1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
molecule tags Hydrolase (carboxypeptidase)
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
3OPMA 3IDAA 4HVTA 3NGMA 2JEZA 3WJ1A 3KDAA 2Y2UA 4BVKA 1CUVA 1XQXA 2QKYA 2WUEA 1XQWA 5IVIA 4FTWA 4OB7A 4ZGBA 5JD5A 1F6WA 4X6XA 5D7BA 3G02A 5HQ3B 3TJMA 3EQ8A 2V97A 3I2FA 1OILA 3F97A 4B82A 2CUTA 3EQ7A 1J06A 1QFSA 3IUMA 4GDMA 3DKKA 3FSGA 4MYDA 2BJHA 2WU4A 1DT3A 2OCLA 4OUKX 1MU0A 1CUZA 1E66A 1Q83A 2J4CA 3WWCA 2JIDA 3HSSA 3VDXA 2WG1A 5FKJA 5AKIA 4Y2VA 4FFVA 4B85A 4WFKA 3WIBA 2X5XA 4W9RA 1U2EA 3S8YA 3C5WP 4X00A 3IULA 4PO3X 5IVKA 2C58A 2ACKA 3IIIA 5ALTA 5KREA 1YA4A 5HFNA 3L1IA 3SK0A 3IB3A 2VA9A 3HXKA 3LP5A 4DM7A 1UK6A 2B9VA 4K5QA 1XZFA 4KRYA 1B41A 5DYWA 5LYYA 5DTJA 4YASA 1CLEA 2XUFA 1W4LA 3W06A 1JT2A 1PV1A 3G8YA 2QZPA 1W6RA 4OYYA 5ESRA 3BDIA 3WK7A 5JATA 1LLFA 1CUJA 2IIVA 2AJLI 4WCVA 5JALA 3DEAA 1XRNA 4KR0A 4UHHA 5AJHA 4N8EA 4JNCA 5HKAA 4BE4A 3R3XA 3BL8A 3DD5A 2J3QA 2WUGA 3H2HA 3KXPA 1CUBA 1QGED 5K3FA 5EGNA 4ARAA 4I4CA 2HHAA 2WHRA 2GYVA 1QOZA 4PV7A 4C4YA 5ALQA 4EUSA 4OU4A 5SYMA 4X6YA 3M83A 4AMYA 5DWDA 3U1TA 4BCCA 1ZD3A 4S0XA 1GGVA 3WK8A 4GI1A 5JYCA 3UUFA 1XLWA 3I2KA 3D2AA 4Y2XA 4MQLA 1YS2X 2V9ZA 1QIHA 4H35A 2PU7A 1BCSA 4L72A 5I9IA 4GEGA 3STWA 1OCEA 1TIBA 2XQJA 1CIJA 3IURA 4UHBA 4Y2JA 1ZI8A 1SOMA 2ZYSA 3ZLTA 1U4NA 2ZJ7A 4LIPD 2OPHA 5ALVA 3U0VA 4EZIA 3ZLUA 4BYMA 2VJAA 3A6ZA 1J2EA 5CMLA 5H3HA 2JF0A 1F8UA 2WFZA 4UHDA 4U2DA 1CUHA 3QPCA 3BF7A 1YSCA 3QITA 3EBLA 1VXOA 5AK3A 1J1IA 1DU4A 1EB9A 1QFMA 2B20A 4MXDA 3MUNA 3STYA 2WUDA 3IUNA 2WSLA 2XQGA 4IH9A 4UBJA 5AOAA 5I7UA 5AI8A 4X97A 1H23A 5KWIA 1M33A 2VT7A 3ICWA 4EY6A 5IVHA 1QIFA 5AKXA 4J0KA 3WYDA 5ALJA 5CT6A 1IMJA 4BP8A 1P0IA 2NW6A 2Y1KA 5T4EA 2OAEA 2YXPX 4Q3KA 2PUJA 4P08A 4DSZA 4C01A 5AM2A 4KYVA 4BAUA 3FNBA 1X70A 5DTIA 4AO8A 2I03A 1JU3A 1U65A 3BXPA 3G9ZA 4UBIA 4O08A 1CUFA 3D59A 1CUUA 5LLSA 5JAUA 3S2ZA 5FP0A 3WIOA 2Q0XA 3HABA 1DTEA 5A71A 5EHQA 5D3KA 5BOVA 1AMNA 4K6GA 1DINA 1Y7IA 4UPDA 2GYWA 3WWEA 3FAKA 1RYYA 2HU7A 3QYJA 3STVA 4DMCA 4QZVA 4DNQA 4E14A 3HRHA 3I6YA 3RM3A 1EI9A 1AUOA 3H2JA 1MX5A 5DJ5A 4DNOA 1UT6A 1EB8A 2ORYA 4UFOA 2X76A 4FKBA 1A8UA 1LNSA 1FJ2A 4XWGA 4CCYA 5DLPA 2WIDA 5AM3A 1ISPA 4N5HX 4LYDA 4L9AA 1CV2A 4FDMA 4G8CA 4BZWA 4UHEA 5FUMA 4ZI5A 1IVYA 1DWOA 3ZI7A 4H18A 3FYUA 2ROQA 1MAHA 3I2GA 3BF8A 5EIHA 4QDUA 2XUJA 1XZBA 3FWHA 4P92A 2ZYHA 5EFZA 4FNMA 3G9UA 2UZ0A 3OC0A 1CUIA 1LPAB 3DOHA 1LPBB 2HL6A 3W2TA 5HK8A 3HEAA 1XQVA 4BVJA 2WIKA 4MEBA 3DL7A 1Q0ZA 1THTA 4Y2YA 5YASA 4GLBA 3QBJA 1YB7A 2G5TA 1PJAA 3WWDA 2RGUA 1CQWA 4QA9A 2OQIA 4H0CA 3DYIA 2BKLA 4XX1A 1QTIA 1QLWA 4NS4A 2WG2A 5C7YA 3LIPA 4CG2A 1GKLA 1QIIA 4UBLA 3G0IA 2BGRA 3STTA 5FXMA 4EHBA 4EA6A 1SCQA 2E3JA 2DHCA 5AM5A 4M0MA 2HRRA 3FLAA 2YASA 2ACEA 2QS9A 3M3DA 1D07A 1EDBA 1QZ3A 4KE6A 3C8HA 1YCDA 3OOSA 3QM1A 4Q3LA 3FLBA 1XRQA 4RPCA 3R40A 1LZLA 4ZWNA 4X91A 4K2AA 1XRLA 4EY4A 4ZV9A 2ZJFA 4JUIA 4Q82A 2JGIA 1GPKA 2WTNA 3IUJA 4G4IA 4AO6A 3KWFA 1MO2A 5T4BA 1BEEA 2PM8A 5JZ9A 3TGLA 4FBLA 2GBIA 3PDCA 3GZJA 3DJYA 5CT5A 3V1NA 4L0CA 1QIKA 2HA6A 1ORWA 5ALNA 1EDDA 4F5ZA 2H7XA 3EF3A 3SC2A 2XMGA 3WA7A 1UOOA 3G0CA 2JGEA 1IZ7A 4TGLA 3LS2A 5ALUA 4JH0A 4OD0A 2HFJA 1IZ8A 4XIIA 1W1IA 2XMSA 2VTVA 5ALFA 1R1DA 5AKEA 5KBYA 2G63A 3NUZA 1YS1X 4AN1A 2HA4A 5ALXA 3WK9A 3V9AA 4EB0A 4MEAA 4DMFA 2BGNA 4G4GA 2Z3WA 2B4KA 2FJ0A 5EI5A 3AIKA 4WFIA 5JZBA 2PU5A 4HZGA 1SC9A 5DNUA 5AICA 2ZYIA 1G66A 4GECA 4QLOA 5AI0A 2C5FA 2IX9A 4H7JA 3HJUA 1RWQA 2HFKA 3VXKA 5IH7A 4FMPA 1JJFA 5HF6A 1L7AA 5CH3A 1YASA 3IUQA 3KD2A 4DMKA 5AKHA 3H19A 4FFWA 3TRDA 2Z8XA 3NOXA 3ANTA 1GPNA 1NX9A 2XI4A 4KACA 1CR6A 1TCAA 5F4ZA 3WWPA 4J03A 1XQYA 5CH8A 4UBNA 3YASA 3P2MA 3D2CA 5AKLA 3AJAA 5A7HA 1CUGA 1L7QA 4A16A 4X7BA 1ACJA 1K5PA 3C6YA 5JAPA 3ESBA 2XMQA 2H1IA 1AQLA 1USWA 5EIAA 3E0XA 2RHTA 2XQKA 3FYUC 4ROTA 1CRLA 4BRZA 1VA4A 4EY8A 4P9NA 2XUQA 1JJBA 1VA5A 2O7RA 1ZD4A 2HA7A 4FNGA 1VOTA 3W9BA 4P93A 1QTRA 4G9EA 3WA6A 3T52A 1HPLA 4QDZA 4AN0A 3FYTA 3H2GA 5E4YA 3WL6A 2WU3A 3GELA 5ALRA 1DQYA 5E4JA 5A2GA 2PL5A 2WIGA 3DKRA 5ALYA 3IBTA 1ACLA 2WQZA 2XMRA 1QIDA 4Q05A 5K3BA 2W6CX 4H77A 3AIOA 5FPQA 2D0DA 2G5PA 2W22A 5D6OA 1UOQA 2XUGA 4DNFA 2YH2A 3O4GA 3ZWQA 1XLVA 2XQIA 2IITA 4C4ZA 3T4UA 3RKSA 4XJVA 1U8EA 5J3JA 1YR2A 5AP9A 1K6EA 3VVMA 1F0PA 4KAFA 1H2XA 3VKFA 1FFCA 5KWJA 1EINA 2XLBA 2EEPA 1BCRA 1P0MA 4CG1A 1QIEA 1ZIXA 4PQEA 3VJLA 5BV7A 3VJKA 2QM0A 4DIUA 5DNWA 1EVEA 2C5GA 2HA5A 2HU5A 2FJPA 4B80A 3I6MA 5EIEA 3LIIA 3ESDA 2JGFA 2V96A 1ORVA 2XMZA 4J0CA 2Y2VA 4QDXA 4AB1A 3G9XA 1EX9A 4TPKA 4LXGA 1TKRA 1QJ4A 2O2HA 1SCKA 1EHYA 3OTQA 2QR5A 4Q1VA 4DYHA 4BZZA 2ECFA 3D4LA 1BN6A 5EHZA 5DYYA 5AM1A 1R3DA 2DQZA 2JEYA 3G9TA 1ODSA 4Y2SA 4GBGA 2QXTA 1BROA 5HKBA 1XZEA 3WK6A 1FFDA 1PFQA 4X95A 5LP1A 4G5XA 3UMJA 3O9MA 4Y2PA 4JYPA 5ALKA 5JANA 4DLNA 3ICVA 4J0HA 4BCBA 3I2HA 3I28A 4JEIA 1DQZA 3G7NA 4Y9SA 4U2CA 2CEKA 1I6WA 1LPNA 4BATA 4KEAA 2HIHA 3BIWA 2C7BA 5A62A 1XZAA 5LZ9A 5SYNA 1GZ7A 2QMQA 4FLEA 5CT8A 2RIPA 2DQYA 2WG0A 3FVTA 2V98A 5BWCA 1HLGA 1VE7A 1H2YA 1XRPA 1HKHA 1TAHA 5HK9A 3W05A 4HAIA 3NWOA 4B9EA 4UHFA 4WJLA 2OG1A 5JARA 5K3EA 3RARA 4Z49A 4OU5A 4N5IX 4EY7A 1UKBA 4RE6A 4C88A 3QZUA 2PPLA 4QDTA 2J4FA 3ED1A 5JASA 1UKCA 3WKCA 1XKTA 1HQDA 2GBCA 3I1IA 1JMKC 5AI5A 1XZKA 4BAZA 3K6KA 1RP1A 4B81A 2GYUA 5ALOA 3K9BA 4H7EA 4CIAA 4PW0A 3QMMA 4OB8A 2WLSA 3GUUA 2CZQA 1O6GA 4Q3OA 1XZIA 1IUNA 1ZD5A 2K2QB 3D0KA 1B6GA 4DSAA 1R88A 1QONA 2AJ8A 1ZI6A 5ALHA 1VJ5A 1K4YA 2XMBA 4FLFA 3QMWA 1XZCA 3F67A 4HS9A 1H2ZA 1UK8A 1EA5A 4KJXA 2OCIA 2PKYX 4H7DA 4DNPA 2VT6A 5EHXA 1WM1A 4OCZA 3H17A 5HCUA 2H7CA 4W63A 4UFPA 1P0PA 4UUQA 2VSQA 2FX5A 2I78A 2JGJA 4WDQA 4K6KA 4BE9A 4HXGA 4FOLA 3BWXA 2WIJA 5AM4A 4KAJA 5AK4A 1Q0RA 2O2IA 2WM2A 3R3VA 3WZLA 2PBLA 3WI7A 3DQZA 2R8BA 5AI9A 2OAGA 3ILSA 2ZYRA 2WIFA 5JD6A 1QO9A 2QUBA 1LGYA 5AIAA 1VZ3A 4ZREA 1HL7A 4ETWA 3WKEA 3KSRA 2XB6A 4JYMA 1CUDA 1A88A 5I8PA 1QIJA 2GZSA 5E2IA 4KE9A 2WHPB 3E1GA 1ZD2P 4B0OA 5C81A 2WKWA 1FFAA 4H7KA 4KAAA 4G8DA 4DGQA 1JKMA 2VAVA 2OCKA 4AZ3A 1MNAA 4B83A 4C89A 5AI6A 2HRQA 3OURA 3WLAA 4AXBA 4H7HA 1XZHA 3UUEA 3F8SA 1ZIYA 4QLAA 4OYLA 4C87A 1WPXA 4HRXA 1O6FA 4PNZA 5A6VA 3PUIA 4K6HA 1BN7A 4X92A 3V1LA 1WHTA 3WWOA 3AZPA 1MX1A 3DL4A 3N2ZB 1W52X 1MN6A 3H1AA 1SCIA 2WTMA 1TCCA 2XT0A 3CN7A 5AKYA 1CFJA 3CN9A 1IUOA 3BJRA 2QVBA 2CKMA 1TCBA 4G1FA 3N0TA 4KRXA 1MNQA 4QDOA 3I6ZA 4E11A 5CT4A 3GROA 5K3CA 4BB0A 3E4DA 1EK2A 3PUHA 4G9GA 1CUEA 2JGMA 4Y7DA 2I3ZA 1E5TA 3LLCA 4ITVA 1TK3A 3F9CA 1R9MA 1N1MA 4HRYA 2ZJ6A 4W1PA 1OXMA 4ZRDA 5JIBA 1CUSA 4HXFB 3Q8WA 2PX6A 1H2WA 3A70A 1GQRA 1EH5A 3R3WA 5CXXA 5LZ5A 3WYNA 5FV4A 1WCYA 5BWBA 4U2GA 4EY5A 3G0BA 2PSHA 4BRSA 2RONA 1AX9A 3HACA 4KE8A 2VJBA 2OGSA 3PE6A 3SX4A 5AIBA 5ALWA 2CJPA 1H22A 1JJIA 2G4LA 6YASA 4UFNA 5C8VA 1AGYA 4L3WA 2D5LA 2XUHA 1YAJA 3I1YA 4Y2QA 4M0EA 3BDVA 5DNVA 3B3QA 3GA7A 4INZA 1UKAA 5AOBA 4B0PA 4LXIA 5AKJA 1UWCA 4H7FA 3ZV7A 4Q34A 2X8BA 1ZI9A 2BUAA 5ALMA 4WDRA 1JFRA 4G8BA 3KWJA 4FHZA 5ALEA 4W1QA 2DR0A 1CUXA 1E89A 1L7RA 4U2EA 5ISMA 1N8SA 2Z8ZA 4NMWA 5AKZA 5CTAA 1QO7A 2PVSA 1CQZA 1GKKA 2VF2A 1NU6A 1Y37A 4MWTA 2BUBA 1E8MA 3ESCA 3MUOA 3MGAA 3AZOA 2DHEA 1GXSA 4LHEA 2WJ3A 4WY5A 5HZGA 3AZQA 4YPVA 3FCYA 1WB4A 3JYHA 1UK9A 3RK4A 5EHNA 3KOOA 2BUCA 2VJCA 5HF9A 4B6GA 5E4TA 4HXEB 4IO0A 1R50A 4X3CA 5AHXA 4J0JA 5C8ZA 2FUKA 1VXRA 2WUFA 1A7UA 1KU6A 2RHWA 4YK7A 4CCWA 4ZV7A 3BE8A 2VEOA 1UFOA 5LIPA 4N8SA 1EK1A 3A2MA 2VATA 1MAAA 3R0VA 3PFCA 1MT3A 4UBOA 1ZJ5A 4FWBA 3DNMA 4NZZA 4PSUA 1Y7HA 3V48A 1DWQA 4X71A 3FSGD 3ZLVA 4LKOA 4MQMA 4WY8A 4J3JA 1X2BA 3QMVA 3A2NA 4J0GA 1BEZA 3O95A 1AC5A 3V1KA 3WKAA 1WB6A 2PSFA 2HA2A 5K3DA 1BU8A 4GXNA 1LPPA 1G5FA 2QUAA 4IH1A 3ESAA 4U2FA 2BFNA 3EIOA 2Y6VA 5JZSA 3STXA 2XDWA 3WL7A 2ZVDA 1T2NA 1JI3A 1XRMA 4I3FA 4H7IA 3D3NA 4EBBA 4GHWA 3K2IA 4FLMA 2C0QA 4FBMA 4G4JA 3VJMA 3HLKA 2WJ6A 3M81A 3STUA 3HC7A 5CH5A 4CIBA 1GPLA 1R4ZA 1T4MA 1AURA 1HDEA 1CUWA 1TRHA 3SWWA 1GT6A 3B12A 3C45A 3H04A 1DX4A 3I2JA 2GBFA 5ALIA 3JW8A 3DLTA 4TVKA 1E3QA 3HI4A 1R9NA 3WZMA 1JU4A 1XKLA 1MX9A 3O4JA 4YX9A 3O0DA 2HDWA 4B9AA 3C87A 1WPRA 4X6UA 3WKBA 2WHQA 1DWPA 1LPOA 2XE4A 4DTCA 4CFSA 4Y2TA 2ZSHA 2WFMA 3R3ZA 5LKAA 4BTVA 1EDEA 2H7YA 1LPSA 1MTZA 3AIMA 4X93A 4BC1A 1EVQA 3R3UA 4X94A 3WL8A 3WK5A 1G4HA 3DYVA 3AUKA 5ALZA 4D9JA 1N5MA 3QVMA 3MVEA 2DFPA 2ONCA 1UZAA 2VQ6A 3R41A 5IVDA 2Z5GA 5HFAA 3CCBA 5AOCA 2QRUA 3WQHA 4BBZA 1BE0A 1THGA 3TEJA 5FLKA 1QIGA 4W1RA 4A23A 1A8SA 1LPMA 3FBWA 5LZ2A 5AKKA 1E8NA 5K5EA 2XMDA 5K3FB 1QIMA 2XUIA 4AZ0A 4XVCA 3CCCA 1HBJA 2XUDA 2AXEA 3FOBA 1E8DA 1ETHA 3HYSA 4LYEA 3M82A 4X90A 2QT9A 4UBMA 1XZLA 2CB9A 2ES4A 2O7VA 3QPDA 2WFLA 1TQHA 3R3YA 5FOQA 2QTBA 4DMHA 5CRIA 4BTLA 1VZ2A 4PSDA 3H18A 2BCEA 3FCXA 1G42A 4RE5A 5LZ4A 2HU8A 4BDTA 1DT5A 1UXOA 5ALGA 2RI6A 4M0FA 3H1BA 1KU0A 2OXEA 3AFIA 2WHPA 5ALPA 1XZGA 1ZICA 3C6XA 1MJ5A 3WMRA 2WJ4A 5A7GA 3IVMA 3G0DA 1K63A 1ZGBA 1YAHA 2QOEA 3FVRA 1CEXA 2OQVA 3C6BA 3C6ZA 3JWEA 1FFBA 4QNNA 1VKHA 2WILA 1CVLA 3IA2A 4QWWA 4RGYA 4BAGA 1X2EA 2QJRA 4IHAA 4IH4A 5JAHA 2RAUA 1WB5A 2JGKA 5LZ7A 3CXUA 3WL5A 4B7ZA 3F96A 2VAXA 1JMYA 4RNCA 1BRTA 2C0PA 3RLIA 1ODTC 2CBGA 2XMCA 5AO9A 1VLQA 2HA3A 3F98A 1DX6A 1MPXA 2JBWA 3B5EA 2WFLB 4B84A 4HTAA 4GWLA 3GFFA 4C6HA 1J07A 2OLEA 2Z3ZA 1NU8A 3A2LA 5T4HA 2OCGA 1LZKA 1Q84A 4W1SA 5C8XA 2XUAA 3OM8A 2EDCA 4A5SA 2JGLA 2LIPA 2CMFA 4MJ3A 1XFDA 2C4HA 3O4IA 2QXUA 5HF5A 1YB6A 2O2GA 4E15A 3L1HA 3D2BA 4MYSA 2BAGA 1C4XA 3PF8A 3OG9A 5CURA 4AQDA 1VE6A 5K3AA 3X3HA 3I2IA 1XZJA 5A7FA 3HZOA 4BDSA 3FLEA 2Y6UA 3QH4A 5T4FA 1GQSA 4I19A 4ARBA 5LKRA 1F0NA 3VVLA 2HA0A 3WJ2A 2XUKA 4E46A 4CG3A 1YA8A 2HM7A 2XLCA 4CCYB 3C70A 3BIXA 3PF9A 3DCNA 3G0GA 2GZRA 3VISA 3W04A 5JD4A 4Y2RA 4PF1A 4IQ4A 4AMZA 1C7IA 1P0QA 5AK6A 3FYUB 5AI4A 5JADA 1XZMA 4F0JA 2H9YA 4CI9A 1W76A 3C43A 2OGTA 3E3AA 1FFEA 2DCMA 1QE3A 4C4XA 4UHCA 2XQFA 4BCDA 4J7AA 1ODCA 1XRRA 1ZGCA 3H2KA 4WFJA 2EDAA 4ZXFA 3H2IA 2PSJA 4MWSA 2B61A 4BP9A 5DYTA 5AK5A 3H0CA 2VJDA 5FRDA 1KEZA 5AM0A 1CUAA 1CPYA 1CUYA 3ZPXA 3PICA 3WK4A 3V1MA 4U2BA 1XZDA 4GW3A 4PSCA 5LZ8A 3DS8A 3DDUA 3AINA 1LBTA 4QWMA 4J0IA 2QJWA 1UOPA 4QE3A 2PSDA 1WOMA 1AZWA 4QEKA 3PI6A 2PSEA 5FPPA 5FDFA 4OPMA 2XUOA 3Q0TA 5HF8A 4V2IA 3C5VA 1UK7A 7YASA 1S8OA 2PUHA 5CT9A 2DSNA 1N5RA 5JAOA 3C8DA 1ZOIA 3L1JA 2AJDA 2YYSA 4F21A 1AKNA 5HQ3A 5CBKA 3QPAA 3D7RA 5ALLA 5IKXA 3W9UA 1ZJ4A 2R11A 1W75A 2AJBA 4J0DA 5AH0A 1WHSA 4AO7A 1K8QA 2AJCA 4Y2UA 2ZSIA 1EXWA 4LXHA 5D3ZA 3O9VA 3GBSA 4BVLA 3D5EA 5CXUA 3ANSA 4OSEA 3EQ9A 1Z68A 1CUCA 3DOIA 4BC0A 3LCRA 2OGZA 2DHDA 4AX4A 4F60A 3O4HA 5ALSA 3WKDA 5CW2A 2P8SA 1LBSA 4OB6A 1FSSA 4N8DA 3AILA 1SFRA 1A8QA 3PFBA 4UBKA 3BJMA 1IUPA 4X85A 2XUPA 2I3DA 5AKGA 4KE7A 1BS9A 2GBGA 5ALDA 2HADA 1C7JA 1XLUA 1XROA 4NVRA 2J3DA
chains in the Genus database with same CATH superfamily
1EVYA 2EERA 2NSHA 4HPXB 5CM2Z 1NYTA 1QPGA 4QPKA 1YA6A 1C0LA 1VLJA 3KDAA 1M73E 4JCCA 3TWOA 4F8YA 1XQXA 5HSGA 5IJ9A 4XTRA 3RHSA 4FYJA 5KDLA 3JZMA 3F97A 1EFAA 1PR2A 4CF5A 1FLAA 2NZWA 3RVQA 4U8GA 4ZQIA 1LBIA 5IKPA 1OAOA 1LI7A 1TYBE 3JCUZ 4Q3DA 4AXXA 2OCLA 4OUKX 2QG4A 1PZXA 3I4CA 2JIDA 3T5DA 2VP3A 3DEYX 4YUYA 4G5RA 2I4LA 1N7IA 3FI0A 4DLTA 1F48A 1QKKA 3KCNA 2ZJ3A 5DE3A 3WGHA 2VA9A 3M9XA 2QPTA 3OOWA 1UK6A 1S2GA 2ZJ5A 2BSKA 4MV8A 1XZFA 1W4LA 4BKOA 2D0OB 2QE7D 4QFDA 4DRXA 4AG6A 1Q17A 1II8B 5DK6A 3GLHA 1QX4A 4N8EA 1H85A 3TW4A 4DM3A 3R3XA 3VU0A 4KSYA 3OFVA 2C84A 3LF1A 4MYTA 3NHLA 5IN5A 2Y99A 3D1LA 2QYTA 1TGOA 1QR6A 4I4CA 1MORA 3DXYA 1SCAA 4EA8A 1FFTB 3VR4H 3ZRWA 3ZZUA 2D4AA 5BV1A 1Y80A 4GI1A 2FPPA 3E5RA 1G20B 4AN4A 3KDPA 1NJIW 1GA4A 2FUCA 1Q6HA 2PU7A 1KP9A 3X43A 1HFJA 2HYDA 4G1MB 3H1IH 1ORDA 1XNJA 2HWUA 4O4HB 2CVHA 4N76A 1Z2NX 1OI3A 2MR6A 3JATB 4B7CA 3U0VA 4M9XA 1GZUA 1NHWA 4D8YA 3ENKA 1E2JA 3FUVA 1G6KA 3B1KA 1VE5A 3CW9A 1Y4ZA 1JLRA 3C39A 4TZ6A 2HW8A 1L7VC 5CPFA 2HIMA 4EY6A 4MGEA 2NSLA 1QIFA 3EXIB 3PJGA 2C9CA 1CE8B 4BP8A 4GMFA 2FUG1 3ZE2B 1DAMA 3B7GA 2JIZG 4KR6A 1YOVB 1FDIA 1U3VA 2BFDB 5KC8A 3AI2A 4ZODA 4M0DA 3N0VA 3FDZB 1K8ZB 5KTMA 1JHPA 4LDZA 2XEXA 3D59A 1Z5OA 3TDNA 1CUUA 1HFEL 2BFCA 5JAUA 2H2DA 4B7KA 1J5PA 3S3WA 5IT5A 3KTOA 3NBFA 5EHQA 1QK4A 1JZQA 1W5FA 5SICE 3B8NA 4WGGA 1VGQA 1NUPA 1DBSA 5ICGA 3STVA 4QZVA 1ODLA 4HOYA 3M89A 4MV0A 1JEEA 5TVKA 3KE9A 2JAWA 4K3UA 4X24A 1KYYA 2KJQA 4RV9A 2G82A 3W1VA 4RNDB 5FUMA 4PRKA 2BFMA 4BASA 3BG5A 4W5HA 3BERA 4RTNA 4M8SA 4MGYR 4N3AA 1KZGB 4I1IA 4RY0A 1Z8NA 3E7PA 1U1CA 1CUIA 4EABA 3ZDQA 3FZQA 3QI7A 1S9DA 1Z07A 3AG3B 3DOHA 1FNNA 3BPZA 1NW6A 4W7HA 6REQA 3PC2A 2LUOA 4BEWA 3WTCA 2V4ZA 5ICEA 5U9CA 4B7UA 3AL2A 4QA9A 1NVKA 2ZDQA 4NHEA 1YI0A 1GTOA 3DFMA 5TISZ 4G0YA 2GK7A 1KBOA 3AETB 2DWCA 4C0KA 4M9CA 1Q0QA 3C3WA 5DGIA 1Y3AA 3CX6A 4HNHA 4BVFA 4YLGA 1OHHG 4ALMA 5KMGB 1M6VA 5EHGA 4NCKA 4K1XA 4BVAA 2PZGA 3UWDA 4O4IF 3NIDB 1YULA 2CGEA 1BL8A 1FUYB 4G97A 1D2HA 3RIGA 1PEYA 3QSYA 4H1TA 1W87A 4UU7A 2P2NA 2VTBB 1MRNA 3HPQA 4JUIA 4WJZA 4CMIB 5KQRA 3QKSA 1S5PA 1P5FA 2XOXA 1P5JA 3O1HB 3DJYA 4L0CA 2OB1A 4ZVPA 1ORWA 2RK4A 3WYGA 5ALNA 4N82A 1LK0A 1SRRA 5B6JA 3VSCA 3EF3A 3SC2A 2H16A 1GLGA 3G0CA 4KQXA 3EFFK 4MQFB 3DVLA 1RRGA 3LS2A 3RU3A 2XRMA 1QZZA 3LVBA 5F2KA 4NX2A 1KH1A 1TTTA 4CODB 2IEIA 4M53A 3I34X 2YFKA 5DHFA 2W90A 3TO5A 4CMKA 1NXSA 1W25A 3TCNA 1WLYA 3ZHOA 2XA9A 5AJVB 1P2FA 3D43A 1ZCJA 2DVMA 4NZ9A 3OI7A 5A04A 1BA3A 3PB3A 2H85A 1UWLA 5A5DA 2G76A 2Z4SA 1BQ4A 1S77D 4BBPA 3H19A 1GO2A 3JVVA 2UXBB 4MI1A 1TGVA 3AF3A 2YV3A 4EKWA 1GZ4A 4H3VA 3ZUGA 1GLVA 3F9RA 1DDOA 2BM0A 2RHJA 3DAYA 3O84A 2F8LA 3ISTA 1QV6A 2EIHA 5BN4B 4DQKA 4Y6SA 4HH1A 4P2GA 3V55A 1M7BA 3MQFA 3ESBA 2VZLA 3LHFA 3K0EA 4J4HA 1II8A 4DREA 4BRZA 3JWPA 4XDZA 4LHXA 1E1QA 3OAAD 3RUPA 2RGXA 2H1OA 1OX5A 1ZCZA 1E5QA 3WA6A 1SULA 1YBAA 2WU3A 3VR5D 1ZNQO 4LS3A 5ELLA 1P7GA 3W5VA 1SUEA 1Y6FA 4MTXA 3BE4A 2RB4A 2BGMA 4H77A 3AIOA 1M56B 5CVEA 4HDCA 1F20A 4HN2A 4HV4A 3QPBA 3OPXA 4S12A 1G5TA 1XLVA 4KODA 4EZBA 4IQ8A 4R7ZA 5EIBC 4BU0A 1M2EA 5BW4A 1E62A 4B5KA 3VVMA 3LXUX 4O4HA 1RYDA 4BLOA 4EFMA 3S2FA 5EC1C 3JATA 4BX8A 4PPQA 1AGNA 3TBFA 3VJKA 4MVJE 1XCBA 5A1JA 1FS0G 2DYSB 2JEXA 4G0ZA 2JEOA 3L7AA 1ZCAA 3RBVA 3KKMA 1A5TA 4UUBA 3G59A 2ZIOA 1GZ5A 3G9XA 4O4LB 5JCOA 3VBBA 2B8TA 3SF8B 1A9PA 3AVWA 2C1EA 2JVIA 4GVPA 2JEYA 4AJNA 2JFFA 3ZDXB 1PHPA 1BVUA 2GX6A 3NORA 5AT1A 2AIRA 4DLNA 3T9EA 1E92A 4NV1A 3P9ZA 4CC6A 3RTBA 1YOVA 1VM6A 1U63A 2CTPA 1FRQA 3X1YA 2CYCA 1RRVA 1JDVA 2IH1C 4CV1A 1KH3A 4JLPA 3IXQA 1P18A 4P81A 4M89A 5A3QA 3ZY3A 1ZP6A 1KFJB 2EKPA 2OCHA 2RIPA 1HE4A 3QUCA 3OCCA 4JLBA 1O58A 5HBRA 1PD3A 1TAHA 6AT1A 2BJWA 1G9SA 4QUGA 3CRVA 2EFDB 4AF6A 3ZXSA 1EBOA 4EATA 2PUDA 2F1HA 2C2KA 3JCZA 1UBJS 5LOVF 3RV4A 4BQRA 3KEFA 3B77A 3PEFA 3DC6A 1KEWA 4Q12A 2FV8A 2PRYA 4LRYA 2QEXV 2D59A 3AFGA 2GEVA 3IELA 4PPGA 2GYUA 3I3SR 5TGTA 1WA8B 5ALOA 1AXEA 3D6TB 2WLSA 2IKQA 3FB7C 1P62B 1U28A 1RI3A 1K7CA 3HCBA 4XUEA 2IY9A 2PR2A 4LFBB 4WXRA 4ACBA 4CCAA 3I73A 1FYJA 4NEHB 2CK3G 4DPMA 2IUEA 1T8TA 3RF7A 3T34A 2PGIA 1G21B 2EGHA 3AHDA 4S1PA 4WXHA 3ZN1A 4GPEA 2V65A 3AETA 1VG9B 4JTCB 1NPDA 5KOIA 5A9TA 1MENA 5JSHA 1VI6A 4BMOB 5JRZA 3H1KH 3RJTA 2ZSDA 2MSCB 4FOLA 3WC4A 2H94A 1ZNWA 3CE9A 4I81A 3VSBA 1E63A 3GVCA 4IVPA 3FWNA 4W5RA 3R3VA 2FMIA 3LFTA 2FSFA 4E13A 4KZPA 2QUBA 1LGYA 2VTBA 1UFQA 1Z38A 2D2FA 3G6EV 4CMIA 1GAQA 3L4EA 1K92A 3SJQC 4WBSA 7ADHA 4IPTA 4M0LA 1H3NA 5EGSA 4OXIA 1EWTA 2G1AA 5E2IA 3LHIA 3BBPA 4B0OA 1UDXA 2WKWA 2L0XA 4US0R 1T8RA 3FW1A 3WIVA 4G6ZA 3ADDA 3BABA 3VV2A 2Q2VA 1K7XB 2XCQA 3CKMA 4J7JA 5LPNA 1MGOA 1G6UA 1TVMA 4D0LB 3QVXA 3NV7A 3LTEA 3QUTA 1DTOA 4IIBA 4M1EA 3IAUA 3CIFA 3L1UA 1G7CA 3PUIA 1ZD8A 2ZUVA 1E5LA 3DL4A 1F14A 4DZZA 3D6AA 2JIPA 5E8RA 3PGJA 3BD8A 2IOYA 2H2IA 1NC1A 2HCJB 5FWDA 3UZUA 5CB4F 1XDGA 3L74H 1L7BA 5ADHA 2ONZA 5G0UA 2Q6LA 4HTFB 3LC2O 3TRFA 2FSVA 4RXMA 4K9RA 1J90A 4YQEA 2W70A 3SS7X 2RJZA 2R8RA 2PX6A 3IEIA 5BN4A 1XPOA 3R3WA 3RTDA 3RNLA 3WMGA 3GPLA 1VLVA 1MG1A 3FWPA 1RJ9B 1SF9A 4N39A 4A10A 2VPXA 4LGCA 3VZSA 4KE8A 4UTVA 1K89A 4JXKA 5CIWA 1WHTB 2OV2A 3BGDA 3WL3A 5ALWA 4GPIB 4QT0A 3L9WA 3IX7A 4UVAA 2O0HA 2W7TA 1GM9A 1IXRC 3T5PA 6ABPA 3I1YA 1WMBA 3HUFA 4FYHA 3LC1O 3BDVA 5AW2A 1OCCC 3JD1A 3CVWA 3PEVA 4QU5A 3CR8A 4MVWA 4ND7A 3TR5A 5FD8A 2D7CA 4MICA 2I2XB 1NYQA 2ZTVA 2C9ZA 1E89A 3BHJA 3DEZA 3LZCA 3ZS8C 1NLZA 3BRWA 2ZATA 2H65A 3FUTA 1MT0A 4M7RA 1JLLB 3PQ3A 1AJNA 4OXSA 3I55V 2NTVA 3ZWDA 5KTOA 3FTDA 2ZFUA 4CV0A 2FTKA 2H11A 4IO0A 4EB3A 4X3CA 4HGNA 4GVLA 3VR6D 3SF8A 1HYQA 1ND5A 2NZVG 5GJWC 2HSEA 5ES4B 1FX0B 5TQ2B 3KHTA 2VATA 1MAAA 2WYHA 1F2DA 4EYQA 4UUNA 1SUDA 1U96A 1RZVA 1N2JA 4G1EB 4OQMA 4X71A 3X2QB 3ZLVA 3GLFB 4C0BA 5DM6V 1FDVA 5LXTF 2V03A 3IDZA 2OCCB 1E9EA 1KVTA 3GG9A 2R8EA 3O95A 4YFYA 1FTWA 3QU9A 2EX0A 2ZCJA 1SC6A 5LQDA 4EMTA 1KY4A 3PR3A 2INGX 3DTNA 2NO0A 4OGFA 3LVRE 4L75A 3H4TA 5KQMA 1SOUA 1NFQA 1CEYA 1YIDA 3HC7A 1RHJA 1JMVA 5CA1F 1RYFA 4A26A 4TTRA 5FO1A 5JJBA 4FUQA 2ZUTA 3CUUA 2ZB4A 4NE9A 2NYAA 1JJAA 3I2JA 4JIGA 3OH8A 4A3SA 4YHHB 3ANLA 3SHTA 2AXTZ 4WN3A 3F3SA 1XZPA 1U8AA 1WA8A 1PGOA 1CHDA 1JFVA 4NDAA 5BWMA 3SYTA 4B3RO 3BM5A 5LQAA 5BZBA 3QHAA 4Y2TA 4BTVA 2H7YA 4FXPA 4XBFA 2WA1A 3BWEA 2J46A 1J97A 2GN9A 1XCPA 1OFVA 2VQ6A 1G21A 3TZQA 1M57C 2WEKA 3EFOB 4P32A 4OOEA 1RVDA 221PA 1DOZA 1VYHA 5LP6F 2O0MA 1H0RA 1C80A 2BEJA 2IXGA 2YVAA 4N47A 4L7QA 5KEIA 3EMKA 3ZGVA 6GPBA 3I9V1 2C61A 5AKKA 4C4SA 4J9VA 3E3LA 4LYEA 1FDOA 3KTDA 1GVNB 3T9CA 1XZLA 1P7ZA 3ZQKA 1OFHA 3A04A 1SQVH 1DC8A 1HZZC 3WB2A 3JTEA 3B89A 4RE5A 1TEVA 1YZ3A 1E3TA 4MTLA 3NALA 2O52A 1EZ4A 5ALGA 5BV2P 4B76A 1KU0A 4E3WA 4PVCA 1M5TA 5C1OA 1FXHA 3RG2A 4P34A 2JASA 5EMNA 5SV2A 1ZM9A 3AW8A 1AXGA 2YOFA 1T4GA 1CEXA 2O8VA 2PUFA 1QG2A 1T13A 2WILA 5GINE 3I39X 4BAGA 1M8GA 1MC8A 4MA0A 3P9YA 3AG4B 4Q4HB 2RAUA 3GO4A 1I3KA 2IHTA 3BWMA 3KQOA 1ORHA 1RHMA 1KJNA 4IWYA 5F23A 4KWEA 3OZXA 2HA3A 5JBIA 4B79A 1B2LA 2PX0A 1GQQA 4DCSA 3PNPA 4Z8XA 4AKSA 2X8AA 9LDTA 4RDXA 1RCUA 3DE1X 4J9ZB 4IGEA 2UXCO 4HAUA 4E2YA 2A7QA 4HTFA 2VHTA 5FWXB 2A9PA 2C83A 3T4EA 2QDOA 1QDLB 2YIVX 3A10A 1YB6A 3C48A 3T7CA 4QTZA 4UCTA 4YY3B 1GN3A 1EVKA 3COJA 1IBCA 1Y1RA 5JYEA 4DR5O 4AX8A 1XTBA 2HK8A 2CMGA 3NZEA 1SUSA 1M1KW 5J9PC 5FB3A 2IY8A 2X0KA 1V1JA 1RJ9A 2ZNIA 3COSA 2QUHA 2R4QA 1BWQA 1EK6A 3FCAA 4NBTA 4D3SA 3G6WA 4DR2O 2IUUA 1Q11A 3IILA 3W04A 4Y2RA 2EKQA 5M04A 4KN9S 1W4AA 4F0JA 3WP0A 3GNQA 5JCZA 4DV1O 3L02A 5DK4A 1AUVA 1WXDA 2QAGA 4F72A 1SKUA 4HF7A 4M7PA 5DGDA 1KEZA 4W4LA 1JR2A 2B7LA 3TTYA 5JQGF 2XBUA 1JLLA 3EGEA 4LRSB 2XJ9A 4C6SA 3AM3A 2C9BA 4BVEA 4DXAA 4DXDA 1KI3A 1M8KA 1FBNA 3BFKA 4RPLA 3WQSB 2XTAA 4PZCA 4R81A 2GBOA 7YASA 2F43G 1N5RA 2VG8A 4BNVA 1Y8AA 3PPIA 1AKNA 4LJKA 4MW6A 1X42A 4PEVA 4DA6A 5EXSA 2J9ZB 1FX0A 5TQ2A 3HY4A 3DBOB 1WHSA 4IDBA 4J1SA 1R6XA 1T35A 5A03A 1IXZA 3KSAC 5CXUA 3GLFA 1S8AA 4LG1A 3MIIA 4RMIA 5KHKA 8OHMA 4MT8A 1WS6A 1LQ2A 4N8DA 3TCUA 3CCLV 1A8QA 3QE4A 3NS7A 2XVMA 1FMFA 1CERA 3UQYS 1Q82W 2D3WA 3TNYA 3S8MA 1ZVJA 4AJOA 2D06A 1AS3A 4RTSA 5REQA 2ZI5A 2AR7A 3VNUA 1SZJG 2JEZA 1Y9DA 3P9SA 1E0DA 2PIAA 2FKXA 4ZQHA 1RLMA 1A3CA 2X7RB 5KNBA 1YQDA 3LUPA 1YXBA 3ES9A 1S89A 2Q6OA 2WAAA 3SOZA 5K4GA 4BX2A 2FN9A 3HA5A 1LFAA 1RWWA 4JBLA 3OT5A 5AKIA 1I4WA 4PN7A 4WFKA 1SVNA 2IZ6A 3OZWA 2A5GA 4FCCA 3UICA 3C16C 3IIIA 4F7WA 1VLZA 3F46A 4HQLA 3F73A 4QDJA 2Q6IA 5FTMA 2HJGA 3BMNB 4UATA 2B9VA 1NVTA 2ZD9A 5G1PA 4ARUA 3R7WB 4LECA 3BDIA 1VEWA 1RC1A 1CUJA 3NIFB 1T3GA 3N8IA 5KIAA 3EFOA 4UHHA 1GM5A 3ADBA 3X0DA 3I12A 3F7YC 2Y27A 5GGYA 3FM9A 1T3TA 2J3QA 4EAQA 1V0JA 5DXFA 1QOZA 4PHHA 3G68A 1P29A 4EUSA 1GUBA 1VHWA 5J23A 2MYPA 4DV0B 1JPUA 3I5AA 1FU7A 1EVLA 2FOXA 3RTEA 1XLWA 3E9NA 1OKKD 2HMUA 1HT0A 5GZ1A 4R69A 4ZQGA 1OQAA 1CIJA 1IUKA 4OHYA 2DOKA 4Y6GB 4E09A 4GS5A 3BX1A 1LRKA 2EINB 1TK2A 2ZJ7A 3G88A 1VMGA 1E9DA 3NEJA 4A92A 5H2FZ 3IP3A 2B4AA 1E77A 2F3TA 1BMFD 4D0RA 5H3HA 4KFSA 1W94A 4Y98A 4U2DA 2EILB 1GGMA 1NSTA 2IU3A 4LQLA 1D6JA 2GXAA 3EBLA 1PS8A 1EB9A 5JD3A 2R9VA 4Q4HA 3STYA 1PE0A 4KUHA 4B40A 1V16A 5AKXA 4LXQA 3VR0A 1M76A 2HF9A 1UINA 3QUQA 2IUYA 3QU5A 5JFGA 1DS6A 2Q6TA 2NZ2A 3HK2A 2Q3BA 3QOYA 1NXQA 5IDXA 4HX2A 5DMHA 2IV3A 3W8DA 3SEFA 3PQ2A 5FWXA 3ZWPA 1CY2A 1B76A 3UAOA 3GJYA 1FVFA 5D3KA 4ILKA 3L7DA 2ZSUA 2Q67A 1C30B 3FPKA 4CLOB 3KOUA 4LZWA 5FL7G 3N0WA 4GMHA 4XDJA 4WOPA 4LGMA 4KBFA 2Q5CA 1G5PA 1BYIA 4PC3A 3H2JA 3DT9A 1HR0B 2HGSA 5EAIA 3LV8A 1PG2A 4KPGA 1QP0A 5CM8B 1LTQA 2WIDA 1U9CA 5CVJA 3EWSA 1AKUA 4IF4A 4JZKA 4GX1A 2MSNA 3KYJB 5GGXA 3ZI7A 2WDPA 1ZUD1 4CL8A 4HEA1 5I7HA 4G67A 3QX3A 4P92A 3TSWA 3GGJA 4KXLA 1COWG 4TQDA 2UZ0A 1I0IA 4KXUA 1QTNA 2BN4A 4FGJA 1MSDA 3QEMA 2Y77A 3W2TA 4BVJA 2G1PA 1GTVA 3JWIA 1QP8A 2WYOA 2QR2A 1V5FA 4LJYA 4PICA 3KFXA 4EG0A 3UJDA 5FUVA 1YVDA 1ZXXA 1AHPA 3OT1B 1JKFA 3L46A 3K96A 1E2IA 3GAFA 5KAFZ 1T9AA 5C7YA 1G5HA 5J4KA 2RHDA 1NWCA 4J1QA 2E74B 3V4ZA 4UBLA 3GH1A 3KKOA 1KWGA 3E3OA 2C3UA 2OHOA 1V54C 4FIPC 2G5CA 5I9TA 1DWUA 1P1BA 2E3JA 4OI1A 5AM5A 5F7JA 3LQRA 5PNTA 2Z0AA 3DZIA 4AVYA 1YTFB 5C4MA 1J2YA 4RV4A 4QL3A 3CTMA 2FFBA 4DUZB 1LDEA 1U8CB 5DP1A 1J8VA 3I32A 4XVQA 3NHZA 3RSHA 2V3CC 1SH7A 1QYVA 2ZWVA 3IUJA 4J42A 3TQQA 5KNBH 2D74A 3QPWA 3PDCA 2CTWA 2F6RA 3HHEA 4FQ8A 1SXQA 3W4KA 3K9HA 1Z6XA 4IM7A 2JJ1G 3ZBUA 3FRJA 1TU0A 1EN5A 3JVEA 4FCTA 4OGWA 1JYFA 3ER6A 4ZGWA 4UNRA 2J87A 3VR2A 1E2BA 1IK6A 1N7GA 4DWWA 5BT9A 2WSSD 3NTUA 2QROA 1R1DA 1VC2A 4F38A 3LUJA 2H5IA 1YQUA 5KNDH 1RXEA 1TTQB 3VOUA 1R9JA 3IC7A 2FJ0A 2ZBGA 4GL4A 4WEOA 4NR0A 3GW8A 5DNUA 2ZYIA 4CKBA 3TL2A 2WNSA 3X2EA 4QLOA 3FFTA 2BFAA 2XZLA 4QBHA 1JN0A 2ZI7A 1WMDA 4DBLC 4RDIA 3VXKA 2HMSA 5H59A 1Y76B 1YASA 4C0WA 1EP2B 3BQNB 3BILA 5I5GA 3V7YA 3ETDA 4XGNA 2ETXA 3UB2A 4JMPA 2XI4A 2OK7A 3GJQA 1FMTA 1K6XA 4I4TF 5AK0A 5F33A 4ZDKA 1DAIA 1DAEA 5EE5B 5KUTA 3BMNA 4GKBA 2P9BA 5KKCA 3FYDA 1YACA 2GM5A 3R6GA 3R7WA 4J0EA 2YV4A 1OX4B 2HB6A 1ZMTA 2EIJB 1CBUA 5IH3A 4ROTA 2VWHA 1HK7A 1WCV1 1ZM3A 5JI2E 3JQFC 4C76A 3CU5A 2QYHA 4EF5A 3OIDA 2J5QA 2OESA 4MTOA 3R5HA 1JPXA 2YDEA 1YR3A 3EG9B 3MMPA 3QNUA 2PL5A 2WIGA 5FPYA 3ACDA 5CLHA 1KBHA 1GPAA 4JI7B 4CMGA 4HAYA 1E3LA 3NP7A 4BFLA 1KMMA 4B4UA 2O5VA 1H4SA 4FOTA 4DCPA 3UK7A 1F8YA 2CL7X 3VHRA 1Y3FE 5KWJA 2B4TO 5G0WA 4QO8A 2IA5A 3VJLA 3VTZA 5HKKD 2VQ3A 4B45A 4DQUA 1QHIA 4TYNA 1Z0KA 1F7UA 2XMZA 1SCNE 1N5KA 2Y2VA 4QDXA 2H0QA 4W5NA 4TPKA 3PPXA 4ITUA 2QT1A 1N75A 3AP1A 3PS9A 1AIPA 3IQZA 5AM1A 2AXNA 1X1CA 2C99A 2XOEA 2OC4A 4P0TA 1IRXA 1TQ8A 3LQQA 4OXQA 2HLDD 5LP1A 4UTPA 2GA9A 3GLGE 3FSJX 3JQQA 3MWDB 4DLBA 5JANA 5JMWA 1KIMA 3S7ZA 5I7AA 2J9RA 2D6FA 1JFTA 2B6NA 4J94A 5IY5C 1LW7A 1KDTA 3SJBA 4EW6A 2A1TR 3PQ8A 5BY1A 3X1MA 4D92A 3AF4A 2OD9A 4KQFA 2JLYA 3BFJA 2Q2NA 5SYNA 2HREA 3ONWA 3EDMA 2WU0A 1OH7A 2WG0A 4NBWA 5FWYB 4CLOA 2V98A 4P5PA 5I7VA 1LD3A 1ZEMA 2CDCA 3SMQA 3V1UA 4HATA 1UOEA 4ARCA 1SU8A 2OFPA 2QUJA 1YB4A 4HMQA 2OG1A 3MN1A 4C21A 5GOTA 3HB1A 4N5IX 3B4SA 2H17A 3QXSA 4PBSA 3GRYA 3ER8A 1HTWA 5LA6B 1K3EA 1GOTA 2B1GA 4EJ6A 3WTBA 4RLHA 3GEMA 2HYIC 4D2IA 4PCUA 2Y1XA 2QSJA 2GUGA 1ZX1A 4AY4A 1L4BA 1LUVA 2L82A 3S2SA 1AQJA 5J2UF 1TVCA 5JSFA 3B1ZA 1ZI6A 3QQ5A 2F64A 4WMLA 3ZX4A 5KYGA 3OT1A 1NUAA 1XQ1A 3F67A 3QG1A 4DQVA 3H3XA 2P9GA 4ID9A 4KJXA 1Q77A 4DCCA 1CZHA 2CHVA 3U37A 4POOA 5IT9A 5EKTA 1BAPA 2VJMA 5EPEA 3EZNA 3I0ZA 3TQRA 1KL7A 1B23P 4UJ5A 1MKYA 2KMLA 5I9NA 2NXCA 4EELA 3DDWA 2D13A 1MVNA 2GAAA 1XU4A 1Q0RA 3EVKA 1Z9BA 2OBNA 2VPQA 4NCNA 4AG5A 4WLFA 2P4VA 5THQA 4BO7A 3SHOA 2CLIB 2J3LA 2WPNA 5C9ZA 3DE3X 1DC4A 2C1ZA 2CBZA 1UP7A 2P4QA 3ITNA 3K5IA 1KP2A 3FUUA 4KQGA 2G1JA 1VQNV 4ONEA 1MIOB 4IICA 1MXHA 1XNHA 4H7HA 1GZ3A 4HFNA 1ZOOA 3ZDZB 1Q1EA 1EFCA 2WJVA 1XUQA 2FKAA 3I3OA 4B3GA 3UJ7A 4ZTUB 3ND6A 1YE3A 5HGJA 2XB8A 5BSWA 3V1LA 4DJFC 2QVCA 2GD1O 5BR1A 3DOOA 1IH8A 5EIBD 2FYUH 1HM5A 2AOVA 3RHTA 5AKYA 3D8SA 2R7KA 4UPEA 5B4UA 1LFDB 1CVRA 1Y76A 1G0NA 2OHHA 5K3CA 2J67A 4Z3DA 4J4TA 4DR4B 3LDHA 1A98A 2IEYA 4EHAA 2JGNA 2DQ4A 1ZX3A 4JI1O 2OXTA 4QGFA 3BTVA 3RK0A 3FKSG 3WYNA 1EFRD 2G71A 4HP8A 3LTNC 3ESYA 4KXRA 2ESRA 4QFCA 4PRYA 1OX4A 4LSMA 2RONA 4REOA 3PE6A 3IIKA 1R7RA 4YECA 3ZE7A 1BNCA 2IQ5A 2Q28A 3K16A 3UENA 2XXAA 1VIYA 1N3BA 4V1CB 3D5QA 2PDAA 1AKQA 4LC9A 4KDCA 3LDAA 4IXNA 5HTOA 3EG9A 4AJ1A 4OXRA 4Y67A 5IUJC 5EL0A 3KOXA 1EM1A 3A6KA 3C3XA 1NV9A 4LXIA 4JYCA 4ZC1A 2FPXA 5ALMA 4PNHA 3ASUA 4FHZA 3KKPA 2A7WA 1A1SA 1R0YA 2GXUA 4PPFA 5K2OA 4OG2A 3UCSC 5JNRA 3GCGA 1D3AA 3EODA 4W82A 3SVTA 5BSUA 4LRQA 3RVLA 4BZQA 5KWSA 2QLLA 2BUCA 4MZDA 2XSZA 1IN7A 1ZYUA 4TYMA 4Q02A 3A6DA 3AR6A 3RYTC 3M34A 2IPNA 3LY7A 3F5FA 2PNJA 4DMMA 3BMOB 3SF0A 4I8DA 1PR5A 3ED5A 1WL8A 1Z75A 3M6FA 4R01A 1EK1A 4BHTA 3M6AA 4J07A 3PXDA 1Y7HA 5H4GA 3RIHA 1JG1A 1VQ5V 1LB1B 3MWDA 1V55C 3PXUA 1VBFA 4ENRA 4J3JA 1RZRD 3AG2B 1ESNA 5LJLA 1MCZA 2Z1MA 1E5XA 3TOXA 5U4QA 1OR8A 3UMRA 4YMVA 3JZAA 1IG0A 1XXLA 5GTDA 2Y6VA 2ZCUA 3ZXUB 4NWIA 5F3DA 1Z33A 1R0KA 1FYEA 5JWOA 1W5EA 1ZBQA 3T7RA 1U81A 2AS0A 4GRIA 5KOJB 4OPHA 5KNCD 4Z51A 1R3KC 4CIBA 5D86A 2Y8EA 5AMXA 3TGWA 2PFGA 2PYIA 2JJ8A 1JTVA 4CL3A 1P7WA 4UV9A 3AVYA 2H1HA 5CGQB 1Z28A 5LA6A 3H5IA 3JD4A 4CQNA 1OPXA 3DLTA 5FPKA 4TVKA 3VMMA 3TUJC 3PIDA 2MK3A 1B1AA 3O4JA 2QU7A 2XOKA 2P0EA 2HDWA 2Y4OA 4ZU6X 3A2FA 2C7OA 1F2VA 1E20A 3A4MA 4JAAA 5KYUA 1KH2A 4ZYYA 2GASA 5FBRB 2AW9A 4BC1A 1PZFA 1WCXA 2R8PA 3ZI4A 1NH2B 1JBKA 3F5DA 2GAIA 4D81A 3CH5A 4C3ZA 1SBYA 1PZEA 1U98A 2PGLA 1TCUA 3OQIB 3WQHA 3EYAA 2JI9A 5ILQA 3Q9SA 3EVNA 3KR9A 2C2GA 2XGSA 4D9CA 3FBWA 4LY9A 5EJ5A 2XB4A 1A8IA 3KXKA 4I99A 1RQ7A 1HBJA 2XUDA 4C5AA 5JS8A 3OD4A 1GRRA 4RJIA 5G41A 2WAYA 1GAWA 2VHUA 4R5HA 4TWRA 4R1LA 5EZ6B 4BTLA 4DUGA 2AVDA 4IINA 5E1BA 4BDTA 1YDXA 4PXAA 4YRQA 4M0FA 3H1BA 1CQXA 4O8ZA 3R1IA 1GRQA 3E1SA 2H48A 4G3XA 3FBTA 4FHFA 2CTRA 1TZBA 3DF7A 3IVMA 4CR8A 3DOEA 3KBOA 3DVRX 1X4TA 2OBBA 4DLRA 1X87A 3WGUA 1U2PA 1E69A 1HDJA 3GNTA 1XNQO 5DTMA 4RBNA 3T54A 3CF4G 4MCHA 1A8PA 1M0WA 4KZKA 4RNCA 4C43A 4Z1MD 1NF9A 2XMCA 3THWA 4D82A 2XAFA 2W98A 5EWLA 3DFUA 3O8CA 3SKYA 3A2LA 5EP2A 3F2VA 1XN1A 1T4BA 1PT8A 4A8TA 2OILA 1RXVA 2FPRA 4JP1A 1IEWA 2I55A 5EMJA 1GUAA 1U0NA 5A4DA 1SERA 2ILTA 3WADA 2O2GA 3LT2A 1IZYA 3WNVA 1GPDG 4K05A 3HYLA 1MAWA 1RWBA 1VQ8V 4WK2B 1KAGA 5T4FA 4KB5A 4C7UA 3IAS1 4TSKA 2PIDA 1RJGA 5BMVF 2JFBA 1H2NA 4LBYA 3BCUA 5HDQA 2WZQA 4A27A 5A9SB 4IQ4A 1H6AA 1C7IA 4V1CA 3OEEG 3AJDA 2F9FA 4Z9BA 5C5DA 3LO5A 4IQ0A 3QVTA 1ZSVA 1V3UA 2ACWA 4IMPA 5A4MS 1PQYA 1XJ5A 1DPFA 1VG0B 3PFWO 4JI6B 1V8FA 1RI5A 2PQ2A 2I6UA 1FSGA 1C3VA 3MTEA 5EP4A 2CTQA 4KR3A 3I76A 3CO0S 5G53C 1DCFA 4EG6A 3GQBB 4FZ5A 4YPOA 3ZWMA 4TL7A 2X8WA 1KORA 3AU8A 4FZ1A 2PLAA 1BS1A 5FPSA 5B53A 1GITA 1FX1A 5FPPA 1FU8A 1MC1A 2PFSA 2CLKB 4FX5A 4WAUA 4G1BA 1HNXO 5E8JA 2C7PA 4EARA 2ZR0A 3BMOA 3UC9A 4N65A 3PFGA 4ZT5A 2JFXA 5CB0A 2ZSIA 3C3DA 4KQJA 1LR1A 3GBSA 3G80A 1X3SA 4BVLA 2YINC 3ANSA 3CWZA 4LF8O 3H01A 2GESA 3JRNA 1WEHA 1ULSA 4OOFA 1YRWA 5BSFA 1U1EA 4PX5A 4C0HA 2IPLA 2IY7A 1S3IA 1SETA 4LRWA 4AJIA 4K9OA 4TQAA 4UBKA 4FM2A 1IUPA 1TO6A 5KQLA 1O7JA 2IGBA 4FPPA 1YKGA 2X0NA 1V25A 3MYRA 2A6PA 3SYQA 3C5EA 1YC5A 4BTEA 4MUJA 1DQPA 3K03A 4U5XA 1EEHA 1SQSA 1SUCA 4H6VA 2XR1A 1I7NA 5JD5A 4DV5B 5KOJA 4ZO7A 4UVHA 4BO4A 2QLMA 3I2FA 2D4HA 3KT0A 3ROPA 1Z17A 1I6LA 4PR0A 1ZTEA 1DJLA 1XA0A 1K27A 3QPVA 1IYZA 2BCGY 4GKKO 1X14A 3VNVA 4JVOA 3VDXA 4J76A 1G8HA 5DBIA 4B3TO 1A8HA 1N2CE 4G0MA 2QM8A 3S8YA 1G20A 2YS8A 3G17A 3IULA 3SZ3A 5BQ3A 1F23A 5C1BA 1HP8A 3I09A 1DAPA 4HWGA 4KL8S 4UEQA 1D5CA 1Q0PA 1TEZA 3VTFA 4YASA 4OJYA 1SIOA 4E30A 2QZPA 4BLUA 3OQIA 1RLTA 3IVCA 4PSAA 4DJTA 4JB3A 4KIJA 4FFRA 3WWZA 1P6QA 5ER6A 1BGXT 4DRYA 1ZU5A 1BMTA 1IM5A 2F1OA 4DYDA 3H2HA 1T4DA 4UOEA 2C5HA 3S1SA 4UFZA 5EGNA 3T06B 2XNCA 4QAQA 2O8DB 4XYGA 4X8OA 3RTAA 2ZR7A 4OU4A 2KS6A 3ZD7A 1KFKB 2B6HA 3OEYA 3GZTB 3EXIA 5J58A 3O7WA 1CE8A 2XA2A 4I4NA 4R8MA 1JKXA 4OSPA 3GCXA 1PRYA 5A4IS 3QVVA 4BNKA 3MT9A 1YI8A 1FQJA 2BFDA 3AHJA 1CRQA 3NH9A 2OV1A 1Z12A 2QTFA 3D1JA 5I9IA 1EUYA 4GEGA 3FDZA 3T8YA 3S3XA 4IIUA 2CLFB 3O90A 5TE9A 2ZITA 1SOMA 2VT3A 2Z3YA 2B69A 2D62A 2DKNA 4WXMA 3JAMA 1NDHA 1X7DA 2R8OA 4HYOA 1W0JA 1J2EA 2P91A 2Z57A 3OTFA 1YBHA 2YHAA 3SQMA 2J9XB 2JATA 5FT9A 4BMPB 4ZEVA 2H4ZA 3GMSA 2BFPA 4MXDA 3CSUA 1QYRA 2X5NA 3FPSA 4X97A 3P30A 1JSZA 5IVHA 2LDBA 1CT9A 2E5LB 2P6UA 2Q69A 5ALJA 3H9BA 1JAYA 3CLTD 3MGGA 3SEZA 4GUNA 1W88B 2FVYA 3RRBA 4AO8A 3A3NA 1NBMA 5DI9A 1ZMRA 3KHSA 4NBVA 1TU3A 2MW2B 2ZR9A 2HJHA 2DJ5A 4A5OA 5H68A 2VDVE 5FNVF 4TYYA 2PY5A 1LWNA 5I01A 1L5RA 2HEPA 4UHJA 4CM1A 2M1ZA 3CUWA 3MAAC 1XTUA 1N0IA 3AR9A 3HWWA 3JWGA 1WSWA 4O8CA 2VVTA 4DMCA 1Y6QA 4WKPA 1L3CA 4DNQA 2OSVA 2P2LA 3ONEA 4MPJA 4UQPA 2W2TA 1UT6A 3I9FA 3WQBA 3U0ZA 2V8OA 3SGIA 3IA7A 1JQLB 3DB2A 3LPCA 2K5UA 1SBQA 5A9SA 1BFKA 5KMGA 1W48A 5F9HA 2PSSA 4DSNA 3WIDA 4MKFA 2ROQA 3BF8A 1KC8W 4GPD1 4OAQA 2AFRA 1AB3A 2P1ZA 3G9UA 3M6VA 3TTWA 4WZBE 3ZEAA 2RQ6A 2XHEA 4OLHA 1VDMA 1DKPA 1BHAA 3CS3A 4EW3A 3SYOA 3SEAA 4FFDA 2SICE 4MEBA 2P9ZA 2X14A 2JIZD 3GDFA 2XW6A 2ZS8A 1ABFA 4QICA 2QG6A 2OQIA 1DB3A 2WLJA 3C8MA 1FMLA 4LJ4A 1K3FA 4GLLA 4N18A 5GWXA 1WA5A 3EZFA 2PD3A 1QCDA 3ABRB 3MCTA 3P9XA 1GNSA 4KQ2A 5F12A 4LH7A 2RK3A 4F46A 2BBWA 2I2DA 5DGCA 4MQFA 1FLVA 1AKTA 3AJ8A 4L5BA 1XG5A 2OZVA 4DDMA 5TLSA 1O87A 4Y9DA 4NTWA 4B3SB 3GVMA 4ED9A 1A32A 2EIXA 5E38A 1KMIZ 4WINA 2BW0A 1ACMA 1QZ3A 3OLYA 5HS6A 4YQFA 1XZ8A 2WF9A 1Y9EA 2YRFA 3VUFA 3H1FA 5LUBA 5ELXA 1ZFNA 4BO1A 4YAJA 3ASNB 3I45A 3NPAA 4UAVA 4UPVA 5T4BA 3TSYA 2WJYA 2IZ7A 1IXSB 1SVWA 2HPAA 5L7WA 2X4LA 2ZJYA 1W0KG 3OQ1A 4GSYA 4DJEC 4U7GA 5DBGA 1QIKA 5IRCD 3PE3A 2C2HA 1V6CA 4PSKA 4BV2A 3GLTA 3N86A 3EPLA 1S5HC 3GRFA 3PHLA 1SN7A 2HFJA 5WRFA 1IZ8A 4XIIA 3C3MA 1YO6A 3IUEA 4MS2A 4D6YA 1Q44A 5G4LA 3OPYI 1I0HA 2H0RA 2PRZA 3DAGA 2BGNA 1F2UB 4UU1A 1N6IA 1Z2PX 1UJMA 2M9MA 1GFWA 1XAJA 4GM4A 4XQEA 2PU5A 2Q3HA 1ZM7A 2BZGA 2H2WA 1G66A 4LJ8A 3WV5A 1OHHD 4GCZA 2C5FA 4EUNA 3UMVA 5JYBA 4UCUA 5TF0A 3AG1C 3PEYA 3ZK9A 4GG1A 4EKGA 3KQQA 5E2BA 4NCJA 3V7FA 1J4AA 3AY7A 4DQDA 5GVRA 4WECA 1PFYA 1FDRA 3LNNA 3I37X 3B1WA 4G41A 3DEJA 4R4JA 4PX2A 4FQ7A 2QTGA 3AOEA 3BFPA 1FP4B 3CY6A 3ZXYA 3HG7A 5I7FA 1RC0A 1FP2A 2XAAA 2H1IA 3L0PA 1DOHA 4CETA 1I1QB 4Q5IA 3E0XA 3EIFA 3ENNA 3FYUC 4Q3AA 1I4LD 5F35A 3MLEA 4GU5A 2W2XA 4YUXA 4BNDB 3W9BA 4CM9A 5K0LA 2R70A 2EG5A 2GZHA 4LOIA 3WFZA 3H75A 4O4LA 3FYTA 3NO4A 3NR2A 4TKVB 2DQKA 3RFXA 2Q5QA 2O8DA 2PKXA 2A0KA 4EFNA 1QPBA 5BXYA 4FU0A 2V7QG 1SKBA 1OWOA 2QNIA 3KAJA 4Q05A 1MA0A 1JDTA 3TZBA 3PX3A 1F9EA 4F97A 1K34A 1WXHA 3O4GA 4F2DA 4EMSA 2XGOA 1D2MA 2XQIA 4XWAA 1KJYA 2PO5A 3NAZA 1Q6IA 4PDMA 3TQSA 2AOUB 1MIHA 4KAFA 4GUDA 4WK6A 2QVLA 2HNAA 2G4CA 4NYJR 2WW8A 2DBZA 2C5GA 5KX5B 2FJPA 2WSBA 4AM8A 3B09A 4N48A 2HJ9A 2W6ZA 3USZA 3TX6A 3LGXA 3K0HA 2J0UB 3IJEB 4BZZA 3TRJA 1KO1A 2DPYA 2UZAA 4IGFA 4OUDB 3QEAZ 2I4RA 5AJTA 4DK1A 3GPBA 3LUCA 1UZMA 3T4ZA 1ZVVA 1MO5A 3OMXA 1W88A 4J0HA 1T15A 4JEIA 3LZ6A 4P36A 4U2CA 1I6WA 8AT1A 4R1TA 3A1UA 3I42A 4JT2A 2FMTA 2KBFA 4QTYA 5JNSA 1FS6A 5BVGB 4B6FA 3PR2B 1Y3HA 1UBKS 3N6RA 4D4IA 3AF5A 4TS4A 3A58B 4G4SP 1KSFX 1ILEA 4E12A 2D2EA 4YYEA 4UHFA 4XB2A 1OXBB 1A9QA 2IE8A 1CQIB 2HLPA 2D00A 1TYEB 4L4YA 2EP7A 2VP6A 4L1KA 1SK9A 1L4KA 3HP1A 2DBQA 2R9IA 4QDTA 1IN1A 3ED1A 4C2BA 1RD4A 4LCUC 4UNSA 2RGYA 3C90A 4W4TA 3UM7A 1GARA 1JHQA 3W6NA 4H7EA 1J42A 4OB8A 3WHKA 1GIAA 3DAOA 2CZQA 4RGQA 4Q3OA 4Z0TA 4IG9A 2CDRA 1AILA 1QONA 3ST7A 2IXEA 4YACA 2O8NA 1E9AA 3PRJA 1K4YA 3DKVA 1ZGGA 4OK6A 1RYNA 1RM1B 4BRWA 4UFPA 2GPWA 4JI4O 3KQLA 3HYTA 1N0HA 3AK4A 1H6CA 1QRRA 4EMUA 1MMMA 3TOCA 4JB2A 1UPAA 3HKBB 4EHJA 1Z35A 3EA5A 3E70C 4TVBA 4RUKA 5MGNA 3WX0A 1J22A 2PZSA 4E51A 3TETA 1IQ0A 2LPMA 5CNJA 3HY3A 3KSRA 3PNLA 1CUDA 2EW8A 2Q8PA 1PEDA 4N7RA 1HE1C 1T0JB 1S4QA 2WHPB 4HZUB 4D8VA 3TOVA 5A0VA 2ZIVB 3BA1A 3OP1A 4P84A 1UFIA 2UUBB 2VRCD 1J56A 2CK3D 4N3CA 3VHXB 4ZU1X 5DT2A 4C87A 4IL5A 2JKZA 5JVDB 3F5WC 1QLJA 1XI2A 1WE2A 1F2UA 1WHTA 4EG3A 1JQBA 1K4MA 4A8JC 4L27A 3FYCA 3W6UA 3CA8A 1CJVC 5KTYA 3N28A 2FMKA 1KJZA 2QGNA 4DLUA 3QGMA 2EJUA 5CDFA 2P5SA 1T34A 1C8KA 4V24A 2BFOA 2I3ZA 1ULHA 1TK3A 3F9CA 4GZLA 2ECPA 1L7EA 2C7VA 3BHMA 16PKA 2XNDG 1UBUS 1DFGA 2NG1A 4MLCA 2WPDG 4Q7JB 3ETNA 1FP4A 2UUAB 2FWBA 4MWZA 3ZY2A 4ZICA 3CLTC 3JASB 2ECQA 4IXMA 4BRSA 1JFLA 3QLUC 4K3VA 3NM5A 4U7WA 4BNDA 5B1DA 3TJZA 1P60A 1X8XA 4TRNA 5G4KB 4YCAA 1NYLA 2VSXA 3ND5A 3R3HA 3CT4A 1XFAA 4TKVA 3JRWA 2EGUA 2YL2A 1YS6A 2EKLA 3KUKA 3B9RA 4P1ZA 4QVIA 2QF7A 3HDTA 4H7FA 1PQUA 1Q1NA 5JS2A 1L5ZA 2IYAA 1NURA 1OUMA 5JXJA 4XLZA 2H8PC 2JFHA 3HN7A 3KZXA 1YRLA 2BUBA 2QZJA 4I5GA 3KBBA 3A0HZ 2DHEA 5IJ0B 2W58A 5DSZA 3HJBA 5AESA 3FCYA 1D7AA 2HMAA 2JGRA 1U3TA 5HF9A 1Y74B 3JYLA 2BBOA 5EBMC 5E4TA 5D00A 4I4LA 3S27A 1KO8A 2GHTA 2DAPA 5B57C 2A35A 2BGLA 2UUPA 2J0UA 4K8XA 1KU6A 4CPDA 4PNEA 4E5YA 4MIEA 3I04M 4ZAYA 4JQYA 2W8ZA 1KB9F 3F6EX 3T3MB 4ZOLB 2P30A 3EBOA 3EEIA 3OJFA 3NEPX 3E7XA 1OYVA 1XJ0A 3WJAA 5FL3A 3RRYA 5LU8A 1R12A 1VGVA 5IG2A 5B1EA 3DTYA 2OTCA 3GLIE 2DWUA 1GCGA 4Q01A 1Q7YW 3WLIA 2VK2A 3E84A 2O50A 4REMA 2K7FA 4QUAA 3HCNA 3N2YA 3W5JA 1P1RA 6LDHA 2DQSA 5BVGA 3I30X 4Q3CA 3K4HA 3OMLA 1BKYA 3AIIA 1MOPA 4FOOA 1II9A 4MV3A 3EWNA 4MUBA 2PS1A 3TFOA 2IYOA 1E99A 3MOGA 4S05A 2DWOA 3PVSA 5JS6A 2LTAA 4BW9A 1CQIA 3FMVA 4OMFG 2DUJA 3RCBA 1XDSA 3G8CA 2J9FB 2Z4TA 4BNZA 3C0KA 4N6NA 2ZYUX 2X7HA 3BGSA 3TE7A 3KSDO 2C59A 3BJIC 2J0VA 2H4FA 5JWPA 4TYPA 5U4XA 1MTZA 1FTSA 1Z62A 4GPZA 2I91A 3RSLA 4X94A 4IT5A 2R00A 2VSYA 2QTHA 1ZUIA 5E6SB 1R6KA 3IALA 3KETA 2JKYA 5B1IA 3R41A 2A30A 3JZFA 5AW6A 5JS7A 2QRUA 4BBZA 5B7PA 2GFIA 3DMHA 4AILC 3TMKA 5BY2A 1P4RA 4M38A 3L8DA 4Z8YA 3OFKA 1TM3E 2UYCA 2MSLA 5CD1A 2YY5A 2FEWB 3WHLA 1GRJA 3QFTA 3ND7A 4HDSB 2VZ9A 1U7OA 1AQNA 5C1PA 3K9CA 1SMKA 1RI4A 4BV9A 3CT6A 4EYGA 3H9UA 1AHHA 1GG2A 3N8DA 3SSOA 5AVWA 4ZGGA 1GSIA 4ND4A 2WOOA 1X6VA 2A9JA 3ZCCA 2OXEA 3R7DA 2WHPA 4HZUA 4ZVKA 1ZVQA 1GDDA 3KT3A 1NBIA 1PI3A 3N9IA 2IZOA 3EUEA 1OYYA 2C77A 3MWJA 3O73A 2R84A 2O1XA 5JAQA 1K63A 1UP4A 3S99A 4LA4A 4DDKA 2FLVA 3FVRA 1N0JA 1PHRA 3VHXA 2ZRGA 1HSZA 1JQAA 1AQUA 2Z1NA 5EWJB 2A86A 4WKGA 2ZE5A 1CG6A 1RAHA 4CQMB 4BKMA 4IH4A 1KMQA 5HKOA 4KQKA 1N0UA 4QREA 4MWBA 4YJKA 4NTXA 4FDUA 2NPIA 3NBXX 2JBWA 1YT5A 4B84A 5H82A 1XF1A 2ZQMA 5CJ2A 4I08A 3HUUA 1XAGA 3W2HA 1NU8A 2RH4A 3IUPA 3NYWA 2JFNA 1KECA 4OQEA 3WB9A 4KGZA 3U0BA 1PTKA 2REQB 5HF5A 4QYWA 3UA3A 1Q12A 4N3NA 3FGPA 1UQUA 4NE2A 3KT8A 3ZHYA 1YR7A 3JASA 2ZEJA 3EVTA 4U7FA 4QG3A 2NUAB 3DPSA 5FQNA 5SYAA 2BM1A 5TGDA 2HA0A 3WJ2A 1RM5A 3B1YA 1NJ1A 3K9GA 3MLBA 5G4KA 3H5OA 2GZRA 4OBWA 2BH2A 1FVHA 4EIWA 2FL4A 1AN9A 3TDMA 1G19A 2M2IA 1I2ZA 1P91A 4D3XA 1FFEA 3RFTA 3R5XA 3R7LA 1RLOA 2VBFA 4GE3A 3MRXA 4CS3A 1SZPA 3ENWA 3J80A 4RC9A 1DRVA 3LQ4A 1G0OA 5B12A 2B61A 2WU8A 3QU4A 5AK5A 1I4DD 3IVRA 4GIBA 3ZJVA 2J6IA 5IJ0A 1ZUQA 3OHPA 4GW3A 1TF5A 4WOKA 1TDJA 5AVZA 1ENPA 3LOQA 2ZXEA 4FEAA 4L07A 1Y74A 2PSEA 4GR5A 3VNSA 4Z5XA 2WT8A 2F1KA 4JAVC 2YNMA 4NJEB 2PFKA 5CT9A 2YYSA 2WVJA 5SY4A 4D4MA 1Q90D 5A9RA 1BS2A 1ENYA 3HU1A 1L3IA 1W4RA 3PVCA 4P3PA 1Y4DE 1VCHA 3U4HA 1UC4B 1YQXA 1HQYE 1IEQA 2NX2A 2R8YA 4JGBA 2X8LA 2VBCA 4BC0A 2JD0A 4TTPA 1WVMA 2HZ7A 2ZSFA 2D7DA 2VL7A 4Y18A 2H08A 4RCZA 1QQ6A 4HEQA 3THRA 5FA5A 1Y3BE 1FSSA 2SKDA 4D0SA 1SFRA 2DGDA 1JNYA 3RO7A 1REQB 4O3MA 2WYIA 1F4LA 2OC9A 1J1ZA 2CF5A 4KE7A 5HZKA 4P35A 3D6VA 2ZG6A 3G82C 2ZRQA 2VPTA 3QVUA 3L0ZA 2R6AA 4HVTA 3I53A 4LF5O 3ZHUA 4FYPA 5T64A 3D2LA 4TKUB 3QKUA 4ZGBA 2V7TA 3DLIA 3ACCA 2A84A 4UCQA 4EPXA 2ZU6A 2FE4A 2XWSA 4FS3A 1PV4A 4BVBA 3WXMA 5MF6A 2W2QA 3ONFA 5F76A 1JAIA 2NO4A 3DKKA 5DO9A 4M6WB 3AB8A 3BZBA 3BPSA 3G1WA 3OX2A 3I83A 4JI2O 3GNSA 2J9FA 1OF1A 3TNFA 3CZPA 5IBPA 1J24A 3W5AA 3GT7A 3T15A 5GONB 1WMFA 4FFVA 2X5XA 4W9RA 4DFDA 4X00A 2VQEO 3DCYA 3SIXA 3I04A 1AVMA 3DHWC 3LW8A 2RNBA 3TLZA 1NM5A 5E6SA 5DVZA 4V0NA 1HGXA 3OQOA 3WLJA 4OYYA 3D3WB 5JATA 3QOFA 3D8HA 1QR2A 1X3LA 3A06A 3ZDDA 1ZHHA 5EHIA 3MCWA 1WSDA 3BL8A 4Z2YA 1WF3A 3I5MA 5DNEA 2MOKA 3E7FA 2E85A 2OYQA 1XAHA 2WUGA 1PIWA 4YJ2F 5FFFA 1YR1A 4R0VA 2YSUB 1N92A 4OGKA 5HG0A 1OYOA 2AHYA 3PQ6A 4HFJA 4HDSA 4HEHA 4TV8F 4KO2S 1Y8QB 2WTAA 3TX2A 4S0XA 4NFHA 3WLLA 5JDCA 1NI3A 2NR5A 2ZRHA 2C1XA 4F5DA 2ZUEA 1OCEA 2MSWA 1L5NA 4M87A 2J5XA 3K0SA 1D8AA 4Q21A 3GXBA 3IKJA 4GX5A 2EF0A 4R2IA 2P90A 2YKGA 1C30A 3A6ZA 1BQEA 2PX3A 1OZGA 2X4DA 1UJNA 4YR9A 5EWJA 3KTFA 3ZOKA 2WYUA 4CQMA 3WBJA 2B20A 3CF0A 3MUNA 1L5YA 2WUDA 5BSVA 1LH0A 5AI8A 1M33A 3HR8A 4OLBA 1FFHA 1L4LA 4FMCB 2VHEA 3ELYA 1RADA 2HPHA 3EVDA 3H5NA 3BB3A 2OZPA 1H3FA 3AM4A 2IDZA 3U80A 1T8YA 1N78A 3BXPA 4RK7A 1NDUA 2W93A 3A3YA 2QDKA 1DJQA 5EA2A 2RGEA 1OZ0A 3IT1A 2Y67A 2AHOA 4RK1A 5GTIZ 2IHKA 4UPDA 3U56A 3NNNA 1RYYA 4X62B 4DR7O 4TV9B 2LXNA 2NUAA 1IHOA 3BOSA 1QQBA 2X2FA 2QYOA 2X6AA 3GFBA 2YICA 3SX0A 3EW9A 4GX0A 3KZMA 1X1RA 3T5TA 4Q9AA 7ABPA 2IZ5A 3EISA 4BZWA 2OHIA 4ZI5A 2FPKA 1NW7A 3HCFA 3SCZA 1Y1QA 2Z0MA 5EIHA 4QXRA 3R77A 4A8PA 2DTEA 4FHEA 3EMVA 3OC0A 4KVGA 1XK7A 4Q7LA 2AFIE 5EMHA 1RTKA 2IE0A 3T9BA 4Q93A 1QPZA 3HEAA 1PR6A 3HP7A 4D74A 3KQHA 4H1VA 2EIKC 2DTXA 3F1KA 2ZM6B 1D5AA 2ISSD 3TGPA 5HDBB 3TAXA 4AIRA 2BKLA 3EGWA 2GLXA 4MO9A 2DPLA 2NZUG 5BORA 5CLJA 1QMPA 2C4MA 2V7BA 3ZCVA 2DFLA 3TFQA 1PX0A 3L77A 4MW0A 4BWFB 5FL7D 2QAIA 4NJEA 3DR3A 1YR9A 3PZBA 5IDJA 3GJ4A 4E03A 3FGNA 4M1MA 5JRDS 3IQXA 4X89A 1NF3A 4XAQA 3LQ1A 1E7QA 2ACEA 1D07A 3C3YA 3OWHA 5FORA 3OOSA 3QM1A 4KRGA 9MHTA 2I7DA 4JDPA 2CE4A 3O3OB 3I9V6 1M6YA 4E6PA 1XTSA 1JR3D 5DFAA 2NNLD 4RTRA 3QLVA 1ONNA 3KQTA 2A58A 3G6KA 5EJMA 1WXQA 1XT6A 1H5NA 2P0YA 5HQJA 1MO2A 4LZOA 3O2QB 4YMWA 1COWD 3RU9A 1REQA 3Q3IA 2GDZA 3VQVA 2QXYA 3K0AB 3DDZX 5HUQA 4N21A 3OUUA 2UZ3A 3HKDB 3GWGA 2EV9A 4Q6GA 5SZKB 5ENZA 2Q49A 2G63A 2ADQB 2QPAA 5H8WA 3V7NA 3GRAA 3OE1A 3D3IA 1Y3DE 1II0A 4Y8VA 2IWHA 4M6WA 1I7PA 1NRJB 3ZDAA 5BO5A 4MWGA 1TIPA 5C3UA 5GONA 5DIFA 4CDMA 2HD4A 2Z8XA 4E70A 3G71V 5JMOA 3LL7A 2ALJA 3VHLB 4BNNA 4PY2A 5I4IA 3R09A 2O5EA 3WYAA 1RWKA 1JPVA 4PG7A 2V59A 3W7BA 4GEKA 3W2EA 5KVSA 2P41A 2XMQA 3D3WA 4RFVA 3T0FA 4URXR 1DAKA 4JI0B 2D5IA 2E82A 2BMJA 2JJ1D 6PFKA 1R73A 1WXGA 2WLMA 3NXSA 3QO5A 2KLBA 4FIZA 4AN0A 1F4VA 1H8HA 1TYZA 2XASA 1KQGA 1UJ4A 3V6LA 2AI2A 1MH1A 2GN2A 3UKMA 3K20A 1Y8QA 4BV8A 3KS9A 1UJCA 4KC0A 1Y67A 1YL6A 4TWZA 3C14C 4XE5A 4IILA 1BSMA 3P97A 5EJ4A 1UBCA 2N05A 1PDWA 2IITA 2ZWPA 1L1QA 4J9UE 4O1MA 3RSSA 1EINA 3OBIA 1EK0A 3C97A 1VCMA 2QM0A 2QW0X 5FWYA 2DBYA 5FBQB 1YCGA 4WCFB 1ZINA 1XOIA 3D4LA 5KDOA 5DYYA 5K45A 3NTLA 4WWHA 1NN1A 3OZCA 4HGRA 1G7TA 1UJ5A 1G3IA 1A2BA 2QQ5A 1SUBA 4GBMA 2J6BA 4ZVUA 4IDHA 3IHWA 9ABPA 4F5YA 5BSEA 3I28A 3QTCA 4BXOB 3Q3JB 3BSYA 4DOMA 3UB3A 2CFCA 4YTEA 4PZ9A 5B3SC 1LDNA 1L1FA 2ET6A 4W6QA 2E89A 3PJRA 1ZKDA 4FLEA 3R0QA 2DFKB 3FVTA 1LNZA 3MWEB 3NHUA 3HV2A 3LHKA 1K8AW 1VE7A 2Q73A 1AGXA 1QGDA 2ZJOA 1V9LA 4RMJA 4Y6OA 1DFIA 4TV9A 3C74A 4EDFA 2XRFA 3JVIA 4ENQA 1P3Y1 4K6FA 2G9VA 2FCAA 3O7MA 1U31A 1FNMA 3SBOA 4B2IA 3GDWA 3VZRA 1IAQA 2XJ4A 1ONBA 2Q3JA 1I36A 5CA0F 4O6VA 1PZMA 1Q0UA 2JCGA 4NYJQ 4L9WA 3EAFA 2ZIEA 2ONYA 4JJEA 4CIAA 3QMMA 4M1SA 3LP8A 3RVMA 5ERXA 2JLSA 4RKEA 1FOEB 1TK9A 1QHTA 2B99A 2QPLA 1U04A 3WSWA 1I0ZA 2PYLA 4MW4A 3OZEA 1WZCA 3H1EA 3FTPA 1MIOA 5BN1A 3QXCA 2PKYX 3P9QA 2Q5FA 3MUEA 1K4DC 4C0XA 3PTAA 5HCUA 2H54A 3G2OA 4P83A 3BWXA 1F3LA 4LY3A 5AM4A 4WBXC 3E83A 1E7RA 7GPBA 2XGJA 3KYDB 3OCXA 1ORQC 2QENA 3FKJA 4MVRA 3DTVB 1GK9A 2OAGA 3DL0A 3BFVA 2Q41A 4RZSA 3AKDA 3FXAA 1RPJA 4ETWA 4JT9A 1B00A 2FXVA 4G4SO 4GOKA 5IDQA 4H7KA 3K0AA 1MG5A 2H1CA 4K28A 1KGDA 5IYZF 2G6TA 3UWSA 3ENVA 1I7DA 2F66C 1CZRA 3OE4A 2FQXA 2B1RA 2ZSAA 3HKDA 3FFWA 5TEVA 2Y0DA 5EVCA 2QRQA 2C4NA 2ZYVX 3T3GA 2OCBA 4H08A 1Y4AE 1TMKA 4YB8A 4KXQA 3ZX5A 3IXLA 2OZKA 2C7QA 5EJEA 3UKJA 1JH8A 2XT0A 4M8KA 4JN6B 3VYVA 3JD3A 1RQXA 2E21A 3F5SA 3NDBB 4YAEA 1Y6GA 4MX8A 3LBFA 3SD7A 1VARA 4E22A 3UWKA 3I6ZA 2P6NA 3U6KA 2YIJA 5LQRA 2OCAA 4ZANA 1KIAA 1ZU4A 4XYMA 4KLNA 1KSGA 2AVNA 4QUDA 4Y7DA 2AB0A 3LLCA 4RSMA 2QQFA 3L73H 4XYBA 5HJ2A 1XTIA 4J10A 4XDYA 1R6DA 3C3AA 3A05A 2OG2A 2OLKA 3ADPA 4NAVA 2JLVA 8GPBA 1SA0B 1HA3A 4R2KA 4BNWA 4UTXA 3A0UA 3GK3A 1M67A 1HE3A 3KFLA 1I2CA 1DAOA 3WG7C 1TI7A 2G4LA 1KQFA 5B1BB 3BWCA 3MS7A 4TWJA 2P65A 4Y2QA 1QGYA 3AI7A 4LF4O 2FR8A 4LZJA 1XX6A 2Z5UA 4DQ0A 1KKMA 4KSBA 1UKYA 5T6MA 2SBTA 1AA6A 2IBTA 4X60A 2QEQA 1HDGO 1ZI9A 4JI3O 3E61A 2WP8J 4YRBA 5AR1A 4YMLA 5CDUA 5E3IA 4DS3A 4O2AB 4KXMA 2YRXA 1T2AA 1T6YA 2XT6A 1Y37A 1OFGA 2B8WA 1SU4A 5JS1A 2PMKA 4HT3B 3DDSA 1JAHA 3QU7A 1ZJWA 3KELA 3VKWA 1JG3A 2EBWA 1N32O 2GVNA 1SBIA 5EJ8A 4E5MA 2WSIA 1PQ4A 4HEJA 2WA4A 4JV5O 3PN1A 3FKSD 5KS2A 3Q7QA 4M2LA 5CNMA 1P2UA 4C3UA 4WCFA 2FUKA 3MSXA 1BC5A 3VNRA 3OY7A 4KXNA 2CC2A 1MUUA 2H4XA 1GEEA 3EJ6A 1G18A 1H4TA 3AV0B 3DMTC 4HSEA 4OHFA 1Y66A 3DMFA 4BWGA 4JOBA 5CVDA 5FUYA 1I8TA 1EFDN 5E95A 4HQRA 3ROTA 3FLMA 1VJRA 4BJHB 5BSTA 2RJOA 1OXSC 2F7SA 4YHBA 4BXOA 1N6LA 2SHKA 4HNVA <