4DR4O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr4O00
4B3TO 1A32A 2AGAA 5H5NA 4DR3O 4LF6O 4YHHO 4NXMO 3SDLA 2VQFO 4LF8O 4B3MO 1HNZO 2LW7A 4DUZO 1FYJA 1AB3A 5LL6Y 2F4VO 2UXBO 2UXCO 2VQEO 1N36O 5LMNO 4X62O 1R1BA 4JI3O 5FLXN 4YY3O 1IBKO 1J5EO 2UUCO 3J7AU 4DV6O 2FKXA 1XEQA 4DR5O 4JI6O 4LF5O 2JRIA 4JV5O 4GKKO 3R66A 4LF7O 1R6TA 4KHPO 4X64O 4JI4O 2Z0AA 4DV4O 4X66O 1G1XB 4DR7O 4JI8O 4DV0O 3M8AA 1DK1A 1N34O 5IWAO 4B3RO 4DR4O 3J81N 4JI7O 1IBLO 4NXNO 4OPHA 1X59A 2N74A 4JI2O 2DOSA 1XMQO 5A2QN 4DV1O 3T1HO 1HR0O 4DR2O 4GKJO 1HNXO 5LMUO 4DV3O 4LFAO 1N32O 4AQYO 2UUBO 5IT9N 1I94O 4DV2O 1XNRO 1XMOO 4A5UB 4JYAO 4DUYO 5BR8O 4LFCO 1KUQA 4DR1O 3OTOO 1D2DA 4B3SO 1AILA 2E5LO 5BY1A 4DV5O 4K0KO 4DV7O 1N33O 1IBMO 1FJGO 4LF4O 1XNQO 4LFBO 3T1YO 3F5TA 2ZM6O 4OPAA 1HNWO 2UU9O 5BXZA 2UXDO 4JI0O 2ZKOA 4LF9O 4JI5O 1YZBA 3J80N 2HHHO 4X65O 4DR6O 3O65A 2DJVA 1NS1A 4JI1O 1FKAO 1F7YA 4OX9O 3RT3C 2UUAO 3JAMN
chains in the Genus database with same CATH superfamily
4AI8A 2AGAA 4FIPC 1G8MA 1M93A 3HKBA 2Q7GA 2QM4A 2VQFB 1K7DA 2PGGA 4J7ZA 4GYCB 1EN4A 1S77D 1HNXB 4G28B 2FTKA 2R9RB 5EK0A 1WA8A 1QR8A 1MZFA 4PDVA 4DV6O 3CRCA 5FPOA 3OM3B 4IHJB 4LH7A 3KZIZ 2KQXA 4X64O 3OE7G 3CXCU 1K34A 1M5IA 3P3PA 2VWKA 1PM9A 2QE7G 4DV0B 1Q90D 3IC7A 3JAKB 4QGPA 4PV1B 5FNVB 4DV1O 1M1KW 1PPJH 3HB3B 3CJHB 3OMAB 1H8EG 3AG3C 4FPPA 3H1HH 1K4DC 4Z2WA 4LFCB 2IU0A 3APQA 2Y4TA 3RVZA 4O4IA 1XQ8A 3ZEDA 1VQ9V 4B3TB 1IDSA 1OJHA 4X20A 2K1EA 4UB8Z 3JD1A 4QE9A 5EZYB 1FPOA 2KG7B 1OV9A 3ZRXA 4DXWA 2UU9B 5JWPA 1M57C 5J2UA 2Q0OC 3ZRWA 3CMAV 4RUFA 1N33B 5LXTB 3RYCA 2IU3A 2YUAA 2Y0PA 1JJOA 1AR1B 2D3OW 4TUYA 3ETEA 2AZ0A 2W0XA 4ASUG 1XMQB 4FFBA 5LA6B 1H2MA 1M57B 3O9OA 1VQ6V 4I5SA 5KMGB 4O4LA 1FD9A 1NZ6A 3FYIB 3ZN0A 4ZOLA 3BFRA 4DV2B 4TV8B 3ZHQA 2M7WA 1S72V 3WB2A 1ZUQA 4PDRA 2FKXA 4MVSA 4JI1B 1S3JA 1PP9H 1M9NA 3NXSA 1Y76B 1J95A 1JR9A 3TCUA 2CE4A 4BAYA 4NXMB 3CB2A 4LF8B 4I7ZB 4IYHA 3JALA 2AXTZ 5B5EZ 5JJEB 3IFXA 1IBMB 5IYZB 1S5LZ 4NKGB 1VMGA 1NBMG 3E22B 4G2KA 2NNUA 3H1IH 3D36A 5L3CA 1MSWD 1M4UA 4DV2O 4QE7A 2M6YA 5FL7G 2RCVA 3JAWB 3KCYA 2QSAA 5IE9A 3CYOA 2PI4A 1HNWB 1V9PA 2BTOA 4O4IB 1BHAA 1AI6A 5HFMA 4H0LB 4PJ0Z 4LP8A 5D5QA 3EFFK 4IIJA 2F1MA 3AG4B 3B40A 4GX1A 3T1YO 3K57A 5H6RA 4WBNB 1SQVH 1HNWO 1K8AW 2UU9O 2E74B 4J10A 4JV5B 2P5OA 3HR0A 4LF9O 2Q5ZA 4JI5O 4JAVA 3CC4V 3DGEA 1NR1A 3AK1A 3A0BZ 4JTDB 2RJZA 4X64B 3FD9A 1R73A 3PJSK 2QTOA 4DW1A 2YIBD 1TVKB 2PF4E 1G4YB 1TAEA 2RN9A 4JTAB 1FXKC 4WFEA 1XILA 3C90A 2A9HA 1Y74A 2F4VO 4FZ0A 1LR1A 4KUMA 1Y76A 3BA8A 2EINB 1JMKC 4DV5B 2LFSA 3RYFA 1J5EO 4CS3A 4D6TH 3L71H 2R9AA 5GONA 1NVPD 2OCHA 2O57A 5EZYA 1B6QA 2KKWA 4JZGA 4ZBMA 3N27A 4RQFA 4D7TA 4KHPB 1P7BA 5IWAO 1JVMA 2NR5A 2CTQA 4WFFA 4JI2B 4B3MB 1FXHA 2Q6AA 3BVOA 4O4HA 1LNQA 2QWNB 1Q86W 1JFFB 3CHXA 4K3AA 1VQ7V 1SQXH 4NB5A 4UUJC 3VBBA 2QWOB 3JSNA 1VQ5V 4WCEV 3E22A 1RP3B 4UXNA 5J2TA 4AQYO 4TV9B 2CDYA 4FLWA 1GTOA 1MOFA 4X9QA 4J7KA 2E3CA 3D3QA 2ZR2A 1NKDA 1RSOB 2ATKC 1B04A 3M99B 5LP6C 3OR6C 5LBQA 3KKYA 4J11A 1EBOA 2HHHO 2EX3A 4X65O 3K59A 5DECA 2ZE7A 4X1KA 2DW4A 4JI1O 4JTCB 3LNNA 4CC6A 3W7TA 2RQ6A 2F66C 2UUAO 4NXNB 3SYQA 3TETA 1PL4A 2PYJA 1E79G 3E8FA 3HKEB 4B08A 4X65B 3GVMA 2WLIA 3CX5F 4FLZA 2CK3G 1SRYA 4WFBV 2KG7A 3AG4C 2BTQA 3SJBC 2ITCC 2GSMB 5LMNO 3LSSA 3E8HA 1YITV 1IBKO 4KXRA 4JI6O 4BIUA 5B1AB 3SYAA 3SPIA 2YSUB 3CC7V 3K79A 4DV0O 3RYFB 3ZHSA 5DM6V 4BIOA 2LO1A 1N0NA 4UCOA 3EXAA 1XI1A 1BCCH 4JI6B 2EJ7A 1IBLO 2ZXWC 1KQSU 1YVWA 5CA1B 3I56V 1UFIA 2HVKC 2DOSA 1H2SB 1ZSPA 1VQPV 5EYPB 5B1OA 5IYDO 3UCSC 5BMVA 4JASA 5LMUO 4YJ2A 2WLMA 2Q0AA 4JYAB 1I94O 1XNRO 3ZHRA 5KHGA 1XNQB 2XAJA 4FLVA 4X1IB 5B3SB 3BABA 3CSXA 5JJJB 5KA5A 1AVMA 2E5LO 4QIWF 5CB4B 1XNQO 2Q69A 4LFBO 2WWWA 4IL6Z 4LF5B 3ZRVA 3C3SA 3G4SV 4NTYA 5BXZA 4FFKA 1GN3A 2JVDA 1CP9A 5IJ9B 1IBLB 4RUEA 3MD0A 1J5EB 3ZX6A 1SERA 2OT5A 2P4VA 4BW5A 4WFAV 4WFGA 4OX9O 2VQEB 3RT3C 3OEHG 3LNMB 3AK2A 1A32A 2P67A 3R65A 3ZMTA 2JEXA 3HKEA 1URFA 4QPJA 4B3MO 1AR4A 4O2BB 4DV7B 1Q82W 1BZKA 1YF2A 4CS2A 3CCSV 3ABMB 2KSDA 4HYOA 2JGDA 5TISZ 3T2MA 1R1BA 1OCCB 1NT2B 2JJ1G 4LF5O 2YIAA 1FFTB 4DV4O 5LYJA 3OUFA 4DR7O 5GONB 1EN5A 1YSCA 1H2NA 3A0RA 4NTXA 5JJNB 4WF9V 1VF6C 4OX9B 1WAZA 3RWRD 4OXSA 5LOVA 3JYCA 2IM9A 3CCEV 1K3EA 1ZAUA 4HZ3A 2GTAA 4YIOA 3U11A 1JQ0A 4CH5A 3BHPA 3G67A 1N32O 2LGWA 3JASA 4K35A 2ILMA 3SYCA 4BIZA 1OCZB 3ASOB 1XL6A 4PHZA 1FXVA 3QNEA 1GN4A 2LGQA 2JJ2G 3P3NA 1W0KG 1AR5A 1Q3EA 4X88A 4ZOLB 4I55A 1WA8B 3ABTA 3ETQA 3DXRA 1NQTA 2Y69C 3VQYA 2WLJA 1YJ9V 1YTFB 3TK1A 4DW0A 3RW0A 4L8JA 2ZXWB 4FM2A 1SQPH 3SGIA 1OCRC 1Y4MA 5JH7A 4BW9A 1NTZH 3FKSG 2JS5A 1KU9A 1WN7A 4B3RB 2QWPB 4UCRA 2OIEA 2QM7A 1M56B 4DO2A 2OIGA 3KCXA 4GKKO 1F51A 5IY5C 4JGSA 3ZS8C 4YY3B 3QO7A 2ZNJA 3H1KH 2AW9A 3RYHA 3L73H 4MVZA 2YICA 3GWOA 4DR4B 5BR8B 3IJ4A 4LFAB 5LHHA 2DWEC 3A0HZ 1AJNA 3ABLC 3H01A 5JH7B 3LSQA 3IAYA 3CCUV 1FS0G 4H44B 4DUYO 1AI7A 2Q7EA 4JI3B 2ZE6A 4U3FH 3SPGA 3ZIAG 1TA8A 5EYPA 1Z5VA 4DV5O 4KFMA 4DV7O 3CRQA 3CD6V 3OGCC 5LP6A 3K08A 1QLEC 3F5TA 2P22C 3ZMZA 4OPAA 3MAQA 4AHCA 3BPZA 3DC6A 5JVDA 3W7UA 1YCIA 4LNUB 2FYUH 2RDCA 5GTIZ 3B4SA 5H2FZ 5EBLC 5JCOC 4NR1A 1GM8A 1K73W 1FKAO 4J9ZB 1Q6UA 4X89A 3JCUZ 1YHQV 4JI7B 2X6BA 5CA0B 2V1DA 4JAAA 2UUBB 4ZIBA 3THOA 5BMVB 4O4HB 5B1NA 3CS5A 4DR5B 1TGOA 1JFFA 1M56C 1BL8A 2ADPA 5LL6Y 1YTFD 4PA7A 2PZSA 4YJ3B 1EZVH 2XUMA 1S5JA 5EC2C 1VQ4V 4MTOA 4FM1A 3JARB 1WNSA 5DEDA 4PELA 3DC5A 3FX7A 4HBNA 2IJIA 4MS2A 2XAQA 4ZI7B 2A79B 3DSQA 3M8AA 2Y69B 4FLXA 3CP1A 4IIJB 5CBFA 3K03A 1GM9A 4PI0A 2PYLA 4J9YB 1WLEA 4NVPA 1WP7A 3WFVA 3IGAC 1HNXO 1SA0A 3JSLA 2H8PC 1QVGU 5K1PA 4DV3B 3N2KA 1UJWB 2X0LA 3E83A 4GX0A 1PKXA 4LH6A 4DR7B 2MK3A 2HJFC 1SETA 1B3QA 1AILA 4LNUA 3RYIB 5BY1A 4EFEA 2L6LA 4RO2A 1DLBA 1JA8A 4PI2A 2ZM6O 4DV1B 4ZHQA 1OCOC 1P84F 2UXDO 3AG2B 5IJ9A 4G27B 3ZHTA 2DYSC 1QNMA 4J42A 4GUNA 2LJ2A 1BQ0A 3BEHA 3JAMN 1HP8A 5JVDB 3OMIB 3FB6C 4LF6O 3K9AA 2ARHA 4I50A 3BY6A 4RAIA 4CZZA 1SQFA 3FAVA 1YDXA 4J7JA 1ZWIC 1KBHA 2CUGA 2ZD9A 3CC2V 1JX9A 2YXLA 5CA1A 4PDLA 1GAXA 3RYCB 3SJCC 3VQWA 2JRIA 3TXQA 2PI5A 1AP5A 2UXDB 3R66A 1ZL8A 1NU1H 3STZC 5C8YB 4LFBB 4Q20A 3EHBB 2IH3C 1QU7A 1N34O 1W59A 4GCZA 5FPRA 2ZR3A 3J81N 1K5QA 4LR3A 3UM7A 2Q73A 3ABUA 4JI2O 1QCEA 2XHBA 4DR3B 1YEWA 5ITZA 1COWG 3SPHA 1GK9A 2QWQB 2EILC 5CB4A 3FB5C 4H37A 2OYQA 4N23A 2ZIMA 3LDDA 3OEEG 4JAUA 2H3OA 5KUKA 2N05A 4FFBB 3K5LA 5AG2A 3K04A 1MG1A 2Q7HA 1AP6A 3OUSA 4MVMA 3AG1C 2VRZA 1D2DA 3ETDA 1V54C 4B3SO 4TUYB 1KC8W 2YI9A 4H13B 3UO3A 1V55C 1L0NH 5E1AC 2B5UA 1IBMO 3ZRWB 4B7KA 5LYJB 1BE3H 1TUEB 2FB5A 2WAMA 5ITZB 1RM1C 1PV0A 2E5LB 1Y74B 4JPRA 3CPWU 3W7SA 1FXKB 1Q8IA 2HG5C 2WPDG 2UXXA 1I08A 1US6A 3UQ8A 1D5NA 2EIMB 3HKBB 3ZMVA 1Y6XA 3D36C 4X1IA 1IVSA 4YIPA 1HNZO 1K92A 1N32B 2YDEA 4JYBA 2RMKB 1K33A 3FB8C 2UXBO 5DN6G 2VQEO 1SA0B 4O4LB 5KX5A 1MMMA 3X2QB 1XEQA 3RBZA 1IURA 3RFRA 5CN0A 4XBFA 2B1GA 2ZNIA 3OMNB 4JI4O 1SQQH 4PA4A 4JI8O 4FLUA 4F6EA 2PTMA 1XL4A 1EFRG 3FFQA 5IJ0A 3RYHB 3OGIB 2DYRC 3T1HO 3UKMA 1SQGA 2DN9A 2WSSG 4O4JB 1XHZA 4JYCA 2LQTA 3SPCA 2XTAA 1Y66A 2A3QA 1YIJV 2QR4A 4JYAO 1GO3F 2NLJC 3CJHA 2Q68A 3ETGA 4JF3A 1R6KA 3OTOO 3ABMC 4TWKA 4W4KA 1BMFG 4L87A 5IJ0B 4JZ2A 5LOVB 4XDJA 2CTWA 1DF5A 2HFEC 4EKWA 2OTLV 1ZL8B 2GUZB 5EBMC 3WG7B 3LSUA 2EILB 3EVKA 3ZRSA 3T4ZA 1IXBA 3JATB 4P9PA 4HNAB 1ZTEA 4YHHO 3ASNC 1G6UA 1R3LC 3SDLA 5LA6A 2P7TC 1GM7A 4Q6GA 2DMXA 3OAAG 3CXHF 2LW1A 2ZIOA 3HKCB 3T1CA 1R3KC 2FMLA 4PDMA 5FLXN 4RWUA 1KMIZ 3BCCH 1PD3A 2OCCB 3VOUA 2B9ZA 1I5YA 4KHPO 4QNHB 1RPRA 1SQBH 3UO2A 3S3WA 4X1YB 1DK1A 1RPOA 1VQLV 3VQVA 1OCOB 3ZMUA 2XAFA 4DK0A 1EN6A 3TGUH 4LF7B 4HAMA 4DR2O 3CRRA 1GKFA 2QWRB 3I55V 4R6ZA 4ZKIA 3K5NA 4DV3O 1IBKB 2C2AA 4O2BA 4Z1MG 2ZINA 5C8YA 1S76D 4ICGA 4MW8A 1XMOO 2BE3A 4A5UB 1Q7YW 3M7MX 5BR8O 4YJ3A 3BAAA 5IY5B 4LFCO 2EZOA 3JAWA 3OTFA 2EIJC 1P7GA 1XREA 2YIBA 2OWOA 2X7RB 3QF7A 2YEVB 2X6AA 5FNVA 2UUCB 4MVRA 3LDCA 1N0JA 2ZKOA 4O2AB 1YZBA 1M90W 1LUWA 3SYPA 3ZBHA 4X1KB 2YS8A 1I94B 1F4MA 3B09A 4FK5C 2QJ1A 2GHYA 3JCZA 3J7AU 5EIBC 4B7EA 1CPYA 4HNAA 3E86A 3FB7C 3B8NA 5IDJA 2E76B 2GUZA 1XMOB 1ORQC 1L0LH 3AG1B 5LHIA 3CCJV 1VQMV 1ROPA 1HDJA 2JGDB 3STLC 3CCRV 3TJTA 4DUZO 2PY5A 4TV8A 3ZMSA 5D5PA 4TV9A 2XAGA 4I4TA 2WLIB 3CRAA 1NR7A 3N2KB 3WB1A 4PA9A 2UUCO 4DR1B 2LP7A 1R6NA 5A9GA 1RFYA 3GWKC 5EIBD 4JV5O 4UVAA 2HLDG 1AI4A 1I5XA 2IJHA 1R6TA 5KMGA 3E89A 2Q4PA 4AQYB 3H1JH 4JI7O 3RGBA 4ZHQB 2EIKC 3CCMV 2N74A 3B77A 2UXBB 3H1LH 5A2QN 2W6JG 3W7WA 3L74H 4MW3A 1IX9A 4LFAO 2DYSB 1P49A 1XBLA 1JCHA 4EFBA 5IT9N 2DQ0A 2ITDC 2ZE5A 4FLTA 2HP8A 2CGOA 5J2TB 4H33A 4D7SA 3G6EV 1VARA 3CCQV 4JI8B 4UV8A 2V4DA 2GBOA 4P2ZA 1R3IC 4LF4B 4K0KO 2BTQB 5J9PC 4PA3A 2Q67A 4TSFG 1MNGA 2QTSA 3ML0A 3ASNB 1PL0A 3JD4A 1F4NA 4TT3G 4LCUC 3SPJA 3C3TA 5B1BB 1KECA 1VF6A 2R9IA 3K06A 4DRXA 3AEIA 4MT8A 3WG7C 4B3TO 5KLVH 3CCLV 4DR3O 5KA6A 2VQFO 4LF8O 3ZN1A 1MABG 2LW7A 1FFXB 1FYJA 1RSOA 1QQCA 4FZ1A 4OGQB 1SC5B 2EJRA 4YJ2B 4X66B 1XOUA 1TVKA 4DUZB 1NJIW 1PNKA 5KX5B 2PUSA 2Y0IA 1X4TA 5LGTA 1ZX3A 2HEPA 4JI4B 2F95B 5H9CA 2BOCC 3OD4A 3FAVB 5LHGA 5KUMA 3D8CA 2BSKB 5JQGB 3F5WC 4IT5A 3B8MA 3A8TA 1KD1W 4FLYA 4WBNA 3B2EE 3KG2A 1EM1A 4U3JB 5KHKA 4EB6B 1FJGB 1K9MW 2A0LA 4I0XA 4LF6B 2XASA 1HR0O 4W4LA 3SR2C 3CWBH 2JEUA 2IW5A 2XAHA 1H38A 4I0XB 1NVPB 2EULA 1XDCA 2KB1A 1YI2V 5HFLA 5KAIZ 3X2QC 4LC1A 2DWDC 2EIJB 3L70H 4UCTA 2CH7A 1W2BU 1CXZB 1GN6A 4WFHA 2CTPA 1Q5OA 4X62B 4QJFB 1CEZA 1QBZA 3BRCA 3MHHC 2F4VB 4TQFA 4DR2B 3F7YC 1K97A 5CBGA 2GDSA 3PN1A 5E79Z 5KAFZ 1V54B 4B3SB 3SJAC 3O65A 4IHJA 5EC1C 1HR0B 1HNZB 4KP4A 1H2GA 1F23A 1WP8A 3L72H 4LBEC 1WB7A 4U7NA 1VQKV 4DV6B 1AI5A 1U96A 2ZE8A 3Q4HA 2UXCB 2F23A 3L75H 5IYBO 4O2AA 4E4EA 4PD4F 2WA3A 2GV9A 3WB0A 2D2CB 1JPXA 5LP6B 1WPBA 4JI5B 4X62O 4GT1A 3RYIA 2DE0X 3AG7A 3OTOB 4K8XA 1OCCC 2P06A 2XOKG 1NH2D 4CS4A 4TOIA 1OZ0A 2Q8VA 3N2GB 2Y48A 1VF7A 2A7WA 2UXNA 5KHJA 2FL4A 3P32A 3K0DA 4DR4O 2ODMA 2Z5UA 4R8CA 2P4KA 4OPHA 5LXTA 4FMTA 4I4TB 3HKCA 1SZTA 4EEQA 4MVOA 2HR3A 1XMQO 2QEXV 2BCCH 1K4CC 5C93A 2JIZG 2WLNA 2WLHA 1THZA 2QGNA 2WA4A 4J41A 1TUBA 5BZBA 2HJDA 5B3SC 2QKSA 2DYRB 2XT9A 2HVJC 2X6CA 3JD2A 1NH2B 3U0ZA 2CGNA 3W7XA 2XNDG 5B1AC 5L3BA 1DGSA 2VWJA 3DTUB 4U3JA 2IJKA 3AG2C 1W0JG 1Z2GA 3FYEB 3ASOC 1GRJA 1IXMA 5IYZA 1KP2A 1VEWA 2K9PA 4GX2A 3K58A 5LMNB 5GW7A 2AZ2A 2IH1C 2AHYA 2DJVA 3NR7A 1FAFA 3JASB 3H9VA 3CCVV 2R72A 1MSDA 3ZHVA 2Y4UA 1AJPA 5H5NA 4CBCA 1IZ3A 3IC9A 1D5AA 4ZI7A 1Q43A 3TXSA 4E2LA 4K0KB 4P30A 4GKKB 3E35A 3L9DA 2RNBA 2UXCO 1QR9A 2Q9LA 1BQZA 4DRXB 4NTWA 4YHHB 4JI3O 3ABKB 4YY3O 1RM1B 3U10A 3QG5A 4XDKA 3MDSA 1KB9F 2VS0A 1BS3A 3A2FA 4LF7O 3K0GA 4BR6A 2UUAB 2F93B 2Z0AA 3QTCA 1V55B 3OT7A 1G1XB 3UT5B 3OR7C 1L8DA 4B3RO 2EIMC 1Q6HA 3K9SA 4FM0A 3JAKA 1X59A 2N04A 4I50B 1BSMA 1SF9A 1I7FA 3K5OA 2QM8A 1BHBA 3E8GA 2P90A 3CRMA 1GH6A 2H94A 4UCSA 2P6JA 4J80A 2UUBO 2ZQMA 4MVQA 3ZJZA 2JS3A 3T1YB 4DYLA 2W0FC 5CMUA 1FFXA 1K5SA 1L1FA 2CAZC 4GLXA 1KUQA 4N21A 4EB6A 4U7OA 1GMGA 3OFNG 1SESA 1KYOF 3RVYA 5K1XA 4C7UA 3ZHUA 5L3DA 1FJGO 4LWSB 3D3IA 1SZXA 5JCOA 4GKJB 2JGUA 1XHXA 4ABMA 1B06A 1O9HA 4UCUA 1BT8A 2BSKA 3J80N 4X8AA 1QVFU 1NI8A 1YXBA 2CH7B 3HKDA 3JALB 3N2GA 4CH4A 4UB6Z 4UVCA 3QVNA 1F7YA 4MTFA 3DXRB 1NTKH 2B1IA 2ADQB 1XUQA 4MTGA 4CH3A 3HPLC 4PA6A 2ZDIC 2IBZH 1MZEA 2EIKB 4AILC 2YIDA 4GZRB 2HKOA 1JOYA 2Z3YA 3QO5A 3JD0A 5F2VO 1I0HA 1AB3A 1R3JC 5IYCO 1TUBB 1N36O 1DF4A 2CTRA 4JI0B 2YXHA 1VQ8V 4DR5O 1VQOV 2GTSA 2YI8A 4LF9B 2YEVA 5L3FA 1QHTA 5GTHZ 1VQNV 2A06H 4IGGA 4I9QA 2OTJV 1AJQA 3CEIA 4RQEA 1H2KA 1E1QG 1MA1A 4MTXA 1JJ2U 1YJWV 1VIBA 3GB7C 4UCVA 4UFZA 1N4CA 2QKAA 5J2UB 2AHZA 4UVBA 1S0VA 5EBWC 1SKVA 4GX5A 1N36B 3JARA 1P4RA 4R50A 1Q81W 3F7VC 3P30A 4IYIA 3E8BA 3ICXA 4DR1O 1OHHG 3APOA 3CE2A 4XDLA 2ZT9B 3JATA 1OCRB 1Z5WA 2MW2B 4QPKA 1S5HC 1T5EA 1U97A 2ZCEA 2E75B 4LWSA 1WJZA 5CA3A 1O9GA 1KKDA 3T1HB 1KP3A 5IWAB 1ZLZA 1WB8A 4Z1VA 2WLLB 2ETNA 3E2EA 3BA9A 4KL1A 1OCZC 4DR6O 4BWAA 1YJNV 2JK5C 2QA4V 1Y67A 3LUTB 3OW2U 4YXWG 3CMEV 4CH6A 4I55B 3LDEA 1PNMA 3WU2Z 1BGYH 4NXMO 3G6BA 2QDOA 1PNLA 4TQDA 4DR6B 1UPGA 4MSWC 5LMUB 5B1BC 4X20B 1NTMH 3K3WA 4UV9A 2IJJA 5CA0A 3JD3A 1XNRB 1HW7A 5LGUA 3G80A 5KHIA 2EZPA 1N34B 3VQXA 2OCCC 2EBOA 3I5DA 2ZM6B 3AK3A 5KHHA 1Q6IA 5L3GA 1SS3A 4F4LA 2HHHB 2JDIG 2YXYA 3ABLB 4X66O 1E1RG 4FVMA 5L3EA 3QO8A 3AG3B 1EZJA 1ENVA 1DTOA 3UT5A 4NXNO 4FJCC 1GN2A 4F6RB 4GKJO 2QKCA 3SYOA 4DK1A 1WPXA 4O4JA 1FXKA 2F43G 5B66Z 1VP7A 2EINC 1QLEB 5H6QA 2BOBC 2DQ3A 1LUVA 3K5MA 2R70A 3ABKC 2WLKA 1H2LA 1H8HG 3Q4HB 2YC0A 3G71V 2NN4A 4K8ZA 5JQGA 4MVUA 2L35A 1N8RW 4P9OA 4X1YA 1N33O 5CBHA 5LGNA 4LF4O 1HWYA 1KKCA 1AROP 1VF5B 3RN4A 3MHSC 4CC5A 4JI0O 4F6RA 4JYYA 2LFRA 3ZCCA 2WLLA 1QLNA 4R7CA 4DV4B 3S3XA 4NYKA 1NS1A 2W6IG 2V7QG 3SJQC 2ZDIA 4I9WA 4DUYB 3T4DA 3HKDB 2G38A
chains in the Genus database with same CATH topology
4B3TO 1A32A 2AGAA 5H5NA 4DR3O 4LF6O 4YHHO 4NXMO 3SDLA 2VQFO 4LF8O 4B3MO 1HNZO 2LW7A 4DUZO 1FYJA 1AB3A 5LL6Y 2F4VO 2UXBO 2UXCO 2VQEO 1N36O 5LMNO 4X62O 1R1BA 4JI3O 5FLXN 4YY3O 1IBKO 1J5EO 2UUCO 3J7AU 4DV6O 2FKXA 1XEQA 4DR5O 4JI6O 4LF5O 2JRIA 4JV5O 4GKKO 3R66A 4LF7O 1R6TA 4KHPO 4X64O 4JI4O 2Z0AA 4DV4O 4X66O 1G1XB 4DR7O 4JI8O 4DV0O 3M8AA 1DK1A 1N34O 5IWAO 4B3RO 4DR4O 3J81N 4JI7O 1IBLO 4NXNO 4OPHA 1X59A 2N74A 4JI2O 2DOSA 1XMQO 5A2QN 4DV1O 3T1HO 1HR0O 4DR2O 4GKJO 1HNXO 5LMUO 4DV3O 4LFAO 1N32O 4AQYO 2UUBO 5IT9N 1I94O 4DV2O 1XNRO 1XMOO 4A5UB 4JYAO 4DUYO 5BR8O 4LFCO 1KUQA 4DR1O 3OTOO 1D2DA 4B3SO 1AILA 2E5LO 5BY1A 4DV5O 4K0KO 4DV7O 1N33O 1IBMO 1FJGO 4LF4O 1XNQO 4LFBO 3T1YO 3F5TA 2ZM6O 4OPAA 1HNWO 2UU9O 5BXZA 2UXDO 4JI0O 2ZKOA 4LF9O 4JI5O 1YZBA 3J80N 2HHHO 4X65O 4DR6O 3O65A 2DJVA 1NS1A 4JI1O 1FKAO 1F7YA 4OX9O 3RT3C 2UUAO 3JAMN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  1A32 A;  2AGA A;  5H5N A;  4DR3 O;  4LF6 O;  4YHH O;  4NXM O;  3SDL A;  2VQF O;  4LF8 O;  4B3M O;  1HNZ O;  2LW7 A;  4DUZ O;  1FYJ A;  1AB3 A;  5LL6 Y;  2F4V O;  2UXB O;  2UXC O;  2VQE O;  1N36 O;  5LMN O;  4X62 O;  1R1B A;  4JI3 O;  5FLX N;  4YY3 O;  1IBK O;  1J5E O;  2UUC O;  3J7A U;  4DV6 O;  2FKX A;  1XEQ A;  4DR5 O;  4JI6 O;  4LF5 O;  2JRI A;  4JV5 O;  4GKK O;  3R66 A;  4LF7 O;  1R6T A;  4KHP O;  4X64 O;  4JI4 O;  2Z0A A;  4DV4 O;  4X66 O;  1G1X B;  4DR7 O;  4JI8 O;  4DV0 O;  3M8A A;  1DK1 A;  1N34 O;  5IWA O;  4B3R O;  4DR4 O;  3J81 N;  4JI7 O;  1IBL O;  4NXN O;  4OPH A;  1X59 A;  2N74 A;  4JI2 O;  2DOS A;  1XMQ O;  5A2Q N;  4DV1 O;  3T1H O;  1HR0 O;  4DR2 O;  4GKJ O;  1HNX O;  5LMU O;  4DV3 O;  4LFA O;  1N32 O;  4AQY O;  2UUB O;  5IT9 N;  1I94 O;  4DV2 O;  1XNR O;  1XMO O;  4A5U B;  4JYA O;  4DUY O;  5BR8 O;  4LFC O;  1KUQ A;  4DR1 O;  3OTO O;  1D2D A;  4B3S O;  1AIL A;  2E5L O;  5BY1 A;  4DV5 O;  4K0K O;  4DV7 O;  1N33 O;  1IBM O;  1FJG O;  4LF4 O;  1XNQ O;  4LFB O;  3T1Y O;  3F5T A;  2ZM6 O;  4OPA A;  1HNW O;  2UU9 O;  5BXZ A;  2UXD O;  4JI0 O;  2ZKO A;  4LF9 O;  4JI5 O;  1YZB A;  3J80 N;  2HHH O;  4X65 O;  4DR6 O;  3O65 A;  2DJV A;  1NS1 A;  4JI1 O;  1FKA O;  1F7Y A;  4OX9 O;  3RT3 C;  2UUA O;  3JAM N; 
#chains in the Genus database with same CATH topology
 4AI8 A;  2AGA A;  4FIP C;  1G8M A;  1M93 A;  3HKB A;  2Q7G A;  2QM4 A;  2VQF B;  1K7D A;  2PGG A;  4J7Z A;  4GYC B;  1EN4 A;  1S77 D;  1HNX B;  4G28 B;  2FTK A;  2R9R B;  5EK0 A;  1WA8 A;  1QR8 A;  1MZF A;  4PDV A;  4DV6 O;  3CRC A;  5FPO A;  3OM3 B;  4IHJ B;  4LH7 A;  3KZI Z;  2KQX A;  4X64 O;  3OE7 G;  3CXC U;  1K34 A;  1M5I A;  3P3P A;  2VWK A;  1PM9 A;  2QE7 G;  4DV0 B;  1Q90 D;  3IC7 A;  3JAK B;  4QGP A;  4PV1 B;  5FNV B;  4DV1 O;  1M1K W;  1PPJ H;  3HB3 B;  3CJH B;  3OMA B;  1H8E G;  3AG3 C;  4FPP A;  3H1H H;  1K4D C;  4Z2W A;  4LFC B;  2IU0 A;  3APQ A;  2Y4T A;  3RVZ A;  4O4I A;  1XQ8 A;  3ZED A;  1VQ9 V;  4B3T B;  1IDS A;  1OJH A;  4X20 A;  2K1E A;  4UB8 Z;  3JD1 A;  4QE9 A;  5EZY B;  1FPO A;  2KG7 B;  1OV9 A;  3ZRX A;  4DXW A;  2UU9 B;  5JWP A;  1M57 C;  5J2U A;  2Q0O C;  3ZRW A;  3CMA V;  4RUF A;  1N33 B;  5LXT B;  3RYC A;  2IU3 A;  2YUA A;  2Y0P A;  1JJO A;  1AR1 B;  2D3O W;  4TUY A;  3ETE A;  2AZ0 A;  2W0X A;  4ASU G;  1XMQ B;  4FFB A;  5LA6 B;  1H2M A;  1M57 B;  3O9O A;  1VQ6 V;  4I5S A;  5KMG B;  4O4L A;  1FD9 A;  1NZ6 A;  3FYI B;  3ZN0 A;  4ZOL A;  3BFR A;  4DV2 B;  4TV8 B;  3ZHQ A;  2M7W A;  1S72 V;  3WB2 A;  1ZUQ A;  4PDR A;  2FKX A;  4MVS A;  4JI1 B;  1S3J A;  1PP9 H;  1M9N A;  3NXS A;  1Y76 B;  1J95 A;  1JR9 A;  3TCU A;  2CE4 A;  4BAY A;  4NXM B;  3CB2 A;  4LF8 B;  4I7Z B;  4IYH A;  3JAL A;  2AXT Z;  5B5E Z;  5JJE B;  3IFX A;  1IBM B;  5IYZ B;  1S5L Z;  4NKG B;  1VMG A;  1NBM G;  3E22 B;  4G2K A;  2NNU A;  3H1I H;  3D36 A;  5L3C A;  1MSW D;  1M4U A;  4DV2 O;  4QE7 A;  2M6Y A;  5FL7 G;  2RCV A;  3JAW B;  3KCY A;  2QSA A;  5IE9 A;  3CYO A;  2PI4 A;  1HNW B;  1V9P A;  2BTO A;  4O4I B;  1BHA A;  1AI6 A;  5HFM A;  4H0L B;  4PJ0 Z;  4LP8 A;  5D5Q A;  3EFF K;  4IIJ A;  2F1M A;  3AG4 B;  3B40 A;  4GX1 A;  3T1Y O;  3K57 A;  5H6R A;  4WBN B;  1SQV H;  1HNW O;  1K8A W;  2UU9 O;  2E74 B;  4J10 A;  4JV5 B;  2P5O A;  3HR0 A;  4LF9 O;  2Q5Z A;  4JI5 O;  4JAV A;  3CC4 V;  3DGE A;  1NR1 A;  3AK1 A;  3A0B Z;  4JTD B;  2RJZ A;  4X64 B;  3FD9 A;  1R73 A;  3PJS K;  2QTO A;  4DW1 A;  2YIB D;  1TVK B;  2PF4 E;  1G4Y B;  1TAE A;  2RN9 A;  4JTA B;  1FXK C;  4WFE A;  1XIL A;  3C90 A;  2A9H A;  1Y74 A;  2F4V O;  4FZ0 A;  1LR1 A;  4KUM A;  1Y76 A;  3BA8 A;  2EIN B;  1JMK C;  4DV5 B;  2LFS A;  3RYF A;  1J5E O;  4CS3 A;  4D6T H;  3L71 H;  2R9A A;  5GON A;  1NVP D;  2OCH A;  2O57 A;  5EZY A;  1B6Q A;  2KKW A;  4JZG A;  4ZBM A;  3N27 A;  4RQF A;  4D7T A;  4KHP B;  1P7B A;  5IWA O;  1JVM A;  2NR5 A;  2CTQ A;  4WFF A;  4JI2 B;  4B3M B;  1FXH A;  2Q6A A;  3BVO A;  4O4H A;  1LNQ A;  2QWN B;  1Q86 W;  1JFF B;  3CHX A;  4K3A A;  1VQ7 V;  1SQX H;  4NB5 A;  4UUJ C;  3VBB A;  2QWO B;  3JSN A;  1VQ5 V;  4WCE V;  3E22 A;  1RP3 B;  4UXN A;  5J2T A;  4AQY O;  4TV9 B;  2CDY A;  4FLW A;  1GTO A;  1MOF A;  4X9Q A;  4J7K A;  2E3C A;  3D3Q A;  2ZR2 A;  1NKD A;  1RSO B;  2ATK C;  1B04 A;  3M99 B;  5LP6 C;  3OR6 C;  5LBQ A;  3KKY A;  4J11 A;  1EBO A;  2HHH O;  2EX3 A;  4X65 O;  3K59 A;  5DEC A;  2ZE7 A;  4X1K A;  2DW4 A;  4JI1 O;  4JTC B;  3LNN A;  4CC6 A;  3W7T A;  2RQ6 A;  2F66 C;  2UUA O;  4NXN B;  3SYQ A;  3TET A;  1PL4 A;  2PYJ A;  1E79 G;  3E8F A;  3HKE B;  4B08 A;  4X65 B;  3GVM A;  2WLI A;  3CX5 F;  4FLZ A;  2CK3 G;  1SRY A;  4WFB V;  2KG7 A;  3AG4 C;  2BTQ A;  3SJB C;  2ITC C;  2GSM B;  5LMN O;  3LSS A;  3E8H A;  1YIT V;  1IBK O;  4KXR A;  4JI6 O;  4BIU A;  5B1A B;  3SYA A;  3SPI A;  2YSU B;  3CC7 V;  3K79 A;  4DV0 O;  3RYF B;  3ZHS A;  5DM6 V;  4BIO A;  2LO1 A;  1N0N A;  4UCO A;  3EXA A;  1XI1 A;  1BCC H;  4JI6 B;  2EJ7 A;  1IBL O;  2ZXW C;  1KQS U;  1YVW A;  5CA1 B;  3I56 V;  1UFI A;  2HVK C;  2DOS A;  1H2S B;  1ZSP A;  1VQP V;  5EYP B;  5B1O A;  5IYD O;  3UCS C;  5BMV A;  4JAS A;  5LMU O;  4YJ2 A;  2WLM A;  2Q0A A;  4JYA B;  1I94 O;  1XNR O;  3ZHR A;  5KHG A;  1XNQ B;  2XAJ A;  4FLV A;  4X1I B;  5B3S B;  3BAB A;  3CSX A;  5JJJ B;  5KA5 A;  1AVM A;  2E5L O;  4QIW F;  5CB4 B;  1XNQ O;  2Q69 A;  4LFB O;  2WWW A;  4IL6 Z;  4LF5 B;  3ZRV A;  3C3S A;  3G4S V;  4NTY A;  5BXZ A;  4FFK A;  1GN3 A;  2JVD A;  1CP9 A;  5IJ9 B;  1IBL B;  4RUE A;  3MD0 A;  1J5E B;  3ZX6 A;  1SER A;  2OT5 A;  2P4V A;  4BW5 A;  4WFA V;  4WFG A;  4OX9 O;  2VQE B;  3RT3 C;  3OEH G;  3LNM B;  3AK2 A;  1A32 A;  2P67 A;  3R65 A;  3ZMT A;  2JEX A;  3HKE A;  1URF A;  4QPJ A;  4B3M O;  1AR4 A;  4O2B B;  4DV7 B;  1Q82 W;  1BZK A;  1YF2 A;  4CS2 A;  3CCS V;  3ABM B;  2KSD A;  4HYO A;  2JGD A;  5TIS Z;  3T2M A;  1R1B A;  1OCC B;  1NT2 B;  2JJ1 G;  4LF5 O;  2YIA A;  1FFT B;  4DV4 O;  5LYJ A;  3OUF A;  4DR7 O;  5GON B;  1EN5 A;  1YSC A;  1H2N A;  3A0R A;  4NTX A;  5JJN B;  4WF9 V;  1VF6 C;  4OX9 B;  1WAZ A;  3RWR D;  4OXS A;  5LOV A;  3JYC A;  2IM9 A;  3CCE V;  1K3E A;  1ZAU A;  4HZ3 A;  2GTA A;  4YIO A;  3U11 A;  1JQ0 A;  4CH5 A;  3BHP A;  3G67 A;  1N32 O;  2LGW A;  3JAS A;  4K35 A;  2ILM A;  3SYC A;  4BIZ A;  1OCZ B;  3ASO B;  1XL6 A;  4PHZ A;  1FXV A;  3QNE A;  1GN4 A;  2LGQ A;  2JJ2 G;  3P3N A;  1W0K G;  1AR5 A;  1Q3E A;  4X88 A;  4ZOL B;  4I55 A;  1WA8 B;  3ABT A;  3ETQ A;  3DXR A;  1NQT A;  2Y69 C;  3VQY A;  2WLJ A;  1YJ9 V;  1YTF B;  3TK1 A;  4DW0 A;  3RW0 A;  4L8J A;  2ZXW B;  4FM2 A;  1SQP H;  3SGI A;  1OCR C;  1Y4M A;  5JH7 A;  4BW9 A;  1NTZ H;  3FKS G;  2JS5 A;  1KU9 A;  1WN7 A;  4B3R B;  2QWP B;  4UCR A;  2OIE A;  2QM7 A;  1M56 B;  4DO2 A;  2OIG A;  3KCX A;  4GKK O;  1F51 A;  5IY5 C;  4JGS A;  3ZS8 C;  4YY3 B;  3QO7 A;  2ZNJ A;  3H1K H;  2AW9 A;  3RYH A;  3L73 H;  4MVZ A;  2YIC A;  3GWO A;  4DR4 B;  5BR8 B;  3IJ4 A;  4LFA B;  5LHH A;  2DWE C;  3A0H Z;  1AJN A;  3ABL C;  3H01 A;  5JH7 B;  3LSQ A;  3IAY A;  3CCU V;  1FS0 G;  4H44 B;  4DUY O;  1AI7 A;  2Q7E A;  4JI3 B;  2ZE6 A;  4U3F H;  3SPG A;  3ZIA G;  1TA8 A;  5EYP A;  1Z5V A;  4DV5 O;  4KFM A;  4DV7 O;  3CRQ A;  3CD6 V;  3OGC C;  5LP6 A;  3K08 A;  1QLE C;  3F5T A;  2P22 C;  3ZMZ A;  4OPA A;  3MAQ A;  4AHC A;  3BPZ A;  3DC6 A;  5JVD A;  3W7U A;  1YCI A;  4LNU B;  2FYU H;  2RDC A;  5GTI Z;  3B4S A;  5H2F Z;  5EBL C;  5JCO C;  4NR1 A;  1GM8 A;  1K73 W;  1FKA O;  4J9Z B;  1Q6U A;  4X89 A;  3JCU Z;  1YHQ V;  4JI7 B;  2X6B A;  5CA0 B;  2V1D A;  4JAA A;  2UUB B;  4ZIB A;  3THO A;  5BMV B;  4O4H B;  5B1N A;  3CS5 A;  4DR5 B;  1TGO A;  1JFF A;  1M56 C;  1BL8 A;  2ADP A;  5LL6 Y;  1YTF D;  4PA7 A;  2PZS A;  4YJ3 B;  1EZV H;  2XUM A;  1S5J A;  5EC2 C;  1VQ4 V;  4MTO A;  4FM1 A;  3JAR B;  1WNS A;  5DED A;  4PEL A;  3DC5 A;  3FX7 A;  4HBN A;  2IJI A;  4MS2 A;  2XAQ A;  4ZI7 B;  2A79 B;  3DSQ A;  3M8A A;  2Y69 B;  4FLX A;  3CP1 A;  4IIJ B;  5CBF A;  3K03 A;  1GM9 A;  4PI0 A;  2PYL A;  4J9Y B;  1WLE A;  4NVP A;  1WP7 A;  3WFV A;  3IGA C;  1HNX O;  1SA0 A;  3JSL A;  2H8P C;  1QVG U;  5K1P A;  4DV3 B;  3N2K A;  1UJW B;  2X0L A;  3E83 A;  4GX0 A;  1PKX A;  4LH6 A;  4DR7 B;  2MK3 A;  2HJF C;  1SET A;  1B3Q A;  1AIL A;  4LNU A;  3RYI B;  5BY1 A;  4EFE A;  2L6L A;  4RO2 A;  1DLB A;  1JA8 A;  4PI2 A;  2ZM6 O;  4DV1 B;  4ZHQ A;  1OCO C;  1P84 F;  2UXD O;  3AG2 B;  5IJ9 A;  4G27 B;  3ZHT A;  2DYS C;  1QNM A;  4J42 A;  4GUN A;  2LJ2 A;  1BQ0 A;  3BEH A;  3JAM N;  1HP8 A;  5JVD B;  3OMI B;  3FB6 C;  4LF6 O;  3K9A A;  2ARH A;  4I50 A;  3BY6 A;  4RAI A;  4CZZ A;  1SQF A;  3FAV A;  1YDX A;  4J7J A;  1ZWI C;  1KBH A;  2CUG A;  2ZD9 A;  3CC2 V;  1JX9 A;  2YXL A;  5CA1 A;  4PDL A;  1GAX A;  3RYC B;  3SJC C;  3VQW A;  2JRI A;  3TXQ A;  2PI5 A;  1AP5 A;  2UXD B;  3R66 A;  1ZL8 A;  1NU1 H;  3STZ C;  5C8Y B;  4LFB B;  4Q20 A;  3EHB B;  2IH3 C;  1QU7 A;  1N34 O;  1W59 A;  4GCZ A;  5FPR A;  2ZR3 A;  3J81 N;  1K5Q A;  4LR3 A;  3UM7 A;  2Q73 A;  3ABU A;  4JI2 O;  1QCE A;  2XHB A;  4DR3 B;  1YEW A;  5ITZ A;  1COW G;  3SPH A;  1GK9 A;  2QWQ B;  2EIL C;  5CB4 A;  3FB5 C;  4H37 A;  2OYQ A;  4N23 A;  2ZIM A;  3LDD A;  3OEE G;  4JAU A;  2H3O A;  5KUK A;  2N05 A;  4FFB B;  3K5L A;  5AG2 A;  3K04 A;  1MG1 A;  2Q7H A;  1AP6 A;  3OUS A;  4MVM A;  3AG1 C;  2VRZ A;  1D2D A;  3ETD A;  1V54 C;  4B3S O;  4TUY B;  1KC8 W;  2YI9 A;  4H13 B;  3UO3 A;  1V55 C;  1L0N H;  5E1A C;  2B5U A;  1IBM O;  3ZRW B;  4B7K A;  5LYJ B;  1BE3 H;  1TUE B;  2FB5 A;  2WAM A;  5ITZ B;  1RM1 C;  1PV0 A;  2E5L B;  1Y74 B;  4JPR A;  3CPW U;  3W7S A;  1FXK B;  1Q8I A;  2HG5 C;  2WPD G;  2UXX A;  1I08 A;  1US6 A;  3UQ8 A;  1D5N A;  2EIM B;  3HKB B;  3ZMV A;  1Y6X A;  3D36 C;  4X1I A;  1IVS A;  4YIP A;  1HNZ O;  1K92 A;  1N32 B;  2YDE A;  4JYB A;  2RMK B;  1K33 A;  3FB8 C;  2UXB O;  5DN6 G;  2VQE O;  1SA0 B;  4O4L B;  5KX5 A;  1MMM A;  3X2Q B;  1XEQ A;  3RBZ A;  1IUR A;  3RFR A;  5CN0 A;  4XBF A;  2B1G A;  2ZNI A;  3OMN B;  4JI4 O;  1SQQ H;  4PA4 A;  4JI8 O;  4FLU A;  4F6E A;  2PTM A;  1XL4 A;  1EFR G;  3FFQ A;  5IJ0 A;  3RYH B;  3OGI B;  2DYR C;  3T1H O;  3UKM A;  1SQG A;  2DN9 A;  2WSS G;  4O4J B;  1XHZ A;  4JYC A;  2LQT A;  3SPC A;  2XTA A;  1Y66 A;  2A3Q A;  1YIJ V;  2QR4 A;  4JYA O;  1GO3 F;  2NLJ C;  3CJH A;  2Q68 A;  3ETG A;  4JF3 A;  1R6K A;  3OTO O;  3ABM C;  4TWK A;  4W4K A;  1BMF G;  4L87 A;  5IJ0 B;  4JZ2 A;  5LOV B;  4XDJ A;  2CTW A;  1DF5 A;  2HFE C;  4EKW A;  2OTL V;  1ZL8 B;  2GUZ B;  5EBM C;  3WG7 B;  3LSU A;  2EIL B;  3EVK A;  3ZRS A;  3T4Z A;  1IXB A;  3JAT B;  4P9P A;  4HNA B;  1ZTE A;  4YHH O;  3ASN C;  1G6U A;  1R3L C;  3SDL A;  5LA6 A;  2P7T C;  1GM7 A;  4Q6G A;  2DMX A;  3OAA G;  3CXH F;  2LW1 A;  2ZIO A;  3HKC B;  3T1C A;  1R3K C;  2FML A;  4PDM A;  5FLX N;  4RWU A;  1KMI Z;  3BCC H;  1PD3 A;  2OCC B;  3VOU A;  2B9Z A;  1I5Y A;  4KHP O;  4QNH B;  1RPR A;  1SQB H;  3UO2 A;  3S3W A;  4X1Y B;  1DK1 A;  1RPO A;  1VQL V;  3VQV A;  1OCO B;  3ZMU A;  2XAF A;  4DK0 A;  1EN6 A;  3TGU H;  4LF7 B;  4HAM A;  4DR2 O;  3CRR A;  1GKF A;  2QWR B;  3I55 V;  4R6Z A;  4ZKI A;  3K5N A;  4DV3 O;  1IBK B;  2C2A A;  4O2B A;  4Z1M G;  2ZIN A;  5C8Y A;  1S76 D;  4ICG A;  4MW8 A;  1XMO O;  2BE3 A;  4A5U B;  1Q7Y W;  3M7M X;  5BR8 O;  4YJ3 A;  3BAA A;  5IY5 B;  4LFC O;  2EZO A;  3JAW A;  3OTF A;  2EIJ C;  1P7G A;  1XRE A;  2YIB A;  2OWO A;  2X7R B;  3QF7 A;  2YEV B;  2X6A A;  5FNV A;  2UUC B;  4MVR A;  3LDC A;  1N0J A;  2ZKO A;  4O2A B;  1YZB A;  1M90 W;  1LUW A;  3SYP A;  3ZBH A;  4X1K B;  2YS8 A;  1I94 B;  1F4M A;  3B09 A;  4FK5 C;  2QJ1 A;  2GHY A;  3JCZ A;  3J7A U;  5EIB C;  4B7E A;  1CPY A;  4HNA A;  3E86 A;  3FB7 C;  3B8N A;  5IDJ A;  2E76 B;  2GUZ A;  1XMO B;  1ORQ C;  1L0L H;  3AG1 B;  5LHI A;  3CCJ V;  1VQM V;  1ROP A;  1HDJ A;  2JGD B;  3STL C;  3CCR V;  3TJT A;  4DUZ O;  2PY5 A;  4TV8 A;  3ZMS A;  5D5P A;  4TV9 A;  2XAG A;  4I4T A;  2WLI B;  3CRA A;  1NR7 A;  3N2K B;  3WB1 A;  4PA9 A;  2UUC O;  4DR1 B;  2LP7 A;  1R6N A;  5A9G A;  1RFY A;  3GWK C;  5EIB D;  4JV5 O;  4UVA A;  2HLD G;  1AI4 A;  1I5X A;  2IJH A;  1R6T A;  5KMG A;  3E89 A;  2Q4P A;  4AQY B;  3H1J H;  4JI7 O;  3RGB A;  4ZHQ B;  2EIK C;  3CCM V;  2N74 A;  3B77 A;  2UXB B;  3H1L H;  5A2Q N;  2W6J G;  3W7W A;  3L74 H;  4MW3 A;  1IX9 A;  4LFA O;  2DYS B;  1P49 A;  1XBL A;  1JCH A;  4EFB A;  5IT9 N;  2DQ0 A;  2ITD C;  2ZE5 A;  4FLT A;  2HP8 A;  2CGO A;  5J2T B;  4H33 A;  4D7S A;  3G6E V;  1VAR A;  3CCQ V;  4JI8 B;  4UV8 A;  2V4D A;  2GBO A;  4P2Z A;  1R3I C;  4LF4 B;  4K0K O;  2BTQ B;  5J9P C;  4PA3 A;  2Q67 A;  4TSF G;  1MNG A;  2QTS A;  3ML0 A;  3ASN B;  1PL0 A;  3JD4 A;  1F4N A;  4TT3 G;  4LCU C;  3SPJ A;  3C3T A;  5B1B B;  1KEC A;  1VF6 A;  2R9I A;  3K06 A;  4DRX A;  3AEI A;  4MT8 A;  3WG7 C;  4B3T O;  5KLV H;  3CCL V;  4DR3 O;  5KA6 A;  2VQF O;  4LF8 O;  3ZN1 A;  1MAB G;  2LW7 A;  1FFX B;  1FYJ A;  1RSO A;  1QQC A;  4FZ1 A;  4OGQ B;  1SC5 B;  2EJR A;  4YJ2 B;  4X66 B;  1XOU A;  1TVK A;  4DUZ B;  1NJI W;  1PNK A;  5KX5 B;  2PUS A;  2Y0I A;  1X4T A;  5LGT A;  1ZX3 A;  2HEP A;  4JI4 B;  2F95 B;  5H9C A;  2BOC C;  3OD4 A;  3FAV B;  5LHG A;  5KUM A;  3D8C A;  2BSK B;  5JQG B;  3F5W C;  4IT5 A;  3B8M A;  3A8T A;  1KD1 W;  4FLY A;  4WBN A;  3B2E E;  3KG2 A;  1EM1 A;  4U3J B;  5KHK A;  4EB6 B;  1FJG B;  1K9M W;  2A0L A;  4I0X A;  4LF6 B;  2XAS A;  1HR0 O;  4W4L A;  3SR2 C;  3CWB H;  2JEU A;  2IW5 A;  2XAH A;  1H38 A;  4I0X B;  1NVP B;  2EUL A;  1XDC A;  2KB1 A;  1YI2 V;  5HFL A;  5KAI Z;  3X2Q C;  4LC1 A;  2DWD C;  2EIJ B;  3L70 H;  4UCT A;  2CH7 A;  1W2B U;  1CXZ B;  1GN6 A;  4WFH A;  2CTP A;  1Q5O A;  4X62 B;  4QJF B;  1CEZ A;  1QBZ A;  3BRC A;  3MHH C;  2F4V B;  4TQF A;  4DR2 B;  3F7Y C;  1K97 A;  5CBG A;  2GDS A;  3PN1 A;  5E79 Z;  5KAF Z;  1V54 B;  4B3S B;  3SJA C;  3O65 A;  4IHJ A;  5EC1 C;  1HR0 B;  1HNZ B;  4KP4 A;  1H2G A;  1F23 A;  1WP8 A;  3L72 H;  4LBE C;  1WB7 A;  4U7N A;  1VQK V;  4DV6 B;  1AI5 A;  1U96 A;  2ZE8 A;  3Q4H A;  2UXC B;  2F23 A;  3L75 H;  5IYB O;  4O2A A;  4E4E A;  4PD4 F;  2WA3 A;  2GV9 A;  3WB0 A;  2D2C B;  1JPX A;  5LP6 B;  1WPB A;  4JI5 B;  4X62 O;  4GT1 A;  3RYI A;  2DE0 X;  3AG7 A;  3OTO B;  4K8X A;  1OCC C;  2P06 A;  2XOK G;  1NH2 D;  4CS4 A;  4TOI A;  1OZ0 A;  2Q8V A;  3N2G B;  2Y48 A;  1VF7 A;  2A7W A;  2UXN A;  5KHJ A;  2FL4 A;  3P32 A;  3K0D A;  4DR4 O;  2ODM A;  2Z5U A;  4R8C A;  2P4K A;  4OPH A;  5LXT A;  4FMT A;  4I4T B;  3HKC A;  1SZT A;  4EEQ A;  4MVO A;  2HR3 A;  1XMQ O;  2QEX V;  2BCC H;  1K4C C;  5C93 A;  2JIZ G;  2WLN A;  2WLH A;  1THZ A;  2QGN A;  2WA4 A;  4J41 A;  1TUB A;  5BZB A;  2HJD A;  5B3S C;  2QKS A;  2DYR B;  2XT9 A;  2HVJ C;  2X6C A;  3JD2 A;  1NH2 B;  3U0Z A;  2CGN A;  3W7X A;  2XND G;  5B1A C;  5L3B A;  1DGS A;  2VWJ A;  3DTU B;  4U3J A;  2IJK A;  3AG2 C;  1W0J G;  1Z2G A;  3FYE B;  3ASO C;  1GRJ A;  1IXM A;  5IYZ A;  1KP2 A;  1VEW A;  2K9P A;  4GX2 A;  3K58 A;  5LMN B;  5GW7 A;  2AZ2 A;  2IH1 C;  2AHY A;  2DJV A;  3NR7 A;  1FAF A;  3JAS B;  3H9V A;  3CCV V;  2R72 A;  1MSD A;  3ZHV A;  2Y4U A;  1AJP A;  5H5N A;  4CBC A;  1IZ3 A;  3IC9 A;  1D5A A;  4ZI7 A;  1Q43 A;  3TXS A;  4E2L A;  4K0K B;  4P30 A;  4GKK B;  3E35 A;  3L9D A;  2RNB A;  2UXC O;  1QR9 A;  2Q9L A;  1BQZ A;  4DRX B;  4NTW A;  4YHH B;  4JI3 O;  3ABK B;  4YY3 O;  1RM1 B;  3U10 A;  3QG5 A;  4XDK A;  3MDS A;  1KB9 F;  2VS0 A;  1BS3 A;  3A2F A;  4LF7 O;  3K0G A;  4BR6 A;  2UUA B;  2F93 B;  2Z0A A;  3QTC A;  1V55 B;  3OT7 A;  1G1X B;  3UT5 B;  3OR7 C;  1L8D A;  4B3R O;  2EIM C;  1Q6H A;  3K9S A;  4FM0 A;  3JAK A;  1X59 A;  2N04 A;  4I50 B;  1BSM A;  1SF9 A;  1I7F A;  3K5O A;  2QM8 A;  1BHB A;  3E8G A;  2P90 A;  3CRM A;  1GH6 A;  2H94 A;  4UCS A;  2P6J A;  4J80 A;  2UUB O;  2ZQM A;  4MVQ A;  3ZJZ A;  2JS3 A;  3T1Y B;  4DYL A;  2W0F C;  5CMU A;  1FFX A;  1K5S A;  1L1F A;  2CAZ C;  4GLX A;  1KUQ A;  4N21 A;  4EB6 A;  4U7O A;  1GMG A;  3OFN G;  1SES A;  1KYO F;  3RVY A;  5K1X A;  4C7U A;  3ZHU A;  5L3D A;  1FJG O;  4LWS B;  3D3I A;  1SZX A;  5JCO A;  4GKJ B;  2JGU A;  1XHX A;  4ABM A;  1B06 A;  1O9H A;  4UCU A;  1BT8 A;  2BSK A;  3J80 N;  4X8A A;  1QVF U;  1NI8 A;  1YXB A;  2CH7 B;  3HKD A;  3JAL B;  3N2G A;  4CH4 A;  4UB6 Z;  4UVC A;  3QVN A;  1F7Y A;  4MTF A;  3DXR B;  1NTK H;  2B1I A;  2ADQ B;  1XUQ A;  4MTG A;  4CH3 A;  3HPL C;  4PA6 A;  2ZDI C;  2IBZ H;  1MZE A;  2EIK B;  4AIL C;  2YID A;  4GZR B;  2HKO A;  1JOY A;  2Z3Y A;  3QO5 A;  3JD0 A;  5F2V O;  1I0H A;  1AB3 A;  1R3J C;  5IYC O;  1TUB B;  1N36 O;  1DF4 A;  2CTR A;  4JI0 B;  2YXH A;  1VQ8 V;  4DR5 O;  1VQO V;  2GTS A;  2YI8 A;  4LF9 B;  2YEV A;  5L3F A;  1QHT A;  5GTH Z;  1VQN V;  2A06 H;  4IGG A;  4I9Q A;  2OTJ V;  1AJQ A;  3CEI A;  4RQE A;  1H2K A;  1E1Q G;  1MA1 A;  4MTX A;  1JJ2 U;  1YJW V;  1VIB A;  3GB7 C;  4UCV A;  4UFZ A;  1N4C A;  2QKA A;  5J2U B;  2AHZ A;  4UVB A;  1S0V A;  5EBW C;  1SKV A;  4GX5 A;  1N36 B;  3JAR A;  1P4R A;  4R50 A;  1Q81 W;  3F7V C;  3P30 A;  4IYI A;  3E8B A;  3ICX A;  4DR1 O;  1OHH G;  3APO A;  3CE2 A;  4XDL A;  2ZT9 B;  3JAT A;  1OCR B;  1Z5W A;  2MW2 B;  4QPK A;  1S5H C;  1T5E A;  1U97 A;  2ZCE A;  2E75 B;  4LWS A;  1WJZ A;  5CA3 A;  1O9G A;  1KKD A;  3T1H B;  1KP3 A;  5IWA B;  1ZLZ A;  1WB8 A;  4Z1V A;  2WLL B;  2ETN A;  3E2E A;  3BA9 A;  4KL1 A;  1OCZ C;  4DR6 O;  4BWA A;  1YJN V;  2JK5 C;  2QA4 V;  1Y67 A;  3LUT B;  3OW2 U;  4YXW G;  3CME V;  4CH6 A;  4I55 B;  3LDE A;  1PNM A;  3WU2 Z;  1BGY H;  4NXM O;  3G6B A;  2QDO A;  1PNL A;  4TQD A;  4DR6 B;  1UPG A;  4MSW C;  5LMU B;  5B1B C;  4X20 B;  1NTM H;  3K3W A;  4UV9 A;  2IJJ A;  5CA0 A;  3JD3 A;  1XNR B;  1HW7 A;  5LGU A;  3G80 A;  5KHI A;  2EZP A;  1N34 B;  3VQX A;  2OCC C;  2EBO A;  3I5D A;  2ZM6 B;  3AK3 A;  5KHH A;  1Q6I A;  5L3G A;  1SS3 A;  4F4L A;  2HHH B;  2JDI G;  2YXY A;  3ABL B;  4X66 O;  1E1R G;  4FVM A;  5L3E A;  3QO8 A;  3AG3 B;  1EZJ A;  1ENV A;  1DTO A;  3UT5 A;  4NXN O;  4FJC C;  1GN2 A;  4F6R B;  4GKJ O;  2QKC A;  3SYO A;  4DK1 A;  1WPX A;  4O4J A;  1FXK A;  2F43 G;  5B66 Z;  1VP7 A;  2EIN C;  1QLE B;  5H6Q A;  2BOB C;  2DQ3 A;  1LUV A;  3K5M A;  2R70 A;  3ABK C;  2WLK A;  1H2L A;  1H8H G;  3Q4H B;  2YC0 A;  3G71 V;  2NN4 A;  4K8Z A;  5JQG A;  4MVU A;  2L35 A;  1N8R W;  4P9O A;  4X1Y A;  1N33 O;  5CBH A;  5LGN A;  4LF4 O;  1HWY A;  1KKC A;  1ARO P;  1VF5 B;  3RN4 A;  3MHS C;  4CC5 A;  4JI0 O;  4F6R A;  4JYY A;  2LFR A;  3ZCC A;  2WLL A;  1QLN A;  4R7C A;  4DV4 B;  3S3X A;  4NYK A;  1NS1 A;  2W6I G;  2V7Q G;  3SJQ C;  2ZDI A;  4I9W A;  4DUY B;  3T4D A;  3HKD B;  2G38 A; 
#chains in the Genus database with same CATH homology
 4B3T O;  1A32 A;  2AGA A;  5H5N A;  4DR3 O;  4LF6 O;  4YHH O;  4NXM O;  3SDL A;  2VQF O;  4LF8 O;  4B3M O;  1HNZ O;  2LW7 A;  4DUZ O;  1FYJ A;  1AB3 A;  5LL6 Y;  2F4V O;  2UXB O;  2UXC O;  2VQE O;  1N36 O;  5LMN O;  4X62 O;  1R1B A;  4JI3 O;  5FLX N;  4YY3 O;  1IBK O;  1J5E O;  2UUC O;  3J7A U;  4DV6 O;  2FKX A;  1XEQ A;  4DR5 O;  4JI6 O;  4LF5 O;  2JRI A;  4JV5 O;  4GKK O;  3R66 A;  4LF7 O;  1R6T A;  4KHP O;  4X64 O;  4JI4 O;  2Z0A A;  4DV4 O;  4X66 O;  1G1X B;  4DR7 O;  4JI8 O;  4DV0 O;  3M8A A;  1DK1 A;  1N34 O;  5IWA O;  4B3R O;  4DR4 O;  3J81 N;  4JI7 O;  1IBL O;  4NXN O;  4OPH A;  1X59 A;  2N74 A;  4JI2 O;  2DOS A;  1XMQ O;  5A2Q N;  4DV1 O;  3T1H O;  1HR0 O;  4DR2 O;  4GKJ O;  1HNX O;  5LMU O;  4DV3 O;  4LFA O;  1N32 O;  4AQY O;  2UUB O;  5IT9 N;  1I94 O;  4DV2 O;  1XNR O;  1XMO O;  4A5U B;  4JYA O;  4DUY O;  5BR8 O;  4LFC O;  1KUQ A;  4DR1 O;  3OTO O;  1D2D A;  4B3S O;  1AIL A;  2E5L O;  5BY1 A;  4DV5 O;  4K0K O;  4DV7 O;  1N33 O;  1IBM O;  1FJG O;  4LF4 O;  1XNQ O;  4LFB O;  3T1Y O;  3F5T A;  2ZM6 O;  4OPA A;  1HNW O;  2UU9 O;  5BXZ A;  2UXD O;  4JI0 O;  2ZKO A;  4LF9 O;  4JI5 O;  1YZB A;  3J80 N;  2HHH O;  4X65 O;  4DR6 O;  3O65 A;  2DJV A;  1NS1 A;  4JI1 O;  1FKA O;  1F7Y A;  4OX9 O;  3RT3 C;  2UUA O;  3JAM N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...