1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
molecule tags Hydrolase (carboxypeptidase)
molecule keywords SERINE CARBOXYPEPTIDASE
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
5AKZA 4BB0A 2XMBA 4H0CA 4EY6A 3PUHA 2Y2UA 1FFBA 3GBSA 1LPNA 1LZKA 4DIUA 5EIAA 1CUDA 1DTEA 2OAEA 3I2GA 4I3FA 4KYVA 5FKJA 4BTLA 5SYNA 2CJPA 5EHNA 4W1SA 1W75A 1THGA 3CN9A 5DYWA 2O2IA 3BJMA 4QE3A 2CBGA 4L9AA 1CUVA 3B5EA 2WHPA 5CMLA 4J0HA 4WCVA 5IVDA 2X8BA 3QZUA 1P0QA 2XMQA 3FLEA 5CW2A 2VAVA 1JFRA 4FLEA 3WL8A 5AOBA 2OAGA 4LHEA 2G4LA 3D3NA 4PSCA 4EB0A 3HI4A 4EHBA 2PUJA 3I28A 4DNQA 2WHPB 4KAAA 5JD5A 3RKSA 5FP0A 2JGEA 5AI6A 1MN6A 3FCXA 2HA2A 1TKRA 3O0DA 4Y2TA 3W9BA 3EQ9A 1AKNA 2YH2A 2XMCA 4C4YA 1BN7A 1BROA 5LKRA 2HA6A 2Z5GA 4B85A 4FOLA 4W1QA 1A8UA 5CH5A 4JH0A 2J4FA 4UHBA 2VJBA 1ZICA 4M0EA 4ZREA 2XI4A 3TRDA 5LZ5A 1GZ7A 5JAUA 2QS9A 2QZPA 1A8QA 4B9EA 2BUBA 1A7UA 2H7YA 3I1YA 5HCUA 4G1FA 4WY5A 5C7YA 1ODCA 3PUIA 3NUZA 2H9YA 5KWJA 1TCBA 1QLWA 3EQ7A 2B4KA 1WM1A 3ANTA 4BVJA 1XRNA 2XMSA 1CUIA 4JEIA 5LKAA 3FYTA 1ZD3A 1CUEA 2C58A 1Y37A 1CPYA 3WYDA 2HDWA 2OGSA 5ALHA 3WK6A 2I78A 4KE6A 3PFCA 5HQ3B 4HS9A 2IIVA 1SC9A 5JAOA 2G5TA 4H7JA 5AM4A 2JEZA 3ZLUA 3M3DA 3YASA 1EH5A 4XX1A 3QH4A 3R3ZA 1H23A 4DGQA 5AIAA 4B0PA 1E3QA 4Y2JA 3G9ZA 3D5EA 2I3DA 5C8XA 2WTNA 5T4HA 4DMHA 2JGIA 2WJ6A 3WK5A 1N8SA 4NMWA 1AURA 3QMMA 3ESDA 4Q1VA 1SOMA 3VJKA 4F21A 3QVMA 7YASA 4B0OA 1PV1A 4X00A 3OPMA 3DEAA 4QDXA 4ARAA 2WIFA 4RE5A 2PVSA 1JJFA 1HL7A 4FFWA 2CEKA 4AZ3A 4UFOA 1T4MA 4AN0A 5DTIA 2RHTA 1GXSA 5AOCA 3DCNA 3BJRA 4AXBA 4DYHA 1HBJA 2B9VA 4BVLA 3WWPA 2PSEA 1JMYA 1CUFA 3R3YA 4A23A 5E4JA 1EDBA 4OUKX 1JJBA 5AM3A 1MO2A 2IITA 1SCIA 1IMJA 1OXMA 4E11A 1EB8A 4D9JA 4DSZA 3BDIA 3TGLA 3G0GA 2JGLA 4KJXA 4FMPA 3A6ZA 1ORWA 3CXUA 2R11A 4ZRDA 2V98A 2XQKA 4HRXA 3X3HA 4J0CA 4TPKA 2E3JA 5BOVA 3V1NA 4GI1A 1ZGCA 2ACEA 3H17A 3UUEA 3KDAA 4EZIA 1QIEA 1TQHA 3QPCA 4FTWA 4KEAA 4IH1A 1JKMA 1FFCA 3A70A 3H2GA 1W1IA 1K63A 1CR6A 3SX4A 5T4FA 3O4HA 2WU3A 2HA3A 3V1KA 2RGUA 4B83A 4B9AA 1XLUA 2WM2A 4NZZA 5I8PA 2QXUA 2VA9A 3STTA 4XVCA 1QZ3A 2XUPA 4OPMA 5A7FA 1CQZA 5LYYA 1SCQA 2WQZA 1BEZA 1QJ4A 1UOOA 2PL5A 2VTVA 3KWJA 3IB3A 3GELA 3LLCA 5DNWA 1EK2A 3WKAA 3JYHA 4DTCA 3FVRA 4EY7A 4B81A 3BWXA 3OC0A 1XLWA 1H2XA 4GHWA 4UBIA 4QZVA 1BE0A 3E1GA 5ESRA 1MX9A 4QWMA 3MUOA 1D07A 5JADA 5ALMA 2HADA 1H2ZA 5A2GA 5JYCA 1X2BA 2H7CA 1UOQA 3I2KA 1A8SA 3OOSA 3I2FA 3L1IA 2XMGA 4QEKA 1Q84A 3WYNA 1XZKA 3MUNA 3ICWA 2QOEA 3F8SA 3WWEA 5H3HA 2XUGA 4OYLA 4YK7A 3DL7A 4MQLA 4FHZA 2OCKA 3PE6A 1LPOA 2WIKA 2OGZA 2BGRA 2FUKA 5LZ8A 3O4JA 4Y2YA 3I6MA 3UMJA 5A7HA 5DTJA 3WJ1A 3E3AA 4X85A 5HK8A 2HM7A 2QJRA 4OCZA 4FWBA 4G9GA 2IX9A 5JIBA 1KU6A 2ZYHA 5CRIA 3ZPXA 4GXNA 4BTVA 4MYDA 5ALTA 1CUYA 1CUAA 1AC5A 2BJHA 1GT6A 1GPLA 2VT6A 3BIWA 1HLGA 3PDCA 4CCYB 4G8BA 2RAUA 5AJHA 4FNGA 5HF9A 2ZJ6A 3PFBA 3OURA 3B3QA 1NU6A 5LZ7A 4AO6A 3H1AA 1PFQA 1CUHA 2AJ8A 1GQSA 1XZGA 3K9BA 5EGNA 1Y7IA 1JT2A 2OQVA 5AI4A 2PX6A 3FBWA 1CUWA 4GLBA 1WOMA 4Y9SA 4BE4A 1CUBA 5HFNA 2OLEA 3ZLVA 1XZCA 2BCEA 1XZLA 1LBSA 2Z3ZA 3JW8A 1FFDA 1BRTA 1YAHA 2UZ0A 5CT6A 3ZWQA 5D6OA 3C6XA 3K6KA 2XQIA 2C0QA 3A2MA 4BAZA 4ZV7A 4QA9A 4PSUA 2HRQA 3VKFA 3HEAA 2RI6A 5JD6A 4W63A 4BE9A 5I7UA 2JGFA 5JD4A 1XZEA 4J3JA 1XKTA 3H19A 5FXMA 2OQIA 5K3AA 4Z49A 1DX6A 1R50A 2FJPA 1U8EA 2VSQA 4JYMA 3GUUA 2JGMA 2V9ZA 1E8NA 3DOIA 2Y6VA 4BCDA 2WUFA 2QT9A 5HFAA 3W2TA 1L7QA 3M81A 3G9XA 1QFSA 4FBLA 2HU7A 5JALA 4N8DA 2ZYSA 2WG2A 3R3XA 4HZGA 4RNCA 1SFRA 3LIPA 4ROTA 5ALRA 5T4EA 3F98A 4N8SA 2G63A 5EFZA 3FVTA 4M0FA 1JMKC 1TAHA 4X90A 4M0MA 5LLSA 3C43A 5ALFA 1E89A 2WHRA 4BP8A 2C5FA 3WA6A 3AIOA 4C89A 2ORYA 2WFZA 2GBCA 3CCCA 3DS8A 5KBYA 3C6ZA 3STUA 3IIIA 5HZGA 5AIBA 2JEYA 4Q82A 3KWFA 4WDRA 3KXPA 5D7BA 4Y2SA 2HL6A 5IKXA 3AZOA 3WA7A 2J3QA 2HHAA 3WWCA 4I19A 1QOZA 2XMRA 3D7RA 1QE3A 1QIMA 2Y6UA 4DNOA 1U2EA 3AJAA 2JGJA 2XMZA 2I03A 4ITVA 4BDSA 3VISA 3ESAA 3PF9A 4E15A 3H04A 1XZFA 4J7AA 5AKIA 2OXEA 2XMDA 1K8QA 2XUIA 4KE9A 3Q8WA 1XRPA 1Y7HA 4G8DA 5DNVA 5KREA 3MVEA 4JNCA 3QMWA 5CXUA 2J3DA 2XUJA 3HYSA 4F5ZA 2FX5A 5IVIA 5K3FA 2AJDA 3A2NA 4Y2VA 3BL8A 4H18A 2ZJFA 3W04A 4BVKA 1DT3A 3CCBA 3O9VA 3DYVA 2GYUA 1UKAA 4Y2PA 1USWA 1RP1A 2JF0A 5AI9A 4WY8A 5AICA 2XLCA 1XQXA 1BS9A 1YSCA 3S8YA 1DINA 3SC2A 4TGLA 5E4YA 4DNPA 2QXTA 3VXKA 3I1IA 1IZ8A 1WHTA 2VAXA 1UWCA 1F0PA 5C81A 1YASA 5AHXA 2XLBA 4H7KA 4MEAA 5CT9A 1X2EA 4K5QA 3G0DA 1ZD2P 3L1JA 3N0TA 3ESCA 3I6ZA 3I2HA 5D3ZA 1UK8A 1LPPA 2C5GA 4GW3A 1EINA 2CUTA 5IVKA 3K2IA 3HJUA 5E2IA 5JZSA 4V2IA 1R9NA 1XFDA 2BUAA 5FV4A 1C7JA 3AUKA 3ZV7A 1AQLA 4QDZA 2QTBA 3U0VA 5FPPA 2CZQA 3I2JA 4B82A 3OM8A 3WI7A 4OB6A 3CN7A 4U2FA 4XIIA 1CUJA 1IUOA 2QJWA 2XUFA 2Q0XA 2OPHA 3ICVA 2H1IA 4ZI5A 2CKMA 4H77A 1Q83A 1S8OA 4RE6A 1PJAA 1ODTC 2VJAA 3V48A 2WFMA 4FLFA 5K3CA 1LPSA 2HRRA 3AIKA 1MT3A 4CG3A 1HQDA 1CEXA 1IUNA 3STXA 4CI9A 4G9EA 2ZYRA 3T4UA 3R0VA 4N5IX 5AKHA 5BWBA 4C87A 1J2EA 2OCIA 4LXHA 3WL5A 4OB8A 1B6GA 4OSEA 2DR0A 4G8CA 4EBBA 1QIIA 2OG1A 1H2YA 4K6HA 4HXGA 1BCSA 1ACLA 5AM5A 1GKLA 4MEBA 5AKLA 4DLNA 2QKYA 2DHEA 5ALDA 4BCBA 3MGAA 1JU4A 3C5WP 1XZDA 2YXPX 3C70A 1EK1A 2XQFA 4J0JA 2J4CA 1BCRA 4OD0A 4XWGA 2H7XA 5BV7A 5LZ9A 4IHAA 3C8DA 1F0NA 3QYJA 3GROA 2XT0A 3C6BA 4X7BA 5F4ZA 4KE8A 2PSFA 3AFIA 3R40A 5AI8A 1CLEA 4DMFA 1CRLA 3Q0TA 4EUSA 2DQZA 5JZ9A 1AX9A 4AN1A 2WFLA 4K2AA 4KRXA 4KACA 5JARA 5CTAA 3LIIA 3TJMA 4MQMA 4AO8A 4GECA 3HABA 1J1IA 1ZI6A 2PU7A 3H1BA 1N1MA 1O6FA 4IO0A 2WIGA 1EDEA 1R1DA 2AXEA 2VQ6A 3C8HA 4O08A 1W76A 4P9NA 1XRMA 1SCKA 1RYYA 2HA0A 4QDUA 3GFFA 1R3DA 5JAPA 1U4NA 4UFPA 1G5FA 3EF3A 4J0KA 5D3KA 4ARBA 4W1PA 2JIDA 2V97A 3RM3A 1IVYA 4BBZA 1GKKA 1MX5A 3D0KA 4IQ4A 4LKOA 1QONA 2K2QB 4W1RA 4WJLA 4AO7A 4P08A 5AI5A 1I6WA 2BFNA 5A62A 5ALYA 2WG0A 2C4HA 3BE8A 4HVTA 5EI5A 3WKDA 1ETHA 2LIPA 4CIAA 1H22A 2WJ3A 1UFOA 3WMRA 1VJ5A 2HIHA 5JANA 2PSDA 5ALSA 3ANSA 3WJ2A 5CURA 4MYSA 4YASA 4G4GA 4AMYA 4OU5A 5CT4A 5CH8A 1U65A 4WFKA 2PBLA 4BATA 3WK4A 3PICA 1FSSA 2GZRA 5EIEA 4WFIA 5ALNA 1XZBA 2XDWA 1ORVA 4KAJA 1ZJ4A 4BZZA 3DJYA 3HRHA 1W6RA 1CQWA 1QO9A 3WL7A 2QM0A 1UK7A 1VKHA 4G4IA 3BDVA 1Z68A 5DNUA 2WILA 2AJLI 1GQRA 1XROA 4JYPA 3O4GA 4BP9A 3KOOA 1VLQA 3H0CA 4BYMA 3FYUB 4OB7A 2D5LA 1ZI8A 1DWOA 3G7NA 1R88A 2FJ0A 2GZSA 2CMFA 3EBLA 4CCYA 3O4IA 1EVEA 2QMQA 2WLSA 3WK7A 1LBTA 3QITA 1N5MA 4PQEA 1YCDA 4UFNA 5ALUA 4QWWA 1C4XA 1QO7A 3G9TA 3ZLTA 4UPDA 1XLVA 4LXGA 4YPVA 1FJ2A 4Y2QA 2C7BA 1ZOIA 3STYA 5CT5A 5FRDA 1CUUA 5DLPA 3ED1A 1GPNA 3EIOA 4PSDA 2X5XA 1VOTA 1WCYA 1YAJA 1VZ3A 3C45A 4DNFA 4TVKA 2P8SA 1X70A 2DQYA 2W6CX 1HKHA 3H2IA 4QDOA 2WJ4A 1YS1X 1BU8A 4Q3KA 1YS2X 4UBLA 4HTAA 3OG9A 4H35A 1J07A 4PNZA 2XB6A 4C01A 2YASA 4IH9A 1MNAA 3E0XA 5CH3A 4J0GA 1AZWA 1YB6A 4X71A 4DSAA 4BCCA 5HF6A 5JAHA 1H2WA 4A16A 1P0MA 4P92A 3STWA 4BC0A 3D2AA 4WDQA 4KRYA 3A2LA 1LPBB 1UKCA 4E14A 3WQHA 3VVMA 4ZV9A 1ODSA 4H7EA 4U2DA 4Y2UA 3WL6A 1M33A 5IH7A 1XZAA 4KR0A 4UBOA 5LIPA 3DKKA 3F9CA 1ZJ5A 4CCWA 4FKBA 3O95A 2WTMA 4A5SA 3NGMA 2HU8A 4N8EA 2YYSA 2DHDA 4Y7DA 5I9IA 1EB9A 5IVHA 4HXEB 3M83A 3AZQA 5A7GA 1K4YA 2Y1KA 5FOQA 4RGYA 1J06A 4I4CA 3WZLA 3N2ZB 2ECFA 4INZA 3V1LA 1ZIXA 2QUAA 4BZWA 2GYWA 3FAKA 3TEJA 1DQYA 3V9AA 4AB1A 3ILSA 3BXPA 5HKBA 2VEOA 4PV7A 5AK4A 2WIDA 4X95A 1G42A 1TIBA 3G0CA 2WFLB 1XZMA 3QBJA 1G66A 3JWEA 4X91A 3C5VA 2XQGA 3IDAA 3DQZA 4XJVA 2PM8A 1EDDA 2DHCA 5T4BA 5K3BA 4U2BA 1Q0RA 2QVBA 4H7FA 4EY5A 1QTIA 1ISPA 1TCCA 5EIHA 4CG2A 1FFAA 4BRSA 3C6YA 3FLAA 4WFJA 1F8UA 5ALKA 2VJCA 1ZD4A 3IVMA 5DYTA 1UT6A 2OCGA 1YA4A 2PU5A 3T52A 2GBIA 1NU8A 4BAGA 1EX9A 2XUOA 5AM0A 5CT8A 2XUQA 3WWDA 3DLTA 1UZAA 4BDTA 4MWSA 1E8DA 4L72A 1KU0A 3HSSA 2PPLA 3VJMA 3F96A 2Z3WA 4PW0A 1DWQA 4B80A 2HA5A 1XQVA 5J3JA 1VA4A 1THTA 4UBKA 3WKBA 4CG1A 3NOXA 2JGKA 3WIOA 4ZWNA 4KAFA 4AZ0A 1MPXA 2WUEA 1MAHA 4B84A 4P93A 1KEZA 1MX1A 3D4LA 5ALEA 3I6YA 3C87A 4QLAA 1TK3A 1GGVA 3B12A 1HPLA 1P0IA 1ACJA 4AMZA 1VA5A 5ALWA 3D2CA 3IA2A 1WHSA 3G9UA 1E66A 4G4JA 3FYUA 3WZMA 3IURA 1JU3A 1QIJA 3LS2A 4UHHA 3SK0A 5ALJA 2BAGA 4BC1A 1XZJA 2D0DA 5C8ZA 3DKRA 3FWHA 2HA4A 4X93A 4FLMA 1K6EA 1ZI9A 4GEGA 4W9RA 1UKBA 4IH4A 3F97A 1TRHA 4H7IA 1JJIA 3GZJA 1F6WA 4UBMA 1OCEA 2ZJ7A 2RIPA 2HFJA 3V1MA 1C7IA 3H2KA 3G0BA 1MJ5A 1ZGBA 2PSJA 3AILA 2VF2A 4B7ZA 4HRYA 4UHFA 2Z8XA 3QMVA 3NWOA 4E46A 3O9MA 3HLKA 4U2CA 4MWTA 3FLBA 1IZ7A 3DOHA 3IUQA 3VJLA 1JI3A 1WPRA 3KSRA 5SYMA 1UK9A 1UXOA 2GBFA 5BWCA 5AKJA 5FDFA 2O2HA 3D2BA 2ZVDA 2WUDA 4L3WA 2WSLA 1EA5A 1L7AA 1T2NA 1XZHA 3H18A 5AKGA 4EY4A 3P2MA 1ZD5A 1ZIYA 2Y2VA 1N5RA 2VT7A 3UUFA 1AMNA 4F60A 2CB9A 4C4ZA 2O7RA 1LNSA 2WG1A 4DMKA 4G5XA 2VJDA 1G4HA 2WIJA 4KE7A 4LYEA 5HQ3A 1W4LA 4UHEA 1WPXA 2ZSIA 4X92A 1L7RA 5JASA 5HK9A 3HACA 4FDMA 4RPCA 1AGYA 4DMCA 4UHCA 3ESBA 2XUAA 4JUIA 1YA8A 3D59A 2AJCA 5E4TA 2NW6A 2HU5A 2XUKA 2Z8ZA 5FPQA 3WK9A 3FCYA 4BRZA 4FNMA 3KD2A 4PF1A 1YR2A 4PO3X 3FSGD 1A88A 1WB5A 5YASA 5HF8A 3M82A 4DM7A 3PF8A 2DFPA 4Q3LA 1EHYA 5ALZA 3EQ8A 3AZPA 3R41A 2B61A 1BN6A 5AK3A 4LXIA 5AP9A 1HDEA 2XQJA 4CFSA 1LPAB 3PI6A 4GBGA 3RK4A 1DWPA 3WIBA 4J0IA 5FLKA 3LP5A 5ALQA 4X97A 5ALPA 1TCAA 3AIMA 3HC7A 5EHZA 5K5EA 3FYUC 1P0PA 2ONCA 3STVA 4NVRA 5ALGA 4L0CA 3S2ZA 5K3FB 1MU0A 5K3EA 2X76A 1QGED 1XRRA 5ALXA 5AI0A 4Q3OA 2GBGA 4UBNA 5EHQA 2PSHA 1W52X 3HZOA 4CIBA 4X6YA 5JATA 1VZ2A 4C6HA 1BEEA 1E5TA 3QM1A 1R4ZA 1UOPA 3DL4A 5LZ2A 3IUMA 3R3VA 3FNBA 4UBJA 5ALOA 2WHQA 4HAIA 5ALVA 4FBMA 5ALLA 2O2GA 3WWOA 1CIJA 2RONA 1MTZA 4K6KA 2VATA 3RLIA 2QUBA 5AKKA 2AJBA 3VVLA 1E8MA 4MJ3A 2O7VA 3WK8A 4MXDA 3IUNA 3G0IA 2EEPA 1UK6A 5AM2A 5AM1A 5DYYA 4AX4A 1EVQA 3IULA 1XRLA 1IUPA 4H7DA 3R3UA 4B6GA 1VXRA 5A6VA 1MAAA 5AKYA 1CUSA 5FUMA 2QRUA 1QIDA 2ACKA 1LZLA 1CUXA 5HKAA 2G5PA 2PKYX 1FFEA 1AUOA 1CUZA 4J03A 2XE4A 1VE7A 1DU4A 4FFVA 2C0PA 4U2GA 3DNMA 3BF8A 4QNNA 3HXKA 3FSGA 1VE6A 2BGNA 2PUHA 1QTRA 4X6UA 5JZBA 3QPAA 3G8YA 3ZI7A 4EY8A 5ALIA 4ZXFA 2ZSHA 2DSNA 2DCMA 3E4DA 5AK6A 3W05A 5AK5A 1GPKA 1NX9A 5CBKA 1XRQA 3RARA 4BAUA 3WKEA 1OILA 6YASA 3F67A 5KWIA 4S0XA 4ETWA 2EDCA 2OGTA 1YB7A 1VXOA 2EDAA 3WKCA 5ISMA 5AOAA 1Q0ZA 4Q05A 2WKWA 3L1HA 2QR5A 3FOBA 5DWDA 3DD5A 4HXFB 3BF7A 4UUQA 5AO9A 1CVLA 1EXWA 3R3WA 3G02A 4EA6A 4OYYA 1LGYA 4NS4A 1XQWA 5HF5A 4QLOA 4Y2XA 5C8VA 2ROQA 4J0DA 1XZIA 1DX4A 5AKXA 1WB4A 4AQDA 5A71A 1R9MA 2B20A 2GYVA 1O6GA 4UHDA 1QIKA 3WLAA 3QPDA 4QDTA 2ES4A 5AKEA 2HA7A 1LLFA 1LPMA 4Y2RA 3OTQA 1DQZA 1B41A 3GA7A 4OU4A 4U2EA 2JBWA 2XUDA 3IUJA 2W22A 3DYIA 3SWWA 2BUCA 4LYDA 2RHWA 2ZYIA 1CV2A 4ZGBA 5K3DA 1K5PA 5AH0A 3I2IA 5CXXA 3DDUA 3IBTA 1QIFA 4C4XA 1QIHA 2BKLA 1CUGA 2OCLA 5LP1A 2HFKA 4C88A 4YX9A 2WU4A 3AINA 4F0JA 3W9UA 4Q34A 4GWLA 1CUCA 3LCRA 5LZ4A 1EI9A 2XUHA 2WUGA 4X94A 2R8BA 4N5HX 4K6GA 4H7HA 3H2HA 3U1TA 1XQYA 2V96A 1QIGA 1DT5A 3W06A 4X6XA 1CFJA 1QFMA 5DJ5A 3BIXA 5EHXA 1WB6A 4X3CA 4LIPD 1MNQA 1RWQA 2I3ZA 1XKLA 3VDXA 3H2JA 4GDMA
chains in the Genus database with same CATH superfamily
3AO0B 1ESNA 4ZHQF 3OD1A 1GGKA 2VBCA 4FXOA 4BB0A 2NX2A 3ZN2A 3AL3A 2JEXA 3G5LA 4UEQA 4C7UA 2K7ZA 3AG4B 5KHKA 1NVBA 2CXNA 4EY6A 4UAUA 4YAWA 5L4SA 1B0ZA 2XWPA 3LUCA 4NS1A 4WLNA 5JPIA 3PUHA 3AH8A 4R2JA 5IC6A 2XDYA 5LBIA 3AM3A 3ZD7A 1FFBA 4B76A 1QZTA 2RGNC 4F1KA 4C78A 4ND7A 3O92A 1G6Q1 2EW1A 5THXA 1SIBE 4CLEA 5EIAA 4V24A 3L8YA 1U8UA 3PX2A 1ZKMA 4KQGA 4N54A 2F9MA 3CLSD 3R7LA 2C8JA 5HTOA 4R31A 5F3DA 1RXEA 4L5BA 4FPPA 1W25A 2EWVA 3L8MA 1D8TA 1P1FA 4FX5A 4NCAA 1Z28A 3HCCA 3AGPA 1RAFA 4UC0A 1U99A 2OB1A 3UHFA 2PNFA 3NGLA 2EAUA 3UGKA 1CHDA 4K9NA 3RTEA 4UAGA 1AQYA 4CLRB 5K03A 3CN9A 1Q1BA 3UNXA 4YN3A 3U7QA 5JZOA 2Y0PA 4W9MC 1FJXA 1A77A 2CK3D 3N07A 1RQNA 2O50A 1E58A 3HADA 4CI0B 1RR6A 1YIJV 2O2IA 3LBIA 3AY0A 4FDLA 3BJMA 4UV9A 1BRMA 4U3JA 1J2RA 1PGNA 2GM5A 4NPHA 2CXPA 3H5AA 3NR2A 3TW4A 4E21A 4KFCA 2CBGA 4IIYA 4Q0MA 2M1ZA 4J2OA 1TU4A 4L9AA 3MGBA 5BO5A 1KIAA 2INGX 2E82A 3V5NA 4NARA 4DLLA 1QGDA 1JAXA 1H0HA 1RKUA 2QP3A 1UKEA 3SYKA 5IVDA 2AN1A 1J90A 2HN9A 4HVCA 4DUYO 1KB9F 1W29A 2CFSA 4GR4A 1VBNA 5KNCH 3KYCB 5IF3A 3P30A 2Q8QA 2CK3G 3D3WA 3K9LA 1R6AA 2CUKA 4L78A 3KJGA 1VL6A 3OGCC 3OT7A 3Q9LA 1TYDE 1P9OA 3AFOA 3G3EA 4RVNA 5HFLA 3ROPA 3RUHA 1TOAA 1ENYA 5JSZA 2VYVD 3DE2X 3M0EA 5DW0A 3TAUA 4XDKA 4Z6KA 1HKUA 2PUTA 2VAVA 1SCUB 1CX9B 1DEXA 1M6WA 3IGFA 4FLEA 3ZDQA 4D6PA 3CRNA 3QKRB 3K9FC 4MPPA 1G0OA 1EWVA 4X1OA 3OIYA 3PZRA 5FWAA 3L7BA 1NKSA 3FG9A 3D3NA 3WIEA 2YIBD 5IE9A 1RZ3A 3BSWA 4FZJA 5CVUA 3U4DA 4EHBA 3HI4A 4F5DA 5CLIA 1A8IA 4KX5A 1ESCA 3I28A 4N7JA 2JFWA 2VWQA 2XCUA 2JD1A 2LDXA 2WHPB 3EN0A 4KAAA 4X5OA 5LB4A 4RDXA 5JD5A 3B85A 4DV0B 2ZJYA 1QYXA 3RKSA 3MCZA 1TCVA 1VJCA 3A4YA 4QELA 2ZJ1A 1HYQA 3KE8A 1MN6A 4F4JA 4ZBMA 1TKRA 3EYWA 4A0FA 4Y2TA 4AY2A 3CR3C 1AQJA 3O82A 5H81A 4GQAA 2BZ0A 4UQPA 4RXUA 4XOUA 5EIOA 3DLBA 4MKHA 1AKNA 5CLQA 1RZVA 2XMCA 3GEIA 1PV0A 2BDTA 2OXFA 2XGSA 3AEQA 3P2IA 1BROA 1LBHA 4D57A 4HY3A 5BR1A 1F38A 2QT1A 3G85A 3OT4A 4HSEA 2I62A 3N87A 4FFNA 4DQDA 4TUYF 4LA4A 1NDQA 3I55V 1W73A 1WNFA 3OUUA 4GOXA 3BQ9A 3D8SA 2ZBFA 3GNSA 2H1HA 1KAQA 2VZ8A 4L5CA 3R3HA 3NHKA 3LCCA 5C37A 3UMCA 2XRYA 4PC2A 3EC7A 1ZK0A 4CF7A 2X6CA 3C3KA 4ARSA 1WMAA 3E53A 4BE7B 2DMRA 4M0UA 4RHTA 1IBLB 4EMUA 3Q3IA 4PYNA 3CE2A 2FW0A 2MDTA 1PNTA 1VPLA 4MO2A 4M0EA 1XUQA 5IK2A 2EG9A 4FKMA 3U62A 1N3IA 2XI4A 4WH0A 3TSZA 1A1SA 2AC4A 1Y9EA 3TRDA 4P6VF 3FGZA 5BV0A 1KY3A 3GLIA 1RYZA 1NU1H 4EITA 4OKIA 4HAZA 1W1WA 3UV6A 2ZZNA 1G9XA 4JB3A 1ZAYA 5B4TA 2BUBA 4KVGA 4D25A 4RD0A 1E9SA 3C41J 4N01A 5HCUA 4LNUA 3R7NA 4LECA 4G1FA 4WY5A 2UVQA 2X9QA 3UPUA 1GRJA 2OZLA 2FQ1A 2ZD9A 1NT4A 3QX3A 5TY0A 3U44B 1PN3A 4GM4A 4NL4H 3HB7A 5IC5A 4JYZA 1HYEA 1R66A 4XFDA 1QP7A 2UYCA 2OY0A 1L4NA 1ORIA 2FR8A 3C74A 3C4JA 3D3KA 3JVVA 3NUZA 4RF4A 2HBQA 3WRXA 2AVDA 1IBRA 2HIAA 1WDKA 3L93A 2QPTA 4TVOA 3T7RA 5CVDA 1S0VA 5EGSA 3AGQA 4DZRA 1LJLA 4O02B 2VQFB 5JJJB 3AEIA 2DFKB 3AEZA 4WLOA 1T9KA 4BN4A 2Y4TA 2HF2A 3UJBA 3I61A 1WM1A 2HNBA 4WESA 1JPXA 4BVJA 4LP8A 4NFYA 1FYJA 3UVEA 2CNKA 3I9V1 5HWSA 2AZDA 1SQSA 2RC5A 5FBLB 2PX5A 6PFKA 4CKZA 2IW3A 1VRVA 3QO8A 2C58A 3KSZO 3MFQA 1Y37A 2PXAA 1CPYA 1IN6A 3EE6A 2J0UB 4ENWA 1JDTA 1DKOA 1YU9A 4N7MA 4RA9A 5ALHA 3WGHA 4XWWA 1DIGA 4GGMX 1W6UA 2BCCH 3EWAA 4TT3G 4FZRA 2I2WA 3V4OA 4A1OA 4C5CA 5AFSA 3GT3A 3DZGA 7REQA 4WIAA 4HS9A 5ERXA 4O25A 5HGXA 2IIVA 3AK2A 1B16A 2YR0A 3OFKA 4PG8A 5D01A 1AKWA 5GJCA 3LBFA 3HR4A 4KXUA 4MWEA 5E1AC 4H7JA 3FIJA 3P4UA 2JEZA 5E2AA 1MRZA 3OM1A 4U7DA 3QSYA 1XZQA 1JHMA 2P1RA 3S55A 1EH5A 2HC9A 3VPXA 2A9FA 4UVBA 1GAQA 1MOQA 1NVKA 1PR4A 3SPHA 1IOWA 2H48A 1WS6A 3KVOA 3P9SA 3QVTA 4MUGA 1I10A 3DR5A 1BT8A 4YWJA 4B0PA 1E3QA 5DBHX 4JI7B 1A95A 2XGOA 5K1ZA 4MUXA 3G9ZA 2EFHB 4GPD1 1F1BA 2I3DA 3QPWA 1Y66A 2W6ID 4B4OA 3W5BA 1EWYA 1KAOA 2WTNA 3OT1A 4D26A 1E4YA 3B77A 4GZ6A 1W9HA 2M2IA 3NBZC 4LY9A 1X80B 3WK5A 4DHWA 5FL3A 1BTOA 1LNQA 4DYDA 1ZRMA 2W11A 5FOWA 4BX3A 2IJJA 5CFQA 5JRJA 3AJ9A 4KOEC 1VQ5V 4YMIA 1WN7A 1SOMA 2ZU0C 1SKAA 1V71A 1N33O 3HPRA 4PLTA 1MF7A 4MPTA 4F5YA 2JDIG 4LZNA 4JLOA 1HNZB 3SP1A 3VNSA 4P81A 7YASA 5L8VA 4W82A 1N36B 2RGCA 3DZFA 3U4MA 3N6RA 3ZCVA 2CLIB 4QDXA 3TGPA 1UDRA 3LFHA 2WYIA 1SIOA 1P1IA 4OX9B 1I2DA 3LNCA 4FFPA 4BGDA 5J4HA 4UCSA 4I0XA 2ETVA 3FKQA 3FPCA 1CJUC 1JJFA 4CLOA 1JEOA 1N2CB 3T1YB 1QVGU 2VQDA 1PL7A 2NYVA 4X41A 3AVTA 3OFJA 4J90A 1C4KA 2D5IA 2H65A 4I2VA 3K09A 4L9WA 4AZ3A 2ATKC 1H05A 3R0ZA 3GGJA 4HDKA 4W9NC 2WUVA 3AF1A 3SC4A 4MKXA 2AFIE 3K15A 2X8AA 3SS9X 721PA 2HIMA 3PTLA 1AKRA 3F6EX 4N3AA 2RHTA 4FIZA 3ZVLA 4I8IA 5I01A 5DM6V 1PR3A 5G3YA 2IVZA 4BFZA 2JJ1G 4ASUG 4EYQA 4RIHA 1ECPA 4AUEA 3A3PA 1ZJZA 3SICE 3SFZA 1R8SA 4UVHA 3IBCA 3RFTA 4J16A 3BD9A 1JCHA 5KHIA 4RMJA 3COWA 3FRHA 3RG8A 3U60B 1EBFA 1JSRA 4MP6A 4NCHA 5J59A 3VKHA 3FPKA 3OEWA 4YNBA 1WABA 5E1MA 5JCZA 1TTTA 1OX4A 2D54A 3TZQA 4E4RA 2XCIA 3O65A 3IP9A 3A1FA 4HMQA 3TN7A 4ITUA 1T91A 1E1QD 2B37A 1PEDA 3SLKA 1I7PA 4DA0A 1U2ZA 3ZGXA 1RS0A 2IYPA 1E1NA 3BILA 3IE2A 1BGVA 4IZOA 1NONA 1IMJA 2Z2YA 4QHSA 2JEOA 4RQUA 1MQAA 2HYIC 1A4RA 3OTWA 4RZ2A 1E99A 1XTVA 3W8DA 4D45A 3HTXA 2P5TB 5E2BA 1LH0A 2ZIOA 3L01A 4FCTA 1DNPA 5LMUB 5F3RA 1VDZA 4DSZA 4KN6A 3TGLA 1XTJA 2Q9BA 1GA1A 3DP9A 3AG7A 2WJWA 3C3EA 3C5CA 5B37A 1H3EA 2JGLA 1W85A 4BNDA 3S2EA 2UZ1B 3TETA 2YMQA 5T6BA 3D6NB 1U0BB 2WAYA 5B3JA 3N70A 1SZXA 1KO7A 2PF4E 1AI7A 3AUUA 2FPXA 1GN2A 4CS2A 3MTIA 5EZ5A 5K4GA 1CS0A 2EXXA 3MWEA 4G0XA 3Q72A 3KKKA 4PWYA 5B58T 5JRZA 3FZQA 4UZEA 2JFQA 1T9CA 1LV8A 1J20A 2ZIVB 3X3HA 2P5OA 1WMSA 4K26A 3DKIA 5LD2B 3Q7SA 2CVOA 3ZN0A 3BZUA 1PTJC 4P32A 5HKOA 5BR8B 4ZVTA 2I7TA 4GYWA 1EGAA 1RJGA 3QUBA 3HCOA 3R7FA 5DN6A 3VA7A 1QQBA 4LXYA 1EJ0A 1B8OA 2E3JA 3QJYA 2GN6A 5DM4A 1VQ8V 3T1TA 1TW2A 4TTSA 1NQXA 1RDFA 5I5GA 5FO0A 2Q67A 4NBRA 5GONB 4J49A 2ACEA 2J9FA 5C2JB 5HX7A 3VPDA 2ZUWA 3HCRA 3P71T 5AHKA 2IH5A 3EEBA 3U3ZA 2OAQ1 2AFHB 1BE6A 4EPVA 1EN6A 2C20A 2O3JA 3BHNA 3DFZA 4PHFA 5COAA 4IH1A 1SNYA 4WOBA 5F1KA 4PN3A 1W96A 3CVOA 5LVAA 4BY9E 1Q6UA 1X80A 4CEIB 4ZVNA 4CR6A 3H3JA 2HCFA 2Q3BA 4YCLA 2F64A 4BO1A 5AW6A 5DLQC 3WYFA 4WK2B 3T4XA 2H1RA 4F7DA 1JQ5A 3H75A 1K63A 1NQOA 5B64A 1KRWA 4YHHB 4ON9A 1JIVA 1FS0G 1JSZA 2BGMA 1QVWA 1T3GA 5IZCC 1ICEA 1KQNA 4L2IB 5T4FA 3GWGA 3EA4A 3B38A 4LAFA 4GICA 4K8XA 4RK7A 2H18A 3CUWA 3VZDA 1IDOA 4B5KA 4OYRA 4UTPA 4FM2A 4IUCS 2O07A 4A2CA 4NZZA 5TMEA 3GAMA 4MHTA 5F7XA 2UVDA 2X8JA 4FB4A 3QX9A 4R2XA 5K6RA 3DLPX 3VNBA 1BVHA 3B2EA 3L43A 2ZB4A 3EG9A 4P5PA 1JHPA 3AFNA 1LJ8A 5J43A 3R6TA 3WBFA 1XL0A 3TCXB 1ZR2A 2CTRA 4DY4A 2O4UX 2JIZD 2NVWA 4EFLA 2XUPA 3OA0A 3QXHA 1ZL8A 2XADA 1Z74A 1MAWA 2P9ZA 1NMEA 4LQDA 5LYYA 2P2NA 3R77A 1SCQA 2WQZA 4AMGA 4YPOA 1QJ4A 2FUEA 5J4LA 1MOSA 2P77A 1VHJA 3IB3A 1NFRA 1M5RA 1RBYA 3UJ9A 3A25A 1QYCA 1ZM2A 3GMTA 4QPJC 3USCS 5TJHA 4DLRA 4PG7A 4B7AA 5M2QA 5A4IS 3EK2A 2WYOA 3L1VA 4LY6A 2HPZA 2AUMA 2XAJA 3AKCA 3COSA 3O8OA 4HOYA 2H4ZA 1HO3A 4JP8A 1AR1B 3GZNA 3U48A 2YIAA 3X1MA 1NTKH 3AW9A 4Q37A 4EI7A 4B3MO 4EY7A 5CCDA 3TTWA 2NQTA 3OC0A 4A92A 2B2NA 4IDNA 4RIFA 1G5QA 3DB2A 4GHWA 1QJCA 1YZGA 2WJHA 4I2NA 4QZVA 4UZFA 1MNGA 3A1DA 4EAAA 1CY2A 1PL0A 1BE0A 2Q5QA 3E1GA 4KGZA 3CCSV 5EVCA 5LP6C 4JOCA 3RARA 4LTMA 1B15A 5L9AA 2OBNA 2QVXX 3MUOA 3LVBA 4U39A 1BWPA 1CQPA 4ZOBA 4B3RB 3QF7A 1M4UA 4WBNB 3FOEC 4NCIA 3K7EA 5K2MA 1SXPA 1U7PA 3OOSA 4R7ZA 1OB5A 4ETNA 3G8BA 3N86A 3EVZA 2H54A 3O47A 4IZIA 3UIEA 5C8YF 1Z5GA 1HNWB 1Z9BA 4RTRA 1L0LH 1QQ5A 3MUNA 5A9TA 4KR3A 2RGYA 3HM9A 2PRZA 1K6MA 4FXPA 2H5EA 2JFGA 2WK1A 3EY9A 4BGUA 5CFLA 3L7LA 2ZWMA 3F1KA 2F9LA 3MMNA 2GD6A 2D8AA 1XCLA 1RLIA 1X8LA 3P4XA 3K0DA 2JW5A 3HL4A 3UHPA 5KAFZ 5ITSA 1NVMB 3ICQB 4ZEOA 1I5YA 5GV7A 2PLFA 4UUNA 3SJUA 3MTEA 1AZTA 5EXXA 4UJ5A 4HWOA 3OMAB 4F8JA 4HAUA 5MN6A 1Z6AA 2XOEA 5CNKA 4HGNA 3L4BA 2CH7A 2BGRA 4O5AA 2IA5A 1Z3CA 4GI7A 1RZRA 1YTFB 2LWIA 3LY5A 2ZUSA 3QPUA 4KDFA 4LW8A 4Y6SA 5IN4A 3O4JA 1KZ6A 3O4VA 3B8HA 1DAPA 3L8EA 2ZB2A 3ZV6A 3IRUA 3I6MA 1XD8A 4BGIA 4US1R 3DFMA 2YXLA 2O3RA 3HU5A 2V4UA 5A7HA 3RV4A 4D97A 3E3AA 3RSGA 2H0QA 1O95D 4OK6A 1P75A 4X85A 2VHEA 1PX0A 2Q2OA 4LBZA 3KLMX 3M2PA 1VI5A 2W4QA 5LP6B 1A5TA 4UCXA 1VMGA 2WAOA 3AF2A 1M2KA 4QPCA 4QRDA 1YBVA 4I9HA 4RX1A 2X41A 3W1EA 4G9GA 4ZOQI 3JALA 2IX9A 1KP2A 3VKGA 4PSKA 1CJMA 2QMHA 4OHWA 2QLTA 1ZW1A 2M32A 4EAQA 4PLYA 4OHPA 3EXG1 1O89A 4MVOA 2PKQO 5B12A 1BSMA 1XXHE 4D8UA 4L6AA 3ASYA 4UE3S 4G5RA 2GB4A 3GEEA 1JEYA 4OQ4A 4CMEC 1GT6A 2A88A 1GPLA 1PE0A 2VT6A 2VI5A 3EC1A 4I5DA 4NBUA 3SX0A 1EKXA 1NE7A 4UB6Z 3FMGA 3PDCA 3WTBA 2E89A 2RAUA 2IS6A 5DX1A 3ER6A 3VQYA 5HF9A 2Q29A 1JIUA 2QEXV 4KHPB 3GX1A 1CP2A 4NZ9A 1YCIA 3SQLA 4O6VA 1FVOA 3P9RA 4I4IA 3OURA 3ZDXB 1GM5A 3DEHA 4XWOA 4YCMA 3IMFA 4PXSA 3TDMA 2FR1A 2CSUA 4IIJA 3F78A 4QUJA 1PFQA 2AJ8A 2JZCA 2L18A 2SKDA 3U7QB 1FRVA 1MD9A 4AP9A 5A3RA 1GQSA 1CXZB 4IIFA 5DBOA 4Z3KA 1G20B 2QPLA 1BQ0A 2IYVA 5DHQA 4YIPA 2FPMA 3A32A 2OQVA 1U2PA 1I7DA 3RG2A 1VLLA 2D8MA 3TL3A 5CYOA 3FBWA 4MPDA 4C0WA 1FFXA 4JR0A 2PD6A 4YCBA 1I6LA 4R8LA 4C9BA 1MFZA 2EYQA 4ZKEA 2EATA 1N78A 2WPNA 5DGXA 1CUBA 1I7LA 4HNQA 5DN6D 2NO9A 1JDZA 1YTLA 2RJZA 3E0QA 4UEKA 3SFVA 4IS3A 1U31A 4N76A 1RMTA 3HJFA 2QX7A 4DV2O 3IALA 3ADCA 3ZLVA 3OZSA 1K2WA 4ISBA 2H2GA 1O2DA 3TL2A 1LBSA 4ALMA 4YRIA 5K0EA 2DMXA 2OORC 3I6BA 5G1OA 1BVUA 4CE6A 5CD9A 1DBPA 3B5IA 2W70A 4E12A 1LU9A 4JBNA 4FFOA 3X1XA 3VQXA 3QYAA 5CNIA 4B6FA 1RFYA 3BPSA 3IODA 1PJSA 1GV0A 3LNNA 5CT6A 3ZWQA 1G2PA 3NHYA 2FYTA 4AYTA 5FNVF 3C6XA 4MUHA 1NMSA 2UZAA 4GM1A 1F6DA 4OH1A 1B3QA 1UL1X 3E84A 3A2MA 3UFXA 4ANFA 5C5IA 1IHUA 4CKBA 4P86A 1QCCA 4K9OA 2AHRA 3GLRA 1HEIA 1UJWB 4PSUA 3TQIA 1MZEA 4M60A 5HZHA 3GLVA 2Y4UA 2ZJZA 3BERA 1CKEA 2MINA 3LHFA 1O4WA 1A50B 2YQ4A 1DAOA 3HXOA 2IUFA 3AP1A 3R8CA 4DWJA 2QENA 5I7UA 3MCUA 1ICIA 3EPLA 4N0EA 4ER5A 4MLZA 3I37X 1W0CA 1WSDA 3R4CA 5KKCA 3AXTA 1PUIA 2MU1A 1D6NA 3HKDA 1SXJB 2QD5A 5E4FA 3PLAE 4ZD6A 3AETB 2ZPTX 1E1KA 2OQIA 5C3MA 4EH1A 2FF7A 2IF2A 4MTGA 5H3CA 1KZ4A 4TXLA 1C9JA 1L7XA 2BFEB 3RB8A 4MUEA 1E94E 1JA8A 1WV0A 2FTKA 3IXQA 4PY2A 1GG2A 4EFEA 5CIYA 3DT6A 1BC5A 4WA7A 4F9GA 4JYMA 1NVWQ 4FMCF 3X44A 3HN7A 1Y3HA 1QFZA 1VJ0A 4EDHA 5B1AC 1ULBA 4IL6Z 2V9ZA 5IYZF 5JXJA 1OT5A 1SZDA 3G17A 1S0UA 4GI5A 1N1GA 3DVSX 4N0DA 3LUBA 4RU1A 1KMHA 2B5VA 1XK6A 5LQRA 1UFRA 5LGNA 1L7QA 1M1KW 3M6IA 2IWHA 3G9XA 3U3JA 5EIXA 1QFSA 2W6MA 1A8HA 3OY2A 5LHGA 2HU7A 2N9UA 4PVCA 2R66A 3SXUB 1SQXH 3FAVA 2JHCA 4CMEA 1IY1A 2V7QD 3C24A 4WK0B 1QV7A 3CBGA 5HNKA 1TAGA 2OHXA 3R3XA 1ZBDA 3A9VA 3EF0A 1MG1A 3OTFA 1AU9A 4JL5A 4KIGA 3FHCB 1XI1A 3O3NB 3E22A 1VL8A 2J31A 2W2PA 4ND5A 1SFRA 4RNCA 3NVDA 1W44A 2Z04A 2ZM5A 4JPRA 1AKTA 3PU6A 4LXTA 4WZBB 2J09A 4ATNA 2N0SA 4CN8A 1C8VB 2OVFA 4H1WA 2UXNA 4X89A 1GRNA 1OX5A 1WCV1 2JFUA 3NV7A 2I87A 4G0VA 4NATA 4B4DA 4N8SA 3ZIUA 3MSXA 4J7JA 2IYRA 1KC8W 3GFSA 4X90A 3OCJA 2HTEA 3C43A 3V8NA 3DLHA 5L3SA 3EIEA 4EWLA 1VMIA 2R1TB 2AMYA 2R72A 2CDRA 5CCXA 4JBIA 4QDJA 3RVPA 4EG4A 2ORYA 2BEWA 3D6HA 2WSBA 2WFZA 3KJEA 4TL7A 4P4GA 5JYEA 5CG2A 5HJ5A 3V2HA 3UM7A 1V16A 4KSBA 4LCUC 4Z9FA 4KN8A 3IIIA 4CVNA 4EEZA 1AB3A 3NU1A 3AI2A 2JEYA 3BGOS 2CHGA 3IEPA 3B5JA 1PEAA 4P22A 4REOA 1CJBA 1PR0A 2DBZA 2R7MA 4XD2A 2Q68A 1KE2A 4M9UA 4X8LA 3RK1A 3E22B 1TZKA 1ZL2A 2GO1A 2XD9A 4WDRA 3TRIA 1OQAA 3RU9A 2HL6A 1ZSYA 4LJ9A 5IKXA 4BX9A 3NNDA 3AZOA 1X9IA 2EV9A 1IDN1 2RCNA 2RJOA 5COQA 2E4ZA 1A9ZA 2J3QA 2HHAA 3FWNA 4H3KB 4D9NA 2P4SA 2WT9A 3WWCA 1RPAA 4G0YA 4LMRA 4FFDA 4XPZA 1QE3A 1QLEC 1Y5NA 4JLJA 2NTJA 2Y6UA 1G7CA 4DNOA 2VRCD 2I29A 5DXAA 4ZZ2A 5KNBA 1LQ2A 3GLGA 3ZWOA 4QO7A 4Q4HB 2YS8A 2FPIA 2F3TA 2IJHA 1S1MA 2YFYA 3PJDA 1F2UB 4U7GA 2F1MA 1FRFS 3JR3A 3T35A 1Y74B 4UDXX 4E6PA 1A82A 3NWJA 3U6BA 4DR1O 1FSFA 4J7AA 1QVAA 2BP7B 2G07A 4NTXA 1V9CA 1K8QA 2FPUA 2ENWA 4LXXA 2IH4A 2VQEO 1T6XA 2IOHA 5H1YA 3Q8WA 4YAOA 4HPWA 4V0RA 5SZIA 1US6A 2DJIA 2J41A 1TK9A 3OZTA 3CMEV 1R9GA 2R5NA 1U3VA 4HCJA 1UODA 3OR7C 3V1TC 2I67A 9LDBA 2Q7XA 4JNCA 5L40A 4GNRA 3QMWA 1VSTA 2H11A 3OIVA 1IMOA 1L2TA 3LPLA 4NENA 2J3DA 1J21A 1JEEA 2J4DA 2XIQA 1ZEJA 4WNCA 1Z07A 4HTFA 3I72A 5IJ0B 4F2HA 3WOHA 2BMDA 2A3NA 1FYXA 1D4OA 3PPXA 1VMKA 2FX3A 4NULA 5FLEX 2ZJFA 4E2XA 4OX9Y 3W04A 2BYTA 4C5BA 4D6TH 2QX9A 1FXKA 3CF4G 1R5BA 3QJ5A 1X1QA 4OSOA 4X7RA 5TE9A 1IXZA 4BMPB 5LHIA 4U7FA 2D1RA 1KFEB 4AJHA 1NC1A 4I9WA 3ZRWB 3KQUA 1RPRA 1AE1A 2XDQA 2PAAA 1M9NA 3ND9A 3UA4A 4BJ6A 3U3OA 4MARA 3CCBA 5HRAA 2DVMA 1A1VA 1A76A 1M75A 4XASA 2GYUA 3ZOKA 2VIIA 3SHVA 1U0HC 1USWA 3K06A 2VKTA 3CJQA 2Q5LA 5M34A 3H8JA 3H6KA 2E76B 3OBBA 5EL0A 4YR9A 4D0LB 3DAFA 4WY8A 2R70A 1YB5A 1JLHA 2WD7B 2IOFK 1OH7A 3CONA 5DGTA 4BBAA 3U44A 3WG9A 1WXXA 2IP1A 1JDJA 1KF0A 2ZWAA 3FMPB 2QL9A 1HTWA 1M76A 1WSAA 1OWPA 1VBFA 3QKRA 2F93B 1DUIA 1ISSA 3FFXA 3HHEA 3R3SA 5TPZD 3ZS9A 1YSCA 5CDYA 4XVRA 1ZCZA 2AZMA 2DJVA 2QD4A 2XYPA 2JFBA 2CXUA 3IV6A 4M1ZA 1E7SA 3B1XA 2XBLA 3LO8A 1N6OA 1K3FA 1JJOA 2A1UA 2XWBF 4MAMA 5B57C 5I47A 3ONEA 4RK1A 4HZUB 1G0NA 2FZ4A 3M6FA 3LXXA 4XQGA 3SG0A 5CA1F 3INRA 5HIMA 1AHIA 1IZ8A 4A5OA 3R8XA 3VFDA 5HRUA 3GLHA 2OTLV 2X3UA 4S0ZA 2W37A 1UWCA 5C81A 1SD5A 5DCLA 3TTTA 2SCUA 2MOKA 2PZFA 2V6BA 2XLBA 5FAXA 3MTJA 4ZYXA 4XDHA 4O1HA 5CT9A 4DNXA 1HDXA 1E2DA 1X2EA 2AG1A 3AHEA 3IQWA 4K5QA 4V38A 3G0DA 1ZD2P 3LRPA 3E58A 4LX8A 1AF4A 1PHPA 5L4LA 4X1IB 1D4ZA 1Y34E 4OHXA 2FUG1 5D3ZA 4I55B 1UK8A 2P91A 5C18A 1EWTA 4AS3A 2DUJA 1Z2GA 5IEJA 2GK7A 4OK5A 4W5HA 3G0HA 1QC5A 4ZU1X 5KYYA 3OE7G 3UT0A 5K8JB 2GVZC 3IC5A 4R8RA 1D9XA 1MJGA 1SKBA 1MAVA 1K6XA 1PTJA 1V8PA 4W5NA 1ZGZA 4DRXB 1AV7A 1P2VA 4MKFA 3NKVA 1KPHA 1AKEA 1TGOA 4RZ3A 2X1VA 2FLVA 3UF0A 4YT2A 1SUDA 4JYAB 4I4TA 1JR6A 1G7RA 1O1YA 1P61B 1TYCA 3FNEA 3H5VA 4UKDA 1PVDA 5JEDA 4OL0A 2RDMA 5IK2D 4EENA 2BFFB 2QTBA 3HP4A 4X20B 4A8JB 3TPZA 5J58A 3BABA 1TTQB 2AKEA 1TVKA 3BWVA 3I53A 2PQ2A 1KR5A 3I2JA 3CZ9A 5I9TA 1CJVC 3OQNA 1X59A 1VP7A 4IQ8A 1VQLV 3K2QA 2NUPB 4Q20A 3K1JA 3OU6A 1TA0A 3RS0A 3UB2A 4FK8A 2AMJA 3ZLBA 3GLQA 1ATIA 2DYSC 3C4VA 3KHKA 2HSWA 3FWPA 4KCGA 4C4SA 1D2NA 2BFBA 3ICVA 3IQZA 5C7IO 1JSLA 3HLYA 4RQEA 1GGMA 4NTZA 4W7SA 1L3IA 1JR3E 3UO2A 1PWZA 1XNHA 3PKJA 3PUKA 4JLMA 4RTPA 1Q83A 4KP7A 3UC9A 4NXMB 1VSVA 1PJAA 4B3TB 1AROP 4DCNA 5KU7A 4BNYA 2WVAA 1XOIA 2JKVA 3U4QB 4CBCA 1PLJA 2SHKA 2WFMA 2WQ7A 5KTTA 3W7SA 4PX9A 2BFOA 1G4AE 1S2GA 4G1MB 1LPSA 3RN4A 1SKYB 2WJYA 3OQVA 1QHFA 2EIKC 2PTHA 2VJMB 1H2FA 4PRYA 4D3ZA 1MT3A 3ZYCA 3KSUA 1HQDA 1AQIA 4QARA 3V80A 3VR2A 4R1TA 1J2TA 2VTDA 4DLVA 1K9VF 1Q1NA 3VBEA 4PYLA 5EMLA 1K1EA 1UXJA 3DUFA 3STXA 2PG3A 4QOFA 4URHA 2IIPA 3T0FA 3D43A 3R0VA 2AG5A 4V3CA 3ELWA 4DZTA 5LM3A 4N5IX 5AKHA 2X19A 1RFGE 1XMSA 3MRSA 3ZNNA 1R64A 2GKOA 1QRAA 5BWBA 3S1SA 1QGUB 3IAS6 4PA6A 1PD3A 2BRUA 2BM1A 3LA8A 4L4YA 4ZOLF 4OB8A 3WL5A 3ZZUA 3CMCO 4EW3A 3GAZA 4G8CA 1XT6A 1HYBA 3TRFA 5PGMA 1VF5B 2VUUA 1XDBA 4ECEA 1VHDA 3M1YA 4DV7O 3QLVA 2OO5A 4TV8F 4YY3B 4C1NA 2RHLA 1T5SA 3X2EA 3HYLA 1H1DA 2KLHA 1UZUA 3QMPA 4LF5O 4MW7A 4FI3F 3IJ5A 1L8DA 1ZMRA 1J09A 3QVOA 3R24A 3BAAA 2DTXA 2JCSA 1L4FA 4LCJA 3TM4A 5EYPA 2JLSA 2J0SA 4V0ME 1T9ZA 4FPXA 4LQLA 1NX6A 1Y9JA 2Q6AA 4BFLA 4BCBA 1QDEA 2F3RA 2Y05A 1TECE 3LPDA 3CPJB 1Z5UA 2C3UA 1B3BA 3DUFB 4A8JC 2YNMA 4MI1A 2G5GX 3AEQB 3DLCA 4HPXB 3ZKAA 4RAIA 3BXGA 3Q2KA 2N74A 2X6QA 3EA5A 4J0JA 4HJRA 4P0TA 4GR9A 4YAKA 2AOUA 2GNPA 2ZIZA 3BC1A 3EMBA 4EGFA 2RGXA 4CL8A 3FX7A 1OU4A 2XRFA 1OWOA 2PRJA 1FUIA 4UARA 4GZRB 2V1XA 4K46A 3EOAI 3HWSA 5E8JA 1EMDA 4WFAV 3KU1A 2C3OA 4FGZA 4IYHA 5IYDO 1F0NA 3U6KA 3R9XB 1BW9A 3KSDO 1TA4A 3R44A 1GKIA 3U49A 3I9NA 5CYGA 3UY4A 2FAXA 2PSFA 3UBTA 3R40A 2QLNA 4B79A 1KA9H 4FS8A 1P5RA 2GAJA 4IVQA 4DMFA 4Q21A 2EJBA 4ETMA 4O0LA 1WCIB 2A6PA 4M9RA 3V8EA 1NATA 3BVPA 3QIAA 5JZ9A 1AX9A 2ZYGA 3L8GA 5F2EA 1KSFX 3FCAA 4PDLA 4K2AA 4QGHA 3M9WA 3ZXIA 4KRXA 3VAZA 4EBFA 4HGPA 3NETA 2IS2A 3O73A 4UMDA 2V74B 1M6YA 2Z6VA 3OHSX 1L5GB 4LE1A 1JDUA 3AF6A 1FMFA 4ZIRA 4FT4A 2QTGA 3TECE 4TV9A 3GDHA 3KXIA 1BHSA 2C5SA 2V0NA 3VR4A 821PA 4LV6A 1QQAA 1COZA 3MJCA 2DBRA 4PC7A 1A71A 2YOFA 3H1IH 1V3UA 2AZTA 4R40A 3TNLA 5KI6A 5IM4A 3IC9A 2DWUA 4HK4A 1JL3A 1YUMA 1SVIA 3AHDA 1U9JA 3H1BA 4ONEA 4TSKA 3KTAB 3VHRA 2VP0A 3GFQA 3R5JA 5EIWA 1O6FA 1J42A 1QKIA 1QMGA 4IO0A 3W5SA 1EDEA 4DRXA 1FXKC 2C98A 3JZIA 2R4UA 3HZHA 1EIZA 1KQPA 3NX4A 4BP3A 2PD3A 3IHLA 4PC3A 2BHNA 4BV9A 1I2ZA 3OFNA 4OM7A 3I04M 2ECQA 4ZI7A 1E20A 5KOYA 2Q1XA 2C4MA 2HA0A 1ZJWA 2AZ0A 1MZFA 5GONA 5C8YB 1U4NA 4RQBA 5JAPA 1BS1A 4C1BA 4UFPA 1BD4A 2ZTMA 2M1XA 1P2DA 2J0VA 4LC1A 1PEKE 2COEA 3CEPB 3GU3A 3HCFA 2G1KA 1KC3A 4Q7EA 4TMFA 4GE3A 3EF3A 5D3KA 1BMQA 2DHQA 3CGWA 2ATIA 3B36A 4G1CA 5CHEA 3RFUA 3SC6A 2C9CA 3PFNA 3GIDA 3P20A 1IVYA 2Z5UA 2JFZA 5K0ZA 1GKKA 4CMGA 1DAHA 1OLSA 3KFVA 4JJEA 4NU8X 1MX5A 2W90A 3D0KA 5DK6A 5C5CA 1OYYA 2UYHA 4W1RA 4MYHA 2ZUTA 2V3WA 1KS9A 2AK2A 3AB7A 1XN1A 3PEEA 3AG3B 3L46A 3OO1A 1NVAA 5CTJA 1R3LC 4AO7A 4E6EA 1FSGA 1I6WA 5D85A 2I1VB 2JGNA 3MJVA 2YOHA 5ALYA 5KYXB 5IAKA 3JVDA 1LDYA 1PFYA 4HVTA 1TZCA 1QYIA 4XYBA 1H2AS 2HXYA 2OFOA 3E9MA 4P7JA 4E33A 1ETHA 1THMA 2LIPA 4ESHA 1X1EA 3UO8B 2V3CC 1UFOA 4E5YA 3ETHA 4CCAA 1N34B 4MI9A 4XGQA 3NHPA 2YFQA 1ML3A 3TLZA 4QUKA 3FVWA 1M8FA 3NI2A 2RGDA 3L8HA 3SF8A 1VLHA 2POCA 5A9GA 1TIPA 2ETXA 3TIVA 4CM6A 4IQGA 3WJ2A 5A4AA 4ESVA 4KLAA 4PHCA 5IM4F 3B8NA 3MLEA 4MYSA 3JAWB 2O4CA 2QRMA 1YBMA 2VBFA 2YXHA 3SQMA 4A4DA 1AY0A 1T5TA 1C7QA 3FKJA 3UHOA 4OU5A 1KS2A 1Q3KA 2NVUB 2E87A 3AJRA 5CH8A 1B23P 4MB6A 4M7PA 4WFKA 4A15A 1R3KC 1XDCA 1Z2NX 1PL8A 1FSSA 4PQGA 4F3TA 2FK8A 1NN0A 4WFIA 2NZVG 4UM9D 3GJZA 2PY6A 1R5JA 4TL8A 3K3PA 5ALNA 1UFVA 4G4SP 4HQOA 3TNFA 3VO9A 4C20A 3UMRA 2H52A 1XZBA 4BEJA 1IG0A 2P06A 1OVGA 1RYNA 2GS9A 4NDNE 1V8FA 4XOIA 2HRBA 3PDHA 3GJRA 4PA7A 3BH6A 4KAJA 2OYCA 2A9KA 5BRNA 1ZJ4A 2E6KA 4AXXA 3A9TA 1YVPA 8ADHA 1U9ZA 2UYYA 1N25A 4M98A 2AN4A 2PGOA 1G8JA 2HLHA 2PRIA 1QKKA 1QO9A 3JAWA 1SULA 2B1QA 3B3GA 2QM0A 3GK3A 1CQIB 4RM2A 3WHIA 4DDMA 5J2TB 1ESDA 1QX4A 1R4NB 3MNFA 5J1TB 3H1PA 4DT1A 4IDPA 4KK3A 1M1XB 2P79A 4LE0A 1Z68A 1KJWA 2P3LA 3I76A 3M5WA 4LZLA 3D7MA 5E1DA 3HXTA 3CLUC 2G0AA 2I8AA 3UJ3X 4DSTA 4JI1O 1GQRA 2QN8A 3CLRC 1W2BU 2FMUA 3SYPA 4DS3A 1B6RA 1C1XA 3QF4B 5B5EZ 2VAWA 4RMNA 2HIGA 3HA7A 3KOOA 4PC1A 1XEQA 2FPRA 3GVPA 2VHCA 4NE7A 3ZU2A 2Y76A 3H0CA 3O2SB 2YXBA 2DLCX 2XCSB 1QF6A 3K5WA 1BVYF 1Y89A 3UICA 4WKGA 3WTCA 3E7DA 5JZVA 4D6XA 1K5QA 2C9MA 2ZRMA 4HZIA 3AFGA 1ONSA 3TSWA 4DBVO 1A7AA 3IEUA 1SOUA 4P0QB 3H7AA 2FJ0A 3JX9A 1PYOA 1USUA 4KV9A 4TQUS 4YBRA 4KWTA 3C4QA 1P73A 4D79A 1DG3A 1U1CA 2PIAA 1CU1A 5TB5A 4HYYA 1ZOOA 1O5TA 1SO8A 1V16B 1C3LA 5IYZA 1ZNXA 3E5NA 3JQBC 4CCYA 4LRUA 3W5UA 1ZWLA 3AYXB 2HJ9A 3FHOA 3GG9A 3DVAA 5B2FA 1QU7A 3UTDA 3R9XA 2Q3LA 1JHXA 4DARA 4XJTA 4D3FA 1XMQB 4OQZA 5AT1A 1N5MA 3CRAA 1T13A 2X58A 3HLTA 2XODA 2XKKA 4PIVA 2VWPA 2JI8A 1KR2A 4W6QA 3HE3A 4DVGA 1WAZA 1KEEB 5BURA 1WW2A 1FVFA 4QYIB 4V0OA 4DIBA 2AFIB 3PHBE 2A1TR 2JLBA 4GBED 4J7CA 4XYGA 5K0LA 3WYCA 1C9MA 2J9ZB 3E3MA 4PZ9A 4CR8A 1D5WA 1MJFA 5EBWC 2H2WA 3PGMA 1XRSB 4TZTA 3RSSA 4Q3AA 3ZWYA 3RO7A 4EW6A 2BMEA 2FZWA 4KXLA 3MUFA 4KVFA 5AW4A 3KWMA 2NZ2A 3QOWA 4YMHA 4P0PB 4ZOLB 4FZ3A 1C5KA 2C7BA 2LW7A 4FOSA 1GDDA 2BSXA 4CRWB 2HQOA 4M9QA 1TZ2A 4H0LB 4N41A 4UOQA 5ITVA 5KUKA 2AR7A 5DMHA 2ABWA 2HK8A 3EXEB 3C1UA 5KYNA 3HPLC 1NXXA 2OGWA 1HE3A 1SXJA 2X5XA 3LX8A 1VOTA 1WCYA 2DPYA 2ZRNA 4G63A 4Z3DA 1VZ3A 1QHEA 3QVNA 2GHRA 5AOVA 4YJ3A 4B3XA 3OX1A 4IJVA 3PD0A 2NZ8A 3O7WA 2NO6A 3H1TA 4RJLA 2IQIA 5EJ2A 2A9QA 1WULS 3H2IA 4QDOA 4WNAB 2AN9A 2VNHA 2I2BA 5CVEA 5FFMA 1PBTA 1QG4A 1YDFA 3LCUA 4DPKA 4EPXA 1M3SA 2FMHA 3WHKA 3V6MA 5BVGA 1K2VN 4PYRA 4QPZA 3F3YA 3GB9A 3PJSK 1DEHA 3H1EA 5F1YA 1P2UA 2X1LA 2QTLA 2H51A 2YUAA 4FI3C 1P3Y1 3KB6A 4MIYA 5AQEA 1X13A 1NBAA 3AESB 3IX7A 1YS2X 3JR7A 3JY6A 1KKMA 2Y99A 4UBLA 1XTPA 4XUEA 1LR1A 5KYKA 1DIHA 2Y0CA 2NNWB 3BTSA 4N39A 4YFVA 1Q1GA 1BGYH 1V25A 1GFZA 3MBKA 4E13A 5A05A 2YASA 2R8ZA 3LT1A 5TEWA 4CS4A 1Y8RA 1FA9A 4N3GA 1LV7A 2C2HA 3OP4A 4ZT2A 3RLFA 1MPTA 5D51S 1FXWA 3UQYS 3PB3A 4OXSA 2O8BB 1WPBA 3IR7A 2EULA 4XYMA 4JENA 2BCGY 4J0GA 1Y5LA 4TTQA 3WGLA 1EESA 1G4YB 3U10A 4X71A 5EUQB 4F6CA 4DSAA 4GI2A 4BCCA 4IOMA 2CJFA 2H5IA 1RSOB 3FDFA 4GNKA 1PJLA 1JOYA 3STWA 3V3TA 3PXXA 3S7TA 4BC0A 2QGFA 4WDQA 3NWPA 5DK4A 1E7RA 1GMGA 4JIMA 1IZ9A 1H2EA 2GUZA 3EH2A 4NJMB 1R00A 3QFCA 3TX6A 1W0JD 4C6RA 4DG9A 3DH0A 1KPGA 3DWIA 4E5SA 3WP0A 4WZZA 2EU8A 4F9TA 3LK7A 4CT5A 4EEQA 1HORA 3EOZA 4EQ6B 3KS9A 1DG9A 4CUKA 3KDSE 1SXHA 3A6EA 4HMOA 1MOPA 1GVHA 1JS1X 2FEPA 3ABKC 4I50A 1IAQA 2YINC 3D8UA 3F90A 4KDRA 4MV1A 4C0KA 3NTUA 3RAFC 3E1SA 3H1LH 5EPUA 1S9HA 1FCJA 5IAAA 2OL4A 2DE0X 2PGAA 2D74A 3A1EA 4WXMA 4PRZA 1OXKB 1XZAA 3E8SA 4PQFA 3KYCA 1Y6FA 3QXCA 3CXCU 1U11A 1P8JA 1RM1C 5BN5A 4YRKA 4QYIA 2R5WA 4HYQA 4US0R 4QPKA 1JVNA 2HT1A 3BA6A 3O95A 5BMVB 4FZ0A 2PMFA 3SSAA 4A5SA 2GDZA 2D2VA 2DPHA 3NH6A 3M89A 4TVSA 4QGGA 2VYNA 3GVXA 4P3OA 2C07A 4F46A 3AL0C 3EISA 2G8NA 1FUKA 1CLUA 4IINA 3GLHB 1Q57A 4KQ2A 4OTZA 4EL5A 4DJ5X 4BR6A 2ZYVX 5IVHA 3MJTA 4Z4EA 3TQHA 2R00A 3F73A 5JSYA 2AZXA 3LF1A 2P6MA 3OQ1A 3CX3A 3GWOA 1BDHA 1VE3A 1IHYA 3WMXA 1Y63A 3CRVA 4TUYB 2X3YA 4ZYYA 5FOQA 1HZZA 3SQWA 3DE3X 3PL1A 4RGYA 1PVVA 4F8YA 3ZEDA 2ACVA 4I4CA 3JD1A 1DRVA 4XTCS 4FR0A 5GIPE 2ECFA 4HQNA 4KPEC 2LO1A 1ZVKA 2CE2X 1AGRA 3GPCA 3DE5X 4RF2A 1I4LD 1GTG1 1ZK4A 3S2FA 4RHCA 2KKWA 1LFDB 3A58B 4DGQA 1PNLA 2WWRA 2YXEA 2D0PB 4NEHB 2GXAA 3KL4A 3NS7A 1DQYA 2Z8YA 1NW5A 5K2OA 3ESQA 2L69A 4C7XA 3T9AA 4AB1A 3CVVA 1W2WB 2CHUA 4TKVB 2X42A 1GAJA 2DLNA 3FNIA 3GQVA 2B8EA 3H3XA 3MCTA 4M9SA 5JNLA 2BTQB 1KNXA 2IV2X 3R0JA 4NFLA 1XR3A 2EFJA 2ZYTX 4TZ0A 5AG2A 4X95A 2W0XA 2KHZA 2FKXA 5K4HA 3G0CA 4ID3A 1RLOA 3MRXA 4ZQCB 2FPGB 1FX1A 2IJIA 2N1MA 3AHCA 1XZMA 3FI0A 3KEMA 1H0SA 4WESB 5HBGA 3IHWA 1EFHA 5LXTA 4MYRA 1FPMA 1G66A 3JWEA 4G2KA 4NAHA 4HXYA 4DOMA 2G1UA 1VJTA 3BXXA 5TARA 3W2EA 2OCDA 3D36C 2RG1A 1Q12A 4WVLA 3ROZA 4ZEVA 4QTTB 3QE4A 3C5VA 4XEHA 3HCAA 5D6NA 4YP9A 3WGGA 3KB1A 3DQZA 4CETA 4KGVA 3KEQA 1U97A 2VEDA 4JD5A 3N0XA 4RVFA 2IYYA 4B3TO 4JJKA 1DCTA 3L41A 3MA0A 5DECA 4LVUA 4QREA 3RFRA 1VPVA 1H2LA 2A3QA 4L08A 1QTIA 3NQ41 1GWNA 2XYVA 3D6TB 2A9RA 1Y5IA 2Z2KA 4XPIB 2G72A 4A0GA 5DT9A 2RB4A 4HZUA 2OTJV 1KZGB 2GCNA 2XHZA 3K8YA 4JOQA 5EIHA 1V6CA 2J7KA 4G1VA 4Z4HA 1AV6A 2PS0A 1YB4A 1ZLXA 2OHFA 1GNVA 2GTIA 3BE4A 3IBYA 2FPIB 3C6YA 1NQTA 4QYWA 3WLPA 1PDOA 2WMDA 2GJAA 1QR9A 2C2AA 1Z2PX 2FV8A 2VJCA 2XCLA 1L8OA 3FRJA 3LD9A 1AJPA 4M4SA 1ZD4A 1LX7A 2BV3A 3CLVA 4DXWA 3AVVA 3LOUA 1JR3A 1BHAA 3OM9A 3QELB 4XYEA 1TZBA 4KK4A 1II8A 5B1OA 5DYTA 1XU4A 1YB1A 2NU7B 4LOIA 3WB1A 4MGYR 4UTXA 3L71H 2OCGA 4DBLC 3EDMA 1KXZA 3PR2B 4MVJH 5REQB 1CJKC 3GAAA 2PAFA 3HCWA 4CMKA 5CITA 9ATCA 3RSFA 1EX9A 2P27A 1GSOA 4TLLB 2EJRA 5AM0A 1Y3IA 1WE2A 1DQNA 1XNQB 1GRCA 1EZ4A 1PD0A 3JQFC 2W6IG 3LUHA 4OSPA 4BNWA 4C0JA 4I6JA 4AJLA 3HXPA 4YV2A 2Z9BA 2RJNA 5LYJB 3A0UA 3KT3A 4OYHA 4WFEA 1QVZA 2HWKA 4WHMA 2M9MA 4XCXA 3HSSA 4A8PA 4DJEC 1KARA 2YBDA 3GCZA 5DBFA 4F4UA 1FXKB 1XQ6A 2EOAA 3G2HA 4XVHA 5CXSA 2V7QG 3OUSA 2APJA 2K6GA 1V9PA 2ZSEA 3HWRA 5H68A 3AEKA 4GZ5A 4YUVA 1BX3A 1JJAA 3F96A 3VJMA 1AMUA 2M6KA 3TB6A 1WXFA 1N5OX 4B80A 2EX3A 2PYDA 4RUFA 1XQVA 4YR7A 3HHPA 3RREA 1VA4A 1VFNA 2KPOA 1THTA 3L72H 4EHJA 4X20A 3FUTA 2ZK7A 2OBBA 1QZUA 3MW8A 2QM7A 2EHDA 4NG4A 4QYMA 4CG1A 4TS1A 5B6JA 2QTAA 2O5VA 3QRWA 1RTKA 2JGKA 3SYAA 2OD2A 4KXRA 4ZEWA 3NJ4A 3THXA 3VQWA 3NCHA 3WJ7A 4J1TC 5JU6A 3TPCA 4EECA 1QRTA 1MPXA 1EE9A 3G49A 1NKTA 3ENQA 4FNAA 4G89A 4L87A 1PS9A 1DJQA 1SVKA 4B84A 2CDNA 3FSRA 3AUFA 4PCAA 1KEZA 1I51A 1MX1A 4GMDA 3IQFA 1H2HA 5MDHA 3GH1A 3A37A 5ALEA 3E27A 5DLDA 1C0EA 4K35A 2JS7A 3I6YA 1VCMA 1TUEB 2EINC 1E3DA 5DBEX 4B6JA 1KMMA 1PJZA 4JJ7A 1XBLA 3FPJA 5JSFA 2O2SA 2WLHA 4HEA1 2QE7G 3HU1A 4HNHA 3G89A 1QHSA 3FTNA 5FPKA 4G5QA 3B12A 5C4IA 8LDHA 1BXGA 5FTJA 1ACJA 4TT3A 3IB6A 1MVOA 1VA5A 3PFGA 3CYFA 3UV7A 4URWR 5TPZA 1E2BA 4QBFA 3S1LA 2HBZA 3OJOA 4J94A 3RRXA 3O8BA 1GTRA 4OGKA 1M10A 3G9UA 2BISA 4BO3A 1W0JA 1FY2A 3FYUA 2W2QA 2J9YB 1CS0B 2HHCA 2ZJBA 1BDIA 1ZIDA 3SJCA 3LS2A 1FDVA 1UJMA 3GAFA 3IHTA 13PKA 4M1WA 3UAGA 5KTOA 5ALJA 2BAGA 2KX7A 2PV0A 2QN1A 4GZLA 1XMPA 3DEIA 2IW1A 3QXJA 2IVFA 5JJCA 2QR3A 1OI7A 4MCJA 2PGLA 4PYIA 4JP3A 5CEFA 2C42A 2G3YA 5TF0A 2YJZA 3VTKA 2BI4A 4TRJA 3LT4A 3M7IA 3SBXA 4B43A 1KO1A 3L0OA 5CP8A 3PCRB 3PYMA 4AKEA 1K6EA 3TSYA 2C0CA 5DTMA 1ZI9A 2X77A 4HX5A 4ND2A 4D99A 3KETA 3QA3E 5BSTA 4Q1FA 3JXEA 4YT4A 1JLSA 4H7IA 1PJTA 2W8BB 3AB8A 4Q15A 1OYWA 1XAGA 3EIFA 5FR2A 1VTKA 4BVBA 1JIQA 1N7GA 4FP9A 3SGLA 3DMGA 5F9HA 2GJ4A 1TMOA 1TRKA 7MDHA 2DR2A 1H8HA 2RIPA 2HFJA 4PNEA 2ZNJA 1P7BA 1G2IA 1L7MA 3THWB 5F1OA 1HE4A 1YONA 2XGGA 1PEYA 3NRBA 3G0BA 2HDOA 3INGA 1Y82A 2X7HA 1I3CA 1V48A 1MJ5A 2ZCUA 3PBKA 4HBZA 5B3KA 1KAEA 1AUQA 4N65A 3G7SA 2YW2A 3SZ3A 3JQBA 3GLFB 1HDJA 1TI7A 4MW8A 1NH2B 1EWRA 4P3KA 1PX2A 5B3LA 2ZSFA 1PK9A 4H4EA 3R5HA 3PEYA 4JLAA 1G8YA 1NW3A 1SURA 5KJ6A 1JZQA 3LW7A 2AFHE 3KB8A 4F91B 1RYFA 3LC2O 2IZ5A 4BN0A 3AOGA 4DDVA 3E9YA 4YXWG 3NWOA 2ZZMA 4WFHA 2D0IA 5JBIA 2K2WA 1ZO8A 2QTOA 3AF0A 3CF0A 3O9MA 4DV1O 2AEJA 3O8NA 1BG6A 1USVA 3E2MA 3SOZA 5DSXA 4BQNA 4F1JA 4A1FA 2PA0A 4QSHA 1RKXA 2JANA 5A9SA 2O8EA 2C9ZA 3DOHA 3ZIAD 4D6YA 1XNGA 3IUQA 1S96A 2I8CA 3B3AA 3MT8A 4O0MA 5CM8B 1YDWA 3SYMA 2IEBA 4PDVA 1FQJA 3ZZ1A 3ZCSA 1Q17A 1NE2A 1UK9A 2GBFA 2WHEA 1JVMA 4KXNA 2RKBA 4XIFA 1Z8FA 5DPMA 1HY3A 5I6DA 1NG9A 3DDWA 2ZVDA 3DM5A 4RORA 1KKLA 3FKSD 4HWTA 2J3MA 2QLBA 2UYGA 3Q40A 4GPZA 4R1QA 5IWCA 2ACWA 2P0AA 4Q12A 4OI1A 4X3OA 5FWYA 2WSLA 1L7AA 3H18A 3P9QA 4P1ZA 3MRVA 3VYUB 3ORRA 2B83A 4UOEA 5JNUA 2P8JA 4EY4A 4OM8A 3E9NA 1Y81A 2BM9A 1UDCA 4ZN6A 2BCJQ 3LDFA 4B4KA 4R81A 2WP0A 3S2SA 1IAVA 3UUFA 3GRCA 3IVXA 3HMQA 4RKEA 1JLLB 4UE6A 1HFJA 3UHJA 4F60A 3TKAA 3S3TA 2FPGA 4KN9S 4WZAA 4XRGA 3PC2A 4PAQA 2ZVJA 5I9NA 3B1JA 2O7RA 4FFRA 1P9LA 2VJLA 3Q4HB 3ED5A 1Q86W 3KUXA 1FL9A 5JHGB 4WJKB 2E85A 2HCTA 4OOFA 4NE9A 5KHHA 4QUBA 1M93A 3LDHA 1L0BA 4J29A 1P0CA 2WD8A 5DGDA 3VR0A 2C9OA 3EF1A 3OEHA 1JB1A 3EEFA 4KE7A 2RI0A 1A3CA 3ZMVA 2IF0A 4L85A 3MYRA 3VC1A 2VQSA 4CM8A 1I30A 1GLVA 1XC7A 2BEWB 3OEEA 2QQ0A 2ZSIA 1T2FA 2ZAMA 4Q24A 1GM7A 2HXSA 4P5EA 5EKDA 3Q7QA 5I7FA 1K5SA 3LGXA 2VDKB 2PQ6A 3JRWA 1PT6A 3T34A 5JFOA 1NZJA 4MUNA 1TJPB 3ZQ6A 1P19A 3MTBA 1COWA 3FSJX 4N03A 4HFRA 1J99A 1YI0A 3OOHA 1NUQA 4D44A 2IY9A 2XUAA 3V1UA 3ZJVA 5CR9A 3K79A 1FDOA 3WRYA 5B1BC 3V97A 4DMGA 3D59A 1G20A 3BEHA 4JI0B 2AJCA 3STHA 4YJGB 4C29A 3I8XA 1H4SA 5JV5A 1J56A 4X9QA 2DWEC 2HWYA 3PN1A 2V58A 3KV1A 1LI5A 4QHYA 5GV8A 4D43A 3BMOA 4FYJA 4YUAA 4AUMA 2RGWA 2WA4A 4P31A 3COPA 4F38A 2JHPA 2PBFA 1JQJC 1EVYA 1QOQB 3NJRA 4U3JB 1YRAA 2PVPA 3QLUA 3AVPA 3IKVA 3IPXA 4M8KA 4TLBA 3NEAA 2VS0A 3SJAC 1J24A 2DYRC 4B7UA 3G59A 1NVFA 1M90W 2P69A 3HVUA 4P36A 4PS1A 4PO3X 3RT7A 3DTVD 3VH1A 1ULTA 3B13B 1J0DA 2LP4Y 3AUJB 5L4NA 1OCRB 1EHYA 4JV5B 1GO2A 3T9CA 4G28B 2ZIUB 5ALZA 5FV7A 5C1DA 1VJRA 4X88A 5KC8A 1L5KA 3ZVKA 3GRYA 4JZ2A 2R8OA 4ZODA 4D81A 1SG0A 4G1UC 1XVTA 4YV0A 3BK2A 1OFGA 3O03A 4IXDA 4JP2A 1EYZA 4O2AF 2WOJA 3AZPA 4Q9HA 3TM5A 3CLKA 3I62A 2FZKA 3L07A 2B5WA 1ELOA 1FF9A 1VP9A 2LGWA 2RBGA 2B61A 2O14A 3GFRA 1CZRA 4KFTA 2E7ZA 2QKAA 2P5SA 1C7RA 1F1JA 3L7OA 4R9RA 4AAYA 3WLJA 5A4JA 1NP7A 1GRRA 1Q5PA 3T54A 3TAHA 3H5OA 1XNRB 1FX0B 1KMHB 3DBIA 3K4HA 1SS3A 3CXHF 1V2GA 2XQJA 3IMEA 4IM7A 3VHLB 2L19A 1XVVA 1XTBA 4HUJA 4GVPA 3NTXA 2HLDG 3KCXA 2O7SA 3KYBA 4GBGA 4PSVA 2QAGC 3WYGA 3ZTTA 2AN5A 4REMA 2NG1A 4PLCA 2NP6A 3ICOA 5KWSA 2CYBA 3DUWA 5ALQA 3U4CA 2PXCA 2ZAGA 4RF3A 1HDRA 2OFWA 1MRSA 4HAMA 4F93B 1OLUB 4J9UE 3GVMA 1T0UA 3HB4X 4YDQA 2JCYA 1O97C 3A0HZ 1TPYA 5IJ9B 2D2IA 3K0CA 4ASUA 1P0PA 1P62B 5IASA 3EW7A 4YACA 5ALGA 2CNWA 4GX1A 5ELMA 1G38A 4LDNA 1JQDA 3BRSA 1PK8A 2HT6A 1XQ8A 2QSAA 1MU0A 3GP3A 3W78A 3OEHG 4TS3A 1QGED 1XRRA 2RGRA 5A3VA 5IDQA 5KYUB 1VCIA 4E07A 3D6VA 4Q3OA 2GBGA 3N74A 4RPLA 1ZUNA 1KK2A 4TRMA 4OPAA 3GB7C 2YY6A 3HB3B 4ZPXA 1YZHA 4OHBA 5EHQA 1MB2A 3I4LA 1W52X 1Y1SA 2V7BA 4CIBA 4JMLA 1Y1PA 1YRYE 2PT5A 1VZ2A 3D6AA 4PYMA 5U1PA 1BDBA 1NJ1A 3EULA 1JYFA 1BEEA 1RWKA 2PO7A 3QEMA 5AJTA 4C4RA 3AG3C 1UOPA 3M49A 5EZ6B 2HLDD 3CIFA 4QVGA 2WHXA 4JX9A 1U6KA 3IUMA 4R1MA 1TIKA 2XPCA 3DOEA 3A4VA 4DLUA 1IL0A 5JQGB 2QG9A 4N6NA 5IXJA 1DEOA 1J7KA 3EGEA 3T7TA 1VF6A 5IAEA 2HJVA 2PUVA 3CF6R 3LWZA 3UWDA 2ZI9A 3CCEV 4DJJA 2VRWA 1XJWA 2P7HA 1FD9A 1WP7A 3IAM6 2EKZA 2W00A 4FBMA 4NH4A 4UXIA 2YYZA 1KO4A 4R1PA 2XY4A 3OQIA 5E1BA 2OZKA 2VT2A 2AN3A 2XITA 1M66A 1RWPA 1MTZA 2JLRA 3F5TA 4DKJA 5TNXA 4OJNA 2QAIA 2GDJA 4IYRA 1NKDA 2CXTA 4N9WA 3KXLA 2QUBA 5AKKA 2IYLD 4YP6A 1C0LA 2GHQA 3RK0A 3DEFA 1DMRA 4BKPA 1L3BA 2QT0A 2OUIA 1SR8A 2GLXA 4YJ2B 3DJFA 5AJYA 2Q9LA 1E8MA 4P2ZA 1U7XA 1K92A 2O7VA 5C52B 4C7JA 1GT91 3HYRA 1A9OA 2A78A 1S76D 1F8XA 3C3YA 3E05A 3WK8A 2JVIA 4A3SA 4Y7CA 5EUCA 1KZ9A 4ER7A 5FHRA 1FYVA 2UUBB 3HJHA 3IUNA 2DWOA 2ZJ3A 5AVUA 3S28A 1NQVA 2EEPA 4QPDA 2Z6AA 2Z8YM 3KUCA 4GYYA 1Z82A 1ADGA 2JGAA 5DE3A 4BMZA 3UT6A 2H16A 5DYYA 1F7YA 2VUSA 1RQ2A 2LKDA 3B1KA 4M1MA 1EVQA 3C16C 1JVSA 4P3PA 3T5DA 2BJWA 5B6IA 10MHA 2P4EA 3EWIA 3IP8A 1JR3D 1TKCA 1IEQA 3ISTA 3PL5A 3PQ6A 1DDOA 4BXOA 4JEUA 1OV9A 2WJIA 1K3EA 4WCDA 1U2GA 4M55A 1RSOA 4MUJA 4ZQBA 3SR2C 1F4PA 4TWZA 3NVAA 5EPEA 4CQLA 1U6IA 5BN4B 5CIQA 5KHLB 1DO2A 4ETIA 3K1AB 2EIJC 5EXTA 1WETA 1VLJA 1PBNA 1VRCA 3CEMA 1OC2A 3AG6A 3NM6B 2OHIA 2WVGA 3OLYA 3RU2A 2JI7A 1CWUA 2N1BA 4EKDA 3GXBA 2R84A 4DEVA 1I0IA 1T2UA 2GPSA 4FILA 1E4EB 2G5PA 4K9MA 2OVBA 4RZXA 4AIRA 2BGUA 5LGUA 1PWEA 4L9SA 4H6XA 1RW4A 3T7DA 4EM6A 1AUOA 2ID4A 3NGXA 3TI9A 2WJPA 4J03A 2V7TA 4BX8A 5HJ2A 1PGOA 1LS6A 3OEHD 2ZRAA 4HQLA 2Q4EA 3VKVA 4II3A 5F5NA 3WB0A 3CWBH 2VF8A 1FLNA 4D3SA 3PYLA 2FR0A 1N0UA 5L3EA 2NPIA 2AR9A 1H0KA 3PXCX 3U31A 3DNMA 3PKIA 4B35A 3BF8A 4QNNA 2R4TA 2V6JA 2GGSA 3VH4A 4LTNA 2OSBA 3FSGA 5IT4A 4MTOA 3F3KA 2YZMA 4HTFB 1QS0B 2ATEA 3O3OB 4ABTA 2FJUA 2PUHA 1S72V 3CEJA 3OSUA 1QTRA 2P75A 3KM0A 2QE7A 3H0EA 4WEOA 3GLGB 3HH8A 3GWKC 2IZ6A 4I0XB 3C3MA 3O8QA 2XVZA