1NH2D

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
104
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNSKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 104
sequence length 117
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2D01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1nh2D02
1YTFC 1NVPD 5IYDO 1RM1B 5IYBO 1NH2D 1YTFD 1NVPC 5IYCO 1RM1C 1NH2C
chains in the Genus database with same CATH superfamily
2QA4V 1NBMG 3F5TA 4DR2B 4DR6O 1FXKC 3JAKA 3LNNA 1FXKA 5EC1C 1K34A 4LCUC 4B3RO 4LP8A 1GMGA 5L3GA 4ZKIA 4GUNA 3JD0A 4FM1A 1SQFA 1Z2GA 4ABMA 4J42A 2P6JA 4L8JA 2JVDA 5E79Z 2JGUA 2YUAA 4DV4O 4K35A 3E8BA 1MMMA 4NVPA 3ASOC 2LGQA 3CXCU 2QR4A 3M99B 1W59A 1OCOC 2DQ0A 2BTQB 4UVCA 4UV8A 5LA6B 5J2TA 3JASB 1N33O 4FZ1A 4LF7O 4FM0A 1WJZA 4RUFA 3MHSC 3K0DA 3ETDA 1VQ7V 1NQTA 5IE9A 1VF6A 1PNKA 3T2MA 3B4SA 1GN4A 1SQVH 1TAEA 4JGSA 2X6BA 4JI3O 4LR3A 5B66Z 2Y69B 4DV1O 1I0HA 4MVOA 1WP8A 4OXSA 3C3SA 3T1CA 2DMXA 3ZHTA 5IYCO 3QNEA 1VQ6V 3X2QB 4X66B 4X1YB 4YJ3A 4UVBA 5ITZB 2PY5A 4I5SA 1W0JG 2P22C 1YJ9V 1BGYH 2Q6AA 3U0ZA 2BSKA 4BIUA 3OTFA 2RQ6A 3K58A 1S3JA 4OGQB 1QLNA 4XDLA 1KD1W 2IM9A 1Z5WA 2V1DA 2ZR2A 3A0RA 1K97A 1YZBA 4FLXA 1SZXA 5B5EZ 4NR1A 1AI5A 3FAVA 1BHBA 3BA8A 3TCUA 5IYZB 4FVMA 1PV0A 2QWNB 1NH2C 1R6NA 4JV5O 1M90W 3FKSG 2UUCB 1YF2A 5H2FZ 3SPIA 3CCEV 1N32B 3SPJA 5KA5A 4OX9B 5EBLC 2BOBC 4HAMA 5L3EA 2P90A 1HR0B 3CXHF 4JI0B 4I55A 3SR2C 2QE7G 4MTOA 2LFRA 4DK0A 2WLLB 3FFQA 3OFNG 2UXXA 4X1KB 1ZX3A 2RN9A 3N2KB 5A9GA 2YXLA 5LMNO 4TUYA 2Y69C 2MK3A 2QM8A 1M56C 2PGGA 1DK1A 3WFVA 3WB0A 4DV6B 4MVRA 3G6EV 4QPJA 4PDRA 2GTAA 4XDKA 2QWPB 1NJIW 2Q7HA 1VQPV 2ODMA 1PL4A 3H01A 2Q5ZA 3W7WA 3KZIZ 2ZKOA 3SYQA 1VEWA 4LWSB 3APQA 1AP5A 1HNXB 2UUBO 5LL6Y 4B3SB 3DGEA 1RM1B 4P2ZA 4HZ3A 4QE7A 3ZRXA 2DYRC 4GKJB 3AK3A 3OGIB 3RYFA 4TV9A 1XNQB 4QGPA 4UCSA 4GKKB 4FLUA 3CCQV 4IT5A 3OT7A 1ENVA 3LDCA 4JPRA 1NKDA 1MSDA 5JVDB 4JI5B 5B1OA 2EILC 4PDLA 2EJ7A 3ZHQA 3D3QA 4JI1B 1M1KW 5CN0A 1P7BA 4TQDA 5EYPB 4F6RB 2RCVA 3JARA 2Q4PA 4WBNA 1QR9A 3NXSA 4X64B 3HKEA 2L35A 2H94A 3JSNA 4YJ2A 2R9RB 3QO5A 1NVPB 3K5OA 3G67A 4WFGA 5EC2C 5LHHA 4JZ2A 1JOYA 2P5OA 2WSSG 3CCLV 4LF9B 1JA8A 3SJBC 2E74B 2CGOA 3CJHA 1OCRC 2P4VA 4I50A 4LFCB 5B3SB 2HJDA 2QWRB 4IL6Z 1YHQV 4O4HB 3TXQA 3FB6C 2KKWA 4DV2B 1VF5B 1AP6A 1YTFB 1WPBA 5BR8B 3ZN1A 2R9IA 5FNVA 5FL7G 4B3MO 4X62B 2YEVA 1QNMA 3SDLA 3FX7A 2WA4A 2CH7A 1Q82W 4EB6A 4DRXA 1MZFA 4NXMO 5EBWC 1F4MA 2HFEC 1PP9H 2CTWA 5IY5B 4DUZO 2AHYA 2VRZA 3AEIA 3Q4HA 2HVJC 4IHJA 5IDJA 3K3WA 5KX5B 4UV9A 3UO2A 4MVQA 2GV9A 2KG7B 4H33A 5LGNA 4DW0A 5H6RA 2DYSB 4JI8O 3ABTA 1N0NA 4X20B 3RYCA 1IDSA 4O2AA 2FKXA 4QE9A 4WFHA 4DV5B 2Q68A 3UO3A 1RFYA 1P49A 1CP9A 1P7GA 4DR3B 2Q7EA 1E1RG 4R8CA 3ZMTA 4DV0O 3VBBA 1PPJH 2M7WA 2ZINA 1SA0A 4KXRA 3K03A 4CC6A 3CC2V 2YIBA 4B3TO 1XREA 3E89A 4FZ0A 1HNWO 1QBZA 1YTFC 1K92A 1F4NA 1JVMA 5IWAO 5CBFA 2HHHO 3MDSA 3OTOB 4X9QA 2D3OW 5CBHA 1FFXB 4ZI7B 3QO8A 4O4IB 4LNUB 5TISZ 4DUYB 4ASUG 3P3PA 3PN1A 1LUWA 2E75B 3E8FA 1QVGU 3AG3B 1Q43A 2ZIMA 2QSAA 4Z2WA 1CXZB 1OCCB 1G4YB 3BFRA 3ZBHA 2AHZA 5IJ0A 1IBLB 2ZR3A 1DF4A 1K5SA 4JYBA 2EULA 1I94O 1H38A 3TGUH 4A5UB 3HKBB 5EIBD 3IGAC 4G2KA 3SPCA 3CCMV 2UUAO 3O65A 4ZHQB 5LP6B 1WB8A 1NS1A 1LNQA 1R3KC 3IAYA 3CE2A 2HVKC 3HB3B 5LMUB 2CE4A 5C8YA 3OUFA 4NXNB 3T1YO 1SQQH 4WFAV 4LF5O 1PNLA 1J5EB 5JJJB 1Q3EA 3LNMB 5CA1A 2UXCB 4U3JB 2XOKG 1H2KA 1X59A 4FFBA 4JI2O 3P3NA 4LH6A 4FLVA 5CA0A 1N36O 4PA6A 1RP3B 2N04A 3CP1A 4UXNA 3ABMB 5LHIA 2F66C 4AHCA 4JYAB 5J2UB 4JZGA 1LR1A 3GWOA 1KB9F 2P7TC 4JYYA 1VQLV 3W7TA 2AGAA 2LJ2A 2PZSA 1TUBA 3SYOA 1XBLA 2DE0X 1GO3F 4I9WA 4E2LA 5FLXN 3U10A 1I5XA 1TUEB 3DSQA 1AILA 2EZOA 3HKDB 1GN3A 1XILA 2VQFO 1OCCC 4JI4O 3SPHA 2WWWA 1TVKB 1IBMB 1JQ0A 3UT5B 2A3QA 1AR5A 3K0GA 3HR0A 5B1AB 2ADPA 5JH7B 4DK1A 1DLBA 4AILC 3K57A 4JAVA 4UCUA 5LP6C 2L6LA 3B2EE 1OV9A 1Q81W 3RYIB 1YITV 1B6QA 4X1IA 4FLTA 1M57C 5BMVA 4B08A 1R6TA 4JI6O 4RQFA 4DV4B 2ZXWC 1EFRG 4J9YB 4I0XA 3WB2A 1Y4MA 2QKAA 3CMAV 2AXTZ 2DN9A 1Y74B 1S72V 4WFEA 2ZCEA 1THZA 3S3WA 3HKCA 4I4TB 3CRRA 5KMGA 4OPAA 1Q5OA 2WLIB 3QTCA 1EZJA 4JI3B 2QM7A 1EBOA 1TGOA 4DXWA 1W2BU 1DTOA 1KUQA 1RSOA 4DV1B 1AROP 1F7YA 1NU1H 1WAZA 1JX9A 4DR1O 3K04A 2BCCH 2IW5A 2OCCB 3JYCA 5LYJA 3FYEB 2UXBO 3T1HO 4J7JA 1KECA 1D5AA 5KAIZ 1N34O 1OCZC 1ROPA 5EZYB 2AZ0A 1LUVA 1YCIA 2LGWA 2IJKA 4JASA 4ZOLA 3SPGA 2RJZA 2Q67A 4O4LB 3BEHA 2W6IG 2XAJA 2XAGA 3IFXA 3AG4B 2ZQMA 3JCZA 4MVUA 4JV5B 3MAQA 5GONA 2VS0A 2EZPA 4O2BB 2BOCC 5KAFZ 4OPHA 3KG2A 4DR5O 4GT1A 3CSXA 4J41A 4GCZA 3ZS8C 5H9CA 2JDIG 4CC5A 2OCHA 1MABG 2RDCA 4MW3A 3BRCA 1J95A 4CH4A 3ASNB 1Q86W 3SYPA 3BVOA 1NTZH 2Q9LA 3CPWU 1K9MW 4O4JB 2Q0AA 2XUMA 3L71H 1R1BA 4LFBO 1OJHA 2NNUA 1NI8A 3WG7B 1JMKC 2ITCC 2VQEO 3CCVV 4BW5A 3RW0A 3ZMVA 3F5WC 4TUYB 2LW1A 2D2CB 3CCRV 3QF7A 3SJQC 3QG5A 3MHHC 4R6ZA 1NZ6A 1IX9A 1BE3H 3SYAA 1D2DA 4DR2O 4FLZA 2K1EA 1MA1A 4K8ZA 1FD9A 1L8DA 3RBZA 2QGNA 1US6A 4JTDB 1S77D 2EBOA 1F23A 5IJ9B 3JAWB 1K73W 3CRMA 2Y0IA 4TT3G 1AJQA 3IC9A 2GUZB 2LP7A 4LF6B 4H13B 2BTQA 2H8PC 1B3QA 1KKCA 2OIGA 3JASA 5KA6A 4CS4A 2JRIA 1L0LH 3K59A 2ZDIC 3SJCC 2ZDIA 4NB5A 1HDJA 5KHGA 2HJFC 3RYHB 2JGDB 3OR6C 5JQGB 4J9ZB 1GM9A 1I5YA 3ETQA 1GK9A 2IJJA 3ABLB 4YXWG 2QM4A 4Z1VA 3WG7C 3X2QC 3PJSK 4X1YA 5ITZA 4DR4B 4FK5C 3DC6A 5CBGA 3P32A 1S5JA 1BSMA 4UCVA 3QVNA 2Q73A 1ZWIC 1BZKA 4X66O 2BTOA 5J9PC 1AI6A 4Q6GA 1PL0A 3CHXA 2YDEA 2XNDG 2Z3YA 5IYZA 1L1FA 1NTKH 3E8GA 4J7KA 1V55B 3C3TA 4TV8B 1YSCA 1SETA 4NXMB 4GX5A 4JTAB 5B1BB 4YY3B 1JFFA 4DYLA 1YJWV 4DUZB 2CTQA 4C7UA 5AG2A 2WAMA 2WLNA 4ZBMA 1D5NA 1N32O 5KHJA 2QTOA 4OX9O 1WNSA 2WLLA 4X1KA 4JI8B 1QCEA 1WN7A 3N2KA 4AQYO 3I55V 4RQEA 5LOVA 4N21A 3EHBB 1QHTA 3H1LH 1FFTB 2CK3G 3I56V 1YVWA 3E8HA 3CRQA 3BY6A 4DV0B 3OE7G 3RN4A 4XDJA 2QWQB 3FD9A 4DV6O 4XBFA 4DV3B 2HKOA 3E86A 2AW9A 4LWSA 2PI4A 4B3TB 4DO2A 1XHXA 4BIOA 4WF9V 1HNWB 5KHIA 2M6YA 1RM1C 1AR1B 2Z0AA 2QTSA 3CX5F 3JD1A 5IWAB 1U97A 1KP3A 2K9PA 1XI1A 4PA9A 3JALB 4F6EA 3FB8C 5H6QA 1HNXO 1VQOV 2PYLA 1VIBA 1JJOA 5JVDA 1NH2D 1V55C 5F2VO 2ZE7A 2A06H 1AI4A 1QLEB 2P06A 4MSWC 4IYIA 3VOUA 5B1BC 3TETA 5EYPA 1BQ0A 4F6RA 5CB4A 2KB1A 1NR7A 4GX0A 2FL4A 3RVZA 1KYOF 5C93A 4JI5O 1H2MA 1AVMA 1I94B 1RPOA 4DV7B 2W0FC 2PYJA 4EKWA 4MTFA 1BCCH 4UB6Z 3CRAA 3OMNB 3ZJZA 5KUMA 3CS5A 2EINB 2UUAB 4LF8O 1GM7A 1WA8B 1XL4A 1ZL8B 1NVPC 4NTWA 2X6AA 4IYHA 3WB1A 3D36C 1YIJV 4X64O 1GAXA 3D36A 1MSWD 1Z5VA 1Q7YW 1YEWA 4RWUA 4LFAO 3LDEA 3VQXA 3T1YB 4R50A 3G71V 4BW9A 1FXHA 3R66A 4UCTA 4MVZA 5B3SC 2KQXA 3N27A 4HNAA 1V54B 2R9AA 1M9NA 2EIJB 4IIJB 4K8XA 4O4HA 4QIWF 5C8YB 4JI2B 2DW4A 3L9DA 1N36B 1XMOB 2FB5A 2YSUB 4MS2A 1EN6A 1XEQA 1XL6A 1NR1A 2OYQA 3L73H 4GYCB 1QVFU 1O9GA 3ZEDA 4TOIA 4DV2O 3ZHVA 2GBOA 5CA0B 3SJAC 4TWKA 1K8AW 5BR8O 3STZC 1R6KA 4X62O 5IY5C 4FLWA 1H2GA 2ITDC 2VQFB 4JI4B 1RPRA 2XHBA 5B1NA 1Y67A 5KX5A 1Y76A 5LXTA 4PHZA 4FPPA 2KG7A 2JJ2G 2ZIOA 2DYSC 2JK5C 1VARA 3UQ8A 4P30A 1VQNV 2O57A 3AG2B 1E79G 3E22B 4EFBA 2XT9A 4WCEV 4X20A 4LF4B 4KHPB 4HBNA 1T5EA 3CCJV 2F4VO 1BT8A 1XUQA 3K5MA 3ZRWB 1N0JA 1S5HC 1H8HG 1FS0G 2YI8A 3E35A 1B06A 1PM9A 4G28B 4ICGA 2XASA 3KCXA 5LBQA 4DR7B 1HNZB 3LUTB 3J81N 1KMIZ 4ZIBA 4CH5A 1R3JC 1DGSA 2WA3A 2XAHA 2EIJC 1B04A 3A0HZ 2PTMA 3WU2Z 4DR3O 3JATB 4D7TA 4CH3A 3ABKB 1M93A 2EIKB 2R70A 2JEUA 1ZAUA 4ZI7A 1YXBA 4O4IA 3DXRB 4LNUA 1AI7A 1XNRO 4TQFA 4H37A 3AG3C 3RGBA 5KLVH 3H1KH 4WFBV 4UCRA 4UVAA 3AG1B 1JPXA 4WFFA 4QPKA 1SQPH 4YHHO 1SESA 2ADQB 4DUYO 2FYUH 1Q6UA 4DR6B 1JR9A 3K9SA 2E76B 4DR1B 2DJVA 1S76D 2VWJA 3HKBA 3K08A 4B3RB 1CPYA 2RNBA 1SKVA 3TXSA 2UXBB 1N34B 4ZHQA 5LP6A 1IBLO 1WB7A 2LQTA 5JCOC 4CS2A 3JAKB 5JCOA 1FXKB 2YXHA 5EBMC 2F43G 3DC5A 3B09A 4MW8A 4J7ZA 1GRJA 2YXYA 3OM3B 1Y6XA 1KQSU 3JAMN 3VQWA 1YJNV 2MW2B 4J80A 3OMAB 5L3CA 3HPLC 5L3DA 4PA7A 3L74H 3K06A 2ZM6O 5LMUO 4U3JA 1DF5A 1BQZA 3L75H 2YIBD 1N33B 1Q90D 4LF7B 3ABMC 1S5LZ 4RUEA 3CMEV 3GB7C 3BCCH 1EM1A 4W4KA 1SQBH 3N2GA 1YTFD 3ASOB 5J2UA 1H8EG 1VQ4V 4UFZA 1J5EO 3RWRD 1ORQC 2UU9O 3I5DA 5HFMA 4RO2A 1N8RW 1HP8A 1OCOB 5J2TB 3G80A 1K4DC 5JWPA 3K5LA 3W7XA 4W4LA 2LFSA 3OW2U 4I7ZB 5H5NA 1AB3A 1ZSPA 4EEQA 1UJWB 3OEHG 1A32A 4JYAO 1IBKO 1K3EA 3BPZA 3AG1C 2YICA 2YC0A 3B8MA 5DECA 4FFKA 3HKDA 4MTXA 2IH1C 1GH6A 1EZVH 1TVKA 3THOA 3UT5A 4LFBB 2GDSA 5B1AC 1XMQO 4PI2A 5JH7A 2VQEB 1G6UA 3UM7A 2XAFA 2CAZC 3UKMA 3DTUB 2ZD9A 5LGUA 3FB5C 1SS3A 1IBMO 4MT8A 4JI7O 1FJGO 3RYIA 2A9HA 3CEIA 2E5LO 4YJ3B 1GTOA 2WLKA 1WLEA 1EN4A 3UCSC 1U96A 4B7EA 3W7UA 3FB7C 3W7SA 2BSKB 3CCSV 1ZUQA 2A7WA 4K0KO 4X89A 5BXZA 4KP4A 3JSLA 3K79A 5L3FA 3SGIA 3FAVB 2FMLA 1E1QG 3APOA 3ZMZA 3ZRSA 2RMKB 3S3XA 1NH2B 1Y74A 3L72H 4J10A 3C90A 4I4TA 5HFLA 2WLIA 2B1GA 2JEXA 2C2AA 2Y0PA 3H1IH 3P30A 3ETGA 1SZTA 3D3IA 4CH6A 5LMNB 2QJ1A 1VF6C 2DWEC 2F95B 2YS8A 4E4EA 1I7FA 2UXNA 4I55B 3H1HH 3CWBH 4UUJC 4F4LA 2JS5A 5DM6V 5IYDO 2PUSA 4L87A 2OCCC 4PI0A 4X65O 1YI2V 1H2SB 2P67A 3U11A 2EX3A 1MNGA 3ZMSA 5KHHA 4D7SA 1M56B 3OUSA 5LGTA 2HEPA 4U7OA 3SYCA 2UXDO 5EZYA 3CRCA 2W0XA 2UUBB 4LH7A 1Q6IA 3BAAA 1S0VA 3A0BZ 4PDMA 3B8NA 2W6JG 2NR5A 1KC8W 4P9OA 4O4LA 2Y48A 3KKYA 3AG4C 1P4RA 3RFRA 1QR8A 2WLMA 1SRYA 3A8TA 2B1IA 1FKAO 5LA6A 4O2BA 2EIMB 3RYFB 4TV9B 2DYRB 1W0KG 3OGCC 4JTCB 4J11A 2CTPA 3JD3A 2NN4A 3LSUA 3LDDA 1SF9A 2EILB 2CDYA 4HYOA 5E1AC 1SERA 3ASNC 1ZTEA 3M7MX 4PELA 2H3OA 2Y4TA 3OR7C 1JFFB 1R3LC 1FYJA 3JARB 4N23A 4AQYB 4O4JA 2DWDC 4B7KA 4WBNB 1KU9A 1VF7A 3LSSA 1JCHA 3HKEB 1AJPA 1G1XB 4YJ2B 2IBZH 1R73A 5LOVB 2QKSA 4CZZA 1BHAA 1P84F 1KKDA 2DQ3A 3K9AA 1WP7A 4H0LB 2OTJV 3G4SV 3RT3C 2X6CA 2WPDG 4B3MB 2FTKA 3VQYA 1AR4A 3CJHB 4I50B 5IJ9A 1V9PA 1OCRB 3JAWA 3CC4V 2E3CA 2ZE8A 3TJTA 4JAAA 5GTIZ 2XTAA 4FJCC 4BR6A 2GUZA 1Q8IA 3ETEA 1Q6HA 1VQKV 3OEEG 2EIMC 2YIDA 3JCUZ 3JD2A 2NLJC 5FNVB 2YEVB 3LSQA 4H44B 1BL8A 3ZX6A 2R72A 2UUCO 5IYBO 2CH7B 2QEXV 4EB6B 1ZLZA 1I08A 3TK1A 4DRXB 4LF6O 3ZIAG 2G38A 3CC7V 2HR3A 5JJNB 4R7CA 2YI9A 2JIZG 2QWOB 5FPRA 5K1XA 1HR0O 5CB4B 3NR7A 3Q4HB 3OAAG 4IHJB 4JI0O 2IU3A 4LF8B 3RYHA 1FPOA 1NT2B 2JGDA 3ABLC 5JQGA 5EIBC 3BABA 3ZHSA 2JJ1G 4LFAB 2V7QG 2GHYA 4YIPA 3RYCB 4O2AB 3CD6V 1QU7A 4BIZA 4NKGB 5D5PA 3E83A 3ABUA 2YIAA 2GTSA 2ZE5A 4YIOA 1QQCA 1XHZA 1VQ9V 1SA0B 4FIPC 2HHHB 1N4CA 4DR4O 4HNAB 4MTGA 1K33A 2ZNIA 5IT9N 4PJ0Z 1SC5B 4IGGA 4B3SO 2ETNA 2BE3A 4BAYA 3GWKC 4TV8A 3MD0A 4GKJO 1XNQO 1VP7A 4GKKO 3J7AU 1M5IA 1COWG 3ZCCA 3H1JH 2F93B 3EVKA 1BMFG 1O9HA 3CYOA 2X7RB 2B5UA 4JI1O 2A79B 5CA3A 2IU0A 3AK1A 4YY3O 4CS3A 2QDOA 3A2FA 5IJ0B 3O9OA 1GN2A 4U3FH 3IC7A 3STLC 2ZE6A 1Y76B 1VQMV 1XQ8A 5LXTB 2F4VB 1X4TA 4G27B 2CTRA 4CBCA 3K5NA 5FPOA 2V4DA 1YDXA 3E2EA 1AJNA 2A0LA 5EK0A 2WLHA 1TA8A 2F1MA 2N05A 4LF5B 3CCUV 1KP2A 1PKXA 1F51A 4QNHB 1BS3A 3OMIB 3IJ4A 3F7YC 2PI5A 3JD4A 1VMGA 1IZ3A 4LF9O 3ZMUA 5BY1A 3EXAA 2LW7A 3AG7A 4PA4A 4LFCO 5CA1B 4DV3O 1HW7A 2Y4UA 3JALA 4FFBB 3T4ZA 4QJFB 2CGNA 1VQ5V 3F7VC 2WLJA 1H2NA 1R3IC 1XDCA 4K3AA 1QLEC 4AI8A 1XNRB 4FM2A 4UCOA 4I9QA 2X0LA 4GZRB 4PDVA 4YHHB 1TUBB 2ARHA 4D6TH 4NTYA 2LO1A 1IXMA 3AK2A 2ZT9B 3M8AA 4PD4F 1IVSA 2EINC 1FAFA 1K7DA 4MVSA 4P9PA 1OHHG 2JS3A 2F23A 4FLYA 2DOSA 1WA8A 1ZL8A 2Q0OC 4NTXA 4X8AA 2Z5UA 1GKFA 5KUKA 3FYIB 4DV7O 3B40A 4DW1A 4BWAA 4RAIA 4JI6B 4GX2A 3ZN0A 4DV5O 1L0NH 1V54C 4X1IB 2ZM6B 4IIJA 2AZ2A 2OWOA 5BMVB 2IJIA 1M57B 1Y66A 1SQXH 2OIEA 4PV1B 2ZXWB 2OTLV 1WPXA 4I0XB 2Q69A 4X88A 2UU9B 1FFXA 4KFMA 4FMTA 3ZRVA 4KUMA 4GLXA 5GTHZ 5KHKA 3ZHUA 3KCYA 1VQ8V 2GSMB 1NTMH 3ICXA 3VQVA 1XMOO 1GM8A 3OTOO 3N2GB 4LBEC 1IBKB 2QKCA 2ILMA 1OZ0A 3HKCB 4KL1A 5KMGB 3R65A 4LC1A 5JJEB 1HWYA 1G8MA 2EJRA 1XMQB 3ML0A 1JJ2U 1URFA 1IXBA 2N74A 3AG2C 5CMUA 3T1HB 5D5QA 3E22A 1RSOB 1CEZA 3G6BA 5DN6G 4U7NA 1K5QA 2Q8VA 4JI7B 1FJGB 5LYJB 1NVPD 2E5LB 3ZRWA 2HLDG 2PF4E 2OT5A 4JF3A 4Z1MG 4LF4O 1MG1A 1OCZB 4UB8Z 4KHPO 3ZHRA 2IH3C 4Q20A 3J80N 4GX1A 3T4DA 4K0KB 5BZBA 4EFEA 1K4CC 4JYCA 1UPGA 3BHPA 4NXNO 1XOUA 5DEDA 3JATA 4ZOLB 3ABKC 3B77A 3H9VA 4DR5B 1EN5A 4DR7O 4TSFG 1HNZO 1IURA 2IJHA 2EIKC 1SQGA 2UXCO 5GONB 3GVMA 3CB2A 1M4UA 2HP8A 4JAUA 1FXVA 1UFIA 1PNMA 2P4KA 3DXRA 2ZNJA 3D8CA 4PA3A 2Q7GA 3L70H 3OD4A 1PD3A 2HG5C 3EFFK 1GN6A 5K1PA 5LHGA 1KBHA 3RVYA 4NYKA 2CUGA 3QO7A 2ATKC 2XAQA 4X65B 4MVMA 2VWKA 1MZEA 2B9ZA 2KSDA 5L3BA 5GW7A 1MOFA 3BA9A 1H2LA 5A2QN 2UXDB
chains in the Genus database with same CATH topology
2QA4V 3FB8C 5H6QA 1NBMG 1R3LC 1VQOV 4WFAV 4N23A 1FXKC 1NH2D 1V55C 2DWDC 1AI4A 1FXKA 1QLEB 1PNLA 4MSWC 5EC1C 1K34A 4LCUC 3LNMB 3VOUA 3LSSA 1JCHA 2XOKG 5B1BC 4LP8A 1GMGA 3TETA 5L3GA 1AJPA 2KB1A 1NR7A 4ZKIA 4PA6A 4GX0A 3RVZA 3JD0A 3CP1A 4UXNA 3ABMB 1R73A 5C93A 5LHIA 3GWOA 1RPOA 2W0FC 2P7TC 2QKSA 4CZZA 2P6JA 4EKWA 4MTFA 1BHAA 1VQLV 3W7TA 1KKDA 3OMNB 2DQ3A 3K9AA 3ZJZA 5KUMA 3E8BA 3SYOA 2OTJV 2EINB 3ASOC 1GO3F 3CXCU 3G4SV 4I9WA 1GM7A 4E2LA 1XL4A 1NVPC 3M99B 2X6AA 1I5XA 1TUEB 1OCOC 2X6CA 2DQ0A 2WPDG 4UV8A 2FTKA 2EZOA 4UVCA 1YIJV 1OCCC 3D36A 1MSWD 1Q7YW 1OCRB 3SPHA 3LDEA 2WWWA 3CC4V 1JQ0A 4RUFA 3MHSC 4FJCC 3K0GA 3ETEA 4R50A 3G71V 3K0DA 3ETDA 1VQ7V 1NQTA 1VQKV 3OEEG 5B1AB 1FXHA 2EIMC 1PNKA 3JD2A 4MVZA 1DLBA 2NLJC 3T2MA 5B3SC 2YEVB 1V54B 3LSQA 1M9NA 2EIJB 1BL8A 4QIWF 4JAVA 4JGSA 2DW4A 2X6BA 5IYBO 2QEXV 1Q81W 2YSUB 3TK1A 4MS2A 1YITV 1B6QA 3ZIAG 2Y69B 1XL6A 1NR1A 4MVOA 3CC7V 4OXSA 1QVFU 1M57C 2HR3A 3T1CA 4R7CA 2JIZG 4RQFA 5IYCO 2ZXWC 3QNEA 1VQ6V 1EFRG 4TWKA 3OAAG 3X2QB 4J9YB 2IU3A 1K8AW 4UVBA 3ABLC 3STZC 4I5SA 1W0JG 1R6KA 5IY5C 1H2GA 1YJ9V 2Q6AA 4BIUA 2ITDC 2JJ1G 1Y4MA 1S3JA 3CMAV 1RPRA 2V7QG 2GHYA 1QLNA 4XDLA 5B1NA 1KD1W 2V1DA 2ZR2A 3A0RA 3CD6V 1K97A 1S72V 4WFEA 4FPPA 4BIZA 1THZA 2JJ2G 2DYSC 2JK5C 3E83A 3ABUA 4P30A 1VQNV 3AG2B 1E79G 1AI5A 1BHBA 2WLIB 4WCEV 3TCUA 1NH2C 1EZJA 1R6NA 1M90W 3FKSG 3CCJV 2QM7A 1VQ9V 1EBOA 3SPIA 4FIPC 3ZRWB 4DXWA 3CCEV 1S5HC 1H8HG 3SPJA 1FS0G 5KA5A 1W2BU 1DTOA 3E35A 4MTGA 1AROP 5EBLC 2BOBC 4G28B 1K33A 2XASA 4HAMA 5LBQA 1JX9A 5L3EA 2P90A 3K04A 4BAYA 3LUTB 2IW5A 2OCCB 3JYCA 3MD0A 1R3JC 3FYEB 2XAHA 2EIJC 2QE7G 1KECA 4MTOA 2LFRA 1OCZC 2WLLB 1ROPA 1COWG 3OFNG 2UXXA 3ZCCA 3ABKB 1BMFG 3CYOA 2X7RB 2Y69C 2B5UA 2MK3A 2QM8A 1M56C 2A79B 5CA3A 2IJKA 2EIKB 3WFVA 2JEUA 2IU0A 4MVRA 4JASA 3G6EV 3SPGA 2Q67A 4QPJA 4PDRA 3BEHA 1AI7A 2W6IG 2XAJA 2XAGA 3IFXA 3AG4B 4XDKA 4H37A 3AG3C 3IC7A 3STLC 1NJIW 2ZQMA 3JCZA 4MVUA 1VQPV 4WFBV 3H01A 1VQMV 3W7WA 4UVAA 3AG1B 2EZPA 3SYQA 2BOCC 1JPXA 4G27B 4WFFA 4QPKA 4CBCA 3KG2A 1SESA 3E2EA 1AJNA 4GT1A 2A0LA 4GCZA 5EK0A 2WLHA 5H9CA 2JDIG 3DGEA 1S76D 1RM1B 4P2ZA 4HZ3A 4QE7A 3CCUV 3ZRXA 1KP2A 2DYRC 3K08A 1MABG 1CPYA 1PKXA 1F51A 4QNHB 4MW3A 3OMIB 1J95A 3F7YC 3CCQV 2PI5A 3JD4A 3ASNB 1Q86W 1ENVA 3LDCA 4JPRA 1NKDA 3SYPA 3ZMUA 3CPWU 1K9MW 5B1OA 1FXKB 2EILC 4PDLA 5EBMC 2F43G 4PA4A 4MW8A 1M1KW 5CN0A 3T4ZA 1P7BA 3OM3B 4QJFB 2NNUA 1KQSU 1VQ5V 3F7VC 2WLJA 1YJNV 1R3IC 3WG7B 3OMAB 1QLEC 2ITCC 5L3CA 3CCVV 3HPLC 5L3DA 3RW0A 3ZMVA 4BW5A 3F5WC 4PA7A 3K06A 1QR9A 3CCRV 1DF5A 3NXSA 3SJQC 2X0LA 3MHHC 4R6ZA 2H94A 3SYAA 4PDVA 3ABMC 4RUEA 3CMEV 3GB7C 2K1EA 2R9RB 3ASOB 1YTFD 1H8EG 1VQ4V 1IXMA 3RBZA 3QO5A 1ORQC 1NVPB 4JTDB 1S77D 5HFMA 4RO2A 4WFGA 2EBOA 1N8RW 1OCOB 5EC2C 1F23A 1K4DC 2EINC 1K7DA 4MVSA 5LHHA 4P9PA 1K73W 3W7XA 1JOYA 1OHHG 2LFSA 4TT3G 3OW2U 1AJQA 2WSSG 1UJWB 2LP7A 3OEHG 4X8AA 3CCLV 2Z5UA 1K3EA 1GKFA 3AG1C 5KUKA 3FYIB 3B8MA 1OCRC 4MTXA 2H8PC 5B3SB 2IH1C 4RAIA 1YHQV 3FB6C 4GX2A 5KA6A 3ZN0A 5B1AC 1YTFB 3ZN1A 1V54C 2R9IA 5FL7G 3UM7A 2XAFA 2YEVA 3UKMA 3DTUB 2ZD9A 5LGUA 3FB5C 2IJIA 2ZDIC 1M57B 4MT8A 1Q82W 1Y66A 2ZDIA 2A9HA 2HJFC 2ZXWB 2OTLV 1GTOA 1WPXA 2WLKA 1WLEA 3OR6C 2Q69A 5EBWC 4J9ZB 1F4MA 4X88A 1GM9A 1I5YA 3W7UA 1GK9A 2HFEC 2IJJA 3ABLB 3FB7C 4KFMA 4YXWG 4FMTA 3ZRVA 4KUMA 3W7SA 5IY5B 2AHYA 3WG7C 3CCSV 3X2QC 3AEIA 1VQ8V 2GSMB 2HVJC 4X89A 5IDJA 3PJSK 3K3WA 4UV9A 1GM8A 4MVQA 4KP4A 4LBEC 3K79A 4H33A 1OZ0A 5L3FA 5LGNA 5H6RA 2DYSB 4FK5C 5CBGA 3ABTA 3P32A 3R65A 4LC1A 1E1QG 3ZMZA 3ZRSA 1HWYA 1G8MA 1ZWIC 2EJRA 1NH2B 4QE9A 4WFHA 3ML0A 1AI6A 5J9PC 1JJ2U 2Q68A 3AG2C 5CMUA 1PL0A 1CP9A 5HFLA 2XNDG 2WLIA 1CEZA 2B1GA 2JEXA 2Z3YA 1L1FA 5DN6G 2C2AA 4U7NA 3P30A 3ETGA 1K5QA 3E8GA 1E1RG 1SZTA 3D3IA 4R8CA 3ZMTA 3VBBA 2M7WA 1V55B 2DWEC 1NVPD 3ZRWA 3K03A 2HLDG 1YSCA 1SETA 2UXNA 4GX5A 4UUJC 4F4LA 4JTAB 5DM6V 2OT5A 5B1BB 5IYDO 3CC2V 3E89A 4JF3A 4Z1MG 1YJWV 1MG1A 1OCZB 4L87A 1QBZA 2IH3C 4Q20A 2OCCC 1YTFC 1YI2V 4GX1A 1K92A 3T4DA 2P67A 5BZBA 1F4NA 1JVMA 5CBFA 2WAMA 1K4CC 2WLNA 4ZBMA 4JYCA 3ZMSA 2QTOA 1M56B 3OUSA 5CBHA 5LGTA 2D3OW 2WLLA 4U7OA 3SYCA 3QO8A 3ABKC 3B77A 1QCEA 4ASUG 3I55V 4RQEA 4TSFG 4N21A 1S0VA 2IJHA 3EHBB 2EIKC 1QVGU 3E8FA 3AG3B 4PDMA 3B8NA 2W6JG 4JAUA 1FXVA 1FFTB 2CK3G 1KC8W 4P9OA 1PNMA 1OCCB 1G4YB 2Y48A 3AG4C 4PA3A 2AHZA 3I56V 2ZR3A 1DF4A 1K5SA 1PD3A 1P4RA 1QR8A 4JYBA 3E8HA 2WLMA 1SRYA 2HG5C 3BY6A 3EFFK 1H38A 2B1IA 5LHGA 3OE7G 4XDJA 3RVYA 2EIMB 3QO7A 3IGAC 4G2KA 4XBFA 2DYRB 1W0KG 2HKOA 3OGCC 3SPCA 3E86A 2PI4A 4JTCB 3CCMV 3JD3A 4DO2A 1LNQA 2ATKC 2XAQA 4WF9V 1RM1C 1R3KC 3LDDA 1AR1B 4MVMA 2HVKC 5L3BA 5GW7A 3JD1A 1MOFA 3HB3B 1KP3A 2EILB 4HYOA 5E1AC 1SERA 3ASNC 4PA9A 4PELA 3OUFA 3OR7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF C;  1NVP D;  5IYD O;  1RM1 B;  5IYB O;  1NH2 D;  1YTF D;  1NVP C;  5IYC O;  1RM1 C;  1NH2 C; 
#chains in the Genus database with same CATH topology
 2QA4 V;  1NBM G;  3F5T A;  4DR2 B;  4DR6 O;  1FXK C;  3JAK A;  3LNN A;  1FXK A;  5EC1 C;  1K34 A;  4LCU C;  4B3R O;  4LP8 A;  1GMG A;  5L3G A;  4ZKI A;  4GUN A;  3JD0 A;  4FM1 A;  1SQF A;  1Z2G A;  4ABM A;  4J42 A;  2P6J A;  4L8J A;  2JVD A;  5E79 Z;  2JGU A;  2YUA A;  4DV4 O;  4K35 A;  3E8B A;  1MMM A;  4NVP A;  3ASO C;  2LGQ A;  3CXC U;  2QR4 A;  3M99 B;  1W59 A;  1OCO C;  2DQ0 A;  2BTQ B;  4UVC A;  4UV8 A;  5LA6 B;  5J2T A;  3JAS B;  1N33 O;  4FZ1 A;  4LF7 O;  4FM0 A;  1WJZ A;  4RUF A;  3MHS C;  3K0D A;  3ETD A;  1VQ7 V;  1NQT A;  5IE9 A;  1VF6 A;  1PNK A;  3T2M A;  3B4S A;  1GN4 A;  1SQV H;  1TAE A;  4JGS A;  2X6B A;  4JI3 O;  4LR3 A;  5B66 Z;  2Y69 B;  4DV1 O;  1I0H A;  4MVO A;  1WP8 A;  4OXS A;  3C3S A;  3T1C A;  2DMX A;  3ZHT A;  5IYC O;  3QNE A;  1VQ6 V;  3X2Q B;  4X66 B;  4X1Y B;  4YJ3 A;  4UVB A;  5ITZ B;  2PY5 A;  4I5S A;  1W0J G;  2P22 C;  1YJ9 V;  1BGY H;  2Q6A A;  3U0Z A;  2BSK A;  4BIU A;  3OTF A;  2RQ6 A;  3K58 A;  1S3J A;  4OGQ B;  1QLN A;  4XDL A;  1KD1 W;  2IM9 A;  1Z5W A;  2V1D A;  2ZR2 A;  3A0R A;  1K97 A;  1YZB A;  4FLX A;  1SZX A;  5B5E Z;  4NR1 A;  1AI5 A;  3FAV A;  1BHB A;  3BA8 A;  3TCU A;  5IYZ B;  4FVM A;  1PV0 A;  2QWN B;  1NH2 C;  1R6N A;  4JV5 O;  1M90 W;  3FKS G;  2UUC B;  1YF2 A;  5H2F Z;  3SPI A;  3CCE V;  1N32 B;  3SPJ A;  5KA5 A;  4OX9 B;  5EBL C;  2BOB C;  4HAM A;  5L3E A;  2P90 A;  1HR0 B;  3CXH F;  4JI0 B;  4I55 A;  3SR2 C;  2QE7 G;  4MTO A;  2LFR A;  4DK0 A;  2WLL B;  3FFQ A;  3OFN G;  2UXX A;  4X1K B;  1ZX3 A;  2RN9 A;  3N2K B;  5A9G A;  2YXL A;  5LMN O;  4TUY A;  2Y69 C;  2MK3 A;  2QM8 A;  1M56 C;  2PGG A;  1DK1 A;  3WFV A;  3WB0 A;  4DV6 B;  4MVR A;  3G6E V;  4QPJ A;  4PDR A;  2GTA A;  4XDK A;  2QWP B;  1NJI W;  2Q7H A;  1VQP V;  2ODM A;  1PL4 A;  3H01 A;  2Q5Z A;  3W7W A;  3KZI Z;  2ZKO A;  3SYQ A;  1VEW A;  4LWS B;  3APQ A;  1AP5 A;  1HNX B;  2UUB O;  5LL6 Y;  4B3S B;  3DGE A;  1RM1 B;  4P2Z A;  4HZ3 A;  4QE7 A;  3ZRX A;  2DYR C;  4GKJ B;  3AK3 A;  3OGI B;  3RYF A;  4TV9 A;  1XNQ B;  4QGP A;  4UCS A;  4GKK B;  4FLU A;  3CCQ V;  4IT5 A;  3OT7 A;  1ENV A;  3LDC A;  4JPR A;  1NKD A;  1MSD A;  5JVD B;  4JI5 B;  5B1O A;  2EIL C;  4PDL A;  2EJ7 A;  3ZHQ A;  3D3Q A;  4JI1 B;  1M1K W;  5CN0 A;  1P7B A;  4TQD A;  5EYP B;  4F6R B;  2RCV A;  3JAR A;  2Q4P A;  4WBN A;  1QR9 A;  3NXS A;  4X64 B;  3HKE A;  2L35 A;  2H94 A;  3JSN A;  4YJ2 A;  2R9R B;  3QO5 A;  1NVP B;  3K5O A;  3G67 A;  4WFG A;  5EC2 C;  5LHH A;  4JZ2 A;  1JOY A;  2P5O A;  2WSS G;  3CCL V;  4LF9 B;  1JA8 A;  3SJB C;  2E74 B;  2CGO A;  3CJH A;  1OCR C;  2P4V A;  4I50 A;  4LFC B;  5B3S B;  2HJD A;  2QWR B;  4IL6 Z;  1YHQ V;  4O4H B;  3TXQ A;  3FB6 C;  2KKW A;  4DV2 B;  1VF5 B;  1AP6 A;  1YTF B;  1WPB A;  5BR8 B;  3ZN1 A;  2R9I A;  5FNV A;  5FL7 G;  4B3M O;  4X62 B;  2YEV A;  1QNM A;  3SDL A;  3FX7 A;  2WA4 A;  2CH7 A;  1Q82 W;  4EB6 A;  4DRX A;  1MZF A;  4NXM O;  5EBW C;  1F4M A;  2HFE C;  1PP9 H;  2CTW A;  5IY5 B;  4DUZ O;  2AHY A;  2VRZ A;  3AEI A;  3Q4H A;  2HVJ C;  4IHJ A;  5IDJ A;  3K3W A;  5KX5 B;  4UV9 A;  3UO2 A;  4MVQ A;  2GV9 A;  2KG7 B;  4H33 A;  5LGN A;  4DW0 A;  5H6R A;  2DYS B;  4JI8 O;  3ABT A;  1N0N A;  4X20 B;  3RYC A;  1IDS A;  4O2A A;  2FKX A;  4QE9 A;  4WFH A;  4DV5 B;  2Q68 A;  3UO3 A;  1RFY A;  1P49 A;  1CP9 A;  1P7G A;  4DR3 B;  2Q7E A;  1E1R G;  4R8C A;  3ZMT A;  4DV0 O;  3VBB A;  1PPJ H;  2M7W A;  2ZIN A;  1SA0 A;  4KXR A;  3K03 A;  4CC6 A;  3CC2 V;  2YIB A;  4B3T O;  1XRE A;  3E89 A;  4FZ0 A;  1HNW O;  1QBZ A;  1YTF C;  1K92 A;  1F4N A;  1JVM A;  5IWA O;  5CBF A;  2HHH O;  3MDS A;  3OTO B;  4X9Q A;  2D3O W;  5CBH A;  1FFX B;  4ZI7 B;  3QO8 A;  4O4I B;  4LNU B;  5TIS Z;  4DUY B;  4ASU G;  3P3P A;  3PN1 A;  1LUW A;  2E75 B;  3E8F A;  1QVG U;  3AG3 B;  1Q43 A;  2ZIM A;  2QSA A;  4Z2W A;  1CXZ B;  1OCC B;  1G4Y B;  3BFR A;  3ZBH A;  2AHZ A;  5IJ0 A;  1IBL B;  2ZR3 A;  1DF4 A;  1K5S A;  4JYB A;  2EUL A;  1I94 O;  1H38 A;  3TGU H;  4A5U B;  3HKB B;  5EIB D;  3IGA C;  4G2K A;  3SPC A;  3CCM V;  2UUA O;  3O65 A;  4ZHQ B;  5LP6 B;  1WB8 A;  1NS1 A;  1LNQ A;  1R3K C;  3IAY A;  3CE2 A;  2HVK C;  3HB3 B;  5LMU B;  2CE4 A;  5C8Y A;  3OUF A;  4NXN B;  3T1Y O;  1SQQ H;  4WFA V;  4LF5 O;  1PNL A;  1J5E B;  5JJJ B;  1Q3E A;  3LNM B;  5CA1 A;  2UXC B;  4U3J B;  2XOK G;  1H2K A;  1X59 A;  4FFB A;  4JI2 O;  3P3N A;  4LH6 A;  4FLV A;  5CA0 A;  1N36 O;  4PA6 A;  1RP3 B;  2N04 A;  3CP1 A;  4UXN A;  3ABM B;  5LHI A;  2F66 C;  4AHC A;  4JYA B;  5J2U B;  4JZG A;  1LR1 A;  3GWO A;  1KB9 F;  2P7T C;  4JYY A;  1VQL V;  3W7T A;  2AGA A;  2LJ2 A;  2PZS A;  1TUB A;  3SYO A;  1XBL A;  2DE0 X;  1GO3 F;  4I9W A;  4E2L A;  5FLX N;  3U10 A;  1I5X A;  1TUE B;  3DSQ A;  1AIL A;  2EZO A;  3HKD B;  1GN3 A;  1XIL A;  2VQF O;  1OCC C;  4JI4 O;  3SPH A;  2WWW A;  1TVK B;  1IBM B;  1JQ0 A;  3UT5 B;  2A3Q A;  1AR5 A;  3K0G A;  3HR0 A;  5B1A B;  2ADP A;  5JH7 B;  4DK1 A;  1DLB A;  4AIL C;  3K57 A;  4JAV A;  4UCU A;  5LP6 C;  2L6L A;  3B2E E;  1OV9 A;  1Q81 W;  3RYI B;  1YIT V;  1B6Q A;  4X1I A;  4FLT A;  1M57 C;  5BMV A;  4B08 A;  1R6T A;  4JI6 O;  4RQF A;  4DV4 B;  2ZXW C;  1EFR G;  4J9Y B;  4I0X A;  3WB2 A;  1Y4M A;  2QKA A;  3CMA V;  2AXT Z;  2DN9 A;  1Y74 B;  1S72 V;  4WFE A;  2ZCE A;  1THZ A;  3S3W A;  3HKC A;  4I4T B;  3CRR A;  5KMG A;  4OPA A;  1Q5O A;  2WLI B;  3QTC A;  1EZJ A;  4JI3 B;  2QM7 A;  1EBO A;  1TGO A;  4DXW A;  1W2B U;  1DTO A;  1KUQ A;  1RSO A;  4DV1 B;  1ARO P;  1F7Y A;  1NU1 H;  1WAZ A;  1JX9 A;  4DR1 O;  3K04 A;  2BCC H;  2IW5 A;  2OCC B;  3JYC A;  5LYJ A;  3FYE B;  2UXB O;  3T1H O;  4J7J A;  1KEC A;  1D5A A;  5KAI Z;  1N34 O;  1OCZ C;  1ROP A;  5EZY B;  2AZ0 A;  1LUV A;  1YCI A;  2LGW A;  2IJK A;  4JAS A;  4ZOL A;  3SPG A;  2RJZ A;  2Q67 A;  4O4L B;  3BEH A;  2W6I G;  2XAJ A;  2XAG A;  3IFX A;  3AG4 B;  2ZQM A;  3JCZ A;  4MVU A;  4JV5 B;  3MAQ A;  5GON A;  2VS0 A;  2EZP A;  4O2B B;  2BOC C;  5KAF Z;  4OPH A;  3KG2 A;  4DR5 O;  4GT1 A;  3CSX A;  4J41 A;  4GCZ A;  3ZS8 C;  5H9C A;  2JDI G;  4CC5 A;  2OCH A;  1MAB G;  2RDC A;  4MW3 A;  3BRC A;  1J95 A;  4CH4 A;  3ASN B;  1Q86 W;  3SYP A;  3BVO A;  1NTZ H;  2Q9L A;  3CPW U;  1K9M W;  4O4J B;  2Q0A A;  2XUM A;  3L71 H;  1R1B A;  4LFB O;  1OJH A;  2NNU A;  1NI8 A;  3WG7 B;  1JMK C;  2ITC C;  2VQE O;  3CCV V;  4BW5 A;  3RW0 A;  3ZMV A;  3F5W C;  4TUY B;  2LW1 A;  2D2C B;  3CCR V;  3QF7 A;  3SJQ C;  3QG5 A;  3MHH C;  4R6Z A;  1NZ6 A;  1IX9 A;  1BE3 H;  3SYA A;  1D2D A;  4DR2 O;  4FLZ A;  2K1E A;  1MA1 A;  4K8Z A;  1FD9 A;  1L8D A;  3RBZ A;  2QGN A;  1US6 A;  4JTD B;  1S77 D;  2EBO A;  1F23 A;  5IJ9 B;  3JAW B;  1K73 W;  3CRM A;  2Y0I A;  4TT3 G;  1AJQ A;  3IC9 A;  2GUZ B;  2LP7 A;  4LF6 B;  4H13 B;  2BTQ A;  2H8P C;  1B3Q A;  1KKC A;  2OIG A;  3JAS A;  5KA6 A;  4CS4 A;  2JRI A;  1L0L H;  3K59 A;  2ZDI C;  3SJC C;  2ZDI A;  4NB5 A;  1HDJ A;  5KHG A;  2HJF C;  3RYH B;  2JGD B;  3OR6 C;  5JQG B;  4J9Z B;  1GM9 A;  1I5Y A;  3ETQ A;  1GK9 A;  2IJJ A;  3ABL B;  4YXW G;  2QM4 A;  4Z1V A;  3WG7 C;  3X2Q C;  3PJS K;  4X1Y A;  5ITZ A;  4DR4 B;  4FK5 C;  3DC6 A;  5CBG A;  3P32 A;  1S5J A;  1BSM A;  4UCV A;  3QVN A;  2Q73 A;  1ZWI C;  1BZK A;  4X66 O;  2BTO A;  5J9P C;  1AI6 A;  4Q6G A;  1PL0 A;  3CHX A;  2YDE A;  2XND G;  2Z3Y A;  5IYZ A;  1L1F A;  1NTK H;  3E8G A;  4J7K A;  1V55 B;  3C3T A;  4TV8 B;  1YSC A;  1SET A;  4NXM B;  4GX5 A;  4JTA B;  5B1B B;  4YY3 B;  1JFF A;  4DYL A;  1YJW V;  4DUZ B;  2CTQ A;  4C7U A;  5AG2 A;  2WAM A;  2WLN A;  4ZBM A;  1D5N A;  1N32 O;  5KHJ A;  2QTO A;  4OX9 O;  1WNS A;  2WLL A;  4X1K A;  4JI8 B;  1QCE A;  1WN7 A;  3N2K A;  4AQY O;  3I55 V;  4RQE A;  5LOV A;  4N21 A;  3EHB B;  1QHT A;  3H1L H;  1FFT B;  2CK3 G;  3I56 V;  1YVW A;  3E8H A;  3CRQ A;  3BY6 A;  4DV0 B;  3OE7 G;  3RN4 A;  4XDJ A;  2QWQ B;  3FD9 A;  4DV6 O;  4XBF A;  4DV3 B;  2HKO A;  3E86 A;  2AW9 A;  4LWS A;  2PI4 A;  4B3T B;  4DO2 A;  1XHX A;  4BIO A;  4WF9 V;  1HNW B;  5KHI A;  2M6Y A;  1RM1 C;  1AR1 B;  2Z0A A;  2QTS A;  3CX5 F;  3JD1 A;  5IWA B;  1U97 A;  1KP3 A;  2K9P A;  1XI1 A;  4PA9 A;  3JAL B;  4F6E A;  3FB8 C;  5H6Q A;  1HNX O;  1VQO V;  2PYL A;  1VIB A;  1JJO A;  5JVD A;  1NH2 D;  1V55 C;  5F2V O;  2ZE7 A;  2A06 H;  1AI4 A;  1QLE B;  2P06 A;  4MSW C;  4IYI A;  3VOU A;  5B1B C;  3TET A;  5EYP A;  1BQ0 A;  4F6R A;  5CB4 A;  2KB1 A;  1NR7 A;  4GX0 A;  2FL4 A;  3RVZ A;  1KYO F;  5C93 A;  4JI5 O;  1H2M A;  1AVM A;  1I94 B;  1RPO A;  4DV7 B;  2W0F C;  2PYJ A;  4EKW A;  4MTF A;  1BCC H;  4UB6 Z;  3CRA A;  3OMN B;  3ZJZ A;  5KUM A;  3CS5 A;  2EIN B;  2UUA B;  4LF8 O;  1GM7 A;  1WA8 B;  1XL4 A;  1ZL8 B;  1NVP C;  4NTW A;  2X6A A;  4IYH A;  3WB1 A;  3D36 C;  1YIJ V;  4X64 O;  1GAX A;  3D36 A;  1MSW D;  1Z5V A;  1Q7Y W;  1YEW A;  4RWU A;  4LFA O;  3LDE A;  3VQX A;  3T1Y B;  4R50 A;  3G71 V;  4BW9 A;  1FXH A;  3R66 A;  4UCT A;  4MVZ A;  5B3S C;  2KQX A;  3N27 A;  4HNA A;  1V54 B;  2R9A A;  1M9N A;  2EIJ B;  4IIJ B;  4K8X A;  4O4H A;  4QIW F;  5C8Y B;  4JI2 B;  2DW4 A;  3L9D A;  1N36 B;  1XMO B;  2FB5 A;  2YSU B;  4MS2 A;  1EN6 A;  1XEQ A;  1XL6 A;  1NR1 A;  2OYQ A;  3L73 H;  4GYC B;  1QVF U;  1O9G A;  3ZED A;  4TOI A;  4DV2 O;  3ZHV A;  2GBO A;  5CA0 B;  3SJA C;  4TWK A;  1K8A W;  5BR8 O;  3STZ C;  1R6K A;  4X62 O;  5IY5 C;  4FLW A;  1H2G A;  2ITD C;  2VQF B;  4JI4 B;  1RPR A;  2XHB A;  5B1N A;  1Y67 A;  5KX5 A;  1Y76 A;  5LXT A;  4PHZ A;  4FPP A;  2KG7 A;  2JJ2 G;  2ZIO A;  2DYS C;  2JK5 C;  1VAR A;  3UQ8 A;  4P30 A;  1VQN V;  2O57 A;  3AG2 B;  1E79 G;  3E22 B;  4EFB A;  2XT9 A;  4WCE V;  4X20 A;  4LF4 B;  4KHP B;  4HBN A;  1T5E A;  3CCJ V;  2F4V O;  1BT8 A;  1XUQ A;  3K5M A;  3ZRW B;  1N0J A;  1S5H C;  1H8H G;  1FS0 G;  2YI8 A;  3E35 A;  1B06 A;  1PM9 A;  4G28 B;  4ICG A;  2XAS A;  3KCX A;  5LBQ A;  4DR7 B;  1HNZ B;  3LUT B;  3J81 N;  1KMI Z;  4ZIB A;  4CH5 A;  1R3J C;  1DGS A;  2WA3 A;  2XAH A;  2EIJ C;  1B04 A;  3A0H Z;  2PTM A;  3WU2 Z;  4DR3 O;  3JAT B;  4D7T A;  4CH3 A;  3ABK B;  1M93 A;  2EIK B;  2R70 A;  2JEU A;  1ZAU A;  4ZI7 A;  1YXB A;  4O4I A;  3DXR B;  4LNU A;  1AI7 A;  1XNR O;  4TQF A;  4H37 A;  3AG3 C;  3RGB A;  5KLV H;  3H1K H;  4WFB V;  4UCR A;  4UVA A;  3AG1 B;  1JPX A;  4WFF A;  4QPK A;  1SQP H;  4YHH O;  1SES A;  2ADQ B;  4DUY O;  2FYU H;  1Q6U A;  4DR6 B;  1JR9 A;  3K9S A;  2E76 B;  4DR1 B;  2DJV A;  1S76 D;  2VWJ A;  3HKB A;  3K08 A;  4B3R B;  1CPY A;  2RNB A;  1SKV A;  3TXS A;  2UXB B;  1N34 B;  4ZHQ A;  5LP6 A;  1IBL O;  1WB7 A;  2LQT A;  5JCO C;  4CS2 A;  3JAK B;  5JCO A;  1FXK B;  2YXH A;  5EBM C;  2F43 G;  3DC5 A;  3B09 A;  4MW8 A;  4J7Z A;  1GRJ A;  2YXY A;  3OM3 B;  1Y6X A;  1KQS U;  3JAM N;  3VQW A;  1YJN V;  2MW2 B;  4J80 A;  3OMA B;  5L3C A;  3HPL C;  5L3D A;  4PA7 A;  3L74 H;  3K06 A;  2ZM6 O;  5LMU O;  4U3J A;  1DF5 A;  1BQZ A;  3L75 H;  2YIB D;  1N33 B;  1Q90 D;  4LF7 B;  3ABM C;  1S5L Z;  4RUE A;  3CME V;  3GB7 C;  3BCC H;  1EM1 A;  4W4K A;  1SQB H;  3N2G A;  1YTF D;  3ASO B;  5J2U A;  1H8E G;  1VQ4 V;  4UFZ A;  1J5E O;  3RWR D;  1ORQ C;  2UU9 O;  3I5D A;  5HFM A;  4RO2 A;  1N8R W;  1HP8 A;  1OCO B;  5J2T B;  3G80 A;  1K4D C;  5JWP A;  3K5L A;  3W7X A;  4W4L A;  2LFS A;  3OW2 U;  4I7Z B;  5H5N A;  1AB3 A;  1ZSP A;  4EEQ A;  1UJW B;  3OEH G;  1A32 A;  4JYA O;  1IBK O;  1K3E A;  3BPZ A;  3AG1 C;  2YIC A;  2YC0 A;  3B8M A;  5DEC A;  4FFK A;  3HKD A;  4MTX A;  2IH1 C;  1GH6 A;  1EZV H;  1TVK A;  3THO A;  3UT5 A;  4LFB B;  2GDS A;  5B1A C;  1XMQ O;  4PI2 A;  5JH7 A;  2VQE B;  1G6U A;  3UM7 A;  2XAF A;  2CAZ C;  3UKM A;  3DTU B;  2ZD9 A;  5LGU A;  3FB5 C;  1SS3 A;  1IBM O;  4MT8 A;  4JI7 O;  1FJG O;  3RYI A;  2A9H A;  3CEI A;  2E5L O;  4YJ3 B;  1GTO A;  2WLK A;  1WLE A;  1EN4 A;  3UCS C;  1U96 A;  4B7E A;  3W7U A;  3FB7 C;  3W7S A;  2BSK B;  3CCS V;  1ZUQ A;  2A7W A;  4K0K O;  4X89 A;  5BXZ A;  4KP4 A;  3JSL A;  3K79 A;  5L3F A;  3SGI A;  3FAV B;  2FML A;  1E1Q G;  3APO A;  3ZMZ A;  3ZRS A;  2RMK B;  3S3X A;  1NH2 B;  1Y74 A;  3L72 H;  4J10 A;  3C90 A;  4I4T A;  5HFL A;  2WLI A;  2B1G A;  2JEX A;  2C2A A;  2Y0P A;  3H1I H;  3P30 A;  3ETG A;  1SZT A;  3D3I A;  4CH6 A;  5LMN B;  2QJ1 A;  1VF6 C;  2DWE C;  2F95 B;  2YS8 A;  4E4E A;  1I7F A;  2UXN A;  4I55 B;  3H1H H;  3CWB H;  4UUJ C;  4F4L A;  2JS5 A;  5DM6 V;  5IYD O;  2PUS A;  4L87 A;  2OCC C;  4PI0 A;  4X65 O;  1YI2 V;  1H2S B;  2P67 A;  3U11 A;  2EX3 A;  1MNG A;  3ZMS A;  5KHH A;  4D7S A;  1M56 B;  3OUS A;  5LGT A;  2HEP A;  4U7O A;  3SYC A;  2UXD O;  5EZY A;  3CRC A;  2W0X A;  2UUB B;  4LH7 A;  1Q6I A;  3BAA A;  1S0V A;  3A0B Z;  4PDM A;  3B8N A;  2W6J G;  2NR5 A;  1KC8 W;  4P9O A;  4O4L A;  2Y48 A;  3KKY A;  3AG4 C;  1P4R A;  3RFR A;  1QR8 A;  2WLM A;  1SRY A;  3A8T A;  2B1I A;  1FKA O;  5LA6 A;  4O2B A;  2EIM B;  3RYF B;  4TV9 B;  2DYR B;  1W0K G;  3OGC C;  4JTC B;  4J11 A;  2CTP A;  3JD3 A;  2NN4 A;  3LSU A;  3LDD A;  1SF9 A;  2EIL B;  2CDY A;  4HYO A;  5E1A C;  1SER A;  3ASN C;  1ZTE A;  3M7M X;  4PEL A;  2H3O A;  2Y4T A;  3OR7 C;  1JFF B;  1R3L C;  1FYJ A;  3JAR B;  4N23 A;  4AQY B;  4O4J A;  2DWD C;  4B7K A;  4WBN B;  1KU9 A;  1VF7 A;  3LSS A;  1JCH A;  3HKE B;  1AJP A;  1G1X B;  4YJ2 B;  2IBZ H;  1R73 A;  5LOV B;  2QKS A;  4CZZ A;  1BHA A;  1P84 F;  1KKD A;  2DQ3 A;  3K9A A;  1WP7 A;  4H0L B;  2OTJ V;  3G4S V;  3RT3 C;  2X6C A;  2WPD G;  4B3M B;  2FTK A;  3VQY A;  1AR4 A;  3CJH B;  4I50 B;  5IJ9 A;  1V9P A;  1OCR B;  3JAW A;  3CC4 V;  2E3C A;  2ZE8 A;  3TJT A;  4JAA A;  5GTI Z;  2XTA A;  4FJC C;  4BR6 A;  2GUZ A;  1Q8I A;  3ETE A;  1Q6H A;  1VQK V;  3OEE G;  2EIM C;  2YID A;  3JCU Z;  3JD2 A;  2NLJ C;  5FNV B;  2YEV B;  3LSQ A;  4H44 B;  1BL8 A;  3ZX6 A;  2R72 A;  2UUC O;  5IYB O;  2CH7 B;  2QEX V;  4EB6 B;  1ZLZ A;  1I08 A;  3TK1 A;  4DRX B;  4LF6 O;  3ZIA G;  2G38 A;  3CC7 V;  2HR3 A;  5JJN B;  4R7C A;  2YI9 A;  2JIZ G;  2QWO B;  5FPR A;  5K1X A;  1HR0 O;  5CB4 B;  3NR7 A;  3Q4H B;  3OAA G;  4IHJ B;  4JI0 O;  2IU3 A;  4LF8 B;  3RYH A;  1FPO A;  1NT2 B;  2JGD A;  3ABL C;  5JQG A;  5EIB C;  3BAB A;  3ZHS A;  2JJ1 G;  4LFA B;  2V7Q G;  2GHY A;  4YIP A;  3RYC B;  4O2A B;  3CD6 V;  1QU7 A;  4BIZ A;  4NKG B;  5D5P A;  3E83 A;  3ABU A;  2YIA A;  2GTS A;  2ZE5 A;  4YIO A;  1QQC A;  1XHZ A;  1VQ9 V;  1SA0 B;  4FIP C;  2HHH B;  1N4C A;  4DR4 O;  4HNA B;  4MTG A;  1K33 A;  2ZNI A;  5IT9 N;  4PJ0 Z;  1SC5 B;  4IGG A;  4B3S O;  2ETN A;  2BE3 A;  4BAY A;  3GWK C;  4TV8 A;  3MD0 A;  4GKJ O;  1XNQ O;  1VP7 A;  4GKK O;  3J7A U;  1M5I A;  1COW G;  3ZCC A;  3H1J H;  2F93 B;  3EVK A;  1BMF G;  1O9H A;  3CYO A;  2X7R B;  2B5U A;  4JI1 O;  2A79 B;  5CA3 A;  2IU0 A;  3AK1 A;  4YY3 O;  4CS3 A;  2QDO A;  3A2F A;  5IJ0 B;  3O9O A;  1GN2 A;  4U3F H;  3IC7 A;  3STL C;  2ZE6 A;  1Y76 B;  1VQM V;  1XQ8 A;  5LXT B;  2F4V B;  1X4T A;  4G27 B;  2CTR A;  4CBC A;  3K5N A;  5FPO A;  2V4D A;  1YDX A;  3E2E A;  1AJN A;  2A0L A;  5EK0 A;  2WLH A;  1TA8 A;  2F1M A;  2N05 A;  4LF5 B;  3CCU V;  1KP2 A;  1PKX A;  1F51 A;  4QNH B;  1BS3 A;  3OMI B;  3IJ4 A;  3F7Y C;  2PI5 A;  3JD4 A;  1VMG A;  1IZ3 A;  4LF9 O;  3ZMU A;  5BY1 A;  3EXA A;  2LW7 A;  3AG7 A;  4PA4 A;  4LFC O;  5CA1 B;  4DV3 O;  1HW7 A;  2Y4U A;  3JAL A;  4FFB B;  3T4Z A;  4QJF B;  2CGN A;  1VQ5 V;  3F7V C;  2WLJ A;  1H2N A;  1R3I C;  1XDC A;  4K3A A;  1QLE C;  4AI8 A;  1XNR B;  4FM2 A;  4UCO A;  4I9Q A;  2X0L A;  4GZR B;  4PDV A;  4YHH B;  1TUB B;  2ARH A;  4D6T H;  4NTY A;  2LO1 A;  1IXM A;  3AK2 A;  2ZT9 B;  3M8A A;  4PD4 F;  1IVS A;  2EIN C;  1FAF A;  1K7D A;  4MVS A;  4P9P A;  1OHH G;  2JS3 A;  2F23 A;  4FLY A;  2DOS A;  1WA8 A;  1ZL8 A;  2Q0O C;  4NTX A;  4X8A A;  2Z5U A;  1GKF A;  5KUK A;  3FYI B;  4DV7 O;  3B40 A;  4DW1 A;  4BWA A;  4RAI A;  4JI6 B;  4GX2 A;  3ZN0 A;  4DV5 O;  1L0N H;  1V54 C;  4X1I B;  2ZM6 B;  4IIJ A;  2AZ2 A;  2OWO A;  5BMV B;  2IJI A;  1M57 B;  1Y66 A;  1SQX H;  2OIE A;  4PV1 B;  2ZXW B;  2OTL V;  1WPX A;  4I0X B;  2Q69 A;  4X88 A;  2UU9 B;  1FFX A;  4KFM A;  4FMT A;  3ZRV A;  4KUM A;  4GLX A;  5GTH Z;  5KHK A;  3ZHU A;  3KCY A;  1VQ8 V;  2GSM B;  1NTM H;  3ICX A;  3VQV A;  1XMO O;  1GM8 A;  3OTO O;  3N2G B;  4LBE C;  1IBK B;  2QKC A;  2ILM A;  1OZ0 A;  3HKC B;  4KL1 A;  5KMG B;  3R65 A;  4LC1 A;  5JJE B;  1HWY A;  1G8M A;  2EJR A;  1XMQ B;  3ML0 A;  1JJ2 U;  1URF A;  1IXB A;  2N74 A;  3AG2 C;  5CMU A;  3T1H B;  5D5Q A;  3E22 A;  1RSO B;  1CEZ A;  3G6B A;  5DN6 G;  4U7N A;  1K5Q A;  2Q8V A;  4JI7 B;  1FJG B;  5LYJ B;  1NVP D;  2E5L B;  3ZRW A;  2HLD G;  2PF4 E;  2OT5 A;  4JF3 A;  4Z1M G;  4LF4 O;  1MG1 A;  1OCZ B;  4UB8 Z;  4KHP O;  3ZHR A;  2IH3 C;  4Q20 A;  3J80 N;  4GX1 A;  3T4D A;  4K0K B;  5BZB A;  4EFE A;  1K4C C;  4JYC A;  1UPG A;  3BHP A;  4NXN O;  1XOU A;  5DED A;  3JAT A;  4ZOL B;  3ABK C;  3B77 A;  3H9V A;  4DR5 B;  1EN5 A;  4DR7 O;  4TSF G;  1HNZ O;  1IUR A;  2IJH A;  2EIK C;  1SQG A;  2UXC O;  5GON B;  3GVM A;  3CB2 A;  1M4U A;  2HP8 A;  4JAU A;  1FXV A;  1UFI A;  1PNM A;  2P4K A;  3DXR A;  2ZNJ A;  3D8C A;  4PA3 A;  2Q7G A;  3L70 H;  3OD4 A;  1PD3 A;  2HG5 C;  3EFF K;  1GN6 A;  5K1P A;  5LHG A;  1KBH A;  3RVY A;  4NYK A;  2CUG A;  3QO7 A;  2ATK C;  2XAQ A;  4X65 B;  4MVM A;  2VWK A;  1MZE A;  2B9Z A;  2KSD A;  5L3B A;  5GW7 A;  1MOF A;  3BA9 A;  1H2L A;  5A2Q N;  2UXD B; 
#chains in the Genus database with same CATH homology
 2QA4 V;  3FB8 C;  5H6Q A;  1NBM G;  1R3L C;  1VQO V;  4WFA V;  4N23 A;  1FXK C;  1NH2 D;  1V55 C;  2DWD C;  1AI4 A;  1FXK A;  1QLE B;  1PNL A;  4MSW C;  5EC1 C;  1K34 A;  4LCU C;  3LNM B;  3VOU A;  3LSS A;  1JCH A;  2XOK G;  5B1B C;  4LP8 A;  1GMG A;  3TET A;  5L3G A;  1AJP A;  2KB1 A;  1NR7 A;  4ZKI A;  4PA6 A;  4GX0 A;  3RVZ A;  3JD0 A;  3CP1 A;  4UXN A;  3ABM B;  1R73 A;  5C93 A;  5LHI A;  3GWO A;  1RPO A;  2W0F C;  2P7T C;  2QKS A;  4CZZ A;  2P6J A;  4EKW A;  4MTF A;  1BHA A;  1VQL V;  3W7T A;  1KKD A;  3OMN B;  2DQ3 A;  3K9A A;  3ZJZ A;  5KUM A;  3E8B A;  3SYO A;  2OTJ V;  2EIN B;  3ASO C;  1GO3 F;  3CXC U;  3G4S V;  4I9W A;  1GM7 A;  4E2L A;  1XL4 A;  1NVP C;  3M99 B;  2X6A A;  1I5X A;  1TUE B;  1OCO C;  2X6C A;  2DQ0 A;  2WPD G;  4UV8 A;  2FTK A;  2EZO A;  4UVC A;  1YIJ V;  1OCC C;  3D36 A;  1MSW D;  1Q7Y W;  1OCR B;  3SPH A;  3LDE A;  2WWW A;  3CC4 V;  1JQ0 A;  4RUF A;  3MHS C;  4FJC C;  3K0G A;  3ETE A;  4R50 A;  3G71 V;  3K0D A;  3ETD A;  1VQ7 V;  1NQT A;  1VQK V;  3OEE G;  5B1A B;  1FXH A;  2EIM C;  1PNK A;  3JD2 A;  4MVZ A;  1DLB A;  2NLJ C;  3T2M A;  5B3S C;  2YEV B;  1V54 B;  3LSQ A;  1M9N A;  2EIJ B;  1BL8 A;  4QIW F;  4JAV A;  4JGS A;  2DW4 A;  2X6B A;  5IYB O;  2QEX V;  1Q81 W;  2YSU B;  3TK1 A;  4MS2 A;  1YIT V;  1B6Q A;  3ZIA G;  2Y69 B;  1XL6 A;  1NR1 A;  4MVO A;  3CC7 V;  4OXS A;  1QVF U;  1M57 C;  2HR3 A;  3T1C A;  4R7C A;  2JIZ G;  4RQF A;  5IYC O;  2ZXW C;  3QNE A;  1VQ6 V;  1EFR G;  4TWK A;  3OAA G;  3X2Q B;  4J9Y B;  2IU3 A;  1K8A W;  4UVB A;  3ABL C;  3STZ C;  4I5S A;  1W0J G;  1R6K A;  5IY5 C;  1H2G A;  1YJ9 V;  2Q6A A;  4BIU A;  2ITD C;  2JJ1 G;  1Y4M A;  1S3J A;  3CMA V;  1RPR A;  2V7Q G;  2GHY A;  1QLN A;  4XDL A;  5B1N A;  1KD1 W;  2V1D A;  2ZR2 A;  3A0R A;  3CD6 V;  1K97 A;  1S72 V;  4WFE A;  4FPP A;  4BIZ A;  1THZ A;  2JJ2 G;  2DYS C;  2JK5 C;  3E83 A;  3ABU A;  4P30 A;  1VQN V;  3AG2 B;  1E79 G;  1AI5 A;  1BHB A;  2WLI B;  4WCE V;  3TCU A;  1NH2 C;  1EZJ A;  1R6N A;  1M90 W;  3FKS G;  3CCJ V;  2QM7 A;  1VQ9 V;  1EBO A;  3SPI A;  4FIP C;  3ZRW B;  4DXW A;  3CCE V;  1S5H C;  1H8H G;  3SPJ A;  1FS0 G;  5KA5 A;  1W2B U;  1DTO A;  3E35 A;  4MTG A;  1ARO P;  5EBL C;  2BOB C;  4G28 B;  1K33 A;  2XAS A;  4HAM A;  5LBQ A;  1JX9 A;  5L3E A;  2P90 A;  3K04 A;  4BAY A;  3LUT B;  2IW5 A;  2OCC B;  3JYC A;  3MD0 A;  1R3J C;  3FYE B;  2XAH A;  2EIJ C;  2QE7 G;  1KEC A;  4MTO A;  2LFR A;  1OCZ C;  2WLL B;  1ROP A;  1COW G;  3OFN G;  2UXX A;  3ZCC A;  3ABK B;  1BMF G;  3CYO A;  2X7R B;  2Y69 C;  2B5U A;  2MK3 A;  2QM8 A;  1M56 C;  2A79 B;  5CA3 A;  2IJK A;  2EIK B;  3WFV A;  2JEU A;  2IU0 A;  4MVR A;  4JAS A;  3G6E V;  3SPG A;  2Q67 A;  4QPJ A;  4PDR A;  3BEH A;  1AI7 A;  2W6I G;  2XAJ A;  2XAG A;  3IFX A;  3AG4 B;  4XDK A;  4H37 A;  3AG3 C;  3IC7 A;  3STL C;  1NJI W;  2ZQM A;  3JCZ A;  4MVU A;  1VQP V;  4WFB V;  3H01 A;  1VQM V;  3W7W A;  4UVA A;  3AG1 B;  2EZP A;  3SYQ A;  2BOC C;  1JPX A;  4G27 B;  4WFF A;  4QPK A;  4CBC A;  3KG2 A;  1SES A;  3E2E A;  1AJN A;  4GT1 A;  2A0L A;  4GCZ A;  5EK0 A;  2WLH A;  5H9C A;  2JDI G;  3DGE A;  1S76 D;  1RM1 B;  4P2Z A;  4HZ3 A;  4QE7 A;  3CCU V;  3ZRX A;  1KP2 A;  2DYR C;  3K08 A;  1MAB G;  1CPY A;  1PKX A;  1F51 A;  4QNH B;  4MW3 A;  3OMI B;  1J95 A;  3F7Y C;  3CCQ V;  2PI5 A;  3JD4 A;  3ASN B;  1Q86 W;  1ENV A;  3LDC A;  4JPR A;  1NKD A;  3SYP A;  3ZMU A;  3CPW U;  1K9M W;  5B1O A;  1FXK B;  2EIL C;  4PDL A;  5EBM C;  2F43 G;  4PA4 A;  4MW8 A;  1M1K W;  5CN0 A;  3T4Z A;  1P7B A;  3OM3 B;  4QJF B;  2NNU A;  1KQS U;  1VQ5 V;  3F7V C;  2WLJ A;  1YJN V;  1R3I C;  3WG7 B;  3OMA B;  1QLE C;  2ITC C;  5L3C A;  3CCV V;  3HPL C;  5L3D A;  3RW0 A;  3ZMV A;  4BW5 A;  3F5W C;  4PA7 A;  3K06 A;  1QR9 A;  3CCR V;  1DF5 A;  3NXS A;  3SJQ C;  2X0L A;  3MHH C;  4R6Z A;  2H94 A;  3SYA A;  4PDV A;  3ABM C;  4RUE A;  3CME V;  3GB7 C;  2K1E A;  2R9R B;  3ASO B;  1YTF D;  1H8E G;  1VQ4 V;  1IXM A;  3RBZ A;  3QO5 A;  1ORQ C;  1NVP B;  4JTD B;  1S77 D;  5HFM A;  4RO2 A;  4WFG A;  2EBO A;  1N8R W;  1OCO B;  5EC2 C;  1F23 A;  1K4D C;  2EIN C;  1K7D A;  4MVS A;  5LHH A;  4P9P A;  1K73 W;  3W7X A;  1JOY A;  1OHH G;  2LFS A;  4TT3 G;  3OW2 U;  1AJQ A;  2WSS G;  1UJW B;  2LP7 A;  3OEH G;  4X8A A;  3CCL V;  2Z5U A;  1K3E A;  1GKF A;  3AG1 C;  5KUK A;  3FYI B;  3B8M A;  1OCR C;  4MTX A;  2H8P C;  5B3S B;  2IH1 C;  4RAI A;  1YHQ V;  3FB6 C;  4GX2 A;  5KA6 A;  3ZN0 A;  5B1A C;  1YTF B;  3ZN1 A;  1V54 C;  2R9I A;  5FL7 G;  3UM7 A;  2XAF A;  2YEV A;  3UKM A;  3DTU B;  2ZD9 A;  5LGU A;  3FB5 C;  2IJI A;  2ZDI C;  1M57 B;  4MT8 A;  1Q82 W;  1Y66 A;  2ZDI A;  2A9H A;  2HJF C;  2ZXW B;  2OTL V;  1GTO A;  1WPX A;  2WLK A;  1WLE A;  3OR6 C;  2Q69 A;  5EBW C;  4J9Z B;  1F4M A;  4X88 A;  1GM9 A;  1I5Y A;  3W7U A;  1GK9 A;  2HFE C;  2IJJ A;  3ABL B;  3FB7 C;  4KFM A;  4YXW G;  4FMT A;  3ZRV A;  4KUM A;  3W7S A;  5IY5 B;  2AHY A;  3WG7 C;  3CCS V;  3X2Q C;  3AEI A;  1VQ8 V;  2GSM B;  2HVJ C;  4X89 A;  5IDJ A;  3PJS K;  3K3W A;  4UV9 A;  1GM8 A;  4MVQ A;  4KP4 A;  4LBE C;  3K79 A;  4H33 A;  1OZ0 A;  5L3F A;  5LGN A;  5H6R A;  2DYS B;  4FK5 C;  5CBG A;  3ABT A;  3P32 A;  3R65 A;  4LC1 A;  1E1Q G;  3ZMZ A;  3ZRS A;  1HWY A;  1G8M A;  1ZWI C;  2EJR A;  1NH2 B;  4QE9 A;  4WFH A;  3ML0 A;  1AI6 A;  5J9P C;  1JJ2 U;  2Q68 A;  3AG2 C;  5CMU A;  1PL0 A;  1CP9 A;  5HFL A;  2XND G;  2WLI A;  1CEZ A;  2B1G A;  2JEX A;  2Z3Y A;  1L1F A;  5DN6 G;  2C2A A;  4U7N A;  3P30 A;  3ETG A;  1K5Q A;  3E8G A;  1E1R G;  1SZT A;  3D3I A;  4R8C A;  3ZMT A;  3VBB A;  2M7W A;  1V55 B;  2DWE C;  1NVP D;  3ZRW A;  3K03 A;  2HLD G;  1YSC A;  1SET A;  2UXN A;  4GX5 A;  4UUJ C;  4F4L A;  4JTA B;  5DM6 V;  2OT5 A;  5B1B B;  5IYD O;  3CC2 V;  3E89 A;  4JF3 A;  4Z1M G;  1YJW V;  1MG1 A;  1OCZ B;  4L87 A;  1QBZ A;  2IH3 C;  4Q20 A;  2OCC C;  1YTF C;  1YI2 V;  4GX1 A;  1K92 A;  3T4D A;  2P67 A;  5BZB A;  1F4N A;  1JVM A;  5CBF A;  2WAM A;  1K4C C;  2WLN A;  4ZBM A;  4JYC A;  3ZMS A;  2QTO A;  1M56 B;  3OUS A;  5CBH A;  5LGT A;  2D3O W;  2WLL A;  4U7O A;  3SYC A;  3QO8 A;  3ABK C;  3B77 A;  1QCE A;  4ASU G;  3I55 V;  4RQE A;  4TSF G;  4N21 A;  1S0V A;  2IJH A;  3EHB B;  2EIK C;  1QVG U;  3E8F A;  3AG3 B;  4PDM A;  3B8N A;  2W6J G;  4JAU A;  1FXV A;  1FFT B;  2CK3 G;  1KC8 W;  4P9O A;  1PNM A;  1OCC B;  1G4Y B;  2Y48 A;  3AG4 C;  4PA3 A;  2AHZ A;  3I56 V;  2ZR3 A;  1DF4 A;  1K5S A;  1PD3 A;  1P4R A;  1QR8 A;  4JYB A;  3E8H A;  2WLM A;  1SRY A;  2HG5 C;  3BY6 A;  3EFF K;  1H38 A;  2B1I A;  5LHG A;  3OE7 G;  4XDJ A;  3RVY A;  2EIM B;  3QO7 A;  3IGA C;  4G2K A;  4XBF A;  2DYR B;  1W0K G;  2HKO A;  3OGC C;  3SPC A;  3E86 A;  2PI4 A;  4JTC B;  3CCM V;  3JD3 A;  4DO2 A;  1LNQ A;  2ATK C;  2XAQ A;  4WF9 V;  1RM1 C;  1R3K C;  3LDD A;  1AR1 B;  4MVM A;  2HVK C;  5L3B A;  5GW7 A;  3JD1 A;  1MOF A;  3HB3 B;  1KP3 A;  2EIL B;  4HYO A;  5E1A C;  1SER A;  3ASN C;  4PA9 A;  4PEL A;  3OUF A;  3OR7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...