4DR4O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr4O00
4NXNO 1N34O 1AILA 2UUBO 2F4VO 3O65A 1X59A 4LF9O 4YHHO 1AB3A 4LF4O 5LMNO 3J7AU 4GKJO 1D2DA 4KHPO 5IT9N 4JI0O 1FKAO 1NS1A 1R6TA 4LF8O 2VQFO 4JI6O 4LF5O 4DR2O 4X64O 3F5TA 4JI3O 4LF7O 1G1XB 2UU9O 2FKXA 2UXBO 2LW7A 4JI7O 1XNQO 5IWAO 4X65O 5BR8O 1IBMO 2DOSA 3J81N 2E5LO 1XEQA 5FLXN 2VQEO 4B3SO 1N32O 4JI5O 4GKKO 3SDLA 3T1YO 4DV1O 1HNWO 4DR1O 3M8AA 2DJVA 4JV5O 4B3MO 4DR7O 5LMUO 4A5UB 5A2QN 2UXCO 4X62O 2N74A 1IBLO 5LL6Y 2UUAO 2ZM6O 4LFBO 4DUZO 4OPHA 1I94O 3J80N 4DV5O 3T1HO 1DK1A 4NXMO 4DV7O 4K0KO 4JI1O 1XNRO 1N33O 1F7YA 3JAMN 1FJGO 4DV4O 1HR0O 2UUCO 4B3TO 1YZBA 1N36O 4DUYO 4DR5O 4DV3O 3RT3C 1KUQA 4JYAO 1FYJA 1A32A 1HNZO 1J5EO 3R66A 3OTOO 4X66O 4OX9O 2AGAA 4YY3O 2ZKOA 1IBKO 4B3RO 2UXDO 4DR3O 4DV6O 4LFAO 4OPAA 4JI2O 2Z0AA 4JI4O 4DR6O 5BXZA 2JRIA 4AQYO 4DR4O 4LF6O 1HNXO 1R1BA 4DV2O 1XMOO 2HHHO 1XMQO 4LFCO 5H5NA 5BY1A 4DV0O 4JI8O
chains in the Genus database with same CATH superfamily
2X7RB 3OMIB 2F4VO 2OIEA 3QO7A 5AG2A 1PKXA 4J7ZA 4JAUA 4DUYB 4W4KA 2QTOA 4EB6B 4J7KA 1VEWA 2AW9A 5L3BA 4DR2O 2P4VA 2YC0A 4G2KA 1VF7A 1S0VA 4R7CA 2Q6AA 1RM1C 1TVKB 1H8EG 3EXAA 4DV0B 1AI6A 1DF5A 1S5HC 4LP8A 3A0RA 2MW2B 1XHZA 4PD4F 5EC1C 4DV1O 3RGBA 3M8AA 4CC6A 4YHHB 1BZKA 2EIJC 4P2ZA 4A5UB 3ASOB 4JYYA 3QNEA 2RNBA 3VQXA 1IBLO 2LW1A 1Y74A 1BE3H 3QO5A 1KP2A 1NTKH 3T1HO 4DV7O 3VQYA 4O4IA 3IFXA 2ZDIA 1DF4A 3L70H 3JSNA 4IT5A 4O2AA 3ZBHA 5KHGA 4JYCA 1WN7A 2YI8A 4ZOLA 4L87A 1GK9A 3D3IA 4GKKB 3UO2A 1SQVH 3C90A 5FL7G 2UXDO 2D3OW 4JI6B 5EBWC 3RW0A 1R3JC 1TUBA 3ICXA 3C3TA 1ZL8B 3E86A 3CE2A 3RYCB 3I55V 2XHBA 1N33B 2ITDC 2W0XA 1V55B 3JD3A 4FLTA 2EIKC 1XQ8A 2IU0A 5L3FA 1L0LH 3FB8C 1LUVA 3AK1A 5LA6A 1HNZB 3N2KB 4CC5A 3OE7G 2X6CA 4ZIBA 2M6YA 3VBBA 4F6EA 3F5TA 4LF7O 5CA1B 2FKXA 4NXMB 2N05A 1IBMO 4N21A 1COWG 3ZHVA 3FB7C 4LFCB 4Z1MG 5LYJB 2ATKC 2ADPA 3SDLA 3OR7C 4RUFA 1MZEA 1M57B 1FXHA 3B4SA 3WU2Z 3CSXA 2DJVA 1PNMA 5CBHA 4ZHQA 5IJ9B 4FLUA 1CEZA 3T1CA 1F4NA 3F5WC 3M7MX 4I50B 2ZM6O 5LP6A 5A9GA 1PNLA 4J10A 1DK1A 3GWKC 1F7YA 2DWEC 4PDMA 2QWRB 4UFZA 4RWUA 3N2GB 4ZBMA 3OTOO 4JI5B 3WB0A 3JYCA 4K8XA 4O4JA 4FPPA 5JVDA 3H01A 4LWSA 1IBKO 4UCTA 4FLZA 3EHBB 4DV6O 1YJ9V 1RPOA 4O4HA 3CRRA 4CH5A 3CMAV 4B3MB 4F4LA 4UUJC 3WFVA 3M99B 4XDJA 5IWAB 2Q73A 1ZSPA 5BR8B 1IURA 2VRZA 1YJNV 2E74B 3OTFA 5FNVA 2Y48A 4O2BB 2DQ3A 4IHJB 4WCEV 2WLLA 1FS0G 4CBCA 2F1MA 1ZWIC 3RYIB 1N36B 4UV9A 5IT9N 4DR5B 2VWJA 3K5NA 3ZX6A 2FL4A 2CE4A 4X20B 5J9PC 1J5EB 3H1KH 1SZXA 1OCCC 3DC6A 4MW3A 3B8NA 3KZIZ 2H94A 1W0KG 3UT5A 1Q82W 3HKBB 1VF6C 3DGEA 4BR6A 4IYHA 4JGSA 1EN5A 3CWBH 4X65O 1F4MA 3ZRXA 1LUWA 1VQ7V 4NB5A 4I7ZB 5J2UB 1M5IA 1WA8A 3CRCA 2EINB 3E8GA 4NVPA 1MA1A 3HKEA 4I4TB 3JAKA 2YIAA 1VARA 3STZC 4UCRA 1L0NH 3CC2V 3Q4HA 1FPOA 3EFFK 3H1LH 5ITZB 3K5LA 4TT3G 3J80N 4RQFA 2JGDB 2Q9LA 1K5QA 1TAEA 1S72V 4MVMA 4JI3B 1YITV 2Q67A 4KXRA 1GN3A 5KX5B 2BSKB 1XNQB 4TV8B 1M4UA 1YF2A 4RO2A 4TV9A 3SPJA 1TGOA 3P3PA 5DN6G 1K73W 1UPGA 2VQFB 5B3SC 4JV5B 5JJNB 2XAGA 2WSSG 3AG4B 5EYPA 1AP5A 1OCZB 1DLBA 1Y6XA 2WAMA 2WLIB 2ZQMA 4CH4A 2UU9B 5BMVA 3AEIA 2P5OA 1FFXA 4LFBB 3ASNB 1W2BU 4AI8A 4IGGA 3WB1A 2ADQB 4ZI7B 2QKAA 4NXNO 3O65A 4NTYA 1EFRG 5GTHZ 1AI5A 4X8AA 4QGPA 5C8YA 1S5JA 1MABG 2CAZC 2CDYA 3E89A 2GV9A 2QWPB 4TUYA 4LF5O 1K5SA 2XT9A 4X64O 2WA3A 4DO2A 5LBQA 4JI2B 3CS5A 4H37A 4P30A 2HJFC 2Q5ZA 1MSWD 1Z2GA 3MAQA 4BW9A 1MZFA 1LNQA 1AI7A 4B3SO 4YJ3A 1JFFA 4H33A 1CPYA 3T1YO 4X1KA 1K9MW 5KAIZ 4HZ3A 4DR1O 3CCJV 1ZUQA 3K59A 1I7FA 4PI0A 1Q43A 3JAWB 3FX7A 1F51A 1SA0B 4TWKA 3QVNA 4JZGA 3JD2A 4LF6B 1Q8IA 2QWOB 1I94O 3ASOC 1MMMA 4FVMA 2UXBB 5EC2C 3K06A 3FAVB 2DE0X 4Q6GA 1GRJA 2UUCO 1P49A 3ZHQA 4DW1A 2Q7GA 4LF4B 4FLYA 2Z3YA 4KHPB 4RQEA 4OX9O 3H1HH 3ETGA 3WG7B 3B2EE 3OEEG 1HNWB 1M56B 1VQ9V 4JI4O 1VQLV 3QTCA 2V1DA 4LR3A 1K7DA 1DTOA 4X62B 3G6EV 2ZNJA 2HP8A 3AK3A 2WLHA 3CJHB 5L3CA 3JD4A 4JI8O 3UO3A 2EJ7A 3RYHA 2EZPA 2C2AA 4PHZA 1XNRB 1WAZA 4GLXA 4BAYA 4K8ZA 4XDLA 5LMNO 4GUNA 1QNMA 5KMGA 1ZAUA 4JI0O 4IIJB 2R72A 4QE9A 5LHHA 1NS1A 1V55C 2A79B 3MDSA 4FFBB 1XI1A 3CCMV 1RSOB 3JATB 4LC1A 1L8DA 5EBMC 4JTCB 2QWQB 3CCUV 3CRMA 1Q86W 1KECA 4JZ2A 5LXTB 3TXSA 1BHBA 2JJ2G 3D8CA 3OMNB 4K0KB 4JI7O 3TK1A 1WNSA 4H0LB 4YIOA 1XMOB 3BAAA 3LNMB 3K08A 2CGNA 2FB5A 1B04A 1AR4A 5E79Z 2GUZB 1ZL8A 2YXYA 5LMUO 1PM9A 1M57C 2BOCC 1VQPV 2WA4A 1XDCA 3DXRB 1SQBH 4BIZA 3ABTA 2NR5A 4JAVA 2ZR3A 2Y69B 1K4CC 3AG1B 1NTMH 1HR0O 1YZBA 1M93A 5HFMA 1OCRC 2A7WA 2YXLA 1SKVA 1AVMA 2ZD9A 1K34A 3L9DA 5LHIA 4B3RO 2BOBC 2ETNA 5CA0A 5KA5A 2IM9A 1K3EA 1NKDA 3HKDA 2XUMA 5GONB 1NH2D 1PV0A 3CCSV 4WFEA 5BXZA 5IYZA 4PDRA 3BA9A 3E22A 3LSUA 4X9QA 3CCLV 1R1BA 2HR3A 4QJFB 1GH6A 2QWNB 4LH7A 1QCEA 3E2EA 4HYOA 3SYCA 5IYBO 3G80A 3ZMUA 2Y4UA 4F6RB 4JYBA 4UB8Z 5GW7A 2Q7HA 2KG7A 1R6TA 5KHIA 1H2SB 4I9QA 2F93B 1XUQA 1IZ3A 2RCVA 4JI6O 1S77D 2F95B 1VQ4V 4TSFG 1Z5WA 1VQ8V 2DW4A 4I55B 2IJJA 3N2GA 3CHXA 1X4TA 4H44B 3DC5A 2P06A 1VQ5V 4ASUG 1H2LA 1JPXA 2ZIOA 2UUBB 2ITCC 2ZXWB 4EEQA 1P84F 3L73H 4MVRA 3E8BA 2QJ1A 1PNKA 4WBNB 2GDSA 4B7KA 4DR3B 2EINC 4GKJB 5A2QN 2IH3C 2LFRA 1JCHA 4O2BA 4IHJA 4X1IB 5LOVB 2HVJC 5HFLA 2HHHB 4DRXA 4NXMO 4KL1A 1YJWV 4B08A 1US6A 1MNGA 4Z1VA 2X6BA 4YXWG 5IDJA 5DEDA 3JARB 4CS3A 3W7XA 5DM6V 3L71H 2ARHA 4YY3O 5EZYB 2A06H 4J80A 2ODMA 1RP3B 2KSDA 1J95A 3K9SA 3JALB 4AQYO 3I56V 1VQOV 1XMQO 2A3QA 2EULA 2FMLA 1JJ2U 3ABLB 4JPRA 3AG4C 1OCZC 5ITZA 2LO1A 2DYSB 3CC7V 4LF9O 2HVKC 3ASNC 5JQGB 3RFRA 2HLDG 2WPDG 3CYOA 1FKAO 1M90W 5CB4A 3I5DA 2K1EA 3KCXA 2Q4PA 4DUZB 4LCUC 2QKSA 2Y4TA 2ZE5A 1FXVA 1NVPD 5JH7A 5IWAO 3OMAB 5BR8O 3RYFA 1E79G 2B1IA 4R8CA 1GMGA 1VQKV 4B3TB 1GO3F 3LDCA 2CTQA 2F4VB 2WLIA 5B1BB 2R9RB 1KP3A 3CCVV 1VQNV 3SJCC 3CRQA 4LFAB 1V54B 4PI2A 1BL8A 1V9PA 3AG3B 4BWAA 1MG1A 3U11A 4DK1A 4B7EA 4DR2B 3TCUA 1PP9H 2PY5A 3CXHF 1P4RA 3KCYA 5IYCO 1Y76B 4FM1A 3SJBC 1FJGO 1M9NA 1HW7A 1SS3A 1HDJA 2F66C 1KB9F 4IYIA 2KKWA 3FKSG 5IYDO 3ML0A 3T4DA 4X66O 3VOUA 4WF9V 4P9OA 3THOA 4H13B 2XTAA 4DV1B 3D36C 3BRCA 3R65A 3VQVA 1NH2B 4KFMA 4RAIA 3B77A 3WG7C 3CX5F 1IBLB 3B40A 1NTZH 1TUEB 2LGQA 1AJPA 4DV7B 3JAWA 3ZEDA 5CBGA 1SA0A 1KKCA 4UV8A 3GB7C 4NTWA 4LNUA 3J7AU 5D5PA 3HKCA 3ZMZA 2JS5A 5IY5B 3RBZA 3A0BZ 3TETA 1Z5VA 1WP7A 2V4DA 1SF9A 4FLWA 2VQFO 2ZNIA 2QM8A 1IDSA 2UXDB 3FYIB 2L35A 2WWWA 3D36A 4FMTA 2OCCB 2UU9O 2QGNA 2RMKB 4TQFA 2CH7B 2Q7EA 2PZSA 3EVKA 3P3NA 3J81N 4QNHB 2E5LO 2DMXA 3UQ8A 1I5YA 3BABA 4U7NA 1YTFD 2X6AA 3HB3B 3SPGA 1MOFA 3K79A 1OZ0A 2KB1A 1NR7A 1JJOA 5KUMA 3CB2A 3K58A 1XHXA 4R6ZA 2EIMB 3JD0A 3MD0A 4G28B 2H3OA 2QKCA 2IW5A 4J11A 4PJ0Z 3JCUZ 4IIJA 4LF7B 4L8JA 1XOUA 5B1NA 1GAXA 1IBMB 4FFBA 1RSOA 3JATA 4E2LA 2JJ1G 1YCIA 3OFNG 1K97A 3BPZA 2Y69C 3AG1C 1WB8A 4YJ2B 5LXTA 1AJNA 1JA8A 5H9CA 4ABMA 2EILB 1NJIW 4O4IB 5L3DA 1SERA 3W7SA 1YEWA 1IXMA 4PA4A 1OCOB 4LF6O 4O2AB 1VF6A 2B1GA 1HNXO 2XOKG 5F2VO 1U96A 2ZM6B 3GVMA 3T2MA 5BY1A 5LGNA 2FYUH 2YSUB 1QLEB 1IVSA 3UKMA 3CMEV 3JASA 1EBOA 3OD4A 3ZMTA 3K03A 1AB3A 2BTOA 3RWRD 4LF4O 4KHPO 2NLJC 1EN4A 2VS0A 3B09A 4DR7B 3OTOB 3WB2A 2X0LA 1SQXH 1IBKB 2JEXA 1ZTEA 4J9YB 4WFGA 1KQSU 4DV6B 1DGSA 3DSQA 4X1YA 5B1AB 2OIGA 4G27B 5KHHA 4JI1B 2DYRB 2P4KA 2UXXA 4Q20A 1SQPH 4MW8A 2XASA 2P67A 1PL4A 1P7GA 5K1PA 2WLKA 3OM3B 3TGUH 2XAQA 2Q69A 4HNAA 1NBMG 1I08A 4LH6A 2W6IG 4P9PA 2UXCO 4QIWF 4DXWA 2ZXWC 4O4LA 2D2CB 3CXCU 3CCRV 3OUSA 1BHAA 4K0KO 4F6RA 5EIBC 1THZA 2HJDA 3ZCCA 1KMIZ 3BHPA 4X65B 2EJRA 4ZHQB 3IAYA 2BTQA 4MVSA 4DV3O 4JYAO 1UJWB 5LP6B 4GX1A 5JCOC 1N0JA 2IJHA 5LGUA 3K0GA 4X88A 3U0ZA 3G6BA 2QR4A 4EKWA 3F7VC 2F43G 1GM9A 5CA3A 4DV2O 1N4CA 3ZHTA 4EB6A 3ZHRA 2YS8A 3SPIA 1BQZA 4WBNA 2B9ZA 1JMKC 4O4JB 2CK3G 1AROP 4LWSB 4NR1A 2IH1C 2IJIA 3SYPA 3L72H 1NR1A 1VMGA 2NNUA 3ABLC 4X1IA 4FLXA 3ZRSA 5IJ0B 3K3WA 1TVKA 4IL6Z 2WLNA 1I0HA 1H2KA 2DYSC 4FK5C 3BCCH 1HWYA 1KKDA 4FZ0A 5FNVB 5J2TB 2OTLV 3B8MA 3ABUA 2WLLB 1QU7A 4JF3A 3JARA 2DQ0A 2WLJA 4I0XB 2DN9A 1BMFG 1LR1A 2H8PC 2VQEO 1N32O 3SJAC 4NXNB 3FYEB 1EN6A 4UVCA 2ZE7A 2NN4A 3UM7A 2YIDA 4CH6A 4RUEA 5B1BC 1SQGA 1Y67A 3ABKB 4BW5A 4MSWC 2Q0AA 1Q81W 4X64B 1KD1W 1V54C 1BCCH 3OUFA 1SZTA 3RVZA 2QTSA 1B6QA 1VF5B 3AG3C 5FPRA 4UCUA 3F7YC 3K0DA 4DUYO 3ZHUA 3IGAC 4B3SB 2UXNA 3R66A 3ABMB 3RYCA 3W7WA 4PELA 1QBZA 1XL4A 4AILC 3LNNA 4DR3O 2PGGA 5EBLC 2QEXV 1G4YB 2XAHA 4UCSA 4DR1B 3BEHA 3VQWA 4PA6A 4TOIA 3W7UA 1VP7A 2HHHO 2LGWA 3N2KA 3K57A 1L1FA 4DV0O 4HBNA 2GHYA 4TV9B 1YIJV 2Z5UA 2QDOA 2P6JA 1FAFA 5TISZ 5CA1A 4YHHO 3ETDA 2YIBD 2R9IA 2YIBA 2GSMB 5BMVB 5LYJA 2IJKA 1U97A 4GX2A 4HAMA 4OX9B 1Y76A 2R9AA 4JTAB 4UB6Z 1RFYA 1EZVH 2UUAB 5IY5C 1GM8A 3ZRWB 2Q0OC 2GTAA 1Q7YW 4DV5B 1AJQA 4JI4B 1R6KA 5IJ9A 4TQDA 3FFQA 1K8AW 5BZBA 1GM7A 4I50A 4MS2A 2OCCC 2K9PA 3BFRA 4GKKO 3STLC 4TUYB 2HKOA 3SYAA 1JOYA 1AR1B 1D5AA 5LMNB 4JI0B 3APQA 2LQTA 3P32A 4DR4B 4DUZO 3A0HZ 4YJ3B 5KHJA 1JFFB 3LSQA 1JX9A 5B66Z 4FM2A 4X1KB 1E1QG 1N33O 1KBHA 2EIMC 3W7TA 1N34B 1ORQC 2XNDG 4JI7B 3D3QA 4B3TO 2PTMA 1A32A 1HNZO 4KUMA 3ZIAG 1BS3A 2ZKOA 4LF8B 2CH7A 2GBOA 4NKGB 2IBZH 3APOA 4LFAO 5L3EA 1W0JG 4OPAA 4QPJA 2Y0IA 3RYIA 2ZT9B 5LMUB 4DK0A 2EILC 1E1RG 4X20A 3ZJZA 4LFCO 2ZDIC 2PYLA 2QM7A 1QVGU 2QM4A 1OCOC 3JD1A 3AG2B 3HKBA 3BVOA 4D7TA 1YDXA 4QE7A 2PYJA 1XL6A 2RDCA 1QLEC 1YSCA 1HR0B 4CZZA 1D2DA 3KKYA 1O9GA 2HEPA 2YICA 3AG7A 4NTXA 2W6JG 5J2UA 2ZCEA 3PJSK 2PI4A 4I4TA 5LGTA 4I5SA 3RYHB 1BGYH 4B3RB 2F23A 1I5XA 2E3CA 1G8MA 4UVAA 3IJ4A 1AP6A 1G6UA 2O57A 5JJEB 4E4EA 4GCZA 4X89A 4GT1A 4YJ2A 5KMGB 1AI4A 4DV4B 1Q90D 4N23A 5L3GA 5FLXN 5B1AC 4JI5O 1P7BA 4FJCC 2JGDA 2DYRC 2RQ6A 3A2FA 4MVZA 5KX5A 1XREA 2BSKA 3LSSA 5H6QA 3ETEA 4B3MO 4KP4A 4TV8A 4ICGA 4DR6B 2CUGA 4J41A 2RJZA 1BT8A 4C7UA 2CTPA 2ZR2A 3OGCC 4LBEC 4U3JB 3SPCA 1O9HA 1N36O 3S3XA 4DR5O 2YEVB 1FXKB 2CTWA 1NU1H 1FYJA 1GN2A 1J5EO 2P7TC 4ZI7A 3MHSC 3ZHSA 1H8HG 5B1OA 2Z0AA 5LP6C 3OR6C 3SYQA 2HG5C 2KQXA 2XAJA 3K5OA 3CRAA 1H2GA 1QQCA 1WLEA 4ZKIA 1BSMA 3X2QB 2CTRA 5CA0B 2Y0PA 3MHHC 1GKFA 3HKDB 4OGQB 5FPOA 3ZS8C 1H38A 5IYZB 1S5LZ 3E22B 2JVDA 2ZIMA 1JR9A 4GZRB 4YY3B 1M56C 1KYOF 1W59A 2XAFA 1WB7A 4JI3O 1Q6HA 1G1XB 1F23A 3T1HB 1R3LC 1XNQO 4AQYB 3HPLC 1R73A 1XMQB 5KUKA 2KG7B 3OT7A 1ZX3A 1OCRB 2Q68A 1OJHA 2R70A 1JQ0A 1SQQH 5B5EZ 3QF7A 4LF9B 1URFA 3FAVA 2E76B 4JV5O 2V7QG 1YHQV 1QLNA 4DR7O 1Y66A 4PDLA 2WLMA 4PA9A 3T4ZA 4LFBO 5JWPA 3K5MA 3CEIA 3CD6V 5H2FZ 1FFTB 1SRYA 2QSAA 2W0FC 4K3AA 4JI1O 3G71V 3JAMN 5IJ0A 1N8RW 3ABKC 4CS2A 2OYQA 2HFEC 1S3JA 1Q3EA 4WFAV 3CJHA 5J2TA 3SJQC 3ZN1A 4UVBA 4J7JA 4DRXB 2A0LA 3L75H 4GYCB 3RVYA 4I0XA 5KLVH 5CMUA 4JI2O 3ABMC 3PN1A 1NZ6A 3N27A 4FM0A 3BY6A 3ZN0A 3H1IH 1VIBA 5H5NA 1AILA 2A9HA 5CBFA 1Y74B 1X59A 2G38A 1FJGB 2ZE6A 1EM1A 3IC7A 4J42A 2QA4V 3OAAG 2AZ0A 4X66B 4XBFA 3BA8A 3E83A 4MT8A 2AHYA 4ZOLB 1RM1B 3FD9A 2FTKA 2GUZA 2VWKA 2UXBO 1NQTA 2LW7A 4CS4A 2GTSA 1SETA 4DW0A 2E75B 2DOSA 1BQ0A 1QR8A 3JSLA 3ZRVA 3L74H 2EIJB 3DXRA 4OXSA 5CB4B 1TUBB 1HNWO 1XILA 1ZLZA 3O9OA 1MSDA 2ZINA 5JH7B 1NVPB 3QO8A 3S3WA 1NT2B 4U7OA 3RYFB 4X62O 1H2NA 5LA6B 1S76D 1XNRO 3OEHG 4J9ZB 1GTOA 4UXNA 4QPKA 1ROPA 1Q6IA 4I9WA 3SPHA 5GONA 1VQ6V 3LDDA 1KU9A 3H1JH 1WPBA 1KC8W 3LDEA 5CN0A 1QR9A 2AHZA 2E5LB 2LFSA 3ZRWA 2AGAA 1K4DC 2M7WA 2OTJV 4WFHA 1SESA 2OWOA 3DTUB 3CPWU 2PF4E 4MTXA 2ILMA 5K1XA 2JIZG 4EFBA 4FLVA 1XMOO 1YI2V 1TA8A 2EIKB 1R6NA 1PD3A 4PA3A 4I55A 2EBOA 4U3FH 4MTOA 5GTIZ 5KAFZ 2YXHA 3P30A 1K33A 3AG2C 4CH3A 1XBLA 4WFBV 2JEUA 4FZ1A 4JAAA 2BE3A 1H2MA 1UFIA 2AZ2A 5DECA 4Z2WA 4FIPC 4AHCA 2OT5A 1IXBA 5JVDB 2MK3A 2AXTZ 1T5EA 2LP7A 3KG2A 4LNUB 3CC4V 3HKCB 1Q5OA 4JASA 5EIBD 3SYOA 1HNXB 5LHGA 1GN6A 4O4HB 2L6LA 2IU3A 1XEQA 3K9AA 5LOVA 4UCVA 1PPJH 1FD9A 5JCOA 4W4LA 1AR5A 3UCSC 3QG5A 4D6TH 3H9VA 2P90A 3RN4A 3GWOA 2N74A 3SR2C 5LL6Y 2UUAO 1SC5B 3G67A 5EZYA 4DV5O 1YTFB 5H6RA 2B5UA 3G4SV 1WPXA 1JVMA 5D5QA 1Q6UA 3JALA 3UT5B 4XDKA 3NR7A 2CGOA 4R50A 3RT3C 1WJZA 1IX9A 2BCCH 1WA8B 1FXKC 4UCOA 4LF5B 3HKEB 1B06A 4MVQA 5JQGA 3JAKB 3CCEV 4DR4O 2UXCB 3Q4HB 4BIUA 1K92A 2JDIG 1Y4MA 1ENVA 3SGIA 1SQFA 1GN4A 2EZOA 1N34O 1NI8A 2UUBO 4K35A 1WP8A 1R3KC 4GX0A 1OCCB 3T1YB 2PI5A 4PV1B 3NXSA 4GKJO 4EFEA 1B3QA 1R3IC 5C93A 4DV3B 4FFKA 1PL0A 3X2QC 4JYAB 4LF8O 3E35A 3LUTB 4U3JA 3OGIB 2JK5C 4DYLA 4MVUA 1RPRA 4BIOA 1CXZB 4PA7A 2OCHA 1YXBA 1OHHG 2EX3A 2QE7G 3JASB 3HR0A 3U10A 1I94B 1HP8A 3OW2U 2YEVA 1FXKA 1CP9A 4MTFA 4JTDB 3TXQA 2DWDC 4D7SA 4DV2B 3FB6C 2LJ2A 2UUCB 2P22C 2Q8VA 5EYPB 3ETQA 4NYKA 5KHKA 3FB5C 1N0NA 3ZMSA 1FFXB 1OV9A 4X1YB 3CP1A 3E8FA 2JGUA 3A8TA 1EZJA 3C3SA 4WFFA 3E8HA 4YIPA 3AK2A 1QHTA 4GX5A 5C8YB 4OPHA 2YDEA 4MTGA 4JI8B 3JCZA 4HNAB 4DV4O 2YUAA 1M1KW 1KUQA 4O4LB 5B3SB 2VQEB 1N32B 1QVFU 3CCQV 2ZE8A 5IE9A 3K04A 2N04A 2RN9A 1D5NA 3ZMVA 5EK0A 2PUSA 4DR6O 1YVWA 5E1AC 2JRIA 5KA6A 3TJTA 2BTQB 4PDVA 4MVOA 5JJJB 1VQMV 3IC9A 2YI9A 2JS3A
chains in the Genus database with same CATH topology
4NXNO 1N34O 1AILA 2UUBO 2F4VO 3O65A 1X59A 4LF9O 4YHHO 1AB3A 4LF4O 5LMNO 3J7AU 4GKJO 1D2DA 4KHPO 5IT9N 4JI0O 1FKAO 1NS1A 1R6TA 4LF8O 2VQFO 4JI6O 4LF5O 4DR2O 4X64O 3F5TA 4JI3O 4LF7O 1G1XB 2UU9O 2FKXA 2UXBO 2LW7A 4JI7O 1XNQO 5IWAO 4X65O 5BR8O 1IBMO 2DOSA 3J81N 2E5LO 1XEQA 5FLXN 2VQEO 4B3SO 1N32O 4JI5O 4GKKO 3SDLA 3T1YO 4DV1O 1HNWO 4DR1O 3M8AA 2DJVA 4JV5O 4B3MO 4DR7O 5LMUO 4A5UB 5A2QN 2UXCO 4X62O 2N74A 1IBLO 5LL6Y 2UUAO 2ZM6O 4LFBO 4DUZO 4OPHA 1I94O 3J80N 4DV5O 3T1HO 1DK1A 4NXMO 4DV7O 4K0KO 4JI1O 1XNRO 1N33O 1F7YA 3JAMN 1FJGO 4DV4O 1HR0O 2UUCO 4B3TO 1YZBA 1N36O 4DUYO 4DR5O 4DV3O 3RT3C 1KUQA 4JYAO 1FYJA 1A32A 1HNZO 1J5EO 3R66A 3OTOO 4X66O 4OX9O 2AGAA 4YY3O 2ZKOA 1IBKO 4B3RO 2UXDO 4DR3O 4DV6O 4LFAO 4OPAA 4JI2O 2Z0AA 4JI4O 4DR6O 5BXZA 2JRIA 4AQYO 4DR4O 4LF6O 1HNXO 1R1BA 4DV2O 1XMOO 2HHHO 1XMQO 4LFCO 5H5NA 5BY1A 4DV0O 4JI8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN O;  1N34 O;  1AIL A;  2UUB O;  2F4V O;  3O65 A;  1X59 A;  4LF9 O;  4YHH O;  1AB3 A;  4LF4 O;  5LMN O;  3J7A U;  4GKJ O;  1D2D A;  4KHP O;  5IT9 N;  4JI0 O;  1FKA O;  1NS1 A;  1R6T A;  4LF8 O;  2VQF O;  4JI6 O;  4LF5 O;  4DR2 O;  4X64 O;  3F5T A;  4JI3 O;  4LF7 O;  1G1X B;  2UU9 O;  2FKX A;  2UXB O;  2LW7 A;  4JI7 O;  1XNQ O;  5IWA O;  4X65 O;  5BR8 O;  1IBM O;  2DOS A;  3J81 N;  2E5L O;  1XEQ A;  5FLX N;  2VQE O;  4B3S O;  1N32 O;  4JI5 O;  4GKK O;  3SDL A;  3T1Y O;  4DV1 O;  1HNW O;  4DR1 O;  3M8A A;  2DJV A;  4JV5 O;  4B3M O;  4DR7 O;  5LMU O;  4A5U B;  5A2Q N;  2UXC O;  4X62 O;  2N74 A;  1IBL O;  5LL6 Y;  2UUA O;  2ZM6 O;  4LFB O;  4DUZ O;  4OPH A;  1I94 O;  3J80 N;  4DV5 O;  3T1H O;  1DK1 A;  4NXM O;  4DV7 O;  4K0K O;  4JI1 O;  1XNR O;  1N33 O;  1F7Y A;  3JAM N;  1FJG O;  4DV4 O;  1HR0 O;  2UUC O;  4B3T O;  1YZB A;  1N36 O;  4DUY O;  4DR5 O;  4DV3 O;  3RT3 C;  1KUQ A;  4JYA O;  1FYJ A;  1A32 A;  1HNZ O;  1J5E O;  3R66 A;  3OTO O;  4X66 O;  4OX9 O;  2AGA A;  4YY3 O;  2ZKO A;  1IBK O;  4B3R O;  2UXD O;  4DR3 O;  4DV6 O;  4LFA O;  4OPA A;  4JI2 O;  2Z0A A;  4JI4 O;  4DR6 O;  5BXZ A;  2JRI A;  4AQY O;  4DR4 O;  4LF6 O;  1HNX O;  1R1B A;  4DV2 O;  1XMO O;  2HHH O;  1XMQ O;  4LFC O;  5H5N A;  5BY1 A;  4DV0 O;  4JI8 O; 
#chains in the Genus database with same CATH topology
 2X7R B;  3OMI B;  2F4V O;  2OIE A;  3QO7 A;  5AG2 A;  1PKX A;  4J7Z A;  4JAU A;  4DUY B;  4W4K A;  2QTO A;  4EB6 B;  4J7K A;  1VEW A;  2AW9 A;  5L3B A;  4DR2 O;  2P4V A;  2YC0 A;  4G2K A;  1VF7 A;  1S0V A;  4R7C A;  2Q6A A;  1RM1 C;  1TVK B;  1H8E G;  3EXA A;  4DV0 B;  1AI6 A;  1DF5 A;  1S5H C;  4LP8 A;  3A0R A;  2MW2 B;  1XHZ A;  4PD4 F;  5EC1 C;  4DV1 O;  3RGB A;  3M8A A;  4CC6 A;  4YHH B;  1BZK A;  2EIJ C;  4P2Z A;  4A5U B;  3ASO B;  4JYY A;  3QNE A;  2RNB A;  3VQX A;  1IBL O;  2LW1 A;  1Y74 A;  1BE3 H;  3QO5 A;  1KP2 A;  1NTK H;  3T1H O;  4DV7 O;  3VQY A;  4O4I A;  3IFX A;  2ZDI A;  1DF4 A;  3L70 H;  3JSN A;  4IT5 A;  4O2A A;  3ZBH A;  5KHG A;  4JYC A;  1WN7 A;  2YI8 A;  4ZOL A;  4L87 A;  1GK9 A;  3D3I A;  4GKK B;  3UO2 A;  1SQV H;  3C90 A;  5FL7 G;  2UXD O;  2D3O W;  4JI6 B;  5EBW C;  3RW0 A;  1R3J C;  1TUB A;  3ICX A;  3C3T A;  1ZL8 B;  3E86 A;  3CE2 A;  3RYC B;  3I55 V;  2XHB A;  1N33 B;  2ITD C;  2W0X A;  1V55 B;  3JD3 A;  4FLT A;  2EIK C;  1XQ8 A;  2IU0 A;  5L3F A;  1L0L H;  3FB8 C;  1LUV A;  3AK1 A;  5LA6 A;  1HNZ B;  3N2K B;  4CC5 A;  3OE7 G;  2X6C A;  4ZIB A;  2M6Y A;  3VBB A;  4F6E A;  3F5T A;  4LF7 O;  5CA1 B;  2FKX A;  4NXM B;  2N05 A;  1IBM O;  4N21 A;  1COW G;  3ZHV A;  3FB7 C;  4LFC B;  4Z1M G;  5LYJ B;  2ATK C;  2ADP A;  3SDL A;  3OR7 C;  4RUF A;  1MZE A;  1M57 B;  1FXH A;  3B4S A;  3WU2 Z;  3CSX A;  2DJV A;  1PNM A;  5CBH A;  4ZHQ A;  5IJ9 B;  4FLU A;  1CEZ A;  3T1C A;  1F4N A;  3F5W C;  3M7M X;  4I50 B;  2ZM6 O;  5LP6 A;  5A9G A;  1PNL A;  4J10 A;  1DK1 A;  3GWK C;  1F7Y A;  2DWE C;  4PDM A;  2QWR B;  4UFZ A;  4RWU A;  3N2G B;  4ZBM A;  3OTO O;  4JI5 B;  3WB0 A;  3JYC A;  4K8X A;  4O4J A;  4FPP A;  5JVD A;  3H01 A;  4LWS A;  1IBK O;  4UCT A;  4FLZ A;  3EHB B;  4DV6 O;  1YJ9 V;  1RPO A;  4O4H A;  3CRR A;  4CH5 A;  3CMA V;  4B3M B;  4F4L A;  4UUJ C;  3WFV A;  3M99 B;  4XDJ A;  5IWA B;  2Q73 A;  1ZSP A;  5BR8 B;  1IUR A;  2VRZ A;  1YJN V;  2E74 B;  3OTF A;  5FNV A;  2Y48 A;  4O2B B;  2DQ3 A;  4IHJ B;  4WCE V;  2WLL A;  1FS0 G;  4CBC A;  2F1M A;  1ZWI C;  3RYI B;  1N36 B;  4UV9 A;  5IT9 N;  4DR5 B;  2VWJ A;  3K5N A;  3ZX6 A;  2FL4 A;  2CE4 A;  4X20 B;  5J9P C;  1J5E B;  3H1K H;  1SZX A;  1OCC C;  3DC6 A;  4MW3 A;  3B8N A;  3KZI Z;  2H94 A;  1W0K G;  3UT5 A;  1Q82 W;  3HKB B;  1VF6 C;  3DGE A;  4BR6 A;  4IYH A;  4JGS A;  1EN5 A;  3CWB H;  4X65 O;  1F4M A;  3ZRX A;  1LUW A;  1VQ7 V;  4NB5 A;  4I7Z B;  5J2U B;  1M5I A;  1WA8 A;  3CRC A;  2EIN B;  3E8G A;  4NVP A;  1MA1 A;  3HKE A;  4I4T B;  3JAK A;  2YIA A;  1VAR A;  3STZ C;  4UCR A;  1L0N H;  3CC2 V;  3Q4H A;  1FPO A;  3EFF K;  3H1L H;  5ITZ B;  3K5L A;  4TT3 G;  3J80 N;  4RQF A;  2JGD B;  2Q9L A;  1K5Q A;  1TAE A;  1S72 V;  4MVM A;  4JI3 B;  1YIT V;  2Q67 A;  4KXR A;  1GN3 A;  5KX5 B;  2BSK B;  1XNQ B;  4TV8 B;  1M4U A;  1YF2 A;  4RO2 A;  4TV9 A;  3SPJ A;  1TGO A;  3P3P A;  5DN6 G;  1K73 W;  1UPG A;  2VQF B;  5B3S C;  4JV5 B;  5JJN B;  2XAG A;  2WSS G;  3AG4 B;  5EYP A;  1AP5 A;  1OCZ B;  1DLB A;  1Y6X A;  2WAM A;  2WLI B;  2ZQM A;  4CH4 A;  2UU9 B;  5BMV A;  3AEI A;  2P5O A;  1FFX A;  4LFB B;  3ASN B;  1W2B U;  4AI8 A;  4IGG A;  3WB1 A;  2ADQ B;  4ZI7 B;  2QKA A;  4NXN O;  3O65 A;  4NTY A;  1EFR G;  5GTH Z;  1AI5 A;  4X8A A;  4QGP A;  5C8Y A;  1S5J A;  1MAB G;  2CAZ C;  2CDY A;  3E89 A;  2GV9 A;  2QWP B;  4TUY A;  4LF5 O;  1K5S A;  2XT9 A;  4X64 O;  2WA3 A;  4DO2 A;  5LBQ A;  4JI2 B;  3CS5 A;  4H37 A;  4P30 A;  2HJF C;  2Q5Z A;  1MSW D;  1Z2G A;  3MAQ A;  4BW9 A;  1MZF A;  1LNQ A;  1AI7 A;  4B3S O;  4YJ3 A;  1JFF A;  4H33 A;  1CPY A;  3T1Y O;  4X1K A;  1K9M W;  5KAI Z;  4HZ3 A;  4DR1 O;  3CCJ V;  1ZUQ A;  3K59 A;  1I7F A;  4PI0 A;  1Q43 A;  3JAW B;  3FX7 A;  1F51 A;  1SA0 B;  4TWK A;  3QVN A;  4JZG A;  3JD2 A;  4LF6 B;  1Q8I A;  2QWO B;  1I94 O;  3ASO C;  1MMM A;  4FVM A;  2UXB B;  5EC2 C;  3K06 A;  3FAV B;  2DE0 X;  4Q6G A;  1GRJ A;  2UUC O;  1P49 A;  3ZHQ A;  4DW1 A;  2Q7G A;  4LF4 B;  4FLY A;  2Z3Y A;  4KHP B;  4RQE A;  4OX9 O;  3H1H H;  3ETG A;  3WG7 B;  3B2E E;  3OEE G;  1HNW B;  1M56 B;  1VQ9 V;  4JI4 O;  1VQL V;  3QTC A;  2V1D A;  4LR3 A;  1K7D A;  1DTO A;  4X62 B;  3G6E V;  2ZNJ A;  2HP8 A;  3AK3 A;  2WLH A;  3CJH B;  5L3C A;  3JD4 A;  4JI8 O;  3UO3 A;  2EJ7 A;  3RYH A;  2EZP A;  2C2A A;  4PHZ A;  1XNR B;  1WAZ A;  4GLX A;  4BAY A;  4K8Z A;  4XDL A;  5LMN O;  4GUN A;  1QNM A;  5KMG A;  1ZAU A;  4JI0 O;  4IIJ B;  2R72 A;  4QE9 A;  5LHH A;  1NS1 A;  1V55 C;  2A79 B;  3MDS A;  4FFB B;  1XI1 A;  3CCM V;  1RSO B;  3JAT B;  4LC1 A;  1L8D A;  5EBM C;  4JTC B;  2QWQ B;  3CCU V;  3CRM A;  1Q86 W;  1KEC A;  4JZ2 A;  5LXT B;  3TXS A;  1BHB A;  2JJ2 G;  3D8C A;  3OMN B;  4K0K B;  4JI7 O;  3TK1 A;  1WNS A;  4H0L B;  4YIO A;  1XMO B;  3BAA A;  3LNM B;  3K08 A;  2CGN A;  2FB5 A;  1B04 A;  1AR4 A;  5E79 Z;  2GUZ B;  1ZL8 A;  2YXY A;  5LMU O;  1PM9 A;  1M57 C;  2BOC C;  1VQP V;  2WA4 A;  1XDC A;  3DXR B;  1SQB H;  4BIZ A;  3ABT A;  2NR5 A;  4JAV A;  2ZR3 A;  2Y69 B;  1K4C C;  3AG1 B;  1NTM H;  1HR0 O;  1YZB A;  1M93 A;  5HFM A;  1OCR C;  2A7W A;  2YXL A;  1SKV A;  1AVM A;  2ZD9 A;  1K34 A;  3L9D A;  5LHI A;  4B3R O;  2BOB C;  2ETN A;  5CA0 A;  5KA5 A;  2IM9 A;  1K3E A;  1NKD A;  3HKD A;  2XUM A;  5GON B;  1NH2 D;  1PV0 A;  3CCS V;  4WFE A;  5BXZ A;  5IYZ A;  4PDR A;  3BA9 A;  3E22 A;  3LSU A;  4X9Q A;  3CCL V;  1R1B A;  2HR3 A;  4QJF B;  1GH6 A;  2QWN B;  4LH7 A;  1QCE A;  3E2E A;  4HYO A;  3SYC A;  5IYB O;  3G80 A;  3ZMU A;  2Y4U A;  4F6R B;  4JYB A;  4UB8 Z;  5GW7 A;  2Q7H A;  2KG7 A;  1R6T A;  5KHI A;  1H2S B;  4I9Q A;  2F93 B;  1XUQ A;  1IZ3 A;  2RCV A;  4JI6 O;  1S77 D;  2F95 B;  1VQ4 V;  4TSF G;  1Z5W A;  1VQ8 V;  2DW4 A;  4I55 B;  2IJJ A;  3N2G A;  3CHX A;  1X4T A;  4H44 B;  3DC5 A;  2P06 A;  1VQ5 V;  4ASU G;  1H2L A;  1JPX A;  2ZIO A;  2UUB B;  2ITC C;  2ZXW B;  4EEQ A;  1P84 F;  3L73 H;  4MVR A;  3E8B A;  2QJ1 A;  1PNK A;  4WBN B;  2GDS A;  4B7K A;  4DR3 B;  2EIN C;  4GKJ B;  5A2Q N;  2IH3 C;  2LFR A;  1JCH A;  4O2B A;  4IHJ A;  4X1I B;  5LOV B;  2HVJ C;  5HFL A;  2HHH B;  4DRX A;  4NXM O;  4KL1 A;  1YJW V;  4B08 A;  1US6 A;  1MNG A;  4Z1V A;  2X6B A;  4YXW G;  5IDJ A;  5DED A;  3JAR B;  4CS3 A;  3W7X A;  5DM6 V;  3L71 H;  2ARH A;  4YY3 O;  5EZY B;  2A06 H;  4J80 A;  2ODM A;  1RP3 B;  2KSD A;  1J95 A;  3K9S A;  3JAL B;  4AQY O;  3I56 V;  1VQO V;  1XMQ O;  2A3Q A;  2EUL A;  2FML A;  1JJ2 U;  3ABL B;  4JPR A;  3AG4 C;  1OCZ C;  5ITZ A;  2LO1 A;  2DYS B;  3CC7 V;  4LF9 O;  2HVK C;  3ASN C;  5JQG B;  3RFR A;  2HLD G;  2WPD G;  3CYO A;  1FKA O;  1M90 W;  5CB4 A;  3I5D A;  2K1E A;  3KCX A;  2Q4P A;  4DUZ B;  4LCU C;  2QKS A;  2Y4T A;  2ZE5 A;  1FXV A;  1NVP D;  5JH7 A;  5IWA O;  3OMA B;  5BR8 O;  3RYF A;  1E79 G;  2B1I A;  4R8C A;  1GMG A;  1VQK V;  4B3T B;  1GO3 F;  3LDC A;  2CTQ A;  2F4V B;  2WLI A;  5B1B B;  2R9R B;  1KP3 A;  3CCV V;  1VQN V;  3SJC C;  3CRQ A;  4LFA B;  1V54 B;  4PI2 A;  1BL8 A;  1V9P A;  3AG3 B;  4BWA A;  1MG1 A;  3U11 A;  4DK1 A;  4B7E A;  4DR2 B;  3TCU A;  1PP9 H;  2PY5 A;  3CXH F;  1P4R A;  3KCY A;  5IYC O;  1Y76 B;  4FM1 A;  3SJB C;  1FJG O;  1M9N A;  1HW7 A;  1SS3 A;  1HDJ A;  2F66 C;  1KB9 F;  4IYI A;  2KKW A;  3FKS G;  5IYD O;  3ML0 A;  3T4D A;  4X66 O;  3VOU A;  4WF9 V;  4P9O A;  3THO A;  4H13 B;  2XTA A;  4DV1 B;  3D36 C;  3BRC A;  3R65 A;  3VQV A;  1NH2 B;  4KFM A;  4RAI A;  3B77 A;  3WG7 C;  3CX5 F;  1IBL B;  3B40 A;  1NTZ H;  1TUE B;  2LGQ A;  1AJP A;  4DV7 B;  3JAW A;  3ZED A;  5CBG A;  1SA0 A;  1KKC A;  4UV8 A;  3GB7 C;  4NTW A;  4LNU A;  3J7A U;  5D5P A;  3HKC A;  3ZMZ A;  2JS5 A;  5IY5 B;  3RBZ A;  3A0B Z;  3TET A;  1Z5V A;  1WP7 A;  2V4D A;  1SF9 A;  4FLW A;  2VQF O;  2ZNI A;  2QM8 A;  1IDS A;  2UXD B;  3FYI B;  2L35 A;  2WWW A;  3D36 A;  4FMT A;  2OCC B;  2UU9 O;  2QGN A;  2RMK B;  4TQF A;  2CH7 B;  2Q7E A;  2PZS A;  3EVK A;  3P3N A;  3J81 N;  4QNH B;  2E5L O;  2DMX A;  3UQ8 A;  1I5Y A;  3BAB A;  4U7N A;  1YTF D;  2X6A A;  3HB3 B;  3SPG A;  1MOF A;  3K79 A;  1OZ0 A;  2KB1 A;  1NR7 A;  1JJO A;  5KUM A;  3CB2 A;  3K58 A;  1XHX A;  4R6Z A;  2EIM B;  3JD0 A;  3MD0 A;  4G28 B;  2H3O A;  2QKC A;  2IW5 A;  4J11 A;  4PJ0 Z;  3JCU Z;  4IIJ A;  4LF7 B;  4L8J A;  1XOU A;  5B1N A;  1GAX A;  1IBM B;  4FFB A;  1RSO A;  3JAT A;  4E2L A;  2JJ1 G;  1YCI A;  3OFN G;  1K97 A;  3BPZ A;  2Y69 C;  3AG1 C;  1WB8 A;  4YJ2 B;  5LXT A;  1AJN A;  1JA8 A;  5H9C A;  4ABM A;  2EIL B;  1NJI W;  4O4I B;  5L3D A;  1SER A;  3W7S A;  1YEW A;  1IXM A;  4PA4 A;  1OCO B;  4LF6 O;  4O2A B;  1VF6 A;  2B1G A;  1HNX O;  2XOK G;  5F2V O;  1U96 A;  2ZM6 B;  3GVM A;  3T2M A;  5BY1 A;  5LGN A;  2FYU H;  2YSU B;  1QLE B;  1IVS A;  3UKM A;  3CME V;  3JAS A;  1EBO A;  3OD4 A;  3ZMT A;  3K03 A;  1AB3 A;  2BTO A;  3RWR D;  4LF4 O;  4KHP O;  2NLJ C;  1EN4 A;  2VS0 A;  3B09 A;  4DR7 B;  3OTO B;  3WB2 A;  2X0L A;  1SQX H;  1IBK B;  2JEX A;  1ZTE A;  4J9Y B;  4WFG A;  1KQS U;  4DV6 B;  1DGS A;  3DSQ A;  4X1Y A;  5B1A B;  2OIG A;  4G27 B;  5KHH A;  4JI1 B;  2DYR B;  2P4K A;  2UXX A;  4Q20 A;  1SQP H;  4MW8 A;  2XAS A;  2P67 A;  1PL4 A;  1P7G A;  5K1P A;  2WLK A;  3OM3 B;  3TGU H;  2XAQ A;  2Q69 A;  4HNA A;  1NBM G;  1I08 A;  4LH6 A;  2W6I G;  4P9P A;  2UXC O;  4QIW F;  4DXW A;  2ZXW C;  4O4L A;  2D2C B;  3CXC U;  3CCR V;  3OUS A;  1BHA A;  4K0K O;  4F6R A;  5EIB C;  1THZ A;  2HJD A;  3ZCC A;  1KMI Z;  3BHP A;  4X65 B;  2EJR A;  4ZHQ B;  3IAY A;  2BTQ A;  4MVS A;  4DV3 O;  4JYA O;  1UJW B;  5LP6 B;  4GX1 A;  5JCO C;  1N0J A;  2IJH A;  5LGU A;  3K0G A;  4X88 A;  3U0Z A;  3G6B A;  2QR4 A;  4EKW A;  3F7V C;  2F43 G;  1GM9 A;  5CA3 A;  4DV2 O;  1N4C A;  3ZHT A;  4EB6 A;  3ZHR A;  2YS8 A;  3SPI A;  1BQZ A;  4WBN A;  2B9Z A;  1JMK C;  4O4J B;  2CK3 G;  1ARO P;  4LWS B;  4NR1 A;  2IH1 C;  2IJI A;  3SYP A;  3L72 H;  1NR1 A;  1VMG A;  2NNU A;  3ABL C;  4X1I A;  4FLX A;  3ZRS A;  5IJ0 B;  3K3W A;  1TVK A;  4IL6 Z;  2WLN A;  1I0H A;  1H2K A;  2DYS C;  4FK5 C;  3BCC H;  1HWY A;  1KKD A;  4FZ0 A;  5FNV B;  5J2T B;  2OTL V;  3B8M A;  3ABU A;  2WLL B;  1QU7 A;  4JF3 A;  3JAR A;  2DQ0 A;  2WLJ A;  4I0X B;  2DN9 A;  1BMF G;  1LR1 A;  2H8P C;  2VQE O;  1N32 O;  3SJA C;  4NXN B;  3FYE B;  1EN6 A;  4UVC A;  2ZE7 A;  2NN4 A;  3UM7 A;  2YID A;  4CH6 A;  4RUE A;  5B1B C;  1SQG A;  1Y67 A;  3ABK B;  4BW5 A;  4MSW C;  2Q0A A;  1Q81 W;  4X64 B;  1KD1 W;  1V54 C;  1BCC H;  3OUF A;  1SZT A;  3RVZ A;  2QTS A;  1B6Q A;  1VF5 B;  3AG3 C;  5FPR A;  4UCU A;  3F7Y C;  3K0D A;  4DUY O;  3ZHU A;  3IGA C;  4B3S B;  2UXN A;  3R66 A;  3ABM B;  3RYC A;  3W7W A;  4PEL A;  1QBZ A;  1XL4 A;  4AIL C;  3LNN A;  4DR3 O;  2PGG A;  5EBL C;  2QEX V;  1G4Y B;  2XAH A;  4UCS A;  4DR1 B;  3BEH A;  3VQW A;  4PA6 A;  4TOI A;  3W7U A;  1VP7 A;  2HHH O;  2LGW A;  3N2K A;  3K57 A;  1L1F A;  4DV0 O;  4HBN A;  2GHY A;  4TV9 B;  1YIJ V;  2Z5U A;  2QDO A;  2P6J A;  1FAF A;  5TIS Z;  5CA1 A;  4YHH O;  3ETD A;  2YIB D;  2R9I A;  2YIB A;  2GSM B;  5BMV B;  5LYJ A;  2IJK A;  1U97 A;  4GX2 A;  4HAM A;  4OX9 B;  1Y76 A;  2R9A A;  4JTA B;  4UB6 Z;  1RFY A;  1EZV H;  2UUA B;  5IY5 C;  1GM8 A;  3ZRW B;  2Q0O C;  2GTA A;  1Q7Y W;  4DV5 B;  1AJQ A;  4JI4 B;  1R6K A;  5IJ9 A;  4TQD A;  3FFQ A;  1K8A W;  5BZB A;  1GM7 A;  4I50 A;  4MS2 A;  2OCC C;  2K9P A;  3BFR A;  4GKK O;  3STL C;  4TUY B;  2HKO A;  3SYA A;  1JOY A;  1AR1 B;  1D5A A;  5LMN B;  4JI0 B;  3APQ A;  2LQT A;  3P32 A;  4DR4 B;  4DUZ O;  3A0H Z;  4YJ3 B;  5KHJ A;  1JFF B;  3LSQ A;  1JX9 A;  5B66 Z;  4FM2 A;  4X1K B;  1E1Q G;  1N33 O;  1KBH A;  2EIM C;  3W7T A;  1N34 B;  1ORQ C;  2XND G;  4JI7 B;  3D3Q A;  4B3T O;  2PTM A;  1A32 A;  1HNZ O;  4KUM A;  3ZIA G;  1BS3 A;  2ZKO A;  4LF8 B;  2CH7 A;  2GBO A;  4NKG B;  2IBZ H;  3APO A;  4LFA O;  5L3E A;  1W0J G;  4OPA A;  4QPJ A;  2Y0I A;  3RYI A;  2ZT9 B;  5LMU B;  4DK0 A;  2EIL C;  1E1R G;  4X20 A;  3ZJZ A;  4LFC O;  2ZDI C;  2PYL A;  2QM7 A;  1QVG U;  2QM4 A;  1OCO C;  3JD1 A;  3AG2 B;  3HKB A;  3BVO A;  4D7T A;  1YDX A;  4QE7 A;  2PYJ A;  1XL6 A;  2RDC A;  1QLE C;  1YSC A;  1HR0 B;  4CZZ A;  1D2D A;  3KKY A;  1O9G A;  2HEP A;  2YIC A;  3AG7 A;  4NTX A;  2W6J G;  5J2U A;  2ZCE A;  3PJS K;  2PI4 A;  4I4T A;  5LGT A;  4I5S A;  3RYH B;  1BGY H;  4B3R B;  2F23 A;  1I5X A;  2E3C A;  1G8M A;  4UVA A;  3IJ4 A;  1AP6 A;  1G6U A;  2O57 A;  5JJE B;  4E4E A;  4GCZ A;  4X89 A;  4GT1 A;  4YJ2 A;  5KMG B;  1AI4 A;  4DV4 B;  1Q90 D;  4N23 A;  5L3G A;  5FLX N;  5B1A C;  4JI5 O;  1P7B A;  4FJC C;  2JGD A;  2DYR C;  2RQ6 A;  3A2F A;  4MVZ A;  5KX5 A;  1XRE A;  2BSK A;  3LSS A;  5H6Q A;  3ETE A;  4B3M O;  4KP4 A;  4TV8 A;  4ICG A;  4DR6 B;  2CUG A;  4J41 A;  2RJZ A;  1BT8 A;  4C7U A;  2CTP A;  2ZR2 A;  3OGC C;  4LBE C;  4U3J B;  3SPC A;  1O9H A;  1N36 O;  3S3X A;  4DR5 O;  2YEV B;  1FXK B;  2CTW A;  1NU1 H;  1FYJ A;  1GN2 A;  1J5E O;  2P7T C;  4ZI7 A;  3MHS C;  3ZHS A;  1H8H G;  5B1O A;  2Z0A A;  5LP6 C;  3OR6 C;  3SYQ A;  2HG5 C;  2KQX A;  2XAJ A;  3K5O A;  3CRA A;  1H2G A;  1QQC A;  1WLE A;  4ZKI A;  1BSM A;  3X2Q B;  2CTR A;  5CA0 B;  2Y0P A;  3MHH C;  1GKF A;  3HKD B;  4OGQ B;  5FPO A;  3ZS8 C;  1H38 A;  5IYZ B;  1S5L Z;  3E22 B;  2JVD A;  2ZIM A;  1JR9 A;  4GZR B;  4YY3 B;  1M56 C;  1KYO F;  1W59 A;  2XAF A;  1WB7 A;  4JI3 O;  1Q6H A;  1G1X B;  1F23 A;  3T1H B;  1R3L C;  1XNQ O;  4AQY B;  3HPL C;  1R73 A;  1XMQ B;  5KUK A;  2KG7 B;  3OT7 A;  1ZX3 A;  1OCR B;  2Q68 A;  1OJH A;  2R70 A;  1JQ0 A;  1SQQ H;  5B5E Z;  3QF7 A;  4LF9 B;  1URF A;  3FAV A;  2E76 B;  4JV5 O;  2V7Q G;  1YHQ V;  1QLN A;  4DR7 O;  1Y66 A;  4PDL A;  2WLM A;  4PA9 A;  3T4Z A;  4LFB O;  5JWP A;  3K5M A;  3CEI A;  3CD6 V;  5H2F Z;  1FFT B;  1SRY A;  2QSA A;  2W0F C;  4K3A A;  4JI1 O;  3G71 V;  3JAM N;  5IJ0 A;  1N8R W;  3ABK C;  4CS2 A;  2OYQ A;  2HFE C;  1S3J A;  1Q3E A;  4WFA V;  3CJH A;  5J2T A;  3SJQ C;  3ZN1 A;  4UVB A;  4J7J A;  4DRX B;  2A0L A;  3L75 H;  4GYC B;  3RVY A;  4I0X A;  5KLV H;  5CMU A;  4JI2 O;  3ABM C;  3PN1 A;  1NZ6 A;  3N27 A;  4FM0 A;  3BY6 A;  3ZN0 A;  3H1I H;  1VIB A;  5H5N A;  1AIL A;  2A9H A;  5CBF A;  1Y74 B;  1X59 A;  2G38 A;  1FJG B;  2ZE6 A;  1EM1 A;  3IC7 A;  4J42 A;  2QA4 V;  3OAA G;  2AZ0 A;  4X66 B;  4XBF A;  3BA8 A;  3E83 A;  4MT8 A;  2AHY A;  4ZOL B;  1RM1 B;  3FD9 A;  2FTK A;  2GUZ A;  2VWK A;  2UXB O;  1NQT A;  2LW7 A;  4CS4 A;  2GTS A;  1SET A;  4DW0 A;  2E75 B;  2DOS A;  1BQ0 A;  1QR8 A;  3JSL A;  3ZRV A;  3L74 H;  2EIJ B;  3DXR A;  4OXS A;  5CB4 B;  1TUB B;  1HNW O;  1XIL A;  1ZLZ A;  3O9O A;  1MSD A;  2ZIN A;  5JH7 B;  1NVP B;  3QO8 A;  3S3W A;  1NT2 B;  4U7O A;  3RYF B;  4X62 O;  1H2N A;  5LA6 B;  1S76 D;  1XNR O;  3OEH G;  4J9Z B;  1GTO A;  4UXN A;  4QPK A;  1ROP A;  1Q6I A;  4I9W A;  3SPH A;  5GON A;  1VQ6 V;  3LDD A;  1KU9 A;  3H1J H;  1WPB A;  1KC8 W;  3LDE A;  5CN0 A;  1QR9 A;  2AHZ A;  2E5L B;  2LFS A;  3ZRW A;  2AGA A;  1K4D C;  2M7W A;  2OTJ V;  4WFH A;  1SES A;  2OWO A;  3DTU B;  3CPW U;  2PF4 E;  4MTX A;  2ILM A;  5K1X A;  2JIZ G;  4EFB A;  4FLV A;  1XMO O;  1YI2 V;  1TA8 A;  2EIK B;  1R6N A;  1PD3 A;  4PA3 A;  4I55 A;  2EBO A;  4U3F H;  4MTO A;  5GTI Z;  5KAF Z;  2YXH A;  3P30 A;  1K33 A;  3AG2 C;  4CH3 A;  1XBL A;  4WFB V;  2JEU A;  4FZ1 A;  4JAA A;  2BE3 A;  1H2M A;  1UFI A;  2AZ2 A;  5DEC A;  4Z2W A;  4FIP C;  4AHC A;  2OT5 A;  1IXB A;  5JVD B;  2MK3 A;  2AXT Z;  1T5E A;  2LP7 A;  3KG2 A;  4LNU B;  3CC4 V;  3HKC B;  1Q5O A;  4JAS A;  5EIB D;  3SYO A;  1HNX B;  5LHG A;  1GN6 A;  4O4H B;  2L6L A;  2IU3 A;  1XEQ A;  3K9A A;  5LOV A;  4UCV A;  1PPJ H;  1FD9 A;  5JCO A;  4W4L A;  1AR5 A;  3UCS C;  3QG5 A;  4D6T H;  3H9V A;  2P90 A;  3RN4 A;  3GWO A;  2N74 A;  3SR2 C;  5LL6 Y;  2UUA O;  1SC5 B;  3G67 A;  5EZY A;  4DV5 O;  1YTF B;  5H6R A;  2B5U A;  3G4S V;  1WPX A;  1JVM A;  5D5Q A;  1Q6U A;  3JAL A;  3UT5 B;  4XDK A;  3NR7 A;  2CGO A;  4R50 A;  3RT3 C;  1WJZ A;  1IX9 A;  2BCC H;  1WA8 B;  1FXK C;  4UCO A;  4LF5 B;  3HKE B;  1B06 A;  4MVQ A;  5JQG A;  3JAK B;  3CCE V;  4DR4 O;  2UXC B;  3Q4H B;  4BIU A;  1K92 A;  2JDI G;  1Y4M A;  1ENV A;  3SGI A;  1SQF A;  1GN4 A;  2EZO A;  1N34 O;  1NI8 A;  2UUB O;  4K35 A;  1WP8 A;  1R3K C;  4GX0 A;  1OCC B;  3T1Y B;  2PI5 A;  4PV1 B;  3NXS A;  4GKJ O;  4EFE A;  1B3Q A;  1R3I C;  5C93 A;  4DV3 B;  4FFK A;  1PL0 A;  3X2Q C;  4JYA B;  4LF8 O;  3E35 A;  3LUT B;  4U3J A;  3OGI B;  2JK5 C;  4DYL A;  4MVU A;  1RPR A;  4BIO A;  1CXZ B;  4PA7 A;  2OCH A;  1YXB A;  1OHH G;  2EX3 A;  2QE7 G;  3JAS B;  3HR0 A;  3U10 A;  1I94 B;  1HP8 A;  3OW2 U;  2YEV A;  1FXK A;  1CP9 A;  4MTF A;  4JTD B;  3TXQ A;  2DWD C;  4D7S A;  4DV2 B;  3FB6 C;  2LJ2 A;  2UUC B;  2P22 C;  2Q8V A;  5EYP B;  3ETQ A;  4NYK A;  5KHK A;  3FB5 C;  1N0N A;  3ZMS A;  1FFX B;  1OV9 A;  4X1Y B;  3CP1 A;  3E8F A;  2JGU A;  3A8T A;  1EZJ A;  3C3S A;  4WFF A;  3E8H A;  4YIP A;  3AK2 A;  1QHT A;  4GX5 A;  5C8Y B;  4OPH A;  2YDE A;  4MTG A;  4JI8 B;  3JCZ A;  4HNA B;  4DV4 O;  2YUA A;  1M1K W;  1KUQ A;  4O4L B;  5B3S B;  2VQE B;  1N32 B;  1QVF U;  3CCQ V;  2ZE8 A;  5IE9 A;  3K04 A;  2N04 A;  2RN9 A;  1D5N A;  3ZMV A;  5EK0 A;  2PUS A;  4DR6 O;  1YVW A;  5E1A C;  2JRI A;  5KA6 A;  3TJT A;  2BTQ B;  4PDV A;  4MVO A;  5JJJ B;  1VQM V;  3IC9 A;  2YI9 A;  2JS3 A; 
#chains in the Genus database with same CATH homology
 4NXN O;  1N34 O;  1AIL A;  2UUB O;  2F4V O;  3O65 A;  1X59 A;  4LF9 O;  4YHH O;  1AB3 A;  4LF4 O;  5LMN O;  3J7A U;  4GKJ O;  1D2D A;  4KHP O;  5IT9 N;  4JI0 O;  1FKA O;  1NS1 A;  1R6T A;  4LF8 O;  2VQF O;  4JI6 O;  4LF5 O;  4DR2 O;  4X64 O;  3F5T A;  4JI3 O;  4LF7 O;  1G1X B;  2UU9 O;  2FKX A;  2UXB O;  2LW7 A;  4JI7 O;  1XNQ O;  5IWA O;  4X65 O;  5BR8 O;  1IBM O;  2DOS A;  3J81 N;  2E5L O;  1XEQ A;  5FLX N;  2VQE O;  4B3S O;  1N32 O;  4JI5 O;  4GKK O;  3SDL A;  3T1Y O;  4DV1 O;  1HNW O;  4DR1 O;  3M8A A;  2DJV A;  4JV5 O;  4B3M O;  4DR7 O;  5LMU O;  4A5U B;  5A2Q N;  2UXC O;  4X62 O;  2N74 A;  1IBL O;  5LL6 Y;  2UUA O;  2ZM6 O;  4LFB O;  4DUZ O;  4OPH A;  1I94 O;  3J80 N;  4DV5 O;  3T1H O;  1DK1 A;  4NXM O;  4DV7 O;  4K0K O;  4JI1 O;  1XNR O;  1N33 O;  1F7Y A;  3JAM N;  1FJG O;  4DV4 O;  1HR0 O;  2UUC O;  4B3T O;  1YZB A;  1N36 O;  4DUY O;  4DR5 O;  4DV3 O;  3RT3 C;  1KUQ A;  4JYA O;  1FYJ A;  1A32 A;  1HNZ O;  1J5E O;  3R66 A;  3OTO O;  4X66 O;  4OX9 O;  2AGA A;  4YY3 O;  2ZKO A;  1IBK O;  4B3R O;  2UXD O;  4DR3 O;  4DV6 O;  4LFA O;  4OPA A;  4JI2 O;  2Z0A A;  4JI4 O;  4DR6 O;  5BXZ A;  2JRI A;  4AQY O;  4DR4 O;  4LF6 O;  1HNX O;  1R1B A;  4DV2 O;  1XMO O;  2HHH O;  1XMQ O;  4LFC O;  5H5N A;  5BY1 A;  4DV0 O;  4JI8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...