4JI3O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji3O00
3R66A 4LF6O 2Z0AA 1XMQO 1NS1A 4X62O 1R6TA 1HNWO 1G1XB 1I94O 3M8AA 2UXBO 1XNRO 4A5UB 2F4VO 2LW7A 4OPAA 1AILA 4DR7O 4DR5O 1YZBA 2VQFO 4DV3O 4GKJO 5BXZA 4YHHO 1IBLO 1IBKO 5FLXN 4DUZO 4LF4O 4DV5O 4NXMO 4LF9O 2AGAA 4X64O 4AQYO 2E5LO 4JI2O 4B3MO 3T1HO 1FYJA 1N32O 1HR0O 4LF5O 4DR6O 4DR4O 4DUYO 4OPHA 4JI6O 4NXNO 5H5NA 2UXCO 1IBMO 4YY3O 5LMUO 4JI0O 4DR1O 1N33O 4DV4O 4LFBO 3O65A 4DV7O 1HNXO 4DV1O 4DR3O 2UXDO 3J80N 1XMOO 2VQEO 1J5EO 1XNQO 5IT9N 4DV0O 4JV5O 3J81N 2ZM6O 2JRIA 1HNZO 2UUAO 4JI5O 1DK1A 3F5TA 4GKKO 2UUCO 4LFAO 4B3TO 4JI3O 1R1BA 4DV2O 4KHPO 3OTOO 5LL6Y 4LF8O 2UU9O 4JYAO 1F7YA 4K0KO 2FKXA 4DR2O 1FKAO 1N34O 1KUQA 4B3RO 2N74A 1D2DA 3RT3C 1A32A 4JI8O 5A2QN 1XEQA 5BY1A 4X66O 1N36O 1FJGO 2ZKOA 5BR8O 4JI4O 2HHHO 4OX9O 2UUBO 5LMNO 2DOSA 3J7AU 4DV6O 3T1YO 1AB3A 3SDLA 1X59A 5IWAO 2DJVA 4B3SO 3JAMN 4LFCO 4X65O 4JI1O 4LF7O 4JI7O
chains in the Genus database with same CATH superfamily
4GX1A 1JCHA 1S76D 5D5QA 3K58A 1R73A 4LWSA 2ZCEA 4OPAA 4DV1B 2IW5A 3HKBB 4GKJO 3AG3C 1XMOB 1MZEA 4MTFA 1Y76B 3DGEA 4DV5O 3E22B 4CH5A 2F93B 3T1HB 1I7FA 3K79A 1P7GA 5KX5B 3B09A 2WLJA 2DWDC 1K9MW 2ZR2A 1I0HA 3K5LA 4GT1A 1P84F 4O4IB 3CCVV 4DR1O 2Q68A 2R9AA 4MW8A 5LP6C 1IVSA 3BRCA 1XUQA 1WNSA 2ZXWB 4I0XA 1FJGB 4UCUA 2RJZA 3RFRA 2HR3A 5B1BB 1GK9A 4B7KA 4FLZA 3LSUA 4WFGA 4MVZA 3RN4A 5KMGA 4DV2B 1ZX3A 3GVMA 3DTUB 4WFEA 2Q69A 4UVCA 3OE7G 4JYAO 2R72A 2CTPA 3A0HZ 3EFFK 3EVKA 4LF6B 3W7XA 4FLWA 1M9NA 1Z5VA 1XHZA 1HNWB 3CD6V 1I5YA 5JVDA 1MSDA 1AJQA 5KAIZ 2DOSA 3D3IA 5GW7A 1AROP 3CC4V 4IYIA 4D7TA 5EZYB 1FAFA 2XUMA 3JARB 4LFCO 4UB8Z 4XDLA 3CCUV 2PUSA 4JI7O 2HG5C 4ZI7A 1MG1A 1ZAUA 2JK5C 1Y67A 4TUYA 5LP6B 2Q6AA 2WLMA 3C3TA 2PI5A 1VQ5V 2P06A 4I55B 2G38A 4CZZA 1JMKC 2VQFO 3RYFB 1OCCC 1D5AA 2ILMA 4P2ZA 2AHZA 4RO2A 4R50A 3WB1A 5LOVA 2LP7A 5B66Z 4JI2B 2EINC 3BVOA 3ETEA 4AQYO 5LBQA 3FB8C 3SYQA 3O9OA 2ADQB 3HKEB 1M1KW 3CXCU 4JI6O 2LGWA 5A9GA 4JF3A 1N33O 5CA1A 2KG7A 1BE3H 2JS5A 3ICXA 2RMKB 4HYOA 3RW0A 4DR3O 2NLJC 2ZIMA 5L3BA 4D6TH 4MTOA 2PF4E 1NR7A 2B9ZA 1KB9F 1DF5A 2DWEC 3TGUH 5LHHA 2UUAO 4FFKA 1YJWV 4KHPB 3F5TA 4X1IA 4FFBB 1GM8A 1K97A 4LF8O 3HB3B 2Y0PA 4KP4A 3G67A 2FKXA 1FKAO 1WAZA 1N34O 2P7TC 2R9IA 5FNVA 3WB2A 2H8PC 2GUZB 2D3OW 1BQZA 1G8MA 3K06A 4JYYA 1CPYA 1YXBA 4MVQA 3CCMV 3K3WA 1OCCB 3M7MX 1Q6IA 4NYKA 3JALA 3G80A 1WB8A 4IYHA 2EINB 4RUEA 3APQA 1XOUA 2DJVA 2OTJV 2F23A 4NKGB 2Q7EA 4I9QA 1QVGU 2Z0AA 4PELA 3JASA 3JSNA 2UXBO 1XNRO 2YI9A 1QQCA 3CCJV 3CMEV 2GSMB 5HFLA 5J9PC 2WPDG 4IHJB 1VQ8V 5DM6V 2OWOA 1FFXA 4LF4B 4KUMA 3MAQA 5JH7B 4QE7A 5DEDA 1W0KG 4LF9B 3HPLC 4X1KA 4JV5B 1PNMA 2E5LO 4LF5O 4IIJA 5C8YA 4RQEA 3ETGA 3E2EA 3CS5A 1FFTB 4O2BB 2AZ2A 3QO8A 2YIBA 3A0BZ 3ZHSA 4LP8A 3ABTA 4K0KB 3TETA 1E1RG 1AR1B 4DV1O 1XMOO 1VF6C 4H37A 4E2LA 2ZM6B 4QPKA 1K92A 1W2BU 5BR8B 4JGSA 4FPPA 3SYPA 4CH4A 4CS4A 1ZTEA 4DV6B 2QWPB 1RM1C 3N2KA 5KHKA 3UT5A 3A2FA 4AI8A 4RWUA 3OUFA 1GM9A 3AG4C 2DN9A 4TWKA 4LNUB 5LHGA 1SQPH 1YTFB 3CYOA 4LR3A 4JI8O 4JAUA 3RYIB 4X1YA 1FJGO 2IJIA 2QWRB 3VQWA 1WJZA 3VOUA 3K59A 3H9VA 3B2EE 1SC5B 1JFFB 3CWBH 4X64B 3CJHA 4YIPA 3RWRD 4LF6O 4O4LA 1HNWO 1TUBB 5IYDO 4JAVA 4GKJB 1IZ3A 3AEIA 3HKDA 3ETDA 1UJWB 2JS3A 5CA3A 2XASA 3H1HH 3KCYA 4TV8A 3QO7A 4PI0A 1RM1B 2UUCB 2JJ1G 4JI3B 3P30A 5GONA 1CEZA 3AG4B 2O57A 3BAAA 1RP3B 3BFRA 3TXQA 4I50B 4NTWA 4Z1MG 4H44B 3SYCA 1M57C 1NTKH 4PDMA 1PL0A 1VP7A 3CMAV 4PA3A 4CC6A 4EFBA 4UCOA 3J81N 2P4KA 5IJ9A 4JI5O 3T1YB 4PJ0Z 1YTFD 2ADPA 1SA0B 3ZMUA 1I5XA 1D5NA 2JIZG 2IU0A 4JYAB 3OM3B 3ZHRA 4P9PA 1SS3A 3WFVA 1M5IA 1EN5A 2Z3YA 2YIAA 3MD0A 4JZGA 5CBHA 2QKCA 1RPOA 3CXHF 4BIZA 1X4TA 1R6NA 2CUGA 4IL6Z 5KHHA 2A7WA 4LH6A 3LSQA 2F95B 5KUKA 3ZX6A 4YJ3A 1RSOB 5IWAO 2YIDA 5CB4A 2F66C 2MK3A 1Y4MA 4JI7B 1DLBA 4BW9A 3FB6C 3BA9A 1KP3A 4TQDA 1OV9A 4XDJA 3I55V 2E74B 2Q0OC 4WFBV 4ABMA 1G1XB 4YY3B 4UCVA 4LFBB 3BA8A 1M57B 2VQFB 3ETQA 1AILA 4F6EA 2ZDIA 5BXZA 5LGNA 1GH6A 3UM7A 3L74H 1Y74A 4AQYB 2CE4A 2F1MA 1PNKA 3TCUA 3OW2U 2WLLA 4I4TB 1FPOA 2X7RB 2L6LA 2ZNJA 1XILA 1GKFA 1Q8IA 3L75H 2XNDG 3LNMB 1H38A 3DC6A 1OZ0A 3E89A 2EJRA 2YDEA 4UB6Z 5EBLC 4DR3B 2OYQA 1HNXO 1FXHA 3N2GB 5H9CA 1WA8B 2ODMA 1XNQO 1YJNV 3ZRXA 1KYOF 1IDSA 5BMVA 4JV5O 1R3IC 3PJSK 2A06H 4PA4A 3D36A 3SJAC 3TJTA 2N05A 4MW3A 3OFNG 5LL6Y 1NU1H 3L71H 2FL4A 1LNQA 4NVPA 4EB6A 3K0GA 3LSSA 4K0KO 3WU2Z 4LF7B 3EXAA 1YHQV 3CHXA 3CSXA 3OR7C 1EZJA 4Q20A 1FXVA 4WBNA 5BR8O 1W59A 4DR7B 3FB7C 3ZHTA 3J7AU 3R65A 4DV6O 1OCOC 4GX0A 5EYPA 2B1IA 1NH2B 3LUTB 2ZINA 2RN9A 4JTCB 1BL8A 1URFA 4PHZA 1NT2B 1YCIA 3ZHUA 2UXBB 1XNRB 2EULA 1NZ6A 2L35A 3ZCCA 5LXTB 2ZIOA 4A5UB 4FK5C 2LGQA 3OUSA 4WCEV 3VBBA 1YI2V 5LYJA 3DC5A 4UCSA 2E5LB 1NTZH 1H2MA 1BHAA 2ZE5A 1R3KC 3ZRWA 1TVKA 4X64O 4MTXA 5BZBA 1QR9A 2GBOA 4Q6GA 3SJBC 3CCLV 3BPZA 2QEXV 4MVMA 2DW4A 4CBCA 2JGUA 2KQXA 5HFMA 1IBMO 4UCRA 3CPWU 1NVPD 3AK3A 2D2CB 3CRQA 3HKBA 3CRAA 1N0JA 1NR1A 1KU9A 3E22A 1US6A 4UCTA 1RPRA 1N0NA 3KKYA 1OCOB 1S5LZ 4W4KA 2UUCO 4JI3O 1R1BA 1SQQH 3OEEG 3SJCC 5KX5A 1K3EA 5L3CA 1MSWD 1S72V 3K9SA 3QF7A 1WN7A 5J2TB 4JI8B 2N74A 3K03A 4FM2A 1L1FA 2Q4PA 1VQMV 3BHPA 1NH2D 4JAAA 1FXKA 1YSCA 2F4VB 4JI4O 3GWKC 4R8CA 3C3SA 2ZE8A 3T1YO 4LBEC 2BTQB 2BOBC 3JATA 3SDLA 5K1PA 2YXLA 5B1NA 5IYZB 3B40A 4EFEA 4FLVA 5EIBC 1IX9A 2EZPA 2ZR3A 1ZL8B 1HR0B 2WAMA 3R66A 2CAZC 3CX5F 4X62O 2YUAA 3DSQA 4UXNA 3L72H 3AG3B 3JAWA 4KFMA 4J11A 1B6QA 5B3SC 1HW7A 5LA6A 2UXDB 3ASOC 5KA5A 3CC2V 2ZQMA 2ZE6A 2E3CA 5IYBO 2CTWA 5IE9A 1K5QA 1K4CC 1EN4A 2AGAA 3ZMZA 3JARA 1P49A 1ZLZA 1BSMA 4CC5A 2C2AA 4PDVA 1JVMA 4J7KA 4TOIA 2LFRA 4Z1VA 5LP6A 4YY3O 1YITV 1BHBA 2X6CA 4LFBO 3G6EV 3O65A 3QTCA 2DQ0A 4I55A 5LHIA 4X20B 3RYFA 4MVSA 2IH3C 1L8DA 1SQGA 2QGNA 3HR0A 4UUJC 4JI5B 1AP6A 1HNZO 4LH7A 2V1DA 1DK1A 1DTOA 1QNMA 5GTIZ 1IXBA 3H1KH 4O2AA 2KSDA 2UU9O 5IJ0B 2YSUB 2WWWA 4NTXA 4DR2O 3VQXA 1A32A 2E76B 5B3SB 3W7UA 2ZKOA 1Q43A 3ASOB 1NI8A 4DR5B 5EBMC 3IJ4A 1IBLB 1EBOA 5IWAB 1QCEA 2A0LA 4C7UA 5GTHZ 3SJQC 2CH7A 1CP9A 1OCZC 2XOKG 3APOA 3FFQA 1BS3A 1GN3A 4LF7O 4PDRA 2CGOA 1AI7A 3LNNA 2GUZA 3ZHQA 4DRXA 3FYEB 4F6RA 4H33A 2W0FC 1H2LA 3H01A 2VWKA 4GLXA 4O4HB 4NR1A 4DR7O 2IJKA 5FNVB 1QU7A 3CCSV 2PZSA 4ICGA 1F4NA 3B4SA 1NKDA 3E8GA 3CRMA 3VQVA 4BIOA 3IC7A 1GMGA 4DW1A 3E35A 4FMTA 3JALB 2GHYA 1SZXA 4G2KA 5LMUO 5ITZA 1HNXB 3W7SA 2OCCC 3OTFA 4HBNA 4IHJA 1K34A 2LW1A 1XNQB 2QM7A 5JH7A 1XBLA 4J41A 2JEUA 4B7EA 5EIBD 5KUMA 5E1AC 2JDIG 4CH6A 1AJPA 4OX9B 1ORQC 4O4JB 3T4ZA 2WLIA 1W0JG 1FFXB 2EBOA 4CS2A 5JJNB 1OCZB 3ABUA 4X1KB 4O2BA 4PA6A 3ZEDA 1SERA 2EIKC 1PKXA 5KHJA 4IIJB 5C8YB 2QJ1A 1KKCA 1VF5B 4PA7A 4DW0A 1JJ2U 3QVNA 2RDCA 3CCEV 1M93A 5KA6A 1COWG 1MMMA 3H1IH 4ZOLA 3THOA 3RYCB 1IBKB 1Q6UA 5IY5C 1K33A 2Q9LA 3RYHB 5J2UA 2FYUH 4DR6B 2QWNB 3CE2A 4L8JA 1VQ6V 2XT9A 3UT5B 3JD4A 3RYIA 2P22C 3MDSA 1QHTA 2OCCB 2OT5A 3JAKB 3AG7A 2P90A 4HNAA 2F4VO 1SETA 3K08A 2JGDB 1YZBA 3STLC 3QG5A 4H0LB 4BR6A 2VQEB 1XQ8A 1AJNA 1GM7A 4DUZO 4DV0B 5JQGA 2XAHA 3DXRB 2CTQA 3OD4A 4DXWA 4MT8A 1MNGA 4KXRA 4GKKB 4B3TB 1HR0O 2DYSC 1OJHA 1WPBA 4OPHA 1IBMB 2EIKB 1THZA 3M99B 4R6ZA 1VQOV 4GCZA 1K7DA 3CJHB 1LR1A 3CC7V 1VF6A 2UXDO 2OTLV 4BWAA 1Y6XA 3CCRV 5IT9N 4JYCA 4YJ2A 1Q7YW 2PGGA 2JVDA 3Q4HA 2HP8A 4GYCB 1BQ0A 5IY5B 5CBFA 4P9OA 1YDXA 2EX3A 5L3GA 2YIBD 4TV8B 4QGPA 2QWQB 1AVMA 5L3EA 2ZD9A 4P30A 2QTSA 1D2DA 3CCQV 3HKCB 4TT3G 2AW9A 1OCRC 4XBFA 1XEQA 2GDSA 1N36O 2YEVB 4JI4B 2DYRC 3SR2C 3UO2A 3OT7A 4D7SA 2BSKB 1QR8A 2XAFA 1SA0A 1BT8A 2ZDIC 3K5OA 2XAJA 4MVUA 2Y48A 1GRJA 2DYSB 2PTMA 1SESA 5IJ9B 3FB5C 4X65O 4F4LA 3ABKC 4X62B 5F2VO 4DK0A 4BAYA 2RCVA 5B1OA 3KG2A 1SQBH 2EJ7A 1AI4A 1H8EG 4DO2A 3SGIA 1BGYH 4DR5O 1IBLO 2PY5A 2R9RB 4J10A 2WA3A 2UXXA 4ZHQB 2QM8A 4PI2A 4B3MO 1HP8A 2LO1A 3D36C 4YJ3B 5H5NA 2UXCO 1HWYA 1QLEC 3OMIB 1WP8A 3W7TA 4B3RB 2EIMC 1OCRB 1MZFA 1JPXA 5E79Z 2DYRB 1FS0G 1HNZB 1Q86W 3TXSA 1I08A 2XTAA 3KZIZ 1V9PA 1EN6A 1S0VA 5CA0B 2V7QG 5H6RA 4I4TA 2UU9B 3L73H 3KCXA 1WP7A 2HVJC 1JX9A 2DQ3A 2YXHA 1SQXH 4UV8A 4KL1A 3ABKB 3ZRVA 4DR2B 3IGAC 4TV9A 1YVWA 3UCSC 3AG1C 3I56V 4GZRB 2OIEA 4NB5A 1KC8W 3N2GA 5A2QN 1NVPB 4X66O 3U0ZA 1J95A 2HVKC 1Q5OA 4OXSA 4QJFB 2HHHO 4OX9O 5DN6G 1E79G 3RGBA 2UXNA 4X9QA 4PV1B 5K1XA 3ABMC 3JSLA 4G27B 1AI6A 4L87A 4AHCA 3H1LH 1VQ9V 3SPIA 2Q67A 2RNBA 1VQ7V 2QR4A 1QLEB 5EC2C 2W6JG 4I9WA 2HFEC 1GN6A 2NR5A 1Q81W 2Q8VA 2EIMB 4EB6B 5JCOA 4YHHO 4FJCC 1T5EA 1IBKO 3K57A 3D3QA 1BMFG 4JTAB 1V55C 1K73W 3P3PA 2QM4A 2IU3A 4DR6O 3F5WC 2LFSA 5LMUB 2H94A 4FIPC 2QKAA 3CEIA 4U7OA 3FAVB 3AG1B 4DV4O 1G6UA 4GUNA 1LUWA 4X89A 1YJ9V 4J9ZB 3ZMTA 4N21A 5IDJA 4WFAV 1E1QG 2VQEO 4FLUA 1EZVH 2A79B 4DV0O 2EZOA 2QKSA 1VQLV 1YF2A 5FPRA 2BE3A 3SPGA 1FXKC 4GKKO 3SPJA 4U3JB 3ABMB 4OGQB 4B3TO 4X8AA 1M4UA 1PL4A 1YIJV 2RQ6A 4X88A 2FMLA 2HJDA 1Q90D 3LDEA 4B3SB 3T2MA 1TVKB 3H1JH 3RT3C 2JJ2G 4ASUG 4E4EA 1Y76A 4PD4F 3ZJZA 1I94B 4LWSB 1KP2A 1NTMH 1B06A 5CMUA 3ZMVA 2H3OA 4ZBMA 2ZT9B 5KHIA 4UVAA 4RAIA 4O4IA 1V55B 5B5EZ 4UV9A 4DR4B 5J2TA 2ARHA 2YXYA 3E86A 3CP1A 2CK3G 5FL7G 2PYLA 2VS0A 5KAFZ 2YS8A 4U3FH 2P6JA 1R3JC 1JQ0A 3QO5A 3SYAA 2WLNA 3L9DA 4DUZB 1FD9A 1PM9A 2BTOA 4I0XB 3WG7C 2BTQA 1NQTA 3ZN0A 1FXKB 3CRRA 5IYZA 4DK1A 3JD1A 5KMGB 5CBGA 1U97A 4LCUC 4K35A 4YXWG 1ZL8A 3E8FA 4J7ZA 1VQNV 4R7CA 2VRZA 4UFZA 4BW5A 3JATB 4NXNO 1JR9A 1EM1A 1QBZA 1S5JA 3C90A 3LDDA 2K9PA 4DV7O 3TK1A 1CXZB 4TSFG 1SQFA 1TAEA 3IC9A 1BZKA 5EZYA 2QTOA 5D5PA 2X6AA 5EK0A 1ZSPA 2B5UA 5JVDB 3JAWB 3K9AA 2QDOA 3L70H 1R6KA 5LA6B 5IYCO 1AR5A 2IH1C 1SKVA 1KKDA 5H6QA 3P32A 2BOCC 3K5MA 1VIBA 1JJOA 4UVBA 2EIJC 2YICA 3A8TA 3ZMSA 1DF4A 2FTKA 4B3RO 4ZI7B 5TISZ 1N36B 4X20A 4JPRA 4TUYB 2BCCH 5JJJB 3NR7A 3ML0A 2DE0X 3P3NA 2QE7G 4QNHB 2M7WA 4PDLA 2UUBO 4K8ZA 3WG7B 2P4VA 3HKEA 3A0RA 5LOVB 1P4RA 1X59A 2IM9A 3JYCA 1H2GA 5IJ0A 2X0LA 4X65B 2IJHA 1XDCA 3GB7C 3LDCA 1SF9A 4WFFA 4MTGA 1XMQO 1NS1A 4WF9V 2KB1A 3OGCC 4O2AB 1AI5A 4MSWC 3M8AA 5CA1B 2KG7B 2YI8A 3I5DA 3WB0A 3QNEA 4FFBA 4GX2A 1J5EB 5AG2A 5FLXN 2GTSA 4I5SA 5FPOA 4CS3A 4B3MB 4HAMA 1VQ4V 3U10A 4X1IB 1N32O 1IXMA 2UXCB 4DUYO 1NBMG 2EIJB 2K1EA 3BABA 3BCCH 2CH7B 1M56C 1PD3A 2V4DA 3S3XA 1VMGA 3VQYA 4O4HA 1XL6A 3OMNB 3SPCA 3J80N 2Y4UA 4ZIBA 3AG2C 2KKWA 2Y4TA 2YC0A 1V54C 4DRXB 1VEWA 4F6RB 1S3JA 2QWOB 1PPJH 1TUEB 5L3FA 4RQFA 1G4YB 5H2FZ 4FLXA 2XAQA 3B8MA 3CRCA 4K8XA 4RUFA 4J42A 1F7YA 1XHXA 2W0XA 2CGNA 2WA4A 4AILC 2A3QA 3ZN1A 1KUQA 1GTOA 3JASB 2PYJA 4X66B 3PN1A 1Y66A 1H2KA 1LUVA 2LJ2A 2HHHB 1P7BA 3W7WA 5ITZB 4O4JA 4DV3B 3N27A 3GWOA 3E8HA 4NXMB 2AZ0A 4IGGA 1KBHA 4FVMA 4B3SO 2CDYA 4HZ3A 3IFXA 1S5HC 3T1CA 3B8NA 2N04A 2WLIB 3B77A 4IT5A 5EC1C 1QLNA 2Q7HA 2XAGA 4XDKA 3FD9A 1R6TA 1M56B 1I94O 3UKMA 4JI0B 1U96A 4YHHB 3AG2B 3OGIB 1V54B 3FKSG 3E8BA 3RYCA 1SRYA 5JJEB 3AK2A 1BCCH 4LNUA 1K8AW 1Z5WA 3RYHA 4LFAB 2MW2B 3T1HO 1GAXA 2Q0AA 3N2KB 4DR4O 3OTOB 2VWJA 4ZOLB 4DV4B 2ZNIA 3T4DA 2WSSG 4FZ1A 3JAKA 5J2UB 3ABLC 2JGDA 3F7YC 4BIUA 4X1YB 3BY6A 2Y0IA 1JFFA 1B04A 4FZ0A 1K5SA 2JEXA 2WLHA 4HNAB 4EEQA 3DXRA 1EFRG 5LMNB 5C93A 4DV2O 3RVZA 1F4MA 4I7ZB 5JQGB 1TUBA 4CH3A 1H8HG 1KQSU 4J9YB 4JI1B 4O4LB 5CN0A 5BY1A 4PA9A 2HKOA 1WLEA 3EHBB 4LC1A 3HKDB 2Q73A 1MOFA 4FM1A 4EKWA 1MABG 1H2NA 4DV5B 4I50A 2HJFC 5KLVH 5L3DA 4YJ2B 2DMXA 2ETNA 2R70A 3JAMN 2ITDC 3SYOA 1YEWA 1O9HA 2IJJA 2LQTA 3BEHA 3Q4HB 5GONB 1XREA 1OHHG 2ITCC 3CB2A 1VF7A 2OCHA 2Y69C 3HKCA 1KECA 1HDJA 4DR1B 3ABLB 2YEVA 4U7NA 2ATKC 2EILC 2LW7A 3S3WA 1XI1A 2BSKA 2W6IG 1L0NH 1IURA 4JASA 1F23A 2ZE7A 4JI2O 3AK1A 1FYJA 3OMAB 3ZHVA 3G6BA 4NXNB 1N4CA 2HLDG 3OR6C 4YIOA 3RVYA 3SPHA 4DYLA 3X2QC 2WLKA 4FLTA 4NTYA 4DV7B 2B1GA 1GN4A 1PNLA 3K5NA 2P5OA 1KD1W 4QE9A 1XL4A 3D8CA 1PV0A 1H2SB 1RSOA 4Z2WA 1J5EO 1UFIA 4JTDB 1GO3F 2PI4A 4J7JA 4ZHQA 2P67A 1QVFU 3G71V 1L0LH 4KHPO 3ASNC 3RBZA 1PP9H 4B08A 5CB4B 3IAYA 1F51A 2Q7GA 4LFCB 5JWPA 2Z5UA 2Y69B 2QSAA 2EILB 5B1AC 4GX5A 2GTAA 2CTRA 2UUBB 1S77D 5EBWC 3ZS8C 4G28B 4MVRA 5CA0A 1AB3A 1O9GA 5LGTA 4MS2A 1Y74B 5JCOC 4FLYA 1B3QA 3STZC 4QPJA 1MA1A 3K0DA 1VQPV 2WLLB 1XMQB 3X2QB 3ZRSA 2NN4A 4J80A 4N23A 4JI6B 1WA8A 1Q3EA 1N33B 1AR4A 4TV9B 3FYIB 3JCZA 1VARA 2OIGA 4DV3O 1KMIZ 4LF4O 2AHYA 2IBZH 4NXMO 4LF9O 2NNUA 5BMVB 2XHBA 2UUAB 2Q5ZA 2QA4V 1WB7A 1N32B 4FM0A 3E83A 4DUYB 3ASNB 5KHGA 2M6YA 4LF8B 3JD0A 1SZTA 1R3LC 3F7VC 4JI0O 1VQKV 3ZIAG 3UO3A 4TQFA 1ENVA 3JD2A 2E75B 1N34B 4QIWF 1ZUQA 5B1AB 1WPXA 1AP5A 3G4SV 1SQVH 1TGOA 4K3AA 4WBNB 1M90W 5DECA 2A9HA 2ZM6O 2JRIA 2F43G 4H13B 1Z2GA 2X6BA 3MHSC 2GV9A 4JYBA 4LFAO 2HEPA 2AXTZ 3MHHC 5EYPB 4WFHA 3OTOO 1N8RW 3U11A 5LXTA 1ZWIC 1K4DC 3FAVA 3ZBHA 3OEHG 2FB5A 1Q6HA 1Q82W 3K04A 3NXSA 5LGUA 1UPGA 3UQ8A 3JCUZ 2ZXWC 1NJIW 4MVOA 3FX7A 5LMNO 5B1BC 3OAAG 1TA8A 1DGSA 4U3JA 4W4LA 5LYJB 3JD3A 1JOYA 4JZ2A 3ZRWB 1ROPA 1RFYA 4ZKIA 4LF5B 4JI1O 1GN2A 1JA8A
chains in the Genus database with same CATH topology
3R66A 4LF6O 2Z0AA 1XMQO 1NS1A 4X62O 1R6TA 1HNWO 1G1XB 1I94O 3M8AA 2UXBO 1XNRO 4A5UB 2F4VO 2LW7A 4OPAA 1AILA 4DR7O 4DR5O 1YZBA 2VQFO 4DV3O 4GKJO 5BXZA 4YHHO 1IBLO 1IBKO 5FLXN 4DUZO 4LF4O 4DV5O 4NXMO 4LF9O 2AGAA 4X64O 4AQYO 2E5LO 4JI2O 4B3MO 3T1HO 1FYJA 1N32O 1HR0O 4LF5O 4DR6O 4DR4O 4DUYO 4OPHA 4JI6O 4NXNO 5H5NA 2UXCO 1IBMO 4YY3O 5LMUO 4JI0O 4DR1O 1N33O 4DV4O 4LFBO 3O65A 4DV7O 1HNXO 4DV1O 4DR3O 2UXDO 3J80N 1XMOO 2VQEO 1J5EO 1XNQO 5IT9N 4DV0O 4JV5O 3J81N 2ZM6O 2JRIA 1HNZO 2UUAO 4JI5O 1DK1A 3F5TA 4GKKO 2UUCO 4LFAO 4B3TO 4JI3O 1R1BA 4DV2O 4KHPO 3OTOO 5LL6Y 4LF8O 2UU9O 4JYAO 1F7YA 4K0KO 2FKXA 4DR2O 1FKAO 1N34O 1KUQA 4B3RO 2N74A 1D2DA 3RT3C 1A32A 4JI8O 5A2QN 1XEQA 5BY1A 4X66O 1N36O 1FJGO 2ZKOA 5BR8O 4JI4O 2HHHO 4OX9O 2UUBO 5LMNO 2DOSA 3J7AU 4DV6O 3T1YO 1AB3A 3SDLA 1X59A 5IWAO 2DJVA 4B3SO 3JAMN 4LFCO 4X65O 4JI1O 4LF7O 4JI7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R66 A;  4LF6 O;  2Z0A A;  1XMQ O;  1NS1 A;  4X62 O;  1R6T A;  1HNW O;  1G1X B;  1I94 O;  3M8A A;  2UXB O;  1XNR O;  4A5U B;  2F4V O;  2LW7 A;  4OPA A;  1AIL A;  4DR7 O;  4DR5 O;  1YZB A;  2VQF O;  4DV3 O;  4GKJ O;  5BXZ A;  4YHH O;  1IBL O;  1IBK O;  5FLX N;  4DUZ O;  4LF4 O;  4DV5 O;  4NXM O;  4LF9 O;  2AGA A;  4X64 O;  4AQY O;  2E5L O;  4JI2 O;  4B3M O;  3T1H O;  1FYJ A;  1N32 O;  1HR0 O;  4LF5 O;  4DR6 O;  4DR4 O;  4DUY O;  4OPH A;  4JI6 O;  4NXN O;  5H5N A;  2UXC O;  1IBM O;  4YY3 O;  5LMU O;  4JI0 O;  4DR1 O;  1N33 O;  4DV4 O;  4LFB O;  3O65 A;  4DV7 O;  1HNX O;  4DV1 O;  4DR3 O;  2UXD O;  3J80 N;  1XMO O;  2VQE O;  1J5E O;  1XNQ O;  5IT9 N;  4DV0 O;  4JV5 O;  3J81 N;  2ZM6 O;  2JRI A;  1HNZ O;  2UUA O;  4JI5 O;  1DK1 A;  3F5T A;  4GKK O;  2UUC O;  4LFA O;  4B3T O;  4JI3 O;  1R1B A;  4DV2 O;  4KHP O;  3OTO O;  5LL6 Y;  4LF8 O;  2UU9 O;  4JYA O;  1F7Y A;  4K0K O;  2FKX A;  4DR2 O;  1FKA O;  1N34 O;  1KUQ A;  4B3R O;  2N74 A;  1D2D A;  3RT3 C;  1A32 A;  4JI8 O;  5A2Q N;  1XEQ A;  5BY1 A;  4X66 O;  1N36 O;  1FJG O;  2ZKO A;  5BR8 O;  4JI4 O;  2HHH O;  4OX9 O;  2UUB O;  5LMN O;  2DOS A;  3J7A U;  4DV6 O;  3T1Y O;  1AB3 A;  3SDL A;  1X59 A;  5IWA O;  2DJV A;  4B3S O;  3JAM N;  4LFC O;  4X65 O;  4JI1 O;  4LF7 O;  4JI7 O; 
#chains in the Genus database with same CATH topology
 4GX1 A;  1JCH A;  1S76 D;  5D5Q A;  3K58 A;  1R73 A;  4LWS A;  2ZCE A;  4OPA A;  4DV1 B;  2IW5 A;  3HKB B;  4GKJ O;  3AG3 C;  1XMO B;  1MZE A;  4MTF A;  1Y76 B;  3DGE A;  4DV5 O;  3E22 B;  4CH5 A;  2F93 B;  3T1H B;  1I7F A;  3K79 A;  1P7G A;  5KX5 B;  3B09 A;  2WLJ A;  2DWD C;  1K9M W;  2ZR2 A;  1I0H A;  3K5L A;  4GT1 A;  1P84 F;  4O4I B;  3CCV V;  4DR1 O;  2Q68 A;  2R9A A;  4MW8 A;  5LP6 C;  1IVS A;  3BRC A;  1XUQ A;  1WNS A;  2ZXW B;  4I0X A;  1FJG B;  4UCU A;  2RJZ A;  3RFR A;  2HR3 A;  5B1B B;  1GK9 A;  4B7K A;  4FLZ A;  3LSU A;  4WFG A;  4MVZ A;  3RN4 A;  5KMG A;  4DV2 B;  1ZX3 A;  3GVM A;  3DTU B;  4WFE A;  2Q69 A;  4UVC A;  3OE7 G;  4JYA O;  2R72 A;  2CTP A;  3A0H Z;  3EFF K;  3EVK A;  4LF6 B;  3W7X A;  4FLW A;  1M9N A;  1Z5V A;  1XHZ A;  1HNW B;  3CD6 V;  1I5Y A;  5JVD A;  1MSD A;  1AJQ A;  5KAI Z;  2DOS A;  3D3I A;  5GW7 A;  1ARO P;  3CC4 V;  4IYI A;  4D7T A;  5EZY B;  1FAF A;  2XUM A;  3JAR B;  4LFC O;  4UB8 Z;  4XDL A;  3CCU V;  2PUS A;  4JI7 O;  2HG5 C;  4ZI7 A;  1MG1 A;  1ZAU A;  2JK5 C;  1Y67 A;  4TUY A;  5LP6 B;  2Q6A A;  2WLM A;  3C3T A;  2PI5 A;  1VQ5 V;  2P06 A;  4I55 B;  2G38 A;  4CZZ A;  1JMK C;  2VQF O;  3RYF B;  1OCC C;  1D5A A;  2ILM A;  4P2Z A;  2AHZ A;  4RO2 A;  4R50 A;  3WB1 A;  5LOV A;  2LP7 A;  5B66 Z;  4JI2 B;  2EIN C;  3BVO A;  3ETE A;  4AQY O;  5LBQ A;  3FB8 C;  3SYQ A;  3O9O A;  2ADQ B;  3HKE B;  1M1K W;  3CXC U;  4JI6 O;  2LGW A;  5A9G A;  4JF3 A;  1N33 O;  5CA1 A;  2KG7 A;  1BE3 H;  2JS5 A;  3ICX A;  2RMK B;  4HYO A;  3RW0 A;  4DR3 O;  2NLJ C;  2ZIM A;  5L3B A;  4D6T H;  4MTO A;  2PF4 E;  1NR7 A;  2B9Z A;  1KB9 F;  1DF5 A;  2DWE C;  3TGU H;  5LHH A;  2UUA O;  4FFK A;  1YJW V;  4KHP B;  3F5T A;  4X1I A;  4FFB B;  1GM8 A;  1K97 A;  4LF8 O;  3HB3 B;  2Y0P A;  4KP4 A;  3G67 A;  2FKX A;  1FKA O;  1WAZ A;  1N34 O;  2P7T C;  2R9I A;  5FNV A;  3WB2 A;  2H8P C;  2GUZ B;  2D3O W;  1BQZ A;  1G8M A;  3K06 A;  4JYY A;  1CPY A;  1YXB A;  4MVQ A;  3CCM V;  3K3W A;  1OCC B;  3M7M X;  1Q6I A;  4NYK A;  3JAL A;  3G80 A;  1WB8 A;  4IYH A;  2EIN B;  4RUE A;  3APQ A;  1XOU A;  2DJV A;  2OTJ V;  2F23 A;  4NKG B;  2Q7E A;  4I9Q A;  1QVG U;  2Z0A A;  4PEL A;  3JAS A;  3JSN A;  2UXB O;  1XNR O;  2YI9 A;  1QQC A;  3CCJ V;  3CME V;  2GSM B;  5HFL A;  5J9P C;  2WPD G;  4IHJ B;  1VQ8 V;  5DM6 V;  2OWO A;  1FFX A;  4LF4 B;  4KUM A;  3MAQ A;  5JH7 B;  4QE7 A;  5DED A;  1W0K G;  4LF9 B;  3HPL C;  4X1K A;  4JV5 B;  1PNM A;  2E5L O;  4LF5 O;  4IIJ A;  5C8Y A;  4RQE A;  3ETG A;  3E2E A;  3CS5 A;  1FFT B;  4O2B B;  2AZ2 A;  3QO8 A;  2YIB A;  3A0B Z;  3ZHS A;  4LP8 A;  3ABT A;  4K0K B;  3TET A;  1E1R G;  1AR1 B;  4DV1 O;  1XMO O;  1VF6 C;  4H37 A;  4E2L A;  2ZM6 B;  4QPK A;  1K92 A;  1W2B U;  5BR8 B;  4JGS A;  4FPP A;  3SYP A;  4CH4 A;  4CS4 A;  1ZTE A;  4DV6 B;  2QWP B;  1RM1 C;  3N2K A;  5KHK A;  3UT5 A;  3A2F A;  4AI8 A;  4RWU A;  3OUF A;  1GM9 A;  3AG4 C;  2DN9 A;  4TWK A;  4LNU B;  5LHG A;  1SQP H;  1YTF B;  3CYO A;  4LR3 A;  4JI8 O;  4JAU A;  3RYI B;  4X1Y A;  1FJG O;  2IJI A;  2QWR B;  3VQW A;  1WJZ A;  3VOU A;  3K59 A;  3H9V A;  3B2E E;  1SC5 B;  1JFF B;  3CWB H;  4X64 B;  3CJH A;  4YIP A;  3RWR D;  4LF6 O;  4O4L A;  1HNW O;  1TUB B;  5IYD O;  4JAV A;  4GKJ B;  1IZ3 A;  3AEI A;  3HKD A;  3ETD A;  1UJW B;  2JS3 A;  5CA3 A;  2XAS A;  3H1H H;  3KCY A;  4TV8 A;  3QO7 A;  4PI0 A;  1RM1 B;  2UUC B;  2JJ1 G;  4JI3 B;  3P30 A;  5GON A;  1CEZ A;  3AG4 B;  2O57 A;  3BAA A;  1RP3 B;  3BFR A;  3TXQ A;  4I50 B;  4NTW A;  4Z1M G;  4H44 B;  3SYC A;  1M57 C;  1NTK H;  4PDM A;  1PL0 A;  1VP7 A;  3CMA V;  4PA3 A;  4CC6 A;  4EFB A;  4UCO A;  3J81 N;  2P4K A;  5IJ9 A;  4JI5 O;  3T1Y B;  4PJ0 Z;  1YTF D;  2ADP A;  1SA0 B;  3ZMU A;  1I5X A;  1D5N A;  2JIZ G;  2IU0 A;  4JYA B;  3OM3 B;  3ZHR A;  4P9P A;  1SS3 A;  3WFV A;  1M5I A;  1EN5 A;  2Z3Y A;  2YIA A;  3MD0 A;  4JZG A;  5CBH A;  2QKC A;  1RPO A;  3CXH F;  4BIZ A;  1X4T A;  1R6N A;  2CUG A;  4IL6 Z;  5KHH A;  2A7W A;  4LH6 A;  3LSQ A;  2F95 B;  5KUK A;  3ZX6 A;  4YJ3 A;  1RSO B;  5IWA O;  2YID A;  5CB4 A;  2F66 C;  2MK3 A;  1Y4M A;  4JI7 B;  1DLB A;  4BW9 A;  3FB6 C;  3BA9 A;  1KP3 A;  4TQD A;  1OV9 A;  4XDJ A;  3I55 V;  2E74 B;  2Q0O C;  4WFB V;  4ABM A;  1G1X B;  4YY3 B;  4UCV A;  4LFB B;  3BA8 A;  1M57 B;  2VQF B;  3ETQ A;  1AIL A;  4F6E A;  2ZDI A;  5BXZ A;  5LGN A;  1GH6 A;  3UM7 A;  3L74 H;  1Y74 A;  4AQY B;  2CE4 A;  2F1M A;  1PNK A;  3TCU A;  3OW2 U;  2WLL A;  4I4T B;  1FPO A;  2X7R B;  2L6L A;  2ZNJ A;  1XIL A;  1GKF A;  1Q8I A;  3L75 H;  2XND G;  3LNM B;  1H38 A;  3DC6 A;  1OZ0 A;  3E89 A;  2EJR A;  2YDE A;  4UB6 Z;  5EBL C;  4DR3 B;  2OYQ A;  1HNX O;  1FXH A;  3N2G B;  5H9C A;  1WA8 B;  2ODM A;  1XNQ O;  1YJN V;  3ZRX A;  1KYO F;  1IDS A;  5BMV A;  4JV5 O;  1R3I C;  3PJS K;  2A06 H;  4PA4 A;  3D36 A;  3SJA C;  3TJT A;  2N05 A;  4MW3 A;  3OFN G;  5LL6 Y;  1NU1 H;  3L71 H;  2FL4 A;  1LNQ A;  4NVP A;  4EB6 A;  3K0G A;  3LSS A;  4K0K O;  3WU2 Z;  4LF7 B;  3EXA A;  1YHQ V;  3CHX A;  3CSX A;  3OR7 C;  1EZJ A;  4Q20 A;  1FXV A;  4WBN A;  5BR8 O;  1W59 A;  4DR7 B;  3FB7 C;  3ZHT A;  3J7A U;  3R65 A;  4DV6 O;  1OCO C;  4GX0 A;  5EYP A;  2B1I A;  1NH2 B;  3LUT B;  2ZIN A;  2RN9 A;  4JTC B;  1BL8 A;  1URF A;  4PHZ A;  1NT2 B;  1YCI A;  3ZHU A;  2UXB B;  1XNR B;  2EUL A;  1NZ6 A;  2L35 A;  3ZCC A;  5LXT B;  2ZIO A;  4A5U B;  4FK5 C;  2LGQ A;  3OUS A;  4WCE V;  3VBB A;  1YI2 V;  5LYJ A;  3DC5 A;  4UCS A;  2E5L B;  1NTZ H;  1H2M A;  1BHA A;  2ZE5 A;  1R3K C;  3ZRW A;  1TVK A;  4X64 O;  4MTX A;  5BZB A;  1QR9 A;  2GBO A;  4Q6G A;  3SJB C;  3CCL V;  3BPZ A;  2QEX V;  4MVM A;  2DW4 A;  4CBC A;  2JGU A;  2KQX A;  5HFM A;  1IBM O;  4UCR A;  3CPW U;  1NVP D;  3AK3 A;  2D2C B;  3CRQ A;  3HKB A;  3CRA A;  1N0J A;  1NR1 A;  1KU9 A;  3E22 A;  1US6 A;  4UCT A;  1RPR A;  1N0N A;  3KKY A;  1OCO B;  1S5L Z;  4W4K A;  2UUC O;  4JI3 O;  1R1B A;  1SQQ H;  3OEE G;  3SJC C;  5KX5 A;  1K3E A;  5L3C A;  1MSW D;  1S72 V;  3K9S A;  3QF7 A;  1WN7 A;  5J2T B;  4JI8 B;  2N74 A;  3K03 A;  4FM2 A;  1L1F A;  2Q4P A;  1VQM V;  3BHP A;  1NH2 D;  4JAA A;  1FXK A;  1YSC A;  2F4V B;  4JI4 O;  3GWK C;  4R8C A;  3C3S A;  2ZE8 A;  3T1Y O;  4LBE C;  2BTQ B;  2BOB C;  3JAT A;  3SDL A;  5K1P A;  2YXL A;  5B1N A;  5IYZ B;  3B40 A;  4EFE A;  4FLV A;  5EIB C;  1IX9 A;  2EZP A;  2ZR3 A;  1ZL8 B;  1HR0 B;  2WAM A;  3R66 A;  2CAZ C;  3CX5 F;  4X62 O;  2YUA A;  3DSQ A;  4UXN A;  3L72 H;  3AG3 B;  3JAW A;  4KFM A;  4J11 A;  1B6Q A;  5B3S C;  1HW7 A;  5LA6 A;  2UXD B;  3ASO C;  5KA5 A;  3CC2 V;  2ZQM A;  2ZE6 A;  2E3C A;  5IYB O;  2CTW A;  5IE9 A;  1K5Q A;  1K4C C;  1EN4 A;  2AGA A;  3ZMZ A;  3JAR A;  1P49 A;  1ZLZ A;  1BSM A;  4CC5 A;  2C2A A;  4PDV A;  1JVM A;  4J7K A;  4TOI A;  2LFR A;  4Z1V A;  5LP6 A;  4YY3 O;  1YIT V;  1BHB A;  2X6C A;  4LFB O;  3G6E V;  3O65 A;  3QTC A;  2DQ0 A;  4I55 A;  5LHI A;  4X20 B;  3RYF A;  4MVS A;  2IH3 C;  1L8D A;  1SQG A;  2QGN A;  3HR0 A;  4UUJ C;  4JI5 B;  1AP6 A;  1HNZ O;  4LH7 A;  2V1D A;  1DK1 A;  1DTO A;  1QNM A;  5GTI Z;  1IXB A;  3H1K H;  4O2A A;  2KSD A;  2UU9 O;  5IJ0 B;  2YSU B;  2WWW A;  4NTX A;  4DR2 O;  3VQX A;  1A32 A;  2E76 B;  5B3S B;  3W7U A;  2ZKO A;  1Q43 A;  3ASO B;  1NI8 A;  4DR5 B;  5EBM C;  3IJ4 A;  1IBL B;  1EBO A;  5IWA B;  1QCE A;  2A0L A;  4C7U A;  5GTH Z;  3SJQ C;  2CH7 A;  1CP9 A;  1OCZ C;  2XOK G;  3APO A;  3FFQ A;  1BS3 A;  1GN3 A;  4LF7 O;  4PDR A;  2CGO A;  1AI7 A;  3LNN A;  2GUZ A;  3ZHQ A;  4DRX A;  3FYE B;  4F6R A;  4H33 A;  2W0F C;  1H2L A;  3H01 A;  2VWK A;  4GLX A;  4O4H B;  4NR1 A;  4DR7 O;  2IJK A;  5FNV B;  1QU7 A;  3CCS V;  2PZS A;  4ICG A;  1F4N A;  3B4S A;  1NKD A;  3E8G A;  3CRM A;  3VQV A;  4BIO A;  3IC7 A;  1GMG A;  4DW1 A;  3E35 A;  4FMT A;  3JAL B;  2GHY A;  1SZX A;  4G2K A;  5LMU O;  5ITZ A;  1HNX B;  3W7S A;  2OCC C;  3OTF A;  4HBN A;  4IHJ A;  1K34 A;  2LW1 A;  1XNQ B;  2QM7 A;  5JH7 A;  1XBL A;  4J41 A;  2JEU A;  4B7E A;  5EIB D;  5KUM A;  5E1A C;  2JDI G;  4CH6 A;  1AJP A;  4OX9 B;  1ORQ C;  4O4J B;  3T4Z A;  2WLI A;  1W0J G;  1FFX B;  2EBO A;  4CS2 A;  5JJN B;  1OCZ B;  3ABU A;  4X1K B;  4O2B A;  4PA6 A;  3ZED A;  1SER A;  2EIK C;  1PKX A;  5KHJ A;  4IIJ B;  5C8Y B;  2QJ1 A;  1KKC A;  1VF5 B;  4PA7 A;  4DW0 A;  1JJ2 U;  3QVN A;  2RDC A;  3CCE V;  1M93 A;  5KA6 A;  1COW G;  1MMM A;  3H1I H;  4ZOL A;  3THO A;  3RYC B;  1IBK B;  1Q6U A;  5IY5 C;  1K33 A;  2Q9L A;  3RYH B;  5J2U A;  2FYU H;  4DR6 B;  2QWN B;  3CE2 A;  4L8J A;  1VQ6 V;  2XT9 A;  3UT5 B;  3JD4 A;  3RYI A;  2P22 C;  3MDS A;  1QHT A;  2OCC B;  2OT5 A;  3JAK B;  3AG7 A;  2P90 A;  4HNA A;  2F4V O;  1SET A;  3K08 A;  2JGD B;  1YZB A;  3STL C;  3QG5 A;  4H0L B;  4BR6 A;  2VQE B;  1XQ8 A;  1AJN A;  1GM7 A;  4DUZ O;  4DV0 B;  5JQG A;  2XAH A;  3DXR B;  2CTQ A;  3OD4 A;  4DXW A;  4MT8 A;  1MNG A;  4KXR A;  4GKK B;  4B3T B;  1HR0 O;  2DYS C;  1OJH A;  1WPB A;  4OPH A;  1IBM B;  2EIK B;  1THZ A;  3M99 B;  4R6Z A;  1VQO V;  4GCZ A;  1K7D A;  3CJH B;  1LR1 A;  3CC7 V;  1VF6 A;  2UXD O;  2OTL V;  4BWA A;  1Y6X A;  3CCR V;  5IT9 N;  4JYC A;  4YJ2 A;  1Q7Y W;  2PGG A;  2JVD A;  3Q4H A;  2HP8 A;  4GYC B;  1BQ0 A;  5IY5 B;  5CBF A;  4P9O A;  1YDX A;  2EX3 A;  5L3G A;  2YIB D;  4TV8 B;  4QGP A;  2QWQ B;  1AVM A;  5L3E A;  2ZD9 A;  4P30 A;  2QTS A;  1D2D A;  3CCQ V;  3HKC B;  4TT3 G;  2AW9 A;  1OCR C;  4XBF A;  1XEQ A;  2GDS A;  1N36 O;  2YEV B;  4JI4 B;  2DYR C;  3SR2 C;  3UO2 A;  3OT7 A;  4D7S A;  2BSK B;  1QR8 A;  2XAF A;  1SA0 A;  1BT8 A;  2ZDI C;  3K5O A;  2XAJ A;  4MVU A;  2Y48 A;  1GRJ A;  2DYS B;  2PTM A;  1SES A;  5IJ9 B;  3FB5 C;  4X65 O;  4F4L A;  3ABK C;  4X62 B;  5F2V O;  4DK0 A;  4BAY A;  2RCV A;  5B1O A;  3KG2 A;  1SQB H;  2EJ7 A;  1AI4 A;  1H8E G;  4DO2 A;  3SGI A;  1BGY H;  4DR5 O;  1IBL O;  2PY5 A;  2R9R B;  4J10 A;  2WA3 A;  2UXX A;  4ZHQ B;  2QM8 A;  4PI2 A;  4B3M O;  1HP8 A;  2LO1 A;  3D36 C;  4YJ3 B;  5H5N A;  2UXC O;  1HWY A;  1QLE C;  3OMI B;  1WP8 A;  3W7T A;  4B3R B;  2EIM C;  1OCR B;  1MZF A;  1JPX A;  5E79 Z;  2DYR B;  1FS0 G;  1HNZ B;  1Q86 W;  3TXS A;  1I08 A;  2XTA A;  3KZI Z;  1V9P A;  1EN6 A;  1S0V A;  5CA0 B;  2V7Q G;  5H6R A;  4I4T A;  2UU9 B;  3L73 H;  3KCX A;  1WP7 A;  2HVJ C;  1JX9 A;  2DQ3 A;  2YXH A;  1SQX H;  4UV8 A;  4KL1 A;  3ABK B;  3ZRV A;  4DR2 B;  3IGA C;  4TV9 A;  1YVW A;  3UCS C;  3AG1 C;  3I56 V;  4GZR B;  2OIE A;  4NB5 A;  1KC8 W;  3N2G A;  5A2Q N;  1NVP B;  4X66 O;  3U0Z A;  1J95 A;  2HVK C;  1Q5O A;  4OXS A;  4QJF B;  2HHH O;  4OX9 O;  5DN6 G;  1E79 G;  3RGB A;  2UXN A;  4X9Q A;  4PV1 B;  5K1X A;  3ABM C;  3JSL A;  4G27 B;  1AI6 A;  4L87 A;  4AHC A;  3H1L H;  1VQ9 V;  3SPI A;  2Q67 A;  2RNB A;  1VQ7 V;  2QR4 A;  1QLE B;  5EC2 C;  2W6J G;  4I9W A;  2HFE C;  1GN6 A;  2NR5 A;  1Q81 W;  2Q8V A;  2EIM B;  4EB6 B;  5JCO A;  4YHH O;  4FJC C;  1T5E A;  1IBK O;  3K57 A;  3D3Q A;  1BMF G;  4JTA B;  1V55 C;  1K73 W;  3P3P A;  2QM4 A;  2IU3 A;  4DR6 O;  3F5W C;  2LFS A;  5LMU B;  2H94 A;  4FIP C;  2QKA A;  3CEI A;  4U7O A;  3FAV B;  3AG1 B;  4DV4 O;  1G6U A;  4GUN A;  1LUW A;  4X89 A;  1YJ9 V;  4J9Z B;  3ZMT A;  4N21 A;  5IDJ A;  4WFA V;  1E1Q G;  2VQE O;  4FLU A;  1EZV H;  2A79 B;  4DV0 O;  2EZO A;  2QKS A;  1VQL V;  1YF2 A;  5FPR A;  2BE3 A;  3SPG A;  1FXK C;  4GKK O;  3SPJ A;  4U3J B;  3ABM B;  4OGQ B;  4B3T O;  4X8A A;  1M4U A;  1PL4 A;  1YIJ V;  2RQ6 A;  4X88 A;  2FML A;  2HJD A;  1Q90 D;  3LDE A;  4B3S B;  3T2M A;  1TVK B;  3H1J H;  3RT3 C;  2JJ2 G;  4ASU G;  4E4E A;  1Y76 A;  4PD4 F;  3ZJZ A;  1I94 B;  4LWS B;  1KP2 A;  1NTM H;  1B06 A;  5CMU A;  3ZMV A;  2H3O A;  4ZBM A;  2ZT9 B;  5KHI A;  4UVA A;  4RAI A;  4O4I A;  1V55 B;  5B5E Z;  4UV9 A;  4DR4 B;  5J2T A;  2ARH A;  2YXY A;  3E86 A;  3CP1 A;  2CK3 G;  5FL7 G;  2PYL A;  2VS0 A;  5KAF Z;  2YS8 A;  4U3F H;  2P6J A;  1R3J C;  1JQ0 A;  3QO5 A;  3SYA A;  2WLN A;  3L9D A;  4DUZ B;  1FD9 A;  1PM9 A;  2BTO A;  4I0X B;  3WG7 C;  2BTQ A;  1NQT A;  3ZN0 A;  1FXK B;  3CRR A;  5IYZ A;  4DK1 A;  3JD1 A;  5KMG B;  5CBG A;  1U97 A;  4LCU C;  4K35 A;  4YXW G;  1ZL8 A;  3E8F A;  4J7Z A;  1VQN V;  4R7C A;  2VRZ A;  4UFZ A;  4BW5 A;  3JAT B;  4NXN O;  1JR9 A;  1EM1 A;  1QBZ A;  1S5J A;  3C90 A;  3LDD A;  2K9P A;  4DV7 O;  3TK1 A;  1CXZ B;  4TSF G;  1SQF A;  1TAE A;  3IC9 A;  1BZK A;  5EZY A;  2QTO A;  5D5P A;  2X6A A;  5EK0 A;  1ZSP A;  2B5U A;  5JVD B;  3JAW B;  3K9A A;  2QDO A;  3L70 H;  1R6K A;  5LA6 B;  5IYC O;  1AR5 A;  2IH1 C;  1SKV A;  1KKD A;  5H6Q A;  3P32 A;  2BOC C;  3K5M A;  1VIB A;  1JJO A;  4UVB A;  2EIJ C;  2YIC A;  3A8T A;  3ZMS A;  1DF4 A;  2FTK A;  4B3R O;  4ZI7 B;  5TIS Z;  1N36 B;  4X20 A;  4JPR A;  4TUY B;  2BCC H;  5JJJ B;  3NR7 A;  3ML0 A;  2DE0 X;  3P3N A;  2QE7 G;  4QNH B;  2M7W A;  4PDL A;  2UUB O;  4K8Z A;  3WG7 B;  2P4V A;  3HKE A;  3A0R A;  5LOV B;  1P4R A;  1X59 A;  2IM9 A;  3JYC A;  1H2G A;  5IJ0 A;  2X0L A;  4X65 B;  2IJH A;  1XDC A;  3GB7 C;  3LDC A;  1SF9 A;  4WFF A;  4MTG A;  1XMQ O;  1NS1 A;  4WF9 V;  2KB1 A;  3OGC C;  4O2A B;  1AI5 A;  4MSW C;  3M8A A;  5CA1 B;  2KG7 B;  2YI8 A;  3I5D A;  3WB0 A;  3QNE A;  4FFB A;  4GX2 A;  1J5E B;  5AG2 A;  5FLX N;  2GTS A;  4I5S A;  5FPO A;  4CS3 A;  4B3M B;  4HAM A;  1VQ4 V;  3U10 A;  4X1I B;  1N32 O;  1IXM A;  2UXC B;  4DUY O;  1NBM G;  2EIJ B;  2K1E A;  3BAB A;  3BCC H;  2CH7 B;  1M56 C;  1PD3 A;  2V4D A;  3S3X A;  1VMG A;  3VQY A;  4O4H A;  1XL6 A;  3OMN B;  3SPC A;  3J80 N;  2Y4U A;  4ZIB A;  3AG2 C;  2KKW A;  2Y4T A;  2YC0 A;  1V54 C;  4DRX B;  1VEW A;  4F6R B;  1S3J A;  2QWO B;  1PPJ H;  1TUE B;  5L3F A;  4RQF A;  1G4Y B;  5H2F Z;  4FLX A;  2XAQ A;  3B8M A;  3CRC A;  4K8X A;  4RUF A;  4J42 A;  1F7Y A;  1XHX A;  2W0X A;  2CGN A;  2WA4 A;  4AIL C;  2A3Q A;  3ZN1 A;  1KUQ A;  1GTO A;  3JAS B;  2PYJ A;  4X66 B;  3PN1 A;  1Y66 A;  1H2K A;  1LUV A;  2LJ2 A;  2HHH B;  1P7B A;  3W7W A;  5ITZ B;  4O4J A;  4DV3 B;  3N27 A;  3GWO A;  3E8H A;  4NXM B;  2AZ0 A;  4IGG A;  1KBH A;  4FVM A;  4B3S O;  2CDY A;  4HZ3 A;  3IFX A;  1S5H C;  3T1C A;  3B8N A;  2N04 A;  2WLI B;  3B77 A;  4IT5 A;  5EC1 C;  1QLN A;  2Q7H A;  2XAG A;  4XDK A;  3FD9 A;  1R6T A;  1M56 B;  1I94 O;  3UKM A;  4JI0 B;  1U96 A;  4YHH B;  3AG2 B;  3OGI B;  1V54 B;  3FKS G;  3E8B A;  3RYC A;  1SRY A;  5JJE B;  3AK2 A;  1BCC H;  4LNU A;  1K8A W;  1Z5W A;  3RYH A;  4LFA B;  2MW2 B;  3T1H O;  1GAX A;  2Q0A A;  3N2K B;  4DR4 O;  3OTO B;  2VWJ A;  4ZOL B;  4DV4 B;  2ZNI A;  3T4D A;  2WSS G;  4FZ1 A;  3JAK A;  5J2U B;  3ABL C;  2JGD A;  3F7Y C;  4BIU A;  4X1Y B;  3BY6 A;  2Y0I A;  1JFF A;  1B04 A;  4FZ0 A;  1K5S A;  2JEX A;  2WLH A;  4HNA B;  4EEQ A;  3DXR A;  1EFR G;  5LMN B;  5C93 A;  4DV2 O;  3RVZ A;  1F4M A;  4I7Z B;  5JQG B;  1TUB A;  4CH3 A;  1H8H G;  1KQS U;  4J9Y B;  4JI1 B;  4O4L B;  5CN0 A;  5BY1 A;  4PA9 A;  2HKO A;  1WLE A;  3EHB B;  4LC1 A;  3HKD B;  2Q73 A;  1MOF A;  4FM1 A;  4EKW A;  1MAB G;  1H2N A;  4DV5 B;  4I50 A;  2HJF C;  5KLV H;  5L3D A;  4YJ2 B;  2DMX A;  2ETN A;  2R70 A;  3JAM N;  2ITD C;  3SYO A;  1YEW A;  1O9H A;  2IJJ A;  2LQT A;  3BEH A;  3Q4H B;  5GON B;  1XRE A;  1OHH G;  2ITC C;  3CB2 A;  1VF7 A;  2OCH A;  2Y69 C;  3HKC A;  1KEC A;  1HDJ A;  4DR1 B;  3ABL B;  2YEV A;  4U7N A;  2ATK C;  2EIL C;  2LW7 A;  3S3W A;  1XI1 A;  2BSK A;  2W6I G;  1L0N H;  1IUR A;  4JAS A;  1F23 A;  2ZE7 A;  4JI2 O;  3AK1 A;  1FYJ A;  3OMA B;  3ZHV A;  3G6B A;  4NXN B;  1N4C A;  2HLD G;  3OR6 C;  4YIO A;  3RVY A;  3SPH A;  4DYL A;  3X2Q C;  2WLK A;  4FLT A;  4NTY A;  4DV7 B;  2B1G A;  1GN4 A;  1PNL A;  3K5N A;  2P5O A;  1KD1 W;  4QE9 A;  1XL4 A;  3D8C A;  1PV0 A;  1H2S B;  1RSO A;  4Z2W A;  1J5E O;  1UFI A;  4JTD B;  1GO3 F;  2PI4 A;  4J7J A;  4ZHQ A;  2P67 A;  1QVF U;  3G71 V;  1L0L H;  4KHP O;  3ASN C;  3RBZ A;  1PP9 H;  4B08 A;  5CB4 B;  3IAY A;  1F51 A;  2Q7G A;  4LFC B;  5JWP A;  2Z5U A;  2Y69 B;  2QSA A;  2EIL B;  5B1A C;  4GX5 A;  2GTA A;  2CTR A;  2UUB B;  1S77 D;  5EBW C;  3ZS8 C;  4G28 B;  4MVR A;  5CA0 A;  1AB3 A;  1O9G A;  5LGT A;  4MS2 A;  1Y74 B;  5JCO C;  4FLY A;  1B3Q A;  3STZ C;  4QPJ A;  1MA1 A;  3K0D A;  1VQP V;  2WLL B;  1XMQ B;  3X2Q B;  3ZRS A;  2NN4 A;  4J80 A;  4N23 A;  4JI6 B;  1WA8 A;  1Q3E A;  1N33 B;  1AR4 A;  4TV9 B;  3FYI B;  3JCZ A;  1VAR A;  2OIG A;  4DV3 O;  1KMI Z;  4LF4 O;  2AHY A;  2IBZ H;  4NXM O;  4LF9 O;  2NNU A;  5BMV B;  2XHB A;  2UUA B;  2Q5Z A;  2QA4 V;  1WB7 A;  1N32 B;  4FM0 A;  3E83 A;  4DUY B;  3ASN B;  5KHG A;  2M6Y A;  4LF8 B;  3JD0 A;  1SZT A;  1R3L C;  3F7V C;  4JI0 O;  1VQK V;  3ZIA G;  3UO3 A;  4TQF A;  1ENV A;  3JD2 A;  2E75 B;  1N34 B;  4QIW F;  1ZUQ A;  5B1A B;  1WPX A;  1AP5 A;  3G4S V;  1SQV H;  1TGO A;  4K3A A;  4WBN B;  1M90 W;  5DEC A;  2A9H A;  2ZM6 O;  2JRI A;  2F43 G;  4H13 B;  1Z2G A;  2X6B A;  3MHS C;  2GV9 A;  4JYB A;  4LFA O;  2HEP A;  2AXT Z;  3MHH C;  5EYP B;  4WFH A;  3OTO O;  1N8R W;  3U11 A;  5LXT A;  1ZWI C;  1K4D C;  3FAV A;  3ZBH A;  3OEH G;  2FB5 A;  1Q6H A;  1Q82 W;  3K04 A;  3NXS A;  5LGU A;  1UPG A;  3UQ8 A;  3JCU Z;  2ZXW C;  1NJI W;  4MVO A;  3FX7 A;  5LMN O;  5B1B C;  3OAA G;  1TA8 A;  1DGS A;  4U3J A;  4W4L A;  5LYJ B;  3JD3 A;  1JOY A;  4JZ2 A;  3ZRW B;  1ROP A;  1RFY A;  4ZKI A;  4LF5 B;  4JI1 O;  1GN2 A;  1JA8 A; 
#chains in the Genus database with same CATH homology
 3R66 A;  4LF6 O;  2Z0A A;  1XMQ O;  1NS1 A;  4X62 O;  1R6T A;  1HNW O;  1G1X B;  1I94 O;  3M8A A;  2UXB O;  1XNR O;  4A5U B;  2F4V O;  2LW7 A;  4OPA A;  1AIL A;  4DR7 O;  4DR5 O;  1YZB A;  2VQF O;  4DV3 O;  4GKJ O;  5BXZ A;  4YHH O;  1IBL O;  1IBK O;  5FLX N;  4DUZ O;  4LF4 O;  4DV5 O;  4NXM O;  4LF9 O;  2AGA A;  4X64 O;  4AQY O;  2E5L O;  4JI2 O;  4B3M O;  3T1H O;  1FYJ A;  1N32 O;  1HR0 O;  4LF5 O;  4DR6 O;  4DR4 O;  4DUY O;  4OPH A;  4JI6 O;  4NXN O;  5H5N A;  2UXC O;  1IBM O;  4YY3 O;  5LMU O;  4JI0 O;  4DR1 O;  1N33 O;  4DV4 O;  4LFB O;  3O65 A;  4DV7 O;  1HNX O;  4DV1 O;  4DR3 O;  2UXD O;  3J80 N;  1XMO O;  2VQE O;  1J5E O;  1XNQ O;  5IT9 N;  4DV0 O;  4JV5 O;  3J81 N;  2ZM6 O;  2JRI A;  1HNZ O;  2UUA O;  4JI5 O;  1DK1 A;  3F5T A;  4GKK O;  2UUC O;  4LFA O;  4B3T O;  4JI3 O;  1R1B A;  4DV2 O;  4KHP O;  3OTO O;  5LL6 Y;  4LF8 O;  2UU9 O;  4JYA O;  1F7Y A;  4K0K O;  2FKX A;  4DR2 O;  1FKA O;  1N34 O;  1KUQ A;  4B3R O;  2N74 A;  1D2D A;  3RT3 C;  1A32 A;  4JI8 O;  5A2Q N;  1XEQ A;  5BY1 A;  4X66 O;  1N36 O;  1FJG O;  2ZKO A;  5BR8 O;  4JI4 O;  2HHH O;  4OX9 O;  2UUB O;  5LMN O;  2DOS A;  3J7A U;  4DV6 O;  3T1Y O;  1AB3 A;  3SDL A;  1X59 A;  5IWA O;  2DJV A;  4B3S O;  3JAM N;  4LFC O;  4X65 O;  4JI1 O;  4LF7 O;  4JI7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...