4JI3O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji3O00
4DV3O 4DV7O 5LMNO 3OTOO 2ZKOA 5LMUO 1J5EO 2UUCO 4NXMO 4JI4O 1FYJA 1XEQA 4LFCO 5BXZA 2F4VO 4KHPO 4AQYO 4B3MO 4DR3O 1IBLO 4DV6O 2UXBO 5LL6Y 2UUAO 4JI1O 4JI6O 4OPAA 4JV5O 4JI7O 2HHHO 4DV5O 1XMQO 4LF8O 4JI3O 4LF9O 2UXDO 4JI5O 1N33O 3T1HO 4DR7O 4DR2O 4YY3O 4LF7O 4DR5O 4K0KO 4LF6O 1AILA 2N74A 1I94O 1HNWO 4DUZO 1R6TA 4GKJO 1N36O 4OX9O 4X66O 3M8AA 4DV2O 1IBKO 1FKAO 4DUYO 4YHHO 4DV0O 1HNZO 5IT9N 4DR4O 3J80N 4X62O 1D2DA 2UXCO 4LFBO 2E5LO 3J81N 1HR0O 4JI2O 1FJGO 2DOSA 3SDLA 4JI8O 4GKKO 2LW7A 1A32A 4A5UB 5BR8O 2VQFO 2UUBO 5A2QN 2UU9O 1X59A 5H5NA 2ZM6O 3O65A 4B3RO 2DJVA 4DR1O 2AGAA 3JAMN 1IBMO 1XNRO 2Z0AA 1DK1A 4B3TO 4JYAO 4JI0O 3RT3C 4X65O 1N32O 2VQEO 5BY1A 4X64O 4DV1O 4LF4O 4LFAO 5FLXN 3R66A 1HNXO 3T1YO 5IWAO 4NXNO 4OPHA 2JRIA 1G1XB 4LF5O 4DR6O 1N34O 3J7AU 1NS1A 1AB3A 1R1BA 3F5TA 1F7YA 1YZBA 1XMOO 1XNQO 1KUQA 4B3SO 2FKXA 4DV4O
chains in the Genus database with same CATH superfamily
4EFBA 4GZRB 4WFGA 2ZE5A 1AJPA 5KX5A 2FMLA 5CBGA 4J7ZA 2KKWA 2JGDA 2JK5C 2MK3A 1DTOA 3JD2A 3OTOB 2WLLB 3ZEDA 2QM8A 2B5UA 4MTXA 2PY5A 2UUAO 2EIJB 4IYIA 3CCUV 4JI6O 2YC0A 1VF5B 5H6QA 5L3GA 1MABG 1XL4A 3K3WA 1MA1A 4UCRA 4LF9O 3N27A 4FFKA 4GX1A 1US6A 4MTFA 2OWOA 3ZHQA 1P4RA 3LSUA 4X1KB 2ZT9B 3SJAC 1QNMA 1S77D 1X4TA 1K4DC 1K97A 1YCIA 4I0XB 4DR4O 3J80N 5KHJA 1D2DA 1AP5A 5LP6C 5K1XA 5LGNA 5EZYB 1Q6IA 3CP1A 4LFBO 2E5LO 2ODMA 1M1KW 1HP8A 1WPXA 3BHPA 4JI0B 3OFNG 4W4LA 2AXTZ 1KMIZ 1M57C 1Y76A 2IU3A 2JS3A 2QEXV 2ZM6O 3AG1B 3O65A 4XDJA 5LXTA 4PA7A 4DW1A 2AGAA 5EBLC 2HR3A 4DR6B 2QSAA 4JYAO 3RT3C 4N21A 3N2GB 5BY1A 4LR3A 3CMAV 2Y0IA 2GSMB 4B3SB 1BS3A 4MVQA 1BL8A 2QR4A 3FFQA 4DV7B 4O2AB 1KECA 5BZBA 3UQ8A 3C90A 1Y4MA 4LFCB 2ZCEA 1QLEC 3Q4HA 4KUMA 2EILB 1PV0A 1NS1A 1T5EA 1YF2A 1AB3A 5LHIA 4GT1A 2BTQA 1YJ9V 5J2TA 2FKXA 1V54B 1N34B 1GM8A 5GONB 3K04A 1GH6A 5ITZA 2K9PA 4QE9A 4NXMO 1SC5B 1XNQB 3B77A 1AI6A 1H8HG 1S72V 1SQGA 3FYEB 1M90W 4P30A 4DK0A 3CSXA 5IJ9A 3ZMUA 5LL6Y 3E8BA 4KXRA 4WFAV 3QNEA 1W0JG 4ABMA 1GN4A 4OPAA 2CAZC 2YI8A 3H1LH 4DV5O 5FNVA 2A3QA 2A7WA 2ZR3A 4ZI7B 1WB7A 3HKCA 1Z5VA 1DF4A 2BOCC 4J7KA 4MVRA 4TUYB 4U3JB 4UB8Z 4PDLA 2XTAA 3TGUH 2AZ2A 2VQFB 2UUBB 1FKAO 2JJ2G 3JD1A 4TV8A 1SA0A 1K3EA 5EC1C 3IJ4A 1OV9A 2F66C 2VRZA 1YIJV 5FL7G 1FJGO 3ABMB 2UXCB 4GLXA 4ZHQB 4X20A 2FYUH 2LFSA 5EK0A 2QWRB 1RM1C 1X59A 2OIGA 1U97A 4CS4A 1D5AA 4O4IA 2E74B 4WBNA 1XOUA 3SYOA 5H6RA 1FFXA 2WLJA 5LOVB 1L8DA 2OCHA 1COWG 1IBMB 4EB6B 1WB8A 4PDVA 1DF5A 3G80A 4PA9A 1G1XB 1AROP 4GCZA 3G71V 3W7XA 4RAIA 3BVOA 3DXRA 1M56B 3AG3B 5LGTA 1NH2B 3JARB 2UUAB 5IYZA 3OEHG 3LSQA 2DYRB 1NKDA 4JI6B 4Z1MG 1M9NA 3MAQA 2GTAA 5EBWC 1J5EB 4LF9B 1NTKH 4ZIBA 4TV9B 2QM7A 1IBLO 3GWOA 2PYJA 3RGBA 4DR3B 2IM9A 3HKEB 4XDKA 2HHHO 1AVMA 3K9SA 3KG2A 3TK1A 4IIJA 1N0JA 3RYIB 5IY5C 2FL4A 4DR4B 2Y69C 5IYCO 2RMKB 3SPIA 5LP6B 4DR5O 2AHZA 1VARA 2EJ7A 4LFBB 3ZHSA 3D36A 4EKWA 1AILA 3HKBB 2A79B 4IHJB 4OX9O 5GW7A 3PN1A 1M57B 2YIBA 2B1IA 1SQFA 3JASB 4X1IA 1Z5WA 4ZOLA 5D5QA 1G8MA 5EYPA 5TISZ 4JYAB 4J11A 2VS0A 4MSWC 1F4NA 2WLLA 5JCOC 4E4EA 4W4KA 4JTAB 1UJWB 2HLDG 2E3CA 1L1FA 2WAMA 3ZRSA 1VQ8V 3JATB 4UFZA 3IC7A 3BY6A 2P90A 3OTFA 4RUFA 5KX5B 1VQ9V 2JGDB 1SQQH 2HJDA 2ZE7A 1YHQV 3CC4V 4DRXA 4NXMB 1KQSU 3T1YB 2LFRA 1UPGA 2QKAA 4X1KA 1R1BA 1KD1W 3CCLV 3STZC 3FD9A 4I0XA 2QKSA 4I4TA 3BCCH 3HB3B 5KLVH 2ZKOA 5LMUO 1H2KA 4NB5A 1THZA 3R65A 5BXZA 2YS8A 4U3FH 1J95A 4ZKIA 3LNNA 4KHPB 5LYJA 4PV1B 4JV5O 3H01A 5JWPA 3CC7V 1NVPD 1JJ2U 2UXNA 3X2QC 2CK3G 2M7WA 3OMIB 3ZS8C 4O2AA 3UO3A 3ZRWB 4UUJC 1ZX3A 4XDLA 2KQXA 2H3OA 1FJGB 1N36O 4DV2O 2CGOA 1IBKO 5CBHA 3VQWA 5K1PA 2VWJA 1FXKA 3OGIB 5LXTB 3UT5A 4DV0O 1RM1B 2EINC 4IGGA 4DUZB 1FS0G 3CJHA 2Q7EA 4U7OA 3CRAA 2ILMA 4A5UB 1CP9A 1WJZA 3ETGA 2GV9A 4JYCA 4PELA 3K03A 4HAMA 4GKKB 3Q4HB 3UCSC 5IYDO 2WA3A 1VQPV 4JGSA 3JSLA 2BTQB 2R70A 4G27B 2IU0A 5J2TB 2H94A 4B3TO 4PHZA 1S76D 5ITZB 1IDSA 1B06A 3MHHC 4LF4O 3P32A 1VF6A 5KHKA 1FAFA 2YDEA 1S3JA 4LF5O 4BIZA 2XT9A 2QTOA 5IJ9B 4MT8A 1KP3A 1OCRB 2JEXA 1Q81W 1IBLB 1I08A 2OCCC 1VQ5V 1KUQA 2WLMA 2WLNA 1OCCB 3BPZA 1NU1H 1NT2B 3B8NA 4DV6O 4X1YB 1GN2A 2Y69B 3PJSK 2LQTA 1NR7A 3ASNC 4N23A 5D5PA 4AQYB 1Q6HA 4TV8B 3L73H 3SJBC 1GM7A 1SA0B 3F7YC 3OR6C 4OX9B 1KC8W 2CE4A 3WB2A 1N33O 1KP2A 3U0ZA 1JOYA 2JVDA 1BMFG 3SR2C 3ABKB 1FPOA 4X20B 1FXKC 4YY3B 4H33A 3ZJZA 3CEIA 4O4IB 4WBNB 3F7VC 5KAIZ 4PI0A 1FFXB 4JAUA 4DUYB 1AR5A 1WP7A 3E8GA 3CMEV 4JPRA 3WFVA 4PA4A 4NYKA 4PA6A 4F4LA 4DO2A 3FB8C 5DEDA 2WLIA 1IURA 2ITCC 2X0LA 1MSDA 3VOUA 3H1KH 2RJZA 5IYZB 2Z5UA 5JVDB 2BSKA 4LFAO 4WCEV 3SPJA 5LMUB 4QGPA 1NTMH 3HKBA 3TJTA 2OYQA 2QWOB 1HNXB 3IGAC 1WA8A 3T2MA 1Y66A 4CC6A 1VEWA 3KKYA 3WU2Z 4IIJB 2YXYA 3FB5C 4OGQB 4J9ZB 4BAYA 1NTZH 4UVCA 2OIEA 2F4VO 1OHHG 5BMVA 2UUCB 4BIUA 5B3SC 1BT8A 1YJNV 1QHTA 2P7TC 3D3QA 3VQXA 4DV2B 3RWRD 4X1IB 4FK5C 1MNGA 5FPRA 4ZOLB 1VF7A 4FVMA 1BQ0A 5EYPB 3AEIA 2EINB 3OM3B 2ZXWB 3E89A 3U10A 3T4ZA 2IJKA 4BR6A 4QNHB 4DYLA 1HNWO 3RYFA 2JIZG 3K06A 1GRJA 5GTHZ 4X9QA 1I94B 2OTLV 1PPJH 5B5EZ 1W2BU 4DK1A 2AZ0A 2IW5A 1K5SA 2QJ1A 1NQTA 1OCOB 3A0RA 4YIOA 5L3FA 1SZXA 4NTYA 3ZHRA 4LF4B 4DRXB 1S0VA 4JI2B 2DN9A 2KB1A 4MVZA 3ZHVA 1K5QA 2ZE8A 1PD3A 1XNRO 2PTMA 4I4TB 1GK9A 1Q8IA 3CPWU 5KAFZ 2L35A 1R6NA 3K5OA 4GX2A 2Q68A 3ZN0A 3ZRWA 4O4HA 2P67A 3OMNB 3MD0A 1H2NA 3FB7C 3SGIA 5LYJB 1R3JC 1TAEA 3ASNB 5LMNO 2YIDA 2ADPA 3ABUA 2RQ6A 3DTUB 1P7BA 2Q6AA 2F93B 5LGUA 3JD3A 3ETEA 1N4CA 2UXBO 2PGGA 4QPKA 2B1GA 1FXKB 2ZDIC 3UT5B 4JI7O 4JI3O 4IT5A 3CJHB 4J7JA 4TOIA 3G6BA 1DLBA 1TUBA 1XMQB 4LF8B 3UKMA 4L87A 4MVOA 3B8MA 1KKCA 5EBMC 4GKJO 1QCEA 3FB6C 1VQLV 2XNDG 5LHGA 2EIKC 3HPLC 1L0NH 2N04A 3WG7B 5KA6A 5LHHA 1NR1A 3MDSA 1BE3H 1HR0O 2F23A 4CBCA 5HFLA 4LFAB 4X1YA 4R8CA 3OW2U 4F6EA 3F5WC 2HJFC 1VQOV 3SYPA 1LR1A 1BSMA 2HKOA 1ROPA 3S3WA 5B1BC 1LNQA 2UU9B 2Q69A 4JZ2A 4J10A 4BWAA 4U7NA 5KUKA 5FLXN 4FLWA 1TA8A 2EX3A 4FZ1A 2VQEB 3GVMA 2JRIA 3QVNA 2X6AA 4O2BA 3GWKC 5IWAB 2F4VB 3K5MA 5JCOA 1YZBA 4D7SA 1V55C 2CGNA 1LUVA 5B3SB 1K92A 5KMGA 1XMOO 1YEWA 1ZUQA 2HVKC 1SETA 1KYOF 1NZ6A 2BCCH 1NI8A 4UCTA 2P06A 4QPJA 4I5SA 4YJ2A 3EXAA 2Y4TA 1K8AW 3QO5A 1Q6UA 1SQXH 3FYIB 4BW5A 2ARHA 4GX0A 1E79G 3L72H 1AJNA 2JEUA 2EZPA 1KB9F 5JVDA 4I9QA 2BTOA 4DR7O 4DR2O 3RYCA 2BE3A 4PI2A 4LF6O 5L3CA 3AK1A 1MMMA 4KFMA 3BA8A 1P7GA 1K9MW 2WLHA 3N2KA 2WLIB 2XASA 2EULA 4C7UA 4CC5A 4J41A 1JX9A 2DW4A 3RYHA 4HZ3A 1SRYA 1XNRB 3J81N 2BSKB 2XAFA 5C8YB 3KCYA 4I9WA 5JJJB 4FM0A 2D3OW 2E5LB 4FIPC 2DQ3A 3OEEG 3ZMSA 3CS5A 1WA8B 1H38A 1PNLA 2DJVA 3JAMN 3AG2C 1R3LC 4Q6GA 2ZM6B 1N32O 4CH4A 2Y4UA 4I55B 5CN0A 1Q43A 1LUWA 2V1DA 3W7WA 5LMNB 5CB4B 1XILA 2XHBA 5BMVB 4FLXA 1JA8A 4P9PA 4NKGB 4HYOA 2Z3YA 3OAAG 3AG4C 4PA3A 1BQZA 1EZVH 4DV4O 1O9GA 1QLEB 5HFMA 1VQKV 1H2GA 1TVKA 2KG7A 4OXSA 3CB2A 2GBOA 3SYQA 3FAVA 4JI7B 1HDJA 2OTJV 2R9IA 4JI3B 1Q3EA 3CCQV 2PI4A 2QA4V 2L6LA 3RYFB 4B7EA 1ZSPA 1YTFD 4ZBMA 4GKJB 5IJ0B 4UB6Z 2Q0AA 3M7MX 4RQEA 2W6IG 5IE9A 1G4YB 3CWBH 2RNBA 4JI5O 1QR9A 5IYBO 2EIMC 5L3DA 3L74H 1O9HA 4LF7O 4DV5B 1JFFA 2F1MA 4RO2A 1HR0B 2WSSG 1OCZC 1MG1A 3SJQC 2X6BA 3DC5A 1XDCA 2P4KA 3LDEA 1VMGA 1M5IA 2Q4PA 4DXWA 1IVSA 4MW8A 3UO2A 4BIOA 5IDJA 5A9GA 2ADQB 1L0LH 3K5NA 3L70H 2VWKA 4UV8A 2HG5C 4O4HB 4FFBB 2RDCA 1DGSA 5KHGA 3NR7A 4FLZA 4BW9A 2XUMA 4X65O 3T1CA 1KU9A 2Y0PA 1QR8A 1Q5OA 1V9PA 4OPHA 4X8AA 1KBHA 3CX5F 2DYSC 4UVAA 1ZTEA 1ZL8B 4UVBA 4YXWG 3DGEA 3BAAA 1GO3F 1WAZA 3OTOO 3ETQA 1Q90D 1CEZA 1VP7A 1XEQA 3K0GA 3SPCA 1RP3B 5JJEB 2EIJC 1PP9H 1TUBB 1H2LA 3OUSA 5B1NA 5GTIZ 2FB5A 3CCJV 2Q7GA 2PZSA 3AK2A 4DR7B 1EN5A 3KZIZ 2HP8A 4LF6B 4H0LB 4NR1A 4JI1O 5E79Z 4G2KA 5CA0A 2CDYA 4FLTA 3W7TA 1K33A 4WFBV 4O4JB 4AHCA 2HHHB 3APQA 1F4MA 5IY5B 3BABA 2IH1C 2Q0OC 4D6TH 2ZNIA 2CTQA 1R6TA 1XUQA 4DR5B 3ZRXA 3JAKA 3JALA 2IBZH 1VQNV 1JVMA 1MZEA 4YHHO 5FPOA 4B08A 4G28B 1BHBA 3ZX6A 3CE2A 1S5HC 3ZMZA 3AG2B 3SDLA 1N32B 5KHIA 2G38A 1WNSA 4F6RA 4PDMA 4WFFA 3I55V 3HR0A 4O2BB 2BOBC 3ZMTA 1YJWV 5DECA 1Y74A 1AR4A 2V7QG 1OJHA 3B2EE 4JASA 5KMGB 1AI4A 2JDIG 2PF4E 4LWSA 4DV4B 1B6QA 1S5JA 2XAGA 3QTCA 4YJ2B 1H2MA 4YJ3B 5B1AC 1KKDA 2D2CB 1V54C 4QJFB 1N34O 1B3QA 3RN4A 5H2FZ 3GB7C 5JH7A 1F7YA 2A0LA 2P4VA 3K08A 1XNQO 1QBZA 1YVWA 4UXNA 2ZNJA 1NJIW 1FFTB 2Q9LA 3CCVV 4JI4O 3CCRV 4FM1A 2OT5A 5C8YA 1BCCH 3RYCB 4JI5B 4TSFG 2YSUB 3N2KB 2ZD9A 1SQPH 1BHAA 1SS3A 1W59A 3FX7A 3L75H 5L3BA 4MS2A 3RYHB 1ENVA 2WA4A 4I55A 4JV5B 1JQ0A 5CB4A 4RUEA 1WLEA 3RBZA 3X2QB 2P5OA 2CTRA 3RFRA 1EN6A 4KP4A 1N36B 3SPHA 4GUNA 3L71H 4MW3A 1IBKB 2UXCO 1MOFA 2QDOA 2MW2B 1Y6XA 4DV0B 1EM1A 2ZDIA 1VQ7V 2R9AA 5KHHA 4JI8O 1S5LZ 2DE0X 2LW7A 2QKCA 1N0NA 4K8ZA 5BR8O 4Z2WA 2IJJA 4FLVA 4DR1O 2DYSB 2LW1A 3TXSA 4X88A 1IBMO 5IJ0A 1XREA 3LDDA 1QU7A 1TVKB 2KG7B 1PM9A 5B66Z 2CUGA 3QO8A 3CCSV 1GMGA 4J9YB 3FAVB 3IC9A 4B3TB 3RW0A 4NXNO 1M56C 2EBOA 1SESA 4UV9A 3AG3C 1I0HA 3EVKA 1XI1A 1PKXA 2AW9A 1QVGU 3CRMA 2DYRC 4CZZA 1W0KG 2W0XA 2W0FC 5EIBD 4LF5B 2QWQB 4JI1B 1J5EO 3E8FA 1SERA 2OCCB 2Q5ZA 3JSNA 4MVMA 1XL6A 3CRQA 3A2FA 2YIBD 4DR3O 1JFFB 1TUEB 4FFBA 3E83A 5J9PC 2LGWA 1RFYA 3KCXA 4NVPA 3OE7G 2ZIOA 4TT3G 4DV6B 2YXHA 3H1IH 4I7ZB 3TCUA 3K79A 4R50A 4YHHB 4RWUA 1ORQC 4LNUA 2GTSA 3HKDA 2EJRA 1GN3A 4CS3A 1K7DA 1IZ3A 3E86A 5CBFA 1M4UA 1N33B 3VQVA 1ZL8A 2CH7B 4JAAA 4LC1A 3EHBB 4L8JA 4IL6Z 2RCVA 3ZCCA 2ITDC 5DN6G 2GHYA 2F43G 1XHXA 4CS2A 3CD6V 1A32A 3TXQA 4PDRA 4AI8A 3K5LA 1PNKA 3I5DA 1IX9A 3K59A 3OMAB 2JS5A 4B3RO 4E2LA 5B1AB 4WFHA 3OGCC 3MHSC 3I56V 4H37A 2EZOA 2NNUA 2XAHA 4X64O 4DV1O 2LP7A 3R66A 4LCUC 3CYOA 3T1YO 4O4JA 4ASUG 3CCMV 4TQDA 3P3NA 4JI4B 4JYYA 5CA1A 3K57A 3E22A 3QF7A 3LSSA 3CCEV 1N8RW 2CTWA 1YI2V 2QWPB 4DW0A 2HVJC 1WP8A 5JQGB 4MTOA 2M6YA 5CA0B 2JJ1G 2R9RB 4JF3A 3SJCC 3JYCA 4LH6A 3LNMB 2RN9A 3P3PA 1VQ6V 4KHPO 2LGQA 2KSDA 1D5NA 3ABTA 4HNAA 1R73A 1I5YA 3C3SA 1FXHA 4KL1A 3AK3A 3JALB 3JAKB 3JAWA 2QE7G 1P84F 2YI9A 2UXDO 1JPXA 3ETDA 5CA3A 3T1HO 2YXLA 3O9OA 2Y48A 3JCUZ 3H1JH 4O4LA 1TGOA 2HFEC 4H13B 4F6RB 4YJ3A 3OUFA 3CRRA 5LA6A 5J2UA 4JI8B 2R72A 1AI5A 4DUZO 1ZLZA 1PL4A 4FPPA 1GTOA 4MVUA 4X66O 5BR8B 1Y74B 2F95B 4P9OA 1HNWB 2QGNA 3D3IA 4DR1B 3FKSG 4QIWF 4LWSB 1AI7A 4GKKO 4IYHA 1I7FA 3G6EV 4XBFA 5A2QN 4NXNB 4R6ZA 2CTPA 2Q7HA 5JH7B 1RSOB 2ATKC 2E76B 5DM6V 3APOA 3ZHUA 3ZBHA 3CC2V 4B7KA 1VIBA 1AR1B 2ZE6A 1YXBA 3WB1A 1K73W 4FLYA 1OCRC 3H1HH 4H44B 2YIAA 1MZFA 1M93A 1VQMV 2Q8VA 3F5TA 4NTWA 1OCCC 1YSCA 3G4SV 1HWYA 2A9HA 4JTDB 3S3XA 3EFFK 4DV3O 4I50A 4WF9V 4UCVA 1YTFB 5JJNB 2X6CA 4AQYO 2GUZA 1NH2D 4PD4F 3G67A 3VQYA 5C93A 3JCZA 1QVFU 2DWEC 1K34A 3C3TA 4WFEA 2UXBB 4GYCB 4UCOA 1WN7A 3ABKC 3LDCA 3D8CA 4YY3O 4K0KO 1EFRG 1P49A 2P6JA 3QG5A 3E2EA 2YEVB 3RVYA 1NVPB 1SF9A 2N05A 3M8AA 1VQ4V 1EZJA 2LJ2A 4DUYO 1HNZO 3AG7A 1IXBA 4X62O 1U96A 2IH3C 4B3RB 3K0DA 5KUMA 2WPDG 3TETA 3OT7A 2EIKB 3CXHF 4X64B 1IXMA 2QWNB 4DV1B 3A0BZ 1E1QG 1H2SB 2K1EA 2ZR2A 5H5NA 3U11A 2WLKA 2O57A 2PYLA 4TQFA 3ZMVA 3DC6A 4K8XA 5H9CA 3OR7C 3L9DA 1QQCA 1K4CC 5EZYA 2ETNA 3BFRA 5B1BB 1HNXO 1OZ0A 1QLNA 4MVSA 1JCHA 3ABLC 3ASOC 2QM4A 3ICXA 3J7AU 3CRCA 2C2AA 2CH7A 3QO7A 2NR5A 4JAVA 4FJCC 5EIBC 3N2GA 5E1AC 1V55B 2UUCO 4EFEA 3D36C 1XMOB 2XAJA 3P30A 1MSWD 1BZKA 1SQBH 3B09A 1SQVH 4NTXA 1B04A 3IAYA 1AJQA 4LNUB 3W7SA 3HKDB 4K3AA 4B3MO 2UXDB 1Y76B 2XOKG 3T1HB 4FMTA 5CMUA 3UM7A 3NXSA 4PJ0Z 2QTSA 3LUTB 5L3EA 3BEHA 3BRCA 2YUAA 1XBLA 2W6JG 1HW7A 3E35A 5LBQA 2ZXWC 3BA9A 4R7CA 5GONA 4X66B 1RPOA 4K35A 4J80A 5B1OA 1I94O 1FXVA 4DR2B 1XQ8A 2XAQA 1AP6A 4YIPA 1OCOC 1GKFA 1Y67A 2X7RB 1PL0A 3SYCA 5JQGA 2IJIA 4Z1VA 1WPBA 2UXXA 3JD0A 4ZI7A 4JI2O 2NN4A 2H8PC 5AG2A 1FD9A 2Q67A 1F51A 1CPYA 3ZRVA 3OD4A 3CXCU 4TUYA 3ZIAG 4U3JA 1Q82W 5CA1B 1G6UA 1GAXA 3E22B 2A06H 4RQFA 4TWKA 1F23A 4P2ZA 3H9VA 4MTGA 4JYBA 4QE7A 4CH3A 2HEPA 2NLJC 4JI0O 1JMKC 1JR9A 4LH7A 5FNVB 3SPGA 4DV3B 3ML0A 4ZHQA 2Q73A 2B9ZA 3AG1C 3HKCB 3JD4A 2DQ0A 4DR6O 4HNAB 5F2VO 5KA5A 2ZIMA 3CHXA 4FZ0A 4B3SO 2DWDC 3B40A 1H8EG 2WWWA 3JAWB 4DV7O 4JZGA 3AG4B 3WB0A 5LOVA 3W7UA 1SZTA 4EB6A 1EN4A 1FYJA 4LFCO 4UCUA 2EILC 2YICA 1Q7YW 2DMXA 4CH6A 4O4LB 2FTKA 3VBBA 1GM9A 5J2UB 5LA6B 1YITV 4Q20A 4K0KB 2PUSA 5EC2C 3RVZA 1BGYH 3DSQA 4UCSA 1RSOA 4GX5A 3JARA 3SYAA 1XMQO 4LF8O 1HNZB 1NBMG 4X62B 4LP8A 3K9AA 1YDXA 1Z2GA 1GN6A 4ICGA 3K58A 3A8TA 4TV9A 2AHYA 2N74A 3T4DA 2EIMB 3WG7C 4LF7B 3HKEA 1URFA 2PI5A 3DXRB 1R3KC 1E1RG 3STLC 5IT9N 4FM2A 1CXZB 1OCZB 3ZN1A 2IJHA 3RYIA 1VF6C 4CH5A 2V4DA 2ZINA 4FLUA 2DOSA 5LP6A 2E75B 4LBEC 1I5XA 1EBOA 2VQFO 2ZQMA 2UUBO 1UFIA 3M99B 2UU9O 1JJOA 4EEQA 1Q86W 4IHJA 3THOA 1PNMA 2GDSA 3E8HA 3IFXA 1XHZA 3ABLB 3ASOB 3B4SA 4AILC 3JASA 1RPRA 2Z0AA 1DK1A 3ABMC 2VQEO 1ZAUA 4I50B 4J42A 3ZHTA 5IWAO 1R3IC 4X65B 1SKVA 4HBNA 2JGUA 4D7TA 2YEVA 2GUZB 3A0HZ 1ZWIC 4B3MB 3JATA 4JTCB 4X89A 1R6KA 2P22C 2LO1A
chains in the Genus database with same CATH topology
4DV3O 4DV7O 5LMNO 3OTOO 2ZKOA 5LMUO 1J5EO 2UUCO 4NXMO 4JI4O 1FYJA 1XEQA 4LFCO 5BXZA 2F4VO 4KHPO 4AQYO 4B3MO 4DR3O 1IBLO 4DV6O 2UXBO 5LL6Y 2UUAO 4JI1O 4JI6O 4OPAA 4JV5O 4JI7O 2HHHO 4DV5O 1XMQO 4LF8O 4JI3O 4LF9O 2UXDO 4JI5O 1N33O 3T1HO 4DR7O 4DR2O 4YY3O 4LF7O 4DR5O 4K0KO 4LF6O 1AILA 2N74A 1I94O 1HNWO 4DUZO 1R6TA 4GKJO 1N36O 4OX9O 4X66O 3M8AA 4DV2O 1IBKO 1FKAO 4DUYO 4YHHO 4DV0O 1HNZO 5IT9N 4DR4O 3J80N 4X62O 1D2DA 2UXCO 4LFBO 2E5LO 3J81N 1HR0O 4JI2O 1FJGO 2DOSA 3SDLA 4JI8O 4GKKO 2LW7A 1A32A 4A5UB 5BR8O 2VQFO 2UUBO 5A2QN 2UU9O 1X59A 5H5NA 2ZM6O 3O65A 4B3RO 2DJVA 4DR1O 2AGAA 3JAMN 1IBMO 1XNRO 2Z0AA 1DK1A 4B3TO 4JYAO 4JI0O 3RT3C 4X65O 1N32O 2VQEO 5BY1A 4X64O 4DV1O 4LF4O 4LFAO 5FLXN 3R66A 1HNXO 3T1YO 5IWAO 4NXNO 4OPHA 2JRIA 1G1XB 4LF5O 4DR6O 1N34O 3J7AU 1NS1A 1AB3A 1R1BA 3F5TA 1F7YA 1YZBA 1XMOO 1XNQO 1KUQA 4B3SO 2FKXA 4DV4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 O;  4DV7 O;  5LMN O;  3OTO O;  2ZKO A;  5LMU O;  1J5E O;  2UUC O;  4NXM O;  4JI4 O;  1FYJ A;  1XEQ A;  4LFC O;  5BXZ A;  2F4V O;  4KHP O;  4AQY O;  4B3M O;  4DR3 O;  1IBL O;  4DV6 O;  2UXB O;  5LL6 Y;  2UUA O;  4JI1 O;  4JI6 O;  4OPA A;  4JV5 O;  4JI7 O;  2HHH O;  4DV5 O;  1XMQ O;  4LF8 O;  4JI3 O;  4LF9 O;  2UXD O;  4JI5 O;  1N33 O;  3T1H O;  4DR7 O;  4DR2 O;  4YY3 O;  4LF7 O;  4DR5 O;  4K0K O;  4LF6 O;  1AIL A;  2N74 A;  1I94 O;  1HNW O;  4DUZ O;  1R6T A;  4GKJ O;  1N36 O;  4OX9 O;  4X66 O;  3M8A A;  4DV2 O;  1IBK O;  1FKA O;  4DUY O;  4YHH O;  4DV0 O;  1HNZ O;  5IT9 N;  4DR4 O;  3J80 N;  4X62 O;  1D2D A;  2UXC O;  4LFB O;  2E5L O;  3J81 N;  1HR0 O;  4JI2 O;  1FJG O;  2DOS A;  3SDL A;  4JI8 O;  4GKK O;  2LW7 A;  1A32 A;  4A5U B;  5BR8 O;  2VQF O;  2UUB O;  5A2Q N;  2UU9 O;  1X59 A;  5H5N A;  2ZM6 O;  3O65 A;  4B3R O;  2DJV A;  4DR1 O;  2AGA A;  3JAM N;  1IBM O;  1XNR O;  2Z0A A;  1DK1 A;  4B3T O;  4JYA O;  4JI0 O;  3RT3 C;  4X65 O;  1N32 O;  2VQE O;  5BY1 A;  4X64 O;  4DV1 O;  4LF4 O;  4LFA O;  5FLX N;  3R66 A;  1HNX O;  3T1Y O;  5IWA O;  4NXN O;  4OPH A;  2JRI A;  1G1X B;  4LF5 O;  4DR6 O;  1N34 O;  3J7A U;  1NS1 A;  1AB3 A;  1R1B A;  3F5T A;  1F7Y A;  1YZB A;  1XMO O;  1XNQ O;  1KUQ A;  4B3S O;  2FKX A;  4DV4 O; 
#chains in the Genus database with same CATH topology
 4EFB A;  4GZR B;  4WFG A;  2ZE5 A;  1AJP A;  5KX5 A;  2FML A;  5CBG A;  4J7Z A;  2KKW A;  2JGD A;  2JK5 C;  2MK3 A;  1DTO A;  3JD2 A;  3OTO B;  2WLL B;  3ZED A;  2QM8 A;  2B5U A;  4MTX A;  2PY5 A;  2UUA O;  2EIJ B;  4IYI A;  3CCU V;  4JI6 O;  2YC0 A;  1VF5 B;  5H6Q A;  5L3G A;  1MAB G;  1XL4 A;  3K3W A;  1MA1 A;  4UCR A;  4LF9 O;  3N27 A;  4FFK A;  4GX1 A;  1US6 A;  4MTF A;  2OWO A;  3ZHQ A;  1P4R A;  3LSU A;  4X1K B;  2ZT9 B;  3SJA C;  1QNM A;  1S77 D;  1X4T A;  1K4D C;  1K97 A;  1YCI A;  4I0X B;  4DR4 O;  3J80 N;  5KHJ A;  1D2D A;  1AP5 A;  5LP6 C;  5K1X A;  5LGN A;  5EZY B;  1Q6I A;  3CP1 A;  4LFB O;  2E5L O;  2ODM A;  1M1K W;  1HP8 A;  1WPX A;  3BHP A;  4JI0 B;  3OFN G;  4W4L A;  2AXT Z;  1KMI Z;  1M57 C;  1Y76 A;  2IU3 A;  2JS3 A;  2QEX V;  2ZM6 O;  3AG1 B;  3O65 A;  4XDJ A;  5LXT A;  4PA7 A;  4DW1 A;  2AGA A;  5EBL C;  2HR3 A;  4DR6 B;  2QSA A;  4JYA O;  3RT3 C;  4N21 A;  3N2G B;  5BY1 A;  4LR3 A;  3CMA V;  2Y0I A;  2GSM B;  4B3S B;  1BS3 A;  4MVQ A;  1BL8 A;  2QR4 A;  3FFQ A;  4DV7 B;  4O2A B;  1KEC A;  5BZB A;  3UQ8 A;  3C90 A;  1Y4M A;  4LFC B;  2ZCE A;  1QLE C;  3Q4H A;  4KUM A;  2EIL B;  1PV0 A;  1NS1 A;  1T5E A;  1YF2 A;  1AB3 A;  5LHI A;  4GT1 A;  2BTQ A;  1YJ9 V;  5J2T A;  2FKX A;  1V54 B;  1N34 B;  1GM8 A;  5GON B;  3K04 A;  1GH6 A;  5ITZ A;  2K9P A;  4QE9 A;  4NXM O;  1SC5 B;  1XNQ B;  3B77 A;  1AI6 A;  1H8H G;  1S72 V;  1SQG A;  3FYE B;  1M90 W;  4P30 A;  4DK0 A;  3CSX A;  5IJ9 A;  3ZMU A;  5LL6 Y;  3E8B A;  4KXR A;  4WFA V;  3QNE A;  1W0J G;  4ABM A;  1GN4 A;  4OPA A;  2CAZ C;  2YI8 A;  3H1L H;  4DV5 O;  5FNV A;  2A3Q A;  2A7W A;  2ZR3 A;  4ZI7 B;  1WB7 A;  3HKC A;  1Z5V A;  1DF4 A;  2BOC C;  4J7K A;  4MVR A;  4TUY B;  4U3J B;  4UB8 Z;  4PDL A;  2XTA A;  3TGU H;  2AZ2 A;  2VQF B;  2UUB B;  1FKA O;  2JJ2 G;  3JD1 A;  4TV8 A;  1SA0 A;  1K3E A;  5EC1 C;  3IJ4 A;  1OV9 A;  2F66 C;  2VRZ A;  1YIJ V;  5FL7 G;  1FJG O;  3ABM B;  2UXC B;  4GLX A;  4ZHQ B;  4X20 A;  2FYU H;  2LFS A;  5EK0 A;  2QWR B;  1RM1 C;  1X59 A;  2OIG A;  1U97 A;  4CS4 A;  1D5A A;  4O4I A;  2E74 B;  4WBN A;  1XOU A;  3SYO A;  5H6R A;  1FFX A;  2WLJ A;  5LOV B;  1L8D A;  2OCH A;  1COW G;  1IBM B;  4EB6 B;  1WB8 A;  4PDV A;  1DF5 A;  3G80 A;  4PA9 A;  1G1X B;  1ARO P;  4GCZ A;  3G71 V;  3W7X A;  4RAI A;  3BVO A;  3DXR A;  1M56 B;  3AG3 B;  5LGT A;  1NH2 B;  3JAR B;  2UUA B;  5IYZ A;  3OEH G;  3LSQ A;  2DYR B;  1NKD A;  4JI6 B;  4Z1M G;  1M9N A;  3MAQ A;  2GTA A;  5EBW C;  1J5E B;  4LF9 B;  1NTK H;  4ZIB A;  4TV9 B;  2QM7 A;  1IBL O;  3GWO A;  2PYJ A;  3RGB A;  4DR3 B;  2IM9 A;  3HKE B;  4XDK A;  2HHH O;  1AVM A;  3K9S A;  3KG2 A;  3TK1 A;  4IIJ A;  1N0J A;  3RYI B;  5IY5 C;  2FL4 A;  4DR4 B;  2Y69 C;  5IYC O;  2RMK B;  3SPI A;  5LP6 B;  4DR5 O;  2AHZ A;  1VAR A;  2EJ7 A;  4LFB B;  3ZHS A;  3D36 A;  4EKW A;  1AIL A;  3HKB B;  2A79 B;  4IHJ B;  4OX9 O;  5GW7 A;  3PN1 A;  1M57 B;  2YIB A;  2B1I A;  1SQF A;  3JAS B;  4X1I A;  1Z5W A;  4ZOL A;  5D5Q A;  1G8M A;  5EYP A;  5TIS Z;  4JYA B;  4J11 A;  2VS0 A;  4MSW C;  1F4N A;  2WLL A;  5JCO C;  4E4E A;  4W4K A;  4JTA B;  1UJW B;  2HLD G;  2E3C A;  1L1F A;  2WAM A;  3ZRS A;  1VQ8 V;  3JAT B;  4UFZ A;  3IC7 A;  3BY6 A;  2P90 A;  3OTF A;  4RUF A;  5KX5 B;  1VQ9 V;  2JGD B;  1SQQ H;  2HJD A;  2ZE7 A;  1YHQ V;  3CC4 V;  4DRX A;  4NXM B;  1KQS U;  3T1Y B;  2LFR A;  1UPG A;  2QKA A;  4X1K A;  1R1B A;  1KD1 W;  3CCL V;  3STZ C;  3FD9 A;  4I0X A;  2QKS A;  4I4T A;  3BCC H;  3HB3 B;  5KLV H;  2ZKO A;  5LMU O;  1H2K A;  4NB5 A;  1THZ A;  3R65 A;  5BXZ A;  2YS8 A;  4U3F H;  1J95 A;  4ZKI A;  3LNN A;  4KHP B;  5LYJ A;  4PV1 B;  4JV5 O;  3H01 A;  5JWP A;  3CC7 V;  1NVP D;  1JJ2 U;  2UXN A;  3X2Q C;  2CK3 G;  2M7W A;  3OMI B;  3ZS8 C;  4O2A A;  3UO3 A;  3ZRW B;  4UUJ C;  1ZX3 A;  4XDL A;  2KQX A;  2H3O A;  1FJG B;  1N36 O;  4DV2 O;  2CGO A;  1IBK O;  5CBH A;  3VQW A;  5K1P A;  2VWJ A;  1FXK A;  3OGI B;  5LXT B;  3UT5 A;  4DV0 O;  1RM1 B;  2EIN C;  4IGG A;  4DUZ B;  1FS0 G;  3CJH A;  2Q7E A;  4U7O A;  3CRA A;  2ILM A;  4A5U B;  1CP9 A;  1WJZ A;  3ETG A;  2GV9 A;  4JYC A;  4PEL A;  3K03 A;  4HAM A;  4GKK B;  3Q4H B;  3UCS C;  5IYD O;  2WA3 A;  1VQP V;  4JGS A;  3JSL A;  2BTQ B;  2R70 A;  4G27 B;  2IU0 A;  5J2T B;  2H94 A;  4B3T O;  4PHZ A;  1S76 D;  5ITZ B;  1IDS A;  1B06 A;  3MHH C;  4LF4 O;  3P32 A;  1VF6 A;  5KHK A;  1FAF A;  2YDE A;  1S3J A;  4LF5 O;  4BIZ A;  2XT9 A;  2QTO A;  5IJ9 B;  4MT8 A;  1KP3 A;  1OCR B;  2JEX A;  1Q81 W;  1IBL B;  1I08 A;  2OCC C;  1VQ5 V;  1KUQ A;  2WLM A;  2WLN A;  1OCC B;  3BPZ A;  1NU1 H;  1NT2 B;  3B8N A;  4DV6 O;  4X1Y B;  1GN2 A;  2Y69 B;  3PJS K;  2LQT A;  1NR7 A;  3ASN C;  4N23 A;  5D5P A;  4AQY B;  1Q6H A;  4TV8 B;  3L73 H;  3SJB C;  1GM7 A;  1SA0 B;  3F7Y C;  3OR6 C;  4OX9 B;  1KC8 W;  2CE4 A;  3WB2 A;  1N33 O;  1KP2 A;  3U0Z A;  1JOY A;  2JVD A;  1BMF G;  3SR2 C;  3ABK B;  1FPO A;  4X20 B;  1FXK C;  4YY3 B;  4H33 A;  3ZJZ A;  3CEI A;  4O4I B;  4WBN B;  3F7V C;  5KAI Z;  4PI0 A;  1FFX B;  4JAU A;  4DUY B;  1AR5 A;  1WP7 A;  3E8G A;  3CME V;  4JPR A;  3WFV A;  4PA4 A;  4NYK A;  4PA6 A;  4F4L A;  4DO2 A;  3FB8 C;  5DED A;  2WLI A;  1IUR A;  2ITC C;  2X0L A;  1MSD A;  3VOU A;  3H1K H;  2RJZ A;  5IYZ B;  2Z5U A;  5JVD B;  2BSK A;  4LFA O;  4WCE V;  3SPJ A;  5LMU B;  4QGP A;  1NTM H;  3HKB A;  3TJT A;  2OYQ A;  2QWO B;  1HNX B;  3IGA C;  1WA8 A;  3T2M A;  1Y66 A;  4CC6 A;  1VEW A;  3KKY A;  3WU2 Z;  4IIJ B;  2YXY A;  3FB5 C;  4OGQ B;  4J9Z B;  4BAY A;  1NTZ H;  4UVC A;  2OIE A;  2F4V O;  1OHH G;  5BMV A;  2UUC B;  4BIU A;  5B3S C;  1BT8 A;  1YJN V;  1QHT A;  2P7T C;  3D3Q A;  3VQX A;  4DV2 B;  3RWR D;  4X1I B;  4FK5 C;  1MNG A;  5FPR A;  4ZOL B;  1VF7 A;  4FVM A;  1BQ0 A;  5EYP B;  3AEI A;  2EIN B;  3OM3 B;  2ZXW B;  3E89 A;  3U10 A;  3T4Z A;  2IJK A;  4BR6 A;  4QNH B;  4DYL A;  1HNW O;  3RYF A;  2JIZ G;  3K06 A;  1GRJ A;  5GTH Z;  4X9Q A;  1I94 B;  2OTL V;  1PPJ H;  5B5E Z;  1W2B U;  4DK1 A;  2AZ0 A;  2IW5 A;  1K5S A;  2QJ1 A;  1NQT A;  1OCO B;  3A0R A;  4YIO A;  5L3F A;  1SZX A;  4NTY A;  3ZHR A;  4LF4 B;  4DRX B;  1S0V A;  4JI2 B;  2DN9 A;  2KB1 A;  4MVZ A;  3ZHV A;  1K5Q A;  2ZE8 A;  1PD3 A;  1XNR O;  2PTM A;  4I4T B;  1GK9 A;  1Q8I A;  3CPW U;  5KAF Z;  2L35 A;  1R6N A;  3K5O A;  4GX2 A;  2Q68 A;  3ZN0 A;  3ZRW A;  4O4H A;  2P67 A;  3OMN B;  3MD0 A;  1H2N A;  3FB7 C;  3SGI A;  5LYJ B;  1R3J C;  1TAE A;  3ASN B;  5LMN O;  2YID A;  2ADP A;  3ABU A;  2RQ6 A;  3DTU B;  1P7B A;  2Q6A A;  2F93 B;  5LGU A;  3JD3 A;  3ETE A;  1N4C A;  2UXB O;  2PGG A;  4QPK A;  2B1G A;  1FXK B;  2ZDI C;  3UT5 B;  4JI7 O;  4JI3 O;  4IT5 A;  3CJH B;  4J7J A;  4TOI A;  3G6B A;  1DLB A;  1TUB A;  1XMQ B;  4LF8 B;  3UKM A;  4L87 A;  4MVO A;  3B8M A;  1KKC A;  5EBM C;  4GKJ O;  1QCE A;  3FB6 C;  1VQL V;  2XND G;  5LHG A;  2EIK C;  3HPL C;  1L0N H;  2N04 A;  3WG7 B;  5KA6 A;  5LHH A;  1NR1 A;  3MDS A;  1BE3 H;  1HR0 O;  2F23 A;  4CBC A;  5HFL A;  4LFA B;  4X1Y A;  4R8C A;  3OW2 U;  4F6E A;  3F5W C;  2HJF C;  1VQO V;  3SYP A;  1LR1 A;  1BSM A;  2HKO A;  1ROP A;  3S3W A;  5B1B C;  1LNQ A;  2UU9 B;  2Q69 A;  4JZ2 A;  4J10 A;  4BWA A;  4U7N A;  5KUK A;  5FLX N;  4FLW A;  1TA8 A;  2EX3 A;  4FZ1 A;  2VQE B;  3GVM A;  2JRI A;  3QVN A;  2X6A A;  4O2B A;  3GWK C;  5IWA B;  2F4V B;  3K5M A;  5JCO A;  1YZB A;  4D7S A;  1V55 C;  2CGN A;  1LUV A;  5B3S B;  1K92 A;  5KMG A;  1XMO O;  1YEW A;  1ZUQ A;  2HVK C;  1SET A;  1KYO F;  1NZ6 A;  2BCC H;  1NI8 A;  4UCT A;  2P06 A;  4QPJ A;  4I5S A;  4YJ2 A;  3EXA A;  2Y4T A;  1K8A W;  3QO5 A;  1Q6U A;  1SQX H;  3FYI B;  4BW5 A;  2ARH A;  4GX0 A;  1E79 G;  3L72 H;  1AJN A;  2JEU A;  2EZP A;  1KB9 F;  5JVD A;  4I9Q A;  2BTO A;  4DR7 O;  4DR2 O;  3RYC A;  2BE3 A;  4PI2 A;  4LF6 O;  5L3C A;  3AK1 A;  1MMM A;  4KFM A;  3BA8 A;  1P7G A;  1K9M W;  2WLH A;  3N2K A;  2WLI B;  2XAS A;  2EUL A;  4C7U A;  4CC5 A;  4J41 A;  1JX9 A;  2DW4 A;  3RYH A;  4HZ3 A;  1SRY A;  1XNR B;  3J81 N;  2BSK B;  2XAF A;  5C8Y B;  3KCY A;  4I9W A;  5JJJ B;  4FM0 A;  2D3O W;  2E5L B;  4FIP C;  2DQ3 A;  3OEE G;  3ZMS A;  3CS5 A;  1WA8 B;  1H38 A;  1PNL A;  2DJV A;  3JAM N;  3AG2 C;  1R3L C;  4Q6G A;  2ZM6 B;  1N32 O;  4CH4 A;  2Y4U A;  4I55 B;  5CN0 A;  1Q43 A;  1LUW A;  2V1D A;  3W7W A;  5LMN B;  5CB4 B;  1XIL A;  2XHB A;  5BMV B;  4FLX A;  1JA8 A;  4P9P A;  4NKG B;  4HYO A;  2Z3Y A;  3OAA G;  3AG4 C;  4PA3 A;  1BQZ A;  1EZV H;  4DV4 O;  1O9G A;  1QLE B;  5HFM A;  1VQK V;  1H2G A;  1TVK A;  2KG7 A;  4OXS A;  3CB2 A;  2GBO A;  3SYQ A;  3FAV A;  4JI7 B;  1HDJ A;  2OTJ V;  2R9I A;  4JI3 B;  1Q3E A;  3CCQ V;  2PI4 A;  2QA4 V;  2L6L A;  3RYF B;  4B7E A;  1ZSP A;  1YTF D;  4ZBM A;  4GKJ B;  5IJ0 B;  4UB6 Z;  2Q0A A;  3M7M X;  4RQE A;  2W6I G;  5IE9 A;  1G4Y B;  3CWB H;  2RNB A;  4JI5 O;  1QR9 A;  5IYB O;  2EIM C;  5L3D A;  3L74 H;  1O9H A;  4LF7 O;  4DV5 B;  1JFF A;  2F1M A;  4RO2 A;  1HR0 B;  2WSS G;  1OCZ C;  1MG1 A;  3SJQ C;  2X6B A;  3DC5 A;  1XDC A;  2P4K A;  3LDE A;  1VMG A;  1M5I A;  2Q4P A;  4DXW A;  1IVS A;  4MW8 A;  3UO2 A;  4BIO A;  5IDJ A;  5A9G A;  2ADQ B;  1L0L H;  3K5N A;  3L70 H;  2VWK A;  4UV8 A;  2HG5 C;  4O4H B;  4FFB B;  2RDC A;  1DGS A;  5KHG A;  3NR7 A;  4FLZ A;  4BW9 A;  2XUM A;  4X65 O;  3T1C A;  1KU9 A;  2Y0P A;  1QR8 A;  1Q5O A;  1V9P A;  4OPH A;  4X8A A;  1KBH A;  3CX5 F;  2DYS C;  4UVA A;  1ZTE A;  1ZL8 B;  4UVB A;  4YXW G;  3DGE A;  3BAA A;  1GO3 F;  1WAZ A;  3OTO O;  3ETQ A;  1Q90 D;  1CEZ A;  1VP7 A;  1XEQ A;  3K0G A;  3SPC A;  1RP3 B;  5JJE B;  2EIJ C;  1PP9 H;  1TUB B;  1H2L A;  3OUS A;  5B1N A;  5GTI Z;  2FB5 A;  3CCJ V;  2Q7G A;  2PZS A;  3AK2 A;  4DR7 B;  1EN5 A;  3KZI Z;  2HP8 A;  4LF6 B;  4H0L B;  4NR1 A;  4JI1 O;  5E79 Z;  4G2K A;  5CA0 A;  2CDY A;  4FLT A;  3W7T A;  1K33 A;  4WFB V;  4O4J B;  4AHC A;  2HHH B;  3APQ A;  1F4M A;  5IY5 B;  3BAB A;  2IH1 C;  2Q0O C;  4D6T H;  2ZNI A;  2CTQ A;  1R6T A;  1XUQ A;  4DR5 B;  3ZRX A;  3JAK A;  3JAL A;  2IBZ H;  1VQN V;  1JVM A;  1MZE A;  4YHH O;  5FPO A;  4B08 A;  4G28 B;  1BHB A;  3ZX6 A;  3CE2 A;  1S5H C;  3ZMZ A;  3AG2 B;  3SDL A;  1N32 B;  5KHI A;  2G38 A;  1WNS A;  4F6R A;  4PDM A;  4WFF A;  3I55 V;  3HR0 A;  4O2B B;  2BOB C;  3ZMT A;  1YJW V;  5DEC A;  1Y74 A;  1AR4 A;  2V7Q G;  1OJH A;  3B2E E;  4JAS A;  5KMG B;  1AI4 A;  2JDI G;  2PF4 E;  4LWS A;  4DV4 B;  1B6Q A;  1S5J A;  2XAG A;  3QTC A;  4YJ2 B;  1H2M A;  4YJ3 B;  5B1A C;  1KKD A;  2D2C B;  1V54 C;  4QJF B;  1N34 O;  1B3Q A;  3RN4 A;  5H2F Z;  3GB7 C;  5JH7 A;  1F7Y A;  2A0L A;  2P4V A;  3K08 A;  1XNQ O;  1QBZ A;  1YVW A;  4UXN A;  2ZNJ A;  1NJI W;  1FFT B;  2Q9L A;  3CCV V;  4JI4 O;  3CCR V;  4FM1 A;  2OT5 A;  5C8Y A;  1BCC H;  3RYC B;  4JI5 B;  4TSF G;  2YSU B;  3N2K B;  2ZD9 A;  1SQP H;  1BHA A;  1SS3 A;  1W59 A;  3FX7 A;  3L75 H;  5L3B A;  4MS2 A;  3RYH B;  1ENV A;  2WA4 A;  4I55 A;  4JV5 B;  1JQ0 A;  5CB4 A;  4RUE A;  1WLE A;  3RBZ A;  3X2Q B;  2P5O A;  2CTR A;  3RFR A;  1EN6 A;  4KP4 A;  1N36 B;  3SPH A;  4GUN A;  3L71 H;  4MW3 A;  1IBK B;  2UXC O;  1MOF A;  2QDO A;  2MW2 B;  1Y6X A;  4DV0 B;  1EM1 A;  2ZDI A;  1VQ7 V;  2R9A A;  5KHH A;  4JI8 O;  1S5L Z;  2DE0 X;  2LW7 A;  2QKC A;  1N0N A;  4K8Z A;  5BR8 O;  4Z2W A;  2IJJ A;  4FLV A;  4DR1 O;  2DYS B;  2LW1 A;  3TXS A;  4X88 A;  1IBM O;  5IJ0 A;  1XRE A;  3LDD A;  1QU7 A;  1TVK B;  2KG7 B;  1PM9 A;  5B66 Z;  2CUG A;  3QO8 A;  3CCS V;  1GMG A;  4J9Y B;  3FAV B;  3IC9 A;  4B3T B;  3RW0 A;  4NXN O;  1M56 C;  2EBO A;  1SES A;  4UV9 A;  3AG3 C;  1I0H A;  3EVK A;  1XI1 A;  1PKX A;  2AW9 A;  1QVG U;  3CRM A;  2DYR C;  4CZZ A;  1W0K G;  2W0X A;  2W0F C;  5EIB D;  4LF5 B;  2QWQ B;  4JI1 B;  1J5E O;  3E8F A;  1SER A;  2OCC B;  2Q5Z A;  3JSN A;  4MVM A;  1XL6 A;  3CRQ A;  3A2F A;  2YIB D;  4DR3 O;  1JFF B;  1TUE B;  4FFB A;  3E83 A;  5J9P C;  2LGW A;  1RFY A;  3KCX A;  4NVP A;  3OE7 G;  2ZIO A;  4TT3 G;  4DV6 B;  2YXH A;  3H1I H;  4I7Z B;  3TCU A;  3K79 A;  4R50 A;  4YHH B;  4RWU A;  1ORQ C;  4LNU A;  2GTS A;  3HKD A;  2EJR A;  1GN3 A;  4CS3 A;  1K7D A;  1IZ3 A;  3E86 A;  5CBF A;  1M4U A;  1N33 B;  3VQV A;  1ZL8 A;  2CH7 B;  4JAA A;  4LC1 A;  3EHB B;  4L8J A;  4IL6 Z;  2RCV A;  3ZCC A;  2ITD C;  5DN6 G;  2GHY A;  2F43 G;  1XHX A;  4CS2 A;  3CD6 V;  1A32 A;  3TXQ A;  4PDR A;  4AI8 A;  3K5L A;  1PNK A;  3I5D A;  1IX9 A;  3K59 A;  3OMA B;  2JS5 A;  4B3R O;  4E2L A;  5B1A B;  4WFH A;  3OGC C;  3MHS C;  3I56 V;  4H37 A;  2EZO A;  2NNU A;  2XAH A;  4X64 O;  4DV1 O;  2LP7 A;  3R66 A;  4LCU C;  3CYO A;  3T1Y O;  4O4J A;  4ASU G;  3CCM V;  4TQD A;  3P3N A;  4JI4 B;  4JYY A;  5CA1 A;  3K57 A;  3E22 A;  3QF7 A;  3LSS A;  3CCE V;  1N8R W;  2CTW A;  1YI2 V;  2QWP B;  4DW0 A;  2HVJ C;  1WP8 A;  5JQG B;  4MTO A;  2M6Y A;  5CA0 B;  2JJ1 G;  2R9R B;  4JF3 A;  3SJC C;  3JYC A;  4LH6 A;  3LNM B;  2RN9 A;  3P3P A;  1VQ6 V;  4KHP O;  2LGQ A;  2KSD A;  1D5N A;  3ABT A;  4HNA A;  1R73 A;  1I5Y A;  3C3S A;  1FXH A;  4KL1 A;  3AK3 A;  3JAL B;  3JAK B;  3JAW A;  2QE7 G;  1P84 F;  2YI9 A;  2UXD O;  1JPX A;  3ETD A;  5CA3 A;  3T1H O;  2YXL A;  3O9O A;  2Y48 A;  3JCU Z;  3H1J H;  4O4L A;  1TGO A;  2HFE C;  4H13 B;  4F6R B;  4YJ3 A;  3OUF A;  3CRR A;  5LA6 A;  5J2U A;  4JI8 B;  2R72 A;  1AI5 A;  4DUZ O;  1ZLZ A;  1PL4 A;  4FPP A;  1GTO A;  4MVU A;  4X66 O;  5BR8 B;  1Y74 B;  2F95 B;  4P9O A;  1HNW B;  2QGN A;  3D3I A;  4DR1 B;  3FKS G;  4QIW F;  4LWS B;  1AI7 A;  4GKK O;  4IYH A;  1I7F A;  3G6E V;  4XBF A;  5A2Q N;  4NXN B;  4R6Z A;  2CTP A;  2Q7H A;  5JH7 B;  1RSO B;  2ATK C;  2E76 B;  5DM6 V;  3APO A;  3ZHU A;  3ZBH A;  3CC2 V;  4B7K A;  1VIB A;  1AR1 B;  2ZE6 A;  1YXB A;  3WB1 A;  1K73 W;  4FLY A;  1OCR C;  3H1H H;  4H44 B;  2YIA A;  1MZF A;  1M93 A;  1VQM V;  2Q8V A;  3F5T A;  4NTW A;  1OCC C;  1YSC A;  3G4S V;  1HWY A;  2A9H A;  4JTD B;  3S3X A;  3EFF K;  4DV3 O;  4I50 A;  4WF9 V;  4UCV A;  1YTF B;  5JJN B;  2X6C A;  4AQY O;  2GUZ A;  1NH2 D;  4PD4 F;  3G67 A;  3VQY A;  5C93 A;  3JCZ A;  1QVF U;  2DWE C;  1K34 A;  3C3T A;  4WFE A;  2UXB B;  4GYC B;  4UCO A;  1WN7 A;  3ABK C;  3LDC A;  3D8C A;  4YY3 O;  4K0K O;  1EFR G;  1P49 A;  2P6J A;  3QG5 A;  3E2E A;  2YEV B;  3RVY A;  1NVP B;  1SF9 A;  2N05 A;  3M8A A;  1VQ4 V;  1EZJ A;  2LJ2 A;  4DUY O;  1HNZ O;  3AG7 A;  1IXB A;  4X62 O;  1U96 A;  2IH3 C;  4B3R B;  3K0D A;  5KUM A;  2WPD G;  3TET A;  3OT7 A;  2EIK B;  3CXH F;  4X64 B;  1IXM A;  2QWN B;  4DV1 B;  3A0B Z;  1E1Q G;  1H2S B;  2K1E A;  2ZR2 A;  5H5N A;  3U11 A;  2WLK A;  2O57 A;  2PYL A;  4TQF A;  3ZMV A;  3DC6 A;  4K8X A;  5H9C A;  3OR7 C;  3L9D A;  1QQC A;  1K4C C;  5EZY A;  2ETN A;  3BFR A;  5B1B B;  1HNX O;  1OZ0 A;  1QLN A;  4MVS A;  1JCH A;  3ABL C;  3ASO C;  2QM4 A;  3ICX A;  3J7A U;  3CRC A;  2C2A A;  2CH7 A;  3QO7 A;  2NR5 A;  4JAV A;  4FJC C;  5EIB C;  3N2G A;  5E1A C;  1V55 B;  2UUC O;  4EFE A;  3D36 C;  1XMO B;  2XAJ A;  3P30 A;  1MSW D;  1BZK A;  1SQB H;  3B09 A;  1SQV H;  4NTX A;  1B04 A;  3IAY A;  1AJQ A;  4LNU B;  3W7S A;  3HKD B;  4K3A A;  4B3M O;  2UXD B;  1Y76 B;  2XOK G;  3T1H B;  4FMT A;  5CMU A;  3UM7 A;  3NXS A;  4PJ0 Z;  2QTS A;  3LUT B;  5L3E A;  3BEH A;  3BRC A;  2YUA A;  1XBL A;  2W6J G;  1HW7 A;  3E35 A;  5LBQ A;  2ZXW C;  3BA9 A;  4R7C A;  5GON A;  4X66 B;  1RPO A;  4K35 A;  4J80 A;  5B1O A;  1I94 O;  1FXV A;  4DR2 B;  1XQ8 A;  2XAQ A;  1AP6 A;  4YIP A;  1OCO C;  1GKF A;  1Y67 A;  2X7R B;  1PL0 A;  3SYC A;  5JQG A;  2IJI A;  4Z1V A;  1WPB A;  2UXX A;  3JD0 A;  4ZI7 A;  4JI2 O;  2NN4 A;  2H8P C;  5AG2 A;  1FD9 A;  2Q67 A;  1F51 A;  1CPY A;  3ZRV A;  3OD4 A;  3CXC U;  4TUY A;  3ZIA G;  4U3J A;  1Q82 W;  5CA1 B;  1G6U A;  1GAX A;  3E22 B;  2A06 H;  4RQF A;  4TWK A;  1F23 A;  4P2Z A;  3H9V A;  4MTG A;  4JYB A;  4QE7 A;  4CH3 A;  2HEP A;  2NLJ C;  4JI0 O;  1JMK C;  1JR9 A;  4LH7 A;  5FNV B;  3SPG A;  4DV3 B;  3ML0 A;  4ZHQ A;  2Q73 A;  2B9Z A;  3AG1 C;  3HKC B;  3JD4 A;  2DQ0 A;  4DR6 O;  4HNA B;  5F2V O;  5KA5 A;  2ZIM A;  3CHX A;  4FZ0 A;  4B3S O;  2DWD C;  3B40 A;  1H8E G;  2WWW A;  3JAW B;  4DV7 O;  4JZG A;  3AG4 B;  3WB0 A;  5LOV A;  3W7U A;  1SZT A;  4EB6 A;  1EN4 A;  1FYJ A;  4LFC O;  4UCU A;  2EIL C;  2YIC A;  1Q7Y W;  2DMX A;  4CH6 A;  4O4L B;  2FTK A;  3VBB A;  1GM9 A;  5J2U B;  5LA6 B;  1YIT V;  4Q20 A;  4K0K B;  2PUS A;  5EC2 C;  3RVZ A;  1BGY H;  3DSQ A;  4UCS A;  1RSO A;  4GX5 A;  3JAR A;  3SYA A;  1XMQ O;  4LF8 O;  1HNZ B;  1NBM G;  4X62 B;  4LP8 A;  3K9A A;  1YDX A;  1Z2G A;  1GN6 A;  4ICG A;  3K58 A;  3A8T A;  4TV9 A;  2AHY A;  2N74 A;  3T4D A;  2EIM B;  3WG7 C;  4LF7 B;  3HKE A;  1URF A;  2PI5 A;  3DXR B;  1R3K C;  1E1R G;  3STL C;  5IT9 N;  4FM2 A;  1CXZ B;  1OCZ B;  3ZN1 A;  2IJH A;  3RYI A;  1VF6 C;  4CH5 A;  2V4D A;  2ZIN A;  4FLU A;  2DOS A;  5LP6 A;  2E75 B;  4LBE C;  1I5X A;  1EBO A;  2VQF O;  2ZQM A;  2UUB O;  1UFI A;  3M99 B;  2UU9 O;  1JJO A;  4EEQ A;  1Q86 W;  4IHJ A;  3THO A;  1PNM A;  2GDS A;  3E8H A;  3IFX A;  1XHZ A;  3ABL B;  3ASO B;  3B4S A;  4AIL C;  3JAS A;  1RPR A;  2Z0A A;  1DK1 A;  3ABM C;  2VQE O;  1ZAU A;  4I50 B;  4J42 A;  3ZHT A;  5IWA O;  1R3I C;  4X65 B;  1SKV A;  4HBN A;  2JGU A;  4D7T A;  2YEV A;  2GUZ B;  3A0H Z;  1ZWI C;  4B3M B;  3JAT A;  4JTC B;  4X89 A;  1R6K A;  2P22 C;  2LO1 A; 
#chains in the Genus database with same CATH homology
 4DV3 O;  4DV7 O;  5LMN O;  3OTO O;  2ZKO A;  5LMU O;  1J5E O;  2UUC O;  4NXM O;  4JI4 O;  1FYJ A;  1XEQ A;  4LFC O;  5BXZ A;  2F4V O;  4KHP O;  4AQY O;  4B3M O;  4DR3 O;  1IBL O;  4DV6 O;  2UXB O;  5LL6 Y;  2UUA O;  4JI1 O;  4JI6 O;  4OPA A;  4JV5 O;  4JI7 O;  2HHH O;  4DV5 O;  1XMQ O;  4LF8 O;  4JI3 O;  4LF9 O;  2UXD O;  4JI5 O;  1N33 O;  3T1H O;  4DR7 O;  4DR2 O;  4YY3 O;  4LF7 O;  4DR5 O;  4K0K O;  4LF6 O;  1AIL A;  2N74 A;  1I94 O;  1HNW O;  4DUZ O;  1R6T A;  4GKJ O;  1N36 O;  4OX9 O;  4X66 O;  3M8A A;  4DV2 O;  1IBK O;  1FKA O;  4DUY O;  4YHH O;  4DV0 O;  1HNZ O;  5IT9 N;  4DR4 O;  3J80 N;  4X62 O;  1D2D A;  2UXC O;  4LFB O;  2E5L O;  3J81 N;  1HR0 O;  4JI2 O;  1FJG O;  2DOS A;  3SDL A;  4JI8 O;  4GKK O;  2LW7 A;  1A32 A;  4A5U B;  5BR8 O;  2VQF O;  2UUB O;  5A2Q N;  2UU9 O;  1X59 A;  5H5N A;  2ZM6 O;  3O65 A;  4B3R O;  2DJV A;  4DR1 O;  2AGA A;  3JAM N;  1IBM O;  1XNR O;  2Z0A A;  1DK1 A;  4B3T O;  4JYA O;  4JI0 O;  3RT3 C;  4X65 O;  1N32 O;  2VQE O;  5BY1 A;  4X64 O;  4DV1 O;  4LF4 O;  4LFA O;  5FLX N;  3R66 A;  1HNX O;  3T1Y O;  5IWA O;  4NXN O;  4OPH A;  2JRI A;  1G1X B;  4LF5 O;  4DR6 O;  1N34 O;  3J7A U;  1NS1 A;  1AB3 A;  1R1B A;  3F5T A;  1F7Y A;  1YZB A;  1XMO O;  1XNQ O;  1KUQ A;  4B3S O;  2FKX A;  4DV4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...