1JVMA

Kcsa potassium channel with tba (tetrabutylammonium) and rubidium
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Energetic optimization of ion conduction rate by the K+ selectivity filter.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
total genus 34
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jvmA00
4P30A 2JK5C 3STZC 1J95A 4P9OA 3FB5C 4X89A 2A79B 4J9ZB 1R3JC 3AG3C 2HFEC 2H8PC 3GB7C 1XL4A 2DWEC 5KUMA 1M56C 1K4DC 3HPLC 4LCUC 2IH1C 4MS2A 4MVSA 5EBMC 4WFGA 2X6AA 4WFHA 2WLNA 3IGAC 3SPCA 3STLC 2ZXWC 4RUEA 2DWDC 3F7YC 4G27B 3LNMB 4JTDB 2R9RB 4MW3A 3K04A 4MW8A 4PA3A 4R6ZA 3T4DA 4P9PA 4R50A 2WLIB 3K06A 4UUJC 2WLMA 4MSWC 1R3KC 4JTAB 3FB7C 4OXSA 5EK0A 3T4ZA 3E8BA 3RVZA 3AG1C 4R7CA 2EINC 2WLKA 5B1BC 4MTGA 4WFFA 2A0LA 4XDLA 2IH3C 1V54C 1JVMA 4TWKA 4XDKA 3RBZA 3SYQA 3SPGA 2Y69C 3ASNC 3TCUA 4EKWA 4F4LA 2BOCC 2HJFC 2BOBC 2WLHA 3AG4C 3F5WC 4I9WA 2KB1A 3K0GA 3LDDA 1ORQC 5EBWC 3SYCA 4WFEA 4X88A 2Q68A 2HG5C 3OUFA 3K0DA 3VOUA 2ZD9A 1R3LC 3X2QC 3IFXA 1M57C 3K08A 3RW0A 1K4CC 1R3IC 3EFFK 2DYSC 4X8AA 4BW5A 3E8FA 4MVQA 3SPJA 3SPHA 3OUSA 3ABLC 3OR6C 2EIMC 3LDCA 3LDEA 4PA4A 2ITCC 2OCCC 2X6CA 2EIJC 4GX0A 4LBEC 5EBLC 4PA6A 5J9PC 2ITDC 2P7TC 4CBCA 3E8HA 4LP8A 3RVYA 3UKMA 3WG7C 1OCRC 2NLJC 4PDMA 3JYCA 5B1AC 4P2ZA 3SYPA 4H37A 4PDLA 4MVZA 2K1EA 4MTFA 3PJSK 3T1CA 4MVRA 3TETA 2QTOA 2Q6AA 4MVMA 3F7VC 3LUTB 1OCZC 4MVUA 4RUFA 1S5HC 4GX5A 3SPIA 4QE7A 2YEVA 3ZJZA 3E83A 3E8GA 1QLEC 2HVKC 4ZBMA 5IY5C 4QE9A 3KG2A 4GX1A 1XL6A 2X6BA 2WLIA 4HYOA 4MTOA 4GX2A 2QKSA 2DYRC 3FB8C 1BL8A 5EC1C 3E86A 5E1AC 1ZWIC 3OGCC 4PA9A 4XDJA 4R8CA 2WLJA 2HVJC 4RAIA 1KKDA 2Q67A 4MVOA 5EC2C 1LNQA 5BZBA 4JTCB 5CBFA 1G4YB 3K03A 4RO2A 3AG2C 1V55C 2AHYA 4DXWA 4QNHB 5B3SC 3SYOA 3ASOC 4PDVA 2A9HA 2W0FC 4PA7A 4PDRA 5KUKA 2EIKC 3BEHA 2AHZA 3ABKC 2WLLA 3E89A 4H33A 3T2MA 4G28B 3UM7A 1OCCC 3ZRSA 4HZ3A 2Q69A 5CBGA 4KFMA 4J9YB 2ATKC 1OCOC 3OR7C 2EILC 2WLLB 3FB6C 3R65A 3ABMC 3SJQC 5CBHA 1P7BA 3SYAA
chains in the Genus database with same CATH superfamily
3HKDA 3RN4A 2YIBA 3STZC 4X89A 1HP8A 1RM1B 1XL4A 1YCIA 4DUZO 3M7MX 4ZHQB 4GKKO 3GWOA 2ZXWC 3KZIZ 4G27B 1XREA 4NYKA 4FVMA 2B9ZA 5CMUA 4DR1O 5B1BC 5IWAO 2FL4A 1IX9A 3MDSA 4J11A 4X88A 2LFRA 5IE9A 3AG2B 3OTOB 1THZA 1EZJA 2DMXA 1NR1A 3X2QC 3DSQA 3ZRWA 3E22A 5C93A 1VEWA 2LQTA 2W6JG 1S5JA 3KKYA 4IT5A 3IC9A 2GTSA 3N2KA 5IJ0B 4LP8A 3ETGA 4Z1MG 5BMVA 3X2QB 5KHKA 4O4LB 1VF7A 3WB1A 4CC6A 1NVPB 5JJEB 2LJ2A 3TETA 4FLTA 1GK9A 1Q8IA 1Q7YW 1S5HC 3ETDA 3HKCB 2ZM6B 3AEIA 2FB5A 4ZBMA 5EYPA 3P3PA 2WLIA 4ZKIA 1H8HG 3NXSA 1SF9A 1M56B 1JA8A 3ABMB 4YXWG 4K35A 3O9OA 4YY3O 2MW2B 1D5AA 5JJNB 3EVKA 4UB6Z 2R9IA 3JSNA 4QNHB 2A9HA 1WN7A 2RDCA 1IXMA 1Q6IA 1UFIA 4O2AB 1PL4A 2BTQA 1Y67A 5F2VO 3ABMC 1K73W 3ZS8C 3JCZA 4P9OA 4ASUG 2DQ3A 1XNQO 4CC5A 4B7EA 1ROPA 1COWG 3ZHSA 1VQ8V 1KYOF 2WLNA 4X64B 2BSKA 2LW1A 4NVPA 3T1HB 3LNMB 1W0KG 1YF2A 2ETNA 4ABMA 3TGUH 2ZNJA 3ETQA 4R7CA 2XHBA 4LF8B 2WAMA 2JJ1G 4X9QA 4JI5B 4FLZA 5B5EZ 3SPGA 5H6QA 4LF5O 1QNMA 3N27A 4H13B 1Y6XA 1TUBB 2IBZH 3DGEA 3ABTA 5DEDA 1I94B 1R3IC 2ADPA 1E1QG 1KUQA 1AR4A 4JI3O 2Q9LA 3ABLC 4UXNA 2ITCC 1YJWV 1AI6A 1GMGA 3ZN1A 1URFA 3OTOO 2ITDC 2UUBO 1XILA 3D8CA 1AP6A 4HNAA 2QEXV 4IL6Z 4NXMB 2AZ2A 2PYLA 1DF5A 4WBNA 3ABLB 1ZL8A 4RUFA 4DRXA 2OCCB 5IJ9B 1TVKA 2WSSG 4MTOA 5LMUB 4GX2A 3H1HH 3S3XA 4HNAB 5EZYB 4KHPB 1GN6A 2ZXWB 4FK5C 1XBLA 3D36C 3VQYA 1WA8B 1KD1W 4E2LA 4LFBB 4NTXA 3SYOA 3E89A 5LOVB 2Q4PA 3ZRSA 4O4LA 2YXYA 5LA6B 2KSDA 1GAXA 1GN2A 2R9AA 1NI8A 4XBFA 1GM9A 2GTAA 5CN0A 3W7SA 5LXTB 2N04A 4BAYA 2KG7B 2E5LO 2UUCO 4MVSA 2CUGA 1NTZH 2X7RB 1N34B 1AI7A 3F7YC 2JGDA 4PA3A 4UCTA 4FM0A 2IJHA 1S76D 1FXKA 1YTFD 4WFFA 4IIJB 2PI5A 4TUYB 4F4LA 1KB9F 5CB4B 1B6QA 2KB1A 1KBHA 1QBZA 3LSUA 2ODMA 1Y66A 1K4CC 2DYSC 4X8AA 4BW5A 1AB3A 4PJ0Z 1HNZO 4KHPO 3LDCA 4DR7B 4LC1A 1HWYA 3CCRV 2V1DA 3BVOA 3HKBB 1KC8W 4NTYA 1PP9H 4P2ZA 1PV0A 3C90A 5LOVA 1JFFB 3JD0A 3SGIA 2IJJA 2JEUA 1YIJV 3QO7A 2QSAA 2Q6AA 1TUBA 2A06H 1H2NA 1BHAA 4UCRA 5JQGB 1BS3A 4X1KB 5JVDB 4AQYB 4DYLA 3LSQA 3CCQV 1XL6A 3APOA 4LFAB 3UO2A 4JI1B 2A7WA 4KL1A 3BY6A 3W7XA 1WP7A 4RAIA 1TUEB 4EFBA 3QG5A 1AILA 1ZL8B 2X0LA 2UXNA 2UU9O 4O4IA 3FYIB 3BHPA 4PA7A 3QO5A 1SQPH 4LNUB 2AHZA 2W6IG 5KA5A 3CRCA 3OR7C 4HBNA 3CCVV 2VQEB 3JASB 1FKAO 1R3JC 2L35A 1H8EG 1FJGO 1Q6UA 1GN4A 1QVFU 3CSXA 2XAJA 1OHHG 1JJ2U 1X4TA 3F5TA 1NVPD 1QLNA 2WLMA 2F4VB 1VQ6V 3ABUA 2UU9B 5B1BB 4CH6A 1IURA 2UUCB 4J41A 1V54C 2F1MA 1EM1A 1V55B 5GONA 3L72H 1EFRG 3S3WA 1JFFA 4QPJA 2XNDG 3BFRA 2YS8A 3H9VA 4O2BB 4DV1O 3W7TA 3OUFA 3VOUA 3JAMN 4W4KA 1XNRO 1BGYH 3L9DA 5AG2A 3IFXA 1P84F 3RW0A 3CC4V 3ZBHA 5BMVB 5KHJA 1FFTB 4AQYO 1ZX3A 5CA0A 3UT5A 1JJOA 4FZ0A 4DR3O 4YJ3A 1PNMA 3VQXA 4PA4A 4TV8A 1NTKH 4UCVA 2ZE8A 1M1KW 1XDCA 2FMLA 3HB3B 1WNSA 4B3SB 2NLJC 1B06A 2OT5A 1PPJH 1WPXA 4TUYA 1FXKB 1HR0O 1LUWA 4CH3A 1RSOA 4CH4A 1HNXB 5EYPB 4U3JB 1M4UA 4GX1A 3Q4HB 4EFEA 3N2KB 2WLJA 4FFBB 3WB0A 1FXHA 4Z2WA 1K8AW 3ZHRA 2EIKC 4ZIBA 4HZ3A 2Q69A 2R72A 4PELA 5J2UA 2CGNA 1P7BA 2JK5C 1IXBA 4NXNO 3FB5C 4I0XA 3SJBC 3JAWA 3ZHUA 3P32A 2IH1C 4UVCA 1PNKA 5LYJA 4IHJA 3ICXA 2DWDC 2CH7A 2R9RB 4MW3A 3K04A 1VQPV 4QGPA 4R50A 3ASNB 4TV9B 5EIBD 4UVBA 4X1KA 5EK0A 3E8BA 1XMOO 4MTGA 1SKVA 4X65O 2QM4A 2GSMB 1K33A 1JVMA 1R73A 3N2GA 3UT5B 3TCUA 1OCZB 4JI6B 1ZTEA 5LP6B 2H94A 1AROP 2LGQA 2ZR3A 4GZRB 1J5EO 2QWQB 3ZX6A 2DE0X 3G4SV 1O9HA 3OEEG 3EXAA 2P67A 1OCOB 3K57A 1KP3A 4C7UA 5LP6A 3SR2C 3GVMA 1I0HA 3L73H 1QCEA 2ARHA 2KQXA 2PGGA 3K59A 2CTQA 4FMTA 4JYAO 1SC5B 3MAQA 5FLXN 4MVRA 1K7DA 4HAMA 4MVMA 3LUTB 1BSMA 1S0VA 1T5EA 5B66Z 1R1BA 4QE9A 3CRQA 1SS3A 4O2AA 2QKSA 4LFCB 2D3OW 5EC1C 4R8CA 4GKJO 4QPKA 2Q67A 1P7GA 4NTWA 5CBFA 3K03A 3UQ8A 1YJNV 4O4HA 3ZMZA 4FM1A 3Q4HA 4UFZA 1QVGU 2QKAA 2QWRB 3FB6C 3SJQC 3UO3A 5IYBO 4U7OA 3ZMVA 5DM6V 3BA8A 1ZAUA 1MABG 5A2QN 1G1XB 2YIBD 4LCUC 1J5EB 3N2GB 2EIJB 1L0LH 1IBKB 3BA9A 4DV6O 2WLIB 3FD9A 3CC7V 5LGTA 1R3KC 4U3JA 4B3RB 3VBBA 3DC6A 4CS4A 5D5PA 3K9SA 4BIOA 2HJFC 4I0XB 1GN3A 4TQFA 2LP7A 1GM7A 3D3IA 5IJ0A 4B3TB 2P90A 1IBMB 2V7QG 3OTFA 1UPGA 5LHHA 2XTAA 2YUAA 3OR6C 5L3GA 3AG7A 3LDEA 2EIMB 5EBLC 5J9PC 3A2FA 2HHHO 1VQ7V 4PDMA 3BCCH 4I50B 4DV5O 4PDLA 5LHGA 2OTLV 1N33B 4DV2B 4LF8O 1JMKC 2B1IA 4LF4B 1CEZA 2XASA 2YEVB 1QHTA 3FAVB 1WA8A 1ZWIC 2L6LA 1DTOA 1DF4A 1KKDA 1R6TA 4JI2B 4JTCB 2G38A 1GKFA 3CB2A 2CH7B 2FTKA 4N23A 2CTWA 4PDRA 3ABKC 4H33A 2CTRA 4G28B 2EX3A 3M99B 3K9AA 4IYHA 4DV2O 1HDJA 2YIAA 4GYCB 2V4DA 4B3RO 2XUMA 1VQ9V 1QU7A 2P22C 3DXRA 3AK3A 3IGAC 4I4TB 3T1YB 3K5NA 2CDYA 4MW8A 4LF9O 1FPOA 4GKKB 3RVZA 4X1IB 1F7YA 2WLKA 4XDLA 2HLDG 4TT3G 2ZNIA 4TWKA 1VF6A 2CE4A 1BZKA 3RWRD 2BOCC 2JEXA 4WFAV 5KA6A 2WLHA 4ZOLA 1IBLB 1Z5VA 1FXVA 3K0GA 2VQEO 4WFEA 3G6EV 3K0DA 3ZRXA 4JYCA 5KHGA 1D2DA 4IGGA 1BQZA 3E8FA 3SPJA 1PKXA 5KMGB 5J2TB 2VWJA 3RGBA 2Q7GA 2QM7A 1PM9A 3BPZA 4JYBA 3OEHG 4MVZA 4BIUA 1MOFA 1K3EA 2WWWA 5KX5A 2AXTZ 2HVKC 1SQBH 2EINB 3EHBB 4I50A 4WFBV 4J10A 4DR4O 2ILMA 1L8DA 1OCRB 3HKEA 5IDJA 2Z3YA 4RWUA 2XAFA 1N34O 2EIKB 3CWBH 3THOA 4DXWA 3WB2A 1AJNA 3HKBA 1PL0A 1F51A 3ZMTA 4P30A 3K5MA 5IJ9A 2FKXA 1SA0A 1XUQA 4J9ZB 1FD9A 2GUZB 2YC0A 1YXBA 3B8MA 2EZOA 4AHCA 2DYRB 3HPLC 4FZ1A 5E79Z 4WFHA 3JALB 4WCEV 1K34A 3D36A 5CB4A 1S3JA 4JI8B 4K0KO 4WBNB 1CXZB 3CD6V 2ZIOA 1IDSA 4F6RB 5CA1B 3OMAB 4BW9A 5JH7B 1HNZB 3JSLA 3RFRA 1VQNV 3JAWB 1SQQH 1N32B 5IT9N 5CA0B 2JJ2G 2F95B 3ZN0A 5L3CA 3K08A 2QKCA 4FJCC 1S72V 1FFXB 2F43G 1MSDA 4I7ZB 4K3AA 4Z1VA 1MMMA 3OM3B 2NN4A 4O4JB 1I7FA 2KG7A 3TXSA 4DV7O 4JI7O 1AI5A 1WB7A 1NTMH 4J7KA 4OGQB 4CBCA 4LF6O 3RVYA 1VF5B 4LFCO 4ZOLB 1F4NA 2P4VA 4MTFA 2WA3A 4CH5A 1NR7A 3OMIB 2ZKOA 4U3FH 3CXHF 2ZDIA 2CTPA 1AI4A 2Z5UA 3F7VC 3ETEA 2DJVA 2XT9A 1HW7A 2RNBA 3E8GA 2Q5ZA 1V54B 3J7AU 1R6KA 4QIWF 4DV1B 4YIPA 4HYOA 3FB8C 1BL8A 5E1AC 1XNRB 3FFQA 5A9GA 5KMGA 5H9CA 1M5IA 3JD4A 3DXRB 1EN5A 4FLYA 2Y4TA 4AILC 4RO2A 3K79A 2AHYA 4JV5B 5H5NA 2JGDB 4UCSA 1AR1B 2ZINA 2PTMA 3T2MA 1VQ5V 1KECA 1Z5WA 2Z0AA 5HFLA 1OCCB 2LO1A 3H1JH 1M57B 2F4VO 4DW1A 2UXCO 3I56V 2OWOA 5LBQA 2F23A 2YDEA 5IY5B 5JQGA 3A8TA 1RM1C 2Y69B 4DV3O 3RYFA 5FPOA 3T4ZA 2EINC 1S5LZ 2YXHA 4OPAA 1I08A 2QWPB 4EKWA 2ZM6O 2ZT9B 3JASA 2UXBO 4JI4B 3CHXA 1R3LC 4GUNA 5J2UB 1M57C 2IU0A 5DECA 2DYSB 3JALA 4DV0O 2LGWA 3RYCA 3RYHB 3OAAG 1JCHA 2E74B 2EIJC 2PZSA 1WB8A 3JARB 5DN6G 4D7SA 1RPRA 5GONB 2VS0A 2BTQB 3IAYA 3WG7C 1OCRC 1VIBA 1YEWA 4JGSA 4GT1A 1N0NA 2UXBB 3J81N 4B3TO 3T1HO 4LFAO 3SPIA 4KP4A 3E83A 1KMIZ 1QLEB 4J80A 3B77A 5EZYA 2NR5A 1VQOV 4ZHQA 1EBOA 5EC2C 4JI5O 1SESA 3AG4B 5FNVB 1LR1A 5L3BA 1L0NH 5LGUA 2W0FC 4FM2A 3ZCCA 2Q7HA 2ZE6A 5IYZA 5CBGA 1Y76B 1OCOC 1SETA 1UJWB 3K5LA 2WLLB 1WP8A 1VQLV 2EILB 4LF7B 3CC2V 1QR8A 4X1YA 5JJJB 4GLXA 2JRIA 2DWEC 3LNNA 1K4DC 4WFGA 5FPRA 3TJTA 2D2CB 3SPCA 5KHHA 2ZCEA 3G67A 1K92A 2RN9A 1B3QA 2UXDO 1ENVA 2GV9A 4JTAB 4X20A 4E4EA 1Q6HA 2IH3C 5C8YA 2M7WA 4B08A 5LHIA 3ASNC 5JVDA 4I9WA 3AG4C 1W2BU 3LDDA 3RYFB 4DV3B 3L74H 1WJZA 1BHBA 3AK2A 4JZ2A 3HKDB 4MVQA 1Y74B 3H1LH 1HNWO 5D5QA 1YHQV 3IC7A 5ITZB 2Y0IA 4B3SO 3C3TA 4GX0A 4X64O 5LYJB 1X59A 4NXMO 2ZE7A 4PI2A 4JYYA 5CA3A 2R70A 5B1AC 1H38A 2QWNB 4H37A 2ZR2A 1SQFA 3ZRVA 2BTOA 4MVUA 2GUZA 3ZJZA 3JD2A 3L70H 5B1OA 4DK0A 1ZSPA 4CS3A 1PD3A 3ZEDA 2DOSA 3K58A 1NBMG 1Q90D 1US6A 4Q6GA 3VQWA 2JDIG 3B2EE 1V55C 3JAKB 3TK1A 2E3CA 5L3DA 4FIPC 1EN6A 4LFBO 4JPRA 3UM7A 3AG3B 4BIZA 4MT8A 5LXTA 4QJFB 3CCLV 1R6NA 1N36O 4LF4O 1E79G 1WLEA 4YJ2B 3CRRA 2X6AA 3R66A 4JTDB 1NT2B 1XMOB 2XAGA 3NR7A 2BE3A 4LF7O 1AR5A 4IIJA 1M93A 2XAQA 3FB7C 5HFMA 2VQFO 1H2SB 2EULA 1RSOB 3RYHA 3I55V 1HNWB 1FXKC 3CE2A 4YJ2A 2Y4UA 3BABA 4X65B 4DV7B 4JI7B 4X1YB 1FAFA 1N36B 3RT3C 2YICA 1VMGA 2LFSA 2ZD9A 5LA6A 3MHHC 5IYZB 3QO8A 1K9MW 1EN4A 3W7UA 2AGAA 4GCZA 5J2TA 4RQFA 1I5XA 4JI0B 2UXXA 4PA6A 3G80A 3JAKA 4LF9B 3MHSC 4O2BA 3SYPA 4AI8A 1WAZA 3W7WA 2EJRA 1Q3EA 1VF6C 4FLUA 1SERA 2B5UA 3QNEA 5LGNA 1OCZC 3UCSC 4QE7A 3ZHQA 3KCYA 1JX9A 4TV9A 1NH2D 1SZTA 4DO2A 2GBOA 1H2LA 2ZDIC 4DK1A 4PA9A 4JI4O 4X66B 3ZIAG 1KP2A 5BR8O 3G71V 5GTIZ 3T1YO 2HR3A 1PNLA 1XMQO 3BEHA 1Q81W 2WLLA 1SRYA 4O4IB 5FL7G 4TV8B 4J7ZA 4KFMA 3ZRWB 1D5NA 3BRCA 1QQCA 4LNUA 2VQFB 2PF4E 2RQ6A 2IJIA 3OGIB 1KQSU 4Q20A 3AG3C 3ABKB 4ZI7A 3J80N 3GB7C 3FAVA 3KCXA 2DN9A 2QE7G 1TAEA 3T4DA 1JR9A 3K5OA 4X20B 2Q8VA 4YHHO 5C8YB 3CRAA 3CJHB 2HKOA 2A0LA 5BY1A 3CPWU 4O4JA 5L3FA 1RP3B 5IYDO 1XHXA 1W0JG 3F5WC 4UB8Z 1BT8A 2DQ0A 1I94O 2PY5A 1IZ3A 2HG5C 3L71H 2IU3A 2EZPA 4IYIA 2H3OA 5IYCO 1JPXA 4K0KB 2EIMC 3QF7A 5KLVH 2ZE5A 2UUAB 2RCVA 4A5UB 3WFVA 5FNVA 4UV9A 3ML0A 1MG1A 4NB5A 3OD4A 1VP7A 2QDOA 3PJSK 2WPDG 3T1CA 4DUZB 3QTCA 3TXQA 2QR4A 5BR8B 2Q0OC 2QWOB 2C2AA 1O9GA 4GX5A 2YEVA 3B4SA 1HR0B 1XMQB 3C3SA 4DR2B 4KUMA 4DUYB 1NS1A 4DV0B 4DV4B 1F4MA 1MNGA 2DYRC 4EEQA 1F23A 4EB6A 4DR5O 3OGCC 2ZQMA 1H2KA 3AK1A 1LNQA 4ICGA 1OV9A 2PUSA 1YSCA 1E1RG 1QR9A 1EZVH 3AG2C 3SDLA 4F6EA 4FFBA 1I5YA 5B1NA 2VWKA 4OX9O 4I55B 3RYIA 2Q73A 2W0XA 3APQA 2E76B 3JCUZ 2EILC 3R65A 2PI4A 3SJCC 1XEQA 1Y4MA 2P6JA 1K97A 2JS3A 4U7NA 2BCCH 5KUMA 2CGOA 1M56C 4LH6A 3B09A 5EBMC 2OCHA 5JH7A 2Y0PA 3L75H 3CMEV 2AW9A 2QA4V 1Q86W 3CRMA 2N74A 3GWKC 3CCMV 4UUJC 1VARA 3VQVA 3U10A 4OXSA 1YJ9V 4DRXB 2UUAO 1MA1A 5LMNB 4JAAA 3H1IH 2XAHA 2ZIMA 1TGOA 4FLWA 4X1IA 4J7JA 3SYCA 3E35A 4LF6B 2Q68A 1SQVH 1K5SA 1KU9A 3D3QA 5K1XA 3OUSA 2EJ7A 1FYJA 2QM8A 4DR5B 4RQEA 2JS5A 3CJHA 2MK3A 3U0ZA 2P5OA 4DUYO 4DV4O 4B3MO 4JYAB 3UKMA 1YZBA 1CPYA 1A32A 5H6RA 3JYCA 1OZ0A 4TOIA 2K1EA 3P30A 3CCSV 4D6TH 3JD3A 5KX5B 5JCOA 1KKCA 4JV5O 3KG2A 4X62B 4DR4B 3CCJV 3OMNB 1Y76A 4JAVA 3BAAA 3RYIB 4CZZA 1SA0B 4UV8A 2K9PA 4XDJA 1V9PA 1NH2B 2YXLA 3QVNA 4K8XA 1M9NA 4KXRA 2PYJA 3CXCU 5TISZ 1P4RA 1DGSA 5LMNO 3OE7G 5JWPA 5IWAB 4J42A 4LR3A 3SJAC 2JIZG 3CEIA 1N0JA 4D7TA 5BZBA 5B3SC 3SYAA 2RJZA 1FJGB 1VQMV 3A0HZ 1N8RW 1ZLZA 2OIGA 1B04A 4NKGB 3CCUV 1W59A 1S77D 4UVAA 4X62O 4TSFG 4MS2A 1MZEA 3STLC 4RUEA 3ZMSA 3PN1A 4EB6B 4F6RA 1GM8A 2HJDA 1Q82W 1IBKO 1AJQA 5B3SB 3JD1A 4JI8O 3AG1C 2UUBB 2F93B 1TA8A 4XDKA 4DW0A 3SYQA 3RYCB 2Y69C 1GRJA 2BOBC 3O65A 5EBWC 4JASA 3U11A 1IVSA 2P4KA 4DR6B 1U97A 1K5QA 1YVWA 5ITZA 1G6UA 5LMUO 1NU1H 3SPHA 1XOUA 3CS5A 2F66C 3ZHTA 3B40A 3IJ4A 2P7TC 2N05A 4MTXA 4O4HB 1G8MA 4DV5B 5GTHZ 4N21A 3JATB 2CAZC 2QGNA 4B3MB 3DTUB 4BR6A 4JI0O 4BWAA 1TVKB 1SZXA 4MVOA 2DW4A 5K1PA 2HP8A 2EBOA 3H1KH 1IBLO 3ASOC 4NR1A 5LP6C 1OCCC 3OFNG 2AZ0A 2XOKG 2HHHB 5CBHA 3H01A 2B1GA 3K3WA 4PD4F 1J95A 4FLXA 1M90W 1N33O 1JOYA 4DR6O 2OIEA 2QTSA 4DR7O 1GTOA 1VQ4V 2UXCB 4R6ZA 1MSWD 3OW2U 1CP9A 1Q5OA 2HEPA 1BQ0A 1SQGA 1AVMA 5EIBC 1MZFA 1RPOA 4B7KA 1XNQB 1FS0G 1XI1A 4JI2O 3RBZA 2M6YA 4YIOA 4H0LB 5JCOC 2YIDA 3G6BA 2YI9A 1H2GA 1H2MA 3ASOB 3B8NA 1XHZA 2Y48A 1BE3H 3EFFK 2BSKB 4G2KA 1SQXH 1NQTA 2GHYA 4LF5B 3CYOA 4JI1O 2E75B 1DLBA 4L87A 4ZI7B 5CA1A 2Q0AA 2OCCC 5H2FZ 4LBEC 3FKSG 1BCCH 2KKWA 3HR0A 3E8HA 4JZGA 2WA4A 4DR2O 4I5SA 3WG7B 4PI0A 2JGUA 4IHJB 2QJ1A 1NKDA 1RFYA 1GH6A 1AJPA 4H44B 1QLEC 5IY5C 4CS2A 4GKJB 2X6BA 2E5LB 3CMAV 4I9QA 5KHIA 3E86A 1WPBA 4X66O 4UCUA 2HVJC 1U96A 3JATA 3FX7A 1NZ6A 2IW5A 4OPHA 4PDVA 1P49A 5KUKA 3HKCA 2A3QA 3HKEB 1IBMO 4J9YB 2ATKC 3CP1A 2ADQB 3M8AA 4K8ZA 4JI3B 2A79B 4FPPA 2HFEC 5BXZA 2H8PC 4LWSB 4DR1B 4YJ3B 2P06A 2LW7A 2YSUB 3JARA 1LUVA 3I5DA 1XQ8A 2RMKB 4YHHB 4UCOA 2IJKA 4JF3A 3AG1B 4P9PA 4DR3B 3FYEB 3K06A 4MSWC 5KAFZ 4DV6B 1DK1A 3E22B 2FYUH 1AP5A 3MD0A 5KAIZ 1JQ0A 4L8JA 1BMFG 3ZMUA 3ZHVA 2VRZA 2YI8A 1VQKV 1ORQC 4JAUA 3DC5A 1Y74A 1Q43A 1YTFB 1YDXA 3E2EA 1N32O 2O57A 1Z2GA 1N4CA 5GW7A 1YITV 1GO3F 4PHZA 3CCEV 4LH7A 1FFXA 4PV1B 2X6CA 2CK3G 4I4TA 3CX5F 2UXDB 4W4LA 5LL6Y 4FFKA 4YY3B 3A0RA 2Q7EA 2QTOA 3P3NA 2JVDA 3OT7A 2GDSA 4NXNB 1YI2V 1OJHA 5L3EA 2NNUA 1HNXO 1ZUQA 1L1FA 4FLVA 4WF9V 2OYQA 1NJIW 2OTJV 1G4YB 2IM9A 4TQDA 4LWSA 4I55A 4OX9B 3WU2Z 3LSSA 3A0BZ 4JI6O 5B1AB
chains in the Genus database with same CATH topology
2P6JA 2JK5C 1K97A 3STZC 4X89A 3FB5C 4U7NA 1RM1B 1XL4A 5KUMA 3P32A 3I56V 1M56C 5EBMC 5LBQA 2IH1C 4UVCA 1PNKA 3CMEV 3GWOA 2ZXWC 2DWDC 5IY5B 4G27B 2R9RB 4MW3A 3K04A 2QA4V 1Q86W 1VQPV 4R50A 1RM1C 3CCMV 2Y69B 3ASNB 4UUJC 4UVBA 4OXSA 5EK0A 3T4ZA 3E8BA 5CMUA 1YJ9V 2EINC 5B1BC 4MTGA 2GSMB 1K33A 2XAHA 1JVMA 1R73A 3TCUA 4EKWA 1OCZB 2H94A 3SYCA 1AROP 3E35A 4X88A 2LFRA 2Q68A 3AG2B 1THZA 2ZR3A 1EZJA 1R3LC 1NR1A 3X2QC 3ZRWA 5C93A 3G4SV 1K5SA 1M57C 2IU0A 2DYSB 3OEEG 2P67A 3OUSA 2W6JG 3OAAG 1OCOB 2QM8A 1JCHA 4RQEA 1KP3A 4Q20A 2MK3A 2EIJC 5DN6G 1RPRA 4LP8A 3ETGA 4Z1MG 3UKMA 1CPYA 1QCEA 1OCRC 3WG7C 5H6RA 3X2QB 3JYCA 4JGSA 4FMTA 1OZ0A 4GT1A 2K1EA 1NVPB 3P30A 4MVRA 3CCSV 3JD3A 3TETA 1K7DA 1GK9A 4HAMA 4MVMA 3LUTB 1Q7YW 1S5HC 3ETDA 3SPIA 1S0VA 4KP4A 3E83A 3AEIA 4ZBMA 1QLEB 4QE9A 3KG2A 3B77A 2WLIA 3OMNB 1H8HG 4ZKIA 3CCJV 2QKSA 3NXSA 4JAVA 1M56B 4CZZA 2D3OW 5EC1C 3ABMB 4YXWG 1VQOV 4UV8A 4XDJA 4R8CA 4QPKA 1NH2B 1EBOA 2Q67A 5EC2C 1M9NA 5CBFA 1SESA 3K03A 2R9IA 3CXCU 4QNHB 3AG4B 1YJNV 5L3BA 5LGUA 3ZMZA 2A9HA 2W0FC 1P4RA 3ZCCA 3OE7G 1QVGU 5CBGA 1IXMA 1OCOC 1SETA 2JIZG 1UJWB 2WLLB 3FB6C 3SJQC 3ABMC 5BZBA 1VQLV 2EILB 1K73W 5B3SC 3SYAA 5IYBO 3CC2V 1VQMV 1QR8A 4U7OA 3JCZA 4P9OA 4ASUG 3ZMVA 5DM6V 1N8RW 2DQ3A 1S77D 3CCUV 1MABG 2DWEC 4UVAA 1K4DC 4LCUC 1ROPA 1COWG 4MS2A 4TSFG 1VQ8V 4WFGA 2EIJB 2WLNA 3SPCA 3STLC 4RUEA 3ZMSA 1K92A 3LNMB 1W0KG 1GM8A 1Q82W 2WLIB 1ENVA 3CC7V 5LGTA 1AJQA 1R3KC 4JTAB 5B3SB 3JD1A 3AG1C 4R7CA 3VBBA 2IH3C 2WAMA 2M7WA 5LHIA 2JJ1G 4XDKA 3SYQA 3SPGA 2Y69C 3ASNC 5H6QA 2HJFC 2BOBC 4I9WA 3AG4C 1W2BU 3LDDA 5EBWC 3DGEA 4JASA 2LP7A 1GM7A 3D3IA 3ABTA 1K5QA 2P90A 2V7QG 1R3IC 1BHBA 1E1QG 4MVQA 5LHHA 3SPHA 3ABLC 3OR6C 4UXNA 1YHQV 3IC7A 5L3GA 3LDEA 2ITCC 2EIMB 1YJWV 1AI6A 1GMGA 3ZN1A 4GX0A 5EBLC 5J9PC 2ITDC 2P7TC 2QEXV 1VQ7V 5CA3A 4PDMA 5B1AC 1H38A 4MTXA 4H37A 4PDLA 5LHGA 2ZR2A 2OTLV 1G8MA 3ZRVA 1DF5A 4N21A 3ABLB 4MVUA 4RUFA 3ZJZA 3JD2A 2B1IA 2OCCB 5B1OA 1CEZA 2XASA 2YEVB 3DTUB 1PD3A 2WSSG 4MTOA 4GX2A 1NBMG 1ZWIC 2ZXWB 4FK5C 1DTOA 1DF4A 1KKDA 4MVOA 2DW4A 4JTCB 2JDIG 1KD1W 2EBOA 1V55C 4E2LA 1GKFA 3TK1A 2FTKA 4N23A 3SYOA 3ASOC 5L3DA 4PDRA 4FIPC 3E89A 3ABKC 4H33A 4JPRA 3ZRSA 4G28B 3UM7A 1OCCC 3OFNG 3AG3B 2XOKG 3M99B 3K9AA 4MT8A 4BIZA 4QJFB 3CCLV 5CBHA 3H01A 2B1GA 3K3WA 1R6NA 4XBFA 1GM9A 1J95A 5CN0A 3W7SA 1E79G 4BAYA 1VQ9V 1M90W 1WLEA 4MVSA 1JOYA 2X6AA 3IGAC 1GTOA 2X7RB 1VQ4V 1AI7A 3F7YC 4JTDB 4R6ZA 4PA3A 4MW8A 1MSWD 3OW2U 2XAGA 1CP9A 2IJHA 1S76D 1FXKA 2XAQA 3FB7C 5HFMA 1YTFD 3RVZA 1RPOA 2WLKA 4WFFA 1FS0G 4XDLA 2HLDG 4TT3G 3I55V 1FXKC 4TWKA 3RBZA 2PI5A 4F4LA 2BOCC 2JEXA 4WFAV 5KA6A 1H2GA 2WLHA 1B6QA 2KB1A 1FXVA 3K0GA 3ASOB 3B8NA 4WFEA 3G6EV 2LFSA 3K0DA 2ZD9A 3ZRXA 2Y48A 1QBZA 4JYCA 3MHHC 1Y66A 1K4CC 3QO8A 1K9MW 3EFFK 2DYSC 4X8AA 4BW5A 3W7UA 3E8FA 4G2KA 1NQTA 2GHYA 3SPJA 3CYOA 4GCZA 1PKXA 1DLBA 4RQFA 1I5XA 4L87A 3LDCA 2OCCC 2UXXA 4LBEC 4PA6A 3FKSG 4LC1A 1HWYA 3E8HA 2V1DA 3CCRV 4I5SA 3WG7B 1KC8W 2QM7A 3MHSC 3SYPA 4P2ZA 4JYBA 3W7WA 3JD0A 3OEHG 4MVZA 1NKDA 2EJRA 2IJJA 2JEUA 1YIJV 4BIUA 1MOFA 1AJPA 3QO7A 1SERA 2B5UA 2Q6AA 1K3EA 3QNEA 5LGNA 1OCZC 2WWWA 1BHAA 4QE7A 1JX9A 1QLEC 2HVKC 5IY5C 3LSQA 3CCQV 2EINB 3EHBB 1XL6A 2X6BA 1SZTA 1NH2D 4DO2A 3CMAV 2ZDIC 4WFBV 3E86A 3BY6A 4PA9A 3W7XA 2HVJC 4RAIA 1TUEB 3ZIAG 2X0LA 2UXNA 1KP2A 1OCRB 5IDJA 2IW5A 3G71V 3FYIB 2Z3YA 2XAFA 4PDVA 2EIKB 2HR3A 1PNLA 3QO5A 4PA7A 5KUKA 3BEHA 2AHZA 2W6IG 2WLLA 4DXWA 1Q81W 1SRYA 5KA5A 5FL7G 1AJNA 4KFMA 4J9YB 3ZRWB 2ATKC 3CP1A 3OR7C 1PL0A 1F51A 3ZMTA 4P30A 2IJIA 3CCVV 1KQSU 2A79B 4FPPA 1R3JC 3AG3C 2HFEC 3ABKB 3B8MA 4J9ZB 2H8PC 2EZOA 3GB7C 2DYRB 1H8EG 3HPLC 2QE7G 2YSUB 4WFHA 1QVFU 4WCEV 1K34A 3D36A 2IJKA 3T4DA 1S3JA 2XAJA 4JF3A 3AG1B 1OHHG 4P9PA 3FYEB 1JJ2U 3CD6V 3K06A 1NVPD 1QLNA 2WLMA 4MSWC 1VQ6V 3ABUA 2HKOA 5B1BB 3OMAB 2A0LA 1V54C 3MD0A 3CPWU 5L3FA 1V55B 5IYDO 1JQ0A 1EFRG 1VQNV 1BMFG 4QPJA 3ZMUA 1W0JG 2XNDG 3F5WC 1VQKV 1ORQC 4JAUA 2DQ0A 3W7TA 2HG5C 3OUFA 3VOUA 2IU3A 1YTFB 3E2EA 2JJ2G 2EZPA 3ZN0A 3IFXA 5L3CA 3K08A 4FJCC 3RW0A 1S72V 3CC4V 5IYCO 1FFTB 2F43G 5GW7A 1YITV 1GO3F 3OM3B 1JPXA 1PNMA 3CCEV 2EIMC 4PA4A 1AI5A 2X6CA 2CK3G 3WFVA 1M1KW 4CBCA 3RVYA 3HB3B 4UV9A 3ML0A 1MG1A 2NLJC 2OT5A 1F4NA 1WPXA 4MTFA 3PJSK 2WPDG 1NR7A 3OMIB 3T1CA 1FXKB 2ZDIA 3A0RA 2QTOA 1AI4A 2Z5UA 3F7VC 3ETEA 2C2AA 4GX5A 2YEVA 1YI2V 3E8GA 1V54B 1R6KA 4KUMA 4QIWF 4GX1A 5L3EA 1F4MA 2NNUA 4HYOA 2DYRC 3FB8C 1BL8A 1F23A 1L1FA 5E1AC 3OGCC 2ZQMA 4WF9V 2WLJA 5H9CA 3JD4A 1LNQA 1NJIW 2OTJV 1FXHA 1G4YB 1YSCA 1E1RG 1QR9A 4RO2A 3AG2C 3K79A 2AHYA 1K8AW 1AR1B 1I5YA 5B1NA 2EIKC 3LSSA 3T2MA 1VQ5V 1KECA 2Q69A 4HZ3A 5HFLA 1OCCB 4PELA 2EILC 1M57B 3R65A 5B1AB 2PI4A 1P7BA 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P30 A;  2JK5 C;  3STZ C;  1J95 A;  4P9O A;  3FB5 C;  4X89 A;  2A79 B;  4J9Z B;  1R3J C;  3AG3 C;  2HFE C;  2H8P C;  3GB7 C;  1XL4 A;  2DWE C;  5KUM A;  1M56 C;  1K4D C;  3HPL C;  4LCU C;  2IH1 C;  4MS2 A;  4MVS A;  5EBM C;  4WFG A;  2X6A A;  4WFH A;  2WLN A;  3IGA C;  3SPC A;  3STL C;  2ZXW C;  4RUE A;  2DWD C;  3F7Y C;  4G27 B;  3LNM B;  4JTD B;  2R9R B;  4MW3 A;  3K04 A;  4MW8 A;  4PA3 A;  4R6Z A;  3T4D A;  4P9P A;  4R50 A;  2WLI B;  3K06 A;  4UUJ C;  2WLM A;  4MSW C;  1R3K C;  4JTA B;  3FB7 C;  4OXS A;  5EK0 A;  3T4Z A;  3E8B A;  3RVZ A;  3AG1 C;  4R7C A;  2EIN C;  2WLK A;  5B1B C;  4MTG A;  4WFF A;  2A0L A;  4XDL A;  2IH3 C;  1V54 C;  1JVM A;  4TWK A;  4XDK A;  3RBZ A;  3SYQ A;  3SPG A;  2Y69 C;  3ASN C;  3TCU A;  4EKW A;  4F4L A;  2BOC C;  2HJF C;  2BOB C;  2WLH A;  3AG4 C;  3F5W C;  4I9W A;  2KB1 A;  3K0G A;  3LDD A;  1ORQ C;  5EBW C;  3SYC A;  4WFE A;  4X88 A;  2Q68 A;  2HG5 C;  3OUF A;  3K0D A;  3VOU A;  2ZD9 A;  1R3L C;  3X2Q C;  3IFX A;  1M57 C;  3K08 A;  3RW0 A;  1K4C C;  1R3I C;  3EFF K;  2DYS C;  4X8A A;  4BW5 A;  3E8F A;  4MVQ A;  3SPJ A;  3SPH A;  3OUS A;  3ABL C;  3OR6 C;  2EIM C;  3LDC A;  3LDE A;  4PA4 A;  2ITC C;  2OCC C;  2X6C A;  2EIJ C;  4GX0 A;  4LBE C;  5EBL C;  4PA6 A;  5J9P C;  2ITD C;  2P7T C;  4CBC A;  3E8H A;  4LP8 A;  3RVY A;  3UKM A;  3WG7 C;  1OCR C;  2NLJ C;  4PDM A;  3JYC A;  5B1A C;  4P2Z A;  3SYP A;  4H37 A;  4PDL A;  4MVZ A;  2K1E A;  4MTF A;  3PJS K;  3T1C A;  4MVR A;  3TET A;  2QTO A;  2Q6A A;  4MVM A;  3F7V C;  3LUT B;  1OCZ C;  4MVU A;  4RUF A;  1S5H C;  4GX5 A;  3SPI A;  4QE7 A;  2YEV A;  3ZJZ A;  3E83 A;  3E8G A;  1QLE C;  2HVK C;  4ZBM A;  5IY5 C;  4QE9 A;  3KG2 A;  4GX1 A;  1XL6 A;  2X6B A;  2WLI A;  4HYO A;  4MTO A;  4GX2 A;  2QKS A;  2DYR C;  3FB8 C;  1BL8 A;  5EC1 C;  3E86 A;  5E1A C;  1ZWI C;  3OGC C;  4PA9 A;  4XDJ A;  4R8C A;  2WLJ A;  2HVJ C;  4RAI A;  1KKD A;  2Q67 A;  4MVO A;  5EC2 C;  1LNQ A;  5BZB A;  4JTC B;  5CBF A;  1G4Y B;  3K03 A;  4RO2 A;  3AG2 C;  1V55 C;  2AHY A;  4DXW A;  4QNH B;  5B3S C;  3SYO A;  3ASO C;  4PDV A;  2A9H A;  2W0F C;  4PA7 A;  4PDR A;  5KUK A;  2EIK C;  3BEH A;  2AHZ A;  3ABK C;  2WLL A;  3E89 A;  4H33 A;  3T2M A;  4G28 B;  3UM7 A;  1OCC C;  3ZRS A;  4HZ3 A;  2Q69 A;  5CBG A;  4KFM A;  4J9Y B;  2ATK C;  1OCO C;  3OR7 C;  2EIL C;  2WLL B;  3FB6 C;  3R65 A;  3ABM C;  3SJQ C;  5CBH A;  1P7B A;  3SYA A; 
#chains in the Genus database with same CATH topology
 3HKD A;  3RN4 A;  2YIB A;  3STZ C;  4X89 A;  1HP8 A;  1RM1 B;  1XL4 A;  1YCI A;  4DUZ O;  3M7M X;  4ZHQ B;  4GKK O;  3GWO A;  2ZXW C;  3KZI Z;  4G27 B;  1XRE A;  4NYK A;  4FVM A;  2B9Z A;  5CMU A;  4DR1 O;  5B1B C;  5IWA O;  2FL4 A;  1IX9 A;  3MDS A;  4J11 A;  4X88 A;  2LFR A;  5IE9 A;  3AG2 B;  3OTO B;  1THZ A;  1EZJ A;  2DMX A;  1NR1 A;  3X2Q C;  3DSQ A;  3ZRW A;  3E22 A;  5C93 A;  1VEW A;  2LQT A;  2W6J G;  1S5J A;  3KKY A;  4IT5 A;  3IC9 A;  2GTS A;  3N2K A;  5IJ0 B;  4LP8 A;  3ETG A;  4Z1M G;  5BMV A;  3X2Q B;  5KHK A;  4O4L B;  1VF7 A;  3WB1 A;  4CC6 A;  1NVP B;  5JJE B;  2LJ2 A;  3TET A;  4FLT A;  1GK9 A;  1Q8I A;  1Q7Y W;  1S5H C;  3ETD A;  3HKC B;  2ZM6 B;  3AEI A;  2FB5 A;  4ZBM A;  5EYP A;  3P3P A;  2WLI A;  4ZKI A;  1H8H G;  3NXS A;  1SF9 A;  1M56 B;  1JA8 A;  3ABM B;  4YXW G;  4K35 A;  3O9O A;  4YY3 O;  2MW2 B;  1D5A A;  5JJN B;  3EVK A;  4UB6 Z;  2R9I A;  3JSN A;  4QNH B;  2A9H A;  1WN7 A;  2RDC A;  1IXM A;  1Q6I A;  1UFI A;  4O2A B;  1PL4 A;  2BTQ A;  1Y67 A;  5F2V O;  3ABM C;  1K73 W;  3ZS8 C;  3JCZ A;  4P9O A;  4ASU G;  2DQ3 A;  1XNQ O;  4CC5 A;  4B7E A;  1ROP A;  1COW G;  3ZHS A;  1VQ8 V;  1KYO F;  2WLN A;  4X64 B;  2BSK A;  2LW1 A;  4NVP A;  3T1H B;  3LNM B;  1W0K G;  1YF2 A;  2ETN A;  4ABM A;  3TGU H;  2ZNJ A;  3ETQ A;  4R7C A;  2XHB A;  4LF8 B;  2WAM A;  2JJ1 G;  4X9Q A;  4JI5 B;  4FLZ A;  5B5E Z;  3SPG A;  5H6Q A;  4LF5 O;  1QNM A;  3N27 A;  4H13 B;  1Y6X A;  1TUB B;  2IBZ H;  3DGE A;  3ABT A;  5DED A;  1I94 B;  1R3I C;  2ADP A;  1E1Q G;  1KUQ A;  1AR4 A;  4JI3 O;  2Q9L A;  3ABL C;  4UXN A;  2ITC C;  1YJW V;  1AI6 A;  1GMG A;  3ZN1 A;  1URF A;  3OTO O;  2ITD C;  2UUB O;  1XIL A;  3D8C A;  1AP6 A;  4HNA A;  2QEX V;  4IL6 Z;  4NXM B;  2AZ2 A;  2PYL A;  1DF5 A;  4WBN A;  3ABL B;  1ZL8 A;  4RUF A;  4DRX A;  2OCC B;  5IJ9 B;  1TVK A;  2WSS G;  4MTO A;  5LMU B;  4GX2 A;  3H1H H;  3S3X A;  4HNA B;  5EZY B;  4KHP B;  1GN6 A;  2ZXW B;  4FK5 C;  1XBL A;  3D36 C;  3VQY A;  1WA8 B;  1KD1 W;  4E2L A;  4LFB B;  4NTX A;  3SYO A;  3E89 A;  5LOV B;  2Q4P A;  3ZRS A;  4O4L A;  2YXY A;  5LA6 B;  2KSD A;  1GAX A;  1GN2 A;  2R9A A;  1NI8 A;  4XBF A;  1GM9 A;  2GTA A;  5CN0 A;  3W7S A;  5LXT B;  2N04 A;  4BAY A;  2KG7 B;  2E5L O;  2UUC O;  4MVS A;  2CUG A;  1NTZ H;  2X7R B;  1N34 B;  1AI7 A;  3F7Y C;  2JGD A;  4PA3 A;  4UCT A;  4FM0 A;  2IJH A;  1S76 D;  1FXK A;  1YTF D;  4WFF A;  4IIJ B;  2PI5 A;  4TUY B;  4F4L A;  1KB9 F;  5CB4 B;  1B6Q A;  2KB1 A;  1KBH A;  1QBZ A;  3LSU A;  2ODM A;  1Y66 A;  1K4C C;  2DYS C;  4X8A A;  4BW5 A;  1AB3 A;  4PJ0 Z;  1HNZ O;  4KHP O;  3LDC A;  4DR7 B;  4LC1 A;  1HWY A;  3CCR V;  2V1D A;  3BVO A;  3HKB B;  1KC8 W;  4NTY A;  1PP9 H;  4P2Z A;  1PV0 A;  3C90 A;  5LOV A;  1JFF B;  3JD0 A;  3SGI A;  2IJJ A;  2JEU A;  1YIJ V;  3QO7 A;  2QSA A;  2Q6A A;  1TUB A;  2A06 H;  1H2N A;  1BHA A;  4UCR A;  5JQG B;  1BS3 A;  4X1K B;  5JVD B;  4AQY B;  4DYL A;  3LSQ A;  3CCQ V;  1XL6 A;  3APO A;  4LFA B;  3UO2 A;  4JI1 B;  2A7W A;  4KL1 A;  3BY6 A;  3W7X A;  1WP7 A;  4RAI A;  1TUE B;  4EFB A;  3QG5 A;  1AIL A;  1ZL8 B;  2X0L A;  2UXN A;  2UU9 O;  4O4I A;  3FYI B;  3BHP A;  4PA7 A;  3QO5 A;  1SQP H;  4LNU B;  2AHZ A;  2W6I G;  5KA5 A;  3CRC A;  3OR7 C;  4HBN A;  3CCV V;  2VQE B;  3JAS B;  1FKA O;  1R3J C;  2L35 A;  1H8E G;  1FJG O;  1Q6U A;  1GN4 A;  1QVF U;  3CSX A;  2XAJ A;  1OHH G;  1JJ2 U;  1X4T A;  3F5T A;  1NVP D;  1QLN A;  2WLM A;  2F4V B;  1VQ6 V;  3ABU A;  2UU9 B;  5B1B B;  4CH6 A;  1IUR A;  2UUC B;  4J41 A;  1V54 C;  2F1M A;  1EM1 A;  1V55 B;  5GON A;  3L72 H;  1EFR G;  3S3W A;  1JFF A;  4QPJ A;  2XND G;  3BFR A;  2YS8 A;  3H9V A;  4O2B B;  4DV1 O;  3W7T A;  3OUF A;  3VOU A;  3JAM N;  4W4K A;  1XNR O;  1BGY H;  3L9D A;  5AG2 A;  3IFX A;  1P84 F;  3RW0 A;  3CC4 V;  3ZBH A;  5BMV B;  5KHJ A;  1FFT B;  4AQY O;  1ZX3 A;  5CA0 A;  3UT5 A;  1JJO A;  4FZ0 A;  4DR3 O;  4YJ3 A;  1PNM A;  3VQX A;  4PA4 A;  4TV8 A;  1NTK H;  4UCV A;  2ZE8 A;  1M1K W;  1XDC A;  2FML A;  3HB3 B;  1WNS A;  4B3S B;  2NLJ C;  1B06 A;  2OT5 A;  1PPJ H;  1WPX A;  4TUY A;  1FXK B;  1HR0 O;  1LUW A;  4CH3 A;  1RSO A;  4CH4 A;  1HNX B;  5EYP B;  4U3J B;  1M4U A;  4GX1 A;  3Q4H B;  4EFE A;  3N2K B;  2WLJ A;  4FFB B;  3WB0 A;  1FXH A;  4Z2W A;  1K8A W;  3ZHR A;  2EIK C;  4ZIB A;  4HZ3 A;  2Q69 A;  2R72 A;  4PEL A;  5J2U A;  2CGN A;  1P7B A;  2JK5 C;  1IXB A;  4NXN O;  3FB5 C;  4I0X A;  3SJB C;  3JAW A;  3ZHU A;  3P32 A;  2IH1 C;  4UVC A;  1PNK A;  5LYJ A;  4IHJ A;  3ICX A;  2DWD C;  2CH7 A;  2R9R B;  4MW3 A;  3K04 A;  1VQP V;  4QGP A;  4R50 A;  3ASN B;  4TV9 B;  5EIB D;  4UVB A;  4X1K A;  5EK0 A;  3E8B A;  1XMO O;  4MTG A;  1SKV A;  4X65 O;  2QM4 A;  2GSM B;  1K33 A;  1JVM A;  1R73 A;  3N2G A;  3UT5 B;  3TCU A;  1OCZ B;  4JI6 B;  1ZTE A;  5LP6 B;  2H94 A;  1ARO P;  2LGQ A;  2ZR3 A;  4GZR B;  1J5E O;  2QWQ B;  3ZX6 A;  2DE0 X;  3G4S V;  1O9H A;  3OEE G;  3EXA A;  2P67 A;  1OCO B;  3K57 A;  1KP3 A;  4C7U A;  5LP6 A;  3SR2 C;  3GVM A;  1I0H A;  3L73 H;  1QCE A;  2ARH A;  2KQX A;  2PGG A;  3K59 A;  2CTQ A;  4FMT A;  4JYA O;  1SC5 B;  3MAQ A;  5FLX N;  4MVR A;  1K7D A;  4HAM A;  4MVM A;  3LUT B;  1BSM A;  1S0V A;  1T5E A;  5B66 Z;  1R1B A;  4QE9 A;  3CRQ A;  1SS3 A;  4O2A A;  2QKS A;  4LFC B;  2D3O W;  5EC1 C;  4R8C A;  4GKJ O;  4QPK A;  2Q67 A;  1P7G A;  4NTW A;  5CBF A;  3K03 A;  3UQ8 A;  1YJN V;  4O4H A;  3ZMZ A;  4FM1 A;  3Q4H A;  4UFZ A;  1QVG U;  2QKA A;  2QWR B;  3FB6 C;  3SJQ C;  3UO3 A;  5IYB O;  4U7O A;  3ZMV A;  5DM6 V;  3BA8 A;  1ZAU A;  1MAB G;  5A2Q N;  1G1X B;  2YIB D;  4LCU C;  1J5E B;  3N2G B;  2EIJ B;  1L0L H;  1IBK B;  3BA9 A;  4DV6 O;  2WLI B;  3FD9 A;  3CC7 V;  5LGT A;  1R3K C;  4U3J A;  4B3R B;  3VBB A;  3DC6 A;  4CS4 A;  5D5P A;  3K9S A;  4BIO A;  2HJF C;  4I0X B;  1GN3 A;  4TQF A;  2LP7 A;  1GM7 A;  3D3I A;  5IJ0 A;  4B3T B;  2P90 A;  1IBM B;  2V7Q G;  3OTF A;  1UPG A;  5LHH A;  2XTA A;  2YUA A;  3OR6 C;  5L3G A;  3AG7 A;  3LDE A;  2EIM B;  5EBL C;  5J9P C;  3A2F A;  2HHH O;  1VQ7 V;  4PDM A;  3BCC H;  4I50 B;  4DV5 O;  4PDL A;  5LHG A;  2OTL V;  1N33 B;  4DV2 B;  4LF8 O;  1JMK C;  2B1I A;  4LF4 B;  1CEZ A;  2XAS A;  2YEV B;  1QHT A;  3FAV B;  1WA8 A;  1ZWI C;  2L6L A;  1DTO A;  1DF4 A;  1KKD A;  1R6T A;  4JI2 B;  4JTC B;  2G38 A;  1GKF A;  3CB2 A;  2CH7 B;  2FTK A;  4N23 A;  2CTW A;  4PDR A;  3ABK C;  4H33 A;  2CTR A;  4G28 B;  2EX3 A;  3M99 B;  3K9A A;  4IYH A;  4DV2 O;  1HDJ A;  2YIA A;  4GYC B;  2V4D A;  4B3R O;  2XUM A;  1VQ9 V;  1QU7 A;  2P22 C;  3DXR A;  3AK3 A;  3IGA C;  4I4T B;  3T1Y B;  3K5N A;  2CDY A;  4MW8 A;  4LF9 O;  1FPO A;  4GKK B;  3RVZ A;  4X1I B;  1F7Y A;  2WLK A;  4XDL A;  2HLD G;  4TT3 G;  2ZNI A;  4TWK A;  1VF6 A;  2CE4 A;  1BZK A;  3RWR D;  2BOC C;  2JEX A;  4WFA V;  5KA6 A;  2WLH A;  4ZOL A;  1IBL B;  1Z5V A;  1FXV A;  3K0G A;  2VQE O;  4WFE A;  3G6E V;  3K0D A;  3ZRX A;  4JYC A;  5KHG A;  1D2D A;  4IGG A;  1BQZ A;  3E8F A;  3SPJ A;  1PKX A;  5KMG B;  5J2T B;  2VWJ A;  3RGB A;  2Q7G A;  2QM7 A;  1PM9 A;  3BPZ A;  4JYB A;  3OEH G;  4MVZ A;  4BIU A;  1MOF A;  1K3E A;  2WWW A;  5KX5 A;  2AXT Z;  2HVK C;  1SQB H;  2EIN B;  3EHB B;  4I50 A;  4WFB V;  4J10 A;  4DR4 O;  2ILM A;  1L8D A;  1OCR B;  3HKE A;  5IDJ A;  2Z3Y A;  4RWU A;  2XAF A;  1N34 O;  2EIK B;  3CWB H;  3THO A;  4DXW A;  3WB2 A;  1AJN A;  3HKB A;  1PL0 A;  1F51 A;  3ZMT A;  4P30 A;  3K5M A;  5IJ9 A;  2FKX A;  1SA0 A;  1XUQ A;  4J9Z B;  1FD9 A;  2GUZ B;  2YC0 A;  1YXB A;  3B8M A;  2EZO A;  4AHC A;  2DYR B;  3HPL C;  4FZ1 A;  5E79 Z;  4WFH A;  3JAL B;  4WCE V;  1K34 A;  3D36 A;  5CB4 A;  1S3J A;  4JI8 B;  4K0K O;  4WBN B;  1CXZ B;  3CD6 V;  2ZIO A;  1IDS A;  4F6R B;  5CA1 B;  3OMA B;  4BW9 A;  5JH7 B;  1HNZ B;  3JSL A;  3RFR A;  1VQN V;  3JAW B;  1SQQ H;  1N32 B;  5IT9 N;  5CA0 B;  2JJ2 G;  2F95 B;  3ZN0 A;  5L3C A;  3K08 A;  2QKC A;  4FJC C;  1S72 V;  1FFX B;  2F43 G;  1MSD A;  4I7Z B;  4K3A A;  4Z1V A;  1MMM A;  3OM3 B;  2NN4 A;  4O4J B;  1I7F A;  2KG7 A;  3TXS A;  4DV7 O;  4JI7 O;  1AI5 A;  1WB7 A;  1NTM H;  4J7K A;  4OGQ B;  4CBC A;  4LF6 O;  3RVY A;  1VF5 B;  4LFC O;  4ZOL B;  1F4N A;  2P4V A;  4MTF A;  2WA3 A;  4CH5 A;  1NR7 A;  3OMI B;  2ZKO A;  4U3F H;  3CXH F;  2ZDI A;  2CTP A;  1AI4 A;  2Z5U A;  3F7V C;  3ETE A;  2DJV A;  2XT9 A;  1HW7 A;  2RNB A;  3E8G A;  2Q5Z A;  1V54 B;  3J7A U;  1R6K A;  4QIW F;  4DV1 B;  4YIP A;  4HYO A;  3FB8 C;  1BL8 A;  5E1A C;  1XNR B;  3FFQ A;  5A9G A;  5KMG A;  5H9C A;  1M5I A;  3JD4 A;  3DXR B;  1EN5 A;  4FLY A;  2Y4T A;  4AIL C;  4RO2 A;  3K79 A;  2AHY A;  4JV5 B;  5H5N A;  2JGD B;  4UCS A;  1AR1 B;  2ZIN A;  2PTM A;  3T2M A;  1VQ5 V;  1KEC A;  1Z5W A;  2Z0A A;  5HFL A;  1OCC B;  2LO1 A;  3H1J H;  1M57 B;  2F4V O;  4DW1 A;  2UXC O;  3I56 V;  2OWO A;  5LBQ A;  2F23 A;  2YDE A;  5IY5 B;  5JQG A;  3A8T A;  1RM1 C;  2Y69 B;  4DV3 O;  3RYF A;  5FPO A;  3T4Z A;  2EIN C;  1S5L Z;  2YXH A;  4OPA A;  1I08 A;  2QWP B;  4EKW A;  2ZM6 O;  2ZT9 B;  3JAS A;  2UXB O;  4JI4 B;  3CHX A;  1R3L C;  4GUN A;  5J2U B;  1M57 C;  2IU0 A;  5DEC A;  2DYS B;  3JAL A;  4DV0 O;  2LGW A;  3RYC A;  3RYH B;  3OAA G;  1JCH A;  2E74 B;  2EIJ C;  2PZS A;  1WB8 A;  3JAR B;  5DN6 G;  4D7S A;  1RPR A;  5GON B;  2VS0 A;  2BTQ B;  3IAY A;  3WG7 C;  1OCR C;  1VIB A;  1YEW A;  4JGS A;  4GT1 A;  1N0N A;  2UXB B;  3J81 N;  4B3T O;  3T1H O;  4LFA O;  3SPI A;  4KP4 A;  3E83 A;  1KMI Z;  1QLE B;  4J80 A;  3B77 A;  5EZY A;  2NR5 A;  1VQO V;  4ZHQ A;  1EBO A;  5EC2 C;  4JI5 O;  1SES A;  3AG4 B;  5FNV B;  1LR1 A;  5L3B A;  1L0N H;  5LGU A;  2W0F C;  4FM2 A;  3ZCC A;  2Q7H A;  2ZE6 A;  5IYZ A;  5CBG A;  1Y76 B;  1OCO C;  1SET A;  1UJW B;  3K5L A;  2WLL B;  1WP8 A;  1VQL V;  2EIL B;  4LF7 B;  3CC2 V;  1QR8 A;  4X1Y A;  5JJJ B;  4GLX A;  2JRI A;  2DWE C;  3LNN A;  1K4D C;  4WFG A;  5FPR A;  3TJT A;  2D2C B;  3SPC A;  5KHH A;  2ZCE A;  3G67 A;  1K92 A;  2RN9 A;  1B3Q A;  2UXD O;  1ENV A;  2GV9 A;  4JTA B;  4X20 A;  4E4E A;  1Q6H A;  2IH3 C;  5C8Y A;  2M7W A;  4B08 A;  5LHI A;  3ASN C;  5JVD A;  4I9W A;  3AG4 C;  1W2B U;  3LDD A;  3RYF B;  4DV3 B;  3L74 H;  1WJZ A;  1BHB A;  3AK2 A;  4JZ2 A;  3HKD B;  4MVQ A;  1Y74 B;  3H1L H;  1HNW O;  5D5Q A;  1YHQ V;  3IC7 A;  5ITZ B;  2Y0I A;  4B3S O;  3C3T A;  4GX0 A;  4X64 O;  5LYJ B;  1X59 A;  4NXM O;  2ZE7 A;  4PI2 A;  4JYY A;  5CA3 A;  2R70 A;  5B1A C;  1H38 A;  2QWN B;  4H37 A;  2ZR2 A;  1SQF A;  3ZRV A;  2BTO A;  4MVU A;  2GUZ A;  3ZJZ A;  3JD2 A;  3L70 H;  5B1O A;  4DK0 A;  1ZSP A;  4CS3 A;  1PD3 A;  3ZED A;  2DOS A;  3K58 A;  1NBM G;  1Q90 D;  1US6 A;  4Q6G A;  3VQW A;  2JDI G;  3B2E E;  1V55 C;  3JAK B;  3TK1 A;  2E3C A;  5L3D A;  4FIP C;  1EN6 A;  4LFB O;  4JPR A;  3UM7 A;  3AG3 B;  4BIZ A;  4MT8 A;  5LXT A;  4QJF B;  3CCL V;  1R6N A;  1N36 O;  4LF4 O;  1E79 G;  1WLE A;  4YJ2 B;  3CRR A;  2X6A A;  3R66 A;  4JTD B;  1NT2 B;  1XMO B;  2XAG A;  3NR7 A;  2BE3 A;  4LF7 O;  1AR5 A;  4IIJ A;  1M93 A;  2XAQ A;  3FB7 C;  5HFM A;  2VQF O;  1H2S B;  2EUL A;  1RSO B;  3RYH A;  3I55 V;  1HNW B;  1FXK C;  3CE2 A;  4YJ2 A;  2Y4U A;  3BAB A;  4X65 B;  4DV7 B;  4JI7 B;  4X1Y B;  1FAF A;  1N36 B;  3RT3 C;  2YIC A;  1VMG A;  2LFS A;  2ZD9 A;  5LA6 A;  3MHH C;  5IYZ B;  3QO8 A;  1K9M W;  1EN4 A;  3W7U A;  2AGA A;  4GCZ A;  5J2T A;  4RQF A;  1I5X A;  4JI0 B;  2UXX A;  4PA6 A;  3G80 A;  3JAK A;  4LF9 B;  3MHS C;  4O2B A;  3SYP A;  4AI8 A;  1WAZ A;  3W7W A;  2EJR A;  1Q3E A;  1VF6 C;  4FLU A;  1SER A;  2B5U A;  3QNE A;  5LGN A;  1OCZ C;  3UCS C;  4QE7 A;  3ZHQ A;  3KCY A;  1JX9 A;  4TV9 A;  1NH2 D;  1SZT A;  4DO2 A;  2GBO A;  1H2L A;  2ZDI C;  4DK1 A;  4PA9 A;  4JI4 O;  4X66 B;  3ZIA G;  1KP2 A;  5BR8 O;  3G71 V;  5GTI Z;  3T1Y O;  2HR3 A;  1PNL A;  1XMQ O;  3BEH A;  1Q81 W;  2WLL A;  1SRY A;  4O4I B;  5FL7 G;  4TV8 B;  4J7Z A;  4KFM A;  3ZRW B;  1D5N A;  3BRC A;  1QQC A;  4LNU A;  2VQF B;  2PF4 E;  2RQ6 A;  2IJI A;  3OGI B;  1KQS U;  4Q20 A;  3AG3 C;  3ABK B;  4ZI7 A;  3J80 N;  3GB7 C;  3FAV A;  3KCX A;  2DN9 A;  2QE7 G;  1TAE A;  3T4D A;  1JR9 A;  3K5O A;  4X20 B;  2Q8V A;  4YHH O;  5C8Y B;  3CRA A;  3CJH B;  2HKO A;  2A0L A;  5BY1 A;  3CPW U;  4O4J A;  5L3F A;  1RP3 B;  5IYD O;  1XHX A;  1W0J G;  3F5W C;  4UB8 Z;  1BT8 A;  2DQ0 A;  1I94 O;  2PY5 A;  1IZ3 A;  2HG5 C;  3L71 H;  2IU3 A;  2EZP A;  4IYI A;  2H3O A;  5IYC O;  1JPX A;  4K0K B;  2EIM C;  3QF7 A;  5KLV H;  2ZE5 A;  2UUA B;  2RCV A;  4A5U B;  3WFV A;  5FNV A;  4UV9 A;  3ML0 A;  1MG1 A;  4NB5 A;  3OD4 A;  1VP7 A;  2QDO A;  3PJS K;  2WPD G;  3T1C A;  4DUZ B;  3QTC A;  3TXQ A;  2QR4 A;  5BR8 B;  2Q0O C;  2QWO B;  2C2A A;  1O9G A;  4GX5 A;  2YEV A;  3B4S A;  1HR0 B;  1XMQ B;  3C3S A;  4DR2 B;  4KUM A;  4DUY B;  1NS1 A;  4DV0 B;  4DV4 B;  1F4M A;  1MNG A;  2DYR C;  4EEQ A;  1F23 A;  4EB6 A;  4DR5 O;  3OGC C;  2ZQM A;  1H2K A;  3AK1 A;  1LNQ A;  4ICG A;  1OV9 A;  2PUS A;  1YSC A;  1E1R G;  1QR9 A;  1EZV H;  3AG2 C;  3SDL A;  4F6E A;  4FFB A;  1I5Y A;  5B1N A;  2VWK A;  4OX9 O;  4I55 B;  3RYI A;  2Q73 A;  2W0X A;  3APQ A;  2E76 B;  3JCU Z;  2EIL C;  3R65 A;  2PI4 A;  3SJC C;  1XEQ A;  1Y4M A;  2P6J A;  1K97 A;  2JS3 A;  4U7N A;  2BCC H;  5KUM A;  2CGO A;  1M56 C;  4LH6 A;  3B09 A;  5EBM C;  2OCH A;  5JH7 A;  2Y0P A;  3L75 H;  3CME V;  2AW9 A;  2QA4 V;  1Q86 W;  3CRM A;  2N74 A;  3GWK C;  3CCM V;  4UUJ C;  1VAR A;  3VQV A;  3U10 A;  4OXS A;  1YJ9 V;  4DRX B;  2UUA O;  1MA1 A;  5LMN B;  4JAA A;  3H1I H;  2XAH A;  2ZIM A;  1TGO A;  4FLW A;  4X1I A;  4J7J A;  3SYC A;  3E35 A;  4LF6 B;  2Q68 A;  1SQV H;  1K5S A;  1KU9 A;  3D3Q A;  5K1X A;  3OUS A;  2EJ7 A;  1FYJ A;  2QM8 A;  4DR5 B;  4RQE A;  2JS5 A;  3CJH A;  2MK3 A;  3U0Z A;  2P5O A;  4DUY O;  4DV4 O;  4B3M O;  4JYA B;  3UKM A;  1YZB A;  1CPY A;  1A32 A;  5H6R A;  3JYC A;  1OZ0 A;  4TOI A;  2K1E A;  3P30 A;  3CCS V;  4D6T H;  3JD3 A;  5KX5 B;  5JCO A;  1KKC A;  4JV5 O;  3KG2 A;  4X62 B;  4DR4 B;  3CCJ V;  3OMN B;  1Y76 A;  4JAV A;  3BAA A;  3RYI B;  4CZZ A;  1SA0 B;  4UV8 A;  2K9P A;  4XDJ A;  1V9P A;  1NH2 B;  2YXL A;  3QVN A;  4K8X A;  1M9N A;  4KXR A;  2PYJ A;  3CXC U;  5TIS Z;  1P4R A;  1DGS A;  5LMN O;  3OE7 G;  5JWP A;  5IWA B;  4J42 A;  4LR3 A;  3SJA C;  2JIZ G;  3CEI A;  1N0J A;  4D7T A;  5BZB A;  5B3S C;  3SYA A;  2RJZ A;  1FJG B;  1VQM V;  3A0H Z;  1N8R W;  1ZLZ A;  2OIG A;  1B04 A;  4NKG B;  3CCU V;  1W59 A;  1S77 D;  4UVA A;  4X62 O;  4TSF G;  4MS2 A;  1MZE A;  3STL C;  4RUE A;  3ZMS A;  3PN1 A;  4EB6 B;  4F6R A;  1GM8 A;  2HJD A;  1Q82 W;  1IBK O;  1AJQ A;  5B3S B;  3JD1 A;  4JI8 O;  3AG1 C;  2UUB B;  2F93 B;  1TA8 A;  4XDK A;  4DW0 A;  3SYQ A;  3RYC B;  2Y69 C;  1GRJ A;  2BOB C;  3O65 A;  5EBW C;  4JAS A;  3U11 A;  1IVS A;  2P4K A;  4DR6 B;  1U97 A;  1K5Q A;  1YVW A;  5ITZ A;  1G6U A;  5LMU O;  1NU1 H;  3SPH A;  1XOU A;  3CS5 A;  2F66 C;  3ZHT A;  3B40 A;  3IJ4 A;  2P7T C;  2N05 A;  4MTX A;  4O4H B;  1G8M A;  4DV5 B;  5GTH Z;  4N21 A;  3JAT B;  2CAZ C;  2QGN A;  4B3M B;  3DTU B;  4BR6 A;  4JI0 O;  4BWA A;  1TVK B;  1SZX A;  4MVO A;  2DW4 A;  5K1P A;  2HP8 A;  2EBO A;  3H1K H;  1IBL O;  3ASO C;  4NR1 A;  5LP6 C;  1OCC C;  3OFN G;  2AZ0 A;  2XOK G;  2HHH B;  5CBH A;  3H01 A;  2B1G A;  3K3W A;  4PD4 F;  1J95 A;  4FLX A;  1M90 W;  1N33 O;  1JOY A;  4DR6 O;  2OIE A;  2QTS A;  4DR7 O;  1GTO A;  1VQ4 V;  2UXC B;  4R6Z A;  1MSW D;  3OW2 U;  1CP9 A;  1Q5O A;  2HEP A;  1BQ0 A;  1SQG A;  1AVM A;  5EIB C;  1MZF A;  1RPO A;  4B7K A;  1XNQ B;  1FS0 G;  1XI1 A;  4JI2 O;  3RBZ A;  2M6Y A;  4YIO A;  4H0L B;  5JCO C;  2YID A;  3G6B A;  2YI9 A;  1H2G A;  1H2M A;  3ASO B;  3B8N A;  1XHZ A;  2Y48 A;  1BE3 H;  3EFF K;  2BSK B;  4G2K A;  1SQX H;  1NQT A;  2GHY A;  4LF5 B;  3CYO A;  4JI1 O;  2E75 B;  1DLB A;  4L87 A;  4ZI7 B;  5CA1 A;  2Q0A A;  2OCC C;  5H2F Z;  4LBE C;  3FKS G;  1BCC H;  2KKW A;  3HR0 A;  3E8H A;  4JZG A;  2WA4 A;  4DR2 O;  4I5S A;  3WG7 B;  4PI0 A;  2JGU A;  4IHJ B;  2QJ1 A;  1NKD A;  1RFY A;  1GH6 A;  1AJP A;  4H44 B;  1QLE C;  5IY5 C;  4CS2 A;  4GKJ B;  2X6B A;  2E5L B;  3CMA V;  4I9Q A;  5KHI A;  3E86 A;  1WPB A;  4X66 O;  4UCU A;  2HVJ C;  1U96 A;  3JAT A;  3FX7 A;  1NZ6 A;  2IW5 A;  4OPH A;  4PDV A;  1P49 A;  5KUK A;  3HKC A;  2A3Q A;  3HKE B;  1IBM O;  4J9Y B;  2ATK C;  3CP1 A;  2ADQ B;  3M8A A;  4K8Z A;  4JI3 B;  2A79 B;  4FPP A;  2HFE C;  5BXZ A;  2H8P C;  4LWS B;  4DR1 B;  4YJ3 B;  2P06 A;  2LW7 A;  2YSU B;  3JAR A;  1LUV A;  3I5D A;  1XQ8 A;  2RMK B;  4YHH B;  4UCO A;  2IJK A;  4JF3 A;  3AG1 B;  4P9P A;  4DR3 B;  3FYE B;  3K06 A;  4MSW C;  5KAF Z;  4DV6 B;  1DK1 A;  3E22 B;  2FYU H;  1AP5 A;  3MD0 A;  5KAI Z;  1JQ0 A;  4L8J A;  1BMF G;  3ZMU A;  3ZHV A;  2VRZ A;  2YI8 A;  1VQK V;  1ORQ C;  4JAU A;  3DC5 A;  1Y74 A;  1Q43 A;  1YTF B;  1YDX A;  3E2E A;  1N32 O;  2O57 A;  1Z2G A;  1N4C A;  5GW7 A;  1YIT V;  1GO3 F;  4PHZ A;  3CCE V;  4LH7 A;  1FFX A;  4PV1 B;  2X6C A;  2CK3 G;  4I4T A;  3CX5 F;  2UXD B;  4W4L A;  5LL6 Y;  4FFK A;  4YY3 B;  3A0R A;  2Q7E A;  2QTO A;  3P3N A;  2JVD A;  3OT7 A;  2GDS A;  4NXN B;  1YI2 V;  1OJH A;  5L3E A;  2NNU A;  1HNX O;  1ZUQ A;  1L1F A;  4FLV A;  4WF9 V;  2OYQ A;  1NJI W;  2OTJ V;  1G4Y B;  2IM9 A;  4TQD A;  4LWS A;  4I55 A;  4OX9 B;  3WU2 Z;  3LSS A;  3A0B Z;  4JI6 O;  5B1A B; 
#chains in the Genus database with same CATH homology
 2P6J A;  2JK5 C;  1K97 A;  3STZ C;  4X89 A;  3FB5 C;  4U7N A;  1RM1 B;  1XL4 A;  5KUM A;  3P32 A;  3I56 V;  1M56 C;  5EBM C;  5LBQ A;  2IH1 C;  4UVC A;  1PNK A;  3CME V;  3GWO A;  2ZXW C;  2DWD C;  5IY5 B;  4G27 B;  2R9R B;  4MW3 A;  3K04 A;  2QA4 V;  1Q86 W;  1VQP V;  4R50 A;  1RM1 C;  3CCM V;  2Y69 B;  3ASN B;  4UUJ C;  4UVB A;  4OXS A;  5EK0 A;  3T4Z A;  3E8B A;  5CMU A;  1YJ9 V;  2EIN C;  5B1B C;  4MTG A;  2GSM B;  1K33 A;  2XAH A;  1JVM A;  1R73 A;  3TCU A;  4EKW A;  1OCZ B;  2H94 A;  3SYC A;  1ARO P;  3E35 A;  4X88 A;  2LFR A;  2Q68 A;  3AG2 B;  1THZ A;  2ZR3 A;  1EZJ A;  1R3L C;  1NR1 A;  3X2Q C;  3ZRW A;  5C93 A;  3G4S V;  1K5S A;  1M57 C;  2IU0 A;  2DYS B;  3OEE G;  2P67 A;  3OUS A;  2W6J G;  3OAA G;  1OCO B;  2QM8 A;  1JCH A;  4RQE A;  1KP3 A;  4Q20 A;  2MK3 A;  2EIJ C;  5DN6 G;  1RPR A;  4LP8 A;  3ETG A;  4Z1M G;  3UKM A;  1CPY A;  1QCE A;  1OCR C;  3WG7 C;  5H6R A;  3X2Q B;  3JYC A;  4JGS A;  4FMT A;  1OZ0 A;  4GT1 A;  2K1E A;  1NVP B;  3P30 A;  4MVR A;  3CCS V;  3JD3 A;  3TET A;  1K7D A;  1GK9 A;  4HAM A;  4MVM A;  3LUT B;  1Q7Y W;  1S5H C;  3ETD A;  3SPI A;  1S0V A;  4KP4 A;  3E83 A;  3AEI A;  4ZBM A;  1QLE B;  4QE9 A;  3KG2 A;  3B77 A;  2WLI A;  3OMN B;  1H8H G;  4ZKI A;  3CCJ V;  2QKS A;  3NXS A;  4JAV A;  1M56 B;  4CZZ A;  2D3O W;  5EC1 C;  3ABM B;  4YXW G;  1VQO V;  4UV8 A;  4XDJ A;  4R8C A;  4QPK A;  1NH2 B;  1EBO A;  2Q67 A;  5EC2 C;  1M9N A;  5CBF A;  1SES A;  3K03 A;  2R9I A;  3CXC U;  4QNH B;  3AG4 B;  1YJN V;  5L3B A;  5LGU A;  3ZMZ A;  2A9H A;  2W0F C;  1P4R A;  3ZCC A;  3OE7 G;  1QVG U;  5CBG A;  1IXM A;  1OCO C;  1SET A;  2JIZ G;  1UJW B;  2WLL B;  3FB6 C;  3SJQ C;  3ABM C;  5BZB A;  1VQL V;  2EIL B;  1K73 W;  5B3S C;  3SYA A;  5IYB O;  3CC2 V;  1VQM V;  1QR8 A;  4U7O A;  3JCZ A;  4P9O A;  4ASU G;  3ZMV A;  5DM6 V;  1N8R W;  2DQ3 A;  1S77 D;  3CCU V;  1MAB G;  2DWE C;  4UVA A;  1K4D C;  4LCU C;  1ROP A;  1COW G;  4MS2 A;  4TSF G;  1VQ8 V;  4WFG A;  2EIJ B;  2WLN A;  3SPC A;  3STL C;  4RUE A;  3ZMS A;  1K92 A;  3LNM B;  1W0K G;  1GM8 A;  1Q82 W;  2WLI B;  1ENV A;  3CC7 V;  5LGT A;  1AJQ A;  1R3K C;  4JTA B;  5B3S B;  3JD1 A;  3AG1 C;  4R7C A;  3VBB A;  2IH3 C;  2WAM A;  2M7W A;  5LHI A;  2JJ1 G;  4XDK A;  3SYQ A;  3SPG A;  2Y69 C;  3ASN C;  5H6Q A;  2HJF C;  2BOB C;  4I9W A;  3AG4 C;  1W2B U;  3LDD A;  5EBW C;  3DGE A;  4JAS A;  2LP7 A;  1GM7 A;  3D3I A;  3ABT A;  1K5Q A;  2P90 A;  2V7Q G;  1R3I C;  1BHB A;  1E1Q G;  4MVQ A;  5LHH A;  3SPH A;  3ABL C;  3OR6 C;  4UXN A;  1YHQ V;  3IC7 A;  5L3G A;  3LDE A;  2ITC C;  2EIM B;  1YJW V;  1AI6 A;  1GMG A;  3ZN1 A;  4GX0 A;  5EBL C;  5J9P C;  2ITD C;  2P7T C;  2QEX V;  1VQ7 V;  5CA3 A;  4PDM A;  5B1A C;  1H38 A;  4MTX A;  4H37 A;  4PDL A;  5LHG A;  2ZR2 A;  2OTL V;  1G8M A;  3ZRV A;  1DF5 A;  4N21 A;  3ABL B;  4MVU A;  4RUF A;  3ZJZ A;  3JD2 A;  2B1I A;  2OCC B;  5B1O A;  1CEZ A;  2XAS A;  2YEV B;  3DTU B;  1PD3 A;  2WSS G;  4MTO A;  4GX2 A;  1NBM G;  1ZWI C;  2ZXW B;  4FK5 C;  1DTO A;  1DF4 A;  1KKD A;  4MVO A;  2DW4 A;  4JTC B;  2JDI G;  1KD1 W;  2EBO A;  1V55 C;  4E2L A;  1GKF A;  3TK1 A;  2FTK A;  4N23 A;  3SYO A;  3ASO C;  5L3D A;  4PDR A;  4FIP C;  3E89 A;  3ABK C;  4H33 A;  4JPR A;  3ZRS A;  4G28 B;  3UM7 A;  1OCC C;  3OFN G;  3AG3 B;  2XOK G;  3M99 B;  3K9A A;  4MT8 A;  4BIZ A;  4QJF B;  3CCL V;  5CBH A;  3H01 A;  2B1G A;  3K3W A;  1R6N A;  4XBF A;  1GM9 A;  1J95 A;  5CN0 A;  3W7S A;  1E79 G;  4BAY A;  1VQ9 V;  1M90 W;  1WLE A;  4MVS A;  1JOY A;  2X6A A;  3IGA C;  1GTO A;  2X7R B;  1VQ4 V;  1AI7 A;  3F7Y C;  4JTD B;  4R6Z A;  4PA3 A;  4MW8 A;  1MSW D;  3OW2 U;  2XAG A;  1CP9 A;  2IJH A;  1S76 D;  1FXK A;  2XAQ A;  3FB7 C;  5HFM A;  1YTF D;  3RVZ A;  1RPO A;  2WLK A;  4WFF A;  1FS0 G;  4XDL A;  2HLD G;  4TT3 G;  3I55 V;  1FXK C;  4TWK A;  3RBZ A;  2PI5 A;  4F4L A;  2BOC C;  2JEX A;  4WFA V;  5KA6 A;  1H2G A;  2WLH A;  1B6Q A;  2KB1 A;  1FXV A;  3K0G A;  3ASO B;  3B8N A;  4WFE A;  3G6E V;  2LFS A;  3K0D A;  2ZD9 A;  3ZRX A;  2Y48 A;  1QBZ A;  4JYC A;  3MHH C;  1Y66 A;  1K4C C;  3QO8 A;  1K9M W;  3EFF K;  2DYS C;  4X8A A;  4BW5 A;  3W7U A;  3E8F A;  4G2K A;  1NQT A;  2GHY A;  3SPJ A;  3CYO A;  4GCZ A;  1PKX A;  1DLB A;  4RQF A;  1I5X A;  4L87 A;  3LDC A;  2OCC C;  2UXX A;  4LBE C;  4PA6 A;  3FKS G;  4LC1 A;  1HWY A;  3E8H A;  2V1D A;  3CCR V;  4I5S A;  3WG7 B;  1KC8 W;  2QM7 A;  3MHS C;  3SYP A;  4P2Z A;  4JYB A;  3W7W A;  3JD0 A;  3OEH G;  4MVZ A;  1NKD A;  2EJR A;  2IJJ A;  2JEU A;  1YIJ V;  4BIU A;  1MOF A;  1AJP A;  3QO7 A;  1SER A;  2B5U A;  2Q6A A;  1K3E A;  3QNE A;  5LGN A;  1OCZ C;  2WWW A;  1BHA A;  4QE7 A;  1JX9 A;  1QLE C;  2HVK C;  5IY5 C;  3LSQ A;  3CCQ V;  2EIN B;  3EHB B;  1XL6 A;  2X6B A;  1SZT A;  1NH2 D;  4DO2 A;  3CMA V;  2ZDI C;  4WFB V;  3E86 A;  3BY6 A;  4PA9 A;  3W7X A;  2HVJ C;  4RAI A;  1TUE B;  3ZIA G;  2X0L A;  2UXN A;  1KP2 A;  1OCR B;  5IDJ A;  2IW5 A;  3G71 V;  3FYI B;  2Z3Y A;  2XAF A;  4PDV A;  2EIK B;  2HR3 A;  1PNL A;  3QO5 A;  4PA7 A;  5KUK A;  3BEH A;  2AHZ A;  2W6I G;  2WLL A;  4DXW A;  1Q81 W;  1SRY A;  5KA5 A;  5FL7 G;  1AJN A;  4KFM A;  4J9Y B;  3ZRW B;  2ATK C;  3CP1 A;  3OR7 C;  1PL0 A;  1F51 A;  3ZMT A;  4P30 A;  2IJI A;  3CCV V;  1KQS U;  2A79 B;  4FPP A;  1R3J C;  3AG3 C;  2HFE C;  3ABK B;  3B8M A;  4J9Z B;  2H8P C;  2EZO A;  3GB7 C;  2DYR B;  1H8E G;  3HPL C;  2QE7 G;  2YSU B;  4WFH A;  1QVF U;  4WCE V;  1K34 A;  3D36 A;  2IJK A;  3T4D A;  1S3J A;  2XAJ A;  4JF3 A;  3AG1 B;  1OHH G;  4P9P A;  3FYE B;  1JJ2 U;  3CD6 V;  3K06 A;  1NVP D;  1QLN A;  2WLM A;  4MSW C;  1VQ6 V;  3ABU A;  2HKO A;  5B1B B;  3OMA B;  2A0L A;  1V54 C;  3MD0 A;  3CPW U;  5L3F A;  1V55 B;  5IYD O;  1JQ0 A;  1EFR G;  1VQN V;  1BMF G;  4QPJ A;  3ZMU A;  1W0J G;  2XND G;  3F5W C;  1VQK V;  1ORQ C;  4JAU A;  2DQ0 A;  3W7T A;  2HG5 C;  3OUF A;  3VOU A;  2IU3 A;  1YTF B;  3E2E A;  2JJ2 G;  2EZP A;  3ZN0 A;  3IFX A;  5L3C A;  3K08 A;  4FJC C;  3RW0 A;  1S72 V;  3CC4 V;  5IYC O;  1FFT B;  2F43 G;  5GW7 A;  1YIT V;  1GO3 F;  3OM3 B;  1JPX A;  1PNM A;  3CCE V;  2EIM C;  4PA4 A;  1AI5 A;  2X6C A;  2CK3 G;  3WFV A;  1M1K W;  4CBC A;  3RVY A;  3HB3 B;  4UV9 A;  3ML0 A;  1MG1 A;  2NLJ C;  2OT5 A;  1F4N A;  1WPX A;  4MTF A;  3PJS K;  2WPD G;  1NR7 A;  3OMI B;  3T1C A;  1FXK B;  2ZDI A;  3A0R A;  2QTO A;  1AI4 A;  2Z5U A;  3F7V C;  3ETE A;  2C2A A;  4GX5 A;  2YEV A;  1YI2 V;  3E8G A;  1V54 B;  1R6K A;  4KUM A;  4QIW F;  4GX1 A;  5L3E A;  1F4M A;  2NNU A;  4HYO A;  2DYR C;  3FB8 C;  1BL8 A;  1F23 A;  1L1F A;  5E1A C;  3OGC C;  2ZQM A;  4WF9 V;  2WLJ A;  5H9C A;  3JD4 A;  1LNQ A;  1NJI W;  2OTJ V;  1FXH A;  1G4Y B;  1YSC A;  1E1R G;  1QR9 A;  4RO2 A;  3AG2 C;  3K79 A;  2AHY A;  1K8A W;  1AR1 B;  1I5Y A;  5B1N A;  2EIK C;  3LSS A;  3T2M A;  1VQ5 V;  1KEC A;  2Q69 A;  4HZ3 A;  5HFL A;  1OCC B;  4PEL A;  2EIL C;  1M57 B;  3R65 A;  5B1A B;  2PI4 A;  1P7B A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...