1NH2D

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
104
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEDQSVISVDKLRIVACNSKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 25
structure length 104
sequence length 117
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nh2D01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1nh2D02
1RM1B 1NVPC 1NVPD 1NH2C 1RM1C 1YTFC 5IYDO 5IYBO 5IYCO 1YTFD 1NH2D
chains in the Genus database with same CATH superfamily
4MVQA 4U3JB 1QLEB 3Q4HA 2P06A 2ZINA 3JALA 2W6JG 2AZ0A 1ENVA 1NR7A 1IDSA 5LYJA 1QR8A 1VQ4V 4K35A 2CGOA 4KXRA 1B06A 5BR8B 1MOFA 2Q4PA 4CS4A 5B3SC 4X64B 4JI8B 4DR6O 1XMQO 4HYOA 1OV9A 1W59A 2F93B 3T2MA 3E2EA 3ETQA 2UXNA 2LJ2A 3T4ZA 5H6RA 4LF9O 4DR4B 1SQQH 2PYJA 1GRJA 3P32A 2H94A 4LF5O 2V1DA 2WLLB 4GKJB 1FKAO 3JAWB 4YXWG 1XI1A 4K8XA 4DR3O 5A2QN 1S77D 3RW0A 3UO3A 2BSKA 3T1CA 1LUWA 2HLDG 5L3GA 3AK3A 1Q6HA 4LFAB 3DSQA 1S5HC 4O4HB 4R6ZA 4ZOLA 5EBMC 4FLXA 4I0XA 4K0KB 3SYQA 1TVKA 1RFYA 3LDDA 2E3CA 1XOUA 3JAKB 1IZ3A 1E1QG 3SPJA 4IHJA 2WLIB 1K92A 3ZS8C 1VEWA 4TUYA 4R7CA 3BEHA 3FAVA 2BTQA 2EIJB 1R1BA 4LF8B 1AI4A 4DV1O 3HKBA 3CMAV 3W7XA 2YDEA 3BAAA 2IH1C 1L0LH 4FMTA 1H2GA 4JI3O 4QGPA 2XASA 1I5YA 2Q6AA 1HNWO 3AEIA 5DM6V 4JAAA 4Z1MG 4KHPB 2N05A 4JASA 4GZRB 4I4TB 1FJGB 3I56V 1R73A 1NJIW 2ODMA 4DRXA 4D7TA 3B2EE 1NVPD 2QTOA 1Q81W 3HR0A 4I5SA 2UXXA 4OX9B 4ZIBA 2EZOA 4RUEA 4GX1A 3WB2A 4IIJB 3G71V 3L9DA 5LMUB 1RPRA 3GWOA 3ZHSA 2AXTZ 4X1KB 5LOVB 3K5NA 1FFXB 4QNHB 4J11A 5KAFZ 2Z5UA 4FM1A 3L75H 1XMOB 5C93A 5CA1A 1VF6C 3E22B 1R3IC 4YY3B 4CH6A 2UXBB 4JI0O 1Y67A 5KHIA 2JVDA 2BTOA 4DR7B 1PD3A 3BA8A 3DXRB 4RWUA 4NB5A 2PYLA 5GTHZ 2XT9A 2VQEB 1SQBH 4JI1B 5IYZB 3ZRXA 4D7SA 2XTAA 1AJNA 2HEPA 3E83A 2MW2B 3SYOA 3OM3B 3N2GA 5IYBO 1N0NA 1Y76B 2K9PA 2P4KA 3UM7A 1G6UA 3WG7C 2GTSA 1WPBA 1GK9A 1DGSA 1H38A 2GV9A 3RYHB 1G4YB 1R3KC 3ASOB 3M7MX 3BA9A 1GM9A 1X59A 3O9OA 3ZN0A 1I94O 4BIUA 3STZC 3ASNC 3ETEA 4JYCA 2CE4A 1M1KW 5JVDA 1ZAUA 3K9SA 3ZMVA 1YZBA 2IU3A 1J5EB 3CD6V 4J7KA 3H9VA 2ZR2A 5IDJA 4JI5B 5B66Z 5KMGB 5KX5B 3FB5C 3CPWU 4ZHQB 1I5XA 4X88A 4FFBA 3HB3B 1URFA 4I50B 2P6JA 5J2TB 4LH7A 1IBMB 2GBOA 1VQ9V 3B8NA 4CS3A 4UVAA 2Z3YA 2HVJC 3T1HO 1XNQO 1KUQA 4LC1A 4LCUC 1M5IA 4MW3A 1IURA 1L0NH 2QM4A 3FB7C 4X1YA 2UUCO 1MZEA 3CRCA 2Q0AA 1S72V 3C3TA 5LA6B 1Z5VA 2LFRA 4DR2B 1QCEA 4R8CA 4LFCB 3ABUA 1YXBA 2UUAB 2FB5A 4JI2B 1K33A 4P30A 2GTAA 5CA0B 2JS3A 4X65O 2ZD9A 3K06A 4LFBB 1XUQA 2VWJA 2C2AA 1WNSA 3SYPA 4B08A 3OEHG 1NTKH 3BVOA 2Q73A 2CTRA 3VOUA 1JOYA 1EZJA 1DF4A 1KBHA 1MMMA 4J7ZA 1RSOB 1QHTA 4JF3A 4NR1A 1KECA 3CCUV 2UU9B 4QE9A 2Q7EA 3G80A 4CH3A 4DV5O 4UV8A 4C7UA 1FS0G 2X0LA 3AK1A 2HKOA 3ZX6A 1VF7A 3WB1A 2Y4UA 1WLEA 2BOBC 1NS1A 1PL4A 2A0LA 3AG3C 1DLBA 1SRYA 1IBLO 1FPOA 3FYEB 4JYAO 3RYFB 1ORQC 4X66B 4BW5A 2EIKB 2XOKG 3ZRWA 1NVPC 3E86A 3CP1A 2H8PC 2VQFB 3SPCA 4TQFA 3R65A 4YJ2B 3ZIAG 1AI6A 3HKEB 2KKWA 4MVOA 3APOA 4W4LA 1NU1H 2JIZG 2AW9A 5H2FZ 3M99B 4YJ3A 3D36A 5LGTA 4LNUB 5JJNB 3ZHQA 2QWQB 1ZX3A 3ZCCA 1OCCC 2XAGA 1BCCH 1OCOC 1VQ8V 5EC1C 1XDCA 3IFXA 4DV3B 4UVBA 3TK1A 5JWPA 2ZE7A 5IJ0B 2QTSA 3F5TA 2CK3G 3ML0A 1E1RG 5CBHA 3ZMTA 1W2BU 2PI4A 2CAZC 1WA8A 5B3SB 4AILC 2AGAA 1HR0O 4N21A 3JATA 5E79Z 5KUKA 3CE2A 2ATKC 1FXKA 1N4CA 3HKCB 3SDLA 4I7ZB 3HKDB 2WA4A 4DV2B 3CSXA 1VQKV 3H1HH 1EBOA 2E5LO 4ZKIA 3OUFA 5ITZB 5CMUA 1VQNV 1JR9A 4CZZA 4JTAB 4YIOA 2MK3A 4UB6Z 1CXZB 1ZL8A 4P9PA 1VP7A 5EBLC 4F6RB 4X89A 1MZFA 2PUSA 2YUAA 2EULA 4X62O 1SQGA 2WAMA 5B1AC 3K57A 1JA8A 1YVWA 3VQYA 2ZCEA 4KFMA 1VQ5V 4ZOLB 4WFGA 4YIPA 1R3LC 2QWNB 2QWRB 2NR5A 1YTFD 1GH6A 3CCEV 2CGNA 2R70A 2A06H 4NVPA 1Q5OA 3E8HA 4EB6A 4O2AB 1WPXA 2BTQB 3OMAB 2X6BA 4X1IB 5KA5A 2YXYA 1XNRO 4XDLA 3L73H 1W0JG 3C3SA 1Y74A 2ZE6A 3B4SA 2W0FC 3F5WC 4DV7O 4DR1O 1E79G 2UUBO 1BE3H 2VRZA 3OAAG 3N2KB 5DEDA 4NXNO 4DUYB 2GDSA 5JQGA 4UUJC 2Y69C 3K08A 2X7RB 2IJIA 4HNAA 3UCSC 4O4LB 2DN9A 5JCOC 5C8YA 3BPZA 3IC7A 3D3QA 2PF4E 2DMXA 5EYPB 4PA9A 1N32B 3W7SA 2PY5A 1F4MA 2E75B 4PDVA 1N33O 5GW7A 4JYYA 3CMEV 1L8DA 1YEWA 5KHJA 1M9NA 4UCTA 3A0BZ 1DTOA 1SESA 4LH6A 3OMNB 4JI6B 2Q5ZA 1FD9A 1LUVA 3QF7A 1KQSU 4UCRA 4O4JB 1AVMA 3CCVV 1SA0A 4DV4B 1MNGA 5CA1B 4PHZA 2WWWA 4JI7B 3B77A 4RQFA 1TUBA 1TUEB 3ZMUA 4HBNA 3ZRSA 2M7WA 1JMKC 3GWKC 3K58A 1NR1A 4FLWA 4JI0B 1NH2D 1F4NA 4WBNA 3W7UA 4LF7B 4TV9B 1EN4A 1K7DA 1LNQA 3WG7B 3T4DA 4IT5A 4QIWF 3CCQV 3RT3C 4B3SB 3OR7C 3K79A 2IBZH 2DYRC 4B3MO 3OTOO 2ADPA 3ASNB 2YSUB 2YXLA 4J41A 3SJCC 4H0LB 2OWOA 4FLUA 3H1JH 1XEQA 2R72A 4JTCB 1YHQV 4H37A 5JVDB 4FLVA 2R9IA 3AG7A 1WB7A 2WPDG 1HNZO 3T1YO 4K3AA 5LP6A 2CTPA 2RNBA 4P2ZA 1KU9A 1YI2V 5H5NA 5IT9N 4LBEC 1AP5A 3RYCA 1EFRG 2OCHA 5LBQA 2QGNA 2QM7A 3ABLC 3I5DA 1VF5B 5JJJB 1QBZA 2Y48A 1AROP 3DTUB 2HHHO 1D2DA 1AP6A 1M90W 1WB8A 1R3JC 3JARB 3CB2A 3EHBB 1R6TA 2UXDB 5BMVA 4ZBMA 4DUZB 2KB1A 1Q7YW 3L72H 4DV0O 2EINC 2ZM6O 2YIBA 4BR6A 1XREA 5L3EA 4PA7A 3JCUZ 1YTFC 4KUMA 3SJBC 2DOSA 2QKAA 1K97A 2UXCO 1MA1A 2XHBA 4LF6O 4DW0A 2YICA 4DV6B 3OUSA 1GN3A 3BY6A 2EX3A 1G1XB 1SQPH 2JRIA 3U10A 1N8RW 1H2LA 4B3TB 3TCUA 1FXHA 4PI2A 4BIOA 1IX9A 2DQ3A 2ITDC 2JS5A 1O9HA 5J2UA 5LGUA 4W4KA 2Q69A 2JJ1G 2K1EA 3CJHB 3AG3B 4AQYB 4UVCA 1U96A 4TV8A 4FK5C 3IAYA 2CTWA 5LL6Y 3E8GA 2M6YA 4JV5O 1OCRC 1SQXH 3A0RA 4AI8A 2ETNA 1KP3A 3OE7G 1OHHG 1NVPB 3AG1C 3CC2V 4MVZA 2XAHA 1QVFU 2B9ZA 2OTLV 2CDYA 3CYOA 1GN6A 1AI7A 2FKXA 1XL4A 4TT3G 1SF9A 1N34O 1Q6UA 1RPOA 1JFFA 1AJQA 1JJOA 2Y0PA 5EZYA 1K4CC 4WFAV 1HNXB 2KQXA 3FKSG 4DO2A 4MS2A 2CH7A 1KD1W 2FTKA 1OCCB 2KG7B 1OCOB 4EEQA 1GAXA 4JI4B 2P67A 1OCZC 4PDLA 3B8MA 2DJVA 2W0XA 5IWAB 3L71H 4PA3A 2VWKA 4FJCC 4FZ1A 3O65A 1NH2C 2NN4A 4U3JA 1WJZA 2ZIOA 5KHGA 2OCCC 4H33A 4KL1A 5JJEB 1VARA 3RYIB 2A3QA 4O2BB 5BR8O 2QKCA 1JJ2U 1SKVA 2P22C 2HFEC 4J80A 4JI8O 2EBOA 1GN4A 2PGGA 4MSWC 5GONB 1US6A 2PZSA 2L6LA 4QE7A 1AI5A 3KG2A 2ZKOA 1KYOF 5CBFA 1YIJV 4DR4O 1ZLZA 2JJ2G 1NZ6A 4YHHB 1M4UA 2WSSG 3B40A 3P3NA 3RVYA 4LF4B 4GKJO 5FNVA 2QM8A 2F4VB 3G6EV 2OYQA 4DR5B 4QPJA 5L3BA 3S3XA 3JAWA 3IGAC 3FX7A 5B1AB 2V7QG 1KMIZ 2LGWA 4NXMB 2JEUA 5CB4A 4IYHA 1JVMA 1S3JA 1I08A 4LFAO 5KA6A 1IVSA 3JD3A 3CC7V 1B3QA 2JGUA 2JGDA 4K0KO 4G2KA 1BZKA 1V54C 4O4HA 1B04A 1UPGA 5L3FA 4MTFA 1NQTA 5H9CA 1X4TA 4FVMA 1K9MW 1Q90D 3JAKA 4X20B 4O4IA 4H13B 5B1BC 2WLIA 4U7NA 2Y4TA 2YEVA 2DWDC 3H1LH 4PD4F 4NTWA 2LP7A 1N36B 2LGQA 1IBKB 4B7KA 2OT5A 3SPHA 1EZVH 1WN7A 4L87A 4A5UB 1M56C 1V9PA 1TA8A 4JTDB 1H8HG 2Y69B 2EJ7A 3LDCA 3G4SV 1BQ0A 2QE7G 3WU2Z 2RJZA 1VQPV 2EIMC 2Q8VA 2GUZB 3SPGA 5B1NA 1FJGO 3ABMC 1QU7A 2XUMA 3OGIB 4P9OA 4PV1B 2ZE5A 1NBMG 4OX9O 2P90A 4NTYA 1VQLV 1H2SB 4IYIA 5LMUO 3K5OA 5B1OA 1CP9A 2QJ1A 4IIJA 1IXMA 2ZNIA 2RCVA 3FB6C 3SPIA 1XMOO 1NKDA 2VS0A 4MVUA 4X1KA 1K3EA 5LOVA 4B3RB 1FFXA 2DQ0A 2XAQA 5LXTA 4YY3O 1W0KG 1ZSPA 3AG2C 2UXBO 3D36C 2B5UA 2ZXWC 4MW8A 3CWBH 4DR7O 3E22A 1SERA 4GUNA 1BL8A 2RMKB 4MTXA 4TWKA 3Q4HB 4OPAA 2VQEO 3JALB 4JI1O 3UT5A 2A9HA 2ILMA 5IYCO 5LYJB 2DYRB 3H1KH 5IYZA 3D3IA 4JPRA 1AR4A 2V4DA 1Y76A 3W7WA 2YI8A 3AG4C 3SYAA 2R9RB 1S5JA 1FXKC 3CC4V 4GYCB 4DR6B 4JAVA 1XMQB 3ABKC 4PI0A 3OFNG 3U11A 3SYCA 1J5EO 5IYDO 3FYIB 4JI5O 3T1YB 5BXZA 4LF9B 1PV0A 3OMIB 4ABMA 2EZPA 4LF5B 3ABLB 1G8MA 4IGGA 5D5QA 5KX5A 2BSKB 3OR6C 1P4RA 1VIBA 4LWSA 4ZHQA 4DR3B 1WAZA 5J9PC 1BMFG 1IBMO 3B09A 3MD0A 1B6QA 2ADQB 4MTOA 2B1IA 4RO2A 5JH7A 1KB9F 4I50A 4GCZA 1S5LZ 5F2VO 2Q67A 2EJRA 4I0XB 4F4LA 2NNUA 2EINB 2YIBD 4HZ3A 3UKMA 1TVKB 2BE3A 3BCCH 2R9AA 3DC6A 1PL0A 1SQVH 3DGEA 4DR2O 2DYSC 3OD4A 4LFCO 1SZTA 4IHJB 2UUAO 1YTFB 4JI2O 3PN1A 4TUYB 2DWEC 5LA6A 5CN0A 3ZHTA 3FAVB 1BGYH 3SR2C 3EFFK 5LHIA 4LFBO 3HKBB 2GHYA 1JQ0A 4J9YB 5CA0A 2X6CA 2ZE8A 4UCOA 1H2NA 1BT8A 4DV1B 4J10A 4I9QA 4LF6B 3L70H 3LNNA 4JI3B 5E1AC 4PA4A 2UU9O 1GO3F 4K8ZA 4E2LA 4ASUG 5J2UB 1Z5WA 1HNWB 4MVMA 1OZ0A 2QSAA 4OPHA 3QVNA 1QQCA 4WFBV 1OCRB 2CTQA 1GTOA 4DRXB 2O57A 4JYBA 5LHHA 5AG2A 1BQZA 2H3OA 3SJQC 3AG1B 5KUMA 3H1IH 3JSLA 4UB8Z 1YF2A 3A8TA 5DECA 4AHCA 4X66O 2PI5A 2RDCA 1I7FA 5IJ9A 4J9ZB 1NT2B 3ABTA 2QDOA 1FXVA 2WLNA 1F23A 1DF5A 3RYFA 1BHAA 3MAQA 2VQFO 5CA3A 3E8BA 4RAIA 1JFFB 1EN5A 2F66C 3OT7A 3CRMA 4YJ2A 2CH7B 3WFVA 1M93A 4RUFA 3A2FA 3HKEA 3K5LA 1OCZB 4NKGB 1S76D 4H44B 1JCHA 3J7AU 1BS3A 3KKYA 4FLTA 1M57C 1Y66A 3JD2A 4LNUA 2WLHA 1NH2B 5GTIZ 2AZ2A 3N2GB 2WLKA 4F6EA 4DV3O 3WB0A 4GT1A 5HFMA 2OCCB 2RN9A 2PTMA 1SS3A 1Q82W 2HR3A 1UFIA 1MSWD 4I9WA 1RM1C 4BWAA 1P7GA 4LP8A 5IJ0A 5LMNO 1V55C 1SC5B 1SZXA 2IJKA 3UQ8A 1I94B 1TGOA 4DV2O 1H2KA 4EFEA 3CRQA 2F23A 1FFTB 5LP6C 1QNMA 3HKCA 2LO1A 3HKDA 3H01A 3C90A 4L8JA 2WLMA 1R6KA 4U3FH 4FFBB 4I55A 4NTXA 3G6BA 4HAMA 2QEXV 5ITZA 4WFFA 1K5SA 5FNVB 2QWOB 5IE9A 1CEZA 4X9QA 4GX5A 4CH4A 3DC5A 4MVRA 3FD9A 4PELA 3T1HB 1XNQB 3CX5F 4EFBA 4F6RA 5CB4B 4X1YB 2F1MA 5EC2C 2YIDA 3D8CA 5KHHA 2UUCB 3TGUH 2JEXA 5CBGA 4FM0A 1V54B 1K73W 2IW5A 3JCZA 2JGDB 1ZUQA 3X2QC 3SGIA 5LGNA 4ICGA 1AR5A 2OTJV 1OJHA 1T5EA 4X65B 5B1BB 3QO5A 3ZEDA 4CS2A 4O4IB 3K0DA 2YEVB 4ZI7A 2YXHA 3K0GA 4O2AA 1M56B 4UCUA 3JASA 1L1FA 2ARHA 4EKWA 3RWRD 4X1IA 4FM2A 2Y0IA 4DV5B 1PNLA 1SQFA 2EIMB 3NR7A 4DUYO 2ZNJA 3L74H 1XILA 3ICXA 3ABMB 3STLC 5EIBD 3N2KA 3K04A 4FLYA 2EILC 1O9GA 1IBLB 4WFHA 4O4LA 1J95A 1N32O 3ZRWB 4JYAB 1HP8A 3RN4A 1YITV 5FPRA 1COWG 5EYPA 3JYCA 2F95B 1XL6A 3E89A 1YCIA 3LSUA 1GM7A 2E74B 4JI6O 4DK0A 4GKKO 5FLXN 1LR1A 3TETA 3MHHC 3FFQA 1PNKA 5IY5C 5DN6G 4G28B 4DV4O 2OIGA 3ZMSA 3AG2B 5EBWC 4YJ3B 2ZXWB 4J42A 4JI7O 4O4JA 4UCVA 1VF6A 3ZBHA 5LXTB 3U0ZA 4FLZA 1VQOV 1P84F 2IJHA 2P7TC 3VQWA 1WP7A 2Q68A 4PDRA 1XQ8A 2QR4A 3CRAA 3RFRA 4DXWA 4LF7O 4WF9V 3UT5B 1PM9A 2IJJA 1FAFA 3F7VC 4B7EA 1CPYA 1WA8B 4UFZA 4TV9A 4OGQB 4CC5A 4B3SO 5H6QA 5FPOA 1QLEC 2B1GA 1GKFA 2X6AA 3AG4B 2P4VA 3JATB 1Y4MA 3E8FA 4Z2WA 1VQ7V 4X64O 1FXKB 2L35A 3ABKB 1N0JA 1HR0B 1WP8A 3A0HZ 2IU0A 2RQ6A 4GX0A 2JDIG 4PA6A 4JAUA 1QLNA 3JAMN 4LR3A 4PJ0Z 2A79B 4DW1A 2QA4V 2E5LB 2IM9A 2ZQMA 3ZHUA 1AB3A 2HJDA 2YC0A 1XBLA 3THOA 5LHGA 5K1XA 1ZL8B 2ZDIA 4DYLA 5K1PA 3K9AA 1Q3EA 3ZHVA 2WLLA 2ZDIC 4LWSB 4QJFB 2Q7HA 5KHKA 1Z2GA 3CCRV 5JH7B 1YDXA 4X62B 1NI8A 3IC9A 2W6IG 3HPLC 3SJAC 3VQVA 2UXDO 1XHXA 4E4EA 3APQA 1S0VA 2CUGA 2A7WA 4DUZO 4R50A 3EVKA 3KCYA 1D5NA 2DYSB 3JARA 2BCCH 3AK2A 2XAFA 1D5AA 3ZN1A 3LSSA 4MT8A 1P49A 2F43G 4EB6B 3CCMV 5A9GA 3CEIA 1F51A 4U7OA 1KKDA 2KSDA 4LF8O 1VQMV 1PNMA 3BABA 1AJPA 1K5QA 1PP9H 3JSNA 1Q43A 2WA3A 4DV6O 1Y74B 3ETGA 4UV9A 3JD4A 1P7BA 1XNRB 1KKCA 4B3TO 2EIJC 3CHXA 1VQ6V 1YJ9V 3RVZA 1IXBA 4DV7B 4DR1B 2N04A 5JQGB 2UUBB 4JZ2A 1YJWV 2DE0X 3F7YC 3ZJZA 4HNAB 3TXQA 4KHPO 4NXNB 3CCLV 3GB7C 1EN6A 3J80N 4AQYO 1Y6XA 5C8YB 1AR1B 2JK5C 1QR9A 4GLXA 2N74A 3CJHA 2YIAA 1GN2A 4I4TA 3K5MA 2OIEA 4RQEA 4JGSA 4MTGA 5EIBC 3QTCA 5KAIZ 1F7YA 3KCXA 1ROPA 4Q6GA 1Q8IA 1N33B 3CXCU 5IJ9B 5B5EZ 1H8EG 3KZIZ 2LFSA 3N27A 4MVSA 1SA0B 1K4DC 3LSQA 2HJFC 1NTZH 4FPPA 4XBFA 1TUBB 2GSMB 2IH3C 2DW4A 3J81N 2Z0AA 3MHSC 1HNXO 3S3WA 4UXNA 4NYKA 3VQXA 1M57B 3OGCC 1KP2A 4WBNB 4FIPC 3FB8C 4JI4O 4IL6Z 3DXRA 5HFLA 2KG7A 3QO8A 1ZWIC 4WFEA 3CCJV 1K8AW 5IWAO 5EK0A 2ZT9B 2FMLA 1HW7A 4Z1VA 2LW7A 1RM1B 4DK1A 2ITCC 4QPKA 4KP4A 3CS5A 3QNEA 1V55B 2AHYA 4D6TH 3K03A 4B3MB 3OTOB 1PKXA 3QG5A 3RYHA 4BAYA 3OW2U 2NLJC 4CBCA 3RYIA 5LMNB 3CCSV 1YSCA 3ASOC 5LP6B 4O2BA 3LDEA 1JPXA 1THZA 2ZIMA 1HNZB 5L3DA 4UCSA 5GONA 1U97A 4GX2A 1JX9A 3NXSA 3OEEG 3BRCA 3ZMZA 1AILA 3RYCB 1NTMH 5KMGA 1GM8A 1Q86W 4YHHO 4I55B 3K3WA 1SETA 1BHBA 3RBZA 2Q0OC 4LF4O 2HP8A 1MG1A 1PPJH 2F4VO 4G27B 4JZGA 4DR5O 5J2TA 2LQTA 1YJNV 2LW1A 2Q7GA 5BMVB 1KC8W 2HHHB 4NXMO 3CRRA 1HDJA 2G38A 4PDMA 3E35A 1FYJA 4TSFG 1QVGU 2QWPB 3CXHF 2FYUH 4FFKA 3X2QB 4CC6A 3BHPA 4DV0B 2ZM6B 4N23A 3EXAA 4CH5A 2YS8A 1MSDA 4X8AA 3UO2A 3K59A 3IJ4A 2UXCB 1GMGA 4ZI7B 3QO7A 1UJWB 4X20A 3JASB 3LUTB 3W7TA 1N36O 1IBKO 1BSMA 1RSOA 3RGBA 1MABG 5BY1A 3TJTA 3M8AA 1H2MA 4XDJA 1VMGA 5FL7G 3OTFA 4TV8B 4BIZA 1HWYA 3ZRVA 4TOIA 4XDKA 2EILB 2YI9A 1ZTEA 4TQDA 1R6NA 3ETDA 4Q20A 3TXSA 5KLVH 1I0HA 3ZHRA 3P3PA 4JV5B 3JD1A 5JCOA 1DK1A 2XAJA 2HG5C 2Q9LA 3P30A 5BZBA 1XHZA 4WCEV 4FZ0A 3VBBA 1RP3B 2GUZA 5D5PA 3PJSK 2E76B 3R66A 2HVKC 3JD0A 3BFRA 5IY5B 2WLJA 2D3OW 5EZYB 5L3CA 4J7JA 1Q6IA 1N34B 2EIKC 5TISZ 2AHZA 3LNMB 1A32A 2QKSA 2XNDG 4GKKB 4B3RO 4OXSA 2BOCC 2D2CB 1TAEA 1EM1A 2FL4A 2P5OA 3I55V 2ZR3A 4BW9A 3G67A 1K34A 3MDSA 3GVMA
chains in the Genus database with same CATH topology
4MVQA 3ZRWB 1VQNV 4CZZA 1K9MW 1QLEB 4JTAB 2MK3A 1YITV 4P9PA 1COWG 5B1BC 5EBLC 2W6JG 3JYCA 2WLIA 1XL6A 3E89A 4U7NA 2YEVA 4X89A 2DWDC 1GM7A 1ENVA 1NR7A 1QR8A 2LP7A 2OT5A 3SPHA 3TETA 3MHHC 1VQ4V 1PNKA 2WAMA 5IY5C 5DN6G 4G28B 4L87A 1MOFA 5B1AC 1M56C 3ZMSA 4JTDB 1H8HG 3AG2B 2Y69B 5EBWC 5B3SC 2ZXWB 3LDCA 3G4SV 4HYOA 2QE7G 4KFMA 1VQOV 1VQ5V 1VQPV 4WFGA 2IJHA 2EIMC 1R3LC 2P7TC 3T2MA 2Q68A 4PDRA 3E2EA 1YTFD 2UXNA 3SPGA 5B1NA 3T4ZA 3CCEV 3ABMC 5H6RA 3P32A 2H94A 4P9OA 4DXWA 3E8HA 4WF9V 2V1DA 2IJJA 2WLLB 3F7VC 1CPYA 1NBMG 4YXWG 1WPXA 3OMAB 2P90A 5H6QA 2X6BA 1QLEC 1VQLV 1S77D 5KA5A 2B1GA 1GKFA 3RW0A 2X6AA 3AG4B 4XDLA 1W0JG 5B1OA 1Y4MA 1CP9A 3E8FA 1VQ7V 3T1CA 1FXKB 2W0FC 3F5WC 1IXMA 2HLDG 3FB6C 3ABKB 3SPIA 1E79G 1NKDA 4MVUA 1K3EA 2IU0A 4GX0A 5L3GA 2JDIG 3OAAG 2DQ0A 2XAQA 1S5HC 4PA6A 4JAUA 1W0KG 3AG2C 2Y69C 4UUJC 3K08A 2X7RB 1QLNA 2B5UA 2ZXWC 4MW8A 2IJIA 4R6ZA 5EBMC 2A79B 2QA4V 3SYQA 1SERA 2ZQMA 3LDDA 1BL8A 4TWKA 4MTXA 5LHGA 3IC7A 2ZDIA 1E1QG 3K9AA 3SPJA 2WLIB 1K92A 4PA9A 3W7SA 2A9HA 1F4MA 2WLLA 4PDVA 3BEHA 2ZDIC 4R7CA 5IYCO 5GW7A 4QJFB 3CMEV 2DYRB 2EIJB 1AI4A 1M9NA 3CMAV 3W7XA 3D3IA 1DTOA 4JPRA 1SESA 3CCRV 3OMNB 2IH1C 1KQSU 2W6IG 3HPLC 4FMTA 1H2GA 3W7WA 3CCVV 2XASA 1I5YA 3AG4C 3SYAA 2R9RB 1S0VA 1FXKC 2Q6AA 3CC4V 2WWWA 4R50A 3B77A 4RQFA 3AEIA 4JAVA 2DYSB 1TUEB 3ABKC 3ZMUA 5DM6V 3OFNG 4Z1MG 3SYCA 2XAFA 3ZRSA 3ZN1A 2M7WA 3LSSA 5IYDO 4MT8A 4JASA 1NR1A 3FYIB 2F43G 3I56V 3CCMV 1R73A 1NJIW 1F51A 1NH2D 3OMIB 4U7OA 1F4NA 3W7UA 1KKDA 2EZPA 3ABLB 1G8MA 1VQMV 1K7DA 1NVPD 1PNMA 2QTOA 1LNQA 1AJPA 1K5QA 3WG7B 1Q81W 4I5SA 3T4DA 2UXXA 3OR6C 1P4RA 3ETGA 4QIWF 3CCQV 2EZOA 4UV9A 4RUEA 5J9PC 4GX1A 1BMFG 3OR7C 3JD4A 3MD0A 3G71V 3K79A 1B6QA 4MTOA 1P7BA 2B1IA 1RPRA 3GWOA 2DYRC 4RO2A 2EIJC 4GCZA 4QNHB 1VQ6V 1YJ9V 3ASNB 2YSUB 3RVZA 2Z5UA 5C93A 2Q67A 1YJWV 3F7YC 3ZJZA 2EJRA 4F4LA 3CCLV 4JTCB 3GB7C 2NNUA 4H37A 1YHQV 2EINB 4HZ3A 3UKMA 1R3IC 2R9IA 1AR1B 2WPDG 2JK5C 1QR9A 1PL0A 3DGEA 2DYSC 4P2ZA 1SZTA 1YTFB 1YI2V 1PD3A 2DWEC 4RQEA 4JGSA 4LBEC 4MTGA 5CN0A 3EFFK 5LHIA 1ROPA 2GHYA 1JQ0A 3ZRXA 4J9YB 1EFRG 1AJNA 3E83A 5LBQA 3CXCU 2X6CA 3SYOA 1H8EG 3OM3B 2QM7A 3ABLC 5IYBO 2LFSA 3UM7A 3WG7C 1QBZA 2Y48A 1AROP 4MVSA 1K4DC 3LSQA 1GK9A 1H38A 2HJFC 3DTUB 4FPPA 1G4YB 1R3KC 1M90W 1R3JC 3ASOB 4XBFA 5E1AC 4PA4A 2GSMB 2IH3C 1GM9A 2DW4A 1GO3F 3EHBB 4E2LA 4ASUG 3ZN0A 4ZBMA 4BIUA 3STZC 3ASNC 2KB1A 3ETEA 4JYCA 1OZ0A 4MVMA 3MHSC 1M1KW 4UXNA 1Q7YW 4WFBV 1OCRB 3ZMVA 1M57B 3OGCC 2IU3A 1GTOA 1KP2A 3CD6V 2EINC 2ZR2A 4JYBA 4FIPC 5LHHA 3FB8C 5IDJA 3SJQC 3AG1B 5HFLA 3QO8A 1ZWIC 4WFEA 5KUMA 3FB5C 5L3EA 3CPWU 3CCJV 4PA7A 1K8AW 1YTFC 5EK0A 4KUMA 1I5XA 2PI5A 1RM1B 4X88A 1K97A 2ITCC 4QPKA 3HB3B 4J9ZB 3OUSA 3ABTA 2P6JA 1FXVA 3BY6A 4KP4A 2WLNA 3QNEA 1F23A 1V55B 2AHYA 1DF5A 1VQ9V 1N8RW 3B8NA 3K03A 1BHAA 4UVAA 2Z3YA 2HVJC 1PKXA 5CA3A 3TCUA 3E8BA 4LC1A 4RAIA 4BAYA 1FXHA 4LCUC 3OW2U 2DQ3A 2ITDC 2NLJC 4MW3A 4CBCA 3CCSV 3FB7C 1YSCA 3ASOC 5LGUA 2Q69A 2JJ1G 2K1EA 3LDEA 3WFVA 3AG3B 1S72V 1JPXA 1THZA 4RUFA 4UVCA 2LFRA 4FK5C 5L3DA 1OCZB 1QCEA 4R8CA 3E8GA 3ABUA 1S76D 1JCHA 4GX2A 1JX9A 3NXSA 3OEEG 3ZMZA 1K33A 1OCRC 4P30A 1GM8A 1M57C 1Y66A 3JD2A 1Q86W 3K3WA 3A0RA 1SETA 2WLHA 1BHBA 1NH2B 2ZD9A 1KP3A 3K06A 3RBZA 2WLKA 3OE7G 1OHHG 1NVPB 2C2AA 4GT1A 3SYPA 1MG1A 3AG1C 5HFMA 2OCCB 3OEHG 3CC2V 4MVZA 2XAHA 1QVFU 4G27B 1Q82W 3VOUA 2HR3A 2OTLV 1JOYA 1EZJA 3CYOA 1DF4A 1MSWD 1YJNV 1AI7A 4I9WA 1RM1C 1XL4A 4TT3G 4LP8A 1KC8W 1RPOA 1V55C 4JF3A 1AJQA 1KECA 4PDMA 3E35A 3CCUV 4QE9A 4TSFG 1QVGU 2IJKA 1K4CC 4UV8A 1FS0G 3X2QB 2X0LA 4WFAV 3FKSG 4DO2A 4MS2A 2HKOA 1KD1W 2FTKA 1OCCB 1FFTB 1OCOB 1WLEA 2BOBC 3H01A 2A0LA 3AG3C 1DLBA 4N23A 2WLMA 1R6KA 1SRYA 2P67A 1OCZC 4PDLA 4X8AA 3B8MA 4HAMA 3FYEB 2QEXV 4PA3A 1ORQC 4FJCC 4WFFA 4BW5A 1K5SA 1GMGA 1NH2C 2EIKB 2XOKG 3ZRWA 1CEZA 4GX5A 1NVPC 3QO7A 3E86A 3CP1A 1UJWB 2OCCC 2H8PC 4MVRA 4H33A 3LUTB 3W7TA 4PELA 3SPCA 1MABG 5EC2C 3R65A 1JJ2U 4XDJA 3ZIAG 1AI6A 2HFEC 5FL7G 4BIZA 2EBOA 1HWYA 4MSWC 4MVOA 3ZRVA 2JIZG 4XDKA 2EILB 5CBGA 2JEXA 1V54B 3M99B 1K73W 2IW5A 4QE7A 3JCZA 1AI5A 3D36A 3KG2A 5LGTA 3X2QC 1R6NA 3ETDA 5CBFA 4Q20A 5LGNA 1YIJV 3JD1A 2OTJV 2XAJA 3ZCCA 2HG5C 1OCCC 2XAGA 2JJ2G 3P30A 1OCOC 5BZBA 2WSSG 4WCEV 5B1BB 5EC1C 3QO5A 1VQ8V 3VBBA 3IFXA 3PJSK 4UVBA 3RVYA 3TK1A 2QM8A 2HVKC 3JD0A 3G6EV 3K0DA 2YEVB 2CK3G 3ML0A 1E1RG 5CBHA 4QPJA 5IY5B 5L3BA 2WLJA 3K0GA 3ZMTA 3IGAC 2D3OW 5B1AB 1M56B 1W2BU 2PI4A 5L3CA 2V7QG 1L1FA 2EIKC 5B3SB 4EKWA 2AHZA 2JEUA 3LNMB 2QKSA 2XNDG 4N21A 4OXSA 5KUKA 1JVMA 2ATKC 1FXKA 2BOCC 1PNLA 1S3JA 2EIMB 5KA6A 3JD3A 1VQKV 3CC7V 3ABMB 3STLC 1EBOA 3I55V 2ZR3A 3K04A 4ZKIA 2EILC 4G2KA 3OUFA 1V54C 1K34A 5L3FA 4MTFA 1NQTA 5CMUA 4WFHA 5H9CA 1J95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 B;  1NVP C;  1NVP D;  1NH2 C;  1RM1 C;  1YTF C;  5IYD O;  5IYB O;  5IYC O;  1YTF D;  1NH2 D; 
#chains in the Genus database with same CATH topology
 4MVQ A;  4U3J B;  1QLE B;  3Q4H A;  2P06 A;  2ZIN A;  3JAL A;  2W6J G;  2AZ0 A;  1ENV A;  1NR7 A;  1IDS A;  5LYJ A;  1QR8 A;  1VQ4 V;  4K35 A;  2CGO A;  4KXR A;  1B06 A;  5BR8 B;  1MOF A;  2Q4P A;  4CS4 A;  5B3S C;  4X64 B;  4JI8 B;  4DR6 O;  1XMQ O;  4HYO A;  1OV9 A;  1W59 A;  2F93 B;  3T2M A;  3E2E A;  3ETQ A;  2UXN A;  2LJ2 A;  3T4Z A;  5H6R A;  4LF9 O;  4DR4 B;  1SQQ H;  2PYJ A;  1GRJ A;  3P32 A;  2H94 A;  4LF5 O;  2V1D A;  2WLL B;  4GKJ B;  1FKA O;  3JAW B;  4YXW G;  1XI1 A;  4K8X A;  4DR3 O;  5A2Q N;  1S77 D;  3RW0 A;  3UO3 A;  2BSK A;  3T1C A;  1LUW A;  2HLD G;  5L3G A;  3AK3 A;  1Q6H A;  4LFA B;  3DSQ A;  1S5H C;  4O4H B;  4R6Z A;  4ZOL A;  5EBM C;  4FLX A;  4I0X A;  4K0K B;  3SYQ A;  1TVK A;  1RFY A;  3LDD A;  2E3C A;  1XOU A;  3JAK B;  1IZ3 A;  1E1Q G;  3SPJ A;  4IHJ A;  2WLI B;  1K92 A;  3ZS8 C;  1VEW A;  4TUY A;  4R7C A;  3BEH A;  3FAV A;  2BTQ A;  2EIJ B;  1R1B A;  4LF8 B;  1AI4 A;  4DV1 O;  3HKB A;  3CMA V;  3W7X A;  2YDE A;  3BAA A;  2IH1 C;  1L0L H;  4FMT A;  1H2G A;  4JI3 O;  4QGP A;  2XAS A;  1I5Y A;  2Q6A A;  1HNW O;  3AEI A;  5DM6 V;  4JAA A;  4Z1M G;  4KHP B;  2N05 A;  4JAS A;  4GZR B;  4I4T B;  1FJG B;  3I56 V;  1R73 A;  1NJI W;  2ODM A;  4DRX A;  4D7T A;  3B2E E;  1NVP D;  2QTO A;  1Q81 W;  3HR0 A;  4I5S A;  2UXX A;  4OX9 B;  4ZIB A;  2EZO A;  4RUE A;  4GX1 A;  3WB2 A;  4IIJ B;  3G71 V;  3L9D A;  5LMU B;  1RPR A;  3GWO A;  3ZHS A;  2AXT Z;  4X1K B;  5LOV B;  3K5N A;  1FFX B;  4QNH B;  4J11 A;  5KAF Z;  2Z5U A;  4FM1 A;  3L75 H;  1XMO B;  5C93 A;  5CA1 A;  1VF6 C;  3E22 B;  1R3I C;  4YY3 B;  4CH6 A;  2UXB B;  4JI0 O;  1Y67 A;  5KHI A;  2JVD A;  2BTO A;  4DR7 B;  1PD3 A;  3BA8 A;  3DXR B;  4RWU A;  4NB5 A;  2PYL A;  5GTH Z;  2XT9 A;  2VQE B;  1SQB H;  4JI1 B;  5IYZ B;  3ZRX A;  4D7S A;  2XTA A;  1AJN A;  2HEP A;  3E83 A;  2MW2 B;  3SYO A;  3OM3 B;  3N2G A;  5IYB O;  1N0N A;  1Y76 B;  2K9P A;  2P4K A;  3UM7 A;  1G6U A;  3WG7 C;  2GTS A;  1WPB A;  1GK9 A;  1DGS A;  1H38 A;  2GV9 A;  3RYH B;  1G4Y B;  1R3K C;  3ASO B;  3M7M X;  3BA9 A;  1GM9 A;  1X59 A;  3O9O A;  3ZN0 A;  1I94 O;  4BIU A;  3STZ C;  3ASN C;  3ETE A;  4JYC A;  2CE4 A;  1M1K W;  5JVD A;  1ZAU A;  3K9S A;  3ZMV A;  1YZB A;  2IU3 A;  1J5E B;  3CD6 V;  4J7K A;  3H9V A;  2ZR2 A;  5IDJ A;  4JI5 B;  5B66 Z;  5KMG B;  5KX5 B;  3FB5 C;  3CPW U;  4ZHQ B;  1I5X A;  4X88 A;  4FFB A;  3HB3 B;  1URF A;  4I50 B;  2P6J A;  5J2T B;  4LH7 A;  1IBM B;  2GBO A;  1VQ9 V;  3B8N A;  4CS3 A;  4UVA A;  2Z3Y A;  2HVJ C;  3T1H O;  1XNQ O;  1KUQ A;  4LC1 A;  4LCU C;  1M5I A;  4MW3 A;  1IUR A;  1L0N H;  2QM4 A;  3FB7 C;  4X1Y A;  2UUC O;  1MZE A;  3CRC A;  2Q0A A;  1S72 V;  3C3T A;  5LA6 B;  1Z5V A;  2LFR A;  4DR2 B;  1QCE A;  4R8C A;  4LFC B;  3ABU A;  1YXB A;  2UUA B;  2FB5 A;  4JI2 B;  1K33 A;  4P30 A;  2GTA A;  5CA0 B;  2JS3 A;  4X65 O;  2ZD9 A;  3K06 A;  4LFB B;  1XUQ A;  2VWJ A;  2C2A A;  1WNS A;  3SYP A;  4B08 A;  3OEH G;  1NTK H;  3BVO A;  2Q73 A;  2CTR A;  3VOU A;  1JOY A;  1EZJ A;  1DF4 A;  1KBH A;  1MMM A;  4J7Z A;  1RSO B;  1QHT A;  4JF3 A;  4NR1 A;  1KEC A;  3CCU V;  2UU9 B;  4QE9 A;  2Q7E A;  3G80 A;  4CH3 A;  4DV5 O;  4UV8 A;  4C7U A;  1FS0 G;  2X0L A;  3AK1 A;  2HKO A;  3ZX6 A;  1VF7 A;  3WB1 A;  2Y4U A;  1WLE A;  2BOB C;  1NS1 A;  1PL4 A;  2A0L A;  3AG3 C;  1DLB A;  1SRY A;  1IBL O;  1FPO A;  3FYE B;  4JYA O;  3RYF B;  1ORQ C;  4X66 B;  4BW5 A;  2EIK B;  2XOK G;  3ZRW A;  1NVP C;  3E86 A;  3CP1 A;  2H8P C;  2VQF B;  3SPC A;  4TQF A;  3R65 A;  4YJ2 B;  3ZIA G;  1AI6 A;  3HKE B;  2KKW A;  4MVO A;  3APO A;  4W4L A;  1NU1 H;  2JIZ G;  2AW9 A;  5H2F Z;  3M99 B;  4YJ3 A;  3D36 A;  5LGT A;  4LNU B;  5JJN B;  3ZHQ A;  2QWQ B;  1ZX3 A;  3ZCC A;  1OCC C;  2XAG A;  1BCC H;  1OCO C;  1VQ8 V;  5EC1 C;  1XDC A;  3IFX A;  4DV3 B;  4UVB A;  3TK1 A;  5JWP A;  2ZE7 A;  5IJ0 B;  2QTS A;  3F5T A;  2CK3 G;  3ML0 A;  1E1R G;  5CBH A;  3ZMT A;  1W2B U;  2PI4 A;  2CAZ C;  1WA8 A;  5B3S B;  4AIL C;  2AGA A;  1HR0 O;  4N21 A;  3JAT A;  5E79 Z;  5KUK A;  3CE2 A;  2ATK C;  1FXK A;  1N4C A;  3HKC B;  3SDL A;  4I7Z B;  3HKD B;  2WA4 A;  4DV2 B;  3CSX A;  1VQK V;  3H1H H;  1EBO A;  2E5L O;  4ZKI A;  3OUF A;  5ITZ B;  5CMU A;  1VQN V;  1JR9 A;  4CZZ A;  4JTA B;  4YIO A;  2MK3 A;  4UB6 Z;  1CXZ B;  1ZL8 A;  4P9P A;  1VP7 A;  5EBL C;  4F6R B;  4X89 A;  1MZF A;  2PUS A;  2YUA A;  2EUL A;  4X62 O;  1SQG A;  2WAM A;  5B1A C;  3K57 A;  1JA8 A;  1YVW A;  3VQY A;  2ZCE A;  4KFM A;  1VQ5 V;  4ZOL B;  4WFG A;  4YIP A;  1R3L C;  2QWN B;  2QWR B;  2NR5 A;  1YTF D;  1GH6 A;  3CCE V;  2CGN A;  2R70 A;  2A06 H;  4NVP A;  1Q5O A;  3E8H A;  4EB6 A;  4O2A B;  1WPX A;  2BTQ B;  3OMA B;  2X6B A;  4X1I B;  5KA5 A;  2YXY A;  1XNR O;  4XDL A;  3L73 H;  1W0J G;  3C3S A;  1Y74 A;  2ZE6 A;  3B4S A;  2W0F C;  3F5W C;  4DV7 O;  4DR1 O;  1E79 G;  2UUB O;  1BE3 H;  2VRZ A;  3OAA G;  3N2K B;  5DED A;  4NXN O;  4DUY B;  2GDS A;  5JQG A;  4UUJ C;  2Y69 C;  3K08 A;  2X7R B;  2IJI A;  4HNA A;  3UCS C;  4O4L B;  2DN9 A;  5JCO C;  5C8Y A;  3BPZ A;  3IC7 A;  3D3Q A;  2PF4 E;  2DMX A;  5EYP B;  4PA9 A;  1N32 B;  3W7S A;  2PY5 A;  1F4M A;  2E75 B;  4PDV A;  1N33 O;  5GW7 A;  4JYY A;  3CME V;  1L8D A;  1YEW A;  5KHJ A;  1M9N A;  4UCT A;  3A0B Z;  1DTO A;  1SES A;  4LH6 A;  3OMN B;  4JI6 B;  2Q5Z A;  1FD9 A;  1LUV A;  3QF7 A;  1KQS U;  4UCR A;  4O4J B;  1AVM A;  3CCV V;  1SA0 A;  4DV4 B;  1MNG A;  5CA1 B;  4PHZ A;  2WWW A;  4JI7 B;  3B77 A;  4RQF A;  1TUB A;  1TUE B;  3ZMU A;  4HBN A;  3ZRS A;  2M7W A;  1JMK C;  3GWK C;  3K58 A;  1NR1 A;  4FLW A;  4JI0 B;  1NH2 D;  1F4N A;  4WBN A;  3W7U A;  4LF7 B;  4TV9 B;  1EN4 A;  1K7D A;  1LNQ A;  3WG7 B;  3T4D A;  4IT5 A;  4QIW F;  3CCQ V;  3RT3 C;  4B3S B;  3OR7 C;  3K79 A;  2IBZ H;  2DYR C;  4B3M O;  3OTO O;  2ADP A;  3ASN B;  2YSU B;  2YXL A;  4J41 A;  3SJC C;  4H0L B;  2OWO A;  4FLU A;  3H1J H;  1XEQ A;  2R72 A;  4JTC B;  1YHQ V;  4H37 A;  5JVD B;  4FLV A;  2R9I A;  3AG7 A;  1WB7 A;  2WPD G;  1HNZ O;  3T1Y O;  4K3A A;  5LP6 A;  2CTP A;  2RNB A;  4P2Z A;  1KU9 A;  1YI2 V;  5H5N A;  5IT9 N;  4LBE C;  1AP5 A;  3RYC A;  1EFR G;  2OCH A;  5LBQ A;  2QGN A;  2QM7 A;  3ABL C;  3I5D A;  1VF5 B;  5JJJ B;  1QBZ A;  2Y48 A;  1ARO P;  3DTU B;  2HHH O;  1D2D A;  1AP6 A;  1M90 W;  1WB8 A;  1R3J C;  3JAR B;  3CB2 A;  3EHB B;  1R6T A;  2UXD B;  5BMV A;  4ZBM A;  4DUZ B;  2KB1 A;  1Q7Y W;  3L72 H;  4DV0 O;  2EIN C;  2ZM6 O;  2YIB A;  4BR6 A;  1XRE A;  5L3E A;  4PA7 A;  3JCU Z;  1YTF C;  4KUM A;  3SJB C;  2DOS A;  2QKA A;  1K97 A;  2UXC O;  1MA1 A;  2XHB A;  4LF6 O;  4DW0 A;  2YIC A;  4DV6 B;  3OUS A;  1GN3 A;  3BY6 A;  2EX3 A;  1G1X B;  1SQP H;  2JRI A;  3U10 A;  1N8R W;  1H2L A;  4B3T B;  3TCU A;  1FXH A;  4PI2 A;  4BIO A;  1IX9 A;  2DQ3 A;  2ITD C;  2JS5 A;  1O9H A;  5J2U A;  5LGU A;  4W4K A;  2Q69 A;  2JJ1 G;  2K1E A;  3CJH B;  3AG3 B;  4AQY B;  4UVC A;  1U96 A;  4TV8 A;  4FK5 C;  3IAY A;  2CTW A;  5LL6 Y;  3E8G A;  2M6Y A;  4JV5 O;  1OCR C;  1SQX H;  3A0R A;  4AI8 A;  2ETN A;  1KP3 A;  3OE7 G;  1OHH G;  1NVP B;  3AG1 C;  3CC2 V;  4MVZ A;  2XAH A;  1QVF U;  2B9Z A;  2OTL V;  2CDY A;  3CYO A;  1GN6 A;  1AI7 A;  2FKX A;  1XL4 A;  4TT3 G;  1SF9 A;  1N34 O;  1Q6U A;  1RPO A;  1JFF A;  1AJQ A;  1JJO A;  2Y0P A;  5EZY A;  1K4C C;  4WFA V;  1HNX B;  2KQX A;  3FKS G;  4DO2 A;  4MS2 A;  2CH7 A;  1KD1 W;  2FTK A;  1OCC B;  2KG7 B;  1OCO B;  4EEQ A;  1GAX A;  4JI4 B;  2P67 A;  1OCZ C;  4PDL A;  3B8M A;  2DJV A;  2W0X A;  5IWA B;  3L71 H;  4PA3 A;  2VWK A;  4FJC C;  4FZ1 A;  3O65 A;  1NH2 C;  2NN4 A;  4U3J A;  1WJZ A;  2ZIO A;  5KHG A;  2OCC C;  4H33 A;  4KL1 A;  5JJE B;  1VAR A;  3RYI B;  2A3Q A;  4O2B B;  5BR8 O;  2QKC A;  1JJ2 U;  1SKV A;  2P22 C;  2HFE C;  4J80 A;  4JI8 O;  2EBO A;  1GN4 A;  2PGG A;  4MSW C;  5GON B;  1US6 A;  2PZS A;  2L6L A;  4QE7 A;  1AI5 A;  3KG2 A;  2ZKO A;  1KYO F;  5CBF A;  1YIJ V;  4DR4 O;  1ZLZ A;  2JJ2 G;  1NZ6 A;  4YHH B;  1M4U A;  2WSS G;  3B40 A;  3P3N A;  3RVY A;  4LF4 B;  4GKJ O;  5FNV A;  2QM8 A;  2F4V B;  3G6E V;  2OYQ A;  4DR5 B;  4QPJ A;  5L3B A;  3S3X A;  3JAW A;  3IGA C;  3FX7 A;  5B1A B;  2V7Q G;  1KMI Z;  2LGW A;  4NXM B;  2JEU A;  5CB4 A;  4IYH A;  1JVM A;  1S3J A;  1I08 A;  4LFA O;  5KA6 A;  1IVS A;  3JD3 A;  3CC7 V;  1B3Q A;  2JGU A;  2JGD A;  4K0K O;  4G2K A;  1BZK A;  1V54 C;  4O4H A;  1B04 A;  1UPG A;  5L3F A;  4MTF A;  1NQT A;  5H9C A;  1X4T A;  4FVM A;  1K9M W;  1Q90 D;  3JAK A;  4X20 B;  4O4I A;  4H13 B;  5B1B C;  2WLI A;  4U7N A;  2Y4T A;  2YEV A;  2DWD C;  3H1L H;  4PD4 F;  4NTW A;  2LP7 A;  1N36 B;  2LGQ A;  1IBK B;  4B7K A;  2OT5 A;  3SPH A;  1EZV H;  1WN7 A;  4L87 A;  4A5U B;  1M56 C;  1V9P A;  1TA8 A;  4JTD B;  1H8H G;  2Y69 B;  2EJ7 A;  3LDC A;  3G4S V;  1BQ0 A;  2QE7 G;  3WU2 Z;  2RJZ A;  1VQP V;  2EIM C;  2Q8V A;  2GUZ B;  3SPG A;  5B1N A;  1FJG O;  3ABM C;  1QU7 A;  2XUM A;  3OGI B;  4P9O A;  4PV1 B;  2ZE5 A;  1NBM G;  4OX9 O;  2P90 A;  4NTY A;  1VQL V;  1H2S B;  4IYI A;  5LMU O;  3K5O A;  5B1O A;  1CP9 A;  2QJ1 A;  4IIJ A;  1IXM A;  2ZNI A;  2RCV A;  3FB6 C;  3SPI A;  1XMO O;  1NKD A;  2VS0 A;  4MVU A;  4X1K A;  1K3E A;  5LOV A;  4B3R B;  1FFX A;  2DQ0 A;  2XAQ A;  5LXT A;  4YY3 O;  1W0K G;  1ZSP A;  3AG2 C;  2UXB O;  3D36 C;  2B5U A;  2ZXW C;  4MW8 A;  3CWB H;  4DR7 O;  3E22 A;  1SER A;  4GUN A;  1BL8 A;  2RMK B;  4MTX A;  4TWK A;  3Q4H B;  4OPA A;  2VQE O;  3JAL B;  4JI1 O;  3UT5 A;  2A9H A;  2ILM A;  5IYC O;  5LYJ B;  2DYR B;  3H1K H;  5IYZ A;  3D3I A;  4JPR A;  1AR4 A;  2V4D A;  1Y76 A;  3W7W A;  2YI8 A;  3AG4 C;  3SYA A;  2R9R B;  1S5J A;  1FXK C;  3CC4 V;  4GYC B;  4DR6 B;  4JAV A;  1XMQ B;  3ABK C;  4PI0 A;  3OFN G;  3U11 A;  3SYC A;  1J5E O;  5IYD O;  3FYI B;  4JI5 O;  3T1Y B;  5BXZ A;  4LF9 B;  1PV0 A;  3OMI B;  4ABM A;  2EZP A;  4LF5 B;  3ABL B;  1G8M A;  4IGG A;  5D5Q A;  5KX5 A;  2BSK B;  3OR6 C;  1P4R A;  1VIB A;  4LWS A;  4ZHQ A;  4DR3 B;  1WAZ A;  5J9P C;  1BMF G;  1IBM O;  3B09 A;  3MD0 A;  1B6Q A;  2ADQ B;  4MTO A;  2B1I A;  4RO2 A;  5JH7 A;  1KB9 F;  4I50 A;  4GCZ A;  1S5L Z;  5F2V O;  2Q67 A;  2EJR A;  4I0X B;  4F4L A;  2NNU A;  2EIN B;  2YIB D;  4HZ3 A;  3UKM A;  1TVK B;  2BE3 A;  3BCC H;  2R9A A;  3DC6 A;  1PL0 A;  1SQV H;  3DGE A;  4DR2 O;  2DYS C;  3OD4 A;  4LFC O;  1SZT A;  4IHJ B;  2UUA O;  1YTF B;  4JI2 O;  3PN1 A;  4TUY B;  2DWE C;  5LA6 A;  5CN0 A;  3ZHT A;  3FAV B;  1BGY H;  3SR2 C;  3EFF K;  5LHI A;  4LFB O;  3HKB B;  2GHY A;  1JQ0 A;  4J9Y B;  5CA0 A;  2X6C A;  2ZE8 A;  4UCO A;  1H2N A;  1BT8 A;  4DV1 B;  4J10 A;  4I9Q A;  4LF6 B;  3L70 H;  3LNN A;  4JI3 B;  5E1A C;  4PA4 A;  2UU9 O;  1GO3 F;  4K8Z A;  4E2L A;  4ASU G;  5J2U B;  1Z5W A;  1HNW B;  4MVM A;  1OZ0 A;  2QSA A;  4OPH A;  3QVN A;  1QQC A;  4WFB V;  1OCR B;  2CTQ A;  1GTO A;  4DRX B;  2O57 A;  4JYB A;  5LHH A;  5AG2 A;  1BQZ A;  2H3O A;  3SJQ C;  3AG1 B;  5KUM A;  3H1I H;  3JSL A;  4UB8 Z;  1YF2 A;  3A8T A;  5DEC A;  4AHC A;  4X66 O;  2PI5 A;  2RDC A;  1I7F A;  5IJ9 A;  4J9Z B;  1NT2 B;  3ABT A;  2QDO A;  1FXV A;  2WLN A;  1F23 A;  1DF5 A;  3RYF A;  1BHA A;  3MAQ A;  2VQF O;  5CA3 A;  3E8B A;  4RAI A;  1JFF B;  1EN5 A;  2F66 C;  3OT7 A;  3CRM A;  4YJ2 A;  2CH7 B;  3WFV A;  1M93 A;  4RUF A;  3A2F A;  3HKE A;  3K5L A;  1OCZ B;  4NKG B;  1S76 D;  4H44 B;  1JCH A;  3J7A U;  1BS3 A;  3KKY A;  4FLT A;  1M57 C;  1Y66 A;  3JD2 A;  4LNU A;  2WLH A;  1NH2 B;  5GTI Z;  2AZ2 A;  3N2G B;  2WLK A;  4F6E A;  4DV3 O;  3WB0 A;  4GT1 A;  5HFM A;  2OCC B;  2RN9 A;  2PTM A;  1SS3 A;  1Q82 W;  2HR3 A;  1UFI A;  1MSW D;  4I9W A;  1RM1 C;  4BWA A;  1P7G A;  4LP8 A;  5IJ0 A;  5LMN O;  1V55 C;  1SC5 B;  1SZX A;  2IJK A;  3UQ8 A;  1I94 B;  1TGO A;  4DV2 O;  1H2K A;  4EFE A;  3CRQ A;  2F23 A;  1FFT B;  5LP6 C;  1QNM A;  3HKC A;  2LO1 A;  3HKD A;  3H01 A;  3C90 A;  4L8J A;  2WLM A;  1R6K A;  4U3F H;  4FFB B;  4I55 A;  4NTX A;  3G6B A;  4HAM A;  2QEX V;  5ITZ A;  4WFF A;  1K5S A;  5FNV B;  2QWO B;  5IE9 A;  1CEZ A;  4X9Q A;  4GX5 A;  4CH4 A;  3DC5 A;  4MVR A;  3FD9 A;  4PEL A;  3T1H B;  1XNQ B;  3CX5 F;  4EFB A;  4F6R A;  5CB4 B;  4X1Y B;  2F1M A;  5EC2 C;  2YID A;  3D8C A;  5KHH A;  2UUC B;  3TGU H;  2JEX A;  5CBG A;  4FM0 A;  1V54 B;  1K73 W;  2IW5 A;  3JCZ A;  2JGD B;  1ZUQ A;  3X2Q C;  3SGI A;  5LGN A;  4ICG A;  1AR5 A;  2OTJ V;  1OJH A;  1T5E A;  4X65 B;  5B1B B;  3QO5 A;  3ZED A;  4CS2 A;  4O4I B;  3K0D A;  2YEV B;  4ZI7 A;  2YXH A;  3K0G A;  4O2A A;  1M56 B;  4UCU A;  3JAS A;  1L1F A;  2ARH A;  4EKW A;  3RWR D;  4X1I A;  4FM2 A;  2Y0I A;  4DV5 B;  1PNL A;  1SQF A;  2EIM B;  3NR7 A;  4DUY O;  2ZNJ A;  3L74 H;  1XIL A;  3ICX A;  3ABM B;  3STL C;  5EIB D;  3N2K A;  3K04 A;  4FLY A;  2EIL C;  1O9G A;  1IBL B;  4WFH A;  4O4L A;  1J95 A;  1N32 O;  3ZRW B;  4JYA B;  1HP8 A;  3RN4 A;  1YIT V;  5FPR A;  1COW G;  5EYP A;  3JYC A;  2F95 B;  1XL6 A;  3E89 A;  1YCI A;  3LSU A;  1GM7 A;  2E74 B;  4JI6 O;  4DK0 A;  4GKK O;  5FLX N;  1LR1 A;  3TET A;  3MHH C;  3FFQ A;  1PNK A;  5IY5 C;  5DN6 G;  4G28 B;  4DV4 O;  2OIG A;  3ZMS A;  3AG2 B;  5EBW C;  4YJ3 B;  2ZXW B;  4J42 A;  4JI7 O;  4O4J A;  4UCV A;  1VF6 A;  3ZBH A;  5LXT B;  3U0Z A;  4FLZ A;  1VQO V;  1P84 F;  2IJH A;  2P7T C;  3VQW A;  1WP7 A;  2Q68 A;  4PDR A;  1XQ8 A;  2QR4 A;  3CRA A;  3RFR A;  4DXW A;  4LF7 O;  4WF9 V;  3UT5 B;  1PM9 A;  2IJJ A;  1FAF A;  3F7V C;  4B7E A;  1CPY A;  1WA8 B;  4UFZ A;  4TV9 A;  4OGQ B;  4CC5 A;  4B3S O;  5H6Q A;  5FPO A;  1QLE C;  2B1G A;  1GKF A;  2X6A A;  3AG4 B;  2P4V A;  3JAT B;  1Y4M A;  3E8F A;  4Z2W A;  1VQ7 V;  4X64 O;  1FXK B;  2L35 A;  3ABK B;  1N0J A;  1HR0 B;  1WP8 A;  3A0H Z;  2IU0 A;  2RQ6 A;  4GX0 A;  2JDI G;  4PA6 A;  4JAU A;  1QLN A;  3JAM N;  4LR3 A;  4PJ0 Z;  2A79 B;  4DW1 A;  2QA4 V;  2E5L B;  2IM9 A;  2ZQM A;  3ZHU A;  1AB3 A;  2HJD A;  2YC0 A;  1XBL A;  3THO A;  5LHG A;  5K1X A;  1ZL8 B;  2ZDI A;  4DYL A;  5K1P A;  3K9A A;  1Q3E A;  3ZHV A;  2WLL A;  2ZDI C;  4LWS B;  4QJF B;  2Q7H A;  5KHK A;  1Z2G A;  3CCR V;  5JH7 B;  1YDX A;  4X62 B;  1NI8 A;  3IC9 A;  2W6I G;  3HPL C;  3SJA C;  3VQV A;  2UXD O;  1XHX A;  4E4E A;  3APQ A;  1S0V A;  2CUG A;  2A7W A;  4DUZ O;  4R50 A;  3EVK A;  3KCY A;  1D5N A;  2DYS B;  3JAR A;  2BCC H;  3AK2 A;  2XAF A;  1D5A A;  3ZN1 A;  3LSS A;  4MT8 A;  1P49 A;  2F43 G;  4EB6 B;  3CCM V;  5A9G A;  3CEI A;  1F51 A;  4U7O A;  1KKD A;  2KSD A;  4LF8 O;  1VQM V;  1PNM A;  3BAB A;  1AJP A;  1K5Q A;  1PP9 H;  3JSN A;  1Q43 A;  2WA3 A;  4DV6 O;  1Y74 B;  3ETG A;  4UV9 A;  3JD4 A;  1P7B A;  1XNR B;  1KKC A;  4B3T O;  2EIJ C;  3CHX A;  1VQ6 V;  1YJ9 V;  3RVZ A;  1IXB A;  4DV7 B;  4DR1 B;  2N04 A;  5JQG B;  2UUB B;  4JZ2 A;  1YJW V;  2DE0 X;  3F7Y C;  3ZJZ A;  4HNA B;  3TXQ A;  4KHP O;  4NXN B;  3CCL V;  3GB7 C;  1EN6 A;  3J80 N;  4AQY O;  1Y6X A;  5C8Y B;  1AR1 B;  2JK5 C;  1QR9 A;  4GLX A;  2N74 A;  3CJH A;  2YIA A;  1GN2 A;  4I4T A;  3K5M A;  2OIE A;  4RQE A;  4JGS A;  4MTG A;  5EIB C;  3QTC A;  5KAI Z;  1F7Y A;  3KCX A;  1ROP A;  4Q6G A;  1Q8I A;  1N33 B;  3CXC U;  5IJ9 B;  5B5E Z;  1H8E G;  3KZI Z;  2LFS A;  3N27 A;  4MVS A;  1SA0 B;  1K4D C;  3LSQ A;  2HJF C;  1NTZ H;  4FPP A;  4XBF A;  1TUB B;  2GSM B;  2IH3 C;  2DW4 A;  3J81 N;  2Z0A A;  3MHS C;  1HNX O;  3S3W A;  4UXN A;  4NYK A;  3VQX A;  1M57 B;  3OGC C;  1KP2 A;  4WBN B;  4FIP C;  3FB8 C;  4JI4 O;  4IL6 Z;  3DXR A;  5HFL A;  2KG7 A;  3QO8 A;  1ZWI C;  4WFE A;  3CCJ V;  1K8A W;  5IWA O;  5EK0 A;  2ZT9 B;  2FML A;  1HW7 A;  4Z1V A;  2LW7 A;  1RM1 B;  4DK1 A;  2ITC C;  4QPK A;  4KP4 A;  3CS5 A;  3QNE A;  1V55 B;  2AHY A;  4D6T H;  3K03 A;  4B3M B;  3OTO B;  1PKX A;  3QG5 A;  3RYH A;  4BAY A;  3OW2 U;  2NLJ C;  4CBC A;  3RYI A;  5LMN B;  3CCS V;  1YSC A;  3ASO C;  5LP6 B;  4O2B A;  3LDE A;  1JPX A;  1THZ A;  2ZIM A;  1HNZ B;  5L3D A;  4UCS A;  5GON A;  1U97 A;  4GX2 A;  1JX9 A;  3NXS A;  3OEE G;  3BRC A;  3ZMZ A;  1AIL A;  3RYC B;  1NTM H;  5KMG A;  1GM8 A;  1Q86 W;  4YHH O;  4I55 B;  3K3W A;  1SET A;  1BHB A;  3RBZ A;  2Q0O C;  4LF4 O;  2HP8 A;  1MG1 A;  1PPJ H;  2F4V O;  4G27 B;  4JZG A;  4DR5 O;  5J2T A;  2LQT A;  1YJN V;  2LW1 A;  2Q7G A;  5BMV B;  1KC8 W;  2HHH B;  4NXM O;  3CRR A;  1HDJ A;  2G38 A;  4PDM A;  3E35 A;  1FYJ A;  4TSF G;  1QVG U;  2QWP B;  3CXH F;  2FYU H;  4FFK A;  3X2Q B;  4CC6 A;  3BHP A;  4DV0 B;  2ZM6 B;  4N23 A;  3EXA A;  4CH5 A;  2YS8 A;  1MSD A;  4X8A A;  3UO2 A;  3K59 A;  3IJ4 A;  2UXC B;  1GMG A;  4ZI7 B;  3QO7 A;  1UJW B;  4X20 A;  3JAS B;  3LUT B;  3W7T A;  1N36 O;  1IBK O;  1BSM A;  1RSO A;  3RGB A;  1MAB G;  5BY1 A;  3TJT A;  3M8A A;  1H2M A;  4XDJ A;  1VMG A;  5FL7 G;  3OTF A;  4TV8 B;  4BIZ A;  1HWY A;  3ZRV A;  4TOI A;  4XDK A;  2EIL B;  2YI9 A;  1ZTE A;  4TQD A;  1R6N A;  3ETD A;  4Q20 A;  3TXS A;  5KLV H;  1I0H A;  3ZHR A;  3P3P A;  4JV5 B;  3JD1 A;  5JCO A;  1DK1 A;  2XAJ A;  2HG5 C;  2Q9L A;  3P30 A;  5BZB A;  1XHZ A;  4WCE V;  4FZ0 A;  3VBB A;  1RP3 B;  2GUZ A;  5D5P A;  3PJS K;  2E76 B;  3R66 A;  2HVK C;  3JD0 A;  3BFR A;  5IY5 B;  2WLJ A;  2D3O W;  5EZY B;  5L3C A;  4J7J A;  1Q6I A;  1N34 B;  2EIK C;  5TIS Z;  2AHZ A;  3LNM B;  1A32 A;  2QKS A;  2XND G;  4GKK B;  4B3R O;  4OXS A;  2BOC C;  2D2C B;  1TAE A;  1EM1 A;  2FL4 A;  2P5O A;  3I55 V;  2ZR3 A;  4BW9 A;  3G67 A;  1K34 A;  3MDS A;  3GVM A; 
#chains in the Genus database with same CATH homology
 4MVQ A;  3ZRW B;  1VQN V;  4CZZ A;  1K9M W;  1QLE B;  4JTA B;  2MK3 A;  1YIT V;  4P9P A;  1COW G;  5B1B C;  5EBL C;  2W6J G;  3JYC A;  2WLI A;  1XL6 A;  3E89 A;  4U7N A;  2YEV A;  4X89 A;  2DWD C;  1GM7 A;  1ENV A;  1NR7 A;  1QR8 A;  2LP7 A;  2OT5 A;  3SPH A;  3TET A;  3MHH C;  1VQ4 V;  1PNK A;  2WAM A;  5IY5 C;  5DN6 G;  4G28 B;  4L87 A;  1MOF A;  5B1A C;  1M56 C;  3ZMS A;  4JTD B;  1H8H G;  3AG2 B;  2Y69 B;  5EBW C;  5B3S C;  2ZXW B;  3LDC A;  3G4S V;  4HYO A;  2QE7 G;  4KFM A;  1VQO V;  1VQ5 V;  1VQP V;  4WFG A;  2IJH A;  2EIM C;  1R3L C;  2P7T C;  3T2M A;  2Q68 A;  4PDR A;  3E2E A;  1YTF D;  2UXN A;  3SPG A;  5B1N A;  3T4Z A;  3CCE V;  3ABM C;  5H6R A;  3P32 A;  2H94 A;  4P9O A;  4DXW A;  3E8H A;  4WF9 V;  2V1D A;  2IJJ A;  2WLL B;  3F7V C;  1CPY A;  1NBM G;  4YXW G;  1WPX A;  3OMA B;  2P90 A;  5H6Q A;  2X6B A;  1QLE C;  1VQL V;  1S77 D;  5KA5 A;  2B1G A;  1GKF A;  3RW0 A;  2X6A A;  3AG4 B;  4XDL A;  1W0J G;  5B1O A;  1Y4M A;  1CP9 A;  3E8F A;  1VQ7 V;  3T1C A;  1FXK B;  2W0F C;  3F5W C;  1IXM A;  2HLD G;  3FB6 C;  3ABK B;  3SPI A;  1E79 G;  1NKD A;  4MVU A;  1K3E A;  2IU0 A;  4GX0 A;  5L3G A;  2JDI G;  3OAA G;  2DQ0 A;  2XAQ A;  1S5H C;  4PA6 A;  4JAU A;  1W0K G;  3AG2 C;  2Y69 C;  4UUJ C;  3K08 A;  2X7R B;  1QLN A;  2B5U A;  2ZXW C;  4MW8 A;  2IJI A;  4R6Z A;  5EBM C;  2A79 B;  2QA4 V;  3SYQ A;  1SER A;  2ZQM A;  3LDD A;  1BL8 A;  4TWK A;  4MTX A;  5LHG A;  3IC7 A;  2ZDI A;  1E1Q G;  3K9A A;  3SPJ A;  2WLI B;  1K92 A;  4PA9 A;  3W7S A;  2A9H A;  1F4M A;  2WLL A;  4PDV A;  3BEH A;  2ZDI C;  4R7C A;  5IYC O;  5GW7 A;  4QJF B;  3CME V;  2DYR B;  2EIJ B;  1AI4 A;  1M9N A;  3CMA V;  3W7X A;  3D3I A;  1DTO A;  4JPR A;  1SES A;  3CCR V;  3OMN B;  2IH1 C;  1KQS U;  2W6I G;  3HPL C;  4FMT A;  1H2G A;  3W7W A;  3CCV V;  2XAS A;  1I5Y A;  3AG4 C;  3SYA A;  2R9R B;  1S0V A;  1FXK C;  2Q6A A;  3CC4 V;  2WWW A;  4R50 A;  3B77 A;  4RQF A;  3AEI A;  4JAV A;  2DYS B;  1TUE B;  3ABK C;  3ZMU A;  5DM6 V;  3OFN G;  4Z1M G;  3SYC A;  2XAF A;  3ZRS A;  3ZN1 A;  2M7W A;  3LSS A;  5IYD O;  4MT8 A;  4JAS A;  1NR1 A;  3FYI B;  2F43 G;  3I56 V;  3CCM V;  1R73 A;  1NJI W;  1F51 A;  1NH2 D;  3OMI B;  4U7O A;  1F4N A;  3W7U A;  1KKD A;  2EZP A;  3ABL B;  1G8M A;  1VQM V;  1K7D A;  1NVP D;  1PNM A;  2QTO A;  1LNQ A;  1AJP A;  1K5Q A;  3WG7 B;  1Q81 W;  4I5S A;  3T4D A;  2UXX A;  3OR6 C;  1P4R A;  3ETG A;  4QIW F;  3CCQ V;  2EZO A;  4UV9 A;  4RUE A;  5J9P C;  4GX1 A;  1BMF G;  3OR7 C;  3JD4 A;  3MD0 A;  3G71 V;  3K79 A;  1B6Q A;  4MTO A;  1P7B A;  2B1I A;  1RPR A;  3GWO A;  2DYR C;  4RO2 A;  2EIJ C;  4GCZ A;  4QNH B;  1VQ6 V;  1YJ9 V;  3ASN B;  2YSU B;  3RVZ A;  2Z5U A;  5C93 A;  2Q67 A;  1YJW V;  3F7Y C;  3ZJZ A;  2EJR A;  4F4L A;  3CCL V;  4JTC B;  3GB7 C;  2NNU A;  4H37 A;  1YHQ V;  2EIN B;  4HZ3 A;  3UKM A;  1R3I C;  2R9I A;  1AR1 B;  2WPD G;  2JK5 C;  1QR9 A;  1PL0 A;  3DGE A;  2DYS C;  4P2Z A;  1SZT A;  1YTF B;  1YI2 V;  1PD3 A;  2DWE C;  4RQE A;  4JGS A;  4LBE C;  4MTG A;  5CN0 A;  3EFF K;  5LHI A;  1ROP A;  2GHY A;  1JQ0 A;  3ZRX A;  4J9Y B;  1EFR G;  1AJN A;  3E83 A;  5LBQ A;  3CXC U;  2X6C A;  3SYO A;  1H8E G;  3OM3 B;  2QM7 A;  3ABL C;  5IYB O;  2LFS A;  3UM7 A;  3WG7 C;  1QBZ A;  2Y48 A;  1ARO P;  4MVS A;  1K4D C;  3LSQ A;  1GK9 A;  1H38 A;  2HJF C;  3DTU B;  4FPP A;  1G4Y B;  1R3K C;  1M90 W;  1R3J C;  3ASO B;  4XBF A;  5E1A C;  4PA4 A;  2GSM B;  2IH3 C;  1GM9 A;  2DW4 A;  1GO3 F;  3EHB B;  4E2L A;  4ASU G;  3ZN0 A;  4ZBM A;  4BIU A;  3STZ C;  3ASN C;  2KB1 A;  3ETE A;  4JYC A;  1OZ0 A;  4MVM A;  3MHS C;  1M1K W;  4UXN A;  1Q7Y W;  4WFB V;  1OCR B;  3ZMV A;  1M57 B;  3OGC C;  2IU3 A;  1GTO A;  1KP2 A;  3CD6 V;  2EIN C;  2ZR2 A;  4JYB A;  4FIP C;  5LHH A;  3FB8 C;  5IDJ A;  3SJQ C;  3AG1 B;  5HFL A;  3QO8 A;  1ZWI C;  4WFE A;  5KUM A;  3FB5 C;  5L3E A;  3CPW U;  3CCJ V;  4PA7 A;  1K8A W;  1YTF C;  5EK0 A;  4KUM A;  1I5X A;  2PI5 A;  1RM1 B;  4X88 A;  1K97 A;  2ITC C;  4QPK A;  3HB3 B;  4J9Z B;  3OUS A;  3ABT A;  2P6J A;  1FXV A;  3BY6 A;  4KP4 A;  2WLN A;  3QNE A;  1F23 A;  1V55 B;  2AHY A;  1DF5 A;  1VQ9 V;  1N8R W;  3B8N A;  3K03 A;  1BHA A;  4UVA A;  2Z3Y A;  2HVJ C;  1PKX A;  5CA3 A;  3TCU A;  3E8B A;  4LC1 A;  4RAI A;  4BAY A;  1FXH A;  4LCU C;  3OW2 U;  2DQ3 A;  2ITD C;  2NLJ C;  4MW3 A;  4CBC A;  3CCS V;  3FB7 C;  1YSC A;  3ASO C;  5LGU A;  2Q69 A;  2JJ1 G;  2K1E A;  3LDE A;  3WFV A;  3AG3 B;  1S72 V;  1JPX A;  1THZ A;  4RUF A;  4UVC A;  2LFR A;  4FK5 C;  5L3D A;  1OCZ B;  1QCE A;  4R8C A;  3E8G A;  3ABU A;  1S76 D;  1JCH A;  4GX2 A;  1JX9 A;  3NXS A;  3OEE G;  3ZMZ A;  1K33 A;  1OCR C;  4P30 A;  1GM8 A;  1M57 C;  1Y66 A;  3JD2 A;  1Q86 W;  3K3W A;  3A0R A;  1SET A;  2WLH A;  1BHB A;  1NH2 B;  2ZD9 A;  1KP3 A;  3K06 A;  3RBZ A;  2WLK A;  3OE7 G;  1OHH G;  1NVP B;  2C2A A;  4GT1 A;  3SYP A;  1MG1 A;  3AG1 C;  5HFM A;  2OCC B;  3OEH G;  3CC2 V;  4MVZ A;  2XAH A;  1QVF U;  4G27 B;  1Q82 W;  3VOU A;  2HR3 A;  2OTL V;  1JOY A;  1EZJ A;  3CYO A;  1DF4 A;  1MSW D;  1YJN V;  1AI7 A;  4I9W A;  1RM1 C;  1XL4 A;  4TT3 G;  4LP8 A;  1KC8 W;  1RPO A;  1V55 C;  4JF3 A;  1AJQ A;  1KEC A;  4PDM A;  3E35 A;  3CCU V;  4QE9 A;  4TSF G;  1QVG U;  2IJK A;  1K4C C;  4UV8 A;  1FS0 G;  3X2Q B;  2X0L A;  4WFA V;  3FKS G;  4DO2 A;  4MS2 A;  2HKO A;  1KD1 W;  2FTK A;  1OCC B;  1FFT B;  1OCO B;  1WLE A;  2BOB C;  3H01 A;  2A0L A;  3AG3 C;  1DLB A;  4N23 A;  2WLM A;  1R6K A;  1SRY A;  2P67 A;  1OCZ C;  4PDL A;  4X8A A;  3B8M A;  4HAM A;  3FYE B;  2QEX V;  4PA3 A;  1ORQ C;  4FJC C;  4WFF A;  4BW5 A;  1K5S A;  1GMG A;  1NH2 C;  2EIK B;  2XOK G;  3ZRW A;  1CEZ A;  4GX5 A;  1NVP C;  3QO7 A;  3E86 A;  3CP1 A;  1UJW B;  2OCC C;  2H8P C;  4MVR A;  4H33 A;  3LUT B;  3W7T A;  4PEL A;  3SPC A;  1MAB G;  5EC2 C;  3R65 A;  1JJ2 U;  4XDJ A;  3ZIA G;  1AI6 A;  2HFE C;  5FL7 G;  4BIZ A;  2EBO A;  1HWY A;  4MSW C;  4MVO A;  3ZRV A;  2JIZ G;  4XDK A;  2EIL B;  5CBG A;  2JEX A;  1V54 B;  3M99 B;  1K73 W;  2IW5 A;  4QE7 A;  3JCZ A;  1AI5 A;  3D36 A;  3KG2 A;  5LGT A;  3X2Q C;  1R6N A;  3ETD A;  5CBF A;  4Q20 A;  5LGN A;  1YIJ V;  3JD1 A;  2OTJ V;  2XAJ A;  3ZCC A;  2HG5 C;  1OCC C;  2XAG A;  2JJ2 G;  3P30 A;  1OCO C;  5BZB A;  2WSS G;  4WCE V;  5B1B B;  5EC1 C;  3QO5 A;  1VQ8 V;  3VBB A;  3IFX A;  3PJS K;  4UVB A;  3RVY A;  3TK1 A;  2QM8 A;  2HVK C;  3JD0 A;  3G6E V;  3K0D A;  2YEV B;  2CK3 G;  3ML0 A;  1E1R G;  5CBH A;  4QPJ A;  5IY5 B;  5L3B A;  2WLJ A;  3K0G A;  3ZMT A;  3IGA C;  2D3O W;  5B1A B;  1M56 B;  1W2B U;  2PI4 A;  5L3C A;  2V7Q G;  1L1F A;  2EIK C;  5B3S B;  4EKW A;  2AHZ A;  2JEU A;  3LNM B;  2QKS A;  2XND G;  4N21 A;  4OXS A;  5KUK A;  1JVM A;  2ATK C;  1FXK A;  2BOC C;  1PNL A;  1S3J A;  2EIM B;  5KA6 A;  3JD3 A;  1VQK V;  3CC7 V;  3ABM B;  3STL C;  1EBO A;  3I55 V;  2ZR3 A;  3K04 A;  4ZKI A;  2EIL C;  4G2K A;  3OUF A;  1V54 C;  1K34 A;  5L3F A;  4MTF A;  1NQT A;  5CMU A;  4WFH A;  5H9C A;  1J95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...