QE7A 3K04A 3LDEA 3STZC 3SYCA 4MTGA 3TETA 2WLLB 3TCUA 4RAIA 3F5WC 3E8BA 4J9YB 4OXSA 2X6AA 1M56C 2X6BA 1R3IC 2IH1C 3ASOC 3ASNC 1OCOC 4P9OA 3AG2C 4LCUC 5CBFA 2DWEC 3R65A 1XL4A 3OR6C 4R6ZA 1K4CC 4KFMA 3OR7C 4I9WA 1ZWIC 3ABLC 1R3KC 4JTCB 1R3LC 2Y69C 3RW0A 2HJFC 1G4YB 2W0FC 4HZ3A 4MTOA 3SPCA 4HYOA 3K0GA 3FB5C 1V54C 1V55C 3BEHA 3PJSK 4ZBMA 3F7YC 2NLJC 4GX0A 2EIKC 2K1EA 1K4DC 4MW8A 4MVOA 3SJQC 4WFEA 3E8FA 2X6CA 3HPLC 3SYPA 5EC2C 3IGAC 3K06A 3X2QC 3GB7C 1OCZC 5EK0A 4EKWA 2WLMA 4MSWC 2HVKC 4BW5A 2WLIB 3SYOA 1KKDA 2H8PC 5B1AC 2A79B 2Q68A 4JTAB 2DWDC 2HFEC 1XL6A 2WLLA 4X89A 4MVZA 5BZBA 2ZXWC 4MVUA 2WLHA 3ABMC 3E8HA 3IFXA 3SPHA 3VOUA 2Q6AA 4MVQA 3SPIA 3T4DA 2A9HA 2HVJC 3E8GA 4F4LA 4PA9A 1JVMA 5B1BC 5EBLC 5EBWC 5B3SC 1R3JC 2KB1A 3OUFA 4XDJA 3ZJZA 2DYRC 3SPJA 3FB8C 1LNQA 4MVSA 2ZD9A 3RBZA 4CBCA 2A0LA 2EILC 4LP8A 5KUMA 3SPGA 3F7VC 4MTFA 3RVYA 4P30A 2EIMC 4PDLA 4QNHB 3AG3C 5CBHA 2YEVA 3EFFK 1OCRC 2JK5C 4X8AA 2QKSA 3AG1C 3E86A 3OUSA 4R8CA 4GX1A 4PA4A 3T2MA 1OCCC 2BOBC 5EBMC 4TWKA 2ITDC 3E89A 3LDCA 4UUJC 2AHYA 5E1AC 2WLNA 2ITCC 2AHZA 3K03A 2WLIA 4PA6A 4RUEA 3KG2A 2EINC 4MVMA 1BL8A 2WLJA 1P7BA 4H33A 4XDKA 2BOCC 3E83A 4XDLA 4PA3A 3RVZA 4G27B 4WFGA 2P7TC 3STLC 3LNMB 4LBEC 3UM7A 4MS2A 3ZRSA 2OCCC 4JTDB 3LDDA 3K0DA 4P2ZA 2EIJC 3T1CA 2WLKA 2IH3C 3AG4C 2Q67A 5KUKA 4QE9A 4R50A 3T4ZA 1M57C 4G28B 4RO2A 2HG5C 4MW3A 4RUFA 5J9PC 4MVRA 3LUTB 5CBGA 4WFHA 3OGCC 2QTOA 5EC1C 3JYCA 2R9RB 4GX5A 4H37A 4R7CA 3FB7C 4PDMA 2Q69A 3UKMA 2ATKC 4X88A 4J9ZB 3ABKC
chains in the Genus database with same CATH superfamily
5IJ9A 4FLWA 3D3QA 1PD3A 2KSDA 1K5QA 2CE4A 3M8AA 4H0LB 3JATB 3SYCA 3TETA 2WLLB 4UCRA 2KKWA 3HKEA 3QF7A 2JS5A 3ZRWB 3K59A 3CRCA 1DK1A 2VQEB 1RSOA 1VIBA 1QLEB 3OR7C 1ZWIC 5JJJB 2QEXV 1I5YA 3F7YC 4UFZA 2EIKC 4B3SO 3HPLC 3BA8A 3G6BA 1NVPB 1Y74B 2QKCA 4DV6B 5ITZA 1GRJA 3CS5A 5B3SB 2XAGA 1NR1A 4JGSA 4CH4A 2OIGA 3FD9A 4F6EA 1KU9A 1EZVH 4I50A 1GAXA 2UUCO 5H9CA 4BIUA 4CC5A 4QIWF 3J80N 5E79Z 2BSKA 1HR0B 5FL7G 4J41A 3GWOA 4FK5C 2B1GA 1AJNA 1AVMA 1AILA 4KXRA 1VQMV 3F5TA 2QDOA 1SZXA 2RNBA 1VF5B 1MABG 1BQ0A 1K97A 3ICXA 2F4VO 3TJTA 1QVGU 1M93A 4MVMA 5EYPB 2HKOA 3FAVB 4NKGB 4YJ3B 5KX5A 5KHJA 5IYZB 3ZIAG 1Y76B 2UXDB 4K0KB 4IYIA 3K9SA 3JD1A 3ETQA 5J9PC 4DR7O 3LUTB 1MSWD 4U7NA 2QM4A 3RYCB 4GKKB 3JSNA 5KA6A 4O2BA 4JI5B 2ZR3A 3THOA 4UB8Z 4DR3B 5CA1B 4FZ1A 1JFFB 4PHZA 1MOFA 1SQVH 1YEWA 2X6AA 1EM1A 3CCJV 4LF4O 4C7UA 4P9OA 3AG2C 5IYCO 1VQKV 2Y0IA 1R3KC 2Y69C 4FJCC 2Q0OC 3VQVA 3IAYA 4HZ3A 5EZYB 1I94O 1XHZA 1ZLZA 1X59A 4X1KA 3LNNA 1XOUA 3VQXA 5C8YA 1VQOV 4HNAA 2ZM6B 4UCSA 2UXCB 3JARB 4JI3O 5F2VO 5KA5A 3Q4HB 4MVQA 2A06H 2A9HA 2QWOB 1HNXO 4PA9A 5IT9N 2UUBB 4CH6A 5B3SC 2K9PA 2JEUA 4PI2A 1FJGO 2E74B 5JJEB 4LP8A 5KUMA 4OX9B 2Q9LA 2XOKG 4LFBB 1YF2A 4CC6A 1HNZO 5LGNA 4GKJO 2GTSA 3I56V 4IHJA 3N2GB 1NVPD 1AP5A 1GKFA 5CB4B 1W0KG 3CCEV 3VBBA 2BOBC 3E89A 1XNRO 3ZN1A 5H6RA 4MT8A 4EFEA 1NH2B 1QNMA 1IZ3A 2XNDG 3R66A 3AG3B 4G27B 2Q5ZA 5KAIZ 3K0DA 3DC6A 1H2MA 3ZHUA 3ZHQA 1B6QA 2AGAA 2L6LA 1WB7A 2VWKA 3HB3B 4DV1O 5GONA 5EC1C 1OHHG 1VMGA 2Q8VA 4R7CA 4WFFA 5IY5C 1S5HC 2IJIA 3RYIA 3E22A 2IU3A 2P6JA 3OTOB 2YICA 4DR6B 2V1DA 5JCOA 4J9YB 2BTOA 1OCOC 1UJWB 5B5EZ 5DM6V 4K3AA 5IWAO 4PV1B 4TQDA 4JYAB 4X64O 1TA8A 2CGOA 2Q0AA 2OTJV 1S0VA 1JA8A 1RPRA 4X1IB 5LBQA 4LF7B 1Q6UA 1IBKO 4I7ZB 3G6EV 2OWOA 3OM3B 4CS2A 1K5SA 2PF4E 3JD4A 5L3FA 4JTAB 4X89A 3MHSC 3ABMC 1LUWA 1BS3A 1GN3A 4YJ2B 4XDJA 1D5NA 4LWSB 1L0NH 2N04A 3RBZA 2UXBB 1PV0A 2JGUA 2NR5A 3IC9A 2BCCH 3O9OA 1VQ6V 4QNHB 4AHCA 4JI7O 3AK3A 3HKDA 3G71V 2WA4A 4QGPA 2CTRA 4R8CA 5B1BB 2EJ7A 4DR5B 4LF5B 3OT7A 3LDCA 5E1AC 1S5JA 2YC0A 3W7WA 4LF8O 2BOCC 1NR7A 4JZ2A 3LNMB 3LSQA 4NR1A 1FPOA 2WLKA 3CJHA 4PJ0Z 4JI1O 4UV8A 5LYJA 3CMEV 2PY5A 2DOSA 1XQ8A 4H37A 2VRZA 5IYDO 2JEXA 1RPOA 4X88A 1AJPA 1WPXA 2PI5A 4DK1A 3SJAC 3BCCH 1KUQA 2JJ1G 3VQWA 1M57B 3K08A 4FFBA 3ZEDA 4QE7A 4O4IA 1AP6A 2GUZB 1Q82W 1VQNV 1NJIW 2IH1C 1PNMA 1XL4A 3JAKB 1N4CA 3ZMZA 2X0LA 1IXBA 2EZPA 3BFRA 3J81N 4JI4B 2L35A 1QVFU 3N2KB 1V54C 1V55C 3A2FA 3ASNB 3SYPA 1RM1C 3E2EA 2PGGA 3NR7A 3QVNA 4ZOLA 2OT5A 1SQFA 1XL6A 1M1KW 3VQYA 1N32B 3DXRB 3VOUA 2JGDA 2ZDIC 4X65O 3X2QB 4X66O 2F93B 2EX3A 4DV7O 2RJZA 3APOA 3WU2Z 5LHHA 3RVYA 1FS0G 3ZMVA 3KCYA 1SQXH 5LGTA 4FM0A 5BMVB 5LP6C 3G80A 4GX1A 1EN4A 4RWUA 2AHYA 2AHZA 2LFRA 4J42A 4H33A 5L3CA 1XNQB 3E83A 1PKXA 4LC1A 1DLBA 3AG4C 1Y4MA 4K8ZA 1OCCB 4UCUA 1YVWA 1YCIA 1YIJV 1N36B 1LUVA 4JI6B 1GM7A 4WF9V 2F66C 3T1HB 4PDMA 2Q69A 1ZX3A 1MNGA 1FXVA 1IBMB 2QTSA 1FFXA 3W7TA 2DYSC 3RYHA 2CTQA 2ARHA 2VQFO 4W4KA 3E8BA 4OXSA 3I5DA 4I0XA 4DR4O 1J5EO 2ZNIA 4EFBA 1SRYA 4IT5A 2HLDG 5LOVB 4I9WA 2H3OA 3UT5B 1YSCA 2JS3A 3BEHA 4DV5O 5CA3A 4O2AA 1VQ5V 5BR8B 3AG7A 1IURA 4LFAO 4DUYB 3K06A 3SJCC 2YSUB 4MSWC 3EXAA 3H1KH 1JX9A 1P4RA 4I9QA 3J7AU 4N23A 1K34A 4N21A 5K1XA 3JATA 2WLLA 1KKCA 1B04A 1AI4A 2EIKB 3ZRWA 4GCZA 1NTMH 3OMAB 1PNKA 1K9MW 3CCLV 3LSUA 1N33O 4D7SA 1XDCA 3SPJA 1LNQA 1H2GA 1OJHA 2EILC 2W6IG 4P30A 1F7YA 5EIBD 3CRQA 4A5UB 1XMOO 3QNEA 1OCRC 2IJKA 1DTOA 4BWAA 4J7KA 2DMXA 1H8EG 1Y74A 4B3TO 4LF6O 1NTZH 3CMAV 2P7TC 1BCCH 4Z1MG 3H1IH 3K5LA 1KMIZ 2UXXA 1WNSA 4OPHA 1YZBA 4X9QA 4I55B 4I5SA 1W2BU 3CD6V 2Q7HA 2YUAA 4UCVA 2LQTA 2YIAA 2QE7G 1R73A 3SYQA 3LDEA 4U7OA 1T5EA 3ZHSA 3P32A 5EYPA 4FM2A 3SR2C 3FAVA 2IBZH 4B3SB 3ASOC 4BIZA 4YJ3A 2A7WA 3K57A 5IYZA 1S3JA 5CA0B 1Y76A 5H2FZ 1YJNV 3BVOA 3CXHF 5LMNO 3K0GA 4DR2O 1ZTEA 4J7ZA 1Q43A 4TV9B 3ZBHA 2EJRA 2N74A 1G8MA 3AG2B 2RCVA 3ZS8C 3RYCA 2UUCB 3CB2A 1F51A 2Y69B 4X1YA 4FLUA 1PM9A 2A79B 1YTFB 1MG1A 2JDIG 5CA1A 4I4TB 1JFFA 5KMGB 2DJVA 3ZX6A 2Q6AA 3T4DA 3ZRXA 3RYFB 3FYEB 5J2TB 2Y0PA 2F4VB 5IDJA 1K7DA 3JAMN 5CMUA 1NKDA 5EZYA 3JALB 1UFIA 4FLXA 3MDSA 4IIJB 2OCHA 4NYKA 2UU9O 4O4JB 3ZHVA 4DR7B 1K92A 4PA6A 2WA3A 5LXTB 2AZ0A 4NXNO 3UQ8A 1TVKB 3JARA 4NTWA 3Q4HA 2V4DA 2QWNB 2ZIOA 4JI8O 4R50A 5FPOA 4B7KA 3TK1A 2PYJA 1GM8A 1JOYA 4U3FH 3OGCC 3JYCA 1H2KA 2PI4A 1L0LH 5JH7B 4LF4B 3WB0A 5H5NA 3OUSA 4WFAV 3DSQA 3N2GA 4JI0O 5CB4A 1EBOA 2QWRB 1I94B 1QQCA 4B3MO 1S72V 4HAMA 1OZ0A 3R65A 1AI5A 3ML0A 5IY5B 1K4CC 2P67A 4X20B 2XAHA 4DV2O 4TQFA 4HYOA 2CTPA 5KAFZ 4IL6Z 3U11A 4JI3B 3APQA 4K8XA 1K4DC 4MVOA 4EEQA 1OCOB 1HNXB 4D7TA 4NTYA 2P06A 1FJGB 2WLIB 1KKDA 4QPKA 1XILA 4GLXA 2DWDC 4FLVA 5JWPA 1HNZB 1WA8B 1SESA 4GKJB 4H13B 2XHBA 1PPJH 1JMKC 2CH7B 1XNRB 1GN2A 2ZD9A 4DUZB 4LF9O 3ABUA 3BA9A 4B3RO 1VQPV 4DV0O 3ABMB 4X8AA 2QSAA 4WBNB 4RQEA 3CCSV 3AG1C 4X1IA 1DGSA 3OFNG 4L8JA 4TWKA 1R1BA 1YTFD 1HWYA 2RMKB 5H6QA 4DV1B 2BTQB 4AILC 2E5LO 3SGIA 4JAUA 3L72H 3T1CA 1VF6C 5LA6B 4YJ2A 3B8NA 2Z5UA 1XREA 4LWSA 4WFHA 4FPPA 1H2LA 5HFMA 2FYUH 4AQYO 4DV4O 1AR5A 4DUZO 4NTXA 5IWAB 1YDXA 1K3EA 4X64B 3TCUA 1NI8A 3A0RA 1BZKA 2IW5A 2ZE6A 1KQSU 1GO3F 3KZIZ 4W4LA 3ZRVA 1FKAO 4F6RB 1IBKB 2YIBD 2LW7A 3HR0A 3ZCCA 3JD0A 3RW0A 2WPDG 2LGWA 1THZA 2F1MA 3L70H 4PD4F 5FLXN 1FXKC 1UPGA 3M7MX 5D5PA 3E8FA 4O4HB 1S77D 1WPBA 2WLMA 1FD9A 3ZHTA 2H8PC 5DECA 1V55B 1V54B 3TXQA 1B06A 4JI7B 2WLHA 2GUZA 3E8HA 3SPHA 1G6UA 2HVJC 1RM1B 1JVMA 2B5UA 3JAKA 4E4EA 4FMTA 4LF8B 2R72A 3IC7A 2Q73A 3N2KA 2ZE8A 2RDCA 3G4SV 3OEHG 2D3OW 3CCUV 3AEIA 4FFKA 1ZUQA 4JI1B 1Q3EA 2UUAO 2IJHA 1YJ9V 1HDJA 5LMUO 3H1HH 2WLJA 2AXTZ 1K33A 4PA3A 5FNVB 3S3WA 3GWKC 4ZI7B 4JTDB 3DXRA 3LDDA 2CK3G 4HBNA 1VARA 5LP6B 1KECA 1R6TA 2ADPA 1JJ2U 4G28B 1IVSA 2HG5C 3JASB 4MVRA 2HEPA 1EN6A 1PP9H 4KP4A 3HKBB 1WAZA 1PL0A 1QHTA 3AG4B 5BMVA 4JYCA 1U97A 3STZC 2ZKOA 4JAVA 3P3NA 1BGYH 2Y4UA 3D36A 4LCUC 3K79A 4BR6A 3W7XA 3OGIB 3K5NA 1QU7A 2DYSB 2QM7A 2X7RB 1H8HG 2HHHO 3FB5C 1VP7A 4TV8B 1COWG 4MW8A 5BY1A 1BHAA 2QR4A 2M6YA 4E2LA 4X65B 3ZMSA 2HP8A 3DTUB 4X66B 2PZSA 3IJ4A 4FM1A 4LFCO 4BW5A 4DV7B 1XUQA 3NXSA 1SQPH 3OEEG 1F23A 2IJJA 4LNUB 2YDEA 4LR3A 4G2KA 1IBLO 3TGUH 3S3XA 5IYBO 1DF4A 5TISZ 1R3JC 2GHYA 3OUFA 5LOVA 2ZE5A 3UT5A 2XASA 1FFTB 2E75B 3P3PA 2PUSA 4J10A 2CDYA 5B66Z 3EFFK 3H01A 5B1NA 4NXMO 4ZKIA 4JV5O 2EZOA 2EILB 2IM9A 4PI0A 1EZJA 3STLC 4UV9A 1US6A 4DW0A 1OCRB 3UO2A 3CC7V 1N8RW 5JQGB 3K5MA 2VQFB 1O9GA 4OPAA 1YITV 1AJQA 1D2DA 2QWQB 4GX5A 4DR4B 1J5EB 4UB6Z 2Q4PA 3W7SA 1XMQO 1VQ4V 1AROP 3CHXA 5IJ0B 4MTXA 4DV5B 1BMFG 1X4TA 2Y4TA 1M56C 4DK0A 1R3IC 3H1LH 4LFAB 3L74H 2OIEA 1ENVA 3OR6C 2QWPB 4B08A 2QKAA 4Q6GA 1MSDA 4CS4A 3ABLC 3T1YO 3OTFA 5JVDB 4TUYB 3ETEA 3MD0A 1OCZB 1TAEA 3CWBH 2NLJC 2K1EA 1BHBA 2YEVB 4I55A 4CS3A 1URFA 1KBHA 2X6CA 3ASOB 4X62O 2GV9A 3CX5F 1NBMG 2ZR2A 3UCSC 1N33B 2ETNA 4DV3O 3SYOA 5B1AC 2DQ3A 1PNLA 4JAAA 1NS1A 1XMOB 1NZ6A 2OTLV 4GZRB 3KKYA 3L9DA 5J2UB 5CA0A 4B3TB 1IDSA 4LF6B 5JCOC 2QA4V 1K73W 4JYBA 4TV9A 1KB9F 5CBHA 1R6KA 1AR1B 4UVCA 1Q7YW 2WWWA 1EN5A 2KG7B 1BL8A 5LL6Y 3KCXA 1L8DA 4I4TA 1BT8A 5KMGA 4FIPC 1ZSPA 2EIJC 3CC4V 5A9GA 2IH3C 1TUBB 3RYFA 5J2TA 1N34O 1Z5WA 4RO2A 4MW3A 1HNWO 1G1XB 4ZIBA 2YI9A 2QTOA 4DR1O 3JALA 3QO7A 5A2QN 2CUGA 3FB7C 2VWJA 3ZMTA 4JI2O 1Y6XA 3U0ZA 3A0HZ 1SERA 1YI2V 2QJ1A 5LMNB 4IIJA 2JIZG 1Q6IA 2ODMA 4DR2B 4RAIA 3CCMV 3EVKA 5LXTA 1DF5A 2NNUA 5CBFA 1TVKA 2DWEC 4UVAA 1QCEA 4YY3O 4TOIA 2R9IA 2EBOA 1KD1W 4JASA 4DO2A 2IU0A 4JTCB 3ZMUA 2YIBA 1B3QA 2ZQMA 5L3EA 1VQ9V 3AK1A 2YIDA 1VEWA 2P5OA 2CGNA 4WFEA 5JH7A 5LGUA 5EC2C 1HW7A 1OCZC 1RFYA 1NTKH 2Q7EA 3I55V 1ZL8B 3BHPA 2ZXWC 3JCZA 2XAFA 2AZ2A 2UU9B 4MVSA 4X20A 3CPWU 1I5XA 4DRXB 4ZHQB 4NXNB 3EHBB 1SA0B 2LJ2A 4U3JB 2RN9A 2W0XA 1M4UA 2QKSA 4O2AB 3CXCU 2ZIMA 1I0HA 4JI8B 1OV9A 3RGBA 2VS0A 2WLIA 1YHQV 3KG2A 4YIOA 1Y66A 4LH7A 4KHPO 1GN6A 4J80A 1WA8A 3ZRSA 4L87A 3AG1B 4JI0B 1NQTA 3K9AA 4QE9A 3CE2A 1P7GA 2CH7A 3SDLA 4B3MB 2QGNA 1E1RG 1GN4A 1XBLA 2R9RB 2JVDA 3B2EE 3SJQC 3ABKC 1AI6A 4GX2A 4WBNA 3WG7C 4DV2B 3FB6C 1I7FA 1NU1H 4EB6B 1HP8A 5DEDA 3F5WC 4K35A 4O4LB 2R9AA 1ZAUA 4YHHO 2BTQA 1Z5VA 3HKCB 1MA1A 1KP3A 4JPRA 5LA6A 2XAQA 5L3GA 5L3BA 4MTOA 3WB1A 2ADQB 3CC2V 2VQEO 3IGAC 1FXHA 3OMIB 1KYOF 2JRIA 2YXHA 4LF9B 3B77A 4B3RB 2DYRB 1FXKB 4DV0B 3AK2A 3SPIA 3E8GA 4F6RA 4BIOA 3JD3A 3JAWB 2LO1A 2PTMA 4DV6O 3ETDA 2A3QA 3BY6A 2LW1A 2ZCEA 2XTAA 2EIMC 1R6NA 4JZGA 1Y67A 2E5LB 5IJ9B 1TUEB 2JK5C 4O4HA 4YXWG 5BXZA 5FPRA 2ITDC 3ZN0A 1H2SB 3HKEB 2ITCC 2LFSA 1HR0O 2CTWA 1GM9A 3CP1A 2FB5A 2EINC 4X1YB 4XDKA 1RSOB 1XHXA 2ZT9B 4WFGA 4AQYB 4J7JA 4LBEC 4MS2A 4DV4B 2OCCC 1E1QG 1Z2GA 3DC5A 1K8AW 2FTKA 1F4NA 3UO3A 3T4ZA 2H94A 4RUFA 3RFRA 1SKVA 4ABMA 2FKXA 3E35A 5GTIZ 2FL4A 1JR9A 1QR9A 4P9PA 1QLEC 1W59A 2D2CB 2W6JG 2UXDO 2ZDIA 2N05A 5ITZB 4K0KO 1ORQC 3O65A 1RP3B 5GW7A 2NN4A 1H38A 3QG5A 4I50B 5FNVA 2PYLA 1W0JG 4ZI7A 4GKKO 5GTHZ 3CRAA 3B4SA 2RQ6A 2HJDA 5LP6A 2BSKB 1CP9A 4JI5O 2W0FC 3FKSG 4DR3O 3CCVV 3JASA 1AR4A 3PJSK 4ZBMA 4GX0A 1BE3H 3L71H 3WFVA 3HKBA 3GB7C 3L75H 1GMGA 4WCEV 1MZFA 3QTCA 3FYIB 2R70A 1VQLV 2Q68A 1P49A 4WFBV 4MVZA 5KX5B 2LGQA 1SQQH 2CAZC 4CH3A 2DYRC 2UUAB 2ZM6O 5LMUB 3F7VC 4MTFA 2ZNJA 2UXCO 1GH6A 4TV8A 1JQ0A 1SS3A 1D5AA 1S5LZ 2Z0AA 2UUBO 2ZINA 2Q7GA 3WB2A 4O2BB 3M99B 3K03A 3N27A 5DN6G 1I08A 4OX9O 4TT3G 1P7BA 3BAAA 4LFBO 1MZEA 4LNUA 4UVBA 3RVZA 1SQGA 4FLZA 1GK9A 4LH6A 2YI8A 2YXLA 1WB8A 4YIPA 4X1KB 4ASUG 3OE7G 2ZE7A 5C8YB 1XI1A 4HNAB 4UCTA 2O57A 1WN7A 3K04A 4MTGA 2HHHB 1PL4A 3OD4A 1U96A 1CXZB 2X6BA 2YXYA 2HR3A 3OW2U 4NVPA 3ABTA 2GDSA 4LFCB 1R3LC 5JQGA 1QBZA 4FLYA 3LSSA 3OTOO 1S76D 4DR6O 4IHJB 1M56B 2G38A 1IX9A 1IBLB 4XBFA 4GUNA 3MAQA 4EKWA 3OAAG 1LR1A 2F95B 3ABLB 4RQFA 3K3WA 1JPXA 4JYAO 5IJ0A 1M90W 5KHIA 3A8TA 5BZBA 1AI7A 1H2NA 4MVUA 5C93A 3B8MA 2YS8A 3CRRA 4F4LA 2P4KA 4LF7O 3FFQA 5EBLC 5AG2A 2KB1A 2KQXA 3H1JH 3P30A 3ZJZA 4NXMB 4JV5B 4NB5A 5B1AB 1QR8A 2FMLA 5GONB 5JVDA 4TUYA 4UXNA 1P84F 4PDLA 3C3TA 4DYLA 1ROPA 3AG3C 2YEVA 3L73H 3RYIB 4PA4A 3E22B 4QJFB 4IGGA 4OGQB 4UUJC 2UXBO 4RUEA 4J11A 1WLEA 3SJBC 3GVMA 1NH2D 1VQ7V 3JD2A 2XUMA 3ETGA 3UM7A 5KHGA 4BAYA 4FLTA 4AI8A 1XMQB 2Z3YA 1SQBH 5KUKA 4DR5O 4LF5O 5J2UA 5KHHA 2MW2B 1Q8IA 3QO8A 4Z1VA 5LHGA 3RWRD 1Q90D 2B1IA 1CPYA 1E79G 3UKMA 2V7QG 5CBGA 1F4MA 2EIJB 4PDVA 4BW9A 4PA7A 4Q20A 3T1YB 1J95A 3SYAA 3TXSA 2WSSG 5B1OA 2KG7A 4PELA 1SETA 3U10A 4X62B 3OMNB 3RT3C 2MK3A 4KFMA 4DV3B 1TUBA 3C3SA 3JCUZ 3SPCA 2QM8A 5LHIA 3HKDB 5KHKA 4JF3A 1SC5B 1M9NA 5EK0A 2GTAA 2OYQA 2HVKC 2B9ZA 2P22C 3H9VA 3D3IA 1FYJA 1O9HA 3K58A 4JI4O 4GYCB 1VQ8V 2P90A 3A0BZ 3IFXA 1Q6HA 3CJHB 1BQZA 5B1BC 1AB3A 4KL1A 4D6TH 5LYJB 2DQ0A 3CCQV 2ZXWB 2GBOA 4KUMA 3W7UA 1N32O 1KP2A 3CYOA 3E86A 3BABA 5IE9A 4FFBB 1TGOA 3T2MA 1JJOA 4O4IB 1N34B 5EBMC 2XT9A 2LP7A 3MHHC 1HNWB 2C2AA 1KC8W 3RN4A 1ZL8A 4DR1B 2EULA 1JCHA 4JI2B 2P4VA 4IYHA 1N0JA 2Q67A 4FZ0A 3CCRV 3QO5A 1M57C 3B09A 2BE3A 3B40A 4GT1A 3JSLA 2Y48A 2M7WA 4DRXA 4ZHQA 1XNQO 2E3CA 4UCOA 1NT2B 1SF9A 2ATKC 4J9ZB 1SA0A 2WAMA 4U3JA 4PDRA 4YY3B 5CN0A 4ZOLB 3BRCA 4DXWA 1SZTA 2XAJA 5JJNB 1N36O 1IXMA 4JI6O 1Q86W 3T1HO 2F23A 2JGDB 3ASNC 3C90A 5EIBC 3ABKB 4R6ZA 1IBMO 3DGEA 3WG7B 5D5QA 4B7EA 3D8CA 2HJFC 1YXBA 1G4YB 1V9PA 4TSFG 3FX7A 2ILMA 1FAFA 1QLNA 2DW4A 1A32A 5K1PA 3X2QC 4O4JA 1VF6A 2JJ2G 2DE0X 3G67A 2E76B 4CZZA 3PN1A 3CEIA 2DN9A 4JYYA 2HFEC 4EB6A 4O4LA 1BSMA 1GTOA 5BR8O 5KLVH 1XEQA 3BPZA 4DUYO 4QPJA 1EFRG 5EBWC 2GSMB 3HKCA 2AW9A 3FB8C 4CBCA 2A0LA 3SPGA 2F43G 4KHPB 3D36C 1L1FA 2UXNA 4ICGA 1FFXB 1M5IA 3ZHRA 1WP8A 1OCCC 5HFLA 1VF7A 3RYHB 4H44B 1WJZA 2WLNA 1MMMA 3K5OA 1N0NA 2EIMB 4I0XB 1YJWV 4XDLA 1FXKA 1Q5OA 1WP7A 4P2ZA 1Q81W 4FVMA 3JAWA 3CSXA 3CRMA 1CEZA 2EINB 4YHHB 4CH5A 4Z2WA 4DW1A 5L3DA 2OCCB
chains in the Genus database with same CATH topology
4P9PA 1FXVA 1PL0A 1QLEC 2W6JG 1PD3A 3AG4B 2ZDIA 3W7TA 4JYCA 2DYSC 1K5QA 1ORQC 3STZC 3SYCA 3TETA 2WLLB 4JAVA 5GW7A 3ZRWB 3E8BA 1H38A 4OXSA 3D36A 4LCUC 1SRYA 1W0JG 3K79A 3W7XA 1QLEB 2HLDG 3OR7C 4I9WA 1ZWIC 2QM7A 2DYSB 2X7RB 2QEXV 1CP9A 1YSCA 2W0FC 1I5YA 1H8HG 3FKSG 3FB5C 3BEHA 3CCVV 5CA3A 3PJSK 4ZBMA 3F7YC 4GX0A 1COWG 2EIKC 4MW8A 1VQ5V 1BHAA 3HPLC 4E2LA 3WFVA 3K06A 3ZMSA 3GB7C 1NVPB 3DTUB 2YSUB 1GMGA 4MSWC 4WCEV 1JX9A 1P4RA 4BW5A 3NXSA 1K34A 4N23A 3OEEG 3FYIB 4N21A 1VQLV 2Q68A 1F23A 2IJJA 5B3SB 2WLLA 2XAGA 4MVZA 4WFBV 3ZRWA 1AI4A 1NR1A 2EIKB 4JGSA 4GCZA 3OMAB 4G2KA 5IYBO 1DF4A 1PNKA 1K9MW 3CCLV 5H9CA 4BIUA 1R3JC 2GHYA 3OUFA 4QIWF 2DYRC 3SPJA 1LNQA 1H2GA 2EILC 5FL7G 2XASA 3GWOA 5IY5B 3F7VC 1FFTB 4MTFA 2W6IG 4P30A 4FK5C 2B1GA 1AJNA 1JQ0A 3EFFK 3QNEA 1OCRC 1VQMV 3H01A 2IJKA 1DTOA 1H8EG 1MABG 5B1NA 1K97A 4ZKIA 3M99B 3K03A 5DN6G 2EZOA 2EILB 1QVGU 4MVMA 4TT3G 2HKOA 1P7BA 4UVBA 3RVZA 1EZJA 3CMAV 2P7TC 3STLC 3ZIAG 4Z1MG 4UV9A 1OCRB 3CC7V 1N8RW 1GK9A 3JD1A 2UXXA 5J9PC 3LUTB 1YITV 4I5SA 1AJQA 1MSWD 1W2BU 4GX5A 4U7NA 3CD6V 4ASUG 3OE7G 3W7SA 1VQ4V 1AROP 5KA6A 2QE7G 1R73A 3SYQA 3K04A 2ZR3A 3LDEA 4U7OA 4MTGA 4MTXA 1BMFG 1MOFA 2X6AA 3P32A 3CCJV 1M56C 2X6BA 1R3IC 2HR3A 3ASOC 4BIZA 4P9OA 3OW2U 3AG2C 1ENVA 1S3JA 3OR6C 5IYCO 1VQKV 3ABTA 1YJNV 3ABLC 1R3KC 1R3LC 2Y69C 4FJCC 1QBZA 4HZ3A 3ETEA 3LSSA 3MD0A 3K0GA 1S76D 1OCZB 2NLJC 2K1EA 1BHBA 2YEVB 2EJRA 1M56B 2X6CA 3ASOB 4XBFA 1G8MA 3AG2B 1NBMG 2ZR2A 4EKWA 3OAAG 1VQOV 3ABLB 4RQFA 1F51A 3K3WA 2Y69B 1JPXA 3SYOA 5B1AC 2DQ3A 1PNLA 2A79B 1YTFB 1M90W 5BZBA 1MG1A 2JDIG 1AI7A 4MVUA 5KA5A 5C93A 2Q6AA 3B8MA 2OTLV 4MVQA 3T4DA 2A9HA 3ZRXA 4F4LA 4PA9A 3FYEB 5EBLC 5B3SC 2KB1A 3ZJZA 3P30A 2JEUA 5IDJA 1K7DA 5B1AB 1QR8A 5CMUA 1NKDA 4LP8A 2QA4V 5KUMA 4UXNA 1K73W 2XOKG 4PDLA 4JYBA 1ROPA 3AG3C 5LGNA 5CBHA 3I56V 1R6KA 2YEVA 1NVPD 1GKFA 1AR1B 4UVCA 1Q7YW 4PA4A 1W0KG 4QJFB 2WWWA 3CCEV 3VBBA 2BOBC 3E89A 4UUJC 3ZN1A 1K92A 5H6RA 4MT8A 4PA6A 4RUEA 1NH2B 1BL8A 1WLEA 2XNDG 1NH2D 3AG3B 4G27B 3JD2A 1VQ7V 4FIPC 3ETGA 3UM7A 4BAYA 3K0DA 2EIJC 2Z3YA 3CC4V 2IH3C 5KUKA 4R50A 1B6QA 3TK1A 4RO2A 4MW3A 1GM8A 1JOYA 3QO8A 3HB3B 5LHGA 3OGCC 2QTOA 5EC1C 3JYCA 1OHHG 2PI4A 2B1IA 3QO7A 1CPYA 4R7CA 1E79G 3FB7C 3UKMA 3ZMTA 2V7QG 3OUSA 1F4MA 4WFAV 4WFFA 5CBGA 5IY5C 2EIJB 4PDVA 1S5HC 2IJIA 4PA7A 1SERA 4Q20A 1EBOA 1YI2V 1J95A 2IU3A 3SYAA 2WSSG 2P6JA 2JIZG 5B1OA 4RAIA 2V1DA 4PELA 4HAMA 3CCMV 4J9YB 1S72V 1OZ0A 1SETA 1DF5A 1OCOC 2NNUA 3OMNB 5CBFA 1UJWB 2DWEC 3R65A 4UVAA 2MK3A 1AI5A 1QCEA 3ML0A 1K4CC 2P67A 2R9IA 2EBOA 5DM6V 4JASA 4KFMA 4DO2A 1KD1W 2IU0A 4JTCB 2XAHA 3ZMUA 2ZQMA 5L3EA 3SPCA 4HYOA 1VQ9V 2QM8A 5LHIA 2OTJV 1K4DC 4MVOA 4JF3A 1S0VA 4WFEA 1RPRA 5LGUA 1OCOB 1M9NA 5EC2C 5LBQA 1OCZC 5EK0A 3G6EV 3OM3B 2HVKC 3I55V 2WLIB 1K5SA 1KKDA 3D3IA 4QPKA 3JD4A 5L3FA 4JTAB 2DWDC 4X89A 2ZXWC 3MHSC 3JCZA 1VQ8V 2XAFA 2P90A 3ABMC 1SESA 3IFXA 5B1BC 4XDJA 4MVSA 3RBZA 2ZD9A 3ABUA 2DQ0A 3CCQV 3CPWU 1I5XA 2ZXWB 4KUMA 1VQ6V 3W7UA 4QNHB 1VQPV 3ABMB 3EHBB 3G71V 4X8AA 4RQEA 2QKSA 3AG1C 1KP2A 3CYOA 3E86A 3CCSV 4R8CA 5B1BB 3CXCU 3T2MA 3OFNG 5EBMC 4TWKA 3LDCA 2LP7A 3MHHC 1HWYA 5E1AC 2C2AA 1YTFD 1KC8W 2WLIA 3W7WA 1YHQV 5H6QA 3KG2A 1Y66A 2BOCC 1JCHA 1NR7A 4JAUA 3LNMB 3ZRSA 3LSQA 4L87A 3T1CA 3AG1B 2WLKA 1NQTA 2Q67A 3K9AA 4QE9A 3CCRV 3QO5A 1M57C 3B8NA 2Z5UA 4GT1A 4UV8A 4WFHA 2Y48A 4FPPA 3CMEV 1E1RG 2M7WA 2R9RB 5HFMA 4H37A 5IYDO 2JEXA 2ATKC 1RPOA 4J9ZB 4X88A 3ABKC 3SJQC 1AI6A 2WAMA 4PDRA 4GX2A 1AJPA 1WPXA 5CN0A 2PI5A 3WG7C 4DXWA 2JJ1G 1K3EA 1M57B 3FB6C 1SZTA 3K08A 2XAJA 4QE7A 3TCUA 3A0RA 2IW5A 1KQSU 3F5WC 1GO3F 1IXMA 1Q82W 3ZRVA 1VQNV 1NJIW 1Q86W 2IH1C 1PNMA 3ASNC 1XL4A 3ABKB 4R6ZA 3DGEA 2X0LA 3ZMZA 1KP3A 4JPRA 3WG7B 3ZCCA 3JD0A 3RW0A 2EZPA 2HJFC 2WPDG 1G4YB 1THZA 2XAQA 4TSFG 4MTOA 5L3GA 5L3BA 1QVFU 1V54C 1V55C 1FXKC 3CC2V 3E8FA 1QLNA 3ASNB 3SYPA 2DW4A 1S77D 3IGAC 1RM1C 3X2QC 3E2EA 1FXHA 2WLMA 3OMIB 2JJ2G 2OT5A 4CZZA 2H8PC 3B77A 2HFEC 1V55B 1V54B 1XL6A 1M1KW 2DYRB 1FXKB 2WLHA 3E8HA 3SPHA 1GTOA 3VOUA 3SPIA 2HVJC 3E8GA 2ZDIC 4QPJA 1JVMA 3X2QB 1RM1B 1EFRG 5EBWC 2GSMB 2B5UA 3JD3A 4FMTA 3FB8C 3ETDA 4CBCA 2A0LA 3SPGA 3BY6A 5LHHA 3IC7A 3RVYA 1FS0G 3ZMVA 2F43G 2EIMC 1R6NA 1L1FA 5LGTA 3OEHG 3G4SV 2UXNA 1TUEB 2JK5C 4GX1A 2D3OW 3CCUV 3AEIA 4YXWG 1OCCC 5HFLA 2ITDC 3ZN0A 2AHYA 2IJHA 1YJ9V 2AHZA 2ITCC 2LFSA 2LFRA 2WLNA 1GM9A 3CP1A 2EINC 2WLJA 4H33A 5L3CA 2EIMB 4XDKA 1YJWV 1K33A 3E83A 4XDLA 4PA3A 1FXKA 4WFGA 4LBEC 4MS2A 2OCCC 4JTDB 1PKXA 3LDDA 4P2ZA 2CK3G 1E1QG 1Q81W 1KECA 1DLBA 3AG4C 1Y4MA 4LC1A 1K8AW 1JJ2U 2FTKA 1F4NA 3T4ZA 1OCCB 2H94A 4G28B 2HG5C 4RUFA 4MVRA 1YIJV 1CEZA 2EINB 3E35A 1GM7A 4WF9V 4KP4A 4PDMA 2Q69A 5L3DA 1QR9A 2OCCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9P A;  1QLE C;  4PDR A;  4WFF A;  4GX2 A;  4PDV A;  5IY5 C;  1S5H C;  4PA7 A;  3WG7 C;  4DXW A;  2DYS C;  1J95 A;  3FB6 C;  3K08 A;  3SYA A;  3SYQ A;  1ORQ C;  4QE7 A;  3K04 A;  3LDE A;  3STZ C;  3SYC A;  4MTG A;  3TET A;  2WLL B;  3TCU A;  4RAI A;  3F5W C;  3E8B A;  4J9Y B;  4OXS A;  2X6A A;  1M56 C;  2X6B A;  1R3I C;  2IH1 C;  3ASO C;  3ASN C;  1OCO C;  4P9O A;  3AG2 C;  4LCU C;  5CBF A;  2DWE C;  3R65 A;  1XL4 A;  3OR6 C;  4R6Z A;  1K4C C;  4KFM A;  3OR7 C;  4I9W A;  1ZWI C;  3ABL C;  1R3K C;  4JTC B;  1R3L C;  2Y69 C;  3RW0 A;  2HJF C;  1G4Y B;  2W0F C;  4HZ3 A;  4MTO A;  3SPC A;  4HYO A;  3K0G A;  3FB5 C;  1V54 C;  1V55 C;  3BEH A;  3PJS K;  4ZBM A;  3F7Y C;  2NLJ C;  4GX0 A;  2EIK C;  2K1E A;  1K4D C;  4MW8 A;  4MVO A;  3SJQ C;  4WFE A;  3E8F A;  2X6C A;  3HPL C;  3SYP A;  5EC2 C;  3IGA C;  3K06 A;  3X2Q C;  3GB7 C;  1OCZ C;  5EK0 A;  4EKW A;  2WLM A;  4MSW C;  2HVK C;  4BW5 A;  2WLI B;  3SYO A;  1KKD A;  2H8P C;  5B1A C;  2A79 B;  2Q68 A;  4JTA B;  2DWD C;  2HFE C;  1XL6 A;  2WLL A;  4X89 A;  4MVZ A;  5BZB A;  2ZXW C;  4MVU A;  2WLH A;  3ABM C;  3E8H A;  3IFX A;  3SPH A;  3VOU A;  2Q6A A;  4MVQ A;  3SPI A;  3T4D A;  2A9H A;  2HVJ C;  3E8G A;  4F4L A;  4PA9 A;  1JVM A;  5B1B C;  5EBL C;  5EBW C;  5B3S C;  1R3J C;  2KB1 A;  3OUF A;  4XDJ A;  3ZJZ A;  2DYR C;  3SPJ A;  3FB8 C;  1LNQ A;  4MVS A;  2ZD9 A;  3RBZ A;  4CBC A;  2A0L A;  2EIL C;  4LP8 A;  5KUM A;  3SPG A;  3F7V C;  4MTF A;  3RVY A;  4P30 A;  2EIM C;  4PDL A;  4QNH B;  3AG3 C;  5CBH A;  2YEV A;  3EFF K;  1OCR C;  2JK5 C;  4X8A A;  2QKS A;  3AG1 C;  3E86 A;  3OUS A;  4R8C A;  4GX1 A;  4PA4 A;  3T2M A;  1OCC C;  2BOB C;  5EBM C;  4TWK A;  2ITD C;  3E89 A;  3LDC A;  4UUJ C;  2AHY A;  5E1A C;  2WLN A;  2ITC C;  2AHZ A;  3K03 A;  2WLI A;  4PA6 A;  4RUE A;  3KG2 A;  2EIN C;  4MVM A;  1BL8 A;  2WLJ A;  1P7B A;  4H33 A;  4XDK A;  2BOC C;  3E83 A;  4XDL A;  4PA3 A;  3RVZ A;  4G27 B;  4WFG A;  2P7T C;  3STL C;  3LNM B;  4LBE C;  3UM7 A;  4MS2 A;  3ZRS A;  2OCC C;  4JTD B;  3LDD A;  3K0D A;  4P2Z A;  2EIJ C;  3T1C A;  2WLK A;  2IH3 C;  3AG4 C;  2Q67 A;  5KUK A;  4QE9 A;  4R50 A;  3T4Z A;  1M57 C;  4G28 B;  4RO2 A;  2HG5 C;  4MW3 A;  4RUF A;  5J9P C;  4MVR A;  3LUT B;  5CBG A;  4WFH A;  3OGC C;  2QTO A;  5EC1 C;  3JYC A;  2R9R B;  4GX5 A;  4H37 A;  4R7C A;  3FB7 C;  4PDM A;  2Q69 A;  3UKM A;  2ATK C;  4X88 A;  4J9Z B;  3ABK C; 
#chains in the Genus database with same CATH topology
 5IJ9 A;  4FLW A;  3D3Q A;  1PD3 A;  2KSD A;  1K5Q A;  2CE4 A;  3M8A A;  4H0L B;  3JAT B;  3SYC A;  3TET A;  2WLL B;  4UCR A;  2KKW A;  3HKE A;  3QF7 A;  2JS5 A;  3ZRW B;  3K59 A;  3CRC A;  1DK1 A;  2VQE B;  1RSO A;  1VIB A;  1QLE B;  3OR7 C;  1ZWI C;  5JJJ B;  2QEX V;  1I5Y A;  3F7Y C;  4UFZ A;  2EIK C;  4B3S O;  3HPL C;  3BA8 A;  3G6B A;  1NVP B;  1Y74 B;  2QKC A;  4DV6 B;  5ITZ A;  1GRJ A;  3CS5 A;  5B3S B;  2XAG A;  1NR1 A;  4JGS A;  4CH4 A;  2OIG A;  3FD9 A;  4F6E A;  1KU9 A;  1EZV H;  4I50 A;  1GAX A;  2UUC O;  5H9C A;  4BIU A;  4CC5 A;  4QIW F;  3J80 N;  5E79 Z;  2BSK A;  1HR0 B;  5FL7 G;  4J41 A;  3GWO A;  4FK5 C;  2B1G A;  1AJN A;  1AVM A;  1AIL A;  4KXR A;  1VQM V;  3F5T A;  2QDO A;  1SZX A;  2RNB A;  1VF5 B;  1MAB G;  1BQ0 A;  1K97 A;  3ICX A;  2F4V O;  3TJT A;  1QVG U;  1M93 A;  4MVM A;  5EYP B;  2HKO A;  3FAV B;  4NKG B;  4YJ3 B;  5KX5 A;  5KHJ A;  5IYZ B;  3ZIA G;  1Y76 B;  2UXD B;  4K0K B;  4IYI A;  3K9S A;  3JD1 A;  3ETQ A;  5J9P C;  4DR7 O;  3LUT B;  1MSW D;  4U7N A;  2QM4 A;  3RYC B;  4GKK B;  3JSN A;  5KA6 A;  4O2B A;  4JI5 B;  2ZR3 A;  3THO A;  4UB8 Z;  4DR3 B;  5CA1 B;  4FZ1 A;  1JFF B;  4PHZ A;  1MOF A;  1SQV H;  1YEW A;  2X6A A;  1EM1 A;  3CCJ V;  4LF4 O;  4C7U A;  4P9O A;  3AG2 C;  5IYC O;  1VQK V;  2Y0I A;  1R3K C;  2Y69 C;  4FJC C;  2Q0O C;  3VQV A;  3IAY A;  4HZ3 A;  5EZY B;  1I94 O;  1XHZ A;  1ZLZ A;  1X59 A;  4X1K A;  3LNN A;  1XOU A;  3VQX A;  5C8Y A;  1VQO V;  4HNA A;  2ZM6 B;  4UCS A;  2UXC B;  3JAR B;  4JI3 O;  5F2V O;  5KA5 A;  3Q4H B;  4MVQ A;  2A06 H;  2A9H A;  2QWO B;  1HNX O;  4PA9 A;  5IT9 N;  2UUB B;  4CH6 A;  5B3S C;  2K9P A;  2JEU A;  4PI2 A;  1FJG O;  2E74 B;  5JJE B;  4LP8 A;  5KUM A;  4OX9 B;  2Q9L A;  2XOK G;  4LFB B;  1YF2 A;  4CC6 A;  1HNZ O;  5LGN A;  4GKJ O;  2GTS A;  3I56 V;  4IHJ A;  3N2G B;  1NVP D;  1AP5 A;  1GKF A;  5CB4 B;  1W0K G;  3CCE V;  3VBB A;  2BOB C;  3E89 A;  1XNR O;  3ZN1 A;  5H6R A;  4MT8 A;  4EFE A;  1NH2 B;  1QNM A;  1IZ3 A;  2XND G;  3R66 A;  3AG3 B;  4G27 B;  2Q5Z A;  5KAI Z;  3K0D A;  3DC6 A;  1H2M A;  3ZHU A;  3ZHQ A;  1B6Q A;  2AGA A;  2L6L A;  1WB7 A;  2VWK A;  3HB3 B;  4DV1 O;  5GON A;  5EC1 C;  1OHH G;  1VMG A;  2Q8V A;  4R7C A;  4WFF A;  5IY5 C;  1S5H C;  2IJI A;  3RYI A;  3E22 A;  2IU3 A;  2P6J A;  3OTO B;  2YIC A;  4DR6 B;  2V1D A;  5JCO A;  4J9Y B;  2BTO A;  1OCO C;  1UJW B;  5B5E Z;  5DM6 V;  4K3A A;  5IWA O;  4PV1 B;  4TQD A;  4JYA B;  4X64 O;  1TA8 A;  2CGO A;  2Q0A A;  2OTJ V;  1S0V A;  1JA8 A;  1RPR A;  4X1I B;  5LBQ A;  4LF7 B;  1Q6U A;  1IBK O;  4I7Z B;  3G6E V;  2OWO A;  3OM3 B;  4CS2 A;  1K5S A;  2PF4 E;  3JD4 A;  5L3F A;  4JTA B;  4X89 A;  3MHS C;  3ABM C;  1LUW A;  1BS3 A;  1GN3 A;  4YJ2 B;  4XDJ A;  1D5N A;  4LWS B;  1L0N H;  2N04 A;  3RBZ A;  2UXB B;  1PV0 A;  2JGU A;  2NR5 A;  3IC9 A;  2BCC H;  3O9O A;  1VQ6 V;  4QNH B;  4AHC A;  4JI7 O;  3AK3 A;  3HKD A;  3G71 V;  2WA4 A;  4QGP A;  2CTR A;  4R8C A;  5B1B B;  2EJ7 A;  4DR5 B;  4LF5 B;  3OT7 A;  3LDC A;  5E1A C;  1S5J A;  2YC0 A;  3W7W A;  4LF8 O;  2BOC C;  1NR7 A;  4JZ2 A;  3LNM B;  3LSQ A;  4NR1 A;  1FPO A;  2WLK A;  3CJH A;  4PJ0 Z;  4JI1 O;  4UV8 A;  5LYJ A;  3CME V;  2PY5 A;  2DOS A;  1XQ8 A;  4H37 A;  2VRZ A;  5IYD O;  2JEX A;  1RPO A;  4X88 A;  1AJP A;  1WPX A;  2PI5 A;  4DK1 A;  3SJA C;  3BCC H;  1KUQ A;  2JJ1 G;  3VQW A;  1M57 B;  3K08 A;  4FFB A;  3ZED A;  4QE7 A;  4O4I A;  1AP6 A;  2GUZ B;  1Q82 W;  1VQN V;  1NJI W;  2IH1 C;  1PNM A;  1XL4 A;  3JAK B;  1N4C A;  3ZMZ A;  2X0L A;  1IXB A;  2EZP A;  3BFR A;  3J81 N;  4JI4 B;  2L35 A;  1QVF U;  3N2K B;  1V54 C;  1V55 C;  3A2F A;  3ASN B;  3SYP A;  1RM1 C;  3E2E A;  2PGG A;  3NR7 A;  3QVN A;  4ZOL A;  2OT5 A;  1SQF A;  1XL6 A;  1M1K W;  3VQY A;  1N32 B;  3DXR B;  3VOU A;  2JGD A;  2ZDI C;  4X65 O;  3X2Q B;  4X66 O;  2F93 B;  2EX3 A;  4DV7 O;  2RJZ A;  3APO A;  3WU2 Z;  5LHH A;  3RVY A;  1FS0 G;  3ZMV A;  3KCY A;  1SQX H;  5LGT A;  4FM0 A;  5BMV B;  5LP6 C;  3G80 A;  4GX1 A;  1EN4 A;  4RWU A;  2AHY A;  2AHZ A;  2LFR A;  4J42 A;  4H33 A;  5L3C A;  1XNQ B;  3E83 A;  1PKX A;  4LC1 A;  1DLB A;  3AG4 C;  1Y4M A;  4K8Z A;  1OCC B;  4UCU A;  1YVW A;  1YCI A;  1YIJ V;  1N36 B;  1LUV A;  4JI6 B;  1GM7 A;  4WF9 V;  2F66 C;  3T1H B;  4PDM A;  2Q69 A;  1ZX3 A;  1MNG A;  1FXV A;  1IBM B;  2QTS A;  1FFX A;  3W7T A;  2DYS C;  3RYH A;  2CTQ A;  2ARH A;  2VQF O;  4W4K A;  3E8B A;  4OXS A;  3I5D A;  4I0X A;  4DR4 O;  1J5E O;  2ZNI A;  4EFB A;  1SRY A;  4IT5 A;  2HLD G;  5LOV B;  4I9W A;  2H3O A;  3UT5 B;  1YSC A;  2JS3 A;  3BEH A;  4DV5 O;  5CA3 A;  4O2A A;  1VQ5 V;  5BR8 B;  3AG7 A;  1IUR A;  4LFA O;  4DUY B;  3K06 A;  3SJC C;  2YSU B;  4MSW C;  3EXA A;  3H1K H;  1JX9 A;  1P4R A;  4I9Q A;  3J7A U;  4N23 A;  1K34 A;  4N21 A;  5K1X A;  3JAT A;  2WLL A;  1KKC A;  1B04 A;  1AI4 A;  2EIK B;  3ZRW A;  4GCZ A;  1NTM H;  3OMA B;  1PNK A;  1K9M W;  3CCL V;  3LSU A;  1N33 O;  4D7S A;  1XDC A;  3SPJ A;  1LNQ A;  1H2G A;  1OJH A;  2EIL C;  2W6I G;  4P30 A;  1F7Y A;  5EIB D;  3CRQ A;  4A5U B;  1XMO O;  3QNE A;  1OCR C;  2IJK A;  1DTO A;  4BWA A;  4J7K A;  2DMX A;  1H8E G;  1Y74 A;  4B3T O;  4LF6 O;  1NTZ H;  3CMA V;  2P7T C;  1BCC H;  4Z1M G;  3H1I H;  3K5L A;  1KMI Z;  2UXX A;  1WNS A;  4OPH A;  1YZB A;  4X9Q A;  4I55 B;  4I5S A;  1W2B U;  3CD6 V;  2Q7H A;  2YUA A;  4UCV A;  2LQT A;  2YIA A;  2QE7 G;  1R73 A;  3SYQ A;  3LDE A;  4U7O A;  1T5E A;  3ZHS A;  3P32 A;  5EYP A;  4FM2 A;  3SR2 C;  3FAV A;  2IBZ H;  4B3S B;  3ASO C;  4BIZ A;  4YJ3 A;  2A7W A;  3K57 A;  5IYZ A;  1S3J A;  5CA0 B;  1Y76 A;  5H2F Z;  1YJN V;  3BVO A;  3CXH F;  5LMN O;  3K0G A;  4DR2 O;  1ZTE A;  4J7Z A;  1Q43 A;  4TV9 B;  3ZBH A;  2EJR A;  2N74 A;  1G8M A;  3AG2 B;  2RCV A;  3ZS8 C;  3RYC A;  2UUC B;  3CB2 A;  1F51 A;  2Y69 B;  4X1Y A;  4FLU A;  1PM9 A;  2A79 B;  1YTF B;  1MG1 A;  2JDI G;  5CA1 A;  4I4T B;  1JFF A;  5KMG B;  2DJV A;  3ZX6 A;  2Q6A A;  3T4D A;  3ZRX A;  3RYF B;  3FYE B;  5J2T B;  2Y0P A;  2F4V B;  5IDJ A;  1K7D A;  3JAM N;  5CMU A;  1NKD A;  5EZY A;  3JAL B;  1UFI A;  4FLX A;  3MDS A;  4IIJ B;  2OCH A;  4NYK A;  2UU9 O;  4O4J B;  3ZHV A;  4DR7 B;  1K92 A;  4PA6 A;  2WA3 A;  5LXT B;  2AZ0 A;  4NXN O;  3UQ8 A;  1TVK B;  3JAR A;  4NTW A;  3Q4H A;  2V4D A;  2QWN B;  2ZIO A;  4JI8 O;  4R50 A;  5FPO A;  4B7K A;  3TK1 A;  2PYJ A;  1GM8 A;  1JOY A;  4U3F H;  3OGC C;  3JYC A;  1H2K A;  2PI4 A;  1L0L H;  5JH7 B;  4LF4 B;  3WB0 A;  5H5N A;  3OUS A;  4WFA V;  3DSQ A;  3N2G A;  4JI0 O;  5CB4 A;  1EBO A;  2QWR B;  1I94 B;  1QQC A;  4B3M O;  1S72 V;  4HAM A;  1OZ0 A;  3R65 A;  1AI5 A;  3ML0 A;  5IY5 B;  1K4C C;  2P67 A;  4X20 B;  2XAH A;  4DV2 O;  4TQF A;  4HYO A;  2CTP A;  5KAF Z;  4IL6 Z;  3U11 A;  4JI3 B;  3APQ A;  4K8X A;  1K4D C;  4MVO A;  4EEQ A;  1OCO B;  1HNX B;  4D7T A;  4NTY A;  2P06 A;  1FJG B;  2WLI B;  1KKD A;  4QPK A;  1XIL A;  4GLX A;  2DWD C;  4FLV A;  5JWP A;  1HNZ B;  1WA8 B;  1SES A;  4GKJ B;  4H13 B;  2XHB A;  1PPJ H;  1JMK C;  2CH7 B;  1XNR B;  1GN2 A;  2ZD9 A;  4DUZ B;  4LF9 O;  3ABU A;  3BA9 A;  4B3R O;  1VQP V;  4DV0 O;  3ABM B;  4X8A A;  2QSA A;  4WBN B;  4RQE A;  3CCS V;  3AG1 C;  4X1I A;  1DGS A;  3OFN G;  4L8J A;  4TWK A;  1R1B A;  1YTF D;  1HWY A;  2RMK B;  5H6Q A;  4DV1 B;  2BTQ B;  4AIL C;  2E5L O;  3SGI A;  4JAU A;  3L72 H;  3T1C A;  1VF6 C;  5LA6 B;  4YJ2 A;  3B8N A;  2Z5U A;  1XRE A;  4LWS A;  4WFH A;  4FPP A;  1H2L A;  5HFM A;  2FYU H;  4AQY O;  4DV4 O;  1AR5 A;  4DUZ O;  4NTX A;  5IWA B;  1YDX A;  1K3E A;  4X64 B;  3TCU A;  1NI8 A;  3A0R A;  1BZK A;  2IW5 A;  2ZE6 A;  1KQS U;  1GO3 F;  3KZI Z;  4W4L A;  3ZRV A;  1FKA O;  4F6R B;  1IBK B;  2YIB D;  2LW7 A;  3HR0 A;  3ZCC A;  3JD0 A;  3RW0 A;  2WPD G;  2LGW A;  1THZ A;  2F1M A;  3L70 H;  4PD4 F;  5FLX N;  1FXK C;  1UPG A;  3M7M X;  5D5P A;  3E8F A;  4O4H B;  1S77 D;  1WPB A;  2WLM A;  1FD9 A;  3ZHT A;  2H8P C;  5DEC A;  1V55 B;  1V54 B;  3TXQ A;  1B06 A;  4JI7 B;  2WLH A;  2GUZ A;  3E8H A;  3SPH A;  1G6U A;  2HVJ C;  1RM1 B;  1JVM A;  2B5U A;  3JAK A;  4E4E A;  4FMT A;  4LF8 B;  2R72 A;  3IC7 A;  2Q73 A;  3N2K A;  2ZE8 A;  2RDC A;  3G4S V;  3OEH G;  2D3O W;  3CCU V;  3AEI A;  4FFK A;  1ZUQ A;  4JI1 B;  1Q3E A;  2UUA O;  2IJH A;  1YJ9 V;  1HDJ A;  5LMU O;  3H1H H;  2WLJ A;  2AXT Z;  1K33 A;  4PA3 A;  5FNV B;  3S3W A;  3GWK C;  4ZI7 B;  4JTD B;  3DXR A;  3LDD A;  2CK3 G;  4HBN A;  1VAR A;  5LP6 B;  1KEC A;  1R6T A;  2ADP A;  1JJ2 U;  4G28 B;  1IVS A;  2HG5 C;  3JAS B;  4MVR A;  2HEP A;  1EN6 A;  1PP9 H;  4KP4 A;  3HKB B;  1WAZ A;  1PL0 A;  1QHT A;  3AG4 B;  5BMV A;  4JYC A;  1U97 A;  3STZ C;  2ZKO A;  4JAV A;  3P3N A;  1BGY H;  2Y4U A;  3D36 A;  4LCU C;  3K79 A;  4BR6 A;  3W7X A;  3OGI B;  3K5N A;  1QU7 A;  2DYS B;  2QM7 A;  2X7R B;  1H8H G;  2HHH O;  3FB5 C;  1VP7 A;  4TV8 B;  1COW G;  4MW8 A;  5BY1 A;  1BHA A;  2QR4 A;  2M6Y A;  4E2L A;  4X65 B;  3ZMS A;  2HP8 A;  3DTU B;  4X66 B;  2PZS A;  3IJ4 A;  4FM1 A;  4LFC O;  4BW5 A;  4DV7 B;  1XUQ A;  3NXS A;  1SQP H;  3OEE G;  1F23 A;  2IJJ A;  4LNU B;  2YDE A;  4LR3 A;  4G2K A;  1IBL O;  3TGU H;  3S3X A;  5IYB O;  1DF4 A;  5TIS Z;  1R3J C;  2GHY A;  3OUF A;  5LOV A;  2ZE5 A;  3UT5 A;  2XAS A;  1FFT B;  2E75 B;  3P3P A;  2PUS A;  4J10 A;  2CDY A;  5B66 Z;  3EFF K;  3H01 A;  5B1N A;  4NXM O;  4ZKI A;  4JV5 O;  2EZO A;  2EIL B;  2IM9 A;  4PI0 A;  1EZJ A;  3STL C;  4UV9 A;  1US6 A;  4DW0 A;  1OCR B;  3UO2 A;  3CC7 V;  1N8R W;  5JQG B;  3K5M A;  2VQF B;  1O9G A;  4OPA A;  1YIT V;  1AJQ A;  1D2D A;  2QWQ B;  4GX5 A;  4DR4 B;  1J5E B;  4UB6 Z;  2Q4P A;  3W7S A;  1XMQ O;  1VQ4 V;  1ARO P;  3CHX A;  5IJ0 B;  4MTX A;  4DV5 B;  1BMF G;  1X4T A;  2Y4T A;  1M56 C;  4DK0 A;  1R3I C;  3H1L H;  4LFA B;  3L74 H;  2OIE A;  1ENV A;  3OR6 C;  2QWP B;  4B08 A;  2QKA A;  4Q6G A;  1MSD A;  4CS4 A;  3ABL C;  3T1Y O;  3OTF A;  5JVD B;  4TUY B;  3ETE A;  3MD0 A;  1OCZ B;  1TAE A;  3CWB H;  2NLJ C;  2K1E A;  1BHB A;  2YEV B;  4I55 A;  4CS3 A;  1URF A;  1KBH A;  2X6C A;  3ASO B;  4X62 O;  2GV9 A;  3CX5 F;  1NBM G;  2ZR2 A;  3UCS C;  1N33 B;  2ETN A;  4DV3 O;  3SYO A;  5B1A C;  2DQ3 A;  1PNL A;  4JAA A;  1NS1 A;  1XMO B;  1NZ6 A;  2OTL V;  4GZR B;  3KKY A;  3L9D A;  5J2U B;  5CA0 A;  4B3T B;  1IDS A;  4LF6 B;  5JCO C;  2QA4 V;  1K73 W;  4JYB A;  4TV9 A;  1KB9 F;  5CBH A;  1R6K A;  1AR1 B;  4UVC A;  1Q7Y W;  2WWW A;  1EN5 A;  2KG7 B;  1BL8 A;  5LL6 Y;  3KCX A;  1L8D A;  4I4T A;  1BT8 A;  5KMG A;  4FIP C;  1ZSP A;  2EIJ C;  3CC4 V;  5A9G A;  2IH3 C;  1TUB B;  3RYF A;  5J2T A;  1N34 O;  1Z5W A;  4RO2 A;  4MW3 A;  1HNW O;  1G1X B;  4ZIB A;  2YI9 A;  2QTO A;  4DR1 O;  3JAL A;  3QO7 A;  5A2Q N;  2CUG A;  3FB7 C;  2VWJ A;  3ZMT A;  4JI2 O;  1Y6X A;  3U0Z A;  3A0H Z;  1SER A;  1YI2 V;  2QJ1 A;  5LMN B;  4IIJ A;  2JIZ G;  1Q6I A;  2ODM A;  4DR2 B;  4RAI A;  3CCM V;  3EVK A;  5LXT A;  1DF5 A;  2NNU A;  5CBF A;  1TVK A;  2DWE C;  4UVA A;  1QCE A;  4YY3 O;  4TOI A;  2R9I A;  2EBO A;  1KD1 W;  4JAS A;  4DO2 A;  2IU0 A;  4JTC B;  3ZMU A;  2YIB A;  1B3Q A;  2ZQM A;  5L3E A;  1VQ9 V;  3AK1 A;  2YID A;  1VEW A;  2P5O A;  2CGN A;  4WFE A;  5JH7 A;  5LGU A;  5EC2 C;  1HW7 A;  1OCZ C;  1RFY A;  1NTK H;  2Q7E A;  3I55 V;  1ZL8 B;  3BHP A;  2ZXW C;  3JCZ A;  2XAF A;  2AZ2 A;  2UU9 B;  4MVS A;  4X20 A;  3CPW U;  1I5X A;  4DRX B;  4ZHQ B;  4NXN B;  3EHB B;  1SA0 B;  2LJ2 A;  4U3J B;  2RN9 A;  2W0X A;  1M4U A;  2QKS A;  4O2A B;  3CXC U;  2ZIM A;  1I0H A;  4JI8 B;  1OV9 A;  3RGB A;  2VS0 A;  2WLI A;  1YHQ V;  3KG2 A;  4YIO A;  1Y66 A;  4LH7 A;  4KHP O;  1GN6 A;  4J80 A;  1WA8 A;  3ZRS A;  4L87 A;  3AG1 B;  4JI0 B;  1NQT A;  3K9A A;  4QE9 A;  3CE2 A;  1P7G A;  2CH7 A;  3SDL A;  4B3M B;  2QGN A;  1E1R G;  1GN4 A;  1XBL A;  2R9R B;  2JVD A;  3B2E E;  3SJQ C;  3ABK C;  1AI6 A;  4GX2 A;  4WBN A;  3WG7 C;  4DV2 B;  3FB6 C;  1I7F A;  1NU1 H;  4EB6 B;  1HP8 A;  5DED A;  3F5W C;  4K35 A;  4O4L B;  2R9A A;  1ZAU A;  4YHH O;  2BTQ A;  1Z5V A;  3HKC B;  1MA1 A;  1KP3 A;  4JPR A;  5LA6 A;  2XAQ A;  5L3G A;  5L3B A;  4MTO A;  3WB1 A;  2ADQ B;  3CC2 V;  2VQE O;  3IGA C;  1FXH A;  3OMI B;  1KYO F;  2JRI A;  2YXH A;  4LF9 B;  3B77 A;  4B3R B;  2DYR B;  1FXK B;  4DV0 B;  3AK2 A;  3SPI A;  3E8G A;  4F6R A;  4BIO A;  3JD3 A;  3JAW B;  2LO1 A;  2PTM A;  4DV6 O;  3ETD A;  2A3Q A;  3BY6 A;  2LW1 A;  2ZCE A;  2XTA A;  2EIM C;  1R6N A;  4JZG A;  1Y67 A;  2E5L B;  5IJ9 B;  1TUE B;  2JK5 C;  4O4H A;  4YXW G;  5BXZ A;  5FPR A;  2ITD C;  3ZN0 A;  1H2S B;  3HKE B;  2ITC C;  2LFS A;  1HR0 O;  2CTW A;  1GM9 A;  3CP1 A;  2FB5 A;  2EIN C;  4X1Y B;  4XDK A;  1RSO B;  1XHX A;  2ZT9 B;  4WFG A;  4AQY B;  4J7J A;  4LBE C;  4MS2 A;  4DV4 B;  2OCC C;  1E1Q G;  1Z2G A;  3DC5 A;  1K8A W;  2FTK A;  1F4N A;  3UO3 A;  3T4Z A;  2H94 A;  4RUF A;  3RFR A;  1SKV A;  4ABM A;  2FKX A;  3E35 A;  5GTI Z;  2FL4 A;  1JR9 A;  1QR9 A;  4P9P A;  1QLE C;  1W59 A;  2D2C B;  2W6J G;  2UXD O;  2ZDI A;  2N05 A;  5ITZ B;  4K0K O;  1ORQ C;  3O65 A;  1RP3 B;  5GW7 A;  2NN4 A;  1H38 A;  3QG5 A;  4I50 B;  5FNV A;  2PYL A;  1W0J G;  4ZI7 A;  4GKK O;  5GTH Z;  3CRA A;  3B4S A;  2RQ6 A;  2HJD A;  5LP6 A;  2BSK B;  1CP9 A;  4JI5 O;  2W0F C;  3FKS G;  4DR3 O;  3CCV V;  3JAS A;  1AR4 A;  3PJS K;  4ZBM A;  4GX0 A;  1BE3 H;  3L71 H;  3WFV A;  3HKB A;  3GB7 C;  3L75 H;  1GMG A;  4WCE V;  1MZF A;  3QTC A;  3FYI B;  2R70 A;  1VQL V;  2Q68 A;  1P49 A;  4WFB V;  4MVZ A;  5KX5 B;  2LGQ A;  1SQQ H;  2CAZ C;  4CH3 A;  2DYR C;  2UUA B;  2ZM6 O;  5LMU B;  3F7V C;  4MTF A;  2ZNJ A;  2UXC O;  1GH6 A;  4TV8 A;  1JQ0 A;  1SS3 A;  1D5A A;  1S5L Z;  2Z0A A;  2UUB O;  2ZIN A;  2Q7G A;  3WB2 A;  4O2B B;  3M99 B;  3K03 A;  3N27 A;  5DN6 G;  1I08 A;  4OX9 O;  4TT3 G;  1P7B A;  3BAA A;  4LFB O;  1MZE A;  4LNU A;  4UVB A;  3RVZ A;  1SQG A;  4FLZ A;  1GK9 A;  4LH6 A;  2YI8 A;  2YXL A;  1WB8 A;  4YIP A;  4X1K B;  4ASU G;  3OE7 G;  2ZE7 A;  5C8Y B;  1XI1 A;  4HNA B;  4UCT A;  2O57 A;  1WN7 A;  3K04 A;  4MTG A;  2HHH B;  1PL4 A;  3OD4 A;  1U96 A;  1CXZ B;  2X6B A;  2YXY A;  2HR3 A;  3OW2 U;  4NVP A;  3ABT A;  2GDS A;  4LFC B;  1R3L C;  5JQG A;  1QBZ A;  4FLY A;  3LSS A;  3OTO O;  1S76 D;  4DR6 O;  4IHJ B;  1M56 B;  2G38 A;  1IX9 A;  1IBL B;  4XBF A;  4GUN A;  3MAQ A;  4EKW A;  3OAA G;  1LR1 A;  2F95 B;  3ABL B;  4RQF A;  3K3W A;  1JPX A;  4JYA O;  5IJ0 A;  1M90 W;  5KHI A;  3A8T A;  5BZB A;  1AI7 A;  1H2N A;  4MVU A;  5C93 A;  3B8M A;  2YS8 A;  3CRR A;  4F4L A;  2P4K A;  4LF7 O;  3FFQ A;  5EBL C;  5AG2 A;  2KB1 A;  2KQX A;  3H1J H;  3P30 A;  3ZJZ A;  4NXM B;  4JV5 B;  4NB5 A;  5B1A B;  1QR8 A;  2FML A;  5GON B;  5JVD A;  4TUY A;  4UXN A;  1P84 F;  4PDL A;  3C3T A;  4DYL A;  1ROP A;  3AG3 C;  2YEV A;  3L73 H;  3RYI B;  4PA4 A;  3E22 B;  4QJF B;  4IGG A;  4OGQ B;  4UUJ C;  2UXB O;  4RUE A;  4J11 A;  1WLE A;  3SJB C;  3GVM A;  1NH2 D;  1VQ7 V;  3JD2 A;  2XUM A;  3ETG A;  3UM7 A;  5KHG A;  4BAY A;  4FLT A;  4AI8 A;  1XMQ B;  2Z3Y A;  1SQB H;  5KUK A;  4DR5 O;  4LF5 O;  5J2U A;  5KHH A;  2MW2 B;  1Q8I A;  3QO8 A;  4Z1V A;  5LHG A;  3RWR D;  1Q90 D;  2B1I A;  1CPY A;  1E79 G;  3UKM A;  2V7Q G;  5CBG A;  1F4M A;  2EIJ B;  4PDV A;  4BW9 A;  4PA7 A;  4Q20 A;  3T1Y B;  1J95 A;  3SYA A;  3TXS A;  2WSS G;  5B1O A;  2KG7 A;  4PEL A;  1SET A;  3U10 A;  4X62 B;  3OMN B;  3RT3 C;  2MK3 A;  4KFM A;  4DV3 B;  1TUB A;  3C3S A;  3JCU Z;  3SPC A;  2QM8 A;  5LHI A;  3HKD B;  5KHK A;  4JF3 A;  1SC5 B;  1M9N A;  5EK0 A;  2GTA A;  2OYQ A;  2HVK C;  2B9Z A;  2P22 C;  3H9V A;  3D3I A;  1FYJ A;  1O9H A;  3K58 A;  4JI4 O;  4GYC B;  1VQ8 V;  2P90 A;  3A0B Z;  3IFX A;  1Q6H A;  3CJH B;  1BQZ A;  5B1B C;  1AB3 A;  4KL1 A;  4D6T H;  5LYJ B;  2DQ0 A;  3CCQ V;  2ZXW B;  2GBO A;  4KUM A;  3W7U A;  1N32 O;  1KP2 A;  3CYO A;  3E86 A;  3BAB A;  5IE9 A;  4FFB B;  1TGO A;  3T2M A;  1JJO A;  4O4I B;  1N34 B;  5EBM C;  2XT9 A;  2LP7 A;  3MHH C;  1HNW B;  2C2A A;  1KC8 W;  3RN4 A;  1ZL8 A;  4DR1 B;  2EUL A;  1JCH A;  4JI2 B;  2P4V A;  4IYH A;  1N0J A;  2Q67 A;  4FZ0 A;  3CCR V;  3QO5 A;  1M57 C;  3B09 A;  2BE3 A;  3B40 A;  4GT1 A;  3JSL A;  2Y48 A;  2M7W A;  4DRX A;  4ZHQ A;  1XNQ O;  2E3C A;  4UCO A;  1NT2 B;  1SF9 A;  2ATK C;  4J9Z B;  1SA0 A;  2WAM A;  4U3J A;  4PDR A;  4YY3 B;  5CN0 A;  4ZOL B;  3BRC A;  4DXW A;  1SZT A;  2XAJ A;  5JJN B;  1N36 O;  1IXM A;  4JI6 O;  1Q86 W;  3T1H O;  2F23 A;  2JGD B;  3ASN C;  3C90 A;  5EIB C;  3ABK B;  4R6Z A;  1IBM O;  3DGE A;  3WG7 B;  5D5Q A;  4B7E A;  3D8C A;  2HJF C;  1YXB A;  1G4Y B;  1V9P A;  4TSF G;  3FX7 A;  2ILM A;  1FAF A;  1QLN A;  2DW4 A;  1A32 A;  5K1P A;  3X2Q C;  4O4J A;  1VF6 A;  2JJ2 G;  2DE0 X;  3G67 A;  2E76 B;  4CZZ A;  3PN1 A;  3CEI A;  2DN9 A;  4JYY A;  2HFE C;  4EB6 A;  4O4L A;  1BSM A;  1GTO A;  5BR8 O;  5KLV H;  1XEQ A;  3BPZ A;  4DUY O;  4QPJ A;  1EFR G;  5EBW C;  2GSM B;  3HKC A;  2AW9 A;  3FB8 C;  4CBC A;  2A0L A;  3SPG A;  2F43 G;  4KHP B;  3D36 C;  1L1F A;  2UXN A;  4ICG A;  1FFX B;  1M5I A;  3ZHR A;  1WP8 A;  1OCC C;  5HFL A;  1VF7 A;  3RYH B;  4H44 B;  1WJZ A;  2WLN A;  1MMM A;  3K5O A;  1N0N A;  2EIM B;  4I0X B;  1YJW V;  4XDL A;  1FXK A;  1Q5O A;  1WP7 A;  4P2Z A;  1Q81 W;  4FVM A;  3JAW A;  3CSX A;  3CRM A;  1CEZ A;  2EIN B;  4YHH B;  4CH5 A;  4Z2W A;  4DW1 A;  5L3D A;  2OCC B; 
#chains in the Genus database with same CATH homology
 4P9P A;  1FXV A;  1PL0 A;  1QLE C;  2W6J G;  1PD3 A;  3AG4 B;  2ZDI A;  3W7T A;  4JYC A;  2DYS C;  1K5Q A;  1ORQ C;  3STZ C;  3SYC A;  3TET A;  2WLL B;  4JAV A;  5GW7 A;  3ZRW B;  3E8B A;  1H38 A;  4OXS A;  3D36 A;  4LCU C;  1SRY A;  1W0J G;  3K79 A;  3W7X A;  1QLE B;  2HLD G;  3OR7 C;  4I9W A;  1ZWI C;  2QM7 A;  2DYS B;  2X7R B;  2QEX V;  1CP9 A;  1YSC A;  2W0F C;  1I5Y A;  1H8H G;  3FKS G;  3FB5 C;  3BEH A;  3CCV V;  5CA3 A;  3PJS K;  4ZBM A;  3F7Y C;  4GX0 A;  1COW G;  2EIK C;  4MW8 A;  1VQ5 V;  1BHA A;  3HPL C;  4E2L A;  3WFV A;  3K06 A;  3ZMS A;  3GB7 C;  1NVP B;  3DTU B;  2YSU B;  1GMG A;  4MSW C;  4WCE V;  1JX9 A;  1P4R A;  4BW5 A;  3NXS A;  1K34 A;  4N23 A;  3OEE G;  3FYI B;  4N21 A;  1VQL V;  2Q68 A;  1F23 A;  2IJJ A;  5B3S B;  2WLL A;  2XAG A;  4MVZ A;  4WFB V;  3ZRW A;  1AI4 A;  1NR1 A;  2EIK B;  4JGS A;  4GCZ A;  3OMA B;  4G2K A;  5IYB O;  1DF4 A;  1PNK A;  1K9M W;  3CCL V;  5H9C A;  4BIU A;  1R3J C;  2GHY A;  3OUF A;  4QIW F;  2DYR C;  3SPJ A;  1LNQ A;  1H2G A;  2EIL C;  5FL7 G;  2XAS A;  3GWO A;  5IY5 B;  3F7V C;  1FFT B;  4MTF A;  2W6I G;  4P30 A;  4FK5 C;  2B1G A;  1AJN A;  1JQ0 A;  3EFF K;  3QNE A;  1OCR C;  1VQM V;  3H01 A;  2IJK A;  1DTO A;  1H8E G;  1MAB G;  5B1N A;  1K97 A;  4ZKI A;  3M99 B;  3K03 A;  5DN6 G;  2EZO A;  2EIL B;  1QVG U;  4MVM A;  4TT3 G;  2HKO A;  1P7B A;  4UVB A;  3RVZ A;  1EZJ A;  3CMA V;  2P7T C;  3STL C;  3ZIA G;  4Z1M G;  4UV9 A;  1OCR B;  3CC7 V;  1N8R W;  1GK9 A;  3JD1 A;  2UXX A;  5J9P C;  3LUT B;  1YIT V;  4I5S A;  1AJQ A;  1MSW D;  1W2B U;  4GX5 A;  4U7N A;  3CD6 V;  4ASU G;  3OE7 G;  3W7S A;  1VQ4 V;  1ARO P;  5KA6 A;  2QE7 G;  1R73 A;  3SYQ A;  3K04 A;  2ZR3 A;  3LDE A;  4U7O A;  4MTG A;  4MTX A;  1BMF G;  1MOF A;  2X6A A;  3P32 A;  3CCJ V;  1M56 C;  2X6B A;  1R3I C;  2HR3 A;  3ASO C;  4BIZ A;  4P9O A;  3OW2 U;  3AG2 C;  1ENV A;  1S3J A;  3OR6 C;  5IYC O;  1VQK V;  3ABT A;  1YJN V;  3ABL C;  1R3K C;  1R3L C;  2Y69 C;  4FJC C;  1QBZ A;  4HZ3 A;  3ETE A;  3LSS A;  3MD0 A;  3K0G A;  1S76 D;  1OCZ B;  2NLJ C;  2K1E A;  1BHB A;  2YEV B;  2EJR A;  1M56 B;  2X6C A;  3ASO B;  4XBF A;  1G8M A;  3AG2 B;  1NBM G;  2ZR2 A;  4EKW A;  3OAA G;  1VQO V;  3ABL B;  4RQF A;  1F51 A;  3K3W A;  2Y69 B;  1JPX A;  3SYO A;  5B1A C;  2DQ3 A;  1PNL A;  2A79 B;  1YTF B;  1M90 W;  5BZB A;  1MG1 A;  2JDI G;  1AI7 A;  4MVU A;  5KA5 A;  5C93 A;  2Q6A A;  3B8M A;  2OTL V;  4MVQ A;  3T4D A;  2A9H A;  3ZRX A;  4F4L A;  4PA9 A;  3FYE B;  5EBL C;  5B3S C;  2KB1 A;  3ZJZ A;  3P30 A;  2JEU A;  5IDJ A;  1K7D A;  5B1A B;  1QR8 A;  5CMU A;  1NKD A;  4LP8 A;  2QA4 V;  5KUM A;  4UXN A;  1K73 W;  2XOK G;  4PDL A;  4JYB A;  1ROP A;  3AG3 C;  5LGN A;  5CBH A;  3I56 V;  1R6K A;  2YEV A;  1NVP D;  1GKF A;  1AR1 B;  4UVC A;  1Q7Y W;  4PA4 A;  1W0K G;  4QJF B;  2WWW A;  3CCE V;  3VBB A;  2BOB C;  3E89 A;  4UUJ C;  3ZN1 A;  1K92 A;  5H6R A;  4MT8 A;  4PA6 A;  4RUE A;  1NH2 B;  1BL8 A;  1WLE A;  2XND G;  1NH2 D;  3AG3 B;  4G27 B;  3JD2 A;  1VQ7 V;  4FIP C;  3ETG A;  3UM7 A;  4BAY A;  3K0D A;  2EIJ C;  2Z3Y A;  3CC4 V;  2IH3 C;  5KUK A;  4R50 A;  1B6Q A;  3TK1 A;  4RO2 A;  4MW3 A;  1GM8 A;  1JOY A;  3QO8 A;  3HB3 B;  5LHG A;  3OGC C;  2QTO A;  5EC1 C;  3JYC A;  1OHH G;  2PI4 A;  2B1I A;  3QO7 A;  1CPY A;  4R7C A;  1E79 G;  3FB7 C;  3UKM A;  3ZMT A;  2V7Q G;  3OUS A;  1F4M A;  4WFA V;  4WFF A;  5CBG A;  5IY5 C;  2EIJ B;  4PDV A;  1S5H C;  2IJI A;  4PA7 A;  1SER A;  4Q20 A;  1EBO A;  1YI2 V;  1J95 A;  2IU3 A;  3SYA A;  2WSS G;  2P6J A;  2JIZ G;  5B1O A;  4RAI A;  2V1D A;  4PEL A;  4HAM A;  3CCM V;  4J9Y B;  1S72 V;  1OZ0 A;  1SET A;  1DF5 A;  1OCO C;  2NNU A;  3OMN B;  5CBF A;  1UJW B;  2DWE C;  3R65 A;  4UVA A;  2MK3 A;  1AI5 A;  1QCE A;  3ML0 A;  1K4C C;  2P67 A;  2R9I A;  2EBO A;  5DM6 V;  4JAS A;  4KFM A;  4DO2 A;  1KD1 W;  2IU0 A;  4JTC B;  2XAH A;  3ZMU A;  2ZQM A;  5L3E A;  3SPC A;  4HYO A;  1VQ9 V;  2QM8 A;  5LHI A;  2OTJ V;  1K4D C;  4MVO A;  4JF3 A;  1S0V A;  4WFE A;  1RPR A;  5LGU A;  1OCO B;  1M9N A;  5EC2 C;  5LBQ A;  1OCZ C;  5EK0 A;  3G6E V;  3OM3 B;  2HVK C;  3I55 V;  2WLI B;  1K5S A;  1KKD A;  3D3I A;  4QPK A;  3JD4 A;  5L3F A;  4JTA B;  2DWD C;  4X89 A;  2ZXW C;  3MHS C;  3JCZ A;  1VQ8 V;  2XAF A;  2P90 A;  3ABM C;  1SES A;  3IFX A;  5B1B C;  4XDJ A;  4MVS A;  3RBZ A;  2ZD9 A;  3ABU A;  2DQ0 A;  3CCQ V;  3CPW U;  1I5X A;  2ZXW B;  4KUM A;  1VQ6 V;  3W7U A;  4QNH B;  1VQP V;  3ABM B;  3EHB B;  3G71 V;  4X8A A;  4RQE A;  2QKS A;  3AG1 C;  1KP2 A;  3CYO A;  3E86 A;  3CCS V;  4R8C A;  5B1B B;  3CXC U;  3T2M A;  3OFN G;  5EBM C;  4TWK A;  3LDC A;  2LP7 A;  3MHH C;  1HWY A;  5E1A C;  2C2A A;  1YTF D;  1KC8 W;  2WLI A;  3W7W A;  1YHQ V;  5H6Q A;  3KG2 A;  1Y66 A;  2BOC C;  1JCH A;  1NR7 A;  4JAU A;  3LNM B;  3ZRS A;  3LSQ A;  4L87 A;  3T1C A;  3AG1 B;  2WLK A;  1NQT A;  2Q67 A;  3K9A A;  4QE9 A;  3CCR V;  3QO5 A;  1M57 C;  3B8N A;  2Z5U A;  4GT1 A;  4UV8 A;  4WFH A;  2Y48 A;  4FPP A;  3CME V;  1E1R G;  2M7W A;  2R9R B;  5HFM A;  4H37 A;  5IYD O;  2JEX A;  2ATK C;  1RPO A;  4J9Z B;  4X88 A;  3ABK C;  3SJQ C;  1AI6 A;  2WAM A;  4PDR A;  4GX2 A;  1AJP A;  1WPX A;  5CN0 A;  2PI5 A;  3WG7 C;  4DXW A;  2JJ1 G;  1K3E A;  1M57 B;  3FB6 C;  1SZT A;  3K08 A;  2XAJ A;  4QE7 A;  3TCU A;  3A0R A;  2IW5 A;  1KQS U;  3F5W C;  1GO3 F;  1IXM A;  1Q82 W;  3ZRV A;  1VQN V;  1NJI W;  1Q86 W;  2IH1 C;  1PNM A;  3ASN C;  1XL4 A;  3ABK B;  4R6Z A;  3DGE A;  2X0L A;  3ZMZ A;  1KP3 A;  4JPR A;  3WG7 B;  3ZCC A;  3JD0 A;  3RW0 A;  2EZP A;  2HJF C;  2WPD G;  1G4Y B;  1THZ A;  2XAQ A;  4TSF G;  4MTO A;  5L3G A;  5L3B A;  1QVF U;  1V54 C;  1V55 C;  1FXK C;  3CC2 V;  3E8F A;  1QLN A;  3ASN B;  3SYP A;  2DW4 A;  1S77 D;  3IGA C;  1RM1 C;  3X2Q C;  3E2E A;  1FXH A;  2WLM A;  3OMI B;  2JJ2 G;  2OT5 A;  4CZZ A;  2H8P C;  3B77 A;  2HFE C;  1V55 B;  1V54 B;  1XL6 A;  1M1K W;  2DYR B;  1FXK B;  2WLH A;  3E8H A;  3SPH A;  1GTO A;  3VOU A;  3SPI A;  2HVJ C;  3E8G A;  2ZDI C;  4QPJ A;  1JVM A;  3X2Q B;  1RM1 B;  1EFR G;  5EBW C;  2GSM B;  2B5U A;  3JD3 A;  4FMT A;  3FB8 C;  3ETD A;  4CBC A;  2A0L A;  3SPG A;  3BY6 A;  5LHH A;  3IC7 A;  3RVY A;  1FS0 G;  3ZMV A;  2F43 G;  2EIM C;  1R6N A;  1L1F A;  5LGT A;  3OEH G;  3G4S V;  2UXN A;  1TUE B;  2JK5 C;  4GX1 A;  2D3O W;  3CCU V;  3AEI A;  4YXW G;  1OCC C;  5HFL A;  2ITD C;  3ZN0 A;  2AHY A;  2IJH A;  1YJ9 V;  2AHZ A;  2ITC C;  2LFS A;  2LFR A;  2WLN A;  1GM9 A;  3CP1 A;  2EIN C;  2WLJ A;  4H33 A;  5L3C A;  2EIM B;  4XDK A;  1YJW V;  1K33 A;  3E83 A;  4XDL A;  4PA3 A;  1FXK A;  4WFG A;  4LBE C;  4MS2 A;  2OCC C;  4JTD B;  1PKX A;  3LDD A;  4P2Z A;  2CK3 G;  1E1Q G;  1Q81 W;  1KEC A;  1DLB A;  3AG4 C;  1Y4M A;  4LC1 A;  1K8A W;  1JJ2 U;  2FTK A;  1F4N A;  3T4Z A;  1OCC B;  2H94 A;  4G28 B;  2HG5 C;  4RUF A;  4MVR A;  1YIJ V;  1CEZ A;  2EIN B;  3E35 A;  1GM7 A;  4WF9 V;  4KP4 A;  4PDM A;  2Q69 A;  5L3D A;  1QR9 A;  2OCC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...