1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
b'KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
molecule tags Hydrolase (carboxypeptidase)
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
5AK5A 4G8DA 4XVCA 5EHQA 4KE8A 3DJYA 3AINA 5AKJA 4UFNA 4FFWA 4X00A 1AURA 5C7YA 3A70A 1ZIYA 2C5FA 1QO7A 5FRDA 1G42A 2WFMA 5HF6A 2O7RA 3WQHA 5AI9A 2RHTA 4UHHA 4X95A 1ACLA 2BUCA 5JZBA 2NW6A 3DYIA 4EA6A 3WMRA 5A7HA 3WK4A 1YASA 3UUEA 5ALQA 3KWFA 4F0JA 5AI5A 1UKBA 5E4JA 4JEIA 4DMFA 4LKOA 1A8UA 4BZWA 1QLWA 3EQ7A 2WG1A 1BN7A 2FUKA 4MYSA 4AXBA 4CI9A 3VJMA 3FLBA 2WHRA 2XQKA 1JMKC 4U2CA 5JAOA 1CUZA 1BRTA 2QJWA 2BJHA 1QIKA 2BCEA 3F97A 5CH8A 5CW2A 4CG2A 3E1GA 4BC1A 5IKXA 4Q34A 4UBOA 2HA2A 1UT6A 1WPXA 1Q83A 1EXWA 2ZVDA 4GBGA 1EHYA 2H7CA 5JADA 2XMQA 1VOTA 5DJ5A 1DX6A 5AI6A 5FOQA 4WFJA 4U2EA 3HZOA 1FFCA 5JALA 1R88A 1DWQA 3FYUB 4PSDA 1XZHA 3WZLA 4ROTA 4Y7DA 4X85A 4EY8A 1CUFA 2BFNA 1G5FA 2C0PA 2OGSA 3F96A 1P0IA 3MUOA 4OYLA 4HRYA 5HK9A 2RHWA 1CUJA 4BYMA 1QFMA 3HLKA 4DGQA 2QZPA 3TJMA 3FWHA 1E5TA 2CMFA 3ESBA 4IQ4A 4DNPA 4N8DA 1IUNA 3CCCA 1JJIA 3QPCA 1UWCA 3DL4A 1XFDA 5LZ8A 4MWTA 4M0EA 4I3FA 2C5GA 3G02A 4P92A 4B80A 4IH4A 4FLMA 2GBFA 4Z49A 5ALRA 2HFKA 1E66A 1JMYA 5E4TA 4GEGA 2J3QA 3W9UA 5D3KA 3V9AA 2V9ZA 2QS9A 3H1AA 1E8MA 1PFQA 2VSQA 3BJRA 2ZJ7A 5AO9A 4AN0A 3IB3A 1T2NA 5HF8A 1ZD2P 1GPKA 5T4BA 2JGMA 4HTAA 1XRMA 5LYYA 1A8SA 4GWLA 2OLEA 4K5QA 4Y2TA 3FLAA 3AIKA 4KE7A 3PFCA 3B3QA 1KU0A 1MPXA 2WTNA 4D9JA 4AO8A 5K3AA 1QE3A 4LHEA 4EB0A 1X70A 3WL8A 5AIBA 4OD0A 3GFFA 1QIMA 4LXIA 1H2ZA 5AOBA 5KWJA 2AJCA 2O2HA 3KWJA 2BUAA 2WKWA 3ICWA 5FP0A 2WUGA 2HFJA 3G9XA 3V1KA 3O4IA 4ZWNA 5AICA 5AI8A 3D4LA 3ICVA 5BWBA 3KDAA 3RK4A 3M81A 5ALZA 1KEZA 2DHDA 1FJ2A 4B82A 4LIPD 5FV4A 2OCIA 2WFLA 2OQIA 5AM0A 2OXEA 3EF3A 4BZZA 2VTVA 1A88A 5ALYA 5DLPA 5K3FA 5HCUA 3HEAA 2P8SA 1XZFA 1LPNA 3HACA 1ETHA 2V97A 3F67A 5EHNA 1YR2A 2ZYIA 1EB8A 2QKYA 4RGYA 2YH2A 4AB1A 4Y2SA 5ALDA 4BVJA 3WWDA 3QPDA 1MU0A 1JT2A 1QJ4A 1CUVA 1WCYA 4FMPA 4KE6A 1DQYA 2GZSA 4H7JA 1TCCA 2XMDA 4X6UA 1ZD3A 1AUOA 3I28A 4Q1VA 2FX5A 4ZREA 3WLAA 4QA9A 1ZI8A 2G5TA 5FXMA 4J0KA 3STYA 5LZ2A 1THGA 4CIBA 3PF8A 2AXEA 3QMWA 1YS1X 3HABA 3PICA 4J0DA 4DSZA 4GLBA 1CUWA 4O08A 5EFZA 2ZJFA 5AK3A 5JD4A 5K3DA 1MAAA 2R11A 2WIJA 4J7AA 3DEAA 5HKAA 2VQ6A 3B12A 4X6XA 1BCSA 5LKAA 1YA8A 2XQGA 3WJ2A 1XZJA 3G9TA 4K6HA 4QLAA 1CRLA 4OU4A 2BKLA 2BUBA 2EEPA 3M82A 4EBBA 2G5PA 1MTZA 4FLFA 5T4FA 3C6YA 2B4KA 1O6FA 5AK4A 3HJUA 4MJ3A 1VE6A 2WFZA 1ODTC 4Q3OA 3AIMA 3EIOA 3FCYA 2IX9A 5AM2A 1S8OA 1XZLA 3WK7A 4C4YA 4N5IX 4AO6A 3ZLVA 4BRSA 4AQDA 2CZQA 4U2FA 3ESAA 4B81A 2HDWA 5I9IA 3IULA 1XZBA 1OXMA 1YAJA 3WKBA 3DL7A 2B61A 4XJVA 3I1YA 3I1IA 4Y2XA 4H0CA 3STVA 4H35A 5AM3A 3C70A 1XRPA 5AK6A 4L9AA 1ORVA 4J0HA 1GXSA 2QR5A 1LGYA 2QM0A 2EDAA 1H23A 1J2EA 2ECFA 1LNSA 4EY5A 4QNNA 1NX9A 3N0TA 2Y6UA 1WHTA 4H7HA 3RLIA 2GYUA 3C87A 2XQJA 4CCWA 3H2GA 3IURA 3WI7A 2VJDA 3IUNA 3WL5A 4QDOA 3TRDA 3CN9A 4IH9A 4X7BA 3KD2A 2I3ZA 3C6ZA 1K4YA 2AJ8A 3S2ZA 3K6KA 4WY5A 1XZDA 4UBIA 4W63A 4U2GA 1H2YA 4C87A 4BBZA 2EDCA 4H7EA 2ZYHA 3DNMA 4BDTA 2ZSHA 3G9UA 2PUJA 3EBLA 4E14A 3G0IA 2C58A 4V2IA 3DDUA 4X97A 2JGJA 1IVYA 2XDWA 1SCQA 2OCKA 4S0XA 4M0FA 4UPDA 2PPLA 3QVMA 1VA5A 1BN6A 4B85A 2Z8ZA 3PUHA 1AMNA 3DS8A 3B5EA 2WG2A 2HA4A 3HSSA 4UHEA 3STXA 2JEYA 1JKMA 2WFLB 3W2TA 3VDXA 1VKHA 3I2FA 5JASA 3FSGA 3C5VA 3V1NA 2H7XA 1UZAA 3DCNA 2WIDA 4MQLA 1Q84A 4KR0A 4GDMA 3BIXA 4GI1A 4AN1A 1J1IA 1XQWA 2XMRA 1EVQA 4KRYA 1R4ZA 1UXOA 1CUIA 2OGZA 3M83A 3SC2A 2QXTA 2H1IA 1E8NA 1H2WA 1QONA 3NGMA 4HAIA 3I6ZA 5HK8A 4UFOA 2XLCA 2GYWA 2X76A 4JYPA 1EDEA 2ZJ6A 4JYMA 2E3JA 3VKFA 4BVKA 1I6WA 1XZEA 4X90A 4IHAA 3V1LA 4INZA 5T4HA 3G0CA 1YAHA 5LZ9A 4TPKA 1L7QA 1P0QA 2C0QA 3PF9A 1A8QA 3HRHA 4FHZA 1EH5A 4EHBA 2WIKA 5AJHA 5AM4A 2W6CX 4BCDA 3DLTA 1XKTA 4KJXA 2HHAA 5A2GA 3JYHA 5EIAA 3TGLA 3C6XA 1CQZA 4G9GA 4PSUA 5HF9A 1P0PA 4Y2QA 5ALUA 2BGRA 2I3DA 1ZOIA 1UFOA 4MEAA 5AH0A 3IBTA 1UOQA 2IITA 4PF1A 4KE9A 3GELA 2ORYA 2D0DA 4AX4A 1AC5A 4HZGA 4OCZA 3FOBA 5DTJA 1NU6A 2PBLA 4HRXA 1XRRA 2DQYA 4KACA 2JEZA 3E3AA 4PO3X 4YK7A 4BE9A 3QYJA 1W75A 4DM7A 1PV1A 4NS4A 5ALIA 4F60A 2O7VA 3KSRA 5D7BA 1Z68A 5H3HA 1W1IA 4N8EA 2JGKA 3BXPA 4Q3KA 4Q3LA 4W1QA 3G0GA 4WJLA 3LP5A 4Y2JA 5YASA 1HKHA 3IA2A 3JW8A 3VVLA 4OU5A 1IUOA 2PSFA 4LXGA 5AI4A 4DNOA 1DT5A 1JFRA 5D6OA 5CT8A 2QOEA 4BAUA 1CUYA 3H19A 5AKLA 2Z5GA 2VAVA 3BL8A 1FFAA 1J06A 2XI4A 1CPYA 5AKGA 2QTBA 1JI3A 2XMCA 2WTMA 4C4ZA 4C6HA 2XUKA 1DINA 2Z3WA 4DMKA 1U8EA 4JH0A 1SOMA 1XRQA 3OG9A 2OGTA 7YASA 2AJLI 1F0NA 2XB6A 1VA4A 1ZD4A 2PU7A 3FBWA 5LZ5A 1BS9A 5K3BA 5CT5A 2O2GA 4HVTA 4ARBA 3IUJA 4KAJA 5A7GA 1UK8A 4WCVA 2GZRA 1LPAB 1DQZA 4DTCA 3G8YA 3O95A 3T4UA 4ZI5A 3A6ZA 1IZ7A 3O9VA 2HM7A 4JNCA 1GZ7A 4GHWA 5SYNA 1AZWA 3AUKA 4A23A 1RP1A 3PFBA 2J4CA 5HFAA 5K3CA 3FAKA 3F98A 3WA6A 4E11A 3QM1A 2XUQA 4G9EA 1DTEA 5K3EA 4MEBA 3DKRA 3FVTA 1CVLA 3H1BA 1YSCA 3WZMA 5AKKA 4CCYA 4B0PA 2CBGA 4X3CA 3VXKA 3I2IA 2X5XA 4FFVA 4YX9A 1IMJA 1CLEA 3C8HA 5DNWA 3GZJA 3O4HA 1ZD5A 1EA5A 4G4IA 2GBIA 3I6YA 3MVEA 3R3WA 1QIDA 4OSEA 4M0MA 3OTQA 3PI6A 4MWSA 2WU3A 3VVMA 1TIBA 1MX1A 2G63A 1LPOA 1ODSA 5BOVA 5ALMA 1XQXA 3N2ZB 3P2MA 1MO2A 1N8SA 1LPMA 5EGNA 5LLSA 4MQMA 5ALGA 1WHSA 1WB6A 3AILA 3BDIA 5ALWA 1O6GA 4KRXA 1RYYA 1G66A 3O4GA 3IIIA 1R9NA 4BP8A 2JIDA 4FNMA 1W52X 3SX4A 3WKAA 3CCBA 1THTA 1IUPA 1QOZA 5JZSA 3PDCA 2XMZA 3ILSA 2GBCA 3I6MA 4DLNA 4MXDA 5DYTA 2XMGA 2XQFA 3A2LA 3H04A 4UHBA 3WWPA 1LPPA 3E4DA 2CKMA 5CRIA 4QE3A 3H0CA 4BTLA 3C8DA 1CUAA 1AX9A 4J0JA 3WL7A 4U2BA 1D07A 2WJ4A 1QIGA 4OB7A 4FKBA 1LBSA 3SWWA 5SYMA 4EY4A 1XROA 1HLGA 1SCIA 2J4FA 4XWGA 2XUGA 4ZXFA 1ZICA 3PE6A 2HA0A 4J0CA 2OAGA 5CMLA 5LIPA 3FLEA 1AQLA 1XZCA 3WIBA 3WKCA 3X3HA 4C88A 4ETWA 3H2JA 2XUFA 3WJ1A 1PJAA 1XLWA 2WIGA 4QWWA 3RARA 1VZ2A 4BDSA 5ALJA 1JU4A 1BU8A 4IO0A 3WKDA 1DU4A 3GROA 4IH1A 4DMCA 3AIOA 2HU7A 1WM1A 5AKZA 5LZ7A 4I4CA 1SFRA 1XLUA 1BCRA 2JGEA 5AKEA 2XUHA 2YYSA 2WJ3A 1YCDA 3A2MA 2HL6A 3V48A 2HU8A 4BVLA 1QTIA 3QITA 4KEAA 5ALNA 1CR6A 3O0DA 3HC7A 1ODCA 4C01A 2AJDA 5A62A 5IH7A 4GXNA 5FDFA 3D0KA 5IVDA 1QIEA 4RE6A 4DNQA 4WDQA 2RI6A 1ISPA 4W1SA 3SK0A 1BEEA 3ED1A 4BP9A 2XUIA 4JUIA 4QDZA 5ALFA 3WWOA 2WUDA 2Z3ZA 1F6WA 3C45A 3BJMA 4ZRDA 3UUFA 1JU3A 3YASA 3PUIA 5AOCA 3FSGD 5ESRA 1R50A 1YA4A 5I8PA 4UFPA 1QIFA 1G4HA 4BAZA 2XMSA 2OG1A 1X2EA 1QO9A 5T4EA 2HRQA 3ANTA 3K2IA 2QUBA 1CFJA 1GPLA 2Z8XA 4GW3A 4TVKA 2H9YA 3WWEA 1C7IA 3D2CA 4QDTA 2QMQA 1L7RA 3LIPA 1CUCA 2WHQA 3MGAA 2PU5A 3O9MA 3R0VA 4HXGA 2HA3A 3Q8WA 3IUMA 4Y2YA 3HI4A 4CCYB 4DNFA 4L0CA 5CT9A 1TCBA 3MUNA 4X92A 4UBKA 2WM2A 1NU8A 3I2GA 5ISMA 1ORWA 4Y2RA 2PKYX 1B6GA 2VATA 2PSJA 1FFEA 2VEOA 3F8SA 1GT6A 5HZGA 1M33A 4BCBA 4CIAA 5AKYA 5ALOA 1B41A 4LYDA 4A5SA 1TAHA 3GA7A 5JATA 4H7IA 1YB7A 2GBGA 3WYNA 1ZIXA 4NVRA 4I19A 2PSDA 2VJAA 1TK3A 4PNZA 4N5HX 2PUHA 5JARA 4F5ZA 1E8DA 1ZGCA 2YASA 1X2BA 4LXHA 3NOXA 4KAAA 1XZIA 3JWEA 2RIPA 5FUMA 1UK7A 2XUOA 1XZGA 1WOMA 1CUXA 2ACEA 3RM3A 1XZKA 3R3ZA 3STUA 2Q0XA 5ALEA 4QDUA 2RGUA 5JD6A 4PQEA 5E4YA 3WK6A 1E89A 3GBSA 3AZQA 1XRLA 2WQZA 5HQ3A 1EDBA 5E2IA 4P9NA 4QDXA 5CTAA 2XUDA 3R40A 4FOLA 2Y2UA 3W04A 3C5WP 4XIIA 5C8VA 3WL6A 1WB4A 2Y1KA 3IVMA 1QZ3A 1VZ3A 1U65A 3BDVA 4EZIA 2J3DA 2WUEA 3I2JA 1USWA 1UK9A 5AKHA 1XQVA 2WSLA 2XMBA 1H22A 5AKIA 3U1TA 1LZKA 5K5EA 1HBJA 1CIJA 1EK1A 4CG3A 3R41A 5CXUA 4UHCA 3V1MA 2XUAA 4WFKA 3OM8A 4ARAA 1N5RA 4E15A 3G9ZA 1XLVA 1FSSA 4FDMA 3ZV7A 1ZGBA 2CB9A 4RNCA 4OPMA 1XZMA 4OUKX 5DWDA 4BB0A 4YPVA 5CT4A 4OB8A 2DCMA 2O2IA 1R9MA 2WIFA 4FBLA 1MAHA 3F9CA 2ZYRA 1XRNA 4NZZA 2OCGA 2BAGA 3GUUA 2IIVA 1WPRA 2WHPA 5FKJA 1GKKA 1CV2A 3FNBA 3KXPA 2XUPA 4OYYA 1Q0ZA 4P93A 4BATA 5DNVA 2GYVA 4ZV7A 1J07A 3L1IA 1DWOA 3D2BA 2PSHA 1U4NA 5ALKA 5AM5A 2HIHA 3H18A 4UUQA 2QXUA 1W76A 3M3DA 5CBKA 3U0VA 4EUSA 3L1JA 1Y7HA 2WLSA 2QJRA 1AGYA 1C4XA 3LLCA 1TRHA 1XKLA 5LZ4A 3LS2A 5ALLA 3WK5A 4BTVA 4B9AA 4B84A 4NMWA 2VJBA 5AHXA 3DOHA 5LKRA 3S8YA 4HXEB 3OOSA 1RWQA 2FJPA 4K6KA 2PM8A 3FYUC 3WA7A 3FYTA 3LCRA 1HPLA 3I2HA 1YB6A 4W9RA 3NWOA 1UKAA 4HXFB 3WK8A 2YXPX 1TKRA 1CUGA 1QIJA 2XLBA 3AZOA 3H2HA 3OURA 1UOOA 4X94A 4F21A 4X71A 5EIHA 2HRRA 3ESCA 4X91A 2V98A 4B7ZA 5AOAA 4AMZA 1VXOA 2ONCA 1JJFA 1QGED 2B20A 1HDEA 5EHXA 5I7UA 3Q0TA 3FCXA 2BGNA 3CXUA 4ZV9A 3WK9A 5JAHA 2W22A 4C89A 5AM1A 4EY6A 4YASA 3STWA 2ACKA 3QMMA 4G1FA 3R3XA 1MJ5A 1H2XA 1UKCA 2I78A 3OPMA 1R1DA 1HL7A 3G0BA 5ALPA 2VT6A 5DNUA 4WFIA 3AJAA 5ALVA 3E0XA 4CG1A 2OCLA 4G8BA 4PW0A 2HA6A 4GECA 5LP1A 4P08A 1SCKA 2JGIA 4FNGA 4J0GA 4G5XA 2C4HA 3QBJA 1GKLA 2VAXA 2WUFA 4Q82A 1BEZA 1K5PA 1UOPA 2DHCA 2HA7A 1LPSA 4EY7A 3DKKA 1BROA 4H77A 2Y2VA 3HXKA 1AKNA 3L1HA 1W4LA 5HFNA 2PSEA 2HADA 1TQHA 3WIOA 3G7NA 5JIBA 3QZUA 5JAUA 1MX5A 1GQRA 4ZGBA 5ALSA 3ESDA 3D2AA 5HQ3B 4B9EA 4UBNA 4DSAA 4H7DA 1MNQA 4FBMA 3TEJA 4TGLA 2H7YA 1OILA 3R3UA 5AIAA 3IUQA 2JGFA 4L3WA 4QZVA 3DD5A 2K2QB 1Y7IA 5CH3A 3CN7A 2X8BA 5DYWA 3H2IA 5KREA 5A71A 4PSCA 3HYSA 2RONA 4X93A 1VXRA 5A6VA 1A7UA 5FPPA 4QWMA 2PVSA 4FLEA 4Q05A 1SC9A 2QUAA 4B83A 2HA5A 4XX1A 2ZSIA 4Y2PA 5IVIA 4W1RA 1FFBA 4DYHA 3EQ9A 5C81A 3QH4A 2C7BA 3VJKA 5BV7A 1LPBB 5JAPA 2RAUA 4PV7A 2I03A 4G4GA 1OCEA 2WHPB 1DX4A 2QVBA 3LIIA 2AJBA 1CUBA 4WY8A 4BRZA 1CQWA 5DYYA 4E46A 3AZPA 1P0MA 4FTWA 5HKBA 5JD5A 2VA9A 1QIHA 3BF8A 4C4XA 5C8XA 1EINA 4RE5A 1QFSA 1EX9A 4UBJA 4BCCA 3DYVA 1CUUA 5BWCA 1XZAA 2G4LA 3BF7A 2CEKA 2UZ0A 3OC0A 5ALXA 2LIPA 3STTA 4H18A 4L72A 1W6RA 3R3YA 1VE7A 4H7KA 1R3DA 3VISA 3K9BA 2B9VA 2ES4A 5KBYA 4J03A 4DMHA 1EDDA 3A2NA 4ITVA 5KWIA 3C43A 4KYVA 1LZLA 1U2EA 3RKSA 3W06A 5IVHA 1N5MA 1N1MA 4AMYA 4U2DA 4Y2UA 1WB5A 4RPCA 4UHDA 1BE0A 1ZI9A 2JGLA 4MYDA 1ZJ4A 3ZPXA 5EHZA 4BC0A 5C8ZA 5AKXA 1CUEA 1DT3A 5EI5A 3DQZA 4J0IA 4K6GA 5CXXA 1K63A 2DQZA 3QPAA 1T4MA 4CFSA 5ALHA 4W1PA 2OQVA 1LLFA 3VJLA 1CUHA 3DOIA 4LYEA 1K8QA 2ROQA 1QTRA 2WILA 1HQDA 4G8CA 3WYDA 4J3JA 1CUDA 4X6YA 3D3NA 2DSNA 4KAFA 1F0PA 3C6BA 1F8UA 2XE4A 3WWCA 1ZI6A 1ACJA 3ZLUA 3D59A 5A7FA 3ZWQA 3ANSA 1MT3A 3FYUA 2ZYSA 3IDAA 2QRUA 4G4JA 4A16A 1CEXA 5FPQA 3NUZA 4AZ3A 3EQ8A 3BE8A 1CUSA 1JJBA 4QEKA 2FJ0A 4HS9A 1IZ8A 2XT0A 2VJCA 4B0OA 4FWBA 4Y9SA 4QLOA 4BE4A 1MNAA 1EI9A 4WDRA 5CH5A 1C7JA 2XQIA 2JF0A 4DIUA 5IVKA 5D3ZA 4N8SA 3QMVA 2WG0A 5ALTA 5AI0A 3BIWA 1K6EA 2DFPA 5JYCA 3O4JA 1FFDA 2VT7A 3R3VA 1GQSA 1EVEA 1MX9A 3G0DA 4Y2VA 1DWPA 5FLKA 2CJPA 1GPNA 2XUJA 4B6GA 4H7FA 3AFIA 5JZ9A 2V96A 5HF5A 2CUTA 3ZLTA 2OAEA 1Y37A 1YS2X 4BAGA 2Y6VA 3ZI7A 4AZ0A 5JANA 5K3FB 4UBLA 1MN6A 1QIIA 3H2KA 2DR0A 5EIEA 5DTIA 1UK6A 3D5EA 4OB6A 3FVRA 6YASA 1E3QA 1LBTA 1KU6A 5J3JA 1EB9A 3W05A 3W9BA 3UMJA 3H17A 3I2KA 3WKEA 2WU4A 1GGVA 3D7RA 2D5LA 5F4ZA 5CT6A 2WJ6A 4UBMA 5AP9A 3BWXA 2JBWA 4UHFA 2PX6A 3T52A 1EK2A 2VF2A 3KOOA 1XQYA 2R8BA 5CURA 1Q0RA 1L7AA 1VLQA 2HU5A 2QT9A 4AO7A 2DHEA 2OPHA 1TCAA 2PL5A 4K2AA 1VJ5A 1ZJ5A
chains in the Genus database with same CATH superfamily
1Y6XA 1X8LA 3CF4G 2XRFA 4R54A 2HO5A 5C7YA 3TCXB 2C5FA 1XTVA 2M98A 3COPA 1MZEA 5DNEA 5A4IS 5IFLA 1LTHR 4WT7A 4HD8A 3A4NA 3E27A 4LNUA 1ZCBA 5E6RA 5KYXB 1L3CA 4RC9A 1XDUA 4KB5A 3AU9A 3G23A 4XYMA 1DARA 2EFYA 2PX8A 1DJOA 1PEAA 1YQQA 5IDQA 3HDJA 2Q1WA 2X0NA 3H8JA 3VVBA 5AUQA 1MP0A 4NAVA 3BFKA 4EYOA 2GJ9A 4TT3G 1XSEA 1MOZA 2UUOA 3CW2A 2WHRA 2X2FA 1ZN7A 3T1TA 4TRJA 1TU4A 1Z0FA 3CONA 5IKXA 1R3JC 4CS4A 2X5KO 2VUTA 2ILMA 3UMSA 3RYTC 1SR8A 3I3SR 1IHPA 1UJMA 2XMQA 1VQ8V 4I55B 4BQFA 4U2EA 2LWIA 1DWQA 4BQRA 4YRCA 5HGXA 2GLTA 1X6VA 3G88A 3T54A 2DPGA 2RHWA 4AJNA 2O4CA 4CN9A 5C80A 3B1WA 3FWHA 1YVPA 3BD7A 2UZ4A 1KO4A 4TV8B 3EWAA 2XAUA 3TL6A 5CA1A 4LY9A 1JIQA 1JJIA 4K28A 1QHTA 3DL4A 2QVGA 5AJYA 5FL3A 3U09A 4BO7A 3G13A 4D8WA 1L4YA 2D2VA 4G0UA 3KQTA 2B8JA 2GEFA 3J7AC 1DDIA 4EB3A 1JRLA 3JALB 4MS2A 2OFOA 1PFQA 1H05A 2OM2A 5ES4B 3OM1A 5AVJA 4LVUA 2VPXA 1V41E 3KPWA 2ZQYA 4BUJA 1R6NA 5F3WB 1M2VB 3KQNA 1ZL8B 1JIUA 4AJ2A 2P5OA 2DLCX 3AHJA 5BSUA 5CB4F 4AF8A 4P22A 3AIKA 3N39C 3SXPA 4AKEA 4I7EA 4H4EA 4LCEA 3G8CA 2BGUA 3R6TA 1GNPA 2HMWA 3IT2A 2WR8A 5JJBA 1OJHA 1UKVY 4BZQA 3LBNA 5K7SA 1ZHOA 2A0UA 1QE5A 3FA2A 5CEFA 1OH7A 1ZJ6A 2DH6A 3A1WA 1NX6A 1M83A 2EKPA 1E2JA 1M2KA 4BPBA 4B08A 3VTKA 2CL7X 3GLGE 2R9VA 4BKMA 2A30A 3ORQA 5FORA 4KNVA 5KX5B 1VIYA 1ZAKA 1V4VA 2EGUA 1PV2A 2G1AA 1NFQA 4MV8A 2CV2A 4G5FA 4AJOA 1GVHA 1LFAA 5EHNA 4O4LA 3G79A 2WMYA 4EARA 3SYAA 1KWKA 5HIIA 2R7MA 4WLVA 4PX2A 1IM8A 3LTEA 3I5XA 3H9QA 2XF8A 3WOVA 5EG5A 2QUHA 1P1BA 5G0SA 3OFJA 2AHYA 3E15A 1A7KA 4HTFA 2CFIA 3TDKA 1YS1X 2EJUA 1TUEB 1O87A 1PV4A 5CNKA 3QVUA 1SZTA 4QX6A 1LU9A 4JP8A 4MVUA 3CLRD 3I37X 3VHXA 3QO8A 5AK3A 5JD4A 5KAMA 2WIJA 3WQQA 4HDAA 3CJHA 1ZM3A 4UNNA 1VQLV 4DCMA 2K7FA 1EJ2A 3FPCA 3ZHQA 4OHOA 1FUEA 4K8ZA 4QLAA 3OTOO 2JLZA 3RCBA 3VZDA 1K4DC 2JFNA 1ZD9A 3BS4A 1R4MA 3CCMV 3HJUA 1YS4A 4GKKB 1NXOA 2EEZA 1VE6A 3D6JA 1M4UA 5JNTA 5DHAA 4F7WA 5BURA 3WK7A 1R74A 4O4IF 1M2WA 1CNEA 1Z8NA 3GJ3A 3O0TA 4YAKA 1P73A 3CCEV 2I0FA 3C7DB 1YAJA 3NKVA 4FYIA 1YQXA 4H16A 2OB2A 1GCIA 3HXLA 5J47A 3RIEA 3X1XA 3QPUA 2F3SA 2H1WA 4CU5A 2QM0A 3EFFK 3RRNA 1ZHHA 1H9CA 1HZZC 1WCIB 3DW1X 3NC1C 2NU9A 1GM7A 1EK0A 5T8KA 4C29A 4CLOA 5JY6A 3C5CA 3LY5A 2C8JA 3ND6A 2ZYUX 4UKDA 3H2GA 2GKSA 3RK1A 4U7OA 4ZC1A 1JECA 4GPTA 1CT9A 4JXKA 4ZCIA 4W63A 1YVEI 3IUPA 5A02A 1H4QA 5L45A 4BBZA 3HEBA 1LX6A 3G82C 1ORIA 4OHXA 2ZSHA 3CE6A 3SJUA 3NTUA 1KY5A 1U2GA 3N74A 5TR9A 3L05A 3EY4A 3KJZA 1W73A 2TMKA 3JPYA 1N7JA 3U44B 1Z8HA 3W5UA 4FM1A 3NVAA 3SIPA 4ALJA 5FWNA 3TQFA 1TGYA 1L4FA 2VSYA 1SA0A 3OEYA 5FJIA 2Z2KA 5EPUA 4P31A 4XM0A 1XO1A 2ATIA 4EITA 2VOEA 3RYFB 2OWEA 4KR0A 2OUKA 4Y9TA 2GEVA 4GYJA 3WIVA 2PA0A 1A0OA 3SQMA 4IFBA 1E4OA 4HAZA 5F2EA 3LKBA 2PKQO 4AP5A 1EVQA 2VWJA 4QBTA 1PL4A 4A0QA 4CH3A 5FHQA 1EZJA 5HK8A 5DI9A 1PJTA 3TTSA 3EJWA 4G0ZA 2DUMA 2OHJA 3ZRSA 4S0ZA 1AK2A 3CUEF 2E3JA 5E1AC 5JSKA 1C50A 3IXLA 2VQSA 3F49S 3IQDB 1OA0A 1GPUA 3RODA 5KKAA 5CBPB 4OOEA 2ISQA 4BB6A 3TLZA 5G53C 3KKMA 5EPOA 4DXHA 1NUAA 2BP7A 4NU0A 4Q16A 4KJXA 1QG0A 5A5FA 1NG9A 3JYHA 1PWYE 2QMOA 1I3MA 3K0EA 4U7JA 4ZGGA 1ATZA 5KJ1A 3BMOA 4MAMA 3SMVA 4ZV4A 1NF8A 4KE9A 2D0DA 3KSBC 1X4TA 5B1HA 4HWPA 4PO3X 4BE9A 2REQA 1Q5PA 1N92A 5ALIA 1O94D 4J16A 4YJFA 1BX3A 5H3HA 2ICAA 3AHEA 5EQTA 3BXPA 3VQYA 1WD5A 5IDWA 2ILTA 3OEHD 1KSGA 5H9WA 1TAEA 4F8YA 5BZBA 1ODJA 4ZEVA 1FUYB 2QN9A 4ZCSA 3BL8A 3T1YB 2CVPA 1F3LA 3GMDA 3RLFA 2VHYA 1HDXA 3C1OA 4XRRA 3TEFA 1USUA 4X8HA 4FOOA 1RWWA 3P1JA 5E0OA 1W7AA 4G3XA 1H8EG 3OG9A 3MINB 521PA 5EIXA 2XB6A 1QQAA 1G20A 1M5TA 4FR2A 4B6QA 5HXAA 1YR9A 1GZDA 4UV9A 3NT2A 1MB4A 2QLMA 4K9LA 1O94A 3G5AA 4WCVA 2J7PD 4MZXA 3GCGA 1OREA 2ZBFA 2GAOA 3ZTWA 4UQPA 4PPFA 2FTKE 1MB9A 3AM4A 1L4UA 2HM7A 2ZRIA 4NYIR 3OIDA 4DL9A 2CNOA 5EEGA 2CL5A 3F98A 4HQNA 2ZUBA 5JXIA 1FFSA 4G9EA 5FTNA 3PUXA 1GAWA 5IAAA 4NBTA 5GMOA 3WZMA 1MIOB 3EFHA 2KLBA 1NVMB 4EW3A 2IH5A 5C53B 4EMTA 5EUCA 3ZWXA 5IFKA 1Q2XA 3CBQA 3TZEA 5G1PA 4EMBA 1PPJH 2GBIA 2R2AA 5B6IA 3G3EA 4YV1A 1PGJA 1A9TA 1Z4QA 3IQWA 2IJJA 5B4VA 5LHHA 5CDSA 3NM6B 2CCGA 4ATNA 4WTOA 1TZCA 3E8BA 3N2GB 4EK9A 2MSKA 4Q6GA 3N2ZB 3GEHA 5EGNA 2P4EA 3OUTA 3UPUA 2OXCA 1UDRA 4I7ZB 4QPJC 3CM0A 3OPQA 4G81A 1UBGA 2CAZC 5GTHZ 2WHEA 3VHRA 1EE9A 1IBCA 3SX4A 3CCBA 3W1VA 3CRVA 4DG8A 1GTZA 4NK4A 2BFDA 3PC7A 4UHBA 4ODIA 1VBKA 1ZISA 3PQ3A 4LJSA 4WZBE 2CUNA 2OEPA 3AVWA 3UT5A 1CZKA 2QE7G 4KNWA 4COKA 1CUAA 4LE1A 4Q48A 3DZJA 4W8HA 2W0SA 4TS1A 4G26A 4YRFA 4S35A 2RCNA 1E79G 5EJ5A 3ML1A 1H9AA 3E9EA 3IALA 1U0RA 1YB1A 4YMGA 3DV9A 1BXKA 5LQDA 5AHKA 1PYGA 1V25A 4J4TA 3BXHA 4L8FA 1HGXA 3X3HA 2K87A 3MTIA 2GCIA 1TI7A 3OUZA 2R4TA 4ZICA 4GZ5A 3L7KA 3FD9A 3GRFA 1E5QA 5B1BC 3BA1A 2HU7A 1A72A 5CDUA 4IZOA 1WXIA 4RA6B 3GJ8A 2P9EA 2ODQA 3CWCA 5FO0A 3OWOA 2D00A 2XZLA 3H3FA 3QITA 5BPFA 1P29A 3HC7A 1KRHA 3HUUA 1QLHA 4YCNA 1X74A 3D0KA 5IVDA 1QIEA 4ERXA 4O4LF 4IAOA 4BGIA 1ISPA 3IOCA 1EBOA 1T4DA 4W1SA 1JH9A 4BP9A 3AXTA 1G7CA 3NTRA 3HFRA 1P4HA 2ZSKA 4K0RA 1YQDA 2A0LA 2OIEA 1U7OA 3HU3A 1C7EA 3PCXA 2Q6VA 2NG1A 5SYAA 3JRWA 2ODBA 4F04A 3AF2A 3EDRA 4M9SA 1OBOA 3BWVA 2OECA 3ROFA 2J3MA 2O9JA 2H9YA 4YWJA 4EF4A 4JSTA 1M6HA 4Q01A 1VQ1A 1Q7RA 1T10A 3D2CA 2QMQA 1RXYA 2V7QA 4M0PA 2HT6A 4NBSA 1G9SA 3UMFA 2VF8A 1CDZA 4NS1A 3V8NA 1W0JD 2Q5HA 1MOFA 3OCVA 3DF7A 1II0A 2EF1A 5CM2Z 5ADWA 2CNNA 2QW1A 1XXHE 1GV0A 4QTZA 1GGKA 2QKCA 5FBLB 1DPFA 2UV8A 1Q57A 1NBMD 4WVFA 1KMQA 2XYHA 4CKZA 2FSGA 5CFZA 1XZPA 5KPJA 3N05A 3PKIA 1CRPA 4EOGA 4F5ZA 1A76A 3GWZA 4HSGA 5LQAA 3H3JA 3OTFA 4YT8A 3CU5A 2QROA 4M0LA 1ISSA 4ALNA 1NIPA 4B3FX 2VNJA 2CXSA 2Q5LA 4PYLA 3RUPA 2Q0XA 5I7FA 3LI2A 5HZMA 1FYEA 3NW9A 3LT1A 4TKZA 5FI0B 2XHZA 1BE6A 4ZQFA 1HLFA 3GBSA 5JJKA 4OJMX 1W0JA 4BS9A 3SZRA 1OY1A 2RCVA 1UANA 4QDXA 5CTAA 1WXQA 5C8VA 1QZ3A 5UKDA 3ER8A 3PRJA 5JC1A 3CT6A 1QVFU 3UV3A 1LZKA 2OFFA 5ENVA 5K5EA 3RSGA 4Z0TA 1ZH2A 1FDIA 3DZ8A 1UFRA 1J8FA 1NBMA 3H9GA 3QE0A 4OSOA 3RYHB 4LF4O 5DGXA 1U0TA 2CB9A 3VU9A 2P2NA 1T5SA 5AXDA 5DWDA 3A2KA 2FPPB 1PGNA 4L4XA 4MAAA 2ZKIA 3K96A 3CQ9A 4TV9B 3A0RA 3OEWA 3B40A 2HSJA 2QNIA 3KXPA 1E1QG 2NUBA 4BATA 1PL6A 3ND9A 3CRCA 4BMPB 2YCLA 1QH1A 3UWPA 2OBLA 3F9IA 1C4XA 4O2AA 1I0ZA 1MIHA 1AN0A 1ZXLA 4RVFA 1ORQC 4MCJA 4R16A 5EJFA 4GSYA 1I80A 4PR3A 3WB1A 1DAPA 3SLRA 1JJVA 3LO8A 5EWMB 4MUNA 4UUJC 2OT3B 3OURA 1UOOA 4X94A 2VZ9A 2VH5R 5B2EA 1NM5C 4P3YA 4KWEA 4NNPA 3KLNA 1R6TA 4FZJA 1V5EA 1TM2A 3WR5A 3KYBA 5I7UA 3FCXA 2BFMA 2Y76A 1W36C 1KMHA 1KR5A 4C89A 4J0FA 4FS3A 1OMOA 5G0UA 2OFXA 4G1FA 3O21A 4MCIA 3R5SA 1HZZA 4ER7A 4LHYA 4MMXB 1M1YA 1NVXQ 5A3VA 1XG5A 2GM5A 3PC8C 5GAJA 1X15A 4WFIA 3AR3A 1YK1A 4JX8A 4B71A 1JFTA 1FFXA 4KQMA 5LP1A 4LMPA 3M2TA 3I3OA 5CLGA 3QBJA 1W2BU 2FW1A 4JT9A 1IY8A 3NIBA 3K03A 3FTDA 3ABKB 2CVZA 2DHCA 1M2JA 2GHIA 3DKKA 1NJ5A 5IRCD 1OXBB 4AG3A 3TM4A 2I54A 4ANFA 1EXVA 1T91A 3VKHA 3K70C 4NPHA 3HJBA 1ZN2A 4UTZA 5C4IA 2ZS8A 3PXGA 1CS0B 4JI3B 3Q5DA 4PM4A 2GWRA 5JCXA 2BTOA 2K5UA 2BN4A 4Q05A 3I2YX 2R2GA 4QLBA 2XBUA 1Y5IA 1AJQA 4BJ5A 2B30A 3R76A 2QD3A 1ZESA 3CB2A 4DIOA 1HYEA 1DFGA 1D4OA 1XALA 3AEUA 1JYSA 1NOJA 4TMKA 4CMKA 1IG3A 1Z2NX 4PV7A 3QOXA 1N2HA 3B8HA 4BRZA 2VNKA 1CQWA 2BM9A 2VOJA 2D7DA 3JYPA 1SC1A 4I2VA 1GZSA 4G84A 2LIPA 1NNSA 3CC7V 3GRUA 4JI4B 4WNCA 1TFUA 1YEWA 3EVKA 2ZI9A 4NOLA 4YJHA 4D74A 2YTZA 3DTVD 4S1VA 3EEFA 3D6FA 5DT9A 4PG7A 5BW6B 3L6BA 3WDLA 4CXMA 4AJEA 3ZEDA 3QHPA 4PHHA 1N5MA 5GM2A 4H0NA 2PZJA 1UM9A 2WE8A 4YLGA 1ZI9A 3BTSA 1NDUA 4FT2A 3P9YA 3X2QC 4IJWA 2QTFA 2IKQA 5FI3A 4ZYLA 3AFHA 2VSXA 5FPTA 3C16C 5ALHA 3TFQA 3BREA 1U1CA 1CUHA 1Y4SA 2H2WA 3P97A 3NWPA 4G8CA 1Z6AA 3KKEA 1TLFA 1CUDA 2Y1GA 3I8SA 4LJ7A 4N6OA 2GJAA 4PYRA 3SXUB 5EUQB 2QAIA 3G2PA 3JAKA 3ZLUA 2DXIA 4U3JA 5EE5B 3IDAA 2QRUA 3DTVA 4CIWA 4E1VA 4IRMA 2EC5A 2GTAA 5F73A 1QG2A 4D92A 1YFKA 4EVIA 4F93B 1OBVA 1ZMXA 1XE3A 4OI0A 4F2PA 1L0NH 3BCHA 3L7MA 4L2IB 2HXSA 2GWHA 3G9QA 5H7XA 2QTMA 3EXG2 3GJ5A 5D3ZA 3DM9B 4YMUA 3GPLA 4K9QA 1Z6ZA 3KE8A 2WG0A 3TRHA 3QLVC 1KEEA 2DFPA 2D54A 3RT1A 1RWKA 1MEEA 1FRVA 2ZBVA 2VT7A 1M2OB 2AZMA 4JZKA 1WXXA 2I6XA 4XJXA 2B2CA 1ZX3A 4DJFC 4KPFC 1V1RB 3VQWA 1DWPA 5AR1A 8ABPA 3T0IA 5FR2A 1TRKA 3RC2A 3CY6A 1OGYA 3K7EA 4F5YA 1AIPA 1PFKA 2GGSA 221PA 3DDCA 4PZYA 4XOIA 6YASA 2NQ2C 8AT1A 2IU0A 3I9NA 2IEBA 1IC6A 4I9GA 2Q7EA 2QVXX 1SC4A 4LVOA 2XRYA 2ZDQA 3F6YA 3ZGLA 2PZGA 4IPTA 2W2VA 4ZO4A 1RYDA 2RGGA 1SHZA 3ANXA 3IGAC 4QPJA 1IY2A 3GB9A 1DLIA 1JHYA 2O8FB 4JYZA 1NYTA 3K4HA 4MR7A 5K3OA 1UJWB 3CSXA 3QE2A 1PJSA 4J94A 3KT8A 4LFCO 4MR8A 2E1PA 2IYLD 1FC0A 4LTMA 5H1YA 5CX1A 3H5AA 3BG5A 3HA7A 4JHXA 3KETA 4Q3NA 4U7WA 5C34B 2EF0A 2HI0A 2XDYA 3KR0A 821PA 1T8PA 3WS7A 4F0JA 1IIRA 2Q3BA 5BV8A 4TN5A 1BN7A 5DF1A 3FTEA 1D5NA 1Y8QA 3GLGB 2QMUA 3DE4X 2KQXA 1KSFX 4O1IA 1JG1A 2BJHA 4YIPA 2HQOA 4L27A 4YXWD 2OKGA 2IPAB 4Q34A 1DGQA 1EHYA 5CVUA 1E60A 1JQJC 1XNRB 2AZXA 1RZUA 2FUCA 3SZLA 5I9BA 1YJXA 1I9GA 1AI6A 1B8NA 5L4NA 1XF1A 1FMTA 1X9IA 2Q8QA 1EN4A 4EH1A 2IOQA 1QSGA 2W98A 2QZPA 3WLOA 4H59A 1K75A 1SHJA 3JAMA 4N8DA 2A5GA 5CLFA 1RXCA 2VEDA 5L3FA 3L4KA 3AGPA 5HM6A 3C6QA 4R6XA 4TTTS 3FX7A 4J9UE 1IK4A 3DG9A 4CC6A 3H9EO 4UVDA 2ZE5A 5BR8B 4EHLA 3FMIA 2HFKA 4YXWA 3H1EA 3MJVA 3A1CA 1GVNB 4ZXPA 4G1MB 4LE0A 4B4KA 2IUYA 1S3GA 1YFZA 4J43A 2Q2WA 2FE1A 3O3NB 2QY9A 1A8SA 4ZVLA 3GJ0A 3ZK8A 1N6NA 3DNPA 3IELA 3PDUA 2P9HA 5C51B 1YL6A 5KIAA 4JC4A 4R2XA 3DT8A 3D3WA 4C30A 4R83A 3J81k 1H3FA 1KBHA 1CP3A 3EZ2A 2IPOA 1MXHA 3OU2A 3IJ4A 3ANNA 5IAOA 5JDCC 1IIBA 1TTHA 1HNNA 1DOHA 2OOKA 3TF5A 1RRFA 3RYCA 1K5SA 5BUZA 3O8DA 4YDRA 2FP4B 4TL9A 3UHAA 1UBNA 4P4LA 4MUGA 4GICA 3CPEA 2YFKA 5K3FA 3DB1A 3HEAA 3CV3A 3OFNG 5CMUA 3TSCA 2IYVA 2IHNA 5IEJA 4DSOA 1HYQA 2A1IA 1TJYA 2LJ2A 1Z5WA 1GN3A 2PH5A 2XB8A 1UBJS 5DWQA 2G76A 1F12A 3H4TA 2CMDA 3QQ5A 1O3YA 8MHTA 2FMTA 3S1SA 5LZ2A 1MJNA 1GNRA 2O2XA 4KXLA 3KXLA 3HABA 2DVMA 2XCOA 3AR9A 2IQIA 3EIUA 3WADA 2F90A 1ES9A 3MRTA 2JFPA 4RV4A 1I3NA 3O65A 3VR6H 4BRWA 2XKAA 1FW6A 2FQWA 1C41A 5B2FA 4RLQA 1HETA 1OU4A 4K6CA 1AHIA 1PHRA 3G9TA 2VNIA 2FEMA 4QULA 1PX2A 1N33B 3QVOA 3GWKC 2B4KA 3VHQA 1L8AA 4BV9A 2H7VA 3C1AA 4CH4A 3IQHX 4CUZA 1E6UA 2CJYA 4K7JA 3L02A 1FX1A 4AQDA 2DY1A 1W36D 4LRQA 4B3TB 1QH8A 1X7WA 3DR5A 3UICA 1IPFA 3B38A 2AQ8A 4LFAO 4C4SA 2X4IA 1I6MA 4H0CA 2Y0IA 1FUIA 4HGNA 4CZZA 1RC0A 1N0VC 3MT8A 1H23A 2LCFA 3UB4A 3GLFA 4FWIB 1IY1A 1X7XA 1YJNV 4WCFB 1DO0A 2I34A 3IS3A 3GR6A 4MPTA 2QJFA 3CUVA 5AW0A 4UCRA 3BK2A 4RXTA 4XWOA 1V6CA 4PR0A 1NM5A 1V3UA 3I8OA 3IFXA 3E9NA 1RZVA 3V55A 3P3NA 3C6ZA 4ECAA 3ZQ6A 4IEIA 4NBKA 3LPMA 4P4UA 1IXBA 2ZUEA 4X0EA 1BHQ1 2FMXA 3G0IA 4F7DA 5AOVA 4DCPA 1SOVA 1XEQA 3KVNA 4JJAA 3PC8A 1NASA 2CDBA 3MJDA 2QE6A 4YPOA 1QO0A 1X94A 3W2TA 1Z75A 5A0TA 5GV7A 2YW9A 2CYAA 1YRLA 5D3MA 6Q21A 4JI6B 4NMMA 5ER6A 3JAWB 1Y1PA 3KYIB 3TB6A 4GI1A 2BC9A 1DAFA 1J1IA 3GAMA 1SIWA 5H4GA 2BMEA 4N0QA 3ZLBA 4CF5A 4N3AA 1GAEO 4MQ4A 2OQ2A 1W9MA 3L0YA 2LV8A 4QPNA 1FNMA 5HIMA 4P35A 4E3ZA 4KWHA 3VJRA 1KR2A 5LMUO 2I4NA 5LJLA 4EHBA 3QO5A 4BVBA 1DUSA 2W6CX 4RV9A 1TVEA 1W8DA 2WLHA 1ICEA 3WGTA 3B3AA 1G8AA 4GRIA 4HDOB 4PZUA 1V8DA 2X23A 2W37A 1SC6A 3B9QA 3EGXA 5EINA 3TLKA 4HRXA 2F3UA 4QEDA 2C4MA 5TPWA 6ABPA 3QYJA 3VAZA 4BVEA 1R4AA 1BA2A 4EYKA 2VDLB 2Q9BA 5DECA 4O2LA 2FXIA 1M8KA 4MV4A 2RJZA 5TNXA 2YZMA 1KO7A 4RPHA 4MYUA 3JW8A 4IZ6A 1RXWA 3ZW8A 1DT5A 3W5IA 4NJEA 1LVUA 5D6OA 4QJFB 4N47A 5CT8A 4WZBB 4AXXA 2L69A 1LQTA 1W581 5CBGA 4M88A 1Q1GA 5E7IA 4AN4A 3T9CA 4UMDA 1ZUNB 1PDOA 3SP1A 2EIMB 4TKUB 5KCMA 5K05A 2ZM6O 2FLVA 4IV8A 121PA 1YI1A 1OI4A 2VYQA 2WLNA 1M54A 2XY4A 2MCFA 1N1GA 3ZNPA 1ANKA 2WA2A 1XTBA 1EK5A 3CPJB 1DEOA 2QHXA 3MELA 5G02A 3A6ZA 5A4MS 3K6SB 4AY2A 2WJAA 4UTVA 1Z2PX 4ZI3A 1DBVO 4C0BA 4TKMA 4XEHA 3FB7C 2GMWA 4FOSA 1RP1A 5HFAA 3OZTA 3T4XA 4R8CA 3H83A 3I01M 1OYWA 1TC1A 4M38A 1E3SA 2HZ7A 3L82B 5CB0A 4KQKA 2ID4A 3KYDA 4KSYA 1ESCA 2XRMA 1XILA 1I24A 2X5XA 4GLFA 4GO1A 1Z0DA 2IE0A 2AR0A 1IMJA 5EQFA 5F51A 1G6Q1 2Q99A 2YV3A 3QLVA 2VQFB 2OGWA 3CZ5A 3EDCA 3R65A 5GJBA 1ACMA 2XIJA 2RIRA 2VQ3A 1UXJA 2CFTA 4GGMX 3ZMZA 4K81B 2ZR2A 3IQFA 2YCBA 4E13A 3M4JA 1A2QA 1PG2A 1ZH4A 1C30A 2WWVD 5H6RA 1V54B 4ZTZB 1EDZA 1CJSA 2PG3A 3NVDA 4RAOA 2QLNA 3OJOA 5EIFA 5ERGB 2VHTA 1US8B 3FCEA 4O4IA 4F9EA 4ZZ0A 1G3QA 4OAOA 1JNXX 1XOIA 1TU0A 3FCUB 1OXTA 4PZCA 3OCZA 1XXHB 4WERA 4OATA 1YC5A 3I39X 3B9PA 1Y74B 5MFZA 1GGEA 1XROA 2C9MA 3OMNB 1I08A 3QFRA 2DH5A 2HVJC 3MILA 3GEEA 5GV8A 2ZPAA 5DBGA 3VR3D 3GLIA 4ND3A 2IL1A 3IP8A 2ISCA 4AU1A 3B70A 4CRWB 2AS0A 3QWIA 4MQEB 1NTRA 3C4VA 1N8TA 2AD5A 1KYIA 4HGQA 1E2BA 2EKBA 3C3TA 1UF9A 1E58A 3JWGA 1DU4A 3GROA 4R4JA 4JA2A 3I5UA 1KZ1A 4H1VA 4ZAVA 4HBZA 3NB0A 3QUTA 1T3ZA 1ST2A 2ZI6A 2ZIOA 1F5SA 1QUFA 3C6KA 1R7RA 3WG7C 8LDHA 3V48A 1JJ2U 4BVLA 3GH3A 1XELA 4KCGA 2W58A 1JKJB 5KYKA 1ODCA 5EMJA 1T8SA 2W2QA 4M87A 4NENA 2ZXWB 1PKEA 4RE6A 5ICEA 3FFXA 4Z53A 1RACA 3KRTA 5K09A 3ASYA 4JPRA 3VR3A 3DHWC 3AH8A 3UJDA 5L9AA 4DDWA 5FHRA 5JJLA 2HNKA 3AR4A 1RLTA 4LSGA 3ASOB 4QFCA 4Z9BA 3ZXYA 5I8PA 2X1VA 3ZNNA 2PPVA 3DEKA 2FOLA 2XMSA 3ANTA 4EG7A 3FW1A 1Q14A 4TVKA 1EMDA 3EIWA 3UAVA 4TKVB 4F3KA 1JDJA 2WPDD 2GLXA 3IUMA 5AESA 5EA2A 2D74A 3I9OA 3U13A 5JRDS 3ME5A 1ZCFA 5G1OA 4MICA 1Q6YA 3GZNB 1ORWA 2WF8A 2IP1A 1XA3A 2NSJA 4RPJA 1DUVG 3W7TA 5ALOA 3TIXB 2VF7A 2XYGA 4A5SA 4GX0A 3O74A 1Z7EA 4NH4A 3DZBA 4X9QA 2OK7A 2R48A 4ZKIA 2GN9A 1WHSB 2ZM5A 1NMXA 1PWZA 2W0MA 1AF4A 2O57A 1MDFA 1E8DA 2EBHX 1ZGCA 3OE4A 3LCUA 4D9MA 1NA5A 3QU5A 6GPBA 4PTZA 3L4BA 3TXSA 2AA3A 4F6EA 4LMBA 3NHJA 4J75A 2VZLA 4K1LA 2W6OA 3E1KA 1KYVA 4KXNA 1K08A 3RM3A 1QYIA 1Z74A 2XADA 2EG9A 1S4QA 1RQ2A 4BNTA 5BP7A 3L8MA 5JDCA 2A14A 1ZFNA 3JZIA 3GDHA 2GAAA 2Q5OA 3IQIX 2C5AA 4QAQA 5KSPA 1OI3A 2P4HX 2UZ1A 3I2JA 4HXYA 2BRUC 1F2TB 2AE1A 1V1JA 5LBIA 3KOMA 1RYFA 4HJXA 1R6DA 2Z6QA 2XYVA 1VECA 1HBJA 3CJQA 1AKMA 1BH2A 1H3EA 4D97A 4DR6B 5BV1A 2MIIA 2F1HA 2WOOA 4ZDKA 3JR7A 3UW1A 4RNCA 3VBEA 1QZUA 2Q2NA 4PLGA 2QTVA 4V0MA 5JTUA 4YPVA 5BN5B 4OB8A 3PLAE 3E9YA 3ACDA 4MWBA 1MAHA 4YRMA 2QENA 2O1XA 1BL8A 3IDOA 1OC2A 2IIVA 4D6YA 1LV8A 3CG4A 4PAOA 2C9DA 4W82A 2XUPA 2CUKA 5DNYB 1Q0ZA 2Z43A 1VJGA 4MP6A 3ZU2A 1B2LA 1XMVA 5HFMA 3B1KA 3CZAA 5P8WA 2R3SA 3SMQA 1XT6A 1D2NA 1QAMA 4KBFA 4DV7O 2WLSA 3QQPA 1ZG3A 1CQIB 3SCZA 2QM7A 4AQYO 3WK5A 3FYHA 1L5ZA 2QM4A 3EE6A 4EGJA 4G5OA 4QRDA 3DVAA 1SCAA 2YHUA 4FDLA 1OZHA 3KQVA 1TCUA 5LWHA 3EVTA 2C1ZA 1H85A 3ZHVA 3K59A 4KPGA 3PRYA 1AP5A 1TW2A 2FZKA 1KKDA 4LJ8A 4B3RO 3GUYA 4Y9RA 2GPTA 4MJLA 3WK8A 4AJKA 2YXPX 4WW0A 1TKRA 2EJ7A 3REOA 2H52A 2QTNA 4CKCB 2ACVA 3E8HA 4OHYA 3MWJA 2IJGX 2NZVG 3DC2A 5ARDA 3R7WA 2ODEA 3NV7A 1MJGA 2ONCA 1YJ5A 3LNNA 4KYUA 2XOEA 1II9A 4UDYX 3EW9A 1OV9A 3TLBA 1VPWA 3GVIA 1NVPB 2VWHA 4CTJA 4J11A 3AEYA 2F4VB 3IUYA 4GQBA 3LGAA 5DNUA 1EWTA 5LBUA 4TLDA 1U8XX 3LUGA 1HYGA 3RVYA 4B6JA 1JDSA 4Z54A 3TZKA 2GK4A 4UREA 2YDXA 4Q82A 5DI3B 3FNRA 2D8AA 2VRCD 2UUCB 1Y76A 1Q86W 2EATA 2FWBA 3TECE 1PZFA 3KQMA 4RDXA 1JU9A 2ERCA 1RJWA 4RFLA 5FEUA 3TQQA 1GQRA 1ENPA 2AH5A 5CDFA 4ZDIA 3ZGNA 1SOAA 3BB1A 3OLCX 2QW0X 4DSAA 4FBMA 4KQIA 3CCJV 4KO4S 1DAKA 3PLRA 4ABMA 5FTKA 2AGVA 5ITVA 2Q4BA 3CN7A 5IX8A 3U9LA 1U0GA 3KSZO 2OAP1 1ML3A 4PC1A 5DP1A 1KK2A 4M9RA 3QX9A 1KQGA 4X93A 4J7XA 4EECA 5GY7A 1VXRA 2Y48A 1IXSB 3U4HA 2I91A 4TMZA 2JK0A 4C4PA 5LBQA 4DC0A 2FU5C 4B40A 2W2PA 1X42A 4MVJH 2FYTA 5GVRA 3JD3A 4IDFA 4GKJO 5I7AA 1NJ6A 2FWPA 3H13A 1H69A 2D1QA 4S1WA 4AMVA 3TNLA 3HY4A 3IDZA 5JAPA 2A4KA 4RH1A 5HDBB 3SU8A 2GZMA 5BUQA 5IKEA 4G4GA 3EPKA 4MKXA 3L41A 3WV4A 1LLCA 4L5BA 2YXYA 3T7AA 1XAIA 1U4SA 1U3DA 4DMGA 3I9KA 3UO2A 1Y8ZA 1FYJA 4QIHA 2QM3A 4LOJA 3A06A 3TTTA 5DYNA 3B5IA 2WPNA 2EBWA 1OFGA 1DMSA 3BN3A 2R1VB 2H48A 2B9VA 4BWFB 4PD4F 2IWRA 1N34B 1OTYA 4KYVA 4P7FA 1Q0QA 3ER6A 1KQNA 1JWLA 1BE0A 2I99A 4FEAA 1ISGA 3BY6A 1XL0A 4FLVA 4HMPA 3CCSV 3TINA 7AT1A 1BS3A 1YBFA 3WNBA 2DQZA 4Q9HA 3MTBA 1FP4A 5AW3A 3R75A 4EKDA 4NBLA 3H4IA 2WILA 1SVUA 1P80A 2VPQA 2BEUB 2FLWA 3JR3A 2XGMA 1EKXA 1W5AA 5ECGC 2DSNA 3BQMB 5CYOA 2XE4A 3WWCA 4ASUD 2FZLA 4FLUA 3QKSB 2DLDA 4B6FA 3FAVB 4RK5A 4NCIA 3UQZA 3FYEB 2VHVA 3NKFA 3BE8A 1A5BB 4YWHA 4BMVA 3O1HB 1YHZA 4LOIA 3HCEA 1MZPA 1FMCA 3KYJB 2CLIB 4QTUB 4ARIA 2OXIA 1ZP6A 2JF0A 1YB2A 3RT7A 3HJCA 2VHEA 4WBNB 1YJBA 2H54A 4KR7A 3B85A 4KKXB 1JEOA 4CC5A 3QMVA 1UJCA 2RD2A 4U0KA 4AY5A 4DF3A 4B6RA 1M1ZA 2E4WA 2PMEA 3OWXA 4YO8A 3CRMA 2X41A 2H11A 3IRUA 3N3BC 3NWBA 1PLJA 1WSDA 2QGFA 3ETGA 5F9MA 4XDYA 1LVHA 1E9FA 2OR3A 1EDOA 2NV2B 1XD2A 2BOBC 1UBOS 4FGJA 3CMAV 2XCRB 5HF5A 3TRJA 5F52A 4DLUA 2Q29A 3NHMA 3FFWA 5I7WA 2UXCO 4CEHA 4XIYA 1G7SA 2JFQA 2LR0A 2QIPA 2G28A 3UMJA 1YONA 2M1ZA 4FFOA 2HC9A 1Z63A 3HV2A 4JA0A 3TW8B 1YJWV 2J09A 1UH5A 3ETJA 4UBMA 5FAXA 4IXDA 4YMTA 3MQ4A 4AG5A 5FNZA 2QTCA 5KOIA 1B0PA 1C8KA 4E32A 3UXMA 4RABA 3JQAB 4JELA 2J0VA 2PL5A 5HSGA 3RASA 1LI4A 3OE7D 3U9TA 3CZ9A 1BZKA 2H18A 4ZZ1A 1N8KA 1WNTA 3QYAA 3THOA 2FUNB 4W5NA 3L06A 3P4UA 2VXBA 1J0AA 4HI0E 1N7IA 2O7RA 1NC3A 3GT4A 2ZRMA 5AI9A 1RLMA 2QQFA 4J8PA 1UEIA 2RB5A 4I6EA 4B3GA 1GPH1 5CG2A 3BMNA 3DW3X 3KWFA 3LCMA 1GTJ1 3ZY2A 1IOZA 5DP2A 5KA6A 3F1LA 3CCVV 2AWOA 4BZWA 2RHOA 2ZT9B 4I81A 3FUCA 4EP1A 3FLBA 1FBTA 2NNUA 3OU7A 5JAOA 2NU7A 1R4NA 2BD0A 1QIKA 2Z2YA 2NTJA 1N2GA 1SC3A 1GD1O 1WPXA 4TRMA 1V43A 2F43G 3OE7A 4NB5A 1T0IA 4WFJA 1R0LA 5JQGB 2BSKA 4TMXA 4LF9B 1Z82A 3SN6A 1O97D 4BNWA 2IM9A 3T3HA 3RC7A 1R66A 4DGQA 5KCZA 3OUSA 3KZXA 2GD2A 4OKNA 4ZVTA 4QYWA 1E5TA 2B0JA 2A1TR 3ESBA 4W6ZA 2HMAA 3PJSK 2GETA 3PBKA 3TDMA 1EVYA 4YAWA 1R9JA 4O63O 3DFFA 4IQ0A 4BMOB 3Q3CA 4I3FA 1I8TA 3TZ6A 3DE1X 1X77A 3A05A 3QUAA 4QGSA 1KNXA 1TDJA 4J49A 1A9QA 5IF9A 3KAQA 2BFPA 4QOGA 3HFSA 2PLRA 1ZNYA 1RKBA 4JT4A 1E2PA 1NW9B 3MT9A 5B1AB 2VSQA 1FP7A 3OEHA 3KOZA 2XPCA 1X7HA 5KQPA 1U0NA 1T2NA 4KI7A 3U4MA 2XGJA 4EMSA 1JG7A 1GPKA 1Y67A 3A1VA 2PD4A 1M1KW 4KN5A 1U0BB 3JYCA 5LYYA 2Y66A 4KR9A 4GWLA 3OHPA 1JLRA 2NTEA 1OLUA 2W90A 3CX6A 1T0BA 1NVEA 4DV5O 4FMBB 1DKMA 1SOWA 5H4HA 1QP0A 4DHEA 4XPZA 5K3AA 4YUWA 2GN8A 3ZG6A 1SURA 4Z9YA 2FG7C 1AXEA 2X6RA 2BHLA 4OQLA 3DFKA 2UZAA 3ZHRA 1OX4B 2BT4A 2RJOA 2DBYA 1FSFA 4Y2GA 2C92A 4BMXA 1GAJA 2J9XB 2GTSA 2HFJA 1I4TD 4MGIR 4Q7QA 4GOND 3N87A 1NMYA 4U7PB 3FF1A 3D4LA 1LK0A 5E0KB 3QI2A 5ALZA 3DBRB 3NGXA 2ZRAA 5I5GA 2J7PA 2NUPA 3KPYA 3KJHA 2OCIA 3Q11A 4I66A 1HEIA 3RVOA 5IH3A 1VGVA 4H3HB 3WSWA 4RZ3A 3V2IA 1PJQA 1OVMA 5FPOA 5JU6A 1U3GA 3GGPA 4R7CA 2XTZA 4FM0A 2FSUA 2AW3A 1GYQA 2NO5A 4Q4HB 3TVDA 5EMMA 3RS9A 1DQYA 2GZSA 4H7JA 2XMDA 4R3NA 5F78A 4UW9A 2B1GA 3HFJA 1FNBA 4HLUC 3HRIA 3NTVA 2BRUA 1S0VA 4QA9A 5FXMA 4EHJA 4PI0A 3EMBA 2EZ9A 4BIIA 3QMWA 1HF3A 3MD0A 4DSZA 4G2NA 1WDMA 2AG1A 3IR7A 1E2EA 5EFZA 4HYOA 3U0BA 1F9AA 3CNNA 3JASB 2VQ6A 4JBNA 3QVGA 2HIMA 2QD1A 4YIOA 3ZVNA 3FDZB 3CR7A 3KBOA 4I4NA 1TYBE 3ID6C 3GQBB 5CDTA 4I1VA 2C82A 1BMTA 2QK4A 2AMVA 4XB6B 2Z4TA 1C0EA 4PCVA 3PX3A 2JCBA 1VDMA 4MJ3A 5DV9A 1RE1A 1IN5A 2Z1DA 3FCYA 2NXCA 2CLHB 4AO6A 3TNYA 3DSQA 2C5BA 2CBZA 1CY6A 1WV0A 1QRAA 1BCCH 4P3KA 3ZBHA 3Q5EA 3LOUA 3PS9A 3T12A 4B7EA 3CBGA 1WB9A 4MVWA 1XJ5A 2JJ2D 5AM3A 5BNFA 1Z34A 4WZAE 4EO7A 1Z3CA 1XKXA 4F46A 4D4IA 4DV4B 1YBHA 5G41A 2VYVD 2DF8A 5E4FA 4X64O 1ZD8A 5K51A 1C1XB 3L79A 3SICE 5HRCA 2IUTA 1S2IA 5GQSA 3JZMA 4NBNA 2QWPB 5LGUA 4TV8A 5FNVB 2WUWE 4D4LA 1XIVA 1RAFA 3S2ZA 3B89A 3OE1A 3ST7A 1J0DA 2J31A 4NU5A 4S05A 1EK6A 1TVKA 1E18A 2RKBA 5LPNA 1KP2A 3G9UA 1N36B 4MYRA 3FNFA 3AJDA 1B8OA 3P9PA 2C58A 3I6QA 1OC4A 4IDEA 1E5LA 3F6PA 2Z4SA 3W4IA 4WZ6A 4FZ0A 3WHKA 1J4AA 1J25A 1CC1S 3X1WA 3SQOA 3F6RA 4RVGA 3TPZA 4RELA 1HNZO 2OHVA 1GKUB 1D9XA 4LF5O 1M2VA 2WFLB 1MRSA 2VYVA 4GVXA 6REQA 3V1NA 1ZL8A 3LTNC 4K0KB 3OJXA 3C7AA 1XAGA 1XZQA 3CRNA 3KJFA 3QFTA 2XECA 2Q3MA 5KNDD 3L01A 2D1RA 4UUPA 4HBNA 3BIXA 1G7TA 1GZ5A 3CWBH 3C74A 3CLKA 4E6EA 3OQOA 1ECPA 4JITA 4F92B 4HZUA 5C3UA 5H9CA 1RMYA 2H8GA 5TIIA 2FN9A 3G0HA 2C1EA 4WPGA 1NQTA 4JTCB 4HGZA 3RS8A 2I33A 3U39A 2Z4RA 3DC6A 4LW8A 1D2AA 4G1BA 3A9CA 3JYOA 4ZOLA 4A2CA 2IJHA 4NSNA 2EFEB 4XLTA 1L4NA 4QGHA 3WIEA 5AJHA 4J2TA 3FMOB 3O47A 1XKTA 1T1GA 2QX4A 2PRKA 4BWYA 2IZZA 1MC1A 4MNTA 3TOSA 1U9YA 1JN0A 4JLUA 2X6AA 1S4MA 2AW9A 1UFOA 2IEZA 2VR1A 5FOUA 4FN4A 2ORYA 3FNIA 1R18A 2Y0DA 2JEZA 4JXZA 4Y1GA 3QXXA 2O7VA 3MBKA 4N8EA 1G2IA 3HUFA 4LJKA 4WJLA 4ZT5A 2OMEA 3IDSA 3RTBA 5GW7A 1YOVA 3MRXA 2HSDA 3KQKA 1T1JA 3NEPX 2DLNA 1D1SA 4BAUA 3SIRA 2Q0OC 2WYOA 4D0RA 2QSAA 2XI4A 1EM8B 1YH3A 1NBEA 4RDCA 5A4AA 1DCTA 4PHFA 5JISA 1VDZA 3MJRA 4CM3A 1I0HA 4WNAB 5CG1A 4DMKA 2QJOA 2WJPA 5DPMA 7YASA 3D8CA 3KB1A 5HJEA 5FQOA 2REOA 3DOFA 5EVJA 3RPEA 3SHVA 5I7OA 2CNBA 2EQBA 3KPJA 7REQB 2QX8A 4G0QA 1YHQV 2FEWB 3VZPA 4YEDA 1L5KA 2YZNA 3RHSA 1QU2A 1WCIA 1QQCA 2HCFA 3C5EA 2IX3A 1ZK2A 4I4TA 3WQRA 2DR3A 2VP6A 2QWXA 3LX6A 5LN1A 3DTNA 3HKBA 3AUKA 2R7KA 3KXKA 4KWIA 2VH2A 1Y8CA 4F6LA 1ICIA 1WY5A 4JI7O 4TROA 5DSXA 1C3LA 1I1HA 3PC6A 1CDEA 4KOEC 4XVUA 3ABKC 2JATA 3K73O 2BCGY 1UAGA 3EUEA 3C41J 4GM0A 3BUSA 4GKVA 4OMUA 4A2PA 3FCAA 2XASA 4FEGA 4J2HA 5BW4A 5BY2A 3BHMA 5BVGB 1BZYA 3U44A 2WSIA 2K2WA 2ZSJA 1Q0TA 3SJAC 1PVVA 3W6PA 2XBLA 3R5KA 1EUCB 3IIIA 3WHIA 4WX2B 3I55V 4WKGA 2SCUB 1VARA 2C03A 4HB2A 1NN0A 5C5IA 1KA9H 1KJQA 3NVMB 1JVMA 3SQXA 1ISIA 1LSUA 1MV5A 2Z09A 4FW9A 4R2WA 2AFIB 2G80A 3ZI0A 3D81A 4K2HA 4U2BA 4GYWA 5IG2A 1FTQA 1KAQA 2O52A 5SYMA 4YR7A 1Y3CE 4LY6A 1WQ4A 2XH8A 3FYSA 5M7EA 2PT6A 5JG7A 1NJFA 3NMUF 4C5AA 5CBPA 5LIPA 4DLVA 3A6FA 5EYPB 4BVAA 4OHBA 5GZ1A 3O8QB 3R5TA 3FY4A 4GZ6A 4Q7MB 2GCPA 4UCQA 4LF7B 3ZV5A 4G01B 5ALJA 3ZV3A 2L18A 2B9ZA 2DJVA 1I94O 1X0VA 3AIOA 4C78A 5EJ4A 2CD7A 1SFRA 1UP7A 1XLUA 2HDHA 4NJMB 3ZW9A 4CHGA 2VZ0A 4RTMA 1PEYA 1JL3A 4B4OA 3A2MA 3AESA 3O8RA 1SQ6A 2O8DB 3W5CA 5ALNA 5JCPA 3R9XB 1XEXA 2N47A 3AHGA 2IYUA 3LH5A 2Q4TA 1NKTA 2QF7A 3KXIA 4KXQA 1ZLZA 4NQRA 2Z0AA 3OD5A 2YIAA 2PD3A 1M57B 2Z3ZA 1A9PA 4K86A 4ZP1A 4S1OA 5AOCA 1KAHA 5ECWA 4XVHA 1FZQA 1Q1EA 2YJNA 4N01A 4PANA 4BE7B 4G5GA 4RPIA 3K1AB 4ZGWA 4GW3A 4BX3A 3QU2A 2C2HA 1TJ4A 4NI5A 4H1TA 2VRBA 4S3MA 2WHXA 3D36C 2PUTA 4F5DA 2ZUWA 4ICGA 1CJTC 1Y9AA 4NY1A 5IZCC 4DR5B 1KYYA 4JXXA 1B6GA 4IIJB 4Y1FA 4FHCA 5FR1A 4BCBA 2HV8A 4JU9A 2BM0A 4Z3OA 3ILVA 3HN6A 4WN3A 1L5WA 3GRRA 1UBCA 2GVDC 1YIJV 2O2CA 3V42A 3ABTA 1RPNA 3OQ6A 4Z2AA 3IJ5A 4B76A 1EBFA 1CEQA 4I55F 1DNPA 4N9WA 3LPCA 1WUHS 4O6VA 2YZ2A 3DLAA 4LCBA 2IV2X 1YFLA 5EWJB 4OQFA 4YV0A 3VH3A 3FYCA 3HVHA 3VO8A 2GSMB 2O07A 2XJ4A 3WNVA 3OY7A 4CE6A 1V2GA 3TTUA 3TL2A 1D2DA 2Q7OE 4TV8F 2CVQA 4F5EA 1BEUB 3O7WA 1OBHA 2VNSA 1XTRA 3PGXA 1VZ3A 3LZ6A 1CR1A 3BZUA 3ZDBA 3AEZA 3UG6A 3W7WA 2R9AA 4CVNA 1OYYA 4ZO8A 4DBLE 1E62A 5BYAA 3D31A 4GMDA 1MA3A 4ZVQA 1HNWO 4BN0A 1DOZA 3R41A 3IP5A 4HH0A 4OAPA 2N04A 2VO1A 2A35A 2ESRA 2HUPA 5AJTA 4IQGA 1PX0A 2DBVO 3I4CA 1X9GA 4NTZA 5T64A 4W5OA 2DZDA 2G6TA 2CGOA 5CCBA 4DLZA 3KWMA 5IUJC 5C18A 3DB2A 2ATCA 1R0XA 4EUKA 3ZDFA 1FFWA 3QXSA 3MOSA 3EHEA 5KU1A 4P93A 2GYVA 3EW7A 3TB4A 4EBFA 5LGTA 1A9XB 4UUQA 3AHCA 1ORTA 5C2JB 5KZMB 4EUSA 7MDHA 3TJTA 5C3MA 2A3RA 1Z7YA 3LLCA 4HG2A 4Q9DA 1RQ7A 4YAJA 3TFWA 2ZR7A 4C3UA 4HNTA 2QVYX 3OM3B 2WYHA 5L40A 2WQ6A 3BGSA 4BTVA 2C88A 1K2WA 4DV1O 3RV3A 3ONDA 1JJOA 1H6AA 3ICEA 4I1PA 4F4HA 4JROA 3G6KA 4LOAA 4W9RA 3NWOA 4ZOLF 4QICA 4DQLA 5K6AC 2QTTA 3VKVA 4LISA 3TLMA 1ZJJA 3FWKA 4CV1A 2NUAA 4R9SA 3TBKA 3K94A 1THMA 1RWOA 1J49A 2BJWA 1RFLA 4TTPA 1VHTA 4X91A 4DQDA 4DSUA 3JARB 2AKEA 4N0EA 3O8OA 4QBIA 3UFXB 5GZ3A 1U1EA 3CIOA 3OZFA 2OLJA 3I23A 3II6X 3BXGA 3WQBA 2G1KA 4O59O 1R2QA 1EFPB 2FRVA 3QMMA 5FIUA 3R3XA 1P60A 2FG6C 1AKWA 4MA4A 4WKPA 3FIUA 1H2XA 3VNUA 2B5WA 1R1DA 1SHLA 3MOIA 3BH7A 3AB7A 2OCLA 5C5DA 2G67A 1RU3A 1PTKA 2JIBA 4WZZA 1UWKA 4QT4A 3CVUA 5C5CA 2Z3VA 1GKLA 1GNQA 1XI1A 4GX2A 1RPAA 2E5LO 4L3VA 2XT6A 4HK4A 5TT0A 2IYRA 5DXFA 4OFXA 3KKOA 1S7CA 1S8FA 1R0SA 4UEKA 1PW7A 1N6KA 4TMWA 1YTUA 1GRVA 1QQ7A 1MA0A 1A1VA 4JBIA 4L8JA 1GZ4A 3TEJA 2G83A 4OLBA 2PX4A 3IVXA 1OILA 3SYOA 2K7ZA 2YYYA 1UC9A 1SHUX 1WMSA 3FROA 4TS4A 3TG8A 4TZKA 1JHQA 3VO2A 4XDHA 2XX3A 4IOJA 3OJEA 4B83A 1CB7A 2BFWA 3AUYA 1IE3A 3HDVA 3GGJA 4Y2PA 4WLUA 2BHTA 4I4TF 2EFHB 4NX2A 2OGUA 5JMPA 3EQ9A 3CCFA 3S4YA 1QR2A 3HYLA 3O83A 5DXAA 2AI1A 5E9JA 4A36A 2QN3A 3OOWA 4IOMA 4XGRA 2D2XA 1CUBA 3HP4A 4TSKA 2D5IA 3RDPA 4YAOA 2FFHA 4ZQHA 1RQXA 2DAPA 1AO3A 3Q0EA 1QX4A 4FMCB 3ZDEA 3WFZA 4RXUA 4KSCA 4A0HA 2HK6A 4FWTA 1REQB 1QYCA 1YQTA 4A2WA 2VJPA 5KO2A 1JX6A 3KVVA 1RWBA 1XEWY 1N4CA 1R16A 1V3TA 2FPPA 3QP9A 1XBTA 2OKCA 1E3DA 1QQ5A 1BVHA 2W6ID 2V6MA 5IUNC 1N1MA 1LW7A 2AFHE 1TO1E 2GPJA 2JIRA 4M8KA 2TSYB 2WA1A 2EP7A 4CFYA 4AECA 2GYYA 1QKIA 1IURA 3PRHA 2Q69A 2J3IA 3ELYA 4LJ5A 2ENWA 4R68A 4BNJA 1WPBA 3FB8C 3HB9A 4D4MA 4XVQA 2MYNA 3LSUA 5E3IA 5DNCA 1K63A 2HB6A 3A6JA 2JVJA 5HYVA 4G2TA 2VHJA 3DOIA 3RSHA 2Y69B 2ROQA 2O1EA 4DR7O 1L7NA 2BPOA 4ND1A 1J7JA 1W46A 3G2OA 1ABFA 4HWGA 2HCRA 3SDSA 3M5PA 4HKTA 4TLEA 2QYOA 4FR0A 1B93A 1RTKA 3ANSA 2CXRA 1VIMA 1GNLA 2V6FA 1EN5A 1AHHA 4QEKA 1USIA 5EE9A 3ZCQA 1T25A 1U31A 1KC8W 1YQEA 4B0OA 1FS0G 2TRSB 3SQLA 5KYGA 5DGTA 1NP7A 1SU4A 1E1NA 3UN1A 5IVKA 2ZNJA 5B55A 1P7CA 4QRIA 4PC2A 3SVLA 4B2PA 3D8SA 3VM6A 5ALTA 2PA3A 2KYRA 1SKVA 2Q1YA 1YA6A 1VPDA 5ITWA 4EELA 2I6QA 4DA4A 1G5HA 5GWXA 9GPBA 1N0JA 4EI2A 1WETA 4PHGA 2Q2VA 5JZ9A 3AJ9A 4IYJA 1B76A 3P0EA 3W6UA 3BHIA 1YS2X 1ID8A 1Z0IA 3TXQA 5FWYB 3DYBA 1KPHA 4J4HA 2QBYA 4BLSA 3AK3A 3N70A 4Y8VA 3H3XA 3ROKA 4YLEA 2F1JA 1EB9A 2P9CA 5LD2B 2O6LA 5A3QA 4JJ7A 3H17A 1G2QA 3WKEA 2HLDG 1GGVA 4ND7A 2F1OA 2XE7A 2ZULA 3CUSA 5F4ZA 5CT6A 4MLDA 3QENA 1H2NA 1NN3A 1CF4A 3OIGA 2X15A 3HO1A 3OZDA 1Z5PA 1CS0A 1ADFA 3O91A 3GXBA 2Q50A 2AV6A 1OCZC 2OCXA 2AI2A 5DHSA 1JE0A 1W94A 2GAJA 2CFOA 5EHQA 3BK1A 4D79A 4UUOA 3GCZA 2ZRFA 4TL7A 1EGVB 4Q1EA 1OIXA 1C0KA 3HY6A 3WQHA 5G4KA 2FI1A 1Q92A 2QEXV 3R5XA 2YHIA 4M49A 4WFQA 5FBVB 2NO7A 4E70A 3KOYA 1M6VB 3KT0A 2O0JA 3F90A 5G1NA 2Q4RA 2VUHB 1RJEA 3MTGA 4KIFA 3D3IA 3RJ9A 1FNDA 3WMGA 2FF5A 2ONJA 2JCSA 3UJNA 1N5DA 4XWTA 1U2ZA 2D1YA 3U7GA 3VUEA 4MW5A 4RZSA 2R66A 4DMLA 1G21E 4I5FA 1ZCJA 4HDNA 3HUTA 4Q1FA 2PZKA 1KAEA 2PV0A 2PUFA 1DAMA 5L3SA 1S1MA 4MIYA 5LC1A 4DG5A 3FYUB 3WZLA 4Y7DA 2PWYA 3ICOA 4QREA 4HRYA 5HK9A 4NHOA 4N03A 3IPRA 4OPAA 1PJRA 2ZJ2A 1L8OA 4LGYA 1Z0UA 3UHOA 4RM2A 1OIVA 2FDXA 3QFFA 3E5RA 3H75A 3NJ8A 4DC9A 1X7YB 3CO0S 2IZOA 4GBED 4BFYA 1MABG 4EA7A 1N5IA 4TXJA 3V4OA 1KZ9A 1KDYA 1R6VA 3DO5A 1RYHA 5ALRA 4U02A 4CM8A 3EVGA 3WGYA 2ZQ5A 4JX9A 4U7FA 2YXLA 1FQWA 1WRBA 1B1AA 2YRFA 1GN6A 2P6OA 4X1YA 2DOSA 3D36A 1AA6A 3PKZA 3E53A 3TR5A 4AW9A 5DRTA 4DR4B 3T99A 3WGVA 4ILKA 5IZCA 1P6QA 1SBZA 4DW0A 2EFCB 2IHBA 4YJGA 2RCYA 3DLBA 4LHZA 2I4LA 1C9YA 4WZAB 2R6FA 5T41A 2DWQA 1ZNZA 3L9WA 3V1KA 3WP0A 1P2UA 4F45A 4ZK6A 1V1RA 4LK2A 1IUKA 5HILA 1LSJA 4B82A 1UQUA 3PJEA 5LNK6 3AERA 1OCCB 2QWQB 2HMTA 1PD3A 2CK3D 3WLJA 4RVHA 4G97A 3I9FA 1L5FA 1GP2A 2XAFA 2D2EA 3GI1A 3LUKA 4IP0A 1NVKA 2EKQA 1SKUA 1Y5NA 5JXWA 4WGGA 1G6HA 1EB8A 1SUAA 3PPYA 3QYFA 4R81A 1NS1A 2Q3JA 1NLFA 3IOMA 2WYVA 1OFIA 3RAFC 3AR7A 3CEHA 4JAVC 2C9YA 1LQ2A 1TCCA 4MP8A 1IEQA 1A5AB 2O4UX 1OWLA 3BD9A 1P7YA 3M4YA 3PX2A 4Y98A 2CMKA 3R23A 4QOSA 4KWTA 2Q0SA 4HDSA 3OBBA 4EHDA 2GF9A 2R11A 1N2EA 1V6SA 3ESRA 1SRQA 1UPXA 2ID7A 1A8IA 1DG1G 1Q21A 2ZCJA 2MYPA 3OJCA 5B58T 4GGOA 3A1NA 4JJIA 2GM3A 2ITDC 4PG5A 3MHPA 3HCFA 1ODTC 4WA7A 1BDIA 4ZCRA 4E2YA 1FP1D 2I29A 1JILA 3ZLVA 5FA6A 1FU4A 1Y63A 1MW8X 1XMOO 4G41A 5I9IA 4QYMA 4KGZA 1YNOA 3MLBA 3APQA 3DL7A 1O6BA 1R64A 2EARA 4J2OA 4Y2XA 1WCWA 3P5SA 4O0MA 2O8CB 4N82A 3ZY4A 1POXA 4H1WA 1UJ5A 1VCHA 1PR6A 3FNGA 4OP1A 5HBGA 1RLOA 1E77A 2X2PA 4WHMA 5K6AA 3GMIA 2Y6UA 4S12A 4CV3A 2CXQA 3ZWNA 4PTLA 3BFXA 4FK8A 2DYRC 4YRBA 5IANA 4TWRA 4MCAA 1U7PA 3B36A 4NR1A 5EFOA 1ZN9A 5FA8A 4X7BA 1U9ZA 2NU8B 3BMCB 4KVFA 4CF3A 1YCFA 5LWQA 4TV9F 4RFVA 2D6FA 3A04A 1N2JA 3GFBA 1O97C 4M89A 4IVQA 3CWQA 1TT7A 1W85A 5BRJA 3MRVA 5G0VA 1HE2A 3DH0A 1O95D 2PUJA 1KQ3A 3RTDA 3UNXA 2E9SA 4Q1CA 2Z8ZA 2Z08A 1P49A 1OLSA 4CKEA 4RADA 1V55C 3STXA 2QU7A 3PUYA 5TQ2B 1E3TA 4A8HA 2P3QA 5C31A 3EGCA 3KUKA 1E9RA 1AGNA 2Q41A 2NU6B 4FYVA 2GOYA 4X60A 2JCVA 1ECJA 4FYJA 1JQKA 4QGBA 3RRFA 5K1PA 2O23A 4IJKA 2ZSAA 4UAVA 2WPDA 4KRYA 4KOAA 3M83A 2V1XA 3SYMA 1CJBA 4BJHB 1E8NA 4LHSA 2GD1O 4F8EA 3MC1A 3F4BA 2CHQA 2C2MA 4UFOA 2X76A 4ND8B 4JYPA 2IV3A 5L3QA 3N2KA 2BHRA 1XZEA 2F59A 3IEKA 1J22A 3Q15C 1C8BA 3HDTA 3PXCX 2QTZA 1X14A 1BCSB 4ENVA 2FRDC 1ZQ9A 1JEAA 3F3SA 1CQZA 3A9SA 1P3Y1 4Z9FA 2YQ5A 3EYWA 2IUFA 3S2EA 3SR3A 2IYPA 2FPIB 4XM1A 2X0RA 1E7YA 3IBTA 4PHTA 2I2FA 4ECEA 5CFPA 1B6TA 4C4TA 3KQOA 1LBQA 1BD4A 1ZWIC 3I56V 2XQVA 1XMXA 5SY6A 1LC0A 5CJJA 3KSRA 2VTBB 2GUZB 3CTMA 1Y80A 3G5MA 4CPDA 1J5EO 2PMWB 2C3MA 2GERA 1GEEA 5JWRA 3S3XA 4PEVA 3DBOB 4TWAA 1W5BA 2GN1A 3L8DA 5C7LO 4M1KA 1Z15A 4M99A 4CFZA 1E0JA 1H5UA 1OPXA 3W2FA 4Z3DA 3EZFA 3HB3B 1Z4OA 1VQ6V 4EQZA 4H0LB 1FRZA 3Q7TA 1DINA 3SE0A 2AZ2A 2WC1A 4JVOA 5M2QA 1W96A 3PFIA 5KINB 2UUBO 5EMLA 2P4KA 1BS9A 1P1CA 2Y1LA 4JSRA 4C7MA 2VDVE 3PDJA 1LPAB 3T1HO 2BE9A 3I53A 4R40A 4WCEV 3OHSX 4P58A 2A0WA 3EG5A 3U2QA 3SR2C 2B5UA 1IN1A 5J2TB 8OHMA 1A27A 3COZA 1KP9A 4J7ZA 3QBEA 1P9OA 4PZEA 1GCGA 4D7TA 1VGRA 4E11A 3K9LA 3P2YA 4HHEA 5K3EA 1VP7A 1AVTA 3ZX5A 1EGQA 2GRUA 4PBSA 4IF4A 2WSBA 2PGIA 4DZZA 1CLEA 5HZHA 3ETCA 4CL3A 2DFTA 2G17A 4N65A 1ENVA 1VRCA 1RI5A 3OTQA 2ZGVA 4LBZA 3RWOA 5IKPA 4J0QA 4J6FA 2X42A 1QHHA 2QGNA 1Z2OX 2X0FA 5PGMA 2IXTA 5IARA 3JPWA 1DF4A 2P22C 2HNBA 4HAWA 4M1YA 2R8OA 1U7UA 2PCJA 4V1CB 1DAOA 1COWD 4PN3A 2PT7A 4RLHA 3OU6A 3GDFA 3W5HA 4DLNA 3CGWA 2XMGA 3H04A 3E22A 2P5SA 4J9ZB 4AWAA 5E9QA 1LPPA 1CY4A 2QTAA 2DJ5A 3C3AA 4JR1A 1CBUA 3AUSA 2A58A 3PTLA 1JDTA 1ZVKA 2VRCA 3CRRA 2J3HA 4FKBA 3AKYA 2ECQA 4F1JA 1ISHA 1WSBA 2NO6A 1ZZGA 2GRJA 4CUKA 2IW3A 5J5CA 1QDUA 1XOUA 3PXEA 4ETWA 4NTWA 4ZTUB 3MJSA 3WJ1A 4M9UA 5JMTA 1PJAA 2V58A 5F5XA 1KWGA 1A5ZA 3O8NA 1PNRA 1P1HA 1X1DA 2V7GA 3OQIA 2VK4A 3LLMA 4IO0A 1OROA 4YRRA 4B46A 3H1KH 5KVSA 4Z7OB 1UDBA 4F5WA 1Y7LA 1XTZA 2CHEA 4I0WB 2JGEA 2IU3A 1YR3A 3JVEA 3VR6D 5JC8A 2P40A 1YIAA 3CC2V 3GF4A