4DR4O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr4O00
5BY1A 1N33O 1DK1A 1HNZO 1XNQO 3RT3C 4DR7O 4LFCO 3J7AU 1N36O 1FYJA 1N32O 5LMUO 4DUYO 1XMOO 3T1YO 5LL6Y 4X64O 4DR2O 1X59A 1XEQA 4DV2O 4DV4O 4JYAO 4DV6O 5BXZA 5A2QN 4X65O 1AB3A 1IBKO 1FKAO 1IBMO 1R6TA 2UXDO 3F5TA 4X62O 4LFBO 2N74A 1NS1A 5FLXN 2JRIA 2HHHO 4B3MO 4B3SO 1YZBA 2LW7A 5H5NA 4OPHA 2FKXA 4LF9O 1N34O 1J5EO 2E5LO 4LF5O 5IWAO 3R66A 4GKKO 4K0KO 1KUQA 1HR0O 2DOSA 4AQYO 4OX9O 1HNXO 4A5UB 4LFAO 4NXNO 4JI8O 4YY3O 1XMQO 4LF4O 2F4VO 4DR3O 2UXCO 4DR6O 4DV1O 4KHPO 1AILA 1FJGO 4NXMO 2Z0AA 3T1HO 1A32A 4DV7O 2UU9O 1R1BA 4DV5O 4JI2O 4LF8O 2ZM6O 4X66O 4B3TO 4DR4O 4JV5O 3SDLA 4YHHO 3OTOO 2UUAO 1F7YA 5LMNO 3J80N 4JI6O 3O65A 4DR5O 2AGAA 2UXBO 1G1XB 4JI3O 4JI4O 3M8AA 2ZKOA 4JI0O 4DR1O 4GKJO 4DV0O 2UUCO 4DUZO 5IT9N 1I94O 5BR8O 4JI5O 4DV3O 4B3RO 1XNRO 4OPAA 2UUBO 2VQFO 3J81N 4JI7O 2DJVA 4LF7O 1D2DA 1HNWO 4JI1O 1IBLO 2VQEO 4LF6O 3JAMN
chains in the Genus database with same CATH superfamily
2H94A 5K1XA 2Y69C 3ABMB 4JI6B 4D7SA 2GHYA 3AG7A 3UKMA 3QNEA 4JI3B 4PA9A 3K58A 4ZHQB 3OMAB 4UCVA 2M6YA 3S3XA 4GKJB 1BMFG 2EZOA 3WB2A 1K92A 5IJ9A 4AI8A 1NI8A 1R6TA 1V54B 3CCQV 1BQ0A 1NS1A 2LGQA 2JRIA 3E35A 2YEVA 4WCEV 1MSWD 1F4NA 1N34O 1J5EO 4MT8A 4LF5O 2R9AA 4R7CA 2YIDA 1VQ5V 3K57A 3ABKB 4AQYO 3ZCCA 4P30A 3ZRSA 1KBHA 1KECA 2IJKA 3UT5A 3DC6A 3TETA 2AXTZ 1R73A 5IE9A 3JARA 2Z0AA 4O2AA 2VS0A 4MSWC 3SJQC 3W7XA 1HP8A 4TQFA 3ABTA 2B5UA 4B3SB 5IYDO 3CYOA 3EFFK 1S5HC 4FFBB 3FFQA 1SQVH 2Z3YA 4W4KA 2ZE5A 2OCCC 3HKDA 4DV4B 3SJCC 5EBWC 4E4EA 5B1AC 2F4VB 1YI2V 3MD0A 2UUCO 3CMEV 1AP6A 2OYQA 4J7JA 4OPAA 3OUFA 3FB6C 4UFZA 1ZL8B 4XDLA 3CX5F 4E2LA 1UJWB 1EM1A 4WBNA 4K8XA 4FLUA 1SKVA 3OMNB 5LGTA 1YIJV 3WFVA 4TV8A 3THOA 5KX5A 1VF6C 5IJ0A 4LNUB 2VWJA 3SYAA 2V7QG 1ZSPA 5BMVB 1SQGA 5CB4B 1EBOA 4LFCO 4X1KA 3D36C 5L3CA 4JI4B 3VQWA 4ZIBA 3SR2C 1GN2A 1E79G 4DO2A 2RN9A 2WLKA 5CMUA 3AG1C 3TGUH 1RSOA 2RNBA 2IH3C 1H8HG 1CP9A 5J2UA 4OGQB 2KG7B 2P90A 1OCCC 4X1YA 3UQ8A 1WJZA 4I50A 3B09A 1YTFB 1XHZA 2GV9A 3SYCA 5EIBD 5KA5A 2P5OA 1QCEA 2EIMB 4CC6A 4ZI7A 3T1YB 1PM9A 1JVMA 1SA0B 3CRRA 4Z1VA 3HKBB 2BCCH 2OIGA 2OWOA 5LYJA 1R6KA 1MABG 1A32A 2EJ7A 3AG2C 4YJ2B 4TV9B 2A79B 4CH4A 2E76B 2B1GA 1SRYA 4EB6A 4TQDA 3FAVB 4X20A 4FM2A 1GM9A 1RFYA 5B1AB 3SDLA 4YHHO 3H1KH 1G6UA 2GTAA 3O65A 3BEHA 3F5WC 1DLBA 2Q0AA 3X2QC 4I4TA 4PJ0Z 2UXBO 3M8AA 4IL6Z 2PGGA 3E89A 4TT3G 3EXAA 3LDDA 2UXCB 1FJGB 2E75B 2ILMA 4FVMA 5CA0A 2HVKC 2DJVA 4J11A 4LBEC 1E1RG 3B77A 4O4LB 4CBCA 1PNKA 2RQ6A 2ZXWB 1AJQA 1ZWIC 1K4CC 4FLZA 1KU9A 1WPXA 4DUYO 4F6RA 5CN0A 4KFMA 3K9AA 1YITV 1BHBA 4X65O 4ZKIA 3AG3C 4CH3A 2HG5C 4D6TH 3N2GA 1NZ6A 2XAGA 1JA8A 3ZRVA 1Z5WA 3S3WA 4HYOA 1IBLB 5JVDA 3LSUA 1Q86W 1XOUA 4U3JB 1K4DC 4DRXA 1ROPA 3NR7A 5C8YB 3AK3A 4R6ZA 5IYZA 4A5UB 4LR3A 5JJEB 5LMUB 5FNVA 5LGNA 2M7WA 3ZS8C 4FPPA 1WA8B 4JGSA 5EC2C 2JJ2G 3MHHC 3FYIB 2IU3A 1HNWB 3K5OA 4LFBB 4LF8O 2QE7G 3CJHB 4X66O 3LUTB 3G6BA 5DN6G 1E1QG 4MVOA 4JI6O 3D3IA 4CZZA 4R8CA 2CAZC 4JI3O 3SYQA 5D5PA 3JALA 4GKJO 1OV9A 1R3JC 4B7EA 2A06H 4JAUA 2LQTA 1H2SB 3HPLC 4I9WA 2DYRC 3K03A 4ZOLB 3Q4HA 1AR5A 1SETA 4BW5A 4RAIA 3OR6C 3RBZA 5IY5B 3TJTA 1Y6XA 2XNDG 3VQXA 1M57B 1SZXA 2QDOA 5TISZ 1P84F 2HLDG 1H38A 3JAWB 2DQ3A 2CDYA 4DYLA 5IYBO 1SZTA 3JASA 1VQPV 2KKWA 4JI0B 2WA3A 4RUFA 1FFTB 4UV8A 3OE7G 3OT7A 5H2FZ 4NKGB 1IBKO 3M7MX 1JFFB 2KSDA 1FKAO 1VQMV 4YIOA 1QNMA 4K8ZA 3K0DA 3CE2A 3FYEB 2VQFB 1FFXB 4B3SO 4UCTA 2QSAA 4ASUG 2FKXA 1EZVH 5LBQA 5DECA 5LXTA 1Y74B 4ABMA 2DQ0A 2PF4E 1XNQB 4DR7B 4ICGA 3JD2A 1IXBA 2DYSC 5BZBA 2YXHA 3DXRB 4HNAA 2Q4PA 4IHJB 2WPDG 2F4VO 2YDEA 3AK1A 2Q69A 2ZDIC 1AJNA 3ZRWB 2EIKC 1XBLA 2Q6AA 3WB0A 4QNHB 4FIPC 1YDXA 1XDCA 1HW7A 1FXKB 1Z2GA 4O4JA 3EVKA 4BW9A 4P9OA 2XUMA 1K5QA 1VF6A 4O2BA 5L3DA 2DYRB 4PA3A 4X1IA 4F6EA 3PJSK 3D36A 1DF4A 4JI4O 1JOYA 1AI4A 5KUMA 1UFIA 3CCVV 3AG4C 5LP6B 3W7UA 5IJ9B 3SPCA 3CCMV 3ZN0A 3HKEA 4UVBA 4DV5B 1NH2B 4LF7O 1MG1A 4J7KA 1BHAA 4MW8A 3E8HA 2ZR2A 2ZM6B 3E22A 1RM1B 4GCZA 1XREA 2EILB 2H8PC 1F4MA 2JS3A 4JZ2A 4BWAA 2CTWA 2Y4TA 4JAAA 3J7AU 2WLHA 1OCRB 2L35A 3T1YO 1T5EA 4FLVA 1X59A 5KMGB 3K3WA 3JARB 1ZAUA 2O57A 5F2VO 2WLLA 1VQOV 1THZA 3E8BA 5L3BA 4B3RB 3OEHG 1KKCA 3P3NA 1YHQV 5FLXN 4JTCB 4X9QA 5H5NA 1KYOF 2D3OW 3UO3A 4BIZA 1VMGA 3LNNA 2EIKB 4MVMA 3N2KA 1OCZB 3OM3B 2LP7A 1NR7A 3ABMC 1XI1A 3UO2A 4DV2B 2IW5A 2UXCO 3W7WA 4D7TA 1FJGO 1H2GA 2LFRA 1XILA 2CH7B 5FPRA 4QPKA 3SGIA 5GW7A 1YJ9V 1K8AW 1JCHA 5JJJB 1O9GA 5JQGB 4IYHA 1V54C 2ZT9B 2UUAO 1WLEA 2LGWA 3O9OA 2A7WA 2QWRB 2GTSA 5LA6B 3ETQA 2KQXA 2YC0A 1S76D 1VQNV 4LF4B 2X6AA 4JYYA 2IJIA 3ABKC 4MW3A 3RVZA 4QPJA 5A9GA 2GUZB 5CBGA 1BQZA 4DV7B 2UUBO 2PY5A 5EYPA 2YXLA 2R9RB 1US6A 3CRAA 1IBLO 1VF5B 1QVFU 1N8RW 4X1YB 2CGOA 3ZJZA 3IFXA 1R3LC 5DEDA 5IYCO 2OCHA 4I0XA 1OZ0A 1TVKB 3LSQA 2B1IA 1BGYH 4O4HB 4FMTA 1W59A 5LMUO 4NTYA 1EN5A 1I5YA 4CH6A 1NTMH 5LYJB 3QVNA 1MSDA 2YS8A 4LFBO 1DF5A 2BTQA 2JGDB 4JI7B 2D2CB 3L71H 2ADQB 4Z2WA 1P7BA 4L8JA 3CHXA 4KL1A 4LWSA 1M4UA 4GYCB 5B66Z 2JVDA 1H2MA 4JYCA 3AK2A 4UV9A 1N32B 5GTIZ 5H6RA 3APQA 4XDJA 1SQPH 5KHHA 3U11A 1PNMA 3JATA 1XL4A 1BZKA 1SERA 3WG7B 1B04A 5B1NA 2FTKA 4LC1A 2DE0X 2WA4A 3PN1A 4FJCC 1LUWA 3C3TA 1NU1H 3ZIAG 2PYJA 3B40A 4O4IA 4MTXA 1VQKV 3UCSC 4PI2A 5AG2A 1YSCA 3CRCA 3JAKA 5IDJA 2E5LB 1EN6A 1M56B 3ML0A 4MVSA 2ITDC 1MZFA 4Z1MG 2F95B 3P30A 2DWEC 4PDMA 3QO7A 4GUNA 2ZKOA 4UB8Z 4YY3B 5B3SB 1IURA 4JI0O 1LUVA 1IBKB 4IGGA 2PYLA 2EIMC 2W6JG 1PPJH 3MAQA 4TUYA 3L75H 2VQFO 3K9SA 1W0KG 3RYCA 2BOCC 2WLJA 1TAEA 2EINB 5KHIA 2G38A 5CA1B 1P4RA 3ZHTA 1QU7A 5EZYA 5B5EZ 3SJAC 4MVQA 2YIAA 2QM7A 1XNQO 4DR7O 1QHTA 1TUBB 2N04A 3IJ4A 5JJNB 1IZ3A 1SF9A 5JH7B 4WFBV 2X0LA 2BSKA 2ZDIA 4JI5B 2E74B 1TUEB 1UPGA 1WB8A 3H1LH 4YJ3A 1FXHA 4GX5A 4H0LB 3CPWU 3E83A 1YZBA 4UVAA 2EZPA 1VARA 2VRZA 1KUQA 2RMKB 3QF7A 4MTOA 3B4SA 2Q7HA 2ZXWC 3IC9A 2IBZH 2EX3A 3GB7C 3K5LA 3CC4V 3HKCB 4N23A 3FKSG 1NVPD 3RVYA 4LF7B 4RO2A 2QWNB 3P3PA 1R1BA 4DV5O 2QWQB 4I55A 4G27B 3RYIA 3L73H 3JCZA 1EN4A 3CSXA 2ZM6O 5JCOC 3JYCA 4GKKB 2QM8A 5KHJA 1AR1B 3LDEA 4B08A 2AGAA 4BR6A 4JPRA 4JI8B 3JASB 5GONB 4PD4F 4DR1O 4PDRA 4LCUC 1IX9A 1Y76B 3SJBC 5CA3A 4DV1B 2QA4V 1NBMG 4B3RO 2CGNA 1PD3A 1K33A 1K9MW 3KZIZ 2YI8A 2YICA 3M99B 3ZHSA 4FM1A 5LMNB 1K5SA 2XAFA 2HP8A 2HEPA 1XEQA 4DV2O 1BL8A 2WAMA 4UCOA 5ITZB 5KLVH 2YXYA 4ZHQA 4F4LA 3ZMUA 1PV0A 1COWG 2OIEA 2N74A 5H9CA 1JMKC 2UUAB 5LHGA 4KXRA 3K5MA 2LW7A 1R3IC 1VQ6V 5JWPA 5LHHA 2ZQMA 1JJ2U 5IY5C 1ZTEA 3W7SA 1S3JA 4LF4O 1M57C 4X64B 5EBLC 3KCYA 1OCOB 4DV6B 4KP4A 2XAJA 4DR6O 2CE4A 2UUBB 4NXMO 2VWKA 2Q8VA 1S5LZ 4DV7O 1YF2A 3HKEB 3CXCU 4GT1A 1W0JG 3BA9A 4PA6A 2JJ1G 4PA7A 3ETEA 3WB1A 1YEWA 1GN4A 3GWKC 1Z5VA 3F7VC 1S77D 2IH1C 2A3QA 3J80N 5LOVB 3H1IH 4B7KA 3ETGA 4QE7A 1WPBA 4FFBA 4WFAV 2ATKC 5J2TA 2UXNA 1I5XA 1WB7A 1GO3F 3LDCA 4I9QA 3G71V 4NTXA 1X4TA 3D3QA 4JI7O 1YJWV 4UCUA 2P4VA 3IC7A 4Q20A 2R70A 2JGUA 1ZX3A 2XT9A 1KQSU 3OTOB 1R6NA 1ZL8A 1H8EG 2ITCC 3E8FA 3RW0A 2AW9A 4XBFA 1FXKC 1N32O 1D5NA 4CS4A 4DW0A 3CCLV 1HWYA 2V4DA 2WLMA 4LNUA 2QR4A 3ZMZA 5CB4A 2Q7EA 2EIJB 4MVUA 5BR8B 4NVPA 4JASA 2HFEC 3F5TA 4P2ZA 2AZ2A 2DN9A 2W0FC 4JYBA 1NKDA 1IXMA 1FXVA 5LP6C 3ZMTA 4JI1B 2UXXA 3A2FA 3TXQA 2E5LO 3K06A 1K97A 3ZEDA 2QEXV 4J10A 2ZIOA 2ZCEA 1S5JA 2KG7A 2YSUB 4MTGA 3KKYA 3TK1A 2PUSA 3L74H 1RM1C 4YY3O 4DR2B 2EILC 4RQEA 5D5QA 5B1BB 2L6LA 1OCRC 1AILA 3A0BZ 1FAFA 1WNSA 3OGCC 2P22C 1SA0A 2UXDB 5EYPB 2JS5A 3HKBA 4X62B 4DW1A 1M93A 3JD4A 3CB2A 1LNQA 3MDSA 4YJ2A 4TV9A 2PI4A 3G4SV 1L1FA 3FAVA 3RYHB 1JJOA 3QO8A 2LW1A 3OFNG 3ASOB 3BABA 4CH5A 4ZBMA 3QG5A 4JI5O 1OCZC 3SYPA 3H1JH 1Q6UA 4TOIA 2BTQB 2YI9A 4WFHA 2WLIB 4PDLA 4NTWA 2EBOA 4H33A 2X7RB 1VQLV 1S72V 4DR4B 5E79Z 4O4LA 4BIUA 3BVOA 1BS3A 2QTSA 4FZ1A 2QKSA 3FB5C 1N0JA 1B3QA 2EULA 3RWRD 2XAHA 3JATB 2MK3A 2P4KA 4DV0B 4DK0A 1Y66A 2FMLA 5E1AC 1AI6A 1R3KC 3ZHQA 2YEVB 1HDJA 2F1MA 4RUEA 2FYUH 2GBOA 2IM9A 3C90A 2P6JA 4O4IB 5JCOA 2W0XA 1WP7A 4GZRB 2HJFC 3FB8C 4GKKO 3UT5B 1HNZB 4TWKA 3ABLB 4XDKA 1P7GA 1VQ7V 2W6IG 4DR1B 2YIBA 1N0NA 4U3JA 4JI8O 4X89A 2ETNA 4O2AB 5C8YA 4NB5A 2CTPA 1L0LH 4DV1O 1VQ8V 2MW2B 1XHXA 1WA8A 1CEZA 4X8AA 4MTFA 1PP9H 2XAQA 1VQ9V 2JEXA 3HKDB 4UCRA 5LMNO 3JSLA 4PV1B 3DGEA 1YXBA 4FLWA 3ICXA 4NXNB 3CCSV 1XMQB 4N21A 4H37A 2R72A 1GM7A 1MOFA 4FFKA 4DR3B 2BE3A 3OUSA 2ARHA 4WBNB 1JQ0A 1H2LA 1Y67A 4JAVA 3FD9A 3VQVA 3WG7C 4TV8B 1RP3B 1D2DA 2FL4A 1U96A 5KX5B 4ZOLA 3VOUA 5IJ0B 2Q67A 1NTZH 4B3TB 4X1KB 1PNLA 2NNUA 1GK9A 3T4ZA 3G67A 4FZ0A 3CCEV 3BCCH 2XOKG 4DR6B 2P06A 1ZUQA 1M56C 4J41A 1MA1A 2XTAA 1L8DA 4X64O 3CCRV 1GH6A 4NXMB 1RSOB 2K1EA 4YIPA 2CUGA 4DV6O 3CCJV 5J2UB 1Q3EA 3CEIA 3E2EA 3QTCA 4OXSA 1FPOA 4EFBA 2JIZG 2CTRA 1IBMO 3E8GA 5B3SC 3OD4A 3RGBA 2LJ2A 3RYIB 4HZ3A 1K3EA 5EIBC 1JFFA 1H2KA 2IJHA 3F7YC 4I50B 4AHCA 2VQEB 3ZHVA 4JF3A 4HBNA 4LF6B 4ZI7B 1FFXA 1Y4MA 2EINC 1O9HA 2DOSA 2P7TC 2YUAA 3TCUA 1SS3A 1Y74A 1GKFA 5DM6V 4G2KA 1BSMA 1CXZB 3CP1A 3JD1A 1Q6HA 2QKAA 2A9HA 3DXRA 4EB6B 3R65A 3DTUB 4IHJA 4X20B 4LH7A 4W4LA 3CC7V 3RYFA 1TA8A 1LR1A 4I5SA 3L70H 3ZRWA 3I5DA 3ETDA 4I4TB 3OTOO 3BPZA 4JZGA 1XUQA 1JR9A 4K0KB 1M5IA 2AHZA 2HVJC 3ASNB 5EC1C 3ZMSA 3CRMA 5CA0B 4KHPB 5BR8O 2Q7GA 5K1PA 4K3AA 3RFRA 3A8TA 2ZNJA 3AEIA 5LP6A 3SYOA 1DTOA 3BRCA 2ODMA 4JI1O 3SPGA 1NVPB 1SQQH 1N4CA 4LH6A 1N33O 1GN6A 3UM7A 3CS5A 4RQFA 4F6RB 4JTAB 3RT3C 2XASA 5LHIA 1W2BU 1OHHG 3K04A 5CBHA 3A0HZ 4DR2O 3STLC 3N2GB 5BXZA 1IDSA 3ZBHA 1V55B 3CD6V 1I7FA 2B9ZA 2LO1A 1AB3A 1KP3A 5KMGA 2UXDO 1XNRB 4X62O 5JVDB 3CWBH 1G4YB 2QM4A 5GTHZ 1Q43A 4DRXB 4JTDB 1K73W 4NR1A 1VEWA 5IYZB 1BE3H 3IGAC 5FNVB 3APOA 1N36B 1QLEB 4C7UA 3EHBB 4BIOA 1XMOB 3E86A 1B06A 4HAMA 5J2TB 4CS3A 5HFLA 2HR3A 2Y4UA 1NT2B 4JYAB 1FD9A 3K59A 4FLYA 4G28B 4PI0A 3VBBA 2Y0IA 2H3OA 1AI5A 2RCVA 2Y69B 3U10A 3HB3B 3B8NA 2CH7A 4WFGA 2NR5A 4DR4O 2ZD9A 4UUJC 1Q82W 2NLJC 1GRJA 3JCUZ 3JALB 3P32A 5JQGA 4QGPA 2DWDC 2CTQA 5HFMA 1QVGU 2X6BA 2ZE7A 1HNXB 3ZHUA 4FLXA 3ZHRA 5LA6A 3Q4HB 4DV0O 3OMIB 1OJHA 5IT9N 5LGUA 3CCUV 2Q0OC 2JEUA 2UU9B 4NYKA 1OCOC 2K9PA 1NR1A 2GUZA 4JV5B 3JAMN 4YXWG 4CC5A 1HNZO 1Q7YW 1M1KW 4DR5B 4PELA 1FYJA 3LSSA 3NXSA 1TVKA 1QBZA 3SPHA 2JK5C 1EZJA 1Q5OA 4O4HA 2DW4A 5A2QN 4DUZB 1SQFA 2F93B 1D5AA 4PDVA 4LP8A 5KA6A 1MZEA 4U7NA 1GAXA 5LXTB 1WN7A 4B3MO 3H9VA 4BAYA 2OCCB 3G80A 4IIJA 3STZC 3ZMVA 2JGDA 1VP7A 4HNAB 1Q6IA 2AHYA 4OX9O 2QTOA 3RN4A 4NXNO 1XQ8A 1XMQO 4DXWA 2F23A 1CPYA 3K5NA 3HR0A 3T2MA 4DR3O 4U3FH 2PI5A 1P49A 3GVMA 4O4JB 4R50A 4O2BB 2EIJC 4PA4A 4X1IB 4B3TO 2Q73A 4LF9B 1KKDA 2Q68A 5IWAB 4RWUA 1HR0B 2P67A 1PL0A 1SQXH 3AG1B 1SQBH 4AILC 4LFAB 3ABUA 3N27A 3H01A 2PTMA 1RPRA 1IBMB 2E3CA 4IYIA 3L9DA 5B1OA 4J7ZA 3CXHF 5L3GA 4DV3O 3OW2U 3T1HB 1OCCB 5B1BC 3FB7C 3E22B 1YTFD 4JI2B 4GLXA 2C2AA 1K34A 1F23A 2VQEO 4LF6O 3OAAG 2Q9LA 1VF7A 5CA1A 1RPOA 1WP8A 4H13B 1PL4A 2WLLB 2ZINA 3AG2B 3A0RA 3BAAA 2RDCA 2QWPB 1TUBA 5FL7G 1I94B 3ASOC 2LFSA 3JD0A 5JH7A 5C93A 2HHHO 1NJIW 3X2QB 4OPHA 2QWOB 3N2KB 4K0KO 1ORQC 5KAIZ 1S0VA 1MMMA 2HKOA 4K35A 2N05A 2CK3G 5BMVA 5EBMC 3SPIA 1YJNV 1K7DA 3BHPA 5L3EA 2IU0A 3K08A 1ZLZA 4KHPO 5KHKA 1KB9F 1QQCA 1AI7A 1QR9A 3CMAV 1AP5A 3HKCA 2BTOA 1N33B 1Q8IA 2EJRA 1SESA 2F66C 1N34B 1J5EB 1GMGA 4LF5B 1F7YA 1I0HA 4MVZA 2Y48A 1M9NA 4J42A 2AZ0A 2ZE6A 4H44B 4EEQA 3BA8A 4AQYB 2BOBC 3CC2V 2QKCA 3BY6A 3AG3B 3ABLC 2HJDA 4U7OA 3T1CA 1FS0G 3WU2Z 4FM0A 2WLNA 5GONA 2DMXA 2YIBD 1XNRO 3OGIB 1Y76A 3G6EV 2F43G 4UVCA 4I0XB 3TXSA 3K79A 4QE9A 1DK1A 1JX9A 5KUKA 4Q6GA 2V1DA 4GX1A 1N36O 2NN4A 1GTOA 1XMOO 1WAZA 5LL6Y 3I55V 2IJJA 2Z5UA 4J80A 4DV4O 4JYAO 4J9YB 3D8CA 1SC5B 2UUCB 4IT5A 2Q5ZA 2OTLV 4LWSB 3RYFB 1AROP 3T4DA 4QJFB 5EK0A 5ITZA 5KAFZ 1M90W 1VQ4V 1GN3A 2GDSA 4QIWF 5CBFA 1BCCH 3B2EE 1Q81W 4GX0A 1J95A 1YVWA 4LFCB 1HNXO 2X6CA 1BT8A 4L87A 4P9PA 4CS2A 1PKXA 3SPJA 4WF9V 3W7TA 1AR4A 3ZRXA 3VQYA 1GM8A 2UU9O 5FPOA 3JAKB 4UXNA 5KHGA 3GWOA 2ZR3A 3JSNA 3IAYA 4JV5O 3ZX6A 1KP2A 3DC5A 4FK5C 1NQTA 3LNMB 4DR5O 1G8MA 2RJZA 3JD3A 1NTKH 3OTFA 5LOVA 3KCXA 3L72H 1KD1W 3CRQA 1VIBA 2WWWA 4TUYB 1Q90D 1TGOA 3RYCB 4DUZO 1IVSA 4MS2A 2FB5A 2KB1A 3ZN1A 1KC8W 4B3MB 4I7ZB 1F51A 2R9IA 4MVRA 3J81N 3K0GA 5EZYB 4UCSA 4WFEA 4WFFA 3CJHA 3C3SA 4YHHB 2DYSB 5BY1A 4OX9B 1JPXA 3I56V 3U0ZA 2WSSG 1AJPA 2UXBB 1XL6A 4EKWA 2BSKB 4KUMA 4YJ3B 1YCIA 3ASNC 2QGNA 1URFA 1EFRG 1U97A 2XHBA 1I08A 1AVMA 4LF9O 2GSMB 2ZIMA 5IWAO 4TSFG 3R66A 1L0NH 3FX7A 1HR0O 5H6QA 3AG4B 3H1HH 4LFAO 3JAWA 4DUYB 2ZNIA 4EFEA 4UB6Z 1NH2D 4DV3B 1QR8A 4I55B 4X88A 2QJ1A 5L3FA 4X65B 2JDIG 1ENVA 4GX2A 3T1HO 2Y0PA 4JI2O 2OT5A 1MNGA 3KG2A 1V55C 3OEEG 4PHZA 1QLNA 4FLTA 1B6QA 4DK1A 3OR7C 1H2NA 4J9ZB 3B8MA 1G1XB 5J9PC 2ADPA 3MHSC 3BFRA 3DSQA 3RYHA 2ZE8A 3QO5A 1QLEC 1I94O 2HHHB 2PZSA 2A0LA 1DGSA 1V9PA 2OTJV 4LF8B 1HNWO 1KMIZ 4IIJB 4X66B 1FXKA 2WLIA
chains in the Genus database with same CATH topology
5BY1A 1N33O 1DK1A 1HNZO 1XNQO 3RT3C 4DR7O 4LFCO 3J7AU 1N36O 1FYJA 1N32O 5LMUO 4DUYO 1XMOO 3T1YO 5LL6Y 4X64O 4DR2O 1X59A 1XEQA 4DV2O 4DV4O 4JYAO 4DV6O 5BXZA 5A2QN 4X65O 1AB3A 1IBKO 1FKAO 1IBMO 1R6TA 2UXDO 3F5TA 4X62O 4LFBO 2N74A 1NS1A 5FLXN 2JRIA 2HHHO 4B3MO 4B3SO 1YZBA 2LW7A 5H5NA 4OPHA 2FKXA 4LF9O 1N34O 1J5EO 2E5LO 4LF5O 5IWAO 3R66A 4GKKO 4K0KO 1KUQA 1HR0O 2DOSA 4AQYO 4OX9O 1HNXO 4A5UB 4LFAO 4NXNO 4JI8O 4YY3O 1XMQO 4LF4O 2F4VO 4DR3O 2UXCO 4DR6O 4DV1O 4KHPO 1AILA 1FJGO 4NXMO 2Z0AA 3T1HO 1A32A 4DV7O 2UU9O 1R1BA 4DV5O 4JI2O 4LF8O 2ZM6O 4X66O 4B3TO 4DR4O 4JV5O 3SDLA 4YHHO 3OTOO 2UUAO 1F7YA 5LMNO 3J80N 4JI6O 3O65A 4DR5O 2AGAA 2UXBO 1G1XB 4JI3O 4JI4O 3M8AA 2ZKOA 4JI0O 4DR1O 4GKJO 4DV0O 2UUCO 4DUZO 5IT9N 1I94O 5BR8O 4JI5O 4DV3O 4B3RO 1XNRO 4OPAA 2UUBO 2VQFO 3J81N 4JI7O 2DJVA 4LF7O 1D2DA 1HNWO 4JI1O 1IBLO 2VQEO 4LF6O 3JAMN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BY1 A;  1N33 O;  1DK1 A;  1HNZ O;  1XNQ O;  3RT3 C;  4DR7 O;  4LFC O;  3J7A U;  1N36 O;  1FYJ A;  1N32 O;  5LMU O;  4DUY O;  1XMO O;  3T1Y O;  5LL6 Y;  4X64 O;  4DR2 O;  1X59 A;  1XEQ A;  4DV2 O;  4DV4 O;  4JYA O;  4DV6 O;  5BXZ A;  5A2Q N;  4X65 O;  1AB3 A;  1IBK O;  1FKA O;  1IBM O;  1R6T A;  2UXD O;  3F5T A;  4X62 O;  4LFB O;  2N74 A;  1NS1 A;  5FLX N;  2JRI A;  2HHH O;  4B3M O;  4B3S O;  1YZB A;  2LW7 A;  5H5N A;  4OPH A;  2FKX A;  4LF9 O;  1N34 O;  1J5E O;  2E5L O;  4LF5 O;  5IWA O;  3R66 A;  4GKK O;  4K0K O;  1KUQ A;  1HR0 O;  2DOS A;  4AQY O;  4OX9 O;  1HNX O;  4A5U B;  4LFA O;  4NXN O;  4JI8 O;  4YY3 O;  1XMQ O;  4LF4 O;  2F4V O;  4DR3 O;  2UXC O;  4DR6 O;  4DV1 O;  4KHP O;  1AIL A;  1FJG O;  4NXM O;  2Z0A A;  3T1H O;  1A32 A;  4DV7 O;  2UU9 O;  1R1B A;  4DV5 O;  4JI2 O;  4LF8 O;  2ZM6 O;  4X66 O;  4B3T O;  4DR4 O;  4JV5 O;  3SDL A;  4YHH O;  3OTO O;  2UUA O;  1F7Y A;  5LMN O;  3J80 N;  4JI6 O;  3O65 A;  4DR5 O;  2AGA A;  2UXB O;  1G1X B;  4JI3 O;  4JI4 O;  3M8A A;  2ZKO A;  4JI0 O;  4DR1 O;  4GKJ O;  4DV0 O;  2UUC O;  4DUZ O;  5IT9 N;  1I94 O;  5BR8 O;  4JI5 O;  4DV3 O;  4B3R O;  1XNR O;  4OPA A;  2UUB O;  2VQF O;  3J81 N;  4JI7 O;  2DJV A;  4LF7 O;  1D2D A;  1HNW O;  4JI1 O;  1IBL O;  2VQE O;  4LF6 O;  3JAM N; 
#chains in the Genus database with same CATH topology
 2H94 A;  5K1X A;  2Y69 C;  3ABM B;  4JI6 B;  4D7S A;  2GHY A;  3AG7 A;  3UKM A;  3QNE A;  4JI3 B;  4PA9 A;  3K58 A;  4ZHQ B;  3OMA B;  4UCV A;  2M6Y A;  3S3X A;  4GKJ B;  1BMF G;  2EZO A;  3WB2 A;  1K92 A;  5IJ9 A;  4AI8 A;  1NI8 A;  1R6T A;  1V54 B;  3CCQ V;  1BQ0 A;  1NS1 A;  2LGQ A;  2JRI A;  3E35 A;  2YEV A;  4WCE V;  1MSW D;  1F4N A;  1N34 O;  1J5E O;  4MT8 A;  4LF5 O;  2R9A A;  4R7C A;  2YID A;  1VQ5 V;  3K57 A;  3ABK B;  4AQY O;  3ZCC A;  4P30 A;  3ZRS A;  1KBH A;  1KEC A;  2IJK A;  3UT5 A;  3DC6 A;  3TET A;  2AXT Z;  1R73 A;  5IE9 A;  3JAR A;  2Z0A A;  4O2A A;  2VS0 A;  4MSW C;  3SJQ C;  3W7X A;  1HP8 A;  4TQF A;  3ABT A;  2B5U A;  4B3S B;  5IYD O;  3CYO A;  3EFF K;  1S5H C;  4FFB B;  3FFQ A;  1SQV H;  2Z3Y A;  4W4K A;  2ZE5 A;  2OCC C;  3HKD A;  4DV4 B;  3SJC C;  5EBW C;  4E4E A;  5B1A C;  2F4V B;  1YI2 V;  3MD0 A;  2UUC O;  3CME V;  1AP6 A;  2OYQ A;  4J7J A;  4OPA A;  3OUF A;  3FB6 C;  4UFZ A;  1ZL8 B;  4XDL A;  3CX5 F;  4E2L A;  1UJW B;  1EM1 A;  4WBN A;  4K8X A;  4FLU A;  1SKV A;  3OMN B;  5LGT A;  1YIJ V;  3WFV A;  4TV8 A;  3THO A;  5KX5 A;  1VF6 C;  5IJ0 A;  4LNU B;  2VWJ A;  3SYA A;  2V7Q G;  1ZSP A;  5BMV B;  1SQG A;  5CB4 B;  1EBO A;  4LFC O;  4X1K A;  3D36 C;  5L3C A;  4JI4 B;  3VQW A;  4ZIB A;  3SR2 C;  1GN2 A;  1E79 G;  4DO2 A;  2RN9 A;  2WLK A;  5CMU A;  3AG1 C;  3TGU H;  1RSO A;  2RNB A;  2IH3 C;  1H8H G;  1CP9 A;  5J2U A;  4OGQ B;  2KG7 B;  2P90 A;  1OCC C;  4X1Y A;  3UQ8 A;  1WJZ A;  4I50 A;  3B09 A;  1YTF B;  1XHZ A;  2GV9 A;  3SYC A;  5EIB D;  5KA5 A;  2P5O A;  1QCE A;  2EIM B;  4CC6 A;  4ZI7 A;  3T1Y B;  1PM9 A;  1JVM A;  1SA0 B;  3CRR A;  4Z1V A;  3HKB B;  2BCC H;  2OIG A;  2OWO A;  5LYJ A;  1R6K A;  1MAB G;  1A32 A;  2EJ7 A;  3AG2 C;  4YJ2 B;  4TV9 B;  2A79 B;  4CH4 A;  2E76 B;  2B1G A;  1SRY A;  4EB6 A;  4TQD A;  3FAV B;  4X20 A;  4FM2 A;  1GM9 A;  1RFY A;  5B1A B;  3SDL A;  4YHH O;  3H1K H;  1G6U A;  2GTA A;  3O65 A;  3BEH A;  3F5W C;  1DLB A;  2Q0A A;  3X2Q C;  4I4T A;  4PJ0 Z;  2UXB O;  3M8A A;  4IL6 Z;  2PGG A;  3E89 A;  4TT3 G;  3EXA A;  3LDD A;  2UXC B;  1FJG B;  2E75 B;  2ILM A;  4FVM A;  5CA0 A;  2HVK C;  2DJV A;  4J11 A;  4LBE C;  1E1R G;  3B77 A;  4O4L B;  4CBC A;  1PNK A;  2RQ6 A;  2ZXW B;  1AJQ A;  1ZWI C;  1K4C C;  4FLZ A;  1KU9 A;  1WPX A;  4DUY O;  4F6R A;  5CN0 A;  4KFM A;  3K9A A;  1YIT V;  1BHB A;  4X65 O;  4ZKI A;  3AG3 C;  4CH3 A;  2HG5 C;  4D6T H;  3N2G A;  1NZ6 A;  2XAG A;  1JA8 A;  3ZRV A;  1Z5W A;  3S3W A;  4HYO A;  1IBL B;  5JVD A;  3LSU A;  1Q86 W;  1XOU A;  4U3J B;  1K4D C;  4DRX A;  1ROP A;  3NR7 A;  5C8Y B;  3AK3 A;  4R6Z A;  5IYZ A;  4A5U B;  4LR3 A;  5JJE B;  5LMU B;  5FNV A;  5LGN A;  2M7W A;  3ZS8 C;  4FPP A;  1WA8 B;  4JGS A;  5EC2 C;  2JJ2 G;  3MHH C;  3FYI B;  2IU3 A;  1HNW B;  3K5O A;  4LFB B;  4LF8 O;  2QE7 G;  3CJH B;  4X66 O;  3LUT B;  3G6B A;  5DN6 G;  1E1Q G;  4MVO A;  4JI6 O;  3D3I A;  4CZZ A;  4R8C A;  2CAZ C;  4JI3 O;  3SYQ A;  5D5P A;  3JAL A;  4GKJ O;  1OV9 A;  1R3J C;  4B7E A;  2A06 H;  4JAU A;  2LQT A;  1H2S B;  3HPL C;  4I9W A;  2DYR C;  3K03 A;  4ZOL B;  3Q4H A;  1AR5 A;  1SET A;  4BW5 A;  4RAI A;  3OR6 C;  3RBZ A;  5IY5 B;  3TJT A;  1Y6X A;  2XND G;  3VQX A;  1M57 B;  1SZX A;  2QDO A;  5TIS Z;  1P84 F;  2HLD G;  1H38 A;  3JAW B;  2DQ3 A;  2CDY A;  4DYL A;  5IYB O;  1SZT A;  3JAS A;  1VQP V;  2KKW A;  4JI0 B;  2WA3 A;  4RUF A;  1FFT B;  4UV8 A;  3OE7 G;  3OT7 A;  5H2F Z;  4NKG B;  1IBK O;  3M7M X;  1JFF B;  2KSD A;  1FKA O;  1VQM V;  4YIO A;  1QNM A;  4K8Z A;  3K0D A;  3CE2 A;  3FYE B;  2VQF B;  1FFX B;  4B3S O;  4UCT A;  2QSA A;  4ASU G;  2FKX A;  1EZV H;  5LBQ A;  5DEC A;  5LXT A;  1Y74 B;  4ABM A;  2DQ0 A;  2PF4 E;  1XNQ B;  4DR7 B;  4ICG A;  3JD2 A;  1IXB A;  2DYS C;  5BZB A;  2YXH A;  3DXR B;  4HNA A;  2Q4P A;  4IHJ B;  2WPD G;  2F4V O;  2YDE A;  3AK1 A;  2Q69 A;  2ZDI C;  1AJN A;  3ZRW B;  2EIK C;  1XBL A;  2Q6A A;  3WB0 A;  4QNH B;  4FIP C;  1YDX A;  1XDC A;  1HW7 A;  1FXK B;  1Z2G A;  4O4J A;  3EVK A;  4BW9 A;  4P9O A;  2XUM A;  1K5Q A;  1VF6 A;  4O2B A;  5L3D A;  2DYR B;  4PA3 A;  4X1I A;  4F6E A;  3PJS K;  3D36 A;  1DF4 A;  4JI4 O;  1JOY A;  1AI4 A;  5KUM A;  1UFI A;  3CCV V;  3AG4 C;  5LP6 B;  3W7U A;  5IJ9 B;  3SPC A;  3CCM V;  3ZN0 A;  3HKE A;  4UVB A;  4DV5 B;  1NH2 B;  4LF7 O;  1MG1 A;  4J7K A;  1BHA A;  4MW8 A;  3E8H A;  2ZR2 A;  2ZM6 B;  3E22 A;  1RM1 B;  4GCZ A;  1XRE A;  2EIL B;  2H8P C;  1F4M A;  2JS3 A;  4JZ2 A;  4BWA A;  2CTW A;  2Y4T A;  4JAA A;  3J7A U;  2WLH A;  1OCR B;  2L35 A;  3T1Y O;  1T5E A;  4FLV A;  1X59 A;  5KMG B;  3K3W A;  3JAR B;  1ZAU A;  2O57 A;  5F2V O;  2WLL A;  1VQO V;  1THZ A;  3E8B A;  5L3B A;  4B3R B;  3OEH G;  1KKC A;  3P3N A;  1YHQ V;  5FLX N;  4JTC B;  4X9Q A;  5H5N A;  1KYO F;  2D3O W;  3UO3 A;  4BIZ A;  1VMG A;  3LNN A;  2EIK B;  4MVM A;  3N2K A;  1OCZ B;  3OM3 B;  2LP7 A;  1NR7 A;  3ABM C;  1XI1 A;  3UO2 A;  4DV2 B;  2IW5 A;  2UXC O;  3W7W A;  4D7T A;  1FJG O;  1H2G A;  2LFR A;  1XIL A;  2CH7 B;  5FPR A;  4QPK A;  3SGI A;  5GW7 A;  1YJ9 V;  1K8A W;  1JCH A;  5JJJ B;  1O9G A;  5JQG B;  4IYH A;  1V54 C;  2ZT9 B;  2UUA O;  1WLE A;  2LGW A;  3O9O A;  2A7W A;  2QWR B;  2GTS A;  5LA6 B;  3ETQ A;  2KQX A;  2YC0 A;  1S76 D;  1VQN V;  4LF4 B;  2X6A A;  4JYY A;  2IJI A;  3ABK C;  4MW3 A;  3RVZ A;  4QPJ A;  5A9G A;  2GUZ B;  5CBG A;  1BQZ A;  4DV7 B;  2UUB O;  2PY5 A;  5EYP A;  2YXL A;  2R9R B;  1US6 A;  3CRA A;  1IBL O;  1VF5 B;  1QVF U;  1N8R W;  4X1Y B;  2CGO A;  3ZJZ A;  3IFX A;  1R3L C;  5DED A;  5IYC O;  2OCH A;  4I0X A;  1OZ0 A;  1TVK B;  3LSQ A;  2B1I A;  1BGY H;  4O4H B;  4FMT A;  1W59 A;  5LMU O;  4NTY A;  1EN5 A;  1I5Y A;  4CH6 A;  1NTM H;  5LYJ B;  3QVN A;  1MSD A;  2YS8 A;  4LFB O;  1DF5 A;  2BTQ A;  2JGD B;  4JI7 B;  2D2C B;  3L71 H;  2ADQ B;  4Z2W A;  1P7B A;  4L8J A;  3CHX A;  4KL1 A;  4LWS A;  1M4U A;  4GYC B;  5B66 Z;  2JVD A;  1H2M A;  4JYC A;  3AK2 A;  4UV9 A;  1N32 B;  5GTI Z;  5H6R A;  3APQ A;  4XDJ A;  1SQP H;  5KHH A;  3U11 A;  1PNM A;  3JAT A;  1XL4 A;  1BZK A;  1SER A;  3WG7 B;  1B04 A;  5B1N A;  2FTK A;  4LC1 A;  2DE0 X;  2WA4 A;  3PN1 A;  4FJC C;  1LUW A;  3C3T A;  1NU1 H;  3ZIA G;  2PYJ A;  3B40 A;  4O4I A;  4MTX A;  1VQK V;  3UCS C;  4PI2 A;  5AG2 A;  1YSC A;  3CRC A;  3JAK A;  5IDJ A;  2E5L B;  1EN6 A;  1M56 B;  3ML0 A;  4MVS A;  2ITD C;  1MZF A;  4Z1M G;  2F95 B;  3P30 A;  2DWE C;  4PDM A;  3QO7 A;  4GUN A;  2ZKO A;  4UB8 Z;  4YY3 B;  5B3S B;  1IUR A;  4JI0 O;  1LUV A;  1IBK B;  4IGG A;  2PYL A;  2EIM C;  2W6J G;  1PPJ H;  3MAQ A;  4TUY A;  3L75 H;  2VQF O;  3K9S A;  1W0K G;  3RYC A;  2BOC C;  2WLJ A;  1TAE A;  2EIN B;  5KHI A;  2G38 A;  5CA1 B;  1P4R A;  3ZHT A;  1QU7 A;  5EZY A;  5B5E Z;  3SJA C;  4MVQ A;  2YIA A;  2QM7 A;  1XNQ O;  4DR7 O;  1QHT A;  1TUB B;  2N04 A;  3IJ4 A;  5JJN B;  1IZ3 A;  1SF9 A;  5JH7 B;  4WFB V;  2X0L A;  2BSK A;  2ZDI A;  4JI5 B;  2E74 B;  1TUE B;  1UPG A;  1WB8 A;  3H1L H;  4YJ3 A;  1FXH A;  4GX5 A;  4H0L B;  3CPW U;  3E83 A;  1YZB A;  4UVA A;  2EZP A;  1VAR A;  2VRZ A;  1KUQ A;  2RMK B;  3QF7 A;  4MTO A;  3B4S A;  2Q7H A;  2ZXW C;  3IC9 A;  2IBZ H;  2EX3 A;  3GB7 C;  3K5L A;  3CC4 V;  3HKC B;  4N23 A;  3FKS G;  1NVP D;  3RVY A;  4LF7 B;  4RO2 A;  2QWN B;  3P3P A;  1R1B A;  4DV5 O;  2QWQ B;  4I55 A;  4G27 B;  3RYI A;  3L73 H;  3JCZ A;  1EN4 A;  3CSX A;  2ZM6 O;  5JCO C;  3JYC A;  4GKK B;  2QM8 A;  5KHJ A;  1AR1 B;  3LDE A;  4B08 A;  2AGA A;  4BR6 A;  4JPR A;  4JI8 B;  3JAS B;  5GON B;  4PD4 F;  4DR1 O;  4PDR A;  4LCU C;  1IX9 A;  1Y76 B;  3SJB C;  5CA3 A;  4DV1 B;  2QA4 V;  1NBM G;  4B3R O;  2CGN A;  1PD3 A;  1K33 A;  1K9M W;  3KZI Z;  2YI8 A;  2YIC A;  3M99 B;  3ZHS A;  4FM1 A;  5LMN B;  1K5S A;  2XAF A;  2HP8 A;  2HEP A;  1XEQ A;  4DV2 O;  1BL8 A;  2WAM A;  4UCO A;  5ITZ B;  5KLV H;  2YXY A;  4ZHQ A;  4F4L A;  3ZMU A;  1PV0 A;  1COW G;  2OIE A;  2N74 A;  5H9C A;  1JMK C;  2UUA B;  5LHG A;  4KXR A;  3K5M A;  2LW7 A;  1R3I C;  1VQ6 V;  5JWP A;  5LHH A;  2ZQM A;  1JJ2 U;  5IY5 C;  1ZTE A;  3W7S A;  1S3J A;  4LF4 O;  1M57 C;  4X64 B;  5EBL C;  3KCY A;  1OCO B;  4DV6 B;  4KP4 A;  2XAJ A;  4DR6 O;  2CE4 A;  2UUB B;  4NXM O;  2VWK A;  2Q8V A;  1S5L Z;  4DV7 O;  1YF2 A;  3HKE B;  3CXC U;  4GT1 A;  1W0J G;  3BA9 A;  4PA6 A;  2JJ1 G;  4PA7 A;  3ETE A;  3WB1 A;  1YEW A;  1GN4 A;  3GWK C;  1Z5V A;  3F7V C;  1S77 D;  2IH1 C;  2A3Q A;  3J80 N;  5LOV B;  3H1I H;  4B7K A;  3ETG A;  4QE7 A;  1WPB A;  4FFB A;  4WFA V;  2ATK C;  5J2T A;  2UXN A;  1I5X A;  1WB7 A;  1GO3 F;  3LDC A;  4I9Q A;  3G71 V;  4NTX A;  1X4T A;  3D3Q A;  4JI7 O;  1YJW V;  4UCU A;  2P4V A;  3IC7 A;  4Q20 A;  2R70 A;  2JGU A;  1ZX3 A;  2XT9 A;  1KQS U;  3OTO B;  1R6N A;  1ZL8 A;  1H8E G;  2ITC C;  3E8F A;  3RW0 A;  2AW9 A;  4XBF A;  1FXK C;  1N32 O;  1D5N A;  4CS4 A;  4DW0 A;  3CCL V;  1HWY A;  2V4D A;  2WLM A;  4LNU A;  2QR4 A;  3ZMZ A;  5CB4 A;  2Q7E A;  2EIJ B;  4MVU A;  5BR8 B;  4NVP A;  4JAS A;  2HFE C;  3F5T A;  4P2Z A;  2AZ2 A;  2DN9 A;  2W0F C;  4JYB A;  1NKD A;  1IXM A;  1FXV A;  5LP6 C;  3ZMT A;  4JI1 B;  2UXX A;  3A2F A;  3TXQ A;  2E5L O;  3K06 A;  1K97 A;  3ZED A;  2QEX V;  4J10 A;  2ZIO A;  2ZCE A;  1S5J A;  2KG7 A;  2YSU B;  4MTG A;  3KKY A;  3TK1 A;  2PUS A;  3L74 H;  1RM1 C;  4YY3 O;  4DR2 B;  2EIL C;  4RQE A;  5D5Q A;  5B1B B;  2L6L A;  1OCR C;  1AIL A;  3A0B Z;  1FAF A;  1WNS A;  3OGC C;  2P22 C;  1SA0 A;  2UXD B;  5EYP B;  2JS5 A;  3HKB A;  4X62 B;  4DW1 A;  1M93 A;  3JD4 A;  3CB2 A;  1LNQ A;  3MDS A;  4YJ2 A;  4TV9 A;  2PI4 A;  3G4S V;  1L1F A;  3FAV A;  3RYH B;  1JJO A;  3QO8 A;  2LW1 A;  3OFN G;  3ASO B;  3BAB A;  4CH5 A;  4ZBM A;  3QG5 A;  4JI5 O;  1OCZ C;  3SYP A;  3H1J H;  1Q6U A;  4TOI A;  2BTQ B;  2YI9 A;  4WFH A;  2WLI B;  4PDL A;  4NTW A;  2EBO A;  4H33 A;  2X7R B;  1VQL V;  1S72 V;  4DR4 B;  5E79 Z;  4O4L A;  4BIU A;  3BVO A;  1BS3 A;  2QTS A;  4FZ1 A;  2QKS A;  3FB5 C;  1N0J A;  1B3Q A;  2EUL A;  3RWR D;  2XAH A;  3JAT B;  2MK3 A;  2P4K A;  4DV0 B;  4DK0 A;  1Y66 A;  2FML A;  5E1A C;  1AI6 A;  1R3K C;  3ZHQ A;  2YEV B;  1HDJ A;  2F1M A;  4RUE A;  2FYU H;  2GBO A;  2IM9 A;  3C90 A;  2P6J A;  4O4I B;  5JCO A;  2W0X A;  1WP7 A;  4GZR B;  2HJF C;  3FB8 C;  4GKK O;  3UT5 B;  1HNZ B;  4TWK A;  3ABL B;  4XDK A;  1P7G A;  1VQ7 V;  2W6I G;  4DR1 B;  2YIB A;  1N0N A;  4U3J A;  4JI8 O;  4X89 A;  2ETN A;  4O2A B;  5C8Y A;  4NB5 A;  2CTP A;  1L0L H;  4DV1 O;  1VQ8 V;  2MW2 B;  1XHX A;  1WA8 A;  1CEZ A;  4X8A A;  4MTF A;  1PP9 H;  2XAQ A;  1VQ9 V;  2JEX A;  3HKD B;  4UCR A;  5LMN O;  3JSL A;  4PV1 B;  3DGE A;  1YXB A;  4FLW A;  3ICX A;  4NXN B;  3CCS V;  1XMQ B;  4N21 A;  4H37 A;  2R72 A;  1GM7 A;  1MOF A;  4FFK A;  4DR3 B;  2BE3 A;  3OUS A;  2ARH A;  4WBN B;  1JQ0 A;  1H2L A;  1Y67 A;  4JAV A;  3FD9 A;  3VQV A;  3WG7 C;  4TV8 B;  1RP3 B;  1D2D A;  2FL4 A;  1U96 A;  5KX5 B;  4ZOL A;  3VOU A;  5IJ0 B;  2Q67 A;  1NTZ H;  4B3T B;  4X1K B;  1PNL A;  2NNU A;  1GK9 A;  3T4Z A;  3G67 A;  4FZ0 A;  3CCE V;  3BCC H;  2XOK G;  4DR6 B;  2P06 A;  1ZUQ A;  1M56 C;  4J41 A;  1MA1 A;  2XTA A;  1L8D A;  4X64 O;  3CCR V;  1GH6 A;  4NXM B;  1RSO B;  2K1E A;  4YIP A;  2CUG A;  4DV6 O;  3CCJ V;  5J2U B;  1Q3E A;  3CEI A;  3E2E A;  3QTC A;  4OXS A;  1FPO A;  4EFB A;  2JIZ G;  2CTR A;  1IBM O;  3E8G A;  5B3S C;  3OD4 A;  3RGB A;  2LJ2 A;  3RYI B;  4HZ3 A;  1K3E A;  5EIB C;  1JFF A;  1H2K A;  2IJH A;  3F7Y C;  4I50 B;  4AHC A;  2VQE B;  3ZHV A;  4JF3 A;  4HBN A;  4LF6 B;  4ZI7 B;  1FFX A;  1Y4M A;  2EIN C;  1O9H A;  2DOS A;  2P7T C;  2YUA A;  3TCU A;  1SS3 A;  1Y74 A;  1GKF A;  5DM6 V;  4G2K A;  1BSM A;  1CXZ B;  3CP1 A;  3JD1 A;  1Q6H A;  2QKA A;  2A9H A;  3DXR A;  4EB6 B;  3R65 A;  3DTU B;  4IHJ A;  4X20 B;  4LH7 A;  4W4L A;  3CC7 V;  3RYF A;  1TA8 A;  1LR1 A;  4I5S A;  3L70 H;  3ZRW A;  3I5D A;  3ETD A;  4I4T B;  3OTO O;  3BPZ A;  4JZG A;  1XUQ A;  1JR9 A;  4K0K B;  1M5I A;  2AHZ A;  2HVJ C;  3ASN B;  5EC1 C;  3ZMS A;  3CRM A;  5CA0 B;  4KHP B;  5BR8 O;  2Q7G A;  5K1P A;  4K3A A;  3RFR A;  3A8T A;  2ZNJ A;  3AEI A;  5LP6 A;  3SYO A;  1DTO A;  3BRC A;  2ODM A;  4JI1 O;  3SPG A;  1NVP B;  1SQQ H;  1N4C A;  4LH6 A;  1N33 O;  1GN6 A;  3UM7 A;  3CS5 A;  4RQF A;  4F6R B;  4JTA B;  3RT3 C;  2XAS A;  5LHI A;  1W2B U;  1OHH G;  3K04 A;  5CBH A;  3A0H Z;  4DR2 O;  3STL C;  3N2G B;  5BXZ A;  1IDS A;  3ZBH A;  1V55 B;  3CD6 V;  1I7F A;  2B9Z A;  2LO1 A;  1AB3 A;  1KP3 A;  5KMG A;  2UXD O;  1XNR B;  4X62 O;  5JVD B;  3CWB H;  1G4Y B;  2QM4 A;  5GTH Z;  1Q43 A;  4DRX B;  4JTD B;  1K73 W;  4NR1 A;  1VEW A;  5IYZ B;  1BE3 H;  3IGA C;  5FNV B;  3APO A;  1N36 B;  1QLE B;  4C7U A;  3EHB B;  4BIO A;  1XMO B;  3E86 A;  1B06 A;  4HAM A;  5J2T B;  4CS3 A;  5HFL A;  2HR3 A;  2Y4U A;  1NT2 B;  4JYA B;  1FD9 A;  3K59 A;  4FLY A;  4G28 B;  4PI0 A;  3VBB A;  2Y0I A;  2H3O A;  1AI5 A;  2RCV A;  2Y69 B;  3U10 A;  3HB3 B;  3B8N A;  2CH7 A;  4WFG A;  2NR5 A;  4DR4 O;  2ZD9 A;  4UUJ C;  1Q82 W;  2NLJ C;  1GRJ A;  3JCU Z;  3JAL B;  3P32 A;  5JQG A;  4QGP A;  2DWD C;  2CTQ A;  5HFM A;  1QVG U;  2X6B A;  2ZE7 A;  1HNX B;  3ZHU A;  4FLX A;  3ZHR A;  5LA6 A;  3Q4H B;  4DV0 O;  3OMI B;  1OJH A;  5IT9 N;  5LGU A;  3CCU V;  2Q0O C;  2JEU A;  2UU9 B;  4NYK A;  1OCO C;  2K9P A;  1NR1 A;  2GUZ A;  4JV5 B;  3JAM N;  4YXW G;  4CC5 A;  1HNZ O;  1Q7Y W;  1M1K W;  4DR5 B;  4PEL A;  1FYJ A;  3LSS A;  3NXS A;  1TVK A;  1QBZ A;  3SPH A;  2JK5 C;  1EZJ A;  1Q5O A;  4O4H A;  2DW4 A;  5A2Q N;  4DUZ B;  1SQF A;  2F93 B;  1D5A A;  4PDV A;  4LP8 A;  5KA6 A;  1MZE A;  4U7N A;  1GAX A;  5LXT B;  1WN7 A;  4B3M O;  3H9V A;  4BAY A;  2OCC B;  3G80 A;  4IIJ A;  3STZ C;  3ZMV A;  2JGD A;  1VP7 A;  4HNA B;  1Q6I A;  2AHY A;  4OX9 O;  2QTO A;  3RN4 A;  4NXN O;  1XQ8 A;  1XMQ O;  4DXW A;  2F23 A;  1CPY A;  3K5N A;  3HR0 A;  3T2M A;  4DR3 O;  4U3F H;  2PI5 A;  1P49 A;  3GVM A;  4O4J B;  4R50 A;  4O2B B;  2EIJ C;  4PA4 A;  4X1I B;  4B3T O;  2Q73 A;  4LF9 B;  1KKD A;  2Q68 A;  5IWA B;  4RWU A;  1HR0 B;  2P67 A;  1PL0 A;  1SQX H;  3AG1 B;  1SQB H;  4AIL C;  4LFA B;  3ABU A;  3N27 A;  3H01 A;  2PTM A;  1RPR A;  1IBM B;  2E3C A;  4IYI A;  3L9D A;  5B1O A;  4J7Z A;  3CXH F;  5L3G A;  4DV3 O;  3OW2 U;  3T1H B;  1OCC B;  5B1B C;  3FB7 C;  3E22 B;  1YTF D;  4JI2 B;  4GLX A;  2C2A A;  1K34 A;  1F23 A;  2VQE O;  4LF6 O;  3OAA G;  2Q9L A;  1VF7 A;  5CA1 A;  1RPO A;  1WP8 A;  4H13 B;  1PL4 A;  2WLL B;  2ZIN A;  3AG2 B;  3A0R A;  3BAA A;  2RDC A;  2QWP B;  1TUB A;  5FL7 G;  1I94 B;  3ASO C;  2LFS A;  3JD0 A;  5JH7 A;  5C93 A;  2HHH O;  1NJI W;  3X2Q B;  4OPH A;  2QWO B;  3N2K B;  4K0K O;  1ORQ C;  5KAI Z;  1S0V A;  1MMM A;  2HKO A;  4K35 A;  2N05 A;  2CK3 G;  5BMV A;  5EBM C;  3SPI A;  1YJN V;  1K7D A;  3BHP A;  5L3E A;  2IU0 A;  3K08 A;  1ZLZ A;  4KHP O;  5KHK A;  1KB9 F;  1QQC A;  1AI7 A;  1QR9 A;  3CMA V;  1AP5 A;  3HKC A;  2BTO A;  1N33 B;  1Q8I A;  2EJR A;  1SES A;  2F66 C;  1N34 B;  1J5E B;  1GMG A;  4LF5 B;  1F7Y A;  1I0H A;  4MVZ A;  2Y48 A;  1M9N A;  4J42 A;  2AZ0 A;  2ZE6 A;  4H44 B;  4EEQ A;  3BA8 A;  4AQY B;  2BOB C;  3CC2 V;  2QKC A;  3BY6 A;  3AG3 B;  3ABL C;  2HJD A;  4U7O A;  3T1C A;  1FS0 G;  3WU2 Z;  4FM0 A;  2WLN A;  5GON A;  2DMX A;  2YIB D;  1XNR O;  3OGI B;  1Y76 A;  3G6E V;  2F43 G;  4UVC A;  4I0X B;  3TXS A;  3K79 A;  4QE9 A;  1DK1 A;  1JX9 A;  5KUK A;  4Q6G A;  2V1D A;  4GX1 A;  1N36 O;  2NN4 A;  1GTO A;  1XMO O;  1WAZ A;  5LL6 Y;  3I55 V;  2IJJ A;  2Z5U A;  4J80 A;  4DV4 O;  4JYA O;  4J9Y B;  3D8C A;  1SC5 B;  2UUC B;  4IT5 A;  2Q5Z A;  2OTL V;  4LWS B;  3RYF B;  1ARO P;  3T4D A;  4QJF B;  5EK0 A;  5ITZ A;  5KAF Z;  1M90 W;  1VQ4 V;  1GN3 A;  2GDS A;  4QIW F;  5CBF A;  1BCC H;  3B2E E;  1Q81 W;  4GX0 A;  1J95 A;  1YVW A;  4LFC B;  1HNX O;  2X6C A;  1BT8 A;  4L87 A;  4P9P A;  4CS2 A;  1PKX A;  3SPJ A;  4WF9 V;  3W7T A;  1AR4 A;  3ZRX A;  3VQY A;  1GM8 A;  2UU9 O;  5FPO A;  3JAK B;  4UXN A;  5KHG A;  3GWO A;  2ZR3 A;  3JSN A;  3IAY A;  4JV5 O;  3ZX6 A;  1KP2 A;  3DC5 A;  4FK5 C;  1NQT A;  3LNM B;  4DR5 O;  1G8M A;  2RJZ A;  3JD3 A;  1NTK H;  3OTF A;  5LOV A;  3KCX A;  3L72 H;  1KD1 W;  3CRQ A;  1VIB A;  2WWW A;  4TUY B;  1Q90 D;  1TGO A;  3RYC B;  4DUZ O;  1IVS A;  4MS2 A;  2FB5 A;  2KB1 A;  3ZN1 A;  1KC8 W;  4B3M B;  4I7Z B;  1F51 A;  2R9I A;  4MVR A;  3J81 N;  3K0G A;  5EZY B;  4UCS A;  4WFE A;  4WFF A;  3CJH A;  3C3S A;  4YHH B;  2DYS B;  5BY1 A;  4OX9 B;  1JPX A;  3I56 V;  3U0Z A;  2WSS G;  1AJP A;  2UXB B;  1XL6 A;  4EKW A;  2BSK B;  4KUM A;  4YJ3 B;  1YCI A;  3ASN C;  2QGN A;  1URF A;  1EFR G;  1U97 A;  2XHB A;  1I08 A;  1AVM A;  4LF9 O;  2GSM B;  2ZIM A;  5IWA O;  4TSF G;  3R66 A;  1L0N H;  3FX7 A;  1HR0 O;  5H6Q A;  3AG4 B;  3H1H H;  4LFA O;  3JAW A;  4DUY B;  2ZNI A;  4EFE A;  4UB6 Z;  1NH2 D;  4DV3 B;  1QR8 A;  4I55 B;  4X88 A;  2QJ1 A;  5L3F A;  4X65 B;  2JDI G;  1ENV A;  4GX2 A;  3T1H O;  2Y0P A;  4JI2 O;  2OT5 A;  1MNG A;  3KG2 A;  1V55 C;  3OEE G;  4PHZ A;  1QLN A;  4FLT A;  1B6Q A;  4DK1 A;  3OR7 C;  1H2N A;  4J9Z B;  3B8M A;  1G1X B;  5J9P C;  2ADP A;  3MHS C;  3BFR A;  3DSQ A;  3RYH A;  2ZE8 A;  3QO5 A;  1QLE C;  1I94 O;  2HHH B;  2PZS A;  2A0L A;  1DGS A;  1V9P A;  2OTJ V;  4LF8 B;  1HNW O;  1KMI Z;  4IIJ B;  4X66 B;  1FXK A;  2WLI A; 
#chains in the Genus database with same CATH homology
 5BY1 A;  1N33 O;  1DK1 A;  1HNZ O;  1XNQ O;  3RT3 C;  4DR7 O;  4LFC O;  3J7A U;  1N36 O;  1FYJ A;  1N32 O;  5LMU O;  4DUY O;  1XMO O;  3T1Y O;  5LL6 Y;  4X64 O;  4DR2 O;  1X59 A;  1XEQ A;  4DV2 O;  4DV4 O;  4JYA O;  4DV6 O;  5BXZ A;  5A2Q N;  4X65 O;  1AB3 A;  1IBK O;  1FKA O;  1IBM O;  1R6T A;  2UXD O;  3F5T A;  4X62 O;  4LFB O;  2N74 A;  1NS1 A;  5FLX N;  2JRI A;  2HHH O;  4B3M O;  4B3S O;  1YZB A;  2LW7 A;  5H5N A;  4OPH A;  2FKX A;  4LF9 O;  1N34 O;  1J5E O;  2E5L O;  4LF5 O;  5IWA O;  3R66 A;  4GKK O;  4K0K O;  1KUQ A;  1HR0 O;  2DOS A;  4AQY O;  4OX9 O;  1HNX O;  4A5U B;  4LFA O;  4NXN O;  4JI8 O;  4YY3 O;  1XMQ O;  4LF4 O;  2F4V O;  4DR3 O;  2UXC O;  4DR6 O;  4DV1 O;  4KHP O;  1AIL A;  1FJG O;  4NXM O;  2Z0A A;  3T1H O;  1A32 A;  4DV7 O;  2UU9 O;  1R1B A;  4DV5 O;  4JI2 O;  4LF8 O;  2ZM6 O;  4X66 O;  4B3T O;  4DR4 O;  4JV5 O;  3SDL A;  4YHH O;  3OTO O;  2UUA O;  1F7Y A;  5LMN O;  3J80 N;  4JI6 O;  3O65 A;  4DR5 O;  2AGA A;  2UXB O;  1G1X B;  4JI3 O;  4JI4 O;  3M8A A;  2ZKO A;  4JI0 O;  4DR1 O;  4GKJ O;  4DV0 O;  2UUC O;  4DUZ O;  5IT9 N;  1I94 O;  5BR8 O;  4JI5 O;  4DV3 O;  4B3R O;  1XNR O;  4OPA A;  2UUB O;  2VQF O;  3J81 N;  4JI7 O;  2DJV A;  4LF7 O;  1D2D A;  1HNW O;  4JI1 O;  1IBL O;  2VQE O;  4LF6 O;  3JAM N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...