1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
molecule tags Hydrolase (carboxypeptidase)
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
3WWOA 5ISMA 3MUNA 3PUIA 4H7IA 1QJ4A 1OCEA 2FX5A 1VXOA 5C8ZA 3O4IA 4Y2PA 3WZMA 3BIWA 1JT2A 4YK7A 3QZUA 1QO7A 2EDAA 4O08A 1AUOA 5CT4A 3W05A 4IO0A 1MX1A 1GPLA 1YA4A 4BYMA 4H7KA 1HQDA 5ALZA 2OLEA 4Y2QA 3ESBA 5IVDA 3QVMA 4OPMA 4QNNA 2JGFA 5HFNA 2WTNA 1EK2A 1XRNA 4WY5A 3G0GA 2WG0A 2XUDA 3AJAA 4L3WA 3IVMA 3G9XA 4BP8A 2XT0A 2OCIA 4G5XA 4KR0A 5CT8A 1MU0A 2C58A 2QS9A 1UWCA 5EIAA 5JZSA 1BRTA 5CT6A 3ESCA 3AFIA 4HS9A 3FYTA 2QR5A 2GZRA 5JAUA 3AIKA 4PSDA 3LS2A 1T2NA 3G0IA 4AX4A 3IBTA 3KWJA 2AJLI 1UK9A 2DHDA 5JYCA 1PJAA 3D2CA 2BUCA 3U1TA 5C7YA 5ALWA 1GZ7A 1AZWA 3STTA 4EBBA 2D0DA 3WA7A 3R3VA 3AINA 1S8OA 3H19A 4GW3A 1CUUA 1K63A 2Y1KA 3OG9A 3L1IA 4FKBA 2JGLA 3G0CA 3ZLTA 2ZJ7A 2QKYA 2CB9A 2ACKA 2WQZA 3M81A 3OURA 1CVLA 1XQXA 4G4IA 4MWTA 1THTA 4EY6A 5LZ4A 3V9AA 3IDAA 1WM1A 5AI5A 3BF8A 4BDTA 1QIDA 2ZYIA 5ALIA 2Z3ZA 3FLEA 5AKLA 4U2FA 3C87A 1JJBA 3NOXA 1X2BA 1YAJA 5DYYA 1AGYA 2PU7A 2LIPA 1XZIA 3WI7A 5DLPA 5J3JA 1XLWA 2QVBA 4CIBA 5A71A 1CR6A 5ALDA 4C4ZA 2Y6VA 4EA6A 4AN1A 2FJ0A 1NU6A 1WOMA 5ALRA 5CT9A 4U2GA 2C4HA 2PVSA 5DYTA 2QTBA 4WFJA 3GFFA 1DINA 2Y2UA 2BAGA 3WK7A 3T52A 1QONA 3WZLA 3O95A 4N8SA 1EX9A 4UBKA 2XUIA 5YASA 3FAKA 4BB0A 2ZYRA 2H7CA 5A7GA 1UKAA 2PSFA 4MWSA 4DYHA 4LYDA 3CN9A 1CUHA 1XLUA 4YPVA 5HQ3A 1XQYA 3PFCA 3UMJA 4LKOA 2DSNA 3KD2A 4AMYA 2V9ZA 4E15A 3KOOA 4JH0A 3SK0A 4BC1A 1KU0A 2CMFA 1TQHA 5D3KA 1IZ8A 1O6GA 5HQ3B 2YASA 2H1IA 5EIEA 1I6WA 3M83A 5ESRA 3G9UA 2XMZA 2OAGA 1X70A 2XMBA 3DYVA 5BOVA 5AOBA 4G8DA 3H2IA 3PE6A 4KAAA 4C87A 5LZ2A 1E8NA 1ODTC 2XE4A 4WFKA 2IITA 3E3AA 4PV7A 3SX4A 4P92A 1VA4A 4B82A 1XROA 3H2HA 2AJBA 1UOPA 3F67A 2B61A 2OCLA 4J0HA 4N5IX 1W52X 3ICWA 4ZGBA 1DQYA 4WJLA 2JGJA 5K5EA 2CJPA 2WIGA 2X5XA 4ETWA 2Q0XA 1SC9A 2HRQA 3JWEA 5CXXA 1YAHA 1H22A 3C6BA 2GZSA 2HL6A 3BXPA 4UBOA 2WHRA 3QPCA 2ZJFA 4CFSA 2B20A 4UHFA 1OXMA 3BDVA 1LPBB 4J0JA 1CUSA 1MO2A 4AO7A 1QTRA 3IIIA 4AZ3A 1SCQA 1QGED 1YB7A 2QJWA 3H1AA 1ZI9A 3WL7A 5LKRA 1VKHA 5T4EA 2PPLA 5T4BA 3TRDA 5IVHA 1IMJA 1ZJ5A 3WKEA 3F96A 5JANA 2I3DA 4BRZA 4QDZA 1VZ2A 1YA8A 2JIDA 5LZ7A 1N1MA 1ZOIA 1FJ2A 3IUQA 1GKKA 1LPPA 1UKBA 4BVJA 4U2CA 5JARA 1H2ZA 1XZGA 5D6OA 5IVIA 2Y2VA 2Z8ZA 3HEAA 5AI9A 3C43A 4OB6A 3I1YA 1C4XA 3LCRA 1QO9A 1UT6A 4M0EA 5AIBA 1XZBA 5I9IA 3I6YA 4KACA 3EQ7A 1AQLA 1A7UA 2G5TA 4DGQA 2OGZA 3PUHA 4BTVA 3QH4A 1C7IA 5JZBA 3AZPA 2RHWA 2WJ4A 5AK5A 2EDCA 3ANSA 4RE5A 4QWWA 2HA3A 3V48A 2PUHA 5AM0A 3Q8WA 2PUJA 3G7NA 5ALMA 4H35A 2CUTA 4A5SA 3GELA 4J7AA 4J03A 4DLNA 4OYLA 1QIGA 3BIXA 4YASA 2HA0A 3IUNA 2PKYX 2DR0A 2ROQA 1YSCA 5AKHA 2YH2A 4CI9A 5CBKA 1A88A 4B84A 4HXEB 3MUOA 1BS9A 1LPOA 1X2EA 4B85A 1TRHA 2G4LA 1ZICA 4CG3A 4GEGA 3EQ8A 4W1QA 2VAVA 5SYMA 4GBGA 5LZ5A 4QWMA 4BBZA 5K3BA 1XZKA 2VF2A 1N8SA 1ZD4A 2JGIA 3WK9A 4XJVA 4UFNA 1WB6A 4KRXA 2HA7A 3RLIA 5AO9A 1QIJA 3WK6A 4OYYA 2J4CA 4FFVA 3A2MA 2VA9A 4X93A 2WU3A 4MJ3A 4MYSA 1XRPA 4KE6A 1AURA 3WWPA 5AKIA 1G5FA 3HXKA 4N8DA 4KJXA 2YYSA 4PO3X 5AI0A 3HC7A 1FFBA 2X76A 3OC0A 4FMPA 2ZSHA 4UUQA 1CUJA 5F4ZA 3R3UA 3QITA 4F5ZA 2XLBA 2OCGA 2Z8XA 3FLBA 5FRDA 3B5EA 2XUPA 5AM4A 2H9YA 2WHQA 1F6WA 1DU4A 5LYYA 1ZD2P 5AKKA 4I19A 1U8EA 2C5GA 3F97A 1MJ5A 4IH1A 3WK4A 3WL8A 2XQJA 3H17A 4EY8A 4K5QA 1U4NA 3O0DA 3AILA 4KE9A 4NMWA 4HTAA 1CFJA 1IUNA 1Q0RA 4MQMA 3C8HA 3R40A 4K6HA 5AJHA 4LXGA 3I1IA 5HKBA 3DJYA 3RARA 1LPAB 4PQEA 5IKXA 2IX9A 1EVEA 4X6YA 3ZWQA 3WK5A 3DOHA 4EY7A 1ORVA 3M82A 2J4FA 4UBNA 2BKLA 3STYA 5ALTA 3JW8A 3V1MA 2ACEA 2GYVA 2DQYA 4Q1VA 4EZIA 2X8BA 2VATA 3STWA 1LZKA 1CUGA 5A7FA 3EQ9A 3TGLA 3QYJA 3WYDA 1YR2A 1EVQA 1WCYA 2VJDA 4MQLA 4UHEA 4HAIA 2OAEA 4V2IA 1JU3A 4QDTA 1DWQA 3I2GA 5AOCA 1CUFA 3F8SA 4UBIA 3R41A 1GPKA 3F98A 3R3YA 3EF3A 2PU5A 2WUDA 3DKKA 2HDWA 4RNCA 4Y9SA 4H7JA 1C7JA 1MN6A 4E46A 1PFQA 1LLFA 3ICVA 3D3NA 3L1JA 3QPDA 2VEOA 3G8YA 4TPKA 4A16A 5AKXA 4EHBA 1G66A 4X92A 1J06A 3WWEA 2O2GA 1LZLA 4KE7A 2QXUA 5AM3A 1H2YA 2G63A 2XUQA 1LBTA 1DWPA 4BE4A 1CUZA 2H7YA 1EK1A 2WUGA 1XZEA 2RONA 5CT5A 2B9VA 3C5WP 4FDMA 5CH5A 1JMKC 5AKEA 2BGRA 5AM1A 5AKZA 5ALNA 1U65A 3HYSA 2RHTA 4H18A 1VE6A 1XQVA 1Y7HA 3E1GA 2OQIA 1XLVA 2ORYA 4GHWA 4G9EA 4XX1A 4X85A 1CRLA 4IH4A 2VTVA 1E8DA 3DEAA 4FOLA 1LPMA 5HCUA 4W9RA 4DTCA 1ETHA 1GPNA 4LIPD 3A70A 3LIIA 3H2JA 1BCRA 3G9TA 1LGYA 5ALEA 1VXRA 1EA5A 1GXSA 1UKCA 3N2ZB 2V96A 3R3ZA 4WFIA 4X91A 1MTZA 4DMKA 4BZZA 4INZA 2XUAA 5ALSA 5JD4A 1UK8A 2WJ6A 4PSUA 4X90A 5C8XA 3V1KA 1W76A 1GQSA 4LYEA 1R50A 1B41A 4D9JA 4ZV7A 3WL5A 1CEXA 4ROTA 2CZQA 3K9BA 3C70A 2ZSIA 5KWJA 2ZVDA 4QLOA 1NU8A 1JJFA 5K3EA 4B7ZA 2D5LA 4WCVA 5ALJA 1DTEA 4B83A 3C6YA 3AZQA 2HADA 1FSSA 4TVKA 1P0QA 2RAUA 3WIOA 3O9VA 4DNOA 2UZ0A 4JYMA 2WIKA 4QEKA 5ALPA 4P08A 1AKNA 1TAHA 4WY8A 4UHDA 4YX9A 4TGLA 3O9MA 3MGAA 3I6MA 2JGEA 3K2IA 5CMLA 2QOEA 4FNMA 4G8BA 3I28A 4FLEA 5LZ8A 1RP1A 3OOSA 2WG1A 1IUOA 1TIBA 3W9UA 1BEEA 1BCSA 4I4CA 2JGMA 2HRRA 3HJUA 3QMMA 1CUYA 1OILA 4OU4A 3FLAA 1ZGBA 4K6GA 5ALXA 2VAXA 5E4JA 2H7XA 3R3WA 2GBFA 1BN6A 3A2NA 3V1NA 2C0QA 2WU4A 4Y2UA 1IVYA 4ZWNA 5BWBA 3FCXA 2OGSA 3VVMA 2PSJA 5AIAA 4Y2XA 2FUKA 4G4JA 5BV7A 1ZIXA 2HU8A 4ZV9A 2AJCA 3FBWA 4C88A 1CLEA 2O2HA 5LIPA 5K3DA 1J07A 2XQGA 4KYVA 2HA5A 4HXGA 3FWHA 2PSDA 3H2KA 5EHNA 1MX5A 2O2IA 1EB8A 1JFRA 2ZJ6A 2RI6A 4GECA 1XZMA 4DNQA 4BP9A 4A23A 2HM7A 4BDSA 3OPMA 4HZGA 4DMFA 3C8DA 4UPDA 4DMHA 4OB7A 3H2GA 3STXA 3AUKA 4KAJA 3QM1A 1A8UA 5AH0A 3LLCA 4GI1A 4J0CA 4OU5A 4AO8A 1TK3A 3U0VA 6YASA 5JD5A 5FPQA 4XVCA 1EDDA 5ALVA 3C5VA 1UFOA 5JZ9A 5JADA 1MX9A 4QZVA 5BWCA 4LHEA 1D07A 1MAHA 5H3HA 1W6RA 3A6ZA 2VJAA 1JI3A 3TJMA 4ARBA 1XKTA 3GBSA 4HRYA 3OTQA 1LPSA 1QIMA 1WHSA 4OSEA 1KEZA 4J3JA 3TEJA 2ONCA 4EB0A 4CG2A 3QMVA 4MXDA 3WJ1A 2HFJA 5C81A 5A7HA 5I7UA 4QDUA 4IHAA 2QMQA 1WPRA 3WA6A 3ESDA 4U2BA 2HU5A 2EEPA 4LXIA 1R1DA 2HU7A 3EIOA 3AIMA 2WUFA 3I6ZA 1SCIA 1R88A 1EXWA 3H04A 5DNUA 5AI8A 5DTJA 5EHZA 5KWIA 4PNZA 4Q34A 1ZGCA 3H0CA 2WUEA 1QIEA 2XUJA 3KSRA 4BCCA 3PDCA 3ZPXA 5JALA 4J0KA 4BCBA 5AP9A 3RM3A 3WKBA 4CIAA 1BEZA 2WTMA 1ZJ4A 1SCKA 2HA2A 5AKJA 1DX4A 5KBYA 4U2EA 4MYDA 3L1HA 2QUBA 3D59A 3PI6A 4EY4A 3ZV7A 3CN7A 5EHXA 2PSHA 3JYHA 4X95A 5DYWA 4KEAA 1M33A 2AXEA 1BU8A 3I2IA 3HABA 2XDWA 3EBLA 3MVEA 1VLQA 3HZOA 1FFCA 4BAZA 4W1RA 1MNAA 1XRRA 2JGKA 1GQRA 1ORWA 4QDXA 5T4FA 3CCCA 4C89A 1VA5A 4E11A 3BDIA 2ZYSA 1YS2X 4HXFB 1WB5A 5FP0A 3D2BA 1ZD3A 1L7QA 1W4LA 4DM7A 1JU4A 1R9MA 1XZAA 1E3QA 5HF5A 3PFBA 1Q83A 3C6ZA 4Y7DA 1QFMA 2R11A 5ALQA 2BUBA 5FXMA 2VJCA 4X6XA 1E8MA 1G42A 3VKFA 2XQFA 3C45A 5HK8A 5HZGA 3WIBA 4C4YA 4H7HA 4DNFA 4MEAA 4UBMA 2XLCA 5EGNA 2DCMA 3WKDA 2WSLA 4H7DA 3ED1A 4DIUA 3DKRA 4X00A 5AK4A 2QM0A 2PBLA 4Y2YA 4BE9A 3VJKA 5A2GA 1BROA 3D4LA 4W1SA 3DOIA 4W1PA 4ZRDA 3STUA 2WFZA 1WB4A 2GBIA 3G02A 4Y2VA 3PF8A 4QDOA 5FLKA 3IUJA 3W04A 3WL6A 3FSGA 3FYUA 4BC0A 5JAOA 5FUMA 2JF0A 3DD5A 2C7BA 1JKMA 2Z3WA 4ZI5A 3ZI7A 1TKRA 3WWDA 1EHYA 1R3DA 2J3DA 3WLAA 3I2KA 3H1BA 3P2MA 5ALYA 2XI4A 4Y2JA 3G0DA 4NS4A 3FYUB 2OGTA 3I2JA 2XMQA 5FV4A 2JEYA 5K3AA 1UOQA 1LPNA 3T4UA 2XMDA 5D3ZA 3ESAA 2WILA 1GT6A 1UZAA 1RWQA 2XMCA 3GZJA 4Q3LA 2G5PA 4X7BA 5EI5A 2WM2A 1B6GA 4B9AA 4B81A 3PF9A 3LIPA 5E4YA 3ZLUA 4M0MA 1DT5A 2HFKA 2ZYHA 4G8CA 5AK6A 4X94A 5IVKA 4DSZA 1GGVA 5E4TA 4BAUA 5FPPA 3NWOA 1ODCA 4X6UA 1BN7A 4H7FA 2HHAA 1CUVA 4BVLA 1AX9A 2OCKA 1IUPA 1AC5A 4N8EA 5KREA 1ZIYA 1WHTA 2E3JA 2XMGA 4KRYA 3R3XA 3DL4A 1QIIA 3ANTA 1VOTA 2WIDA 1LBSA 5SYNA 5EIHA 2OG1A 4JYPA 3HLKA 1QZ3A 1XZCA 2BUAA 3BF7A 1F8UA 2CEKA 1L7AA 4J0DA 1XZFA 4FHZA 4B80A 1P0MA 2FJPA 2PM8A 2JBWA 3D5EA 4Y2RA 1CUAA 1XFDA 2YXPX 4GDMA 2WJ3A 1MNQA 4G9GA 2W22A 4PW0A 2I78A 4H7EA 1FFEA 3IURA 1QFSA 1J2EA 1Y7IA 2B4KA 2O7RA 2XMSA 1J1IA 3W9BA 1XRMA 4MEBA 4AXBA 5AM2A 1Q84A 3BL8A 3DS8A 1WPXA 3GA7A 1THGA 4OUKX 2HA4A 1W1IA 3X3HA 5CXUA 4U2DA 4PF1A 5HF8A 1K5PA 3R0VA 4CG1A 1MT3A 4W63A 3D0KA 4FFWA 3FYUC 1U2EA 5AM5A 5LP1A 2JEZA 1QOZA 3DNMA 3A2LA 4C4XA 1ZI8A 3VJMA 1SFRA 3HSSA 4FLMA 1P0PA 4P9NA 3IB3A 1XZHA 3HACA 3PICA 5K3FA 5LKAA 4X97A 3LP5A 3V1LA 2OQVA 5FDFA 4UFOA 3G9ZA 3VXKA 7YASA 2P8SA 2QRUA 4IQ4A 1CUCA 2AJ8A 2QT9A 1EINA 3WWCA 4AO6A 5ALGA 4JNCA 4J0IA 1CUIA 2WG2A 4AQDA 5K3FB 1Y37A 2K2QB 4FTWA 5ALHA 3DLTA 5JAHA 2XUOA 4L72A 2XUFA 1EB9A 2PSEA 4K2AA 1UK6A 4DMCA 3ZLVA 4UBJA 3B12A 1TCBA 3D2AA 2XUGA 1O6FA 2WKWA 5JATA 1E89A 2WIJA 1DT3A 2IIVA 2C5FA 2R8BA 4OB8A 1HDEA 1EDEA 2QJRA 4CCYA 4BRSA 5LZ9A 4S0XA 2DHCA 2CKMA 3I2HA 3OM8A 4RGYA 4AMZA 1H2WA 4BCDA 1T4MA 4L9AA 5ALUA 4BAGA 3HRHA 4UHBA 2BCEA 4Q05A 2CBGA 4CCYB 5CTAA 1ACLA 1UK7A 3DDUA 3FVTA 2BGNA 4QA9A 3QBJA 5EHQA 1QTIA 5ALFA 4UBLA 3E4DA 2W6CX 4J0GA 4E14A 3H18A 2QUAA 1EH5A 1G4HA 3S8YA 1YASA 1XQWA 3WMRA 3DQZA 1QIFA 4NVRA 1R4ZA 2Y6UA 3Q0TA 2XQIA 1VZ3A 3GUUA 3VISA 1LNSA 5HK9A 4M0FA 5A62A 4ARAA 4BATA 5CRIA 5HF6A 2AJDA 2GBGA 3IULA 3BE8A 4OD0A 1R9NA 1CUEA 4RPCA 3VVLA 4LXHA 3UUFA 5AOAA 3WK8A 4EY5A 1NX9A 1ZI6A 3BJMA 1BE0A 1YS1X 3BWXA 1P0IA 4Z49A 3WYNA 4AB1A 2QZPA 1QLWA 5CH3A 1YCDA 4K6KA 4HVTA 1HPLA 5CW2A 5HKAA 1HBJA 5C8VA 2I03A 4F0JA 2WIFA 4X71A 3IUMA 3WKAA 3FNBA 5K3CA 1MPXA 4PSCA 4C6HA 2RGUA 1ODSA 1XKLA 1VE7A 2WHPA 3KDAA 1ACJA 1EDBA 2HIHA 1H2XA 4ZXFA 3SWWA 5EFZA 3GROA 4FBMA 3STVA 3BJRA 3DCNA 3RK4A 3KWFA 2GYUA 3QMWA 1A8SA 4DNPA 5AKYA 1VJ5A 2WLSA 1HL7A 5ALKA 1TCCA 3O4HA 4H77A 2WHPB 4P93A 4AZ0A 3CCBA 4GWLA 1XRLA 1K8QA 1DWOA 4F21A 1FFDA 1CUDA 4AN0A 1N5MA 1MAAA 4IH9A 1CQWA 1CUXA 2XB6A 1CUWA 1Z68A 2VT6A 1QIKA 4UFPA 1TCAA 5HFAA 5AI4A 1AMNA 1K6EA 4Q3OA 2DHEA 4B0OA 1JJIA 1F0NA 1SOMA 3FVRA 4JEIA 3B3QA 4N5HX 2VSQA 3VJLA 2PX6A 4FNGA 1FFAA 1YB6A 4RE6A 3RKSA 3HI4A 3W2TA 1K4YA 4OCZA 3WKCA 4NZZA 2DFPA 1IZ7A 4B0PA 1XRQA 4I3FA 2OPHA 3M3DA 4FWBA 5AHXA 2XMRA 2XQKA 1UXOA 3YASA 5HF9A 4XWGA 5DNVA 1GKLA 3VDXA 1CUBA 5AKGA 5ALLA 4Y2TA 2DQZA 2PL5A 2WFMA 4CCWA 3DYIA 4XIIA 3FOBA 3WJ2A 2NW6A 3K6KA 3CXUA 5IH7A 2VJBA 3DL7A 4B9EA 2QXTA 1F0PA 3ILSA 1PV1A 5DWDA 4H0CA 4QE3A 2VQ6A 5DTIA 2O7VA 5FKJA 5JIBA 4EUSA 2BJHA 4Y2SA 1E66A 1XZLA 4BVKA 4DSAA 1RYYA 4Q82A 1XZDA 4UHHA 4FLFA 5ALOA 3N0TA 1H23A 4X3CA 2HA6A 3NGMA 1EI9A 1W75A 1KU6A 2XUHA 4Q3KA 3I2FA 3O4GA 2J3QA 4JUIA 1CPYA 2VT7A 3G0BA 3O4JA 2ECFA 1UOOA 2OXEA 1JMYA 4B6GA 5T4HA 3KXPA 2XUKA 4GXNA 2WFLA 2V98A 4UHCA 1E5TA 2GBCA 3S2ZA 5E2IA 4KE8A 5I8PA 4ITVA 3FCYA 2ES4A 4KAFA 1CQZA 2WFLB 5D7BA 2Z5GA 1A8QA 4WDRA 3NUZA 3SC2A 1QIHA 3F9CA 5AK3A 3C6XA 4BTLA 4ZREA 5LLSA 4G1FA 4GLBA 1ISPA 5DNWA 3WQHA 1DQZA 2I3ZA 3W06A 4HRXA 4G4GA 4WDQA 2BFNA 1DX6A 5JASA 5JD6A 5CURA 3D7RA 3IA2A 5A6VA 5DJ5A 5CH8A 1XZJA 3AIOA 3FSGD 4QLAA 2V97A 5FOQA 2GYWA 4L0CA 1ZD5A 5JAPA 5AICA 3AZOA 5AI6A 4C01A 1HLGA 3QPAA 1CV2A 2RIPA 1HKHA 1L7RA 1Q0ZA 2C0PA 1QE3A 3UUEA 1CIJA 1N5RA 4BZWA 3E0XA 4F60A 4FBLA 1USWA
chains in the Genus database with same CATH superfamily
3DAOA 3S29A 1N2OA 4Y2HA 1UJWB 3NJ4A 3JAKA 4KODA 3SQDA 1OCEA 3SU8A 4UTXA 2AEEA 1FTQA 3AVXA 4AT1A 1SU8A 4HSEA 5J43A 2EDAA 3GVHA 1U0SY 1JP7A 1GTZA 3KKMA 1JEJA 5GWXA 2AD1A 3TOXA 2OIGA 5CBPA 3KRTA 4IQGA 2Q3DA 4WBSA 5LXTB 2TRSB 3ESBA 5IVDA 3KV1A 3GT0A 2MJLA 3UJNA 3IUYA 4XW2A 3IVMA 1ZIPA 4DR3O 4JBLA 2PWYA 3AFHA 1G9TA 1X14A 1IWPB 4C0SA 4RTPA 3OZFA 2YQ4A 4MVJG 2LIVA 4DGSA 3LI2A 4DQVA 2LKCA 1MJNA 3ZEAA 2WSMA 1A82A 3RSCA 4IIYA 1JH9A 4RADA 4NXNB 1LK7A 3KSUA 2VDLB 1GIAA 3RGWS 4C4AA 3L6DA 3NBQA 2ZXEA 1NAIA 3BFXA 4GE0A 4R9SA 2JKYA 2I54A 1F8YA 5GZ3A 4NEGA 4F4LA 3H19A 2Q8VA 2Y1KA 4Z2YA 2I2BA 3W5UA 2ZJ7A 1M34E 4XWWA 3CKLA 2QBYB 3CG0A 3SFTA 4GKAA 4QAJA 4FSXA 5HM6A 2P6UA 3SBDA 3BF8A 1IXRC 3S3WA 2AG0A 4QIWF 2ZYIA 2IS2A 3HFRA 1ULTA 4I8DA 4U2FA 3JATA 2FUG1 3IV9A 4XEHA 1AGYA 4PC2A 5DBFA 3RSLA 3DL2A 1JHPA 1N2GA 1Q7CA 1TAGA 5E6UB 1K5GA 2G6TA 5KQLA 1LWOA 1PGOA 1XN1A 2F4VB 2J41A 5KVQA 3GPBA 2B4TO 1WW2A 2F43G 1E2EA 4GO1A 3I05A 4YJ3F 4DXDA 4UCWA 3QW2A 5EY5B 4G3XA 2JCXA 2ZYRA 3A6FA 2UYHA 4QOHA 3CC8A 3PIIA 2EKZA 1P7VA 1P2VA 4GPD1 1L1FA 3DEJA 4MUBA 2WLJA 1T4CA 4XDKA 1G8GA 1I80A 3A31A 2B2NA 4ZEMA 3GAAA 4YROA 2C2KA 1YV9A 4I5EA 1G6UA 3DZDA 3NDJA 3GLKA 2EULA 1EAMA 4TUYA 3DYVA 1AQNA 3CLVA 3GCXA 4ESEA 1B0AA 5EJAA 4NI5A 1LLUA 3D1VA 2ZETA 3ISTA 2JFPA 5KYKA 2IKQA 1SQSA 1QHYA 5TMDA 2Q68A 2GWHA 1YAHA 3OJ0A 1PR6A 2WHRA 5HX7A 4GLOA 3DOEA 1YVUA 5J58A 3DDZX 5F9FA 3AK4A 1V5GA 3E81A 3SNKA 2GFHA 5GVSA 1J00A 3CNNA 1JR3E 4E21A 3H1AA 1ZI9A 4B32A 3JQBA 3WBBA 1M5RA 2OO3A 4QOIA 4GCZA 4XDLA 4R9VA 3QUAA 3Q7EA 4TRJA 3QO5A 4BRZA 2YHIA 4MVJI 2XVXA 5C1DA 3UFXA 4WHMA 2RHMA 3AG4C 1RM4A 2Z8ZA 1KC3A 3HEAA 3W7VA 3HZHA 4DANA 2R9RB 3LCRA 3AI3A 3THXB 4RS3A 1KDOA 3QJGA 1HMYA 3D0RA 5KVVA 3BCRA 3EQ7A 3OJOA 3NHAA 1QYCA 3PUHA 3UT5A 4ZKDA 3KPYA 2BGKA 3URKA 5B1NA 1UAYA 8GPBA 5B1YA 4GOOD 6ABPA 1OE0A 1G9XA 2AFHE 5EMKA 1GL3A 4FIZA 2AI3A 4BFLA 2QAGC 3ODPA 5K03A 3OJWA 4B5KA 4XOIA 2YH2A 3BWEA 4E07A 3E53A 3L8GA 4BNHA 2XH8A 3EQ8A 1JBKA 4NULA 3FVQA 1AN0A 1RJDA 3VOSA 1R00A 1X7YA 3GMSA 4FLYA 2H52A 2Q9CA 2XXBA 1UJ6A 4LY9A 1JEEA 1YZNA 3I9NA 2JDIA 4RJIA 1N2CB 2H1SA 3WO0A 3RLFA 3A2MA 5HIIA 3FKSA 3HS3A 3EGDB 5B1BC 3ND7A 5B4VA 4MYSA 3PJSK 2PZKA 4ZEOA 1L4KA 1G5FA 1N5KA 4RENA 4P8RA 1E20A 3HP7A 4TV8B 4UFZA 1LNQA 3U7HB 3FLBA 1QSGA 3K16A 2OBXA 1U1GA 3SR4A 4KB5A 1WQ1R 3QVXA 3AKEA 1ND5A 2C5GA 2O52A 1EFLA 4I6GA 4GKJB 2NXNA 1HWYA 1YF2A 1U0TA 2QG4A 3LQYA 1R64A 4GLFA 1ORIA 2FR1A 2Q7XA 4PG7A 1J5XA 5AW1A 3UUWA 1C5KA 3R0XA 5SZKB 4WVLA 4AF8A 1WKCA 2AOTA 5AUOB 3ZWQA 3IFSA 1SXJC 1E18A 2E7ZA 3CNEA 2O3QA 1VF7A 6REQA 2W5UA 3DKVA 2QN6A 4N6OA 2YRFA 4M7PA 5FUYA 2BMWA 2PYZA 3LCVB 3C3BA 2TS1A 5T41A 2ORWA 4FW9A 4FT4A 4ASUA 1Z2NX 3RSGA 2Y48A 2WTUA 1P7BA 2ON6A 4RLSA 3PPWA 5CA0F 1E0JA 4ZZIA 3GGDA 1WCIA 3RQIA 1YUBA 2HDWA 4NQRA 1LLFA 4PI2A 3BIJA 1Z5UA 2VA8A 5C53B 2K7FA 4UTPA 4EHBA 1ZH0A 2WKPA 1J1ZA 5HDBB 3KT8A 2QXUA 4EPYA 5CA1B 4PTZA 1WCWA 1ZO8A 3ZZUA 1M8GA 1U3VA 2WEKA 4JP2A 3MHHC 3AVUA 4L8FA 1J23A 1RI3A 3WJ7A 4ZHSA 4I1VA 2RONA 4DMUB 4B74A 2BGRA 1XD8A 1HNNA 1XALA 3V3KA 2QRGA 2ODQA 5BVGA 4V0ME 3SR3A 2QD1A 1VE6A 1IN8A 1QP7A 2XTAA 1TRKA 3AG3B 2PMBA 1KPGA 3LHFA 221PA 3G23A 4BY9E 2OZEA 2R7NA 4UPVA 2WV9A 1VXRA 4GXTA 3FPGA 1U6KA 3ZWVA 3L8FA 3ONWA 3CF0A 1ADYA 2NO5A 2RCYA 4DWOA 1QH9A 1DBQA 4C3VA 3SI7A 1N6OA 4F85A 1D2GA 4KZPA 2XYHA 1Y5RA 3WL5A 5ECGC 2C2HA 1CE8B 2HPAA 4MAAA 2O2DA 1ZM2A 1ZIDA 3ZCRA 1G5HA 5JQGF 1RM5A 1J2YA 2W0FC 4Q20A 2YFYA 1G60A 1THZA 2KI5A 3B2QA 4A0HA 3UQYS 5EG5A 3FFTA 4WE3A 3L8YA 1Y7LA 1DEXA 3ZOKA 4BHTA 4WXPA 3MT7A 4O33A 4G8BA 1P0CA 5BORA 3P9NA 2CNWA 4CG0A 3CD6V 3AL0C 4HLQB 3ER6A 4C0KA 4REMA 2EVWX 2CTPA 3GEDA 2OHIA 4KBYA 1MIHA 5A3RA 3QMMA 4Y9RA 3HWSA 3VH2A 4Q7JB 3N70A 1W0KG 4JI3B 3X1WA 3UXHA 3KQYA 4AUNA 1FLDA 1PZFA 2F66C 4RA6B 4GKBA 4R1OA 2QI9F 1DDIA 4XPZA 2AG6A 2YUTA 1PVOA 4Y0AA 4E4EA 5I7HA 4KYVA 3V8QA 3T38A 2F8MA 1ISFA 1EZVH 2ZPTX 4URFA 1Q2UA 4Y7CA 3RVJA 4BP9A 2BSQA 2RMKA 3C3TA 4BEVA 5EUQB 3CXHF 1SB9A 2GPYA 3FIJA 4OHFA 4NJOA 1TO6A 5KAIZ 3R7FA 2ONZA 5AJTA 3UENA 3S2YA 4OQNA 4LFAO 1QK4A 3MINB 3UM9A 1KNXA 1Q0UA 2A59A 4WL0A 4TXNA 2CVQA 5F33A 1AS3A 3KLOA 1U1IA 1QDUA 1XKTA 1EK5A 3SCZA 4QYWA 1K08A 4ZJUA 4OSEA 3GB9A 5EP3A 4EHIA 4UVDA 4FQ8A 3HYTA 2O3RA 1C3XA 1NW6A 5A7HA 1IC6A 4EKYA 5CGZA 3I6ZA 1PNLA 1UCFA 5JPCA 4ZANA 3UYKA 2DG2A 3DPSA 3DR3A 5TT0A 5LA6F 1VJTA 1O6BA 2NSLA 1GTJ1 3VR6H 2RHHA 2FWNA 5AP9A 5E3JA 1G21E 3PJGA 1BEZA 2IEZA 3IQZA 1G64A 3UO2A 3DE3X 3EWIA 1YGYA 5GV8A 4RSMA 1Z73A 2HA2A 1NXPA 2ERXA 3M5WA 4IGKA 1Q7EA 3ICCA 1AZLA 1G5RA 2B9EA 4IWXA 1GCAA 2G6BA 1BA3A 3AUSA 4DEVA 4C4TA 4U7OA 1ICEA 3I0MA 3QPWA 4HAXA 3AESB 3A6HA 1F8GA 4RUEA 3CEMA 5EE3A 4FI3C 2ITDC 5EQTA 3QE2A 3PQ2A 2YJGA 2AH5A 2HQOA 4UAJA 4C89A 3CHXA 1GPDG 4I2NA 1CETA 4HYEA 2JEXA 4FM1A 2P6OA 1P1BA 3RUHA 3OC6A 4R8SA 4KRGA 3FAZA 4DM7A 2VF4X 2ZRFA 2EFEB 1B0UA 3LPCA 3NKFA 2VTEA 2ODTX 3QTLA 1ZM4A 4CYMA 2BUBA 3A11A 3DM9B 3ROXA 4EYSA 5EGNA 4NENB 2FA9A 4DIUA 3IV6A 1S9DA 2QM0A 5ITSA 5LGNA 3WAGA 2BJVA 3COSA 2HJWA 1WE2A 5FF9A 3GNLA 5A9SA 3VPCA 4ND3A 3V4LA 3WIDA 2FFJA 1HSOA 1M90W 1O95D 4RD4A 2BF7A 3IUJA 4OLJA 2FQ1A 3OZWA 1JDJA 2RHJA 3F3KA 1JKMA 3ZI7A 4ZI5A 4LGYA 2HLNA 1GOTA 5EHIA 5C52B 2R84A 3I2KA 4KDRA 2OD2A 2EJ7A 3LZDA 5IKPA 3GBPA 1O57A 1WG8A 3I04A 4FFMA 1G3RA 2N04A 4RWEA 3T4UA 5A5GA 2Z43A 4XYBA 2WILA 1V6AA 4X7BA 3NJRA 3HV0A 2B2XA 2DYRB 2C2AA 6AT1A 1SKBA 4NZPA 2CUKA 2CHFA 5JVDA 4ZOBA 3MIZA 2Z5VA 3J80N 2FK7A 4HQFA 3VVCA 2F55A 3HH8A 5LWQA 3C4QA 4ZARA 1GO2A 3CC2V 4KOAA 4J11A 4CL3A 3ZTTA 2HHAA 1WA8B 4J4HA 2WWYA 1AC5A 1ZIYA 2YOGA 1RJ9B 1XJCA 4CMCA 2JG3A 1K34A 1F14A 1ZFNA 3DL4A 1LBSA 4C6SA 3DFUA 3DEFA 1FXWF 1T9KA 2HGZA 2J07A 2ZKOA 1UH5A 4AI8A 1FSPA 2P2SA 3SKXA 2P78A 1IPEA 4HMQA 5AVKA 1DRVA 4X1IA 13PKA 4D80A 3AUFA 2WAOA 2XMSA 2PZGA 1RJGA 4CCAA 3HR4A 5K8JB 2A9RA 1YKFA 2DBYA 3VU9B 3P2IA 3B1FA 2QN1A 2Q9LA 3EC2A 3USCS 4V02A 2JI6A 3W2IA 1BKSB 2FY8A 1LS6A 3H87A 2SBTA 4MDYA 4XQ9A 3W3AA 3A2LA 1Q1EA 2AJTA 4C4XA 3P2YA 1WN7A 3KBOA 5LMUO 3PXXA 3BRWD 3TQOA 3UO3A 1TTQB 1PF7E 1R5JA 1DZ3A 3G9ZA 4QPJC 1UZUA 3ETHA 5GV7A 2WUVA 4CIXA 3AETA 3GZTB 3Q3EA 2XUFA 3BWCA 1B6TA 1VKRA 2E5LB 1UK6A 4GR4A 4HMOA 4DMCA 2V3WA 4V3CA 4UBJA 3IS3A 3UJ6A 3ZVNA 1FLNA 1L4HA 5JRZA 4NH0A 1GUFA 5FQOA 5LOVA 1UPBA 2FMLA 5IAJA 1DT3A 4Q1CA 4LY6A 4Y0NA 1C8KA 1I2MA 3ISVA 5A4AA 5ER6A 4RGYA 4DIOA 4L9AA 2OLJA 1FSFA 1EP3B 3GIWA 3COPA 3FHTA 1HYGA 4OXRA 2O50A 4N7JA 3HB4X 3OPNA 2EJTA 5TV2A 4ZQIA 1YJBA 1XC7A 4DJTA 3QBJA 1QTIA 5ALFA 1QGOA 4XSGA 4F06A 5HYVA 2XIJA 5EPOA 4B4UA 2C5SA 5FOSA 1YASA 3ASVA 1MV8A 1GPBA 1FFHA 5CVTA 1F0KA 2ZR0A 2I3GA 1N2SA 4LHVA 3N6XA 2QYHA 1L8QA 2QRNA 3VHQA 2CK3D 3BXGA 4BU1A 4B40A 4LF8O 1K97A 4BX2A 3FMOB 3DBVO 2BP7A 4CM9A 1SA0A 1Z4NA 3O75A 5LU9A 3B3JA 1M8PA 3EVEA 4UJ5A 1OGYA 2OMKA 2ZK7A 4LY0A 4POAA 1APBA 2N75A 2GM4A 2WYVA 3AEKB 4WZAA 3LFHA 4HGPA 4HVTA 5DI3A 3EFFK 5D8DA 2D5IA 1RWMA 2EILB 4M9QA 1IZ9A 2ZSAA 4BN5A 1XZPA 2EU8A 4NKGB 3KB6A 1L1RA 3E0QA 1NVAA 1U2PA 1RPTA 3GGOA 1LQTA 1G0OA 5TNXA 1KI1A 2DFDA 4K26A 1E0KA 1B8NA 4DNPA 4JUAA 3OM1A 4GD3Q 4AZ0A 4LNUA 3R9KA 1Q14A 4QOSA 2CV0A 3TRIA 5JJNB 4D8VA 3H7IA 4HQRA 4ALKA 5B4UA 3ESZA 3FWZA 1N5MA 4HQ6A 4DRYA 1LK0A 5JZVA 4AG3A 1PQUA 2WPNA 1T5BA 3AKDA 5EJ9A 1AMNA 4MRPA 2Y1FA 2F4NA 1Q0SA 2R0QC 2QN7A 1RZ3A 4S1WA 3FVRA 3AR3A 1NI5A 1EA7A 4DR6O 4OJYA 4RE6A 4XGRA 1W0JD 2YOFA 1YQQA 4BO5A 3TZCA 3EODA 2YDYA 1QHTA 3SLGA 3JYOA 1E4VA 1XEAA 2IWHA 3LRXA 5FL7D 1QLEB 4MKHA 3MBOA 4QREA 3UK1A 2MK3A 1E9RA 2BFEB 3NT5A 4X44A 4PSAA 3OMAB 2CHUA 4XIIA 2XNDA 5KYTA 3E7FA 3K6KA 1KO8A 3VR1A 3SPXA 3WQQA 3QLUC 2AOXA 1MB4A 3LF2A 1NATA 2OM2A 2IYFA 4EW1A 1WVGA 5JAMA 1KR5A 1QRRA 3PUWA 5ALOA 3N0TA 1A1SA 1FEZA 3OCWA 2XYVA 4HNTA 1XCJA 4M1WA 2VT7A 2OFXA 1CY4A 4IJVA 4PPFA 2BIFA 4UQOA 2VXBA 2Q6LA 2R6ZA 2V98A 4UTRA 2GBCA 4HC4A 1PG2A 3VR3A 3KKKA 2C07A 4A26A 2ZYTX 1PR2A 3NYQA 4R40A 3PNMA 4E5YA 3F6EX 4C22A 3NUZA 4GYCB 3RN4A 1D7AA 4ZEWA 2UVQA 2YY6A 4MVJM 2ZFUA 1HETA 1ULSA 4DR2O 4YO7A 5K0FA 3FKJA 3O8RA 1H3NA 2G5CA 1YJCA 2GHRA 2ACVA 1OC4A 3LUBA 1OLSA 4GQAA 3LP6A 1HNXO 2E3CA 3UB4A 2YFHA 1L5OA 1RPRA 1XIVA 4Q03A 2O1EA 3T5CA 4NARA 4LP8A 1ZQ9A 5E95A 3HE3A 3AHEA 4NC9A 4LJ8A 3ZK7A 2WNIA 4HVAA 2XDYA 2W6ID 2ZITA 4FGSA 4TYPA 2CB0A 2J0UA 3O3OB 4O4LB 3L41A 3RSFA 4Z9XA 3U5TA 3O26A 5HS6A 5ISMA 3AKZA 2PZ8A 1GZ4A 3RWMB 1WKBA 1FZQA 2AGVA 3PL1A 3VPBA 3WBFA 2P9BA 2IYVA 1Z3IX 2Y1EA 5DBGA 2GPBA 2FX5A 4S2UA 2PEZA 3U7FB 3GLGB 4KXNA 2O1WA 1HRDA 1SOUA 1YMVA 4UXNA 3OZVA 3I1FA 4Z53A 2UXBO 3AXTA 1QO7A 4O08A 4IO0A 2NNWB 1RRVA 2M6YA 2A9KA 4GPTA 3QIVA 4YFVA 2BGJA 3ADBA 3CC4V 1JR6A 4JNKA 2WG0A 2HWKA 1K3UB 3TLBA 3UMVA 1PJZA 4JEMA 4NJMA 5I9LA 2WB2A 4G0YA 1NW4A 1W59A 5CVDA 3MJ4A 1GG8A 5C8DA 2CCJA 2XCSB 1V3QE 4YR7A 3HYNA 3OE4A 4X54A 1UQUA 1W2BU 3LBAA 2IEGA 3ET5A 3RK1A 3TGPA 4AIRA 4XWAA 4HX5A 5EZ6B 2HJGA 5FLYA 1PD1A 4DIKA 4JA0A 2EJVA 1HF3A 2DJVA 3RU3A 3CGWA 1K63A 4A6PA 2JGLA 3G0CA 2XYPA 1ZH2A 4MWTA 4EY6A 2MINB 2DN9A 1W47A 1WM1A 1OI4A 3D8RA 4MCHA 5T57A 4MUMA 2WLHA 1F12A 3OE7A 2MMGA 1JKIA 3ZDYB 2PXAA 4ZT7A 3WYGA 1RU3A 2ZBQA 2SNIE 3OAAG 1K6IA 4JBWA 1JFFA 3UK0A 2GCOA 5EXTA 4R1QA 1NC3A 1ZCAA 3T6KA 2W0MA 2PZFA 3NHSA 1XLTC 4R1TA 2JIZA 4B7KA 1IHPA 3TL6A 5TC4A 2J9RA 1GGMA 4KN6A 3IR7A 4A8JB 4LTNA 3FRJA 1E6WA 4H3VA 3EE6A 4UOZA 4RIIA 1MOSA 4UBKA 2OHOA 3IP1A 4U0KA 5KA5A 3O84A 5A7GA 1NONA 1HTBA 5BN3B 1ISIA 2C97A 3TPCA 1C0KA 3P0FA 1SC6A 2HDOA 5EBMC 1M34A 4HN2A 1SXIA 4RLQA 4WINA 3EC1A 3Q3GE 3E9MA 5HQ3B 1K7FB 1GDTA 3LDGA 4EKIA 2CBXA 5KU7A 4K8XA 1V8OA 4LOJA 4OLBA 1OGJA 5H80A 1Z82A 1E8NA 4ZI7B 1QGZA 3ICOA 1I5RA 1X92A 3V4OA 5AJVB 1U2ZA 3E3AA 4OMFG 2H06A 1EFAA 1PFVA 4OJKA 1I7PA 1PK9A 3UWOA 4ZODA 2FZCA 5IX8A 4HFRA 5CXXA 4YLGA 3RS5A 1CX9B 1Y4UA 2GZSA 1UP4A 2EIKB 2BE7A 3CPEA 1L3BA 5IULC 5LQRA 3AG5A 2UU9O 1RBZA 4JLJA 1J95A 2PG3A 1D1QA 3CRZA 2QUIA 1SCQA 5JNVA 5EP2A 2IHTA 1ODKA 2X8LA 3FPLA 1JGTA 3UTDA 4Q4HA 4R69A 1VKHA 3TRDA 1N5JA 4P0TA 1XRJA 2YSUB 1YA8A 2R7KA 1C7QA 3O83A 1DEOA 2G08A 1H2ZA 4AYTA 2F1JA 2Y2VA 1P2TA 2B4YA 1BXGA 3QLVC 3N8IA 2L17A 2YZ2A 3MTQA 3L3BA 4DG8A 1RKUA 2G5TA 4CKXA 2V7WA 4WBNF 3ENNA 3IUEA 2D1TA 1LDGA 3DR5A 1COWG 2ZREA 3ANSA 1YFZA 1MENA 4U7JA 3AI2A 1NYLA 1MA3A 1T2AA 3EARA 2VSYA 1YQWA 1OASA 4F2GA 2IYPA 2VJOA 3R3JA 2RJOA 4RQUA 4R8VA 4ZQBA 1NVVQ 4H44B 1I7FA 4IMRA 3STHA 2MSEB 4AF7A 2PX3A 4CF6A 1OLOA 1JR3A 5IXSA 1JTFA 5G0WA 5EJGA 2RAFA 5JH7F 1NUHA 1FQWA 4F71A 1IJEA 1BGWA 2C4UA 1NVTA 5DGDA 1Q8IA 1M2NA 2FW6A 5TQJA 3GJYA 3I2YX 2XOKG 1O6ZA 1AMOA 1ABFA 3C2QA 2RKBA 1H1LB 5A1TA 1FYJA 4JLAA 5EQJB 1F1JA 4C6TA 4GBJA 5L3RA 1QBZA 5T67A 1JDSA 1UFKA 2NPFA 1S3SA 1UM8A 4H60A 2WA2A 4HWSA 4NCXA 1Y8QB 3U2QA 2H9YA 4B48A 3AUJB 3HYRA 1Q0HA 4IS2A 4JB8A 4NVPA 2P7HA 1XTRA 3ZNPA 1P7CA 5BN4B 4KIJA 2XQJA 3SG0A 2CXSA 3JARB 1RWBA 4NCIA 3K53A 2CZCA 1YS4A 1EBUA 3PEFA 3TUJC 1RLIA 4HOYA 4H4CA 4X63A 2G40A 4L50A 5HKBA 2JJ2D 4P53A 3R6WA 2ASEA 3ZDAA 1YR9A 1L4MA 1OKKD 5LYJF 1AU9A 2D06A 3LAWA 3ZIAA 4HAOA 1QJCA 1ZESA 2WZDA 4AWXA 4KW7A 5AW8A 4FVTA 5ADUS 1QQCA 2OD9A 4J75A 1WCYA 1KAQA 4B71A 1RBYA 1WF3A 3AG2C 4PELA 3GJQA 4IXWA 2EIHA 3F8SA 3KEFA 1LDBA 3DUFA 4RDCA 1VMEA 1AXEA 4Y3UA 4LYJA 3RS3A 3D7SA 4J76A 2PNJA 1EFRG 2WA4A 3RIXA 4ZDIA 2IODA 4BFYA 2AUTA 3G8YA 1C1YA 3CV3A 2QVGA 4X92A 4DKJA 2F62A 5CK4A 3VPAA 2QTVA 4E5NA 4QUKA 2GTHA 3KKLA 3TSZA 2EZ9A 2W00A 3TJRA 3RTAA 4MUEA 3EGCA 1VE9A 2BBOA 3CX7A 2Q7HA 4CLHA 5JCOA 3W5BA 5JNSA 1JR4A 2FF5A 5KC9A 3HMQA 3H42B 2OQIA 3I45A 1JSRA 1CRLA 1EUCB 4FFBA 4WCEV 1X9IA 1PK8A 4LQDA 5EESA 4G1UC 4W9RA 3WB0A 5IE9A 3SX0A 1KY4A 1KAMA 4JB2A 1ZA1A 3VVBA 1MTZA 4L15A 2Y0IA 4LV8B 3V1TC 4MSUA 1B16A 3AYXB 3OLCX 2WHXA 3F5WC 2XA9A 2IOFK 5C8XA 2R97A 4TT3D 4ZI2A 2JJYA 1M56C 4QXPA 4MROA 1RQPA 2QRLA 1OFTA 1BVRA 1NI4A 1PNQA 3SDZA 2GMWA 2YYZA 3PLRA 4IXNA 3WYCA 2CDYA 1OPXA 1I5OA 4PD4F 2AKAB 1Y4MA 2C88A 4PWZA 4JYMA 4MRVA 4Q02A 3JD3A 3N8DA 3ADOA 4V0MA 3KAKA 2KQUA 1M74A 2A0XA 2WWHA 1HZZA 2JFZA 4FCCA 3IOMA 3L1KA 1GLGA 1IUOA 3EFOA 4WZAE 2X4LA 5FYDA 5LQDA 3RYCB 4LFCO 2PYIA 4FZJA 2B99A 3KKOA 4TWJA 5E2BA 3DO6A 1Y4AE 1FJGO 4AKEA 4I7ZB 3R24A 1X3LA 4Y2UA 3FM9A 1RI5A 1H2FA 2J6HA 3OEHD 1QANA 3O7WA 5D01A 2Y4TA 3JRXA 2LW1A 4QG7A 4B8WA 3Q40A 3C0KA 1Z39A 2W6OA 2A06H 1HORA 5JCXA 1HY3A 4TMXA 3AVOA 3VZCA 1OU4A 1E6EA 1BJRE 3EB9A 3UCEA 3L0PA 3TZ6A 1XF9A 2Q41A 5IZCC 2R7AA 1MX5A 5HOEA 4PGAA 4X60A 2BMVA 2QY9A 4QJ4A 5DHQA 1RYDA 5DEDA 4N49A 4JI5O 1QZZA 2ZM6B 2H2FA 1SULA 4ZRNA 2WI8A 2YINC 3NR7A 4K2HA 1SUSA 1O0BA 2WDZA 2FDCA 4R16A 4GI1A 5TDHA 3MRTA 3EC7A 1EN5A 5EJ5A 3WTBA 5JZ9A 1K0UA 3MXOA 5IK2A 2ZP1A 1ZN2A 3N87A 3DP9A 2F8LA 3GBSA 3KQPA 5AQEA 2UZAA 3T3DA 1NZJA 2AS0A 1ESCA 1T43A 4AJOA 5C81A 4ZZ1A 3H4IA 4XOUA 3WA6A 4CTOA 1AR5A 3JAWB 2XSZD 2LGQA 3QXJA 3G1WA 3A1CA 1Y9AA 3I1JA 3B51X 2KPOA 3H04A 2HN9A 1U6IA 4PM4A 1UJ5A 3TQQA 1BZYA 1N4CA 5DT2A 3E3LA 3I01A 1ZGCA 4RYDA 4DVJA 2VSNA 4BX9A 1Q1ZA 1HNZO 1TIPA 2YBEA 4CDNA 4HYOA 2GQ0A 2DY0A 3WKBA 1U5BB 3NHUA 3T5AA 3GFQA 3RWBA 4G2NA 2WTMA 1FF9A 4EW3A 4S05A 1ENOA 3ZCSA 1RTTA 2PZMA 5ENDA 3L9XA 5J1SB 4U2EA 2QF7A 4GAEA 4UCOA 1F8XA 4PI0A 1TO2E 2AC7A 3ZKWA 1F2TA 3IRVA 4ZTZB 4PAWA 2ZRJA 4KEAA 2AN4A 4X7RA 4EK9A 3JZFA 2I34A 2R44A 2AD5A 4QYIB 1U7ZA 3HZOA 2RHDA 4K1LA 3HUEA 1N6RA 2G70A 4QDXA 1D09A 3BDIA 3ZTWA 5HEKA 1HEIA 4IIJA 5KYWB 5CFZA 1WL8A 3EXEA 1JU4A 2VWHA 3P4UA 2C3YA 2ID4A 4CKEA 2ZBUA 4MS4B 5EK0A 5ALQA 4DMMA 1YHZA 2CVOA 3VMFA 2VJCA 3H6GA 3D3WA 1NY5A 2VN8A 3FI9A 3KTAB 4FKMA 2IZZA 1NF2A 4ESHA 1BWQA 1BE8A 5J5AA 1G21A 3LQ4A 4YJHA 2BEUA 4XQEA 1V3TA 4QBKA 1RLUA 4I9GA 4EMTA 4YY3O 1XTZA 2WWVD 2CDNA 3DOIA 4NEQA 3M1LA 2INGX 2ZUDA 3GF4A 4WNYA 2RGXA 4RVCA 4Z6KA 1KS9A 1NP3A 1KI2A 3W5CA 1RR6A 3WLHA 3PHBE 2FSVC 2C57A 4Q19A 4DUPA 2HLDG 4DLTA 4MW4A 4N0PA 2GZ1A 2YWEA 3WLAA 3H1BA 2XI4A 4NZYA 3I9KA 3PDIA 2XB2A 5FI3A 1YL5A 2AT1A 1H69A 3M6LA 3BOSA 7ADHA 3C4JA 5J4VA 5K3OA 1ESEA 3ESAA 2PBRA 1NGSA 4Q3LA 3OD4A 3IODA 5LDGA 4H1UA 4FOTA 4R0VA 3JY6A 3JX9A 5E0KB 2Q46A 5E4YA 4ZJZA 1ZOSA 3ETQA 1OA1A 4AUKA 2HDHA 1LX7A 3RAEC 2X2OA 5B6IA 1GNSA 2VWPA 2ECPA 3OZEA 5JJKA 3FRIA 1YE8A 2F2TA 3O93A 2ZCEA 4P9PA 3BE5A 4IVPA 4N3AA 5KREA 4CTKA 4EQZA 4I1IA 4BO1A 2E3JA 4X89A 3Q0IA 4UCSA 2IOYA 4GQBA 1ISGA 3SNHA 1SQ0A 1JAHA 3F7VC 4RQBA 1F5NA 1YA6A 3KL2A 1QMGA 4E4TA 1P0MA 5BYAA 1X1DA 1RW4A 4HVCA 3DV9A 1XFDA 4PBTA 4PGHA 1YONA 3ET4A 4NBRA 2J4DA 5EPUA 1VQNV 3I58A 1DIAA 3LSUA 2UUBO 4KQ6A 1OCCC 2IXAA 3L93A 1RKVA 1K73W 1Q84A 2P6PA 1WVIA 2WLLA 3GA7A 3GRRA 4OQPA 1D6NA 5IW8A 4TKUA 3JQCA 3LPNA 3ETLA 4EABA 3R0VA 3H4VA 1AP6A 3GEEA 4LF7O 3ZK8A 1E6CA 1ZK2A 1E1CB 1GEGA 2EFGA 3O21A 1LQUA 4LTMA 1UJCA 4NB5A 2ECQA 3IHLA 4MX8A 5IF9A 5I4KA 1FQJA 1NVVR 4HV4A 4DLSA 5K3FA 3EEOA 3PC8C 1JE0A 4YCBA 3V1LA 3CR8A 3CRVA 5P21A 4UFOA 3K0SA 3T5DA 4EB3A 1E5DA 2NV0A 4DR4B 3WWCA 4JASA 5ALGA 1RJFA 5H2FZ 2H8KA 2BT4A 2GTAA 1ID8A 3P71T 1OCOB 3OQJA 4TWAA 2VRZA 3ZOZA 3KAQA 3I61A 3BREA 1XOUA 3PGMA 2R8ZA 4CMEC 4B34A 3NHWA 5JNUA 1PG0A 4D6PA 2XUGA 3DFMA 1HM5A 2WKWA 4HTFA 1U81A 2R8BA 2FB9A 3KHUA 4Z4HA 4FLVA 1ELOA 3RJTA 4S0XA 2JIQA 4E13A 1A98A 2HPZA 5F7ZA 3WLSA 3AP3A 1OBFO 4GPAA 3AEQA 1O3YA 4UE2A 4DT1B 2VI5A 2C59A 5EHQA 3ZQ4A 1M8KA 2XVYA 3H18A 1V7QA 3E22B 4RM3A 1G38A 3VPHA 4WESB 4PPQA 2Q6IA 2WUWE 3MUFA 1NXVA 3B9RA 4DSOA 4JTDB 4Q12A 4UVAA 5B3JC 3V8BA 4IGGA 3LT4A 4D82A 1JN0A 1UDRA 1T6BY 3EGVA 1IMOA 1B26A 2I8CA 1JHUA 4Q1EA 3WXBA 2XJ4A 3RI3A 1TMYA 2IHKA 4RPCA 3CJQA 4MA5A 4O3MA 2DU8A 4EY5A 4FNAA 2H48A 4CMKA 1D8TA 4F6LA 5GZ1A 1U4SA 1NM5A 3A0RB 3LBIA 1AA6A 1QLWA 3RRJA 5IJZA 4LZAA 4WX2B 1SF9A 1NSYA 4K6KA 5FL3A 3DD1A 3ND5A 1GJRA 2CC2A 4DR7B 1U11A 4F0JA 3CYFA 3CY6A 2EJCA 5K51A 3QYPA 2FF7A 1ZG3A 4K0KO 3MT0A 1PFKA 5B6PA 5IXYA 1N8NA 1R8QA 1T9AA 2XCOA 3BKXA 4F3NA 4FBMA 1FFTB 5CG2A 1GQFA 3VKGA 1RRPA 3RVNA 5AHOA 1FXSA 1L5YA 2GEDA 2QRKA 4L8YA 3G5AA 4FGKA 3RASA 1ZEJA 4R8CA 2IUFA 2ZAMA 1VP3A 4PLZA 1E1KA 3RFVA 4MMZB 3CQ9A 2MYPA 4QICA 3ZGNA 3B5IA 2GDJA 1CNEA 3LPMA 2P1RA 3KM0A 3TE6A 3K73O 5B3LA 3FZGA 1YTLA 3NONA 5AFSA 3M99B 3KUKA 4BIIA 3MCTA 3HI4A 3IVXA 3NVAA 2EBOA 4P7GA 1BS3A 1IZ7A 2C95A 5ECDA 1G1MA 2A1TR 2AG8A 1GTMA 3DULA 1RS0A 4KVFA 4P1ZA 4HX9A 3K94A 2PGXA 3M6AA 5DNVA 3CCLV 1E9BA 1X8LA 2DQZA 3RIEA 4ALJA 1D2AA 4AS1A 5K05A 1SJ9A 5U4XA 3SJQC 1XDCA 2NW6A 3QV1A 3VH3A 3LWBA 3O1LA 1U90A 2GB4A 5TQ2B 4Q4JB 4LHSA 2RGNA 3MBIA 4BVKA 4FFKA 4R0MA 1ZOOA 5IH3A 1QH8B 3Q7IA 4JWTA 2EX4A 4MRSA 3WR5A 2PZEA 1RZVA 1E92A 4NHEA 3PEVA 1YVPA 4PZZA 2W8BB 1GM9A 4PGFA 3T61A 2HY7A 1DJOA 1ULBA 5E2IA 2GWRA 3H97A 3RV3A 4JX8A 1NT2B 4QU9A 1ZN7A 4RWZA 2AW5A 4K6MA 4TKZA 3HTXA 4ZC1A 3ADPA 5C1PA 2B21A 4NESA 1E4EB 3KZKA 5D7BA 2AQHA 4BTLA 2CHGA 2JLXA 5A0VA 3MS4A 3OQBA 3OF5A 5HGXA 2YZ7A 1I1HA 1X1EA 2EJBA 1DX6A 4PR3A 2RG1A 3IA2A 1IWBB 3OQ1A 3FSGD 1EUZA 2HV9A 3KKEA 4IV0A 1I10A 3WRWA 5IZ4A 3TQFA 4DDMA 2AKEA 2NT4A 1FTYA 1G2OA 3ZEDA 1SBCA 4F3YA 2GVDC 1KORA 4BP1A 1PQ4A 1W46A 3KE8A 3BHPA 1NFRA 1CV2A 1Y0BA 2DR3A 4PA4A 2CLIB 1CIJA 4PLVA 1U1FA 2UAGA 3VRHA 3WWOA 2FW1A 3MUNA 3ZWNA 4L0DA 2Q1WA 3RO7A 1R0LA 3INNA 5K1PA 5SV2A 1O4VA 1ILEA 1L4YA 3QKRA 3RAJA 3E8XA 4IGFA 3MT9A 2V0NA 1RFYA 3KR0A 2NSHA 2EKBA 1HUQA 1S2GA 4KQWA 1V6SA 1YA4A 3K0HA 5EN4A 5FTMA 4R84A 2A84A 4MQ5A 3J7AC 1DQPA 1K8XB 1H1TA 1FXKA 3MNFA 4WUVA 1DGQA 1V11A 3KUXA 5EP1A 3HPQA 3KXKA 1O4WA 2ZI5A 3BE6A 4JITA 2JJMA 2GZDA 1NTRA 4QDKA 3D6FA 1T2EA 4FKZA 1T34A 4GSLA 4RMIA 4CEHA 2DUMA 2R1TA 2VTKA 4RULA 4GS5A 4DXAA 4F2HA 3T5TA 4B8ZA 3GFBA 2ORIA 1NJFA 1DLIA 3RAPR 2HXGA 2QSUA 1EVYA 4FHFA 4EBBA 3ZE8A 4ZDJA 4PXAA 1Q17A 4BQFA 4RVNA 3AINA 3G6BA 4DPMA 3UJ8A 2WMNB 4RK1A 1S8OA 2CEAA 1TD1A 4HFJA 4DV2O 4LV5B 3M81A 4MVJA 4ITRC 4B35A 2IL1A 1QS0A 4YJ3B 2VDOB 5LZ4A 2O2SA 5HIKA 3L18A 4NYJR 1VQOV 3B77A 4X45A 1P4SA 3LHDA 1L4NA 2C4WA 2VS1A 5G0TA 5HS4A 1OVGA 4OK6A 2LNDA 5HJ7A 5F78A 5JPIA 1CR6A 2RNBA 4B7UA 3OE1A 3HR8A 4KV7A 2FJ0A 3UHFA 3MF4A 4MW3A 2C4HA 3UGKA 1KOGA 1OV4A 2L2QA 1NNSA 1DINA 5KTYA 4GLLA 3O95A 2WJVA 2V55B 1JA8A 2QNRA 1TGOA 1R0WA 2PSFA 4AYWA 3PA6A 3PFCA 2FZ5A 4WIAA 4YB8A 4FDTA 5A3JA 2MYUA 4JY7A 3OT7A 4TLLB 3GCZA 2F3PA 1P1FA 2HEGA 1UBMS 2F43A 3M83A 1K4KA 2OAGA 4IRUB 4KPEC 3F7YC 1R4NB 1QKJA 4KAAA 2FRVA 3QNMA 3V4VB 1YCIA 4EKEA 2FSIA 1SBYA 1ZY2A 1E5QA 1K7YA 3UVEA 1M7GA 5DNCA 2UKDA 1EBFA 2JFXA 4DWVA 4F1WA 3KOYA 3L0DA 5TRTA 2HHJA 4OHKA 2HRQA 5FWXB 4FFSA 5CDFE 1GITA 1DAMA 1OWNA 1P19A 2OK8A 3DZJA 4BLWA 1Y76A 1I5EA 5JI3E 3BWMA 1YR1A 4MUFA 1CUSA 5T8KA 5KOJB 4R2KA 1B2LA 1DX9A 1YB7A 1GKFA 4MEJA 5A9TA 1XYGA 1VDZA 4UVGA 1V7PC 5LHGA 1DAGA 5BR8O 1T9HA 5T4BA 1ENYA 1TU4A 4AZ3B 1ZA2A 1T9BA 1NTMH 1E7YA 2D13A 2HIGA 1M6VA 2GPSA 4DCVA 4JX9A 4IWYA 3E8FA 4HDKB 1WW8A 2B7BA 3W7BA 2HR3A 4B75A 2J9FA 3FNFA 3Q85A 4UEJA 3IC7A 1I9GA 1Y74A 1J8DA 1P84F 4FS3A 3RB8A 2DFVA 3HKDA 4I50F 4WSOA 4YLEA 5C1IA 2Q0QA 1N32B 4IXTA 3V48A 4J16A 2ZUCA 4O0LA 3Q8WA 1E9CA 4JI2O 3R6LA 4PICA 3BD6A 4CH5A 2ZM5A 4DLNA 4OYLA 4JXJA 3V7WA 1W5BA 1U3GA 4M1EA 3AHJA 3IUNA 5ED4A 3BB3A 1AP5A 3TB6A 4RD2A 4HXEB 4DJEC 3EMDA 3OMIB 3G4SV 3DCIA 3BCSA 4LDQA 5CD9A 1PD0A 1N8SA 1OPRA 1GZHB 3ZNQA 4JZGA 3GRKA 1J49A 1GARA 2F1KA 3MJVA 4R1NA 3RUEA 2XYGA 1DE0A 3RUPA 3L05A 4ZCMA 1BYIA 4LBZA 4XVUA 3K70B 1GYPA 3OFKA 1WQ3A 4LWSB 4NYKA 4HQKA 1SHJA 4Z99A 2ZWPA 4D57A 1J2RA 4D7AA 1RWPA 3PYMA 3FYHA 1O5OA 5F4ZA 1OX6A 1TEVA 3GYBA 4PG8A 3MN1A 2DFKB 3L8DA 2F3QA 5GZ6A 2XKJE 4I19A 3RJZA 4TTAA 1U2QA 2WJGA 2A9PA 4MSWC 2PIDA 4V0LA 3AWDA 3ROGA 3NHKA 4RPLA 1NOKA 4CKCA 2EFHB 5DKFA 5LM3A 5CA0B 3DHWC 4Y1GA 1EVEA 3E18A 5K0NA 5B5SA 4ID3A 2BKLA 4GEKA 2GYVA 4I2VA 3KJQA 2XGGA 3OFND 3GQBB 4NFSA 2VATA 3G6WA 4OLAA 1CJCA 3EQ9A 3QYJA 4V0OA 3F0TA 2Y0CA 2VJDA 4ZAWA 1CB0A 2QGNA 3RCBA 3V2HA 3I2GA 3LVFO 5J5CA 1RWVA 1UMDA 4TROA 2PR2A 1IRXA 4DCJA 4E46A 2LVBA 1DC3A 1E7SA 1PFQA 3VZDA 5BP7A 4W5TA 1MG5A 1XL0A 2BZGA 1HDYA 4A16A 2CD7A 3T7SA 3U7RA 4D9CA 3JQ8A 4YRMA 2WABA 4GX0A 1TJYA 3GUVA 2R8OA 2OB2A 4R3WA 1GP2A 4DZRA 5TIIA 1JQAA 1KQFA 1OJ7A 4AP5A 2OUKA 4XDYA 1PWXA 4HCJA 3HYSA 5HKKD 3E8HA 3TLZA 1C8LA 4TLDA 4XX1A 3D8TA 3A05A 5K8IA 3BXEA 1G7TA 1CJBA 1GPNA 5JQGB 2PUDA 1F38A 3WGJA 5ALEA 1R8SA 2D4HA 2QLJA 3LPDA 3FCEA 4CM4A 3R5SA 5JMWA 4BV8A 2QAIA 1NSTA 1VKZA 4LS3A 5HE9A 1UK8A 1GD1O 2ZB4A 3V1KA 1X80B 1A77A 3WZ2A 1GQSA 3U44A 2M7WA 2R7MA 3BIOA 5BW6B 3SAJA 4EI7A 4YRQA 1V7CA 3ANMA 3Q88A 3AR9A 4D8TA 3RU9A 3HDVA 4BKQA 3L06A 4PYQA 1ECLA 4TQUS 1E1YA 3T7IA 4L5CA 4RKFA 4AP6A 2RI0A 4QEKA 3Q98A 1AKNA 4KGDA 2IF0A 1M2OB 3NBKA 4CS2A 1KJWA 2ZG6A 3JQDA 9ATCA 2VK8A 3K2IA 1RKXA 4PZEA 5A5VA 2IHJA 3ID6C 3ONNA 3ORQA 3CS5A 3GNSA 121PA 3MMXA 4YCLA 2WG1A 3PITA 2OESA 4XB6B 2JGMA 4ZPXA 1CUYA 1OILA 3M4JA 3JR7A 1SAYA 4K6GA 5ELXA 2GBFA 2HMAA 4GIBA 1OROA 4DSTA 3NT2A 4ZU6X 3DT6A 2GAFA 5E1OA 4I4TA 2X0NA 5FUQA 1TK9A 4L8WB 2OGSA 5H6RA 1KYWA 4K3UA 1JSZA 1DMSA 1EWVA 4TKLA 1PFYA 3IRUA 4Z1OA 2F1IA 5AVOA 5LQSA 3GNTA 1EZ4A 3FBWA 1CSEE 4E4YA 4C88A 5K3DA 2K7ZA 4J1QA 5EHNA 2LO1A 2DXIA 1GO3F 1RTKA 1XQ9A 4WKPA 4MKXA 4E7PA 1W0KA 4BO4A 2QTOA 3ZTYA 1S9HA 1OA0A 2XTNA 3I83A 3EZYA 1H2RS 3U0VA 2QTHA 6YASA 1X3SA 5FPQA 1BQ4A 3R44A 1UFOA 3QXXA 3OH8A 5LA6B 1PJBA 3OLXA 1FRNA 1W6RA 3DBHA 1O96A 4PHFA 3JRWA 4ZOLA 5CNIA 1WHSA 4CLXA 1QAMA 1QHHB 1WMDA 3TEJA 2O7SA 3GEBA 2BMEA 1O2DA 2Q1YA 4MCJA 3BD7A 4CUKA 1W30A 5GAJA 1U9JA 3PDUA 3IEUA 3SEFA 1MJFA 4DRXA 5L3GA 1R1DA 2HU7A 2IYXA 5E7MA 5AW2A 2XCQA 3VPGA 2NUAA 4XYGA 1EFVB 2XAJA 1MEEA 4R5HA 1QVFU 2V5AA 2WIBA 2IYOA 3LO8A 3CLSD 1L8DA 3CNLA 4JFRA 3JQRA 1S4MA 3GK3A 4DDTA 3B6EA 2R68A 1WPGA 2C2BA 3VDNB 3MWDB 5EWMB 3GC6A 3DQQA 5FT9A 3PXGA 4FOOA 3UGQA 5AMXA 2ZNIA 2O5CA 2GEUA 3GT4A 4UHKA 4K03A 1BJTA 4S1OA 1TA0A 3F71A 5EHXA 2VPWA 4A73A 4A10A 1ULZA 5IWAO 2ZWMA 5DYWA 1BGXT 3DHNA 1VL5A 1YZQA 4TMZA 4N1AA 1R74A 1Z88A 1ZONA 4YAOA 1PS8A 4D5GA 2ZJ3A 1IQUA 5BSWA 2JLZA 2QN8A 4PZPA 8ATCA 5BWMA 1N36O 4BIMA 3W8DA 1W4ZA 3ZGOA 3K9FC 1WB5A 4UCUA 3IP9A 1L7QA 4E2ZA 2EERA 4HG2A 2Y67A 3G5UA 4C7OB 2IPLA 3UJ7A 3D9QX 3SJBC 4BXOA 3BC1A 3AY7A 2PFSA 1YTUA 2PRKA 2GF2A 3ZHRA 1F4NA 1W94A 3AF4A 4RAIA 1RXSA 3EXAA 3CGGA 4DZTA 2HCBA 4US1R 2NO0A 2VDRB 1CY8A 4HH0A 4JSTA 3UJ3X 3IAM1 1V55C 2KBFA 2XB8A 1Z83A 4A6XA 5KHAA 3AM1A 3H9JA 4IDEA 3KK0A 1ZAUA 2QV7A 1GR1A 3IPYA 2JF0A 3FBTA 4YHHB 1UFVA 1L6IA 4JGBA 5G4LA 5IT9A 3WWDA 5EMHA 3UOGA 1GLNA 3HY6A 4B7XA 1DBRA 2J3DA 3VZSA 5M04A 4K9MA 1E1QG 4NS4A 4JD5A 3A7EA 2V7QD 5ERYA 1U80A 1UM9B 4IJ5A 3LK7A 3UGJA 4EKWA 2QD3A 1W2GA 1ORHA 3E8BA 1GILA 4NONA 3DMTC 1J5EB 2EX0A 5CCDA 3ZLUA 4REOA 2IS4A 4CKWB 4IUDS 5FO1A 2OZPA 5DLYA 4F56A 2H4YA 1OTYA 3MEQA 4IL5A 4FK5C 2C7OA 1NVFA 3JTEA 5CB4A 2J9YB 1SZJG 1IUPA 4JLBA 3G8CA 4G9BA 2V9PA 1D1TA 2F3SA 3RJ9A 2Q50A 1WX1A 1NC1A 3UMGA 1DTSA 2EX1A 4DA6A 4FCTA 3O8OA 4C29A 1SETA 2RGCA 1Z3CA 5IKOA 4WCFB 1F8UA 2XWJI 1P5ZB 3PHGA 2QX9A 2GBLC 4MVJE 3NIFB 4LDZA 3X2FA 3WMXA 2O3SA 3IIJA 3NO4A 4HDOB 4OBWA 1QX4A 4MUHA 3H11B 2XYRA 4RDXA 2C04A 4CT0A 1G59A 2I78A 2K2WA 5P8WA 4C43A 5EYPB 5BMOA 5EIWA 3ZHTA 4FZRA 3T4DA 1BOOA 3F3MA 1MQSA 3H83A 3QE3A 1PZEA 1VLHA 2QLTA 4RK0A 3I9MA 2C5EA 5L3SB 4KXWA 4PNPA 4PF1A 1RQRA 3B1XA 3GFOA 1TYBE 3GHYA 4CMHA 1EVJA 2CGOA 2WWGA 1FJXA 2JEZA 1QOZA 3DUWA 5AUPB 1J90A 4O2AA 4A03A 1FNSA 4PC3A 3E1KA 3VJMA 3U60B 4TMVA 1XZHA 4ARVA 2B4QA 4OH7A 1H3EA 3DDWA 3J81A 2OWEA 4ZZ0A 2EIJC 4U00A 2DLCX 3SJUA 2Q29A 3DEHA 5LB4A 3KZXA 2OXIA 1CNMA 2K2QB 3K15A 2IM9A 3E2EA 3GLVA 3OLWA 6NULA 3ORHA 1ZOPA 2CNDA 1J42A 3OD1A 3RNOA 1BHAA 3OSUA 3VH4A 3BEDA 1H2NA 1JXQA 5D85A 1H2WA 5ALUA 2KHZA 3HDQA 4B5LA 2OXRA 1GAJA 4AZVA 1FCJA 1QC5B 3PZBA 5T64A 4A8TA 4YRNA 2QUAA 1NR5A 1VECA 3HJNA 4CLOB 3U11A 3HVRA 3H1TA 4PZ9A 2XQIA 3GUUA 4HVLA 5A62A 2W70A 2JIRA 3IUBA 1HLFA 5CRIA 4TSRA 2XTJA 3KCXA 3WB2A 4EYQA 3MRXA 5IYZA 1E9EA 1VPEA 3NM4A 1STOA 2XJ9A 4CU5A 3RHTA 1ISJA 1KNQA 1Z0UA 4LK3A 5DXJA 4DWJA 4WXHA 2C9MA 2G07A 4UTZA 2Q4PA 1DBVO 1EE2A 5DEOA 3VDMA 2O8EB 3VTKA 5LC1A 3OMXA 3EUFA 1KDZA 1T8RA 4JI8B 2Z5LA 5LQJA 1KI6A 3IUMA 3FNBA 3VV3A 1KMCA 3BHMA 3TO5A 1FOEB 3UG6A 1QYDA 4PFJA 5B2ZA 1Z2AA 2HIHA 5KJEA 1UZNA 5JYBA 5EFZA 2XXJA 3QVJA 4XUEA 2VVTA 1L7XA 4MW6A 3IIKA 4KLNA 1R5OA 2HR1A 2EV9A 3B6ZA 4HGOA 1Y8RA 4WH0A 2MIIA 2GR9A 2VP5A 4MDEA 6LDHA 2FX3A 3KYDB 1CUDA 4AS2A 3DW1X 4M54A 4TQGA 1F9AA 1YQGA 3DKPA 2NIPA 3FW1A 3KHTA 3V8RA 2J46A 2HW8A 1JTVA 3BCUA 1AGPA 4HEQA 7GPBA 2OWOA 2Q2OA 1MQ8B 1N5OX 1XEWY 2J6CA 3T54A 3FMFA 3CM0A 5JZMA 1XRQA 3FHCB 1CVIA 4AZSA 5AHXA 5CDYA 1AKRA 3UXYA 2XQKA 1ZK0A 1CUBA 4RMJA 5HZHA 5DN9A 4EHJA 4KFCA 2BSKB 2PPVA 3WJ2A 2JHAA 3K8YA 4QDJA 1K8ZB 4LWQA 1I4OA 4LMRA 2OCHA 1YJ5A 5CFQA 3J7TA 2UZ1A 3WLRA 1Y7PA 3EA0A 4RJ2A 4P5DA 4UC0A 3B60A 4C2BA 3GG9A 1YHNA 2DQ0A 3AR7A 1A9XB 3ISJA 5CXSA 5BT9A 4EM6A 4ZGGA 1UBGA 3K70D 1USGA 3I2FA 3ETDA 4D42A 1I7QB 4GX1A 3ILHA 4B3TB 4OK5A 1I08A 4FGWA 2X7HA 4COKA 3UPUA 4B2PA 2Q6VA 2D2IA 4ITVA 3P94A 1T26A 2ZSDA 4YEDA 3RS9A 5L4SA 2ES4A 2E75B 2ATCA 3E9NA 1U0LA 2O7NA 4RHEA 4K35A 1CJVC 3TLGA 1E79G 5GADl 5AK3A 5KYUB 5JMOA 4G25A 4KP7A 2ISCA 1H0SA 3LLVA 5JS6A 3SC2B 4BFXA 3C1TA 3QSGA 1IPHA 3QKSA 3P0RA 4UEQA 2FW0A 4QPJA 3V33A 3RVYA 4RVHA 1U02A 4WEOA 2X0FA 3JZIA 1KQGA 2RJZA 4XWOA 5J2UF 3VQYA 1Z29A 5DM70 3EK2A 2P35A 4CHTA 4H9GA 2P4QA 5CJJA 1UDAA 2ZTSA 1HL3A 2PUVA 1EFTA 5FUBA 2UVPB 1PQYA 3T7AA 3MAGA 3T1HB 2EBUA 1NU1H 3QWIA 4PA6A 1VXOA 2QR3A 1KI9A 5HOQA 1R73A 4MW0A 4ZC8A 4M88A 2E9SA 2WD9A 3EFEA 1CW2B 1FXUA 4BYMA 5IJ0A 1ORRA 3QVMA 2JGFA 1H3FA 2C2YA 4LYYA 4FU0A 4WY5A 2CBZA 3OZGA 4ZFNA 3OA2A 5JDCC 5DTMA 2PKXA 2ZSKA 3W8EA 3GFPA 2FMFA 3TNLA 2NUPB 3CUUA 3LSYA 4LUCA 5E6RA 2FDRA 2OP0A 2ZDQA 2FWBA 1T1EA 4PC7A 3I56V 4YXFA 1AGRA 3C7KA 3RFRA 1I1OA 4HDQB 4MR9A 3MELA 1ZRSA 4UASA 3Q2OA 2YVAA 5FORA 5IAGA 2ETVA 4ENPA 3EGOA 3ZDBA 4B6JA 4OHOA 4W6QA 2J5QA 4O4JA 3PEWA 2V1DA 3GZNA 5BSTA 4EFLA 4AY2A 1XMPA 4DR1O 3OM0A 2CYBA 1BXZA 1X0XA 4RJLA 1J21A 3A3YA 3U3XA 2J9XB 2VCEA 4DV0B 5J4YA 1XK7A 1GFSA 1YBHA 4OP2A 1KY2A 3OWHA 2BF4A 4X8LA 2PI4A 1XZIA 3TMKA 3LXXA 1T0IA 1JFTA 3EAQA 5HQJA 2Z2IA 2QEXV 3SF0A 4I1UA 5K45A 2J0QA 3IE1A 5KVCA 1P75A 2OHXA 3NVDA 2YIBA 2QTBA 1HT2E 3HVUA 3UC9A 3Q9LA 2BAGA 1OX5A 2G06A 4R71A 4X66B 1BIFA 4BB0A 1HFEL 2ET6A 5HKOA 4CEJB 2O9JA 2ZANA 1QQBA 3I9JA 3OAAA 2YWDA 3HXPA 3OP4A 4YRZA 4DM4A 4J9ZB 5TMPA 1VCIA 1KH1A 2ASVA 3WVNA 4BC1A 2XZOA 2JI7A 3GJ3A 3TR6A 1DTOA 2J1LA 4R1MA 4MW9A 1O6GA 3WFJA 2AYZA 4I0WB 1EQUA 3EG5A 3FFWA 4NYIQ 4BFCA 5ECWA 3W5JA 1R0YA 1KEPA 4OHBA 3HKBA 3F5DA 1V4BA 2QPTA 1CF9A 3EXIA 2K5UA 3SX4A 2FCRA 3H2HA 5AVXA 2B61A 3IHWA 1WJZA 1GPWB 1P61B 3KEQA 2PMCA 4E30A 4YIHA 3FUVA 1SXJE 4BFVA 5G1PA 1MLDA 4ETWA 1M73E 4V0NA 5F35A 3O2NA 3EW9A 1QHGA 3MYRA 5CLQA 3I52A 1L8XA 2DTDA 4U1RA 4CFSA 1XXLA 4UHFA 3PUYA 3INTA 1YQDA 4UJ3A 3I53A 5F2EA 3L4SO 2PAFA 3FNEA 4WBNB 4QGBA 4LJRA 3F5TA 2WSSG 3IIIA 5KDDA 1JVSA 1Z5ZA 4PINA 1RMYA 3FB1A 1TEHA 2YICA 5D00A 5DNAA 2P62A 1SEPA 4TUYF 3R6TA 4FE7A 3T7KA 4QYMA 4UCFA 3GARA 1NJ8A 5JANA 5IT4A 4WWHA 2G38A 3G2MA 1L7BA 4CVNA 4YVFA 4OGWA 2FWJA 3IUQA 3M33A 3G7UA 2D5AA 5D6OA 4IJWA 5IVIA 1XYVA 1WXGA 2HKIA 1GN4A 5AI9A 3NWEA 2QL6A 5I9IA 3UN1A 1QCEA 3HCWA 5HUJA 2FEXA 2HMWA 4EUFA 1MOZA 5FOWA 2FOIA 5JH7B 3VU1A 2IXTA 3FZEA 4RE5A 3REGA 3ABZA 2C5LA 4NQZA 4QWWA 4V2UA 3P0EA 1CTQA 1QFJA 4IDOA 5CDFA 3OTFA 4GYWA 4IQFA 2PUTA 4J7AA 2IUYA 4MJ7A 1EQ2A 4YRCA 5LGUA 1FYFA 5IJ9B 4MQEB 4HEHA 1Z36A 2GJAA 3O3NB 4B85A 1QVZA 4C08A 4CQMB 2A14A 2AHZA 2VAVA 2QRQA 2YJ3A 1DC7A 2ZQZA 4XEUA 2WB4A 1COWA 2CJYA 4E70A 4R8RA 3V4RA 1SZPA 2G1JA 1N6PA 5BNIA 2HC9A 4NYJQ 2B5UA 2QQEA 3T7RA 2YWXA 3QQPA 1K5DA 3DOUA 1GYQA 1W5EA 1OI2A 1BZKA 4ZVVA 5I51A 5LJIA 4YAJA 3RS8A 4R31A 2X9VA 3WLIA 4P5EA 4M49A 4EGQA 3I0NA 2PCLA 4KPFC 3R3UA 5LYJB 2V3VA 4ZCRA 1TTTA 2O0LA 4DV7O 3INRA 5C4IA 5D7NA 4F3RA 3E2MA 4EPRA 1MXHA 4Q4AA 3GD7A 2XOKA 1MZVA 1Q20A 2Q8QA 3P9ZA 3NNSA 1N7GA 1CFJA 1QHIA 3C8HA 3ZWWA 4E5UA 4W5WA 3KQNA 4IZ6A 5C9ZA 2GPAA 3DJYA 3RARA 3DC6A 4MA0A 2A78A 2E4VA 2E82A 4DO2A 3I8XA 3ABMC 3KXIA 4NE7A 4WW0A 4XTCS 3QEKA 2Q5CA 1NVKA 3LDAA 3DDHA 1A5TA 1A76A 3WYDA 5TJ9A 3JSNA 1XLTA 3JWHA 4MQLA 2JAPA 4QO7A 1SU6A 4UBIA 1GPKA 3Q6NA 1D5NA 4RZ2A 2B2CA 3A4VA 5IAAA 2CWDA 2QRZA 3NOQA 3T06B 4LHWA 4EELA 4HFNA 3ICVA 3D3NA 2FPSA 4DZZA 2AA3A 4KFTA 1KKLA 3ZCQA 1C9EA 1IY2A 1QAQA 2ILTA 2O2JA 5I45A 4J10A 5AWFC 2JS5A 2H7YA 4GXQA 3AP1A 3APOA 1JMKC 5AM1A 2VWJA 1YC5A 4KQ1A 1BW9B 5LD2C 1KH3A 3L77A 4INAA 2RHTA 4MGEA 4QKQA 4YUXA 3Q2IA 1KKMA 1KJIA 3Q4GA 3E1GA 1EFRA 5EVJA 1AB6A 4X85A 3FWNA 4ETMA 3WB9A 1LPMA 2GUZA 4IS3A 4JKYA 2GJSA 1VI5A 3H2JA 4V0QA 1LW7A 4RTNA 1MX3A 1IOVA 3LVRE 4LRSB 4N5LA 3OQNA 4DV5O 3CRQA 2H94A 3R0IA 2X5JO 3G2QA 1BCRB 3UTCA 2UUAO 1C3OA 1TE2A 4GMGA 4ROTA 2WWIA 2CZQA 3KVYA 3HK2A 4LDRA 1N25A 1OXXK 3F9RA 4RH0A 3JQ9A 3U19A 1NU8A 3HSYA 5ELLA 1XL4A 5ALJA 4WN9A 4RQEA 1AOXA 1T9GS 4HJRA 4WFHA 4JI4B 3DFKA 5JEEA 1SUDA 1PL6A 5F7OA 5LL6Y 4I7EA 4JCCA 2X13A 2BZ0A 4QGSA 1SQXH 3ZN1A 1X7ZB 5F5LA 3ELUA 3DMDA 4HPJB 3Q7RA 5GJCA 1TVKA 5I9TA 4JL8A 5B12A 2JAHA 1KEEB 3RSZA 1PJ8A 3CEAA 2C3UA 3JXEA 2FEPA 3U3OA 4REQB 3WWYA 2ONYA 4P7BA 1DTWA 1VQ8V 4IIUA 3EDCA 3V8NA 5U1PA 3DVAB 3UG7A 4WZBE 2JJ1D 3FPFA 1U94A 3V1NA 5KYXA 4XFDA 2NTYC 1SQVH 5H9CA 3W2GA 1T2CA 4F1KA 1IQRA 5AIAA 1PTKA 4Y2XA 3ZUGA 1WZEA 3B1YA 2V1UA 3UB2A 3E8SA 1OV6A 2YC2C 4V0KA 2II6A 1CZLA 2JFGA 1P4HA 3AR5A 2O2IA 4G81A 2ZJ6A 2Q4EA 4M8LA 4LRTB 4HWGA 1UBUS 4PJ0Z 1WXIA 2BEVB 4KUHA 5GTHZ 3B85A 5JPDA 3EXHB 4DCNA 1J8FA 1YZUA 2A88A 4XD7A 3FG9A 4A9AA 3R0JA 2Q7GA 3JD0A 1TK3A 1P2UA 3SYPA 4F9GA 2D7CA 1IM8A 1JECA 1DJMA 5DK6A 1BHBA 3FDZB 4Z4EA 4KQIA 4DV4B 5IY5B 3LUCA 2I1WA 4ARSA 1Z2OX 3ZMSA 4J90A 3FVWA 2ONCA 4CEIB 5D1HA 2W6JD 3F78A 3VMMA 4BNUA 1AQ6A 1WETA 1R8JA 4LXIA 5FCDA 3MOIA 2D3TA 5EJ2A 1Z37A 1PNOA 4OHUA 4Z8XA 3EFBA 1E64A 4IQ8A 3AM5A 5CB6A 4BVBA 2R751 5FI0B 2JW5A 7ABPA 4M99A 1QRDA 1W96A 5DN6D 2Q9BA 2IZ6A 2FUEA 4BCBA 3JQAB 1V16A 5JNRA 3GT3A 1XCLA 1R0BA 2LP7A 4O3FA 2X1LA 4BVAA 1HQYE 2QSYA 1NDQA 1TD9A 3AJ8A 1ABEA 1ZNXA 1IBLO 5GW7A 1FTNA 1OCZB 5BN5A 2NU7A 5EZYA 1IZYA 4W99A 2XGOA 3MVEA 3HO8A 5LBTA 1U7DA <