2QTOA

An anisotropic model for potassium channel kcsa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Normal-mode refinement of anisotropic thermal parameters for potassium channel KcsA at 3.2 A crystallographic resolution
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport, membrane protein
total genus 33
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qtoA00
3FB5C 2K1EA 4RUFA 4MS2A 3WG7C 2A0LA 1ZWIC 5EC2C 4DXWA 4LCUC 2H8PC 3SPHA 2ATKC 2EIMC 4HYOA 2EIJC 3F5WC 3SYQA 2HJFC 3LNMB 2Q69A 3AG1C 4QE7A 4WFHA 5BZBA 3K04A 4CBCA 3SYCA 4J9YB 1ORQC 4JTAB 3ASNC 4G28B 3LDEA 3RBZA 1XL4A 3VOUA 2IH1C 3UKMA 4XDJA 4MW8A 5KUMA 3SYAA 3GB7C 1S5HC 2EINC 3SPGA 4WFGA 2X6CA 3LDDA 4R50A 3T1CA 3T2MA 2DYRC 2HVJC 3JYCA 3T4ZA 2KB1A 3TCUA 2Y69C 2DWEC 4PA7A 5EBMC 4P9OA 1G4YB 4QE9A 4GX2A 2EIKC 2DYSC 4X88A 3TETA 3F7YC 2QTOA 4PDVA 1M56C 3OUFA 2WLHA 2QKSA 3K06A 5EBLC 3SPCA 4RUEA 2X6AA 2AHYA 1P7BA 1OCOC 2R9RB 4MW3A 5B1AC 4MTGA 3T4DA 3SPIA 4EKWA 4UUJC 2HFEC 3ASOC 2ITCC 4MVRA 2YEVA 5KUKA 2WLLA 4H37A 2ZD9A 5CBFA 3F7VC 3IGAC 4MVSA 3BEHA 3KG2A 3E8GA 4RAIA 4PDLA 4R6ZA 4PDMA 3SYPA 2BOBC 3ZRSA 3OR6C 4HZ3A 3X2QC 1OCRC 1R3KC 3OGCC 5IY5C 4X8AA 2HG5C 4WFEA 2Q6AA 1R3LC 3FB8C 1J95A 1M57C 2Q67A 1R3JC 1QLEC 4PA3A 4R8CA 2JK5C 4JTCB 4PA4A 3SJQC 4TWKA 2WLMA 3LDCA 5J9PC 1OCZC 4LP8A 3R65A 3AG2C 3AG3C 3E83A 4MSWC 4MVQA 4PA9A 3RW0A 4XDKA 2A79B 2WLNA 3K08A 1OCCC 5EC1C 2HVKC 4F4LA 1V54C 3EFFK 4OXSA 1XL6A 3AG4C 2BOCC 4G27B 4H33A 4JTDB 4MVZA 4BW5A 5CBGA 5EBWC 2Q68A 3K0GA 1K4DC 2W0FC 2X6BA 3HPLC 2WLJA 3UM7A 3OUSA 1R3IC 4KFMA 1LNQA 3FB6C 4I9WA 2ZXWC 2WLIA 3ABLC 2WLLB 4PDRA 5E1AC 3RVZA 3IFXA 3E8HA 2P7TC 4PA6A 3LUTB 4MVMA 2OCCC 1BL8A 4P30A 3E86A 3E8BA 2WLIB 3E89A 3K0DA 4X89A 4ZBMA 2IH3C 1JVMA 4J9ZB 1V55C 4P2ZA 5B3SC 4RO2A 4GX0A 4MTOA 4P9PA 4R7CA 5CBHA 3ABMC 2A9HA 3STZC 2NLJC 3E8FA 3ZJZA 4MVUA 5EK0A 4MTFA 4QNHB 3FB7C 2ITDC 1K4CC 2AHZA 2EILC 4GX5A 1KKDA 3ABKC 3RVYA 2WLKA 3OR7C 4GX1A 4LBEC 4WFFA 5B1BC 3K03A 2DWDC 3SPJA 4MVOA 4XDLA 3PJSK 3SYOA 3STLC
chains in the Genus database with same CATH superfamily
1N0NA 4TV9A 1NZ6A 3ML0A 4GZRB 1IBLO 1WA8B 5LGNA 2ATKC 5CA0B 1WLEA 4X1YB 1I5YA 4JTAB 4DR2O 3QO8A 2X6CA 3LDDA 3EXAA 1MZFA 1L0LH 4DV2O 1AI7A 2KB1A 2KG7A 1QR8A 3RN4A 5EBMC 4FVMA 2DYSC 3SJBC 2ZIOA 3FX7A 5H6RA 1Y76A 1NVPB 3CCLV 3IAYA 4IHJB 4MTGA 5EZYB 2E75B 3L9DA 2LQTA 5L3BA 3BEHA 1YIJV 4NTYA 1DLBA 3ETQA 3SYPA 3UQ8A 4X8AA 3I56V 5A2QN 3BVOA 1OCZC 1RFYA 3VQVA 4JI4B 3AG2C 2VQEB 1HNWB 4FPPA 4B3TO 4LF6O 1QNMA 3QO5A 5EC1C 1BQZA 4MVZA 1V54B 5LMUO 3MHHC 5L3CA 2GTSA 2E5LO 1W59A 3OEEG 4I4TA 3JAMN 1YTFD 4UCRA 1XMQB 4ZBMA 3H01A 4ZHQA 4Q20A 4CC6A 2ZE5A 4TV8B 1VARA 2WAMA 5LYJB 3FKSG 1UJWB 3OFNG 1KKDA 3O65A 4GX1A 4WFFA 4PI2A 1EBOA 4DV4B 2HLDG 3PJSK 3ZMUA 5EYPB 2CDYA 2A0LA 1AJQA 1XILA 1B6QA 4HNAB 4DO2A 3AG1C 4WFHA 5KAIZ 3M7MX 3RBZA 1K9MW 1JMKC 4FLXA 3OT7A 1AILA 3B09A 1B3QA 1NTZH 4JZGA 5DEDA 3S3WA 2P67A 1S77D 1WB8A 1SZTA 2W6JG 4GT1A 1GK9A 2CH7B 4JYAO 4GKJB 1G1XB 3K06A 5EBLC 2QE7G 4YJ2B 2LGQA 2K9PA 5K1PA 4CH5A 3ZRSA 1VQ7V 1HNZO 2HHHO 3CJHA 1QHTA 1SQXH 3QF7A 1OCRB 4JTCB 3JARA 4TWKA 3E22B 5J9PC 4B3RO 4NTXA 1VQ9V 2A79B 1IXMA 3DXRA 2QWRB 4QPJA 1JJ2U 1BHBA 1TVKA 2F95B 3K9AA 3KCXA 3FAVB 5KHKA 1XDCA 3OE7G 2P22C 4DV1B 5EIBC 1BL8A 1P84F 1QVFU 1M90W 1HR0B 2OCCB 1XEQA 1AI5A 1SA0B 1QU7A 1NS1A 2AZ0A 3ZMZA 2P6JA 2L6LA 1CP9A 1YDXA 4MVOA 4AQYO 2F43G 2BCCH 1RSOA 4DXWA 4JI2O 5KA5A 2BTQA 4LCUC 1NVPD 1KQSU 3CC7V 3U11A 3WG7B 1VMGA 2HJFC 4MT8A 3LSUA 4UCUA 1JFFB 1PNLA 3CMAV 2JIZG 3HKBA 1M1KW 1S5LZ 3JAWA 5JQGA 3AG7A 1B06A 3SPGA 4OPAA 1JQ0A 1N33B 4X1IA 3HKCA 3K59A 1H2NA 4KL1A 1H2KA 2DWEC 3K79A 2DYRB 3RFRA 3BY6A 1R73A 3ZHUA 5GONA 1YEWA 5KMGA 3F7YC 4WF9V 1M56C 3J7AU 1H2LA 3T1YB 1J5EO 1P7BA 4JAAA 2CTWA 3MHSC 2YICA 1AP5A 2YXYA 3JALB 4JI8O 2B5UA 2GHYA 5CBFA 2AZ2A 3F7VC 1Q7YW 4X66B 3AK3A 1FXKB 5FL7G 3D36C 4DR6O 4DK1A 4O2AB 1AVMA 4TOIA 1SETA 1Q6HA 1COWG 1EZJA 4ZOLB 2UUAB 1I08A 2F93B 1QLEB 2YXHA 4PJ0Z 5B5EZ 1G6UA 1SQGA 1YI2V 3CHXA 4UV8A 5CBGA 3APQA 4LNUB 2MK3A 1K4DC 2LW7A 3HPLC 3AG4B 4YHHO 1S72V 4LFAO 4KFMA 1WA8A 1MABG 4GKKB 1WPXA 2DW4A 5CA0A 2WLIA 5E1AC 3A0BZ 4C7UA 2P7TC 1WJZA 3ZX6A 3E86A 1JCHA 2IH3C 1Q81W 2QR4A 5LP6B 4BAYA 1V55B 1A32A 3E35A 2EILC 4W4KA 2HKOA 1SF9A 3JD3A 1K73W 5LGUA 4LWSB 2XAQA 2L35A 1KMIZ 5EC2C 4LF7B 1WPBA 2R9IA 3CD6V 4PD4F 4IHJA 1Y74B 3CCMV 1H8HG 2EIMC 3ABLB 4DV6O 5EZYA 3H1JH 4CH4A 2Q4PA 2PYLA 1UFIA 2QWQB 3EVKA 3A2FA 4JF3A 1S76D 1JR9A 1ZUQA 2JDIG 5KHHA 4Z2WA 5LXTB 4U7OA 2ZCEA 3ZS8C 4KP4A 3HKEB 4DK0A 4DR7O 4DV7O 4DV5B 2RJZA 4DV0B 4JYCA 1IXBA 4FLWA 4QGPA 1AR1B 1KP2A 2N74A 2DYSB 4ASUG 2R70A 3K5OA 2CTRA 2XHBA 1LUWA 2EIJB 2PI4A 4Z1MG 4UCOA 4D7SA 2Y4TA 3JD1A 3D3QA 4HZ3A 2UU9O 3CXCU 3OGCC 2Z0AA 1K97A 5HFLA 3W7UA 4UVAA 1XMOO 1OCZB 2PY5A 3AG2B 3S3XA 1QQCA 1AJPA 2BE3A 2C2AA 1F23A 1G8MA 1BT8A 3Q4HB 1AB3A 5EYPA 1BSMA 4IL6Z 2YIAA 4HNAA 5JJJB 2Q7EA 2Q0AA 3IFXA 2EBOA 4TUYB 2D3OW 4BR6A 3HKDB 3ABTA 2JGUA 2QDOA 1HNXB 4P2ZA 3UT5B 5LMNO 4NKGB 2CTQA 4QNHB 1MG1A 1VQ5V 4H13B 4TQDA 3K03A 2E76B 2CH7A 1VF6A 4K3AA 1AR5A 2K1EA 4RUFA 1SERA 3RYCB 4YJ2A 1GH6A 4YY3O 3W7XA 2AW9A 4O4LB 1ORQC 2ZKOA 3N2KB 3AG1B 3VOUA 5J2TB 3ZHTA 4H0LB 3H1HH 3OTOO 3T4ZA 4CC5A 3TCUA 1V9PA 2IJHA 4DR4B 2IJJA 3E22A 5LL6Y 4PA7A 1NBMG 3AK1A 1M9NA 2PGGA 5J2UB 4JI5O 4TQFA 3ZMVA 1KECA 4LF4O 3OUFA 2WLHA 1PNKA 3TGUH 4O4IB 1GM9A 1FS0G 4MW3A 2Z5UA 3CSXA 1PL0A 3ASOC 4MVRA 2UXBO 3L73H 5IYZB 5IYDO 2QKAA 2WA3A 2O57A 2HG5C 5FNVA 1WP8A 2UXDB 4K0KO 3ZJZA 1SA0A 3CRRA 4LH6A 4FK5C 2F66C 1Z5WA 1H8EG 2E74B 2W0XA 3B2EE 1IBMB 5AG2A 2KQXA 1MZEA 5IJ0B 1F4NA 2F4VB 1L1FA 1GM7A 2GV9A 5JWPA 1QLNA 2UXCO 4PA6A 5IJ9B 1N34O 4I5SA 4CZZA 1IZ3A 1JFFA 1Z2GA 3TXQA 4PHZA 1BQ0A 2RCVA 2XAGA 3CRQA 3FYEB 4JGSA 4P9PA 5BY1A 3SJCC 5KHGA 4X64O 4OGQB 3VBBA 2JS3A 3FB7C 4U7NA 5B1BC 1K7DA 2E3CA 5KHJA 4DR1B 4LH7A 4CBCA 3OMIB 2JVDA 5H5NA 2DOSA 3N27A 1EM1A 4EB6B 1CXZB 5GTHZ 4PELA 2LGWA 2ZM6O 1U97A 3JALA 1VQPV 1N36B 5LHHA 1FXKA 1MNGA 3GB7C 3CRMA 3RYIB 4O2AA 3K57A 1ZTEA 4DV3O 2QWPB 1FD9A 4ZOLA 1TGOA 3H1LH 3CMEV 1UPGA 1KD1W 1G4YB 1NQTA 5CA1B 2EIKC 3TJTA 3JASB 4EEQA 5BR8O 4DR5B 1F51A 4DUYO 3HB3B 4LNUA 3ZRWB 1M56B 2R9RB 2DQ0A 1SZXA 2EZOA 1IBKO 1FKAO 4JI0B 4JI3O 1TAEA 1NR7A 3RYHB 3E8GA 3GVMA 1YHQV 3OR6C 1S0VA 1R3KC 1Q43A 1MSDA 1SQPH 2Y69B 2JK5C 1K8AW 1VEWA 3R65A 1M5IA 4E2LA 4KHPO 4AI8A 4BWAA 2M7WA 3CWBH 3ZRVA 5ITZB 4LWSA 2FMLA 3CPWU 5LA6B 1KYOF 3H1KH 1Y74A 2OIEA 3THOA 3NR7A 2Y48A 1YSCA 4Z1VA 3T1HB 2YSUB 2QA4V 4GX0A 3ZHRA 3DGEA 3ABMC 3DC5A 3FFQA 5LXTA 4DR6B 4B7EA 1I0HA 1EZVH 1BGYH 4JASA 3RVYA 1E1RG 4FFBB 4BIZA 1KB9F 3FB5C 4FM1A 3ICXA 1WB7A 3IC9A 4HYOA 3BPZA 4JI1O 2HJDA 1SQBH 3W7SA 2EIMB 4I55B 3ZN0A 1AROP 4JV5O 1XL4A 1IX9A 3OM3B 1TUBB 1DGSA 3H9VA 2FKXA 4N21A 2YI8A 1XOUA 1H38A 1N32O 4LF8O 2V4DA 4I9QA 4J41A 4FZ1A 1FYJA 4D7TA 4ZI7B 1D5NA 4AILC 5IWAB 4JPRA 3Q4HA 2UUCB 1FJGO 3VQXA 4O2BB 4B7KA 3G6EV 4UB6Z 1JOYA 2ZD9A 2XAFA 4JZ2A 3ZHVA 1AI6A 3IC7A 3HKDA 2DJVA 3OEHG 1W0KG 5EIBD 1JPXA 3ZHSA 5K1XA 5JCOC 1ZX3A 4LFBO 4LF5O 1RPOA 4XDKA 2MW2B 1SS3A 2FL4A 4X65B 2BSKA 3ZN1A 4G2KA 3BCCH 5EBWC 1I94O 3K0GA 3UM7A 3RYCA 1ZL8B 4B3SO 1ENVA 1NH2B 2VQFB 4NXNB 4O4LA 5D5QA 5J2TA 3H1IH 4B3MO 2ILMA 1XREA 4MTOA 5CBHA 2RMKB 1T5EA 3DC6A 4CS3A 3STZC 2OT5A 3CCSV 1AR4A 4ICGA 2ETNA 3ZMTA 2RQ6A 2OCHA 1FXHA 1ZLZA 3RT3C 3OR7C 4LBEC 5J2UA 3UCSC 2DWDC 1K5SA 4XDLA 4JI7O 4NTWA 1NJIW 4O4IA 4MS2A 3CCVV 1VQ4V 2CK3G 1Q3EA 3GWOA 3JSNA 4UVCA 1KC8W 1Y6XA 1QVGU 4J42A 3UKMA 4FIPC 4MW8A 1PNMA 5IYZA 5GW7A 1VQLV 5CB4B 4NR1A 2JEXA 2LO1A 4DUZO 2VWKA 3TETA 3BAAA 1FFTB 3P3NA 2QTOA 4Q6GA 2ARHA 2Y4UA 4ABMA 1OCOC 3L75H 1FAFA 2YS8A 2H3OA 4GUNA 1Q8IA 2ITCC 4YY3B 4H37A 5IJ9A 1GKFA 2FYUH 2FTKA 4I0XB 3ASOB 3BA8A 4PDMA 1QCEA 4I7ZB 5IY5C 2Y0PA 1SQFA 3QNEA 3JATB 1O9GA 3OTOB 2QGNA 3A0HZ 5CMUA 4NVPA 4F4LA 4JI5B 1F7YA 1E79G 1M4UA 4OPHA 4NXMB 4YJ3B 1WN7A 4X20B 4EB6A 1KUQA 2YEVB 4F6RB 1NTKH 2FB5A 2WPDG 2UXBB 3E8BA 1DK1A 3E8FA 3RYIA 4O4HB 2ZQMA 2ZR3A 2JRIA 3JSLA 2NN4A 3ABKC 5CA1A 3BABA 4JI4O 2VQEO 4JAUA 4GYCB 4FM0A 5B1BB 3OMAB 1YCIA 3EHBB 2F23A 1ZWIC 4X1YA 3ZRWA 3W7WA 3SYQA 1ZAUA 3SYCA 2WA4A 3ASNC 1I5XA 2IH1C 2RNBA 3RYHA 2X0LA 4XDJA 3K9SA 3SYAA 1XMQO 4R50A 3QO7A 3T2MA 3D36A 2M6YA 3LSQA 1IVSA 3OGIB 2IJIA 1PPJH 4U3JB 1XNQB 2LW1A 4NYKA 4LF9B 2EIKB 3L71H 5ITZA 4DV4O 2LP7A 3C90A 4DR3O 5LA6A 4ZIBA 3D3IA 3MD0A 1NH2D 4FLVA 4PDLA 3PN1A 1AI4A 2Q67A 1Y4MA 4LP8A 5DN6G 2YI9A 4A5UB 1Q86W 3K08A 1OCCC 2OTJV 4UV9A 4H33A 1IBLB 2ZT9B 2WLJA 5B66Z 1R3IC 1LNQA 2PYJA 4XBFA 2OYQA 3OD4A 4N23A 4DR2B 2QJ1A 3CXHF 1IBKB 4I55A 1Q5OA 3K0DA 4CS2A 2YUAA 4TV8A 5B3SC 2F1MA 5LYJA 1TUBA 4DV2B 1K33A 1SESA 2PI5A 3JAKB 1K34A 1P4RA 1BCCH 2XASA 5EK0A 3ABMB 1FFXB 5KHIA 3ZIAG 4JI6O 4ZI7A 4DRXB 4J11A 2PF4E 1YJNV 2XT9A 3CC4V 1MMMA 4O2BA 5LGTA 1K5QA 4DW1A 2WSSG 3ETEA 2Z3YA 2OTLV 3K5LA 1OHHG 1HR0O 4HBNA 5JVDB 1SQQH 1EN5A 1XQ8A 5C8YB 2JEUA 4J10A 4LC1A 4B3TB 4LF6B 2ZR2A 4GX2A 4WFBV 2JS5A 1E1QG 4PDVA 5LMUB 2AXTZ 3C3SA 3G67A 3CS5A 1PM9A 2N05A 5B1AC 2E5LB 5LOVB 2V7QG 2ZE8A 3M8AA 3I55V 3IGAC 1XHXA 4JI1B 3KG2A 3JCZA 5KA6A 2CGOA 1YITV 1R3LC 1YJ9V 4RQEA 3SJQC 1BZKA 2VRZA 2CAZC 3RGBA 5IYBO 3OW2U 4LF8B 2Q73A 2HVKC 3FAVA 5BMVB 3ZCCA 2RN9A 2B9ZA 2GSMB 3U0ZA 1TUEB 2ZINA 3SJAC 2EZPA 3T1YO 3ZRXA 3I5DA 1Q6IA 3LUTB 4OX9O 4CS4A 1GN3A 2ZDIC 3LNNA 3WB0A 2NLJC 5CA3A 2QM7A 3K58A 3L70H 4BW9A 5CB4A 2ITDC 1GO3F 1WP7A 2GTAA 2UUAO 5BXZA 1BHAA 4JYAB 3OMNB 2KSDA 1DTOA 3L72H 2AGAA 3SPHA 2DQ3A 1MOFA 2IM9A 3B77A 1H2GA 4GKKO 1VQNV 3QTCA 4CH3A 1HNZB 2HHHB 2GBOA 1U96A 4J7KA 4UCTA 3TXSA 3ETGA 4B3RB 3JAWB 1VQ6V 3JATA 3OTFA 4NB5A 5H9CA 4P9OA 1SQVH 4I50B 1VF5B 3B4SA 3GWKC 5E79Z 1M93A 4RUEA 4FLZA 1WAZA 2QKCA 2VS0A 2ZE6A 4LF7O 3SPIA 1OCOB 3VQWA 4X20A 1EN6A 2YEVA 4F6RA 1JJOA 2Q0OC 3G4SV 3N2GB 3X2QC 1K92A 4R8CA 2PUSA 4O4HA 1VQOV 5IY5B 2P4KA 3RW0A 3AG3C 4DV5O 5H6QA 1S5JA 2WLNA 4AQYB 1ZSPA 4U3FH 3SDLA 1YVWA 4JI2B 3BHPA 3ZBHA 4LFCO 1L8DA 2QWOB 1US6A 2ZXWC 4PDRA 3ABLC 1AJNA 1N4CA 1KBHA 2Q5ZA 4UXNA 5LP6A 4X89A 2WLIB 1DF5A 2QTSA 1GN4A 3RYFB 5KX5B 1YJWV 2CTPA 2Q7GA 2A9HA 3A8TA 1R6KA 2DN9A 2QEXV 1Q82W 1HW7A 4GX5A 5DECA 3BRCA 3ZHQA 4MTXA 4U3JA 5L3DA 3SPJA 3ABKB 1J5EB 2ODMA 4IT5A 1S3JA 3G71V 1LUVA 2QWNB 4X62O 4JI8B 2EIJC 2Q69A 4FJCC 4JYBA 3HKEA 4IGGA 2R9AA 3ASNB 1THZA 1HNXO 1PV0A 2PZSA 2EILB 3CCUV 3WFVA 1XNRO 1H2SB 2ZIMA 4YHHB 4IYHA 3SPCA 4LFAB 2A06H 2OWOA 2X6AA 4JYYA 4JAVA 4X1KB 2YIBD 3J81N 1GRJA 4DW0A 1NR1A 3MAQA 2KKWA 1XI1A 4L87A 1M57C 3JAKA 4UCSA 2IJKA 4PA4A 2CE4A 4B08A 1FFXA 5KAFZ 2B1GA 4DR4O 1NU1H 3EFFK 4OXSA 3K5NA 4BW5A 4JTDB 3W7TA 1OCCB 4WBNB 4DRXA 4DV6B 1ROPA 3U10A 4O4JB 1F4MA 4TUYA 2UUBO 1R6NA 3CRAA 5JH7B 3HR0A 4DR3B 4I9WA 1P49A 3UT5A 2Q8VA 1VIBA 3CCRV 2EJ7A 1DF4A 1VQ8V 1NT2B 5FLXN 4DR7B 4BIOA 4DV7B 5A9GA 2YIDA 5B3SB 4L8JA 5JVDA 4FFKA 4BIUA 1QBZA 4FMTA 5C8YA 3D8CA 2UXDO 1N0JA 1K4CC 2AHZA 4KUMA 1XHZA 2Q9LA 4FZ0A 3CCQV 4IIJB 4K8ZA 5L3GA 1IBMO 2CGNA 1OV9A 1RP3B 2H8PC 1PL4A 4W4LA 2WWWA 2F4VO 5LOVA 3BA9A 3N2KA 1RM1C 5F2VO 5GTIZ 3WB2A 2JJ1G 1FPOA 2UU9B 2UXXA 3LDEA 3KZIZ 2Y0IA 5KUMA 2ADQB 2XAJA 2EINC 5B1NA 3P3PA 2DE0X 4EFBA 2HR3A 1OJHA 1SRYA 1AP6A 3APOA 1XMOB 3ABUA 1P7GA 4GCZA 4QE9A 3DSQA 5LHGA 5JCOA 5BMVA 1Y66A 5IT9N 4JI6B 4DR1O 4J7ZA 3K5MA 2YIBA 3KKYA 4IYIA 3BFRA 4EKWA 2GDSA 5B1AB 1GM8A 3ETDA 1L0NH 4RAIA 3AEIA 1I7FA 2P5OA 2H94A 5LMNB 3UO3A 1N36O 2OIGA 3FB8C 5FNVB 4PA9A 2IU3A 1B04A 5IJ0A 2HEPA 3CEIA 4WCEV 3JD4A 2JGDB 1W2BU 4G27B 2EX3A 2Q68A 1K3EA 2LJ2A 2W0FC 4DR5O 3IJ4A 3CX5F 3OUSA 5L3EA 5IYCO 2WLLB 3RVZA 2YDEA 4MVMA 3G6BA 1KP3A 3E89A 3F5TA 4JI0O 4FLUA 3KCYA 3JCUZ 1GN2A 1Y67A 4LF4B 4PV1B 4I50A 3CCJV 4J80A 3G80A 1SC5B 2QSAA 5KLVH 4UFZA 1KKCA 2YC0A 3F5WC 1IDSA 4QIWF 3LNMB 5H2FZ 5HFMA 2Q7HA 1D2DA 2LFSA 4OX9B 3MDSA 3N2GA 2QM4A 4K0KB 4WFGA 3CYOA 3T1CA 2ZNJA 3T1HO 1Q6UA 3WU2Z 1HNWO 2QM8A 2Y69C 5FPOA 2GUZB 2XNDG 3JASA 3C3TA 5FPRA 4X88A 1D5AA 4LR3A 1IURA 2XAHA 4TV9B 4F6EA 3QG5A 1WNSA 2IU0A 4J7JA 1YF2A 3T4DA 2UXCB 3P32A 1N34B 2HFEC 2UXNA 5KUKA 3VQYA 3P30A 1Q90D 4PI0A 2X7RB 1HDJA 1GTOA 4X64B 3RYFA 5KX5A 2Q6AA 1J95A 4PA3A 2BTOA 3X2QB 2KG7B 1H2MA 1NI8A 1EN4A 2YXLA 3E83A 4MVQA 5D5PA 4RWUA 5LBQA 2ZE7A 1HP8A 1V54C 1NTMH 1XUQA 1Y76B 3AG3B 4UVBA 1CPYA 1JX9A 3ZMSA 5IWAO 5LHIA 2UUCO 3L74H 2ZM6B 1GN6A 3JD2A 3ZEDA 3E8HA 4EFEA 2ZXWB 4P30A 3SR2C 4J9ZB 4RO2A 4DV3B 4QJFB 4KXRA 1XBLA 3AK2A 1VP7A 4RQFA 4YIOA 3M99B 4FFBA 4GKJO 5BR8B 2RDCA 1X59A 2W6IG 4DUYB 3SYOA 3STLC 4X65O 2V1DA 1VQKV 4LFCB 2D2CB 1BMFG 3O9OA 4I4TB 4JI3B 4QE7A 4X1KA 4J9YB 2VQFO 4G28B 4NXNO 4ZHQB 1S5HC 1KU9A 1URFA 1QR9A 2HVJC 2N04A 1CEZA 3OAAG 1Z5VA 4KHPB 4TSFG 3LSSA 3SGIA 1VF6C 3DTUB 1GMGA 4UB8Z 1BS3A 4WBNA 4O4JA 4DV1O 2HP8A 2P90A 5JH7A 1JA8A 4X62B 3FD9A 3J80N 1PKXA 4MVSA 3CCEV 3E2EA 4R6ZA 1RPRA 4AHCA 1OCRC 1EFRG 4WFEA 2WLMA 2NR5A 3LDCA 1O9HA 4H44B 1M57B 4DYLA 4MSWC 2DMXA 3CC2V 2JJ2G 2VWJA 1HWYA 1XL6A 1XNRB 2BOCC 4IIJA 3CB2A 1ZL8A 2X6BA 2BSKB 1MA1A 1GAXA 3FB6C 3QVNA 4JV5B 5L3FA 1R1BA 1PP9H 2OCCC 1MSWD 4FM2A 3K3WA 4X9QA 2ZNIA 1N33O 1N32B 3CJHB 3TK1A 4WFAV 3JARB 4ZKIA 4MTFA 1X4TA 2CUGA 2WLKA 3DXRB 4FLYA 4K8XA 2XOKG 5C93A 1TVKB 4CH6A 3CE2A 1FJGB 1FXVA 1R6TA 3WG7C 1SKVA 2XTAA 2UUBB 1YTFB 5BZBA 4NXMO 2B1IA 4X66O 1OZ0A 3K04A 4HAMA 2G38A 1RM1B 3JD0A 2PTMA 1VQMV 4K35A 3RWRD 2EJRA 2DYRC 3JYCA 2EINB 4LFBB 4LF5B 2EULA 5IDJA 1TA8A 3B8NA 1YZBA 3A0RA 1I94B 2R72A 2JGDA 1RSOB 5DM6V 2QKSA 2AHYA 2BTQB 4B3SB 1YXBA 2P4VA 4I0XA 4UUJC 3FYIB 4TT3G 3WB1A 1FXKC 2WLLA 4UCVA 3B8MA 3HKBB 4B3MB 5JQGB 3CP1A 2BOBC 3CRCA 4GLXA 4X1IB 4YXWG 2ZDIA 3HKCB 1R3JC 1QLEC 2P06A 5JJEB 3R66A 1BE3H 4JI7B 5GONB 5KMGB 4QPKA 3AG4C 4E4EA 4YJ3A 1XNQO 4FLTA 4LF9O 1W0JG 1N8RW 1NKDA 1PD3A 4D6TH 2IW5A 5LP6C 5B1OA 1LR1A 3B40A 1JVMA 3NXSA 1V55C 4YIPA 3UO2A 5IE9A 1VF7A 4R7CA 2A3QA 5CN0A 5JJNB 4DV0O 2IBZH 4MVUA 2XUMA 2LFRA 4DUZB 2NNUA 2GUZA 2ADPA 5TISZ 2A7WA
chains in the Genus database with same CATH topology
5L3GA 3OMAB 3EHBB 2K1EA 4RUFA 1ZWIC 3ML0A 3ZRWA 2H8PC 3W7WA 5LGNA 2WWWA 1SERA 2ATKC 3SYQA 3W7XA 1RM1C 1WLEA 1I5YA 2JJ1G 3SYCA 1ORQC 4JTAB 3ASNC 1I5XA 2UXXA 3AG1B 3LDEA 3VOUA 2IH1C 2X0LA 4XDJA 5KUMA 3SYAA 2XAJA 2EINC 5B1NA 3QO8A 2X6CA 3LDDA 4R50A 3QO7A 3T2MA 3D36A 1AI7A 2HR3A 3T4ZA 2KB1A 1SRYA 3TCUA 1QR8A 3LSQA 2IJHA 2IJJA 3ABUA 4PA7A 5EBMC 1NBMG 4GCZA 1M9NA 4QE9A 2IJIA 2DYSC 3ZMVA 1KECA 5LHGA 5H6RA 3OUFA 2WLHA 1PNKA 1Y66A 2EIKB 1NVPB 1GM9A 2LP7A 3CCLV 1FS0G 4MW3A 4MTGA 2Z5UA 4EKWA 3D3IA 5B1AB 1GM8A 1PL0A 3ASOC 4MVRA 5L3BA 3MD0A 3ETDA 1NH2D 3BEHA 1YIJV 4RAIA 3AEIA 4PDLA 1DLBA 3SYPA 2H94A 5IYDO 4X8AA 2HG5C 1AI4A 3I56V 3FB8C 2Q67A 3ZJZA 1Y4MA 1OCZC 4LP8A 3AG2C 4PA9A 4FK5C 5DN6G 4FPPA 2IU3A 1Q86W 1H8EG 3K08A 1OCCC 3QO5A 4UV9A 5EC1C 2OTJV 4WCEV 3JD4A 1W2BU 4G27B 4H33A 4MVZA 1F4NA 2Q68A 1K3EA 1V54B 2W0FC 3MHHC 1L1FA 2WLJA 1GM7A 3OUSA 1R3IC 5L3CA 5L3EA 1LNQA 5IYCO 1QLNA 3OEEG 4XBFA 2WLLB 3RVZA 4PA6A 1YTFD 4MVMA 4N23A 4I5SA 4CZZA 1KP3A 3K0DA 3E89A 4ZBMA 3FYEB 2XAGA 4JGSA 5B3SC 3H01A 4P9PA 1K33A 1SESA 4Q20A 2PI5A 1K34A 1P4RA 2WAMA 2XASA 5EK0A 3ABMB 3VBBA 3FKSG 1UJWB 3FB7C 3OFNG 1KKDA 4U7NA 5B1BC 4GX1A 1K7DA 4WFFA 1EBOA 3ZIAG 3CCJV 2HLDG 3PJSK 4CBCA 3OMIB 3ZMUA 2A0LA 1AJQA 1YJNV 1B6QA 3CC4V 3F5WC 5LGTA 4QIWF 4DO2A 3LNMB 3AG1C 4WFHA 1K5QA 4PELA 5HFMA 2WSSG 1VQPV 3ETEA 2Z3YA 2OTLV 3RBZA 1K9MW 2LFSA 5LHHA 1FXKA 1OHHG 3GB7C 4WFGA 3CYOA 3T1CA 2JEUA 2QM8A 4LC1A 2Y69C 2ZR2A 2XNDG 3CMEV 2P67A 1KD1W 1S77D 1SZTA 1G4YB 1NQTA 4GX2A 2W6JG 2EIKC 4WFBV 4GT1A 4X88A 1GK9A 1E1QG 4PDVA 2XAHA 1F51A 3K06A 5EBLC 3HB3B 3ZRWB 2IU0A 2QE7G 1M56B 2R9RB 5B1AC 2V7QG 3T4DA 3P32A 2DQ0A 3I55V 2HFEC 2UXNA 2EZOA 5KUKA 3IGAC 3P30A 1NR7A 3KG2A 3E8GA 2X7RB 1YHQV 3JCZA 1GTOA 5KA6A 3ZRSA 3OR6C 1VQ7V 1S0VA 1R3KC 1YITV 2Q6AA 1R3LC 1YJ9V 1J95A 4PA3A 4RQEA 3X2QB 2Y69B 1OCRB 2JK5C 4JTCB 3SJQC 4TWKA 1K8AW 5J9PC 3R65A 3E83A 4MVQA 5LBQA 5IYBO 3OW2U 1VQ9V 2A79B 4E2LA 1IXMA 2HVKC 1V54C 3AG3B 4QPJA 2M7WA 3ZRVA 3ZCCA 1JJ2U 1BHBA 4UVBA 1CPYA 1JX9A 2GSMB 1TUEB 3K9AA 3ZMSA 3CPWU 2EZPA 3OE7G 3ZRXA 5LHIA 2Y48A 3JD2A 1YSCA 3E8HA 3LUTB 1BL8A 2ZXWB 4P30A 2ZDIC 1QVFU 1M90W 4J9ZB 2YSUB 4RO2A 2OCCB 4GX0A 2QA4V 3DGEA 3ABMC 4QJFB 1AI5A 2NLJC 5CA3A 2QM7A 2ITDC 1GO3F 4RQFA 1BHAA 4JASA 3RVYA 3M99B 3OMNB 1E1RG 2W6IG 3ZMZA 2P6JA 1CP9A 4MVOA 3SYOA 2F43G 3STLC 4BIZA 3FB5C 1DTOA 2V1DA 4DXWA 1VQKV 5KA5A 4LCUC 1KQSU 1NVPD 3CC7V 3SPHA 4HYOA 2DQ3A 1BMFG 1MOFA 3WG7B 4MT8A 2HJFC 4QE7A 3W7SA 2EIMB 3B77A 4J9YB 1H2GA 1PNLA 3ZN0A 3CMAV 2JIZG 1AROP 4G28B 1XL4A 1VQNV 1M1KW 3OM3B 1S5HC 3SPGA 1JQ0A 3ETGA 4N21A 1QR9A 2HVJC 1H38A 1CEZA 1VQ6V 3OAAG 2DWEC 3K79A 5H9CA 2DYRB 4P9OA 4TSFG 3LSSA 3BY6A 3DTUB 1R73A 3F7YC 4WF9V 1M56C 1GMGA 4RUEA 4JPRA 1P7BA 3MHSC 3SPIA 2P90A 3G6EV 1OCOB 2YEVA 1JOYA 2B5UA 1PKXA 2ZD9A 5CBFA 2XAFA 3F7VC 4MVSA 1AI6A 3CCEV 3IC7A 1Q7YW 3E2EA 3G4SV 4R6ZA 1FXKB 5FL7G 1RPRA 3X2QC 1K92A 3OEHG 1OCRC 1W0KG 1SETA 1EFRG 1JPXA 4WFEA 1COWG 1EZJA 4R8CA 1VQOV 5IY5B 2WLMA 3LDCA 1M57B 3RW0A 3AG3C 1QLEB 4MSWC 1RPOA 5H6QA 4XDKA 2WLNA 3CC2V 2JJ2G 1HWYA 1XL6A 3ZN1A 2BOCC 1YI2V 4G2KA 4UV8A 5CBGA 5EBWC 3K0GA 2MK3A 1K4DC 2X6BA 3HPLC 3AG4B 1S72V 3UM7A 4KFMA 3FB6C 1MABG 1ENVA 3ABLC 1WPXA 1AJNA 2DW4A 2WLIA 2ZXWC 4PDRA 5E1AC 2P7TC 4UXNA 5L3FA 2OCCC 1MSWD 3E86A 4X89A 2WLIB 1JCHA 3K3WA 1DF5A 2IH3C 1YJWV 1Q81W 4MTOA 5CBHA 4BAYA 2A9HA 3STZC 2OT5A 3TK1A 1R6KA 3CCSV 1V55B 4WFAV 2QEXV 3E35A 4ZKIA 4MTFA 1Q82W 3ZMTA 2EILC 1FXHA 4GX5A 4MTXA 2WLKA 3OR7C 4LBEC 1NH2B 2HKOA 5L3DA 2DWDC 3SPJA 3ABKB 3JD3A 2XOKG 1K5SA 4XDLA 5C93A 1K73W 5LGUA 1NJIW 2XAQA 1FXVA 4MS2A 3WG7C 5EC2C 3CCVV 2R9IA 1S3JA 3G71V 3CD6V 3CCMV 1VQ4V 1H8HG 2EIMC 3ABLB 2CK3G 2EIJC 1YTFB 3GWOA 5BZBA 2B1IA 2Q69A 1OZ0A 4FJCC 3K04A 4UVCA 4HAMA 1KC8W 4JF3A 4JYBA 1RM1B 1S76D 1QVGU 3UKMA 4FIPC 4MW8A 2JDIG 1PNMA 3ASNB 3JD0A 4U7OA 1VQMV 1THZA 5GW7A 4KP4A 2EJRA 2DYRC 1VQLV 3JYCA 2EINB 2EILB 3CCUV 4JYCA 2JEXA 3WFVA 5IDJA 3TETA 3B8NA 1FFTB 3A0RA 2QTOA 1AR1B 1KP2A 5DM6V 2DYSB 4ASUG 2QKSA 3SPCA 2X6AA 2AHYA 1OCOC 2PI4A 2EIJB 4JAVA 4UUJC 3FYIB 4TT3G 2ITCC 4Z1MG 1FXKC 2WLLA 4H37A 3B8MA 1GKFA 2FTKA 3ASOB 3JD1A 1NR1A 4PDMA 3CP1A 1QCEA 2BOBC 4HZ3A 3CXCU 3OGCC 5IY5C 4YXWG 4L87A 2ZDIA 1M57C 1R3JC 1QLEC 3QNEA 2IJKA 4PA4A 1K97A 5HFLA 3W7UA 4UVAA 5CMUA 2B1GA 1OCZB 4QPKA 4F4LA 3AG2B 3EFFK 4OXSA 1AJPA 3AG4C 2C2AA 1F23A 1G8MA 4JTDB 4BW5A 3W7TA 1OCCB 1E79G 1ROPA 1F4MA 1W0JG 1N8RW 1NKDA 1PD3A 1R6NA 4I9WA 2YEVB 3IFXA 2EBOA 2D3OW 2WPDG 2IW5A 3ABTA 5B1OA 3E8BA 3CCRV 4P2ZA 1JVMA 3NXSA 1V55C 1DF4A 1VQ8V 4R7CA 5CN0A 3E8FA 5B3SB 4MVUA 4BIUA 1QBZA 2ZQMA 4FMTA 2LFRA 4QNHB 1K4CC 2AHZA 1MG1A 2ZR3A 2NNUA 4KUMA 1VQ5V 3ABKC 3CCQV 3K03A 4JAUA 2GHYA 5B1BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB5 C;  2K1E A;  4RUF A;  4MS2 A;  3WG7 C;  2A0L A;  1ZWI C;  5EC2 C;  4DXW A;  4LCU C;  2H8P C;  3SPH A;  2ATK C;  2EIM C;  4HYO A;  2EIJ C;  3F5W C;  3SYQ A;  2HJF C;  3LNM B;  2Q69 A;  3AG1 C;  4QE7 A;  4WFH A;  5BZB A;  3K04 A;  4CBC A;  3SYC A;  4J9Y B;  1ORQ C;  4JTA B;  3ASN C;  4G28 B;  3LDE A;  3RBZ A;  1XL4 A;  3VOU A;  2IH1 C;  3UKM A;  4XDJ A;  4MW8 A;  5KUM A;  3SYA A;  3GB7 C;  1S5H C;  2EIN C;  3SPG A;  4WFG A;  2X6C A;  3LDD A;  4R50 A;  3T1C A;  3T2M A;  2DYR C;  2HVJ C;  3JYC A;  3T4Z A;  2KB1 A;  3TCU A;  2Y69 C;  2DWE C;  4PA7 A;  5EBM C;  4P9O A;  1G4Y B;  4QE9 A;  4GX2 A;  2EIK C;  2DYS C;  4X88 A;  3TET A;  3F7Y C;  2QTO A;  4PDV A;  1M56 C;  3OUF A;  2WLH A;  2QKS A;  3K06 A;  5EBL C;  3SPC A;  4RUE A;  2X6A A;  2AHY A;  1P7B A;  1OCO C;  2R9R B;  4MW3 A;  5B1A C;  4MTG A;  3T4D A;  3SPI A;  4EKW A;  4UUJ C;  2HFE C;  3ASO C;  2ITC C;  4MVR A;  2YEV A;  5KUK A;  2WLL A;  4H37 A;  2ZD9 A;  5CBF A;  3F7V C;  3IGA C;  4MVS A;  3BEH A;  3KG2 A;  3E8G A;  4RAI A;  4PDL A;  4R6Z A;  4PDM A;  3SYP A;  2BOB C;  3ZRS A;  3OR6 C;  4HZ3 A;  3X2Q C;  1OCR C;  1R3K C;  3OGC C;  5IY5 C;  4X8A A;  2HG5 C;  4WFE A;  2Q6A A;  1R3L C;  3FB8 C;  1J95 A;  1M57 C;  2Q67 A;  1R3J C;  1QLE C;  4PA3 A;  4R8C A;  2JK5 C;  4JTC B;  4PA4 A;  3SJQ C;  4TWK A;  2WLM A;  3LDC A;  5J9P C;  1OCZ C;  4LP8 A;  3R65 A;  3AG2 C;  3AG3 C;  3E83 A;  4MSW C;  4MVQ A;  4PA9 A;  3RW0 A;  4XDK A;  2A79 B;  2WLN A;  3K08 A;  1OCC C;  5EC1 C;  2HVK C;  4F4L A;  1V54 C;  3EFF K;  4OXS A;  1XL6 A;  3AG4 C;  2BOC C;  4G27 B;  4H33 A;  4JTD B;  4MVZ A;  4BW5 A;  5CBG A;  5EBW C;  2Q68 A;  3K0G A;  1K4D C;  2W0F C;  2X6B A;  3HPL C;  2WLJ A;  3UM7 A;  3OUS A;  1R3I C;  4KFM A;  1LNQ A;  3FB6 C;  4I9W A;  2ZXW C;  2WLI A;  3ABL C;  2WLL B;  4PDR A;  5E1A C;  3RVZ A;  3IFX A;  3E8H A;  2P7T C;  4PA6 A;  3LUT B;  4MVM A;  2OCC C;  1BL8 A;  4P30 A;  3E86 A;  3E8B A;  2WLI B;  3E89 A;  3K0D A;  4X89 A;  4ZBM A;  2IH3 C;  1JVM A;  4J9Z B;  1V55 C;  4P2Z A;  5B3S C;  4RO2 A;  4GX0 A;  4MTO A;  4P9P A;  4R7C A;  5CBH A;  3ABM C;  2A9H A;  3STZ C;  2NLJ C;  3E8F A;  3ZJZ A;  4MVU A;  5EK0 A;  4MTF A;  4QNH B;  3FB7 C;  2ITD C;  1K4C C;  2AHZ A;  2EIL C;  4GX5 A;  1KKD A;  3ABK C;  3RVY A;  2WLK A;  3OR7 C;  4GX1 A;  4LBE C;  4WFF A;  5B1B C;  3K03 A;  2DWD C;  3SPJ A;  4MVO A;  4XDL A;  3PJS K;  3SYO A;  3STL C; 
#chains in the Genus database with same CATH topology
 1N0N A;  4TV9 A;  1NZ6 A;  3ML0 A;  4GZR B;  1IBL O;  1WA8 B;  5LGN A;  2ATK C;  5CA0 B;  1WLE A;  4X1Y B;  1I5Y A;  4JTA B;  4DR2 O;  3QO8 A;  2X6C A;  3LDD A;  3EXA A;  1MZF A;  1L0L H;  4DV2 O;  1AI7 A;  2KB1 A;  2KG7 A;  1QR8 A;  3RN4 A;  5EBM C;  4FVM A;  2DYS C;  3SJB C;  2ZIO A;  3FX7 A;  5H6R A;  1Y76 A;  1NVP B;  3CCL V;  3IAY A;  4IHJ B;  4MTG A;  5EZY B;  2E75 B;  3L9D A;  2LQT A;  5L3B A;  3BEH A;  1YIJ V;  4NTY A;  1DLB A;  3ETQ A;  3SYP A;  3UQ8 A;  4X8A A;  3I56 V;  5A2Q N;  3BVO A;  1OCZ C;  1RFY A;  3VQV A;  4JI4 B;  3AG2 C;  2VQE B;  1HNW B;  4FPP A;  4B3T O;  4LF6 O;  1QNM A;  3QO5 A;  5EC1 C;  1BQZ A;  4MVZ A;  1V54 B;  5LMU O;  3MHH C;  5L3C A;  2GTS A;  2E5L O;  1W59 A;  3OEE G;  4I4T A;  3JAM N;  1YTF D;  4UCR A;  1XMQ B;  4ZBM A;  3H01 A;  4ZHQ A;  4Q20 A;  4CC6 A;  2ZE5 A;  4TV8 B;  1VAR A;  2WAM A;  5LYJ B;  3FKS G;  1UJW B;  3OFN G;  1KKD A;  3O65 A;  4GX1 A;  4WFF A;  4PI2 A;  1EBO A;  4DV4 B;  2HLD G;  3PJS K;  3ZMU A;  5EYP B;  2CDY A;  2A0L A;  1AJQ A;  1XIL A;  1B6Q A;  4HNA B;  4DO2 A;  3AG1 C;  4WFH A;  5KAI Z;  3M7M X;  3RBZ A;  1K9M W;  1JMK C;  4FLX A;  3OT7 A;  1AIL A;  3B09 A;  1B3Q A;  1NTZ H;  4JZG A;  5DED A;  3S3W A;  2P67 A;  1S77 D;  1WB8 A;  1SZT A;  2W6J G;  4GT1 A;  1GK9 A;  2CH7 B;  4JYA O;  4GKJ B;  1G1X B;  3K06 A;  5EBL C;  2QE7 G;  4YJ2 B;  2LGQ A;  2K9P A;  5K1P A;  4CH5 A;  3ZRS A;  1VQ7 V;  1HNZ O;  2HHH O;  3CJH A;  1QHT A;  1SQX H;  3QF7 A;  1OCR B;  4JTC B;  3JAR A;  4TWK A;  3E22 B;  5J9P C;  4B3R O;  4NTX A;  1VQ9 V;  2A79 B;  1IXM A;  3DXR A;  2QWR B;  4QPJ A;  1JJ2 U;  1BHB A;  1TVK A;  2F95 B;  3K9A A;  3KCX A;  3FAV B;  5KHK A;  1XDC A;  3OE7 G;  2P22 C;  4DV1 B;  5EIB C;  1BL8 A;  1P84 F;  1QVF U;  1M90 W;  1HR0 B;  2OCC B;  1XEQ A;  1AI5 A;  1SA0 B;  1QU7 A;  1NS1 A;  2AZ0 A;  3ZMZ A;  2P6J A;  2L6L A;  1CP9 A;  1YDX A;  4MVO A;  4AQY O;  2F43 G;  2BCC H;  1RSO A;  4DXW A;  4JI2 O;  5KA5 A;  2BTQ A;  4LCU C;  1NVP D;  1KQS U;  3CC7 V;  3U11 A;  3WG7 B;  1VMG A;  2HJF C;  4MT8 A;  3LSU A;  4UCU A;  1JFF B;  1PNL A;  3CMA V;  2JIZ G;  3HKB A;  1M1K W;  1S5L Z;  3JAW A;  5JQG A;  3AG7 A;  1B06 A;  3SPG A;  4OPA A;  1JQ0 A;  1N33 B;  4X1I A;  3HKC A;  3K59 A;  1H2N A;  4KL1 A;  1H2K A;  2DWE C;  3K79 A;  2DYR B;  3RFR A;  3BY6 A;  1R73 A;  3ZHU A;  5GON A;  1YEW A;  5KMG A;  3F7Y C;  4WF9 V;  1M56 C;  3J7A U;  1H2L A;  3T1Y B;  1J5E O;  1P7B A;  4JAA A;  2CTW A;  3MHS C;  2YIC A;  1AP5 A;  2YXY A;  3JAL B;  4JI8 O;  2B5U A;  2GHY A;  5CBF A;  2AZ2 A;  3F7V C;  1Q7Y W;  4X66 B;  3AK3 A;  1FXK B;  5FL7 G;  3D36 C;  4DR6 O;  4DK1 A;  4O2A B;  1AVM A;  4TOI A;  1SET A;  1Q6H A;  1COW G;  1EZJ A;  4ZOL B;  2UUA B;  1I08 A;  2F93 B;  1QLE B;  2YXH A;  4PJ0 Z;  5B5E Z;  1G6U A;  1SQG A;  1YI2 V;  3CHX A;  4UV8 A;  5CBG A;  3APQ A;  4LNU B;  2MK3 A;  1K4D C;  2LW7 A;  3HPL C;  3AG4 B;  4YHH O;  1S72 V;  4LFA O;  4KFM A;  1WA8 A;  1MAB G;  4GKK B;  1WPX A;  2DW4 A;  5CA0 A;  2WLI A;  5E1A C;  3A0B Z;  4C7U A;  2P7T C;  1WJZ A;  3ZX6 A;  3E86 A;  1JCH A;  2IH3 C;  1Q81 W;  2QR4 A;  5LP6 B;  4BAY A;  1V55 B;  1A32 A;  3E35 A;  2EIL C;  4W4K A;  2HKO A;  1SF9 A;  3JD3 A;  1K73 W;  5LGU A;  4LWS B;  2XAQ A;  2L35 A;  1KMI Z;  5EC2 C;  4LF7 B;  1WPB A;  2R9I A;  3CD6 V;  4PD4 F;  4IHJ A;  1Y74 B;  3CCM V;  1H8H G;  2EIM C;  3ABL B;  4DV6 O;  5EZY A;  3H1J H;  4CH4 A;  2Q4P A;  2PYL A;  1UFI A;  2QWQ B;  3EVK A;  3A2F A;  4JF3 A;  1S76 D;  1JR9 A;  1ZUQ A;  2JDI G;  5KHH A;  4Z2W A;  5LXT B;  4U7O A;  2ZCE A;  3ZS8 C;  4KP4 A;  3HKE B;  4DK0 A;  4DR7 O;  4DV7 O;  4DV5 B;  2RJZ A;  4DV0 B;  4JYC A;  1IXB A;  4FLW A;  4QGP A;  1AR1 B;  1KP2 A;  2N74 A;  2DYS B;  4ASU G;  2R70 A;  3K5O A;  2CTR A;  2XHB A;  1LUW A;  2EIJ B;  2PI4 A;  4Z1M G;  4UCO A;  4D7S A;  2Y4T A;  3JD1 A;  3D3Q A;  4HZ3 A;  2UU9 O;  3CXC U;  3OGC C;  2Z0A A;  1K97 A;  5HFL A;  3W7U A;  4UVA A;  1XMO O;  1OCZ B;  2PY5 A;  3AG2 B;  3S3X A;  1QQC A;  1AJP A;  2BE3 A;  2C2A A;  1F23 A;  1G8M A;  1BT8 A;  3Q4H B;  1AB3 A;  5EYP A;  1BSM A;  4IL6 Z;  2YIA A;  4HNA A;  5JJJ B;  2Q7E A;  2Q0A A;  3IFX A;  2EBO A;  4TUY B;  2D3O W;  4BR6 A;  3HKD B;  3ABT A;  2JGU A;  2QDO A;  1HNX B;  4P2Z A;  3UT5 B;  5LMN O;  4NKG B;  2CTQ A;  4QNH B;  1MG1 A;  1VQ5 V;  4H13 B;  4TQD A;  3K03 A;  2E76 B;  2CH7 A;  1VF6 A;  4K3A A;  1AR5 A;  2K1E A;  4RUF A;  1SER A;  3RYC B;  4YJ2 A;  1GH6 A;  4YY3 O;  3W7X A;  2AW9 A;  4O4L B;  1ORQ C;  2ZKO A;  3N2K B;  3AG1 B;  3VOU A;  5J2T B;  3ZHT A;  4H0L B;  3H1H H;  3OTO O;  3T4Z A;  4CC5 A;  3TCU A;  1V9P A;  2IJH A;  4DR4 B;  2IJJ A;  3E22 A;  5LL6 Y;  4PA7 A;  1NBM G;  3AK1 A;  1M9N A;  2PGG A;  5J2U B;  4JI5 O;  4TQF A;  3ZMV A;  1KEC A;  4LF4 O;  3OUF A;  2WLH A;  1PNK A;  3TGU H;  4O4I B;  1GM9 A;  1FS0 G;  4MW3 A;  2Z5U A;  3CSX A;  1PL0 A;  3ASO C;  4MVR A;  2UXB O;  3L73 H;  5IYZ B;  5IYD O;  2QKA A;  2WA3 A;  2O57 A;  2HG5 C;  5FNV A;  1WP8 A;  2UXD B;  4K0K O;  3ZJZ A;  1SA0 A;  3CRR A;  4LH6 A;  4FK5 C;  2F66 C;  1Z5W A;  1H8E G;  2E74 B;  2W0X A;  3B2E E;  1IBM B;  5AG2 A;  2KQX A;  1MZE A;  5IJ0 B;  1F4N A;  2F4V B;  1L1F A;  1GM7 A;  2GV9 A;  5JWP A;  1QLN A;  2UXC O;  4PA6 A;  5IJ9 B;  1N34 O;  4I5S A;  4CZZ A;  1IZ3 A;  1JFF A;  1Z2G A;  3TXQ A;  4PHZ A;  1BQ0 A;  2RCV A;  2XAG A;  3CRQ A;  3FYE B;  4JGS A;  4P9P A;  5BY1 A;  3SJC C;  5KHG A;  4X64 O;  4OGQ B;  3VBB A;  2JS3 A;  3FB7 C;  4U7N A;  5B1B C;  1K7D A;  2E3C A;  5KHJ A;  4DR1 B;  4LH7 A;  4CBC A;  3OMI B;  2JVD A;  5H5N A;  2DOS A;  3N27 A;  1EM1 A;  4EB6 B;  1CXZ B;  5GTH Z;  4PEL A;  2LGW A;  2ZM6 O;  1U97 A;  3JAL A;  1VQP V;  1N36 B;  5LHH A;  1FXK A;  1MNG A;  3GB7 C;  3CRM A;  3RYI B;  4O2A A;  3K57 A;  1ZTE A;  4DV3 O;  2QWP B;  1FD9 A;  4ZOL A;  1TGO A;  3H1L H;  3CME V;  1UPG A;  1KD1 W;  1G4Y B;  1NQT A;  5CA1 B;  2EIK C;  3TJT A;  3JAS B;  4EEQ A;  5BR8 O;  4DR5 B;  1F51 A;  4DUY O;  3HB3 B;  4LNU A;  3ZRW B;  1M56 B;  2R9R B;  2DQ0 A;  1SZX A;  2EZO A;  1IBK O;  1FKA O;  4JI0 B;  4JI3 O;  1TAE A;  1NR7 A;  3RYH B;  3E8G A;  3GVM A;  1YHQ V;  3OR6 C;  1S0V A;  1R3K C;  1Q43 A;  1MSD A;  1SQP H;  2Y69 B;  2JK5 C;  1K8A W;  1VEW A;  3R65 A;  1M5I A;  4E2L A;  4KHP O;  4AI8 A;  4BWA A;  2M7W A;  3CWB H;  3ZRV A;  5ITZ B;  4LWS A;  2FML A;  3CPW U;  5LA6 B;  1KYO F;  3H1K H;  1Y74 A;  2OIE A;  3THO A;  3NR7 A;  2Y48 A;  1YSC A;  4Z1V A;  3T1H B;  2YSU B;  2QA4 V;  4GX0 A;  3ZHR A;  3DGE A;  3ABM C;  3DC5 A;  3FFQ A;  5LXT A;  4DR6 B;  4B7E A;  1I0H A;  1EZV H;  1BGY H;  4JAS A;  3RVY A;  1E1R G;  4FFB B;  4BIZ A;  1KB9 F;  3FB5 C;  4FM1 A;  3ICX A;  1WB7 A;  3IC9 A;  4HYO A;  3BPZ A;  4JI1 O;  2HJD A;  1SQB H;  3W7S A;  2EIM B;  4I55 B;  3ZN0 A;  1ARO P;  4JV5 O;  1XL4 A;  1IX9 A;  3OM3 B;  1TUB B;  1DGS A;  3H9V A;  2FKX A;  4N21 A;  2YI8 A;  1XOU A;  1H38 A;  1N32 O;  4LF8 O;  2V4D A;  4I9Q A;  4J41 A;  4FZ1 A;  1FYJ A;  4D7T A;  4ZI7 B;  1D5N A;  4AIL C;  5IWA B;  4JPR A;  3Q4H A;  2UUC B;  1FJG O;  3VQX A;  4O2B B;  4B7K A;  3G6E V;  4UB6 Z;  1JOY A;  2ZD9 A;  2XAF A;  4JZ2 A;  3ZHV A;  1AI6 A;  3IC7 A;  3HKD A;  2DJV A;  3OEH G;  1W0K G;  5EIB D;  1JPX A;  3ZHS A;  5K1X A;  5JCO C;  1ZX3 A;  4LFB O;  4LF5 O;  1RPO A;  4XDK A;  2MW2 B;  1SS3 A;  2FL4 A;  4X65 B;  2BSK A;  3ZN1 A;  4G2K A;  3BCC H;  5EBW C;  1I94 O;  3K0G A;  3UM7 A;  3RYC A;  1ZL8 B;  4B3S O;  1ENV A;  1NH2 B;  2VQF B;  4NXN B;  4O4L A;  5D5Q A;  5J2T A;  3H1I H;  4B3M O;  2ILM A;  1XRE A;  4MTO A;  5CBH A;  2RMK B;  1T5E A;  3DC6 A;  4CS3 A;  3STZ C;  2OT5 A;  3CCS V;  1AR4 A;  4ICG A;  2ETN A;  3ZMT A;  2RQ6 A;  2OCH A;  1FXH A;  1ZLZ A;  3RT3 C;  3OR7 C;  4LBE C;  5J2U A;  3UCS C;  2DWD C;  1K5S A;  4XDL A;  4JI7 O;  4NTW A;  1NJI W;  4O4I A;  4MS2 A;  3CCV V;  1VQ4 V;  2CK3 G;  1Q3E A;  3GWO A;  3JSN A;  4UVC A;  1KC8 W;  1Y6X A;  1QVG U;  4J42 A;  3UKM A;  4FIP C;  4MW8 A;  1PNM A;  5IYZ A;  5GW7 A;  1VQL V;  5CB4 B;  4NR1 A;  2JEX A;  2LO1 A;  4DUZ O;  2VWK A;  3TET A;  3BAA A;  1FFT B;  3P3N A;  2QTO A;  4Q6G A;  2ARH A;  2Y4U A;  4ABM A;  1OCO C;  3L75 H;  1FAF A;  2YS8 A;  2H3O A;  4GUN A;  1Q8I A;  2ITC C;  4YY3 B;  4H37 A;  5IJ9 A;  1GKF A;  2FYU H;  2FTK A;  4I0X B;  3ASO B;  3BA8 A;  4PDM A;  1QCE A;  4I7Z B;  5IY5 C;  2Y0P A;  1SQF A;  3QNE A;  3JAT B;  1O9G A;  3OTO B;  2QGN A;  3A0H Z;  5CMU A;  4NVP A;  4F4L A;  4JI5 B;  1F7Y A;  1E79 G;  1M4U A;  4OPH A;  4NXM B;  4YJ3 B;  1WN7 A;  4X20 B;  4EB6 A;  1KUQ A;  2YEV B;  4F6R B;  1NTK H;  2FB5 A;  2WPD G;  2UXB B;  3E8B A;  1DK1 A;  3E8F A;  3RYI A;  4O4H B;  2ZQM A;  2ZR3 A;  2JRI A;  3JSL A;  2NN4 A;  3ABK C;  5CA1 A;  3BAB A;  4JI4 O;  2VQE O;  4JAU A;  4GYC B;  4FM0 A;  5B1B B;  3OMA B;  1YCI A;  3EHB B;  2F23 A;  1ZWI C;  4X1Y A;  3ZRW A;  3W7W A;  3SYQ A;  1ZAU A;  3SYC A;  2WA4 A;  3ASN C;  1I5X A;  2IH1 C;  2RNB A;  3RYH A;  2X0L A;  4XDJ A;  3K9S A;  3SYA A;  1XMQ O;  4R50 A;  3QO7 A;  3T2M A;  3D36 A;  2M6Y A;  3LSQ A;  1IVS A;  3OGI B;  2IJI A;  1PPJ H;  4U3J B;  1XNQ B;  2LW1 A;  4NYK A;  4LF9 B;  2EIK B;  3L71 H;  5ITZ A;  4DV4 O;  2LP7 A;  3C90 A;  4DR3 O;  5LA6 A;  4ZIB A;  3D3I A;  3MD0 A;  1NH2 D;  4FLV A;  4PDL A;  3PN1 A;  1AI4 A;  2Q67 A;  1Y4M A;  4LP8 A;  5DN6 G;  2YI9 A;  4A5U B;  1Q86 W;  3K08 A;  1OCC C;  2OTJ V;  4UV9 A;  4H33 A;  1IBL B;  2ZT9 B;  2WLJ A;  5B66 Z;  1R3I C;  1LNQ A;  2PYJ A;  4XBF A;  2OYQ A;  3OD4 A;  4N23 A;  4DR2 B;  2QJ1 A;  3CXH F;  1IBK B;  4I55 A;  1Q5O A;  3K0D A;  4CS2 A;  2YUA A;  4TV8 A;  5B3S C;  2F1M A;  5LYJ A;  1TUB A;  4DV2 B;  1K33 A;  1SES A;  2PI5 A;  3JAK B;  1K34 A;  1P4R A;  1BCC H;  2XAS A;  5EK0 A;  3ABM B;  1FFX B;  5KHI A;  3ZIA G;  4JI6 O;  4ZI7 A;  4DRX B;  4J11 A;  2PF4 E;  1YJN V;  2XT9 A;  3CC4 V;  1MMM A;  4O2B A;  5LGT A;  1K5Q A;  4DW1 A;  2WSS G;  3ETE A;  2Z3Y A;  2OTL V;  3K5L A;  1OHH G;  1HR0 O;  4HBN A;  5JVD B;  1SQQ H;  1EN5 A;  1XQ8 A;  5C8Y B;  2JEU A;  4J10 A;  4LC1 A;  4B3T B;  4LF6 B;  2ZR2 A;  4GX2 A;  4WFB V;  2JS5 A;  1E1Q G;  4PDV A;  5LMU B;  2AXT Z;  3C3S A;  3G67 A;  3CS5 A;  1PM9 A;  2N05 A;  5B1A C;  2E5L B;  5LOV B;  2V7Q G;  2ZE8 A;  3M8A A;  3I55 V;  3IGA C;  1XHX A;  4JI1 B;  3KG2 A;  3JCZ A;  5KA6 A;  2CGO A;  1YIT V;  1R3L C;  1YJ9 V;  4RQE A;  3SJQ C;  1BZK A;  2VRZ A;  2CAZ C;  3RGB A;  5IYB O;  3OW2 U;  4LF8 B;  2Q73 A;  2HVK C;  3FAV A;  5BMV B;  3ZCC A;  2RN9 A;  2B9Z A;  2GSM B;  3U0Z A;  1TUE B;  2ZIN A;  3SJA C;  2EZP A;  3T1Y O;  3ZRX A;  3I5D A;  1Q6I A;  3LUT B;  4OX9 O;  4CS4 A;  1GN3 A;  2ZDI C;  3LNN A;  3WB0 A;  2NLJ C;  5CA3 A;  2QM7 A;  3K58 A;  3L70 H;  4BW9 A;  5CB4 A;  2ITD C;  1GO3 F;  1WP7 A;  2GTA A;  2UUA O;  5BXZ A;  1BHA A;  4JYA B;  3OMN B;  2KSD A;  1DTO A;  3L72 H;  2AGA A;  3SPH A;  2DQ3 A;  1MOF A;  2IM9 A;  3B77 A;  1H2G A;  4GKK O;  1VQN V;  3QTC A;  4CH3 A;  1HNZ B;  2HHH B;  2GBO A;  1U96 A;  4J7K A;  4UCT A;  3TXS A;  3ETG A;  4B3R B;  3JAW B;  1VQ6 V;  3JAT A;  3OTF A;  4NB5 A;  5H9C A;  4P9O A;  1SQV H;  4I50 B;  1VF5 B;  3B4S A;  3GWK C;  5E79 Z;  1M93 A;  4RUE A;  4FLZ A;  1WAZ A;  2QKC A;  2VS0 A;  2ZE6 A;  4LF7 O;  3SPI A;  1OCO B;  3VQW A;  4X20 A;  1EN6 A;  2YEV A;  4F6R A;  1JJO A;  2Q0O C;  3G4S V;  3N2G B;  3X2Q C;  1K92 A;  4R8C A;  2PUS A;  4O4H A;  1VQO V;  5IY5 B;  2P4K A;  3RW0 A;  3AG3 C;  4DV5 O;  5H6Q A;  1S5J A;  2WLN A;  4AQY B;  1ZSP A;  4U3F H;  3SDL A;  1YVW A;  4JI2 B;  3BHP A;  3ZBH A;  4LFC O;  1L8D A;  2QWO B;  1US6 A;  2ZXW C;  4PDR A;  3ABL C;  1AJN A;  1N4C A;  1KBH A;  2Q5Z A;  4UXN A;  5LP6 A;  4X89 A;  2WLI B;  1DF5 A;  2QTS A;  1GN4 A;  3RYF B;  5KX5 B;  1YJW V;  2CTP A;  2Q7G A;  2A9H A;  3A8T A;  1R6K A;  2DN9 A;  2QEX V;  1Q82 W;  1HW7 A;  4GX5 A;  5DEC A;  3BRC A;  3ZHQ A;  4MTX A;  4U3J A;  5L3D A;  3SPJ A;  3ABK B;  1J5E B;  2ODM A;  4IT5 A;  1S3J A;  3G71 V;  1LUV A;  2QWN B;  4X62 O;  4JI8 B;  2EIJ C;  2Q69 A;  4FJC C;  4JYB A;  3HKE A;  4IGG A;  2R9A A;  3ASN B;  1THZ A;  1HNX O;  1PV0 A;  2PZS A;  2EIL B;  3CCU V;  3WFV A;  1XNR O;  1H2S B;  2ZIM A;  4YHH B;  4IYH A;  3SPC A;  4LFA B;  2A06 H;  2OWO A;  2X6A A;  4JYY A;  4JAV A;  4X1K B;  2YIB D;  3J81 N;  1GRJ A;  4DW0 A;  1NR1 A;  3MAQ A;  2KKW A;  1XI1 A;  4L87 A;  1M57 C;  3JAK A;  4UCS A;  2IJK A;  4PA4 A;  2CE4 A;  4B08 A;  1FFX A;  5KAF Z;  2B1G A;  4DR4 O;  1NU1 H;  3EFF K;  4OXS A;  3K5N A;  4BW5 A;  4JTD B;  3W7T A;  1OCC B;  4WBN B;  4DRX A;  4DV6 B;  1ROP A;  3U10 A;  4O4J B;  1F4M A;  4TUY A;  2UUB O;  1R6N A;  3CRA A;  5JH7 B;  3HR0 A;  4DR3 B;  4I9W A;  1P49 A;  3UT5 A;  2Q8V A;  1VIB A;  3CCR V;  2EJ7 A;  1DF4 A;  1VQ8 V;  1NT2 B;  5FLX N;  4DR7 B;  4BIO A;  4DV7 B;  5A9G A;  2YID A;  5B3S B;  4L8J A;  5JVD A;  4FFK A;  4BIU A;  1QBZ A;  4FMT A;  5C8Y A;  3D8C A;  2UXD O;  1N0J A;  1K4C C;  2AHZ A;  4KUM A;  1XHZ A;  2Q9L A;  4FZ0 A;  3CCQ V;  4IIJ B;  4K8Z A;  5L3G A;  1IBM O;  2CGN A;  1OV9 A;  1RP3 B;  2H8P C;  1PL4 A;  4W4L A;  2WWW A;  2F4V O;  5LOV A;  3BA9 A;  3N2K A;  1RM1 C;  5F2V O;  5GTI Z;  3WB2 A;  2JJ1 G;  1FPO A;  2UU9 B;  2UXX A;  3LDE A;  3KZI Z;  2Y0I A;  5KUM A;  2ADQ B;  2XAJ A;  2EIN C;  5B1N A;  3P3P A;  2DE0 X;  4EFB A;  2HR3 A;  1OJH A;  1SRY A;  1AP6 A;  3APO A;  1XMO B;  3ABU A;  1P7G A;  4GCZ A;  4QE9 A;  3DSQ A;  5LHG A;  5JCO A;  5BMV A;  1Y66 A;  5IT9 N;  4JI6 B;  4DR1 O;  4J7Z A;  3K5M A;  2YIB A;  3KKY A;  4IYI A;  3BFR A;  4EKW A;  2GDS A;  5B1A B;  1GM8 A;  3ETD A;  1L0N H;  4RAI A;  3AEI A;  1I7F A;  2P5O A;  2H94 A;  5LMN B;  3UO3 A;  1N36 O;  2OIG A;  3FB8 C;  5FNV B;  4PA9 A;  2IU3 A;  1B04 A;  5IJ0 A;  2HEP A;  3CEI A;  4WCE V;  3JD4 A;  2JGD B;  1W2B U;  4G27 B;  2EX3 A;  2Q68 A;  1K3E A;  2LJ2 A;  2W0F C;  4DR5 O;  3IJ4 A;  3CX5 F;  3OUS A;  5L3E A;  5IYC O;  2WLL B;  3RVZ A;  2YDE A;  4MVM A;  3G6B A;  1KP3 A;  3E89 A;  3F5T A;  4JI0 O;  4FLU A;  3KCY A;  3JCU Z;  1GN2 A;  1Y67 A;  4LF4 B;  4PV1 B;  4I50 A;  3CCJ V;  4J80 A;  3G80 A;  1SC5 B;  2QSA A;  5KLV H;  4UFZ A;  1KKC A;  2YC0 A;  3F5W C;  1IDS A;  4QIW F;  3LNM B;  5H2F Z;  5HFM A;  2Q7H A;  1D2D A;  2LFS A;  4OX9 B;  3MDS A;  3N2G A;  2QM4 A;  4K0K B;  4WFG A;  3CYO A;  3T1C A;  2ZNJ A;  3T1H O;  1Q6U A;  3WU2 Z;  1HNW O;  2QM8 A;  2Y69 C;  5FPO A;  2GUZ B;  2XND G;  3JAS A;  3C3T A;  5FPR A;  4X88 A;  1D5A A;  4LR3 A;  1IUR A;  2XAH A;  4TV9 B;  4F6E A;  3QG5 A;  1WNS A;  2IU0 A;  4J7J A;  1YF2 A;  3T4D A;  2UXC B;  3P32 A;  1N34 B;  2HFE C;  2UXN A;  5KUK A;  3VQY A;  3P30 A;  1Q90 D;  4PI0 A;  2X7R B;  1HDJ A;  1GTO A;  4X64 B;  3RYF A;  5KX5 A;  2Q6A A;  1J95 A;  4PA3 A;  2BTO A;  3X2Q B;  2KG7 B;  1H2M A;  1NI8 A;  1EN4 A;  2YXL A;  3E83 A;  4MVQ A;  5D5P A;  4RWU A;  5LBQ A;  2ZE7 A;  1HP8 A;  1V54 C;  1NTM H;  1XUQ A;  1Y76 B;  3AG3 B;  4UVB A;  1CPY A;  1JX9 A;  3ZMS A;  5IWA O;  5LHI A;  2UUC O;  3L74 H;  2ZM6 B;  1GN6 A;  3JD2 A;  3ZED A;  3E8H A;  4EFE A;  2ZXW B;  4P30 A;  3SR2 C;  4J9Z B;  4RO2 A;  4DV3 B;  4QJF B;  4KXR A;  1XBL A;  3AK2 A;  1VP7 A;  4RQF A;  4YIO A;  3M99 B;  4FFB A;  4GKJ O;  5BR8 B;  2RDC A;  1X59 A;  2W6I G;  4DUY B;  3SYO A;  3STL C;  4X65 O;  2V1D A;  1VQK V;  4LFC B;  2D2C B;  1BMF G;  3O9O A;  4I4T B;  4JI3 B;  4QE7 A;  4X1K A;  4J9Y B;  2VQF O;  4G28 B;  4NXN O;  4ZHQ B;  1S5H C;  1KU9 A;  1URF A;  1QR9 A;  2HVJ C;  2N04 A;  1CEZ A;  3OAA G;  1Z5V A;  4KHP B;  4TSF G;  3LSS A;  3SGI A;  1VF6 C;  3DTU B;  1GMG A;  4UB8 Z;  1BS3 A;  4WBN A;  4O4J A;  4DV1 O;  2HP8 A;  2P90 A;  5JH7 A;  1JA8 A;  4X62 B;  3FD9 A;  3J80 N;  1PKX A;  4MVS A;  3CCE V;  3E2E A;  4R6Z A;  1RPR A;  4AHC A;  1OCR C;  1EFR G;  4WFE A;  2WLM A;  2NR5 A;  3LDC A;  1O9H A;  4H44 B;  1M57 B;  4DYL A;  4MSW C;  2DMX A;  3CC2 V;  2JJ2 G;  2VWJ A;  1HWY A;  1XL6 A;  1XNR B;  2BOC C;  4IIJ A;  3CB2 A;  1ZL8 A;  2X6B A;  2BSK B;  1MA1 A;  1GAX A;  3FB6 C;  3QVN A;  4JV5 B;  5L3F A;  1R1B A;  1PP9 H;  2OCC C;  1MSW D;  4FM2 A;  3K3W A;  4X9Q A;  2ZNI A;  1N33 O;  1N32 B;  3CJH B;  3TK1 A;  4WFA V;  3JAR B;  4ZKI A;  4MTF A;  1X4T A;  2CUG A;  2WLK A;  3DXR B;  4FLY A;  4K8X A;  2XOK G;  5C93 A;  1TVK B;  4CH6 A;  3CE2 A;  1FJG B;  1FXV A;  1R6T A;  3WG7 C;  1SKV A;  2XTA A;  2UUB B;  1YTF B;  5BZB A;  4NXM O;  2B1I A;  4X66 O;  1OZ0 A;  3K04 A;  4HAM A;  2G38 A;  1RM1 B;  3JD0 A;  2PTM A;  1VQM V;  4K35 A;  3RWR D;  2EJR A;  2DYR C;  3JYC A;  2EIN B;  4LFB B;  4LF5 B;  2EUL A;  5IDJ A;  1TA8 A;  3B8N A;  1YZB A;  3A0R A;  1I94 B;  2R72 A;  2JGD A;  1RSO B;  5DM6 V;  2QKS A;  2AHY A;  2BTQ B;  4B3S B;  1YXB A;  2P4V A;  4I0X A;  4UUJ C;  3FYI B;  4TT3 G;  3WB1 A;  1FXK C;  2WLL A;  4UCV A;  3B8M A;  3HKB B;  4B3M B;  5JQG B;  3CP1 A;  2BOB C;  3CRC A;  4GLX A;  4X1I B;  4YXW G;  2ZDI A;  3HKC B;  1R3J C;  1QLE C;  2P06 A;  5JJE B;  3R66 A;  1BE3 H;  4JI7 B;  5GON B;  5KMG B;  4QPK A;  3AG4 C;  4E4E A;  4YJ3 A;  1XNQ O;  4FLT A;  4LF9 O;  1W0J G;  1N8R W;  1NKD A;  1PD3 A;  4D6T H;  2IW5 A;  5LP6 C;  5B1O A;  1LR1 A;  3B40 A;  1JVM A;  3NXS A;  1V55 C;  4YIP A;  3UO2 A;  5IE9 A;  1VF7 A;  4R7C A;  2A3Q A;  5CN0 A;  5JJN B;  4DV0 O;  2IBZ H;  4MVU A;  2XUM A;  2LFR A;  4DUZ B;  2NNU A;  2GUZ A;  2ADP A;  5TIS Z;  2A7W A; 
#chains in the Genus database with same CATH homology
 5L3G A;  3OMA B;  3EHB B;  2K1E A;  4RUF A;  1ZWI C;  3ML0 A;  3ZRW A;  2H8P C;  3W7W A;  5LGN A;  2WWW A;  1SER A;  2ATK C;  3SYQ A;  3W7X A;  1RM1 C;  1WLE A;  1I5Y A;  2JJ1 G;  3SYC A;  1ORQ C;  4JTA B;  3ASN C;  1I5X A;  2UXX A;  3AG1 B;  3LDE A;  3VOU A;  2IH1 C;  2X0L A;  4XDJ A;  5KUM A;  3SYA A;  2XAJ A;  2EIN C;  5B1N A;  3QO8 A;  2X6C A;  3LDD A;  4R50 A;  3QO7 A;  3T2M A;  3D36 A;  1AI7 A;  2HR3 A;  3T4Z A;  2KB1 A;  1SRY A;  3TCU A;  1QR8 A;  3LSQ A;  2IJH A;  2IJJ A;  3ABU A;  4PA7 A;  5EBM C;  1NBM G;  4GCZ A;  1M9N A;  4QE9 A;  2IJI A;  2DYS C;  3ZMV A;  1KEC A;  5LHG A;  5H6R A;  3OUF A;  2WLH A;  1PNK A;  1Y66 A;  2EIK B;  1NVP B;  1GM9 A;  2LP7 A;  3CCL V;  1FS0 G;  4MW3 A;  4MTG A;  2Z5U A;  4EKW A;  3D3I A;  5B1A B;  1GM8 A;  1PL0 A;  3ASO C;  4MVR A;  5L3B A;  3MD0 A;  3ETD A;  1NH2 D;  3BEH A;  1YIJ V;  4RAI A;  3AEI A;  4PDL A;  1DLB A;  3SYP A;  2H94 A;  5IYD O;  4X8A A;  2HG5 C;  1AI4 A;  3I56 V;  3FB8 C;  2Q67 A;  3ZJZ A;  1Y4M A;  1OCZ C;  4LP8 A;  3AG2 C;  4PA9 A;  4FK5 C;  5DN6 G;  4FPP A;  2IU3 A;  1Q86 W;  1H8E G;  3K08 A;  1OCC C;  3QO5 A;  4UV9 A;  5EC1 C;  2OTJ V;  4WCE V;  3JD4 A;  1W2B U;  4G27 B;  4H33 A;  4MVZ A;  1F4N A;  2Q68 A;  1K3E A;  1V54 B;  2W0F C;  3MHH C;  1L1F A;  2WLJ A;  1GM7 A;  3OUS A;  1R3I C;  5L3C A;  5L3E A;  1LNQ A;  5IYC O;  1QLN A;  3OEE G;  4XBF A;  2WLL B;  3RVZ A;  4PA6 A;  1YTF D;  4MVM A;  4N23 A;  4I5S A;  4CZZ A;  1KP3 A;  3K0D A;  3E89 A;  4ZBM A;  3FYE B;  2XAG A;  4JGS A;  5B3S C;  3H01 A;  4P9P A;  1K33 A;  1SES A;  4Q20 A;  2PI5 A;  1K34 A;  1P4R A;  2WAM A;  2XAS A;  5EK0 A;  3ABM B;  3VBB A;  3FKS G;  1UJW B;  3FB7 C;  3OFN G;  1KKD A;  4U7N A;  5B1B C;  4GX1 A;  1K7D A;  4WFF A;  1EBO A;  3ZIA G;  3CCJ V;  2HLD G;  3PJS K;  4CBC A;  3OMI B;  3ZMU A;  2A0L A;  1AJQ A;  1YJN V;  1B6Q A;  3CC4 V;  3F5W C;  5LGT A;  4QIW F;  4DO2 A;  3LNM B;  3AG1 C;  4WFH A;  1K5Q A;  4PEL A;  5HFM A;  2WSS G;  1VQP V;  3ETE A;  2Z3Y A;  2OTL V;  3RBZ A;  1K9M W;  2LFS A;  5LHH A;  1FXK A;  1OHH G;  3GB7 C;  4WFG A;  3CYO A;  3T1C A;  2JEU A;  2QM8 A;  4LC1 A;  2Y69 C;  2ZR2 A;  2XND G;  3CME V;  2P67 A;  1KD1 W;  1S77 D;  1SZT A;  1G4Y B;  1NQT A;  4GX2 A;  2W6J G;  2EIK C;  4WFB V;  4GT1 A;  4X88 A;  1GK9 A;  1E1Q G;  4PDV A;  2XAH A;  1F51 A;  3K06 A;  5EBL C;  3HB3 B;  3ZRW B;  2IU0 A;  2QE7 G;  1M56 B;  2R9R B;  5B1A C;  2V7Q G;  3T4D A;  3P32 A;  2DQ0 A;  3I55 V;  2HFE C;  2UXN A;  2EZO A;  5KUK A;  3IGA C;  3P30 A;  1NR7 A;  3KG2 A;  3E8G A;  2X7R B;  1YHQ V;  3JCZ A;  1GTO A;  5KA6 A;  3ZRS A;  3OR6 C;  1VQ7 V;  1S0V A;  1R3K C;  1YIT V;  2Q6A A;  1R3L C;  1YJ9 V;  1J95 A;  4PA3 A;  4RQE A;  3X2Q B;  2Y69 B;  1OCR B;  2JK5 C;  4JTC B;  3SJQ C;  4TWK A;  1K8A W;  5J9P C;  3R65 A;  3E83 A;  4MVQ A;  5LBQ A;  5IYB O;  3OW2 U;  1VQ9 V;  2A79 B;  4E2L A;  1IXM A;  2HVK C;  1V54 C;  3AG3 B;  4QPJ A;  2M7W A;  3ZRV A;  3ZCC A;  1JJ2 U;  1BHB A;  4UVB A;  1CPY A;  1JX9 A;  2GSM B;  1TUE B;  3K9A A;  3ZMS A;  3CPW U;  2EZP A;  3OE7 G;  3ZRX A;  5LHI A;  2Y48 A;  3JD2 A;  1YSC A;  3E8H A;  3LUT B;  1BL8 A;  2ZXW B;  4P30 A;  2ZDI C;  1QVF U;  1M90 W;  4J9Z B;  2YSU B;  4RO2 A;  2OCC B;  4GX0 A;  2QA4 V;  3DGE A;  3ABM C;  4QJF B;  1AI5 A;  2NLJ C;  5CA3 A;  2QM7 A;  2ITD C;  1GO3 F;  4RQF A;  1BHA A;  4JAS A;  3RVY A;  3M99 B;  3OMN B;  1E1R G;  2W6I G;  3ZMZ A;  2P6J A;  1CP9 A;  4MVO A;  3SYO A;  2F43 G;  3STL C;  4BIZ A;  3FB5 C;  1DTO A;  2V1D A;  4DXW A;  1VQK V;  5KA5 A;  4LCU C;  1KQS U;  1NVP D;  3CC7 V;  3SPH A;  4HYO A;  2DQ3 A;  1BMF G;  1MOF A;  3WG7 B;  4MT8 A;  2HJF C;  4QE7 A;  3W7S A;  2EIM B;  3B77 A;  4J9Y B;  1H2G A;  1PNL A;  3ZN0 A;  3CMA V;  2JIZ G;  1ARO P;  4G28 B;  1XL4 A;  1VQN V;  1M1K W;  3OM3 B;  1S5H C;  3SPG A;  1JQ0 A;  3ETG A;  4N21 A;  1QR9 A;  2HVJ C;  1H38 A;  1CEZ A;  1VQ6 V;  3OAA G;  2DWE C;  3K79 A;  5H9C A;  2DYR B;  4P9O A;  4TSF G;  3LSS A;  3BY6 A;  3DTU B;  1R73 A;  3F7Y C;  4WF9 V;  1M56 C;  1GMG A;  4RUE A;  4JPR A;  1P7B A;  3MHS C;  3SPI A;  2P90 A;  3G6E V;  1OCO B;  2YEV A;  1JOY A;  2B5U A;  1PKX A;  2ZD9 A;  5CBF A;  2XAF A;  3F7V C;  4MVS A;  1AI6 A;  3CCE V;  3IC7 A;  1Q7Y W;  3E2E A;  3G4S V;  4R6Z A;  1FXK B;  5FL7 G;  1RPR A;  3X2Q C;  1K92 A;  3OEH G;  1OCR C;  1W0K G;  1SET A;  1EFR G;  1JPX A;  4WFE A;  1COW G;  1EZJ A;  4R8C A;  1VQO V;  5IY5 B;  2WLM A;  3LDC A;  1M57 B;  3RW0 A;  3AG3 C;  1QLE B;  4MSW C;  1RPO A;  5H6Q A;  4XDK A;  2WLN A;  3CC2 V;  2JJ2 G;  1HWY A;  1XL6 A;  3ZN1 A;  2BOC C;  1YI2 V;  4G2K A;  4UV8 A;  5CBG A;  5EBW C;  3K0G A;  2MK3 A;  1K4D C;  2X6B A;  3HPL C;  3AG4 B;  1S72 V;  3UM7 A;  4KFM A;  3FB6 C;  1MAB G;  1ENV A;  3ABL C;  1WPX A;  1AJN A;  2DW4 A;  2WLI A;  2ZXW C;  4PDR A;  5E1A C;  2P7T C;  4UXN A;  5L3F A;  2OCC C;  1MSW D;  3E86 A;  4X89 A;  2WLI B;  1JCH A;  3K3W A;  1DF5 A;  2IH3 C;  1YJW V;  1Q81 W;  4MTO A;  5CBH A;  4BAY A;  2A9H A;  3STZ C;  2OT5 A;  3TK1 A;  1R6K A;  3CCS V;  1V55 B;  4WFA V;  2QEX V;  3E35 A;  4ZKI A;  4MTF A;  1Q82 W;  3ZMT A;  2EIL C;  1FXH A;  4GX5 A;  4MTX A;  2WLK A;  3OR7 C;  4LBE C;  1NH2 B;  2HKO A;  5L3D A;  2DWD C;  3SPJ A;  3ABK B;  3JD3 A;  2XOK G;  1K5S A;  4XDL A;  5C93 A;  1K73 W;  5LGU A;  1NJI W;  2XAQ A;  1FXV A;  4MS2 A;  3WG7 C;  5EC2 C;  3CCV V;  2R9I A;  1S3J A;  3G71 V;  3CD6 V;  3CCM V;  1VQ4 V;  1H8H G;  2EIM C;  3ABL B;  2CK3 G;  2EIJ C;  1YTF B;  3GWO A;  5BZB A;  2B1I A;  2Q69 A;  1OZ0 A;  4FJC C;  3K04 A;  4UVC A;  4HAM A;  1KC8 W;  4JF3 A;  4JYB A;  1RM1 B;  1S76 D;  1QVG U;  3UKM A;  4FIP C;  4MW8 A;  2JDI G;  1PNM A;  3ASN B;  3JD0 A;  4U7O A;  1VQM V;  1THZ A;  5GW7 A;  4KP4 A;  2EJR A;  2DYR C;  1VQL V;  3JYC A;  2EIN B;  2EIL B;  3CCU V;  4JYC A;  2JEX A;  3WFV A;  5IDJ A;  3TET A;  3B8N A;  1FFT B;  3A0R A;  2QTO A;  1AR1 B;  1KP2 A;  5DM6 V;  2DYS B;  4ASU G;  2QKS A;  3SPC A;  2X6A A;  2AHY A;  1OCO C;  2PI4 A;  2EIJ B;  4JAV A;  4UUJ C;  3FYI B;  4TT3 G;  2ITC C;  4Z1M G;  1FXK C;  2WLL A;  4H37 A;  3B8M A;  1GKF A;  2FTK A;  3ASO B;  3JD1 A;  1NR1 A;  4PDM A;  3CP1 A;  1QCE A;  2BOB C;  4HZ3 A;  3CXC U;  3OGC C;  5IY5 C;  4YXW G;  4L87 A;  2ZDI A;  1M57 C;  1R3J C;  1QLE C;  3QNE A;  2IJK A;  4PA4 A;  1K97 A;  5HFL A;  3W7U A;  4UVA A;  5CMU A;  2B1G A;  1OCZ B;  4QPK A;  4F4L A;  3AG2 B;  3EFF K;  4OXS A;  1AJP A;  3AG4 C;  2C2A A;  1F23 A;  1G8M A;  4JTD B;  4BW5 A;  3W7T A;  1OCC B;  1E79 G;  1ROP A;  1F4M A;  1W0J G;  1N8R W;  1NKD A;  1PD3 A;  1R6N A;  4I9W A;  2YEV B;  3IFX A;  2EBO A;  2D3O W;  2WPD G;  2IW5 A;  3ABT A;  5B1O A;  3E8B A;  3CCR V;  4P2Z A;  1JVM A;  3NXS A;  1V55 C;  1DF4 A;  1VQ8 V;  4R7C A;  5CN0 A;  3E8F A;  5B3S B;  4MVU A;  4BIU A;  1QBZ A;  2ZQM A;  4FMT A;  2LFR A;  4QNH B;  1K4C C;  2AHZ A;  1MG1 A;  2ZR3 A;  2NNU A;  4KUM A;  1VQ5 V;  3ABK C;  3CCQ V;  3K03 A;  4JAU A;  2GHY A;  5B1B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...