2F4VO

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2f4vO00
4JI8O 2VQFO 4DR4O 4JI2O 4DR2O 4OX9O 2Z0AA 4LF8O 2UXCO 4LFBO 3RT3C 1F7YA 2DOSA 1YZBA 1DK1A 4DV1O 5H5NA 2VQEO 2UXBO 4JI0O 3F5TA 5IWAO 1N36O 4JI5O 4DUZO 4X66O 2UXDO 1FYJA 3T1HO 4LF9O 4LF5O 4X62O 1XNRO 1KUQA 4NXNO 1FKAO 4DR6O 1HNXO 2ZM6O 5IT9N 1HNWO 1I94O 2AGAA 2HHHO 5LL6Y 4DV7O 4LF4O 4JI3O 4DR7O 1XEQA 1AB3A 1R1BA 4X65O 4DUYO 3SDLA 1N33O 1IBLO 1HR0O 4JI1O 4JI6O 1J5EO 1AILA 4OPHA 4DR1O 3T1YO 1FJGO 4JYAO 4B3SO 4YY3O 4LFCO 1XMOO 4AQYO 3R66A 4LF7O 2FKXA 4B3MO 2DJVA 5LMUO 4YHHO 4JV5O 2LW7A 4OPAA 1IBKO 2E5LO 1N32O 4GKJO 2UUBO 1NS1A 5BXZA 3M8AA 4GKKO 4B3TO 1N34O 3J80N 3O65A 4NXMO 3OTOO 5BR8O 5FLXN 4DV0O 2F4VO 3JAMN 4DR5O 4JI7O 2UU9O 1R6TA 4X64O 4K0KO 5LMNO 4DV2O 2ZKOA 4A5UB 4JI4O 3J7AU 4LFAO 1A32A 2JRIA 2N74A 4DV3O 1G1XB 4DV5O 5A2QN 1D2DA 1XNQO 1X59A 4DV4O 1HNZO 2UUCO 4DR3O 4DV6O 4B3RO 4LF6O 5BY1A 2UUAO 3J81N 4KHPO 1IBMO 1XMQO
chains in the Genus database with same CATH superfamily
1CEZA 4L8JA 1F4NA 4DR4O 2RQ6A 4TSFG 2DN9A 2NLJC 5H6QA 1ZWIC 4MW3A 2ITDC 4LF8B 4CH5A 4LFBB 1BHBA 4BAYA 3OEEG 2ZE5A 4J10A 3RYIB 3CJHA 4LH7A 3AG1B 1KKDA 1JJ2U 2KQXA 2DW4A 4IIJA 1N36O 1N0JA 4CH3A 1IURA 2HJDA 1VEWA 3N2KB 1IX9A 2X6CA 1JPXA 4DRXB 1NTMH 3CWBH 3AK2A 4CS4A 4I4TB 2NN4A 4DR6B 1H2SB 2ZM6B 1FS0G 2QM4A 3BVOA 3SJBC 1Q5OA 2YEVA 4LF4O 3SJQC 5LXTB 1KD1W 1BL8A 4EB6A 3SDLA 1PPJH 5B1AB 3LNNA 3WG7B 3K03A 1H2LA 3T1YB 1VF7A 4TQFA 4FK5C 4JYCA 1U96A 1V55B 4WF9V 4F4LA 1PV0A 4B3MO 2V1DA 3DSQA 1JA8A 1XOUA 3I5DA 2Q6AA 1N32O 2P22C 1R3KC 3H1JH 5LOVA 3ZMUA 4GKKO 4FMTA 2L6LA 3J80N 3CXHF 1KQSU 2V7QG 3HKCB 4DV0O 4YJ2A 4DR5O 1YIJV 3OR7C 4H0LB 3MDSA 1SZTA 1RSOA 1G1XB 2BTOA 4TUYB 4JTCB 1AI5A 4U3FH 1ROPA 4O4IB 1X59A 2WA4A 1HNZO 4D7SA 4DV6B 5BMVB 1V9PA 4ZHQB 4JI8B 1Z2GA 3K5NA 3FB6C 1GTOA 4J7KA 2VWJA 4QJFB 2XAFA 2QWNB 2QA4V 2CTWA 2DOSA 1JOYA 1KMIZ 5ITZA 3F5TA 3WB0A 4DW1A 3CC7V 4DXWA 4X66B 4DUZO 1WN7A 3I55V 2UXDB 2PUSA 1FFTB 4JTAB 2OYQA 5D5PA 1VF6A 4LWSB 2EIMC 4LP8A 1FKAO 3CYOA 3ZX6A 2IH1C 1TA8A 5D5QA 1HNWB 1S5JA 4NYKA 4JYYA 2QE7G 4DR7O 3K04A 4O4LB 1BQ0A 3RYIA 4JI6B 2BTQA 2RCVA 1XILA 3CB2A 4R6ZA 4H13B 1KU9A 2P4KA 2XTAA 3K0GA 3K08A 2JS3A 2YXLA 4LFCB 2HLDG 3AG3B 3BABA 1DGSA 1NZ6A 2GV9A 4DRXA 2E75B 4YIPA 5LMUO 4I4TA 2W6JG 4YHHO 1I0HA 1QQCA 5KUKA 2YI8A 5BR8B 4LNUB 1JQ0A 1BCCH 2ZE6A 3ZBHA 2AZ2A 4RUFA 3KKYA 5FPRA 1Y6XA 3J7AU 4KUMA 5EIBC 2CUGA 4IT5A 1VIBA 5C8YB 1ZUQA 4JTDB 2YICA 1IBMB 1VQ9V 2UUAO 3CCSV 1ORQC 4FM1A 4TV8A 1NTKH 3W7UA 1K34A 1N0NA 3K5LA 3G4SV 5JH7B 4DV1B 3VBBA 2P5OA 1DK1A 4MTOA 4TUYA 4XDKA 4JI5O 1NR1A 4O4IA 4I55B 3D8CA 2JEXA 3TGUH 2HJFC 3D36A 4WFEA 5CBFA 2QR4A 4FFBB 4LF5B 1YXBA 3L70H 1NH2B 3L71H 2B1GA 3ETQA 4PA4A 4GYCB 4GCZA 1TAEA 3QVNA 3ZHSA 3ABMB 5KHHA 5EYPB 4FLUA 2Y48A 2BSKB 4CH6A 2IM9A 5IYBO 3BHPA 1YJ9V 4J7JA 3OMAB 3JATB 4O4HA 5J2TA 1L8DA 4MVOA 4J42A 1CP9A 5FL7G 4ZOLB 4O4JA 3CRMA 4LWSA 1XUQA 4ABMA 2JS5A 3WB2A 3ASNC 1MZEA 4RWUA 2ZDIC 1JFFB 3DC5A 1NU1H 3SPGA 2LGWA 2O57A 2ZXWB 3JAKB 4FLTA 4GX5A 3H9VA 3ZN1A 1Q86W 2F4VO 2XAHA 3OEHG 4HNAB 3E22B 5LYJA 4YIOA 5GONB 2JRIA 1D5AA 1FAFA 4RQEA 2A3QA 5A2QN 2GTAA 1GM8A 3H1HH 3FFQA 4YXWG 2B1IA 3KCXA 3KZIZ 3ZRXA 4UCTA 4KHPB 5JWPA 2PY5A 4UV9A 1XMQO 5H2FZ 4LNUA 4DR2O 1SQPH 2Z0AA 1NH2D 3DTUB 2IJJA 2AHZA 3SGIA 4RO2A 1TVKA 3E2EA 3ZIAG 1F7YA 5JCOC 4GX2A 5IWAO 2Q7EA 5C8YA 5IYZB 2HG5C 1SS3A 1GKFA 1L0LH 4PJ0Z 4ZBMA 3K5MA 1Q6HA 5C93A 2PYJA 3GB7C 3SYPA 3CS5A 3JCUZ 3THOA 3OUSA 3APOA 2RDCA 1H8EG 2C2AA 3QTCA 3CRAA 2P4VA 1RFYA 5EBMC 3ASOC 4X65O 2PI4A 1RPOA 5JH7A 4PDMA 4N23A 1US6A 3A2FA 3B8NA 1KP2A 3JAWA 1N4CA 4R8CA 3ABUA 2EIKC 3CCRV 3KCYA 1P7BA 4FFBA 4JV5B 1IBKB 2E5LB 3ZRVA 3ZHVA 1OZ0A 3JALA 2UUBO 2IJHA 4B3TB 1Y67A 1AJNA 3EXAA 1N34O 3BAAA 4MVRA 1GN6A 3L75H 5EYPA 2WLNA 3CHXA 1RP3B 3HKBA 1H2NA 1H2KA 3ABLB 4WFBV 4E2LA 3F7YC 3HPLC 1AP6A 4DV4B 1LR1A 5B1BB 4AILC 1VQ6V 2ARHA 2GBOA 1R3LC 4Q6GA 3RFRA 4BIUA 4ZI7A 4PDVA 4MTXA 4DK0A 4ASUG 1WAZA 2E76B 1DLBA 2W0FC 1M4UA 2WLLB 2Y4UA 3D3IA 1TUEB 1MZFA 3CJHB 3STZC 4HNAA 5KAIZ 1Q43A 3E22A 1KKCA 5GONA 3A0RA 1VP7A 3AK3A 1KP3A 1M5IA 3KG2A 1JR9A 4KXRA 4FFKA 3T1HO 3K59A 3ZMTA 5J2UB 5L3EA 4QGPA 1MMMA 1FXKC 4EB6B 2QWQB 2IU3A 4PELA 3DC6A 1J95A 5IYZA 1P4RA 3CC4V 2P90A 4F6EA 4JYAO 3BY6A 2EJ7A 3QNEA 5IJ0B 4AQYB 1E79G 2W6IG 4B7KA 2XT9A 4W4LA 5IY5C 2OCCB 4NKGB 4X1YA 4GKJO 1VQ8V 5BXZA 1BHAA 1QLEC 2WLIA 5EZYB 1SA0B 2X0LA 2F23A 3L74H 5L3GA 3O9OA 4X64B 4BWAA 3M99B 3EVKA 5EIBD 1JX9A 2WA3A 4TT3G 5FNVA 1OCRC 3UCSC 3ASNB 1DTOA 2FTKA 3RYHB 4UXNA 2LW1A 4CC6A 4DR3O 2Z5UA 3CEIA 3LDDA 3FB7C 1XL4A 4J11A 3VOUA 4P9OA 4R50A 3G80A 2UXCO 5CN0A 1DF5A 4IYIA 2P7TC 5ITZB 4CZZA 3QG5A 2EIJB 1YCIA 1EZJA 3HKDA 4O2AA 3T2MA 1UPGA 1YI2V 1ZSPA 1MG1A 4X62B 2Q8VA 4NXNB 1KUQA 3CSXA 1VF5B 5B3SB 2WLLA 2BOBC 3R65A 2BTQB 2EINC 4LCUC 5KHKA 2LO1A 1HR0B 3B2EE 4DUYO 1S0VA 1IZ3A 4AI8A 2OWOA 3F7VC 2DYSB 1JMKC 3E8HA 4C7UA 1FJGO 1WJZA 5LP6C 3CC2V 1XMOO 2XAQA 4UVBA 3BCCH 1PM9A 1I5XA 1F23A 3LNMB 1HDJA 3BA9A 2DYRB 5B66Z 4B08A 5J2UA 4JASA 5LGTA 4UFZA 1ZTEA 3E35A 3CCLV 3OTOO 2IBZH 5LA6B 5JJJB 3SPCA 2WLKA 1XQ8A 2W0XA 4OGQB 5BZBA 4DV2O 5KHGA 2GSMB 2YIAA 1D2DA 5IJ0A 4EFBA 3N27A 3N2GB 1RM1B 4IGGA 3OTFA 2EBOA 2CAZC 4ICGA 5H6RA 2UXXA 5CB4B 3APQA 2Q0OC 3UKMA 2ZNIA 2VQFB 1KBHA 4TV8B 2R72A 5EZYA 1SA0A 4OX9B 4U7OA 2CGNA 4K35A 1GMGA 1AI4A 2Z3YA 3JD1A 4X1KA 5JVDA 3Q4HB 2VQEO 1AI6A 1V54C 3JYCA 1S3JA 1SQXH 5DN6G 3SPJA 3ZCCA 2PYLA 3CD6V 1SQBH 2JEUA 3RYHA 2QWOB 1QVGU 2WSSG 1TGOA 2X7RB 1OCZC 4EFEA 4BIOA 2HVKC 4CH4A 1Z5WA 2CDYA 1QVFU 2ETNA 4X8AA 1XNRO 3STLC 4Z1VA 2QTSA 3WB1A 3FX7A 1AR1B 4HBNA 4JZGA 1N33B 1PD3A 4JI1O 4PHZA 4ZIBA 3ABKC 4O4HB 5J2TB 3U0ZA 4LH6A 3CCJV 1Q6IA 4DR1O 4O4JB 1GN3A 4LF7O 4PA9A 1M56B 3RVYA 2M7WA 2ZD9A 5CA1B 1NI8A 3UO3A 3K58A 3M7MX 4ZKIA 3JARB 3OUFA 1S76D 2F43G 4UVAA 1F4MA 1MNGA 4QPKA 5LYJB 2QGNA 1FFXB 1X4TA 2UU9O 1FXHA 2UXNA 5IJ9A 4LFAB 5L3DA 1L0NH 5L3CA 4I50A 1AR4A 3IFXA 1Q6UA 4JAAA 2UUCO 4B3RO 1WLEA 2MK3A 3CMAV 2DWDC 3JD3A 3JD2A 1T5EA 3TXSA 1TVKB 5LA6A 3ABTA 3TCUA 2ZIMA 3QO5A 1PNMA 2DMXA 4H33A 2AXTZ 1EN5A 4KL1A 5H5NA 1OHHG 1OCCB 4NTXA 4JI0O 1N36B 2Y69C 4G2KA 1LUWA 3N2GA 1H2MA 2XNDG 4P30A 3OR6C 5TISZ 3JSNA 1YHQV 4LF9O 1OCOC 5CB4A 2L35A 4QPJA 3PN1A 4G27B 2QDOA 1HNXO 2BE3A 5AG2A 2EILC 3AG4C 2HHHO 4LF4B 1VQLV 5LL6Y 4DV7O 4JI3O 1AP5A 1R1BA 4I9QA 3VQVA 3AG2C 3DXRB 3Q4HA 3MD0A 3JAWB 1J5EO 4MVUA 3ZRWB 1XI1A 4YY3O 2FYUH 5DECA 3AEIA 3ETEA 4B3MB 3H1KH 1NTZH 3JALB 5B5EZ 1XBLA 3B40A 3CMEV 4CC5A 1N32B 3B4SA 3OW2U 1F51A 4GKKB 5IDJA 3C90A 3M8AA 2EJRA 2A9HA 2YXYA 3O65A 4NXMO 3HKBB 2D3OW 4DV0B 1EFRG 2A79B 5FLXN 4K3AA 1U97A 4DR5B 2XAJA 4TWKA 3JASA 3BRCA 1SQGA 4J7ZA 5CBHA 2Q69A 1LUVA 5KHIA 4PDRA 4DV3O 1M93A 3X2QC 3ETDA 4DV5O 3CX5F 1XNQO 1R73A 2WLHA 1HNZB 1FXKA 3IC9A 1RPRA 4ZI7B 1GM7A 1NKDA 5CA1A 3HR0A 3LUTB 1EN4A 3JARA 2A06H 2Q67A 1QNMA 4FVMA 4JI2O 2LFRA 2R9IA 1K3EA 4UB6Z 1FFXA 3L9DA 2KG7A 1YJWV 2RJZA 1XL6A 4UUJC 1KYOF 1K92A 2NR5A 4DUZB 1I08A 1G4YB 3EHBB 2HP8A 5B1OA 3ZMSA 1Q81W 1E1RG 1P49A 4PV1B 4NTYA 2HR3A 1MSDA 2N04A 4FLVA 1ZLZA 1B06A 2GDSA 3G6EV 5IT9N 1K97A 1I94O 4DR7B 2YIBD 3IGAC 1IBLO 2JGDB 1VF6C 1P7GA 2EZPA 1ZL8A 2WLMA 4B3SO 1Y4MA 5LGUA 4F6RA 2LJ2A 1KC8W 4BW9A 2FKXA 2PF4E 4X1YB 5LMUB 4YHHB 2OIEA 3B8MA 3AG1C 2WLIB 2IJIA 3G71V 2CH7B 3OGCC 1SESA 1UFIA 4W4KA 3ZHUA 1R6KA 3OFNG 4JI7O 3DXRA 5IYDO 1K5SA 4K0KO 5FNVB 3AK1A 4IHJA 5LMNO 2EIMB 4UB8Z 4WFAV 4A5UB 4JI4O 3ZRWA 4CBCA 4KFMA 4PD4F 2RMKB 1YTFB 3W7TA 4YJ3B 2JK5C 4D6TH 4J41A 1AROP 5B1AC 2UUAB 2MW2B 3WG7C 2ADPA 4LF6O 1FD9A 4R7CA 2YIBA 3SYCA 2ZCEA 2JVDA 2KB1A 3ETGA 1VQNV 1K4CC 4CS3A 1V55C 5EC2C 5LP6A 4LF8O 4DK1A 4LFBO 2EZOA 4PI2A 1BE3H 3RT3C 2R70A 4X20B 3ZMVA 3DGEA 3RW0A 5GTHZ 2OIGA 4FLXA 3HKDB 4O2AB 4JI5B 1D5NA 1MSWD 4MTFA 1SERA 5H9CA 1FXVA 3FYEB 5KMGB 1I5YA 2LP7A 1QLNA 1R3JC 4DR6O 1B3QA 2ZM6O 2D2CB 5K1PA 1BQZA 2A0LA 4MVSA 1OJHA 2JDIG 2Q73A 1G8MA 4Z1MG 3D36C 4FLWA 2ZQMA 1BZKA 2VRZA 3I56V 1WPXA 4OXSA 3ZS8C 4U3JA 2OCHA 3T1YO 2KKWA 1XDCA 4FLYA 4GX0A 3BA8A 2ZE8A 2LQTA 3HKEA 2E74B 4JAUA 1YTFD 3QF7A 2CTQA 1COWG 3H1LH 3MHSC 2Q7HA 5DEDA 2F4VB 3TXQA 5EC1C 3CRRA 3K0DA 3JAMN 1Z5VA 2JGDA 1R6TA 1XREA 3LSQA 4MS2A 4UCRA 1TUBB 4WBNA 3A8TA 3FB8C 3ML0A 1BSMA 4TOIA 3RBZA 2PZSA 1VARA 3W7SA 4JGSA 1YEWA 4I7ZB 4GZRB 3SYAA 2EULA 2H3OA 4DV6O 4H37A 4KP4A 4DYLA 3RYCA 2CH7A 1XMQB 4RQFA 4I0XB 4JI8O 2FB5A 4JYBA 2WAMA 3AG3C 5A9GA 4JZ2A 4X1KB 1K33A 5JVDB 1SRYA 4TV9B 2WWWA 4QE7A 1M90W 3FD9A 1VQPV 1SC5B 2FL4A 1YZBA 5IWAB 1K9MW 3G67A 4P2ZA 4X66O 5KUMA 4YJ3A 4GLXA 1Y76B 2UXDO 1YF2A 5KLVH 1BGYH 3WU2Z 1FYJA 1M57C 1PL4A 2WLJA 3NXSA 3OAAG 4BIZA 3LDCA 5KAFZ 1ZAUA 4CS2A 4X9QA 2FMLA 3FKSG 1VQMV 3CCUV 4MSWC 4J9ZB 1EZVH 2JJ1G 1HNWO 4FZ1A 5JJEB 4E4EA 4FPPA 2UXBB 3CCVV 4X65B 2EX3A 1WB7A 4X20A 5E79Z 4JI6O 1GN2A 3RVZA 1GM9A 3K3WA 3UQ8A 4DW0A 3UT5A 4LFCO 3CRCA 4EEQA 3OMNB 5KMGA 2ADQB 1VQ7V 4UV8A 3SJCC 1YVWA 2YSUB 2UUBB 1NS1A 2QM7A 2Q7GA 1N34B 1AVMA 4MT8A 3RYFB 2XUMA 5BR8O 2R9AA 1K73W 5IJ9B 4LC1A 4I50B 3S3XA 4B7EA 4K8ZA 3LSUA 2N74A 3SPIA 5L3FA 4X1IB 1BS3A 3ASOB 3ABMC 1K4DC 1JJOA 5JJNB 1IBMO 5JQGA 2B9ZA 2GHYA 1GRJA 1SF9A 2HEPA 2EIKB 3E83A 3TJTA 4Q20A 1AJPA 1TUBA 1HP8A 4DV1O 3FB5C 2ATKC 3QO8A 2Y0IA 2ZXWC 5LGNA 3E89A 2ZINA 3ZHTA 5CA0B 3T1HB 2H94A 3QO7A 4LF5O 1GN4A 1OV9A 3E8FA 2QEXV 4I0XA 1NBMG 3JD4A 4O2BA 1PP9H 3K57A 3P32A 5L3BA 3UO2A 2B5UA 2M6YA 2CTPA 1WP8A 4MVQA 4TV9A 5EBWC 1EM1A 1O9HA 3OMIB 3RGBA 4FJCC 1S72V 3GVMA 2ZDIA 3MAQA 1K5QA 4JYAB 3GWOA 2DQ0A 1Y76A 3RWRD 4NTWA 4PA7A 4I5SA 3H1IH 2X6AA 4HZ3A 4PDLA 2DQ3A 1NT2B 4OPAA 4GKJB 3RN4A 1GH6A 3JASB 3CCQV 2OT5A 2XAGA 5CBGA 4RUEA 2P67A 5B1NA 2JIZG 3ZMZA 4D7TA 1A32A 2VS0A 2YXHA 2R9RB 1YITV 3JSLA 1W59A 3OD4A 1FXKB 1IDSA 1CPYA 1JCHA 2QJ1A 4DR3B 1JVMA 5JCOA 2DE0X 4FLZA 3L72H 1VQKV 4KHPO 5DM6V 4PA3A 3P30A 4BR6A 4QNHB 2HKOA 3RYFA 4U7NA 2KG7B 1THZA 2QKCA 1NVPB 3P3NA 1L1FA 2UXCB 4L87A 5IY5B 1PNLA 2AW9A 2Y0PA 2CE4A 5F2VO 5KX5B 1QLEB 3OT7A 3E8GA 4X1IA 5CA3A 1Q7YW 4NR1A 1M1KW 2A7WA 2ZT9B 4DR4B 3BEHA 3ABLC 3N2KA 3U11A 4UCVA 3PJSK 1OCRB 2ZNJA 4UCUA 5GTIZ 1BMFG 5B1BC 4DUYB 2F95B 2E3CA 1ZL8B 5LXTA 3K79A 3C3SA 1SQVH 2PI5A 1M57B 3SJAC 4F6RB 2OTJV 1FJGB 1H38A 2H8PC 5HFLA 1XMOB 5CA0A 1N8RW 4JV5O 3K5OA 1IBKO 4FIPC 2E5LO 1IVSA 4N21A 4B3TO 3OTOB 2YI9A 2Y4TA 4IHJB 2XHBA 3HKCA 4JPRA 4DV2B 3CE2A 1WNSA 1B04A 2ZKOA 1NVPD 2ITCC 2BOCC 2IH3C 1QHTA 2XOKG 3S3WA 1WA8B 4DV4O 4J80A 2EINB 1K8AW 2HFEC 1KECA 1PKXA 1H2GA 1URFA 1E1QG 1FPOA 3K9SA 4MTGA 3G6BA 4X88A 5BMVA 5LP6B 2DWEC 4ZHQA 3FYIB 2AHYA 3K06A 3CXCU 3OM3B 2OCCC 2VQEB 2F66C 1S5LZ 3VQWA 1YJNV 1DF4A 4HAMA 1SZXA 3FAVB 2LGQA 3VQXA 2K9PA 3E8BA 5KHJA 1SQQH 1XNRB 3EFFK 4H44B 2Q68A 1Q8IA 2YC0A 5K1XA 1VQ4V 5GW7A 1R3IC 4JF3A 4GUNA 3OGIB 3ZRSA 1AB3A 1HW7A 1IXBA 2K1EA 4JI1B 1SETA 2WPDG 4O4LA 1QR8A 4U3JB 4XDLA 1AR5A 1CXZB 5KX5A 2NNUA 2ZR2A 4DR1B 1AILA 2CTRA 4OPHA 5EK0A 3HKEB 2ZR3A 2JJ2G 4AQYO 4LF7B 4AHCA 2QSAA 2ODMA 3CRQA 2CK3G 2LW7A 1ZX3A 3IC7A 1B6QA 2QWPB 2EIJC 1V54B 4IYHA 4DO2A 2ILMA 2IU0A 1ENVA 1W0JG 2AZ0A 3E86A 1OCZB 2UU9B 3HB3B 1P84F 2QKSA 4WBNB 3CP1A 4X64O 2N05A 1W2BU 4BW5A 1O9GA 1MOFA 1UJWB 5B3SC 1PL0A 3H01A 1EBOA 2UUCB 3RYCB 1S77D 5LHHA 1QCEA 4PA6A 4B3RB 3ABKB 2X6BA 4FM2A 2DYSC 3NR7A 5IE9A 4LR3A 1R6NA 3SYOA 1M9NA 1QU7A 1Y74B 1NJIW 1S5HC 2KSDA 3MHHC 4HYOA 4LBEC 1WPBA 2F93B 4GT1A 4JI0B 2UXBO 2DYRC 2YS8A 1WA8A 1QR9A 3B09A 3CCMV 4Z2WA 2Q5ZA 3T4DA 2VWKA 2GUZB 4I55A 4LF9B 1NQTA 4G28B 4X62O 1YSCA 2OTLV 5EBLC 3CPWU 4NXNO 1NR7A 1YDXA 1HNXB 2HHHB 4DV7B 1RM1C 4JI3B 3L73H 1XEQA 2V4DA 2PGGA 5LHGA 3BPZA 1HR0O 1PNKA 2QWRB 5LBQA 3UT5B 1J5EB 2G38A 2BSKA 2Q4PA 4J9YB 2YUAA 4YY3B 4QIWF 3FAVA 4IL6Z 3JCZA 4P9PA 3TK1A 1H8HG 3JATA 2P6JA 2DJVA 2ZIOA 2F1MA 3LDEA 4ZOLA 2Y69B 1QBZA 3C3TA 1KB9F 4NXMB 1MA1A 3D3QA 1JFFA 3CCEV 2QM8A 3JAKA 3P3PA 4FM0A 1OCOB 1WP7A 5IYCO 5HFMA 3ZEDA 4DV3B 4DV5B 1Q90D 3A0HZ 4FZ0A 1XNQB 4UVCA 4IIJB 2EILB 2Q0AA 3AG4B 3WFVA 3U10A 3SPHA 4EKWA 4TQDA 1XHXA 5JQGB 3AG2B 3GWKC 3A0BZ 5KA6A 5LHIA 2QTOA 3TETA 4WFGA 3K9AA 1VQ5V 2VQFO 4JI2B 3T4ZA 3W7XA 1I7FA 1Y66A 2P06A 4OX9O 2XASA 2YEVB 2YDEA 1M56C 3UM7A 4MW8A 1W0KG 1EN6A 1AJQA 3B77A 3OE7G 3VQYA 2ZE7A 3F5WC 2CGOA 1XHZA 4UCSA 1BT8A 5FPOA 4PI0A 4NB5A 1G6UA 1GK9A 4O2BB 4DR2B 2QKAA 3LSSA 2Q9LA 1K7DA 3X2QB 1IXMA 5LOVB 1I94B 1Q82W 1GO3F 3ZHQA 2AGAA 1Y74A 1AI7A 1HWYA 1IBLB 4YJ2B 1N33O 2HVJC 2YIDA 4MVMA 2BCCH 1SKVA 1RSOB 4XDJA 2IW5A 2LFSA 2PTMA 4RAIA 3ZJZA 3ZHRA 4B3SB 4XBFA 1SQFA 4WCEV 2GUZA 4GX1A 4X89A 3R66A 4K8XA 3ICXA 4WFHA 2JGUA 1VQOV 3IAYA 5KA5A 1OCCC 3BFRA 4WFFA 1GAXA 5CMUA 5E1AC 3AG7A 1LNQA 2RNBA 1VMGA 4MVZA 4I9WA 4JI7B 4K0KB 5J9PC 5LMNB 3JD0A 3T1CA 4JI4B 4LFAO 2IJKA 3IJ4A 3W7WA 1MABG 1Q3EA 2GTSA 3SYQA 4UCOA 4NVPA 4JAVA 3SR2C 3ZN0A 4LF6B 5BY1A 1WB8A 3J81N 4QE9A 2RN9A
chains in the Genus database with same CATH topology
4JI8O 2VQFO 4DR4O 4JI2O 4DR2O 4OX9O 2Z0AA 4LF8O 2UXCO 4LFBO 3RT3C 1F7YA 2DOSA 1YZBA 1DK1A 4DV1O 5H5NA 2VQEO 2UXBO 4JI0O 3F5TA 5IWAO 1N36O 4JI5O 4DUZO 4X66O 2UXDO 1FYJA 3T1HO 4LF9O 4LF5O 4X62O 1XNRO 1KUQA 4NXNO 1FKAO 4DR6O 1HNXO 2ZM6O 5IT9N 1HNWO 1I94O 2AGAA 2HHHO 5LL6Y 4DV7O 4LF4O 4JI3O 4DR7O 1XEQA 1AB3A 1R1BA 4X65O 4DUYO 3SDLA 1N33O 1IBLO 1HR0O 4JI1O 4JI6O 1J5EO 1AILA 4OPHA 4DR1O 3T1YO 1FJGO 4JYAO 4B3SO 4YY3O 4LFCO 1XMOO 4AQYO 3R66A 4LF7O 2FKXA 4B3MO 2DJVA 5LMUO 4YHHO 4JV5O 2LW7A 4OPAA 1IBKO 2E5LO 1N32O 4GKJO 2UUBO 1NS1A 5BXZA 3M8AA 4GKKO 4B3TO 1N34O 3J80N 3O65A 4NXMO 3OTOO 5BR8O 5FLXN 4DV0O 2F4VO 3JAMN 4DR5O 4JI7O 2UU9O 1R6TA 4X64O 4K0KO 5LMNO 4DV2O 2ZKOA 4A5UB 4JI4O 3J7AU 4LFAO 1A32A 2JRIA 2N74A 4DV3O 1G1XB 4DV5O 5A2QN 1D2DA 1XNQO 1X59A 4DV4O 1HNZO 2UUCO 4DR3O 4DV6O 4B3RO 4LF6O 5BY1A 2UUAO 3J81N 4KHPO 1IBMO 1XMQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 O;  2VQF O;  4DR4 O;  4JI2 O;  4DR2 O;  4OX9 O;  2Z0A A;  4LF8 O;  2UXC O;  4LFB O;  3RT3 C;  1F7Y A;  2DOS A;  1YZB A;  1DK1 A;  4DV1 O;  5H5N A;  2VQE O;  2UXB O;  4JI0 O;  3F5T A;  5IWA O;  1N36 O;  4JI5 O;  4DUZ O;  4X66 O;  2UXD O;  1FYJ A;  3T1H O;  4LF9 O;  4LF5 O;  4X62 O;  1XNR O;  1KUQ A;  4NXN O;  1FKA O;  4DR6 O;  1HNX O;  2ZM6 O;  5IT9 N;  1HNW O;  1I94 O;  2AGA A;  2HHH O;  5LL6 Y;  4DV7 O;  4LF4 O;  4JI3 O;  4DR7 O;  1XEQ A;  1AB3 A;  1R1B A;  4X65 O;  4DUY O;  3SDL A;  1N33 O;  1IBL O;  1HR0 O;  4JI1 O;  4JI6 O;  1J5E O;  1AIL A;  4OPH A;  4DR1 O;  3T1Y O;  1FJG O;  4JYA O;  4B3S O;  4YY3 O;  4LFC O;  1XMO O;  4AQY O;  3R66 A;  4LF7 O;  2FKX A;  4B3M O;  2DJV A;  5LMU O;  4YHH O;  4JV5 O;  2LW7 A;  4OPA A;  1IBK O;  2E5L O;  1N32 O;  4GKJ O;  2UUB O;  1NS1 A;  5BXZ A;  3M8A A;  4GKK O;  4B3T O;  1N34 O;  3J80 N;  3O65 A;  4NXM O;  3OTO O;  5BR8 O;  5FLX N;  4DV0 O;  2F4V O;  3JAM N;  4DR5 O;  4JI7 O;  2UU9 O;  1R6T A;  4X64 O;  4K0K O;  5LMN O;  4DV2 O;  2ZKO A;  4A5U B;  4JI4 O;  3J7A U;  4LFA O;  1A32 A;  2JRI A;  2N74 A;  4DV3 O;  1G1X B;  4DV5 O;  5A2Q N;  1D2D A;  1XNQ O;  1X59 A;  4DV4 O;  1HNZ O;  2UUC O;  4DR3 O;  4DV6 O;  4B3R O;  4LF6 O;  5BY1 A;  2UUA O;  3J81 N;  4KHP O;  1IBM O;  1XMQ O; 
#chains in the Genus database with same CATH topology
 1CEZ A;  4L8J A;  1F4N A;  4DR4 O;  2RQ6 A;  4TSF G;  2DN9 A;  2NLJ C;  5H6Q A;  1ZWI C;  4MW3 A;  2ITD C;  4LF8 B;  4CH5 A;  4LFB B;  1BHB A;  4BAY A;  3OEE G;  2ZE5 A;  4J10 A;  3RYI B;  3CJH A;  4LH7 A;  3AG1 B;  1KKD A;  1JJ2 U;  2KQX A;  2DW4 A;  4IIJ A;  1N36 O;  1N0J A;  4CH3 A;  1IUR A;  2HJD A;  1VEW A;  3N2K B;  1IX9 A;  2X6C A;  1JPX A;  4DRX B;  1NTM H;  3CWB H;  3AK2 A;  4CS4 A;  4I4T B;  2NN4 A;  4DR6 B;  1H2S B;  2ZM6 B;  1FS0 G;  2QM4 A;  3BVO A;  3SJB C;  1Q5O A;  2YEV A;  4LF4 O;  3SJQ C;  5LXT B;  1KD1 W;  1BL8 A;  4EB6 A;  3SDL A;  1PPJ H;  5B1A B;  3LNN A;  3WG7 B;  3K03 A;  1H2L A;  3T1Y B;  1VF7 A;  4TQF A;  4FK5 C;  4JYC A;  1U96 A;  1V55 B;  4WF9 V;  4F4L A;  1PV0 A;  4B3M O;  2V1D A;  3DSQ A;  1JA8 A;  1XOU A;  3I5D A;  2Q6A A;  1N32 O;  2P22 C;  1R3K C;  3H1J H;  5LOV A;  3ZMU A;  4GKK O;  4FMT A;  2L6L A;  3J80 N;  3CXH F;  1KQS U;  2V7Q G;  3HKC B;  4DV0 O;  4YJ2 A;  4DR5 O;  1YIJ V;  3OR7 C;  4H0L B;  3MDS A;  1SZT A;  1RSO A;  1G1X B;  2BTO A;  4TUY B;  4JTC B;  1AI5 A;  4U3F H;  1ROP A;  4O4I B;  1X59 A;  2WA4 A;  1HNZ O;  4D7S A;  4DV6 B;  5BMV B;  1V9P A;  4ZHQ B;  4JI8 B;  1Z2G A;  3K5N A;  3FB6 C;  1GTO A;  4J7K A;  2VWJ A;  4QJF B;  2XAF A;  2QWN B;  2QA4 V;  2CTW A;  2DOS A;  1JOY A;  1KMI Z;  5ITZ A;  3F5T A;  3WB0 A;  4DW1 A;  3CC7 V;  4DXW A;  4X66 B;  4DUZ O;  1WN7 A;  3I55 V;  2UXD B;  2PUS A;  1FFT B;  4JTA B;  2OYQ A;  5D5P A;  1VF6 A;  4LWS B;  2EIM C;  4LP8 A;  1FKA O;  3CYO A;  3ZX6 A;  2IH1 C;  1TA8 A;  5D5Q A;  1HNW B;  1S5J A;  4NYK A;  4JYY A;  2QE7 G;  4DR7 O;  3K04 A;  4O4L B;  1BQ0 A;  3RYI A;  4JI6 B;  2BTQ A;  2RCV A;  1XIL A;  3CB2 A;  4R6Z A;  4H13 B;  1KU9 A;  2P4K A;  2XTA A;  3K0G A;  3K08 A;  2JS3 A;  2YXL A;  4LFC B;  2HLD G;  3AG3 B;  3BAB A;  1DGS A;  1NZ6 A;  2GV9 A;  4DRX A;  2E75 B;  4YIP A;  5LMU O;  4I4T A;  2W6J G;  4YHH O;  1I0H A;  1QQC A;  5KUK A;  2YI8 A;  5BR8 B;  4LNU B;  1JQ0 A;  1BCC H;  2ZE6 A;  3ZBH A;  2AZ2 A;  4RUF A;  3KKY A;  5FPR A;  1Y6X A;  3J7A U;  4KUM A;  5EIB C;  2CUG A;  4IT5 A;  1VIB A;  5C8Y B;  1ZUQ A;  4JTD B;  2YIC A;  1IBM B;  1VQ9 V;  2UUA O;  3CCS V;  1ORQ C;  4FM1 A;  4TV8 A;  1NTK H;  3W7U A;  1K34 A;  1N0N A;  3K5L A;  3G4S V;  5JH7 B;  4DV1 B;  3VBB A;  2P5O A;  1DK1 A;  4MTO A;  4TUY A;  4XDK A;  4JI5 O;  1NR1 A;  4O4I A;  4I55 B;  3D8C A;  2JEX A;  3TGU H;  2HJF C;  3D36 A;  4WFE A;  5CBF A;  2QR4 A;  4FFB B;  4LF5 B;  1YXB A;  3L70 H;  1NH2 B;  3L71 H;  2B1G A;  3ETQ A;  4PA4 A;  4GYC B;  4GCZ A;  1TAE A;  3QVN A;  3ZHS A;  3ABM B;  5KHH A;  5EYP B;  4FLU A;  2Y48 A;  2BSK B;  4CH6 A;  2IM9 A;  5IYB O;  3BHP A;  1YJ9 V;  4J7J A;  3OMA B;  3JAT B;  4O4H A;  5J2T A;  1L8D A;  4MVO A;  4J42 A;  1CP9 A;  5FL7 G;  4ZOL B;  4O4J A;  3CRM A;  4LWS A;  1XUQ A;  4ABM A;  2JS5 A;  3WB2 A;  3ASN C;  1MZE A;  4RWU A;  2ZDI C;  1JFF B;  3DC5 A;  1NU1 H;  3SPG A;  2LGW A;  2O57 A;  2ZXW B;  3JAK B;  4FLT A;  4GX5 A;  3H9V A;  3ZN1 A;  1Q86 W;  2F4V O;  2XAH A;  3OEH G;  4HNA B;  3E22 B;  5LYJ A;  4YIO A;  5GON B;  2JRI A;  1D5A A;  1FAF A;  4RQE A;  2A3Q A;  5A2Q N;  2GTA A;  1GM8 A;  3H1H H;  3FFQ A;  4YXW G;  2B1I A;  3KCX A;  3KZI Z;  3ZRX A;  4UCT A;  4KHP B;  5JWP A;  2PY5 A;  4UV9 A;  1XMQ O;  5H2F Z;  4LNU A;  4DR2 O;  1SQP H;  2Z0A A;  1NH2 D;  3DTU B;  2IJJ A;  2AHZ A;  3SGI A;  4RO2 A;  1TVK A;  3E2E A;  3ZIA G;  1F7Y A;  5JCO C;  4GX2 A;  5IWA O;  2Q7E A;  5C8Y A;  5IYZ B;  2HG5 C;  1SS3 A;  1GKF A;  1L0L H;  4PJ0 Z;  4ZBM A;  3K5M A;  1Q6H A;  5C93 A;  2PYJ A;  3GB7 C;  3SYP A;  3CS5 A;  3JCU Z;  3THO A;  3OUS A;  3APO A;  2RDC A;  1H8E G;  2C2A A;  3QTC A;  3CRA A;  2P4V A;  1RFY A;  5EBM C;  3ASO C;  4X65 O;  2PI4 A;  1RPO A;  5JH7 A;  4PDM A;  4N23 A;  1US6 A;  3A2F A;  3B8N A;  1KP2 A;  3JAW A;  1N4C A;  4R8C A;  3ABU A;  2EIK C;  3CCR V;  3KCY A;  1P7B A;  4FFB A;  4JV5 B;  1IBK B;  2E5L B;  3ZRV A;  3ZHV A;  1OZ0 A;  3JAL A;  2UUB O;  2IJH A;  4B3T B;  1Y67 A;  1AJN A;  3EXA A;  1N34 O;  3BAA A;  4MVR A;  1GN6 A;  3L75 H;  5EYP A;  2WLN A;  3CHX A;  1RP3 B;  3HKB A;  1H2N A;  1H2K A;  3ABL B;  4WFB V;  4E2L A;  3F7Y C;  3HPL C;  1AP6 A;  4DV4 B;  1LR1 A;  5B1B B;  4AIL C;  1VQ6 V;  2ARH A;  2GBO A;  1R3L C;  4Q6G A;  3RFR A;  4BIU A;  4ZI7 A;  4PDV A;  4MTX A;  4DK0 A;  4ASU G;  1WAZ A;  2E76 B;  1DLB A;  2W0F C;  1M4U A;  2WLL B;  2Y4U A;  3D3I A;  1TUE B;  1MZF A;  3CJH B;  3STZ C;  4HNA A;  5KAI Z;  1Q43 A;  3E22 A;  1KKC A;  5GON A;  3A0R A;  1VP7 A;  3AK3 A;  1KP3 A;  1M5I A;  3KG2 A;  1JR9 A;  4KXR A;  4FFK A;  3T1H O;  3K59 A;  3ZMT A;  5J2U B;  5L3E A;  4QGP A;  1MMM A;  1FXK C;  4EB6 B;  2QWQ B;  2IU3 A;  4PEL A;  3DC6 A;  1J95 A;  5IYZ A;  1P4R A;  3CC4 V;  2P90 A;  4F6E A;  4JYA O;  3BY6 A;  2EJ7 A;  3QNE A;  5IJ0 B;  4AQY B;  1E79 G;  2W6I G;  4B7K A;  2XT9 A;  4W4L A;  5IY5 C;  2OCC B;  4NKG B;  4X1Y A;  4GKJ O;  1VQ8 V;  5BXZ A;  1BHA A;  1QLE C;  2WLI A;  5EZY B;  1SA0 B;  2X0L A;  2F23 A;  3L74 H;  5L3G A;  3O9O A;  4X64 B;  4BWA A;  3M99 B;  3EVK A;  5EIB D;  1JX9 A;  2WA3 A;  4TT3 G;  5FNV A;  1OCR C;  3UCS C;  3ASN B;  1DTO A;  2FTK A;  3RYH B;  4UXN A;  2LW1 A;  4CC6 A;  4DR3 O;  2Z5U A;  3CEI A;  3LDD A;  3FB7 C;  1XL4 A;  4J11 A;  3VOU A;  4P9O A;  4R50 A;  3G80 A;  2UXC O;  5CN0 A;  1DF5 A;  4IYI A;  2P7T C;  5ITZ B;  4CZZ A;  3QG5 A;  2EIJ B;  1YCI A;  1EZJ A;  3HKD A;  4O2A A;  3T2M A;  1UPG A;  1YI2 V;  1ZSP A;  1MG1 A;  4X62 B;  2Q8V A;  4NXN B;  1KUQ A;  3CSX A;  1VF5 B;  5B3S B;  2WLL A;  2BOB C;  3R65 A;  2BTQ B;  2EIN C;  4LCU C;  5KHK A;  2LO1 A;  1HR0 B;  3B2E E;  4DUY O;  1S0V A;  1IZ3 A;  4AI8 A;  2OWO A;  3F7V C;  2DYS B;  1JMK C;  3E8H A;  4C7U A;  1FJG O;  1WJZ A;  5LP6 C;  3CC2 V;  1XMO O;  2XAQ A;  4UVB A;  3BCC H;  1PM9 A;  1I5X A;  1F23 A;  3LNM B;  1HDJ A;  3BA9 A;  2DYR B;  5B66 Z;  4B08 A;  5J2U A;  4JAS A;  5LGT A;  4UFZ A;  1ZTE A;  3E35 A;  3CCL V;  3OTO O;  2IBZ H;  5LA6 B;  5JJJ B;  3SPC A;  2WLK A;  1XQ8 A;  2W0X A;  4OGQ B;  5BZB A;  4DV2 O;  5KHG A;  2GSM B;  2YIA A;  1D2D A;  5IJ0 A;  4EFB A;  3N27 A;  3N2G B;  1RM1 B;  4IGG A;  3OTF A;  2EBO A;  2CAZ C;  4ICG A;  5H6R A;  2UXX A;  5CB4 B;  3APQ A;  2Q0O C;  3UKM A;  2ZNI A;  2VQF B;  1KBH A;  4TV8 B;  2R72 A;  5EZY A;  1SA0 A;  4OX9 B;  4U7O A;  2CGN A;  4K35 A;  1GMG A;  1AI4 A;  2Z3Y A;  3JD1 A;  4X1K A;  5JVD A;  3Q4H B;  2VQE O;  1AI6 A;  1V54 C;  3JYC A;  1S3J A;  1SQX H;  5DN6 G;  3SPJ A;  3ZCC A;  2PYL A;  3CD6 V;  1SQB H;  2JEU A;  3RYH A;  2QWO B;  1QVG U;  2WSS G;  1TGO A;  2X7R B;  1OCZ C;  4EFE A;  4BIO A;  2HVK C;  4CH4 A;  1Z5W A;  2CDY A;  1QVF U;  2ETN A;  4X8A A;  1XNR O;  3STL C;  4Z1V A;  2QTS A;  3WB1 A;  3FX7 A;  1AR1 B;  4HBN A;  4JZG A;  1N33 B;  1PD3 A;  4JI1 O;  4PHZ A;  4ZIB A;  3ABK C;  4O4H B;  5J2T B;  3U0Z A;  4LH6 A;  3CCJ V;  1Q6I A;  4DR1 O;  4O4J B;  1GN3 A;  4LF7 O;  4PA9 A;  1M56 B;  3RVY A;  2M7W A;  2ZD9 A;  5CA1 B;  1NI8 A;  3UO3 A;  3K58 A;  3M7M X;  4ZKI A;  3JAR B;  3OUF A;  1S76 D;  2F43 G;  4UVA A;  1F4M A;  1MNG A;  4QPK A;  5LYJ B;  2QGN A;  1FFX B;  1X4T A;  2UU9 O;  1FXH A;  2UXN A;  5IJ9 A;  4LFA B;  5L3D A;  1L0N H;  5L3C A;  4I50 A;  1AR4 A;  3IFX A;  1Q6U A;  4JAA A;  2UUC O;  4B3R O;  1WLE A;  2MK3 A;  3CMA V;  2DWD C;  3JD3 A;  3JD2 A;  1T5E A;  3TXS A;  1TVK B;  5LA6 A;  3ABT A;  3TCU A;  2ZIM A;  3QO5 A;  1PNM A;  2DMX A;  4H33 A;  2AXT Z;  1EN5 A;  4KL1 A;  5H5N A;  1OHH G;  1OCC B;  4NTX A;  4JI0 O;  1N36 B;  2Y69 C;  4G2K A;  1LUW A;  3N2G A;  1H2M A;  2XND G;  4P30 A;  3OR6 C;  5TIS Z;  3JSN A;  1YHQ V;  4LF9 O;  1OCO C;  5CB4 A;  2L35 A;  4QPJ A;  3PN1 A;  4G27 B;  2QDO A;  1HNX O;  2BE3 A;  5AG2 A;  2EIL C;  3AG4 C;  2HHH O;  4LF4 B;  1VQL V;  5LL6 Y;  4DV7 O;  4JI3 O;  1AP5 A;  1R1B A;  4I9Q A;  3VQV A;  3AG2 C;  3DXR B;  3Q4H A;  3MD0 A;  3JAW B;  1J5E O;  4MVU A;  3ZRW B;  1XI1 A;  4YY3 O;  2FYU H;  5DEC A;  3AEI A;  3ETE A;  4B3M B;  3H1K H;  1NTZ H;  3JAL B;  5B5E Z;  1XBL A;  3B40 A;  3CME V;  4CC5 A;  1N32 B;  3B4S A;  3OW2 U;  1F51 A;  4GKK B;  5IDJ A;  3C90 A;  3M8A A;  2EJR A;  2A9H A;  2YXY A;  3O65 A;  4NXM O;  3HKB B;  2D3O W;  4DV0 B;  1EFR G;  2A79 B;  5FLX N;  4K3A A;  1U97 A;  4DR5 B;  2XAJ A;  4TWK A;  3JAS A;  3BRC A;  1SQG A;  4J7Z A;  5CBH A;  2Q69 A;  1LUV A;  5KHI A;  4PDR A;  4DV3 O;  1M93 A;  3X2Q C;  3ETD A;  4DV5 O;  3CX5 F;  1XNQ O;  1R73 A;  2WLH A;  1HNZ B;  1FXK A;  3IC9 A;  1RPR A;  4ZI7 B;  1GM7 A;  1NKD A;  5CA1 A;  3HR0 A;  3LUT B;  1EN4 A;  3JAR A;  2A06 H;  2Q67 A;  1QNM A;  4FVM A;  4JI2 O;  2LFR A;  2R9I A;  1K3E A;  4UB6 Z;  1FFX A;  3L9D A;  2KG7 A;  1YJW V;  2RJZ A;  1XL6 A;  4UUJ C;  1KYO F;  1K92 A;  2NR5 A;  4DUZ B;  1I08 A;  1G4Y B;  3EHB B;  2HP8 A;  5B1O A;  3ZMS A;  1Q81 W;  1E1R G;  1P49 A;  4PV1 B;  4NTY A;  2HR3 A;  1MSD A;  2N04 A;  4FLV A;  1ZLZ A;  1B06 A;  2GDS A;  3G6E V;  5IT9 N;  1K97 A;  1I94 O;  4DR7 B;  2YIB D;  3IGA C;  1IBL O;  2JGD B;  1VF6 C;  1P7G A;  2EZP A;  1ZL8 A;  2WLM A;  4B3S O;  1Y4M A;  5LGU A;  4F6R A;  2LJ2 A;  1KC8 W;  4BW9 A;  2FKX A;  2PF4 E;  4X1Y B;  5LMU B;  4YHH B;  2OIE A;  3B8M A;  3AG1 C;  2WLI B;  2IJI A;  3G71 V;  2CH7 B;  3OGC C;  1SES A;  1UFI A;  4W4K A;  3ZHU A;  1R6K A;  3OFN G;  4JI7 O;  3DXR A;  5IYD O;  1K5S A;  4K0K O;  5FNV B;  3AK1 A;  4IHJ A;  5LMN O;  2EIM B;  4UB8 Z;  4WFA V;  4A5U B;  4JI4 O;  3ZRW A;  4CBC A;  4KFM A;  4PD4 F;  2RMK B;  1YTF B;  3W7T A;  4YJ3 B;  2JK5 C;  4D6T H;  4J41 A;  1ARO P;  5B1A C;  2UUA B;  2MW2 B;  3WG7 C;  2ADP A;  4LF6 O;  1FD9 A;  4R7C A;  2YIB A;  3SYC A;  2ZCE A;  2JVD A;  2KB1 A;  3ETG A;  1VQN V;  1K4C C;  4CS3 A;  1V55 C;  5EC2 C;  5LP6 A;  4LF8 O;  4DK1 A;  4LFB O;  2EZO A;  4PI2 A;  1BE3 H;  3RT3 C;  2R70 A;  4X20 B;  3ZMV A;  3DGE A;  3RW0 A;  5GTH Z;  2OIG A;  4FLX A;  3HKD B;  4O2A B;  4JI5 B;  1D5N A;  1MSW D;  4MTF A;  1SER A;  5H9C A;  1FXV A;  3FYE B;  5KMG B;  1I5Y A;  2LP7 A;  1QLN A;  1R3J C;  4DR6 O;  1B3Q A;  2ZM6 O;  2D2C B;  5K1P A;  1BQZ A;  2A0L A;  4MVS A;  1OJH A;  2JDI G;  2Q73 A;  1G8M A;  4Z1M G;  3D36 C;  4FLW A;  2ZQM A;  1BZK A;  2VRZ A;  3I56 V;  1WPX A;  4OXS A;  3ZS8 C;  4U3J A;  2OCH A;  3T1Y O;  2KKW A;  1XDC A;  4FLY A;  4GX0 A;  3BA8 A;  2ZE8 A;  2LQT A;  3HKE A;  2E74 B;  4JAU A;  1YTF D;  3QF7 A;  2CTQ A;  1COW G;  3H1L H;  3MHS C;  2Q7H A;  5DED A;  2F4V B;  3TXQ A;  5EC1 C;  3CRR A;  3K0D A;  3JAM N;  1Z5V A;  2JGD A;  1R6T A;  1XRE A;  3LSQ A;  4MS2 A;  4UCR A;  1TUB B;  4WBN A;  3A8T A;  3FB8 C;  3ML0 A;  1BSM A;  4TOI A;  3RBZ A;  2PZS A;  1VAR A;  3W7S A;  4JGS A;  1YEW A;  4I7Z B;  4GZR B;  3SYA A;  2EUL A;  2H3O A;  4DV6 O;  4H37 A;  4KP4 A;  4DYL A;  3RYC A;  2CH7 A;  1XMQ B;  4RQF A;  4I0X B;  4JI8 O;  2FB5 A;  4JYB A;  2WAM A;  3AG3 C;  5A9G A;  4JZ2 A;  4X1K B;  1K33 A;  5JVD B;  1SRY A;  4TV9 B;  2WWW A;  4QE7 A;  1M90 W;  3FD9 A;  1VQP V;  1SC5 B;  2FL4 A;  1YZB A;  5IWA B;  1K9M W;  3G67 A;  4P2Z A;  4X66 O;  5KUM A;  4YJ3 A;  4GLX A;  1Y76 B;  2UXD O;  1YF2 A;  5KLV H;  1BGY H;  3WU2 Z;  1FYJ A;  1M57 C;  1PL4 A;  2WLJ A;  3NXS A;  3OAA G;  4BIZ A;  3LDC A;  5KAF Z;  1ZAU A;  4CS2 A;  4X9Q A;  2FML A;  3FKS G;  1VQM V;  3CCU V;  4MSW C;  4J9Z B;  1EZV H;  2JJ1 G;  1HNW O;  4FZ1 A;  5JJE B;  4E4E A;  4FPP A;  2UXB B;  3CCV V;  4X65 B;  2EX3 A;  1WB7 A;  4X20 A;  5E79 Z;  4JI6 O;  1GN2 A;  3RVZ A;  1GM9 A;  3K3W A;  3UQ8 A;  4DW0 A;  3UT5 A;  4LFC O;  3CRC A;  4EEQ A;  3OMN B;  5KMG A;  2ADQ B;  1VQ7 V;  4UV8 A;  3SJC C;  1YVW A;  2YSU B;  2UUB B;  1NS1 A;  2QM7 A;  2Q7G A;  1N34 B;  1AVM A;  4MT8 A;  3RYF B;  2XUM A;  5BR8 O;  2R9A A;  1K73 W;  5IJ9 B;  4LC1 A;  4I50 B;  3S3X A;  4B7E A;  4K8Z A;  3LSU A;  2N74 A;  3SPI A;  5L3F A;  4X1I B;  1BS3 A;  3ASO B;  3ABM C;  1K4D C;  1JJO A;  5JJN B;  1IBM O;  5JQG A;  2B9Z A;  2GHY A;  1GRJ A;  1SF9 A;  2HEP A;  2EIK B;  3E83 A;  3TJT A;  4Q20 A;  1AJP A;  1TUB A;  1HP8 A;  4DV1 O;  3FB5 C;  2ATK C;  3QO8 A;  2Y0I A;  2ZXW C;  5LGN A;  3E89 A;  2ZIN A;  3ZHT A;  5CA0 B;  3T1H B;  2H94 A;  3QO7 A;  4LF5 O;  1GN4 A;  1OV9 A;  3E8F A;  2QEX V;  4I0X A;  1NBM G;  3JD4 A;  4O2B A;  1PP9 H;  3K57 A;  3P32 A;  5L3B A;  3UO2 A;  2B5U A;  2M6Y A;  2CTP A;  1WP8 A;  4MVQ A;  4TV9 A;  5EBW C;  1EM1 A;  1O9H A;  3OMI B;  3RGB A;  4FJC C;  1S72 V;  3GVM A;  2ZDI A;  3MAQ A;  1K5Q A;  4JYA B;  3GWO A;  2DQ0 A;  1Y76 A;  3RWR D;  4NTW A;  4PA7 A;  4I5S A;  3H1I H;  2X6A A;  4HZ3 A;  4PDL A;  2DQ3 A;  1NT2 B;  4OPA A;  4GKJ B;  3RN4 A;  1GH6 A;  3JAS B;  3CCQ V;  2OT5 A;  2XAG A;  5CBG A;  4RUE A;  2P67 A;  5B1N A;  2JIZ G;  3ZMZ A;  4D7T A;  1A32 A;  2VS0 A;  2YXH A;  2R9R B;  1YIT V;  3JSL A;  1W59 A;  3OD4 A;  1FXK B;  1IDS A;  1CPY A;  1JCH A;  2QJ1 A;  4DR3 B;  1JVM A;  5JCO A;  2DE0 X;  4FLZ A;  3L72 H;  1VQK V;  4KHP O;  5DM6 V;  4PA3 A;  3P30 A;  4BR6 A;  4QNH B;  2HKO A;  3RYF A;  4U7N A;  2KG7 B;  1THZ A;  2QKC A;  1NVP B;  3P3N A;  1L1F A;  2UXC B;  4L87 A;  5IY5 B;  1PNL A;  2AW9 A;  2Y0P A;  2CE4 A;  5F2V O;  5KX5 B;  1QLE B;  3OT7 A;  3E8G A;  4X1I A;  5CA3 A;  1Q7Y W;  4NR1 A;  1M1K W;  2A7W A;  2ZT9 B;  4DR4 B;  3BEH A;  3ABL C;  3N2K A;  3U11 A;  4UCV A;  3PJS K;  1OCR B;  2ZNJ A;  4UCU A;  5GTI Z;  1BMF G;  5B1B C;  4DUY B;  2F95 B;  2E3C A;  1ZL8 B;  5LXT A;  3K79 A;  3C3S A;  1SQV H;  2PI5 A;  1M57 B;  3SJA C;  4F6R B;  2OTJ V;  1FJG B;  1H38 A;  2H8P C;  5HFL A;  1XMO B;  5CA0 A;  1N8R W;  4JV5 O;  3K5O A;  1IBK O;  4FIP C;  2E5L O;  1IVS A;  4N21 A;  4B3T O;  3OTO B;  2YI9 A;  2Y4T A;  4IHJ B;  2XHB A;  3HKC A;  4JPR A;  4DV2 B;  3CE2 A;  1WNS A;  1B04 A;  2ZKO A;  1NVP D;  2ITC C;  2BOC C;  2IH3 C;  1QHT A;  2XOK G;  3S3W A;  1WA8 B;  4DV4 O;  4J80 A;  2EIN B;  1K8A W;  2HFE C;  1KEC A;  1PKX A;  1H2G A;  1URF A;  1E1Q G;  1FPO A;  3K9S A;  4MTG A;  3G6B A;  4X88 A;  5BMV A;  5LP6 B;  2DWE C;  4ZHQ A;  3FYI B;  2AHY A;  3K06 A;  3CXC U;  3OM3 B;  2OCC C;  2VQE B;  2F66 C;  1S5L Z;  3VQW A;  1YJN V;  1DF4 A;  4HAM A;  1SZX A;  3FAV B;  2LGQ A;  3VQX A;  2K9P A;  3E8B A;  5KHJ A;  1SQQ H;  1XNR B;  3EFF K;  4H44 B;  2Q68 A;  1Q8I A;  2YC0 A;  5K1X A;  1VQ4 V;  5GW7 A;  1R3I C;  4JF3 A;  4GUN A;  3OGI B;  3ZRS A;  1AB3 A;  1HW7 A;  1IXB A;  2K1E A;  4JI1 B;  1SET A;  2WPD G;  4O4L A;  1QR8 A;  4U3J B;  4XDL A;  1AR5 A;  1CXZ B;  5KX5 A;  2NNU A;  2ZR2 A;  4DR1 B;  1AIL A;  2CTR A;  4OPH A;  5EK0 A;  3HKE B;  2ZR3 A;  2JJ2 G;  4AQY O;  4LF7 B;  4AHC A;  2QSA A;  2ODM A;  3CRQ A;  2CK3 G;  2LW7 A;  1ZX3 A;  3IC7 A;  1B6Q A;  2QWP B;  2EIJ C;  1V54 B;  4IYH A;  4DO2 A;  2ILM A;  2IU0 A;  1ENV A;  1W0J G;  2AZ0 A;  3E86 A;  1OCZ B;  2UU9 B;  3HB3 B;  1P84 F;  2QKS A;  4WBN B;  3CP1 A;  4X64 O;  2N05 A;  1W2B U;  4BW5 A;  1O9G A;  1MOF A;  1UJW B;  5B3S C;  1PL0 A;  3H01 A;  1EBO A;  2UUC B;  3RYC B;  1S77 D;  5LHH A;  1QCE A;  4PA6 A;  4B3R B;  3ABK B;  2X6B A;  4FM2 A;  2DYS C;  3NR7 A;  5IE9 A;  4LR3 A;  1R6N A;  3SYO A;  1M9N A;  1QU7 A;  1Y74 B;  1NJI W;  1S5H C;  2KSD A;  3MHH C;  4HYO A;  4LBE C;  1WPB A;  2F93 B;  4GT1 A;  4JI0 B;  2UXB O;  2DYR C;  2YS8 A;  1WA8 A;  1QR9 A;  3B09 A;  3CCM V;  4Z2W A;  2Q5Z A;  3T4D A;  2VWK A;  2GUZ B;  4I55 A;  4LF9 B;  1NQT A;  4G28 B;  4X62 O;  1YSC A;  2OTL V;  5EBL C;  3CPW U;  4NXN O;  1NR7 A;  1YDX A;  1HNX B;  2HHH B;  4DV7 B;  1RM1 C;  4JI3 B;  3L73 H;  1XEQ A;  2V4D A;  2PGG A;  5LHG A;  3BPZ A;  1HR0 O;  1PNK A;  2QWR B;  5LBQ A;  3UT5 B;  1J5E B;  2G38 A;  2BSK A;  2Q4P A;  4J9Y B;  2YUA A;  4YY3 B;  4QIW F;  3FAV A;  4IL6 Z;  3JCZ A;  4P9P A;  3TK1 A;  1H8H G;  3JAT A;  2P6J A;  2DJV A;  2ZIO A;  2F1M A;  3LDE A;  4ZOL A;  2Y69 B;  1QBZ A;  3C3T A;  1KB9 F;  4NXM B;  1MA1 A;  3D3Q A;  1JFF A;  3CCE V;  2QM8 A;  3JAK A;  3P3P A;  4FM0 A;  1OCO B;  1WP7 A;  5IYC O;  5HFM A;  3ZED A;  4DV3 B;  4DV5 B;  1Q90 D;  3A0H Z;  4FZ0 A;  1XNQ B;  4UVC A;  4IIJ B;  2EIL B;  2Q0A A;  3AG4 B;  3WFV A;  3U10 A;  3SPH A;  4EKW A;  4TQD A;  1XHX A;  5JQG B;  3AG2 B;  3GWK C;  3A0B Z;  5KA6 A;  5LHI A;  2QTO A;  3TET A;  4WFG A;  3K9A A;  1VQ5 V;  2VQF O;  4JI2 B;  3T4Z A;  3W7X A;  1I7F A;  1Y66 A;  2P06 A;  4OX9 O;  2XAS A;  2YEV B;  2YDE A;  1M56 C;  3UM7 A;  4MW8 A;  1W0K G;  1EN6 A;  1AJQ A;  3B77 A;  3OE7 G;  3VQY A;  2ZE7 A;  3F5W C;  2CGO A;  1XHZ A;  4UCS A;  1BT8 A;  5FPO A;  4PI0 A;  4NB5 A;  1G6U A;  1GK9 A;  4O2B B;  4DR2 B;  2QKA A;  3LSS A;  2Q9L A;  1K7D A;  3X2Q B;  1IXM A;  5LOV B;  1I94 B;  1Q82 W;  1GO3 F;  3ZHQ A;  2AGA A;  1Y74 A;  1AI7 A;  1HWY A;  1IBL B;  4YJ2 B;  1N33 O;  2HVJ C;  2YID A;  4MVM A;  2BCC H;  1SKV A;  1RSO B;  4XDJ A;  2IW5 A;  2LFS A;  2PTM A;  4RAI A;  3ZJZ A;  3ZHR A;  4B3S B;  4XBF A;  1SQF A;  4WCE V;  2GUZ A;  4GX1 A;  4X89 A;  3R66 A;  4K8X A;  3ICX A;  4WFH A;  2JGU A;  1VQO V;  3IAY A;  5KA5 A;  1OCC C;  3BFR A;  4WFF A;  1GAX A;  5CMU A;  5E1A C;  3AG7 A;  1LNQ A;  2RNB A;  1VMG A;  4MVZ A;  4I9W A;  4JI7 B;  4K0K B;  5J9P C;  5LMN B;  3JD0 A;  3T1C A;  4JI4 B;  4LFA O;  2IJK A;  3IJ4 A;  3W7W A;  1MAB G;  1Q3E A;  2GTS A;  3SYQ A;  4UCO A;  4NVP A;  4JAV A;  3SR2 C;  3ZN0 A;  4LF6 B;  5BY1 A;  1WB8 A;  3J81 N;  4QE9 A;  2RN9 A; 
#chains in the Genus database with same CATH homology
 4JI8 O;  2VQF O;  4DR4 O;  4JI2 O;  4DR2 O;  4OX9 O;  2Z0A A;  4LF8 O;  2UXC O;  4LFB O;  3RT3 C;  1F7Y A;  2DOS A;  1YZB A;  1DK1 A;  4DV1 O;  5H5N A;  2VQE O;  2UXB O;  4JI0 O;  3F5T A;  5IWA O;  1N36 O;  4JI5 O;  4DUZ O;  4X66 O;  2UXD O;  1FYJ A;  3T1H O;  4LF9 O;  4LF5 O;  4X62 O;  1XNR O;  1KUQ A;  4NXN O;  1FKA O;  4DR6 O;  1HNX O;  2ZM6 O;  5IT9 N;  1HNW O;  1I94 O;  2AGA A;  2HHH O;  5LL6 Y;  4DV7 O;  4LF4 O;  4JI3 O;  4DR7 O;  1XEQ A;  1AB3 A;  1R1B A;  4X65 O;  4DUY O;  3SDL A;  1N33 O;  1IBL O;  1HR0 O;  4JI1 O;  4JI6 O;  1J5E O;  1AIL A;  4OPH A;  4DR1 O;  3T1Y O;  1FJG O;  4JYA O;  4B3S O;  4YY3 O;  4LFC O;  1XMO O;  4AQY O;  3R66 A;  4LF7 O;  2FKX A;  4B3M O;  2DJV A;  5LMU O;  4YHH O;  4JV5 O;  2LW7 A;  4OPA A;  1IBK O;  2E5L O;  1N32 O;  4GKJ O;  2UUB O;  1NS1 A;  5BXZ A;  3M8A A;  4GKK O;  4B3T O;  1N34 O;  3J80 N;  3O65 A;  4NXM O;  3OTO O;  5BR8 O;  5FLX N;  4DV0 O;  2F4V O;  3JAM N;  4DR5 O;  4JI7 O;  2UU9 O;  1R6T A;  4X64 O;  4K0K O;  5LMN O;  4DV2 O;  2ZKO A;  4A5U B;  4JI4 O;  3J7A U;  4LFA O;  1A32 A;  2JRI A;  2N74 A;  4DV3 O;  1G1X B;  4DV5 O;  5A2Q N;  1D2D A;  1XNQ O;  1X59 A;  4DV4 O;  1HNZ O;  2UUC O;  4DR3 O;  4DV6 O;  4B3R O;  4LF6 O;  5BY1 A;  2UUA O;  3J81 N;  4KHP O;  1IBM O;  1XMQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...