2F4VO

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2f4vO00
4DR7O 1IBKO 1I94O 4DR6O 1FJGO 3J81N 1R6TA 4DV6O 4B3SO 4DR3O 1D2DA 4X64O 5BY1A 1HNWO 5A2QN 3M8AA 1HNXO 4X66O 1NS1A 2UUAO 2Z0AA 3SDLA 4GKJO 2ZM6O 4B3TO 4DV1O 5H5NA 5LMNO 1YZBA 4LF8O 2F4VO 5BXZA 5FLXN 4OX9O 5LL6Y 5IWAO 3J80N 2AGAA 3J7AU 1F7YA 2N74A 4NXMO 4NXNO 4GKKO 1G1XB 4JI4O 4LFCO 4DUYO 3T1HO 4JI2O 1FYJA 4X65O 4A5UB 1IBMO 4JI8O 4JI0O 4YHHO 3F5TA 4JV5O 1XEQA 2UXDO 1R1BA 4AQYO 4JI6O 4B3MO 4DR1O 3R66A 3OTOO 1XNQO 3T1YO 4X62O 2VQEO 1A32A 2FKXA 4DV2O 4LF5O 1N34O 2ZKOA 2UXCO 1HR0O 1XNRO 4K0KO 2UXBO 4JI3O 1N36O 1J5EO 4DR2O 4LFAO 4DV0O 1XMOO 1DK1A 3JAMN 4LF6O 4B3RO 4JI5O 1IBLO 5IT9N 2UUBO 2HHHO 4DV3O 1N33O 4JYAO 4DV5O 4LF9O 2DJVA 4OPHA 1XMQO 2LW7A 1FKAO 4DUZO 4LFBO 4YY3O 4DR5O 4OPAA 3RT3C 2UU9O 1X59A 4LF4O 2VQFO 4JI1O 2JRIA 1KUQA 3O65A 4DV7O 1HNZO 5LMUO 2DOSA 4LF7O 5BR8O 1AILA 1N32O 2UUCO 4DR4O 1AB3A 4JI7O 4DV4O 2E5LO 4KHPO
chains in the Genus database with same CATH superfamily
4MVMA 4PA9A 2QM8A 4QIWF 1O9HA 2R72A 4G2KA 3DXRA 2KG7A 5CA1A 3DSQA 3RBZA 1TVKA 1SQVH 3WG7C 4HAMA 3L71H 1SESA 1IX9A 1GO3F 3AG4C 2F4VO 2CUGA 2Q73A 4EFBA 2UXCB 3H1HH 3J80N 2CH7B 2WLMA 1N36B 1ENVA 3ZRWB 2JS5A 4B7KA 2NN4A 4PDMA 4N21A 3LSQA 5B1BC 2FYUH 4RQFA 2EJ7A 1N33B 2OCCB 1ZL8A 1KQSU 2OYQA 2DW4A 2L35A 3W7SA 4GYCB 4WFEA 5J2UB 1S76D 2DMXA 3W7TA 1QLEB 3ML0A 5L3BA 2FB5A 4FPPA 1BL8A 4LC1A 5LBQA 4DV7B 1WA8A 3ASOB 2UXCO 5KUMA 5LP6B 2KKWA 3ICXA 3RYFB 3UO3A 2WSSG 1N36O 1MMMA 1SRYA 3JAMN 4DR4B 4NB5A 4GKKB 1JX9A 2ITCC 3OUFA 3CWBH 1N33O 3HKBA 1L0NH 1JA8A 4LWSA 2OCCC 1GN6A 1NR7A 1XMQO 1KU9A 2W0XA 2OCHA 2GBOA 2O57A 3BABA 3QO8A 4DUZO 1W0JG 2IJJA 1QLEC 3BVOA 4JAAA 4OPAA 3RYCB 4B3TB 1H2NA 2EINB 2EIKC 5IE9A 3T1YB 4DV7O 5GW7A 3ASOC 1GH6A 4LNUA 3SYOA 1BSMA 4X1YA 1COWG 2ZCEA 1VQOV 4DR4O 4DV4O 4NR1A 1IBMB 4WFAV 5CB4B 3CB2A 4OGQB 4K3AA 4EFEA 3W7XA 3M8AA 1OJHA 2A7WA 1YJWV 4WBNA 5CA0A 4LF9B 1M5IA 4I50B 2DYRB 4B3TO 1P7BA 2VQEB 5L3FA 4JYBA 4I9QA 4MTFA 3K03A 4PA6A 2LO1A 1H8EG 4CC6A 5FNVA 3ZHQA 4WF9V 4PHZA 2CDYA 5JVDB 2OIGA 4FZ0A 4UV9A 1MOFA 1RPOA 1YITV 2LP7A 3QTCA 3O9OA 1IBMO 2CK3G 1K5QA 4BAYA 4ZHQB 1R6KA 4MSWC 4CH5A 1DGSA 3APQA 2K1EA 1RSOB 3LDEA 2M7WA 4HBNA 1HNWB 3TETA 1SZXA 2VQEO 3IGAC 4R6ZA 4F6RA 1HNZB 5E79Z 5LMUB 3ZS8C 5IYBO 1F23A 1XBLA 3SR2C 5BR8B 1PPJH 5IT9N 2MK3A 4UCSA 1J95A 4JAUA 1HNXB 3L9DA 4L8JA 2V4DA 2HEPA 5LHHA 2ZNJA 2ZE8A 5B3SC 3G67A 1FD9A 1GN3A 1SF9A 4MVSA 2Y69B 1RM1B 3JASA 1HNZO 2ODMA 1MNGA 5LMUO 4QPJA 2Q67A 3SYCA 1FXHA 1BHBA 5BR8O 3QF7A 4ZI7A 2NR5A 2HP8A 3OT7A 4OXSA 3G80A 1XMOB 4JV5B 5CN0A 1D2DA 2A0LA 2HHHB 2QA4V 1HNXO 3ZRXA 3JATB 2ATKC 1YF2A 3SDLA 2RCVA 1K73W 5BXZA 4YY3B 3AEIA 2ZE6A 2ZINA 3PN1A 1KP2A 1QQCA 4JI3B 5HFMA 5EC1C 1TAEA 3ASNC 3M99B 1WJZA 3RYIB 4IIJB 1SQQH 3OFNG 2ITDC 3CRRA 4JV5O 1V55B 3LNNA 2WLHA 2HKOA 1Q81W 3X2QC 1F4MA 1AP6A 1VMGA 4FMTA 1AI5A 1SA0A 1N8RW 3E8HA 2HVKC 3FYEB 4LF4B 4MW8A 5K1PA 1BCCH 2N04A 3M7MX 2WLIB 1Y76A 1AJQA 3KCYA 3ZHUA 3B09A 4JI3O 1K33A 2QTOA 4DR2O 1VIBA 5EBLC 2A79B 1IBKB 3BY6A 3JALB 1SQPH 4MW3A 4H33A 3UO2A 1KMIZ 1NI8A 2CTRA 4UCTA 3JSNA 3E2EA 1CXZB 1FXKC 2XASA 5KX5B 3CJHB 4LF4O 4H0LB 4TSFG 1QHTA 5CBHA 3UT5A 4OX9B 1KC8W 3JYCA 4UVCA 1PL0A 3MHHC 4NXNB 3LUTB 2K9PA 4IYHA 3JD4A 2H94A 1Q6IA 4RUFA 4GX1A 4YHHB 3G6BA 4TOIA 1IBKO 2Q6AA 2RMKB 1KYOF 1CPYA 1BE3H 3FB6C 3WB1A 4WFFA 4J7JA 1KKDA 5LXTA 5AG2A 1YJ9V 2HJDA 4JZ2A 5LOVA 3E8GA 3K08A 4NTXA 4OX9O 3ABMB 1SQXH 4H13B 2A06H 1H2GA 4NXNO 4ZBMA 1YTFB 3RFRA 1AI6A 4PDRA 5CBGA 4B3RB 2GDSA 1EZVH 5LA6A 3BFRA 5A9GA 2RQ6A 4LP8A 5LYJA 3VQVA 4YHHO 3AG2B 2BCCH 3E89A 2YXHA 1JMKC 2Q7HA 5C8YB 1V54B 3C3TA 1JPXA 2WLKA 3L72H 2XAJA 4U3JA 1WPBA 4FK5C 1XDCA 1S5LZ 4QE7A 5BMVB 3ABMC 4TV9B 1AR4A 2OIEA 4K35A 4B3RO 2VS0A 2UUCB 2QEXV 5D5PA 2XUMA 1QNMA 4QPKA 1EN4A 3T1CA 3EVKA 4ZKIA 3AG2C 2CGNA 2JEUA 3E8FA 4O4JB 1V54C 2ZT9B 3TGUH 3T4DA 1EZJA 4X20A 1G4YB 1GM8A 1EM1A 3ETGA 2P90A 2E3CA 2OTJV 1ZLZA 4RAIA 4RUEA 5KMGB 1N32O 2UUCO 4UCVA 1IXMA 2Y4UA 3QVNA 4JI8B 3BEHA 1AVMA 2GV9A 3E86A 3KG2A 1Q6UA 1I08A 4CS2A 4QNHB 4DYLA 2ZIMA 3HKCB 4H44B 1OCOB 1VQ7V 1SS3A 4I7ZB 3CCRV 5KHJA 5KAFZ 1YSCA 2UXBB 3ABKC 3RN4A 3C3SA 3OEEG 4DV0B 4B7EA 1M57C 3L73H 1PNKA 1VQPV 4JI8O 3F5TA 4U7NA 1GMGA 4TV8A 3E22B 3K5LA 2GTAA 2PTMA 1S77D 1Q6HA 2Q5ZA 4B3MO 1I94B 1BS3A 3CCUV 1M90W 2Y48A 4DK1A 3EHBB 4HZ3A 3VQXA 2Q4PA 3FYIB 2AW9A 4J7ZA 3CMEV 1XUQA 1LR1A 2QJ1A 5HFLA 1JFFB 2ARHA 4FLUA 4LF7B 2UXBO 1P49A 4FLTA 4DV0O 3KZIZ 4DRXB 3H1LH 1YVWA 4JI2B 4B3SB 3CRQA 4PA4A 1MZEA 1SERA 2YIAA 3K79A 5KHHA 3U11A 2P22C 3WFVA 1FKAO 3A8TA 4EB6A 3OUSA 1Y66A 4JAVA 4DXWA 1PNMA 4NKGB 1YCIA 2R9RB 5J2UA 1N0JA 3ZMTA 4FLVA 1I5XA 5IY5C 1B06A 5LGUA 4LF7O 3WB2A 3LSSA 2CTPA 1AB3A 4UCRA 5LP6A 1OCCC 3JCZA 2IJKA 3RYFA 4B3SO 2YEVB 4UFZA 3K58A 3D36C 3ABLB 4LH7A 4FFBB 4FLXA 2ZQMA 3DGEA 3N2GA 3A0BZ 3H1JH 3ZJZA 1K34A 3OR6C 5DM6V 3CXCU 3H01A 5B1BB 2JJ1G 3RYCA 5JCOA 1FPOA 2XHBA 4X65O 4A5UB 5JJEB 1D5AA 4JTAB 4JI0O 2JGUA 5IYZB 3HKDB 4JYAB 1H2KA 2P67A 4X1IB 2HR3A 2IU3A 2DQ3A 4JI6O 1ORQC 3ABLC 3W7UA 1PL4A 1L8DA 2QDOA 2YSUB 5CB4A 5JQGB 2Q7GA 3DC6A 3QO7A 3K5MA 4DK0A 1F4NA 3N2KA 1SQBH 5CA3A 5EIBC 5EBWC 4I50A 1AI7A 2YIDA 1P84F 3BAAA 1NVPB 4K0KO 4O4LB 2QR4A 5IJ9A 3IC9A 5IWAB 4CH3A 2WWWA 3JD1A 1WP8A 2LJ2A 1Q7YW 5JVDA 4JYAO 5L3EA 1Q82W 4O4HB 2EIKB 2H8PC 1W2BU 4RWUA 2VRZA 3U0ZA 3EXAA 4ZHQA 5J9PC 3MDSA 3CYOA 1JR9A 1NQTA 1V9PA 5LGTA 1NZ6A 1RSOA 2BOBC 1W59A 2HFEC 2W6JG 3ZN1A 3NR7A 4JI4B 4DUYB 4BIZA 3E83A 2Q8VA 2P6JA 1GRJA 2Z5UA 3K9SA 3PJSK 1X4TA 1QVGU 1Q8IA 3CCVV 1AR5A 5BY1A 2AXTZ 4Q20A 2CAZC 2LGWA 5GTIZ 2ZDIC 4IL6Z 2LW1A 1H2SB 3HPLC 4O2BA 1P7GA 5JH7B 4DR5B 1GAXA 1WLEA 3ZHTA 2JVDA 4GKKO 3OGIB 2X0LA 4PJ0Z 2WLLA 4JI4O 4DUYO 3BHPA 3I5DA 4PA3A 4X1KA 4WCEV 1Y74A 2RN9A 4FIPC 2QTSA 1S3JA 4O2AA 3DXRB 1S72V 5CA1B 1TVKB 3LDDA 4Z1MG 1H38A 3T1YO 3CEIA 3K9AA 1QBZA 3SGIA 1E79G 1FS0G 3UQ8A 4CBCA 4PI0A 2EULA 3RVYA 5BZBA 1WP7A 2BSKB 4IT5A 1QR9A 2ZD9A 1O9GA 2IJHA 5B3SB 4DR3B 4LF9O 5EZYA 3IJ4A 5LGNA 3SPHA 3OE7G 3S3WA 1Z5WA 3RYIA 4BWAA 1VQMV 2IW5A 2PI5A 4KXRA 4JTCB 4FFKA 3RVZA 4DO2A 1VQ5V 2KQXA 3CCEV 1K4CC 4ZOLA 4RO2A 2IBZH 3CCQV 4TWKA 3RWRD 4GLXA 3HKBB 2AZ2A 3OAAG 4LWSB 3F5WC 3BPZA 2WLIA 1LNQA 4P2ZA 4X8AA 4O4IB 4DR3O 4U3FH 2UXDB 1HNWO 5KAIZ 4J9ZB 1NS1A 3BA9A 1UPGA 1GK9A 1AJNA 3JALA 1XQ8A 4DV2B 3ASNB 4LNUB 4IHJB 1N34B 3D8CA 4BW5A 1FAFA 1XI1A 2V7QG 3B2EE 3CP1A 2VQFB 3SPJA 3CJHA 5KX5A 1Q86W 3X2QB 1SETA 3A0RA 2UUBB 4L87A 1THZA 3ETDA 3FD9A 2UXDO 5B66Z 4WBNB 2B1IA 3F7VC 1VQKV 4DV6B 2GUZA 5LHGA 4IGGA 3L74H 1SKVA 2HJFC 5KLVH 4DV2O 1MZFA 3FKSG 1N34O 2QKAA 4EKWA 1K7DA 2HVJC 1DF4A 1OCZB 3ZMUA 4UVBA 1YDXA 2PGGA 3CS5A 3Q4HB 5FPOA 1XMOO 1M56C 1R3IC 2M6YA 1AR1B 2UUBO 1VP7A 5TISZ 1JQ0A 2HHHO 3T1HB 4W4KA 3SJBC 2W0FC 4WFGA 1VQ8V 1FXKB 2R9IA 4GT1A 4X66B 1TA8A 1VQ6V 2UUAB 3AG3C 2P5OA 4YY3O 4F6RB 1KD1W 4Q6GA 1XOUA 4P30A 4TUYB 1M4UA 4DV1B 4UUJC 3SYQA 1KUQA 1BMFG 2EZPA 2Q68A 1IVSA 4FVMA 1YXBA 1YTFD 5C8YA 3CD6V 1OCZC 1W0KG 4LFCB 4MS2A 3H1KH 2B1GA 5H6QA 1YEWA 2JS3A 1TUBB 5BMVA 1T5EA 4LFAB 5EYPA 5KA6A 3I56V 4TV9A 3P32A 4JI5B 2YDEA 2F95B 4I4TB 4X66O 4HYOA 2UUAO 3JAKB 3HR0A 3U10A 3JASB 4DV1O 1K3EA 5H5NA 2WLNA 2JGDB 4R8CA 4K8XA 4I0XB 1SC5B 2BTQB 4O4JA 3I55V 1G1XB 4LFCO 1BQ0A 1BGYH 2YI8A 1WPXA 1NTZH 1GTOA 1RPRA 2PUSA 1VF6A 1OCRB 2PF4E 2C2AA 5DECA 2V1DA 5B1NA 3DTUB 1S5JA 1QU7A 1GM9A 1OZ0A 3L75H 1B04A 4JGSA 1VQ4V 1WB8A 1IZ3A 1Z5VA 4YJ3A 4CS4A 4HNAB 5B1AB 1NH2B 1PP9H 2WA4A 1FXVA 2LFRA 2FTKA 4JI7B 1EN6A 1R73A 1QVFU 1OCRC 4KUMA 4OPHA 3SYAA 4YJ2A 3B40A 3JSLA 3CX5F 5KHKA 5DEDA 2PY5A 4ZIBA 1PNLA 3K5NA 2CE4A 3IFXA 3JARB 5B1OA 4DR1B 2EBOA 2RDCA 3ZMSA 2GHYA 2VWKA 5IYDO 3O65A 3SPGA 4X62B 1Y76B 2Z3YA 2E75B 5B1AC 3T4ZA 2IJIA 4JI7O 2FMLA 1I0HA 1L1FA 3CCLV 1B6QA 2EIJC 3F7YC 4WFHA 4TQDA 3JAWB 2PYLA 5JJNB 2ETNA 4DRXA 1ZWIC 1VARA 1PM9A 4YXWG 3CC7V 4BIOA 4FM0A 4CH6A 3UT5B 2YC0A 3ABKB 2DN9A 4E2LA 3VQWA 3JD3A 1M57B 5L3GA 1D5NA 4UXNA 2YUAA 1J5EB 3CSXA 5EC2C 4D6TH 1FYJA 2P7TC 2G38A 2BTOA 4DV3B 2DE0X 4AI8A 5ITZA 1AJPA 2LFSA 1DF5A 2ZIOA 4X64B 3MHSC 2YEVA 2Q69A 4D7TA 4UCUA 5IJ0A 4JI1B 4MTXA 1KBHA 3ZCCA 4FFBA 1GM7A 5JWPA 3SPIA 3SJQC 2LGQA 1N4CA 1ROPA 2JEXA 1J5EO 5LYJB 1DK1A 2WPDG 3RW0A 1SQGA 4DV3O 2ZR2A 4ABMA 5H6RA 4G28B 4QE9A 3SJCC 4J7KA 3LSUA 2XAHA 3AG1B 3HKDA 5IY5B 1BQZA 1I5YA 4IYIA 4X1IA 4LF8B 1DTOA 4FZ1A 4JI1O 2MW2B 4WFBV 2JRIA 3B77A 3E35A 1JOYA 1I7FA 3GB7C 5C93A 2DOSA 1OCCB 3RYHB 2CH7A 4CH4A 3ZRWA 1S5HC 1FFXB 1I94O 1G8MA 2F93B 4JTDB 2EIMC 4AQYB 2RJZA 5DN6G 4N23A 4FLWA 3THOA 3ZHVA 3ZRSA 2Q9LA 3P3NA 4XDKA 1NR1A 3OGCC 3BCCH 4LF8O 3AG1C 4LFBB 2DYSC 3OTFA 4O4HA 1DLBA 2VWJA 1NVPD 1E1QG 3HKEB 2X6BA 2DWEC 2N74A 4P9PA 2AZ0A 4JF3A 4DW1A 2IH1C 4GUNA 2PYJA 4CZZA 2JK5C 4JI2O 2QWQB 3OD4A 3K5OA 2P06A 1WB7A 4UV8A 4DV5B 2WAMA 4AQYO 2ZNIA 1ZSPA 2Y0PA 4I55B 1G6UA 2UXXA 2ILMA 1SZTA 2P4VA 2Q0OC 4NYKA 3G4SV 1XL6A 3K04A 3QG5A 5JH7A 4FM2A 1NU1H 2JJ2G 2CGOA 3NXSA 4B08A 4TV8B 3GWOA 3KCXA 4MTGA 4UB6Z 4QJFB 4DV5O 1PD3A 5KA5A 1H2MA 2LW7A 1XHXA 1Q43A 2EILB 3RT3C 1ZX3A 5LMNB 5J2TB 3OMNB 4BW9A 2QE7G 5CBFA 1RFYA 4I9WA 3CC4V 4KFMA 3BRCA 1K92A 2XAGA 2BSKA 4EB6B 3ZN0A 1M93A 2R70A 2R9AA 1XMQB 3EFFK 3ZBHA 2EILC 5LMNO 4Z2WA 4DUZB 4PV1B 4MT8A 4E4EA 1OV9A 5FLXN 4NTYA 1WAZA 4MVUA 1MG1A 3FAVB 5IWAO 3J7AU 5GTHZ 1URFA 4ASUG 4J9YB 1LUVA 2EZOA 3D3QA 2D2CB 2XOKG 2GTSA 3FB7C 3CE2A 5GONB 1IBLB 4JYYA 1ZAUA 2KSDA 4GX5A 2ZXWB 1PKXA 1R1BA 1VF5B 4DV4B 4PELA 3TXSA 2IH3C 2OWOA 4PI2A 1U97A 3CRAA 3ABTA 3N2GB 1NTMH 2RNBA 3WB0A 1QR8A 3JD0A 2LQTA 1Q90D 1Q3EA 4O4IA 1LUWA 2ZKOA 2A9HA 1ZUQA 4UVAA 3E8BA 1JCHA 3BA8A 1N0NA 1MABG 2KG7B 4IHJA 1AROP 1IBLO 5LP6C 5FPRA 4LCUC 1FJGB 4DR6B 1WNSA 1R6NA 3MAQA 2ZXWC 5EK0A 3TJTA 1KECA 5L3DA 4DR5O 4NVPA 4YIOA 3N2KB 3JATA 1FFTB 2Y0IA 3QO5A 1EN5A 3CCMV 5IJ9B 1B3QA 1ZL8B 5JCOC 2EINC 3VOUA 1SQFA 2F66C 3IC7A 1GKFA 5B5EZ 1F51A 1M9NA 4G27B 2F1MA 1NJIW 1FJGO 4DR6O 2BOCC 1R6TA 4X9QA 1NKDA 3Q4HA 4IIJA 1WA8B 3CCSV 2HG5C 1UJWB 1NTKH 1FXKA 1Q5OA 4LF5B 3B8NA 3AK3A 2IU0A 2QM4A 1Y4MA 4PDVA 3S3XA 2DYRC 2AGAA 2NLJC 3CHXA 1XNRB 3TXQA 4TUYA 2B9ZA 2F43G 3FB8C 1U96A 4MVQA 3B4SA 5KUKA 2PZSA 1R3LC 2XAFA 2IM9A 1KB9F 1TUBA 4QGPA 4X1YB 4O2BB 3SJAC 1XHZA 3AK1A 2GSMB 4LF5O 4NTWA 4I4TA 1M56B 3JAKA 3CXHF 1K5SA 2WLLB 1VF7A 4MVOA 1XNRO 2DQ0A 4X1KB 3CCJV 1BT8A 2NNUA 1Y74B 2JGDA 4O2AB 3H1IH 5CA0B 2YICA 3HB3B 3P30A 3AG3B 4DR7B 4I0XA 4RQEA 1YI2V 2BTQA 5JJJB 2WLJA 4XBFA 3FFQA 5FNVB 1GN4A 2ZM6B 1X59A 3OEHG 2H3OA 4J42A 2VQFO 3UKMA 1UFIA 3ZMVA 2JIZG 1R3KC 2Y69C 1RM1C 2XNDG 1AILA 3JCUZ 1P4RA 4LBEC 2EJRA 5EZYB 4HNAA 4DR2B 4DR7O 4DV6O 2W6IG 4KL1A 4JPRA 2E76B 1Z2GA 1HWYA 4FLZA 1KKCA 1BZKA 2ZE7A 3ZMZA 3K57A 2ZM6O 5FL7G 2YS8A 2QGNA 2XTAA 3L70H 3CMAV 1K9MW 1YHQV 1NH2D 4YIPA 3K3WA 4ZOLB 4U7OA 1IURA 1HP8A 1F7YA 1HR0B 1JJOA 3JARA 3VQYA 3T1HO 3SYPA 2X7RB 2PI4A 2D3OW 1IDSA 2B5UA 3CC2V 4JYCA 3VBBA 2OTLV 3ETEA 3R66A 2A3QA 1VQNV 3JAWA 1V55C 2UU9B 2X6CA 1A32A 4GCZA 4ZI7B 1AP5A 3RGBA 1TGOA 2CTQA 3P3PA 4TQFA 1HR0O 1RP3B 3AK2A 4LFAO 3C90A 1MA1A 4JI5O 2E5LB 5KMGA 4J10A 1EFRG 4AILC 3STZC 5IYCO 4JASA 2BE3A 2GUZB 3DC5A 1GN2A 4GX2A 1JVMA 2UU9O 4F4LA 1E1RG 1XREA 4C7UA 3HKCA 2Y4TA 1BHAA 1VQLV 2EIJB 3FX7A 4X88A 4DW0A 2QWPB 1ZTEA 5F2VO 1HDJA 3TCUA 3ZHRA 5LHIA 2E5LO 2QSAA 5E1AC 3APOA 4GX0A 1SA0B 2UXNA 3J81N 4FLYA 1NT2B 5L3CA 5A2QN 1YJNV 3KKYA 4XDJA 2Q7EA 4FJCC 3E22A 3OTOB 2Z0AA 3D3IA 1MSDA 2OT5A 1YZBA 3QNEA 3ZX6A 2YXYA 1WN7A 4GZRB 4BIUA 3TK1A 4CC5A 4P9OA 4LF6B 3R65A 1JFFA 5D5QA 3GVMA 5EYPB 1L0LH 1YIJV 1H8HG 4ICGA 4D7SA 1PV0A 3CRMA 1N32B 3K06A 3K0DA 3RYHA 4PA7A 3D36A 4DR1O 4CS3A 3OTOO 5K1XA 1CP9A 4X62O 1FFXA 3LDCA 5IDJA 2QWOB 3OM3B 2FKXA 2ZR3A 3STLC 4X89A 4MVRA 2WA3A 4H37A 5H9CA 3UM7A 4LF6O 4W4LA 1EBOA 5LXTB 5H2FZ 3HKEA 2CTWA 4K8ZA 4PD4F 1QLNA 1XL4A 1H2LA 5LOVB 3ZEDA 1K97A 4GKJB 2YI9A 4B3MB 2AHYA 1VEWA 4YJ3B 5LA6B 2FL4A 1Y6XA 2XT9A 2QKCA 2ADPA 3JD2A 4I55A 1TUEB 2YXLA 4UCOA 4XDLA 4NXMB 1QCEA 1MSWD 2QKSA 2QWRB 4R7CA 2EIMB 4LH6A 4MVZA 4TT3G 3ZIAG 1VF6C 5KHIA 4YJ2B 3ETQA 2Q0AA 1K4DC 2ZE5A 3A2FA 1NBMG 4X64O 4U3JB 5IYZA 5EIBD 3G71V 2DYSB 4LR3A 3SPCA 3W7WA 2X6AA 3UCSC 1XNQB 2YIBA 4GKJO 1HW7A 3LNMB 1R3JC 4UB8Z 1AI4A 3GWKC 4KP4A 5JQGA 2XAQA 2F23A 1VQ9V 4Z1VA 3N27A 5LL6Y 4J80A 3ABUA 4NXMO 5CMUA 1OCOC 2YIBD 1JJ2U 3H9VA 2E74B 5J2TA 3K0GA 4O4LA 4BR6A 3ZRVA 1S0VA 3FB5C 4R50A 2KB1A 3T2MA 1XEQA 3OW2U 1OHHG 4X20B 2AHZA 2L6LA 4F6EA 1XNQO 1IXBA 2ZDIA 3CRCA 2ADQB 5KHGA 3MD0A 4MTOA 4FM1A 3IAYA 3B8MA 2P4KA 2QWNB 3WU2Z 1M1KW 4KHPB 3AG7A 5ITZB 3FAVA 2JDIG 1XILA 3K59A 4X65B 2DJVA 2N05A 4JI0B 3CPWU 3OR7C 3WG7B 4PDLA 5GONA 4JZGA 4LFBO 4J11A 1KP3A 5IJ0B 3AG4B 1K8AW 3OMAB 4JI6B 2HLDG 2F4VB 3OMIB 4I5SA 4EEQA 1US6A 3A0HZ 2EX3A 1Y67A 2DWDC 2QM7A 3ZHSA 1CEZA 3G6EV 4AHCA 5EBMC 4J41A 4KHPO 4K0KB
chains in the Genus database with same CATH topology
4DR7O 1IBKO 1I94O 4DR6O 1FJGO 3J81N 1R6TA 4DV6O 4B3SO 4DR3O 1D2DA 4X64O 5BY1A 1HNWO 5A2QN 3M8AA 1HNXO 4X66O 1NS1A 2UUAO 2Z0AA 3SDLA 4GKJO 2ZM6O 4B3TO 4DV1O 5H5NA 5LMNO 1YZBA 4LF8O 2F4VO 5BXZA 5FLXN 4OX9O 5LL6Y 5IWAO 3J80N 2AGAA 3J7AU 1F7YA 2N74A 4NXMO 4NXNO 4GKKO 1G1XB 4JI4O 4LFCO 4DUYO 3T1HO 4JI2O 1FYJA 4X65O 4A5UB 1IBMO 4JI8O 4JI0O 4YHHO 3F5TA 4JV5O 1XEQA 2UXDO 1R1BA 4AQYO 4JI6O 4B3MO 4DR1O 3R66A 3OTOO 1XNQO 3T1YO 4X62O 2VQEO 1A32A 2FKXA 4DV2O 4LF5O 1N34O 2ZKOA 2UXCO 1HR0O 1XNRO 4K0KO 2UXBO 4JI3O 1N36O 1J5EO 4DR2O 4LFAO 4DV0O 1XMOO 1DK1A 3JAMN 4LF6O 4B3RO 4JI5O 1IBLO 5IT9N 2UUBO 2HHHO 4DV3O 1N33O 4JYAO 4DV5O 4LF9O 2DJVA 4OPHA 1XMQO 2LW7A 1FKAO 4DUZO 4LFBO 4YY3O 4DR5O 4OPAA 3RT3C 2UU9O 1X59A 4LF4O 2VQFO 4JI1O 2JRIA 1KUQA 3O65A 4DV7O 1HNZO 5LMUO 2DOSA 4LF7O 5BR8O 1AILA 1N32O 2UUCO 4DR4O 1AB3A 4JI7O 4DV4O 2E5LO 4KHPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 O;  1IBK O;  1I94 O;  4DR6 O;  1FJG O;  3J81 N;  1R6T A;  4DV6 O;  4B3S O;  4DR3 O;  1D2D A;  4X64 O;  5BY1 A;  1HNW O;  5A2Q N;  3M8A A;  1HNX O;  4X66 O;  1NS1 A;  2UUA O;  2Z0A A;  3SDL A;  4GKJ O;  2ZM6 O;  4B3T O;  4DV1 O;  5H5N A;  5LMN O;  1YZB A;  4LF8 O;  2F4V O;  5BXZ A;  5FLX N;  4OX9 O;  5LL6 Y;  5IWA O;  3J80 N;  2AGA A;  3J7A U;  1F7Y A;  2N74 A;  4NXM O;  4NXN O;  4GKK O;  1G1X B;  4JI4 O;  4LFC O;  4DUY O;  3T1H O;  4JI2 O;  1FYJ A;  4X65 O;  4A5U B;  1IBM O;  4JI8 O;  4JI0 O;  4YHH O;  3F5T A;  4JV5 O;  1XEQ A;  2UXD O;  1R1B A;  4AQY O;  4JI6 O;  4B3M O;  4DR1 O;  3R66 A;  3OTO O;  1XNQ O;  3T1Y O;  4X62 O;  2VQE O;  1A32 A;  2FKX A;  4DV2 O;  4LF5 O;  1N34 O;  2ZKO A;  2UXC O;  1HR0 O;  1XNR O;  4K0K O;  2UXB O;  4JI3 O;  1N36 O;  1J5E O;  4DR2 O;  4LFA O;  4DV0 O;  1XMO O;  1DK1 A;  3JAM N;  4LF6 O;  4B3R O;  4JI5 O;  1IBL O;  5IT9 N;  2UUB O;  2HHH O;  4DV3 O;  1N33 O;  4JYA O;  4DV5 O;  4LF9 O;  2DJV A;  4OPH A;  1XMQ O;  2LW7 A;  1FKA O;  4DUZ O;  4LFB O;  4YY3 O;  4DR5 O;  4OPA A;  3RT3 C;  2UU9 O;  1X59 A;  4LF4 O;  2VQF O;  4JI1 O;  2JRI A;  1KUQ A;  3O65 A;  4DV7 O;  1HNZ O;  5LMU O;  2DOS A;  4LF7 O;  5BR8 O;  1AIL A;  1N32 O;  2UUC O;  4DR4 O;  1AB3 A;  4JI7 O;  4DV4 O;  2E5L O;  4KHP O; 
#chains in the Genus database with same CATH topology
 4MVM A;  4PA9 A;  2QM8 A;  4QIW F;  1O9H A;  2R72 A;  4G2K A;  3DXR A;  2KG7 A;  5CA1 A;  3DSQ A;  3RBZ A;  1TVK A;  1SQV H;  3WG7 C;  4HAM A;  3L71 H;  1SES A;  1IX9 A;  1GO3 F;  3AG4 C;  2F4V O;  2CUG A;  2Q73 A;  4EFB A;  2UXC B;  3H1H H;  3J80 N;  2CH7 B;  2WLM A;  1N36 B;  1ENV A;  3ZRW B;  2JS5 A;  4B7K A;  2NN4 A;  4PDM A;  4N21 A;  3LSQ A;  5B1B C;  2FYU H;  4RQF A;  2EJ7 A;  1N33 B;  2OCC B;  1ZL8 A;  1KQS U;  2OYQ A;  2DW4 A;  2L35 A;  3W7S A;  4GYC B;  4WFE A;  5J2U B;  1S76 D;  2DMX A;  3W7T A;  1QLE B;  3ML0 A;  5L3B A;  2FB5 A;  4FPP A;  1BL8 A;  4LC1 A;  5LBQ A;  4DV7 B;  1WA8 A;  3ASO B;  2UXC O;  5KUM A;  5LP6 B;  2KKW A;  3ICX A;  3RYF B;  3UO3 A;  2WSS G;  1N36 O;  1MMM A;  1SRY A;  3JAM N;  4DR4 B;  4NB5 A;  4GKK B;  1JX9 A;  2ITC C;  3OUF A;  3CWB H;  1N33 O;  3HKB A;  1L0N H;  1JA8 A;  4LWS A;  2OCC C;  1GN6 A;  1NR7 A;  1XMQ O;  1KU9 A;  2W0X A;  2OCH A;  2GBO A;  2O57 A;  3BAB A;  3QO8 A;  4DUZ O;  1W0J G;  2IJJ A;  1QLE C;  3BVO A;  4JAA A;  4OPA A;  3RYC B;  4B3T B;  1H2N A;  2EIN B;  2EIK C;  5IE9 A;  3T1Y B;  4DV7 O;  5GW7 A;  3ASO C;  1GH6 A;  4LNU A;  3SYO A;  1BSM A;  4X1Y A;  1COW G;  2ZCE A;  1VQO V;  4DR4 O;  4DV4 O;  4NR1 A;  1IBM B;  4WFA V;  5CB4 B;  3CB2 A;  4OGQ B;  4K3A A;  4EFE A;  3W7X A;  3M8A A;  1OJH A;  2A7W A;  1YJW V;  4WBN A;  5CA0 A;  4LF9 B;  1M5I A;  4I50 B;  2DYR B;  4B3T O;  1P7B A;  2VQE B;  5L3F A;  4JYB A;  4I9Q A;  4MTF A;  3K03 A;  4PA6 A;  2LO1 A;  1H8E G;  4CC6 A;  5FNV A;  3ZHQ A;  4WF9 V;  4PHZ A;  2CDY A;  5JVD B;  2OIG A;  4FZ0 A;  4UV9 A;  1MOF A;  1RPO A;  1YIT V;  2LP7 A;  3QTC A;  3O9O A;  1IBM O;  2CK3 G;  1K5Q A;  4BAY A;  4ZHQ B;  1R6K A;  4MSW C;  4CH5 A;  1DGS A;  3APQ A;  2K1E A;  1RSO B;  3LDE A;  2M7W A;  4HBN A;  1HNW B;  3TET A;  1SZX A;  2VQE O;  3IGA C;  4R6Z A;  4F6R A;  1HNZ B;  5E79 Z;  5LMU B;  3ZS8 C;  5IYB O;  1F23 A;  1XBL A;  3SR2 C;  5BR8 B;  1PPJ H;  5IT9 N;  2MK3 A;  4UCS A;  1J95 A;  4JAU A;  1HNX B;  3L9D A;  4L8J A;  2V4D A;  2HEP A;  5LHH A;  2ZNJ A;  2ZE8 A;  5B3S C;  3G67 A;  1FD9 A;  1GN3 A;  1SF9 A;  4MVS A;  2Y69 B;  1RM1 B;  3JAS A;  1HNZ O;  2ODM A;  1MNG A;  5LMU O;  4QPJ A;  2Q67 A;  3SYC A;  1FXH A;  1BHB A;  5BR8 O;  3QF7 A;  4ZI7 A;  2NR5 A;  2HP8 A;  3OT7 A;  4OXS A;  3G80 A;  1XMO B;  4JV5 B;  5CN0 A;  1D2D A;  2A0L A;  2HHH B;  2QA4 V;  1HNX O;  3ZRX A;  3JAT B;  2ATK C;  1YF2 A;  3SDL A;  2RCV A;  1K73 W;  5BXZ A;  4YY3 B;  3AEI A;  2ZE6 A;  2ZIN A;  3PN1 A;  1KP2 A;  1QQC A;  4JI3 B;  5HFM A;  5EC1 C;  1TAE A;  3ASN C;  3M99 B;  1WJZ A;  3RYI B;  4IIJ B;  1SQQ H;  3OFN G;  2ITD C;  3CRR A;  4JV5 O;  1V55 B;  3LNN A;  2WLH A;  2HKO A;  1Q81 W;  3X2Q C;  1F4M A;  1AP6 A;  1VMG A;  4FMT A;  1AI5 A;  1SA0 A;  1N8R W;  3E8H A;  2HVK C;  3FYE B;  4LF4 B;  4MW8 A;  5K1P A;  1BCC H;  2N04 A;  3M7M X;  2WLI B;  1Y76 A;  1AJQ A;  3KCY A;  3ZHU A;  3B09 A;  4JI3 O;  1K33 A;  2QTO A;  4DR2 O;  1VIB A;  5EBL C;  2A79 B;  1IBK B;  3BY6 A;  3JAL B;  1SQP H;  4MW3 A;  4H33 A;  3UO2 A;  1KMI Z;  1NI8 A;  2CTR A;  4UCT A;  3JSN A;  3E2E A;  1CXZ B;  1FXK C;  2XAS A;  5KX5 B;  3CJH B;  4LF4 O;  4H0L B;  4TSF G;  1QHT A;  5CBH A;  3UT5 A;  4OX9 B;  1KC8 W;  3JYC A;  4UVC A;  1PL0 A;  3MHH C;  4NXN B;  3LUT B;  2K9P A;  4IYH A;  3JD4 A;  2H94 A;  1Q6I A;  4RUF A;  4GX1 A;  4YHH B;  3G6B A;  4TOI A;  1IBK O;  2Q6A A;  2RMK B;  1KYO F;  1CPY A;  1BE3 H;  3FB6 C;  3WB1 A;  4WFF A;  4J7J A;  1KKD A;  5LXT A;  5AG2 A;  1YJ9 V;  2HJD A;  4JZ2 A;  5LOV A;  3E8G A;  3K08 A;  4NTX A;  4OX9 O;  3ABM B;  1SQX H;  4H13 B;  2A06 H;  1H2G A;  4NXN O;  4ZBM A;  1YTF B;  3RFR A;  1AI6 A;  4PDR A;  5CBG A;  4B3R B;  2GDS A;  1EZV H;  5LA6 A;  3BFR A;  5A9G A;  2RQ6 A;  4LP8 A;  5LYJ A;  3VQV A;  4YHH O;  3AG2 B;  2BCC H;  3E89 A;  2YXH A;  1JMK C;  2Q7H A;  5C8Y B;  1V54 B;  3C3T A;  1JPX A;  2WLK A;  3L72 H;  2XAJ A;  4U3J A;  1WPB A;  4FK5 C;  1XDC A;  1S5L Z;  4QE7 A;  5BMV B;  3ABM C;  4TV9 B;  1AR4 A;  2OIE A;  4K35 A;  4B3R O;  2VS0 A;  2UUC B;  2QEX V;  5D5P A;  2XUM A;  1QNM A;  4QPK A;  1EN4 A;  3T1C A;  3EVK A;  4ZKI A;  3AG2 C;  2CGN A;  2JEU A;  3E8F A;  4O4J B;  1V54 C;  2ZT9 B;  3TGU H;  3T4D A;  1EZJ A;  4X20 A;  1G4Y B;  1GM8 A;  1EM1 A;  3ETG A;  2P90 A;  2E3C A;  2OTJ V;  1ZLZ A;  4RAI A;  4RUE A;  5KMG B;  1N32 O;  2UUC O;  4UCV A;  1IXM A;  2Y4U A;  3QVN A;  4JI8 B;  3BEH A;  1AVM A;  2GV9 A;  3E86 A;  3KG2 A;  1Q6U A;  1I08 A;  4CS2 A;  4QNH B;  4DYL A;  2ZIM A;  3HKC B;  4H44 B;  1OCO B;  1VQ7 V;  1SS3 A;  4I7Z B;  3CCR V;  5KHJ A;  5KAF Z;  1YSC A;  2UXB B;  3ABK C;  3RN4 A;  3C3S A;  3OEE G;  4DV0 B;  4B7E A;  1M57 C;  3L73 H;  1PNK A;  1VQP V;  4JI8 O;  3F5T A;  4U7N A;  1GMG A;  4TV8 A;  3E22 B;  3K5L A;  2GTA A;  2PTM A;  1S77 D;  1Q6H A;  2Q5Z A;  4B3M O;  1I94 B;  1BS3 A;  3CCU V;  1M90 W;  2Y48 A;  4DK1 A;  3EHB B;  4HZ3 A;  3VQX A;  2Q4P A;  3FYI B;  2AW9 A;  4J7Z A;  3CME V;  1XUQ A;  1LR1 A;  2QJ1 A;  5HFL A;  1JFF B;  2ARH A;  4FLU A;  4LF7 B;  2UXB O;  1P49 A;  4FLT A;  4DV0 O;  3KZI Z;  4DRX B;  3H1L H;  1YVW A;  4JI2 B;  4B3S B;  3CRQ A;  4PA4 A;  1MZE A;  1SER A;  2YIA A;  3K79 A;  5KHH A;  3U11 A;  2P22 C;  3WFV A;  1FKA O;  3A8T A;  4EB6 A;  3OUS A;  1Y66 A;  4JAV A;  4DXW A;  1PNM A;  4NKG B;  1YCI A;  2R9R B;  5J2U A;  1N0J A;  3ZMT A;  4FLV A;  1I5X A;  5IY5 C;  1B06 A;  5LGU A;  4LF7 O;  3WB2 A;  3LSS A;  2CTP A;  1AB3 A;  4UCR A;  5LP6 A;  1OCC C;  3JCZ A;  2IJK A;  3RYF A;  4B3S O;  2YEV B;  4UFZ A;  3K58 A;  3D36 C;  3ABL B;  4LH7 A;  4FFB B;  4FLX A;  2ZQM A;  3DGE A;  3N2G A;  3A0B Z;  3H1J H;  3ZJZ A;  1K34 A;  3OR6 C;  5DM6 V;  3CXC U;  3H01 A;  5B1B B;  2JJ1 G;  3RYC A;  5JCO A;  1FPO A;  2XHB A;  4X65 O;  4A5U B;  5JJE B;  1D5A A;  4JTA B;  4JI0 O;  2JGU A;  5IYZ B;  3HKD B;  4JYA B;  1H2K A;  2P67 A;  4X1I B;  2HR3 A;  2IU3 A;  2DQ3 A;  4JI6 O;  1ORQ C;  3ABL C;  3W7U A;  1PL4 A;  1L8D A;  2QDO A;  2YSU B;  5CB4 A;  5JQG B;  2Q7G A;  3DC6 A;  3QO7 A;  3K5M A;  4DK0 A;  1F4N A;  3N2K A;  1SQB H;  5CA3 A;  5EIB C;  5EBW C;  4I50 A;  1AI7 A;  2YID A;  1P84 F;  3BAA A;  1NVP B;  4K0K O;  4O4L B;  2QR4 A;  5IJ9 A;  3IC9 A;  5IWA B;  4CH3 A;  2WWW A;  3JD1 A;  1WP8 A;  2LJ2 A;  1Q7Y W;  5JVD A;  4JYA O;  5L3E A;  1Q82 W;  4O4H B;  2EIK B;  2H8P C;  1W2B U;  4RWU A;  2VRZ A;  3U0Z A;  3EXA A;  4ZHQ A;  5J9P C;  3MDS A;  3CYO A;  1JR9 A;  1NQT A;  1V9P A;  5LGT A;  1NZ6 A;  1RSO A;  2BOB C;  1W59 A;  2HFE C;  2W6J G;  3ZN1 A;  3NR7 A;  4JI4 B;  4DUY B;  4BIZ A;  3E83 A;  2Q8V A;  2P6J A;  1GRJ A;  2Z5U A;  3K9S A;  3PJS K;  1X4T A;  1QVG U;  1Q8I A;  3CCV V;  1AR5 A;  5BY1 A;  2AXT Z;  4Q20 A;  2CAZ C;  2LGW A;  5GTI Z;  2ZDI C;  4IL6 Z;  2LW1 A;  1H2S B;  3HPL C;  4O2B A;  1P7G A;  5JH7 B;  4DR5 B;  1GAX A;  1WLE A;  3ZHT A;  2JVD A;  4GKK O;  3OGI B;  2X0L A;  4PJ0 Z;  2WLL A;  4JI4 O;  4DUY O;  3BHP A;  3I5D A;  4PA3 A;  4X1K A;  4WCE V;  1Y74 A;  2RN9 A;  4FIP C;  2QTS A;  1S3J A;  4O2A A;  3DXR B;  1S72 V;  5CA1 B;  1TVK B;  3LDD A;  4Z1M G;  1H38 A;  3T1Y O;  3CEI A;  3K9A A;  1QBZ A;  3SGI A;  1E79 G;  1FS0 G;  3UQ8 A;  4CBC A;  4PI0 A;  2EUL A;  3RVY A;  5BZB A;  1WP7 A;  2BSK B;  4IT5 A;  1QR9 A;  2ZD9 A;  1O9G A;  2IJH A;  5B3S B;  4DR3 B;  4LF9 O;  5EZY A;  3IJ4 A;  5LGN A;  3SPH A;  3OE7 G;  3S3W A;  1Z5W A;  3RYI A;  4BWA A;  1VQM V;  2IW5 A;  2PI5 A;  4KXR A;  4JTC B;  4FFK A;  3RVZ A;  4DO2 A;  1VQ5 V;  2KQX A;  3CCE V;  1K4C C;  4ZOL A;  4RO2 A;  2IBZ H;  3CCQ V;  4TWK A;  3RWR D;  4GLX A;  3HKB B;  2AZ2 A;  3OAA G;  4LWS B;  3F5W C;  3BPZ A;  2WLI A;  1LNQ A;  4P2Z A;  4X8A A;  4O4I B;  4DR3 O;  4U3F H;  2UXD B;  1HNW O;  5KAI Z;  4J9Z B;  1NS1 A;  3BA9 A;  1UPG A;  1GK9 A;  1AJN A;  3JAL A;  1XQ8 A;  4DV2 B;  3ASN B;  4LNU B;  4IHJ B;  1N34 B;  3D8C A;  4BW5 A;  1FAF A;  1XI1 A;  2V7Q G;  3B2E E;  3CP1 A;  2VQF B;  3SPJ A;  3CJH A;  5KX5 A;  1Q86 W;  3X2Q B;  1SET A;  3A0R A;  2UUB B;  4L87 A;  1THZ A;  3ETD A;  3FD9 A;  2UXD O;  5B66 Z;  4WBN B;  2B1I A;  3F7V C;  1VQK V;  4DV6 B;  2GUZ A;  5LHG A;  4IGG A;  3L74 H;  1SKV A;  2HJF C;  5KLV H;  4DV2 O;  1MZF A;  3FKS G;  1N34 O;  2QKA A;  4EKW A;  1K7D A;  2HVJ C;  1DF4 A;  1OCZ B;  3ZMU A;  4UVB A;  1YDX A;  2PGG A;  3CS5 A;  3Q4H B;  5FPO A;  1XMO O;  1M56 C;  1R3I C;  2M6Y A;  1AR1 B;  2UUB O;  1VP7 A;  5TIS Z;  1JQ0 A;  2HHH O;  3T1H B;  4W4K A;  3SJB C;  2W0F C;  4WFG A;  1VQ8 V;  1FXK B;  2R9I A;  4GT1 A;  4X66 B;  1TA8 A;  1VQ6 V;  2UUA B;  3AG3 C;  2P5O A;  4YY3 O;  4F6R B;  1KD1 W;  4Q6G A;  1XOU A;  4P30 A;  4TUY B;  1M4U A;  4DV1 B;  4UUJ C;  3SYQ A;  1KUQ A;  1BMF G;  2EZP A;  2Q68 A;  1IVS A;  4FVM A;  1YXB A;  1YTF D;  5C8Y A;  3CD6 V;  1OCZ C;  1W0K G;  4LFC B;  4MS2 A;  3H1K H;  2B1G A;  5H6Q A;  1YEW A;  2JS3 A;  1TUB B;  5BMV A;  1T5E A;  4LFA B;  5EYP A;  5KA6 A;  3I56 V;  4TV9 A;  3P32 A;  4JI5 B;  2YDE A;  2F95 B;  4I4T B;  4X66 O;  4HYO A;  2UUA O;  3JAK B;  3HR0 A;  3U10 A;  3JAS B;  4DV1 O;  1K3E A;  5H5N A;  2WLN A;  2JGD B;  4R8C A;  4K8X A;  4I0X B;  1SC5 B;  2BTQ B;  4O4J A;  3I55 V;  1G1X B;  4LFC O;  1BQ0 A;  1BGY H;  2YI8 A;  1WPX A;  1NTZ H;  1GTO A;  1RPR A;  2PUS A;  1VF6 A;  1OCR B;  2PF4 E;  2C2A A;  5DEC A;  2V1D A;  5B1N A;  3DTU B;  1S5J A;  1QU7 A;  1GM9 A;  1OZ0 A;  3L75 H;  1B04 A;  4JGS A;  1VQ4 V;  1WB8 A;  1IZ3 A;  1Z5V A;  4YJ3 A;  4CS4 A;  4HNA B;  5B1A B;  1NH2 B;  1PP9 H;  2WA4 A;  1FXV A;  2LFR A;  2FTK A;  4JI7 B;  1EN6 A;  1R73 A;  1QVF U;  1OCR C;  4KUM A;  4OPH A;  3SYA A;  4YJ2 A;  3B40 A;  3JSL A;  3CX5 F;  5KHK A;  5DED A;  2PY5 A;  4ZIB A;  1PNL A;  3K5N A;  2CE4 A;  3IFX A;  3JAR B;  5B1O A;  4DR1 B;  2EBO A;  2RDC A;  3ZMS A;  2GHY A;  2VWK A;  5IYD O;  3O65 A;  3SPG A;  4X62 B;  1Y76 B;  2Z3Y A;  2E75 B;  5B1A C;  3T4Z A;  2IJI A;  4JI7 O;  2FML A;  1I0H A;  1L1F A;  3CCL V;  1B6Q A;  2EIJ C;  3F7Y C;  4WFH A;  4TQD A;  3JAW B;  2PYL A;  5JJN B;  2ETN A;  4DRX A;  1ZWI C;  1VAR A;  1PM9 A;  4YXW G;  3CC7 V;  4BIO A;  4FM0 A;  4CH6 A;  3UT5 B;  2YC0 A;  3ABK B;  2DN9 A;  4E2L A;  3VQW A;  3JD3 A;  1M57 B;  5L3G A;  1D5N A;  4UXN A;  2YUA A;  1J5E B;  3CSX A;  5EC2 C;  4D6T H;  1FYJ A;  2P7T C;  2G38 A;  2BTO A;  4DV3 B;  2DE0 X;  4AI8 A;  5ITZ A;  1AJP A;  2LFS A;  1DF5 A;  2ZIO A;  4X64 B;  3MHS C;  2YEV A;  2Q69 A;  4D7T A;  4UCU A;  5IJ0 A;  4JI1 B;  4MTX A;  1KBH A;  3ZCC A;  4FFB A;  1GM7 A;  5JWP A;  3SPI A;  3SJQ C;  2LGQ A;  1N4C A;  1ROP A;  2JEX A;  1J5E O;  5LYJ B;  1DK1 A;  2WPD G;  3RW0 A;  1SQG A;  4DV3 O;  2ZR2 A;  4ABM A;  5H6R A;  4G28 B;  4QE9 A;  3SJC C;  4J7K A;  3LSU A;  2XAH A;  3AG1 B;  3HKD A;  5IY5 B;  1BQZ A;  1I5Y A;  4IYI A;  4X1I A;  4LF8 B;  1DTO A;  4FZ1 A;  4JI1 O;  2MW2 B;  4WFB V;  2JRI A;  3B77 A;  3E35 A;  1JOY A;  1I7F A;  3GB7 C;  5C93 A;  2DOS A;  1OCC B;  3RYH B;  2CH7 A;  4CH4 A;  3ZRW A;  1S5H C;  1FFX B;  1I94 O;  1G8M A;  2F93 B;  4JTD B;  2EIM C;  4AQY B;  2RJZ A;  5DN6 G;  4N23 A;  4FLW A;  3THO A;  3ZHV A;  3ZRS A;  2Q9L A;  3P3N A;  4XDK A;  1NR1 A;  3OGC C;  3BCC H;  4LF8 O;  3AG1 C;  4LFB B;  2DYS C;  3OTF A;  4O4H A;  1DLB A;  2VWJ A;  1NVP D;  1E1Q G;  3HKE B;  2X6B A;  2DWE C;  2N74 A;  4P9P A;  2AZ0 A;  4JF3 A;  4DW1 A;  2IH1 C;  4GUN A;  2PYJ A;  4CZZ A;  2JK5 C;  4JI2 O;  2QWQ B;  3OD4 A;  3K5O A;  2P06 A;  1WB7 A;  4UV8 A;  4DV5 B;  2WAM A;  4AQY O;  2ZNI A;  1ZSP A;  2Y0P A;  4I55 B;  1G6U A;  2UXX A;  2ILM A;  1SZT A;  2P4V A;  2Q0O C;  4NYK A;  3G4S V;  1XL6 A;  3K04 A;  3QG5 A;  5JH7 A;  4FM2 A;  1NU1 H;  2JJ2 G;  2CGO A;  3NXS A;  4B08 A;  4TV8 B;  3GWO A;  3KCX A;  4MTG A;  4UB6 Z;  4QJF B;  4DV5 O;  1PD3 A;  5KA5 A;  1H2M A;  2LW7 A;  1XHX A;  1Q43 A;  2EIL B;  3RT3 C;  1ZX3 A;  5LMN B;  5J2T B;  3OMN B;  4BW9 A;  2QE7 G;  5CBF A;  1RFY A;  4I9W A;  3CC4 V;  4KFM A;  3BRC A;  1K92 A;  2XAG A;  2BSK A;  4EB6 B;  3ZN0 A;  1M93 A;  2R70 A;  2R9A A;  1XMQ B;  3EFF K;  3ZBH A;  2EIL C;  5LMN O;  4Z2W A;  4DUZ B;  4PV1 B;  4MT8 A;  4E4E A;  1OV9 A;  5FLX N;  4NTY A;  1WAZ A;  4MVU A;  1MG1 A;  3FAV B;  5IWA O;  3J7A U;  5GTH Z;  1URF A;  4ASU G;  4J9Y B;  1LUV A;  2EZO A;  3D3Q A;  2D2C B;  2XOK G;  2GTS A;  3FB7 C;  3CE2 A;  5GON B;  1IBL B;  4JYY A;  1ZAU A;  2KSD A;  4GX5 A;  2ZXW B;  1PKX A;  1R1B A;  1VF5 B;  4DV4 B;  4PEL A;  3TXS A;  2IH3 C;  2OWO A;  4PI2 A;  1U97 A;  3CRA A;  3ABT A;  3N2G B;  1NTM H;  2RNB A;  3WB0 A;  1QR8 A;  3JD0 A;  2LQT A;  1Q90 D;  1Q3E A;  4O4I A;  1LUW A;  2ZKO A;  2A9H A;  1ZUQ A;  4UVA A;  3E8B A;  1JCH A;  3BA8 A;  1N0N A;  1MAB G;  2KG7 B;  4IHJ A;  1ARO P;  1IBL O;  5LP6 C;  5FPR A;  4LCU C;  1FJG B;  4DR6 B;  1WNS A;  1R6N A;  3MAQ A;  2ZXW C;  5EK0 A;  3TJT A;  1KEC A;  5L3D A;  4DR5 O;  4NVP A;  4YIO A;  3N2K B;  3JAT A;  1FFT B;  2Y0I A;  3QO5 A;  1EN5 A;  3CCM V;  5IJ9 B;  1B3Q A;  1ZL8 B;  5JCO C;  2EIN C;  3VOU A;  1SQF A;  2F66 C;  3IC7 A;  1GKF A;  5B5E Z;  1F51 A;  1M9N A;  4G27 B;  2F1M A;  1NJI W;  1FJG O;  4DR6 O;  2BOC C;  1R6T A;  4X9Q A;  1NKD A;  3Q4H A;  4IIJ A;  1WA8 B;  3CCS V;  2HG5 C;  1UJW B;  1NTK H;  1FXK A;  1Q5O A;  4LF5 B;  3B8N A;  3AK3 A;  2IU0 A;  2QM4 A;  1Y4M A;  4PDV A;  3S3X A;  2DYR C;  2AGA A;  2NLJ C;  3CHX A;  1XNR B;  3TXQ A;  4TUY A;  2B9Z A;  2F43 G;  3FB8 C;  1U96 A;  4MVQ A;  3B4S A;  5KUK A;  2PZS A;  1R3L C;  2XAF A;  2IM9 A;  1KB9 F;  1TUB A;  4QGP A;  4X1Y B;  4O2B B;  3SJA C;  1XHZ A;  3AK1 A;  2GSM B;  4LF5 O;  4NTW A;  4I4T A;  1M56 B;  3JAK A;  3CXH F;  1K5S A;  2WLL B;  1VF7 A;  4MVO A;  1XNR O;  2DQ0 A;  4X1K B;  3CCJ V;  1BT8 A;  2NNU A;  1Y74 B;  2JGD A;  4O2A B;  3H1I H;  5CA0 B;  2YIC A;  3HB3 B;  3P30 A;  3AG3 B;  4DR7 B;  4I0X A;  4RQE A;  1YI2 V;  2BTQ A;  5JJJ B;  2WLJ A;  4XBF A;  3FFQ A;  5FNV B;  1GN4 A;  2ZM6 B;  1X59 A;  3OEH G;  2H3O A;  4J42 A;  2VQF O;  3UKM A;  1UFI A;  3ZMV A;  2JIZ G;  1R3K C;  2Y69 C;  1RM1 C;  2XND G;  1AIL A;  3JCU Z;  1P4R A;  4LBE C;  2EJR A;  5EZY B;  4HNA A;  4DR2 B;  4DR7 O;  4DV6 O;  2W6I G;  4KL1 A;  4JPR A;  2E76 B;  1Z2G A;  1HWY A;  4FLZ A;  1KKC A;  1BZK A;  2ZE7 A;  3ZMZ A;  3K57 A;  2ZM6 O;  5FL7 G;  2YS8 A;  2QGN A;  2XTA A;  3L70 H;  3CMA V;  1K9M W;  1YHQ V;  1NH2 D;  4YIP A;  3K3W A;  4ZOL B;  4U7O A;  1IUR A;  1HP8 A;  1F7Y A;  1HR0 B;  1JJO A;  3JAR A;  3VQY A;  3T1H O;  3SYP A;  2X7R B;  2PI4 A;  2D3O W;  1IDS A;  2B5U A;  3CC2 V;  4JYC A;  3VBB A;  2OTL V;  3ETE A;  3R66 A;  2A3Q A;  1VQN V;  3JAW A;  1V55 C;  2UU9 B;  2X6C A;  1A32 A;  4GCZ A;  4ZI7 B;  1AP5 A;  3RGB A;  1TGO A;  2CTQ A;  3P3P A;  4TQF A;  1HR0 O;  1RP3 B;  3AK2 A;  4LFA O;  3C90 A;  1MA1 A;  4JI5 O;  2E5L B;  5KMG A;  4J10 A;  1EFR G;  4AIL C;  3STZ C;  5IYC O;  4JAS A;  2BE3 A;  2GUZ B;  3DC5 A;  1GN2 A;  4GX2 A;  1JVM A;  2UU9 O;  4F4L A;  1E1R G;  1XRE A;  4C7U A;  3HKC A;  2Y4T A;  1BHA A;  1VQL V;  2EIJ B;  3FX7 A;  4X88 A;  4DW0 A;  2QWP B;  1ZTE A;  5F2V O;  1HDJ A;  3TCU A;  3ZHR A;  5LHI A;  2E5L O;  2QSA A;  5E1A C;  3APO A;  4GX0 A;  1SA0 B;  2UXN A;  3J81 N;  4FLY A;  1NT2 B;  5L3C A;  5A2Q N;  1YJN V;  3KKY A;  4XDJ A;  2Q7E A;  4FJC C;  3E22 A;  3OTO B;  2Z0A A;  3D3I A;  1MSD A;  2OT5 A;  1YZB A;  3QNE A;  3ZX6 A;  2YXY A;  1WN7 A;  4GZR B;  4BIU A;  3TK1 A;  4CC5 A;  4P9O A;  4LF6 B;  3R65 A;  1JFF A;  5D5Q A;  3GVM A;  5EYP B;  1L0L H;  1YIJ V;  1H8H G;  4ICG A;  4D7S A;  1PV0 A;  3CRM A;  1N32 B;  3K06 A;  3K0D A;  3RYH A;  4PA7 A;  3D36 A;  4DR1 O;  4CS3 A;  3OTO O;  5K1X A;  1CP9 A;  4X62 O;  1FFX A;  3LDC A;  5IDJ A;  2QWO B;  3OM3 B;  2FKX A;  2ZR3 A;  3STL C;  4X89 A;  4MVR A;  2WA3 A;  4H37 A;  5H9C A;  3UM7 A;  4LF6 O;  4W4L A;  1EBO A;  5LXT B;  5H2F Z;  3HKE A;  2CTW A;  4K8Z A;  4PD4 F;  1QLN A;  1XL4 A;  1H2L A;  5LOV B;  3ZED A;  1K97 A;  4GKJ B;  2YI9 A;  4B3M B;  2AHY A;  1VEW A;  4YJ3 B;  5LA6 B;  2FL4 A;  1Y6X A;  2XT9 A;  2QKC A;  2ADP A;  3JD2 A;  4I55 A;  1TUE B;  2YXL A;  4UCO A;  4XDL A;  4NXM B;  1QCE A;  1MSW D;  2QKS A;  2QWR B;  4R7C A;  2EIM B;  4LH6 A;  4MVZ A;  4TT3 G;  3ZIA G;  1VF6 C;  5KHI A;  4YJ2 B;  3ETQ A;  2Q0A A;  1K4D C;  2ZE5 A;  3A2F A;  1NBM G;  4X64 O;  4U3J B;  5IYZ A;  5EIB D;  3G71 V;  2DYS B;  4LR3 A;  3SPC A;  3W7W A;  2X6A A;  3UCS C;  1XNQ B;  2YIB A;  4GKJ O;  1HW7 A;  3LNM B;  1R3J C;  4UB8 Z;  1AI4 A;  3GWK C;  4KP4 A;  5JQG A;  2XAQ A;  2F23 A;  1VQ9 V;  4Z1V A;  3N27 A;  5LL6 Y;  4J80 A;  3ABU A;  4NXM O;  5CMU A;  1OCO C;  2YIB D;  1JJ2 U;  3H9V A;  2E74 B;  5J2T A;  3K0G A;  4O4L A;  4BR6 A;  3ZRV A;  1S0V A;  3FB5 C;  4R50 A;  2KB1 A;  3T2M A;  1XEQ A;  3OW2 U;  1OHH G;  4X20 B;  2AHZ A;  2L6L A;  4F6E A;  1XNQ O;  1IXB A;  2ZDI A;  3CRC A;  2ADQ B;  5KHG A;  3MD0 A;  4MTO A;  4FM1 A;  3IAY A;  3B8M A;  2P4K A;  2QWN B;  3WU2 Z;  1M1K W;  4KHP B;  3AG7 A;  5ITZ B;  3FAV A;  2JDI G;  1XIL A;  3K59 A;  4X65 B;  2DJV A;  2N05 A;  4JI0 B;  3CPW U;  3OR7 C;  3WG7 B;  4PDL A;  5GON A;  4JZG A;  4LFB O;  4J11 A;  1KP3 A;  5IJ0 B;  3AG4 B;  1K8A W;  3OMA B;  4JI6 B;  2HLD G;  2F4V B;  3OMI B;  4I5S A;  4EEQ A;  1US6 A;  3A0H Z;  2EX3 A;  1Y67 A;  2DWD C;  2QM7 A;  3ZHS A;  1CEZ A;  3G6E V;  4AHC A;  5EBM C;  4J41 A;  4KHP O;  4K0K B; 
#chains in the Genus database with same CATH homology
 4DR7 O;  1IBK O;  1I94 O;  4DR6 O;  1FJG O;  3J81 N;  1R6T A;  4DV6 O;  4B3S O;  4DR3 O;  1D2D A;  4X64 O;  5BY1 A;  1HNW O;  5A2Q N;  3M8A A;  1HNX O;  4X66 O;  1NS1 A;  2UUA O;  2Z0A A;  3SDL A;  4GKJ O;  2ZM6 O;  4B3T O;  4DV1 O;  5H5N A;  5LMN O;  1YZB A;  4LF8 O;  2F4V O;  5BXZ A;  5FLX N;  4OX9 O;  5LL6 Y;  5IWA O;  3J80 N;  2AGA A;  3J7A U;  1F7Y A;  2N74 A;  4NXM O;  4NXN O;  4GKK O;  1G1X B;  4JI4 O;  4LFC O;  4DUY O;  3T1H O;  4JI2 O;  1FYJ A;  4X65 O;  4A5U B;  1IBM O;  4JI8 O;  4JI0 O;  4YHH O;  3F5T A;  4JV5 O;  1XEQ A;  2UXD O;  1R1B A;  4AQY O;  4JI6 O;  4B3M O;  4DR1 O;  3R66 A;  3OTO O;  1XNQ O;  3T1Y O;  4X62 O;  2VQE O;  1A32 A;  2FKX A;  4DV2 O;  4LF5 O;  1N34 O;  2ZKO A;  2UXC O;  1HR0 O;  1XNR O;  4K0K O;  2UXB O;  4JI3 O;  1N36 O;  1J5E O;  4DR2 O;  4LFA O;  4DV0 O;  1XMO O;  1DK1 A;  3JAM N;  4LF6 O;  4B3R O;  4JI5 O;  1IBL O;  5IT9 N;  2UUB O;  2HHH O;  4DV3 O;  1N33 O;  4JYA O;  4DV5 O;  4LF9 O;  2DJV A;  4OPH A;  1XMQ O;  2LW7 A;  1FKA O;  4DUZ O;  4LFB O;  4YY3 O;  4DR5 O;  4OPA A;  3RT3 C;  2UU9 O;  1X59 A;  4LF4 O;  2VQF O;  4JI1 O;  2JRI A;  1KUQ A;  3O65 A;  4DV7 O;  1HNZ O;  5LMU O;  2DOS A;  4LF7 O;  5BR8 O;  1AIL A;  1N32 O;  2UUC O;  4DR4 O;  1AB3 A;  4JI7 O;  4DV4 O;  2E5L O;  4KHP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...