1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (carboxypeptidase)
molecule keywords SERINE CARBOXYPEPTIDASE
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
1QIJA 4H7JA 2JGKA 3BXPA 1DINA 1U65A 4UHHA 2O2IA 2XUQA 5FV4A 2EDAA 4J0HA 1C7IA 3BF8A 1DQZA 4ZV7A 3O95A 5A7FA 4FLMA 5AM2A 5LIPA 1P0IA 1W76A 4UBNA 2YYSA 3JWEA 5AOCA 4Y2JA 3IUMA 4QDZA 1ZJ5A 4Q82A 4EY4A 5BWCA 2WJ4A 3R3WA 1GXSA 4AB1A 3HLKA 3DL7A 2ORYA 2AJBA 3I1YA 3W9UA 4BTLA 5AKJA 2EDCA 1L7AA 1K5PA 2OAEA 2H7CA 2WFLB 2LIPA 4BVJA 5JAPA 4BCBA 4INZA 5ALNA 3VVMA 3WKDA 3BE8A 3VJLA 3C43A 4FTWA 5EHQA 3TGLA 3HABA 2B61A 2WJ3A 4F5ZA 1CUCA 1YA8A 2NW6A 3M83A 3HYSA 4Q3OA 3CN9A 2V9ZA 5CMLA 1UFOA 1CUVA 1R1DA 1CUUA 1CUSA 4N5IX 2XI4A 4BRZA 3E4DA 3QPDA 1BCSA 4OYLA 4Y2YA 5LYYA 2WKWA 3LLCA 3VJKA 2B4KA 1UOPA 4KE7A 1HKHA 2K2QB 3PFCA 5C8XA 3U0VA 1GKKA 1H2YA 3F8SA 3O0DA 1JI3A 2XQGA 2QXTA 3FNBA 3O4JA 5AKIA 3DKRA 4OB8A 3ZLTA 2JBWA 4EB0A 4KYVA 1E89A 1TAHA 1DQYA 3PI6A 1MNQA 3LCRA 4JYPA 3I6MA 2PM8A 3UUFA 4X92A 1XRRA 3AIKA 3M81A 5AK6A 3EF3A 4FBLA 3WZLA 3KDAA 4UBJA 2VJBA 1K63A 4QDXA 4WCVA 4C4YA 1A7UA 3JYHA 1IZ8A 4U2FA 2WFLA 4KRYA 5DTJA 5FRDA 4GHWA 2WM2A 4DYHA 1IUOA 3ZLUA 2ACEA 2XUHA 4EBBA 1JMYA 3I28A 5BV7A 2HA6A 1GGVA 4U2BA 4YASA 4ZXFA 3UMJA 1B41A 4ZV9A 3O4IA 2OGSA 4AMYA 2JEYA 3F9CA 4DMKA 3A2MA 3IUNA 1FJ2A 4W1QA 3WWCA 1YAJA 5AI6A 3VXKA 2XQJA 2E3JA 2HRRA 3F98A 4Y2VA 4PV7A 3KSRA 3H2KA 3I2IA 4FNGA 3F67A 2WG1A 4PSUA 3H1AA 4HRYA 4OU4A 2BFNA 3SC2A 4PSDA 4Q34A 5JD5A 5T4EA 5HKBA 3ANSA 5AH0A 4LKOA 5C8VA 3CN7A 1HPLA 3W2TA 5CW2A 5H3HA 1CPYA 3IDAA 4H0CA 2PVSA 1FSSA 3GFFA 2OCKA 5AI5A 3EQ8A 1XZKA 5AKYA 2XUDA 3C5VA 4KACA 4B82A 4P93A 4X6YA 3AFIA 2G4LA 2XUKA 4U2DA 4J3JA 3WJ2A 4UFPA 4HTAA 5DWDA 3K6KA 3V1MA 1UKCA 1BN7A 4V2IA 1JJFA 3DOHA 2DHDA 1ACLA 3O9VA 3H2JA 1VXRA 3VISA 1FFBA 1NU6A 2B9VA 3BIWA 4HXFB 5IH7A 3V1KA 4B9AA 4E14A 2WHRA 2XB6A 3HEAA 3FYUB 1QE3A 4J0JA 5AKGA 3C6ZA 1VLQA 3S8YA 1AGYA 3OOSA 3AJAA 2JEZA 2VA9A 4I3FA 1ACJA 4BVKA 1LNSA 3H17A 6YASA 5D3KA 1AX9A 4DMFA 4CFSA 4C4XA 4B84A 4B81A 1YASA 2PX6A 5CH3A 2PL5A 3OG9A 1LPBB 2CUTA 2WQZA 4J0GA 5ALDA 4BAZA 4Y2SA 5A7HA 4B80A 1MTZA 2EEPA 3V1NA 1J06A 4GDMA 3Q0TA 4GBGA 4Y2TA 1EDDA 1A8SA 3RARA 1QIHA 4MYDA 3A2LA 3H2HA 5HKAA 1SCQA 1QIMA 3WKCA 4CIBA 2HA0A 1CUWA 1SC9A 5AI8A 1ZIXA 5C8ZA 5HK8A 4X95A 1ZOIA 2WLSA 4UHCA 1O6FA 5JD6A 4Q05A 4KE8A 2GBGA 1ZD5A 4BDSA 3FLBA 3FCYA 5IVDA 3NUZA 2XMCA 3E0XA 5J3JA 2XUFA 3WK9A 5CT8A 3N2ZB 5JZBA 3CXUA 5IVIA 4MEAA 2ONCA 3ESAA 4B7ZA 1MT3A 5CURA 4BP8A 4I19A 1ORVA 5JASA 4P08A 1WCYA 4L72A 3FYUA 4QWWA 3VDXA 4C6HA 3QMVA 2AJCA 2VT6A 1SCKA 4PF1A 4J0CA 5EIEA 4TVKA 5JAHA 5EHZA 2VAXA 5JATA 1VE6A 1HL7A 1H22A 2WTMA 1T4MA 3O4GA 4M0EA 2FX5A 5FPQA 1WHTA 1W4LA 3LP5A 1CUDA 1KU6A 3R41A 1VZ3A 5ISMA 1LPMA 4DSZA 1SCIA 4BDTA 4EY8A 3FVRA 3FAKA 1DWOA 5ALXA 4UFOA 5AO9A 4IO0A 1LPOA 2FJPA 1IUPA 3MUOA 4UBOA 4AN0A 3WWEA 3X3HA 3G7NA 4G1FA 4U2GA 3H2IA 1UXOA 2FJ0A 5CTAA 3NOXA 2J4FA 3ESDA 3BJMA 2PU5A 4IH4A 1N8SA 5DNUA 4EY6A 4AZ3A 5JD4A 3WA7A 1GQRA 2ES4A 4E46A 4HVTA 5ALSA 4BRSA 5AIAA 3B12A 4GXNA 2D5LA 2QR5A 5AI0A 4DM7A 5JZSA 1THGA 1XFDA 1CUIA 3G9XA 3I6ZA 4EY5A 5KWJA 5LKAA 5EFZA 1QIGA 4UPDA 5IVHA 3WZMA 1GZ7A 3Q8WA 4FDMA 3GROA 1H2WA 3IUQA 1R88A 3WJ1A 4WFJA 5HQ3B 2PKYX 1AZWA 1IZ7A 1YSCA 2JGMA 3HI4A 4EUSA 3PUHA 3V48A 4Q1VA 4OB6A 2GBFA 4UUQA 2ZJ7A 1XQYA 4ZWNA 1XKLA 3BDIA 3DD5A 1LPNA 1Q0ZA 1QIFA 2XUOA 4DNOA 1Z68A 3ZLVA 1XRPA 4UFNA 3KD2A 2HA2A 4EA6A 3WWOA 3DDUA 1BRTA 5ALHA 5LZ2A 4JUIA 1CUHA 5KBYA 1DT3A 1H2ZA 2V97A 5ALWA 5FKJA 3W9BA 3AIMA 1CRLA 3IUJA 2C5FA 2DCMA 2BAGA 1VA4A 2ZYSA 2HU7A 4H7EA 5CH8A 1QTIA 1R3DA 4DNQA 4QZVA 2BKLA 4X97A 3H0CA 4MWSA 4OD0A 3QITA 2DSNA 2HFKA 3WKEA 1XLWA 1JT2A 2B20A 4Y2XA 5ALEA 3G0DA 4FHZA 1BE0A 4O08A 2ZJFA 1BEEA 2C0PA 3MVEA 1VKHA 2P8SA 1Y7IA 2C7BA 5DTIA 5EIAA 4C88A 2JIDA 1XZGA 4GEGA 2IIVA 1CUYA 3DKKA 3F97A 1XZJA 1TCBA 2G5TA 3T52A 5K5EA 1H2XA 3PDCA 4S0XA 1XZBA 1F0PA 4GI1A 1MX5A 5HQ3A 1IUNA 1YS2X 4BB0A 5JZ9A 4E15A 2WUEA 4ZREA 5AP9A 2QM0A 3WK4A 2VSQA 1UK6A 3BL8A 4P9NA 2HA7A 2AXEA 1A88A 1ORWA 1QTRA 4I4CA 4X90A 1JU4A 4L3WA 3H2GA 3L1HA 4GLBA 4KE9A 5SYMA 3M3DA 2Z3ZA 3LIIA 4DMCA 5HFAA 4LXIA 5AKKA 1WB5A 3K2IA 4ZRDA 3DL4A 2XMRA 3RKSA 3WQHA 5C81A 3IBTA 3M82A 5JARA 5E4JA 1LGYA 3L1IA 4XX1A 3I1IA 4J7AA 2VEOA 4MQLA 2QRUA 1CQWA 5FDFA 5FUMA 1IMJA 2OAGA 3KWFA 4YPVA 2BUBA 3ANTA 1F0NA 4U2EA 4AXBA 3WKAA 4HXGA 4BE4A 1F6WA 3IA2A 4G8DA 1ZGCA 2Z8XA 2ZYRA 3KOOA 4QNNA 2HU8A 4X3CA 4ZI5A 5EHNA 5A7GA 1SOMA 3GUUA 1C4XA 3WIBA 1LPAB 5EIHA 4XJVA 4JH0A 1DU4A 3A70A 3GA7A 4CCWA 4NS4A 4BZZA 1MAHA 2DHEA 1L7QA 3FYUC 4H7IA 4Y2PA 3PE6A 2JGIA 4BYMA 2XUGA 2JGJA 1WOMA 1Y7HA 4W1RA 4AO6A 3CCBA 3STTA 3H1BA 4WFIA 3WMRA 3C6YA 1EVQA 2DHCA 1DTEA 5LZ5A 3WL7A 2QT9A 4Y2RA 4WY8A 4A5SA 4G8BA 3K9BA 5AM0A 1LZLA 3CCCA 1TCCA 2WFMA 5ALPA 1PV1A 1EDEA 5ALUA 5SYNA 1BN6A 2Q0XA 4FNMA 1VXOA 2DQZA 1MX9A 1EA5A 4QDUA 4DIUA 2BUCA 1CUFA 1MNAA 3HXKA 1C7JA 4RE5A 1J2EA 4EHBA 4G4GA 5HF5A 1USWA 5HZGA 2Y2VA 1KU0A 2ECFA 2DR0A 1YB7A 3D3NA 5ALJA 1XKTA 2Z5GA 4G4JA 5K3CA 5EGNA 1EB8A 1FFAA 2BGRA 2Z3WA 1XQVA 4A16A 3I2KA 2X76A 2CJPA 5JAOA 2XMZA 2XUPA 3LS2A 4KAFA 2JF0A 3G9TA 4X71A 2XMGA 4HAIA 3BDVA 3P2MA 5AKLA 5BOVA 4N8SA 1WB6A 5E2IA 3AINA 1XZEA 1DX6A 4DLNA 5C7YA 3OC0A 1RWQA 4N8DA 3QPCA 5T4BA 4DGQA 4B6GA 1JU3A 3WL8A 2PUJA 4JNCA 4OYYA 5AOBA 2FUKA 3DYIA 4G8CA 3D7RA 4PSCA 2Y2UA 4MQMA 3YASA 4Y2QA 3D4LA 3KWJA 2OXEA 1YA4A 2XMQA 5E4TA 2C4HA 1VJ5A 3HRHA 3DJYA 2ZSHA 2JGEA 3ICWA 4FFVA 2RIPA 2PBLA 5ALRA 2GYWA 1XROA 4Q3LA 1LPSA 4J0KA 3PUIA 5LP1A 3I6YA 5AM4A 3EQ9A 3D5EA 3TJMA 1EINA 5CRIA 3E3AA 3HZOA 2WIDA 4L9AA 5A6VA 3WYNA 1G5FA 2XUIA 2QMQA 2R8BA 3DLTA 4HRXA 1X2EA 5LLSA 2ZYIA 4H7FA 2PSFA 2HA5A 3ILSA 1NX9A 5ALIA 3B3QA 1HDEA 3WL5A 2O7RA 3PF8A 2WU4A 3AIOA 1CFJA 5HK9A 1W75A 3QMMA 4RE6A 2GBCA 4Y9SA 2VTVA 4W1PA 5JYCA 2YH2A 2QVBA 2HDWA 2OCLA 1TQHA 3RM3A 4Q3KA 2WG2A 3ZV7A 3PFBA 1UOQA 1WM1A 1R9NA 2XUJA 3QYJA 4N5HX 4AX4A 5DJ5A 1J07A 1B6GA 4DTCA 1UKBA 2HA3A 4NVRA 2HFJA 2RGUA 5JALA 1GPKA 2IX9A 3WLAA 4B9EA 4KEAA 1XZLA 1XRMA 3OURA 1UKAA 4OCZA 2JGLA 3OTQA 3IVMA 3ZI7A 4AMZA 4CCYA 1Y37A 3A2NA 5DYTA 5FPPA 3I2FA 5CT9A 4U2CA 4RGYA 4GW3A 5I9IA 4C89A 2QOEA 1CEXA 3G9UA 4UBMA 3STVA 3QZUA 2GYUA 4IH1A 4HS9A 3NWOA 3AZPA 5LKRA 4BBZA 5JAUA 4CI9A 4DNPA 2C0QA 3QVMA 4MXDA 4UHFA 3ZPXA 4XVCA 2XQFA 4G9GA 4G4IA 1N5MA 1Q83A 5DLPA 3C6XA 5D3ZA 1GQSA 5D7BA 2X5XA 5HCUA 1QO9A 4QA9A 4FKBA 5HF6A 4TGLA 2CBGA 4W1SA 5ALOA 1DWQA 2WJ6A 1XRLA 3SX4A 4X7BA 4UHDA 2PSEA 2OQIA 1G4HA 2WIFA 1TCAA 3C45A 1GPNA 4PO3X 2WILA 2W6CX 4KRXA 2RAUA 4QDOA 3WK6A 5CT5A 2BCEA 3G02A 3BWXA 4W9RA 3FCXA 4OUKX 5CXXA 5LZ7A 2ZVDA 4NZZA 2D0DA 4A23A 4CG3A 3VKFA 4K6GA 1BEZA 4HZGA 3WWPA 1LBTA 3LIPA 3JW8A 3DYVA 5AK5A 3QH4A 3OPMA 3TEJA 4EY7A 1UK7A 4C87A 3DS8A 2IITA 2O7VA 1VA5A 2GYVA 4KR0A 1W6RA 1HLGA 4WJLA 5T4FA 5AJHA 5CXUA 4F0JA 1THTA 5AICA 3HACA 4F21A 4GWLA 4BC1A 4B0OA 1RP1A 4IHAA 3BJRA 3I2HA 3O4HA 2V98A 4H77A 5AK3A 1JFRA 1MPXA 4Y2UA 3IURA 3QMWA 2ZSIA 5JADA 3FOBA 3G8YA 2XLBA 4Y7DA 3W04A 4LIPD 4CG2A 1F8UA 1ZD2P 2ROQA 3G0GA 4D9JA 3D0KA 1BS9A 3IULA 4K5QA 1UK8A 4X93A 4BTVA 1N1MA 4K6HA 1QOZA 1UOOA 1I6WA 4H7DA 2HHAA 4DSAA 2QS9A 4M0FA 2Y1KA 3R3VA 1T2NA 1J1IA 3SWWA 3VVLA 2ACKA 5CT6A 3DOIA 4MEBA 3A6ZA 1CLEA 2BGNA 2OG1A 2J3DA 1AUOA 4FLFA 3FYTA 5A62A 5JANA 1ZD4A 1ZD3A 4KJXA 1ISPA 3H04A 3S2ZA 5I8PA 5K3FB 3WK5A 3STXA 3D59A 1CUJA 3AILA 5CBKA 1A8UA 1Q0RA 5ESRA 1EDBA 1XZMA 4BZWA 2DFPA 1U4NA 3C70A 3STUA 7YASA 3D2CA 3G0BA 2QZPA 3AUKA 4QLAA 3W05A 3R3UA 4DMHA 4AQDA 5BWBA 2VJAA 1JMKC 5IKXA 4YK7A 5ALQA 4G9EA 2JGFA 4PW0A 1EK1A 3WK7A 2HADA 3WYDA 3BF7A 5ALKA 2WHQA 2WUGA 1JKMA 4CIAA 1MAAA 4UBLA 2OPHA 1NU8A 2OGZA 4KAJA 1LBSA 1E8NA 4ARAA 3FVTA 4L0CA 2OQVA 1CVLA 2R11A 3WL6A 1KEZA 3V1LA 2HIHA 4IH9A 4P92A 2QUAA 3UUEA 1TKRA 2Y6UA 5AIBA 1MN6A 5K3EA 1TK3A 2VJDA 2WHPB 2I03A 4BP9A 3F96A 2OGTA 2VF2A 3TRDA 2XUAA 4YX9A 4TPKA 3ICVA 1QZ3A 5K3FA 2I78A 4K6KA 5AM1A 2QJWA 1LLFA 3AZQA 3C8HA 5AM5A 2XE4A 2VT7A 1HBJA 3FLAA 1GKLA 2O2GA 1U8EA 4HXEB 1QJ4A 2WUFA 2CZQA 2HA4A 1VE7A 1ODSA 4ETWA 1JJIA 2HRQA 1WPRA 2GZSA 3EIOA 3BIXA 2XT0A 2G63A 5E4YA 3R3XA 1XRQA 3STWA 3H18A 2HU5A 3RLIA 2H7XA 2WG0A 3WIOA 4FMPA 5CT4A 5AK4A 1CR6A 5EI5A 1P0PA 4AO8A 1MX1A 3W06A 4AN1A 4LYDA 1LZKA 4WY5A 3PICA 2QTBA 3HC7A 4N8EA 1ODCA 1ZICA 5HF9A 4LHEA 2UZ0A 2BJHA 1E8DA 1IVYA 3V9AA 2HM7A 2DQYA 1XZHA 5HF8A 3VJMA 5HFNA 1ZI8A 1BCRA 2WHPA 5FOQA 1QFSA 1AKNA 3ZWQA 4CG1A 1AQLA 2YXPX 3GELA 1VOTA 4X91A 1UZAA 5AHXA 4AO7A 3H19A 1EH5A 2RHTA 2WIJA 4JYMA 1UK9A 5AM3A 1FFEA 3DCNA 1E8MA 4FWBA 3AZOA 2W22A 5IVKA 4K2AA 3WA6A 1EVEA 1AC5A 2J4CA 3R0VA 3QPAA 2RHWA 1QIIA 1EB9A 4XIIA 1YS1X 1DT5A 4PNZA 1N5RA 5AI4A 1O6GA 3C5WP 4QDTA 2VQ6A 2H7YA 3IIIA 2OLEA 2J3QA 4OU5A 4W63A 4H35A 4JEIA 3KXPA 4QLOA 4CCYB 3ED1A 4MJ3A 5AKEA 2XMSA 5DNVA 2OCIA 1YR2A 1XZAA 4BC0A 1MO2A 3R3YA 3C8DA 5LZ9A 3STYA 2GZRA 3FBWA 1ZI6A 3QBJA 5FXMA 3U1TA 1U2EA 2WTNA 4OPMA 4WDRA 3PF9A 1TRHA 1CQZA 1UWCA 2XQIA 5YASA 1HQDA 1W1IA 1P0QA 3GZJA 1G42A 5AKZA 1BU8A 1K6EA 1QIEA 4UHEA 1BROA 1W52X 3B5EA 3FSGD 1H23A 3G9ZA 2C5GA 5A71A 4DNFA 3R40A 1E3QA 4H7HA 1QIDA 5DNWA 1XQWA 1EXWA 4J0IA 4MWTA 4B85A 3RK4A 1ZGBA 4BAUA 3I2GA 1LPPA 2CB9A 2VAVA 5ALLA 1CUAA 2WUDA 3NGMA 4QWMA 2WIKA 3WK8A 2WU3A 5ALMA 2BUAA 2PU7A 3WI7A 2PSJA 4FFWA 4EZIA 3DQZA 3FWHA 4ITVA 2CEKA 2PSHA 1XZCA 2AJ8A 1QFMA 2RONA 1XRNA 4B0PA 2ZJ6A 1QLWA 4GECA 4F60A 3O9MA 4RPCA 1P0MA 5FP0A 1PFQA 3MGAA 1RYYA 3HSSA 4C4ZA 1A8QA 2QJRA 3I2JA 5K3AA 4J03A 2XMDA 1D07A 4MYSA 3G0CA 4WFKA 1EHYA 1XZDA 4C01A 1DX4A 1OCEA 3HJUA 3C87A 2PPLA 1UT6A 5LZ8A 1FFCA 1AMNA 1MJ5A 2QUBA 4OB7A 1YCDA 1EX9A 2CMFA 3FLEA 5ALZA 1WPXA 4J0DA 2O2HA 2Y6VA 4BCCA 3R3ZA 1ZIYA 2H1IA 1ZJ4A 2OCGA 1FFDA 5EHXA 1GPLA 4X85A 3DEAA 3GBSA 5AI9A 4LXHA 3DNMA 5AKHA 2PSDA 1QO7A 4LXGA 5D6OA 3E1GA 1JJBA 4BE9A 1XZFA 1X2BA 3FSGA 3QM1A 1YB6A 1ODTC 1R4ZA 3EQ7A 2G5PA 5AOAA 5KREA 1GT6A 4BCDA 2X8BA 5A2GA 5AKXA 4FOLA 4ARBA 1CUBA 4OSEA 1WB4A 4NMWA 1CUXA 5CH5A 1XQXA 3L1JA 2RI6A 1DWPA 2XQKA 2Z8ZA 2ZYHA 5I7UA 2HL6A 2C58A 5LZ4A 1ZI9A 4KE6A 4BVLA 1EK2A 2WSLA 3G0IA 1WHSA 1SFRA 1G66A 1CUZA 3ESBA 5DYYA 2I3DA 4X00A 3SK0A 5ALVA 1VZ2A 3D2AA 4ROTA 1PJAA 2QKYA 4KAAA 2XLCA 1QONA 1XZIA 2WFZA 5K3DA 1CUEA 5ALFA 5FLKA 4LYEA 2XDWA 1YAHA 3OM8A 4UBKA 1CIJA 4X6XA 4WDQA 1MU0A 3WWDA 4X6UA 1K4YA 1S8OA 4BAGA 1TIBA 4H18A 1XLUA 4FLEA 5JIBA 4IQ4A 3MUNA 2V96A 4QEKA 3WKBA 1M33A 2WIGA 1AURA 5ALTA 4M0MA 4QE3A 5ALGA 2QXUA 1OXMA 4FBMA 5ALYA 1E5TA 1ETHA 4BATA 5K3BA 4PQEA 4XWGA 2AJLI 4E11A 3T4UA 5KWIA 3ESCA 2AJDA 1L7RA 1QGED 3IB3A 3C6BA 4RNCA 4H7KA 4X94A 1EI9A 2GBIA 2H9YA 1QIKA 4G5XA 2XMBA 1E66A 2PUHA 1Q84A 2I3ZA 1K8QA 3D2BA 4UBIA 4AZ0A 1OILA 5DYWA 1R50A 1R9MA 3N0TA 3EBLA 4ZGBA 1XLVA 1CUGA 2VATA 2YASA 4Z49A 5T4HA 2VJCA 1X70A 5F4ZA 4B83A 2CKMA 1CV2A 4UHBA
chains in the Genus database with same CATH superfamily
4GP9A 4B7CA 1XVIA 5H4HA 2XUQA 4CM4B 3O94A 1JFSA 5A0VA 3PDIB 3K0AA 1OX5A 2PJUA 3GP8A 4WFFA 1P0IA 1JX6A 3VNBA 1VE1A 2FFAA 4G0ZA 3RE1A 3SBOA 3FGZA 1YXBA 4EGSA 4Q82A 2VRZA 1AY0A 1I4LD 1F4VA 2G08A 1ZVKA 4OK6A 2KHZA 3U62A 4BTLA 2X7HA 2W8ZA 2WNSA 2A06H 4WZAA 2FOXA 2VTKA 3IAFA 3FG9A 2PL1A 3OEEA 3RIXA 1EKXA 4LOAA 3DEIA 3MGBA 1DXHA 2PL3A 2IJHA 2V9ZA 3GMIA 2JCSA 4HNAB 3T3HA 2OENG 2B69A 4GYYA 3Q2IA 2G1UA 1KVTA 2QVXX 3G2KA 4ODIA 1NSTA 3PFCA 2GEBA 3BERA 4KYTA 4G5QA 2O8EA 1OCCC 2IW5A 2A33A 1QGUA 1RM0A 3O4JA 3ZLTA 2XXAB 1TAHA 1MNQA 3U26A 4QKQA 1ECJA 3ROZA 1XJWA 2C8JA 1XN1A 3PNOA 1M90W 1RI1A 1SB9A 3TOVA 1A0OA 3H97A 4WCVA 4KOAA 3GLTA 1DBQA 3ABMB 1YK1A 1ZJWA 1Q17A 1GU7A 1UPUA 4X7MA 2WKPA 9GPBA 1F9AA 2GKSA 3PFNA 1OXBB 1EZVH 3B3FA 1H2HA 1NVKA 3QUSA 1I1HA 5KNLA 5BR4A 1VB5A 3SAJA 5I4IA 3L6RA 4LE0A 1RFLA 1S3GA 2OSBA 4M21A 4UVBA 2F7SA 3WWCA 2JI9A 2XWJI 2QRMA 4OBBA 4LH6A 2NPOA 2Q0SA 2XQJA 4BASA 1P0FA 1LLDA 4HNTA 1ESZA 1OGIA 1G2QA 2F8LA 1H0HA 2WG1A 3DKPA 1SKYE 1AKQA 2CCJA 3KL4A 4ACBA 4NXMB 5JD5A 2A1IA 4P4TA 2WJWA 3ANSA 4KO4S 1B7GO 4LX8A 1GZ5A 1M0WA 1HE8B 1HE2A 4QARA 4QJ3A 1NWHA 5AI5A 3CO0S 4D9KA 1YO6A 3E7DA 5HA5A 4MDFA 4ESVA 3U80A 2R4UA 1UP6A 3QXHA 2GTAA 5C3MA 2FW0A 2CMDA 4WBSA 2VJMA 2CUGA 5JBQA 1M2OB 1D0SA 2YXHA 1VXRA 4UVAA 3CCLV 4UM5A 3T5MA 2W43A 3A26A 4MVSA 3R09A 1LEHA 2H5LA 4BQOA 4JXJA 2NU8A 5LIRA 1LNSA 4JT2A 1AX9A 1FFHA 3MB5A 3UCSC 2V3VA 3WDKA 2Q68A 3HWWA 1IYZA 4IPTA 2CUTA 4BO3A 2WQZA 1WW2A 4Y2SA 2YUTA 2O54A 3B09A 3F71A 3ZDFA 5DN6A 4NXMO 5BVHB 1IX9A 4XVRA 3W4JA 4ZVLA 4IUBS 1E1KA 4BO6A 4WBNF 1ISJA 5DBHX 1NM5A 2HREA 2OQ2A 4JJIA 3ZVRA 1WBDA 3JVIA 2IXBA 5FWDA 3UK1A 1EUQA 4TTVA 5KJ6A 4R2KA 1G2PA 3A7EA 1U0FA 4EJ0A 3MDSA 3P19A 1Q16A 3H86A 4TWRA 3SYKA 1Z6GA 4P08A 4PN7A 2XBMA 3L07A 4NBSA 4C6HA 4RUKA 1N5KA 1K27A 1ISGA 4PF1A 4J0CA 4WNIA 3EZ2A 5JAHA 4H3VA 2GPWA 1YJBA 1GGMA 1SC6A 4ZI7A 4RK0A 4ZDKA 1H22A 4MV3A 4JJGA 4C14A 2QSUA 1ZHOA 3B13B 1VZ3A 1LPMA 4FZ1A 1SCIA 5J40A 3W5SA 1WMAA 3TIFA 1DCMA 1PZNA 3MUOA 4UV9A 2Y1EA 4AN0A 1RYDA 3D6JA 2ZI9A 3B8MA 1VCIA 4DQLA 4JNKA 5JD4A 4URHA 3UT0A 4DHEA 5LP6F 4UCXA 5G3YA 5ALSA 4OAOA 4KL8S 2WUVA 3D43A 2EFEB 2VCHA 3E81A 2MINB 1WP7A 4ML3A 1QPBA 3Q87B 1CK4A 4OXQA 1EDOA 1HLDA 1PEYA 2GFQA 1S5JA 4PCUA 4MYTA 3KPUA 1SCAA 5IVHA 1DQSA 1HYGA 3TH5A 1ZMXA 5EK0A 1BYIA 1DAEA 5G53C 3KT0A 3RJZA 3V48A 1E3MA 1A7KA 1X94A 3BDIA 4Q3CA 3QLEA 4FE3A 4FILA 4M7RA 3BCCH 3OPQA 4TTTS 4MR8B 3AQ4A 5DP1A 1SVSA 3WWOA 2DSTA 1T8TA 3BX1A 1H2ZA 3GFOA 4ITRC 4UARA 3QU5A 5KHJA 2QVYX 2QTRA 3R1IA 5FOWA 4EF4A 1TB4A 2ZYSA 3HVIA 2PXAA 4XFKA 3ABUA 3OMAB 4IQGA 4K7JA 4KPEC 4R01A 3AG2C 4HDMA 3CQ9A 2NTEA 1DO0A 3FMIA 5LBIA 2O8EB 3WDMA 2P8SA 4UCQA 1DQPA 1QGUB 1KBHA 4XEHA 1KD1W 5KTKA 1C8VB 3RVNA 3ZU4A 5K5EA 1JQJC 4A0RA 4JP8A 1S3FA 3PDJA 1VKJA 1AS3A 3RN4A 3N2KB 3GLHA 5I9SA 4BB0A 1S0UA 1JR9A 2Q69A 1UP4A 1PD1A 3ABLB 2BR4A 4I7EA 4FCWA 3AI3A 3ABKB 4JOCA 3PR2B 4YJ2B 2R6HA 4OHXA 1BHSA 3EVCA 4JOBA 4UPEA 4KE9A 4WKNA 3DH0A 5KYUB 2OCCB 3P4YA 1B0PA 4CG0A 1MF7A 1ZEMA 3ZX6A 4PYOA 2UZ1A 4HZUA 1Q7CA 5E4JA 3DTUB 3L1IA 2Q73A 1ULTA 4K81B 2DAPA 5BMOA 4CTMA 1U2TA 1IMJA 3R20A 1E79A 4U3JB 1WMBA 2OYSA 1JSZA 2WKQA 3U4IA 5BVGB 1AU9A 4ZCMA 1WMSA 3CFYA 2R62A 5CEEA 2JKVA 3K2BA 2XA2A 2ZT7A 3MJHA 3OWXA 4JH0A 1W36D 4DWOA 4W7SA 2CMHA 5FOXA 2PBRA 1CP2A 2VK1A 3OMIB 3PE6A 5CBGA 4MAAA 3F1KA 3EAGA 4H59A 1NTZH 1QYRA 2BGUA 2PYIA 3C3TA 4AF6A 2DHCA 4CC6A 2VJMB 4PYLA 3OM3B 1MJFA 3WYAA 3B1VA 4D6YA 4R05A 1JDBC 3EWIA 4C4AA 4BBAA 3COZA 2PRZA 2VDUE 2Q0XA 5DOZA 2WB2A 5JW6A 1ADGA 3ICQB 1EA5A 2R68A 2ZJYA 3WGYA 5EZYB 2OK8A 5ECDA 1VARA 3O4VA 4D9EA 2G9QA 3ETDA 2OM6A 2XXBA 4WZBA 2PKCA 4W5JA 4I50F 4FYXA 2AG8A 3F7YC 3WNVA 5LB2A 1RRPA 1NI5A 2XUPA 3VSBA 4PZAA 2JLSA 1J5EO 4GVXA 4E4TA 5JCOA 2OWEA 5DZSA 1GM7A 3P0HA 1C9JA 3TBKA 3ICXA 3T7IA 3B1FA 3DDOA 1H8HA 3THXA 3RV4A 3T1HB 1N25A 4FKMA 3U7HB 4Z4IA 2J0SA 4IGGA 1CLUA 1WWKA 2XMQA 2CK3A 2C7RA 2WKSA 2ODPA 2XITA 3HTXA 4O4HF 4OFZA 3DJYA 5IF3A 3DLAA 1UCFA 5ALRA 4AFNA 1NMXA 3VTKA 2Y0BA 2X77A 5I7VA 4AN4A 3NDBB 2FEPA 4URUR 1I24A 3EIFA 2NXWA 1JQDA 2DUUA 4MW9A 1KQFA 3I01A 3S3XA 2W83A 4PZ0A 3SJZA 4MTFA 2GEUA 2ZYVX 3TNJA 3AVXA 4HRXA 1HH4A 2VS0A 3M1LA 3CW9A 2WSSA 3RSSA 2GHIA 1NX9A 1L1QA 4LHXA 1KC1A 3H01A 2PS1A 4ZCSA 4PEVA 4RFVA 2AS0A 3AK1A 1GL3A 1ULSA 3LWDA 3FKSG 1KSHA 1P0CA 1VCOA 2WSMA 2Q3LA 1NYLA 1P1HA 2XUJA 3HB1A 3QA9A 1GJRA 4FYWA 3R7AA 2ZIOA 1QAMA 4DCNA 3T1HO 2G25A 4OMUA 3IVMA 4HSGA 3A6HA 5IXYA 1L5MA 1CG6A 1N9GB 1RKXA 4XYBA 1ZC3A 2DUWA 3I01M 1PR0A 5JWRA 3NWOA 4FZ5A 4XGNA 4BBZA 1QR8A 1FF9A 2RHRA 2ZATA 4CI9A 1IIRA 2C0QA 1G8PA 4IWXA 2LBPA 1H6AA 1GQSA 5ANRB 2Q5FA 4XIGS 2WJ6A 3HWRA 1VM6A 1IHXA 4PO3X 4G5HA 4KRXA 3JD4A 3A9RA 2RK3A 3G02A 4W9RA 3FCXA 1JMVA 1Z35A 4OUKX 3NORA 2FG6C 2QI9C 4H2DA 3LDEA 2AR7A 3BAFA 3FFWA 3G85A 4EY7A 3DS8A 3JQEA 3SX0A 2CH7B 1HDOA 5IAEA 3OEEG 4ES6A 3OZUA 1O97D 2VBIA 1Y6ZA 1D9XA 4E31A 2G6BA 2EC5A 4HRVA 3NU1A 3GLHB 3ZDCA 3WLFA 2PGOA 1GN9A 4LF8B 4PPGA 4C0LA 3F7TA 1S5LZ 2BEWB 3D02A 1D6MA 2GAIA 3OWHA 2FKNA 1N2CE 1W0KD 2NNWB 3PXEA 3L0IB 3OSZA 3ZWPA 5IP5A 2CVFA 4PG4A 5EP4A 3J7TA 4JB2A 2WICA 4R81A 1V8OA 3NH6A 1U1GA 3VU3A 4HZUB 5IDXA 4WOKA 1G20E 4LGVA 1FFXA 2VQFB 5DBGA 1R0CA 3KQOA 1JLMA 2J3DA 1KJYA 2W11A 4TM8A 1OCZB 1JLHA 1V45E 3ZG6A 3LOQA 5JO9A 4Q9KA 2JVKA 2ZUBA 1Q0RA 4MKXA 2B37A 1ZDMA 3K9QO 1B1CA 4G23A 3G0BA 4OK5A 4WHMA 4BKQA 1OLXB 2M1ZA 4CH3A 4UD6A 3UHJA 2XSZD 4O3MA 3TQSA 5JEEA 2BH9A 5DX8A 1ST3A 4LF8O 4QVGA 2QTHA 5KUKA 4ISCA 2XEDA 3KU4A 1Z2NX 4FC7A 1W2HA 2LKCA 1M0TA 2JFYA 4KXNA 3QVLA 4OXXA 1QGZA 2UAGA 1N7GA 1AS0A 3OE7D 2OQVA 3CC7V 1RJ9A 2QNIA 5AJZA 2GF2A 4UCOA 3BIJA 5HZKA 3UH1A 2VQFO 3R7FA 4PHCA 3QLUC 5HKKA 2V4UA 1YZYA 3CH7A 2NP6A 2R9VA 1EX6A 3R74A 1CRWG 2EBOA 4U3FH 2GPAA 1L8XA 3GFRA 1NP3A 4X9XA 3ANXA 5EMMA 1O4VA 4NMXB 1ODSA 4ETWA 4MVCA 1B73A 1NW8A 4AKEA 3WLKX 5EC1C 4YFVA 5IYCO 5JSKA 3SIPA 4NAUA 3CVJA 1KDTA 4K1XA 1NULA 4W9NC 2UUAB 2PVPA 5AUOB 2OO5C 2C97A 3BTVA 3DBRB 2WG0A 2QUHA 3V3KA 3DC6A 1RBQA 5AYVA 3ROPA 1E3EA 2VPPA 1IAVA 2ZI3A 3HCRA 4DCUA 3AJ9A 4K9OA 5DN6G 1BQZA 3RSGA 1SETA 4HBNA 4YMSA 4F6RB 1DP4A 3EDOA 1B6TA 2C7PA 2C2WA 4LYYA 1DQRA 3V9AA 2DQYA 4DFDA 1IM5A 1G3MA 4FD2A 4JX9A 2Q6IA 1DAPA 1VOTA 1OT3A 2IH5A 5DM0A 4LF5B 2CLSA 3L84A 3CXHF 2RQ6A 4TS9A 1KXZA 3P7MA 1QB7A 3NDIA 3HO8A 2QSAA 3C3DA 3IUBA 2Z1NA 4NLLA 5KQRA 4CV0A 3QSGA 2KB0A 2GM4A 3K08A 3EPPA 2ERXA 3IKMB 3TCKA 4BYGA 4LFCB 4L07A 4HAUA 2FWMX 4FINA 1FUYB 2WAAA 4OXRA 3IDZA 3IC7A 4EZEA 2UUAO 3ZTWA 2YYZA 5CMUA 2YZ2A 3T34A 1FDSA 1U4SA 1MVLA 1CY0A 3CA8A 1O0SA 4MSWC 2FJUA 3RFUA 3S99A 2D2XA 5FXMA 2WTNA 5E7QA 2ZI7A 2V65A 1Y7TA 2IELA 3IEVA 1A69A 1KB9F 2GRAA 1BMDA 3GZJA 2D2IA 3ND8A 3ISJA 4JZ2A 1WS6A 3T3DA 1WPQA 1PLLA 4GEKA 2WWYA 4F97A 4GX0A 4QASA 1TT7A 3GAAA 4RKQA 5BQPA 3X2QC 4R8CA 4P80A 1LW7A 4OKIA 4RPGA 1UIRA 3ILXA 4BNDB 3ZHXA 1ITZA 4MHSA 1J99A 4F93B 2E48A 2FYUH 1E5DA 3ZHQA 4MVWA 2PYZA 4B87A 4IAOA 3DEKA 4LFCO 2ZJ6A 3ZEAA 2JJQA 4F60A 4DLVA 2EZOA 2JGAA 4MS3A 2QW0X 1RWNA 1L5HB 3CR3C 2R7LA 4WFAV 4DDKA 3G0CA 1EHYA 3OF2A 4C01A 5EZ6B 3AERB 1XPRA 1VIBA 1FFCA 4AUMA 5CK5A 4AG3A 2IL1A 3QELA 3R7LA 1DF4A 2K87A 2OGWA 3F6EX 2LJ2A 5D3MA 5FBKA 4EQZA 5EHXA 3F5DA 1JXAA 4WBNA 2QTZA 1Z83A 1YDFA 1LC0A 1NC3A 2HKIA 3P9ZA 3W90A 3ZCQA 2VDQB 2QUKA 3KETA 1MGPA 3OKFA 1VIAA 4X44A 1K0UA 2P6OA 3MOIA 1R4ZA 3EQ7A 4BCDA 3O8RA 1MMMA 1CUBA 4YMIA 1FFXB 1F1BA 2WWGA 3MXOA 5TGTA 1EVIA 1WF3A 4HXYA 3OOHA 4ED9A 2KE5A 5I7UA 2BGTA 1JHRA 2HMWA 2GMWA 1XKQA 5ELLA 3JALA 1RM1C 1K86A 3UQ8A 1VQ6V 1CUZA 1E4EB 3MCTA 1OREA 1VP9A 1NMEA 2HBZA 2XA9A 5K3DA 4AKTA 3FYSA 3W77A 1M6VB 4EA7A 1CUEA 2C2AA 4P1ZA 1ZKDA 2VQEB 3K06A 2H65A 3T7RA 4CMHA 1GPDG 1S8OA 1ZR4A 5CAEB 1DC4A 1HMYA 4O1IA 4WINA 2YHSA 4QE3A 4CEHA 5LP6A 2AMFA 3LHIA 2DC1A 5ALYA 2YCBA 2FPGA 3EVAA 2NAPA 3HEMA 3CEMA 3EEBA 4HQFA 1KPHA 1K8ZB 4UUMA 1RXVA 3R7SA 1T9GS 2B8TA 4ZO8A 2WSBA 2JLZA 4Z4EA 4WNAA 4RJKA 1B8OA 1OSNA 5JJJB 3GZNA 3PTAA 3IEKA 4ZGBA 5L3RA 4OHFA 4KLCA 1V5FA 3RSLA 3TXAA 1DKLA 5CLGA 2VCEA 4Q03A 1DG9A 2DTXA 1N6NA 1T3LA 2PX4A 1ZUNA 4WVLA 2EDAA 1C7IA 4EATA 2CNWD 1IB6A 2CFRA 1VMDA 4M0KA 5KAFZ 3AWIA 2IYNA 1XQ8A 3TPCA 5B7QA 2D3WA 2ORYA 3ZHOA 4DV0O 4FSHA 4TMFA 1B3RA 4R68A 1LTHR 1KKCA 2LIPA 3WAGA 1CULC 3CF4G 4U0JA 2PGXA 4MWZA 2B61A 3MWKA 4J9UE 4FMCB 1DIAA 4WK6A 3CW2A 3ZU5A 1CERA 1RRCA 1ZLYA 3TG8A 3W3AD 4BQIA 5LXTF 5IHXA 5FNVB 4LXXA 2ZPUA 3WLLA 1MC5A 2L42A 4UZEA 3ZDDA 1H8HG 2IJKA 2Z9BA 3UM9A 5EKUA 1YRQA 2GCIA 2QR4A 2BDTA 3G2PA 4HNSA 4JKOA 3VJKA 1GAXA 3E9CA 4H3SA 2EFCB 1OOEA 1IPEA 3IILA 3KQNA 2H59A 1UJ2A 2F93B 4KYVA 3BL5A 3JSXA 4D4JA 4WLEA 1MGOA 5BPFA 3T3EA 3LCRA 1QR6A 2C54A 2I76A 2NLOA 3HB3B 4FW8A 3M81A 1R6VA 3OQPA 4JQYA 2FPPB 3KQYA 1NVVR 1DJPA 5BQOA 1X1RA 3GK3A 2G3YA 1QANA 2WFLA 3BFKA 3O8CA 2PKRA 4TV9A 2WM2A 2LVBA 1LC3A 3PD1A 2X86A 1L5NA 1UZNA 2UVQA 2I87A 1MEOA 3GUVA 3L18A 1ZCZA 2YDXA 1JIUA 3DE3X 2C3PA 2ZAOA 3KEGA 3C85A 2YRWA 4OGWA 1ZCBA 2RH8A 1DIBA 1HI9A 4RKFA 4PRYA 4NS1A 4E09A 3VA7A 3PHJA 3BGDA 4F5WA 3HKEB 1G8HA 4OTZA 5FBRB 1YQEA 3DFIA 1F5SA 3JARB 5T4EA 1LDGA 4IZHA 3U4MA 1Z8DA 1V8FA 2IBZH 3W2TA 1YB1A 5CW2A 1SXHA 3R65A 4G1BA 2NYVA 4X1IB 1T8WA 1H2FA 1XC7A 4FFRA 1VE9A 3EQ8A 4RA9A 1UBUS 4ZK6A 3RANA 4YXFA 5LQUA 3U5ZB 3V1MA 3GP5A 1UKCA 4CU2A 8ABPA 1K5QA 3MTDA 1WP9A 4FJ0A 1GZ3A 3DAGA 2B9VA 1KSJA 4B9AA 4E14A 3AVUA 1XTJA 5ESXA 1BH2A 3SN6A 4JELA 4V0QA 1C1XA 5FOVA 4EKDA 3LTEA 1GCIA 3IODA 6YASA 1X7GA 5E95A 1PZHA 2CCGA 4B84A 5LQDA 4B81A 1YASA 4Z1MD 1U28A 3GWGA 3EWSA 2RH4A 1SCBA 1TT5A 5A7HA 3PYXA 2GTPA 4ENPA 1FXKA 3V1NA 3Q4HA 4JDPA 5DHSA 3ZMZA 3LUAA 3RYFA 3PQ4A 4LS3A 4MYDA 3H2HA 3JQ9C 3GFBA 1EG7A 3MHSC 3LXMA 4KIWA 2P6PA 3A25A 2BOVA 1T8YA 1II0A 1MXHA 1O6FA 3CISA 5GWXA 3UTDA 2R2AA 1P4AA 5DT2A 1LUAA 4BDSA 2ZP1A 5IVDA 3IQZA 4XSVA 4KITB 4PG5A 4E5VA 4OBXA 4U8HA 5BQ5A 3M6WA 1LUWA 1GKUB 5THXA 5CNIA 3A37A 2Q0AA 4B7ZA 3OLCX 3R76A 1S9HA 4D46A 3ECCA 3HPQA 4LQCA 3K3WA 1HSOA 4Y6PA 3LWBA 2BSKA 1GDDA 1GO2A 5I7EA 4B7AA 2DHRA 3HUDA 1VE6A 2FMHA 3K0GA 4B7KA 3IJEB 5I5GA 4DR1B 2OTJV 1X9GA 1PD3A 5IT4A 1B23P 2CW5A 1IHOA 5FCDA 1QCEA 2FW6A 4EEKA 2N47A 4Y0NA 3TR6A 1PP4A 3FDXA 3L7IA 2JBHA 4C7OA 1J2TA 1N8SA 1PHRA 3CCQV 5E2BA 1EUDB 2HZBA 2X8JB 4E46A 4MRSA 2QYOA 4I9GA 4PC2A 3BE6A 2F1JA 4Q20A 5FO1A 4MB6A 2FXVA 2AFIB 1ESCA 1THGA 4LK3A 3U49A 1N77A 4PANA 1ZM7A 3LLVA 1WUJS 2QVCA 3A8TA 4ZICA 3PDWA 5J5AA 3R44A 4EUSA 2I7VA 3KELA 4OB6A 3OU6A 4NU6A 2Q1WA 5LD2C 4HAWA 1A2BA 1XKLA 4AJKA 2RB4A 3SZRA 5REQB 2XUOA 1AIPA 2PR7A 4DR1O 4QTYA 1XQ1A 1RWWA 2CFOA 2RGWA 1O1YA 1KYIA 2PS0A 4LNAA 3VM6A 3HR7A 2XXJA 3KVRA 2G9NA 3RNOA 5GZ3A 5TMBA 4REQB 5C7OO 1G21A 2FY8A 4XYLA 3ECAA 3BXHA 1L8DA 2DSNA 3JPWA 4MWGA 2FEOA 1JR3D 4X0EA 3VNAA 1U97A 3ODGA 4JLOA 3FMGA 3GFVA 3CX4A 3C39A 4F4DA 4QX6A 1H5QA 3UZUA 1FAFA 2D06A 1L4FA 5EZSA 3GGGA 5C7LO 5JT1A 3IP1A 3BXXA 1VRWA 1X1SA 3NTUA 1Y8AA 2MDTA 1JEYA 3OIFA 1XWFA 1N2BA 5IVPA 2QHXA 1NT2A 1A5AB 1FUEA 4BQSA 4UQLA 2Z4SA 4ZODA 3N05A 1USVA 1W2WB 2ZTMA 3FZNA 3K0KA 3VGJA 2MK3A 4EB3A 2XCSB 3H2GA 4MX8A 3RK0A 5F7XA 1HNXB 4PGHA 1PQPA 1NVPD 2JVIA 2HY7A 2VRCD 4HDCA 1WB5A 2AA3A 1OI7A 1T3TA 3E9QA 1O94D 5ED4A 4JSYA 1MDBA 2P77A 4P4NA 2O9JA 2C9BA 2YTZA 2X3UA 4YPVA 4X8HA 4URZR 3MINA 3JD3A 1KC3A 1G5PA 1FTQA 5H9CA 2IKQA 1X7DA 4OI2A 1GFIA 4IICA 2Q29A 4X3CA 5A7GA 1UC8A 3H3FA 2X6QA 3BFXA 3N2YA 4RA9B 4KXYA 1L7QA 2PUFA 3PA8A 1JIVA 3JAWB 3TUZC 4WGGA 1WOMA 4ZEWA 4QHSA 2VZ8A 4LDJA 1I0ZA 3M4JA 2DUNA 1CDDA 3GRFA 2JAHA 2FQQA 1KL7A 3RHFA 4UNPA 1LZLA 3NPAA 2ASVA 1HNXO 2Y76A 3Q6IA 4XGRA 5H1YA 2O50A 4B4KA 3FOAA 1L4HA 2GDJA 2P5UA 5BV8A 3NRJA 3AEUA 3EX7C 1RC1A 2JIMA 3NTOA 3UKDA 1YRWA 4G07A 4MK4A 5D5HA 2IEAA 4GI5A 1XHZA 2PZJA 1NYTA 5BXYA 4O4LA 1W88A 5JAOA 5HIAA 1SG0A 2H57A 1AA9A 1S3IA 3W4KA 5KOJB 5J58A 2J6CA 2C7QA 2SHKA 4BJ5A 2ILMA 1MZFA 2EINC 2QAGA 1Y3DE 4CR8A 2A0WA 2ATIA 2P35A 3RODA 4JYZA 3M4YA 4OM8A 2Y2UA 1Z4MA 5HE9A 2NXJA 4KN6A 3KWJA 3IVRA 2NZXA 3Q10A 1YA4A 1GGKA 4ND7A 1GZ6A 1MOQA 1VJ5A 4CDMA 2PBLA 1K7EB 3KFVA 4J0KA 5MDHA 4MRAA 2BSKB 5K2OA 2FUCA 4KLAA 5CRIA 4UV8A 2K7FA 5HQJA 4YWHA 4GOXA 2QMQA 2R8BA 5KYKA 5ALIA 2C2MA 4AROA 1RFYA 2RCVA 4LMRA 3C3YA 3CH4B 5EE5B 4E5MA 4LRQA 4YRBA 2DLNA 3C41J 2QVBA 1BJKA 1KBOA 2R44A 4BY9E 2OCLA 2X5NA 4N5MA 1BDIA 4Q3KA 3S4YA 4CL8A 4C43A 3GN2A 4N5HX 3W5HA 3QXXA 4TZ6A 3EDQA 5B36A 3PGVA 3IX7A 2JANA 1XZLA 1JBKA 5FPTA 1V9PA 1NFQA 2R8PA 3JQGB 1OIWA 3LUGA 3HP1A 4TWAA 5A5DA 2I4MA 3S5JA 4LYFA 4QUAA 1AHIA 1F48A 1WD5A 1QWOA 3I5YA 5HJEA 1NRIA 3F7NA 3C7KA 5HQTA 1H0RA 4ZTBA 4Q4JA 1CF2O 4LMBA 3I83A 4PZUA 4F04A 4DREA 3H4TA 1SXPA 1VIMA 2AOVA 1U9IA 2R7MA 5BV1A 2VJNA 4F2DA 3QVGA 4KB5A 2Q4RA 4MKIA 4YV0A 3H11B 3CRAA 5LZ7A 3U13A 3QE3A 3IPAA 5G2OA 4HZGA 5TNXA 1RSZA 2FX2A 3F5WC 2BPOA 2NQ8A 2QMZA 5L3QA 1PVDA 2VDVE 1QHTA 3TAUA 4XGQA 3HYCA 5SICE 2O52A 1Q1ZA 3UK6A 1LDYA 1RSOA 2B36A 2GF9A 4C0QC 4HAMA 2FWIA 4BX9A 5DNYB 4GWLA 4QE9A 2EILB 4RDIA 4TYNA 2C03A 1MDFA 3HEBA 4EOGA 3RROA 1RAGA 3WOHA 2VOEA 2ZSIA 5FIUA 3E22A 2QTCA 4GR9A 3I6IA 2FRDA 4YRKA 3VQVA 3V8EA 4D9JA 4ZJPA 3VZQA 3RVJA 3WMFA 4X93A 3QEMB 3LDGA 2HH9A 4ETIA 4RV4A 1JFVA 3F1LA 5TQ0A 3WADA 4YP9A 3SWWA 2E85A 4XYMA 1DRJA 3EWAA 4XTRA 2VF8A 4HUQA 1PJ8A 4IMRA 1Z2CA 1SESA 3SYCA 2G8LA 1M72A 3KOWA 1UINA 2O4CA 4FUQA 4NECA 1RM5A 3NRCA 1Z4KA 2O6HA 3V8NA 1M5TA 3OAAG 1CZNA 3EGIA 3HWSA 4B3XA 2EG5A 4E94A 1V2GA 2GHQA 1U5BA 2FKXA 1G1MA 2CLIB 1APBA 2QE7D 1HNZB 1TA4A 3UB2A 3IKJA 3U3RA 4BNXA 1EM1A 1SBHA 2CV2A 1ZJJA 4HGZA 2VUIB 4K9NA 1VBKA 1Y9ZA 1CP9A 1IBSA 1JG7A 4QO7A 3RKRA 1FLDA 3JRXA 1RRKA 4IZOA 5EJ2A 2OZVA 1FP4A 2M6RA 3JAKB 1KEZA 4RV5A 2HIHA 4JROA 4PGAA 4PZCA 3G7UA 1JN0A 1TKRA 1TYDE 2POCA 2VJDA 5J2UF 4GM0A 1XCLA 1WXFA 1QRAA 3L4JA 4RZ3A 2VPIA 4AS2A 1UBOS 2JLQA 3D6FA 4LCEA 4OOEA 2E5FA 2QV7A 1VQMV 4PBRA 2VT7A 3T1NA 3BREA 3FHLA 1X74A 1XP5A 4D96A 1VE7A 4B8WA 4BW9A 2A14A 3BC1A 3B6ZA 2IYTA 4LRXA 3ABIA 1D2RA 3F8TA 1YQTA 3EIOA 4ZRNA 3CUWA 2V5AA 4NTZA 2IZ1A 2CMKA 1HNZO 3FB5C 2CY0A 1Z9BA 4YCMA 4MQEA 3WB0A 2PLWA 2PZMA 2C2OA 4BN0A 3PQ6A 1PT7A 4MVMA 3S70A 2M98A 2VXCA 3B38A 2QLNA 1LDBA 4ASUD 4F4HA 1JCHA 3K8ZA 5H3LA 3NHLA 2GHTA 2D2VA 3C16C 1DHTA 1G60A 1T24A 1EFCA 3BL6A 4LA4A 3GELA 4NCBA 1ETUA 1PK8A 2WWTA 1CVIA 1Q20A 4J9VA 4JYMA 3OTIA 4ZFNA 3TZQA 4MWOA 1S89A 2I2AA 3AVQA 4FWBA 2NUAB 4BIOA 4DY6A 4X3PA 4CM8A 1XYVA 1U0NA 1DADA 2YC2C 3R0VA 4UFZA 4EGJA 3N0VA 4I9NA 3QKSA 3W6UA 3TSYA 3RI3A 3FCSB 1QU7A 3U39A 1VMIA 1SK9A 3V8VA 4RTPA 3WYGA 3ZY6A 2JBAA 3GF4A 1GPWB 3L9XA 4JC8A 1WCIB 2BP7A 4GYWA 4W63A 1YH3A 4PM4A 3ED1A 4DT1A 1YE8A 4LAFA 3WP0A 1J1UA 2GZRA 5FNZA 4FT2A 3IFSA 2VRBA 4RLSA 4BNGA 2Q8QA 4LXQA 5ECWA 3ANNA 5EIBC 4A8HA 2IBSA 3USZA 3TVTA 2M6KA 1FPOA 3IA7A 1L5LA 4IEFB 5KA6A 4MGHA 2YHIA 4DNFA 4MP3A 4EPXA 4RF5A 4GC9A 2X41A 1XQWA 1ULUA 2C99A 5E7MA 4B85A 3ESXA 3QU2A 1KK3A 1UAYA 3FB7C 1XTTA 4LKRA 2X1HA 4KDEA 3IMFA 4MSUA 2WIKA 3WGGA 4EYKA 2I8CA 4EO7A 1T10A 3L9WA 3BMXA 2RONA 4ZKEA 5ENDA 3PEWA 1CQIA 4A7PA 1FVXA 2YMPA 2J6HA 3R0JA 1VSVA 2NOAA 3HSSA 4BW5A 3ASUA 5L3QB 2VZ9A 3W5JA 1LX6A 4Q9IA 1KMQA 2WM3A 3ESQA 5L7TA 3AUSA 4E5YA 1QPZA 3DTVD 4OB7A 4ZCTA 4JJAA 2IUYA 1QGAA 1JYEA 3C6MA 3W5DA 1GPYA 5B1BC 2H1IA 4EHLA 1QGDA 3A7DA 2PRIA 2CSUA 3D36A 4XDKA 4LXHA 2HNBA 2MU1A 2IYZA 3RTGA 2AG6A 1TF2A 3Q15C 4ETNA 1U1DA 3KX2A 1X2BA 4FMTA 3MLEA 5KREA 3SG0A 5GVSA 4WCFC 1U8ZA 4FOLA 3KB1A 1Q92A 5JMPA 4EUNA 4PTYA 3GOQA 4AZ0B 1CJTC 2PRSA 4HUQB 4FYIA 4KYIB 4EUEA 2HHJA 2XV1A 4QBFA 3M5CA 2C5HA 4BVLA 1ZS9A 3UANA 3INYA 4MV0A 5ALVA 5FBZA 1DTWA 4ROTA 4F4CA 4JKYA 1MRZA 3CKLA 5FLKA 5ILQA 2VYVD 1U1EA 1CIJA 3K0AB 1ZL0A 1A4UA 1NQVA 3LI2A 1AMOA 2AEFA 2O3TA 4Y1EA 3CLVA 2JJ2D 5JNUA 5K99A 5G0TA 1EVZA 3P0JA 4DN6A 4HN2A 5ALTA 4QYSA 4Y18A 4XBFA 3O6VA 3E3NA 3TZ6A 4WOPA 4KFRA 5IE9A 1UXIA 3IIJA 4L8YA 3IAUA 4WZAB 3ZMUA 2R84A 5JDCA 1RKQA 3ZUPA 4LDPA 3JQFC 2MYNA 1Y5LA 1UBCA 4PAOA 2DUMA 2HV9A 2E4XA 5JXIA 1V48A 4ICIA 3K9GA 1RQNA 1J24A 3A9TA 4WCDA 3WLPA 4FDAA 4NZ9A 4OFBA 1WY7A 3G5TA 2BJVA 3K0FA 4KFCA 1OXXK 2Q99A 3BXPA 1DINA 2O2IA 4ZVOA 4S24A 2A58A 5FPKA 3ZDRA 2HZ7A 2RMKA 4Y6OA 3Q2OA 4TQ9A 1X42A 2RCYA 1ZJ5A 1AQNA 2VAPA 4AB1A 2EZ4A 3AOGA 3QKUA 4I8DA 1MB9A 4MCHA 4N3AA 2G0NA 1ISRA 1N1EA 3G5UA 1DBWA 1M0SA 3RRJA 1OX4A 2Q49A 3HJGA 3BE8A 1ZN7A 2P9QA 1IXRC 2CE2X 2RHMA 3BWVA 4IINA 4TTQA 2WJ3A 3HQ4O 1J5PA 2Q1YA 3DOFA 1U0GA 4UTPA 1TE2A 3AG1B 1QZUA 3GGOA 2XRYA 4LXUA 1UEJA 4H3HB 4OIMA 3E4DA 3TXXA 4Z9AA 4CCSA 4H0LB 2CHQA 3CY6A 4OJYA 4B47A 5B1HA 1H2YA 2RGYA 3RIHA 4IYJA 3RJ5A 1IEWA 5T3YA 3PI6A 5CB8A 5A9RA 1L4LA 1XRRA 3A4IA 4A6DA 2ZIEA 1J0BA 4PYKA 2QRKA 3GL9A 1XNQB 2BP7B 2IOHA 1IZ8A 1SXJC 3VU8A 3E84A 3S7ZA 1FRNA 3HO6A 4LPKA 1JDZA 4C7BA 4RXUA 5AW8A 3CM0A 5BV7A 2J09A 4D92A 1GGVA 3PJSK 4WLVA 2Q4DA 3GGDA 3M9WA 3JQPA 1O4WA 2ORWA 5L40A 1B41A 2OGSA 2H08A 5JJKA 5D00A 1ENOA 4RMGA 3IEXA 2NU8B 4P0TA 1R0BA 3F98A 2H4YA 5BW5A 4PR3A 3FMPB 4PV7A 1DK1A 1TXGA 3K20A 3F67A 1KYTA 4PSUA 1KO4A 1PWXA 1SB8A 4ERNA 2IOQA 3R9WA 4X8AA 4PIVA 3IRUA 1KDVA 1ICIA 3UW1A 4LCUC 1BXKA 2C5BA 4BNMA 1YQGA 5I5EA 3CF4A 3CCJV 5C8VA 2PX0A 2W42A 4G5OA 2DXIA 4H0CA 1CQIB 1PG0A 3FTDA 3ACCA 5F1YA 5EIFA 2CXNA 1M8KA 1XNQO 1XNHA 3AF4A 3PXGA 4PSAA 4YAJA 1L1EA 1GTVA 2DOKA 5H81A 3HXLA 3H1GA 2AHOA 3BBLA 3VGPA 1OTHA 5LWHA 4YP5A 2R1UA 2CTQA 2H2GA 1HFKA 4IW3B 3KNZA 2GM3A 1Q43A 4R40A 1UBMS 3RFTA 1AN0A 4DMFA 3X2SA 5CEJA 4ZI7B 2NV0A 1P9OA 1FA9A 3IHLA 1P4HA 3F5FA 3SC3A 2DPYA 4JGGA 1NXPA 3WLQA 1WSDA 4S3MA 5G1OA 1IXYA 3AEQA 3RQIA 5DNCA 2XDAA 4C2TA 2Z6AA 4IGIA 3NOQA 3ON5A 1WXIA 2DWEC 4FZJA 1DTWB 5LMUB 3OR7C 3E0XA 2CLOB 1N7HA 5JZBA 3WRXA 4WNCA 1GARA 4H44B 2R5FA 2CXUA 3L2OB 3RS7A 4QWWA 3WY9A 4W4TA 4PX2A 3HP4A 4Q7EA 4GX5A 3CE6A 1A7JA 4PICA 1VJGA 2FFJA 2H52A 2A57A 2ZKIA 2WPDA 2FN8A 4YFYA 1A9TA 1KU6A 4ZZ3A 5TRTA 5KTYA 4AX8A 4MUBA 3G5MA 5JC1A 2ZULA 5GPBA 4JHXA 4F9GA 3G7NA 4Q6BA 3IBGA 3NEPX 3GLIA 4NCNA 5BYAA 1MAVA 1R0XA 4Q1DA 2OAP1 3LP6A 1FS5A 4HDMB 4F46A 2H4JA 4IHJF 3N1UA 2G7MC 3H5NA 1L5ZA 4DCOA 2QR5A 5LMUO 2ZJ5A 2FQWA 3E7FA 4EY5A 4R7ZA 4PZYA 1SURA 5EFZA 2J5KA 1KI2A 1U6JA 2IUTA 3EFBA 3KHSA 1ZGJA 1R88A 4M9XA 4NZMA 1UPGA 3KXIA 2W6IA 1KGSA 3AKEA 4P4GA 4R1MA 2ASEA 4FDUA 3T15A 1FKAO 3DE0X 3PFIA 4XTCS 1Q95A 1SULA 3MWLA 2O1WA 1TFRA 1JHYA 1JAXA 4Z54A 4MOWA 4UCVA 5F3RA 4EA6A 2OESA 3KKKA 4EI8A 3E58A 1CUHA 1E7YA 3DZBA 3I1FA 3WLSA 3K9SA 1P74A 5DTQA 2V97A 5ALWA 5FKJA 2PUTA 3CLRC 4JYYA 3V7FA 4IIFA 2BOBC 4L9WA 4ZAFA 2UZ1B 4YIKA 5K05A 4X97A 5E9QA 5AHWA 1DUIA 4EI2A 3WKEA 1WA5A 1FP6A 2P27A 3V4FA 1JT2A 4EDHA 1WKCA 4AU1A 2ATCA 1KJQA 4C88A 5A5EA 4K9KA 2J7KA 1GNQA 1N6HA 2EGGA 1H2XA 4EHDA 1QX3A 4ANFA 1INLA 3OIWA 1JKIA 1RZRD 2O3UA 3TLEA 4IL6Z 4KVFA 3CPWU 3M6MD 4CQLA 5DLDA 1UK6A 4XARA 1A88A 1ORWA 1X7YA 4R8LA 4TN1A 2ZCJA 1FPMA 5BN4A 1TEHA 2N42A 5C51B 3ND9A 3CRMA 5AW4A 4F38A 1M1ZA 3KKZA 4DMCA 3PX2A 5ECGC 3LYAA 2IEZA 4IHQA 4MIOA 4DCMA 5AKKA 1BWSA 3S81A 3EZYA 3IOCA 2CLFB 2CNNA 3RKSA 4ZEMA 3SE7A 1WXHA 2H48A 1P4RA 2CXRA 3TLZA 3DO5A 3RRYA 1TM7E 4RENA 2KSDA 2YOGA 3IBYA 4J7AA 4W5QA 4CTOA 1H2NA 4PSVA 1T0BA 2HDHA 1SVIA 2YIJA 4WZBB 5FF9A 3EVFA 3COVA 3IUSA 2JLWA 2EULA 1BD4A 1F6WA 1RQLA 1ZGCA 3ZRXA 2PRJA 3WIEA 3ABTA 2DPGA 2CB0A 1R7RA 2VHQA 5DISB 2M32A 1BE1A 2I4NA 3MMSA 3TWOA 2HPZA 3AL2A 5LBQA 1G4UR 1OGJA 2C8KA 1IM8A 2ZBUA 4W1RA 3B9BA 3U4GA 2GN6A 3THXB 5B1IA 1KARA 4B6JA 1QFXA 2GPBA 3WL7A 2NO7A 5AM0A 4WFGA 1PV1A 1KI6A 1NMYA 5DGCA 2WWWA 5H5NA 3Q41A 4WXEA 2DQZA 3ABSB 1EAMA 5IF9A 1UMDA 2OTCA 2V6IA 4F5EA 2VDLB 4ZQCB 4X8OA 3GJ4A 1DAFA 4QD3A 2CJFA 3LUPA 3E7XA 3E03A 3CU5A 5BZBA 2P79A 3NHFA 4CT4B 3T95A 4KGDA 4D45A 3LS2A 2JF0A 3OZTA 4X45A 4O29A 1PD0A 4W4KA 2C4KA 4JP3A 1GAEO 1MVNA 1Q90D 5C5IA 3RHTA 4UCTA 4S35A 3AINA 4GAEA 3OQNA 5DBEX 1U02A 4H1HA 4EG5A 4CMAA 1GGHA 1B43A 3WWZA 1N3LA 1AKUA 1HDGO 4B7XA 3CVXA 4O5OA 3TNYA 2E3CA 3B2EE 5B5EZ 3AI1A 3LMKA 3MHPA 1XDCA 2VP4A 4LBVA 2OXEA 2I5PO 4C6TA 4Q4HA 1L0LH 4AP5A 1YFLA 3O8OA 1MKYA 5IUJC 2G6TA 1PK9A 4DE5A 3IAEA 1YTLA 4F6CA 3SJUA 4B5LA 2WAOA 4K9DA 3CZ5A 1UDWA 2X2PA 3NUGA 1V6SA 1EX7A 1WEKA 3KSAC 3QUTA 4NJOA 1OKKD 3RAFC 3NBAA 4JHLA 1ZK2A 4RD0A 2X6AA 1SOAA 4LF5O 3O65A 4O1HA 3SZOA 2ZAMA 3JD0A 5CB4F 1YI8A 2O59A 4FP9A 3I73A 4ZJUA 2INGX 2WD8A 1GTZA 1Y6RA 3TSAA 1W7AA 4OPHA 1QV7A 5GOTA 2JL1A 4QPJC 3PFBA 2G72A 5ES4B 4Y6GB 2IS4A 5DJ5A 4D56A 3ASYA 1U90A 2GJSA 4LZJA 3BCRA 5EERA 4G84A 2HK7A 4F4JA 3VI3B 4MCJA 1UKAA 2R6R1 1XX6A 2ZI4A 1RJGA 1L6IA 3S1AA 3ONVA 3PKJA 1YDGA 3EEIA 5HZHA 1IVSA 1X77A 4EYGA 5JNWA 1CEXA 1Z8FA 1ZH4A 1NBME 3LX6A 3CMAV 1KPGA 4DLTA 1IHPA 5LQJA 1ESMA 3QUCA 3EG5A 4B09A 4JP1A 3VPSA 5EUBA 4KRGA 3H5IA 1Q83A 2R6CA 3RG8A 3C6XA 4GPEA 3ZGOA 1PCXA 2NTJA 1Y74A 1RXSA 2ZUFA 3LRPA 4FKBA 4ZTUB 2CBGA 1L5GB 5ALOA 2D1TA 3SICE 4I8IA 3RYHA 3GJZA 3E2PA 4TTAA 1GPNA 2W6CX 2BRUC 2PWPA 1FFWA 2O5VA 1S7CA 3ID6C 4J11A 2JD0A 1QVRA 1SUIA 2ZIZA 3LHKA 4C6SA 1IK6A 1O87A 4OQPA 3LIPA 4F3YA 4BNTA 4L16A 4ZQBA 3RRBA 4Z2AA 4I5GA 4XASA 3UAWA 4CEIA 5EBWC 8LDHA 4HFNA 4PAMA 5LL6Y 2OHFA 1HO3A 1XZNA 2XHBA 4MYUA 1JHVA 5EWMA 1G6HA 2ZXUA 3Q98A 4DV4B 4GYCB 4D74A 4F0JA 2JNWA 2Z2ZA 2WLTA 3TZLA 1EQUA 3FGOA 4V1CI 3P3NA 3BJRA 1Q1EA 5JJLA 2QWPB 1FD9A 2IEGA 3FPCA 5KQPA 4CQLB 5L3VA 4EL0A 1ZUIA 2XLBA 2OAQ1 4BMXA 4NBUA 1WAZA 1NY6A 3I9OA 2OYQA 3PEFA 3D7MA 4PONA 3GN1A 2BMWA 1KTVA 1F8UA 1ZD2P 1UP7A 2BI8A 2NXEA 1YCGA 4M54A 2OT5A 3B52X 1N1MA 3DHVA 3UJAA 4P3XA 4CM5A 4MVJP 2TSYB 3P9RA 1RJ9B 2PWBA 5DECA 4BV9A 3ZEDA 3DOIA 3EVGA 3O1IC 3RT9A 2IH4A 1T5BA 1EGQA 3QBDA 2YJTD 1R8YA 2F64A 1DX9A 3EFOA 5JANA 5C5DA 2X0RA 3QFFA 4D9NA 1XCBA 4ALLA 5KVCA 4AZWA 3LU1A 1PL7A 1KVSA 1K5SA 3D7KA 1T2CA 1RQRA 1JR4A 2WMYA 3JSNA 1U4NA 4DADA 2I4OA 4D6XA 3WFVA 2ZB4A 1BHQ1 4DV4O 4HAXA 3WRVA 2J8ZA 1U31A 5F1PA 5FUXA 4EECA 2VQEO 2VJAA 1RXUA 1DC5A 3EVTA 1PJTA 2WI8A 4JGSA 4DIFA 2HADA 4ZT2A 3PR3A 1SU8A 3G82C 3RC8A 3HDGA 2WUGA 3P9SA 3OVMA 3K1AA 3SYTA 1KUQA 1NBHA 2HFEC 4UEKA 2N1BA 2IY9A 2X5KO 3T9BA 2R11A 5EC8A 2AL7A 3ZE6A 4P92A 3FBTA 3INTA 4HDAA 2VHWA 3GZ4A 3TX6A 1TLLA 2F9MA 1TK3A 3GU3A 2I6UA 1RQXA 2IW3A 2FSSA 2VF2A 3MMXA 1FMTA 3AEZA 4LDAA 4G5FA 3WGKA 5AM1A 4XW2A 3CZCA 5KCMA 2X8AA 3W8FA 4CT5A 1HBJA 3C3AA 4E03A 2C1EA 3L74H 1A50B 2VLBA 1D2MA 2NO1A 1UBSB 2WWHA 1VLVA 2BZ0A 2WMOB 5K01A 1G0OA 2GVNA 4G0OA 5DH9A 4MT8A 1E9DA 1WEHA 4KQCA 3UCXA 3WV5A 3RLIA 4BTEA 2ZR0A 5IULC 2ZETA 4GQIA 5C2JB 4NMLA 4Q4HB 3ER6A 1BFUA 3TQTA 1QE5A 1I51A 3U9LA 1KP3A 2WU0A 2E55A 4D0RA 3OZXA 1U1CA 4JVOA 1B74A 1JDJA 5E1AC 1ZK4A 1TUGA 2ACWA 4NE7A 1IL0A 4PAQA 3OAAA 3K4HA 3M70A 3VOBA 2WHPA 1N5IA 3UAZA 3DVAA 4CLHA 4Z53A 3FDJA 1AQLA 2WVHA 1RXWA 4JASA 4M0UA 3TJZA 4B2PA 4MVXA 2P62A 2RH9B 3B1KA 2J3LA 3WX0A 3R3SA 3QO7A 2NG1A 4BMOB 3G2QA 2XWPA 1FFGA 1WOYA 2QTGA 4EITA 1X6VA 2P2NA 1AN9A 3EPRA 1DT5A 2QYHA 2AXQA 4MV1A 2E82A 1G63A 5IXSA 4MS3B 4FFLA 2JLRA 2ADMA 2G1JA 4JAVC 2X4DA 1FW8A 1X19A 2WPDG 2EX1A 1Q91A 3UVEA 4G81A 3RC2A 4OX9B 4F4LA 5L7YA 5AWFC 2JJMA 3RFVA 4WN3A 3LSUA 3TLKA 4I50A 1W4CA 4NABA 1JP7A 1M1KW 1HQDA 3QELB 4ISBA 3AR5A 1H2EA 1G42A 1SIOA 4R1NA 5D3MB 1OCOC 2IEDA 1AMUA 1E62A 4WBNB 5FBHA 4OP2A 2CDNA 3LV8A 3UIEA 2OV2A 3C90A 3B8NA 3RK4A 4JXXA 4PFSA 1HE4A 4FYVA 3TQHA 4KFSA 4U7WA 5EXTA 4OIFA 1Z4LA 4NFYA 5ALMA 3UHAA 2B21A 2GUWA 1CJSA 1XL6A 4O4HA 1YZNA 3FWHA 4IF4A 4YRTA 1Z12A 2CEKA 3AM1A 3GGPA 1FYVA 4KUGA 2W6IG 2WVAA 2EBWA 5K6TA 2XKKA 1O5IA 1P0MA 4LH7A 1NQAO 1XNGA 5C35A 4ZOLF 4LYGA 1A8QA 2QJRA 3A1NA 3KEOA 3JALB 1Z39A 4MYSA 5EWMB 2OILA 3QEJA 3A6LA 2R65A 2I6XA 5KTSA 1LFAA 2OP0A 3X1YA 3E83A 4OX9O 4HUTA 3STZC 3BTUA 4TVOA 1MO3A 1EX9A 5ALZA 5BSHA 1FJXA 1ZHFA 2YFKA 1KZ4A 5E3HA 3R3ZA 2RI0A 1GQYA 3QLVC 1RRFA 4CEHB 5LP6B 3GLRA 4UB8Z 3E1GA 4BE9A 3RU7A 2ORED 1IWBB 2FPGB 1WX1A 4XWAA 3RS0A 1Q1GA 3HB0A 3MB8A 3KJEA 3U11A 3O4FA 2QUIA 4C7JA 3GH1A 2ZYTX 2OBYA 5KX5F 4B3SB 3M8KA 4OQXA 3IE0A 4BECA 4CXMA 2YZNA 3LQ1A 4RF4A 1AQIA 3KV3O 2HMYB 1B93A 4WNAB 5DB4A 3RC3A 5CH5A 1UQRA 1C9MA 4TYMA 5SY6A 3GZNB 1N0JA 1QQ5A 2XQKA 4FEEA 3EFOB 1S3JA 5MGNA 3HG7A 3PT5A 1DUSA 3CZ9A 2ZCEA 1F0YA 2D7JA 4D4HA 1WHSA 4BXOA 1SFRA 4D9BA 3Q7QA 2RJ3A 1G5HA 3BIOA 1LI7A 2B5WA 1DRKA 1ZUNB 2JLAA 4BMVA 4YP1A 1M3SA 3CWCA 3W4IA 4MV7A 1CRQA 3VR4D 4X6UA 2CD9A 4GWGA 3BCSA 4IQ4A 2BR5A 1CZHA 4QEKA 1PF7E 3FTEA 5IX8A 1RMYA 3F6RA 4XWGA 5C80A 1E5XA 1C2TA 4BGVA 5B1NA 3H1JH 1SVOA 2GBIA 1VHWA 5KNCD 4R8RA 3JVDA 3S0JA 3HXOA 3UCEA 1E66A 3AETA 4B3SO 4E3WA 1E1DA 5GV7A 3HJTA 5LUBA 1Q1BA 2I7DA 4XI9A 1R9MA 2XRFA 3VH2A 4XUEA 3WIVA 1N7IA 3FFXA 2LFSA 4DEYA 1G7SA 2YASA 2XF2A 4ZP1A 4J7XA 2C83A 4RTNA 2CKMA 4UHBA 1EUYA 1JVSA 3NG1A 1P1RA 1HLPA 2ECPA 3FJ1A 4EIWA 4BNYA 5FV4A 3CURA 1FUKA 3ZWYA 3W6ZA 2MOKA 3NVAA 3A6GA 2XGMA 4UUJC 3O95A 3P9KA 4KU4A 4MUGA 2HMTA 2BBTA 3LYHA 3OEHD 4UZSA 3C6QA 3DEZA 1VCHA 5BWCA 3DBLA 3IQDB 5B4UA 2H5IA 1XEXA 3OETA 1GXSA 3HLKA 3ZWDA 4AG5A 3NKLA 1MT0A 3G17A 2QVZX 4JUFA 1HTTA 2XKAA 1ZM3A 3JQ7A 2OAEA 3A6EA 2WFLB 3VHLB 5DX1A 1USKA 4QOFA 4TV9B 5CFMA 1Z0SA 3QY0A 2Y1OA 5IDVA 5EHQA 1IBKB 3ER9A 3S40A 4F5ZA 1DDIA 2IWHA 3V8PA 1UFKA 1BGXT 5EE0A 3VTAA 3P4XA 4OL0A 2VH5R 3NWEA 3OSUA 2Z5LA 3PLAE 1O6BA 1CUUA 3C3WA 2FRVA 3VU0A 3BXFA 3K5HA 1SXJE 3DB2A 3IPYA 4CL0A 3LZ6A 4K9QA 2GDSA 2LQTA 4AP9A 5HPYB 2OXCA 2NQ2C 4ARVA 3I92A 5DLQC 1M2WA 3DDHA 4R2LA 4GLXA 3WC4A 1PZMA 3K5NA 3IP8A 1PGJA 3PHCA 4US2R 2C78A 2ZINA 4UBJA 4LHZA 5KYWA 1E6CA 1IEXA 5I01A 4G8JA 4L74A 3HU3A 3D6NB 1N0UA 4CRWB 1H4QA 1P7GA 4LV8B 2CHEA 4DJFC 2JHGA 4NSNA 3NNDA 1IBKO 2HA6A 4V0ME 4KXXA 4U2BA 1PSZA 1H6CA 3TI9A 5C46F 1C1XB 4P35A 1OWPA 1TAQA 1AM4D 1N3YA 1YVRA 4TROA 3OHSX 4OQLA 2Q6LA 4V0KA 4PSDA 1TT5B 4AECA 1FXKB 3Q4HB 4BIUA 4TSFD 4HEA6 3K09A 4LKOA 3RYFB 1HPLA 2IYQA 1BWQA 3SOZA 3DULA 4MUEA 2VAMA 3I5UA 3TYXA 1CPYA 1IEQA 3IDAA 3TFWA 1V26A 4LYAA 5HXAA 2J9ZB 3NETA 2ZBPA 3GFFA 3RHZA 4OVKA 5G02A 4YCLA 3ZH2A 4MIEA 3UOGA 3JPYA 3R24A 4KACA 4B82A 2G4LA 5AW2A 1I7PA 3NYWA 4ZMRA 4RSRA 5AESA 1XTRA 1GM5A 4V2IA 4J29A 2J33A 5C0OE 3JVEA 1JAIA 4WVFA 1U7DA 4E2YA 3OZAA 5C31A 3G8DA 1GQ2A 3H2JA 1F51A 1GAJA 4H27A 3BIWA 3LM8A 2QAIA 1JA1A 3RUEA 2X14A 1VLQA 2Y0CA 4DK1A 1H2BA 2Y9MB 5A9SA 3F4KA 1OFGA 4DLWA 2PX6A 1S77D 3KB2A 4NBVA 3D8CA 1V9LA 3HGTA 1NW5A 4RO0A 2DYSB 1YR9A 4XWWA 2QM7A 2CUZA 2V45A 1J9EA 1QFZA 1XHLA 4FEGA 5BT8A 2KSQA 3QOFA 2G77B 2B34A 4E6PA 4JLSA 5A9TA 3HUUA 2VWJA 5DHRA 1NPYA 1YNSA 1U8UA 4MS2A 4C7OB 4DPMA 4TUYF 4X95A 1PNQA 4HF7A 1ZOIA 1XZ8A 2OCHA 1TVKA 4NICA 1ZD5A 1P45A 3GXOA 3NUZA 1RC0A 3HVKA 3OQIA 4D82A 4EJSC 1FDUA 3N2ZB 4TZKA 3AFOA 4EH1A 5JI3E 4ZMSA 5DM60 2ONCA 1V16A 2ODNA 2I3AA 1I10A 4EEQA 4I19A 4ZVRA 4Z1VA 3FE2A 4QFCA 2HEGA 1ZTEA 3KJHA 4GOND 3ZW7A 5C53B 3DB1A 5TEVA 1G2OA 5FPQA 2XF8A 2KM1A 3DAFA 5B1OA 5A4DA 3TQQA 3INGA 1NN3A 1NQWA 3P2IA 3LLMA 1BMFD 1QYDA 4MVOA 3WWEA 2UXBB 5JG7A 4M9SA 3RASA 4CZ2A 2RGBA 1ZW6A 1SVMA 5ELMA 1G21B 3EISA 1L8QA 2R6AA 1FQWA 2Z6VA 3BG5A 1BIFA 1PTJC 1VQOV 2Q5HA 2JLXA 4JEHA 4R2JA 2ZJBA 3SJCA 4YS6A 3M9LA 4ZAXA 3UMRA 3BN3A 4DIDA 4F3RA 5ICCA 4FQ8A 4QBTA 1CVRA 1YC2A 3W5VA 3W2HA 4UEOA 1NIJA 3ETQA 2B82A 1AGXA 2G5CA 4NG4A 4LDZA 1JEYB 1IMOA 4DW8A 1KH2A 3GMSA 3P0FA 4QUEA 1IZ7A 2JGMA 1G5TA 3E8BA 3OOJA 2BHTA 1NT2B 4N21A 4UUBA 4FJ1A 4EG4A 1KY5A 1EWVA 5EJGA 2X7RB 3LY7A 1J0DA 3UJDA 4C5CA 5TMEA 1Y8CA 4JUIA 3NYRA 2HCTA 3IYLW 1DTSA 3W9BA 2G4VA 4PO9A 4NYJQ 1QP8A 4XLTA 3ZI4A 5HP4A 2GN4A 2PANA 3N27A 4B6RA 2JLUA 4EUKA 5JNLA 1AHNA 1C8KA 1FP7A 4PFKA 1XN4A 3IXMA 3LNTA 2BFFA 4R51A 3MINB 3UG6A 1S96A 4NFHA 3GEMA 1TJ3A 5MF6A 4F84A 1UDBA 3M1IA 3TFQA 3DBIA 2Q7XA 1F2VA 1VC2A 3VH3A 2Z09A 6ADHA 4F8EA 2Z5FA 4ZVPA 1U3WA 2WT4A 4CETA 5HQ3A 3OEYA 2M7WA 1XA0A 5TVGA 4RVNA 5KINB 1ZRSA 3LVQE 3AHHA 2YIVX 1T2FA 4LFBB 3PHIA 1X0VA 4WKOA 3L1HA 1UC9A 1DC3A 4F85A 1MG1A 3B7WA 3PV0A 1GNVA 2ZUUA 3K2IA 3CVVA 2W2NA 2XMRA 3WQHA 2FWRA 3QWAA 4Q12A 5C81A 2X0IA 5GIOE 3W1VA 1IK4A 1JIXA 3AEUB 1FRFS 3VU9A 2G1KA 3H1TA 3ZRSA 4LDQA 3MJSA 1KY4A 5CFNA 5AUQA 2VEOA 2B8JA 2BGWA 2RGCA 4Q93A 5FDFA 3CUSA 2V7WA 1UDCA 2UYYA 5IN5A 5DI9A 4E1AA 1VGQA 1AK1A 4RQFA 2JK5C 1BWPA 4O4LB 1W88B 3KP1A 2Q6KA 5BRAA 2WF8A 2A7XA 2F3UA 5HMMA 2AN9A 2Y05A 1KI8A 5EIXA 4FVMA 2HWWA 5BW4A 4Y8VA 2QAGB 2C2GA 2VS1A 4H7IA 3RTEA 2V1UA 3TMAA 2OVFA 2HV8A 4P54A 3DWIA 5LXTA 4EHJA 2IPXA 4A2PA 1KETA 2B78A 3H1BA 3EPLA 3D0RA 4MW8A 2PKEA 1NMZA 3RWBA 5TARA 3AEYA 4GUDA 4LFBO 4OMCA 3ZS9A 5GJWC 3VR2A 4X6LA 4E5PA 4NU8X 1JJOA 1NTMH 1VIDA 1IPHA 1DEAA 4DIUA 2XRZA 1KF0A 3A1SA 5DLEA 3CNOA 1V96A 4CKCA 4EHBA 1XD2A 4JC5A 4LWPA 2HN9A 3EMBA 4YV7A 4DR3B 2WF6A 4LUCA 2Z5GA 3ZS8C 1Q7BA 2A9FA 2ZSJA 1P2SA 1LI5A 5LQNA 2Z95A 4M1MA 3TR5A 1DJOA 4OV6B 1DVRA 1Y9DA 3IP3A 4ESEA 4HAIA 5EC2C 1QOQB 1D6JA 3FOZA 2DR3A 1KMMA 1F23A 1SBNE 3CCMV 5T4BA 4YO8A 4B6GA 1U8TA 2PUJA 3PTLA 2VZ0A 1EJ0A 3KL2A 4PVCA 4Y2QA 3REOA 1T13A 4AS3A 2JGEA 4FR0A 1H65A 1N5JA 4OKSA 4OLHA 2ZGVA 2B94A 5A3RA 4V3CA 3D0OA 4O8CA 2WHEA 5AM4A 3IAHA 3TJMA 2C4NA 1SG6A 1GZSA 4Y1GA 1WBJB 5A6VA 4Q4JB 4B33A 3RO7A 3OLZA 4DR3O 2C0CA 4N01A 2II6A 3DVQX 2GETA 3THWA 1Z45A 2QWQB 4CNQA 1YUMA 3SSMA 2D5BA 1Z28A 5FA8A 3F5TA 1AI6A 1R4AA 1KR5A 3BEDA 1CFJA 4AJLA 5CXQA 4S1VA 5IT5A 2P5SA 9LDBA 3HCFA 3RF6A 3QVGB 1O57A 2VTEA 4TYQA 3X2FA 4DY4A 3C7DB 1G3IA 1J97A 1GGFA 2VYND 2C9MA 1R9NA 4IMPA 3DE7X 4WERA 1J07A 3LFUA 3T9CA 4QOJA 5L3SA 5JALA 4D02A 3OMLA 3ANLA 2Z58A 4LWOA 1LQTA 3EJ6A 1EFTA 1NF2A 2DPHA 1L7EA 4M37A 1MPTA 1RSOB 5B3JC 4C89A 1PAUA 5IKMA 5HM6A 2PZAA 3G9UA 2E18A 1T3SA 2J7PA 1NZJA 5FULA 2O3QA 3CCSV 4K86A 4PGMA 2JHAA 4PX9A 2IK8A 4FYKA 5JAUA 1YR7A 1N36B 2Y99A 3QVMA 2YYYA 1U0LA 1EXDA 1G8SA 2I6FA 5D3ZA 3E22B 2Q5JA 5AW5A 2X5XA 3UXYA 3T1TA 3IQWA 5T5QA 4W1SA 3CCRV 4HPJB 3BVOA 3SX4A 1U9ZA 3AH8A 4X7BA 5KHHA 3GCGA 5ENZA 4IVPA 1TCAA 2AZ2A 3ROFA 3CX5F 5TQ0B 1K4MA 1ZP6A 3GT4A 2HT1A 2UKDA 2D0DA 1W1WA 4K6GA 4OKNA 3GJYA 4PPNA 3JW8A 3DYVA 2HQBA 5E1DA 2G07A 4BV3A 1NVAA 1E98A 3EF1A 4DIEA 2A30A 4HQ6A 2IITA 5D87A 2OQRA 3AR7A 1Q2XA 2BFPA 2N0SA 5IARA 2AW9A 2Z5UA 3C4VA 1HLGA 3AUJB 5KX5A 1VHJA 1GUYA 1FW6A 2JAXA 1ORRA 4IZIA 3MD0A 1FFYA 3S55A 1S2OA 4Y2UA 1U5BB 7MHTA 1ZJ6A 4JJKA 3W7AA