2F4VO

30s ribosome + designer antibiotic
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2f4vO00
4DR3O 2UUBO 4JYAO 5BR8O 1AILA 1IBKO 3RT3C 5LMNO 3F5TA 4B3MO 1N36O 4LF4O 4GKJO 3R66A 1N33O 1HNZO 4LFAO 4DUYO 2ZKOA 2DOSA 5H5NA 5LMUO 1XMOO 5FLXN 1FJGO 4DR2O 2UUCO 1N32O 4LFCO 3O65A 1N34O 4JI3O 3M8AA 2E5LO 1IBMO 3JAMN 4YY3O 4DV5O 4LFBO 1A32A 2HHHO 2LW7A 3T1HO 2UU9O 4B3TO 1IBLO 1I94O 4B3RO 1FYJA 1X59A 4NXMO 2N74A 4JI7O 4LF7O 1NS1A 4DV2O 4B3SO 3J81N 1AB3A 2JRIA 1XNQO 1XNRO 1J5EO 2VQEO 1HNWO 4LF9O 3SDLA 4JI6O 3OTOO 4DR5O 4YHHO 4DV4O 4JV5O 2DJVA 2FKXA 4X65O 5LL6Y 2Z0AA 4JI1O 1F7YA 1D2DA 2AGAA 5BY1A 2F4VO 5BXZA 4AQYO 4X62O 4JI2O 5A2QN 2UXCO 3J80N 4LF5O 4OPAA 4GKKO 2UXBO 4A5UB 4LF8O 4JI4O 4DR4O 4DR7O 4JI0O 3T1YO 1XMQO 4JI5O 3J7AU 4KHPO 2UUAO 4X64O 4DUZO 4DV1O 1G1XB 4OPHA 4DR1O 4JI8O 5IWAO 1DK1A 1XEQA 4DV0O 1YZBA 4K0KO 4LF6O 4OX9O 1KUQA 1R1BA 4DR6O 1R6TA 2UXDO 2ZM6O 4DV7O 1FKAO 4X66O 4DV6O 4NXNO 4DV3O 1HNXO 1HR0O 5IT9N 2VQFO
chains in the Genus database with same CATH superfamily
2CTWA 5EBLC 2RMKB 3OGIB 2EIMB 4OGQB 3OMIB 2AZ0A 1SA0B 1N33O 1B6QA 4LFAO 5BZBA 4WFEA 2GDSA 1OCOB 4CH6A 2ADPA 3X2QC 4QPJA 5LMUO 1FAFA 1P7GA 1XREA 1MABG 1BT8A 2JS3A 2Q5ZA 1NR7A 1OHHG 1XNRB 4EKWA 1VF6A 1N0NA 3JSLA 4YY3O 2Q7EA 4YJ3B 4LFBO 2Q68A 1AP5A 1JJOA 1I94O 3ZRWB 2V7QG 3CCUV 4I4TA 2LQTA 1Q7YW 1JFFA 3E2EA 4X65B 5CB4B 3C90A 3T2MA 1WP7A 4FPPA 3CXCU 4FLTA 1BCCH 3E35A 2HLDG 3K79A 4ZOLA 4WFFA 2F4VB 5DM6V 1KYOF 1V54B 3L75H 5CMUA 5A9GA 2WLKA 3CYOA 1H2MA 3UM7A 3IFXA 4JI1O 4JI0B 2UUAB 3SGIA 5EZYA 2Q69A 3ABTA 4JTDB 4CC5A 2R70A 1AI6A 3LSSA 2PUSA 3CCSV 5J2TB 2HR3A 4DV0B 3BRCA 3W7TA 3UT5A 2IU3A 1QLNA 2NNUA 3PJSK 4QE7A 2HG5C 2ZM6B 4KHPO 3LSQA 1ZL8A 4RAIA 2FL4A 4R50A 4FM0A 1KB9F 2PYLA 3F5WC 2DE0X 4F6EA 1H2SB 1D5AA 2EIKB 3IGAC 4BW5A 3ABLC 3ZBHA 3AG3C 2QKSA 2HKOA 2HVJC 4TQDA 3RBZA 1FXKC 4LH6A 3JASA 2H3OA 1NVPD 3ZMVA 5JH7A 1WAZA 4HBNA 4CC6A 3IAYA 4HZ3A 5B3SC 1XHXA 3DXRB 5BR8O 1VQLV 2P5OA 4MS2A 3RT3C 1IBKO 2LGWA 1H2GA 3AG1C 4B3MO 1N36O 4LF4O 4GKJO 2F23A 4UV9A 5LP6B 2UU9B 3QO5A 4B3TB 3H1LH 3EHBB 1XILA 1FJGO 2Y69B 5LYJB 2QR4A 3SPGA 1NQTA 3TETA 2OCCB 3I55V 4LC1A 2LW7A 2W6JG 1D5NA 4JI6B 2XAQA 2NR5A 1RPRA 3BVOA 4NR1A 3J81N 2JGDA 1QVGU 3AG2B 5LXTB 2JJ2G 5KMGA 4D7TA 5AG2A 1KKCA 4X1KA 4HAMA 4X62B 4TV9A 2XAGA 1AP6A 1NI8A 3A0HZ 4PDVA 3STZC 2AGAA 4DUZB 3G80A 1KP3A 1LUVA 4FMTA 2GUZA 1Y74B 3ZHQA 4PELA 1OCCB 2WA4A 4J9ZB 1SQPH 3FD9A 5JJEB 2EIMC 3BY6A 3N2GA 5LOVB 3J7AU 3D8CA 3N27A 2EINB 4P9PA 1R3JC 4DV3B 1OCOC 2VQFB 5LBQA 1KC8W 4G27B 5EBWC 4D6TH 2N04A 1SC5B 1ZTEA 1VQMV 5GTHZ 2ZINA 4O2AB 1LNQA 2X7RB 3K9SA 4HYOA 2IU0A 1YJNV 4GX2A 4LFCB 3G6EV 4EB6B 3HB3B 1VQ4V 2P7TC 1HNZO 5KA6A 3B09A 1V54C 1OCZB 4O4IB 1TVKA 3N2KA 5EIBD 3H1HH 2Y48A 4N21A 4B3RB 1V9PA 4FLVA 3EFFK 4ABMA 5B1AC 1SS3A 4X20B 2DWDC 3RWRD 1Y4MA 5KHGA 4NTXA 4FIPC 3Q4HB 5KX5B 2E5LO 1NTZH 3SR2C 5H6RA 3U0ZA 1BQ0A 1M57B 3ZHUA 3CCRV 3P32A 4YHHB 2Q73A 4LWSB 3TCUA 3RYCA 1YI2V 1Q81W 2YXHA 4ZHQB 3A8TA 1GRJA 1Q5OA 4TT3G 4B3SO 4TSFG 1EBOA 1IDSA 4JASA 5CA0A 5IJ0B 4LF9O 4QE9A 2UXCB 2LJ2A 3T4ZA 5IY5C 4GKKB 3W7SA 4DV4O 4DXWA 5GONA 1BL8A 5L3DA 1DF4A 4UUJC 1H38A 4DV1B 4MVRA 1GKFA 4GLXA 1JR9A 3JD2A 3C3TA 5ITZA 1ZUQA 1IZ3A 5BMVA 2ARHA 1Q8IA 4MTFA 2A3QA 2LFSA 1JA8A 1AR4A 1JPXA 2B1IA 3ZHTA 4X66B 3WB2A 5LP6C 2PZSA 1VP7A 1HNXB 1R73A 1IVSA 1I08A 3K5LA 1E1RG 3BAAA 1M90W 5L3GA 1U97A 2F95B 2IBZH 3FAVB 1K33A 2EULA 1EN6A 4FLYA 1QR9A 1YTFD 2D3OW 1LR1A 1T5EA 2WA3A 3BA9A 1M93A 3FYEB 1S0VA 3R65A 5LMNO 4R7CA 3AG2C 3TXSA 2ZIOA 4DUYO 2VWJA 5KHJA 3FYIB 2Q8VA 1URFA 4RO2A 3CCVV 1AJNA 3JYCA 2ZCEA 3U10A 2EX3A 1RM1C 3M8AA 4PV1B 3QG5A 3CC7V 1MZFA 4X89A 4IIJA 1N8RW 1EZJA 3OTOB 3LSUA 1H8EG 2V1DA 3T1CA 3H1IH 1AB3A 3QVNA 2HVKC 2W6IG 2F93B 2WLHA 1XNRO 3TK1A 4Z1VA 4ZI7B 2EINC 1W0JG 2WLMA 2OWOA 2GSMB 4O4JB 3D36A 3B8MA 3OUSA 3BEHA 4PA9A 4KXRA 4UCRA 2FKXA 4LF8B 3L73H 4X65O 3S3WA 1Q82W 2QM8A 4ZBMA 4X64B 4DR1B 5LHGA 4X8AA 4JGSA 2F4VO 2OTJV 3DC5A 4NYKA 4WF9V 2Y4TA 1WA8A 1FFTB 1VQOV 4JAUA 4NTWA 1JJ2U 1DGSA 1AI4A 2B9ZA 4U3JB 1K92A 4JI0O 3X2QB 2UUAO 3CRQA 4ZKIA 2HP8A 5EC2C 3ZRWA 2B1GA 1XEQA 4DV0O 1PPJH 4IYHA 3CC2V 1Q6IA 3CCEV 3SJCC 5JQGB 2ZM6O 1NJIW 5EC1C 3JD0A 5JJNB 1B04A 4B7KA 3AG7A 4H37A 1MA1A 2LP7A 2CH7A 5KA5A 1M57C 2QWNB 1VQPV 4XBFA 2UUCB 5TISZ 4TQFA 4I50B 1ZX3A 2BCCH 2LO1A 3HKDB 2LFRA 5H5NA 2XAFA 3IC7A 1SF9A 1YF2A 4JAVA 3EXAA 3H1KH 4U3FH 3AG4C 1XNQB 1F4NA 2F1MA 4RQEA 1XHZA 2EILC 1M5IA 1M1KW 1RFYA 3M7MX 2UU9O 3CWBH 4B3TO 2R9IA 1XL4A 4YIPA 4JV5B 2YS8A 1GTOA 2JDIG 3FKSG 2ODMA 2CUGA 3E22A 1RPOA 5H6QA 5KHKA 1QR8A 3AG3B 1N4CA 4FFKA 4JI6O 2CTRA 4J80A 3UCSC 4WFBV 2QWOB 4GCZA 5DECA 4TV8A 2JK5C 4JI4B 2ZNIA 1XMQB 4JI5B 3IJ4A 3QO8A 3L70H 1HWYA 4JI8B 1TA8A 5B3SB 4UCOA 5B1NA 4I55B 4X62O 3ZHVA 3SPJA 2R9AA 3K06A 3I56V 3K5MA 3WG7B 4DYLA 3ZMZA 4DR6B 1H8HG 3WB1A 2CE4A 1Z2GA 1YXBA 1UJWB 4DUZO 4NXNB 4H13B 2XNDG 5JJJB 3ASNC 3OMAB 4FFBB 3JCZA 2YUAA 1M56B 2UUBB 3QTCA 4MVUA 1JX9A 1AI5A 4DV3O 3GB7C 1KQSU 4UFZA 2VQFO 1XDCA 2QTSA 1XMOB 4CBCA 2EJRA 2YICA 1F4MA 4C7UA 1VQNV 5IJ9B 5L3BA 1NTKH 3W7UA 1ROPA 3G71V 4WBNB 2RQ6A 5JWPA 2WLLA 1Y74A 4UCTA 3VQVA 5LGTA 2ITCC 5IYBO 4X9QA 4JTAB 4DK0A 3C3SA 3E86A 4P9OA 4LFCO 1KD1W 4CH3A 3FX7A 4MVSA 3BABA 3JD3A 1Y67A 1G6UA 1UPGA 4EEQA 3BCCH 4HNAB 5L3EA 2A9HA 2KG7B 3APQA 3JALB 4B3RO 2CGNA 3JATA 4K8ZA 2WLIA 2JRIA 1FFXA 5J2UA 5KAFZ 5LA6A 2QWQB 3OTFA 2C2AA 1XL6A 3ASOC 5LGNA 2GTAA 4YHHO 1X4TA 4DRXB 4Q20A 2PF4E 4XDLA 3UO2A 5BY1A 3D3IA 4I9WA 5IYZA 4L8JA 4X1YA 1NR1A 1SETA 3ZHRA 1YIJV 4OX9B 2UXCO 3OEEG 2AHZA 4GKKO 2CAZC 3OD4A 3UQ8A 3Q4HA 3TXQA 1RSOB 1K8AW 3BHPA 4DV1O 1PM9A 1XQ8A 5CBGA 4F6RA 5B1AB 2FYUH 3HKBA 1SRYA 4LWSA 2OIGA 3E8FA 4TWKA 4PA4A 3BFRA 5JCOA 4X66O 3H9VA 5IJ0A 5B5EZ 2UXXA 1HNXO 1YJWV 1AJPA 3CCLV 3OW2U 4X1IA 5CA3A 2QDOA 5IY5B 3VBBA 3CXHF 5DN6G 1JQ0A 2DQ3A 1G8MA 1K5SA 3O9OA 4GX0A 3O65A 1J5EB 2VQEB 1UFIA 3E89A 4I9QA 3CCMV 2PI4A 1FYJA 3WG7C 3L74H 3FAVA 4PI2A 2KB1A 3CCJV 3CHXA 4FJCC 1QCEA 2BTQB 1GN4A 3GWOA 1M56C 1Y76B 3OTOO 2FB5A 4LF5B 3HKEB 4O2BB 2V4DA 4YJ2B 2P67A 1QU7A 2XUMA 3RYHA 4JYCA 5IWAB 2GTSA 2YXYA 3G4SV 2WAMA 2BTOA 2UXDB 1K5QA 2IJIA 4LF8O 1KU9A 1P4RA 2P06A 2YSUB 3EVKA 3JAWB 4X64O 4FM1A 4DR1O 2M6YA 3RFRA 1JVMA 4NVPA 1RM1B 3RYFB 4JYAB 2ADQB 3CX5F 4O4LB 1SQFA 3RVZA 4BIUA 4E4EA 2BSKB 3ETEA 3F7YC 5GTIZ 3JARB 4UVAA 2ZE7A 2AHYA 2XASA 2KKWA 3FB7C 4BR6A 1N32B 3OT7A 5KUMA 2DQ0A 1N34B 1QHTA 1PP9H 2ZKOA 3T1HB 2DYSC 2QKCA 4MW8A 4JYYA 2UUCO 4FVMA 4U3JA 2OYQA 5IE9A 3LDEA 2AW9A 3K5OA 4GYCB 4H0LB 1SKVA 4QGPA 1BHAA 3FB6C 3JAKB 4JZ2A 1R6KA 4IGGA 1NS1A 1TUBA 5IYDO 1EFRG 5KUKA 5JVDA 1XNQO 4TUYA 2IH1C 4B7EA 3CMAV 1TUEB 3M99B 1NH2D 4JI2B 2QM7A 4LNUA 3E8BA 1YSCA 1F51A 2DWEC 4IHJB 5C8YB 4JV5O 4UVCA 2UXNA 4I0XB 3MDSA 3FFQA 1B3QA 3CP1A 3OM3B 4GZRB 4I4TB 1JFFB 1OJHA 4ZOLB 5E1AC 3HKCA 4JI4O 1R6NA 1XMQO 4JI5O 3KG2A 4DV6B 4JI8O 4PA3A 1PNLA 4PHZA 4J42A 3ZMSA 3AG4B 3B8NA 5EZYB 4DR6O 2EILB 5EBMC 4LR3A 4EFEA 3UT5B 4NXNO 3AK1A 3DC6A 4DW1A 4NTYA 3ZMTA 2UUBO 1FXKA 1ZL8B 5H2FZ 4IT5A 1XI1A 2ZDIC 2P4KA 3P3NA 2OCHA 2QWRB 3IC9A 2HJFC 3ZJZA 1CXZB 3BA8A 3KCXA 2LGQA 1YVWA 1XMOO 1FXHA 1QLEC 5FLXN 1YJ9V 4LF7B 4FLXA 5KAIZ 4FLWA 2NN4A 4PDLA 3DSQA 5JH7B 4MSWC 5B1OA 1VQKV 2ZD9A 2ATKC 3ZMUA 1OV9A 5EIBC 2RDCA 1YHQV 3HPLC 3ASNB 4L87A 3ZHSA 1HDJA 2Q7GA 5F2VO 3ZIAG 4AQYB 4YIOA 2R72A 5B1BC 1FS0G 1G4YB 3ZCCA 1TAEA 3SYCA 5IJ9A 1W59A 2DJVA 5LHIA 1J95A 2Z0AA 2ZR2A 3VQXA 2WSSG 1Q90D 1PNMA 3OAAG 3OE7G 2JGDB 4K0KB 1VF7A 1NU1H 1WB7A 5J9PC 4GT1A 5KMGB 1GH6A 4X1KB 1CPYA 1R3IC 3CC4V 5K1PA 2KG7A 4Q6GA 3D3QA 1QVFU 4DR3B 4PA7A 1SA0A 4OX9O 1WP8A 3RYIB 1N0JA 2O57A 3TJTA 3CEIA 2ZXWC 1R6TA 4FZ1A 2GUZB 2Q0AA 2E76B 3H01A 1P84F 3A0RA 3LDCA 3OR6C 5IT9N 1LUWA 3B4SA 1KMIZ 4DRXA 4YJ3A 4QIWF 1AILA 1MOFA 2CK3G 1R3LC 2IJKA 1IBMB 4K35A 1YEWA 3A0BZ 3ASOB 3BPZA 5CB4A 1IBLB 3WFVA 2K1EA 2CTQA 1VF6C 4JI7B 2L35A 3ZRVA 1K3EA 4DV2B 4MTXA 1I0HA 1K7DA 4WFAV 5B66Z 2Z3YA 3CD6V 2Y0IA 2YC0A 3CRAA 5J2TA 1NBMG 1FPOA 1TVKB 3N2KB 3ZEDA 1Q6UA 1J5EO 1KBHA 4WCEV 2VQEO 4BW9A 4PDRA 5CBFA 2H8PC 3WB0A 1K4DC 2UXBB 3QNEA 4P2ZA 5LL6Y 2PYJA 1GK9A 1JCHA 1WB8A 1WN7A 4H33A 3UO3A 3RYCB 2DW4A 4MVQA 4EFBA 4LF6B 4PDMA 1GN3A 4LF5O 3AEIA 5CA0B 4MVOA 1VMGA 1WNSA 1R3KC 1ZSPA 1EN4A 3CJHB 3DXRA 1BS3A 1M4UA 4FM2A 5IWAO 5GONB 4AI8A 1XUQA 5LP6A 3CB2A 3AK3A 2YXLA 1K4CC 2UXDO 2XAJA 1DLBA 3ML0A 5ITZB 1GMGA 2YIBA 5LYJA 1VEWA 4CS2A 2QJ1A 1Z5WA 4JZGA 3HKEA 3VQYA 1SQXH 3OFNG 1O9GA 4GX1A 4JYAO 3RGBA 3K03A 3L9DA 1S3JA 3K0DA 1L0NH 4JI3B 5C93A 3F5TA 3CCQV 2HHHB 1Y66A 2VS0A 4KFMA 1ZAUA 2D2CB 5LXTA 1EZVH 4TOIA 2A79B 4NKGB 1N32O 3MAQA 1NTMH 1N34O 1VF5B 1ZLZA 1HP8A 1GN6A 2QEXV 3T1HO 1IXMA 2KQXA 3RYFA 2QM4A 4DR5B 2N74A 4H44B 4BIZA 1CEZA 4O4HB 3JARA 4J41A 1AVMA 1BMFG 1O9HA 4ICGA 5FPOA 3THOA 5LOVA 1VQ6V 2RCVA 3OMNB 3PN1A 1GAXA 1YCIA 1P7BA 4DR4B 3ABMB 1S76D 4DR7B 4BWAA 3T1YB 3RN4A 2YEVB 4LCUC 1F23A 4O2AA 1Q86W 4JI2O 4LH7A 2KSDA 1GO3F 4A5UB 2DYSB 3CSXA 3OEHG 1NVPB 5EYPB 2Q0OC 3I5DA 1THZA 3CRRA 3ICXA 4EB6A 3JAKA 3W7WA 1WPBA 4RUFA 3WU2Z 2RJZA 1DK1A 4CH4A 4O4IA 2IW5A 1WA8B 4DV6O 4X20A 2DYRC 1GM9A 5FNVB 5LHHA 4PI0A 1QNMA 1NKDA 4Z1MG 5KX5A 5C8YA 4IHJA 5GW7A 1AROP 5CA1B 4I0XA 1U96A 2Q67A 4CS4A 3E8GA 1SQGA 4DV5B 1SQVH 4ZHQA 3ZN1A 4U7OA 2X0LA 1IXBA 4NXMB 1S72V 3LNNA 3GVMA 3SJQC 4U7NA 4UV8A 4JAAA 2CH7B 2PI5A 2IJJA 2IM9A 1WJZA 4CS3A 2CTPA 3STLC 2PGGA 3ABKB 4J9YB 2Q9LA 2P4VA 1E1QG 3ETQA 1PKXA 2WLJA 5E79Z 4LF7O 2QTOA 1GN2A 2MK3A 3LDDA 4FK5C 2W0XA 3SYPA 2Y4UA 3KZIZ 1Q6HA 3H1JH 4MW3A 2JEXA 4WFHA 4QJFB 1FD9A 2ZNJA 2RN9A 3OGCC 3RW0A 4PA6A 4K3AA 2W0FC 2N05A 4J7ZA 4AQYO 2QWPB 3J80N 3E22B 3P3PA 5KHHA 4DV7B 4BIOA 4OXSA 4RWUA 3E8HA 1QLEB 1KKDA 4TV8B 2YIAA 5L3FA 1MMMA 2AZ2A 2QKAA 4K0KO 1KUQA 2JS5A 3SPCA 1PNKA 3SYOA 2WWWA 4QPKA 1EN5A 4XDKA 1KECA 1BSMA 3OUFA 3K57A 3QO7A 4G2KA 3VQWA 1IX9A 1NH2B 4DR3O 4DR2B 2M7WA 4I7ZB 4J10A 1ENVA 2CDYA 3ZS8C 5B1BB 1GM8A 1L1FA 1DTOA 2FMLA 3LUTB 3NXSA 2ZQMA 4ZI7A 3ABMC 3CS5A 4B08A 4K8XA 4O4JA 2PY5A 1IBMO 3JAMN 2BOBC 2OT5A 1HNWB 1NZ6A 3F7VC 4DK1A 1IBLO 3RYIA 1JMKC 2Q6AA 4JI7O 1VIBA 2WLLB 4DV2O 3K59A 2YIDA 2Z5UA 3D36C 1V55B 2XHBA 1AR5A 2RNBA 4AHCA 2ZXWB 4MT8A 3L71H 2CGOA 4R6ZA 4BAYA 2FTKA 1KP2A 5KHIA 3MD0A 1CP9A 5EK0A 3JATB 2F43G 1K9MW 5JQGA 2WLIB 3K5NA 1FFXB 5J2UB 5A2QN 2YIBD 1W2BU 3OR7C 5LA6B 3E83A 3ETDA 2UXBO 1PV0A 3P30A 1H2KA 1I5XA 5DEDA 5IYCO 3GWKC 1YTFB 2H94A 4ASUG 1G1XB 4I50A 2XT9A 3ZX6A 4QNHB 1HR0B 3SPIA 4LF6O 3HKDA 4JTCB 5IYZB 2E3CA 4X1YB 1DF5A 4UXNA 1BGYH 1N33B 4LFAB 4UCUA 4FLZA 1K97A 2HJDA 3ABKC 4MTGA 2P6JA 4GUNA 5LMUB 2WLNA 3CMEV 3DGEA 1WPXA 4F6RB 2X6CA 1MSWD 5FPRA 2QGNA 1S5LZ 2PTMA 3HKBB 4YY3B 1BQZA 1BE3H 3R66A 4LFBB 1XBLA 3L72H 2ILMA 4PJ0Z 1OCRB 1I94B 1S77D 1E79G 2JEUA 1K73W 2IH3C 2JGUA 3FB8C 1S5HC 4MVZA 4JI3O 1ORQC 2EIKC 3DTUB 2GBOA 3CJHA 5KLVH 1H2NA 4R8CA 2HHHO 4X1IB 1NT2B 2E75B 1VQ8V 1FXVA 2XOKG 3K9AA 4RQFA 2F66C 3SYQA 4I55A 4JI1B 3ZRXA 2ETNA 1YDXA 2VWKA 4YXWG 3JASB 3K08A 2R9RB 4DR5O 2A0LA 2ZT9B 4FFBA 1VQ7V 4W4LA 4KUMA 2X6AA 3S3XA 4KHPB 1D2DA 1SQBH 1RP3B 2Y69C 2ZE6A 2EJ7A 2HFEC 2DN9A 2OCCC 2Y0PA 2A06H 4NB5A 4OPAA 1MG1A 4DR4O 4DR7O 3T1YO 2BE3A 1Z5VA 4OPHA 3NR7A 4UCSA 2MW2B 2L6LA 3RYHB 4WBNA 4Z2WA 4UVBA 5CN0A 4O4HA 5BR8B 2JJ1G 1IBKB 4B3MB 1K34A 3FB5C 1WLEA 1N36B 4LF4B 4GKJB 4WFGA 1MSDA 4AILC 3QF7A 2AXTZ 2YI9A 4MVMA 1FJGB 1SQQH 1PD3A 4TV9B 3KKYA 1W0KG 4HNAA 3JD4A 1B06A 3JALA 1JOYA 2EZOA 1OCCC 2LW1A 4D7SA 4JPRA 4G28B 1V55C 2YEVA 4MTOA 3U11A 4I5SA 2DOSA 2HEPA 2X6BA 5L3CA 1L0LH 2JIZG 2EIJB 4IL6Z 3JSNA 5EYPA 3N2GB 3APOA 4W4KA 2NLJC 4JF3A 3RVYA 4DV5O 1BHBA 4LP8A 2YI8A 5D5QA 5FL7G 3ZRSA 1VQ9V 1BZKA 4NXMO 5CBHA 3B40A 3VOUA 5HFMA 3CPWU 3ZN0A 1AR1B 1SESA 5FNVA 4FLUA 3SPHA 1SZXA 1RSOA 3MHHC 1Q3EA 5CA1A 1OCZC 1PL0A 2DYRB 2G38A 4F4LA 4XDJA 2QSAA 3CRCA 1TUBB 4DO2A 5JVDB 2IJHA 4TUYB 2Q4PA 1M9NA 2P90A 3G6BA 4LNUB 1PL4A 2EZPA 5IDJA 1MZEA 4KP4A 1XOUA 1OCRC 1H2LA 5JCOC 4FZ0A 4J7KA 3G67A 3KCYA 2WPDG 1R1BA 5HFLA 3B77A 2YDEA 1VQ5V 4ZIBA 3B2EE 1OZ0A 4DV7O 1FKAO 3HR0A 1HNZB 2GHYA 3ETGA 3AK2A 4RUEA 3HKCB 2QA4V 1HW7A 4GX5A 3JD1A 4JYBA 3K0GA 2XAHA 1QBZA 3LNMB 2E5LB 3CE2A 2ZR3A 4UCVA 1SERA 4LBEC 3ABUA 1VARA 1US6A 2JVDA 2ZDIA 2ITDC 4J7JA 2ZE8A 4DR2O 2BTQA 2OIEA 4B3SB 3ABLB 2Q7HA 5BMVB 4N23A 3SYAA 3CRMA 1COWG 1S5JA 3SJBC 1Y76A 5LGUA 1AI7A 1FXKB 2DMXA 4O2BA 1A32A 4YJ2A 5D5PA 2EBOA 4LF9B 1Y6XA 1X59A 1SZTA 4DV4B 3MHSC 1Q43A 4CH5A 3UKMA 4E2LA 3AG1B 1QQCA 1I5YA 2K9PA 1HNWO 3JAWA 3SDLA 3K3WA 1EM1A 4IYIA 2QE7G 1F7YA 3JCUZ 2E74B 2P22C 4O4LA 3K58A 2ZIMA 2B5UA 1P49A 5K1XA 2BSKA 5BXZA 3SJAC 1ZWIC 2OTLV 1GM7A 1TGOA 4UB8Z 3T4DA 1AJQA 3A2FA 4KL1A 3K04A 4PD4F 1L8DA 3TGUH 4IIJB 1I7FA 2VRZA 1YZBA 5H9CA 1YITV 2EIJC 2GV9A 5LMNB 4UB6Z 1IURA 2ZE5A 1MNGA 4DW0A 2BOCC 3W7XA 4DUYB 4J11A 4CZZA 2A7WA 4P30A 1HR0O 2XTAA 4X88A
chains in the Genus database with same CATH topology
4DR3O 2UUBO 4JYAO 5BR8O 1AILA 1IBKO 3RT3C 5LMNO 3F5TA 4B3MO 1N36O 4LF4O 4GKJO 3R66A 1N33O 1HNZO 4LFAO 4DUYO 2ZKOA 2DOSA 5H5NA 5LMUO 1XMOO 5FLXN 1FJGO 4DR2O 2UUCO 1N32O 4LFCO 3O65A 1N34O 4JI3O 3M8AA 2E5LO 1IBMO 3JAMN 4YY3O 4DV5O 4LFBO 1A32A 2HHHO 2LW7A 3T1HO 2UU9O 4B3TO 1IBLO 1I94O 4B3RO 1FYJA 1X59A 4NXMO 2N74A 4JI7O 4LF7O 1NS1A 4DV2O 4B3SO 3J81N 1AB3A 2JRIA 1XNQO 1XNRO 1J5EO 2VQEO 1HNWO 4LF9O 3SDLA 4JI6O 3OTOO 4DR5O 4YHHO 4DV4O 4JV5O 2DJVA 2FKXA 4X65O 5LL6Y 2Z0AA 4JI1O 1F7YA 1D2DA 2AGAA 5BY1A 2F4VO 5BXZA 4AQYO 4X62O 4JI2O 5A2QN 2UXCO 3J80N 4LF5O 4OPAA 4GKKO 2UXBO 4A5UB 4LF8O 4JI4O 4DR4O 4DR7O 4JI0O 3T1YO 1XMQO 4JI5O 3J7AU 4KHPO 2UUAO 4X64O 4DUZO 4DV1O 1G1XB 4OPHA 4DR1O 4JI8O 5IWAO 1DK1A 1XEQA 4DV0O 1YZBA 4K0KO 4LF6O 4OX9O 1KUQA 1R1BA 4DR6O 1R6TA 2UXDO 2ZM6O 4DV7O 1FKAO 4X66O 4DV6O 4NXNO 4DV3O 1HNXO 1HR0O 5IT9N 2VQFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 O;  2UUB O;  4JYA O;  5BR8 O;  1AIL A;  1IBK O;  3RT3 C;  5LMN O;  3F5T A;  4B3M O;  1N36 O;  4LF4 O;  4GKJ O;  3R66 A;  1N33 O;  1HNZ O;  4LFA O;  4DUY O;  2ZKO A;  2DOS A;  5H5N A;  5LMU O;  1XMO O;  5FLX N;  1FJG O;  4DR2 O;  2UUC O;  1N32 O;  4LFC O;  3O65 A;  1N34 O;  4JI3 O;  3M8A A;  2E5L O;  1IBM O;  3JAM N;  4YY3 O;  4DV5 O;  4LFB O;  1A32 A;  2HHH O;  2LW7 A;  3T1H O;  2UU9 O;  4B3T O;  1IBL O;  1I94 O;  4B3R O;  1FYJ A;  1X59 A;  4NXM O;  2N74 A;  4JI7 O;  4LF7 O;  1NS1 A;  4DV2 O;  4B3S O;  3J81 N;  1AB3 A;  2JRI A;  1XNQ O;  1XNR O;  1J5E O;  2VQE O;  1HNW O;  4LF9 O;  3SDL A;  4JI6 O;  3OTO O;  4DR5 O;  4YHH O;  4DV4 O;  4JV5 O;  2DJV A;  2FKX A;  4X65 O;  5LL6 Y;  2Z0A A;  4JI1 O;  1F7Y A;  1D2D A;  2AGA A;  5BY1 A;  2F4V O;  5BXZ A;  4AQY O;  4X62 O;  4JI2 O;  5A2Q N;  2UXC O;  3J80 N;  4LF5 O;  4OPA A;  4GKK O;  2UXB O;  4A5U B;  4LF8 O;  4JI4 O;  4DR4 O;  4DR7 O;  4JI0 O;  3T1Y O;  1XMQ O;  4JI5 O;  3J7A U;  4KHP O;  2UUA O;  4X64 O;  4DUZ O;  4DV1 O;  1G1X B;  4OPH A;  4DR1 O;  4JI8 O;  5IWA O;  1DK1 A;  1XEQ A;  4DV0 O;  1YZB A;  4K0K O;  4LF6 O;  4OX9 O;  1KUQ A;  1R1B A;  4DR6 O;  1R6T A;  2UXD O;  2ZM6 O;  4DV7 O;  1FKA O;  4X66 O;  4DV6 O;  4NXN O;  4DV3 O;  1HNX O;  1HR0 O;  5IT9 N;  2VQF O; 
#chains in the Genus database with same CATH topology
 2CTW A;  5EBL C;  2RMK B;  3OGI B;  2EIM B;  4OGQ B;  3OMI B;  2AZ0 A;  1SA0 B;  1N33 O;  1B6Q A;  4LFA O;  5BZB A;  4WFE A;  2GDS A;  1OCO B;  4CH6 A;  2ADP A;  3X2Q C;  4QPJ A;  5LMU O;  1FAF A;  1P7G A;  1XRE A;  1MAB G;  1BT8 A;  2JS3 A;  2Q5Z A;  1NR7 A;  1OHH G;  1XNR B;  4EKW A;  1VF6 A;  1N0N A;  3JSL A;  4YY3 O;  2Q7E A;  4YJ3 B;  4LFB O;  2Q68 A;  1AP5 A;  1JJO A;  1I94 O;  3ZRW B;  2V7Q G;  3CCU V;  4I4T A;  2LQT A;  1Q7Y W;  1JFF A;  3E2E A;  4X65 B;  5CB4 B;  3C90 A;  3T2M A;  1WP7 A;  4FPP A;  3CXC U;  4FLT A;  1BCC H;  3E35 A;  2HLD G;  3K79 A;  4ZOL A;  4WFF A;  2F4V B;  5DM6 V;  1KYO F;  1V54 B;  3L75 H;  5CMU A;  5A9G A;  2WLK A;  3CYO A;  1H2M A;  3UM7 A;  3IFX A;  4JI1 O;  4JI0 B;  2UUA B;  3SGI A;  5EZY A;  2Q69 A;  3ABT A;  4JTD B;  4CC5 A;  2R70 A;  1AI6 A;  3LSS A;  2PUS A;  3CCS V;  5J2T B;  2HR3 A;  4DV0 B;  3BRC A;  3W7T A;  3UT5 A;  2IU3 A;  1QLN A;  2NNU A;  3PJS K;  4QE7 A;  2HG5 C;  2ZM6 B;  4KHP O;  3LSQ A;  1ZL8 A;  4RAI A;  2FL4 A;  4R50 A;  4FM0 A;  1KB9 F;  2PYL A;  3F5W C;  2DE0 X;  4F6E A;  1H2S B;  1D5A A;  2EIK B;  3IGA C;  4BW5 A;  3ABL C;  3ZBH A;  3AG3 C;  2QKS A;  2HKO A;  2HVJ C;  4TQD A;  3RBZ A;  1FXK C;  4LH6 A;  3JAS A;  2H3O A;  1NVP D;  3ZMV A;  5JH7 A;  1WAZ A;  4HBN A;  4CC6 A;  3IAY A;  4HZ3 A;  5B3S C;  1XHX A;  3DXR B;  5BR8 O;  1VQL V;  2P5O A;  4MS2 A;  3RT3 C;  1IBK O;  2LGW A;  1H2G A;  3AG1 C;  4B3M O;  1N36 O;  4LF4 O;  4GKJ O;  2F23 A;  4UV9 A;  5LP6 B;  2UU9 B;  3QO5 A;  4B3T B;  3H1L H;  3EHB B;  1XIL A;  1FJG O;  2Y69 B;  5LYJ B;  2QR4 A;  3SPG A;  1NQT A;  3TET A;  2OCC B;  3I55 V;  4LC1 A;  2LW7 A;  2W6J G;  1D5N A;  4JI6 B;  2XAQ A;  2NR5 A;  1RPR A;  3BVO A;  4NR1 A;  3J81 N;  2JGD A;  1QVG U;  3AG2 B;  5LXT B;  2JJ2 G;  5KMG A;  4D7T A;  5AG2 A;  1KKC A;  4X1K A;  4HAM A;  4X62 B;  4TV9 A;  2XAG A;  1AP6 A;  1NI8 A;  3A0H Z;  4PDV A;  3STZ C;  2AGA A;  4DUZ B;  3G80 A;  1KP3 A;  1LUV A;  4FMT A;  2GUZ A;  1Y74 B;  3ZHQ A;  4PEL A;  1OCC B;  2WA4 A;  4J9Z B;  1SQP H;  3FD9 A;  5JJE B;  2EIM C;  3BY6 A;  3N2G A;  5LOV B;  3J7A U;  3D8C A;  3N27 A;  2EIN B;  4P9P A;  1R3J C;  4DV3 B;  1OCO C;  2VQF B;  5LBQ A;  1KC8 W;  4G27 B;  5EBW C;  4D6T H;  2N04 A;  1SC5 B;  1ZTE A;  1VQM V;  5GTH Z;  2ZIN A;  4O2A B;  1LNQ A;  2X7R B;  3K9S A;  4HYO A;  2IU0 A;  1YJN V;  4GX2 A;  4LFC B;  3G6E V;  4EB6 B;  3HB3 B;  1VQ4 V;  2P7T C;  1HNZ O;  5KA6 A;  3B09 A;  1V54 C;  1OCZ B;  4O4I B;  1TVK A;  3N2K A;  5EIB D;  3H1H H;  2Y48 A;  4N21 A;  4B3R B;  1V9P A;  4FLV A;  3EFF K;  4ABM A;  5B1A C;  1SS3 A;  4X20 B;  2DWD C;  3RWR D;  1Y4M A;  5KHG A;  4NTX A;  4FIP C;  3Q4H B;  5KX5 B;  2E5L O;  1NTZ H;  3SR2 C;  5H6R A;  3U0Z A;  1BQ0 A;  1M57 B;  3ZHU A;  3CCR V;  3P32 A;  4YHH B;  2Q73 A;  4LWS B;  3TCU A;  3RYC A;  1YI2 V;  1Q81 W;  2YXH A;  4ZHQ B;  3A8T A;  1GRJ A;  1Q5O A;  4TT3 G;  4B3S O;  4TSF G;  1EBO A;  1IDS A;  4JAS A;  5CA0 A;  5IJ0 B;  4LF9 O;  4QE9 A;  2UXC B;  2LJ2 A;  3T4Z A;  5IY5 C;  4GKK B;  3W7S A;  4DV4 O;  4DXW A;  5GON A;  1BL8 A;  5L3D A;  1DF4 A;  4UUJ C;  1H38 A;  4DV1 B;  4MVR A;  1GKF A;  4GLX A;  1JR9 A;  3JD2 A;  3C3T A;  5ITZ A;  1ZUQ A;  1IZ3 A;  5BMV A;  2ARH A;  1Q8I A;  4MTF A;  2A3Q A;  2LFS A;  1JA8 A;  1AR4 A;  1JPX A;  2B1I A;  3ZHT A;  4X66 B;  3WB2 A;  5LP6 C;  2PZS A;  1VP7 A;  1HNX B;  1R73 A;  1IVS A;  1I08 A;  3K5L A;  1E1R G;  3BAA A;  1M90 W;  5L3G A;  1U97 A;  2F95 B;  2IBZ H;  3FAV B;  1K33 A;  2EUL A;  1EN6 A;  4FLY A;  1QR9 A;  1YTF D;  2D3O W;  1LR1 A;  1T5E A;  2WA3 A;  3BA9 A;  1M93 A;  3FYE B;  1S0V A;  3R65 A;  5LMN O;  4R7C A;  3AG2 C;  3TXS A;  2ZIO A;  4DUY O;  2VWJ A;  5KHJ A;  3FYI B;  2Q8V A;  1URF A;  4RO2 A;  3CCV V;  1AJN A;  3JYC A;  2ZCE A;  3U10 A;  2EX3 A;  1RM1 C;  3M8A A;  4PV1 B;  3QG5 A;  3CC7 V;  1MZF A;  4X89 A;  4IIJ A;  1N8R W;  1EZJ A;  3OTO B;  3LSU A;  1H8E G;  2V1D A;  3T1C A;  3H1I H;  1AB3 A;  3QVN A;  2HVK C;  2W6I G;  2F93 B;  2WLH A;  1XNR O;  3TK1 A;  4Z1V A;  4ZI7 B;  2EIN C;  1W0J G;  2WLM A;  2OWO A;  2GSM B;  4O4J B;  3D36 A;  3B8M A;  3OUS A;  3BEH A;  4PA9 A;  4KXR A;  4UCR A;  2FKX A;  4LF8 B;  3L73 H;  4X65 O;  3S3W A;  1Q82 W;  2QM8 A;  4ZBM A;  4X64 B;  4DR1 B;  5LHG A;  4X8A A;  4JGS A;  2F4V O;  2OTJ V;  3DC5 A;  4NYK A;  4WF9 V;  2Y4T A;  1WA8 A;  1FFT B;  1VQO V;  4JAU A;  4NTW A;  1JJ2 U;  1DGS A;  1AI4 A;  2B9Z A;  4U3J B;  1K92 A;  4JI0 O;  3X2Q B;  2UUA O;  3CRQ A;  4ZKI A;  2HP8 A;  5EC2 C;  3ZRW A;  2B1G A;  1XEQ A;  4DV0 O;  1PPJ H;  4IYH A;  3CC2 V;  1Q6I A;  3CCE V;  3SJC C;  5JQG B;  2ZM6 O;  1NJI W;  5EC1 C;  3JD0 A;  5JJN B;  1B04 A;  4B7K A;  3AG7 A;  4H37 A;  1MA1 A;  2LP7 A;  2CH7 A;  5KA5 A;  1M57 C;  2QWN B;  1VQP V;  4XBF A;  2UUC B;  5TIS Z;  4TQF A;  4I50 B;  1ZX3 A;  2BCC H;  2LO1 A;  3HKD B;  2LFR A;  5H5N A;  2XAF A;  3IC7 A;  1SF9 A;  1YF2 A;  4JAV A;  3EXA A;  3H1K H;  4U3F H;  3AG4 C;  1XNQ B;  1F4N A;  2F1M A;  4RQE A;  1XHZ A;  2EIL C;  1M5I A;  1M1K W;  1RFY A;  3M7M X;  2UU9 O;  3CWB H;  4B3T O;  2R9I A;  1XL4 A;  4YIP A;  4JV5 B;  2YS8 A;  1GTO A;  2JDI G;  3FKS G;  2ODM A;  2CUG A;  3E22 A;  1RPO A;  5H6Q A;  5KHK A;  1QR8 A;  3AG3 B;  1N4C A;  4FFK A;  4JI6 O;  2CTR A;  4J80 A;  3UCS C;  4WFB V;  2QWO B;  4GCZ A;  5DEC A;  4TV8 A;  2JK5 C;  4JI4 B;  2ZNI A;  1XMQ B;  4JI5 B;  3IJ4 A;  3QO8 A;  3L70 H;  1HWY A;  4JI8 B;  1TA8 A;  5B3S B;  4UCO A;  5B1N A;  4I55 B;  4X62 O;  3ZHV A;  3SPJ A;  2R9A A;  3K06 A;  3I56 V;  3K5M A;  3WG7 B;  4DYL A;  3ZMZ A;  4DR6 B;  1H8H G;  3WB1 A;  2CE4 A;  1Z2G A;  1YXB A;  1UJW B;  4DUZ O;  4NXN B;  4H13 B;  2XND G;  5JJJ B;  3ASN C;  3OMA B;  4FFB B;  3JCZ A;  2YUA A;  1M56 B;  2UUB B;  3QTC A;  4MVU A;  1JX9 A;  1AI5 A;  4DV3 O;  3GB7 C;  1KQS U;  4UFZ A;  2VQF O;  1XDC A;  2QTS A;  1XMO B;  4CBC A;  2EJR A;  2YIC A;  1F4M A;  4C7U A;  1VQN V;  5IJ9 B;  5L3B A;  1NTK H;  3W7U A;  1ROP A;  3G71 V;  4WBN B;  2RQ6 A;  5JWP A;  2WLL A;  1Y74 A;  4UCT A;  3VQV A;  5LGT A;  2ITC C;  5IYB O;  4X9Q A;  4JTA B;  4DK0 A;  3C3S A;  3E86 A;  4P9O A;  4LFC O;  1KD1 W;  4CH3 A;  3FX7 A;  4MVS A;  3BAB A;  3JD3 A;  1Y67 A;  1G6U A;  1UPG A;  4EEQ A;  3BCC H;  4HNA B;  5L3E A;  2A9H A;  2KG7 B;  3APQ A;  3JAL B;  4B3R O;  2CGN A;  3JAT A;  4K8Z A;  2WLI A;  2JRI A;  1FFX A;  5J2U A;  5KAF Z;  5LA6 A;  2QWQ B;  3OTF A;  2C2A A;  1XL6 A;  3ASO C;  5LGN A;  2GTA A;  4YHH O;  1X4T A;  4DRX B;  4Q20 A;  2PF4 E;  4XDL A;  3UO2 A;  5BY1 A;  3D3I A;  4I9W A;  5IYZ A;  4L8J A;  4X1Y A;  1NR1 A;  1SET A;  3ZHR A;  1YIJ V;  4OX9 B;  2UXC O;  3OEE G;  2AHZ A;  4GKK O;  2CAZ C;  3OD4 A;  3UQ8 A;  3Q4H A;  3TXQ A;  1RSO B;  1K8A W;  3BHP A;  4DV1 O;  1PM9 A;  1XQ8 A;  5CBG A;  4F6R A;  5B1A B;  2FYU H;  3HKB A;  1SRY A;  4LWS A;  2OIG A;  3E8F A;  4TWK A;  4PA4 A;  3BFR A;  5JCO A;  4X66 O;  3H9V A;  5IJ0 A;  5B5E Z;  2UXX A;  1HNX O;  1YJW V;  1AJP A;  3CCL V;  3OW2 U;  4X1I A;  5CA3 A;  2QDO A;  5IY5 B;  3VBB A;  3CXH F;  5DN6 G;  1JQ0 A;  2DQ3 A;  1G8M A;  1K5S A;  3O9O A;  4GX0 A;  3O65 A;  1J5E B;  2VQE B;  1UFI A;  3E89 A;  4I9Q A;  3CCM V;  2PI4 A;  1FYJ A;  3WG7 C;  3L74 H;  3FAV A;  4PI2 A;  2KB1 A;  3CCJ V;  3CHX A;  4FJC C;  1QCE A;  2BTQ B;  1GN4 A;  3GWO A;  1M56 C;  1Y76 B;  3OTO O;  2FB5 A;  4LF5 B;  3HKE B;  4O2B B;  2V4D A;  4YJ2 B;  2P67 A;  1QU7 A;  2XUM A;  3RYH A;  4JYC A;  5IWA B;  2GTS A;  2YXY A;  3G4S V;  2WAM A;  2BTO A;  2UXD B;  1K5Q A;  2IJI A;  4LF8 O;  1KU9 A;  1P4R A;  2P06 A;  2YSU B;  3EVK A;  3JAW B;  4X64 O;  4FM1 A;  4DR1 O;  2M6Y A;  3RFR A;  1JVM A;  4NVP A;  1RM1 B;  3RYF B;  4JYA B;  2ADQ B;  3CX5 F;  4O4L B;  1SQF A;  3RVZ A;  4BIU A;  4E4E A;  2BSK B;  3ETE A;  3F7Y C;  5GTI Z;  3JAR B;  4UVA A;  2ZE7 A;  2AHY A;  2XAS A;  2KKW A;  3FB7 C;  4BR6 A;  1N32 B;  3OT7 A;  5KUM A;  2DQ0 A;  1N34 B;  1QHT A;  1PP9 H;  2ZKO A;  3T1H B;  2DYS C;  2QKC A;  4MW8 A;  4JYY A;  2UUC O;  4FVM A;  4U3J A;  2OYQ A;  5IE9 A;  3LDE A;  2AW9 A;  3K5O A;  4GYC B;  4H0L B;  1SKV A;  4QGP A;  1BHA A;  3FB6 C;  3JAK B;  4JZ2 A;  1R6K A;  4IGG A;  1NS1 A;  1TUB A;  5IYD O;  1EFR G;  5KUK A;  5JVD A;  1XNQ O;  4TUY A;  2IH1 C;  4B7E A;  3CMA V;  1TUE B;  3M99 B;  1NH2 D;  4JI2 B;  2QM7 A;  4LNU A;  3E8B A;  1YSC A;  1F51 A;  2DWE C;  4IHJ B;  5C8Y B;  4JV5 O;  4UVC A;  2UXN A;  4I0X B;  3MDS A;  3FFQ A;  1B3Q A;  3CP1 A;  3OM3 B;  4GZR B;  4I4T B;  1JFF B;  1OJH A;  4ZOL B;  5E1A C;  3HKC A;  4JI4 O;  1R6N A;  1XMQ O;  4JI5 O;  3KG2 A;  4DV6 B;  4JI8 O;  4PA3 A;  1PNL A;  4PHZ A;  4J42 A;  3ZMS A;  3AG4 B;  3B8N A;  5EZY B;  4DR6 O;  2EIL B;  5EBM C;  4LR3 A;  4EFE A;  3UT5 B;  4NXN O;  3AK1 A;  3DC6 A;  4DW1 A;  4NTY A;  3ZMT A;  2UUB O;  1FXK A;  1ZL8 B;  5H2F Z;  4IT5 A;  1XI1 A;  2ZDI C;  2P4K A;  3P3N A;  2OCH A;  2QWR B;  3IC9 A;  2HJF C;  3ZJZ A;  1CXZ B;  3BA8 A;  3KCX A;  2LGQ A;  1YVW A;  1XMO O;  1FXH A;  1QLE C;  5FLX N;  1YJ9 V;  4LF7 B;  4FLX A;  5KAI Z;  4FLW A;  2NN4 A;  4PDL A;  3DSQ A;  5JH7 B;  4MSW C;  5B1O A;  1VQK V;  2ZD9 A;  2ATK C;  3ZMU A;  1OV9 A;  5EIB C;  2RDC A;  1YHQ V;  3HPL C;  3ASN B;  4L87 A;  3ZHS A;  1HDJ A;  2Q7G A;  5F2V O;  3ZIA G;  4AQY B;  4YIO A;  2R72 A;  5B1B C;  1FS0 G;  1G4Y B;  3ZCC A;  1TAE A;  3SYC A;  5IJ9 A;  1W59 A;  2DJV A;  5LHI A;  1J95 A;  2Z0A A;  2ZR2 A;  3VQX A;  2WSS G;  1Q90 D;  1PNM A;  3OAA G;  3OE7 G;  2JGD B;  4K0K B;  1VF7 A;  1NU1 H;  1WB7 A;  5J9P C;  4GT1 A;  5KMG B;  1GH6 A;  4X1K B;  1CPY A;  1R3I C;  3CC4 V;  5K1P A;  2KG7 A;  4Q6G A;  3D3Q A;  1QVF U;  4DR3 B;  4PA7 A;  1SA0 A;  4OX9 O;  1WP8 A;  3RYI B;  1N0J A;  2O57 A;  3TJT A;  3CEI A;  2ZXW C;  1R6T A;  4FZ1 A;  2GUZ B;  2Q0A A;  2E76 B;  3H01 A;  1P84 F;  3A0R A;  3LDC A;  3OR6 C;  5IT9 N;  1LUW A;  3B4S A;  1KMI Z;  4DRX A;  4YJ3 A;  4QIW F;  1AIL A;  1MOF A;  2CK3 G;  1R3L C;  2IJK A;  1IBM B;  4K35 A;  1YEW A;  3A0B Z;  3ASO B;  3BPZ A;  5CB4 A;  1IBL B;  3WFV A;  2K1E A;  2CTQ A;  1VF6 C;  4JI7 B;  2L35 A;  3ZRV A;  1K3E A;  4DV2 B;  4MTX A;  1I0H A;  1K7D A;  4WFA V;  5B66 Z;  2Z3Y A;  3CD6 V;  2Y0I A;  2YC0 A;  3CRA A;  5J2T A;  1NBM G;  1FPO A;  1TVK B;  3N2K B;  3ZED A;  1Q6U A;  1J5E O;  1KBH A;  4WCE V;  2VQE O;  4BW9 A;  4PDR A;  5CBF A;  2H8P C;  3WB0 A;  1K4D C;  2UXB B;  3QNE A;  4P2Z A;  5LL6 Y;  2PYJ A;  1GK9 A;  1JCH A;  1WB8 A;  1WN7 A;  4H33 A;  3UO3 A;  3RYC B;  2DW4 A;  4MVQ A;  4EFB A;  4LF6 B;  4PDM A;  1GN3 A;  4LF5 O;  3AEI A;  5CA0 B;  4MVO A;  1VMG A;  1WNS A;  1R3K C;  1ZSP A;  1EN4 A;  3CJH B;  3DXR A;  1BS3 A;  1M4U A;  4FM2 A;  5IWA O;  5GON B;  4AI8 A;  1XUQ A;  5LP6 A;  3CB2 A;  3AK3 A;  2YXL A;  1K4C C;  2UXD O;  2XAJ A;  1DLB A;  3ML0 A;  5ITZ B;  1GMG A;  2YIB A;  5LYJ A;  1VEW A;  4CS2 A;  2QJ1 A;  1Z5W A;  4JZG A;  3HKE A;  3VQY A;  1SQX H;  3OFN G;  1O9G A;  4GX1 A;  4JYA O;  3RGB A;  3K03 A;  3L9D A;  1S3J A;  3K0D A;  1L0N H;  4JI3 B;  5C93 A;  3F5T A;  3CCQ V;  2HHH B;  1Y66 A;  2VS0 A;  4KFM A;  1ZAU A;  2D2C B;  5LXT A;  1EZV H;  4TOI A;  2A79 B;  4NKG B;  1N32 O;  3MAQ A;  1NTM H;  1N34 O;  1VF5 B;  1ZLZ A;  1HP8 A;  1GN6 A;  2QEX V;  3T1H O;  1IXM A;  2KQX A;  3RYF A;  2QM4 A;  4DR5 B;  2N74 A;  4H44 B;  4BIZ A;  1CEZ A;  4O4H B;  3JAR A;  4J41 A;  1AVM A;  1BMF G;  1O9H A;  4ICG A;  5FPO A;  3THO A;  5LOV A;  1VQ6 V;  2RCV A;  3OMN B;  3PN1 A;  1GAX A;  1YCI A;  1P7B A;  4DR4 B;  3ABM B;  1S76 D;  4DR7 B;  4BWA A;  3T1Y B;  3RN4 A;  2YEV B;  4LCU C;  1F23 A;  4O2A A;  1Q86 W;  4JI2 O;  4LH7 A;  2KSD A;  1GO3 F;  4A5U B;  2DYS B;  3CSX A;  3OEH G;  1NVP B;  5EYP B;  2Q0O C;  3I5D A;  1THZ A;  3CRR A;  3ICX A;  4EB6 A;  3JAK A;  3W7W A;  1WPB A;  4RUF A;  3WU2 Z;  2RJZ A;  1DK1 A;  4CH4 A;  4O4I A;  2IW5 A;  1WA8 B;  4DV6 O;  4X20 A;  2DYR C;  1GM9 A;  5FNV B;  5LHH A;  4PI0 A;  1QNM A;  1NKD A;  4Z1M G;  5KX5 A;  5C8Y A;  4IHJ A;  5GW7 A;  1ARO P;  5CA1 B;  4I0X A;  1U96 A;  2Q67 A;  4CS4 A;  3E8G A;  1SQG A;  4DV5 B;  1SQV H;  4ZHQ A;  3ZN1 A;  4U7O A;  2X0L A;  1IXB A;  4NXM B;  1S72 V;  3LNN A;  3GVM A;  3SJQ C;  4U7N A;  4UV8 A;  4JAA A;  2CH7 B;  2PI5 A;  2IJJ A;  2IM9 A;  1WJZ A;  4CS3 A;  2CTP A;  3STL C;  2PGG A;  3ABK B;  4J9Y B;  2Q9L A;  2P4V A;  1E1Q G;  3ETQ A;  1PKX A;  2WLJ A;  5E79 Z;  4LF7 O;  2QTO A;  1GN2 A;  2MK3 A;  3LDD A;  4FK5 C;  2W0X A;  3SYP A;  2Y4U A;  3KZI Z;  1Q6H A;  3H1J H;  4MW3 A;  2JEX A;  4WFH A;  4QJF B;  1FD9 A;  2ZNJ A;  2RN9 A;  3OGC C;  3RW0 A;  4PA6 A;  4K3A A;  2W0F C;  2N05 A;  4J7Z A;  4AQY O;  2QWP B;  3J80 N;  3E22 B;  3P3P A;  5KHH A;  4DV7 B;  4BIO A;  4OXS A;  4RWU A;  3E8H A;  1QLE B;  1KKD A;  4TV8 B;  2YIA A;  5L3F A;  1MMM A;  2AZ2 A;  2QKA A;  4K0K O;  1KUQ A;  2JS5 A;  3SPC A;  1PNK A;  3SYO A;  2WWW A;  4QPK A;  1EN5 A;  4XDK A;  1KEC A;  1BSM A;  3OUF A;  3K57 A;  3QO7 A;  4G2K A;  3VQW A;  1IX9 A;  1NH2 B;  4DR3 O;  4DR2 B;  2M7W A;  4I7Z B;  4J10 A;  1ENV A;  2CDY A;  3ZS8 C;  5B1B B;  1GM8 A;  1L1F A;  1DTO A;  2FML A;  3LUT B;  3NXS A;  2ZQM A;  4ZI7 A;  3ABM C;  3CS5 A;  4B08 A;  4K8X A;  4O4J A;  2PY5 A;  1IBM O;  3JAM N;  2BOB C;  2OT5 A;  1HNW B;  1NZ6 A;  3F7V C;  4DK1 A;  1IBL O;  3RYI A;  1JMK C;  2Q6A A;  4JI7 O;  1VIB A;  2WLL B;  4DV2 O;  3K59 A;  2YID A;  2Z5U A;  3D36 C;  1V55 B;  2XHB A;  1AR5 A;  2RNB A;  4AHC A;  2ZXW B;  4MT8 A;  3L71 H;  2CGO A;  4R6Z A;  4BAY A;  2FTK A;  1KP2 A;  5KHI A;  3MD0 A;  1CP9 A;  5EK0 A;  3JAT B;  2F43 G;  1K9M W;  5JQG A;  2WLI B;  3K5N A;  1FFX B;  5J2U B;  5A2Q N;  2YIB D;  1W2B U;  3OR7 C;  5LA6 B;  3E83 A;  3ETD A;  2UXB O;  1PV0 A;  3P30 A;  1H2K A;  1I5X A;  5DED A;  5IYC O;  3GWK C;  1YTF B;  2H94 A;  4ASU G;  1G1X B;  4I50 A;  2XT9 A;  3ZX6 A;  4QNH B;  1HR0 B;  3SPI A;  4LF6 O;  3HKD A;  4JTC B;  5IYZ B;  2E3C A;  4X1Y B;  1DF5 A;  4UXN A;  1BGY H;  1N33 B;  4LFA B;  4UCU A;  4FLZ A;  1K97 A;  2HJD A;  3ABK C;  4MTG A;  2P6J A;  4GUN A;  5LMU B;  2WLN A;  3CME V;  3DGE A;  1WPX A;  4F6R B;  2X6C A;  1MSW D;  5FPR A;  2QGN A;  1S5L Z;  2PTM A;  3HKB B;  4YY3 B;  1BQZ A;  1BE3 H;  3R66 A;  4LFB B;  1XBL A;  3L72 H;  2ILM A;  4PJ0 Z;  1OCR B;  1I94 B;  1S77 D;  1E79 G;  2JEU A;  1K73 W;  2IH3 C;  2JGU A;  3FB8 C;  1S5H C;  4MVZ A;  4JI3 O;  1ORQ C;  2EIK C;  3DTU B;  2GBO A;  3CJH A;  5KLV H;  1H2N A;  4R8C A;  2HHH O;  4X1I B;  1NT2 B;  2E75 B;  1VQ8 V;  1FXV A;  2XOK G;  3K9A A;  4RQF A;  2F66 C;  3SYQ A;  4I55 A;  4JI1 B;  3ZRX A;  2ETN A;  1YDX A;  2VWK A;  4YXW G;  3JAS B;  3K08 A;  2R9R B;  4DR5 O;  2A0L A;  2ZT9 B;  4FFB A;  1VQ7 V;  4W4L A;  4KUM A;  2X6A A;  3S3X A;  4KHP B;  1D2D A;  1SQB H;  1RP3 B;  2Y69 C;  2ZE6 A;  2EJ7 A;  2HFE C;  2DN9 A;  2OCC C;  2Y0P A;  2A06 H;  4NB5 A;  4OPA A;  1MG1 A;  4DR4 O;  4DR7 O;  3T1Y O;  2BE3 A;  1Z5V A;  4OPH A;  3NR7 A;  4UCS A;  2MW2 B;  2L6L A;  3RYH B;  4WBN A;  4Z2W A;  4UVB A;  5CN0 A;  4O4H A;  5BR8 B;  2JJ1 G;  1IBK B;  4B3M B;  1K34 A;  3FB5 C;  1WLE A;  1N36 B;  4LF4 B;  4GKJ B;  4WFG A;  1MSD A;  4AIL C;  3QF7 A;  2AXT Z;  2YI9 A;  4MVM A;  1FJG B;  1SQQ H;  1PD3 A;  4TV9 B;  3KKY A;  1W0K G;  4HNA A;  3JD4 A;  1B06 A;  3JAL A;  1JOY A;  2EZO A;  1OCC C;  2LW1 A;  4D7S A;  4JPR A;  4G28 B;  1V55 C;  2YEV A;  4MTO A;  3U11 A;  4I5S A;  2DOS A;  2HEP A;  2X6B A;  5L3C A;  1L0L H;  2JIZ G;  2EIJ B;  4IL6 Z;  3JSN A;  5EYP A;  3N2G B;  3APO A;  4W4K A;  2NLJ C;  4JF3 A;  3RVY A;  4DV5 O;  1BHB A;  4LP8 A;  2YI8 A;  5D5Q A;  5FL7 G;  3ZRS A;  1VQ9 V;  1BZK A;  4NXM O;  5CBH A;  3B40 A;  3VOU A;  5HFM A;  3CPW U;  3ZN0 A;  1AR1 B;  1SES A;  5FNV A;  4FLU A;  3SPH A;  1SZX A;  1RSO A;  3MHH C;  1Q3E A;  5CA1 A;  1OCZ C;  1PL0 A;  2DYR B;  2G38 A;  4F4L A;  4XDJ A;  2QSA A;  3CRC A;  1TUB B;  4DO2 A;  5JVD B;  2IJH A;  4TUY B;  2Q4P A;  1M9N A;  2P90 A;  3G6B A;  4LNU B;  1PL4 A;  2EZP A;  5IDJ A;  1MZE A;  4KP4 A;  1XOU A;  1OCR C;  1H2L A;  5JCO C;  4FZ0 A;  4J7K A;  3G67 A;  3KCY A;  2WPD G;  1R1B A;  5HFL A;  3B77 A;  2YDE A;  1VQ5 V;  4ZIB A;  3B2E E;  1OZ0 A;  4DV7 O;  1FKA O;  3HR0 A;  1HNZ B;  2GHY A;  3ETG A;  3AK2 A;  4RUE A;  3HKC B;  2QA4 V;  1HW7 A;  4GX5 A;  3JD1 A;  4JYB A;  3K0G A;  2XAH A;  1QBZ A;  3LNM B;  2E5L B;  3CE2 A;  2ZR3 A;  4UCV A;  1SER A;  4LBE C;  3ABU A;  1VAR A;  1US6 A;  2JVD A;  2ZDI A;  2ITD C;  4J7J A;  2ZE8 A;  4DR2 O;  2BTQ A;  2OIE A;  4B3S B;  3ABL B;  2Q7H A;  5BMV B;  4N23 A;  3SYA A;  3CRM A;  1COW G;  1S5J A;  3SJB C;  1Y76 A;  5LGU A;  1AI7 A;  1FXK B;  2DMX A;  4O2B A;  1A32 A;  4YJ2 A;  5D5P A;  2EBO A;  4LF9 B;  1Y6X A;  1X59 A;  1SZT A;  4DV4 B;  3MHS C;  1Q43 A;  4CH5 A;  3UKM A;  4E2L A;  3AG1 B;  1QQC A;  1I5Y A;  2K9P A;  1HNW O;  3JAW A;  3SDL A;  3K3W A;  1EM1 A;  4IYI A;  2QE7 G;  1F7Y A;  3JCU Z;  2E74 B;  2P22 C;  4O4L A;  3K58 A;  2ZIM A;  2B5U A;  1P49 A;  5K1X A;  2BSK A;  5BXZ A;  3SJA C;  1ZWI C;  2OTL V;  1GM7 A;  1TGO A;  4UB8 Z;  3T4D A;  1AJQ A;  3A2F A;  4KL1 A;  3K04 A;  4PD4 F;  1L8D A;  3TGU H;  4IIJ B;  1I7F A;  2VRZ A;  1YZB A;  5H9C A;  1YIT V;  2EIJ C;  2GV9 A;  5LMN B;  4UB6 Z;  1IUR A;  2ZE5 A;  1MNG A;  4DW0 A;  2BOC C;  3W7X A;  4DUY B;  4J11 A;  4CZZ A;  2A7W A;  4P30 A;  1HR0 O;  2XTA A;  4X88 A; 
#chains in the Genus database with same CATH homology
 4DR3 O;  2UUB O;  4JYA O;  5BR8 O;  1AIL A;  1IBK O;  3RT3 C;  5LMN O;  3F5T A;  4B3M O;  1N36 O;  4LF4 O;  4GKJ O;  3R66 A;  1N33 O;  1HNZ O;  4LFA O;  4DUY O;  2ZKO A;  2DOS A;  5H5N A;  5LMU O;  1XMO O;  5FLX N;  1FJG O;  4DR2 O;  2UUC O;  1N32 O;  4LFC O;  3O65 A;  1N34 O;  4JI3 O;  3M8A A;  2E5L O;  1IBM O;  3JAM N;  4YY3 O;  4DV5 O;  4LFB O;  1A32 A;  2HHH O;  2LW7 A;  3T1H O;  2UU9 O;  4B3T O;  1IBL O;  1I94 O;  4B3R O;  1FYJ A;  1X59 A;  4NXM O;  2N74 A;  4JI7 O;  4LF7 O;  1NS1 A;  4DV2 O;  4B3S O;  3J81 N;  1AB3 A;  2JRI A;  1XNQ O;  1XNR O;  1J5E O;  2VQE O;  1HNW O;  4LF9 O;  3SDL A;  4JI6 O;  3OTO O;  4DR5 O;  4YHH O;  4DV4 O;  4JV5 O;  2DJV A;  2FKX A;  4X65 O;  5LL6 Y;  2Z0A A;  4JI1 O;  1F7Y A;  1D2D A;  2AGA A;  5BY1 A;  2F4V O;  5BXZ A;  4AQY O;  4X62 O;  4JI2 O;  5A2Q N;  2UXC O;  3J80 N;  4LF5 O;  4OPA A;  4GKK O;  2UXB O;  4A5U B;  4LF8 O;  4JI4 O;  4DR4 O;  4DR7 O;  4JI0 O;  3T1Y O;  1XMQ O;  4JI5 O;  3J7A U;  4KHP O;  2UUA O;  4X64 O;  4DUZ O;  4DV1 O;  1G1X B;  4OPH A;  4DR1 O;  4JI8 O;  5IWA O;  1DK1 A;  1XEQ A;  4DV0 O;  1YZB A;  4K0K O;  4LF6 O;  4OX9 O;  1KUQ A;  1R1B A;  4DR6 O;  1R6T A;  2UXD O;  2ZM6 O;  4DV7 O;  1FKA O;  4X66 O;  4DV6 O;  4NXN O;  4DV3 O;  1HNX O;  1HR0 O;  5IT9 N;  2VQF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...