1NH2D

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
104
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNSKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 25
structure length 104
sequence length 117
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2D01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1nh2D02
1YTFC 1YTFD 5IYCO 1RM1B 5IYDO 1RM1C 1NVPD 1NVPC 1NH2D 5IYBO 1NH2C
chains in the Genus database with same CATH superfamily
5JVDA 1B3QA 1BL8A 3UO3A 1TUBA 4LR3A 3LNMB 1LUVA 2PF4E 4TV9A 3UCSC 4UB8Z 2XTAA 4GX5A 4E2LA 3ZJZA 4TV8B 2XAFA 5LP6A 2OT5A 2YIBA 1MA1A 2EX3A 5GTIZ 5BMVA 4D6TH 4X1YA 1JPXA 2ITDC 1IXMA 3ZN0A 4Z1MG 1VQMV 4ASUG 3RYFA 3BEHA 2ZQMA 1FJGB 4I4TB 1W59A 1YTFB 4RWUA 4UCVA 1PKXA 1BQZA 3VQXA 4MVMA 1PNKA 1OCRB 2ETNA 1IBMB 5FNVB 2ZXWB 1I0HA 2FMLA 2CH7A 5IE9A 2HKOA 1AR5A 1XMOO 3KG2A 5DN6G 4DK1A 1S76D 3RYCA 5GW7A 2N05A 2QKAA 1HNWO 1RPOA 2ZNJA 3JD0A 4GUNA 5JWPA 1PM9A 3ZX6A 3RYIB 1KECA 3G4SV 2EILC 3FB6C 3B2EE 5H6QA 4LWSB 2JGDA 5E79Z 3L75H 4QE7A 4ABMA 2ZCEA 1XMQB 2BOCC 1ZTEA 1SKVA 4UUJC 1ZLZA 1NU1H 1BSMA 3H9VA 3WG7C 5BY1A 2X6CA 2YICA 3CYOA 1HNWB 4CH6A 3JD1A 2WLLA 3ZMTA 2W6JG 1JQ0A 3K59A 4MT8A 5J9PC 2P6JA 3H1IH 1IBLO 2AHYA 2DYRC 4DV4B 2Q4PA 4E4EA 3I5DA 1VQ5V 2YI9A 2P22C 3HPLC 4PDMA 3ZMSA 1AP5A 1EN4A 3JARA 3FB5C 5KHKA 5D5QA 4DV1O 4DXWA 4J9YB 4JI4B 3T1HO 3E22B 1RSOA 1SQPH 3RFRA 2E74B 3FYEB 3JAMN 4FLVA 2LP7A 2QE7G 3VQVA 4PJ0Z 4DR4O 3X2QC 1IBLB 1I7FA 4J7KA 3TGUH 2FTKA 1AI5A 2CK3G 4PHZA 2QWQB 1KD1W 2HG5C 1CXZB 4JF3A 1S0VA 4X64O 5EBWC 5B1BC 4DV1B 1KBHA 3T1HB 3P3PA 4I4TA 4DR6O 4N21A 4LF7O 4Q20A 1HWYA 1M57B 1F51A 3E8GA 3LSSA 4I55B 1R3JC 2EBOA 1F4NA 5IY5B 2LGQA 4WF9V 3F5TA 1O9GA 3SYQA 3CSXA 3FYIB 2F23A 4IYHA 1VQ6V 3E2EA 1OV9A 3SPHA 4X64B 1SQVH 4QNHB 4Z1VA 5DEDA 4FLTA 2OIEA 2LFSA 3ASOB 2ODMA 3ABMC 1ZUQA 5B3SC 2IJHA 4L8JA 4DR6B 1OCCB 4DRXB 3CXCU 5IJ9A 4LWSA 1QU7A 1OCZB 2VRZA 4UCRA 1NH2C 4GX2A 1SQXH 4W4KA 1G4YB 1X59A 4PD4F 5B5EZ 3IC7A 3MD0A 2XUMA 2D2CB 2DJVA 3D3QA 1D2DA 2Q9LA 2Y4UA 3CHXA 4TT3G 4BR6A 3K5MA 3ZS8C 1NBMG 2R72A 3QG5A 1GN6A 3SPIA 1M5IA 2E3CA 1BQ0A 1I5YA 3ZIAG 4J42A 2GTSA 3TETA 3CMAV 1NR1A 2B1IA 2P4VA 4RAIA 1V55B 3E8FA 4JGSA 4G27B 1M56C 2JRIA 1B04A 2CTPA 4BAYA 1K34A 4UCUA 2QA4V 4WFEA 3RN4A 4KUMA 3N2GB 3ETEA 3IC9A 3JATB 3E22A 5CN0A 4JZGA 4RUFA 3QTCA 5IYCO 4JI3B 3KZIZ 1FD9A 4B3MO 2AHZA 1Q3EA 4TUYB 2YS8A 1M4UA 4JV5O 4ZHQB 3HKBA 4GKJO 5GTHZ 3ASOC 1OCCC 1SQFA 4IHJB 4K35A 2ILMA 2QR4A 1X4TA 3SJAC 3OE7G 3BA8A 1OCZC 1Q6IA 4P30A 5CA3A 1RFYA 3QNEA 3S3XA 4FM1A 4QGPA 4DUYB 4FZ0A 1US6A 4X20B 4MVOA 5KHJA 3B77A 4B3MB 2MK3A 4JAUA 5JQGA 1U97A 5IYDO 3LNNA 5LXTB 4OGQB 4JV5B 3A0RA 4PA3A 1HR0O 3THOA 5F2VO 4NKGB 2PYLA 2LFRA 3AG2B 4NTYA 2BTOA 1K7DA 4H0LB 1QR9A 1YDXA 1U96A 4JTAB 5JH7B 4HBNA 1GTOA 4EFEA 1QHTA 1R73A 2HHHO 1W0KG 2PGGA 3OUFA 1FAFA 2Q8VA 4DRXA 1YZBA 1XNQO 1GN2A 2EIMB 2YXLA 3AG4B 4YJ2B 2F66C 3VOUA 3A0BZ 2VS0A 5CB4A 2RMKB 4LH6A 3QO8A 5KHGA 1HR0B 2ZIOA 4FFKA 5LYJB 1Q82W 1Q8IA 3CCUV 1Y6XA 2QKCA 2N04A 1GM9A 3UKMA 1AILA 1NS1A 3OAAG 3D3IA 2X6AA 4B3SO 3CD6V 3VBBA 2Q5ZA 3ASNB 5GONA 2UUBB 5KX5A 1M1KW 3J80N 3F7VC 3HKEB 2QWPB 5L3FA 2Y48A 3E8BA 1XNQB 3FAVB 1VQ9V 2K9PA 4KFMA 3RYHB 4FLUA 1O9HA 2WSSG 2EIJC 2HVKC 2JIZG 1WPXA 3TJTA 2JJ2G 1COWG 1VQKV 2KG7A 3W7UA 3N2GA 2CAZC 2OTLV 4K0KO 3HKCB 2PI4A 4MVZA 2QKSA 4MTGA 2NN4A 3M8AA 3AG2C 2P90A 2QJ1A 4N23A 1XUQA 2PZSA 4B3SB 4P2ZA 2DYSC 2ZD9A 3BABA 4QE9A 4ZHQA 3HR0A 4ZI7A 2AGAA 4DR2O 2IJJA 4DW0A 1S3JA 1VQLV 4X62B 2H8PC 3CWBH 4I5SA 3PN1A 4CC6A 4AI8A 1V54B 5KLVH 5EBMC 3SYPA 1GO3F 3OGIB 5KA6A 1R3IC 4K0KB 1GMGA 5LMNO 4X20A 4U7NA 2VWJA 1CPYA 3T4ZA 4H33A 2YXYA 3SGIA 4TWKA 2HJDA 1EZVH 3UO2A 3CP1A 4BIUA 1HNZB 3ZRVA 3U0ZA 1G6UA 2QTOA 1AB3A 4G28B 5CBHA 1K4CC 4DR2B 3OR6C 3ZHTA 2RCVA 1VARA 2PUSA 1FS0G 3AG3C 3G67A 4FK5C 4I9WA 3IAYA 3BAAA 3ZBHA 3CCEV 4CZZA 1K97A 4YHHO 4DV2B 2YC0A 5B1OA 3JAWB 5LMNB 2OWOA 1OZ0A 3CS5A 4EFBA 2A0LA 2IJKA 1KP2A 5LMUO 3PJSK 3E35A 5JCOA 3HKDB 1GRJA 5LGUA 5KUKA 2UU9O 1XEQA 3G80A 2EULA 1TUEB 5LYJA 3G6EV 1KC8W 1NQTA 3WFVA 4Z2WA 2JVDA 3CCMV 5LA6A 2JK5C 2XOKG 5CA1A 3P30A 3JCZA 3SJCC 3O65A 5LP6C 1E1QG 4YHHB 1MG1A 4NXNO 3SYOA 1YITV 4DR3O 1VP7A 4K8XA 2EILB 2EIKC 3HKEA 2RQ6A 3RYHA 2ADQB 5LMUB 1JVMA 2YIBD 4TOIA 3B4SA 1THZA 1I5XA 4MTXA 5CMUA 3NR7A 3ABUA 5BZBA 1WA8B 2UU9B 5H2FZ 1UPGA 2WLIB 4JZ2A 2UXDB 3WG7B 1Q43A 4PA9A 5EZYA 2DW4A 2F1MA 3RVZA 1SA0B 4ZOLB 2FKXA 4NXNB 4O2AB 3Q4HA 4DR3B 2YI8A 2DYRB 4OXSA 4IL6Z 3U10A 3C3SA 4KP4A 1NZ6A 4U3JB 2BSKB 4X1IB 4WCEV 4FFBB 1WN7A 1GN3A 2Q7HA 4I50B 2DQ0A 1R3KC 1S5HC 4LFAO 4XDKA 1Y76B 5KMGA 3MHSC 1SC5B 4BW5A 2HEPA 4K3AA 4FIPC 1H38A 5DECA 2Q0AA 3X2QB 2WAMA 4PI2A 1L0NH 4EEQA 4GLXA 5B1NA 5LL6Y 2OTJV 1L0LH 4QPJA 1SS3A 1VF6C 2GV9A 3AK2A 1MOFA 1R6KA 3JD4A 1W0JG 4NXMO 1OJHA 4X1KB 4JYBA 5B1BB 1XILA 1AR1B 2ZKOA 2M6YA 1J5EO 4LFAB 1BT8A 3OTFA 1JOYA 1YIJV 1VQ4V 3JAWA 2DQ3A 2Y0IA 1XMOB 2FL4A 2IBZH 1ZSPA 2ZNIA 2YXHA 4DV6O 1XREA 1QVGU 3HKDA 1W2BU 4OPAA 3AG1C 3EHBB 3WB1A 1TVKB 4BW9A 1P4RA 5KHHA 4JI8O 3BCCH 4Q6GA 1CP9A 1H2NA 2Y0PA 4NXMB 1JX9A 4BWAA 1AR4A 4O4LA 1J5EB 3ABMB 5B3SB 2R70A 3VQYA 3OT7A 2YDEA 3D36C 2BCCH 4RQFA 4DV6B 1NH2B 3L9DA 3OMIB 3ZCCA 1Y4MA 3J81N 1QQCA 5DM6V 2VQFO 2IM9A 2N74A 1DF5A 1K92A 4JI8B 2WLIA 3CRRA 2ZDIA 2UXNA 4KXRA 4GKKO 5J2UB 3ZHVA 4TV8A 1S72V 1EM1A 3SYAA 1SA0A 4O4HB 3C3TA 4ZOLA 3UT5B 1KMIZ 4O2AA 2Z0AA 1GM7A 5AG2A 1AI7A 4U3JA 2BSKA 4X1IA 1RM1C 1M56B 2XNDG 3TXQA 2WWWA 1XL4A 2QWNB 3ZN1A 2H94A 4PDRA 1SZXA 4I50A 1BHAA 3CE2A 1E1RG 1YXBA 1YEWA 4NYKA 3JD3A 5FNVA 4DR4B 1TGOA 5HFMA 1Y76A 4GKKB 2ATKC 4X89A 4MSWC 3FB8C 3CCRV 4UVAA 4J41A 4I0XB 3CCQV 2YIAA 5BR8O 2P7TC 3GB7C 4PDVA 2HVJC 4DV3O 1WJZA 3K03A 1H8HG 1YI2V 4UXNA 1SERA 3RYIA 3OM3B 4LF7B 4IT5A 4O4IB 1G8MA 4PV1B 1NT2B 4F6EA 1EN6A 1YJNV 1JJ2U 3A2FA 1GAXA 1WAZA 3K0GA 4PA7A 3K06A 4HNAB 2JDIG 3I56V 2EZOA 3ETDA 2GUZB 1QR8A 3DC5A 3SPJA 5BR8B 3OGCC 4DV3B 2DOSA 3QO5A 3QF7A 1KB9F 4GX1A 3DGEA 1HW7A 4OPHA 2GBOA 1XI1A 4ZBMA 3AEIA 4DV5O 1PL4A 1NVPD 2W0XA 2E76B 1FXKC 4ICGA 3F5WC 5B66Z 5EK0A 1Q86W 3AK3A 1NR7A 4GZRB 4FLZA 2UUAO 1IDSA 3LUTB 1QNMA 1Y67A 2UUCO 1NI8A 2P4KA 5IYBO 1N32O 5KHIA 5L3GA 1AJQA 3JASB 2Q68A 1H2KA 5B1AB 3CJHB 3APOA 5J2UA 3ZHQA 4DV5B 3LDDA 4NTWA 5IJ0B 5LHHA 2C2AA 2LW1A 3RW0A 4XBFA 4IIJB 3UT5A 2UUAB 4AQYO 1QBZA 1SQGA 2UUCB 1DTOA 4WBNB 4B7EA 4F6RB 2EIJB 2Q73A 1H2GA 2Q69A 3G6BA 2KSDA 2E5LO 2W6IG 3RWRD 1VF7A 2MW2B 4I55A 3KCXA 5LHIA 2ZT9B 3A0HZ 4LF5O 1RPRA 1K4DC 4JPRA 4FLWA 1HNXO 4U7OA 3ABKC 2A7WA 4GKJB 5KA5A 1P84F 4PI0A 4NVPA 1Z5VA 4D7TA 4I0XA 1H2SB 1R3LC 3KCYA 2R9RB 2DYSB 5EIBD 5L3EA 1VIBA 3ZMVA 2VQEO 1YVWA 2UXXA 4O4IA 1N36O 2E5LB 2GSMB 1FFTB 4IGGA 3OTOO 4PA4A 3VQWA 1SESA 2Y69C 4LH7A 1P49A 4LF5B 1TAEA 3K9SA 4HNAA 1HNXB 3MHHC 1M9NA 1K73W 3HB3B 5HFLA 1SF9A 1BGYH 1PV0A 5B1AC 4G2KA 4J7ZA 4LP8A 1Q81W 1NKDA 4P9OA 1ZAUA 3CB2A 2LQTA 2HHHB 2WLKA 4CS3A 2VQEB 2HR3A 4J10A 4B08A 3AG3B 1N36B 4IYIA 3P3NA 3OTOB 1GM8A 1ZL8B 2RJZA 4JI7O 4JI0O 1KQSU 4UB6Z 4LFCO 1MSWD 1KP3A 3B40A 4DR1O 1K3EA 1XDCA 3T1CA 4GT1A 1I94O 3JATA 3AG7A 4LNUB 5J2TB 3LSUA 4LF8O 4I9QA 1IXBA 1F23A 2A9HA 4UCSA 2FYUH 2HP8A 4TUYA 1J95A 3TXSA 4XDLA 2JJ1G 5JVDB 5A9GA 1TUBB 2LJ2A 2LW7A 1DK1A 4R50A 4TV9B 4JI7B 2F95B 2Z5UA 1F7YA 4OX9O 4UCOA 1FXVA 5LP6B 4IIJA 4H44B 4LFCB 4IHJA 1D5NA 2EINC 4DR1B 3RVYA 4DV7O 2EIKB 2XAJA 1GH6A 5BMVB 1I94B 4FLXA 4WBNA 3B09A 1V9PA 3LDEA 4JAAA 4FMTA 4HZ3A 3ETGA 1H2MA 4LF8B 2ARHA 2QM8A 3MDSA 2L6LA 4JI5O 1YCIA 3G71V 5LXTA 1OHHG 3SDLA 2OCHA 3L74H 2XT9A 4OX9B 4U3FH 4NR1A 5JH7A 5L3CA 4R7CA 3ZMUA 4DV7B 4JASA 4LF6O 2IH1C 1XNRO 4J80A 1IZ3A 4TQDA 2ZIMA 4DO2A 4CC5A 4DW1A 3STLC 1JA8A 2CTRA 4LF4O 2WLJA 4X88A 4FM2A 2JEUA 2JS5A 1M93A 4JI5B 1K33A 4YJ2A 2JGDB 3BY6A 3SJBC 2CGOA 3ZMZA 1L1FA 1P7GA 4MS2A 4W4LA 2Q0OC 4DUZO 1OCOC 2ZE6A 5JJJB 2HJFC 3B8NA 3OEEG 3ZHRA 5EYPB 4LF6B 1IX9A 1YJWV 2WPDG 3B8MA 1XNRB 1P7BA 1KKDA 3FAVA 1ZL8A 4LF4B 2A79B 4RUEA 1R6TA 3FB7C 2ZR3A 2IW5A 2OCCC 3TK1A 2EJRA 2CDYA 3BRCA 3OMAB 5L3BA 1QLNA 3UQ8A 1LR1A 4DUZB 4X8AA 3H1LH 3WB0A 4UFZA 3HKCA 2A06H 4LNUA 4GCZA 5J2TA 1WPBA 3AG1B 1E79G 4H37A 1B6QA 3U11A 3L72H 2A3QA 4TSFG 1YJ9V 5E1AC 3D8CA 1Z2GA 4FZ1A 1IBMO 2V7QG 1QLEC 2ZE7A 3E8HA 4BIZA 1EZJA 1MNGA 3K08A 1FXHA 2YEVB 2BE3A 2QDOA 3FFQA 3SR2C 3TCUA 3OMNB 5IT9N 4RO2A 1NJIW 1MZEA 2X7RB 2QSAA 2GTAA 4H13B 4MW8A 4UVBA 2CGNA 4ZKIA 5KAFZ 2DWEC 4QJFB 3WB2A 4WFFA 5LGTA 3EFFK 1VQOV 3ICXA 4NTXA 1XMQO 1HDJA 3CX5F 3M99B 2NLJC 4QIWF 4CH4A 4GX0A 1FPOA 2YIDA 3H1KH 2Q67A 5K1PA 2XAQA 4YY3O 1UJWB 3OEHG 1DLBA 3JALB 1MZFA 3CRCA 3H01A 2IU3A 3RT3C 1RM1B 4JI2O 3IGAC 1Y66A 4EKWA 4MTOA 1S5JA 3N2KB 3STZC 3BFRA 2W0FC 4WFHA 4DV4O 5IJ9B 1BE3H 2QTSA 4UCTA 2X0LA 2PI5A 1JCHA 4FLYA 5L3DA 4UV9A 5EBLC 2Y4TA 1KUQA 3EXAA 4JI4O 4DK0A 2YUAA 4YY3B 2ZDIC 5EYPA 1MSDA 3OFNG 1AROP 1VF6A 3RBZA 4JYYA 4JI2B 3T2MA 3SPCA 2B9ZA 4GYCB 2H3OA 2XHBA 2V1DA 1XL6A 1Q90D 1EN5A 4D7SA 4LBEC 4X9QA 1WA8A 1N34O 1YTFC 4PA6A 1SZTA 1HP8A 3E86A 2LGWA 3L73H 2HFEC 3ZRWB 1GKFA 1YTFD 1BZKA 3JYCA 2WLNA 3CC4V 1OCRC 5CA0B 1WB8A 2ZXWC 1EFRG 4B3TO 4MTFA 4MVQA 2PYJA 1CEZA 2BTQB 5KAIZ 3RGBA 1NVPB 2B5UA 4X65O 1QVFU 3ZEDA 2LO1A 2ZR2A 1MMMA 3JSLA 1JJOA 2R9AA 1FXKB 1XQ8A 2AZ0A 1UFIA 2P67A 5H5NA 2YEVA 4FFBA 3HKBB 4JI6O 1B06A 3K3WA 2QGNA 3CCVV 1LUWA 3MAQA 3CCJV 1WB7A 2K1EA 3CC2V 2VQFB 1WP7A 2WA4A 1N34B 4CBCA 1F4MA 1Q6UA 3D36A 4YIPA 4CS4A 2RDCA 4JI1O 2DMXA 2RN9A 4B3TB 2HLDG 4J11A 4UVCA 1N8RW 5IYZB 5EC1C 3GWKC 2EZPA 4X65B 4O4JB 5CBFA 3APQA 2WA3A 1R1BA 1AI4A 4JAVA 5JQGB 3OR7C 2QWRB 4JI6B 2QM7A 1AI6A 4J7JA 1FFXB 1DGSA 4X1KA 3K79A 3JALA 3N27A 4KL1A 5IDJA 2NR5A 1GN4A 3CCSV 3N2KA 2F93B 4JI1B 1Z5WA 1BCCH 3E89A 3ZRXA 4MW3A 3SYCA 3DXRB 3ABKB 4TQFA 1VF5B 3O9OA 3FD9A 1TVKA 1BHBA 5CB4B 4JTCB 2CTQA 3A8TA 3K5OA 1NH2D 1NVPC 4FM0A 4DV0O 2JEXA 2UXCO 3SJQC 3ZHSA 2F4VO 2FB5A 1XOUA 1K9MW 1QCEA 3P32A 1KU9A 2KKWA 3BA9A 1K8AW 1AP6A 4JI3O 2RNBA 2UXBO 3CXHF 3K0DA 5H6RA 3OW2U 3CRAA 5JJEB 3H1HH 1URFA 5GONB 1YSCA 4KHPO 3ETQA 5KX5B 2ADPA 2Y69B 4HAMA 2E75B 1YF2A 3CRQA 2ZE5A 4EB6B 3UM7A 1M57C 2JGUA 1JR9A 5FLXN 2AZ2A 4B7KA 2AW9A 3LSQA 3GVMA 4DR7O 3ZRWA 4LC1A 1D5AA 2KG7B 5CA0A 4DV0B 1VQ8V 1NTZH 3OUSA 5IY5C 2UXCB 2F4VB 2XASA 3OD4A 5EC2C 4DUYO 3QVNA 3QO7A 4O4HA 2R9IA 2BTQA 1ZX3A 1ZWIC 1Q5OA 2UXBB 3FKSG 4YJ3B 3ZRSA 5FPRA 3IJ4A 3T4DA 4WFBV 2CUGA 1EBOA 3ML0A 4KHPB 1FXKA 1Q7YW 3W7SA 2Q7EA 4ZI7B 3DSQA 3KKYA 3I55V 4K8ZA 1N32B 2CTWA 3H1JH 3T1YO 3JAKB 4LFBO 2V4DA 1R6NA 2KQXA 5TISZ 2F43G 4O2BB 3R66A 3K9AA 2VWKA 1N4CA 1PPJH 4DR7B 4A5UB 4F4LA 1KYOF 2GDSA 4ZIBA 2Z3YA 2D3OW 1VQ7V 5EIBC 4L87A 1JFFB 4FJCC 5IYZA 1M90W 4O4JA 3CPWU 4AQYB 3ABLB 4DR5O 5ITZB 2IH3C 2QEXV 3LDCA 3T1YB 2EINB 4LFBB 1FFXA 1FYJA 2PY5A 4R8CA 5IWAO 1DF4A 4JTDB 1V55C 1IURA 5LBQA 4XDJA 4CH3A 1RP3B 4CS2A 4UV8A 2GUZA 3E83A 2IU0A 2UUBO 3BVOA 2QWOB 4LF9O 3ABTA 3DXRA 2AXTZ 3K5LA 1SRYA 1PNLA 1VQNV 3M7MX 4I7ZB 1BMFG 4DR5B 3K58A 3L70H 4FPPA 2X6BA 1WNSA 3CMEV 5C8YB 5JJNB 3CEIA 5LOVB 5LA6B 5IWAB 3K04A 1WP8A 5CA1B 1Y74B 2EJ7A 4AILC 1H8EG 2ZM6O 3BPZA 4CH5A 1SQBH 3JSNA 5BXZA 4JYAO 4LF9B 3CCLV 4X62O 3F7YC 1WLEA 4RQEA 3JASA 4EB6A 1H2LA 1LNQA 1TA8A 3K5NA 1OCOB 3CJHA 4PDLA 3ABLC 1I08A 5IJ0A 4JI0B 4YIOA 5EZYB 1KKCA 3CRMA 1PL0A 2QM4A 4YJ3A 1K5SA 3FX7A 1HNZO 1N0NA 2DWDC 3Q4HB 2ZM6B 4WFGA 2Q6AA 2PTMA 4X1YB 3W7XA 4JYAB 3GWOA 4F6RA 5CBGA 2OYQA 3RYFB 5LGNA 1IVSA 2DN9A 1AJPA 3JAKA 1JMKC 1SETA 4YXWG 4O2BA 1ORQC 2OCCB 4MVSA 1SQQH 2ZINA 4JYCA 1NTKH 5FL7G 5C93A 3K57A 1VEWA 3WU2Z 2WLHA 2EIMC 3W7WA 3AG4C 5JCOC 1GK9A 4B3RO 1PD3A 5A2QN 2XAHA 4DV2O 4AHCA 5LHGA 2CH7B 2ZE8A 1JFFA 3DC6A 4P9PA 5KMGB 4MVUA 1FKAO 3RYCB 1N0JA 1IBKO 1QLEB 2CE4A 4PELA 5ITZA 3ZHUA 3W7TA 2L35A 1ENVA 2XAGA 3ASNC 2ITCC 4X66O 4HYOA 1MABG 2JS3A 1XHZA 3S3WA 3AK1A 4WFAV 4B3RB 4LCUC 1S77D 5D5PA 1T5EA 4DYLA 4NB5A 2KB1A 2Q7GA 2BOBC 1G1XB 3CC7V 1XHXA 2P06A 1NTMH 1VQPV 1IBKB 2WLMA 1N33O 2WLLB 3BHPA 3L71H 4BIOA 3C90A 2G38A 2B1GA 5KUMA 5C8YA 2UXDO 1XBLA 4J9ZB 1YHQV 1BS3A 5LOVA 2NNUA 3J7AU 2O57A 4X66B 3JD2A 3SPGA 1ROPA 1S5LZ 5H9CA 1Y74A 1K5QA 3NXSA 4C7UA 2OIGA 4O4LB 4R6ZA 1AVMA 5FPOA 4MVRA 1A32A 3JARB 3R65A 1PP9H 1V54C 1VMGA 3DTUB 1L8DA 3EVKA 2YSUB 2M7WA 1AJNA 1PNMA 3IFXA 1FJGO 4QPKA 2DE0X 1RSOB 2IJIA 1Q6HA 5K1XA 1N33B 4FVMA 2GHYA 3JCUZ 2P5OA
chains in the Genus database with same CATH topology
2Q68A 2QKSA 1BL8A 1EFRG 2ZXWC 5B1AB 4MTGA 4MTFA 4MVQA 1CEZA 3LNMB 3AG2C 1NVPB 2P90A 3LDDA 2B5UA 4N23A 1QVFU 4GX5A 4E2LA 3ZJZA 4P2ZA 2ZR2A 5LHHA 2XAFA 2C2AA 2OT5A 3RW0A 2DYSC 2ZD9A 4XBFA 4QE9A 1FXKB 2P67A 2IJJA 1S3JA 2YEVA 1VQLV 3K3WA 3CCVV 2H8PC 4I5SA 1QBZA 3CCJV 1JPXA 2K1EA 3CC2V 2ITDC 1IXMA 3ZN0A 4Z1MG 1VQMV 4ASUG 4CBCA 1F4MA 1DTOA 3BEHA 2EIJB 1V54B 2ZQMA 1H2GA 2Q69A 3D36A 1YTFB 5EBMC 2W6IG 3SYPA 1PKXA 1GO3F 5KA6A 1R3IC 4MVMA 1GMGA 5LHIA 1PNKA 1OCRB 2HLDG 1RPRA 4U7NA 4UVCA 1K4DC 4JPRA 4U7OA 3ABKC 1CPYA 2ZXWB 3T4ZA 5EC1C 4H33A 1N8RW 5KA5A 4TWKA 2EZPA 3CP1A 4BIUA 5CBFA 3ZRVA 2HKOA 3KG2A 5DN6G 1AI4A 4JAVA 1S76D 2QTOA 4G28B 1R3LC 5GW7A 3OR7C 5CBHA 1K4CC 2R9RB 2DYSB 3OR6C 2QM7A 1AI6A 1RPOA 5L3EA 3JD0A 1FS0G 3K79A 3ZMVA 3AG3C 4FK5C 4I9WA 2UXXA 1KECA 2GSMB 1FFTB 3CCEV 5IDJA 4CZZA 3G4SV 1K97A 2EILC 4PA4A 3FB6C 5H6QA 3CCSV 1SESA 2Y69C 5B1OA 4QE7A 1OZ0A 2A0LA 2IJKA 3MHHC 3E89A 1M9NA 4MW3A 3ZRXA 3SYCA 1K73W 2BOCC 1KP2A 3HB3B 5HFLA 3PJSK 3E35A 3ABKB 4UUJC 5B1AC 4G2KA 5KUKA 5LGUA 1BHBA 4LP8A 3WG7C 1Q81W 1NKDA 2X6CA 4JTCB 4P9OA 1NH2D 1TUEB 1NVPC 3G6EV 3CYOA 1KC8W 3JD1A 1NQTA 2WLLA 2WLKA 3WFVA 2JEXA 3SJQC 3ZMTA 2W6JG 1K9MW 3CCMV 1JQ0A 1QCEA 2JK5C 2HR3A 2XOKG 3P32A 4MT8A 5J9PC 2P6JA 3P30A 1K8AW 3AG3B 3JCZA 2AHYA 2DYRC 1GM8A 1E1QG 5H6RA 3K0DA 1MG1A 3OW2U 3SYOA 1YITV 1VQ5V 1KQSU 1YSCA 2EILB 2EIKC 1MSWD 1KP3A 2Y69B 4HAMA 3HPLC 1K3EA 4PDMA 3ZMSA 1JVMA 3FB5C 4GT1A 3T1CA 1THZA 1I5XA 4MTXA 4DXWA 5CMUA 5BZBA 3ABUA 4J9YB 3UM7A 1M57C 3LSQA 3ZRWA 4LC1A 2WLIB 3WG7B 3FYEB 1F23A 2A9HA 1VQ8V 2LP7A 3OUSA 5IY5C 2QE7G 2XASA 4PA9A 5EC2C 1J95A 4XDLA 2JJ1G 2DW4A 3QO7A 3X2QC 2R9IA 3RVZA 1ZWIC 2FTKA 4R50A 3FKSG 2Z5UA 3ZRSA 1AI5A 3T4DA 4WFBV 2DYRB 2CK3G 4OXSA 1FXVA 1EBOA 3ML0A 4KP4A 1FXKA 1Q7YW 1KD1W 2EINC 2HG5C 3W7SA 4WCEV 3I55V 3RVYA 4JF3A 1S0VA 2EIKB 2XAJA 5EBWC 5B1BC 1R6NA 2F43G 3K9AA 2DQ0A 3LDEA 1R3KC 4FMTA 4HZ3A 3ETGA 4N21A 1S5HC 4Q20A 1HWYA 1M57B 4F4LA 2QM8A 1F51A 3E8GA 2Z3YA 3LSSA 4XDKA 1R3JC 2D3OW 3MHSC 1VQ7V 2EBOA 1F4NA 4BW5A 5IY5B 4L87A 3G71V 1OHHG 4FJCC 1M90W 4FIPC 1H38A 4WF9V 3CPWU 3X2QB 2WAMA 3SYQA 3FYIB 3ABLB 1VQ6V 3E2EA 2IH3C 5B1NA 2OTJV 2QEXV 4QPJA 3LDCA 5L3CA 4R7CA 3ZMUA 3SPHA 4JASA 4QNHB 2EINB 1MOFA 1R6KA 2IH1C 3JD4A 1W0JG 2LFSA 3ASOB 4JYBA 3ABMC 4R8CA 5B1BB 5B3SC 1DF4A 2IJHA 4JTDB 4DO2A 1OCCB 1AR1B 1V55C 3STLC 3CXCU 5LBQA 1JOYA 4XDJA 2WLJA 4X88A 2JEUA 1YIJV 1OCZB 1VQ4V 4UV8A 2DQ3A 1K33A 3E83A 1NH2C 3BY6A 4GX2A 2IU0A 3ZMZA 1G4YB 1L1FA 4MS2A 3ABTA 3IC7A 1QVGU 3MD0A 1SRYA 1PNLA 1VQNV 1W2BU 1OCOC 1BMFG 3AG1C 2HJFC 3EHBB 3B8NA 4TT3G 1P4RA 3OEEG 4FPPA 2X6BA 3CMEV 1NBMG 1CP9A 3SPIA 1YJWV 2WPDG 3B8MA 1JX9A 1I5YA 3ZIAG 1P7BA 3K04A 1KKDA 3TETA 3CMAV 3ABMB 1NR1A 5B3SB 2B1IA 2A79B 4RAIA 1V55B 3E8FA 4JGSA 4G27B 4RUEA 3FB7C 1M56C 1H8EG 2ZR3A 4BAYA 4RQFA 1NH2B 3OMIB 2IW5A 2OCCC 1K34A 3TK1A 3CCLV 3F7YC 2EJRA 3ZCCA 3OMAB 1WLEA 5L3BA 1QLNA 4RQEA 1Y4MA 4X8AA 2QA4V 4WFEA 4KUMA 5DM6V 3ETEA 5CN0A 1LNQA 4GCZA 1DF5A 1OCOB 1K92A 4RUFA 2WLIA 3AG1B 1E79G 4H37A 5IYCO 2ZDIA 2UXNA 1B6QA 4PDLA 3ABLC 4TSFG 2AHZA 1YJ9V 1S72V 5E1AC 2V7QG 3SYAA 1QLEC 3E8HA 4BIZA 1EZJA 1PL0A 3K08A 1FXHA 1K5SA 2YEVB 3ASOC 2DWDC 1GM7A 4WFGA 3TCUA 1OCCC 1AI7A 2Q6AA 3OMNB 4RO2A 3W7XA 1NJIW 3GWOA 5CBGA 1RM1C 1M56B 2X7RB 5LGNA 3OE7G 2XNDG 1AJPA 1OCZC 1SETA 1XL4A 2WWWA 4P30A 5CA3A 3ZN1A 2H94A 3QNEA 4YXWG 4PDRA 1ORQC 2OCCB 4MVSA 4MW8A 1BHAA 4UVBA 4JYCA 4ZKIA 1E1RG 5FL7G 5C93A 2WLHA 3JD3A 2EIMC 3W7WA 4MVOA 5HFMA 3AG4C 2DWEC 3B77A 4QJFB 2ATKC 1GK9A 1PD3A 4WFFA 2XAHA 4X89A 4MSWC 2MK3A 3FB8C 5LGTA 3EFFK 4UVAA 5LHGA 3CCRV 1VQOV 4JAUA 4P9PA 3M99B 2NLJC 4MVUA 5IYDO 4QIWF 3CCQV 3A0RA 4PA3A 4GX0A 2P7TC 3GB7C 4PDVA 2HVJC 1QLEB 2Q67A 4PELA 2LFRA 3K03A 3AG2B 1H8HG 2XAQA 1YI2V 1K7DA 4UXNA 1SERA 3W7TA 1UJWB 3OEHG 1DLBA 1QR9A 4JTAB 3OM3B 1GTOA 1ENVA 1R73A 1W0KG 2XAGA 1G8MA 2IU3A 3H01A 3ASNC 1RM1B 2ITCC 1YJNV 3OUFA 1JJ2U 3IGAC 4HYOA 1Y66A 4EKWA 4MTOA 3STZC 1MABG 3K0GA 4PA7A 2W0FC 3K06A 4WFAV 4WFHA 2JDIG 3I56V 2EZOA 3ETDA 4LCUC 2EIMB 1S77D 3AG4B 3VOUA 2KB1A 2X0LA 1JCHA 1QR8A 2PI5A 2BOBC 5L3DA 4UV9A 5EBLC 3CC7V 3QO8A 3SPJA 1VQPV 3OGCC 2WLMA 2WLLB 3QO5A 1Q82W 4GX1A 3CCUV 2ZDIC 3DGEA 1GM9A 2B1GA 5KUMA 3UKMA 4ZBMA 3OFNG 3OAAG 3AEIA 1AROP 4J9ZB 3D3IA 1YHQV 3RBZA 2NNUA 1NVPD 2X6AA 3T2MA 3CD6V 1FXKC 3SPCA 3VBBA 3ASNB 3JD2A 3F5WC 5EK0A 3SPGA 1M1KW 2V1DA 1ROPA 1Q86W 3F7VC 5H9CA 5L3FA 1K5QA 2Y48A 3E8BA 3NXSA 1NR7A 4R6ZA 1XL6A 1VQ9V 3LUTB 4MVRA 4KFMA 2WSSG 3R65A 4LBEC 2EIJC 1V54C 3DTUB 2HVKC 2JIZG 1WPXA 2YSUB 1YTFC 2M7WA 4PA6A 1AJNA 1PNMA 1SZTA 2JJ2G 3IFXA 3E86A 1COWG 4QPKA 5IYBO 2HFEC 3ZRWB 1VQKV 2IJIA 1GKFA 3W7UA 1YTFD 5L3GA 3JYCA 2WLNA 1AJQA 3CC4V 1OCRC 2GHYA 2OTLV 2PI4A 4MVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF C;  1YTF D;  5IYC O;  1RM1 B;  5IYD O;  1RM1 C;  1NVP D;  1NVP C;  1NH2 D;  5IYB O;  1NH2 C; 
#chains in the Genus database with same CATH topology
 5JVD A;  1B3Q A;  1BL8 A;  3UO3 A;  1TUB A;  4LR3 A;  3LNM B;  1LUV A;  2PF4 E;  4TV9 A;  3UCS C;  4UB8 Z;  2XTA A;  4GX5 A;  4E2L A;  3ZJZ A;  4TV8 B;  2XAF A;  5LP6 A;  2OT5 A;  2YIB A;  1MA1 A;  2EX3 A;  5GTI Z;  5BMV A;  4D6T H;  4X1Y A;  1JPX A;  2ITD C;  1IXM A;  3ZN0 A;  4Z1M G;  1VQM V;  4ASU G;  3RYF A;  3BEH A;  2ZQM A;  1FJG B;  4I4T B;  1W59 A;  1YTF B;  4RWU A;  4UCV A;  1PKX A;  1BQZ A;  3VQX A;  4MVM A;  1PNK A;  1OCR B;  2ETN A;  1IBM B;  5FNV B;  2ZXW B;  1I0H A;  2FML A;  2CH7 A;  5IE9 A;  2HKO A;  1AR5 A;  1XMO O;  3KG2 A;  5DN6 G;  4DK1 A;  1S76 D;  3RYC A;  5GW7 A;  2N05 A;  2QKA A;  1HNW O;  1RPO A;  2ZNJ A;  3JD0 A;  4GUN A;  5JWP A;  1PM9 A;  3ZX6 A;  3RYI B;  1KEC A;  3G4S V;  2EIL C;  3FB6 C;  3B2E E;  5H6Q A;  4LWS B;  2JGD A;  5E79 Z;  3L75 H;  4QE7 A;  4ABM A;  2ZCE A;  1XMQ B;  2BOC C;  1ZTE A;  1SKV A;  4UUJ C;  1ZLZ A;  1NU1 H;  1BSM A;  3H9V A;  3WG7 C;  5BY1 A;  2X6C A;  2YIC A;  3CYO A;  1HNW B;  4CH6 A;  3JD1 A;  2WLL A;  3ZMT A;  2W6J G;  1JQ0 A;  3K59 A;  4MT8 A;  5J9P C;  2P6J A;  3H1I H;  1IBL O;  2AHY A;  2DYR C;  4DV4 B;  2Q4P A;  4E4E A;  3I5D A;  1VQ5 V;  2YI9 A;  2P22 C;  3HPL C;  4PDM A;  3ZMS A;  1AP5 A;  1EN4 A;  3JAR A;  3FB5 C;  5KHK A;  5D5Q A;  4DV1 O;  4DXW A;  4J9Y B;  4JI4 B;  3T1H O;  3E22 B;  1RSO A;  1SQP H;  3RFR A;  2E74 B;  3FYE B;  3JAM N;  4FLV A;  2LP7 A;  2QE7 G;  3VQV A;  4PJ0 Z;  4DR4 O;  3X2Q C;  1IBL B;  1I7F A;  4J7K A;  3TGU H;  2FTK A;  1AI5 A;  2CK3 G;  4PHZ A;  2QWQ B;  1KD1 W;  2HG5 C;  1CXZ B;  4JF3 A;  1S0V A;  4X64 O;  5EBW C;  5B1B C;  4DV1 B;  1KBH A;  3T1H B;  3P3P A;  4I4T A;  4DR6 O;  4N21 A;  4LF7 O;  4Q20 A;  1HWY A;  1M57 B;  1F51 A;  3E8G A;  3LSS A;  4I55 B;  1R3J C;  2EBO A;  1F4N A;  5IY5 B;  2LGQ A;  4WF9 V;  3F5T A;  1O9G A;  3SYQ A;  3CSX A;  3FYI B;  2F23 A;  4IYH A;  1VQ6 V;  3E2E A;  1OV9 A;  3SPH A;  4X64 B;  1SQV H;  4QNH B;  4Z1V A;  5DED A;  4FLT A;  2OIE A;  2LFS A;  3ASO B;  2ODM A;  3ABM C;  1ZUQ A;  5B3S C;  2IJH A;  4L8J A;  4DR6 B;  1OCC B;  4DRX B;  3CXC U;  5IJ9 A;  4LWS A;  1QU7 A;  1OCZ B;  2VRZ A;  4UCR A;  1NH2 C;  4GX2 A;  1SQX H;  4W4K A;  1G4Y B;  1X59 A;  4PD4 F;  5B5E Z;  3IC7 A;  3MD0 A;  2XUM A;  2D2C B;  2DJV A;  3D3Q A;  1D2D A;  2Q9L A;  2Y4U A;  3CHX A;  4TT3 G;  4BR6 A;  3K5M A;  3ZS8 C;  1NBM G;  2R72 A;  3QG5 A;  1GN6 A;  3SPI A;  1M5I A;  2E3C A;  1BQ0 A;  1I5Y A;  3ZIA G;  4J42 A;  2GTS A;  3TET A;  3CMA V;  1NR1 A;  2B1I A;  2P4V A;  4RAI A;  1V55 B;  3E8F A;  4JGS A;  4G27 B;  1M56 C;  2JRI A;  1B04 A;  2CTP A;  4BAY A;  1K34 A;  4UCU A;  2QA4 V;  4WFE A;  3RN4 A;  4KUM A;  3N2G B;  3ETE A;  3IC9 A;  3JAT B;  3E22 A;  5CN0 A;  4JZG A;  4RUF A;  3QTC A;  5IYC O;  4JI3 B;  3KZI Z;  1FD9 A;  4B3M O;  2AHZ A;  1Q3E A;  4TUY B;  2YS8 A;  1M4U A;  4JV5 O;  4ZHQ B;  3HKB A;  4GKJ O;  5GTH Z;  3ASO C;  1OCC C;  1SQF A;  4IHJ B;  4K35 A;  2ILM A;  2QR4 A;  1X4T A;  3SJA C;  3OE7 G;  3BA8 A;  1OCZ C;  1Q6I A;  4P30 A;  5CA3 A;  1RFY A;  3QNE A;  3S3X A;  4FM1 A;  4QGP A;  4DUY B;  4FZ0 A;  1US6 A;  4X20 B;  4MVO A;  5KHJ A;  3B77 A;  4B3M B;  2MK3 A;  4JAU A;  5JQG A;  1U97 A;  5IYD O;  3LNN A;  5LXT B;  4OGQ B;  4JV5 B;  3A0R A;  4PA3 A;  1HR0 O;  3THO A;  5F2V O;  4NKG B;  2PYL A;  2LFR A;  3AG2 B;  4NTY A;  2BTO A;  1K7D A;  4H0L B;  1QR9 A;  1YDX A;  1U96 A;  4JTA B;  5JH7 B;  4HBN A;  1GTO A;  4EFE A;  1QHT A;  1R73 A;  2HHH O;  1W0K G;  2PGG A;  3OUF A;  1FAF A;  2Q8V A;  4DRX A;  1YZB A;  1XNQ O;  1GN2 A;  2EIM B;  2YXL A;  3AG4 B;  4YJ2 B;  2F66 C;  3VOU A;  3A0B Z;  2VS0 A;  5CB4 A;  2RMK B;  4LH6 A;  3QO8 A;  5KHG A;  1HR0 B;  2ZIO A;  4FFK A;  5LYJ B;  1Q82 W;  1Q8I A;  3CCU V;  1Y6X A;  2QKC A;  2N04 A;  1GM9 A;  3UKM A;  1AIL A;  1NS1 A;  3OAA G;  3D3I A;  2X6A A;  4B3S O;  3CD6 V;  3VBB A;  2Q5Z A;  3ASN B;  5GON A;  2UUB B;  5KX5 A;  1M1K W;  3J80 N;  3F7V C;  3HKE B;  2QWP B;  5L3F A;  2Y48 A;  3E8B A;  1XNQ B;  3FAV B;  1VQ9 V;  2K9P A;  4KFM A;  3RYH B;  4FLU A;  1O9H A;  2WSS G;  2EIJ C;  2HVK C;  2JIZ G;  1WPX A;  3TJT A;  2JJ2 G;  1COW G;  1VQK V;  2KG7 A;  3W7U A;  3N2G A;  2CAZ C;  2OTL V;  4K0K O;  3HKC B;  2PI4 A;  4MVZ A;  2QKS A;  4MTG A;  2NN4 A;  3M8A A;  3AG2 C;  2P90 A;  2QJ1 A;  4N23 A;  1XUQ A;  2PZS A;  4B3S B;  4P2Z A;  2DYS C;  2ZD9 A;  3BAB A;  4QE9 A;  4ZHQ A;  3HR0 A;  4ZI7 A;  2AGA A;  4DR2 O;  2IJJ A;  4DW0 A;  1S3J A;  1VQL V;  4X62 B;  2H8P C;  3CWB H;  4I5S A;  3PN1 A;  4CC6 A;  4AI8 A;  1V54 B;  5KLV H;  5EBM C;  3SYP A;  1GO3 F;  3OGI B;  5KA6 A;  1R3I C;  4K0K B;  1GMG A;  5LMN O;  4X20 A;  4U7N A;  2VWJ A;  1CPY A;  3T4Z A;  4H33 A;  2YXY A;  3SGI A;  4TWK A;  2HJD A;  1EZV H;  3UO2 A;  3CP1 A;  4BIU A;  1HNZ B;  3ZRV A;  3U0Z A;  1G6U A;  2QTO A;  1AB3 A;  4G28 B;  5CBH A;  1K4C C;  4DR2 B;  3OR6 C;  3ZHT A;  2RCV A;  1VAR A;  2PUS A;  1FS0 G;  3AG3 C;  3G67 A;  4FK5 C;  4I9W A;  3IAY A;  3BAA A;  3ZBH A;  3CCE V;  4CZZ A;  1K97 A;  4YHH O;  4DV2 B;  2YC0 A;  5B1O A;  3JAW B;  5LMN B;  2OWO A;  1OZ0 A;  3CS5 A;  4EFB A;  2A0L A;  2IJK A;  1KP2 A;  5LMU O;  3PJS K;  3E35 A;  5JCO A;  3HKD B;  1GRJ A;  5LGU A;  5KUK A;  2UU9 O;  1XEQ A;  3G80 A;  2EUL A;  1TUE B;  5LYJ A;  3G6E V;  1KC8 W;  1NQT A;  3WFV A;  4Z2W A;  2JVD A;  3CCM V;  5LA6 A;  2JK5 C;  2XOK G;  5CA1 A;  3P30 A;  3JCZ A;  3SJC C;  3O65 A;  5LP6 C;  1E1Q G;  4YHH B;  1MG1 A;  4NXN O;  3SYO A;  1YIT V;  4DR3 O;  1VP7 A;  4K8X A;  2EIL B;  2EIK C;  3HKE A;  2RQ6 A;  3RYH A;  2ADQ B;  5LMU B;  1JVM A;  2YIB D;  4TOI A;  3B4S A;  1THZ A;  1I5X A;  4MTX A;  5CMU A;  3NR7 A;  3ABU A;  5BZB A;  1WA8 B;  2UU9 B;  5H2F Z;  1UPG A;  2WLI B;  4JZ2 A;  2UXD B;  3WG7 B;  1Q43 A;  4PA9 A;  5EZY A;  2DW4 A;  2F1M A;  3RVZ A;  1SA0 B;  4ZOL B;  2FKX A;  4NXN B;  4O2A B;  3Q4H A;  4DR3 B;  2YI8 A;  2DYR B;  4OXS A;  4IL6 Z;  3U10 A;  3C3S A;  4KP4 A;  1NZ6 A;  4U3J B;  2BSK B;  4X1I B;  4WCE V;  4FFB B;  1WN7 A;  1GN3 A;  2Q7H A;  4I50 B;  2DQ0 A;  1R3K C;  1S5H C;  4LFA O;  4XDK A;  1Y76 B;  5KMG A;  3MHS C;  1SC5 B;  4BW5 A;  2HEP A;  4K3A A;  4FIP C;  1H38 A;  5DEC A;  2Q0A A;  3X2Q B;  2WAM A;  4PI2 A;  1L0N H;  4EEQ A;  4GLX A;  5B1N A;  5LL6 Y;  2OTJ V;  1L0L H;  4QPJ A;  1SS3 A;  1VF6 C;  2GV9 A;  3AK2 A;  1MOF A;  1R6K A;  3JD4 A;  1W0J G;  4NXM O;  1OJH A;  4X1K B;  4JYB A;  5B1B B;  1XIL A;  1AR1 B;  2ZKO A;  2M6Y A;  1J5E O;  4LFA B;  1BT8 A;  3OTF A;  1JOY A;  1YIJ V;  1VQ4 V;  3JAW A;  2DQ3 A;  2Y0I A;  1XMO B;  2FL4 A;  2IBZ H;  1ZSP A;  2ZNI A;  2YXH A;  4DV6 O;  1XRE A;  1QVG U;  3HKD A;  1W2B U;  4OPA A;  3AG1 C;  3EHB B;  3WB1 A;  1TVK B;  4BW9 A;  1P4R A;  5KHH A;  4JI8 O;  3BCC H;  4Q6G A;  1CP9 A;  1H2N A;  2Y0P A;  4NXM B;  1JX9 A;  4BWA A;  1AR4 A;  4O4L A;  1J5E B;  3ABM B;  5B3S B;  2R70 A;  3VQY A;  3OT7 A;  2YDE A;  3D36 C;  2BCC H;  4RQF A;  4DV6 B;  1NH2 B;  3L9D A;  3OMI B;  3ZCC A;  1Y4M A;  3J81 N;  1QQC A;  5DM6 V;  2VQF O;  2IM9 A;  2N74 A;  1DF5 A;  1K92 A;  4JI8 B;  2WLI A;  3CRR A;  2ZDI A;  2UXN A;  4KXR A;  4GKK O;  5J2U B;  3ZHV A;  4TV8 A;  1S72 V;  1EM1 A;  3SYA A;  1SA0 A;  4O4H B;  3C3T A;  4ZOL A;  3UT5 B;  1KMI Z;  4O2A A;  2Z0A A;  1GM7 A;  5AG2 A;  1AI7 A;  4U3J A;  2BSK A;  4X1I A;  1RM1 C;  1M56 B;  2XND G;  3TXQ A;  2WWW A;  1XL4 A;  2QWN B;  3ZN1 A;  2H94 A;  4PDR A;  1SZX A;  4I50 A;  1BHA A;  3CE2 A;  1E1R G;  1YXB A;  1YEW A;  4NYK A;  3JD3 A;  5FNV A;  4DR4 B;  1TGO A;  5HFM A;  1Y76 A;  4GKK B;  2ATK C;  4X89 A;  4MSW C;  3FB8 C;  3CCR V;  4UVA A;  4J41 A;  4I0X B;  3CCQ V;  2YIA A;  5BR8 O;  2P7T C;  3GB7 C;  4PDV A;  2HVJ C;  4DV3 O;  1WJZ A;  3K03 A;  1H8H G;  1YI2 V;  4UXN A;  1SER A;  3RYI A;  3OM3 B;  4LF7 B;  4IT5 A;  4O4I B;  1G8M A;  4PV1 B;  1NT2 B;  4F6E A;  1EN6 A;  1YJN V;  1JJ2 U;  3A2F A;  1GAX A;  1WAZ A;  3K0G A;  4PA7 A;  3K06 A;  4HNA B;  2JDI G;  3I56 V;  2EZO A;  3ETD A;  2GUZ B;  1QR8 A;  3DC5 A;  3SPJ A;  5BR8 B;  3OGC C;  4DV3 B;  2DOS A;  3QO5 A;  3QF7 A;  1KB9 F;  4GX1 A;  3DGE A;  1HW7 A;  4OPH A;  2GBO A;  1XI1 A;  4ZBM A;  3AEI A;  4DV5 O;  1PL4 A;  1NVP D;  2W0X A;  2E76 B;  1FXK C;  4ICG A;  3F5W C;  5B66 Z;  5EK0 A;  1Q86 W;  3AK3 A;  1NR7 A;  4GZR B;  4FLZ A;  2UUA O;  1IDS A;  3LUT B;  1QNM A;  1Y67 A;  2UUC O;  1NI8 A;  2P4K A;  5IYB O;  1N32 O;  5KHI A;  5L3G A;  1AJQ A;  3JAS B;  2Q68 A;  1H2K A;  5B1A B;  3CJH B;  3APO A;  5J2U A;  3ZHQ A;  4DV5 B;  3LDD A;  4NTW A;  5IJ0 B;  5LHH A;  2C2A A;  2LW1 A;  3RW0 A;  4XBF A;  4IIJ B;  3UT5 A;  2UUA B;  4AQY O;  1QBZ A;  1SQG A;  2UUC B;  1DTO A;  4WBN B;  4B7E A;  4F6R B;  2EIJ B;  2Q73 A;  1H2G A;  2Q69 A;  3G6B A;  2KSD A;  2E5L O;  2W6I G;  3RWR D;  1VF7 A;  2MW2 B;  4I55 A;  3KCX A;  5LHI A;  2ZT9 B;  3A0H Z;  4LF5 O;  1RPR A;  1K4D C;  4JPR A;  4FLW A;  1HNX O;  4U7O A;  3ABK C;  2A7W A;  4GKJ B;  5KA5 A;  1P84 F;  4PI0 A;  4NVP A;  1Z5V A;  4D7T A;  4I0X A;  1H2S B;  1R3L C;  3KCY A;  2R9R B;  2DYS B;  5EIB D;  5L3E A;  1VIB A;  3ZMV A;  2VQE O;  1YVW A;  2UXX A;  4O4I A;  1N36 O;  2E5L B;  2GSM B;  1FFT B;  4IGG A;  3OTO O;  4PA4 A;  3VQW A;  1SES A;  2Y69 C;  4LH7 A;  1P49 A;  4LF5 B;  1TAE A;  3K9S A;  4HNA A;  1HNX B;  3MHH C;  1M9N A;  1K73 W;  3HB3 B;  5HFL A;  1SF9 A;  1BGY H;  1PV0 A;  5B1A C;  4G2K A;  4J7Z A;  4LP8 A;  1Q81 W;  1NKD A;  4P9O A;  1ZAU A;  3CB2 A;  2LQT A;  2HHH B;  2WLK A;  4CS3 A;  2VQE B;  2HR3 A;  4J10 A;  4B08 A;  3AG3 B;  1N36 B;  4IYI A;  3P3N A;  3OTO B;  1GM8 A;  1ZL8 B;  2RJZ A;  4JI7 O;  4JI0 O;  1KQS U;  4UB6 Z;  4LFC O;  1MSW D;  1KP3 A;  3B40 A;  4DR1 O;  1K3E A;  1XDC A;  3T1C A;  4GT1 A;  1I94 O;  3JAT A;  3AG7 A;  4LNU B;  5J2T B;  3LSU A;  4LF8 O;  4I9Q A;  1IXB A;  1F23 A;  2A9H A;  4UCS A;  2FYU H;  2HP8 A;  4TUY A;  1J95 A;  3TXS A;  4XDL A;  2JJ1 G;  5JVD B;  5A9G A;  1TUB B;  2LJ2 A;  2LW7 A;  1DK1 A;  4R50 A;  4TV9 B;  4JI7 B;  2F95 B;  2Z5U A;  1F7Y A;  4OX9 O;  4UCO A;  1FXV A;  5LP6 B;  4IIJ A;  4H44 B;  4LFC B;  4IHJ A;  1D5N A;  2EIN C;  4DR1 B;  3RVY A;  4DV7 O;  2EIK B;  2XAJ A;  1GH6 A;  5BMV B;  1I94 B;  4FLX A;  4WBN A;  3B09 A;  1V9P A;  3LDE A;  4JAA A;  4FMT A;  4HZ3 A;  3ETG A;  1H2M A;  4LF8 B;  2ARH A;  2QM8 A;  3MDS A;  2L6L A;  4JI5 O;  1YCI A;  3G71 V;  5LXT A;  1OHH G;  3SDL A;  2OCH A;  3L74 H;  2XT9 A;  4OX9 B;  4U3F H;  4NR1 A;  5JH7 A;  5L3C A;  4R7C A;  3ZMU A;  4DV7 B;  4JAS A;  4LF6 O;  2IH1 C;  1XNR O;  4J80 A;  1IZ3 A;  4TQD A;  2ZIM A;  4DO2 A;  4CC5 A;  4DW1 A;  3STL C;  1JA8 A;  2CTR A;  4LF4 O;  2WLJ A;  4X88 A;  4FM2 A;  2JEU A;  2JS5 A;  1M93 A;  4JI5 B;  1K33 A;  4YJ2 A;  2JGD B;  3BY6 A;  3SJB C;  2CGO A;  3ZMZ A;  1L1F A;  1P7G A;  4MS2 A;  4W4L A;  2Q0O C;  4DUZ O;  1OCO C;  2ZE6 A;  5JJJ B;  2HJF C;  3B8N A;  3OEE G;  3ZHR A;  5EYP B;  4LF6 B;  1IX9 A;  1YJW V;  2WPD G;  3B8M A;  1XNR B;  1P7B A;  1KKD A;  3FAV A;  1ZL8 A;  4LF4 B;  2A79 B;  4RUE A;  1R6T A;  3FB7 C;  2ZR3 A;  2IW5 A;  2OCC C;  3TK1 A;  2EJR A;  2CDY A;  3BRC A;  3OMA B;  5L3B A;  1QLN A;  3UQ8 A;  1LR1 A;  4DUZ B;  4X8A A;  3H1L H;  3WB0 A;  4UFZ A;  3HKC A;  2A06 H;  4LNU A;  4GCZ A;  5J2T A;  1WPB A;  3AG1 B;  1E79 G;  4H37 A;  1B6Q A;  3U11 A;  3L72 H;  2A3Q A;  4TSF G;  1YJ9 V;  5E1A C;  3D8C A;  1Z2G A;  4FZ1 A;  1IBM O;  2V7Q G;  1QLE C;  2ZE7 A;  3E8H A;  4BIZ A;  1EZJ A;  1MNG A;  3K08 A;  1FXH A;  2YEV B;  2BE3 A;  2QDO A;  3FFQ A;  3SR2 C;  3TCU A;  3OMN B;  5IT9 N;  4RO2 A;  1NJI W;  1MZE A;  2X7R B;  2QSA A;  2GTA A;  4H13 B;  4MW8 A;  4UVB A;  2CGN A;  4ZKI A;  5KAF Z;  2DWE C;  4QJF B;  3WB2 A;  4WFF A;  5LGT A;  3EFF K;  1VQO V;  3ICX A;  4NTX A;  1XMQ O;  1HDJ A;  3CX5 F;  3M99 B;  2NLJ C;  4QIW F;  4CH4 A;  4GX0 A;  1FPO A;  2YID A;  3H1K H;  2Q67 A;  5K1P A;  2XAQ A;  4YY3 O;  1UJW B;  3OEH G;  1DLB A;  3JAL B;  1MZF A;  3CRC A;  3H01 A;  2IU3 A;  3RT3 C;  1RM1 B;  4JI2 O;  3IGA C;  1Y66 A;  4EKW A;  4MTO A;  1S5J A;  3N2K B;  3STZ C;  3BFR A;  2W0F C;  4WFH A;  4DV4 O;  5IJ9 B;  1BE3 H;  2QTS A;  4UCT A;  2X0L A;  2PI5 A;  1JCH A;  4FLY A;  5L3D A;  4UV9 A;  5EBL C;  2Y4T A;  1KUQ A;  3EXA A;  4JI4 O;  4DK0 A;  2YUA A;  4YY3 B;  2ZDI C;  5EYP A;  1MSD A;  3OFN G;  1ARO P;  1VF6 A;  3RBZ A;  4JYY A;  4JI2 B;  3T2M A;  3SPC A;  2B9Z A;  4GYC B;  2H3O A;  2XHB A;  2V1D A;  1XL6 A;  1Q90 D;  1EN5 A;  4D7S A;  4LBE C;  4X9Q A;  1WA8 A;  1N34 O;  1YTF C;  4PA6 A;  1SZT A;  1HP8 A;  3E86 A;  2LGW A;  3L73 H;  2HFE C;  3ZRW B;  1GKF A;  1YTF D;  1BZK A;  3JYC A;  2WLN A;  3CC4 V;  1OCR C;  5CA0 B;  1WB8 A;  2ZXW C;  1EFR G;  4B3T O;  4MTF A;  4MVQ A;  2PYJ A;  1CEZ A;  2BTQ B;  5KAI Z;  3RGB A;  1NVP B;  2B5U A;  4X65 O;  1QVF U;  3ZED A;  2LO1 A;  2ZR2 A;  1MMM A;  3JSL A;  1JJO A;  2R9A A;  1FXK B;  1XQ8 A;  2AZ0 A;  1UFI A;  2P67 A;  5H5N A;  2YEV A;  4FFB A;  3HKB B;  4JI6 O;  1B06 A;  3K3W A;  2QGN A;  3CCV V;  1LUW A;  3MAQ A;  3CCJ V;  1WB7 A;  2K1E A;  3CC2 V;  2VQF B;  1WP7 A;  2WA4 A;  1N34 B;  4CBC A;  1F4M A;  1Q6U A;  3D36 A;  4YIP A;  4CS4 A;  2RDC A;  4JI1 O;  2DMX A;  2RN9 A;  4B3T B;  2HLD G;  4J11 A;  4UVC A;  1N8R W;  5IYZ B;  5EC1 C;  3GWK C;  2EZP A;  4X65 B;  4O4J B;  5CBF A;  3APQ A;  2WA3 A;  1R1B A;  1AI4 A;  4JAV A;  5JQG B;  3OR7 C;  2QWR B;  4JI6 B;  2QM7 A;  1AI6 A;  4J7J A;  1FFX B;  1DGS A;  4X1K A;  3K79 A;  3JAL A;  3N27 A;  4KL1 A;  5IDJ A;  2NR5 A;  1GN4 A;  3CCS V;  3N2K A;  2F93 B;  4JI1 B;  1Z5W A;  1BCC H;  3E89 A;  3ZRX A;  4MW3 A;  3SYC A;  3DXR B;  3ABK B;  4TQF A;  1VF5 B;  3O9O A;  3FD9 A;  1TVK A;  1BHB A;  5CB4 B;  4JTC B;  2CTQ A;  3A8T A;  3K5O A;  1NH2 D;  1NVP C;  4FM0 A;  4DV0 O;  2JEX A;  2UXC O;  3SJQ C;  3ZHS A;  2F4V O;  2FB5 A;  1XOU A;  1K9M W;  1QCE A;  3P32 A;  1KU9 A;  2KKW A;  3BA9 A;  1K8A W;  1AP6 A;  4JI3 O;  2RNB A;  2UXB O;  3CXH F;  3K0D A;  5H6R A;  3OW2 U;  3CRA A;  5JJE B;  3H1H H;  1URF A;  5GON B;  1YSC A;  4KHP O;  3ETQ A;  5KX5 B;  2ADP A;  2Y69 B;  4HAM A;  2E75 B;  1YF2 A;  3CRQ A;  2ZE5 A;  4EB6 B;  3UM7 A;  1M57 C;  2JGU A;  1JR9 A;  5FLX N;  2AZ2 A;  4B7K A;  2AW9 A;  3LSQ A;  3GVM A;  4DR7 O;  3ZRW A;  4LC1 A;  1D5A A;  2KG7 B;  5CA0 A;  4DV0 B;  1VQ8 V;  1NTZ H;  3OUS A;  5IY5 C;  2UXC B;  2F4V B;  2XAS A;  3OD4 A;  5EC2 C;  4DUY O;  3QVN A;  3QO7 A;  4O4H A;  2R9I A;  2BTQ A;  1ZX3 A;  1ZWI C;  1Q5O A;  2UXB B;  3FKS G;  4YJ3 B;  3ZRS A;  5FPR A;  3IJ4 A;  3T4D A;  4WFB V;  2CUG A;  1EBO A;  3ML0 A;  4KHP B;  1FXK A;  1Q7Y W;  3W7S A;  2Q7E A;  4ZI7 B;  3DSQ A;  3KKY A;  3I55 V;  4K8Z A;  1N32 B;  2CTW A;  3H1J H;  3T1Y O;  3JAK B;  4LFB O;  2V4D A;  1R6N A;  2KQX A;  5TIS Z;  2F43 G;  4O2B B;  3R66 A;  3K9A A;  2VWK A;  1N4C A;  1PPJ H;  4DR7 B;  4A5U B;  4F4L A;  1KYO F;  2GDS A;  4ZIB A;  2Z3Y A;  2D3O W;  1VQ7 V;  5EIB C;  4L87 A;  1JFF B;  4FJC C;  5IYZ A;  1M90 W;  4O4J A;  3CPW U;  4AQY B;  3ABL B;  4DR5 O;  5ITZ B;  2IH3 C;  2QEX V;  3LDC A;  3T1Y B;  2EIN B;  4LFB B;  1FFX A;  1FYJ A;  2PY5 A;  4R8C A;  5IWA O;  1DF4 A;  4JTD B;  1V55 C;  1IUR A;  5LBQ A;  4XDJ A;  4CH3 A;  1RP3 B;  4CS2 A;  4UV8 A;  2GUZ A;  3E83 A;  2IU0 A;  2UUB O;  3BVO A;  2QWO B;  4LF9 O;  3ABT A;  3DXR A;  2AXT Z;  3K5L A;  1SRY A;  1PNL A;  1VQN V;  3M7M X;  4I7Z B;  1BMF G;  4DR5 B;  3K58 A;  3L70 H;  4FPP A;  2X6B A;  1WNS A;  3CME V;  5C8Y B;  5JJN B;  3CEI A;  5LOV B;  5LA6 B;  5IWA B;  3K04 A;  1WP8 A;  5CA1 B;  1Y74 B;  2EJ7 A;  4AIL C;  1H8E G;  2ZM6 O;  3BPZ A;  4CH5 A;  1SQB H;  3JSN A;  5BXZ A;  4JYA O;  4LF9 B;  3CCL V;  4X62 O;  3F7Y C;  1WLE A;  4RQE A;  3JAS A;  4EB6 A;  1H2L A;  1LNQ A;  1TA8 A;  3K5N A;  1OCO B;  3CJH A;  4PDL A;  3ABL C;  1I08 A;  5IJ0 A;  4JI0 B;  4YIO A;  5EZY B;  1KKC A;  3CRM A;  1PL0 A;  2QM4 A;  4YJ3 A;  1K5S A;  3FX7 A;  1HNZ O;  1N0N A;  2DWD C;  3Q4H B;  2ZM6 B;  4WFG A;  2Q6A A;  2PTM A;  4X1Y B;  3W7X A;  4JYA B;  3GWO A;  4F6R A;  5CBG A;  2OYQ A;  3RYF B;  5LGN A;  1IVS A;  2DN9 A;  1AJP A;  3JAK A;  1JMK C;  1SET A;  4YXW G;  4O2B A;  1ORQ C;  2OCC B;  4MVS A;  1SQQ H;  2ZIN A;  4JYC A;  1NTK H;  5FL7 G;  5C93 A;  3K57 A;  1VEW A;  3WU2 Z;  2WLH A;  2EIM C;  3W7W A;  3AG4 C;  5JCO C;  1GK9 A;  4B3R O;  1PD3 A;  5A2Q N;  2XAH A;  4DV2 O;  4AHC A;  5LHG A;  2CH7 B;  2ZE8 A;  1JFF A;  3DC6 A;  4P9P A;  5KMG B;  4MVU A;  1FKA O;  3RYC B;  1N0J A;  1IBK O;  1QLE B;  2CE4 A;  4PEL A;  5ITZ A;  3ZHU A;  3W7T A;  2L35 A;  1ENV A;  2XAG A;  3ASN C;  2ITC C;  4X66 O;  4HYO A;  1MAB G;  2JS3 A;  1XHZ A;  3S3W A;  3AK1 A;  4WFA V;  4B3R B;  4LCU C;  1S77 D;  5D5P A;  1T5E A;  4DYL A;  4NB5 A;  2KB1 A;  2Q7G A;  2BOB C;  1G1X B;  3CC7 V;  1XHX A;  2P06 A;  1NTM H;  1VQP V;  1IBK B;  2WLM A;  1N33 O;  2WLL B;  3BHP A;  3L71 H;  4BIO A;  3C90 A;  2G38 A;  2B1G A;  5KUM A;  5C8Y A;  2UXD O;  1XBL A;  4J9Z B;  1YHQ V;  1BS3 A;  5LOV A;  2NNU A;  3J7A U;  2O57 A;  4X66 B;  3JD2 A;  3SPG A;  1ROP A;  1S5L Z;  5H9C A;  1Y74 A;  1K5Q A;  3NXS A;  4C7U A;  2OIG A;  4O4L B;  4R6Z A;  1AVM A;  5FPO A;  4MVR A;  1A32 A;  3JAR B;  3R65 A;  1PP9 H;  1V54 C;  1VMG A;  3DTU B;  1L8D A;  3EVK A;  2YSU B;  2M7W A;  1AJN A;  1PNM A;  3IFX A;  1FJG O;  4QPK A;  2DE0 X;  1RSO B;  2IJI A;  1Q6H A;  5K1X A;  1N33 B;  4FVM A;  2GHY A;  3JCU Z;  2P5O A; 
#chains in the Genus database with same CATH homology
 2Q68 A;  2QKS A;  1BL8 A;  1EFR G;  2ZXW C;  5B1A B;  4MTG A;  4MTF A;  4MVQ A;  1CEZ A;  3LNM B;  3AG2 C;  1NVP B;  2P90 A;  3LDD A;  2B5U A;  4N23 A;  1QVF U;  4GX5 A;  4E2L A;  3ZJZ A;  4P2Z A;  2ZR2 A;  5LHH A;  2XAF A;  2C2A A;  2OT5 A;  3RW0 A;  2DYS C;  2ZD9 A;  4XBF A;  4QE9 A;  1FXK B;  2P67 A;  2IJJ A;  1S3J A;  2YEV A;  1VQL V;  3K3W A;  3CCV V;  2H8P C;  4I5S A;  1QBZ A;  3CCJ V;  1JPX A;  2K1E A;  3CC2 V;  2ITD C;  1IXM A;  3ZN0 A;  4Z1M G;  1VQM V;  4ASU G;  4CBC A;  1F4M A;  1DTO A;  3BEH A;  2EIJ B;  1V54 B;  2ZQM A;  1H2G A;  2Q69 A;  3D36 A;  1YTF B;  5EBM C;  2W6I G;  3SYP A;  1PKX A;  1GO3 F;  5KA6 A;  1R3I C;  4MVM A;  1GMG A;  5LHI A;  1PNK A;  1OCR B;  2HLD G;  1RPR A;  4U7N A;  4UVC A;  1K4D C;  4JPR A;  4U7O A;  3ABK C;  1CPY A;  2ZXW B;  3T4Z A;  5EC1 C;  4H33 A;  1N8R W;  5KA5 A;  4TWK A;  2EZP A;  3CP1 A;  4BIU A;  5CBF A;  3ZRV A;  2HKO A;  3KG2 A;  5DN6 G;  1AI4 A;  4JAV A;  1S76 D;  2QTO A;  4G28 B;  1R3L C;  5GW7 A;  3OR7 C;  5CBH A;  1K4C C;  2R9R B;  2DYS B;  3OR6 C;  2QM7 A;  1AI6 A;  1RPO A;  5L3E A;  3JD0 A;  1FS0 G;  3K79 A;  3ZMV A;  3AG3 C;  4FK5 C;  4I9W A;  2UXX A;  1KEC A;  2GSM B;  1FFT B;  3CCE V;  5IDJ A;  4CZZ A;  3G4S V;  1K97 A;  2EIL C;  4PA4 A;  3FB6 C;  5H6Q A;  3CCS V;  1SES A;  2Y69 C;  5B1O A;  4QE7 A;  1OZ0 A;  2A0L A;  2IJK A;  3MHH C;  3E89 A;  1M9N A;  4MW3 A;  3ZRX A;  3SYC A;  1K73 W;  2BOC C;  1KP2 A;  3HB3 B;  5HFL A;  3PJS K;  3E35 A;  3ABK B;  4UUJ C;  5B1A C;  4G2K A;  5KUK A;  5LGU A;  1BHB A;  4LP8 A;  3WG7 C;  1Q81 W;  1NKD A;  2X6C A;  4JTC B;  4P9O A;  1NH2 D;  1TUE B;  1NVP C;  3G6E V;  3CYO A;  1KC8 W;  3JD1 A;  1NQT A;  2WLL A;  2WLK A;  3WFV A;  2JEX A;  3SJQ C;  3ZMT A;  2W6J G;  1K9M W;  3CCM V;  1JQ0 A;  1QCE A;  2JK5 C;  2HR3 A;  2XOK G;  3P32 A;  4MT8 A;  5J9P C;  2P6J A;  3P30 A;  1K8A W;  3AG3 B;  3JCZ A;  2AHY A;  2DYR C;  1GM8 A;  1E1Q G;  5H6R A;  3K0D A;  1MG1 A;  3OW2 U;  3SYO A;  1YIT V;  1VQ5 V;  1KQS U;  1YSC A;  2EIL B;  2EIK C;  1MSW D;  1KP3 A;  2Y69 B;  4HAM A;  3HPL C;  1K3E A;  4PDM A;  3ZMS A;  1JVM A;  3FB5 C;  4GT1 A;  3T1C A;  1THZ A;  1I5X A;  4MTX A;  4DXW A;  5CMU A;  5BZB A;  3ABU A;  4J9Y B;  3UM7 A;  1M57 C;  3LSQ A;  3ZRW A;  4LC1 A;  2WLI B;  3WG7 B;  3FYE B;  1F23 A;  2A9H A;  1VQ8 V;  2LP7 A;  3OUS A;  5IY5 C;  2QE7 G;  2XAS A;  4PA9 A;  5EC2 C;  1J95 A;  4XDL A;  2JJ1 G;  2DW4 A;  3QO7 A;  3X2Q C;  2R9I A;  3RVZ A;  1ZWI C;  2FTK A;  4R50 A;  3FKS G;  2Z5U A;  3ZRS A;  1AI5 A;  3T4D A;  4WFB V;  2DYR B;  2CK3 G;  4OXS A;  1FXV A;  1EBO A;  3ML0 A;  4KP4 A;  1FXK A;  1Q7Y W;  1KD1 W;  2EIN C;  2HG5 C;  3W7S A;  4WCE V;  3I55 V;  3RVY A;  4JF3 A;  1S0V A;  2EIK B;  2XAJ A;  5EBW C;  5B1B C;  1R6N A;  2F43 G;  3K9A A;  2DQ0 A;  3LDE A;  1R3K C;  4FMT A;  4HZ3 A;  3ETG A;  4N21 A;  1S5H C;  4Q20 A;  1HWY A;  1M57 B;  4F4L A;  2QM8 A;  1F51 A;  3E8G A;  2Z3Y A;  3LSS A;  4XDK A;  1R3J C;  2D3O W;  3MHS C;  1VQ7 V;  2EBO A;  1F4N A;  4BW5 A;  5IY5 B;  4L87 A;  3G71 V;  1OHH G;  4FJC C;  1M90 W;  4FIP C;  1H38 A;  4WF9 V;  3CPW U;  3X2Q B;  2WAM A;  3SYQ A;  3FYI B;  3ABL B;  1VQ6 V;  3E2E A;  2IH3 C;  5B1N A;  2OTJ V;  2QEX V;  4QPJ A;  3LDC A;  5L3C A;  4R7C A;  3ZMU A;  3SPH A;  4JAS A;  4QNH B;  2EIN B;  1MOF A;  1R6K A;  2IH1 C;  3JD4 A;  1W0J G;  2LFS A;  3ASO B;  4JYB A;  3ABM C;  4R8C A;  5B1B B;  5B3S C;  1DF4 A;  2IJH A;  4JTD B;  4DO2 A;  1OCC B;  1AR1 B;  1V55 C;  3STL C;  3CXC U;  5LBQ A;  1JOY A;  4XDJ A;  2WLJ A;  4X88 A;  2JEU A;  1YIJ V;  1OCZ B;  1VQ4 V;  4UV8 A;  2DQ3 A;  1K33 A;  3E83 A;  1NH2 C;  3BY6 A;  4GX2 A;  2IU0 A;  3ZMZ A;  1G4Y B;  1L1F A;  4MS2 A;  3ABT A;  3IC7 A;  1QVG U;  3MD0 A;  1SRY A;  1PNL A;  1VQN V;  1W2B U;  1OCO C;  1BMF G;  3AG1 C;  2HJF C;  3EHB B;  3B8N A;  4TT3 G;  1P4R A;  3OEE G;  4FPP A;  2X6B A;  3CME V;  1NBM G;  1CP9 A;  3SPI A;  1YJW V;  2WPD G;  3B8M A;  1JX9 A;  1I5Y A;  3ZIA G;  1P7B A;  3K04 A;  1KKD A;  3TET A;  3CMA V;  3ABM B;  1NR1 A;  5B3S B;  2B1I A;  2A79 B;  4RAI A;  1V55 B;  3E8F A;  4JGS A;  4G27 B;  4RUE A;  3FB7 C;  1M56 C;  1H8E G;  2ZR3 A;  4BAY A;  4RQF A;  1NH2 B;  3OMI B;  2IW5 A;  2OCC C;  1K34 A;  3TK1 A;  3CCL V;  3F7Y C;  2EJR A;  3ZCC A;  3OMA B;  1WLE A;  5L3B A;  1QLN A;  4RQE A;  1Y4M A;  4X8A A;  2QA4 V;  4WFE A;  4KUM A;  5DM6 V;  3ETE A;  5CN0 A;  1LNQ A;  4GCZ A;  1DF5 A;  1OCO B;  1K92 A;  4RUF A;  2WLI A;  3AG1 B;  1E79 G;  4H37 A;  5IYC O;  2ZDI A;  2UXN A;  1B6Q A;  4PDL A;  3ABL C;  4TSF G;  2AHZ A;  1YJ9 V;  1S72 V;  5E1A C;  2V7Q G;  3SYA A;  1QLE C;  3E8H A;  4BIZ A;  1EZJ A;  1PL0 A;  3K08 A;  1FXH A;  1K5S A;  2YEV B;  3ASO C;  2DWD C;  1GM7 A;  4WFG A;  3TCU A;  1OCC C;  1AI7 A;  2Q6A A;  3OMN B;  4RO2 A;  3W7X A;  1NJI W;  3GWO A;  5CBG A;  1RM1 C;  1M56 B;  2X7R B;  5LGN A;  3OE7 G;  2XND G;  1AJP A;  1OCZ C;  1SET A;  1XL4 A;  2WWW A;  4P30 A;  5CA3 A;  3ZN1 A;  2H94 A;  3QNE A;  4YXW G;  4PDR A;  1ORQ C;  2OCC B;  4MVS A;  4MW8 A;  1BHA A;  4UVB A;  4JYC A;  4ZKI A;  1E1R G;  5FL7 G;  5C93 A;  2WLH A;  3JD3 A;  2EIM C;  3W7W A;  4MVO A;  5HFM A;  3AG4 C;  2DWE C;  3B77 A;  4QJF B;  2ATK C;  1GK9 A;  1PD3 A;  4WFF A;  2XAH A;  4X89 A;  4MSW C;  2MK3 A;  3FB8 C;  5LGT A;  3EFF K;  4UVA A;  5LHG A;  3CCR V;  1VQO V;  4JAU A;  4P9P A;  3M99 B;  2NLJ C;  4MVU A;  5IYD O;  4QIW F;  3CCQ V;  3A0R A;  4PA3 A;  4GX0 A;  2P7T C;  3GB7 C;  4PDV A;  2HVJ C;  1QLE B;  2Q67 A;  4PEL A;  2LFR A;  3K03 A;  3AG2 B;  1H8H G;  2XAQ A;  1YI2 V;  1K7D A;  4UXN A;  1SER A;  3W7T A;  1UJW B;  3OEH G;  1DLB A;  1QR9 A;  4JTA B;  3OM3 B;  1GTO A;  1ENV A;  1R73 A;  1W0K G;  2XAG A;  1G8M A;  2IU3 A;  3H01 A;  3ASN C;  1RM1 B;  2ITC C;  1YJN V;  3OUF A;  1JJ2 U;  3IGA C;  4HYO A;  1Y66 A;  4EKW A;  4MTO A;  3STZ C;  1MAB G;  3K0G A;  4PA7 A;  2W0F C;  3K06 A;  4WFA V;  4WFH A;  2JDI G;  3I56 V;  2EZO A;  3ETD A;  4LCU C;  2EIM B;  1S77 D;  3AG4 B;  3VOU A;  2KB1 A;  2X0L A;  1JCH A;  1QR8 A;  2PI5 A;  2BOB C;  5L3D A;  4UV9 A;  5EBL C;  3CC7 V;  3QO8 A;  3SPJ A;  1VQP V;  3OGC C;  2WLM A;  2WLL B;  3QO5 A;  1Q82 W;  4GX1 A;  3CCU V;  2ZDI C;  3DGE A;  1GM9 A;  2B1G A;  5KUM A;  3UKM A;  4ZBM A;  3OFN G;  3OAA G;  3AEI A;  1ARO P;  4J9Z B;  3D3I A;  1YHQ V;  3RBZ A;  2NNU A;  1NVP D;  2X6A A;  3T2M A;  3CD6 V;  1FXK C;  3SPC A;  3VBB A;  3ASN B;  3JD2 A;  3F5W C;  5EK0 A;  3SPG A;  1M1K W;  2V1D A;  1ROP A;  1Q86 W;  3F7V C;  5H9C A;  5L3F A;  1K5Q A;  2Y48 A;  3E8B A;  3NXS A;  1NR7 A;  4R6Z A;  1XL6 A;  1VQ9 V;  3LUT B;  4MVR A;  4KFM A;  2WSS G;  3R65 A;  4LBE C;  2EIJ C;  1V54 C;  3DTU B;  2HVK C;  2JIZ G;  1WPX A;  2YSU B;  1YTF C;  2M7W A;  4PA6 A;  1AJN A;  1PNM A;  1SZT A;  2JJ2 G;  3IFX A;  3E86 A;  1COW G;  4QPK A;  5IYB O;  2HFE C;  3ZRW B;  1VQK V;  2IJI A;  1GKF A;  3W7U A;  1YTF D;  5L3G A;  3JYC A;  2WLN A;  1AJQ A;  3CC4 V;  1OCR C;  2GHY A;  2OTL V;  2PI4 A;  4MVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...