3L72H

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l72H00
1SQXH 1L0NH 2A06H 3H1KH 1BCCH 3BCCH 1NTKH 1PPJH 4PD4F 1KYOF 1BGYH 1P84F 3L72H 3CX5F 1SQBH 2IBZH 1SQVH 3L74H 1NU1H 1EZVH 3H1LH 2BCCH 2FYUH 4U3FH 1PP9H 3H1HH 3L75H 3CXHF 1BE3H 3H1JH 1SQPH 3L70H 4D6TH 3L71H 3TGUH 3H1IH 3CWBH 1L0LH 3L73H 5KLVH 1SQQH 1NTZH 1KB9F 1NTMH
chains in the Genus database with same CATH superfamily
1QQCA 3HKEA 1M1KW 2E74B 1VQ6V 4UCOA 3DTUB 1BHAA 2IBZH 4JZGA 4TSFG 4X62B 1S77D 1P7BA 1YF2A 4I9QA 5IJ9A 2EIMC 3I56V 3CEIA 2H3OA 1XL4A 4HAMA 4QNHB 1HR0B 1TUBA 2AW9A 1FKAO 1OCZB 1FJGB 2JEUA 1FYJA 3L75H 2RQ6A 2R72A 4J7ZA 2Q4PA 2LO1A 1S5JA 2O57A 1NBMG 3SPIA 3OTOO 3OMAB 2E5LB 3UT5A 1MNGA 3N2KA 4NTWA 4PJ0Z 5LHHA 4X1IB 3LDEA 1QNMA 1IBMO 2H94A 1HNWO 1FAFA 2ZM6B 3RBZA 4UV8A 2DJVA 5EIBC 2OTLV 5CBGA 4YY3B 1FXKA 4X65B 2CTWA 3THOA 4PDLA 3F5WC 4FIPC 2DYSB 2YXHA 5LXTA 2D2CB 2P22C 4DK0A 1W59A 3OT7A 2NLJC 4ZOLA 4UCUA 4F6EA 4X20B 2PTMA 1NR1A 4I55A 3B8NA 4MTXA 1XMOB 4GCZA 4FLWA 3D3IA 1NR7A 1XQ8A 1THZA 2Y4TA 4AQYO 2PGGA 3RVZA 1IURA 4AILC 2IJHA 1M4UA 4LF8O 2CK3G 4JI1O 2XHBA 3JATA 2DWDC 2Q6AA 4U3JA 2YSUB 4J10A 1M5IA 2IH3C 3ZRSA 4TOIA 3SR2C 1PNKA 2DE0X 1AP6A 2EZOA 4JAVA 4X64B 2ZXWB 1V54B 4LF5O 5B5EZ 5GW7A 2VQEB 4ZKIA 2IH1C 3W7XA 3K5LA 2PI4A 1ZAUA 3E8HA 1JVMA 2DYSC 1AB3A 3ZRWA 4DV7O 4CZZA 2ITCC 4DV3O 2BTOA 1G4YB 5ITZA 1ZSPA 4BAYA 1F51A 1S5HC 4K0KB 4H13B 2DQ3A 4B3MO 3LSUA 1K34A 2RNBA 2JGDA 2RCVA 2YICA 2CAZC 2WAMA 3N2KB 3CC2V 5BY1A 3T4ZA 3IAYA 3SPCA 1YIJV 3CYOA 1YITV 4X89A 3PJSK 3CCMV 2M6YA 2HFEC 4LF4B 1K92A 3STLC 4BW9A 2XUMA 4DR6B 2UXXA 3AK1A 1AJQA 3TGUH 2IM9A 1FXKB 3LSSA 4DV1B 4P30A 2ZXWC 3L73H 2Y4UA 2P4VA 1DGSA 2LFRA 5LXTB 3NR7A 4DR2B 3FKSG 4WFAV 3DGEA 3LDCA 3NXSA 4MW8A 1E79G 2BSKB 5CA3A 1B06A 3VQVA 4I55B 2GV9A 2XTAA 3KCYA 3LUTB 4I9WA 2W6IG 4PA4A 1W2BU 1QLNA 3AG3B 1EN4A 3KZIZ 4GKJO 2JIZG 4X8AA 3ASNB 1PPJH 1URFA 1WP8A 3M8AA 5FPOA 1US6A 1J5EO 4JAUA 4GKKO 4K3AA 1KC8W 4JASA 1QLEB 4QPJA 4JI5B 2YDEA 4DUZO 1AR1B 4OPAA 2EILB 2QM7A 1DTOA 2Q5ZA 1HP8A 1N34B 3EHBB 4LF9O 5H5NA 2CTRA 2FB5A 3QG5A 2Y0IA 1XMQB 2WSSG 4UCSA 3UO3A 2FKXA 1FXKC 3M99B 1IXBA 3ZRWB 2QWRB 4ZBMA 1I5YA 4DR3O 4DRXA 4GX0A 3WB0A 2YI8A 5IYBO 3HKCB 5KA6A 2ZDIA 1ROPA 4P9PA 4B3TO 3RYHB 3H1KH 1H2KA 2BE3A 2Q73A 3AG3C 2EJRA 5L3FA 5LBQA 2JGDB 4NYKA 1Q6UA 3ASNC 4DV2B 3TCUA 3SGIA 4NTXA 2WA3A 2LGWA 3CCEV 3APOA 5JJJB 4U7NA 2IJKA 2WLNA 3FYIB 3KCXA 4FMTA 4G27B 1W0JG 1QLEC 2X6AA 2WLLA 1AI7A 2XAQA 4U7OA 4QIWF 2UXDB 4Q6GA 4EB6B 5JH7A 2YI9A 1Q43A 4K35A 2Y69B 4DV5O 1K73W 4YJ2B 5KAFZ 5A9GA 4DR4O 4JI6O 3FB6C 4TUYA 3RW0A 4LF6B 1QVGU 5FL7G 4RO2A 5BR8O 2QDOA 3K03A 1R6TA 3H01A 1Y74A 4OXSA 1N33O 5KLVH 1H2NA 1FD9A 2GUZB 4PA3A 3T1YO 2FTKA 4UVBA 2YUAA 3BVOA 1F23A 3ZRXA 5CA1B 4PHZA 2EJ7A 4KFMA 3O9OA 1XNQO 4PV1B 3MHHC 3JAWB 3B77A 4MTGA 3A8TA 3K57A 2FL4A 1H2GA 4GX5A 4IYHA 5KUKA 2ARHA 5KHJA 3C3TA 4O4HA 3ZHRA 4JI7O 3BRCA 1HNXO 1WNSA 4ICGA 3ZMVA 4TV8B 3T1HB 1IBKB 4QGPA 2Y69C 5EBLC 1QR9A 2ZT9B 3WB2A 3BAAA 5H9CA 3K5MA 3IC9A 5C93A 2GSMB 4NR1A 4KXRA 3ZHUA 2UU9O 3CE2A 1MA1A 1PM9A 4OGQB 4ZI7B 3LDDA 4UFZA 1S3JA 2F4VB 4CC6A 5JJNB 3QF7A 1IBLB 3CCJV 2UXBB 2HG5C 3K3WA 2BTQB 2YEVA 3WB1A 5A2QN 3K04A 5L3GA 4ZHQB 4CBCA 5LHIA 1OCOC 4KHPB 4LFBO 3UQ8A 2QWNB 2CUGA 4O4LA 1FS0G 4L87A 1NZ6A 2WLMA 2HVKC 2EIKB 1XOUA 4FFBA 2X0LA 2A3QA 3B2EE 3UO2A 4MVUA 1RFYA 3K5NA 3E8BA 4LF7O 1HNZO 1RPRA 2EINB 3X2QB 1NS1A 4LWSA 1Y67A 1Y74B 4L8JA 3S3WA 4LFAB 3OUFA 2XNDG 3R65A 2UXCO 3W7WA 3H1LH 1BSMA 5J2TA 1BZKA 2ZDIC 3CCUV 1R6KA 5KMGA 2K1EA 1Y76B 5L3CA 5E79Z 2HHHB 5B3SB 4MVQA 2QKCA 3GWOA 1N36B 1RM1B 4OPHA 4LBEC 3ZHQA 2E75B 4J9ZB 1MABG 1SZTA 4LNUB 5IWAO 3J81N 1XDCA 1O9GA 1XBLA 3MHSC 2QE7G 5L3EA 1VQPV 1HDJA 2VQFO 1WJZA 3DC5A 2JVDA 1I08A 3LNNA 5EK0A 1L8DA 2W0XA 1K33A 3D36A 3K5OA 5GONA 1BT8A 2DOSA 4X1KB 3UM7A 3KG2A 2W0FC 1QCEA 4NXMB 1MZFA 1Q5OA 2EINC 3X2QC 1VQ7V 2AGAA 4FPPA 4X1YA 5LYJB 1NU1H 1G8MA 1LR1A 3ABLB 2EX3A 1KKDA 1U96A 1BMFG 3L71H 4H0LB 3RYCA 1NTZH 1KP2A 2JJ2G 1OCCB 2VWKA 4KL1A 5B3SC 1YSCA 5IT9N 3W7UA 1RM1C 1K3EA 3JASB 4E4EA 3CCLV 1S76D 1EZVH 3CC4V 1Z5WA 4GT1A 3OFNG 1ORQC 4AHCA 4O4LB 4CH6A 1XNRB 2AXTZ 1I94B 4KUMA 4R50A 5L3BA 1I7FA 4X20A 3N2GA 5IYZB 1GO3F 4FFBB 5DECA 4DO2A 4DW1A 4DR5O 4YHHO 4UUJC 1B6QA 4EKWA 1UJWB 1SQBH 3M7MX 1P7GA 2AZ0A 4R8CA 5CB4B 5E1AC 3AG4B 5KAIZ 3VQWA 4RQEA 1I0HA 4I4TA 4PA7A 3ABLC 2WLHA 1R3LC 2V7QG 4I50B 1Y6XA 4B7KA 4NB5A 3E35A 2NN4A 4X88A 3ZEDA 3J7AU 2JJ1G 1OCCC 5D5QA 4UCRA 3VOUA 2XAGA 2FYUH 3HB3B 3H1HH 4JPRA 4X62O 4FVMA 4X66B 1WB8A 3JD3A 2JS3A 1ZX3A 1ZL8B 1WB7A 1OV9A 1K9MW 2YIBD 1H8EG 4CS2A 1SESA 5JQGB 1CEZA 3WFVA 1OCRB 5GONB 2CTPA 3CD6V 3CRRA 3P3PA 4I7ZB 2DMXA 1V9PA 3FAVA 2F1MA 4PI2A 4GYCB 4X1YB 3AG4C 3ZJZA 1CP9A 3ZBHA 1XEQA 2E5LO 4FJCC 2GBOA 3RYCB 4JI2B 1P84F 3B09A 2ZM6O 1V55B 2XAJA 2YXLA 3OTOB 1JFFB 4ABMA 4X65O 3TK1A 2UUAB 2X6BA 3BA8A 1GM8A 3OAAG 4J80A 2HKOA 3QO5A 1GM7A 1NQTA 1NTMH 5KA5A 4RAIA 4QPKA 2Y0PA 4O4JA 2BSKA 1BQ0A 3N2GB 3A0RA 3D36C 1OCRC 2Q68A 4HNAB 5EZYA 3OGCC 4UV9A 3CMAV 2HJFC 1SQFA 1K5SA 3K0DA 1RSOB 5BXZA 1OCZC 1WN7A 2QTSA 1ZTEA 3E22A 1KB9F 1SQXH 4I4TB 2P06A 1KBHA 1IXMA 2KG7B 1SKVA 3VQXA 4BIOA 3U10A 1IVSA 3JCZA 3QTCA 1LUWA 1D5AA 5FNVA 4DV0B 3AG7A 4JTAB 4AQYB 1K8AW 1V55C 2XT9A 3F7VC 2VQEO 2C2AA 5LOVB 3G71V 1JA8A 3OEEG 1W0KG 2LGQA 4MT8A 2CH7B 4AI8A 2XAHA 3L72H 3ABKB 4MS2A 3G4SV 4FM1A 4DV4O 1K5QA 4U3FH 3FFQA 1L1FA 1PV0A 4LF5B 3HKCA 1VF6A 2JGUA 5C8YB 5KHKA 3RFRA 3AG1B 1D2DA 1SETA 4K0KO 3RYHA 3FAVB 4J7KA 3BHPA 4CS4A 4YXWG 3CCQV 1KYOF 3RWRD 3J80N 1T5EA 5BZBA 2W6JG 3JYCA 4UB8Z 3G6EV 1F4MA 2DWEC 4LF4O 4B3MB 4IIJA 2Y48A 5J9PC 4EB6A 1JQ0A 2Q67A 4Z1VA 4DV1O 4YJ2A 1TA8A 1V54C 4CH4A 5GTHZ 4UB6Z 3K06A 4DK1A 4DR2O 5B1BB 4LFCB 4O4JB 2QM4A 4P9OA 3ABKC 3JD4A 4JI8B 4BIZA 1JCHA 4DR1B 2GUZA 5EZYB 1L0LH 3BA9A 3P3NA 4R7CA 3AG1C 5CA1A 3JD0A 5LHGA 5LGUA 4RQFA 3IGAC 1BGYH 4PA6A 3E22B 2ADQB 2AZ2A 3JAWA 1SF9A 1N0NA 1VEWA 1JOYA 1JMKC 1IX9A 1AJPA 3ZMZA 3JCUZ 5J2UA 5FNVB 1PNLA 2WA4A 1N8RW 1N34O 4JTCB 1XMQO 1D5NA 3CB2A 1NTKH 4TV8A 5IY5B 1B04A 3WG7B 1GKFA 1X59A 2YIDA 2Q69A 4LF9B 2IU0A 4UCVA 3DXRA 2L35A 3BPZA 3G6BA 2PYJA 4ZI7A 3ZN0A 4IT5A 4WFEA 2WLIA 1BS3A 4YIOA 1VQ5V 1QU7A 1MSDA 2QWQB 3CRCA 4DR7B 2BTQA 5LGNA 5KHHA 4O2AB 2P5OA 3Q4HB 3EXAA 4WFBV 4UVCA 4ZHQA 3TETA 4HZ3A 3ZCCA 2HJDA 1TVKB 2XOKG 1P49A 2IW5A 3QVNA 4X9QA 5DEDA 3T1CA 5HFMA 1Z2GA 2P7TC 1XHZA 4IIJB 2E76B 1PKXA 2EILC 3BFRA 1SRYA 4DV6O 1J95A 3RYFB 1NT2B 3ETGA 2Q7EA 3IJ4A 4YJ3A 1QHTA 1N32B 3WU2Z 3OR7C 4PA9A 4LF6O 2EIJB 3WG7C 1VQLV 1PNMA 3TXQA 2OYQA 1F4NA 4JI4O 2V1DA 5BMVB 1CXZB 2OT5A 4WBNB 4BW5A 4DR4B 4JI6B 1VF6C 3T4DA 1U97A 2L6LA 2WPDG 3SJCC 3FB5C 4GZRB 4I0XB 2ZKOA 4LP8A 1QVFU 1Y76A 2JS5A 2F66C 3AK2A 4F4LA 3PN1A 1N33B 4LNUA 1AILA 4DW0A 4MVMA 1TGOA 5J2UB 2HP8A 1M56B 3JARB 1XNQB 4C7UA 2CTQA 1IBKO 4H37A 2HVJC 3S3XA 3OUSA 3GVMA 5FPRA 2Z5UA 4JYBA 4X1KA 2AHZA 1GRJA 2EIJC 1HNXB 2M7WA 4IHJA 3DXRB 1Y4MA 5LYJA 3ZHSA 4XDJA 1KD1W 2F4VO 3CXCU 3ICXA 1VQ4V 1PP9H 2WLIB 3OW2U 2N74A 1IBLO 4FLXA 3UCSC 4JYCA 1BE3H 1YVWA 1ZUQA 3CP1A 3KKYA 2UXBO 3SYPA 4MVSA 2ODMA 3E8FA 5EC1C 1YDXA 3QNEA 3F7YC 1PL4A 1WLEA 4KHPO 3JASA 4O2BA 1TAEA 4JGSA 4JV5B 2NNUA 1N4CA 3SJQC 4BWAA 1WPBA 1VQ9V 3APQA 5IJ0A 1M56C 2ZR2A 2IU3A 2UUBB 1X4TA 2A9HA 1ENVA 2HR3A 4YJ3B 5IYZA 3OM3B 3E2EA 1BCCH 1FFXB 5CB4A 1KMIZ 4KP4A 4TQDA 3ZMUA 5CN0A 1DF4A 2YIBA 4RUFA 1SQVH 2A0LA 4B7EA 3MDSA 5DM6V 1Q81W 2VS0A 4WF9V 2Q7GA 4B3RO 4GLXA 3O65A 4I50A 5FLXN 2ZE7A 1R3KC 1SQQH 2ETNA 4NKGB 5HFLA 1N36O 4A5UB 2FMLA 4HYOA 3CC7V 1XI1A 2A79B 2NR5A 2OTJV 3RYIB 1Q90D 5KX5B 1ZL8A 1GAXA 3A0HZ 4LR3A 2UUCB 2GHYA 4W4LA 1RP3B 3W7TA 5JQGA 1XUQA 4F6RB 3HPLC 3K0GA 3P32A 2EIKC 1SZXA 4JYAB 1E1QG 5CBFA 4Z1MG 1VARA 5LP6B 5IWAB 5B1AB 2OCCB 5H6QA 4NXMO 1YHQV 4IHJB 2VQFB 2E3CA 3CSXA 3GB7C 1K4DC 1YEWA 2ZE5A 5AG2A 2B9ZA 4J42A 4K8XA 5B1OA 4FLVA 2PUSA 5IYDO 4W4KA 1YTFD 1M90W 1JFFA 2JK5C 1H2MA 4O2BB 5KHIA 4O4IA 3U0ZA 4OX9O 1AR4A 4DUYB 4JAAA 3SDLA 2LW7A 3JALB 3C90A 2A7WA 4MVZA 5IJ0B 4B08A 1SQPH 1E1RG 3B4SA 1XNRO 3ZN1A 4B3SO 1GH6A 1DF5A 1RPOA 3B40A 1I94O 2B1IA 2QTOA 4HNAA 5LP6C 5TISZ 1GN3A 2P90A 1RSOA 2OCCC 2JEXA 5LMUB 3CRAA 2UXNA 3K08A 3CJHA 4FK5C 1AROP 3B8MA 2N05A 2R9AA 5K1PA 2EZPA 1R1BA 1NI8A 1R3IC 2KG7A 2QSAA 1WAZA 2KB1A 4DR5B 4YHHB 1GN2A 3E8GA 2Q0AA 2Q8VA 2QWOB 4J9YB 1B3QA 4NXNO 1S0VA 5LMNB 3SYAA 1IDSA 4UCTA 2QGNA 3CRMA 3W7SA 2DQ0A 4JI0B 4JI3B 1VF7A 4TV9A 1AVMA 5LOVA 4LH7A 1QBZA 3DSQA 1VIBA 4FLUA 2CH7A 1G6UA 5EYPB 1UPGA 1HR0O 1FXHA 3SYQA 3SPJA 3SJBC 3ZX6A 2CGOA 1UFIA 5C8YA 4FLZA 2QEXV 1FJGO 2QJ1A 1Q6IA 1K4CC 3I55V 2QR4A 1KECA 4D6TH 2B5UA 5CMUA 3A0BZ 1MMMA 2DW4A 4TT3G 3OGIB 3D3QA 3CCRV 1L0NH 4Z2WA 5JVDA 4WCEV 4QE7A 4JI2O 3K9AA 5CA0A 5IDJA 1SQGA 5EIBD 1VQ8V 2MK3A 3BABA 3JAKA 3L70H 1VQMV 4YY3O 1H2SB 4O4IB 1H2LA 2R9RB 1Q3EA 2UUAO 1SERA 2HEPA 2R70A 2A06H 2XASA 4PDMA 2EULA 1IBMB 2B1GA 1HNWB 4Q20A 1HW7A 2ITDC 1K7DA 1AI5A 4FZ1A 4JTDB 2VRZA 1XMOO 1COWG 4G28B 1YJ9V 4N21A 3CJHB 2XAFA 4G2KA 3HKBB 1Z5VA 1VP7A 5JCOA 3BCCH 2QKSA 4GX2A 1BHBA 3OR6C 3FX7A 4QE9A 3ZMTA 3T2MA 3LNMB 4RWUA 4PI0A 1GMGA 3OTFA 3AK3A 2P4KA 1GM9A 3OE7G 4DV0O 5LGTA 4X64O 2D3OW 1DLBA 3K9SA 4LF8B 2ZR3A 4JI1B 4TQFA 3FB7C 3ETQA 4TV9B 2QWPB 1XILA 2G38A 2OIGA 2CDYA 3HKEB 2ZD9A 4K8ZA 4E2LA 1VQOV 3CCVV 3FB8C 3ZHVA 2ZNJA 2RJZA 2F93B 1EN6A 3H1IH 1R6NA 5IJ9B 1EM1A 2OWOA 4DV7B 5JJEB 3H9VA 1MOFA 1TUBB 4DV3B 5KHGA 4DV4B 4XBFA 4O2AA 3JD1A 1FXVA 2HLDG 3Q4HA 1JJOA 1YXBA 5JVDB 4BR6A 1TVKA 3ABTA 5CA0B 1ZLZA 4H33A 3ABUA 4DR6O 4DYLA 5LL6Y 1K97A 3JAKB 3RYFA 1JPXA 5GTIZ 3K79A 3ASOB 3FYEB 3UT5B 1BQZA 2LJ2A 3OMNB 1CPYA 1AR5A 3OMIB 2GTSA 4LFCO 1Q6HA 1GK9A 1F7YA 1Q8IA 3I5DA 4JI8O 3HKDA 5EBMC 1SA0A 5BMVA 2LW1A 5K1XA 4DR1O 1KUQA 4JZ2A 4FLYA 4WBNA 1H8HG 1KP3A 3ZHTA 2F95B 4D7SA 1MZEA 4I0XA 3UKMA 2KQXA 4D7TA 5EC2C 2ZIMA 2EBOA 4ZOLB 2PF4E 5IE9A 3OEHG 3SYCA 1JR9A 1YJWV 1H38A 1GN4A 1NJIW 1VF5B 4JI5O 2YC0A 1XREA 2YIAA 4RUEA 3F5TA 4GKJB 1SS3A 1WA8A 3BEHA 3JARA 4R6ZA 5H6RA 2JDIG 3C3SA 1J5EB 1BL8A 2JRIA 4GKKB 3DC6A 3JATB 3ASOC 2V4DA 4FM2A 1YJNV 4U3JB 4XDLA 4DUZB 1A32A 4PDVA 5B1BC 1GN6A 2WWWA 5B1NA 1WPXA 3EFFK 5EBWC 3CWBH 5H2FZ 3CS5A 4YIPA 4MSWC 3QO7A 3STZC 3E86A 1EFRG 4UVAA 4DR3B 3ML0A 1M9NA 3SJAC 2BCCH 4DR7O 3EVKA 1KU9A 2RDCA 4DV2O 3JSLA 5JCOC 3H1JH 1KKCA 1OJHA 5ITZB 3SPGA 4GX1A 4BIUA 1YI2V 2QA4V 4B3TB 1NVPB 3ABMB 2UXDO 2DN9A 1LNQA 4J7JA 2ZIOA 1YCIA 2Q7HA 4EFEA 1TUEB 3JSNA 3FD9A 4J11A 4PELA 1N32O 5IY5C 4QJFB 1M93A 1GTOA 5CBHA 1AI6A 3ZRVA 2Z0AA 1FFXA 3HKDB 1SA0B 1XHXA 4DV6B 4DV5B 3TXSA 4WFGA 1NVPD 3G80A 2PY5A 3RGBA 2R9IA 3K58A 3ETEA 5LA6A 4H44B 2MW2B 2CE4A 3QO8A 5BR8B 4JI4B 1JJ2U 2WLJA 1O9HA 4DXWA 4FZ0A 4EEQA 2LFSA 3ZMSA 5F2VO 3T1YB 1JX9A 2DYRB 3ZS8C 3TJTA 5L3DA 1PD3A 3RYIA 5KX5A 3ABMC 4P2ZA 2YXYA 1WA8B 3CMEV 2ADPA 4F6RA 3T1HO 4MVOA 3JD2A 1OCOB 3SPHA 3CRQA 1OHHG 5LP6A 3CCSV 2K9PA 4WFFA 3GWKC 3LSQA 4JI7B 2OCHA 2Z3YA 3AG2B 4CC5A 2IJIA 1NKDA 4EFBA 3R66A 1P4RA 3P30A 3OD4A 4CS3A 4DRXB 4I5SA 1LUVA 2ZNIA 2UU9B 3ETDA 5B66Z 4UXNA 3CPWU 3RN4A 3E83A 4MTOA 1R3JC 3L9DA 3CX5F 1N0JA 4JV5O 2X6CA 2DYRC 3JALA 3ZIAG 3G67A 2RMKB 4MVRA 2UUBO 2F23A 1Y66A 3JAMN 4CH5A 2QKAA 1S72V 2VWJA 3IC7A 1R73A 4LFBB 2QM8A 4N23A 4CH3A 3A2FA 2WLLB 5KUMA 1FFTB 3D8CA 5JH7B 1AP5A 4IYIA 3AG2C 1ZWIC 4J41A 3RT3C 4LFAO 2AHYA 1VMGA 3CXHF 3E89A 1MSWD 4TUYB 2Q0OC 5LA6B 4LC1A 1M57B 1HNZB 4LF7B 2Q9LA 4ZIBA 2ZQMA 2HHHO 3BY6A 2UXCB 1XL6A 4IGGA 3VBBA 4B3RB 2RN9A 2ATKC 4HBNA 3AEIA 2UUCO 5EYPA 4FM0A 3IFXA 4WFHA 2X7RB 4NVPA 5JWPA 4IL6Z 2YS8A 3RVYA 2H8PC 4JYAO 1YTFB 2P67A 1EN5A 4O4HB 2GTAA 2CGNA 5D5PA 1WP7A 1EBOA 4ASUG 2LP7A 1HWYA 1Q82W 1MG1A 2ZE6A 2GDSA 2N04A 4FFKA 1DK1A 4PD4F 1NH2B 1M57C 4JYYA 4FLTA 4NTYA 3U11A 2ZINA 3L74H 1FPOA 2ZE8A 2KSDA 1SC5B 4DUYO 4GUNA 1YZBA 1G1XB 5DN6G 1AI4A 4X1IA 5IYCO 2YEVB 1EZJA 2PI5A 2IJJA 2ILMA 4JF3A 1OZ0A 4PDRA 4OX9B 2EIMB 1PL0A 1IZ3A 1NH2D 1S5LZ 2BOCC 5B1AC 2P6JA 3VQYA 2ZCEA 5LMUO 4LCUC 4B3SB 1VQNV 2F43G 2LQTA 3K59A 2KKWA 3HKBA 2BOBC 3MAQA 2OIEA 1I5XA 5LMNO 3HR0A 1KQSU 3CHXA 1VQKV 4TWKA 4LWSB 4LH6A 2WLKA 1Q86W 3MD0A 4JI0O 4XDKA 4MW3A 4MTFA 2PZSA 1AJNA 4JI3O 4X66O 1QR8A 5J2TB 1Q7YW 2PYLA 3N27A 3SYOA 5KMGB 4NXNB
chains in the Genus database with same CATH topology
1SQXH 1L0NH 2A06H 3H1KH 1BCCH 3BCCH 1NTKH 1PPJH 4PD4F 1KYOF 1BGYH 1P84F 3L72H 3CX5F 1SQBH 2IBZH 1SQVH 3L74H 1NU1H 1EZVH 3H1LH 2BCCH 2FYUH 4U3FH 1PP9H 3H1HH 3L75H 3CXHF 1BE3H 3H1JH 1SQPH 3L70H 4D6TH 3L71H 3TGUH 3H1IH 3CWBH 1L0LH 3L73H 5KLVH 1SQQH 1NTZH 1KB9F 1NTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX H;  1L0N H;  2A06 H;  3H1K H;  1BCC H;  3BCC H;  1NTK H;  1PPJ H;  4PD4 F;  1KYO F;  1BGY H;  1P84 F;  3L72 H;  3CX5 F;  1SQB H;  2IBZ H;  1SQV H;  3L74 H;  1NU1 H;  1EZV H;  3H1L H;  2BCC H;  2FYU H;  4U3F H;  1PP9 H;  3H1H H;  3L75 H;  3CXH F;  1BE3 H;  3H1J H;  1SQP H;  3L70 H;  4D6T H;  3L71 H;  3TGU H;  3H1I H;  3CWB H;  1L0L H;  3L73 H;  5KLV H;  1SQQ H;  1NTZ H;  1KB9 F;  1NTM H; 
#chains in the Genus database with same CATH topology
 1QQC A;  3HKE A;  1M1K W;  2E74 B;  1VQ6 V;  4UCO A;  3DTU B;  1BHA A;  2IBZ H;  4JZG A;  4TSF G;  4X62 B;  1S77 D;  1P7B A;  1YF2 A;  4I9Q A;  5IJ9 A;  2EIM C;  3I56 V;  3CEI A;  2H3O A;  1XL4 A;  4HAM A;  4QNH B;  1HR0 B;  1TUB A;  2AW9 A;  1FKA O;  1OCZ B;  1FJG B;  2JEU A;  1FYJ A;  3L75 H;  2RQ6 A;  2R72 A;  4J7Z A;  2Q4P A;  2LO1 A;  1S5J A;  2O57 A;  1NBM G;  3SPI A;  3OTO O;  3OMA B;  2E5L B;  3UT5 A;  1MNG A;  3N2K A;  4NTW A;  4PJ0 Z;  5LHH A;  4X1I B;  3LDE A;  1QNM A;  1IBM O;  2H94 A;  1HNW O;  1FAF A;  2ZM6 B;  3RBZ A;  4UV8 A;  2DJV A;  5EIB C;  2OTL V;  5CBG A;  4YY3 B;  1FXK A;  4X65 B;  2CTW A;  3THO A;  4PDL A;  3F5W C;  4FIP C;  2DYS B;  2YXH A;  5LXT A;  2D2C B;  2P22 C;  4DK0 A;  1W59 A;  3OT7 A;  2NLJ C;  4ZOL A;  4UCU A;  4F6E A;  4X20 B;  2PTM A;  1NR1 A;  4I55 A;  3B8N A;  4MTX A;  1XMO B;  4GCZ A;  4FLW A;  3D3I A;  1NR7 A;  1XQ8 A;  1THZ A;  2Y4T A;  4AQY O;  2PGG A;  3RVZ A;  1IUR A;  4AIL C;  2IJH A;  1M4U A;  4LF8 O;  2CK3 G;  4JI1 O;  2XHB A;  3JAT A;  2DWD C;  2Q6A A;  4U3J A;  2YSU B;  4J10 A;  1M5I A;  2IH3 C;  3ZRS A;  4TOI A;  3SR2 C;  1PNK A;  2DE0 X;  1AP6 A;  2EZO A;  4JAV A;  4X64 B;  2ZXW B;  1V54 B;  4LF5 O;  5B5E Z;  5GW7 A;  2VQE B;  4ZKI A;  2IH1 C;  3W7X A;  3K5L A;  2PI4 A;  1ZAU A;  3E8H A;  1JVM A;  2DYS C;  1AB3 A;  3ZRW A;  4DV7 O;  4CZZ A;  2ITC C;  4DV3 O;  2BTO A;  1G4Y B;  5ITZ A;  1ZSP A;  4BAY A;  1F51 A;  1S5H C;  4K0K B;  4H13 B;  2DQ3 A;  4B3M O;  3LSU A;  1K34 A;  2RNB A;  2JGD A;  2RCV A;  2YIC A;  2CAZ C;  2WAM A;  3N2K B;  3CC2 V;  5BY1 A;  3T4Z A;  3IAY A;  3SPC A;  1YIJ V;  3CYO A;  1YIT V;  4X89 A;  3PJS K;  3CCM V;  2M6Y A;  2HFE C;  4LF4 B;  1K92 A;  3STL C;  4BW9 A;  2XUM A;  4DR6 B;  2UXX A;  3AK1 A;  1AJQ A;  3TGU H;  2IM9 A;  1FXK B;  3LSS A;  4DV1 B;  4P30 A;  2ZXW C;  3L73 H;  2Y4U A;  2P4V A;  1DGS A;  2LFR A;  5LXT B;  3NR7 A;  4DR2 B;  3FKS G;  4WFA V;  3DGE A;  3LDC A;  3NXS A;  4MW8 A;  1E79 G;  2BSK B;  5CA3 A;  1B06 A;  3VQV A;  4I55 B;  2GV9 A;  2XTA A;  3KCY A;  3LUT B;  4I9W A;  2W6I G;  4PA4 A;  1W2B U;  1QLN A;  3AG3 B;  1EN4 A;  3KZI Z;  4GKJ O;  2JIZ G;  4X8A A;  3ASN B;  1PPJ H;  1URF A;  1WP8 A;  3M8A A;  5FPO A;  1US6 A;  1J5E O;  4JAU A;  4GKK O;  4K3A A;  1KC8 W;  4JAS A;  1QLE B;  4QPJ A;  4JI5 B;  2YDE A;  4DUZ O;  1AR1 B;  4OPA A;  2EIL B;  2QM7 A;  1DTO A;  2Q5Z A;  1HP8 A;  1N34 B;  3EHB B;  4LF9 O;  5H5N A;  2CTR A;  2FB5 A;  3QG5 A;  2Y0I A;  1XMQ B;  2WSS G;  4UCS A;  3UO3 A;  2FKX A;  1FXK C;  3M99 B;  1IXB A;  3ZRW B;  2QWR B;  4ZBM A;  1I5Y A;  4DR3 O;  4DRX A;  4GX0 A;  3WB0 A;  2YI8 A;  5IYB O;  3HKC B;  5KA6 A;  2ZDI A;  1ROP A;  4P9P A;  4B3T O;  3RYH B;  3H1K H;  1H2K A;  2BE3 A;  2Q73 A;  3AG3 C;  2EJR A;  5L3F A;  5LBQ A;  2JGD B;  4NYK A;  1Q6U A;  3ASN C;  4DV2 B;  3TCU A;  3SGI A;  4NTX A;  2WA3 A;  2LGW A;  3CCE V;  3APO A;  5JJJ B;  4U7N A;  2IJK A;  2WLN A;  3FYI B;  3KCX A;  4FMT A;  4G27 B;  1W0J G;  1QLE C;  2X6A A;  2WLL A;  1AI7 A;  2XAQ A;  4U7O A;  4QIW F;  2UXD B;  4Q6G A;  4EB6 B;  5JH7 A;  2YI9 A;  1Q43 A;  4K35 A;  2Y69 B;  4DV5 O;  1K73 W;  4YJ2 B;  5KAF Z;  5A9G A;  4DR4 O;  4JI6 O;  3FB6 C;  4TUY A;  3RW0 A;  4LF6 B;  1QVG U;  5FL7 G;  4RO2 A;  5BR8 O;  2QDO A;  3K03 A;  1R6T A;  3H01 A;  1Y74 A;  4OXS A;  1N33 O;  5KLV H;  1H2N A;  1FD9 A;  2GUZ B;  4PA3 A;  3T1Y O;  2FTK A;  4UVB A;  2YUA A;  3BVO A;  1F23 A;  3ZRX A;  5CA1 B;  4PHZ A;  2EJ7 A;  4KFM A;  3O9O A;  1XNQ O;  4PV1 B;  3MHH C;  3JAW B;  3B77 A;  4MTG A;  3A8T A;  3K57 A;  2FL4 A;  1H2G A;  4GX5 A;  4IYH A;  5KUK A;  2ARH A;  5KHJ A;  3C3T A;  4O4H A;  3ZHR A;  4JI7 O;  3BRC A;  1HNX O;  1WNS A;  4ICG A;  3ZMV A;  4TV8 B;  3T1H B;  1IBK B;  4QGP A;  2Y69 C;  5EBL C;  1QR9 A;  2ZT9 B;  3WB2 A;  3BAA A;  5H9C A;  3K5M A;  3IC9 A;  5C93 A;  2GSM B;  4NR1 A;  4KXR A;  3ZHU A;  2UU9 O;  3CE2 A;  1MA1 A;  1PM9 A;  4OGQ B;  4ZI7 B;  3LDD A;  4UFZ A;  1S3J A;  2F4V B;  4CC6 A;  5JJN B;  3QF7 A;  1IBL B;  3CCJ V;  2UXB B;  2HG5 C;  3K3W A;  2BTQ B;  2YEV A;  3WB1 A;  5A2Q N;  3K04 A;  5L3G A;  4ZHQ B;  4CBC A;  5LHI A;  1OCO C;  4KHP B;  4LFB O;  3UQ8 A;  2QWN B;  2CUG A;  4O4L A;  1FS0 G;  4L87 A;  1NZ6 A;  2WLM A;  2HVK C;  2EIK B;  1XOU A;  4FFB A;  2X0L A;  2A3Q A;  3B2E E;  3UO2 A;  4MVU A;  1RFY A;  3K5N A;  3E8B A;  4LF7 O;  1HNZ O;  1RPR A;  2EIN B;  3X2Q B;  1NS1 A;  4LWS A;  1Y67 A;  1Y74 B;  4L8J A;  3S3W A;  4LFA B;  3OUF A;  2XND G;  3R65 A;  2UXC O;  3W7W A;  3H1L H;  1BSM A;  5J2T A;  1BZK A;  2ZDI C;  3CCU V;  1R6K A;  5KMG A;  2K1E A;  1Y76 B;  5L3C A;  5E79 Z;  2HHH B;  5B3S B;  4MVQ A;  2QKC A;  3GWO A;  1N36 B;  1RM1 B;  4OPH A;  4LBE C;  3ZHQ A;  2E75 B;  4J9Z B;  1MAB G;  1SZT A;  4LNU B;  5IWA O;  3J81 N;  1XDC A;  1O9G A;  1XBL A;  3MHS C;  2QE7 G;  5L3E A;  1VQP V;  1HDJ A;  2VQF O;  1WJZ A;  3DC5 A;  2JVD A;  1I08 A;  3LNN A;  5EK0 A;  1L8D A;  2W0X A;  1K33 A;  3D36 A;  3K5O A;  5GON A;  1BT8 A;  2DOS A;  4X1K B;  3UM7 A;  3KG2 A;  2W0F C;  1QCE A;  4NXM B;  1MZF A;  1Q5O A;  2EIN C;  3X2Q C;  1VQ7 V;  2AGA A;  4FPP A;  4X1Y A;  5LYJ B;  1NU1 H;  1G8M A;  1LR1 A;  3ABL B;  2EX3 A;  1KKD A;  1U96 A;  1BMF G;  3L71 H;  4H0L B;  3RYC A;  1NTZ H;  1KP2 A;  2JJ2 G;  1OCC B;  2VWK A;  4KL1 A;  5B3S C;  1YSC A;  5IT9 N;  3W7U A;  1RM1 C;  1K3E A;  3JAS B;  4E4E A;  3CCL V;  1S76 D;  1EZV H;  3CC4 V;  1Z5W A;  4GT1 A;  3OFN G;  1ORQ C;  4AHC A;  4O4L B;  4CH6 A;  1XNR B;  2AXT Z;  1I94 B;  4KUM A;  4R50 A;  5L3B A;  1I7F A;  4X20 A;  3N2G A;  5IYZ B;  1GO3 F;  4FFB B;  5DEC A;  4DO2 A;  4DW1 A;  4DR5 O;  4YHH O;  4UUJ C;  1B6Q A;  4EKW A;  1UJW B;  1SQB H;  3M7M X;  1P7G A;  2AZ0 A;  4R8C A;  5CB4 B;  5E1A C;  3AG4 B;  5KAI Z;  3VQW A;  4RQE A;  1I0H A;  4I4T A;  4PA7 A;  3ABL C;  2WLH A;  1R3L C;  2V7Q G;  4I50 B;  1Y6X A;  4B7K A;  4NB5 A;  3E35 A;  2NN4 A;  4X88 A;  3ZED A;  3J7A U;  2JJ1 G;  1OCC C;  5D5Q A;  4UCR A;  3VOU A;  2XAG A;  2FYU H;  3HB3 B;  3H1H H;  4JPR A;  4X62 O;  4FVM A;  4X66 B;  1WB8 A;  3JD3 A;  2JS3 A;  1ZX3 A;  1ZL8 B;  1WB7 A;  1OV9 A;  1K9M W;  2YIB D;  1H8E G;  4CS2 A;  1SES A;  5JQG B;  1CEZ A;  3WFV A;  1OCR B;  5GON B;  2CTP A;  3CD6 V;  3CRR A;  3P3P A;  4I7Z B;  2DMX A;  1V9P A;  3FAV A;  2F1M A;  4PI2 A;  4GYC B;  4X1Y B;  3AG4 C;  3ZJZ A;  1CP9 A;  3ZBH A;  1XEQ A;  2E5L O;  4FJC C;  2GBO A;  3RYC B;  4JI2 B;  1P84 F;  3B09 A;  2ZM6 O;  1V55 B;  2XAJ A;  2YXL A;  3OTO B;  1JFF B;  4ABM A;  4X65 O;  3TK1 A;  2UUA B;  2X6B A;  3BA8 A;  1GM8 A;  3OAA G;  4J80 A;  2HKO A;  3QO5 A;  1GM7 A;  1NQT A;  1NTM H;  5KA5 A;  4RAI A;  4QPK A;  2Y0P A;  4O4J A;  2BSK A;  1BQ0 A;  3N2G B;  3A0R A;  3D36 C;  1OCR C;  2Q68 A;  4HNA B;  5EZY A;  3OGC C;  4UV9 A;  3CMA V;  2HJF C;  1SQF A;  1K5S A;  3K0D A;  1RSO B;  5BXZ A;  1OCZ C;  1WN7 A;  2QTS A;  1ZTE A;  3E22 A;  1KB9 F;  1SQX H;  4I4T B;  2P06 A;  1KBH A;  1IXM A;  2KG7 B;  1SKV A;  3VQX A;  4BIO A;  3U10 A;  1IVS A;  3JCZ A;  3QTC A;  1LUW A;  1D5A A;  5FNV A;  4DV0 B;  3AG7 A;  4JTA B;  4AQY B;  1K8A W;  1V55 C;  2XT9 A;  3F7V C;  2VQE O;  2C2A A;  5LOV B;  3G71 V;  1JA8 A;  3OEE G;  1W0K G;  2LGQ A;  4MT8 A;  2CH7 B;  4AI8 A;  2XAH A;  3L72 H;  3ABK B;  4MS2 A;  3G4S V;  4FM1 A;  4DV4 O;  1K5Q A;  4U3F H;  3FFQ A;  1L1F A;  1PV0 A;  4LF5 B;  3HKC A;  1VF6 A;  2JGU A;  5C8Y B;  5KHK A;  3RFR A;  3AG1 B;  1D2D A;  1SET A;  4K0K O;  3RYH A;  3FAV B;  4J7K A;  3BHP A;  4CS4 A;  4YXW G;  3CCQ V;  1KYO F;  3RWR D;  3J80 N;  1T5E A;  5BZB A;  2W6J G;  3JYC A;  4UB8 Z;  3G6E V;  1F4M A;  2DWE C;  4LF4 O;  4B3M B;  4IIJ A;  2Y48 A;  5J9P C;  4EB6 A;  1JQ0 A;  2Q67 A;  4Z1V A;  4DV1 O;  4YJ2 A;  1TA8 A;  1V54 C;  4CH4 A;  5GTH Z;  4UB6 Z;  3K06 A;  4DK1 A;  4DR2 O;  5B1B B;  4LFC B;  4O4J B;  2QM4 A;  4P9O A;  3ABK C;  3JD4 A;  4JI8 B;  4BIZ A;  1JCH A;  4DR1 B;  2GUZ A;  5EZY B;  1L0L H;  3BA9 A;  3P3N A;  4R7C A;  3AG1 C;  5CA1 A;  3JD0 A;  5LHG A;  5LGU A;  4RQF A;  3IGA C;  1BGY H;  4PA6 A;  3E22 B;  2ADQ B;  2AZ2 A;  3JAW A;  1SF9 A;  1N0N A;  1VEW A;  1JOY A;  1JMK C;  1IX9 A;  1AJP A;  3ZMZ A;  3JCU Z;  5J2U A;  5FNV B;  1PNL A;  2WA4 A;  1N8R W;  1N34 O;  4JTC B;  1XMQ O;  1D5N A;  3CB2 A;  1NTK H;  4TV8 A;  5IY5 B;  1B04 A;  3WG7 B;  1GKF A;  1X59 A;  2YID A;  2Q69 A;  4LF9 B;  2IU0 A;  4UCV A;  3DXR A;  2L35 A;  3BPZ A;  3G6B A;  2PYJ A;  4ZI7 A;  3ZN0 A;  4IT5 A;  4WFE A;  2WLI A;  1BS3 A;  4YIO A;  1VQ5 V;  1QU7 A;  1MSD A;  2QWQ B;  3CRC A;  4DR7 B;  2BTQ A;  5LGN A;  5KHH A;  4O2A B;  2P5O A;  3Q4H B;  3EXA A;  4WFB V;  4UVC A;  4ZHQ A;  3TET A;  4HZ3 A;  3ZCC A;  2HJD A;  1TVK B;  2XOK G;  1P49 A;  2IW5 A;  3QVN A;  4X9Q A;  5DED A;  3T1C A;  5HFM A;  1Z2G A;  2P7T C;  1XHZ A;  4IIJ B;  2E76 B;  1PKX A;  2EIL C;  3BFR A;  1SRY A;  4DV6 O;  1J95 A;  3RYF B;  1NT2 B;  3ETG A;  2Q7E A;  3IJ4 A;  4YJ3 A;  1QHT A;  1N32 B;  3WU2 Z;  3OR7 C;  4PA9 A;  4LF6 O;  2EIJ B;  3WG7 C;  1VQL V;  1PNM A;  3TXQ A;  2OYQ A;  1F4N A;  4JI4 O;  2V1D A;  5BMV B;  1CXZ B;  2OT5 A;  4WBN B;  4BW5 A;  4DR4 B;  4JI6 B;  1VF6 C;  3T4D A;  1U97 A;  2L6L A;  2WPD G;  3SJC C;  3FB5 C;  4GZR B;  4I0X B;  2ZKO A;  4LP8 A;  1QVF U;  1Y76 A;  2JS5 A;  2F66 C;  3AK2 A;  4F4L A;  3PN1 A;  1N33 B;  4LNU A;  1AIL A;  4DW0 A;  4MVM A;  1TGO A;  5J2U B;  2HP8 A;  1M56 B;  3JAR B;  1XNQ B;  4C7U A;  2CTQ A;  1IBK O;  4H37 A;  2HVJ C;  3S3X A;  3OUS A;  3GVM A;  5FPR A;  2Z5U A;  4JYB A;  4X1K A;  2AHZ A;  1GRJ A;  2EIJ C;  1HNX B;  2M7W A;  4IHJ A;  3DXR B;  1Y4M A;  5LYJ A;  3ZHS A;  4XDJ A;  1KD1 W;  2F4V O;  3CXC U;  3ICX A;  1VQ4 V;  1PP9 H;  2WLI B;  3OW2 U;  2N74 A;  1IBL O;  4FLX A;  3UCS C;  4JYC A;  1BE3 H;  1YVW A;  1ZUQ A;  3CP1 A;  3KKY A;  2UXB O;  3SYP A;  4MVS A;  2ODM A;  3E8F A;  5EC1 C;  1YDX A;  3QNE A;  3F7Y C;  1PL4 A;  1WLE A;  4KHP O;  3JAS A;  4O2B A;  1TAE A;  4JGS A;  4JV5 B;  2NNU A;  1N4C A;  3SJQ C;  4BWA A;  1WPB A;  1VQ9 V;  3APQ A;  5IJ0 A;  1M56 C;  2ZR2 A;  2IU3 A;  2UUB B;  1X4T A;  2A9H A;  1ENV A;  2HR3 A;  4YJ3 B;  5IYZ A;  3OM3 B;  3E2E A;  1BCC H;  1FFX B;  5CB4 A;  1KMI Z;  4KP4 A;  4TQD A;  3ZMU A;  5CN0 A;  1DF4 A;  2YIB A;  4RUF A;  1SQV H;  2A0L A;  4B7E A;  3MDS A;  5DM6 V;  1Q81 W;  2VS0 A;  4WF9 V;  2Q7G A;  4B3R O;  4GLX A;  3O65 A;  4I50 A;  5FLX N;  2ZE7 A;  1R3K C;  1SQQ H;  2ETN A;  4NKG B;  5HFL A;  1N36 O;  4A5U B;  2FML A;  4HYO A;  3CC7 V;  1XI1 A;  2A79 B;  2NR5 A;  2OTJ V;  3RYI B;  1Q90 D;  5KX5 B;  1ZL8 A;  1GAX A;  3A0H Z;  4LR3 A;  2UUC B;  2GHY A;  4W4L A;  1RP3 B;  3W7T A;  5JQG A;  1XUQ A;  4F6R B;  3HPL C;  3K0G A;  3P32 A;  2EIK C;  1SZX A;  4JYA B;  1E1Q G;  5CBF A;  4Z1M G;  1VAR A;  5LP6 B;  5IWA B;  5B1A B;  2OCC B;  5H6Q A;  4NXM O;  1YHQ V;  4IHJ B;  2VQF B;  2E3C A;  3CSX A;  3GB7 C;  1K4D C;  1YEW A;  2ZE5 A;  5AG2 A;  2B9Z A;  4J42 A;  4K8X A;  5B1O A;  4FLV A;  2PUS A;  5IYD O;  4W4K A;  1YTF D;  1M90 W;  1JFF A;  2JK5 C;  1H2M A;  4O2B B;  5KHI A;  4O4I A;  3U0Z A;  4OX9 O;  1AR4 A;  4DUY B;  4JAA A;  3SDL A;  2LW7 A;  3JAL B;  3C90 A;  2A7W A;  4MVZ A;  5IJ0 B;  4B08 A;  1SQP H;  1E1R G;  3B4S A;  1XNR O;  3ZN1 A;  4B3S O;  1GH6 A;  1DF5 A;  1RPO A;  3B40 A;  1I94 O;  2B1I A;  2QTO A;  4HNA A;  5LP6 C;  5TIS Z;  1GN3 A;  2P90 A;  1RSO A;  2OCC C;  2JEX A;  5LMU B;  3CRA A;  2UXN A;  3K08 A;  3CJH A;  4FK5 C;  1ARO P;  3B8M A;  2N05 A;  2R9A A;  5K1P A;  2EZP A;  1R1B A;  1NI8 A;  1R3I C;  2KG7 A;  2QSA A;  1WAZ A;  2KB1 A;  4DR5 B;  4YHH B;  1GN2 A;  3E8G A;  2Q0A A;  2Q8V A;  2QWO B;  4J9Y B;  1B3Q A;  4NXN O;  1S0V A;  5LMN B;  3SYA A;  1IDS A;  4UCT A;  2QGN A;  3CRM A;  3W7S A;  2DQ0 A;  4JI0 B;  4JI3 B;  1VF7 A;  4TV9 A;  1AVM A;  5LOV A;  4LH7 A;  1QBZ A;  3DSQ A;  1VIB A;  4FLU A;  2CH7 A;  1G6U A;  5EYP B;  1UPG A;  1HR0 O;  1FXH A;  3SYQ A;  3SPJ A;  3SJB C;  3ZX6 A;  2CGO A;  1UFI A;  5C8Y A;  4FLZ A;  2QEX V;  1FJG O;  2QJ1 A;  1Q6I A;  1K4C C;  3I55 V;  2QR4 A;  1KEC A;  4D6T H;  2B5U A;  5CMU A;  3A0B Z;  1MMM A;  2DW4 A;  4TT3 G;  3OGI B;  3D3Q A;  3CCR V;  1L0N H;  4Z2W A;  5JVD A;  4WCE V;  4QE7 A;  4JI2 O;  3K9A A;  5CA0 A;  5IDJ A;  1SQG A;  5EIB D;  1VQ8 V;  2MK3 A;  3BAB A;  3JAK A;  3L70 H;  1VQM V;  4YY3 O;  1H2S B;  4O4I B;  1H2L A;  2R9R B;  1Q3E A;  2UUA O;  1SER A;  2HEP A;  2R70 A;  2A06 H;  2XAS A;  4PDM A;  2EUL A;  1IBM B;  2B1G A;  1HNW B;  4Q20 A;  1HW7 A;  2ITD C;  1K7D A;  1AI5 A;  4FZ1 A;  4JTD B;  2VRZ A;  1XMO O;  1COW G;  4G28 B;  1YJ9 V;  4N21 A;  3CJH B;  2XAF A;  4G2K A;  3HKB B;  1Z5V A;  1VP7 A;  5JCO A;  3BCC H;  2QKS A;  4GX2 A;  1BHB A;  3OR6 C;  3FX7 A;  4QE9 A;  3ZMT A;  3T2M A;  3LNM B;  4RWU A;  4PI0 A;  1GMG A;  3OTF A;  3AK3 A;  2P4K A;  1GM9 A;  3OE7 G;  4DV0 O;  5LGT A;  4X64 O;  2D3O W;  1DLB A;  3K9S A;  4LF8 B;  2ZR3 A;  4JI1 B;  4TQF A;  3FB7 C;  3ETQ A;  4TV9 B;  2QWP B;  1XIL A;  2G38 A;  2OIG A;  2CDY A;  3HKE B;  2ZD9 A;  4K8Z A;  4E2L A;  1VQO V;  3CCV V;  3FB8 C;  3ZHV A;  2ZNJ A;  2RJZ A;  2F93 B;  1EN6 A;  3H1I H;  1R6N A;  5IJ9 B;  1EM1 A;  2OWO A;  4DV7 B;  5JJE B;  3H9V A;  1MOF A;  1TUB B;  4DV3 B;  5KHG A;  4DV4 B;  4XBF A;  4O2A A;  3JD1 A;  1FXV A;  2HLD G;  3Q4H A;  1JJO A;  1YXB A;  5JVD B;  4BR6 A;  1TVK A;  3ABT A;  5CA0 B;  1ZLZ A;  4H33 A;  3ABU A;  4DR6 O;  4DYL A;  5LL6 Y;  1K97 A;  3JAK B;  3RYF A;  1JPX A;  5GTI Z;  3K79 A;  3ASO B;  3FYE B;  3UT5 B;  1BQZ A;  2LJ2 A;  3OMN B;  1CPY A;  1AR5 A;  3OMI B;  2GTS A;  4LFC O;  1Q6H A;  1GK9 A;  1F7Y A;  1Q8I A;  3I5D A;  4JI8 O;  3HKD A;  5EBM C;  1SA0 A;  5BMV A;  2LW1 A;  5K1X A;  4DR1 O;  1KUQ A;  4JZ2 A;  4FLY A;  4WBN A;  1H8H G;  1KP3 A;  3ZHT A;  2F95 B;  4D7S A;  1MZE A;  4I0X A;  3UKM A;  2KQX A;  4D7T A;  5EC2 C;  2ZIM A;  2EBO A;  4ZOL B;  2PF4 E;  5IE9 A;  3OEH G;  3SYC A;  1JR9 A;  1YJW V;  1H38 A;  1GN4 A;  1NJI W;  1VF5 B;  4JI5 O;  2YC0 A;  1XRE A;  2YIA A;  4RUE A;  3F5T A;  4GKJ B;  1SS3 A;  1WA8 A;  3BEH A;  3JAR A;  4R6Z A;  5H6R A;  2JDI G;  3C3S A;  1J5E B;  1BL8 A;  2JRI A;  4GKK B;  3DC6 A;  3JAT B;  3ASO C;  2V4D A;  4FM2 A;  1YJN V;  4U3J B;  4XDL A;  4DUZ B;  1A32 A;  4PDV A;  5B1B C;  1GN6 A;  2WWW A;  5B1N A;  1WPX A;  3EFF K;  5EBW C;  3CWB H;  5H2F Z;  3CS5 A;  4YIP A;  4MSW C;  3QO7 A;  3STZ C;  3E86 A;  1EFR G;  4UVA A;  4DR3 B;  3ML0 A;  1M9N A;  3SJA C;  2BCC H;  4DR7 O;  3EVK A;  1KU9 A;  2RDC A;  4DV2 O;  3JSL A;  5JCO C;  3H1J H;  1KKC A;  1OJH A;  5ITZ B;  3SPG A;  4GX1 A;  4BIU A;  1YI2 V;  2QA4 V;  4B3T B;  1NVP B;  3ABM B;  2UXD O;  2DN9 A;  1LNQ A;  4J7J A;  2ZIO A;  1YCI A;  2Q7H A;  4EFE A;  1TUE B;  3JSN A;  3FD9 A;  4J11 A;  4PEL A;  1N32 O;  5IY5 C;  4QJF B;  1M93 A;  1GTO A;  5CBH A;  1AI6 A;  3ZRV A;  2Z0A A;  1FFX A;  3HKD B;  1SA0 B;  1XHX A;  4DV6 B;  4DV5 B;  3TXS A;  4WFG A;  1NVP D;  3G80 A;  2PY5 A;  3RGB A;  2R9I A;  3K58 A;  3ETE A;  5LA6 A;  4H44 B;  2MW2 B;  2CE4 A;  3QO8 A;  5BR8 B;  4JI4 B;  1JJ2 U;  2WLJ A;  1O9H A;  4DXW A;  4FZ0 A;  4EEQ A;  2LFS A;  3ZMS A;  5F2V O;  3T1Y B;  1JX9 A;  2DYR B;  3ZS8 C;  3TJT A;  5L3D A;  1PD3 A;  3RYI A;  5KX5 A;  3ABM C;  4P2Z A;  2YXY A;  1WA8 B;  3CME V;  2ADP A;  4F6R A;  3T1H O;  4MVO A;  3JD2 A;  1OCO B;  3SPH A;  3CRQ A;  1OHH G;  5LP6 A;  3CCS V;  2K9P A;  4WFF A;  3GWK C;  3LSQ A;  4JI7 B;  2OCH A;  2Z3Y A;  3AG2 B;  4CC5 A;  2IJI A;  1NKD A;  4EFB A;  3R66 A;  1P4R A;  3P30 A;  3OD4 A;  4CS3 A;  4DRX B;  4I5S A;  1LUV A;  2ZNI A;  2UU9 B;  3ETD A;  5B66 Z;  4UXN A;  3CPW U;  3RN4 A;  3E83 A;  4MTO A;  1R3J C;  3L9D A;  3CX5 F;  1N0J A;  4JV5 O;  2X6C A;  2DYR C;  3JAL A;  3ZIA G;  3G67 A;  2RMK B;  4MVR A;  2UUB O;  2F23 A;  1Y66 A;  3JAM N;  4CH5 A;  2QKA A;  1S72 V;  2VWJ A;  3IC7 A;  1R73 A;  4LFB B;  2QM8 A;  4N23 A;  4CH3 A;  3A2F A;  2WLL B;  5KUM A;  1FFT B;  3D8C A;  5JH7 B;  1AP5 A;  4IYI A;  3AG2 C;  1ZWI C;  4J41 A;  3RT3 C;  4LFA O;  2AHY A;  1VMG A;  3CXH F;  3E89 A;  1MSW D;  4TUY B;  2Q0O C;  5LA6 B;  4LC1 A;  1M57 B;  1HNZ B;  4LF7 B;  2Q9L A;  4ZIB A;  2ZQM A;  2HHH O;  3BY6 A;  2UXC B;  1XL6 A;  4IGG A;  3VBB A;  4B3R B;  2RN9 A;  2ATK C;  4HBN A;  3AEI A;  2UUC O;  5EYP A;  4FM0 A;  3IFX A;  4WFH A;  2X7R B;  4NVP A;  5JWP A;  4IL6 Z;  2YS8 A;  3RVY A;  2H8P C;  4JYA O;  1YTF B;  2P67 A;  1EN5 A;  4O4H B;  2GTA A;  2CGN A;  5D5P A;  1WP7 A;  1EBO A;  4ASU G;  2LP7 A;  1HWY A;  1Q82 W;  1MG1 A;  2ZE6 A;  2GDS A;  2N04 A;  4FFK A;  1DK1 A;  4PD4 F;  1NH2 B;  1M57 C;  4JYY A;  4FLT A;  4NTY A;  3U11 A;  2ZIN A;  3L74 H;  1FPO A;  2ZE8 A;  2KSD A;  1SC5 B;  4DUY O;  4GUN A;  1YZB A;  1G1X B;  5DN6 G;  1AI4 A;  4X1I A;  5IYC O;  2YEV B;  1EZJ A;  2PI5 A;  2IJJ A;  2ILM A;  4JF3 A;  1OZ0 A;  4PDR A;  4OX9 B;  2EIM B;  1PL0 A;  1IZ3 A;  1NH2 D;  1S5L Z;  2BOC C;  5B1A C;  2P6J A;  3VQY A;  2ZCE A;  5LMU O;  4LCU C;  4B3S B;  1VQN V;  2F43 G;  2LQT A;  3K59 A;  2KKW A;  3HKB A;  2BOB C;  3MAQ A;  2OIE A;  1I5X A;  5LMN O;  3HR0 A;  1KQS U;  3CHX A;  1VQK V;  4TWK A;  4LWS B;  4LH6 A;  2WLK A;  1Q86 W;  3MD0 A;  4JI0 O;  4XDK A;  4MW3 A;  4MTF A;  2PZS A;  1AJN A;  4JI3 O;  4X66 O;  1QR8 A;  5J2T B;  1Q7Y W;  2PYL A;  3N27 A;  3SYO A;  5KMG B;  4NXN B; 
#chains in the Genus database with same CATH homology
 1SQX H;  1L0N H;  2A06 H;  3H1K H;  1BCC H;  3BCC H;  1NTK H;  1PPJ H;  4PD4 F;  1KYO F;  1BGY H;  1P84 F;  3L72 H;  3CX5 F;  1SQB H;  2IBZ H;  1SQV H;  3L74 H;  1NU1 H;  1EZV H;  3H1L H;  2BCC H;  2FYU H;  4U3F H;  1PP9 H;  3H1H H;  3L75 H;  3CXH F;  1BE3 H;  3H1J H;  1SQP H;  3L70 H;  4D6T H;  3L71 H;  3TGU H;  3H1I H;  3CWB H;  1L0L H;  3L73 H;  5KLV H;  1SQQ H;  1NTZ H;  1KB9 F;  1NTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...