1NH2D

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
104
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNSKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
total genus 25
structure length 104
sequence length 117
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2D01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1nh2D02
5IYCO 5IYDO 5IYBO 1YTFD 1RM1B 1NH2C 1NVPC 1NVPD 1NH2D 1YTFC 1RM1C
chains in the Genus database with same CATH superfamily
4X9QA 1VQOV 2A7WA 4NTWA 4PDLA 4CH6A 3W7WA 3JARB 2PYJA 1H2LA 1BE3H 3A0HZ 2DYRB 2CGOA 5KA5A 1YI2V 1AVMA 4IGGA 1VF7A 3X2QB 3W7XA 1COWG 5KUMA 2XNDG 1LR1A 1MSDA 4DR4B 1QNMA 4MVQA 1HNXB 1GK9A 3D36C 1VMGA 3T2MA 3AG2C 5B1BB 1AR4A 4KXRA 4DR2B 5GONA 1YCIA 1N8RW 1XNRB 3B4SA 2ZXWC 3MHSC 4WFGA 5KHIA 3LDEA 2JEUA 3OUFA 1XUQA 3LNNA 2FYUH 3RT3C 3BAAA 4UCOA 1BQZA 4FM1A 2QEXV 2QKCA 4MVOA 1S5HC 4HNAB 1VQNV 3U11A 1AJQA 1PD3A 1ZUQA 2YI9A 3ZMVA 3IFXA 4JASA 4MTFA 3JSNA 2OTLV 1DLBA 4KUMA 1R3JC 2BTQB 4BW5A 5EZYA 4ZOLA 4GT1A 1VIBA 3SYQA 1QCEA 1BQ0A 5LMNO 4X65O 1H2MA 2FL4A 3QO7A 2M7WA 2F4VB 2GBOA 4JAVA 2UXBB 4DV4O 1R73A 2AHZA 1MG1A 4B7EA 3JAWB 3OR6C 1FXHA 2LW7A 1I0HA 3ASOC 1YTFD 3RN4A 5LMNB 2WLNA 1LUVA 4BW9A 5JJNB 2UUBB 3CS5A 3OD4A 4HZ3A 3TJTA 1I94B 4GLXA 3B09A 5CBFA 2W0FC 2QGNA 3FD9A 2GTAA 4UUJC 5L3BA 1CPYA 4DR7O 2E74B 1XREA 1Q82W 5LYJB 3E22A 4RQFA 3MHHC 4OPHA 2BOCC 3W7UA 4ZI7A 1SQPH 3EXAA 4DV0B 3ZHVA 4JI2O 1IBLO 4JI5O 4PDMA 1QR9A 2YDEA 1P7GA 1XBLA 5KA6A 3CCVV 4JI1O 4O4LA 1IBLB 5LGTA 1IVSA 4F6EA 1NR7A 1M56B 3OTOO 1PNKA 1AILA 4LF7B 1HP8A 4FK5C 3CP1A 2ZNJA 1V54B 4LFBB 2Z3YA 2GTSA 1P84F 2JS3A 1T5EA 1CXZB 5B3SB 4DV5O 2YUAA 3MD0A 2LQTA 1MNGA 2IU0A 3IAYA 1KQSU 4MW3A 2WA4A 2Q0AA 5C93A 3GWOA 1XOUA 4MTGA 2OCHA 5B1OA 5CA1B 3CRCA 3QTCA 4BAYA 1TGOA 2ZNIA 5JWPA 3RYFA 3NXSA 1VP7A 3VQYA 1VQ7V 1NI8A 1QHTA 1KECA 3ABMB 4YJ3A 4GKJB 3L72H 4OXSA 4GYCB 2ZINA 2F4VO 2YC0A 3T1HB 2JGUA 4DR1B 2LW1A 1HNXO 1VQKV 1TA8A 2P7TC 1JX9A 4JTDB 1EFRG 1KUQA 3UM7A 1SQVH 2EJ7A 5FLXN 2C2AA 2Q7HA 3F5TA 4GKKO 3CRRA 1OJHA 1G6UA 4KHPB 4O2AB 5EIBD 4ZHQB 3BRCA 2E75B 4MVRA 2EIKC 2OIEA 4Q6GA 2WLIA 2X7RB 2QWPB 2LO1A 2YIBA 4R7CA 5JH7B 1W59A 3H1KH 5IJ9B 4LNUA 3SGIA 2KB1A 2DJVA 3CXHF 4UVAA 4J7ZA 2JGDA 4X20B 1TUEB 3ASNC 1FXKC 1PV0A 2VWKA 3WU2Z 2NN4A 4MTOA 1VF6C 4JI7B 2CH7B 2IH3C 4P9PA 3ZJZA 2UXCO 1HNWB 4U7NA 3M7MX 2GHYA 2XAFA 4FZ1A 1G1XB 4F6RB 5ITZA 1SA0A 2QTSA 1PPJH 1RFYA 4WCEV 1N4CA 2VRZA 5EZYB 2E3CA 2JJ2G 1L0NH 1KU9A 4ZKIA 5H2FZ 1JOYA 4PI0A 5DECA 1PP9H 4IHJB 4B3TO 3QVNA 2QM8A 3TXSA 2HP8A 2EIMB 2OYQA 1E1RG 3OE7G 2OIGA 2NLJC 2XAGA 3K5MA 3B8MA 2KG7B 2YI8A 4DV2O 1TUBA 3CCEV 1CEZA 2ZR3A 1BCCH 1Q43A 1S77D 2NNUA 3E35A 1BHBA 3K3WA 2F95B 3TCUA 5IWAB 4WFBV 2KQXA 4I0XA 3KZIZ 4NTYA 3JAKA 3OMNB 4IL6Z 4O4HB 4DV6B 2W6IG 1Q6IA 2XOKG 4JV5O 4YXWG 1KKDA 2HLDG 1IBMB 1IBMO 4TWKA 3T4ZA 5TISZ 1YHQV 1R6NA 2Y4UA 3P3NA 5CA0B 4BIUA 1K33A 4BIOA 1O9GA 2Q5ZA 5B1BC 3I55V 4JI1B 4LC1A 3QF7A 4FMTA 2AGAA 3FX7A 3VBBA 2F93B 2FB5A 1QR8A 3MAQA 1QVFU 1WP8A 4FVMA 2P22C 3WG7C 2EZPA 3JSLA 4X88A 3L75H 2EZOA 5D5QA 4Z2WA 2UUCO 2P5OA 4RO2A 2PF4E 2X0LA 4JTAB 5LHGA 1DK1A 5DN6G 1BZKA 4JYBA 4CZZA 3ZCCA 2ZD9A 2LFSA 2R72A 2CUGA 4J9ZB 2CDYA 3CEIA 3L74H 5KAIZ 4D7TA 1JJ2U 4DV3B 2IJKA 4LFCO 4XBFA 3SPJA 2IH1C 3AG1C 4R6ZA 4LCUC 2JVDA 4X64O 4QE7A 5E79Z 1WNSA 3AG3C 3FAVB 1LUWA 1M1KW 2HJFC 5LYJA 2DMXA 4WFEA 2BSKB 2UUAO 1N33B 2F43G 2Y69B 3HKEB 3CYOA 4OGQB 4DUYB 3HKDB 1AJNA 1G8MA 2VQEO 1K8AW 4WFHA 1Y4MA 3GWKC 1S3JA 3JALB 3D3IA 3DC5A 1FYJA 4LR3A 4HBNA 1PM9A 1Q3EA 2Q7EA 4YY3O 4JI0B 4X1IB 1R3LC 3FB7C 4E2LA 1YTFB 1N32B 4JPRA 4JI3O 4EFEA 1VQLV 4NXNO 1GRJA 1JJOA 5H6RA 3LDCA 2LGQA 1SC5B 3N2GA 4K0KB 4FFKA 2YXYA 5GONB 1EZJA 3CCSV 1N36B 4RQEA 5B5EZ 2YIDA 3SPCA 3JASB 4BIZA 2AZ2A 4TUYB 4AQYO 1GN3A 2OT5A 2WLLA 4G27B 3IC7A 2D2CB 1XQ8A 5EIBC 2QDOA 4JI6O 3FYIB 1WLEA 3RVZA 3K5OA 5IE9A 2PGGA 5JJEB 4MTXA 3D8CA 3E83A 3Q4HB 2F66C 4FZ0A 4PA4A 4CBCA 4DR1O 4JF3A 3P3PA 3TETA 2VS0A 3K0GA 4PDVA 2RMKB 3JAKB 4PA3A 1SF9A 4O4HA 1SETA 1RSOB 4ZOLB 1SRYA 1DTOA 1SQXH 3QO5A 1SZXA 2QWOB 3G80A 3RGBA 3CMEV 5L3EA 3K06A 2KKWA 3K59A 4D6TH 1B6QA 4DW1A 2JGDB 1S0VA 4JI8O 4J7KA 3R65A 1N33O 1Y74B 1NVPB 2ZE7A 1NH2B 1XHXA 2WAMA 5CA3A 1QBZA 4W4LA 3RVYA 3HKBB 4WBNB 5BZBA 2AHYA 1FXVA 3G71V 2DYSC 1WP7A 3WG7B 4YHHB 1I94O 4H0LB 2GDSA 4PA9A 4LFAB 3M8AA 1PL4A 3JD3A 1EM1A 2AW9A 1NH2D 1IURA 4X65B 2Q7GA 1XMOB 3AK2A 3W7SA 2XHBA 2HVJC 3JARA 4X62O 2F23A 1QVGU 2KG7A 1K73W 2XASA 4X8AA 1NZ6A 4LF4B 1NR1A 3STZC 1F23A 2LFRA 1V54C 2P4VA 2Y48A 1FXKB 4IIJB 1M56C 4X89A 5DEDA 5H9CA 3AK1A 3CC2V 3ZS8C 2B5UA 1YF2A 2OTJV 1NTKH 3E86A 1S5LZ 2P90A 3ZN0A 2ZE6A 5LP6B 5LP6C 2PUSA 2UXBO 1YTFC 1XL6A 1JVMA 3QG5A 4Z1MG 3MDSA 1R6KA 3C3SA 3T4DA 1K34A 4U3FH 5BY1A 1F4NA 2JK5C 3JALA 1H2KA 2RN9A 2ZE8A 3S3XA 5LGUA 4K8XA 1US6A 5KLVH 1F7YA 5CN0A 1IXBA 4YY3B 3FFQA 3WFVA 3ZBHA 1Z5WA 2YIBD 3UO3A 4X1IA 3ZMUA 4OX9O 1JCHA 1B04A 1NS1A 5J9PC 4MVUA 1YEWA 3K0DA 2L6LA 3B77A 4WF9V 4LF9O 3ZMTA 3U0ZA 2QM7A 4EFBA 4DUZB 3SPIA 2V7QG 1F51A 2K1EA 2QWRB 2EINC 4B08A 2OWOA 2MK3A 1NJIW 1QLEB 1NKDA 3N2KB 4LF8B 1MMMA 1QLEC 4I0XB 1H8HG 5J2UA 3JAWA 3L70H 3LSSA 1OHHG 2WLHA 2HVKC 4ICGA 4L8JA 1BSMA 5JH7A 4C7UA 1WB8A 2PY5A 5CBGA 4LF6O 2BOBC 4LF5O 3STLC 3F7VC 1KKCA 1HNZB 4OX9B 2XAHA 5F2VO 2IW5A 4I9QA 3ZRXA 1ENVA 3A2FA 3H01A 1J5EB 2DW4A 4DV7O 4QGPA 5LHHA 1AP6A 2YXHA 2JS5A 4O4JB 5EYPB 3SYOA 1ZSPA 3CCRV 2JDIG 1X59A 2W0XA 2DN9A 3GB7C 5LMUB 3HPLC 2IJHA 3T1YO 4FFBA 3IC9A 2BE3A 3K9AA 4H13B 5IYZB 3HKCB 4AI8A 3WB0A 4DR7B 1M5IA 2UU9B 3FB5C 5K1PA 3CHXA 4FLZA 2EINB 4B3MB 2LP7A 3EHBB 1I7FA 4I5SA 1FFTB 4B3SO 1Q7YW 3TXQA 4UCUA 4YIOA 4BR6A 1D2DA 2EIJB 1M57B 2Y69C 3JAMN 3L71H 2CTRA 4K3AA 1AJPA 1M9NA 1URFA 1HR0B 1U97A 5IYCO 3OFNG 2BSKA 2Q69A 1JFFA 3UQ8A 3ZEDA 2Q67A 4QE9A 2QTOA 3JATB 4X1YA 4ZI7B 2B1GA 2FMLA 3K5NA 2Y4TA 1VF5B 1NH2C 4DK0A 1K4DC 1NTMH 4QPKA 5FPRA 1SERA 1KP2A 3SPGA 4MSWC 2RCVA 3CCMV 1GM9A 1Y74A 1FKAO 1XDCA 3L73H 1OCZC 1Q81W 1OCCC 2GUZB 2R9IA 4K8ZA 2XAQA 1NTZH 1K92A 3KKYA 2UUBO 5EBWC 5L3DA 4UCVA 1Q90D 4MVMA 3JCZA 3U10A 1QLNA 4NTXA 3VQWA 5C8YB 3RYCA 3PJSK 1O9HA 2DWEC 2P4KA 3DXRB 1YJWV 2Y0IA 1PKXA 1SQBH 4YJ3B 3K58A 4I4TA 2FKXA 4J80A 2E5LO 3O65A 2A3QA 2WLJA 5JQGB 1MABG 2VQFB 1NVPC 5JVDB 4JI0O 1MZEA 4X66O 3E2EA 5EC1C 3G6BA 5CMUA 4UCTA 1FD9A 4GUNA 3SJAC 3QNEA 5A9GA 1PNLA 2E5LB 1N0NA 5GW7A 1ZTEA 1RM1B 2DQ0A 5L3FA 1UPGA 1W0KG 3AG2B 1IZ3A 3S3WA 4F4LA 2QJ1A 3EVKA 4ZIBA 2WPDG 5LP6A 3KG2A 3WB2A 5KHJA 3BABA 3UCSC 4YJ2A 3CXCU 3BA9A 5L3GA 3NR7A 4JAAA 1NQTA 1OCCB 3HKBA 4WBNA 3E8FA 4PV1B 2ARHA 4H44B 3E8GA 4X1KA 1VQ5V 4GCZA 3ASOB 4LH7A 3D3QA 4RUEA 4JZGA 1K5QA 2EBOA 3BEHA 5H5NA 1V55C 1HDJA 3OUSA 5BR8B 1H38A 4JI3B 3G6EV 2VQEB 3BY6A 3ETQA 1TAEA 4G2KA 4KHPO 4KFMA 3CB2A 4MT8A 1BS3A 1Z2GA 4IHJA 1L1FA 3L9DA 1RP3B 3SJCC 2EIMC 5LXTA 4ABMA 4K35A 3SR2C 3VOUA 4DR3B 4DUYO 2H3OA 4JZ2A 2ZIOA 3ICXA 4U3JA 3R66A 3ABTA 1X4TA 2JRIA 1QU7A 3BA8A 2CK3G 3ML0A 4XDLA 1Y76A 4DR3O 2OCCB 4CC5A 1L0LH 4KL1A 1YJNV 2R9RB 1XILA 1MSWD 4U7OA 5BXZA 3LDDA 4J11A 3CCQV 1Z5VA 4NB5A 3VQVA 2IJIA 3AG7A 3DTUB 1SS3A 3SYCA 2KSDA 1IXMA 2DE0X 2XT9A 5CA0A 1KMIZ 1DGSA 3OGIB 1N36O 1BMFG 2ZDIC 3JATA 4X1YB 2EIKB 4TT3G 5KMGB 3DC6A 3HKDA 2JEXA 1AROP 4TV8A 4IT5A 1FXKA 4ZBMA 4IIJA 4LWSA 1H8EG 3Q4HA 3SYPA 3BFRA 4EKWA 3P30A 4NXNB 1KB9F 2Q4PA 2ZDIA 2YICA 4FM2A 1YDXA 4WFAV 1D5NA 1H2NA 2G38A 5K1XA 5IYZA 4DV2B 4PDRA 3SPHA 3ETEA 4DR2O 4LF5B 4DV7B 2XUMA 2ATKC 3E8BA 3ZRSA 3N2GB 2BTOA 1PL0A 2EILC 1UJWB 3OTFA 1ZLZA 2MW2B 3CJHB 1WAZA 2V4DA 3FYEB 4JI8B 1E79G 2LJ2A 3K08A 1EN5A 4JV5B 1FPOA 1ZWIC 1GN2A 1XMQO 2ZQMA 2HHHO 2HHHB 4DO2A 3APQA 1EN4A 4B7KA 1VQPV 3JD0A 2QR4A 1EBOA 4I7ZB 3ABUA 3DXRA 2P67A 2PZSA 1EN6A 3ZMZA 4LF6B 1N34B 5IJ0A 4AILC 4DUZO 4CH3A 1JFFB 2UU9O 5LMUO 2PTMA 4I55A 4LF9B 1OCZB 1HR0O 4JAUA 3TGUH 5KX5B 3OMIB 5IY5C 4NXMO 1FJGB 4TOIA 3E8HA 3HKEA 5IT9N 3B8NA 1H2GA 3H1LH 3ZRWA 2UXCB 4O2BA 3K9SA 5B1AC 4J7JA 1EZVH 4FFBB 4R50A 4PA6A 3GVMA 4AQYB 1GM8A 5CBHA 1ZX3A 2JIZG 2JJ1G 2PI5A 5KHHA 2YSUB 3N27A 1YSCA 4TV9A 1VQMV 1VARA 1N34O 5BMVB 4DW0A 3IGAC 2YIAA 5J2UB 3AEIA 5H6QA 2QM4A 3ZHSA 3SYAA 2P6JA 4RWUA 2ETNA 3F5WC 4JI2B 1SKVA 1YJ9V 5LHIA 5C8YA 4O4JA 5EYPA 4GX1A 4LFBO 5EBMC 5JJJB 4EB6B 5GTHZ 4DV1O 2RQ6A 4TUYA 5L3CA 1ZL8A 4RUFA 3CCJV 2D3OW 1Q8IA 2PI4A 3RFRA 1F4MA 3UT5A 2GSMB 1W0JG 1JR9A 1E1QG 2HR3A 3K03A 3T1HO 2YS8A 2IBZH 3CPWU 3HB3B 3FB6C 3PN1A 3I5DA 1SQFA 4CS3A 1W2BU 2N04A 3UO2A 2HFEC 2VWJA 4R8CA 2UUAB 4QIWF 5B3SC 1AP5A 3RYIB 4DV3O 1BGYH 3LSQA 4FLTA 2QKSA 3AG1B 2N05A 1K3EA 1FS0G 1RSOA 4KP4A 1HW7A 4JI4B 4JGSA 2IM9A 2YEVB 1Q6UA 5FL7G 1RPOA 2L35A 1TVKB 3SJBC 4LBEC 3TK1A 4J41A 2ZM6B 3LSUA 3K57A 2RDCA 3K04A 3DSQA 2F1MA 2QWQB 3OMAB 5LA6A 3OAAG 1MOFA 1GKFA 2CTWA 3CCUV 3BVOA 3RYHA 1NT2B 2Q6AA 2B1IA 4HAMA 4NKGB 4TQDA 2R70A 2DQ3A 4DRXA 2UXDB 2EX3A 3H1HH 4UVBA 3T1CA 1G4YB 3HKCA 1L8DA 4J42A 1OCRB 2GV9A 1THZA 3CJHA 4OPAA 4UFZA 4DR6B 1VQ8V 3N2KA 4FLYA 5J2TB 1UFIA 3WB1A 2WLMA 1AI7A 1I5XA 1ROPA 3CMAV 4QJFB 4UB8Z 1DF4A 3RYFB 3ZIAG 4P30A 1YIJV 3ZHRA 1Y6XA 1OCOC 3CRQA 4IYIA 3FB8C 4DYLA 4FLUA 3CWBH 3AK3A 2O57A 4JI7O 1R3KC 3K79A 1R3IC 3IJ4A 3OT7A 3HR0A 3KCXA 3I56V 3ABKB 4K0KO 4XDKA 1BL8A 1CP9A 3T1YB 5JCOA 3LNMB 1S76D 1KYOF 3ETDA 4UCRA 1GH6A 3APOA 2W6JG 3CE2A 3ZHUA 1B06A 3RYCB 3H1IH 1OCOB 1VQ9V 3ZN1A 4O4LB 4DV4B 4CS2A 4DR5O 1P49A 4DR5B 4X66B 2X6CA 4MW8A 5IJ9A 1QQCA 3QO8A 3ZRVA 1V55B 5EK0A 3RWRD 2R9AA 2HJDA 5JQGA 1OCRC 1NU1H 3F7YC 2E76B 4L87A 4MVZA 1P4RA 2GUZA 2QA4V 1GN6A 2RNBA 5LOVA 2ADPA 4G28B 3KCYA 3AG3B 1MZFA 2Q9LA 4GZRB 2A0LA 2B9ZA 3RBZA 3H1JH 4DK1A 1SQGA 4Q20A 2QSAA 4NVPA 4PI2A 2DYSB 4I50A 3EFFK 1KD1W 4B3RO 4LFCB 3OTOB 2H94A 5FNVA 2ILMA 1TUBB 4ASUG 1SESA 2FTKA 2EILB 3M99B 4TSFG 4MS2A 1KBHA 5CB4A 2AZ0A 5LXTB 5LGNA 1AI4A 2X6BA 1AI5A 4QPJA 4XDJA 3AG4C 3BCCH 1D5AA 4NR1A 4PJ0Z 2ZIMA 3H9VA 3OR7C 1JPXA 4FM0A 2Q0OC 3OGCC 2UXNA 2ZXWB 2CGNA 1M90W 3CC4V 3J81N 1LNQA 1AB3A 4X62B 1JQ0A 3ABLB 4J9YB 1XHZA 4H33A 2N74A 4U3JB 4GKJO 3JD4A 2XTAA 4MVSA 4CH5A 1U96A 4UCSA 3E89A 1M4UA 2M6YA 2WLKA 4F6RA 5ITZB 1KC8W 1R1BA 1GN4A 4JYCA 5KMGA 3A0RA 1WA8B 5GTIZ 1FFXB 4TV8B 4YIPA 4D7SA 2RJZA 2Z0AA 4LWSB 1M93A 4P2ZA 5D5PA 2NR5A 3CSXA 4DV0O 3CCLV 3E22B 5JCOC 4E4EA 1R6TA 1WPBA 1K9MW 2X6AA 4EEQA 4HYOA 4I4TB 1XMOO 4AHCA 2UXXA 1ZAUA 4CH4A 5JVDA 2VQFO 1P7BA 4JI6B 3D36A 4UVCA 4QNHB 1AR1B 4O4IB 2XAJA 5KAFZ 1XMQB 4UV9A 3OEEG 5BR8O 1HNWO 2DWDC 2WLIB 1N32O 4B3MO 1Y76B 5HFLA 4GX2A 2A79B 4JYAO 2ZE5A 2YEVA 2QE7G 1VF6A 4A5UB 5CA1A 3JD2A 1DF5A 4B3RB 4TQFA 4FIPC 1Q86W 5A2QN 3UKMA 3K5LA 1M57C 4X20A 4JI4O 1BT8A 3C3TA 3ASNB 4YJ2B 1YITV 3CRAA 1WPXA 2CH7A 2EULA 4I9WA 3B40A 4LF7O 3OW2U 2K9PA 1GMGA 3ZMSA 2ZKOA 3JCUZ 3X2QC 3ZRWB 4LFAO 1ZL8B 2ZR2A 1K5SA 3LUTB 2UUCB 2CTPA 1Y66A 2DYRC 3OEHG 4CC6A 1J95A 4GX0A 1S5JA 1IBKB 3ABLC 3ABKC 4IYHA 4PELA 1KP3A 1GO3F 2HKOA 2CE4A 4UB6Z 4LNUB 4GX5A 4JTCB 2Y0PA 2Z5UA 1IBKO 1NBMG 5KHKA 4O2BB 1K4CC 5BMVA 1SQQH 3P32A 5J2TA 4O2AA 3RYIA 3SJQC 4BWAA 3JYCA 1I5YA 1OV9A 2QKAA 4GKKB 2CAZC 4PHZA 1S72V 2LGWA 5IYBO 1Q6HA 5LL6Y 5EC2C 1TVKA 1XL4A 2DOSA 3A8TA 5LBQA 2A06H 4EB6A 5FNVB 4JYAB 3CX5F 3A0BZ 1YVWA 3O9OA 4CS4A 1WB7A 2ZCEA 3ZHQA 4B3TB 4P9OA 4DV1B 1H2SB 4N21A 5KX5A 4HNAA 1NVPD 2Q68A 2Q8VA 2UXDO 2IJJA 2IU3A 4X1KB 3THOA 5EBLC 4LF8O 1YXBA 2ZT9B 2A9HA 4LH6A 4UXNA 3OM3B 4FLVA 1RM1C 4NXMB 4LF4O 1VEWA 4RAIA 4ZHQA 4JYYA 2HG5C 1BHAA 3SDLA 3UT5B 2BTQA 3BPZA 4PA7A 1GTOA 1A32A 1VQ6V 2OCCC 1RPRA 1PNMA 5IYDO 2V1DA 3C90A 1AR5A 1XNQO 4WFFA 1IX9A 5AG2A 4TV9B 1IDSA 1Q5OA 4X64B 3J80N 3J7AU 1N0JA 3ETGA 1SZTA 3JASA 2ZM6O 1FFXA 3JD1A 3G4SV 4H37A 4N23A 3FKSG 1XNQB 2HEPA 5DM6V 1XNRO 2ADQB 1K7DA 1VQ4V 5KUKA 1AI6A 2WLLB 4I50B 2QWNB 2WSSG 2EJRA 3CD6V 1K97A 3DGEA 2ODMA 3CC7V 3BHPA 3VQXA 4DR6O 5IWAO 4W4KA 4DR4O 4NYKA 5HFMA 5IJ0B 3G67A 3W7TA 2BCCH 5CB4B 5LA6B 1Y67A 2ITCC 4I55B 3ZHTA 2YXLA 2ITDC 1YZBA 2WA3A 2H8PC 4YHHO 3B2EE 4O4IA 2PYLA 4PD4F 3RYHB 1JA8A 1XEQA 4FJCC 1J5EO 4Z1VA 4DV5B 1XI1A 1I08A 5IY5B 4B3SB 4JI5B 2Q73A 4FLWA 5B66Z 4FLXA 4DRXB 4LP8A 1JMKC 2CTQA 1GAXA 1ORQC 5KHGA 4J10A 3FAVA 1FAFA 1B3QA 4UV8A 1OZ0A 5E1AC 3ZX6A 3RW0A 5LOVB 1HWYA 2P06A 1HNZO 5B1NA 3ABMC 5FPOA 4FPPA 1FJGO 2AXTZ 2WWWA 3AG4B 1WA8A 4DV6O 1GM7A 1WJZA 5B1AB 1V9PA 3CRMA 2EIJC 1WN7A 1MA1A 4DXWA 5IDJA 1SA0B
chains in the Genus database with same CATH topology
1VQOV 3CYOA 4PDLA 4XDKA 1BL8A 3PJSK 1CP9A 3W7WA 1AJNA 3LNMB 1G8MA 2DWEC 1S76D 1K8AW 3ETDA 4WFHA 1Y4MA 1YJWV 1S3JA 2DYRB 3D3IA 2W6JG 5KA5A 1PKXA 1YI2V 1OCOB 1VQ9V 3ZN1A 3X2QB 3W7XA 1COWG 5KUMA 2XNDG 2WLJA 1MABG 4MVQA 1NVPC 1GK9A 2X6CA 4MW8A 3E2EA 3T2MA 3AG2C 5EC1C 5CMUA 3QO8A 3ZRVA 1V55B 5EK0A 1R3LC 3FB7C 4E2LA 3QNEA 5B1BB 1YTFB 4JPRA 1PNLA 1N8RW 1VQLV 5GW7A 1OCRC 1RM1B 5H6RA 3F7YC 2DQ0A 2ZXWC 3LDCA 4L87A 4MVZA 5L3FA 1W0KG 3AG2B 4F4LA 3MHSC 1P4RA 4WFGA 3LDEA 2JEUA 3OUFA 2QA4V 2WPDG 4G28B 1EZJA 3KG2A 3CCSV 3AG3B 2A0LA 4RQEA 3RBZA 3SPCA 4BIZA 3CXCU 5L3GA 4Q20A 2QEXV 1NQTA 1OCCB 4MVOA 3E8FA 1S5HC 1VQNV 2OT5A 2DYSB 3E8GA 1VQ5V 2WLLA 1AJQA 3ASOB 1PD3A 3EFFK 4G27B 4GCZA 1KD1W 3IC7A 4RUEA 3ZMVA 3IFXA 4JASA 1K5QA 2H94A 4MTFA 3FYIB 1WLEA 2EBOA 3RVZA 4ASUG 1SESA 2FTKA 2OTLV 2EILB 3BEHA 3M99B 1DLBA 4KUMA 4TSFG 4MS2A 1V55C 1R3JC 3OUSA 1H38A 5LGNA 4BW5A 1AI4A 3G6EV 4MTXA 2X6BA 1AI5A 4QPJA 4XDJA 3BY6A 3AG4C 3E83A 4GT1A 4PA4A 4G2KA 4CBCA 4KFMA 4MT8A 4JF3A 3SYQA 1QCEA 3TETA 3K0GA 1L1FA 3OR7C 1JPXA 2EIMC 4PDVA 3QO7A 2M7WA 4PA3A 3VOUA 4JAVA 1SETA 3OGCC 1R73A 1SRYA 1DTOA 2UXNA 2ZXWB 3ABTA 3QO5A 2AHZA 1MG1A 3CMEV 5L3EA 3K06A 2CK3G 3OR6C 1M90W 3ML0A 3CC4V 1FXHA 1LNQA 4XDLA 1JQ0A 3ABLB 1B6QA 4J9YB 2OCCB 1S0VA 3ASOC 4H33A 1YTFD 3R65A 1YJNV 2R9RB 3JD4A 2WLNA 1NVPB 1NH2B 1MSWD 4U7OA 2WAMA 4HZ3A 3LDDA 5CA3A 1QBZA 3CCQV 3RVYA 4MVSA 5BZBA 5CBFA 2W0FC 3E89A 2AHYA 1FXVA 2IJIA 3G71V 4UUJC 2DYSC 2WLKA 5L3BA 3DTUB 1CPYA 1KC8W 4JYCA 3SYCA 3WG7B 1Q82W 3A0RA 1IXMA 4RQFA 4PA9A 3MHHC 4P2ZA 3JD3A 2BOCC 1NH2D 1BMFG 2ZDIC 3W7UA 2EIKB 4TT3G 3CCLV 2JEXA 1AROP 4PDMA 1QR9A 1FXKA 3W7SA 2HVJC 4ZBMA 5KA6A 1QVGU 1K9MW 1K73W 1H8EG 3SYPA 4EKWA 2XASA 3P30A 2X6AA 4X8AA 3CCVV 1NR1A 2ZDIA 3STZC 4HYOA 1F23A 2LFRA 1V54C 4WFAV 2Y48A 1FXKB 2UXXA 5LGTA 1NR7A 1M56C 1M56B 4X89A 1PNKA 1P7BA 4QNHB 3D36A 4UVCA 4FK5C 4PDRA 3SPHA 1AR1B 3CP1A 3ETEA 1V54B 5H9CA 2XAJA 4UV9A 3OEEG 2Z3YA 2DWDC 2WLIB 3CC2V 5HFLA 4GX2A 2ATKC 3E8BA 2A79B 2B5UA 2YEVA 3ZRSA 2QE7G 5B3SB 3JD2A 3MD0A 2OTJV 1DF5A 4FIPC 1PL0A 3E86A 2P90A 2EILC 1UJWB 3ZN0A 1Q86W 3UKMA 1M57C 2IU0A 1KQSU 3FYEB 4MW3A 1E79G 1YTFC 5C93A 3K08A 3GWOA 3ASNB 4MTGA 1XL6A 5B1OA 1JVMA 4BAYA 1ZWIC 4Z1MG 1YITV 2ZQMA 1WPXA 1R6KA 4DO2A 3T4DA 4I9WA 1VQPV 1K34A 3JD0A 3NXSA 1EBOA 3ABUA 2P67A 1VQ7V 1F4NA 2JK5C 3OW2U 3ZMZA 1KECA 3ABMB 1GMGA 3ZMSA 4OXSA 5LGUA 3X2QC 3ZRWB 1OCZB 5CN0A 4JAUA 2ZR2A 3OMIB 5IY5C 1K5SA 3LUTB 3WFVA 1VQKV 1Y66A 2DYRC 3ZMUA 3E8HA 3OEHG 1J95A 4GX0A 1JCHA 1H2GA 2P7TC 1JX9A 3ABLC 3ABKC 3B8NA 4JTDB 4PELA 1EFRG 5J9PC 1KP3A 1GO3F 2HKOA 4MVUA 3UM7A 3ZRWA 2C2AA 3K0DA 3B77A 4WF9V 3ZMTA 5B1AC 2QM7A 4GX5A 3SPIA 4JTCB 2V7QG 2Z5UA 1F51A 4MVRA 2K1EA 2EIKC 2EINC 4R50A 4PA6A 2WLIA 1NBMG 2X7RB 2MK3A 4R7CA 1K4CC 1GM8A 1QLEB 1NKDA 1NJIW 3P32A 5CBHA 1QLEC 1H8HG 2KB1A 3SJQC 2JIZG 3LSSA 1OHHG 2JJ1G 2WLHA 2HVKC 3JYCA 2PI5A 1I5YA 2YSUB 4UVAA 1YSCA 1S72V 1VQMV 5IYBO 1TUEB 3ASNC 1FXKC 3IGAC 3AEIA 5EC2C 5CBGA 5H6QA 1XL4A 4MTOA 2BOBC 5LBQA 3STLC 3F7VC 2IH3C 4P9PA 3ZJZA 3SYAA 2P6JA 4U7NA 3F5WC 2GHYA 2XAFA 2XAHA 1YJ9V 5LHIA 2IW5A 4GX1A 4P9OA 4WCEV 3ZRXA 1ENVA 5EBMC 3H01A 2JJ2G 4N21A 2DW4A 4ZKIA 5L3CA 4RUFA 1NVPD 2Q68A 3CCJV 5LHHA 1JOYA 2IJJA 2IU3A 2D3OW 2PI4A 2QM8A 5EBLC 2EIMB 1F4MA 3SYOA 1E1RG 3OE7G 2A9HA 2GSMB 1W0JG 4UXNA 3OM3B 1E1QG 2HR3A 2NLJC 2XAGA 3K03A 3B8MA 3CCRV 2JDIG 1RM1C 3CPWU 3CCEV 3HB3B 1CEZA 3FB6C 2ZR3A 4RAIA 1W2BU 3GB7C 2HG5C 3HPLC 1BHAA 2IJHA 1S77D 2HFEC 2NNUA 3E35A 1BHBA 4PA7A 1GTOA 3K3WA 4R8CA 1VQ6V 2OCCC 3TCUA 1RPRA 4QIWF 3K9AA 5B3SC 1PNMA 4WFBV 5IYDO 2V1DA 3LSQA 2QKSA 3AG1B 3FB5C 3OMNB 1K3EA 2W6IG 2EINB 1FS0G 4WFFA 4KP4A 4JGSA 2LP7A 2XOKG 3EHBB 4I5SA 1FFTB 4YXWG 2YEVB 1KKDA 1Q7YW 2HLDG 3ETGA 1SZTA 5FL7G 1RPOA 4TWKA 3T4ZA 4LBEC 3TK1A 1YHQV 3JD1A 1R6NA 3G4SV 4H37A 4N23A 3K04A 3FKSG 2EIJB 4BIUA 1K33A 1M57B 5DM6V 2Y69C 5B1BC 1K7DA 3I55V 1VQ4V 5KUKA 1AI6A 2WLLB 2WSSG 4LC1A 2EJRA 3OMAB 3CD6V 1K97A 1AJPA 1M9NA 3OAAG 3DGEA 4FMTA 3CC7V 1MOFA 3VBBA 5IYCO 3OFNG 1QR8A 1QVFU 1GKFA 2Q69A 5HFMA 3W7TA 3WG7C 2EZPA 3CCUV 2ITCC 4X88A 2Q6AA 2Q67A 2B1IA 4HAMA 4QE9A 2QTOA 2EZOA 2ITDC 4RO2A 2X0LA 4JTAB 2B1GA 5LHGA 2H8PC 5DN6G 4JYBA 4CZZA 2DQ3A 3ZCCA 2ZD9A 2LFSA 4FJCC 1NH2C 4UVBA 3T1CA 1G4YB 4J9ZB 5IY5B 1K4DC 4QPKA 1SERA 1KP2A 3SPGA 4MSWC 1OCRB 1THZA 4LP8A 3CCMV 1GM9A 1VQ8V 1ORQC 1JJ2U 2WLMA 2IJKA 1AI7A 1I5XA 1ROPA 1OZ0A 4UV8A 1OCZC 5E1AC 4XBFA 1Q81W 1OCCC 3RW0A 3SPJA 4QJFB 3CMAV 2IH1C 3AG1C 1HWYA 1DF4A 4R6ZA 3ZIAG 2R9IA 4P30A 4LCUC 1YIJV 5B1NA 3ABMC 4QE7A 4FPPA 3AG3C 1OCOC 1M1KW 3FB8C 2WWWA 3AG4B 2XAQA 2HJFC 1GM7A 1K92A 1R3KC 5EBWC 5B1AB 3K79A 5L3DA 1R3IC 2EIJC 4WFEA 4MVMA 3JCZA 1QLNA 2F43G 4DXWA 5IDJA 3I56V 2Y69B 3ABKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC O;  5IYD O;  5IYB O;  1YTF D;  1RM1 B;  1NH2 C;  1NVP C;  1NVP D;  1NH2 D;  1YTF C;  1RM1 C; 
#chains in the Genus database with same CATH topology
 4X9Q A;  1VQO V;  2A7W A;  4NTW A;  4PDL A;  4CH6 A;  3W7W A;  3JAR B;  2PYJ A;  1H2L A;  1BE3 H;  3A0H Z;  2DYR B;  2CGO A;  5KA5 A;  1YI2 V;  1AVM A;  4IGG A;  1VF7 A;  3X2Q B;  3W7X A;  1COW G;  5KUM A;  2XND G;  1LR1 A;  1MSD A;  4DR4 B;  1QNM A;  4MVQ A;  1HNX B;  1GK9 A;  3D36 C;  1VMG A;  3T2M A;  3AG2 C;  5B1B B;  1AR4 A;  4KXR A;  4DR2 B;  5GON A;  1YCI A;  1N8R W;  1XNR B;  3B4S A;  2ZXW C;  3MHS C;  4WFG A;  5KHI A;  3LDE A;  2JEU A;  3OUF A;  1XUQ A;  3LNN A;  2FYU H;  3RT3 C;  3BAA A;  4UCO A;  1BQZ A;  4FM1 A;  2QEX V;  2QKC A;  4MVO A;  1S5H C;  4HNA B;  1VQN V;  3U11 A;  1AJQ A;  1PD3 A;  1ZUQ A;  2YI9 A;  3ZMV A;  3IFX A;  4JAS A;  4MTF A;  3JSN A;  2OTL V;  1DLB A;  4KUM A;  1R3J C;  2BTQ B;  4BW5 A;  5EZY A;  4ZOL A;  4GT1 A;  1VIB A;  3SYQ A;  1QCE A;  1BQ0 A;  5LMN O;  4X65 O;  1H2M A;  2FL4 A;  3QO7 A;  2M7W A;  2F4V B;  2GBO A;  4JAV A;  2UXB B;  4DV4 O;  1R73 A;  2AHZ A;  1MG1 A;  4B7E A;  3JAW B;  3OR6 C;  1FXH A;  2LW7 A;  1I0H A;  3ASO C;  1YTF D;  3RN4 A;  5LMN B;  2WLN A;  1LUV A;  4BW9 A;  5JJN B;  2UUB B;  3CS5 A;  3OD4 A;  4HZ3 A;  3TJT A;  1I94 B;  4GLX A;  3B09 A;  5CBF A;  2W0F C;  2QGN A;  3FD9 A;  2GTA A;  4UUJ C;  5L3B A;  1CPY A;  4DR7 O;  2E74 B;  1XRE A;  1Q82 W;  5LYJ B;  3E22 A;  4RQF A;  3MHH C;  4OPH A;  2BOC C;  3W7U A;  4ZI7 A;  1SQP H;  3EXA A;  4DV0 B;  3ZHV A;  4JI2 O;  1IBL O;  4JI5 O;  4PDM A;  1QR9 A;  2YDE A;  1P7G A;  1XBL A;  5KA6 A;  3CCV V;  4JI1 O;  4O4L A;  1IBL B;  5LGT A;  1IVS A;  4F6E A;  1NR7 A;  1M56 B;  3OTO O;  1PNK A;  1AIL A;  4LF7 B;  1HP8 A;  4FK5 C;  3CP1 A;  2ZNJ A;  1V54 B;  4LFB B;  2Z3Y A;  2GTS A;  1P84 F;  2JS3 A;  1T5E A;  1CXZ B;  5B3S B;  4DV5 O;  2YUA A;  3MD0 A;  2LQT A;  1MNG A;  2IU0 A;  3IAY A;  1KQS U;  4MW3 A;  2WA4 A;  2Q0A A;  5C93 A;  3GWO A;  1XOU A;  4MTG A;  2OCH A;  5B1O A;  5CA1 B;  3CRC A;  3QTC A;  4BAY A;  1TGO A;  2ZNI A;  5JWP A;  3RYF A;  3NXS A;  1VP7 A;  3VQY A;  1VQ7 V;  1NI8 A;  1QHT A;  1KEC A;  3ABM B;  4YJ3 A;  4GKJ B;  3L72 H;  4OXS A;  4GYC B;  2ZIN A;  2F4V O;  2YC0 A;  3T1H B;  2JGU A;  4DR1 B;  2LW1 A;  1HNX O;  1VQK V;  1TA8 A;  2P7T C;  1JX9 A;  4JTD B;  1EFR G;  1KUQ A;  3UM7 A;  1SQV H;  2EJ7 A;  5FLX N;  2C2A A;  2Q7H A;  3F5T A;  4GKK O;  3CRR A;  1OJH A;  1G6U A;  4KHP B;  4O2A B;  5EIB D;  4ZHQ B;  3BRC A;  2E75 B;  4MVR A;  2EIK C;  2OIE A;  4Q6G A;  2WLI A;  2X7R B;  2QWP B;  2LO1 A;  2YIB A;  4R7C A;  5JH7 B;  1W59 A;  3H1K H;  5IJ9 B;  4LNU A;  3SGI A;  2KB1 A;  2DJV A;  3CXH F;  4UVA A;  4J7Z A;  2JGD A;  4X20 B;  1TUE B;  3ASN C;  1FXK C;  1PV0 A;  2VWK A;  3WU2 Z;  2NN4 A;  4MTO A;  1VF6 C;  4JI7 B;  2CH7 B;  2IH3 C;  4P9P A;  3ZJZ A;  2UXC O;  1HNW B;  4U7N A;  3M7M X;  2GHY A;  2XAF A;  4FZ1 A;  1G1X B;  4F6R B;  5ITZ A;  1SA0 A;  2QTS A;  1PPJ H;  1RFY A;  4WCE V;  1N4C A;  2VRZ A;  5EZY B;  2E3C A;  2JJ2 G;  1L0N H;  1KU9 A;  4ZKI A;  5H2F Z;  1JOY A;  4PI0 A;  5DEC A;  1PP9 H;  4IHJ B;  4B3T O;  3QVN A;  2QM8 A;  3TXS A;  2HP8 A;  2EIM B;  2OYQ A;  1E1R G;  3OE7 G;  2OIG A;  2NLJ C;  2XAG A;  3K5M A;  3B8M A;  2KG7 B;  2YI8 A;  4DV2 O;  1TUB A;  3CCE V;  1CEZ A;  2ZR3 A;  1BCC H;  1Q43 A;  1S77 D;  2NNU A;  3E35 A;  1BHB A;  3K3W A;  2F95 B;  3TCU A;  5IWA B;  4WFB V;  2KQX A;  4I0X A;  3KZI Z;  4NTY A;  3JAK A;  3OMN B;  4IL6 Z;  4O4H B;  4DV6 B;  2W6I G;  1Q6I A;  2XOK G;  4JV5 O;  4YXW G;  1KKD A;  2HLD G;  1IBM B;  1IBM O;  4TWK A;  3T4Z A;  5TIS Z;  1YHQ V;  1R6N A;  2Y4U A;  3P3N A;  5CA0 B;  4BIU A;  1K33 A;  4BIO A;  1O9G A;  2Q5Z A;  5B1B C;  3I55 V;  4JI1 B;  4LC1 A;  3QF7 A;  4FMT A;  2AGA A;  3FX7 A;  3VBB A;  2F93 B;  2FB5 A;  1QR8 A;  3MAQ A;  1QVF U;  1WP8 A;  4FVM A;  2P22 C;  3WG7 C;  2EZP A;  3JSL A;  4X88 A;  3L75 H;  2EZO A;  5D5Q A;  4Z2W A;  2UUC O;  2P5O A;  4RO2 A;  2PF4 E;  2X0L A;  4JTA B;  5LHG A;  1DK1 A;  5DN6 G;  1BZK A;  4JYB A;  4CZZ A;  3ZCC A;  2ZD9 A;  2LFS A;  2R72 A;  2CUG A;  4J9Z B;  2CDY A;  3CEI A;  3L74 H;  5KAI Z;  4D7T A;  1JJ2 U;  4DV3 B;  2IJK A;  4LFC O;  4XBF A;  3SPJ A;  2IH1 C;  3AG1 C;  4R6Z A;  4LCU C;  2JVD A;  4X64 O;  4QE7 A;  5E79 Z;  1WNS A;  3AG3 C;  3FAV B;  1LUW A;  1M1K W;  2HJF C;  5LYJ A;  2DMX A;  4WFE A;  2BSK B;  2UUA O;  1N33 B;  2F43 G;  2Y69 B;  3HKE B;  3CYO A;  4OGQ B;  4DUY B;  3HKD B;  1AJN A;  1G8M A;  2VQE O;  1K8A W;  4WFH A;  1Y4M A;  3GWK C;  1S3J A;  3JAL B;  3D3I A;  3DC5 A;  1FYJ A;  4LR3 A;  4HBN A;  1PM9 A;  1Q3E A;  2Q7E A;  4YY3 O;  4JI0 B;  4X1I B;  1R3L C;  3FB7 C;  4E2L A;  1YTF B;  1N32 B;  4JPR A;  4JI3 O;  4EFE A;  1VQL V;  4NXN O;  1GRJ A;  1JJO A;  5H6R A;  3LDC A;  2LGQ A;  1SC5 B;  3N2G A;  4K0K B;  4FFK A;  2YXY A;  5GON B;  1EZJ A;  3CCS V;  1N36 B;  4RQE A;  5B5E Z;  2YID A;  3SPC A;  3JAS B;  4BIZ A;  2AZ2 A;  4TUY B;  4AQY O;  1GN3 A;  2OT5 A;  2WLL A;  4G27 B;  3IC7 A;  2D2C B;  1XQ8 A;  5EIB C;  2QDO A;  4JI6 O;  3FYI B;  1WLE A;  3RVZ A;  3K5O A;  5IE9 A;  2PGG A;  5JJE B;  4MTX A;  3D8C A;  3E83 A;  3Q4H B;  2F66 C;  4FZ0 A;  4PA4 A;  4CBC A;  4DR1 O;  4JF3 A;  3P3P A;  3TET A;  2VS0 A;  3K0G A;  4PDV A;  2RMK B;  3JAK B;  4PA3 A;  1SF9 A;  4O4H A;  1SET A;  1RSO B;  4ZOL B;  1SRY A;  1DTO A;  1SQX H;  3QO5 A;  1SZX A;  2QWO B;  3G80 A;  3RGB A;  3CME V;  5L3E A;  3K06 A;  2KKW A;  3K59 A;  4D6T H;  1B6Q A;  4DW1 A;  2JGD B;  1S0V A;  4JI8 O;  4J7K A;  3R65 A;  1N33 O;  1Y74 B;  1NVP B;  2ZE7 A;  1NH2 B;  1XHX A;  2WAM A;  5CA3 A;  1QBZ A;  4W4L A;  3RVY A;  3HKB B;  4WBN B;  5BZB A;  2AHY A;  1FXV A;  3G71 V;  2DYS C;  1WP7 A;  3WG7 B;  4YHH B;  1I94 O;  4H0L B;  2GDS A;  4PA9 A;  4LFA B;  3M8A A;  1PL4 A;  3JD3 A;  1EM1 A;  2AW9 A;  1NH2 D;  1IUR A;  4X65 B;  2Q7G A;  1XMO B;  3AK2 A;  3W7S A;  2XHB A;  2HVJ C;  3JAR A;  4X62 O;  2F23 A;  1QVG U;  2KG7 A;  1K73 W;  2XAS A;  4X8A A;  1NZ6 A;  4LF4 B;  1NR1 A;  3STZ C;  1F23 A;  2LFR A;  1V54 C;  2P4V A;  2Y48 A;  1FXK B;  4IIJ B;  1M56 C;  4X89 A;  5DED A;  5H9C A;  3AK1 A;  3CC2 V;  3ZS8 C;  2B5U A;  1YF2 A;  2OTJ V;  1NTK H;  3E86 A;  1S5L Z;  2P90 A;  3ZN0 A;  2ZE6 A;  5LP6 B;  5LP6 C;  2PUS A;  2UXB O;  1YTF C;  1XL6 A;  1JVM A;  3QG5 A;  4Z1M G;  3MDS A;  1R6K A;  3C3S A;  3T4D A;  1K34 A;  4U3F H;  5BY1 A;  1F4N A;  2JK5 C;  3JAL A;  1H2K A;  2RN9 A;  2ZE8 A;  3S3X A;  5LGU A;  4K8X A;  1US6 A;  5KLV H;  1F7Y A;  5CN0 A;  1IXB A;  4YY3 B;  3FFQ A;  3WFV A;  3ZBH A;  1Z5W A;  2YIB D;  3UO3 A;  4X1I A;  3ZMU A;  4OX9 O;  1JCH A;  1B04 A;  1NS1 A;  5J9P C;  4MVU A;  1YEW A;  3K0D A;  2L6L A;  3B77 A;  4WF9 V;  4LF9 O;  3ZMT A;  3U0Z A;  2QM7 A;  4EFB A;  4DUZ B;  3SPI A;  2V7Q G;  1F51 A;  2K1E A;  2QWR B;  2EIN C;  4B08 A;  2OWO A;  2MK3 A;  1NJI W;  1QLE B;  1NKD A;  3N2K B;  4LF8 B;  1MMM A;  1QLE C;  4I0X B;  1H8H G;  5J2U A;  3JAW A;  3L70 H;  3LSS A;  1OHH G;  2WLH A;  2HVK C;  4ICG A;  4L8J A;  1BSM A;  5JH7 A;  4C7U A;  1WB8 A;  2PY5 A;  5CBG A;  4LF6 O;  2BOB C;  4LF5 O;  3STL C;  3F7V C;  1KKC A;  1HNZ B;  4OX9 B;  2XAH A;  5F2V O;  2IW5 A;  4I9Q A;  3ZRX A;  1ENV A;  3A2F A;  3H01 A;  1J5E B;  2DW4 A;  4DV7 O;  4QGP A;  5LHH A;  1AP6 A;  2YXH A;  2JS5 A;  4O4J B;  5EYP B;  3SYO A;  1ZSP A;  3CCR V;  2JDI G;  1X59 A;  2W0X A;  2DN9 A;  3GB7 C;  5LMU B;  3HPL C;  2IJH A;  3T1Y O;  4FFB A;  3IC9 A;  2BE3 A;  3K9A A;  4H13 B;  5IYZ B;  3HKC B;  4AI8 A;  3WB0 A;  4DR7 B;  1M5I A;  2UU9 B;  3FB5 C;  5K1P A;  3CHX A;  4FLZ A;  2EIN B;  4B3M B;  2LP7 A;  3EHB B;  1I7F A;  4I5S A;  1FFT B;  4B3S O;  1Q7Y W;  3TXQ A;  4UCU A;  4YIO A;  4BR6 A;  1D2D A;  2EIJ B;  1M57 B;  2Y69 C;  3JAM N;  3L71 H;  2CTR A;  4K3A A;  1AJP A;  1M9N A;  1URF A;  1HR0 B;  1U97 A;  5IYC O;  3OFN G;  2BSK A;  2Q69 A;  1JFF A;  3UQ8 A;  3ZED A;  2Q67 A;  4QE9 A;  2QTO A;  3JAT B;  4X1Y A;  4ZI7 B;  2B1G A;  2FML A;  3K5N A;  2Y4T A;  1VF5 B;  1NH2 C;  4DK0 A;  1K4D C;  1NTM H;  4QPK A;  5FPR A;  1SER A;  1KP2 A;  3SPG A;  4MSW C;  2RCV A;  3CCM V;  1GM9 A;  1Y74 A;  1FKA O;  1XDC A;  3L73 H;  1OCZ C;  1Q81 W;  1OCC C;  2GUZ B;  2R9I A;  4K8Z A;  2XAQ A;  1NTZ H;  1K92 A;  3KKY A;  2UUB O;  5EBW C;  5L3D A;  4UCV A;  1Q90 D;  4MVM A;  3JCZ A;  3U10 A;  1QLN A;  4NTX A;  3VQW A;  5C8Y B;  3RYC A;  3PJS K;  1O9H A;  2DWE C;  2P4K A;  3DXR B;  1YJW V;  2Y0I A;  1PKX A;  1SQB H;  4YJ3 B;  3K58 A;  4I4T A;  2FKX A;  4J80 A;  2E5L O;  3O65 A;  2A3Q A;  2WLJ A;  5JQG B;  1MAB G;  2VQF B;  1NVP C;  5JVD B;  4JI0 O;  1MZE A;  4X66 O;  3E2E A;  5EC1 C;  3G6B A;  5CMU A;  4UCT A;  1FD9 A;  4GUN A;  3SJA C;  3QNE A;  5A9G A;  1PNL A;  2E5L B;  1N0N A;  5GW7 A;  1ZTE A;  1RM1 B;  2DQ0 A;  5L3F A;  1UPG A;  1W0K G;  3AG2 B;  1IZ3 A;  3S3W A;  4F4L A;  2QJ1 A;  3EVK A;  4ZIB A;  2WPD G;  5LP6 A;  3KG2 A;  3WB2 A;  5KHJ A;  3BAB A;  3UCS C;  4YJ2 A;  3CXC U;  3BA9 A;  5L3G A;  3NR7 A;  4JAA A;  1NQT A;  1OCC B;  3HKB A;  4WBN A;  3E8F A;  4PV1 B;  2ARH A;  4H44 B;  3E8G A;  4X1K A;  1VQ5 V;  4GCZ A;  3ASO B;  4LH7 A;  3D3Q A;  4RUE A;  4JZG A;  1K5Q A;  2EBO A;  3BEH A;  5H5N A;  1V55 C;  1HDJ A;  3OUS A;  5BR8 B;  1H38 A;  4JI3 B;  3G6E V;  2VQE B;  3BY6 A;  3ETQ A;  1TAE A;  4G2K A;  4KHP O;  4KFM A;  3CB2 A;  4MT8 A;  1BS3 A;  1Z2G A;  4IHJ A;  1L1F A;  3L9D A;  1RP3 B;  3SJC C;  2EIM C;  5LXT A;  4ABM A;  4K35 A;  3SR2 C;  3VOU A;  4DR3 B;  4DUY O;  2H3O A;  4JZ2 A;  2ZIO A;  3ICX A;  4U3J A;  3R66 A;  3ABT A;  1X4T A;  2JRI A;  1QU7 A;  3BA8 A;  2CK3 G;  3ML0 A;  4XDL A;  1Y76 A;  4DR3 O;  2OCC B;  4CC5 A;  1L0L H;  4KL1 A;  1YJN V;  2R9R B;  1XIL A;  1MSW D;  4U7O A;  5BXZ A;  3LDD A;  4J11 A;  3CCQ V;  1Z5V A;  4NB5 A;  3VQV A;  2IJI A;  3AG7 A;  3DTU B;  1SS3 A;  3SYC A;  2KSD A;  1IXM A;  2DE0 X;  2XT9 A;  5CA0 A;  1KMI Z;  1DGS A;  3OGI B;  1N36 O;  1BMF G;  2ZDI C;  3JAT A;  4X1Y B;  2EIK B;  4TT3 G;  5KMG B;  3DC6 A;  3HKD A;  2JEX A;  1ARO P;  4TV8 A;  4IT5 A;  1FXK A;  4ZBM A;  4IIJ A;  4LWS A;  1H8E G;  3Q4H A;  3SYP A;  3BFR A;  4EKW A;  3P30 A;  4NXN B;  1KB9 F;  2Q4P A;  2ZDI A;  2YIC A;  4FM2 A;  1YDX A;  4WFA V;  1D5N A;  1H2N A;  2G38 A;  5K1X A;  5IYZ A;  4DV2 B;  4PDR A;  3SPH A;  3ETE A;  4DR2 O;  4LF5 B;  4DV7 B;  2XUM A;  2ATK C;  3E8B A;  3ZRS A;  3N2G B;  2BTO A;  1PL0 A;  2EIL C;  1UJW B;  3OTF A;  1ZLZ A;  2MW2 B;  3CJH B;  1WAZ A;  2V4D A;  3FYE B;  4JI8 B;  1E79 G;  2LJ2 A;  3K08 A;  1EN5 A;  4JV5 B;  1FPO A;  1ZWI C;  1GN2 A;  1XMQ O;  2ZQM A;  2HHH O;  2HHH B;  4DO2 A;  3APQ A;  1EN4 A;  4B7K A;  1VQP V;  3JD0 A;  2QR4 A;  1EBO A;  4I7Z B;  3ABU A;  3DXR A;  2P67 A;  2PZS A;  1EN6 A;  3ZMZ A;  4LF6 B;  1N34 B;  5IJ0 A;  4AIL C;  4DUZ O;  4CH3 A;  1JFF B;  2UU9 O;  5LMU O;  2PTM A;  4I55 A;  4LF9 B;  1OCZ B;  1HR0 O;  4JAU A;  3TGU H;  5KX5 B;  3OMI B;  5IY5 C;  4NXM O;  1FJG B;  4TOI A;  3E8H A;  3HKE A;  5IT9 N;  3B8N A;  1H2G A;  3H1L H;  3ZRW A;  2UXC B;  4O2B A;  3K9S A;  5B1A C;  4J7J A;  1EZV H;  4FFB B;  4R50 A;  4PA6 A;  3GVM A;  4AQY B;  1GM8 A;  5CBH A;  1ZX3 A;  2JIZ G;  2JJ1 G;  2PI5 A;  5KHH A;  2YSU B;  3N27 A;  1YSC A;  4TV9 A;  1VQM V;  1VAR A;  1N34 O;  5BMV B;  4DW0 A;  3IGA C;  2YIA A;  5J2U B;  3AEI A;  5H6Q A;  2QM4 A;  3ZHS A;  3SYA A;  2P6J A;  4RWU A;  2ETN A;  3F5W C;  4JI2 B;  1SKV A;  1YJ9 V;  5LHI A;  5C8Y A;  4O4J A;  5EYP A;  4GX1 A;  4LFB O;  5EBM C;  5JJJ B;  4EB6 B;  5GTH Z;  4DV1 O;  2RQ6 A;  4TUY A;  5L3C A;  1ZL8 A;  4RUF A;  3CCJ V;  2D3O W;  1Q8I A;  2PI4 A;  3RFR A;  1F4M A;  3UT5 A;  2GSM B;  1W0J G;  1JR9 A;  1E1Q G;  2HR3 A;  3K03 A;  3T1H O;  2YS8 A;  2IBZ H;  3CPW U;  3HB3 B;  3FB6 C;  3PN1 A;  3I5D A;  1SQF A;  4CS3 A;  1W2B U;  2N04 A;  3UO2 A;  2HFE C;  2VWJ A;  4R8C A;  2UUA B;  4QIW F;  5B3S C;  1AP5 A;  3RYI B;  4DV3 O;  1BGY H;  3LSQ A;  4FLT A;  2QKS A;  3AG1 B;  2N05 A;  1K3E A;  1FS0 G;  1RSO A;  4KP4 A;  1HW7 A;  4JI4 B;  4JGS A;  2IM9 A;  2YEV B;  1Q6U A;  5FL7 G;  1RPO A;  2L35 A;  1TVK B;  3SJB C;  4LBE C;  3TK1 A;  4J41 A;  2ZM6 B;  3LSU A;  3K57 A;  2RDC A;  3K04 A;  3DSQ A;  2F1M A;  2QWQ B;  3OMA B;  5LA6 A;  3OAA G;  1MOF A;  1GKF A;  2CTW A;  3CCU V;  3BVO A;  3RYH A;  1NT2 B;  2Q6A A;  2B1I A;  4HAM A;  4NKG B;  4TQD A;  2R70 A;  2DQ3 A;  4DRX A;  2UXD B;  2EX3 A;  3H1H H;  4UVB A;  3T1C A;  1G4Y B;  3HKC A;  1L8D A;  4J42 A;  1OCR B;  2GV9 A;  1THZ A;  3CJH A;  4OPA A;  4UFZ A;  4DR6 B;  1VQ8 V;  3N2K A;  4FLY A;  5J2T B;  1UFI A;  3WB1 A;  2WLM A;  1AI7 A;  1I5X A;  1ROP A;  3CMA V;  4QJF B;  4UB8 Z;  1DF4 A;  3RYF B;  3ZIA G;  4P30 A;  1YIJ V;  3ZHR A;  1Y6X A;  1OCO C;  3CRQ A;  4IYI A;  3FB8 C;  4DYL A;  4FLU A;  3CWB H;  3AK3 A;  2O57 A;  4JI7 O;  1R3K C;  3K79 A;  1R3I C;  3IJ4 A;  3OT7 A;  3HR0 A;  3KCX A;  3I56 V;  3ABK B;  4K0K O;  4XDK A;  1BL8 A;  1CP9 A;  3T1Y B;  5JCO A;  3LNM B;  1S76 D;  1KYO F;  3ETD A;  4UCR A;  1GH6 A;  3APO A;  2W6J G;  3CE2 A;  3ZHU A;  1B06 A;  3RYC B;  3H1I H;  1OCO B;  1VQ9 V;  3ZN1 A;  4O4L B;  4DV4 B;  4CS2 A;  4DR5 O;  1P49 A;  4DR5 B;  4X66 B;  2X6C A;  4MW8 A;  5IJ9 A;  1QQC A;  3QO8 A;  3ZRV A;  1V55 B;  5EK0 A;  3RWR D;  2R9A A;  2HJD A;  5JQG A;  1OCR C;  1NU1 H;  3F7Y C;  2E76 B;  4L87 A;  4MVZ A;  1P4R A;  2GUZ A;  2QA4 V;  1GN6 A;  2RNB A;  5LOV A;  2ADP A;  4G28 B;  3KCY A;  3AG3 B;  1MZF A;  2Q9L A;  4GZR B;  2A0L A;  2B9Z A;  3RBZ A;  3H1J H;  4DK1 A;  1SQG A;  4Q20 A;  2QSA A;  4NVP A;  4PI2 A;  2DYS B;  4I50 A;  3EFF K;  1KD1 W;  4B3R O;  4LFC B;  3OTO B;  2H94 A;  5FNV A;  2ILM A;  1TUB B;  4ASU G;  1SES A;  2FTK A;  2EIL B;  3M99 B;  4TSF G;  4MS2 A;  1KBH A;  5CB4 A;  2AZ0 A;  5LXT B;  5LGN A;  1AI4 A;  2X6B A;  1AI5 A;  4QPJ A;  4XDJ A;  3AG4 C;  3BCC H;  1D5A A;  4NR1 A;  4PJ0 Z;  2ZIM A;  3H9V A;  3OR7 C;  1JPX A;  4FM0 A;  2Q0O C;  3OGC C;  2UXN A;  2ZXW B;  2CGN A;  1M90 W;  3CC4 V;  3J81 N;  1LNQ A;  1AB3 A;  4X62 B;  1JQ0 A;  3ABL B;  4J9Y B;  1XHZ A;  4H33 A;  2N74 A;  4U3J B;  4GKJ O;  3JD4 A;  2XTA A;  4MVS A;  4CH5 A;  1U96 A;  4UCS A;  3E89 A;  1M4U A;  2M6Y A;  2WLK A;  4F6R A;  5ITZ B;  1KC8 W;  1R1B A;  1GN4 A;  4JYC A;  5KMG A;  3A0R A;  1WA8 B;  5GTI Z;  1FFX B;  4TV8 B;  4YIP A;  4D7S A;  2RJZ A;  2Z0A A;  4LWS B;  1M93 A;  4P2Z A;  5D5P A;  2NR5 A;  3CSX A;  4DV0 O;  3CCL V;  3E22 B;  5JCO C;  4E4E A;  1R6T A;  1WPB A;  1K9M W;  2X6A A;  4EEQ A;  4HYO A;  4I4T B;  1XMO O;  4AHC A;  2UXX A;  1ZAU A;  4CH4 A;  5JVD A;  2VQF O;  1P7B A;  4JI6 B;  3D36 A;  4UVC A;  4QNH B;  1AR1 B;  4O4I B;  2XAJ A;  5KAF Z;  1XMQ B;  4UV9 A;  3OEE G;  5BR8 O;  1HNW O;  2DWD C;  2WLI B;  1N32 O;  4B3M O;  1Y76 B;  5HFL A;  4GX2 A;  2A79 B;  4JYA O;  2ZE5 A;  2YEV A;  2QE7 G;  1VF6 A;  4A5U B;  5CA1 A;  3JD2 A;  1DF5 A;  4B3R B;  4TQF A;  4FIP C;  1Q86 W;  5A2Q N;  3UKM A;  3K5L A;  1M57 C;  4X20 A;  4JI4 O;  1BT8 A;  3C3T A;  3ASN B;  4YJ2 B;  1YIT V;  3CRA A;  1WPX A;  2CH7 A;  2EUL A;  4I9W A;  3B40 A;  4LF7 O;  3OW2 U;  2K9P A;  1GMG A;  3ZMS A;  2ZKO A;  3JCU Z;  3X2Q C;  3ZRW B;  4LFA O;  1ZL8 B;  2ZR2 A;  1K5S A;  3LUT B;  2UUC B;  2CTP A;  1Y66 A;  2DYR C;  3OEH G;  4CC6 A;  1J95 A;  4GX0 A;  1S5J A;  1IBK B;  3ABL C;  3ABK C;  4IYH A;  4PEL A;  1KP3 A;  1GO3 F;  2HKO A;  2CE4 A;  4UB6 Z;  4LNU B;  4GX5 A;  4JTC B;  2Y0P A;  2Z5U A;  1IBK O;  1NBM G;  5KHK A;  4O2B B;  1K4C C;  5BMV A;  1SQQ H;  3P32 A;  5J2T A;  4O2A A;  3RYI A;  3SJQ C;  4BWA A;  3JYC A;  1I5Y A;  1OV9 A;  2QKA A;  4GKK B;  2CAZ C;  4PHZ A;  1S72 V;  2LGW A;  5IYB O;  1Q6H A;  5LL6 Y;  5EC2 C;  1TVK A;  1XL4 A;  2DOS A;  3A8T A;  5LBQ A;  2A06 H;  4EB6 A;  5FNV B;  4JYA B;  3CX5 F;  3A0B Z;  1YVW A;  3O9O A;  4CS4 A;  1WB7 A;  2ZCE A;  3ZHQ A;  4B3T B;  4P9O A;  4DV1 B;  1H2S B;  4N21 A;  5KX5 A;  4HNA A;  1NVP D;  2Q68 A;  2Q8V A;  2UXD O;  2IJJ A;  2IU3 A;  4X1K B;  3THO A;  5EBL C;  4LF8 O;  1YXB A;  2ZT9 B;  2A9H A;  4LH6 A;  4UXN A;  3OM3 B;  4FLV A;  1RM1 C;  4NXM B;  4LF4 O;  1VEW A;  4RAI A;  4ZHQ A;  4JYY A;  2HG5 C;  1BHA A;  3SDL A;  3UT5 B;  2BTQ A;  3BPZ A;  4PA7 A;  1GTO A;  1A32 A;  1VQ6 V;  2OCC C;  1RPR A;  1PNM A;  5IYD O;  2V1D A;  3C90 A;  1AR5 A;  1XNQ O;  4WFF A;  1IX9 A;  5AG2 A;  4TV9 B;  1IDS A;  1Q5O A;  4X64 B;  3J80 N;  3J7A U;  1N0J A;  3ETG A;  1SZT A;  3JAS A;  2ZM6 O;  1FFX A;  3JD1 A;  3G4S V;  4H37 A;  4N23 A;  3FKS G;  1XNQ B;  2HEP A;  5DM6 V;  1XNR O;  2ADQ B;  1K7D A;  1VQ4 V;  5KUK A;  1AI6 A;  2WLL B;  4I50 B;  2QWN B;  2WSS G;  2EJR A;  3CD6 V;  1K97 A;  3DGE A;  2ODM A;  3CC7 V;  3BHP A;  3VQX A;  4DR6 O;  5IWA O;  4W4K A;  4DR4 O;  4NYK A;  5HFM A;  5IJ0 B;  3G67 A;  3W7T A;  2BCC H;  5CB4 B;  5LA6 B;  1Y67 A;  2ITC C;  4I55 B;  3ZHT A;  2YXL A;  2ITD C;  1YZB A;  2WA3 A;  2H8P C;  4YHH O;  3B2E E;  4O4I A;  2PYL A;  4PD4 F;  3RYH B;  1JA8 A;  1XEQ A;  4FJC C;  1J5E O;  4Z1V A;  4DV5 B;  1XI1 A;  1I08 A;  5IY5 B;  4B3S B;  4JI5 B;  2Q73 A;  4FLW A;  5B66 Z;  4FLX A;  4DRX B;  4LP8 A;  1JMK C;  2CTQ A;  1GAX A;  1ORQ C;  5KHG A;  4J10 A;  3FAV A;  1FAF A;  1B3Q A;  4UV8 A;  1OZ0 A;  5E1A C;  3ZX6 A;  3RW0 A;  5LOV B;  1HWY A;  2P06 A;  1HNZ O;  5B1N A;  3ABM C;  5FPO A;  4FPP A;  1FJG O;  2AXT Z;  2WWW A;  3AG4 B;  1WA8 A;  4DV6 O;  1GM7 A;  1WJZ A;  5B1A B;  1V9P A;  3CRM A;  2EIJ C;  1WN7 A;  1MA1 A;  4DXW A;  5IDJ A;  1SA0 B; 
#chains in the Genus database with same CATH homology
 1VQO V;  3CYO A;  4PDL A;  4XDK A;  1BL8 A;  3PJS K;  1CP9 A;  3W7W A;  1AJN A;  3LNM B;  1G8M A;  2DWE C;  1S76 D;  1K8A W;  3ETD A;  4WFH A;  1Y4M A;  1YJW V;  1S3J A;  2DYR B;  3D3I A;  2W6J G;  5KA5 A;  1PKX A;  1YI2 V;  1OCO B;  1VQ9 V;  3ZN1 A;  3X2Q B;  3W7X A;  1COW G;  5KUM A;  2XND G;  2WLJ A;  1MAB G;  4MVQ A;  1NVP C;  1GK9 A;  2X6C A;  4MW8 A;  3E2E A;  3T2M A;  3AG2 C;  5EC1 C;  5CMU A;  3QO8 A;  3ZRV A;  1V55 B;  5EK0 A;  1R3L C;  3FB7 C;  4E2L A;  3QNE A;  5B1B B;  1YTF B;  4JPR A;  1PNL A;  1N8R W;  1VQL V;  5GW7 A;  1OCR C;  1RM1 B;  5H6R A;  3F7Y C;  2DQ0 A;  2ZXW C;  3LDC A;  4L87 A;  4MVZ A;  5L3F A;  1W0K G;  3AG2 B;  4F4L A;  3MHS C;  1P4R A;  4WFG A;  3LDE A;  2JEU A;  3OUF A;  2QA4 V;  2WPD G;  4G28 B;  1EZJ A;  3KG2 A;  3CCS V;  3AG3 B;  2A0L A;  4RQE A;  3RBZ A;  3SPC A;  4BIZ A;  3CXC U;  5L3G A;  4Q20 A;  2QEX V;  1NQT A;  1OCC B;  4MVO A;  3E8F A;  1S5H C;  1VQN V;  2OT5 A;  2DYS B;  3E8G A;  1VQ5 V;  2WLL A;  1AJQ A;  3ASO B;  1PD3 A;  3EFF K;  4G27 B;  4GCZ A;  1KD1 W;  3IC7 A;  4RUE A;  3ZMV A;  3IFX A;  4JAS A;  1K5Q A;  2H94 A;  4MTF A;  3FYI B;  1WLE A;  2EBO A;  3RVZ A;  4ASU G;  1SES A;  2FTK A;  2OTL V;  2EIL B;  3BEH A;  3M99 B;  1DLB A;  4KUM A;  4TSF G;  4MS2 A;  1V55 C;  1R3J C;  3OUS A;  1H38 A;  5LGN A;  4BW5 A;  1AI4 A;  3G6E V;  4MTX A;  2X6B A;  1AI5 A;  4QPJ A;  4XDJ A;  3BY6 A;  3AG4 C;  3E83 A;  4GT1 A;  4PA4 A;  4G2K A;  4CBC A;  4KFM A;  4MT8 A;  4JF3 A;  3SYQ A;  1QCE A;  3TET A;  3K0G A;  1L1F A;  3OR7 C;  1JPX A;  2EIM C;  4PDV A;  3QO7 A;  2M7W A;  4PA3 A;  3VOU A;  4JAV A;  1SET A;  3OGC C;  1R73 A;  1SRY A;  1DTO A;  2UXN A;  2ZXW B;  3ABT A;  3QO5 A;  2AHZ A;  1MG1 A;  3CME V;  5L3E A;  3K06 A;  2CK3 G;  3OR6 C;  1M90 W;  3ML0 A;  3CC4 V;  1FXH A;  1LNQ A;  4XDL A;  1JQ0 A;  3ABL B;  1B6Q A;  4J9Y B;  2OCC B;  1S0V A;  3ASO C;  4H33 A;  1YTF D;  3R65 A;  1YJN V;  2R9R B;  3JD4 A;  2WLN A;  1NVP B;  1NH2 B;  1MSW D;  4U7O A;  2WAM A;  4HZ3 A;  3LDD A;  5CA3 A;  1QBZ A;  3CCQ V;  3RVY A;  4MVS A;  5BZB A;  5CBF A;  2W0F C;  3E89 A;  2AHY A;  1FXV A;  2IJI A;  3G71 V;  4UUJ C;  2DYS C;  2WLK A;  5L3B A;  3DTU B;  1CPY A;  1KC8 W;  4JYC A;  3SYC A;  3WG7 B;  1Q82 W;  3A0R A;  1IXM A;  4RQF A;  4PA9 A;  3MHH C;  4P2Z A;  3JD3 A;  2BOC C;  1NH2 D;  1BMF G;  2ZDI C;  3W7U A;  2EIK B;  4TT3 G;  3CCL V;  2JEX A;  1ARO P;  4PDM A;  1QR9 A;  1FXK A;  3W7S A;  2HVJ C;  4ZBM A;  5KA6 A;  1QVG U;  1K9M W;  1K73 W;  1H8E G;  3SYP A;  4EKW A;  2XAS A;  3P30 A;  2X6A A;  4X8A A;  3CCV V;  1NR1 A;  2ZDI A;  3STZ C;  4HYO A;  1F23 A;  2LFR A;  1V54 C;  4WFA V;  2Y48 A;  1FXK B;  2UXX A;  5LGT A;  1NR7 A;  1M56 C;  1M56 B;  4X89 A;  1PNK A;  1P7B A;  4QNH B;  3D36 A;  4UVC A;  4FK5 C;  4PDR A;  3SPH A;  1AR1 B;  3CP1 A;  3ETE A;  1V54 B;  5H9C A;  2XAJ A;  4UV9 A;  3OEE G;  2Z3Y A;  2DWD C;  2WLI B;  3CC2 V;  5HFL A;  4GX2 A;  2ATK C;  3E8B A;  2A79 B;  2B5U A;  2YEV A;  3ZRS A;  2QE7 G;  5B3S B;  3JD2 A;  3MD0 A;  2OTJ V;  1DF5 A;  4FIP C;  1PL0 A;  3E86 A;  2P90 A;  2EIL C;  1UJW B;  3ZN0 A;  1Q86 W;  3UKM A;  1M57 C;  2IU0 A;  1KQS U;  3FYE B;  4MW3 A;  1E79 G;  1YTF C;  5C93 A;  3K08 A;  3GWO A;  3ASN B;  4MTG A;  1XL6 A;  5B1O A;  1JVM A;  4BAY A;  1ZWI C;  4Z1M G;  1YIT V;  2ZQM A;  1WPX A;  1R6K A;  4DO2 A;  3T4D A;  4I9W A;  1VQP V;  1K34 A;  3JD0 A;  3NXS A;  1EBO A;  3ABU A;  2P67 A;  1VQ7 V;  1F4N A;  2JK5 C;  3OW2 U;  3ZMZ A;  1KEC A;  3ABM B;  1GMG A;  3ZMS A;  4OXS A;  5LGU A;  3X2Q C;  3ZRW B;  1OCZ B;  5CN0 A;  4JAU A;  2ZR2 A;  3OMI B;  5IY5 C;  1K5S A;  3LUT B;  3WFV A;  1VQK V;  1Y66 A;  2DYR C;  3ZMU A;  3E8H A;  3OEH G;  1J95 A;  4GX0 A;  1JCH A;  1H2G A;  2P7T C;  1JX9 A;  3ABL C;  3ABK C;  3B8N A;  4JTD B;  4PEL A;  1EFR G;  5J9P C;  1KP3 A;  1GO3 F;  2HKO A;  4MVU A;  3UM7 A;  3ZRW A;  2C2A A;  3K0D A;  3B77 A;  4WF9 V;  3ZMT A;  5B1A C;  2QM7 A;  4GX5 A;  3SPI A;  4JTC B;  2V7Q G;  2Z5U A;  1F51 A;  4MVR A;  2K1E A;  2EIK C;  2EIN C;  4R50 A;  4PA6 A;  2WLI A;  1NBM G;  2X7R B;  2MK3 A;  4R7C A;  1K4C C;  1GM8 A;  1QLE B;  1NKD A;  1NJI W;  3P32 A;  5CBH A;  1QLE C;  1H8H G;  2KB1 A;  3SJQ C;  2JIZ G;  3LSS A;  1OHH G;  2JJ1 G;  2WLH A;  2HVK C;  3JYC A;  2PI5 A;  1I5Y A;  2YSU B;  4UVA A;  1YSC A;  1S72 V;  1VQM V;  5IYB O;  1TUE B;  3ASN C;  1FXK C;  3IGA C;  3AEI A;  5EC2 C;  5CBG A;  5H6Q A;  1XL4 A;  4MTO A;  2BOB C;  5LBQ A;  3STL C;  3F7V C;  2IH3 C;  4P9P A;  3ZJZ A;  3SYA A;  2P6J A;  4U7N A;  3F5W C;  2GHY A;  2XAF A;  2XAH A;  1YJ9 V;  5LHI A;  2IW5 A;  4GX1 A;  4P9O A;  4WCE V;  3ZRX A;  1ENV A;  5EBM C;  3H01 A;  2JJ2 G;  4N21 A;  2DW4 A;  4ZKI A;  5L3C A;  4RUF A;  1NVP D;  2Q68 A;  3CCJ V;  5LHH A;  1JOY A;  2IJJ A;  2IU3 A;  2D3O W;  2PI4 A;  2QM8 A;  5EBL C;  2EIM B;  1F4M A;  3SYO A;  1E1R G;  3OE7 G;  2A9H A;  2GSM B;  1W0J G;  4UXN A;  3OM3 B;  1E1Q G;  2HR3 A;  2NLJ C;  2XAG A;  3K03 A;  3B8M A;  3CCR V;  2JDI G;  1RM1 C;  3CPW U;  3CCE V;  3HB3 B;  1CEZ A;  3FB6 C;  2ZR3 A;  4RAI A;  1W2B U;  3GB7 C;  2HG5 C;  3HPL C;  1BHA A;  2IJH A;  1S77 D;  2HFE C;  2NNU A;  3E35 A;  1BHB A;  4PA7 A;  1GTO A;  3K3W A;  4R8C A;  1VQ6 V;  2OCC C;  3TCU A;  1RPR A;  4QIW F;  3K9A A;  5B3S C;  1PNM A;  4WFB V;  5IYD O;  2V1D A;  3LSQ A;  2QKS A;  3AG1 B;  3FB5 C;  3OMN B;  1K3E A;  2W6I G;  2EIN B;  1FS0 G;  4WFF A;  4KP4 A;  4JGS A;  2LP7 A;  2XOK G;  3EHB B;  4I5S A;  1FFT B;  4YXW G;  2YEV B;  1KKD A;  1Q7Y W;  2HLD G;  3ETG A;  1SZT A;  5FL7 G;  1RPO A;  4TWK A;  3T4Z A;  4LBE C;  3TK1 A;  1YHQ V;  3JD1 A;  1R6N A;  3G4S V;  4H37 A;  4N23 A;  3K04 A;  3FKS G;  2EIJ B;  4BIU A;  1K33 A;  1M57 B;  5DM6 V;  2Y69 C;  5B1B C;  1K7D A;  3I55 V;  1VQ4 V;  5KUK A;  1AI6 A;  2WLL B;  2WSS G;  4LC1 A;  2EJR A;  3OMA B;  3CD6 V;  1K97 A;  1AJP A;  1M9N A;  3OAA G;  3DGE A;  4FMT A;  3CC7 V;  1MOF A;  3VBB A;  5IYC O;  3OFN G;  1QR8 A;  1QVF U;  1GKF A;  2Q69 A;  5HFM A;  3W7T A;  3WG7 C;  2EZP A;  3CCU V;  2ITC C;  4X88 A;  2Q6A A;  2Q67 A;  2B1I A;  4HAM A;  4QE9 A;  2QTO A;  2EZO A;  2ITD C;  4RO2 A;  2X0L A;  4JTA B;  2B1G A;  5LHG A;  2H8P C;  5DN6 G;  4JYB A;  4CZZ A;  2DQ3 A;  3ZCC A;  2ZD9 A;  2LFS A;  4FJC C;  1NH2 C;  4UVB A;  3T1C A;  1G4Y B;  4J9Z B;  5IY5 B;  1K4D C;  4QPK A;  1SER A;  1KP2 A;  3SPG A;  4MSW C;  1OCR B;  1THZ A;  4LP8 A;  3CCM V;  1GM9 A;  1VQ8 V;  1ORQ C;  1JJ2 U;  2WLM A;  2IJK A;  1AI7 A;  1I5X A;  1ROP A;  1OZ0 A;  4UV8 A;  1OCZ C;  5E1A C;  4XBF A;  1Q81 W;  1OCC C;  3RW0 A;  3SPJ A;  4QJF B;  3CMA V;  2IH1 C;  3AG1 C;  1HWY A;  1DF4 A;  4R6Z A;  3ZIA G;  2R9I A;  4P30 A;  4LCU C;  1YIJ V;  5B1N A;  3ABM C;  4QE7 A;  4FPP A;  3AG3 C;  1OCO C;  1M1K W;  3FB8 C;  2WWW A;  3AG4 B;  2XAQ A;  2HJF C;  1GM7 A;  1K92 A;  1R3K C;  5EBW C;  5B1A B;  3K79 A;  5L3D A;  1R3I C;  2EIJ C;  4WFE A;  4MVM A;  3JCZ A;  1QLN A;  2F43 G;  4DXW A;  5IDJ A;  3I56 V;  2Y69 B;  3ABK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...