4DR4O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr4O00
4B3RO 1R6TA 4DR7O 2Z0AA 1NS1A 4DV7O 2LW7A 4KHPO 3F5TA 2HHHO 4DV6O 4LF7O 1F7YA 4JI3O 3JAMN 4YY3O 4DUZO 1HNWO 2AGAA 4JI6O 2JRIA 4DR2O 4X64O 4YHHO 1N34O 1XNRO 2UUBO 4DR4O 5LMUO 2ZM6O 4LF9O 1KUQA 5H5NA 1I94O 4JI4O 3RT3C 1N32O 5BY1A 2UXCO 4DR1O 2DJVA 3OTOO 4DUYO 4JI2O 4LFBO 2UXDO 4DV0O 1N36O 4DV2O 1N33O 4LF8O 1XNQO 4X66O 4OPAA 5LMNO 4LF4O 4OX9O 2UU9O 4GKJO 5BXZA 1IBMO 4K0KO 4DR3O 5FLXN 2UXBO 4DV4O 4NXNO 4LF6O 5LL6Y 2E5LO 3T1YO 3J80N 4JI5O 4B3SO 5IWAO 3T1HO 4JI0O 4A5UB 4LFAO 4JI8O 1X59A 1AB3A 1XEQA 4AQYO 1AILA 4X62O 5A2QN 4OPHA 3O65A 4GKKO 4JYAO 1R1BA 2FKXA 4JI7O 2VQEO 1IBLO 4NXMO 4DV1O 4B3TO 5IT9N 4DR6O 4JI1O 1DK1A 4LFCO 1D2DA 1IBKO 4B3MO 1A32A 1G1XB 4LF5O 4X65O 3R66A 1FKAO 4DV3O 3J81N 1XMOO 1HNZO 1FJGO 4DR5O 2DOSA 2N74A 1J5EO 1HR0O 2VQFO 2UUCO 4JV5O 1XMQO 2UUAO 1YZBA 2F4VO 1HNXO 3M8AA 3SDLA 3J7AU 1FYJA 5BR8O 2ZKOA 4DV5O
chains in the Genus database with same CATH superfamily
2KG7A 4Q20A 1JCHA 3JALA 3JARA 4X89A 1XHZA 3VQWA 2EILB 4YY3O 4JI6O 5EBWC 3HKEA 2GDSA 1ROPA 2LGWA 2KSDA 4EFBA 1TAEA 1E1RG 3JSNA 2EIMB 1D5NA 4UFZA 5DECA 1NKDA 1TA8A 1YVWA 1BQ0A 4X66B 1SQVH 4JI2O 3BVOA 3DXRA 1YSCA 3P32A 1JFFA 4CS3A 5JWPA 2K1EA 5IJ0B 3CMEV 4N21A 2ZR2A 1B06A 1IBMO 2Q7GA 4ABMA 2W6JG 3ABMC 4QE9A 3DC6A 3ABMB 4OGQB 1K73W 5B1OA 4DV6B 4QPJA 3G6EV 1PPJH 1GM8A 1M90W 2NNUA 4GX5A 4ASUG 3QVNA 4FLZA 3D36A 1OCCC 2A06H 2WLLB 3CCRV 2W0FC 3CRQA 4RQEA 1R3IC 3JYCA 4LFCO 3WB1A 1D2DA 1GN6A 4Q6GA 1VQKV 2PYLA 4FFKA 1VQOV 1M9NA 2QKSA 4JYBA 2UUCB 3L73H 3U0ZA 3QO5A 3SYCA 2XHBA 1OCOB 1F23A 2BTOA 4P9OA 3ASOB 5L3DA 4U3JA 4YJ3A 2QTOA 1S5JA 1NS1A 2A79B 2JIZG 1B3QA 2MW2B 2XASA 4RQFA 3WG7C 2QWOB 3EFFK 2ZE5A 4FPPA 2P4KA 3F7YC 2BSKB 4DR2O 1L8DA 1MZEA 4YHHO 5LGUA 4K0KB 2EIKB 1R3LC 4O2BA 2KKWA 2RN9A 1I0HA 2H3OA 1BL8A 4R7CA 2GUZB 2B5UA 4UVBA 2UXDO 3SJCC 2VQEB 1FD9A 1YXBA 1VQ8V 4LF4O 1ENVA 4IYHA 4O4HB 3SJAC 2EINB 1MNGA 3D36C 1RSOB 4DV2B 4YJ3B 5KHHA 3RVYA 4BW5A 5JJNB 3J80N 4H33A 2AXTZ 1BE3H 4KFMA 2DYSB 1YTFB 4ZI7A 4LF5B 4LNUA 4YJ2B 4UV9A 3ZS8C 1S0VA 4CH6A 3Q4HB 1MZFA 3TETA 5E1AC 4FM2A 2CTWA 1OCZB 4JYCA 1K33A 2ARHA 1L0LH 3LNMB 3CJHA 4PELA 2ZXWB 2HVJC 3AG7A 4W4KA 5GW7A 4DR5O 1HR0O 2ZD9A 5H6QA 4HYOA 2GBOA 2EIMC 1SA0B 2EZPA 2WSSG 4I50B 2DN9A 5J2UA 5KHGA 1FYJA 1Q43A 2ZDIC 2CH7B 2N04A 1GO3F 2EULA 1JJOA 3RFRA 4PV1B 4IL6Z 2Z0AA 2OIEA 1THZA 3AG3C 4I55B 1N8RW 2A3QA 2JK5C 1M57B 3RYFB 1Q7YW 3KG2A 3N2KB 1K3EA 4QGPA 4UVCA 3FYIB 2YDEA 3JASB 1FFXA 5H2FZ 4JAAA 4CS4A 3AG1C 3RBZA 4YY3B 2FL4A 1BZKA 1N36B 2UXDB 4FK5C 1VF5B 3CEIA 3K3WA 1GTOA 4OPAA 5LMNO 1F4NA 2WLIB 2Q68A 3S3WA 4LBEC 4DO2A 2JGDB 3OUFA 2JGUA 2XT9A 1Q90D 4K0KO 5EK0A 2W0XA 5LOVB 3AG2C 5FLXN 2UXBO 4JI5O 4K35A 4QNHB 3ZRSA 2AHZA 5GONB 2M7WA 3RN4A 1EZJA 2GSMB 3X2QB 3AG3B 2NN4A 5EIBC 4UCRA 1EN4A 5BR8B 1M57C 1EM1A 4OPHA 5B66Z 4FLUA 3OMAB 1G8MA 4O4IA 1GN2A 1AR1B 3CCEV 2Q7EA 2QTSA 1NVPD 1QVFU 3H1IH 1IBKO 1N0JA 3CE2A 2W6IG 4X65O 5B1AC 3SR2C 2WLHA 2UUBB 3ETDA 3JD3A 3SPJA 4TWKA 1XDCA 3UT5B 3HKBA 1Q6HA 2CTPA 2Z3YA 1P4RA 3P30A 3D3QA 3B8NA 1BCCH 2HEPA 2FB5A 4Z2WA 3ZN0A 3K03A 3FB5C 2YI8A 3ZCCA 2XAGA 2FTKA 2MK3A 4MVUA 1CXZB 3T4DA 4KP4A 1B6QA 3N2GA 1XHXA 4MT8A 3ZMTA 4B3TB 2B9ZA 1IBLB 2V4DA 3H01A 4U3FH 4UCUA 4KUMA 5IYDO 5CB4B 3FB6C 5DN6G 3ZN1A 1FPOA 5CA0A 2ZE7A 1IBMB 1AJPA 3SYPA 4DRXB 1NZ6A 2R72A 3CCUV 2LW1A 4PI2A 5IYZB 2P6JA 5BZBA 2P7TC 4L8JA 4WFEA 4FMTA 4PA9A 4LF8O 4FZ0A 4H44B 4PD4F 1DGSA 1AI5A 1GMGA 1AROP 3RVZA 1FXVA 2AZ0A 2QA4V 4RWUA 3L74H 3APOA 5KA5A 1KECA 3SYAA 3T1HB 4D7SA 2QKAA 3BCCH 4K3AA 5B1NA 2LFSA 2IW5A 2LFRA 5C8YA 4G2KA 2D3OW 1AB3A 1AP6A 1PNLA 3ICXA 5B1BB 2JS3A 1VQPV 2AZ2A 4MTOA 5LHGA 3QG5A 2YIDA 2IJIA 1IBLO 2NR5A 4R50A 4B08A 1X4TA 3WFVA 4WBNB 5JQGB 2C2AA 3UO3A 2QWRB 2AHYA 3JAWA 2QJ1A 4J9YB 1DF5A 1IBKB 5J2TB 3P3PA 3D8CA 3K06A 3J7AU 2VS0A 3LNNA 1NU1H 3SJQC 3ABKC 5BR8O 4JGSA 1YTFD 1QVGU 4X20B 3CCVV 2HJDA 3BA9A 3CCJV 4IIJA 2YS8A 3K08A 4FLYA 4GX0A 5B5EZ 5KUMA 2E75B 3U11A 2ATKC 2QGNA 2OTJV 2X6AA 5H5NA 4I4TA 4JI4O 3RT3C 3IJ4A 1I08A 4DR6B 2JDIG 4LFBO 2ODMA 5FPRA 4NVPA 2Y0IA 5CBHA 1GK9A 2F66C 3JCZA 3WU2Z 3WB0A 3F5WC 3BEHA 2JJ2G 4DR4B 3BHPA 2IJJA 4J7KA 1AR4A 5IY5C 3BABA 3OE7G 5IY5B 1KB9F 1R3KC 1Y74B 4TV8B 4PI0A 2GV9A 2DQ3A 2XNDG 3T1HO 3OGIB 1M4UA 1Y6XA 2RJZA 4F6RA 3ZJZA 1F51A 1EZVH 2F93B 4DW0A 2NLJC 5A2QN 1PNMA 5KHIA 3CC7V 3W7UA 1AJQA 5CA1A 1S72V 4D7TA 1KMIZ 4CS2A 4JI1O 3DSQA 2WLJA 4CH5A 3W7XA 1AR5A 3OW2U 4TUYA 4LFAB 5K1XA 1M56B 1JMKC 1FS0G 4XBFA 1SA0A 2GHYA 4DK1A 1MSWD 1GAXA 2KB1A 4X9QA 4QJFB 4JV5O 4JF3A 2Q5ZA 3UCSC 3ZIAG 3CCSV 3K04A 4UB8Z 1L0NH 1PL0A 1SF9A 1V55B 2N05A 3STZC 4NR1A 1P49A 5LYJA 1VIBA 4O2AA 2G38A 2JS5A 5KAFZ 1Z5WA 1K8AW 3ASOC 5FNVB 2UUBO 1NR7A 1AJNA 4WFBV 4PHZA 4JI8B 3IC7A 4ZHQA 5KHKA 2Y69B 4JI6B 1Q5OA 4X88A 3LDDA 1ZL8A 1QBZA 1HWYA 4O2BB 2AW9A 1R6NA 2Q0OC 2X6BA 3MAQA 2QDOA 3K0DA 2EBOA 1Q86W 2PF4E 5AG2A 2D2CB 2ZM6B 4ZOLB 4BIOA 4LP8A 2HJFC 5J2UB 1WJZA 1MA1A 4B7EA 5GONA 4DR2B 3VBBA 3H9VA 3MHSC 4DR1B 2E5LO 3H1HH 4DV4B 2P22C 4P9PA 1VF7A 4O4JA 3FB7C 4MTXA 3E22A 4X62O 3KCXA 1I7FA 3SGIA 1YI2V 4ZI7B 2DMXA 1SRYA 1TUBB 3G6BA 3HB3B 2P90A 1KC8W 4YIOA 1KYOF 3TJTA 3JAKA 3JD1A 3HKBB 5HFLA 5DM6V 2V7QG 1NVPB 1BS3A 3RYHA 1NQTA 3DGEA 1VQ9V 2Y4TA 4TV9B 3TXSA 1Y76B 3B40A 3E2EA 4BW9A 3M8AA 4C7UA 3CD6V 2F23A 1V54C 3CRCA 3FB8C 2IU3A 1AVMA 1M5IA 5J9PC 1VARA 3RGBA 3KZIZ 4MW8A 5CB4A 3HKCB 4E2LA 4JI3O 5GTIZ 4JTDB 1N0NA 3TGUH 4DUYB 3E8GA 5F2VO 2JRIA 2XAFA 1H8HG 1N34O 1S5HC 5LMUB 2ZM6O 3ABUA 3BAAA 1O9GA 1WPXA 5IJ9B 1N33O 1RPOA 1JQ0A 4IYIA 4PA3A 5EZYA 1XL6A 2PTMA 4X1YA 1NTZH 4JZGA 2QEXV 1R3JC 2P4VA 1DTOA 5LHIA 3PJSK 4LWSA 1BQZA 3CHXA 1HW7A 4DK0A 3VQYA 2R70A 3JARB 5LGTA 1K9MW 4I9QA 3HKEB 4OXSA 3O65A 4R8CA 1HNXB 1XMQB 4DV1O 4B3TO 4DR6O 2RMKB 1Q6UA 3TXQA 2PI4A 3DC5A 4I0XB 4B3MO 3QF7A 2QM7A 5EIBD 5LBQA 3DXRB 2XAHA 1FKAO 1F4MA 4WFHA 1WA8A 4JAVA 2IJKA 5LA6A 2XOKG 4JI1B 1Q6IA 4MS2A 4X1YB 4KHPB 4NXMB 2UXXA 5IJ0A 1WNSA 4CBCA 3STLC 3W7TA 3ZMSA 2ADPA 3T2MA 2Q69A 4DV5O 3OMIB 3B4SA 5C8YB 4RAIA 1R6KA 3CCLV 5LGNA 5KMGB 2LW7A 1XQ8A 3F5TA 2QM8A 1GN4A 5FPOA 3ZHQA 3JAMN 4JTAB 4DUZO 4GZRB 1V9PA 2EIJC 3ASNB 1XNRO 1XBLA 2H8PC 2WAMA 5JH7B 4TQFA 3CMAV 4JI0B 4WFFA 1H2GA 5KHJA 4MVSA 1N32O 2EIKC 1WA8B 3JAWB 1WLEA 5EYPA 4DV0O 4LF7B 3AEIA 4QIWF 4HNAA 4J80A 1IVSA 3CRAA 2WPDG 1JX9A 5LMNB 2YICA 4NKGB 3T4ZA 2F95B 3HKDB 3CCMV 1H38A 1WP8A 1XNRB 4DV0B 1AI7A 3CSXA 3VQVA 3ZBHA 4TQDA 4FLXA 4X20A 4B3SO 4LR3A 4MVRA 2YEVA 5KMGA 4H37A 3H1KH 4UB6Z 2BOCC 3HR0A 3FAVB 1CP9A 2UXNA 1ZLZA 3AG4C 3SYOA 1URFA 3JD0A 1W0KG 4NB5A 5EBMC 3BA8A 1OCRB 2LP7A 1SQGA 1MG1A 4JZ2A 1JVMA 3ZRVA 1WP7A 3AK2A 4WF9V 2LO1A 1YJNV 3K5NA 2K9PA 3TCUA 1XOUA 3FD9A 4X62B 3CS5A 2GTSA 4TT3G 2ILMA 2RQ6A 3RYCB 3ETEA 1WB8A 1DF4A 2IH3C 1H2MA 3QTCA 2VQFB 5BMVA 5L3GA 1K7DA 4BIUA 3HKDA 2HG5C 5D5PA 1HNXO 2WLNA 1NTKH 2QE7G 4J42A 1YITV 2CTQA 3ZMVA 4I55A 3E8FA 5KLVH 5LXTB 2L6LA 1DK1A 3OT7A 1NJIW 1VQ6V 2JEUA 4DV1B 3K9AA 4FJCC 1XILA 2M6YA 3T1YB 4FZ1A 4BR6A 3TK1A 1UJWB 1SQPH 3SPIA 1RM1C 1IXMA 3OM3B 3F7VC 3E35A 1H8EG 2BSKA 4CZZA 4MW3A 1MSDA 3RYCA 1EN5A 2WLIA 4ICGA 1VQLV 1AP5A 1W0JG 3C3SA 2E74B 4P2ZA 2E76B 2GTAA 4JI7B 2ZINA 3GWKC 1OJHA 5IYCO 3AK1A 1VF6A 3B8MA 5EC2C 1NT2B 1G6UA 2VRZA 3OAAG 1WPBA 4LC1A 1YJ9V 1COWG 1N34B 4GLXA 4O4HA 1XI1A 1LUWA 2BOBC 2Q9LA 4B3SB 1SKVA 3BPZA 4TSFG 1ZTEA 5FL7G 4FLTA 3A0RA 4PA6A 3OR6C 4A5UB 4DXWA 2OIGA 1VQMV 4ZIBA 3EVKA 2Q4PA 2CTRA 5JVDB 3X2QC 4F6RB 3JAKB 4JI3B 1IX9A 2HHHB 2WWWA 4LCUC 3EHBB 5TISZ 2ZDIA 5EC1C 4I7ZB 4YIPA 1VQNV 1JOYA 4LF5O 4X65B 5ITZB 3NXSA 3ZHTA 1JR9A 4JAUA 4EB6B 4FLVA 2DOSA 2JVDA 2UUCO 1Y66A 2HFEC 4J11A 2PUSA 3IAYA 4MTGA 3OGCC 2QM4A 3CX5F 1P84F 1KKDA 3ZHUA 3OTOO 1VEWA 4O4JB 4UCOA 4DR7O 3GWOA 4D6TH 4KHPO 1F7YA 2P5OA 4LFBB 3U10A 3K79A 4P30A 4CC6A 2AGAA 4JI4B 1BHBA 1EN6A 1NI8A 1OCOC 4O2AB 4J41A 1BMFG 3G80A 2Q67A 1VMGA 3LSQA 2P67A 4B3MB 2PI5A 2OWOA 3BY6A 4X1KA 2UXCO 2CE4A 2YIBA 4GYCB 2Z5UA 5EZYB 2Q8VA 3UT5A 5HFMA 4XDKA 3H1JH 2X0LA 1B04A 3GVMA 2PYJA 2O57A 5GTHZ 5LHHA 2DW4A 3VQXA 3S3XA 1GM7A 4X64B 1E1QG 2Y0PA 1HNWB 2JGDA 5H9CA 1SQBH 4LF6B 5IWAO 3FKSG 2R9IA 1QLEB 3ZHRA 2ZIOA 4AQYO 3I5DA 4IHJB 4CC5A 2FYUH 4LF4B 3OR7C 4LFCB 2YXHA 4HZ3A 2VQEO 4I0XA 2OCHA 1H2SB 3H1LH 2HVKC 2Q73A 1VQ7V 1Q82W 1CEZA 3OTFA 4UCVA 1BGYH 1QCEA 3ZRXA 3BRCA 3L71H 1PP9H 4DV3O 1Y67A 1SQFA 1ZAUA 1QLNA 2VQFO 2UUAO 1YZBA 4U3JB 4PDRA 3SDLA 1L1FA 3OTOB 2BTQA 4I9WA 3ZHSA 4B3RO 3IFXA 3P3NA 2OCCC 1S5LZ 4IHJA 2KG7B 4ZKIA 2ETNA 3ZMUA 1K5SA 4RUFA 2YUAA 1N4CA 3T1CA 1U96A 4FLWA 2DWEC 2EJ7A 5L3BA 2DJVA 4NXNB 4DRXA 4GX1A 1XNQO 1SERA 5LP6A 2EILC 1TVKB 3RWRD 2UXCB 3LSSA 3QO7A 5J2TA 4OX9O 4PJ0Z 3L9DA 5B1AB 4WFAV 1JFFB 2YEVB 3L72H 1CPYA 1LUVA 3G67A 4EEQA 2XTAA 4EFEA 2IM9A 1N32B 4FIPC 4JTCB 2QKCA 5EBLC 4LF9B 1KU9A 2PGGA 4JI0O 2YI9A 5IYBO 4DR7B 2HR3A 2B1IA 4UV8A 2ZXWC 2YIBD 5CA1B 3N27A 3ZRWB 5JH7A 4JI7O 4IIJB 2QSAA 1FXHA 4JI2B 4I4TB 4DV7B 4L87A 5DEDA 2PZSA 1GRJA 1RFYA 1BHAA 2YXLA 4K8ZA 2ADQB 4UCTA 1G1XB 2DE0X 2WA4A 4BWAA 1DLBA 3R66A 2GUZA 2WLMA 3J81N 2QR4A 5IE9A 2QWPB 2CAZC 1JPXA 1QHTA 3M7MX 2UXBB 2F4VO 4X1IB 3OUSA 1H2KA 1D5AA 4PA7A 4OX9B 3AG1B 4MVQA 3LSUA 4TV8A 3NR7A 3THOA 2BE3A 3N2KA 1BT8A 4JV5B 5H6RA 1S3JA 3JASA 2IJHA 4I5SA 4ZHQB 5LP6C 1KP3A 1Z5VA 3CXHF 2ITDC 4GUNA 4NYKA 3RW0A 1M93A 1FAFA 1ZL8B 1FXKC 3LUTB 1KUQA 2V1DA 3Q4HA 3QO8A 3PN1A 4DUZB 1V54B 4LF8B 2EX3A 1OCCB 1NBMG 1SZXA 1NH2B 1OZ0A 4CH3A 4TUYB 4X66O 3CJHB 3K57A 3MDSA 1QNMA 4R6ZA 5BXZA 5JCOA 3LDEA 3ETGA 4AHCA 4RO2A 4DR5B 3AG2B 1NH2D 1GKFA 1JA8A 4EKWA 5JVDA 1K5QA 4O4IB 1XEQA 3IGAC 4KL1A 4J7JA 1SZTA 1R1BA 1YJWV 1H2NA 3FAVA 1KQSU 3L75H 3JATA 1U97A 1FXKB 3RYHB 3SPCA 1KD1W 3CWBH 2IBZH 3O9OA 4FFBA 4TOIA 3G4SV 1W59A 1LR1A 2L35A 4BIZA 5CBGA 2F4VB 1Q8IA 3CP1A 1K92A 2CK3G 5IWAB 5B3SC 3ABLB 2P06A 4LH7A 2N74A 2ZT9B 1O9HA 4PDMA 3E86A 4YXWG 4DR3B 2ZQMA 1JJ2U 1YCIA 2OTLV 2LJ2A 3I56V 4DV5B 2IU0A 4NTXA 3B77A 2A7WA 5IDJA 2OYQA 5JJJB 4DV7O 4MVMA 1E79G 5LXTA 1P7BA 4UUJC 3JATB 4IT5A 5JCOC 1PM9A 5LMUO 1M1KW 4LF9O 2A0LA 1IXBA 3E89A 2FMLA 3GB7C 4FFBB 1ZSPA 5IJ9A 4JI5B 3OD4A 1XUQA 5D5QA 3KKYA 4DR1O 4DUYO 3K9SA 3BFRA 1FFXB 1N36O 3ML0A 4MVOA 4TV9A 1IZ3A 4B7KA 4EB6A 2EZOA 2ZE8A 4H0LB 2R9RB 2JEXA 2UU9O 4GKJO 1OCZC 4BAYA 2QWQB 3A0HZ 1YIJV 1TUEB 1I5YA 3E8HA 4MSWC 2JJ1G 1VQ4V 2X7RB 3K58A 1Q3EA 1MOFA 2WLLA 4JI8O 3JALB 1P7GA 4UVAA 4B3RB 2CDYA 3W7WA 1WB7A 3JD4A 3K5MA 4GKKO 4JYAO 2FKXA 5A9GA 4WBNA 1R73A 4O4LB 3B09A 4X1KB 1HNZB 2LQTA 4DV3B 3CCQV 5L3CA 1Q81W 1HR0B 3D3IA 1XMOB 1ZUQA 1VP7A 1XMOO 2E5LB 1FJGO 3CXCU 3ABKB 1NTMH 3A0BZ 1HP8A 2Y48A 3OMNB 2F43G 3A8TA 2ZE6A 4AILC 3I55V 2ZKOA 3K0GA 1AI6A 4LWSB 1EFRG 1OCRC 4NTWA 4GCZA 1YHQV 3MD0A 3N2GB 2HKOA 3UQ8A 1HNWO 1K4DC 4AQYB 4X64O 1SQQH 1XREA 2OT5A 1H2LA 1WAZA 1ORQC 2X6CA 2DYRB 3A2FA 2DYRC 2EINC 2XAJA 4N23A 2CUGA 3W7SA 1N33B 3OEHG 3CRRA 1Z2GA 4DV2O 2UU9B 4GKJB 2OCCB 1LNQA 5CMUA 1OV9A 4NTYA 1QU7A 2Q0AA 1RPRA 1Y4MA 2ZNJA 4YHHB 4DV4O 3QNEA 2ZCEA 5JJEB 3LDCA 4G27B 3EXAA 4LFAO 3E8BA 3VOUA 1AILA 3CC4V 4FVMA 4JASA 4RUEA 1HDJA 4DYLA 3SPHA 3AK3A 4Z1VA 5IT9N 3SYQA 2A9HA 1VF6C 2RNBA 4U7OA 2YXYA 3ASNC 1YDXA 4GT1A 5BMVB 1SQXH 4JPRA 5LP6B 3JSLA 4GX2A 4AI8A 5JQGA 5C93A 4J10A 3CC2V 5L3FA 3R65A 3JCUZ 1Y74A 4F6EA 4FM1A 1RSOA 1K34A 3CB2A 2PY5A 2UUAB 2HHHO 4LF7O 4DV6O 3B2EE 2EIJB 1FJGB 4HBNA 4WFGA 4IGGA 3ZRWA 2YC0A 2HLDG 2XUMA 1BSMA 3C3TA 2ZIMA 1J95A 2LGQA 5E79Z 5K1PA 2B1GA 3ZMZA 2BCCH 3KCYA 2RDCA 3WB2A 2DQ0A 5KX5B 3SPGA 1RP3B 5BY1A 3UO2A 1PNKA 2EJRA 4FM0A 1EBOA 1W2BU 5L3EA 4MTFA 5CBFA 1GM9A 2Y4UA 1QR9A 2YIAA 5EYPB 4G28B 4XDJA 4X1IA 1ZWIC 2KQXA 1SESA 1TVKA 4DR3O 4DW1A 2F1MA 2RCVA 2DWDC 4HNAB 4UCSA 1RM1B 4LF6O 4I50A 1J5EB 3T1YO 3K5LA 4JYYA 2WA3A 4MVZA 2E3CA 3ABLC 1X59A 3M99B 2R9AA 3K5OA 5LYJB 4K8XA 4U7NA 3RYFA 2ITCC 3ZEDA 3DTUB 1TGOA 2H94A 5FNVA 4LNUB 2WLKA 5KX5A 4YJ2A 1QQCA 3ABTA 3JD2A 2IH1C 5ITZA 3ETQA 4CH4A 1A32A 1ZX3A 2VWJA 2HP8A 2Q6AA 1IDSA 1G4YB 3APQA 5B1BC 3AG4B 5KAIZ 5B3SB 1S77D 4J7ZA 1HNZO 1J5EO 1FFTB 2YSUB 2Y69C 4F4LA 4XDLA 4JYAB 4GKKB 1UFIA 2CGNA 1S76D 1SS3A 1R6TA 3UKMA 2CH7A 3IC9A 3OFNG 3MHHC 4WCEV 5CA0B 1PD3A 1K4CC 4LH6A 3K59A 3E22B 3RYIB 4UXNA 4DR4O 2XAQA 1K97A 4Z1MG 1I5XA 2QWNB 1TUBA 5CN0A 1YF2A 1I94O 1UPGA 2CGOA 3ZX6A 3G71V 2ZR3A 3FX7A 4ZBMA 4X8AA 1NR1A 1QLEC 4KXRA 5CA3A 3CPWU 1I94B 3WG7B 1VQ5V 3FYEB 1XNQB 1QR8A 1GN3A 1SETA 4NXNO 5LL6Y 4ZOLA 3FFQA 5LOVA 3CRMA 1SC5B 1T5EA 4H13B 3C90A 5KA6A 3OEEG 1V55C 1PV0A 3HKCA 4O4LA 1YEWA 4PA4A 3RYIA 5KUKA 1KP2A 3L70H 1AI4A 4E4EA 4NXMO 1MABG 3HPLC 4HAMA 1PKXA 1US6A 5LA6B 4W4LA 1PL4A 2Q7HA 4QPKA 1KBHA 1FXKA 5IYZA 3SJBC 3E83A 3ZHVA 2DYSC 1KKCA 4PDLA 1M56C 2BTQB 3CYOA 1XL4A 1GH6A 3UM7A 1XMQO 1OHHG 1WN7A 4PDVA 1IURA 1MMMA 2VWKA 1Y76A 2ZNIA 4J9ZB 4QE7A
chains in the Genus database with same CATH topology
4B3RO 1R6TA 4DR7O 2Z0AA 1NS1A 4DV7O 2LW7A 4KHPO 3F5TA 2HHHO 4DV6O 4LF7O 1F7YA 4JI3O 3JAMN 4YY3O 4DUZO 1HNWO 2AGAA 4JI6O 2JRIA 4DR2O 4X64O 4YHHO 1N34O 1XNRO 2UUBO 4DR4O 5LMUO 2ZM6O 4LF9O 1KUQA 5H5NA 1I94O 4JI4O 3RT3C 1N32O 5BY1A 2UXCO 4DR1O 2DJVA 3OTOO 4DUYO 4JI2O 4LFBO 2UXDO 4DV0O 1N36O 4DV2O 1N33O 4LF8O 1XNQO 4X66O 4OPAA 5LMNO 4LF4O 4OX9O 2UU9O 4GKJO 5BXZA 1IBMO 4K0KO 4DR3O 5FLXN 2UXBO 4DV4O 4NXNO 4LF6O 5LL6Y 2E5LO 3T1YO 3J80N 4JI5O 4B3SO 5IWAO 3T1HO 4JI0O 4A5UB 4LFAO 4JI8O 1X59A 1AB3A 1XEQA 4AQYO 1AILA 4X62O 5A2QN 4OPHA 3O65A 4GKKO 4JYAO 1R1BA 2FKXA 4JI7O 2VQEO 1IBLO 4NXMO 4DV1O 4B3TO 5IT9N 4DR6O 4JI1O 1DK1A 4LFCO 1D2DA 1IBKO 4B3MO 1A32A 1G1XB 4LF5O 4X65O 3R66A 1FKAO 4DV3O 3J81N 1XMOO 1HNZO 1FJGO 4DR5O 2DOSA 2N74A 1J5EO 1HR0O 2VQFO 2UUCO 4JV5O 1XMQO 2UUAO 1YZBA 2F4VO 1HNXO 3M8AA 3SDLA 3J7AU 1FYJA 5BR8O 2ZKOA 4DV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R O;  1R6T A;  4DR7 O;  2Z0A A;  1NS1 A;  4DV7 O;  2LW7 A;  4KHP O;  3F5T A;  2HHH O;  4DV6 O;  4LF7 O;  1F7Y A;  4JI3 O;  3JAM N;  4YY3 O;  4DUZ O;  1HNW O;  2AGA A;  4JI6 O;  2JRI A;  4DR2 O;  4X64 O;  4YHH O;  1N34 O;  1XNR O;  2UUB O;  4DR4 O;  5LMU O;  2ZM6 O;  4LF9 O;  1KUQ A;  5H5N A;  1I94 O;  4JI4 O;  3RT3 C;  1N32 O;  5BY1 A;  2UXC O;  4DR1 O;  2DJV A;  3OTO O;  4DUY O;  4JI2 O;  4LFB O;  2UXD O;  4DV0 O;  1N36 O;  4DV2 O;  1N33 O;  4LF8 O;  1XNQ O;  4X66 O;  4OPA A;  5LMN O;  4LF4 O;  4OX9 O;  2UU9 O;  4GKJ O;  5BXZ A;  1IBM O;  4K0K O;  4DR3 O;  5FLX N;  2UXB O;  4DV4 O;  4NXN O;  4LF6 O;  5LL6 Y;  2E5L O;  3T1Y O;  3J80 N;  4JI5 O;  4B3S O;  5IWA O;  3T1H O;  4JI0 O;  4A5U B;  4LFA O;  4JI8 O;  1X59 A;  1AB3 A;  1XEQ A;  4AQY O;  1AIL A;  4X62 O;  5A2Q N;  4OPH A;  3O65 A;  4GKK O;  4JYA O;  1R1B A;  2FKX A;  4JI7 O;  2VQE O;  1IBL O;  4NXM O;  4DV1 O;  4B3T O;  5IT9 N;  4DR6 O;  4JI1 O;  1DK1 A;  4LFC O;  1D2D A;  1IBK O;  4B3M O;  1A32 A;  1G1X B;  4LF5 O;  4X65 O;  3R66 A;  1FKA O;  4DV3 O;  3J81 N;  1XMO O;  1HNZ O;  1FJG O;  4DR5 O;  2DOS A;  2N74 A;  1J5E O;  1HR0 O;  2VQF O;  2UUC O;  4JV5 O;  1XMQ O;  2UUA O;  1YZB A;  2F4V O;  1HNX O;  3M8A A;  3SDL A;  3J7A U;  1FYJ A;  5BR8 O;  2ZKO A;  4DV5 O; 
#chains in the Genus database with same CATH topology
 2KG7 A;  4Q20 A;  1JCH A;  3JAL A;  3JAR A;  4X89 A;  1XHZ A;  3VQW A;  2EIL B;  4YY3 O;  4JI6 O;  5EBW C;  3HKE A;  2GDS A;  1ROP A;  2LGW A;  2KSD A;  4EFB A;  1TAE A;  1E1R G;  3JSN A;  2EIM B;  1D5N A;  4UFZ A;  5DEC A;  1NKD A;  1TA8 A;  1YVW A;  1BQ0 A;  4X66 B;  1SQV H;  4JI2 O;  3BVO A;  3DXR A;  1YSC A;  3P32 A;  1JFF A;  4CS3 A;  5JWP A;  2K1E A;  5IJ0 B;  3CME V;  4N21 A;  2ZR2 A;  1B06 A;  1IBM O;  2Q7G A;  4ABM A;  2W6J G;  3ABM C;  4QE9 A;  3DC6 A;  3ABM B;  4OGQ B;  1K73 W;  5B1O A;  4DV6 B;  4QPJ A;  3G6E V;  1PPJ H;  1GM8 A;  1M90 W;  2NNU A;  4GX5 A;  4ASU G;  3QVN A;  4FLZ A;  3D36 A;  1OCC C;  2A06 H;  2WLL B;  3CCR V;  2W0F C;  3CRQ A;  4RQE A;  1R3I C;  3JYC A;  4LFC O;  3WB1 A;  1D2D A;  1GN6 A;  4Q6G A;  1VQK V;  2PYL A;  4FFK A;  1VQO V;  1M9N A;  2QKS A;  4JYB A;  2UUC B;  3L73 H;  3U0Z A;  3QO5 A;  3SYC A;  2XHB A;  1OCO B;  1F23 A;  2BTO A;  4P9O A;  3ASO B;  5L3D A;  4U3J A;  4YJ3 A;  2QTO A;  1S5J A;  1NS1 A;  2A79 B;  2JIZ G;  1B3Q A;  2MW2 B;  2XAS A;  4RQF A;  3WG7 C;  2QWO B;  3EFF K;  2ZE5 A;  4FPP A;  2P4K A;  3F7Y C;  2BSK B;  4DR2 O;  1L8D A;  1MZE A;  4YHH O;  5LGU A;  4K0K B;  2EIK B;  1R3L C;  4O2B A;  2KKW A;  2RN9 A;  1I0H A;  2H3O A;  1BL8 A;  4R7C A;  2GUZ B;  2B5U A;  4UVB A;  2UXD O;  3SJC C;  2VQE B;  1FD9 A;  1YXB A;  1VQ8 V;  4LF4 O;  1ENV A;  4IYH A;  4O4H B;  3SJA C;  2EIN B;  1MNG A;  3D36 C;  1RSO B;  4DV2 B;  4YJ3 B;  5KHH A;  3RVY A;  4BW5 A;  5JJN B;  3J80 N;  4H33 A;  2AXT Z;  1BE3 H;  4KFM A;  2DYS B;  1YTF B;  4ZI7 A;  4LF5 B;  4LNU A;  4YJ2 B;  4UV9 A;  3ZS8 C;  1S0V A;  4CH6 A;  3Q4H B;  1MZF A;  3TET A;  5E1A C;  4FM2 A;  2CTW A;  1OCZ B;  4JYC A;  1K33 A;  2ARH A;  1L0L H;  3LNM B;  3CJH A;  4PEL A;  2ZXW B;  2HVJ C;  3AG7 A;  4W4K A;  5GW7 A;  4DR5 O;  1HR0 O;  2ZD9 A;  5H6Q A;  4HYO A;  2GBO A;  2EIM C;  1SA0 B;  2EZP A;  2WSS G;  4I50 B;  2DN9 A;  5J2U A;  5KHG A;  1FYJ A;  1Q43 A;  2ZDI C;  2CH7 B;  2N04 A;  1GO3 F;  2EUL A;  1JJO A;  3RFR A;  4PV1 B;  4IL6 Z;  2Z0A A;  2OIE A;  1THZ A;  3AG3 C;  4I55 B;  1N8R W;  2A3Q A;  2JK5 C;  1M57 B;  3RYF B;  1Q7Y W;  3KG2 A;  3N2K B;  1K3E A;  4QGP A;  4UVC A;  3FYI B;  2YDE A;  3JAS B;  1FFX A;  5H2F Z;  4JAA A;  4CS4 A;  3AG1 C;  3RBZ A;  4YY3 B;  2FL4 A;  1BZK A;  1N36 B;  2UXD B;  4FK5 C;  1VF5 B;  3CEI A;  3K3W A;  1GTO A;  4OPA A;  5LMN O;  1F4N A;  2WLI B;  2Q68 A;  3S3W A;  4LBE C;  4DO2 A;  2JGD B;  3OUF A;  2JGU A;  2XT9 A;  1Q90 D;  4K0K O;  5EK0 A;  2W0X A;  5LOV B;  3AG2 C;  5FLX N;  2UXB O;  4JI5 O;  4K35 A;  4QNH B;  3ZRS A;  2AHZ A;  5GON B;  2M7W A;  3RN4 A;  1EZJ A;  2GSM B;  3X2Q B;  3AG3 B;  2NN4 A;  5EIB C;  4UCR A;  1EN4 A;  5BR8 B;  1M57 C;  1EM1 A;  4OPH A;  5B66 Z;  4FLU A;  3OMA B;  1G8M A;  4O4I A;  1GN2 A;  1AR1 B;  3CCE V;  2Q7E A;  2QTS A;  1NVP D;  1QVF U;  3H1I H;  1IBK O;  1N0J A;  3CE2 A;  2W6I G;  4X65 O;  5B1A C;  3SR2 C;  2WLH A;  2UUB B;  3ETD A;  3JD3 A;  3SPJ A;  4TWK A;  1XDC A;  3UT5 B;  3HKB A;  1Q6H A;  2CTP A;  2Z3Y A;  1P4R A;  3P30 A;  3D3Q A;  3B8N A;  1BCC H;  2HEP A;  2FB5 A;  4Z2W A;  3ZN0 A;  3K03 A;  3FB5 C;  2YI8 A;  3ZCC A;  2XAG A;  2FTK A;  2MK3 A;  4MVU A;  1CXZ B;  3T4D A;  4KP4 A;  1B6Q A;  3N2G A;  1XHX A;  4MT8 A;  3ZMT A;  4B3T B;  2B9Z A;  1IBL B;  2V4D A;  3H01 A;  4U3F H;  4UCU A;  4KUM A;  5IYD O;  5CB4 B;  3FB6 C;  5DN6 G;  3ZN1 A;  1FPO A;  5CA0 A;  2ZE7 A;  1IBM B;  1AJP A;  3SYP A;  4DRX B;  1NZ6 A;  2R72 A;  3CCU V;  2LW1 A;  4PI2 A;  5IYZ B;  2P6J A;  5BZB A;  2P7T C;  4L8J A;  4WFE A;  4FMT A;  4PA9 A;  4LF8 O;  4FZ0 A;  4H44 B;  4PD4 F;  1DGS A;  1AI5 A;  1GMG A;  1ARO P;  3RVZ A;  1FXV A;  2AZ0 A;  2QA4 V;  4RWU A;  3L74 H;  3APO A;  5KA5 A;  1KEC A;  3SYA A;  3T1H B;  4D7S A;  2QKA A;  3BCC H;  4K3A A;  5B1N A;  2LFS A;  2IW5 A;  2LFR A;  5C8Y A;  4G2K A;  2D3O W;  1AB3 A;  1AP6 A;  1PNL A;  3ICX A;  5B1B B;  2JS3 A;  1VQP V;  2AZ2 A;  4MTO A;  5LHG A;  3QG5 A;  2YID A;  2IJI A;  1IBL O;  2NR5 A;  4R50 A;  4B08 A;  1X4T A;  3WFV A;  4WBN B;  5JQG B;  2C2A A;  3UO3 A;  2QWR B;  2AHY A;  3JAW A;  2QJ1 A;  4J9Y B;  1DF5 A;  1IBK B;  5J2T B;  3P3P A;  3D8C A;  3K06 A;  3J7A U;  2VS0 A;  3LNN A;  1NU1 H;  3SJQ C;  3ABK C;  5BR8 O;  4JGS A;  1YTF D;  1QVG U;  4X20 B;  3CCV V;  2HJD A;  3BA9 A;  3CCJ V;  4IIJ A;  2YS8 A;  3K08 A;  4FLY A;  4GX0 A;  5B5E Z;  5KUM A;  2E75 B;  3U11 A;  2ATK C;  2QGN A;  2OTJ V;  2X6A A;  5H5N A;  4I4T A;  4JI4 O;  3RT3 C;  3IJ4 A;  1I08 A;  4DR6 B;  2JDI G;  4LFB O;  2ODM A;  5FPR A;  4NVP A;  2Y0I A;  5CBH A;  1GK9 A;  2F66 C;  3JCZ A;  3WU2 Z;  3WB0 A;  3F5W C;  3BEH A;  2JJ2 G;  4DR4 B;  3BHP A;  2IJJ A;  4J7K A;  1AR4 A;  5IY5 C;  3BAB A;  3OE7 G;  5IY5 B;  1KB9 F;  1R3K C;  1Y74 B;  4TV8 B;  4PI0 A;  2GV9 A;  2DQ3 A;  2XND G;  3T1H O;  3OGI B;  1M4U A;  1Y6X A;  2RJZ A;  4F6R A;  3ZJZ A;  1F51 A;  1EZV H;  2F93 B;  4DW0 A;  2NLJ C;  5A2Q N;  1PNM A;  5KHI A;  3CC7 V;  3W7U A;  1AJQ A;  5CA1 A;  1S72 V;  4D7T A;  1KMI Z;  4CS2 A;  4JI1 O;  3DSQ A;  2WLJ A;  4CH5 A;  3W7X A;  1AR5 A;  3OW2 U;  4TUY A;  4LFA B;  5K1X A;  1M56 B;  1JMK C;  1FS0 G;  4XBF A;  1SA0 A;  2GHY A;  4DK1 A;  1MSW D;  1GAX A;  2KB1 A;  4X9Q A;  4QJF B;  4JV5 O;  4JF3 A;  2Q5Z A;  3UCS C;  3ZIA G;  3CCS V;  3K04 A;  4UB8 Z;  1L0N H;  1PL0 A;  1SF9 A;  1V55 B;  2N05 A;  3STZ C;  4NR1 A;  1P49 A;  5LYJ A;  1VIB A;  4O2A A;  2G38 A;  2JS5 A;  5KAF Z;  1Z5W A;  1K8A W;  3ASO C;  5FNV B;  2UUB O;  1NR7 A;  1AJN A;  4WFB V;  4PHZ A;  4JI8 B;  3IC7 A;  4ZHQ A;  5KHK A;  2Y69 B;  4JI6 B;  1Q5O A;  4X88 A;  3LDD A;  1ZL8 A;  1QBZ A;  1HWY A;  4O2B B;  2AW9 A;  1R6N A;  2Q0O C;  2X6B A;  3MAQ A;  2QDO A;  3K0D A;  2EBO A;  1Q86 W;  2PF4 E;  5AG2 A;  2D2C B;  2ZM6 B;  4ZOL B;  4BIO A;  4LP8 A;  2HJF C;  5J2U B;  1WJZ A;  1MA1 A;  4B7E A;  5GON A;  4DR2 B;  3VBB A;  3H9V A;  3MHS C;  4DR1 B;  2E5L O;  3H1H H;  4DV4 B;  2P22 C;  4P9P A;  1VF7 A;  4O4J A;  3FB7 C;  4MTX A;  3E22 A;  4X62 O;  3KCX A;  1I7F A;  3SGI A;  1YI2 V;  4ZI7 B;  2DMX A;  1SRY A;  1TUB B;  3G6B A;  3HB3 B;  2P90 A;  1KC8 W;  4YIO A;  1KYO F;  3TJT A;  3JAK A;  3JD1 A;  3HKB B;  5HFL A;  5DM6 V;  2V7Q G;  1NVP B;  1BS3 A;  3RYH A;  1NQT A;  3DGE A;  1VQ9 V;  2Y4T A;  4TV9 B;  3TXS A;  1Y76 B;  3B40 A;  3E2E A;  4BW9 A;  3M8A A;  4C7U A;  3CD6 V;  2F23 A;  1V54 C;  3CRC A;  3FB8 C;  2IU3 A;  1AVM A;  1M5I A;  5J9P C;  1VAR A;  3RGB A;  3KZI Z;  4MW8 A;  5CB4 A;  3HKC B;  4E2L A;  4JI3 O;  5GTI Z;  4JTD B;  1N0N A;  3TGU H;  4DUY B;  3E8G A;  5F2V O;  2JRI A;  2XAF A;  1H8H G;  1N34 O;  1S5H C;  5LMU B;  2ZM6 O;  3ABU A;  3BAA A;  1O9G A;  1WPX A;  5IJ9 B;  1N33 O;  1RPO A;  1JQ0 A;  4IYI A;  4PA3 A;  5EZY A;  1XL6 A;  2PTM A;  4X1Y A;  1NTZ H;  4JZG A;  2QEX V;  1R3J C;  2P4V A;  1DTO A;  5LHI A;  3PJS K;  4LWS A;  1BQZ A;  3CHX A;  1HW7 A;  4DK0 A;  3VQY A;  2R70 A;  3JAR B;  5LGT A;  1K9M W;  4I9Q A;  3HKE B;  4OXS A;  3O65 A;  4R8C A;  1HNX B;  1XMQ B;  4DV1 O;  4B3T O;  4DR6 O;  2RMK B;  1Q6U A;  3TXQ A;  2PI4 A;  3DC5 A;  4I0X B;  4B3M O;  3QF7 A;  2QM7 A;  5EIB D;  5LBQ A;  3DXR B;  2XAH A;  1FKA O;  1F4M A;  4WFH A;  1WA8 A;  4JAV A;  2IJK A;  5LA6 A;  2XOK G;  4JI1 B;  1Q6I A;  4MS2 A;  4X1Y B;  4KHP B;  4NXM B;  2UXX A;  5IJ0 A;  1WNS A;  4CBC A;  3STL C;  3W7T A;  3ZMS A;  2ADP A;  3T2M A;  2Q69 A;  4DV5 O;  3OMI B;  3B4S A;  5C8Y B;  4RAI A;  1R6K A;  3CCL V;  5LGN A;  5KMG B;  2LW7 A;  1XQ8 A;  3F5T A;  2QM8 A;  1GN4 A;  5FPO A;  3ZHQ A;  3JAM N;  4JTA B;  4DUZ O;  4GZR B;  1V9P A;  2EIJ C;  3ASN B;  1XNR O;  1XBL A;  2H8P C;  2WAM A;  5JH7 B;  4TQF A;  3CMA V;  4JI0 B;  4WFF A;  1H2G A;  5KHJ A;  4MVS A;  1N32 O;  2EIK C;  1WA8 B;  3JAW B;  1WLE A;  5EYP A;  4DV0 O;  4LF7 B;  3AEI A;  4QIW F;  4HNA A;  4J80 A;  1IVS A;  3CRA A;  2WPD G;  1JX9 A;  5LMN B;  2YIC A;  4NKG B;  3T4Z A;  2F95 B;  3HKD B;  3CCM V;  1H38 A;  1WP8 A;  1XNR B;  4DV0 B;  1AI7 A;  3CSX A;  3VQV A;  3ZBH A;  4TQD A;  4FLX A;  4X20 A;  4B3S O;  4LR3 A;  4MVR A;  2YEV A;  5KMG A;  4H37 A;  3H1K H;  4UB6 Z;  2BOC C;  3HR0 A;  3FAV B;  1CP9 A;  2UXN A;  1ZLZ A;  3AG4 C;  3SYO A;  1URF A;  3JD0 A;  1W0K G;  4NB5 A;  5EBM C;  3BA8 A;  1OCR B;  2LP7 A;  1SQG A;  1MG1 A;  4JZ2 A;  1JVM A;  3ZRV A;  1WP7 A;  3AK2 A;  4WF9 V;  2LO1 A;  1YJN V;  3K5N A;  2K9P A;  3TCU A;  1XOU A;  3FD9 A;  4X62 B;  3CS5 A;  2GTS A;  4TT3 G;  2ILM A;  2RQ6 A;  3RYC B;  3ETE A;  1WB8 A;  1DF4 A;  2IH3 C;  1H2M A;  3QTC A;  2VQF B;  5BMV A;  5L3G A;  1K7D A;  4BIU A;  3HKD A;  2HG5 C;  5D5P A;  1HNX O;  2WLN A;  1NTK H;  2QE7 G;  4J42 A;  1YIT V;  2CTQ A;  3ZMV A;  4I55 A;  3E8F A;  5KLV H;  5LXT B;  2L6L A;  1DK1 A;  3OT7 A;  1NJI W;  1VQ6 V;  2JEU A;  4DV1 B;  3K9A A;  4FJC C;  1XIL A;  2M6Y A;  3T1Y B;  4FZ1 A;  4BR6 A;  3TK1 A;  1UJW B;  1SQP H;  3SPI A;  1RM1 C;  1IXM A;  3OM3 B;  3F7V C;  3E35 A;  1H8E G;  2BSK A;  4CZZ A;  4MW3 A;  1MSD A;  3RYC A;  1EN5 A;  2WLI A;  4ICG A;  1VQL V;  1AP5 A;  1W0J G;  3C3S A;  2E74 B;  4P2Z A;  2E76 B;  2GTA A;  4JI7 B;  2ZIN A;  3GWK C;  1OJH A;  5IYC O;  3AK1 A;  1VF6 A;  3B8M A;  5EC2 C;  1NT2 B;  1G6U A;  2VRZ A;  3OAA G;  1WPB A;  4LC1 A;  1YJ9 V;  1COW G;  1N34 B;  4GLX A;  4O4H A;  1XI1 A;  1LUW A;  2BOB C;  2Q9L A;  4B3S B;  1SKV A;  3BPZ A;  4TSF G;  1ZTE A;  5FL7 G;  4FLT A;  3A0R A;  4PA6 A;  3OR6 C;  4A5U B;  4DXW A;  2OIG A;  1VQM V;  4ZIB A;  3EVK A;  2Q4P A;  2CTR A;  5JVD B;  3X2Q C;  4F6R B;  3JAK B;  4JI3 B;  1IX9 A;  2HHH B;  2WWW A;  4LCU C;  3EHB B;  5TIS Z;  2ZDI A;  5EC1 C;  4I7Z B;  4YIP A;  1VQN V;  1JOY A;  4LF5 O;  4X65 B;  5ITZ B;  3NXS A;  3ZHT A;  1JR9 A;  4JAU A;  4EB6 B;  4FLV A;  2DOS A;  2JVD A;  2UUC O;  1Y66 A;  2HFE C;  4J11 A;  2PUS A;  3IAY A;  4MTG A;  3OGC C;  2QM4 A;  3CX5 F;  1P84 F;  1KKD A;  3ZHU A;  3OTO O;  1VEW A;  4O4J B;  4UCO A;  4DR7 O;  3GWO A;  4D6T H;  4KHP O;  1F7Y A;  2P5O A;  4LFB B;  3U10 A;  3K79 A;  4P30 A;  4CC6 A;  2AGA A;  4JI4 B;  1BHB A;  1EN6 A;  1NI8 A;  1OCO C;  4O2A B;  4J41 A;  1BMF G;  3G80 A;  2Q67 A;  1VMG A;  3LSQ A;  2P67 A;  4B3M B;  2PI5 A;  2OWO A;  3BY6 A;  4X1K A;  2UXC O;  2CE4 A;  2YIB A;  4GYC B;  2Z5U A;  5EZY B;  2Q8V A;  3UT5 A;  5HFM A;  4XDK A;  3H1J H;  2X0L A;  1B04 A;  3GVM A;  2PYJ A;  2O57 A;  5GTH Z;  5LHH A;  2DW4 A;  3VQX A;  3S3X A;  1GM7 A;  4X64 B;  1E1Q G;  2Y0P A;  1HNW B;  2JGD A;  5H9C A;  1SQB H;  4LF6 B;  5IWA O;  3FKS G;  2R9I A;  1QLE B;  3ZHR A;  2ZIO A;  4AQY O;  3I5D A;  4IHJ B;  4CC5 A;  2FYU H;  4LF4 B;  3OR7 C;  4LFC B;  2YXH A;  4HZ3 A;  2VQE O;  4I0X A;  2OCH A;  1H2S B;  3H1L H;  2HVK C;  2Q73 A;  1VQ7 V;  1Q82 W;  1CEZ A;  3OTF A;  4UCV A;  1BGY H;  1QCE A;  3ZRX A;  3BRC A;  3L71 H;  1PP9 H;  4DV3 O;  1Y67 A;  1SQF A;  1ZAU A;  1QLN A;  2VQF O;  2UUA O;  1YZB A;  4U3J B;  4PDR A;  3SDL A;  1L1F A;  3OTO B;  2BTQ A;  4I9W A;  3ZHS A;  4B3R O;  3IFX A;  3P3N A;  2OCC C;  1S5L Z;  4IHJ A;  2KG7 B;  4ZKI A;  2ETN A;  3ZMU A;  1K5S A;  4RUF A;  2YUA A;  1N4C A;  3T1C A;  1U96 A;  4FLW A;  2DWE C;  2EJ7 A;  5L3B A;  2DJV A;  4NXN B;  4DRX A;  4GX1 A;  1XNQ O;  1SER A;  5LP6 A;  2EIL C;  1TVK B;  3RWR D;  2UXC B;  3LSS A;  3QO7 A;  5J2T A;  4OX9 O;  4PJ0 Z;  3L9D A;  5B1A B;  4WFA V;  1JFF B;  2YEV B;  3L72 H;  1CPY A;  1LUV A;  3G67 A;  4EEQ A;  2XTA A;  4EFE A;  2IM9 A;  1N32 B;  4FIP C;  4JTC B;  2QKC A;  5EBL C;  4LF9 B;  1KU9 A;  2PGG A;  4JI0 O;  2YI9 A;  5IYB O;  4DR7 B;  2HR3 A;  2B1I A;  4UV8 A;  2ZXW C;  2YIB D;  5CA1 B;  3N27 A;  3ZRW B;  5JH7 A;  4JI7 O;  4IIJ B;  2QSA A;  1FXH A;  4JI2 B;  4I4T B;  4DV7 B;  4L87 A;  5DED A;  2PZS A;  1GRJ A;  1RFY A;  1BHA A;  2YXL A;  4K8Z A;  2ADQ B;  4UCT A;  1G1X B;  2DE0 X;  2WA4 A;  4BWA A;  1DLB A;  3R66 A;  2GUZ A;  2WLM A;  3J81 N;  2QR4 A;  5IE9 A;  2QWP B;  2CAZ C;  1JPX A;  1QHT A;  3M7M X;  2UXB B;  2F4V O;  4X1I B;  3OUS A;  1H2K A;  1D5A A;  4PA7 A;  4OX9 B;  3AG1 B;  4MVQ A;  3LSU A;  4TV8 A;  3NR7 A;  3THO A;  2BE3 A;  3N2K A;  1BT8 A;  4JV5 B;  5H6R A;  1S3J A;  3JAS A;  2IJH A;  4I5S A;  4ZHQ B;  5LP6 C;  1KP3 A;  1Z5V A;  3CXH F;  2ITD C;  4GUN A;  4NYK A;  3RW0 A;  1M93 A;  1FAF A;  1ZL8 B;  1FXK C;  3LUT B;  1KUQ A;  2V1D A;  3Q4H A;  3QO8 A;  3PN1 A;  4DUZ B;  1V54 B;  4LF8 B;  2EX3 A;  1OCC B;  1NBM G;  1SZX A;  1NH2 B;  1OZ0 A;  4CH3 A;  4TUY B;  4X66 O;  3CJH B;  3K57 A;  3MDS A;  1QNM A;  4R6Z A;  5BXZ A;  5JCO A;  3LDE A;  3ETG A;  4AHC A;  4RO2 A;  4DR5 B;  3AG2 B;  1NH2 D;  1GKF A;  1JA8 A;  4EKW A;  5JVD A;  1K5Q A;  4O4I B;  1XEQ A;  3IGA C;  4KL1 A;  4J7J A;  1SZT A;  1R1B A;  1YJW V;  1H2N A;  3FAV A;  1KQS U;  3L75 H;  3JAT A;  1U97 A;  1FXK B;  3RYH B;  3SPC A;  1KD1 W;  3CWB H;  2IBZ H;  3O9O A;  4FFB A;  4TOI A;  3G4S V;  1W59 A;  1LR1 A;  2L35 A;  4BIZ A;  5CBG A;  2F4V B;  1Q8I A;  3CP1 A;  1K92 A;  2CK3 G;  5IWA B;  5B3S C;  3ABL B;  2P06 A;  4LH7 A;  2N74 A;  2ZT9 B;  1O9H A;  4PDM A;  3E86 A;  4YXW G;  4DR3 B;  2ZQM A;  1JJ2 U;  1YCI A;  2OTL V;  2LJ2 A;  3I56 V;  4DV5 B;  2IU0 A;  4NTX A;  3B77 A;  2A7W A;  5IDJ A;  2OYQ A;  5JJJ B;  4DV7 O;  4MVM A;  1E79 G;  5LXT A;  1P7B A;  4UUJ C;  3JAT B;  4IT5 A;  5JCO C;  1PM9 A;  5LMU O;  1M1K W;  4LF9 O;  2A0L A;  1IXB A;  3E89 A;  2FML A;  3GB7 C;  4FFB B;  1ZSP A;  5IJ9 A;  4JI5 B;  3OD4 A;  1XUQ A;  5D5Q A;  3KKY A;  4DR1 O;  4DUY O;  3K9S A;  3BFR A;  1FFX B;  1N36 O;  3ML0 A;  4MVO A;  4TV9 A;  1IZ3 A;  4B7K A;  4EB6 A;  2EZO A;  2ZE8 A;  4H0L B;  2R9R B;  2JEX A;  2UU9 O;  4GKJ O;  1OCZ C;  4BAY A;  2QWQ B;  3A0H Z;  1YIJ V;  1TUE B;  1I5Y A;  3E8H A;  4MSW C;  2JJ1 G;  1VQ4 V;  2X7R B;  3K58 A;  1Q3E A;  1MOF A;  2WLL A;  4JI8 O;  3JAL B;  1P7G A;  4UVA A;  4B3R B;  2CDY A;  3W7W A;  1WB7 A;  3JD4 A;  3K5M A;  4GKK O;  4JYA O;  2FKX A;  5A9G A;  4WBN A;  1R73 A;  4O4L B;  3B09 A;  4X1K B;  1HNZ B;  2LQT A;  4DV3 B;  3CCQ V;  5L3C A;  1Q81 W;  1HR0 B;  3D3I A;  1XMO B;  1ZUQ A;  1VP7 A;  1XMO O;  2E5L B;  1FJG O;  3CXC U;  3ABK B;  1NTM H;  3A0B Z;  1HP8 A;  2Y48 A;  3OMN B;  2F43 G;  3A8T A;  2ZE6 A;  4AIL C;  3I55 V;  2ZKO A;  3K0G A;  1AI6 A;  4LWS B;  1EFR G;  1OCR C;  4NTW A;  4GCZ A;  1YHQ V;  3MD0 A;  3N2G B;  2HKO A;  3UQ8 A;  1HNW O;  1K4D C;  4AQY B;  4X64 O;  1SQQ H;  1XRE A;  2OT5 A;  1H2L A;  1WAZ A;  1ORQ C;  2X6C A;  2DYR B;  3A2F A;  2DYR C;  2EIN C;  2XAJ A;  4N23 A;  2CUG A;  3W7S A;  1N33 B;  3OEH G;  3CRR A;  1Z2G A;  4DV2 O;  2UU9 B;  4GKJ B;  2OCC B;  1LNQ A;  5CMU A;  1OV9 A;  4NTY A;  1QU7 A;  2Q0A A;  1RPR A;  1Y4M A;  2ZNJ A;  4YHH B;  4DV4 O;  3QNE A;  2ZCE A;  5JJE B;  3LDC A;  4G27 B;  3EXA A;  4LFA O;  3E8B A;  3VOU A;  1AIL A;  3CC4 V;  4FVM A;  4JAS A;  4RUE A;  1HDJ A;  4DYL A;  3SPH A;  3AK3 A;  4Z1V A;  5IT9 N;  3SYQ A;  2A9H A;  1VF6 C;  2RNB A;  4U7O A;  2YXY A;  3ASN C;  1YDX A;  4GT1 A;  5BMV B;  1SQX H;  4JPR A;  5LP6 B;  3JSL A;  4GX2 A;  4AI8 A;  5JQG A;  5C93 A;  4J10 A;  3CC2 V;  5L3F A;  3R65 A;  3JCU Z;  1Y74 A;  4F6E A;  4FM1 A;  1RSO A;  1K34 A;  3CB2 A;  2PY5 A;  2UUA B;  2HHH O;  4LF7 O;  4DV6 O;  3B2E E;  2EIJ B;  1FJG B;  4HBN A;  4WFG A;  4IGG A;  3ZRW A;  2YC0 A;  2HLD G;  2XUM A;  1BSM A;  3C3T A;  2ZIM A;  1J95 A;  2LGQ A;  5E79 Z;  5K1P A;  2B1G A;  3ZMZ A;  2BCC H;  3KCY A;  2RDC A;  3WB2 A;  2DQ0 A;  5KX5 B;  3SPG A;  1RP3 B;  5BY1 A;  3UO2 A;  1PNK A;  2EJR A;  4FM0 A;  1EBO A;  1W2B U;  5L3E A;  4MTF A;  5CBF A;  1GM9 A;  2Y4U A;  1QR9 A;  2YIA A;  5EYP B;  4G28 B;  4XDJ A;  4X1I A;  1ZWI C;  2KQX A;  1SES A;  1TVK A;  4DR3 O;  4DW1 A;  2F1M A;  2RCV A;  2DWD C;  4HNA B;  4UCS A;  1RM1 B;  4LF6 O;  4I50 A;  1J5E B;  3T1Y O;  3K5L A;  4JYY A;  2WA3 A;  4MVZ A;  2E3C A;  3ABL C;  1X59 A;  3M99 B;  2R9A A;  3K5O A;  5LYJ B;  4K8X A;  4U7N A;  3RYF A;  2ITC C;  3ZED A;  3DTU B;  1TGO A;  2H94 A;  5FNV A;  4LNU B;  2WLK A;  5KX5 A;  4YJ2 A;  1QQC A;  3ABT A;  3JD2 A;  2IH1 C;  5ITZ A;  3ETQ A;  4CH4 A;  1A32 A;  1ZX3 A;  2VWJ A;  2HP8 A;  2Q6A A;  1IDS A;  1G4Y B;  3APQ A;  5B1B C;  3AG4 B;  5KAI Z;  5B3S B;  1S77 D;  4J7Z A;  1HNZ O;  1J5E O;  1FFT B;  2YSU B;  2Y69 C;  4F4L A;  4XDL A;  4JYA B;  4GKK B;  1UFI A;  2CGN A;  1S76 D;  1SS3 A;  1R6T A;  3UKM A;  2CH7 A;  3IC9 A;  3OFN G;  3MHH C;  4WCE V;  5CA0 B;  1PD3 A;  1K4C C;  4LH6 A;  3K59 A;  3E22 B;  3RYI B;  4UXN A;  4DR4 O;  2XAQ A;  1K97 A;  4Z1M G;  1I5X A;  2QWN B;  1TUB A;  5CN0 A;  1YF2 A;  1I94 O;  1UPG A;  2CGO A;  3ZX6 A;  3G71 V;  2ZR3 A;  3FX7 A;  4ZBM A;  4X8A A;  1NR1 A;  1QLE C;  4KXR A;  5CA3 A;  3CPW U;  1I94 B;  3WG7 B;  1VQ5 V;  3FYE B;  1XNQ B;  1QR8 A;  1GN3 A;  1SET A;  4NXN O;  5LL6 Y;  4ZOL A;  3FFQ A;  5LOV A;  3CRM A;  1SC5 B;  1T5E A;  4H13 B;  3C90 A;  5KA6 A;  3OEE G;  1V55 C;  1PV0 A;  3HKC A;  4O4L A;  1YEW A;  4PA4 A;  3RYI A;  5KUK A;  1KP2 A;  3L70 H;  1AI4 A;  4E4E A;  4NXM O;  1MAB G;  3HPL C;  4HAM A;  1PKX A;  1US6 A;  5LA6 B;  4W4L A;  1PL4 A;  2Q7H A;  4QPK A;  1KBH A;  1FXK A;  5IYZ A;  3SJB C;  3E83 A;  3ZHV A;  2DYS C;  1KKC A;  4PDL A;  1M56 C;  2BTQ B;  3CYO A;  1XL4 A;  1GH6 A;  3UM7 A;  1XMQ O;  1OHH G;  1WN7 A;  4PDV A;  1IUR A;  1MMM A;  2VWK A;  1Y76 A;  2ZNI A;  4J9Z B;  4QE7 A; 
#chains in the Genus database with same CATH homology
 4B3R O;  1R6T A;  4DR7 O;  2Z0A A;  1NS1 A;  4DV7 O;  2LW7 A;  4KHP O;  3F5T A;  2HHH O;  4DV6 O;  4LF7 O;  1F7Y A;  4JI3 O;  3JAM N;  4YY3 O;  4DUZ O;  1HNW O;  2AGA A;  4JI6 O;  2JRI A;  4DR2 O;  4X64 O;  4YHH O;  1N34 O;  1XNR O;  2UUB O;  4DR4 O;  5LMU O;  2ZM6 O;  4LF9 O;  1KUQ A;  5H5N A;  1I94 O;  4JI4 O;  3RT3 C;  1N32 O;  5BY1 A;  2UXC O;  4DR1 O;  2DJV A;  3OTO O;  4DUY O;  4JI2 O;  4LFB O;  2UXD O;  4DV0 O;  1N36 O;  4DV2 O;  1N33 O;  4LF8 O;  1XNQ O;  4X66 O;  4OPA A;  5LMN O;  4LF4 O;  4OX9 O;  2UU9 O;  4GKJ O;  5BXZ A;  1IBM O;  4K0K O;  4DR3 O;  5FLX N;  2UXB O;  4DV4 O;  4NXN O;  4LF6 O;  5LL6 Y;  2E5L O;  3T1Y O;  3J80 N;  4JI5 O;  4B3S O;  5IWA O;  3T1H O;  4JI0 O;  4A5U B;  4LFA O;  4JI8 O;  1X59 A;  1AB3 A;  1XEQ A;  4AQY O;  1AIL A;  4X62 O;  5A2Q N;  4OPH A;  3O65 A;  4GKK O;  4JYA O;  1R1B A;  2FKX A;  4JI7 O;  2VQE O;  1IBL O;  4NXM O;  4DV1 O;  4B3T O;  5IT9 N;  4DR6 O;  4JI1 O;  1DK1 A;  4LFC O;  1D2D A;  1IBK O;  4B3M O;  1A32 A;  1G1X B;  4LF5 O;  4X65 O;  3R66 A;  1FKA O;  4DV3 O;  3J81 N;  1XMO O;  1HNZ O;  1FJG O;  4DR5 O;  2DOS A;  2N74 A;  1J5E O;  1HR0 O;  2VQF O;  2UUC O;  4JV5 O;  1XMQ O;  2UUA O;  1YZB A;  2F4V O;  1HNX O;  3M8A A;  3SDL A;  3J7A U;  1FYJ A;  5BR8 O;  2ZKO A;  4DV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...