4JI3O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji3O00
4X65O 2UU9O 3M8AA 4LFCO 2UXCO 2UUBO 1D2DA 4LF7O 1HNXO 1G1XB 1NS1A 4DR7O 4JI2O 2UXDO 4KHPO 4JI3O 2DJVA 1HNWO 2UXBO 1A32A 4GKJO 2UUCO 4LF9O 4X62O 3T1HO 2E5LO 4NXMO 1R1BA 4OPHA 4B3TO 4LFAO 1FJGO 4B3SO 5BY1A 3R66A 4YHHO 4K0KO 4DUYO 3F5TA 1N32O 4JI6O 4DV4O 1AILA 5IWAO 1X59A 4DR3O 1KUQA 4DV1O 1XNRO 3J81N 2FKXA 4OPAA 3OTOO 1N36O 1J5EO 1IBMO 2VQEO 1IBLO 4DV6O 4B3MO 4LF6O 4LF4O 2Z0AA 4JI1O 5LL6Y 2N74A 4DR2O 5IT9N 4DV3O 5LMUO 3SDLA 1I94O 4X64O 4AQYO 4JYAO 4NXNO 1XMQO 1N34O 1IBKO 4JI8O 1FKAO 1XNQO 4DUZO 4LFBO 4DR4O 2ZKOA 1R6TA 4DV2O 5LMNO 2VQFO 3J7AU 2F4VO 4B3RO 4DR1O 5A2QN 1N33O 2AGAA 5H5NA 3O65A 3RT3C 4YY3O 1F7YA 2UUAO 2DOSA 4LF5O 5FLXN 4A5UB 1YZBA 3J80N 4OX9O 4DV0O 4X66O 3JAMN 4JI5O 2HHHO 1AB3A 2JRIA 4LF8O 4JV5O 4DR6O 5BR8O 1HNZO 5BXZA 2ZM6O 4DV5O 1DK1A 1XMOO 4JI7O 4DR5O 4JI4O 3T1YO 2LW7A 4JI0O 1HR0O 4DV7O 1FYJA 1XEQA 4GKKO
chains in the Genus database with same CATH superfamily
5IYBO 3VOUA 2PGGA 2OCHA 4FLZA 4LFAB 2UUBO 2ADPA 2BOCC 5EC2C 1WAZA 2DYRC 3D3IA 3JSNA 3CRRA 1V54C 1IXBA 5KLVH 1V55C 2F93B 3RWRD 1QR8A 4UXNA 3ZRWA 1B3QA 2V4DA 1COWG 2BTOA 1AILA 3BA9A 1I94B 1XHXA 2ITCC 1KUQA 2RNBA 5EIBD 1N32B 2YXLA 3ABKC 2FKXA 5IYZB 1DF5A 5D5QA 3X2QB 4KUMA 2JJ2G 2OCCC 1PP9H 4UCOA 3RYCA 1EN4A 1VMGA 1VF6A 1J95A 1OCRB 4O2AB 2QA4V 2MW2B 1N34O 3DC5A 3JD1A 3WG7C 3JATA 4AQYB 2WWWA 1GTOA 4O4LB 2YIBA 2AGAA 2QWRB 1SC5B 2F4VB 3E86A 2R9AA 2IH3C 5CA1B 3J80N 4FLUA 3ETGA 3CPWU 4J9ZB 2MK3A 2DQ3A 1AB3A 2ZE7A 1ZL8B 2GBOA 5B3SC 1PL4A 2CTQA 3SJAC 2QJ1A 3B09A 1Y74B 2HJFC 2Q9LA 1YXBA 4JYBA 1XMOO 1W0JG 3QF7A 3LSUA 1YVWA 4XDJA 2LW7A 2Q8VA 4FLWA 4O4JA 2HR3A 1ZAUA 3L73H 2AW9A 1URFA 4I7ZB 3RYHA 3H1KH 4OXSA 4R8CA 1LR1A 1WA8A 2K9PA 1HNXO 4WBNA 2Q6AA 4G2KA 1NS1A 4KXRA 4IGGA 1HNWO 3P32A 3K5NA 3ZMUA 3HKCB 2CGOA 3I5DA 3Q4HA 2LGWA 1J5EB 3ZJZA 5CBHA 1O9GA 4DV6B 4H0LB 1Y66A 3N2GB 1IVSA 4P2ZA 2QDOA 1LUWA 4JI6O 4B3SB 2JK5C 2QKSA 4P30A 3IGAC 4K3AA 5HFMA 3OMIB 1VQ4V 3E22B 3K5OA 5B1AC 3K04A 4X1YB 5EIBC 2ZE6A 2Y4UA 2CTPA 3HB3B 2WLJA 1YI2V 3KKYA 2HG5C 4DR4O 4B7KA 5KAFZ 4PD4F 4MTGA 5C8YB 3SR2C 2UXXA 3ABMC 1AJQA 5K1XA 4LNUA 5ITZB 5A2QN 3CCMV 2B1GA 1JPXA 1S76D 2EIKC 2M6YA 4JYCA 4X8AA 3SYOA 1M56B 1AP6A 1D5AA 4H33A 2PF4E 5K1PA 1RSOA 2RMKB 4DR6O 4X66B 1VIBA 3E2EA 1AJPA 1AR1B 1PL0A 2B9ZA 3ZIAG 2ZM6O 5LYJB 3EHBB 1DK1A 1VQ6V 2VWJA 2GSMB 5BR8B 1ZWIC 4PJ0Z 4GKKO 1SQXH 1TVKA 1SETA 4J42A 4TUYB 4JI4B 2UU9O 1O9HA 3M8AA 3CRCA 2EZOA 1IBMB 4MT8A 4JTAB 1DLBA 4TSFG 4X1KB 1GKFA 5B1BC 1DGSA 1Q81W 2AXTZ 4D7SA 3N27A 3W7SA 3A8TA 1EN5A 4FM0A 1H2MA 2EIJB 5HFLA 4WFBV 3HKEB 3BRCA 2OIGA 1IBKB 4JI8B 3CHXA 2LQTA 3ZBHA 5LOVA 4DV2B 3FAVA 3HKDB 2Q67A 1CPYA 4D6TH 2GUZB 1KB9F 2DQ0A 4LF6O 4XBFA 2BSKB 1QR9A 1WB8A 4RUEA 4KP4A 5DECA 5H6QA 2Q7GA 3JARA 4I50B 2XHBA 4GYCB 3PJSK 5GW7A 2BTQB 1Y76B 5LMNO 3B77A 3H01A 1HP8A 1N34B 3G67A 3CCQV 2A79B 5AG2A 4DV5B 2QWNB 1GK9A 1OCCC 3ABTA 4WFHA 4DV0O 4GUNA 3OE7G 1U97A 3GWKC 1EBOA 3L71H 1JR9A 3ZCCA 3JD4A 4BW9A 4UCSA 5CA0A 4DR5O 2A9HA 4GKJB 5J9PC 4X20B 1XMOB 1MNGA 3JAWB 4FFBB 3QNEA 2JIZG 2W6IG 2Q0AA 1US6A 2CTWA 2ZIMA 1S3JA 4K0KB 3RYFA 4I0XA 1NTKH 1OCOB 4DK1A 4DR7O 3VQYA 2X0LA 1VQ5V 2UXBO 1HNXB 3JD2A 2IW5A 4X62O 4F6RA 3X2QC 2QSAA 4GX0A 2DN9A 4IHJA 2ILMA 3CMEV 4NR1A 4LFAO 3K5MA 3WFVA 3T2MA 1IZ3A 1OCRC 5KAIZ 1MABG 3OFNG 5L3DA 2D3OW 3E8GA 3SPCA 1GM7A 1Q7YW 1E1RG 3K03A 4D7TA 3A0BZ 3K3WA 2JS5A 3K5LA 4GX5A 5H6RA 1B06A 1Z5VA 2W0XA 1I94O 1YTFD 1R3KC 3L74H 3AG1B 3CP1A 3ASNB 1DF4A 4GX2A 3BPZA 3H1HH 4FLVA 5KA6A 3J7AU 1M57B 5LXTA 4MW8A 2YDEA 4TQFA 4BR6A 1BGYH 3UQ8A 2OT5A 1F7YA 2GTSA 2EINB 3OR6C 1EZJA 2PYJA 5LGTA 1N0JA 2D2CB 2Q7HA 3GWOA 5FLXN 4X1IB 1WN7A 3VQWA 4C7UA 2OYQA 4LF7B 2GV9A 4XDKA 3OGCC 3ZX6A 1KC8W 5B1OA 1XL4A 1SA0A 1QNMA 4DR6B 5IJ0B 1OCZB 2ZQMA 1L0LH 2YUAA 3SPHA 3BCCH 2KSDA 3QO7A 1S77D 2ZE8A 3MHSC 3UT5A 3CSXA 1P84F 2EILB 5KMGA 5KX5B 4GKKB 4PDMA 2UU9B 2JEUA 2IJKA 2Q5ZA 1G1XB 1NR1A 2E76B 4TV8A 4DR3B 1W2BU 2R9RB 2X7RB 2Q7EA 1AR4A 3NR7A 4ZBMA 1IURA 3A0HZ 4ZHQB 1R6NA 4EFEA 4O2BB 2QKCA 4K8XA 3SYCA 3MHHC 4JYYA 4GT1A 1GN3A 3HKBB 4O4HB 3J81N 2AZ2A 4ZI7B 3OTOO 1H2LA 1J5EO 4O4IB 1NVPB 2FB5A 3K9SA 1GRJA 4DV6O 2CH7A 1FPOA 3T4DA 4DV3O 1G4YB 1RP3B 3JASA 4LF6B 2V7QG 2EBOA 1BHAA 4J9YB 1M56C 2XAQA 1Q82W 1TGOA 4PHZA 1ZUQA 3ZHVA 3E8FA 1Q8IA 4B3RO 1OZ0A 2YEVB 5BMVB 1M9NA 3RT3C 3WU2Z 2UUAO 2E74B 2IJIA 3JSLA 3CCSV 2PI5A 4DRXA 3SPGA 3OGIB 3FYIB 2YXHA 1BMFG 1VF5B 2FTKA 3OR7C 4DV0B 1Q6IA 3OMAB 3H1JH 5BXZA 3K59A 2ODMA 3K58A 5LA6B 4UV9A 2XNDG 2BCCH 2UUCB 1K4DC 1BS3A 4DR5B 1UJWB 4L87A 4LFCO 4WFEA 2EIJC 2OTJV 4TV9B 5L3GA 4CH6A 4G28B 4UCVA 5JVDB 4JI2O 2UXDO 4KHPO 3ZMVA 3EVKA 1WB7A 2NR5A 2YI9A 1QCEA 3BHPA 2H3OA 4DR7B 4TT3G 1NI8A 4NXMO 2UXBB 4CH5A 4GX1A 4N23A 1Y6XA 4X62B 1OCCB 1YDXA 3RYIA 3ZMSA 3OEHG 4LC1A 4FLTA 4XDLA 4CC5A 4CZZA 1DTOA 4UFZA 2FMLA 5LBQA 3UO2A 3L72H 3LDCA 4B3MO 1VQLV 2HP8A 5J2TB 1QVFU 4FZ1A 2EZPA 3CCJV 2DW4A 1IBKO 4JI8O 1EFRG 4H44B 5IY5B 2ZKOA 1Y67A 4DV2O 2L35A 3IC7A 2JS3A 4DW1A 2JEXA 3K9AA 4WCEV 3UM7A 4X88A 3TJTA 3OD4A 4BIOA 4U7NA 2HFEC 1FFXB 4MTOA 3B4SA 3ZRVA 1SQBH 3RFRA 2WSSG 1LNQA 3TXQA 3G71V 2WLLA 1SQFA 4LF8O 3KG2A 4TWKA 4FVMA 2YXYA 1OCOC 5CBGA 4FFBA 2R9IA 4DV5O 3QTCA 1Q6UA 3G4SV 1SQVH 4NB5A 3CYOA 1VQKV 5JQGB 3CJHA 1G6UA 3SJBC 1OHHG 1TA8A 1ZLZA 4HBNA 2UXCO 2WLIA 1RPOA 3O9OA 1NVPD 2XUMA 2CTRA 3GB7C 3MDSA 1XREA 2KG7B 3ETQA 2XT9A 3HPLC 1ORQC 3LDEA 1F51A 4GKJO 1GO3F 5CMUA 5DN6G 5DEDA 4DXWA 1N8RW 5KHHA 4LH6A 1MZFA 3STZC 2X6BA 2QWPB 4K0KO 1MSWD 1H8EG 4LH7A 3AG1C 5F2VO 4R50A 4PA4A 2AHYA 1AVMA 3AK3A 3ASNC 1GM9A 2GTAA 5IJ9B 1M57C 2R72A 3CRQA 3OT7A 4HZ3A 3FFQA 4KFMA 2KQXA 2A3QA 1WPBA 3OTOB 1H2NA 2EINC 5IT9N 1ZSPA 4X64O 4YJ2A 3B8NA 1LUVA 4H37A 4DV3B 5GONA 4B08A 1QLNA 3K57A 1CEZA 1VQPV 2CE4A 3GVMA 3BAAA 2X6AA 2HEPA 3I56V 3F7YC 1FD9A 3G80A 3TK1A 4DR1O 5L3CA 2PYLA 4WF9V 1HNZB 1SQGA 3CEIA 4B3RB 1OCZC 1JFFB 1I7FA 5A9GA 3IJ4A 3CCLV 1YZBA 5CN0A 2LFSA 2UUAB 3B2EE 3THOA 5EYPA 2EILC 3D3QA 4X65B 1SERA 3JD3A 4LCUC 4PDLA 1YITV 4RO2A 1H2KA 3LSSA 3DXRA 4FIPC 3BEHA 3H9VA 3MAQA 4E4EA 1SRYA 3T1HB 1FXKB 3M7MX 4JASA 3ZRSA 1FJGB 2QM4A 3OTFA 4LF7O 5J2UA 2WPDG 5EBWC 4LFCB 1JX9A 3T4ZA 2JGDA 4LR3A 4MW3A 2EJRA 2DJVA 2IBZH 4O2BA 4JPRA 2C2AA 2Q68A 2E5LO 2ATKC 4E2LA 4JI2B 4KHPB 2UXDB 1SQPH 5JH7A 1R1BA 2IJJA 4FM1A 5EZYB 3ZHRA 4P9PA 1P49A 1NJIW 4NXMB 4J11A 3ZN1A 1WLEA 4HNAB 1GH6A 4QIWF 1EN6A 2HJDA 4DR3O 4U3JA 5JCOC 3JD0A 1VQ7V 1U96A 1W59A 2ETNA 4UVCA 2VQEO 2Y4TA 5LL6Y 4I4TB 4U3FH 1D5NA 4LWSA 1AI7A 4B3MB 4ZOLB 2XAFA 3QO5A 1GM8A 4G27B 4NXNO 1Q6HA 3N2KB 4CBCA 4HYOA 3A0RA 2EX3A 4I55A 5CB4B 3ZHQA 4Q6GA 2WLNA 4IIJB 5FNVB 3CXCU 5IDJA 3ZMZA 3W7UA 5LP6B 4YJ3A 1BL8A 3OW2U 4MVOA 3FYEB 2ZNJA 2LP7A 3JAKA 1K5QA 3APQA 3CCEV 2V1DA 4GZRB 4ASUG 1TUBB 1I08A 2ZIOA 3W7WA 4JZ2A 1TAEA 2Q0OC 4IT5A 1L0NH 4LF8B 1F4MA 1KP2A 3R65A 2LGQA 3ICXA 3T1YO 3CX5F 1HR0O 4HAMA 3SYQA 4QNHB 3BFRA 4UB6Z 2Y0IA 1AI6A 5B5EZ 3ZRWB 2UXCB 3ZHUA 4FPPA 3ETEA 1XI1A 3AG2B 2KB1A 2WLMA 4JI3O 2IU0A 3E35A 2CGNA 1R3IC 4JTDB 4W4LA 2UUCO 1S0VA 4EB6B 2ARHA 4OPHA 3EFFK 3U10A 2DWDC 3RYCB 3F5TA 5IWAO 4ICGA 4J7ZA 5IY5C 4J41A 1JJ2U 3FB7C 3FB6C 3JATB 3QG5A 3AG4B 1FAFA 2UXNA 1P7BA 4DO2A 1VQ8V 2N74A 1YSCA 3OUFA 1FS0G 1NR7A 1KKDA 2E3CA 1VP7A 3JALB 4Z1MG 1R3LC 5IYZA 1N0NA 2QKAA 4X64B 1RM1B 4MVUA 4GCZA 2PTMA 4JAVA 3ZHTA 1K92A 1YJWV 4R6ZA 1K7DA 1SQQH 3CC7V 1N4CA 1G8MA 1K73W 4O2AA 4PA7A 4OGQB 4DR1B 3H1IH 2DOSA 4YIPA 5H2FZ 4FJCC 3ZRXA 4LF5O 2QR4A 4MVRA 1X4TA 4O4LA 1PNMA 4MVZA 1JJOA 1BT8A 4AILC 4JI5O 4WFGA 1AI4A 4O4JB 4EEQA 5D5PA 5E1AC 3ML0A 1F4NA 4CS2A 1HWYA 3RYHB 4ZIBA 2WLHA 5CA1A 2ZXWB 4Z2WA 1WA8B 1P4RA 1ZX3A 4WBNB 3CCVV 1MA1A 1XEQA 1ZL8A 2B5UA 1RFYA 3AEIA 4UVBA 1B04A 2A0LA 1Y74A 3TETA 4JZGA 2RN9A 3FX7A 1K34A 3CXHF 3OUSA 4UCRA 3B8MA 4WFFA 1M93A 3JYCA 5LHIA 1XL6A 2P4KA 3EXAA 4KL1A 2P6JA 4B3TO 1SF9A 1MOFA 5BY1A 3ZEDA 2E5LB 1K9MW 4DV4O 4CS4A 3HKCA 5C93A 2YICA 1Z5WA 2QEXV 3E83A 2NN4A 3N2GA 1IX9A 2P22C 3S3XA 1IDSA 3CS5A 1SZXA 4YY3B 2VQEB 1YIJV 4LNUB 4TOIA 3U11A 3E22A 1FKAO 4DUZO 4X1YA 1GN4A 2A06H 4NXNB 5H5NA 2L6LA 4J7KA 5L3EA 4QPKA 2F43G 4A5UB 1M1KW 5C8YA 1FXKC 5KHKA 4RWUA 2ZDIC 5ITZA 5CBFA 1TVKB 3UO3A 3ZN0A 3HR0A 4PI0A 1HNZO 1MMMA 4QJFB 1K8AW 4JI7O 4UCTA 4EFBA 1WPXA 2Y69B 1S5JA 3JCZA 2RCVA 3LUTB 1M4UA 4X65O 4B7EA 3T1YB 1KKCA 1HR0B 2QWOB 2H8PC 5LYJA 4BAYA 3CCUV 1NH2B 4RAIA 3ETDA 3DC6A 3WB0A 1Q86W 3WB1A 1XILA 3AG3B 5L3BA 4TUYA 2EIMB 1YHQV 1JQ0A 2HKOA 3T1HO 4K8ZA 2RQ6A 3D36C 4JI3B 3K0GA 2DYSB 1FXVA 1PV0A 3C3SA 5LOVB 4H13B 1FJGO 2W0FC 1AR5A 4X1KA 2ZT9B 4Z1VA 3G6BA 4I4TA 1ENVA 3ASOB 1JA8A 5IWAB 3JARB 1VQMV 2QTOA 4UB8Z 3HKEA 5LP6C 1YJNV 2B1IA 4CS3A 5KA5A 5KHJA 2JVDA 1BQ0A 3HKDA 3BVOA 2GUZA 1T5EA 2VQFO 1NTMH 2BSKA 4QE7A 1JMKC 3K0DA 3H1LH 3E89A 4I50A 1K97A 1ROPA 2BTQA 2F95B 5FPRA 1Y76A 2ZE5A 4J80A 1GMGA 4NVPA 5CA0B 3CC4V 1VQNV 4LF5B 3G6EV 1EM1A 2JRIA 1SZTA 4NKGB 2IJHA 3IFXA 3IAYA 4JV5O 4UV8A 1XHZA 5E79Z 4JI5B 2HVKC 1M5IA 2VS0A 3AG2C 2QGNA 2ZR3A 5TISZ 5KHGA 3OAAG 2WAMA 3RYFB 2HLDG 4I0XB 5EBMC 2N04A 2JGUA 1XDCA 2CAZC 1SS3A 4F6RB 1BSMA 4IHJB 4YHHB 2Y0PA 3ZHSA 3KCXA 4EB6A 4X20A 4PA9A 3JAWA 1VF6C 1XUQA 1R6KA 1XNRB 2WA4A 3AG4C 1N36B 2XOKG 4BW5A 4DUYO 3FB8C 2RDCA 1TUEB 3M99B 4NTXA 4B3TB 1NT2B 2K1EA 3U0ZA 2HVJC 1PKXA 1X59A 1RM1C 4DK0A 3SGIA 4DV4B 4LFBB 1L1FA 3JALA 2R70A 4K35A 4IYHA 1AJNA 1V9PA 3TCUA 5IE9A 5LXTB 1VARA 5LMUO 3SDLA 2E75B 2VWKA 2EULA 1YCIA 4F6EA 4AHCA 1XNQO 4UCUA 1BQZA 2BOBC 1R6TA 1NBMG 4YXWG 1E1QG 4MSWC 1M90W 4DUZB 4FFKA 1PD3A 2ZXWC 3D8CA 1QU7A 3TGUH 1SKVA 1H2SB 1K4CC 1VF7A 1KU9A 1NH2D 3CD6V 1SA0B 4LP8A 2EJ7A 3FD9A 4RQEA 5IYDO 1I5XA 4NTYA 3JAMN 3MD0A 3RVYA 3CE2A 3UT5B 1W0KG 2LJ2A 5KMGB 2LFRA 2PI4A 2YS8A 4N21A 4X1IA 4NYKA 2KKWA 2ZD9A 2XAJA 4PI2A 4DV7O 4U7OA 4TV8B 4JI7B 2JDIG 4FM2A 3A2FA 4BIZA 3ZS8C 3S3WA 1GAXA 1B6QA 1D2DA 3ZMTA 4AI8A 1QHTA 1F23A 1QQCA 1GN2A 2F23A 5IJ0A 1YJ9V 4RUFA 5BZBA 4QGPA 1Q3EA 2NNUA 2Y48A 5KX5A 2Q69A 2OIEA 2FYUH 5JJEB 2AZ0A 1NU1H 4PDVA 3F5WC 1I5YA 2BE3A 1NKDA 5EC1C 2CH7B 5KUKA 1HDJA 4X89A 5LHGA 4BIUA 1XMQB 3LNMB 3WB2A 3JASB 1QLEB 1H2GA 4ZHQA 4OPAA 4PDRA 4MVMA 4W4KA 4J10A 4LF4O 4DR2O 1YEWA 4FLYA 4LBEC 1L8DA 3ABLB 3HKBA 4O4HA 2Q73A 4JGSA 3K06A 4ZI7A 3L75H 1BE3H 4OX9B 4O4IA 2WA3A 1AI5A 3W7XA 3E8HA 3LNNA 1YTFB 2DMXA 1MZEA 1NZ6A 1EZVH 2HHHB 4DRXB 4PELA 4IYIA 2CUGA 5B66Z 1S5LZ 2VQFB 4YY3O 2YSUB 3T1CA 2Y69C 1K5SA 1PNLA 5JCOA 2OWOA 1BZKA 2PZSA 1Z2GA 4DYLA 3L70H 2YEVA 5BMVA 4TQDA 5FL7G 3APOA 1SESA 2UUBB 4CC6A 1FXHA 3OMNB 1Q90D 5LHHA 5H9CA 4P9OA 2DWEC 2P4VA 3AG3C 3AK2A 4JV5B 3VBBA 2EIMC 3C3TA 2YI8A 3CCRV 4JI0O 3TXSA 2DYSC 3CWBH 1OJHA 4CH4A 4MVSA 2M7WA 5LA6A 3SJQC 1KD1W 5GTHZ 5IYCO 1UPGA 3RYIB 3QVNA 3ASOC 2QE7G 2QTSA 3OEEG 3I55V 4LF9O 2Z5UA 2FL4A 4TV9A 2ADQB 4FZ0A 1S5HC 2P90A 5JVDA 1P7GA 1KMIZ 3QO8A 2DYRB 1XQ8A 3RW0A 2Q4PA 4DUYB 4DV1O 2ITDC 1V54B 1KYOF 2YIAA 1R3JC 1IBLO 4I9QA 1V55B 2Z0AA 4JI1O 1H8HG 3NXSA 4JAAA 4JYAO 2Z3YA 5KHIA 3UKMA 2O57A 2XTAA 5LMUB 1K3EA 3C90A 5J2TA 3E8BA 3ABKB 1XNQB 2WLLB 2ZNIA 1N33O 3K79A 1VEWA 2OCCB 5EK0A 4R7CA 1QVGU 3KZIZ 5JJJB 1KP3A 3DGEA 2P7TC 3W7TA 3WG7B 2DE0X 3BY6A 5LGUA 1WP7A 5GTIZ 2G38A 3CJHB 3SPIA 1FFXA 3L9DA 2N05A 3FB5C 1CXZB 2GHYA 2WLIB 1JCHA 4MVQA 2F1MA 4UVAA 1S72V 1HNWB 4JF3A 1KQSU 4DV7B 2YC0A 3AK1A 5B3SB 4I9WA 4X9QA 4JI6B 2ZINA 5JQGA 2VRZA 2XAHA 3SPJA 1Q5OA 2PUSA 5FPOA 1THZA 1PNKA 4FLXA 4IL6Z 1QBZA 2AHZA 2KG7A 3R66A 4YHHO 1KECA 3KCYA 4WFAV 1N32O 1YF2A 3STLC 3Q4HB 1WP8A 3RN4A 4BWAA 4NTWA 4L8JA 2IU3A 5KUMA 1XNRO 4YJ2B 4DR4B 5GONB 1N36O 4MTFA 4JTCB 4ABMA 4I5SA 3PN1A 3OM3B 2RJZA 1RPRA 4AQYO 4LF4B 3VQXA 1VQ9V 5IJ9A 4DR2B 5B1NA 1GN6A 1BCCH 4QPJA 4LFBO 3P3PA 5EBLC 1E79G 1FFTB 2CDYA 5B1AB 2F4VO 4PV1B 3RVZA 2XASA 5EYPB 2OTLV 2GDSA 2ZM6B 4PA3A 1K33A 1XOUA 4FK5C 2XAGA 4JAUA 2PY5A 1WJZA 1OV9A 3DXRB 4RQFA 1H38A 4PA6A 1JOYA 3ABMB 1JFFA 2CK3G 4F4LA 1HW7A 5J2UB 4J7JA 1Q43A 4UUJC 2EIKB 1RSOB 2JGDB 1FYJA 1UFIA 2P5OA 3BA8A 3K08A 2YIDA 3JCUZ 3CB2A 3DTUB 4JI0B 2A7WA 5JH7B 3P30A 1I0HA 4FMTA 2NLJC 3BABA 1VQOV 1QLEC 1FXKA 1A32A 2F66C 2ZDIA 2QM7A 2JJ1G 4YIOA 4U3JB 1IXMA 3RBZA 4LF9B 4B3SO 3ABLC 5DM6V 1R73A 5JWPA 4DW0A 3FKSG 1PM9A 1JVMA 3SYPA 1MG1A 4LWSB 3CC2V 5B1BB 4Q20A 5EZYA 1ZTEA 2QM8A 2YIBD 2P67A 5LMNB 1MSDA 1CP9A 1AP5A 4DV1B 1NQTA 2WLKA 2LW1A 4HNAA 2W6JG 3RGBA 4I55B 1IBLB 1AROP 2X6CA 3IC9A 3FAVB 1WNSA 1KBHA 3ABUA 4JI1B 1XMQO 4EKWA 3P3NA 4YJ3B 5CA3A 3UCSC 3D36A 4GLXA 4JYAB 3DSQA 4QE9A 2ZR2A 2H94A 3JAKB 3CRMA 4CH3A 4ZOLA 3O65A 3CMAV 3N2KA 3B40A 2ZCEA 5LGNA 2QWQB 5JJNB 4MTXA 1N33B 4ZKIA 3SYAA 3F7VC 4OX9O 3CRAA 1BHBA 1NTZH 5CB4A 4X66O 5L3FA 4IIJA 5FNVA 2HHHO 5LP6A 3LSQA 4MS2A 5BR8O 1Y4MA 2LO1A 2P06A 2IH1C 3SJCC 3VQVA 3LDDA 4JI4O 1PPJH 2IM9A 1XBLA 3AG7A 1TUBA 1IBMO
chains in the Genus database with same CATH topology
4X65O 2UU9O 3M8AA 4LFCO 2UXCO 2UUBO 1D2DA 4LF7O 1HNXO 1G1XB 1NS1A 4DR7O 4JI2O 2UXDO 4KHPO 4JI3O 2DJVA 1HNWO 2UXBO 1A32A 4GKJO 2UUCO 4LF9O 4X62O 3T1HO 2E5LO 4NXMO 1R1BA 4OPHA 4B3TO 4LFAO 1FJGO 4B3SO 5BY1A 3R66A 4YHHO 4K0KO 4DUYO 3F5TA 1N32O 4JI6O 4DV4O 1AILA 5IWAO 1X59A 4DR3O 1KUQA 4DV1O 1XNRO 3J81N 2FKXA 4OPAA 3OTOO 1N36O 1J5EO 1IBMO 2VQEO 1IBLO 4DV6O 4B3MO 4LF6O 4LF4O 2Z0AA 4JI1O 5LL6Y 2N74A 4DR2O 5IT9N 4DV3O 5LMUO 3SDLA 1I94O 4X64O 4AQYO 4JYAO 4NXNO 1XMQO 1N34O 1IBKO 4JI8O 1FKAO 1XNQO 4DUZO 4LFBO 4DR4O 2ZKOA 1R6TA 4DV2O 5LMNO 2VQFO 3J7AU 2F4VO 4B3RO 4DR1O 5A2QN 1N33O 2AGAA 5H5NA 3O65A 3RT3C 4YY3O 1F7YA 2UUAO 2DOSA 4LF5O 5FLXN 4A5UB 1YZBA 3J80N 4OX9O 4DV0O 4X66O 3JAMN 4JI5O 2HHHO 1AB3A 2JRIA 4LF8O 4JV5O 4DR6O 5BR8O 1HNZO 5BXZA 2ZM6O 4DV5O 1DK1A 1XMOO 4JI7O 4DR5O 4JI4O 3T1YO 2LW7A 4JI0O 1HR0O 4DV7O 1FYJA 1XEQA 4GKKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 O;  2UU9 O;  3M8A A;  4LFC O;  2UXC O;  2UUB O;  1D2D A;  4LF7 O;  1HNX O;  1G1X B;  1NS1 A;  4DR7 O;  4JI2 O;  2UXD O;  4KHP O;  4JI3 O;  2DJV A;  1HNW O;  2UXB O;  1A32 A;  4GKJ O;  2UUC O;  4LF9 O;  4X62 O;  3T1H O;  2E5L O;  4NXM O;  1R1B A;  4OPH A;  4B3T O;  4LFA O;  1FJG O;  4B3S O;  5BY1 A;  3R66 A;  4YHH O;  4K0K O;  4DUY O;  3F5T A;  1N32 O;  4JI6 O;  4DV4 O;  1AIL A;  5IWA O;  1X59 A;  4DR3 O;  1KUQ A;  4DV1 O;  1XNR O;  3J81 N;  2FKX A;  4OPA A;  3OTO O;  1N36 O;  1J5E O;  1IBM O;  2VQE O;  1IBL O;  4DV6 O;  4B3M O;  4LF6 O;  4LF4 O;  2Z0A A;  4JI1 O;  5LL6 Y;  2N74 A;  4DR2 O;  5IT9 N;  4DV3 O;  5LMU O;  3SDL A;  1I94 O;  4X64 O;  4AQY O;  4JYA O;  4NXN O;  1XMQ O;  1N34 O;  1IBK O;  4JI8 O;  1FKA O;  1XNQ O;  4DUZ O;  4LFB O;  4DR4 O;  2ZKO A;  1R6T A;  4DV2 O;  5LMN O;  2VQF O;  3J7A U;  2F4V O;  4B3R O;  4DR1 O;  5A2Q N;  1N33 O;  2AGA A;  5H5N A;  3O65 A;  3RT3 C;  4YY3 O;  1F7Y A;  2UUA O;  2DOS A;  4LF5 O;  5FLX N;  4A5U B;  1YZB A;  3J80 N;  4OX9 O;  4DV0 O;  4X66 O;  3JAM N;  4JI5 O;  2HHH O;  1AB3 A;  2JRI A;  4LF8 O;  4JV5 O;  4DR6 O;  5BR8 O;  1HNZ O;  5BXZ A;  2ZM6 O;  4DV5 O;  1DK1 A;  1XMO O;  4JI7 O;  4DR5 O;  4JI4 O;  3T1Y O;  2LW7 A;  4JI0 O;  1HR0 O;  4DV7 O;  1FYJ A;  1XEQ A;  4GKK O; 
#chains in the Genus database with same CATH topology
 5IYB O;  3VOU A;  2PGG A;  2OCH A;  4FLZ A;  4LFA B;  2UUB O;  2ADP A;  2BOC C;  5EC2 C;  1WAZ A;  2DYR C;  3D3I A;  3JSN A;  3CRR A;  1V54 C;  1IXB A;  5KLV H;  1V55 C;  2F93 B;  3RWR D;  1QR8 A;  4UXN A;  3ZRW A;  1B3Q A;  2V4D A;  1COW G;  2BTO A;  1AIL A;  3BA9 A;  1I94 B;  1XHX A;  2ITC C;  1KUQ A;  2RNB A;  5EIB D;  1N32 B;  2YXL A;  3ABK C;  2FKX A;  5IYZ B;  1DF5 A;  5D5Q A;  3X2Q B;  4KUM A;  2JJ2 G;  2OCC C;  1PP9 H;  4UCO A;  3RYC A;  1EN4 A;  1VMG A;  1VF6 A;  1J95 A;  1OCR B;  4O2A B;  2QA4 V;  2MW2 B;  1N34 O;  3DC5 A;  3JD1 A;  3WG7 C;  3JAT A;  4AQY B;  2WWW A;  1GTO A;  4O4L B;  2YIB A;  2AGA A;  2QWR B;  1SC5 B;  2F4V B;  3E86 A;  2R9A A;  2IH3 C;  5CA1 B;  3J80 N;  4FLU A;  3ETG A;  3CPW U;  4J9Z B;  2MK3 A;  2DQ3 A;  1AB3 A;  2ZE7 A;  1ZL8 B;  2GBO A;  5B3S C;  1PL4 A;  2CTQ A;  3SJA C;  2QJ1 A;  3B09 A;  1Y74 B;  2HJF C;  2Q9L A;  1YXB A;  4JYB A;  1XMO O;  1W0J G;  3QF7 A;  3LSU A;  1YVW A;  4XDJ A;  2LW7 A;  2Q8V A;  4FLW A;  4O4J A;  2HR3 A;  1ZAU A;  3L73 H;  2AW9 A;  1URF A;  4I7Z B;  3RYH A;  3H1K H;  4OXS A;  4R8C A;  1LR1 A;  1WA8 A;  2K9P A;  1HNX O;  4WBN A;  2Q6A A;  4G2K A;  1NS1 A;  4KXR A;  4IGG A;  1HNW O;  3P32 A;  3K5N A;  3ZMU A;  3HKC B;  2CGO A;  3I5D A;  3Q4H A;  2LGW A;  1J5E B;  3ZJZ A;  5CBH A;  1O9G A;  4DV6 B;  4H0L B;  1Y66 A;  3N2G B;  1IVS A;  4P2Z A;  2QDO A;  1LUW A;  4JI6 O;  4B3S B;  2JK5 C;  2QKS A;  4P30 A;  3IGA C;  4K3A A;  5HFM A;  3OMI B;  1VQ4 V;  3E22 B;  3K5O A;  5B1A C;  3K04 A;  4X1Y B;  5EIB C;  2ZE6 A;  2Y4U A;  2CTP A;  3HB3 B;  2WLJ A;  1YI2 V;  3KKY A;  2HG5 C;  4DR4 O;  4B7K A;  5KAF Z;  4PD4 F;  4MTG A;  5C8Y B;  3SR2 C;  2UXX A;  3ABM C;  1AJQ A;  5K1X A;  4LNU A;  5ITZ B;  5A2Q N;  3CCM V;  2B1G A;  1JPX A;  1S76 D;  2EIK C;  2M6Y A;  4JYC A;  4X8A A;  3SYO A;  1M56 B;  1AP6 A;  1D5A A;  4H33 A;  2PF4 E;  5K1P A;  1RSO A;  2RMK B;  4DR6 O;  4X66 B;  1VIB A;  3E2E A;  1AJP A;  1AR1 B;  1PL0 A;  2B9Z A;  3ZIA G;  2ZM6 O;  5LYJ B;  3EHB B;  1DK1 A;  1VQ6 V;  2VWJ A;  2GSM B;  5BR8 B;  1ZWI C;  4PJ0 Z;  4GKK O;  1SQX H;  1TVK A;  1SET A;  4J42 A;  4TUY B;  4JI4 B;  2UU9 O;  1O9H A;  3M8A A;  3CRC A;  2EZO A;  1IBM B;  4MT8 A;  4JTA B;  1DLB A;  4TSF G;  4X1K B;  1GKF A;  5B1B C;  1DGS A;  1Q81 W;  2AXT Z;  4D7S A;  3N27 A;  3W7S A;  3A8T A;  1EN5 A;  4FM0 A;  1H2M A;  2EIJ B;  5HFL A;  4WFB V;  3HKE B;  3BRC A;  2OIG A;  1IBK B;  4JI8 B;  3CHX A;  2LQT A;  3ZBH A;  5LOV A;  4DV2 B;  3FAV A;  3HKD B;  2Q67 A;  1CPY A;  4D6T H;  2GUZ B;  1KB9 F;  2DQ0 A;  4LF6 O;  4XBF A;  2BSK B;  1QR9 A;  1WB8 A;  4RUE A;  4KP4 A;  5DEC A;  5H6Q A;  2Q7G A;  3JAR A;  4I50 B;  2XHB A;  4GYC B;  3PJS K;  5GW7 A;  2BTQ B;  1Y76 B;  5LMN O;  3B77 A;  3H01 A;  1HP8 A;  1N34 B;  3G67 A;  3CCQ V;  2A79 B;  5AG2 A;  4DV5 B;  2QWN B;  1GK9 A;  1OCC C;  3ABT A;  4WFH A;  4DV0 O;  4GUN A;  3OE7 G;  1U97 A;  3GWK C;  1EBO A;  3L71 H;  1JR9 A;  3ZCC A;  3JD4 A;  4BW9 A;  4UCS A;  5CA0 A;  4DR5 O;  2A9H A;  4GKJ B;  5J9P C;  4X20 B;  1XMO B;  1MNG A;  3JAW B;  4FFB B;  3QNE A;  2JIZ G;  2W6I G;  2Q0A A;  1US6 A;  2CTW A;  2ZIM A;  1S3J A;  4K0K B;  3RYF A;  4I0X A;  1NTK H;  1OCO B;  4DK1 A;  4DR7 O;  3VQY A;  2X0L A;  1VQ5 V;  2UXB O;  1HNX B;  3JD2 A;  2IW5 A;  4X62 O;  4F6R A;  3X2Q C;  2QSA A;  4GX0 A;  2DN9 A;  4IHJ A;  2ILM A;  3CME V;  4NR1 A;  4LFA O;  3K5M A;  3WFV A;  3T2M A;  1IZ3 A;  1OCR C;  5KAI Z;  1MAB G;  3OFN G;  5L3D A;  2D3O W;  3E8G A;  3SPC A;  1GM7 A;  1Q7Y W;  1E1R G;  3K03 A;  4D7T A;  3A0B Z;  3K3W A;  2JS5 A;  3K5L A;  4GX5 A;  5H6R A;  1B06 A;  1Z5V A;  2W0X A;  1I94 O;  1YTF D;  1R3K C;  3L74 H;  3AG1 B;  3CP1 A;  3ASN B;  1DF4 A;  4GX2 A;  3BPZ A;  3H1H H;  4FLV A;  5KA6 A;  3J7A U;  1M57 B;  5LXT A;  4MW8 A;  2YDE A;  4TQF A;  4BR6 A;  1BGY H;  3UQ8 A;  2OT5 A;  1F7Y A;  2GTS A;  2EIN B;  3OR6 C;  1EZJ A;  2PYJ A;  5LGT A;  1N0J A;  2D2C B;  2Q7H A;  3GWO A;  5FLX N;  4X1I B;  1WN7 A;  3VQW A;  4C7U A;  2OYQ A;  4LF7 B;  2GV9 A;  4XDK A;  3OGC C;  3ZX6 A;  1KC8 W;  5B1O A;  1XL4 A;  1SA0 A;  1QNM A;  4DR6 B;  5IJ0 B;  1OCZ B;  2ZQM A;  1L0L H;  2YUA A;  3SPH A;  3BCC H;  2KSD A;  3QO7 A;  1S77 D;  2ZE8 A;  3MHS C;  3UT5 A;  3CSX A;  1P84 F;  2EIL B;  5KMG A;  5KX5 B;  4GKK B;  4PDM A;  2UU9 B;  2JEU A;  2IJK A;  2Q5Z A;  1G1X B;  1NR1 A;  2E76 B;  4TV8 A;  4DR3 B;  1W2B U;  2R9R B;  2X7R B;  2Q7E A;  1AR4 A;  3NR7 A;  4ZBM A;  1IUR A;  3A0H Z;  4ZHQ B;  1R6N A;  4EFE A;  4O2B B;  2QKC A;  4K8X A;  3SYC A;  3MHH C;  4JYY A;  4GT1 A;  1GN3 A;  3HKB B;  4O4H B;  3J81 N;  2AZ2 A;  4ZI7 B;  3OTO O;  1H2L A;  1J5E O;  4O4I B;  1NVP B;  2FB5 A;  3K9S A;  1GRJ A;  4DV6 O;  2CH7 A;  1FPO A;  3T4D A;  4DV3 O;  1G4Y B;  1RP3 B;  3JAS A;  4LF6 B;  2V7Q G;  2EBO A;  1BHA A;  4J9Y B;  1M56 C;  2XAQ A;  1Q82 W;  1TGO A;  4PHZ A;  1ZUQ A;  3ZHV A;  3E8F A;  1Q8I A;  4B3R O;  1OZ0 A;  2YEV B;  5BMV B;  1M9N A;  3RT3 C;  3WU2 Z;  2UUA O;  2E74 B;  2IJI A;  3JSL A;  3CCS V;  2PI5 A;  4DRX A;  3SPG A;  3OGI B;  3FYI B;  2YXH A;  1BMF G;  1VF5 B;  2FTK A;  3OR7 C;  4DV0 B;  1Q6I A;  3OMA B;  3H1J H;  5BXZ A;  3K59 A;  2ODM A;  3K58 A;  5LA6 B;  4UV9 A;  2XND G;  2BCC H;  2UUC B;  1K4D C;  1BS3 A;  4DR5 B;  1UJW B;  4L87 A;  4LFC O;  4WFE A;  2EIJ C;  2OTJ V;  4TV9 B;  5L3G A;  4CH6 A;  4G28 B;  4UCV A;  5JVD B;  4JI2 O;  2UXD O;  4KHP O;  3ZMV A;  3EVK A;  1WB7 A;  2NR5 A;  2YI9 A;  1QCE A;  3BHP A;  2H3O A;  4DR7 B;  4TT3 G;  1NI8 A;  4NXM O;  2UXB B;  4CH5 A;  4GX1 A;  4N23 A;  1Y6X A;  4X62 B;  1OCC B;  1YDX A;  3RYI A;  3ZMS A;  3OEH G;  4LC1 A;  4FLT A;  4XDL A;  4CC5 A;  4CZZ A;  1DTO A;  4UFZ A;  2FML A;  5LBQ A;  3UO2 A;  3L72 H;  3LDC A;  4B3M O;  1VQL V;  2HP8 A;  5J2T B;  1QVF U;  4FZ1 A;  2EZP A;  3CCJ V;  2DW4 A;  1IBK O;  4JI8 O;  1EFR G;  4H44 B;  5IY5 B;  2ZKO A;  1Y67 A;  4DV2 O;  2L35 A;  3IC7 A;  2JS3 A;  4DW1 A;  2JEX A;  3K9A A;  4WCE V;  3UM7 A;  4X88 A;  3TJT A;  3OD4 A;  4BIO A;  4U7N A;  2HFE C;  1FFX B;  4MTO A;  3B4S A;  3ZRV A;  1SQB H;  3RFR A;  2WSS G;  1LNQ A;  3TXQ A;  3G71 V;  2WLL A;  1SQF A;  4LF8 O;  3KG2 A;  4TWK A;  4FVM A;  2YXY A;  1OCO C;  5CBG A;  4FFB A;  2R9I A;  4DV5 O;  3QTC A;  1Q6U A;  3G4S V;  1SQV H;  4NB5 A;  3CYO A;  1VQK V;  5JQG B;  3CJH A;  1G6U A;  3SJB C;  1OHH G;  1TA8 A;  1ZLZ A;  4HBN A;  2UXC O;  2WLI A;  1RPO A;  3O9O A;  1NVP D;  2XUM A;  2CTR A;  3GB7 C;  3MDS A;  1XRE A;  2KG7 B;  3ETQ A;  2XT9 A;  3HPL C;  1ORQ C;  3LDE A;  1F51 A;  4GKJ O;  1GO3 F;  5CMU A;  5DN6 G;  5DED A;  4DXW A;  1N8R W;  5KHH A;  4LH6 A;  1MZF A;  3STZ C;  2X6B A;  2QWP B;  4K0K O;  1MSW D;  1H8E G;  4LH7 A;  3AG1 C;  5F2V O;  4R50 A;  4PA4 A;  2AHY A;  1AVM A;  3AK3 A;  3ASN C;  1GM9 A;  2GTA A;  5IJ9 B;  1M57 C;  2R72 A;  3CRQ A;  3OT7 A;  4HZ3 A;  3FFQ A;  4KFM A;  2KQX A;  2A3Q A;  1WPB A;  3OTO B;  1H2N A;  2EIN C;  5IT9 N;  1ZSP A;  4X64 O;  4YJ2 A;  3B8N A;  1LUV A;  4H37 A;  4DV3 B;  5GON A;  4B08 A;  1QLN A;  3K57 A;  1CEZ A;  1VQP V;  2CE4 A;  3GVM A;  3BAA A;  2X6A A;  2HEP A;  3I56 V;  3F7Y C;  1FD9 A;  3G80 A;  3TK1 A;  4DR1 O;  5L3C A;  2PYL A;  4WF9 V;  1HNZ B;  1SQG A;  3CEI A;  4B3R B;  1OCZ C;  1JFF B;  1I7F A;  5A9G A;  3IJ4 A;  3CCL V;  1YZB A;  5CN0 A;  2LFS A;  2UUA B;  3B2E E;  3THO A;  5EYP A;  2EIL C;  3D3Q A;  4X65 B;  1SER A;  3JD3 A;  4LCU C;  4PDL A;  1YIT V;  4RO2 A;  1H2K A;  3LSS A;  3DXR A;  4FIP C;  3BEH A;  3H9V A;  3MAQ A;  4E4E A;  1SRY A;  3T1H B;  1FXK B;  3M7M X;  4JAS A;  3ZRS A;  1FJG B;  2QM4 A;  3OTF A;  4LF7 O;  5J2U A;  2WPD G;  5EBW C;  4LFC B;  1JX9 A;  3T4Z A;  2JGD A;  4LR3 A;  4MW3 A;  2EJR A;  2DJV A;  2IBZ H;  4O2B A;  4JPR A;  2C2A A;  2Q68 A;  2E5L O;  2ATK C;  4E2L A;  4JI2 B;  4KHP B;  2UXD B;  1SQP H;  5JH7 A;  1R1B A;  2IJJ A;  4FM1 A;  5EZY B;  3ZHR A;  4P9P A;  1P49 A;  1NJI W;  4NXM B;  4J11 A;  3ZN1 A;  1WLE A;  4HNA B;  1GH6 A;  4QIW F;  1EN6 A;  2HJD A;  4DR3 O;  4U3J A;  5JCO C;  3JD0 A;  1VQ7 V;  1U96 A;  1W59 A;  2ETN A;  4UVC A;  2VQE O;  2Y4T A;  5LL6 Y;  4I4T B;  4U3F H;  1D5N A;  4LWS A;  1AI7 A;  4B3M B;  4ZOL B;  2XAF A;  3QO5 A;  1GM8 A;  4G27 B;  4NXN O;  1Q6H A;  3N2K B;  4CBC A;  4HYO A;  3A0R A;  2EX3 A;  4I55 A;  5CB4 B;  3ZHQ A;  4Q6G A;  2WLN A;  4IIJ B;  5FNV B;  3CXC U;  5IDJ A;  3ZMZ A;  3W7U A;  5LP6 B;  4YJ3 A;  1BL8 A;  3OW2 U;  4MVO A;  3FYE B;  2ZNJ A;  2LP7 A;  3JAK A;  1K5Q A;  3APQ A;  3CCE V;  2V1D A;  4GZR B;  4ASU G;  1TUB B;  1I08 A;  2ZIO A;  3W7W A;  4JZ2 A;  1TAE A;  2Q0O C;  4IT5 A;  1L0N H;  4LF8 B;  1F4M A;  1KP2 A;  3R65 A;  2LGQ A;  3ICX A;  3T1Y O;  3CX5 F;  1HR0 O;  4HAM A;  3SYQ A;  4QNH B;  3BFR A;  4UB6 Z;  2Y0I A;  1AI6 A;  5B5E Z;  3ZRW B;  2UXC B;  3ZHU A;  4FPP A;  3ETE A;  1XI1 A;  3AG2 B;  2KB1 A;  2WLM A;  4JI3 O;  2IU0 A;  3E35 A;  2CGN A;  1R3I C;  4JTD B;  4W4L A;  2UUC O;  1S0V A;  4EB6 B;  2ARH A;  4OPH A;  3EFF K;  3U10 A;  2DWD C;  3RYC B;  3F5T A;  5IWA O;  4ICG A;  4J7Z A;  5IY5 C;  4J41 A;  1JJ2 U;  3FB7 C;  3FB6 C;  3JAT B;  3QG5 A;  3AG4 B;  1FAF A;  2UXN A;  1P7B A;  4DO2 A;  1VQ8 V;  2N74 A;  1YSC A;  3OUF A;  1FS0 G;  1NR7 A;  1KKD A;  2E3C A;  1VP7 A;  3JAL B;  4Z1M G;  1R3L C;  5IYZ A;  1N0N A;  2QKA A;  4X64 B;  1RM1 B;  4MVU A;  4GCZ A;  2PTM A;  4JAV A;  3ZHT A;  1K92 A;  1YJW V;  4R6Z A;  1K7D A;  1SQQ H;  3CC7 V;  1N4C A;  1G8M A;  1K73 W;  4O2A A;  4PA7 A;  4OGQ B;  4DR1 B;  3H1I H;  2DOS A;  4YIP A;  5H2F Z;  4FJC C;  3ZRX A;  4LF5 O;  2QR4 A;  4MVR A;  1X4T A;  4O4L A;  1PNM A;  4MVZ A;  1JJO A;  1BT8 A;  4AIL C;  4JI5 O;  4WFG A;  1AI4 A;  4O4J B;  4EEQ A;  5D5P A;  5E1A C;  3ML0 A;  1F4N A;  4CS2 A;  1HWY A;  3RYH B;  4ZIB A;  2WLH A;  5CA1 A;  2ZXW B;  4Z2W A;  1WA8 B;  1P4R A;  1ZX3 A;  4WBN B;  3CCV V;  1MA1 A;  1XEQ A;  1ZL8 A;  2B5U A;  1RFY A;  3AEI A;  4UVB A;  1B04 A;  2A0L A;  1Y74 A;  3TET A;  4JZG A;  2RN9 A;  3FX7 A;  1K34 A;  3CXH F;  3OUS A;  4UCR A;  3B8M A;  4WFF A;  1M93 A;  3JYC A;  5LHI A;  1XL6 A;  2P4K A;  3EXA A;  4KL1 A;  2P6J A;  4B3T O;  1SF9 A;  1MOF A;  5BY1 A;  3ZED A;  2E5L B;  1K9M W;  4DV4 O;  4CS4 A;  3HKC A;  5C93 A;  2YIC A;  1Z5W A;  2QEX V;  3E83 A;  2NN4 A;  3N2G A;  1IX9 A;  2P22 C;  3S3X A;  1IDS A;  3CS5 A;  1SZX A;  4YY3 B;  2VQE B;  1YIJ V;  4LNU B;  4TOI A;  3U11 A;  3E22 A;  1FKA O;  4DUZ O;  4X1Y A;  1GN4 A;  2A06 H;  4NXN B;  5H5N A;  2L6L A;  4J7K A;  5L3E A;  4QPK A;  2F43 G;  4A5U B;  1M1K W;  5C8Y A;  1FXK C;  5KHK A;  4RWU A;  2ZDI C;  5ITZ A;  5CBF A;  1TVK B;  3UO3 A;  3ZN0 A;  3HR0 A;  4PI0 A;  1HNZ O;  1MMM A;  4QJF B;  1K8A W;  4JI7 O;  4UCT A;  4EFB A;  1WPX A;  2Y69 B;  1S5J A;  3JCZ A;  2RCV A;  3LUT B;  1M4U A;  4X65 O;  4B7E A;  3T1Y B;  1KKC A;  1HR0 B;  2QWO B;  2H8P C;  5LYJ A;  4BAY A;  3CCU V;  1NH2 B;  4RAI A;  3ETD A;  3DC6 A;  3WB0 A;  1Q86 W;  3WB1 A;  1XIL A;  3AG3 B;  5L3B A;  4TUY A;  2EIM B;  1YHQ V;  1JQ0 A;  2HKO A;  3T1H O;  4K8Z A;  2RQ6 A;  3D36 C;  4JI3 B;  3K0G A;  2DYS B;  1FXV A;  1PV0 A;  3C3S A;  5LOV B;  4H13 B;  1FJG O;  2W0F C;  1AR5 A;  4X1K A;  2ZT9 B;  4Z1V A;  3G6B A;  4I4T A;  1ENV A;  3ASO B;  1JA8 A;  5IWA B;  3JAR B;  1VQM V;  2QTO A;  4UB8 Z;  3HKE A;  5LP6 C;  1YJN V;  2B1I A;  4CS3 A;  5KA5 A;  5KHJ A;  2JVD A;  1BQ0 A;  3HKD A;  3BVO A;  2GUZ A;  1T5E A;  2VQF O;  1NTM H;  2BSK A;  4QE7 A;  1JMK C;  3K0D A;  3H1L H;  3E89 A;  4I50 A;  1K97 A;  1ROP A;  2BTQ A;  2F95 B;  5FPR A;  1Y76 A;  2ZE5 A;  4J80 A;  1GMG A;  4NVP A;  5CA0 B;  3CC4 V;  1VQN V;  4LF5 B;  3G6E V;  1EM1 A;  2JRI A;  1SZT A;  4NKG B;  2IJH A;  3IFX A;  3IAY A;  4JV5 O;  4UV8 A;  1XHZ A;  5E79 Z;  4JI5 B;  2HVK C;  1M5I A;  2VS0 A;  3AG2 C;  2QGN A;  2ZR3 A;  5TIS Z;  5KHG A;  3OAA G;  2WAM A;  3RYF B;  2HLD G;  4I0X B;  5EBM C;  2N04 A;  2JGU A;  1XDC A;  2CAZ C;  1SS3 A;  4F6R B;  1BSM A;  4IHJ B;  4YHH B;  2Y0P A;  3ZHS A;  3KCX A;  4EB6 A;  4X20 A;  4PA9 A;  3JAW A;  1VF6 C;  1XUQ A;  1R6K A;  1XNR B;  2WA4 A;  3AG4 C;  1N36 B;  2XOK G;  4BW5 A;  4DUY O;  3FB8 C;  2RDC A;  1TUE B;  3M99 B;  4NTX A;  4B3T B;  1NT2 B;  2K1E A;  3U0Z A;  2HVJ C;  1PKX A;  1X59 A;  1RM1 C;  4DK0 A;  3SGI A;  4DV4 B;  4LFB B;  1L1F A;  3JAL A;  2R70 A;  4K35 A;  4IYH A;  1AJN A;  1V9P A;  3TCU A;  5IE9 A;  5LXT B;  1VAR A;  5LMU O;  3SDL A;  2E75 B;  2VWK A;  2EUL A;  1YCI A;  4F6E A;  4AHC A;  1XNQ O;  4UCU A;  1BQZ A;  2BOB C;  1R6T A;  1NBM G;  4YXW G;  1E1Q G;  4MSW C;  1M90 W;  4DUZ B;  4FFK A;  1PD3 A;  2ZXW C;  3D8C A;  1QU7 A;  3TGU H;  1SKV A;  1H2S B;  1K4C C;  1VF7 A;  1KU9 A;  1NH2 D;  3CD6 V;  1SA0 B;  4LP8 A;  2EJ7 A;  3FD9 A;  4RQE A;  5IYD O;  1I5X A;  4NTY A;  3JAM N;  3MD0 A;  3RVY A;  3CE2 A;  3UT5 B;  1W0K G;  2LJ2 A;  5KMG B;  2LFR A;  2PI4 A;  2YS8 A;  4N21 A;  4X1I A;  4NYK A;  2KKW A;  2ZD9 A;  2XAJ A;  4PI2 A;  4DV7 O;  4U7O A;  4TV8 B;  4JI7 B;  2JDI G;  4FM2 A;  3A2F A;  4BIZ A;  3ZS8 C;  3S3W A;  1GAX A;  1B6Q A;  1D2D A;  3ZMT A;  4AI8 A;  1QHT A;  1F23 A;  1QQC A;  1GN2 A;  2F23 A;  5IJ0 A;  1YJ9 V;  4RUF A;  5BZB A;  4QGP A;  1Q3E A;  2NNU A;  2Y48 A;  5KX5 A;  2Q69 A;  2OIE A;  2FYU H;  5JJE B;  2AZ0 A;  1NU1 H;  4PDV A;  3F5W C;  1I5Y A;  2BE3 A;  1NKD A;  5EC1 C;  2CH7 B;  5KUK A;  1HDJ A;  4X89 A;  5LHG A;  4BIU A;  1XMQ B;  3LNM B;  3WB2 A;  3JAS B;  1QLE B;  1H2G A;  4ZHQ A;  4OPA A;  4PDR A;  4MVM A;  4W4K A;  4J10 A;  4LF4 O;  4DR2 O;  1YEW A;  4FLY A;  4LBE C;  1L8D A;  3ABL B;  3HKB A;  4O4H A;  2Q73 A;  4JGS A;  3K06 A;  4ZI7 A;  3L75 H;  1BE3 H;  4OX9 B;  4O4I A;  2WA3 A;  1AI5 A;  3W7X A;  3E8H A;  3LNN A;  1YTF B;  2DMX A;  1MZE A;  1NZ6 A;  1EZV H;  2HHH B;  4DRX B;  4PEL A;  4IYI A;  2CUG A;  5B66 Z;  1S5L Z;  2VQF B;  4YY3 O;  2YSU B;  3T1C A;  2Y69 C;  1K5S A;  1PNL A;  5JCO A;  2OWO A;  1BZK A;  2PZS A;  1Z2G A;  4DYL A;  3L70 H;  2YEV A;  5BMV A;  4TQD A;  5FL7 G;  3APO A;  1SES A;  2UUB B;  4CC6 A;  1FXH A;  3OMN B;  1Q90 D;  5LHH A;  5H9C A;  4P9O A;  2DWE C;  2P4V A;  3AG3 C;  3AK2 A;  4JV5 B;  3VBB A;  2EIM C;  3C3T A;  2YI8 A;  3CCR V;  4JI0 O;  3TXS A;  2DYS C;  3CWB H;  1OJH A;  4CH4 A;  4MVS A;  2M7W A;  5LA6 A;  3SJQ C;  1KD1 W;  5GTH Z;  5IYC O;  1UPG A;  3RYI B;  3QVN A;  3ASO C;  2QE7 G;  2QTS A;  3OEE G;  3I55 V;  4LF9 O;  2Z5U A;  2FL4 A;  4TV9 A;  2ADQ B;  4FZ0 A;  1S5H C;  2P90 A;  5JVD A;  1P7G A;  1KMI Z;  3QO8 A;  2DYR B;  1XQ8 A;  3RW0 A;  2Q4P A;  4DUY B;  4DV1 O;  2ITD C;  1V54 B;  1KYO F;  2YIA A;  1R3J C;  1IBL O;  4I9Q A;  1V55 B;  2Z0A A;  4JI1 O;  1H8H G;  3NXS A;  4JAA A;  4JYA O;  2Z3Y A;  5KHI A;  3UKM A;  2O57 A;  2XTA A;  5LMU B;  1K3E A;  3C90 A;  5J2T A;  3E8B A;  3ABK B;  1XNQ B;  2WLL B;  2ZNI A;  1N33 O;  3K79 A;  1VEW A;  2OCC B;  5EK0 A;  4R7C A;  1QVG U;  3KZI Z;  5JJJ B;  1KP3 A;  3DGE A;  2P7T C;  3W7T A;  3WG7 B;  2DE0 X;  3BY6 A;  5LGU A;  1WP7 A;  5GTI Z;  2G38 A;  3CJH B;  3SPI A;  1FFX A;  3L9D A;  2N05 A;  3FB5 C;  1CXZ B;  2GHY A;  2WLI B;  1JCH A;  4MVQ A;  2F1M A;  4UVA A;  1S72 V;  1HNW B;  4JF3 A;  1KQS U;  4DV7 B;  2YC0 A;  3AK1 A;  5B3S B;  4I9W A;  4X9Q A;  4JI6 B;  2ZIN A;  5JQG A;  2VRZ A;  2XAH A;  3SPJ A;  1Q5O A;  2PUS A;  5FPO A;  1THZ A;  1PNK A;  4FLX A;  4IL6 Z;  1QBZ A;  2AHZ A;  2KG7 A;  3R66 A;  4YHH O;  1KEC A;  3KCY A;  4WFA V;  1N32 O;  1YF2 A;  3STL C;  3Q4H B;  1WP8 A;  3RN4 A;  4BWA A;  4NTW A;  4L8J A;  2IU3 A;  5KUM A;  1XNR O;  4YJ2 B;  4DR4 B;  5GON B;  1N36 O;  4MTF A;  4JTC B;  4ABM A;  4I5S A;  3PN1 A;  3OM3 B;  2RJZ A;  1RPR A;  4AQY O;  4LF4 B;  3VQX A;  1VQ9 V;  5IJ9 A;  4DR2 B;  5B1N A;  1GN6 A;  1BCC H;  4QPJ A;  4LFB O;  3P3P A;  5EBL C;  1E79 G;  1FFT B;  2CDY A;  5B1A B;  2F4V O;  4PV1 B;  3RVZ A;  2XAS A;  5EYP B;  2OTL V;  2GDS A;  2ZM6 B;  4PA3 A;  1K33 A;  1XOU A;  4FK5 C;  2XAG A;  4JAU A;  2PY5 A;  1WJZ A;  1OV9 A;  3DXR B;  4RQF A;  1H38 A;  4PA6 A;  1JOY A;  3ABM B;  1JFF A;  2CK3 G;  4F4L A;  1HW7 A;  5J2U B;  4J7J A;  1Q43 A;  4UUJ C;  2EIK B;  1RSO B;  2JGD B;  1FYJ A;  1UFI A;  2P5O A;  3BA8 A;  3K08 A;  2YID A;  3JCU Z;  3CB2 A;  3DTU B;  4JI0 B;  2A7W A;  5JH7 B;  3P30 A;  1I0H A;  4FMT A;  2NLJ C;  3BAB A;  1VQO V;  1QLE C;  1FXK A;  1A32 A;  2F66 C;  2ZDI A;  2QM7 A;  2JJ1 G;  4YIO A;  4U3J B;  1IXM A;  3RBZ A;  4LF9 B;  4B3S O;  3ABL C;  5DM6 V;  1R73 A;  5JWP A;  4DW0 A;  3FKS G;  1PM9 A;  1JVM A;  3SYP A;  1MG1 A;  4LWS B;  3CC2 V;  5B1B B;  4Q20 A;  5EZY A;  1ZTE A;  2QM8 A;  2YIB D;  2P67 A;  5LMN B;  1MSD A;  1CP9 A;  1AP5 A;  4DV1 B;  1NQT A;  2WLK A;  2LW1 A;  4HNA A;  2W6J G;  3RGB A;  4I55 B;  1IBL B;  1ARO P;  2X6C A;  3IC9 A;  3FAV B;  1WNS A;  1KBH A;  3ABU A;  4JI1 B;  1XMQ O;  4EKW A;  3P3N A;  4YJ3 B;  5CA3 A;  3UCS C;  3D36 A;  4GLX A;  4JYA B;  3DSQ A;  4QE9 A;  2ZR2 A;  2H94 A;  3JAK B;  3CRM A;  4CH3 A;  4ZOL A;  3O65 A;  3CMA V;  3N2K A;  3B40 A;  2ZCE A;  5LGN A;  2QWQ B;  5JJN B;  4MTX A;  1N33 B;  4ZKI A;  3SYA A;  3F7V C;  4OX9 O;  3CRA A;  1BHB A;  1NTZ H;  5CB4 A;  4X66 O;  5L3F A;  4IIJ A;  5FNV A;  2HHH O;  5LP6 A;  3LSQ A;  4MS2 A;  5BR8 O;  1Y4M A;  2LO1 A;  2P06 A;  2IH1 C;  3SJC C;  3VQV A;  3LDD A;  4JI4 O;  1PPJ H;  2IM9 A;  1XBL A;  3AG7 A;  1TUB A;  1IBM O; 
#chains in the Genus database with same CATH homology
 4X65 O;  2UU9 O;  3M8A A;  4LFC O;  2UXC O;  2UUB O;  1D2D A;  4LF7 O;  1HNX O;  1G1X B;  1NS1 A;  4DR7 O;  4JI2 O;  2UXD O;  4KHP O;  4JI3 O;  2DJV A;  1HNW O;  2UXB O;  1A32 A;  4GKJ O;  2UUC O;  4LF9 O;  4X62 O;  3T1H O;  2E5L O;  4NXM O;  1R1B A;  4OPH A;  4B3T O;  4LFA O;  1FJG O;  4B3S O;  5BY1 A;  3R66 A;  4YHH O;  4K0K O;  4DUY O;  3F5T A;  1N32 O;  4JI6 O;  4DV4 O;  1AIL A;  5IWA O;  1X59 A;  4DR3 O;  1KUQ A;  4DV1 O;  1XNR O;  3J81 N;  2FKX A;  4OPA A;  3OTO O;  1N36 O;  1J5E O;  1IBM O;  2VQE O;  1IBL O;  4DV6 O;  4B3M O;  4LF6 O;  4LF4 O;  2Z0A A;  4JI1 O;  5LL6 Y;  2N74 A;  4DR2 O;  5IT9 N;  4DV3 O;  5LMU O;  3SDL A;  1I94 O;  4X64 O;  4AQY O;  4JYA O;  4NXN O;  1XMQ O;  1N34 O;  1IBK O;  4JI8 O;  1FKA O;  1XNQ O;  4DUZ O;  4LFB O;  4DR4 O;  2ZKO A;  1R6T A;  4DV2 O;  5LMN O;  2VQF O;  3J7A U;  2F4V O;  4B3R O;  4DR1 O;  5A2Q N;  1N33 O;  2AGA A;  5H5N A;  3O65 A;  3RT3 C;  4YY3 O;  1F7Y A;  2UUA O;  2DOS A;  4LF5 O;  5FLX N;  4A5U B;  1YZB A;  3J80 N;  4OX9 O;  4DV0 O;  4X66 O;  3JAM N;  4JI5 O;  2HHH O;  1AB3 A;  2JRI A;  4LF8 O;  4JV5 O;  4DR6 O;  5BR8 O;  1HNZ O;  5BXZ A;  2ZM6 O;  4DV5 O;  1DK1 A;  1XMO O;  4JI7 O;  4DR5 O;  4JI4 O;  3T1Y O;  2LW7 A;  4JI0 O;  1HR0 O;  4DV7 O;  1FYJ A;  1XEQ A;  4GKK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...