4DR4O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr4O00
4OPHA 1AB3A 4JI0O 4DR4O 4DR5O 1N34O 4LF5O 2FKXA 5LL6Y 1HNWO 3JAMN 4X65O 5LMUO 1N36O 5IT9N 3J80N 5BY1A 1N33O 3RT3C 4DR1O 1IBMO 2UUCO 3J81N 2UXCO 5H5NA 4DV7O 1XNQO 4DUYO 1J5EO 4B3TO 3OTOO 4X66O 3T1YO 4JV5O 2F4VO 4NXMO 4DV0O 3SDLA 3O65A 5IWAO 4LF9O 4JI8O 1I94O 3M8AA 4LF7O 1IBLO 1AILA 3R66A 5LMNO 4LFBO 4KHPO 2UUBO 5FLXN 3F5TA 4LF4O 4B3SO 4DR3O 5BR8O 3J7AU 2Z0AA 2LW7A 1G1XB 1F7YA 4JI2O 2UU9O 2HHHO 4DV4O 4DV1O 2ZKOA 4B3MO 1HR0O 2VQEO 4X62O 4OX9O 4DR6O 4DR2O 4JI1O 4X64O 1KUQA 5BXZA 4DV2O 1R1BA 1R6TA 1FKAO 1NS1A 4LFCO 3T1HO 1DK1A 1A32A 4JI7O 4LF6O 4LFAO 4JI3O 4JI5O 2E5LO 4DV5O 4DV6O 4GKJO 2UUAO 4OPAA 1IBKO 2UXBO 1FYJA 1YZBA 1X59A 1XNRO 1D2DA 4GKKO 4K0KO 4JYAO 4YY3O 1XMOO 5A2QN 4JI4O 4DUZO 1N32O 4B3RO 4YHHO 4JI6O 2UXDO 1XMQO 1XEQA 4NXNO 2ZM6O 2JRIA 4LF8O 2N74A 1HNXO 4DR7O 2VQFO 4DV3O 2DOSA 1FJGO 2AGAA 4AQYO 2DJVA 4A5UB 1HNZO
chains in the Genus database with same CATH superfamily
4DR5O 3MHHC 1N34O 2FKXA 2JK5C 4TSFG 5H2FZ 2ZQMA 3JAMN 5LMUO 4JZ2A 2EIKC 2F23A 3N27A 4K8XA 1R73A 3IJ4A 5BMVA 4JASA 1UJWB 3JD3A 1S0VA 1BZKA 2AXTZ 3LSSA 4CC5A 1L1FA 1OHHG 4X1IB 5CB4B 2HHHB 4GLXA 1TVKB 4MTGA 2EBOA 5EYPB 1QNMA 4PDVA 4HAMA 2ITDC 1OCCB 3M8AA 4LCUC 1AVMA 2E5LB 2E76B 4MTFA 4WF9V 1N0NA 1DTOA 3A0BZ 3ZJZA 1JR9A 2DWDC 1K9MW 3AG3B 3GWOA 2IJHA 5B1NA 4FK5C 3K04A 3OM3B 2EULA 2ZR3A 2OCCC 3CRRA 1N32B 4YHHB 3FB7C 2LW7A 2OTJV 1F7YA 2GDSA 3AG1C 4TV9A 3HKBA 3RYCA 4MT8A 3U0ZA 1NTZH 4OX9O 2LGWA 3OR6C 4O4LB 1RP3B 2IJIA 3CE2A 4JI1O 4I55B 4DV2O 4TWKA 4QPJA 3MHSC 1HNWB 4G28B 1N36B 3K3WA 1QLEB 3AG2B 3ABMB 2UXBO 4DR1B 4KL1A 4F4LA 1IVSA 3D3IA 5KX5A 2ADQB 4K0KO 2L35A 3I56V 1K92A 4MVMA 3ML0A 4NTWA 3ABLC 3AEIA 3HKBB 4GCZA 4YJ3B 2OWOA 1N0JA 3F7VC 1GO3F 1EN5A 5CN0A 4JV5B 4LF8O 4MVQA 3UT5B 1TGOA 4XDJA 4P9OA 2DOSA 3D36C 2UU9B 1S77D 3AK3A 3JALA 4DR4O 4K8ZA 1B06A 3QF7A 3K0DA 3WG7C 1R3JC 2RNBA 3PJSK 4NB5A 1BHBA 3MAQA 1UPGA 4X1YB 3JAWB 3CCSV 4LC1A 4WBNB 4DV5B 2Y69C 3VOUA 1SESA 2JEXA 4CH3A 4PELA 4UCRA 2UXCO 4LH6A 5BR8B 4J80A 2HVKC 3N2KA 3JARA 1MA1A 4X66O 4AILC 4IT5A 1SZXA 1XDCA 3QO8A 4TV8B 2UXDB 1FD9A 3SDLA 4LF9O 3RYHA 2PI5A 2P5OA 1ZL8B 3LNNA 4J42A 5AG2A 5LP6C 1NTKH 1XBLA 1O9HA 2JS3A 2G38A 1BT8A 3R66A 5IY5B 1BE3H 4UB6Z 4GKKB 4MVRA 1K33A 2BSKB 5LOVA 2Q67A 3GB7C 1W0KG 1Q82W 2F93B 1SQGA 4K3AA 2E75B 5KA6A 2VQEO 1PNMA 1VF6A 1OCRC 4W4LA 4DR2O 2HVJC 4B08A 5JJJB 1H8EG 4ASUG 4JI5O 3G67A 3T1CA 4OPAA 2IJKA 1XQ8A 4TT3G 1IBKO 2ARHA 4ZKIA 4D7TA 1RM1C 1AROP 3OMNB 4MSWC 4FLWA 1VQLV 2PGGA 4JI6O 3IC7A 1H2SB 2CTPA 5JWPA 5IJ0A 1IXMA 4I7ZB 1VP7A 1L0NH 1TAEA 2ILMA 4UCTA 1I08A 5K1PA 1YI2V 3RVZA 2X0LA 2DQ0A 1BCCH 2A3QA 2YI9A 4IL6Z 4FJCC 3R65A 3K58A 2EZOA 4FZ0A 2EILB 1K34A 1R6NA 3ZHRA 2ZE7A 1CPYA 1V54C 4CH5A 2HFEC 3G4SV 5DEDA 2AZ2A 4WFAV 2QGNA 3IGAC 1SQFA 3JCUZ 1NZ6A 2CAZC 4JYCA 3ASNC 3JASA 2VWJA 2EX3A 2HR3A 1I94O 3AG4C 4IHJA 5EC1C 3EVKA 5LXTA 4G2KA 3WFVA 2R70A 3S3WA 3AK1A 1MOFA 2Q7GA 4FM2A 4LF4O 3ZHQA 1ZAUA 4DR3O 4B3RB 1QLEC 1RFYA 3ABMC 1G8MA 5LXTB 1D5AA 2ZXWC 3BCCH 5DM6V 1WPBA 2R72A 5KHIA 3T1YB 3VQXA 3T4ZA 2F4VB 4PDMA 5A9GA 2CGOA 4LFCO 3T1HO 4GX5A 4JI7O 4X65B 5FL7G 2MW2B 1P7GA 3RVYA 2WA3A 1TUBA 2PY5A 2YDEA 1Y76B 2P67A 4EB6A 5A2QN 1B6QA 1GTOA 1KMIZ 1U97A 3ZHVA 2XHBA 4DR7O 4UV9A 3BVOA 2ZCEA 5JJNB 2DE0X 5LL6Y 4P9PA 1I7FA 3SYQA 4J41A 3RYIA 1RPOA 1P49A 4LP8A 3FB6C 2HJDA 3BABA 4RQEA 2P90A 2LJ2A 1HDJA 3FFQA 3OFNG 1LUWA 2O57A 3P32A 3SPJA 1JPXA 3ABKC 4PV1B 4X62B 4F6RB 5IWAO 5LGNA 4JI8O 2DYSC 3E8HA 2H8PC 3K79A 2L6LA 4JI3B 3PN1A 3W7TA 3QVNA 5FNVB 2IM9A 4ZHQA 2UUBO 3W7UA 1VQ4V 4PA9A 2H94A 4PA6A 1QHTA 1F51A 2P22C 4J9YB 5D5PA 4O4IB 4CS3A 2Q9LA 1NTMH 4OXSA 2A79B 2H3OA 5EZYA 1IDSA 4DUYB 4TQDA 1BSMA 2EIKB 1WLEA 1VF6C 1R6KA 4DR6O 3B77A 4NTXA 1QR9A 5LA6B 3H1JH 4UVCA 3Q4HB 4GKJO 4O2AA 2UUAO 3E86A 2QM8A 3CB2A 1F4MA 4LNUB 5KLVH 4H44B 4O4JB 5J2TA 3LSQA 1NR1A 4D7SA 2E3CA 4DYLA 4JYYA 1XNQB 1XMOO 2YSUB 3HKEB 3W7WA 4B3TB 4JI4O 2EILC 2EZPA 1JOYA 4D6TH 4HBNA 2M6YA 3RBZA 3ZMVA 1YDXA 1Z5VA 1ZWIC 3SYAA 2OCCB 1AB3A 1KKCA 3NR7A 4BW5A 3K9SA 4ZI7B 3RN4A 4EEQA 3AG1B 4DV6B 1VQ5V 2F43G 4PI0A 5ITZA 4Q20A 2OTLV 3BPZA 2KSDA 3FYIB 4JZGA 1US6A 1K5QA 4GZRB 5JVDA 1CP9A 3L9DA 2IBZH 4FVMA 4NVPA 4FFKA 4DK1A 3T2MA 1BL8A 5GW7A 1TUEB 4QPKA 2IU3A 3EXAA 4ICGA 1SF9A 4FPPA 1CXZB 5D5QA 1AJNA 3FB5C 4L8JA 4FLXA 1MZEA 1YEWA 1Q90D 1N33B 2R9IA 4UVBA 1YIJV 5LGUA 1VQNV 3WG7B 3E22B 1MNGA 5J2UA 2VQFB 1GMGA 5LGTA 2Y69B 2Z5UA 3SPHA 3SJBC 4NXMB 4FMTA 2ZE8A 1YCIA 4GYCB 1H38A 2WLLA 5KAFZ 4PHZA 4TUYA 4EFBA 1RSOA 2CTQA 2GUZA 2UUCB 5HFLA 2LGQA 1XNRO 2M7WA 1D2DA 1U96A 1I5XA 3TK1A 2YS8A 1Q5OA 1VQPV 4KHPB 1MSDA 1ZSPA 3G6BA 1QLNA 4O4HB 3H01A 2JIZG 2P7TC 5LHGA 2XAJA 3CRMA 2R9RB 1PPJH 1MMMA 4BWAA 1S72V 1OCZC 3TETA 3A8TA 1KUQA 4PDLA 4HNAB 3F5WC 5IT9N 2A7WA 1VQOV 4JTDB 4MVOA 2JEUA 3OTFA 3K0GA 1FFXA 3CMAV 1OCRB 3FB8C 5DN6G 1GM7A 2Q6AA 1FS0G 5FPRA 3CD6V 2LFRA 5L3FA 3RYFB 2W6IG 3JD1A 1WAZA 3ZMUA 3JATA 2ZNJA 1VQ7V 4KFMA 1ZX3A 2N04A 4KUMA 1Y74B 5IJ9B 1WB7A 2FTKA 1RM1B 4MVUA 1FFXB 4LF7O 5L3EA 3QO5A 2WWWA 2WLHA 3BEHA 1HNZB 1WNSA 2GBOA 3CRQA 3ZRSA 4DR5B 3CSXA 2DWEC 1SZTA 1Z5WA 1YJWV 4JYAB 1L0LH 1FXVA 2RQ6A 3DXRA 2YXLA 2EJ7A 3THOA 4FFBA 2CTWA 1JA8A 1FXHA 4YIOA 2HHHO 4DV4O 1KP3A 4J9ZB 5BMVB 3OEHG 2LW1A 1FJGB 4EFEA 1V54B 5C93A 1NS1A 1VQ6V 3E35A 4Z2WA 2E5LO 1NH2B 2YIAA 4HZ3A 3N2GA 4MTXA 1QVGU 1FYJA 2AHYA 3ASNB 2IJJA 1E79G 4JYBA 2UXXA 3AG4B 1N32O 4YHHO 4RO2A 5IDJA 2QKSA 4FLTA 2QKCA 3JYCA 2QM4A 1QVFU 2N74A 4I4TA 3ZRWA 1WN7A 5EK0A 3N2GB 1B04A 4H0LB 4ZBMA 1YHQV 1NVPB 5KUKA 3MD0A 5LBQA 4JI1B 5C8YA 1HNWO 1N36O 4TV9B 2ZXWB 4E4EA 3RYCB 3APOA 3HR0A 3FX7A 4DR1O 1I0HA 2ZNIA 3SJCC 2UXBB 1H2NA 2LO1A 3FKSG 4DV7O 3SGIA 1VARA 1Y4MA 2QA4V 3APQA 3W7SA 5IYBO 2OYQA 4DW1A 2PUSA 4N21A 1VMGA 4JV5O 2B5UA 5KX5B 3QG5A 2CK3G 1V9PA 2Q8VA 4LF8B 2KG7A 3TJTA 4AI8A 3GWKC 1VQ8V 4LF6B 2JGUA 1NT2B 4DR4B 2KKWA 1S5JA 5KHJA 1H2LA 5FPOA 1YJNV 4JTAB 2QWNB 4HYOA 1UFIA 2WA4A 3JALB 4PA4A 1NU1H 5BR8O 2CE4A 3ZIAG 1Q6UA 1THZA 1KYOF 3QO7A 2UXCB 2XASA 3HPLC 3H9VA 1GH6A 3JD0A 2BOCC 3H1IH 4DV1O 4GX2A 1QCEA 4NKGB 3N2KB 3H1HH 1TA8A 2RMKB 3JARB 4JI0B 2QEXV 1SERA 1FXKA 1SKVA 2Y4TA 4ZIBA 2PF4E 1Q3EA 4P30A 1VQ9V 4QIWF 3B8NA 3ABKB 2A0LA 3RYHB 1VF5B 4GKKO 5EBMC 1M57C 3X2QC 3TCUA 2P06A 2QE7G 2DYSB 3VQVA 2OIGA 3G71V 2K1EA 1FAFA 3SJAC 3C3SA 2ZM6O 4JF3A 1P4RA 2PYLA 5LOVB 1HNXO 1H2KA 4J10A 5K1XA 2YIBA 1IBLB 1NI8A 3STLC 3WB0A 2WLJA 1Y67A 2NLJC 3WB2A 1IBKB 4BIZA 3P3PA 3ETQA 5H5NA 3OGCC 4MTOA 5B1AC 2BTOA 1NR7A 4JI6B 5TISZ 1Q6HA 1PM9A 3QNEA 2HEPA 1K97A 5F2VO 4U7NA 3DGEA 3DC5A 2CDYA 5CA0A 3ASOC 5IJ0B 1WA8A 2F66C 3KCXA 2D2CB 1KB9F 4MVSA 3BA8A 3K9AA 1R3IC 2NN4A 2JDIG 1SQPH 1XMQB 5HFMA 4ABMA 1M5IA 1G1XB 3B4SA 4UCOA 2YC0A 3WB1A 3M7MX 3H1LH 1M93A 1HR0O 3U10A 4I0XA 2YUAA 1M90W 1I94B 1M56C 1GN4A 4I50A 3JASB 1IBMB 1WP8A 4FIPC 5KHGA 1BQ0A 1OCOC 5B1BC 4IHJB 4BAYA 1VIBA 2JVDA 5EBWC 1SC5B 4DUZO 4B3RO 1EM1A 5IYZA 3G80A 3K57A 1KU9A 4ZOLA 3M99B 1NH2D 4LWSA 1EN6A 1JCHA 3ZX6A 1R3LC 4NR1A 3CCRV 3E8GA 4XDKA 1ENVA 4I9WA 2GV9A 4JTCB 3T4DA 4LF5O 2B1IA 4X65O 1H8HG 1QBZA 3GVMA 4U3JA 3T1HB 4YXWG 1I5YA 1KECA 5CBHA 3CXHF 4RQFA 3DSQA 2WLMA 4X20A 1YXBA 3NXSA 2P6JA 1NVPD 3OTOO 4B7EA 1QU7A 1TUBB 2WSSG 2F1MA 4IIJA 4B3MB 3OW2U 4EB6B 4X64B 2FL4A 5IYDO 3CCEV 3I5DA 4K35A 4LFAB 3B09A 3OE7G 1K8AW 4DW0A 1AR4A 3CJHA 2X6CA 4JAUA 4LFBO 1R3KC 3JCZA 1OCZB 2RDCA 3F5TA 2LFSA 4L87A 5E79Z 2WLIA 2RN9A 3BAAA 1ROPA 5CA3A 5LHHA 4NXNB 2NNUA 5LYJA 3RYIB 2ITCC 5CA1A 2CH7A 4CZZA 3JD4A 4DV3B 3ZS8C 4X62O 1X4TA 4UFZA 1YVWA 2ZIMA 3E83A 5IWAB 1FXKC 1Q43A 2Y4UA 4RUFA 1GN2A 3AG7A 4JI3O 2XOKG 4UV8A 2XAFA 5GONA 4UB8Z 1X59A 5LYJB 5H6RA 4JGSA 5CA1B 2X6AA 4QNHB 3H1KH 1H2MA 2DYRC 4YY3O 1J5EB 2UUBB 1GN6A 1JQ0A 1Q86W 3UQ8A 1N8RW 4R6ZA 4ZHQB 1GRJA 4QE7A 4DV0B 3OMIB 2JGDA 3LNMB 3L75H 4BIOA 4RUEA 2CGNA 2CTRA 2RJZA 1VQMV 4OPHA 4DR6B 2EIJC 5EZYB 5JCOA 3HKDA 4DK0A 1JFFA 2BCCH 2GHYA 2CUGA 3U11A 1YSCA 3OUFA 3ZHSA 1XNQO 2IU0A 4B3TO 4O2AB 1H2GA 2IW5A 4JI2B 1JMKC 4JI4B 5J2TB 4QGPA 5KMGA 3L73H 4UXNA 3MDSA 2GTSA 3TGUH 3ETGA 1QQCA 4KP4A 1YF2A 4RWUA 1SA0A 2B1GA 2ATKC 5FLXN 1GM9A 4J7ZA 3P3NA 1OJHA 5B5EZ 3CPWU 1VF7A 2A06H 2Z0AA 4MS2A 3CCMV 2XAQA 1GM8A 2Q69A 1XHXA 2Q0AA 4B7KA 5H9CA 3DTUB 4UCVA 5ITZB 4AQYB 1S3JA 5JH7A 2LQTA 3CXCU 1AP5A 1FFTB 5JVDB 1DF4A 3ZEDA 4WFBV 1XUQA 1AR5A 1V55C 3JAKA 2AW9A 3TXQA 3K08A 1K4DC 1BMFG 5IE9A 3CEIA 2R9AA 1AP6A 2EIMC 1NQTA 4O2BA 2JRIA 2VQFO 3FAVA 2YICA 2WLNA 4UCUA 3SYPA 5JQGA 1NBMG 2RCVA 2ADPA 4H13B 1Q7YW 1SS3A 4JAAA 1KKDA 4X1KA 5J2UB 2Q5ZA 5DECA 3C90A 2UUCO 3K5NA 4GT1A 1BGYH 5B3SC 2QR4A 5KHHA 4YJ2A 1XNRB 2WLLB 1LNQA 3LSUA 4TUYB 2OT5A 1RSOB 2GUZB 5EBLC 1QR8A 3DC6A 2Q0OC 1M57B 3X2QB 4GX0A 1P84F 1YTFB 1E1RG 3BA9A 3SPGA 2OCHA 5CMUA 1W2BU 5LMNO 4X89A 4CH6A 1EZJA 1XHZA 1OZ0A 3D8CA 4B3SO 1LR1A 2Z3YA 3ETDA 3E2EA 1NJIW 3CYOA 3W7XA 3EHBB 4XBFA 1BQZA 1CEZA 4LBEC 2XAHA 2QSAA 5KHKA 2QWOB 4R7CA 1N34B 3CS5A 2EINC 4CC6A 1YJ9V 2Q7HA 3JATB 5LMUB 4X1IA 1KQSU 4LF7B 2X6BA 5B1AB 5CB4A 3BRCA 1TVKA 4JYAO 5EYPA 1PNKA 1SQQH 1WB8A 2P4KA 1SETA 3ZN0A 1JJ2U 4BW9A 1XEQA 2DQ3A 3ASOB 1SRYA 1G6UA 3ABTA 3JD2A 3ZN1A 3K5LA 2ZE5A 3DXRB 3ETEA 1WP7A 1FJGO 4UVAA 4DV4B 3S3XA 3UKMA 3E89A 3L72H 4FFBB 5JCOC 1PV0A 3SPIA 1K7DA 1S5LZ 1O9GA 3CC7V 3J81N 4O4LA 2WPDG 3D3QA 4I55A 3OR7C 1W0JG 1EN4A 3B40A 2ZINA 1M56B 2QDOA 5CBFA 4OX9B 1OCOB 5B1BB 4DV2B 3LDDA 4BR6A 2IH3C 2FMLA 1IXBA 3CRCA 3ZHTA 4YJ3A 2W0FC 4PD4F 5J9PC 3SJQC 1AILA 4MVZA 1NKDA 1PKXA 4I4TB 3ZRWB 4K0KB 3OT7A 3UT5A 1Y66A 1GN3A 1XL6A 3IC9A 4QE9A 5L3CA 1MABG 5C8YB 3HKCA 4DV7B 3OUSA 1M4UA 2UU9O 3JAWA 4X1YA 4WBNA 2PI4A 1HW7A 1PL0A 3RFRA 4PA7A 1A32A 3L70H 1KBHA 4LF6O 4DV5O 2ODMA 1Q6IA 3HKCB 3FYEB 1YZBA 2KG7B 4TV8A 2XUMA 2HJFC 3L74H 4NTYA 1Q81W 4Z1MG 2VWKA 1ZL8A 4X66B 2ZR2A 1W59A 4U7OA 2V4DA 2UXDO 4LR3A 5H6QA 1Y6XA 2K9PA 2D3OW 3CCQV 4LF9B 2XNDG 2Y0IA 3P30A 2AGAA 2BSKA 3LDCA 4DV1B 4JI0O 2EJRA 3OEEG 2NR5A 3J80N 4H37A 5BY1A 4J7JA 1JVMA 3IFXA 5BZBA 1F23A 2AZ0A 1FXKB 2GTAA 3LUTB 2QTSA 5JJEB 3ZRXA 3ZMSA 2VQEB 5GTIZ 3O65A 2ZM6B 3WU2Z 4DR2B 3VQWA 1HNXB 2ZE6A 2DYRB 1YITV 3G6EV 4JI5B 1FPOA 4PDRA 5E1AC 1IBLO 4P2ZA 2FB5A 1KC8W 2Q4PA 5IYCO 4FLUA 1PL4A 1K73W 4IYIA 2ZDIA 1YTFD 2EIJB 3OMAB 1HWYA 3RWRD 1F4NA 5KA5A 3ICXA 2YIDA 2HLDG 1R1BA 1EBOA 1R6TA 3E8FA 3FD9A 4FLZA 3K5MA 1S76D 4UUJC 2HG5C 1OCCC 1VEWA 3CCUV 2B9ZA 4KXRA 5CA0B 1XMQO 3SPCA 4F6EA 1WA8B 2JJ2G 3CWBH 3AG3C 2PZSA 1HR0B 4A5UB 3UCSC 3CRAA 4FM1A 1AJQA 2ZD9A 2KB1A 4H33A 1AI6A 1MZFA 1RPRA 3JSNA 1OV9A 4I0XB 2V7QG 3RT3C 1XI1A 1IBMO 2VRZA 4LF4B 4N23A 2BE3A 4DR3B 4C7UA 4XDLA 4YIPA 1BHAA 1KD1W 5EIBC 4I50B 5L3GA 4DUZB 3T1YO 3AG2C 3QTCA 2F4VO 4RAIA 3CCVV 1N4CA 3C3TA 4Z1VA 1Y76A 4I5SA 1M1KW 1V55B 4LFCB 5IYZB 3O9OA 3K03A 3CC4V 4JI7B 4BIUA 2JJ1G 4ZOLB 1PD3A 1PP9H 2DMXA 4LWSB 2EIMB 4LF5B 2X7RB 1G4YB 3UM7A 1J95A 3CC2V 4J11A 4TQFA 2XT9A 2BTQA 1L8DA 3HB3B 2FYUH 2A9HA 4I9QA 1JJOA 2GSMB 4IGGA 4R50A 1GK9A 3KKYA 4U3JB 2QM7A 3CHXA 4DR7B 3OTOB 2ZKOA 4B3MO 4DXWA 3SR2C 5B3SB 4X20B 3SYOA 2WLKA 5EIBD 2Q68A 4X64O 1VQKV 1JX9A 2ETNA 4AHCA 4LFAO 1T5EA 2BTQB 2QWQB 1K4CC 4IIJB 2PYJA 4MW8A 5B66Z 1IX9A 4PI2A 3STZC 4R8CA 4F6RA 3RGBA 1M9NA 4LFBB 2QWRB 3F7YC 2IH1C 1IURA 3CJHB 2N05A 4NYKA 4NXNO 3CCJV 3K06A 1WJZA 5IY5C 1DGSA 3BHPA 5FNVA 4DV3O 1GKFA 4JI8B 2WLIB 1AI7A 1XOUA 1K5SA 2F95B 3K5OA 4FM0A 3KG2A 1XILA 1SQXH 2XTAA 4O4IA 2DN9A 3VQYA 1Z2GA 2CH7B 4LH7A 3ZCCA 4JPRA 2JS5A 1ORQC 4FLVA 2QKAA 4J7KA 3ABUA 3KZIZ 4WFHA 1B3QA 4DUYO 1J5EO 2EINB 1SQBH 2PTMA 5LA6A 4YY3B 5GONB 2Y0PA 2OIEA 1K3EA 3Q4HA 4LNUA 1WPXA 3CCLV 5KAIZ 3SYCA 4DV0O 2Q73A 1XL4A 4O4JA 3UO3A 4W4KA 1E1QG 2VS0A 2KQXA 3OAAG 3HKEA 4GKJB 2MK3A 2UUAB 4GX1A 2JGDB 4CS4A 4X9QA 4X88A 2WAMA 2YEVA 1XMOB 2ZDIC 2HKOA 4WFEA 1XREA 3L71H 3HKDB 1EFRG 1JFFB 3BFRA 4DRXA 1DLBA 4JI2O 4ZI7A 3ZMTA 2E74B 2W6JG 1AI4A 1AR1B 4PA3A 4FLYA 1FKAO 2YEVB 2YIBD 2Q7EA 3B8MA 4DV6O 3A2FA 5L3BA 1MG1A 1GAXA 4EKWA 5KMGB 4DRXB 4E2LA 2BOBC 4GUNA 3OD4A 3K59A 4U3FH 2QJ1A 3CX5F 1SQVH 1P7BA 2W0XA 4WFFA 1SA0B 1Q8IA 4X8AA 2P4VA 3RW0A 3A0RA 1IZ3A 2Y48A 4AQYO 3D36A 2DJVA 4IYHA 3E8BA 3VBBA 2AHZA 3ABLB 1DF5A 1ZUQA 2V1DA 1N33O 3E22A 1COWG 1KP2A 5KUMA 3ZMZA 4UCSA 5JH7B 1PNLA 3ZRVA 3I55V 2C2AA 3A0HZ 3LDEA 3IAYA 4NXMO 3TXSA 2LP7A 1AI5A 5EC2C 4MW3A 2ZIOA 1ZTEA 3JAKB 4Q6GA 2QWPB 2HP8A 2QTOA 4FZ1A 4O2BB 1EZVH 4CBCA 2YXYA 4O4HA 3BY6A 5LP6A 3FAVB 4KHPO 1D5NA 2XAGA 3UO2A 1MSWD 5JQGB 3J7AU 3CMEV 4X1KB 1HP8A 4HNAA 5LHIA 1AJPA 5LP6B 1LUVA 3EFFK 4YJ2B 1URFA 5B1OA 4OGQB 5BXZA 3JSLA 4TOIA 1DK1A 4QJFB 3KCYA 2UXNA 3RYFA 1BS3A 1ZLZA 4G27B 4CH4A 4WCEV 2DW4A 3ZBHA 1Y74A 5L3DA 5IJ9A 5LMNB 4DO2A 4JAVA 3OGIB 2YI8A 4B3SB 3AK2A 5GTHZ 5CBGA 3B2EE 2ZT9B 4PJ0Z 1S5HC 4WFGA 2YXHA 3ZHUA 3CP1A 4CS2A 1HNZO
chains in the Genus database with same CATH topology
4OPHA 1AB3A 4JI0O 4DR4O 4DR5O 1N34O 4LF5O 2FKXA 5LL6Y 1HNWO 3JAMN 4X65O 5LMUO 1N36O 5IT9N 3J80N 5BY1A 1N33O 3RT3C 4DR1O 1IBMO 2UUCO 3J81N 2UXCO 5H5NA 4DV7O 1XNQO 4DUYO 1J5EO 4B3TO 3OTOO 4X66O 3T1YO 4JV5O 2F4VO 4NXMO 4DV0O 3SDLA 3O65A 5IWAO 4LF9O 4JI8O 1I94O 3M8AA 4LF7O 1IBLO 1AILA 3R66A 5LMNO 4LFBO 4KHPO 2UUBO 5FLXN 3F5TA 4LF4O 4B3SO 4DR3O 5BR8O 3J7AU 2Z0AA 2LW7A 1G1XB 1F7YA 4JI2O 2UU9O 2HHHO 4DV4O 4DV1O 2ZKOA 4B3MO 1HR0O 2VQEO 4X62O 4OX9O 4DR6O 4DR2O 4JI1O 4X64O 1KUQA 5BXZA 4DV2O 1R1BA 1R6TA 1FKAO 1NS1A 4LFCO 3T1HO 1DK1A 1A32A 4JI7O 4LF6O 4LFAO 4JI3O 4JI5O 2E5LO 4DV5O 4DV6O 4GKJO 2UUAO 4OPAA 1IBKO 2UXBO 1FYJA 1YZBA 1X59A 1XNRO 1D2DA 4GKKO 4K0KO 4JYAO 4YY3O 1XMOO 5A2QN 4JI4O 4DUZO 1N32O 4B3RO 4YHHO 4JI6O 2UXDO 1XMQO 1XEQA 4NXNO 2ZM6O 2JRIA 4LF8O 2N74A 1HNXO 4DR7O 2VQFO 4DV3O 2DOSA 1FJGO 2AGAA 4AQYO 2DJVA 4A5UB 1HNZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  1AB3 A;  4JI0 O;  4DR4 O;  4DR5 O;  1N34 O;  4LF5 O;  2FKX A;  5LL6 Y;  1HNW O;  3JAM N;  4X65 O;  5LMU O;  1N36 O;  5IT9 N;  3J80 N;  5BY1 A;  1N33 O;  3RT3 C;  4DR1 O;  1IBM O;  2UUC O;  3J81 N;  2UXC O;  5H5N A;  4DV7 O;  1XNQ O;  4DUY O;  1J5E O;  4B3T O;  3OTO O;  4X66 O;  3T1Y O;  4JV5 O;  2F4V O;  4NXM O;  4DV0 O;  3SDL A;  3O65 A;  5IWA O;  4LF9 O;  4JI8 O;  1I94 O;  3M8A A;  4LF7 O;  1IBL O;  1AIL A;  3R66 A;  5LMN O;  4LFB O;  4KHP O;  2UUB O;  5FLX N;  3F5T A;  4LF4 O;  4B3S O;  4DR3 O;  5BR8 O;  3J7A U;  2Z0A A;  2LW7 A;  1G1X B;  1F7Y A;  4JI2 O;  2UU9 O;  2HHH O;  4DV4 O;  4DV1 O;  2ZKO A;  4B3M O;  1HR0 O;  2VQE O;  4X62 O;  4OX9 O;  4DR6 O;  4DR2 O;  4JI1 O;  4X64 O;  1KUQ A;  5BXZ A;  4DV2 O;  1R1B A;  1R6T A;  1FKA O;  1NS1 A;  4LFC O;  3T1H O;  1DK1 A;  1A32 A;  4JI7 O;  4LF6 O;  4LFA O;  4JI3 O;  4JI5 O;  2E5L O;  4DV5 O;  4DV6 O;  4GKJ O;  2UUA O;  4OPA A;  1IBK O;  2UXB O;  1FYJ A;  1YZB A;  1X59 A;  1XNR O;  1D2D A;  4GKK O;  4K0K O;  4JYA O;  4YY3 O;  1XMO O;  5A2Q N;  4JI4 O;  4DUZ O;  1N32 O;  4B3R O;  4YHH O;  4JI6 O;  2UXD O;  1XMQ O;  1XEQ A;  4NXN O;  2ZM6 O;  2JRI A;  4LF8 O;  2N74 A;  1HNX O;  4DR7 O;  2VQF O;  4DV3 O;  2DOS A;  1FJG O;  2AGA A;  4AQY O;  2DJV A;  4A5U B;  1HNZ O; 
#chains in the Genus database with same CATH topology
 4DR5 O;  3MHH C;  1N34 O;  2FKX A;  2JK5 C;  4TSF G;  5H2F Z;  2ZQM A;  3JAM N;  5LMU O;  4JZ2 A;  2EIK C;  2F23 A;  3N27 A;  4K8X A;  1R73 A;  3IJ4 A;  5BMV A;  4JAS A;  1UJW B;  3JD3 A;  1S0V A;  1BZK A;  2AXT Z;  3LSS A;  4CC5 A;  1L1F A;  1OHH G;  4X1I B;  5CB4 B;  2HHH B;  4GLX A;  1TVK B;  4MTG A;  2EBO A;  5EYP B;  1QNM A;  4PDV A;  4HAM A;  2ITD C;  1OCC B;  3M8A A;  4LCU C;  1AVM A;  2E5L B;  2E76 B;  4MTF A;  4WF9 V;  1N0N A;  1DTO A;  3A0B Z;  3ZJZ A;  1JR9 A;  2DWD C;  1K9M W;  3AG3 B;  3GWO A;  2IJH A;  5B1N A;  4FK5 C;  3K04 A;  3OM3 B;  2EUL A;  2ZR3 A;  2OCC C;  3CRR A;  1N32 B;  4YHH B;  3FB7 C;  2LW7 A;  2OTJ V;  1F7Y A;  2GDS A;  3AG1 C;  4TV9 A;  3HKB A;  3RYC A;  4MT8 A;  3U0Z A;  1NTZ H;  4OX9 O;  2LGW A;  3OR6 C;  4O4L B;  1RP3 B;  2IJI A;  3CE2 A;  4JI1 O;  4I55 B;  4DV2 O;  4TWK A;  4QPJ A;  3MHS C;  1HNW B;  4G28 B;  1N36 B;  3K3W A;  1QLE B;  3AG2 B;  3ABM B;  2UXB O;  4DR1 B;  4KL1 A;  4F4L A;  1IVS A;  3D3I A;  5KX5 A;  2ADQ B;  4K0K O;  2L35 A;  3I56 V;  1K92 A;  4MVM A;  3ML0 A;  4NTW A;  3ABL C;  3AEI A;  3HKB B;  4GCZ A;  4YJ3 B;  2OWO A;  1N0J A;  3F7V C;  1GO3 F;  1EN5 A;  5CN0 A;  4JV5 B;  4LF8 O;  4MVQ A;  3UT5 B;  1TGO A;  4XDJ A;  4P9O A;  2DOS A;  3D36 C;  2UU9 B;  1S77 D;  3AK3 A;  3JAL A;  4DR4 O;  4K8Z A;  1B06 A;  3QF7 A;  3K0D A;  3WG7 C;  1R3J C;  2RNB A;  3PJS K;  4NB5 A;  1BHB A;  3MAQ A;  1UPG A;  4X1Y B;  3JAW B;  3CCS V;  4LC1 A;  4WBN B;  4DV5 B;  2Y69 C;  3VOU A;  1SES A;  2JEX A;  4CH3 A;  4PEL A;  4UCR A;  2UXC O;  4LH6 A;  5BR8 B;  4J80 A;  2HVK C;  3N2K A;  3JAR A;  1MA1 A;  4X66 O;  4AIL C;  4IT5 A;  1SZX A;  1XDC A;  3QO8 A;  4TV8 B;  2UXD B;  1FD9 A;  3SDL A;  4LF9 O;  3RYH A;  2PI5 A;  2P5O A;  1ZL8 B;  3LNN A;  4J42 A;  5AG2 A;  5LP6 C;  1NTK H;  1XBL A;  1O9H A;  2JS3 A;  2G38 A;  1BT8 A;  3R66 A;  5IY5 B;  1BE3 H;  4UB6 Z;  4GKK B;  4MVR A;  1K33 A;  2BSK B;  5LOV A;  2Q67 A;  3GB7 C;  1W0K G;  1Q82 W;  2F93 B;  1SQG A;  4K3A A;  2E75 B;  5KA6 A;  2VQE O;  1PNM A;  1VF6 A;  1OCR C;  4W4L A;  4DR2 O;  2HVJ C;  4B08 A;  5JJJ B;  1H8E G;  4ASU G;  4JI5 O;  3G67 A;  3T1C A;  4OPA A;  2IJK A;  1XQ8 A;  4TT3 G;  1IBK O;  2ARH A;  4ZKI A;  4D7T A;  1RM1 C;  1ARO P;  3OMN B;  4MSW C;  4FLW A;  1VQL V;  2PGG A;  4JI6 O;  3IC7 A;  1H2S B;  2CTP A;  5JWP A;  5IJ0 A;  1IXM A;  4I7Z B;  1VP7 A;  1L0N H;  1TAE A;  2ILM A;  4UCT A;  1I08 A;  5K1P A;  1YI2 V;  3RVZ A;  2X0L A;  2DQ0 A;  1BCC H;  2A3Q A;  2YI9 A;  4IL6 Z;  4FJC C;  3R65 A;  3K58 A;  2EZO A;  4FZ0 A;  2EIL B;  1K34 A;  1R6N A;  3ZHR A;  2ZE7 A;  1CPY A;  1V54 C;  4CH5 A;  2HFE C;  3G4S V;  5DED A;  2AZ2 A;  4WFA V;  2QGN A;  3IGA C;  1SQF A;  3JCU Z;  1NZ6 A;  2CAZ C;  4JYC A;  3ASN C;  3JAS A;  2VWJ A;  2EX3 A;  2HR3 A;  1I94 O;  3AG4 C;  4IHJ A;  5EC1 C;  3EVK A;  5LXT A;  4G2K A;  3WFV A;  2R70 A;  3S3W A;  3AK1 A;  1MOF A;  2Q7G A;  4FM2 A;  4LF4 O;  3ZHQ A;  1ZAU A;  4DR3 O;  4B3R B;  1QLE C;  1RFY A;  3ABM C;  1G8M A;  5LXT B;  1D5A A;  2ZXW C;  3BCC H;  5DM6 V;  1WPB A;  2R72 A;  5KHI A;  3T1Y B;  3VQX A;  3T4Z A;  2F4V B;  4PDM A;  5A9G A;  2CGO A;  4LFC O;  3T1H O;  4GX5 A;  4JI7 O;  4X65 B;  5FL7 G;  2MW2 B;  1P7G A;  3RVY A;  2WA3 A;  1TUB A;  2PY5 A;  2YDE A;  1Y76 B;  2P67 A;  4EB6 A;  5A2Q N;  1B6Q A;  1GTO A;  1KMI Z;  1U97 A;  3ZHV A;  2XHB A;  4DR7 O;  4UV9 A;  3BVO A;  2ZCE A;  5JJN B;  2DE0 X;  5LL6 Y;  4P9P A;  1I7F A;  3SYQ A;  4J41 A;  3RYI A;  1RPO A;  1P49 A;  4LP8 A;  3FB6 C;  2HJD A;  3BAB A;  4RQE A;  2P90 A;  2LJ2 A;  1HDJ A;  3FFQ A;  3OFN G;  1LUW A;  2O57 A;  3P32 A;  3SPJ A;  1JPX A;  3ABK C;  4PV1 B;  4X62 B;  4F6R B;  5IWA O;  5LGN A;  4JI8 O;  2DYS C;  3E8H A;  2H8P C;  3K79 A;  2L6L A;  4JI3 B;  3PN1 A;  3W7T A;  3QVN A;  5FNV B;  2IM9 A;  4ZHQ A;  2UUB O;  3W7U A;  1VQ4 V;  4PA9 A;  2H94 A;  4PA6 A;  1QHT A;  1F51 A;  2P22 C;  4J9Y B;  5D5P A;  4O4I B;  4CS3 A;  2Q9L A;  1NTM H;  4OXS A;  2A79 B;  2H3O A;  5EZY A;  1IDS A;  4DUY B;  4TQD A;  1BSM A;  2EIK B;  1WLE A;  1VF6 C;  1R6K A;  4DR6 O;  3B77 A;  4NTX A;  1QR9 A;  5LA6 B;  3H1J H;  4UVC A;  3Q4H B;  4GKJ O;  4O2A A;  2UUA O;  3E86 A;  2QM8 A;  3CB2 A;  1F4M A;  4LNU B;  5KLV H;  4H44 B;  4O4J B;  5J2T A;  3LSQ A;  1NR1 A;  4D7S A;  2E3C A;  4DYL A;  4JYY A;  1XNQ B;  1XMO O;  2YSU B;  3HKE B;  3W7W A;  4B3T B;  4JI4 O;  2EIL C;  2EZP A;  1JOY A;  4D6T H;  4HBN A;  2M6Y A;  3RBZ A;  3ZMV A;  1YDX A;  1Z5V A;  1ZWI C;  3SYA A;  2OCC B;  1AB3 A;  1KKC A;  3NR7 A;  4BW5 A;  3K9S A;  4ZI7 B;  3RN4 A;  4EEQ A;  3AG1 B;  4DV6 B;  1VQ5 V;  2F43 G;  4PI0 A;  5ITZ A;  4Q20 A;  2OTL V;  3BPZ A;  2KSD A;  3FYI B;  4JZG A;  1US6 A;  1K5Q A;  4GZR B;  5JVD A;  1CP9 A;  3L9D A;  2IBZ H;  4FVM A;  4NVP A;  4FFK A;  4DK1 A;  3T2M A;  1BL8 A;  5GW7 A;  1TUE B;  4QPK A;  2IU3 A;  3EXA A;  4ICG A;  1SF9 A;  4FPP A;  1CXZ B;  5D5Q A;  1AJN A;  3FB5 C;  4L8J A;  4FLX A;  1MZE A;  1YEW A;  1Q90 D;  1N33 B;  2R9I A;  4UVB A;  1YIJ V;  5LGU A;  1VQN V;  3WG7 B;  3E22 B;  1MNG A;  5J2U A;  2VQF B;  1GMG A;  5LGT A;  2Y69 B;  2Z5U A;  3SPH A;  3SJB C;  4NXM B;  4FMT A;  2ZE8 A;  1YCI A;  4GYC B;  1H38 A;  2WLL A;  5KAF Z;  4PHZ A;  4TUY A;  4EFB A;  1RSO A;  2CTQ A;  2GUZ A;  2UUC B;  5HFL A;  2LGQ A;  1XNR O;  2M7W A;  1D2D A;  1U96 A;  1I5X A;  3TK1 A;  2YS8 A;  1Q5O A;  1VQP V;  4KHP B;  1MSD A;  1ZSP A;  3G6B A;  1QLN A;  4O4H B;  3H01 A;  2JIZ G;  2P7T C;  5LHG A;  2XAJ A;  3CRM A;  2R9R B;  1PPJ H;  1MMM A;  4BWA A;  1S72 V;  1OCZ C;  3TET A;  3A8T A;  1KUQ A;  4PDL A;  4HNA B;  3F5W C;  5IT9 N;  2A7W A;  1VQO V;  4JTD B;  4MVO A;  2JEU A;  3OTF A;  3K0G A;  1FFX A;  3CMA V;  1OCR B;  3FB8 C;  5DN6 G;  1GM7 A;  2Q6A A;  1FS0 G;  5FPR A;  3CD6 V;  2LFR A;  5L3F A;  3RYF B;  2W6I G;  3JD1 A;  1WAZ A;  3ZMU A;  3JAT A;  2ZNJ A;  1VQ7 V;  4KFM A;  1ZX3 A;  2N04 A;  4KUM A;  1Y74 B;  5IJ9 B;  1WB7 A;  2FTK A;  1RM1 B;  4MVU A;  1FFX B;  4LF7 O;  5L3E A;  3QO5 A;  2WWW A;  2WLH A;  3BEH A;  1HNZ B;  1WNS A;  2GBO A;  3CRQ A;  3ZRS A;  4DR5 B;  3CSX A;  2DWE C;  1SZT A;  1Z5W A;  1YJW V;  4JYA B;  1L0L H;  1FXV A;  2RQ6 A;  3DXR A;  2YXL A;  2EJ7 A;  3THO A;  4FFB A;  2CTW A;  1JA8 A;  1FXH A;  4YIO A;  2HHH O;  4DV4 O;  1KP3 A;  4J9Z B;  5BMV B;  3OEH G;  2LW1 A;  1FJG B;  4EFE A;  1V54 B;  5C93 A;  1NS1 A;  1VQ6 V;  3E35 A;  4Z2W A;  2E5L O;  1NH2 B;  2YIA A;  4HZ3 A;  3N2G A;  4MTX A;  1QVG U;  1FYJ A;  2AHY A;  3ASN B;  2IJJ A;  1E79 G;  4JYB A;  2UXX A;  3AG4 B;  1N32 O;  4YHH O;  4RO2 A;  5IDJ A;  2QKS A;  4FLT A;  2QKC A;  3JYC A;  2QM4 A;  1QVF U;  2N74 A;  4I4T A;  3ZRW A;  1WN7 A;  5EK0 A;  3N2G B;  1B04 A;  4H0L B;  4ZBM A;  1YHQ V;  1NVP B;  5KUK A;  3MD0 A;  5LBQ A;  4JI1 B;  5C8Y A;  1HNW O;  1N36 O;  4TV9 B;  2ZXW B;  4E4E A;  3RYC B;  3APO A;  3HR0 A;  3FX7 A;  4DR1 O;  1I0H A;  2ZNI A;  3SJC C;  2UXB B;  1H2N A;  2LO1 A;  3FKS G;  4DV7 O;  3SGI A;  1VAR A;  1Y4M A;  2QA4 V;  3APQ A;  3W7S A;  5IYB O;  2OYQ A;  4DW1 A;  2PUS A;  4N21 A;  1VMG A;  4JV5 O;  2B5U A;  5KX5 B;  3QG5 A;  2CK3 G;  1V9P A;  2Q8V A;  4LF8 B;  2KG7 A;  3TJT A;  4AI8 A;  3GWK C;  1VQ8 V;  4LF6 B;  2JGU A;  1NT2 B;  4DR4 B;  2KKW A;  1S5J A;  5KHJ A;  1H2L A;  5FPO A;  1YJN V;  4JTA B;  2QWN B;  4HYO A;  1UFI A;  2WA4 A;  3JAL B;  4PA4 A;  1NU1 H;  5BR8 O;  2CE4 A;  3ZIA G;  1Q6U A;  1THZ A;  1KYO F;  3QO7 A;  2UXC B;  2XAS A;  3HPL C;  3H9V A;  1GH6 A;  3JD0 A;  2BOC C;  3H1I H;  4DV1 O;  4GX2 A;  1QCE A;  4NKG B;  3N2K B;  3H1H H;  1TA8 A;  2RMK B;  3JAR B;  4JI0 B;  2QEX V;  1SER A;  1FXK A;  1SKV A;  2Y4T A;  4ZIB A;  2PF4 E;  1Q3E A;  4P30 A;  1VQ9 V;  4QIW F;  3B8N A;  3ABK B;  2A0L A;  3RYH B;  1VF5 B;  4GKK O;  5EBM C;  1M57 C;  3X2Q C;  3TCU A;  2P06 A;  2QE7 G;  2DYS B;  3VQV A;  2OIG A;  3G71 V;  2K1E A;  1FAF A;  3SJA C;  3C3S A;  2ZM6 O;  4JF3 A;  1P4R A;  2PYL A;  5LOV B;  1HNX O;  1H2K A;  4J10 A;  5K1X A;  2YIB A;  1IBL B;  1NI8 A;  3STL C;  3WB0 A;  2WLJ A;  1Y67 A;  2NLJ C;  3WB2 A;  1IBK B;  4BIZ A;  3P3P A;  3ETQ A;  5H5N A;  3OGC C;  4MTO A;  5B1A C;  2BTO A;  1NR7 A;  4JI6 B;  5TIS Z;  1Q6H A;  1PM9 A;  3QNE A;  2HEP A;  1K97 A;  5F2V O;  4U7N A;  3DGE A;  3DC5 A;  2CDY A;  5CA0 A;  3ASO C;  5IJ0 B;  1WA8 A;  2F66 C;  3KCX A;  2D2C B;  1KB9 F;  4MVS A;  3BA8 A;  3K9A A;  1R3I C;  2NN4 A;  2JDI G;  1SQP H;  1XMQ B;  5HFM A;  4ABM A;  1M5I A;  1G1X B;  3B4S A;  4UCO A;  2YC0 A;  3WB1 A;  3M7M X;  3H1L H;  1M93 A;  1HR0 O;  3U10 A;  4I0X A;  2YUA A;  1M90 W;  1I94 B;  1M56 C;  1GN4 A;  4I50 A;  3JAS B;  1IBM B;  1WP8 A;  4FIP C;  5KHG A;  1BQ0 A;  1OCO C;  5B1B C;  4IHJ B;  4BAY A;  1VIB A;  2JVD A;  5EBW C;  1SC5 B;  4DUZ O;  4B3R O;  1EM1 A;  5IYZ A;  3G80 A;  3K57 A;  1KU9 A;  4ZOL A;  3M99 B;  1NH2 D;  4LWS A;  1EN6 A;  1JCH A;  3ZX6 A;  1R3L C;  4NR1 A;  3CCR V;  3E8G A;  4XDK A;  1ENV A;  4I9W A;  2GV9 A;  4JTC B;  3T4D A;  4LF5 O;  2B1I A;  4X65 O;  1H8H G;  1QBZ A;  3GVM A;  4U3J A;  3T1H B;  4YXW G;  1I5Y A;  1KEC A;  5CBH A;  3CXH F;  4RQF A;  3DSQ A;  2WLM A;  4X20 A;  1YXB A;  3NXS A;  2P6J A;  1NVP D;  3OTO O;  4B7E A;  1QU7 A;  1TUB B;  2WSS G;  2F1M A;  4IIJ A;  4B3M B;  3OW2 U;  4EB6 B;  4X64 B;  2FL4 A;  5IYD O;  3CCE V;  3I5D A;  4K35 A;  4LFA B;  3B09 A;  3OE7 G;  1K8A W;  4DW0 A;  1AR4 A;  3CJH A;  2X6C A;  4JAU A;  4LFB O;  1R3K C;  3JCZ A;  1OCZ B;  2RDC A;  3F5T A;  2LFS A;  4L87 A;  5E79 Z;  2WLI A;  2RN9 A;  3BAA A;  1ROP A;  5CA3 A;  5LHH A;  4NXN B;  2NNU A;  5LYJ A;  3RYI B;  2ITC C;  5CA1 A;  2CH7 A;  4CZZ A;  3JD4 A;  4DV3 B;  3ZS8 C;  4X62 O;  1X4T A;  4UFZ A;  1YVW A;  2ZIM A;  3E83 A;  5IWA B;  1FXK C;  1Q43 A;  2Y4U A;  4RUF A;  1GN2 A;  3AG7 A;  4JI3 O;  2XOK G;  4UV8 A;  2XAF A;  5GON A;  4UB8 Z;  1X59 A;  5LYJ B;  5H6R A;  4JGS A;  5CA1 B;  2X6A A;  4QNH B;  3H1K H;  1H2M A;  2DYR C;  4YY3 O;  1J5E B;  2UUB B;  1GN6 A;  1JQ0 A;  1Q86 W;  3UQ8 A;  1N8R W;  4R6Z A;  4ZHQ B;  1GRJ A;  4QE7 A;  4DV0 B;  3OMI B;  2JGD A;  3LNM B;  3L75 H;  4BIO A;  4RUE A;  2CGN A;  2CTR A;  2RJZ A;  1VQM V;  4OPH A;  4DR6 B;  2EIJ C;  5EZY B;  5JCO A;  3HKD A;  4DK0 A;  1JFF A;  2BCC H;  2GHY A;  2CUG A;  3U11 A;  1YSC A;  3OUF A;  3ZHS A;  1XNQ O;  2IU0 A;  4B3T O;  4O2A B;  1H2G A;  2IW5 A;  4JI2 B;  1JMK C;  4JI4 B;  5J2T B;  4QGP A;  5KMG A;  3L73 H;  4UXN A;  3MDS A;  2GTS A;  3TGU H;  3ETG A;  1QQC A;  4KP4 A;  1YF2 A;  4RWU A;  1SA0 A;  2B1G A;  2ATK C;  5FLX N;  1GM9 A;  4J7Z A;  3P3N A;  1OJH A;  5B5E Z;  3CPW U;  1VF7 A;  2A06 H;  2Z0A A;  4MS2 A;  3CCM V;  2XAQ A;  1GM8 A;  2Q69 A;  1XHX A;  2Q0A A;  4B7K A;  5H9C A;  3DTU B;  4UCV A;  5ITZ B;  4AQY B;  1S3J A;  5JH7 A;  2LQT A;  3CXC U;  1AP5 A;  1FFT B;  5JVD B;  1DF4 A;  3ZED A;  4WFB V;  1XUQ A;  1AR5 A;  1V55 C;  3JAK A;  2AW9 A;  3TXQ A;  3K08 A;  1K4D C;  1BMF G;  5IE9 A;  3CEI A;  2R9A A;  1AP6 A;  2EIM C;  1NQT A;  4O2B A;  2JRI A;  2VQF O;  3FAV A;  2YIC A;  2WLN A;  4UCU A;  3SYP A;  5JQG A;  1NBM G;  2RCV A;  2ADP A;  4H13 B;  1Q7Y W;  1SS3 A;  4JAA A;  1KKD A;  4X1K A;  5J2U B;  2Q5Z A;  5DEC A;  3C90 A;  2UUC O;  3K5N A;  4GT1 A;  1BGY H;  5B3S C;  2QR4 A;  5KHH A;  4YJ2 A;  1XNR B;  2WLL B;  1LNQ A;  3LSU A;  4TUY B;  2OT5 A;  1RSO B;  2GUZ B;  5EBL C;  1QR8 A;  3DC6 A;  2Q0O C;  1M57 B;  3X2Q B;  4GX0 A;  1P84 F;  1YTF B;  1E1R G;  3BA9 A;  3SPG A;  2OCH A;  5CMU A;  1W2B U;  5LMN O;  4X89 A;  4CH6 A;  1EZJ A;  1XHZ A;  1OZ0 A;  3D8C A;  4B3S O;  1LR1 A;  2Z3Y A;  3ETD A;  3E2E A;  1NJI W;  3CYO A;  3W7X A;  3EHB B;  4XBF A;  1BQZ A;  1CEZ A;  4LBE C;  2XAH A;  2QSA A;  5KHK A;  2QWO B;  4R7C A;  1N34 B;  3CS5 A;  2EIN C;  4CC6 A;  1YJ9 V;  2Q7H A;  3JAT B;  5LMU B;  4X1I A;  1KQS U;  4LF7 B;  2X6B A;  5B1A B;  5CB4 A;  3BRC A;  1TVK A;  4JYA O;  5EYP A;  1PNK A;  1SQQ H;  1WB8 A;  2P4K A;  1SET A;  3ZN0 A;  1JJ2 U;  4BW9 A;  1XEQ A;  2DQ3 A;  3ASO B;  1SRY A;  1G6U A;  3ABT A;  3JD2 A;  3ZN1 A;  3K5L A;  2ZE5 A;  3DXR B;  3ETE A;  1WP7 A;  1FJG O;  4UVA A;  4DV4 B;  3S3X A;  3UKM A;  3E89 A;  3L72 H;  4FFB B;  5JCO C;  1PV0 A;  3SPI A;  1K7D A;  1S5L Z;  1O9G A;  3CC7 V;  3J81 N;  4O4L A;  2WPD G;  3D3Q A;  4I55 A;  3OR7 C;  1W0J G;  1EN4 A;  3B40 A;  2ZIN A;  1M56 B;  2QDO A;  5CBF A;  4OX9 B;  1OCO B;  5B1B B;  4DV2 B;  3LDD A;  4BR6 A;  2IH3 C;  2FML A;  1IXB A;  3CRC A;  3ZHT A;  4YJ3 A;  2W0F C;  4PD4 F;  5J9P C;  3SJQ C;  1AIL A;  4MVZ A;  1NKD A;  1PKX A;  4I4T B;  3ZRW B;  4K0K B;  3OT7 A;  3UT5 A;  1Y66 A;  1GN3 A;  1XL6 A;  3IC9 A;  4QE9 A;  5L3C A;  1MAB G;  5C8Y B;  3HKC A;  4DV7 B;  3OUS A;  1M4U A;  2UU9 O;  3JAW A;  4X1Y A;  4WBN A;  2PI4 A;  1HW7 A;  1PL0 A;  3RFR A;  4PA7 A;  1A32 A;  3L70 H;  1KBH A;  4LF6 O;  4DV5 O;  2ODM A;  1Q6I A;  3HKC B;  3FYE B;  1YZB A;  2KG7 B;  4TV8 A;  2XUM A;  2HJF C;  3L74 H;  4NTY A;  1Q81 W;  4Z1M G;  2VWK A;  1ZL8 A;  4X66 B;  2ZR2 A;  1W59 A;  4U7O A;  2V4D A;  2UXD O;  4LR3 A;  5H6Q A;  1Y6X A;  2K9P A;  2D3O W;  3CCQ V;  4LF9 B;  2XND G;  2Y0I A;  3P30 A;  2AGA A;  2BSK A;  3LDC A;  4DV1 B;  4JI0 O;  2EJR A;  3OEE G;  2NR5 A;  3J80 N;  4H37 A;  5BY1 A;  4J7J A;  1JVM A;  3IFX A;  5BZB A;  1F23 A;  2AZ0 A;  1FXK B;  2GTA A;  3LUT B;  2QTS A;  5JJE B;  3ZRX A;  3ZMS A;  2VQE B;  5GTI Z;  3O65 A;  2ZM6 B;  3WU2 Z;  4DR2 B;  3VQW A;  1HNX B;  2ZE6 A;  2DYR B;  1YIT V;  3G6E V;  4JI5 B;  1FPO A;  4PDR A;  5E1A C;  1IBL O;  4P2Z A;  2FB5 A;  1KC8 W;  2Q4P A;  5IYC O;  4FLU A;  1PL4 A;  1K73 W;  4IYI A;  2ZDI A;  1YTF D;  2EIJ B;  3OMA B;  1HWY A;  3RWR D;  1F4N A;  5KA5 A;  3ICX A;  2YID A;  2HLD G;  1R1B A;  1EBO A;  1R6T A;  3E8F A;  3FD9 A;  4FLZ A;  3K5M A;  1S76 D;  4UUJ C;  2HG5 C;  1OCC C;  1VEW A;  3CCU V;  2B9Z A;  4KXR A;  5CA0 B;  1XMQ O;  3SPC A;  4F6E A;  1WA8 B;  2JJ2 G;  3CWB H;  3AG3 C;  2PZS A;  1HR0 B;  4A5U B;  3UCS C;  3CRA A;  4FM1 A;  1AJQ A;  2ZD9 A;  2KB1 A;  4H33 A;  1AI6 A;  1MZF A;  1RPR A;  3JSN A;  1OV9 A;  4I0X B;  2V7Q G;  3RT3 C;  1XI1 A;  1IBM O;  2VRZ A;  4LF4 B;  4N23 A;  2BE3 A;  4DR3 B;  4C7U A;  4XDL A;  4YIP A;  1BHA A;  1KD1 W;  5EIB C;  4I50 B;  5L3G A;  4DUZ B;  3T1Y O;  3AG2 C;  3QTC A;  2F4V O;  4RAI A;  3CCV V;  1N4C A;  3C3T A;  4Z1V A;  1Y76 A;  4I5S A;  1M1K W;  1V55 B;  4LFC B;  5IYZ B;  3O9O A;  3K03 A;  3CC4 V;  4JI7 B;  4BIU A;  2JJ1 G;  4ZOL B;  1PD3 A;  1PP9 H;  2DMX A;  4LWS B;  2EIM B;  4LF5 B;  2X7R B;  1G4Y B;  3UM7 A;  1J95 A;  3CC2 V;  4J11 A;  4TQF A;  2XT9 A;  2BTQ A;  1L8D A;  3HB3 B;  2FYU H;  2A9H A;  4I9Q A;  1JJO A;  2GSM B;  4IGG A;  4R50 A;  1GK9 A;  3KKY A;  4U3J B;  2QM7 A;  3CHX A;  4DR7 B;  3OTO B;  2ZKO A;  4B3M O;  4DXW A;  3SR2 C;  5B3S B;  4X20 B;  3SYO A;  2WLK A;  5EIB D;  2Q68 A;  4X64 O;  1VQK V;  1JX9 A;  2ETN A;  4AHC A;  4LFA O;  1T5E A;  2BTQ B;  2QWQ B;  1K4C C;  4IIJ B;  2PYJ A;  4MW8 A;  5B66 Z;  1IX9 A;  4PI2 A;  3STZ C;  4R8C A;  4F6R A;  3RGB A;  1M9N A;  4LFB B;  2QWR B;  3F7Y C;  2IH1 C;  1IUR A;  3CJH B;  2N05 A;  4NYK A;  4NXN O;  3CCJ V;  3K06 A;  1WJZ A;  5IY5 C;  1DGS A;  3BHP A;  5FNV A;  4DV3 O;  1GKF A;  4JI8 B;  2WLI B;  1AI7 A;  1XOU A;  1K5S A;  2F95 B;  3K5O A;  4FM0 A;  3KG2 A;  1XIL A;  1SQX H;  2XTA A;  4O4I A;  2DN9 A;  3VQY A;  1Z2G A;  2CH7 B;  4LH7 A;  3ZCC A;  4JPR A;  2JS5 A;  1ORQ C;  4FLV A;  2QKA A;  4J7K A;  3ABU A;  3KZI Z;  4WFH A;  1B3Q A;  4DUY O;  1J5E O;  2EIN B;  1SQB H;  2PTM A;  5LA6 A;  4YY3 B;  5GON B;  2Y0P A;  2OIE A;  1K3E A;  3Q4H A;  4LNU A;  1WPX A;  3CCL V;  5KAI Z;  3SYC A;  4DV0 O;  2Q73 A;  1XL4 A;  4O4J A;  3UO3 A;  4W4K A;  1E1Q G;  2VS0 A;  2KQX A;  3OAA G;  3HKE A;  4GKJ B;  2MK3 A;  2UUA B;  4GX1 A;  2JGD B;  4CS4 A;  4X9Q A;  4X88 A;  2WAM A;  2YEV A;  1XMO B;  2ZDI C;  2HKO A;  4WFE A;  1XRE A;  3L71 H;  3HKD B;  1EFR G;  1JFF B;  3BFR A;  4DRX A;  1DLB A;  4JI2 O;  4ZI7 A;  3ZMT A;  2E74 B;  2W6J G;  1AI4 A;  1AR1 B;  4PA3 A;  4FLY A;  1FKA O;  2YEV B;  2YIB D;  2Q7E A;  3B8M A;  4DV6 O;  3A2F A;  5L3B A;  1MG1 A;  1GAX A;  4EKW A;  5KMG B;  4DRX B;  4E2L A;  2BOB C;  4GUN A;  3OD4 A;  3K59 A;  4U3F H;  2QJ1 A;  3CX5 F;  1SQV H;  1P7B A;  2W0X A;  4WFF A;  1SA0 B;  1Q8I A;  4X8A A;  2P4V A;  3RW0 A;  3A0R A;  1IZ3 A;  2Y48 A;  4AQY O;  3D36 A;  2DJV A;  4IYH A;  3E8B A;  3VBB A;  2AHZ A;  3ABL B;  1DF5 A;  1ZUQ A;  2V1D A;  1N33 O;  3E22 A;  1COW G;  1KP2 A;  5KUM A;  3ZMZ A;  4UCS A;  5JH7 B;  1PNL A;  3ZRV A;  3I55 V;  2C2A A;  3A0H Z;  3LDE A;  3IAY A;  4NXM O;  3TXS A;  2LP7 A;  1AI5 A;  5EC2 C;  4MW3 A;  2ZIO A;  1ZTE A;  3JAK B;  4Q6G A;  2QWP B;  2HP8 A;  2QTO A;  4FZ1 A;  4O2B B;  1EZV H;  4CBC A;  2YXY A;  4O4H A;  3BY6 A;  5LP6 A;  3FAV B;  4KHP O;  1D5N A;  2XAG A;  3UO2 A;  1MSW D;  5JQG B;  3J7A U;  3CME V;  4X1K B;  1HP8 A;  4HNA A;  5LHI A;  1AJP A;  5LP6 B;  1LUV A;  3EFF K;  4YJ2 B;  1URF A;  5B1O A;  4OGQ B;  5BXZ A;  3JSL A;  4TOI A;  1DK1 A;  4QJF B;  3KCY A;  2UXN A;  3RYF A;  1BS3 A;  1ZLZ A;  4G27 B;  4CH4 A;  4WCE V;  2DW4 A;  3ZBH A;  1Y74 A;  5L3D A;  5IJ9 A;  5LMN B;  4DO2 A;  4JAV A;  3OGI B;  2YI8 A;  4B3S B;  3AK2 A;  5GTH Z;  5CBG A;  3B2E E;  2ZT9 B;  4PJ0 Z;  1S5H C;  4WFG A;  2YXH A;  3ZHU A;  3CP1 A;  4CS2 A;  1HNZ O; 
#chains in the Genus database with same CATH homology
 4OPH A;  1AB3 A;  4JI0 O;  4DR4 O;  4DR5 O;  1N34 O;  4LF5 O;  2FKX A;  5LL6 Y;  1HNW O;  3JAM N;  4X65 O;  5LMU O;  1N36 O;  5IT9 N;  3J80 N;  5BY1 A;  1N33 O;  3RT3 C;  4DR1 O;  1IBM O;  2UUC O;  3J81 N;  2UXC O;  5H5N A;  4DV7 O;  1XNQ O;  4DUY O;  1J5E O;  4B3T O;  3OTO O;  4X66 O;  3T1Y O;  4JV5 O;  2F4V O;  4NXM O;  4DV0 O;  3SDL A;  3O65 A;  5IWA O;  4LF9 O;  4JI8 O;  1I94 O;  3M8A A;  4LF7 O;  1IBL O;  1AIL A;  3R66 A;  5LMN O;  4LFB O;  4KHP O;  2UUB O;  5FLX N;  3F5T A;  4LF4 O;  4B3S O;  4DR3 O;  5BR8 O;  3J7A U;  2Z0A A;  2LW7 A;  1G1X B;  1F7Y A;  4JI2 O;  2UU9 O;  2HHH O;  4DV4 O;  4DV1 O;  2ZKO A;  4B3M O;  1HR0 O;  2VQE O;  4X62 O;  4OX9 O;  4DR6 O;  4DR2 O;  4JI1 O;  4X64 O;  1KUQ A;  5BXZ A;  4DV2 O;  1R1B A;  1R6T A;  1FKA O;  1NS1 A;  4LFC O;  3T1H O;  1DK1 A;  1A32 A;  4JI7 O;  4LF6 O;  4LFA O;  4JI3 O;  4JI5 O;  2E5L O;  4DV5 O;  4DV6 O;  4GKJ O;  2UUA O;  4OPA A;  1IBK O;  2UXB O;  1FYJ A;  1YZB A;  1X59 A;  1XNR O;  1D2D A;  4GKK O;  4K0K O;  4JYA O;  4YY3 O;  1XMO O;  5A2Q N;  4JI4 O;  4DUZ O;  1N32 O;  4B3R O;  4YHH O;  4JI6 O;  2UXD O;  1XMQ O;  1XEQ A;  4NXN O;  2ZM6 O;  2JRI A;  4LF8 O;  2N74 A;  1HNX O;  4DR7 O;  2VQF O;  4DV3 O;  2DOS A;  1FJG O;  2AGA A;  4AQY O;  2DJV A;  4A5U B;  1HNZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...