3L72H

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l72H00
1NTZH 2A06H 3L75H 4U3FH 1P84F 3L73H 2FYUH 1NTKH 1BCCH 1L0NH 3L71H 4PD4F 1EZVH 3H1KH 1SQPH 1BE3H 1PPJH 3CXHF 3H1LH 3H1HH 1BGYH 2BCCH 1SQVH 3CX5F 4D6TH 3CWBH 1PP9H 3L70H 1SQQH 3H1IH 1NTMH 1SQBH 1KB9F 3L74H 3BCCH 3TGUH 3H1JH 5KLVH 1NU1H 3L72H 1SQXH 2IBZH 1KYOF 1L0LH
chains in the Genus database with same CATH superfamily
2EIJB 5CMUA 4U3JB 3MD0A 2GV9A 3DXRB 5LGNA 1VQMV 5CBFA 1GAXA 2W6IG 2F95B 3NR7A 4AQYB 3WG7C 1AP5A 3ZRVA 3H01A 3CEIA 4LF7B 4K8XA 1B6QA 4MTOA 1HWYA 4DV2B 1K34A 4FPPA 3FYEB 2ODMA 4WF9V 2AXTZ 1QCEA 3ABMC 3OGCC 4CS2A 1AROP 2QKSA 3N27A 3CC4V 2YIBA 3ABKC 5B1BB 4J7JA 2Q69A 4DUZB 1AVMA 3K5OA 5JCOC 2OTLV 2ILMA 3FB5C 4PDMA 5EC1C 3WB1A 2Z5UA 5KMGA 5HFMA 2AGAA 3SPHA 3EXAA 2VWKA 2CAZC 2HP8A 4JI7O 3B4SA 2Q9LA 3JD3A 5JQGB 1YHQV 4ZOLB 4DR3O 3K0GA 1HNXO 3G6EV 4LFBB 4ABMA 3U11A 3GVMA 3RWRD 3K9SA 4MTXA 5LP6A 4K3AA 2QM4A 4O2AA 4JI1O 3DC5A 4X89A 4X66B 5B66Z 4FLYA 3HKCB 4XDJA 3JD4A 1W59A 3N2KB 2LFRA 3OR6C 2F93B 1M5IA 2CH7B 1WJZA 1S0VA 2XTAA 3T1HB 3H1LH 3BVOA 3T4DA 1FPOA 2EIMB 2EINB 2QM8A 3K5LA 1L1FA 2HR3A 2JEUA 1W0KG 4YJ3A 4PDLA 4MVZA 2ZT9B 3CCEV 1M93A 4N21A 4X20A 2B1IA 4J10A 2F4VO 2GUZA 4LF5O 3OR7C 1SETA 1SQXH 4KHPO 2DQ3A 2G38A 2ZDIA 3ETDA 1QR8A 4HBNA 4CC5A 1GN6A 4BW5A 5IJ9B 4DV4B 3KKYA 4X65B 3B8MA 4I4TA 2EIKC 4YIPA 2ETNA 2JK5C 4FLUA 2JIZG 3ZRXA 3CCUV 4D7SA 1MG1A 2YICA 1HR0B 1PPJH 1WPXA 2ZE8A 4JI0B 3K79A 1NH2B 1ZWIC 1SESA 2EZOA 1N36O 4XBFA 3M99B 4CC6A 2HVJC 1RM1C 2UUCB 1OCZC 1EZJA 1S3JA 2YIBD 2H8PC 2OYQA 2Q7EA 4WFBV 2LP7A 2CUGA 5HFLA 3QO5A 4O4JA 1R6TA 2WLIA 4FLVA 1VQPV 4B3SB 1XNRB 1YI2V 2X0LA 5DECA 4I50A 4LF8B 4NTYA 1PNLA 3JATA 2Y69B 3IC7A 2JJ2G 3I55V 1IBLO 3ZN1A 1N0JA 1WNSA 3A0BZ 2RN9A 3U10A 5LP6C 4IHJA 2PY5A 3RT3C 1Q86W 1VF6A 3E8HA 4BIUA 2RQ6A 4ZI7A 4CH6A 4QJFB 2WLLA 2LQTA 1P49A 2FMLA 2A3QA 3CC7V 2WPDG 4YHHO 3FYIB 4EFEA 4QNHB 3AG3B 3Q4HA 4MW3A 4X1YB 1S5JA 4X9QA 1AILA 5B3SB 4X1KA 3CRAA 1HW7A 4TWKA 3RYIB 2E5LB 5KHHA 1DGSA 2V1DA 4H37A 3SR2C 1SF9A 2Z0AA 1E1RG 4O2BA 1N8RW 4Z1MG 3SYQA 1Y74B 3FFQA 3SYAA 1GN2A 5BMVB 1SS3A 1S76D 3DGEA 4PDVA 2QTOA 5L3GA 3SYCA 2BTOA 4TV8A 4DR5O 2M7WA 2UUBO 2ADQB 3IFXA 1YSCA 5LA6A 4EB6B 2Y0IA 2H3OA 1N33O 3CRQA 4DV5O 1QNMA 4W4LA 1YJNV 3T1CA 4X64O 2DN9A 3IGAC 1E1QG 3OFNG 3OTFA 1OCCC 3K06A 5FNVB 4G2KA 4XDKA 4MVMA 2ZM6O 1TUBA 1CEZA 3RVYA 3ZMSA 2P6JA 1S5LZ 1QVGU 1G8MA 5LGTA 1A32A 4JZGA 4JPRA 3HKBB 5K1PA 3THOA 1MSWD 3AG2B 4UV9A 5IY5C 4FLXA 4MVOA 3J81N 2R9IA 5CA1B 2K1EA 3OD4A 4AI8A 3OMAB 4TQFA 1Z5VA 2OTJV 4G28B 3UM7A 2UXCO 2AW9A 5GONB 4NTWA 4UV8A 4I9WA 4AILC 4DR6B 1GN3A 1OCRB 2M6YA 2R72A 4GZRB 2ZXWB 2B1GA 4GLXA 1BGYH 2Y0PA 2P67A 4CH5A 1N4CA 2PF4E 3MHHC 3SJCC 2KQXA 3TCUA 3U0ZA 4JI6O 3A2FA 1SQFA 5LMNB 2UXXA 4DR1B 1VQ5V 5D5QA 1K3EA 3E86A 4JV5B 1QBZA 3OTOB 5TISZ 5F2VO 3TETA 4LF4B 2YEVA 1BHAA 3VBBA 1P7GA 2KG7A 1US6A 2QWPB 1Q7YW 2IU3A 4UCOA 1F4NA 5KLVH 4DRXB 4U7NA 4UVBA 2NLJC 1R6NA 3JAKA 4BIOA 1VQ4V 1XI1A 5IYZA 4UCVA 3STZC 1YCIA 4EFBA 4O4LA 1BS3A 4O4HB 2XHBA 4LP8A 4J9YB 4DW1A 1CPYA 1JMKC 3ZCCA 2RJZA 3BRCA 3TGUH 4WFEA 2UUAB 4JI8B 3E22A 1XNQB 1FFXB 2YIAA 3K5MA 4DR7B 4Z2WA 3L73H 3UT5A 4JI2O 2FB5A 1KUQA 4JI3B 3OGIB 1B06A 3DXRA 4TT3G 4QPJA 1TUEB 1K8AW 3E89A 5FL7G 2QGNA 2HEPA 4BAYA 1IZ3A 2MW2B 1DLBA 1H2MA 4DV1O 3C3SA 1YTFB 4OPHA 2Q8VA 4JF3A 3JD1A 3RFRA 2QA4V 1I94B 3SYPA 1MSDA 5FPOA 4ZBMA 4JZ2A 5IYBO 1RSOB 4K8ZA 1GMGA 3N2GB 3E8FA 4B3RO 3ABLB 3EVKA 3F7VC 1V55B 3VQYA 4LFAO 2XAHA 3P32A 1QLEB 2UU9B 3QVNA 3OE7G 2ZE5A 2UXBB 3PJSK 3OMIB 3T4ZA 4HZ3A 1VQ9V 1M57B 4H13B 2ZIMA 1LUVA 2DYSC 4P30A 1AJQA 1NR1A 3CP1A 3K9AA 1RFYA 1Q82W 1FJGB 1VQLV 2QKCA 4UXNA 3KG2A 1IBKO 1Y6XA 5KAIZ 5JQGA 2LJ2A 3X2QC 4RUEA 1K92A 1V54C 4ZOLA 1JVMA 5E1AC 2WLKA 2XOKG 4MTGA 2IH1C 5KHGA 5LGUA 1Q8IA 3CWBH 5LHHA 2YUAA 1R3KC 2Q6AA 3CYOA 5DEDA 2GDSA 4ZIBA 4JI4O 4GUNA 2HJDA 5IJ0B 5J2TA 3AK1A 1S72V 5EBLC 3BA9A 3K03A 3W7WA 3HKCA 1PV0A 3JCZA 1EFRG 2YI9A 3APQA 3N2KA 3RW0A 4CS3A 3ZRSA 2CH7A 2P4VA 3ZHSA 1PNKA 4TOIA 3CHXA 4UCRA 3CE2A 4DW0A 2EIJC 1SC5B 3IAYA 4IL6Z 3BEHA 4YXWG 1XDCA 1YVWA 1K9MW 4DUYB 1N34B 4JYAB 2V7QG 1AJPA 4JI5O 3WFVA 4FLZA 2WWWA 4FLWA 2AHYA 2CTPA 1VIBA 4JYCA 5IJ9A 4JYYA 2ZR3A 4B7EA 1B04A 1PL0A 2RDCA 3CMAV 4DV3B 2K9PA 3S3XA 1L0LH 1UFIA 1JFFB 2DE0X 1FXHA 1VEWA 1VMGA 1Q6UA 5B1BC 5FPRA 3A8TA 1PP9H 4PA7A 4GX1A 4NTXA 3K57A 3WU2Z 1NTMH 3ASOB 4NR1A 3JSNA 3W7UA 1WP7A 4UCUA 2O57A 2DOSA 5EIBC 5LMUO 3CS5A 1FAFA 4HNAB 4FZ1A 2XASA 4Z1VA 1HDJA 1DTOA 1LNQA 2B5UA 2ZR2A 3CMEV 1M90W 1MNGA 2XT9A 3ZEDA 1UPGA 3H1JH 1V9PA 4O4IA 5LOVB 2Q4PA 3LDDA 3KZIZ 3LNMB 4CS4A 4DUZO 2FYUH 3ZRWA 3SYOA 3B40A 2X6AA 2BSKB 5BR8O 2GBOA 1YIJV 4LWSB 3ASNB 5CB4B 4OX9O 4LF6O 2EJRA 1K5QA 4B3MO 2AHZA 3WG7B 1N32O 2QWQB 2EIMC 1FD9A 2EINC 2JGUA 2N74A 3SJBC 1JQ0A 4K0KO 2R70A 2EILC 5D5PA 4L8JA 2H94A 3L71H 1SA0B 1Y4MA 4JI7B 3ZMTA 3RYIA 3ZHTA 3CCVV 2BOCC 2CTRA 2GTAA 3E83A 2N05A 4FZ0A 4MT8A 5LHGA 3ABMB 4DR3B 1S5HC 1HNWO 5BMVA 1HNXB 3CSXA 2VRZA 4G27B 4PI2A 1H2KA 1JA8A 1R1BA 2CTWA 1Q90D 5JVDA 1XMQO 3ABKB 3JAMN 3OEEG 1AR4A 4W4KA 4YJ2B 3RGBA 2ZE7A 3T1HO 2Y4TA 1IVSA 5FNVA 4BWAA 2HJFC 5JWPA 5B5EZ 1I7FA 4R7CA 1AR1B 5DN6G 4JAAA 5IWAO 1FXKB 5EC2C 2EZPA 1U96A 1H2NA 3OW2U 1YJ9V 4NXNO 4UFZA 3ABUA 1BQ0A 2IW5A 4PJ0Z 3UCSC 2NN4A 2F4VB 3HKBA 4LF5B 2QE7G 3LNNA 4KHPB 5CA1A 2XNDG 4DV0O 5A2QN 1B3QA 1SQBH 5JJJB 3AK2A 5L3DA 4QE9A 5B1AC 1CP9A 1I08A 1ROPA 2LGQA 4I0XB 3HKEA 1KMIZ 1H8HG 2RNBA 5GONA 2CTQA 2Y69C 1KU9A 3BA8A 4ICGA 2QM7A 2E3CA 4IGGA 1IBMO 4FIPC 1HR0O 1BSMA 3HB3B 4H33A 4TSFG 2A9HA 2E74B 1Z2GA 2Q68A 4UVAA 3UO2A 1TA8A 1MZFA 2QTSA 3SPJA 4J7ZA 1N36B 2ZINA 3EFFK 3AG4B 1VP7A 1XNRO 1XREA 2KKWA 1IX9A 3PN1A 3P3NA 1NI8A 1PD3A 4J9ZB 3JAWB 4RQEA 1H2SB 1H8EG 4MVRA 3ML0A 2LFSA 4R50A 1WLEA 4DRXA 3L75H 1VQ6V 1BCCH 4F6RB 1IBLB 3ZHRA 4MSWC 3RYHB 5JJNB 2WA3A 3W7XA 1P4RA 4D7TA 4O4HA 5A9GA 1FYJA 2W0XA 3TXQA 1G4YB 3FD9A 2R9AA 3ABTA 3FB8C 1ZL8B 4MS2A 2IJJA 5GTIZ 3CJHB 4BW9A 4X1IB 2VWJA 4YHHB 5J2UA 5KA5A 4LCUC 3CRMA 1FFXA 3QF7A 2ZDIC 2E5LO 3OAAG 1XMOO 3LSUA 2DWDC 1EN5A 5L3EA 1ZUQA 1VQOV 2Q67A 3ZHUA 5CN0A 3A0HZ 4DO2A 3L72H 1T5EA 4LFCO 1M9NA 2DQ0A 3D3IA 3APOA 4FFBB 3K5NA 3B77A 1JCHA 4O2AB 2DJVA 3CXHF 2EBOA 4GKKO 4DR5B 3MAQA 3CRRA 2UUBB 2FTKA 1OCRC 3I5DA 1RSOA 4YY3O 3N2GA 2YXYA 5JH7A 4DV6O 4QPKA 4DV5B 2ZXWC 1J5EO 4NXMO 3T1YB 4X64B 3VQWA 1D5AA 1WB7A 2C2AA 3K3WA 1IXBA 1KP3A 2A7WA 3P30A 3W7SA 4QE7A 4PA9A 2ITDC 4U7OA 1QHTA 3OT7A 1KQSU 4DV7O 3ZHVA 1ORQC 2OCCB 2Q5ZA 3VQXA 1Q5OA 3MHSC 3O9OA 3JALB 2VQFO 1GKFA 2HKOA 1WAZA 3VQVA 4GCZA 4PV1B 4WBNB 3J80N 2AZ0A 4PA3A 5C8YB 3BPZA 3T2MA 4DR6O 2YI8A 2UXCB 1WP8A 1NVPB 1R73A 1CXZB 1VF6C 2IJIA 4CBCA 4PA6A 2EX3A 2HG5C 1F7YA 4RUFA 2UXDO 2JJ1G 3F5TA 4I9QA 1OCCB 1M56C 3QNEA 2VQEB 3B09A 2ZIOA 5IJ0A 3RYCB 5IDJA 3CPWU 1OCOC 3AG7A 2BCCH 4JI6B 1XOUA 4NYKA 5EK0A 5GW7A 3ICXA 3K58A 1K7DA 1YZBA 2PGGA 4O4JB 4J7KA 3GWOA 5KUMA 1NR7A 3JARB 1JJ2U 3JASB 3SDLA 4RO2A 1SERA 1G6UA 4J41A 1THZA 3L70H 3HKDB 3QO8A 3K59A 2OIEA 1S77D 3ZJZA 2QKAA 4CH4A 5H5NA 3ETEA 4X8AA 3RN4A 3LUTB 1VQ8V 4F4LA 3M8AA 4TQDA 4TV9B 4X62O 1BT8A 2WSSG 5H6RA 3ABLC 1NTKH 1L0NH 1V55C 1QR9A 3Q4HB 4U3JA 1GN4A 2UUAO 1JFFA 2CE4A 4OPAA 2P7TC 3AG1B 2WAMA 4XDLA 1D2DA 4LNUB 4EEQA 4JAUA 5H6QA 4B08A 1M57C 4LF9O 2QJ1A 1XHZA 1Y67A 1I0HA 4O2BB 2N04A 1J95A 3P3PA 4HNAA 1PM9A 1AI5A 2F66C 3UKMA 1R6KA 1FS0G 2WLJA 4DV1B 3D3QA 4WFHA 1FKAO 3ZBHA 3KCXA 4FK5C 1Q81W 2ZCEA 4DR2O 2IJKA 1EN6A 3A0RA 3RYFB 1Q3EA 2A79B 2HHHO 2YXLA 2UU9O 2ARHA 4B3RB 1Q6HA 4LFAB 5LOVA 5CA0B 3ETGA 3JCUZ 3C3TA 3QG5A 4HAMA 2IU0A 4ZHQB 1KBHA 2BSKA 2Q0AA 1JPXA 2X7RB 2YC0A 4LWSA 5CB4A 4JTCB 4WFFA 1SRYA 4R8CA 4I55B 4TUYB 2CGNA 3S3WA 3G67A 2BOBC 2IBZH 4UCTA 1SZTA 4IIJB 1FJGO 1FFTB 2BTQB 5KHJA 2Q7GA 2PYJA 1R3IC 1PKXA 4OGQB 4GKJO 3CX5F 4GT1A 1I5XA 1SA0A 2JVDA 4MVUA 4R6ZA 1IBKB 3FB6C 5H2FZ 1NS1A 2GTSA 3FAVB 5EYPB 1OJHA 4PI0A 4F6EA 2IJHA 1QVFU 3MDSA 4K35A 1GO3F 1AI7A 1ZX3A 4JI4B 2XAFA 3HPLC 4YJ2A 3CCJV 3H1IH 4DR4O 1HNZO 3QO7A 3TXSA 5IYDO 3FKSG 1LR1A 4JGSA 3LDCA 1MZEA 4X88A 4KFMA 1NTZH 2A06H 2YEVB 3LSSA 5BXZA 3J7AU 1FXKA 1SQPH 3ZMZA 4CZZA 3EHBB 4OXSA 3CCMV 4JI5B 2PI5A 4PA4A 1W0JG 3R66A 4RWUA 2KSDA 4Q20A 4B3TO 2YS8A 4FVMA 4I5SA 4LC1A 1H2LA 4I0XA 2YXHA 4BIZA 3E8BA 3JSLA 1NBMG 3F5WC 1VQNV 1NKDA 2DWEC 3K0DA 1K73W 3SPCA 1R3JC 3O65A 3TJTA 4PDRA 1AR5A 1VARA 2WLMA 5KHKA 2X6BA 1SZXA 4AQYO 4MTFA 2RMKB 2XAQA 3F7YC 3D8CA 5J9PC 3ASNC 4GX2A 4LF7O 4PD4F 1WA8B 3AK3A 4D6TH 1GH6A 4CH3A 4DV2O 4JYBA 3HR0A 2LW7A 3K04A 4JTAB 5LMUB 4L87A 1KC8W 1NJIW 2WLHA 1Y76B 5EIBD 2A0LA 3H9VA 4GX0A 2DYRB 1KYOF 4E4EA 5L3CA 2IH3C 1O9GA 2LO1A 1BHBA 3JAWA 2EJ7A 1HP8A 4ASUG 5FLXN 3H1KH 1GM8A 1VF7A 2F43G 4F6RA 1EBOA 4J11A 1COWG 4UCSA 3RYHA 4P9PA 3BHPA 1BZKA 4X1YA 3G71V 5BR8B 4NKGB 2B9ZA 1ZL8A 4OX9B 4LF6B 3CJHA 4X1IA 4B3MB 2BE3A 3G80A 4LFBO 1N32B 4E2LA 1FXKC 2QWRB 4PHZA 2JS3A 1Y74A 4K0KB 2WA4A 5LYJB 1H2GA 3FX7A 5CA3A 4MVSA 2F1MA 3VOUA 3K08A 2FKXA 5EZYB 3JYCA 4X66O 3DSQA 4KL1A 4J80A 4JI1B 1FXVA 3RBZA 4B7KA 1HNWB 5KA6A 3CD6V 5KUKA 2YSUB 1WB8A 4FFBA 3GWKC 4EB6A 3BY6A 2Y48A 5J2TB 3G6BA 1QU7A 1GK9A 1XMQB 5E79Z 1TVKB 2ZNIA 1O9HA 1BQZA 1N0NA 1H38A 1QQCA 5KX5B 5L3BA 5BY1A 2PYLA 3E8GA 4QGPA 2EILB 1YXBA 5IWAB 3SJQC 4JASA 2KB1A 1W2BU 4DV4O 4X65O 4NXNB 2JGDB 4EKWA 3WB0A 5CBGA 1NH2D 3CCLV 5ITZB 3JALA 3ZIAG 4DV0B 4LBEC 3AG4C 4WBNA 1AB3A 1RPOA 1OHHG 4Q6GA 3CRCA 5C8YA 1M1KW 1PL4A 5LXTB 1YEWA 1XQ8A 1F23A 1KECA 3STLC 2DW4A 1EM1A 4JI0O 5CBHA 3CCRV 2E76B 1IDSA 2PTMA 5IE9A 1IBMB 1ZAUA 2UUCO 2D2CB 2GHYA 1XL4A 3UO3A 2PZSA 3AG3C 3RYCA 1AI6A 1OV9A 3CB2A 4BR6A 1XL6A 5B3SC 2Q7HA 3E35A 2VS0A 4B3SO 3LDEA 4LF8O 4UVCA 4IYIA 5C93A 2EIKB 4DK1A 3FB7C 5B1AB 2ZQMA 5K1XA 5L3FA 5LHIA 2ZKOA 3SGIA 3TK1A 3JARA 1SQVH 5KHIA 3JASA 1KKDA 4O4IB 3ZX6A 4P2ZA 2ZD9A 3DC6A 1KB9F 2ADPA 3HKDA 3R65A 3ZRWB 2CDYA 1NT2B 5IYCO 1MA1A 2MK3A 5KMGB 1RM1B 1Z5WA 3ZMUA 1OCZB 1Y66A 4JTDB 1KP2A 2P22C 3OUFA 1EZVH 4TV9A 1GTOA 3I56V 4UB6Z 2YDEA 4DYLA 3L74H 5GTHZ 4RQFA 5EBWC 1JR9A 3AG2C 1IXMA 3JD0A 3B2EE 4LNUA 3OM3B 2XAGA 2NR5A 1XMOB 2ATKC 2OCCC 1TGOA 5LP6B 2WLNA 1YF2A 4I7ZB 1ZTEA 2L6LA 4LFCB 2W6JG 4FM1A 3ZHQA 5JVDB 1XEQA 1N33B 3OUSA 3M7MX 3G4SV 4LH7A 1GM7A 2JEXA 3KCYA 4GKKB 4YJ3B 3T1YO 3RYFA 2ZM6B 2QEXV 1PNMA 3SPIA 4YY3B 4X20B 4DV6B 1F4MA 1J5EB 1RP3B 4NXMB 2GUZB 3IJ4A 5CA0A 1M4UA 2UXNA 4IT5A 1E79G 1URFA 4ZHQA 1JJOA 2QSAA 3BCCH 5B1OA 1AP6A 1NVPD 1NQTA 1VQKV 2QWNB 3NXSA 1K97A 2P4KA 4DV7B 2LGWA 3ZMVA 4I55A 1WPBA 4TUYA 4U3FH 1X4TA 4I4TB 4ZKIA 4IIJA 2OCHA 2OIGA 2BTQA 2VQFB 5LL6Y 2Q73A 5IT9N 4MW8A 1MABG 4WCEV 4UB8Z 3HKEB 2QWOB 1MMMA 2IM9A 1BL8A 3CCQV 2HVKC 3RVZA 5DM6V 2VQEO 3FAVA 5EYPA 2X6CA 5LMNO 2UXDB 4WFAV 4HYOA 2CK3G 4DR1O 4JV5O 3OTOO 4FMTA 1KKCA 1SQQH 2NNUA 5IY5B 1K5SA 4QIWF 3ZN0A 1P7BA 4DXWA 4LF4O 2WLIB 1GM9A 2RCVA 2ZNJA 4GX5A 5LBQA 2ZE6A 4I50B 5KAFZ 3AG1C 3JATB 2P5OA 3WB2A 3D36A 1ZLZA 4FM0A 4IHJB 5H9CA 1NU1H 2F23A 3UQ8A 1WN7A 4ZI7B 2WLLB 5B1NA 4UUJC 1YITV 4H44B 1M56B 2Q0OC 1QLEC 4JI8O 1XNQO 1LUWA 1XBLA 4DR7O 1OCOB 1YTFD 3BFRA 4X62B 1Q6IA 4X1KB 5EBMC 3W7TA 2HLDG 1DF4A 5J2UB 4JI3O 4JI2B 2OT5A 3IC9A 1SKVA 1YDXA 2EULA 1YJWV 2V4DA 1NZ6A 1P84F 1BE3H 4MVQA 3H1HH 1GRJA 4LF9B 3E2EA 3ETQA 2W0FC 1WA8A 4TV8B 1F51A 2OWOA 1JX9A 1I94O 5LA6B 1VF5B 2XUMA 2GSMB 3BABA 1I5YA 1D5NA 1L8DA 1Y76A 3C90A 2P90A 1MOFA 1R3LC 2PI4A 1TUBB 4H0LB 2JRIA 2UXBO 3ZS8C 4KP4A 1UJWB 5JH7B 2DMXA 3OEHG 4KUMA 4DR2B 2JDIG 3B8NA 1K4CC 3SJAC 4NB5A 3GB7C 4GYCB 2HHHB 1K33A 4KXRA 4PELA 5BZBA 2L35A 2P06A 1EN4A 3BAAA 3SPGA 1IURA 3OMNB 2HFEC 1ZSPA 4LH6A 3L9DA 4N23A 4NVPA 3CXCU 3D36C 4AHCA 1K4DC 4RAIA 2ITCC 1QLNA 2Z3YA 4GKJB 5LYJA 1XILA 2D3OW 2FL4A 3AEIA 1XHXA 4FLTA 5EZYA 3DTUB 1OZ0A 4FM2A 2LW1A 1TAEA 4LR3A 1JOYA 2JS5A 2QR4A 5JCOA 4C7UA 1Q43A 4FFKA 2DYSB 1ENVA 4A5UB 1TVKA 1X59A 3LSQA 1RPRA 4DUYO 4DR4B 1HNZB 1N34O 4JYAO 1G1XB 1U97A 2KG7B 4P9OA 3X2QB 3ASOC 1KD1W 3QTCA 1V54B 1AI4A 5KX5A 2YIDA 4J42A 2E75B 3CCSV 1SQGA 4JAVA 1XUQA 3JAKB 2XAJA 1BMFG 2JGDA 5IYZB 4O4LB 1DF5A 4DV3O 5ITZA 5JJEB 1VQ7V 2PUSA 2CGOA 4WFGA 1AJNA 2Y4UA 2QDOA 4FJCC 4B3TB 3JD2A 2DYRC 2AZ2A 4IYHA 5LXTA 4YIOA 3E22B 3CC2V 1DK1A 4DK0A 5AG2A 3UT5B 2R9RB
chains in the Genus database with same CATH topology
1NTZH 2A06H 3L75H 4U3FH 1P84F 3L73H 2FYUH 1NTKH 1BCCH 1L0NH 3L71H 4PD4F 1EZVH 3H1KH 1SQPH 1BE3H 1PPJH 3CXHF 3H1LH 3H1HH 1BGYH 2BCCH 1SQVH 3CX5F 4D6TH 3CWBH 1PP9H 3L70H 1SQQH 3H1IH 1NTMH 1SQBH 1KB9F 3L74H 3BCCH 3TGUH 3H1JH 5KLVH 1NU1H 3L72H 1SQXH 2IBZH 1KYOF 1L0LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ H;  2A06 H;  3L75 H;  4U3F H;  1P84 F;  3L73 H;  2FYU H;  1NTK H;  1BCC H;  1L0N H;  3L71 H;  4PD4 F;  1EZV H;  3H1K H;  1SQP H;  1BE3 H;  1PPJ H;  3CXH F;  3H1L H;  3H1H H;  1BGY H;  2BCC H;  1SQV H;  3CX5 F;  4D6T H;  3CWB H;  1PP9 H;  3L70 H;  1SQQ H;  3H1I H;  1NTM H;  1SQB H;  1KB9 F;  3L74 H;  3BCC H;  3TGU H;  3H1J H;  5KLV H;  1NU1 H;  3L72 H;  1SQX H;  2IBZ H;  1KYO F;  1L0L H; 
#chains in the Genus database with same CATH topology
 2EIJ B;  5CMU A;  4U3J B;  3MD0 A;  2GV9 A;  3DXR B;  5LGN A;  1VQM V;  5CBF A;  1GAX A;  2W6I G;  2F95 B;  3NR7 A;  4AQY B;  3WG7 C;  1AP5 A;  3ZRV A;  3H01 A;  3CEI A;  4LF7 B;  4K8X A;  1B6Q A;  4MTO A;  1HWY A;  4DV2 B;  1K34 A;  4FPP A;  3FYE B;  2ODM A;  4WF9 V;  2AXT Z;  1QCE A;  3ABM C;  3OGC C;  4CS2 A;  1ARO P;  2QKS A;  3N27 A;  3CC4 V;  2YIB A;  3ABK C;  5B1B B;  4J7J A;  2Q69 A;  4DUZ B;  1AVM A;  3K5O A;  5JCO C;  2OTL V;  2ILM A;  3FB5 C;  4PDM A;  5EC1 C;  3WB1 A;  2Z5U A;  5KMG A;  5HFM A;  2AGA A;  3SPH A;  3EXA A;  2VWK A;  2CAZ C;  2HP8 A;  4JI7 O;  3B4S A;  2Q9L A;  3JD3 A;  5JQG B;  1YHQ V;  4ZOL B;  4DR3 O;  3K0G A;  1HNX O;  3G6E V;  4LFB B;  4ABM A;  3U11 A;  3GVM A;  3RWR D;  3K9S A;  4MTX A;  5LP6 A;  4K3A A;  2QM4 A;  4O2A A;  4JI1 O;  3DC5 A;  4X89 A;  4X66 B;  5B66 Z;  4FLY A;  3HKC B;  4XDJ A;  3JD4 A;  1W59 A;  3N2K B;  2LFR A;  3OR6 C;  2F93 B;  1M5I A;  2CH7 B;  1WJZ A;  1S0V A;  2XTA A;  3T1H B;  3H1L H;  3BVO A;  3T4D A;  1FPO A;  2EIM B;  2EIN B;  2QM8 A;  3K5L A;  1L1F A;  2HR3 A;  2JEU A;  1W0K G;  4YJ3 A;  4PDL A;  4MVZ A;  2ZT9 B;  3CCE V;  1M93 A;  4N21 A;  4X20 A;  2B1I A;  4J10 A;  2F4V O;  2GUZ A;  4LF5 O;  3OR7 C;  1SET A;  1SQX H;  4KHP O;  2DQ3 A;  2G38 A;  2ZDI A;  3ETD A;  1QR8 A;  4HBN A;  4CC5 A;  1GN6 A;  4BW5 A;  5IJ9 B;  4DV4 B;  3KKY A;  4X65 B;  3B8M A;  4I4T A;  2EIK C;  4YIP A;  2ETN A;  2JK5 C;  4FLU A;  2JIZ G;  3ZRX A;  3CCU V;  4D7S A;  1MG1 A;  2YIC A;  1HR0 B;  1PPJ H;  1WPX A;  2ZE8 A;  4JI0 B;  3K79 A;  1NH2 B;  1ZWI C;  1SES A;  2EZO A;  1N36 O;  4XBF A;  3M99 B;  4CC6 A;  2HVJ C;  1RM1 C;  2UUC B;  1OCZ C;  1EZJ A;  1S3J A;  2YIB D;  2H8P C;  2OYQ A;  2Q7E A;  4WFB V;  2LP7 A;  2CUG A;  5HFL A;  3QO5 A;  4O4J A;  1R6T A;  2WLI A;  4FLV A;  1VQP V;  4B3S B;  1XNR B;  1YI2 V;  2X0L A;  5DEC A;  4I50 A;  4LF8 B;  4NTY A;  1PNL A;  3JAT A;  2Y69 B;  3IC7 A;  2JJ2 G;  3I55 V;  1IBL O;  3ZN1 A;  1N0J A;  1WNS A;  3A0B Z;  2RN9 A;  3U10 A;  5LP6 C;  4IHJ A;  2PY5 A;  3RT3 C;  1Q86 W;  1VF6 A;  3E8H A;  4BIU A;  2RQ6 A;  4ZI7 A;  4CH6 A;  4QJF B;  2WLL A;  2LQT A;  1P49 A;  2FML A;  2A3Q A;  3CC7 V;  2WPD G;  4YHH O;  3FYI B;  4EFE A;  4QNH B;  3AG3 B;  3Q4H A;  4MW3 A;  4X1Y B;  1S5J A;  4X9Q A;  1AIL A;  5B3S B;  4X1K A;  3CRA A;  1HW7 A;  4TWK A;  3RYI B;  2E5L B;  5KHH A;  1DGS A;  2V1D A;  4H37 A;  3SR2 C;  1SF9 A;  2Z0A A;  1E1R G;  4O2B A;  1N8R W;  4Z1M G;  3SYQ A;  1Y74 B;  3FFQ A;  3SYA A;  1GN2 A;  5BMV B;  1SS3 A;  1S76 D;  3DGE A;  4PDV A;  2QTO A;  5L3G A;  3SYC A;  2BTO A;  4TV8 A;  4DR5 O;  2M7W A;  2UUB O;  2ADQ B;  3IFX A;  1YSC A;  5LA6 A;  4EB6 B;  2Y0I A;  2H3O A;  1N33 O;  3CRQ A;  4DV5 O;  1QNM A;  4W4L A;  1YJN V;  3T1C A;  4X64 O;  2DN9 A;  3IGA C;  1E1Q G;  3OFN G;  3OTF A;  1OCC C;  3K06 A;  5FNV B;  4G2K A;  4XDK A;  4MVM A;  2ZM6 O;  1TUB A;  1CEZ A;  3RVY A;  3ZMS A;  2P6J A;  1S5L Z;  1QVG U;  1G8M A;  5LGT A;  1A32 A;  4JZG A;  4JPR A;  3HKB B;  5K1P A;  3THO A;  1MSW D;  3AG2 B;  4UV9 A;  5IY5 C;  4FLX A;  4MVO A;  3J81 N;  2R9I A;  5CA1 B;  2K1E A;  3OD4 A;  4AI8 A;  3OMA B;  4TQF A;  1Z5V A;  2OTJ V;  4G28 B;  3UM7 A;  2UXC O;  2AW9 A;  5GON B;  4NTW A;  4UV8 A;  4I9W A;  4AIL C;  4DR6 B;  1GN3 A;  1OCR B;  2M6Y A;  2R72 A;  4GZR B;  2ZXW B;  2B1G A;  4GLX A;  1BGY H;  2Y0P A;  2P67 A;  4CH5 A;  1N4C A;  2PF4 E;  3MHH C;  3SJC C;  2KQX A;  3TCU A;  3U0Z A;  4JI6 O;  3A2F A;  1SQF A;  5LMN B;  2UXX A;  4DR1 B;  1VQ5 V;  5D5Q A;  1K3E A;  3E86 A;  4JV5 B;  1QBZ A;  3OTO B;  5TIS Z;  5F2V O;  3TET A;  4LF4 B;  2YEV A;  1BHA A;  3VBB A;  1P7G A;  2KG7 A;  1US6 A;  2QWP B;  1Q7Y W;  2IU3 A;  4UCO A;  1F4N A;  5KLV H;  4DRX B;  4U7N A;  4UVB A;  2NLJ C;  1R6N A;  3JAK A;  4BIO A;  1VQ4 V;  1XI1 A;  5IYZ A;  4UCV A;  3STZ C;  1YCI A;  4EFB A;  4O4L A;  1BS3 A;  4O4H B;  2XHB A;  4LP8 A;  4J9Y B;  4DW1 A;  1CPY A;  1JMK C;  3ZCC A;  2RJZ A;  3BRC A;  3TGU H;  4WFE A;  2UUA B;  4JI8 B;  3E22 A;  1XNQ B;  1FFX B;  2YIA A;  3K5M A;  4DR7 B;  4Z2W A;  3L73 H;  3UT5 A;  4JI2 O;  2FB5 A;  1KUQ A;  4JI3 B;  3OGI B;  1B06 A;  3DXR A;  4TT3 G;  4QPJ A;  1TUE B;  1K8A W;  3E89 A;  5FL7 G;  2QGN A;  2HEP A;  4BAY A;  1IZ3 A;  2MW2 B;  1DLB A;  1H2M A;  4DV1 O;  3C3S A;  1YTF B;  4OPH A;  2Q8V A;  4JF3 A;  3JD1 A;  3RFR A;  2QA4 V;  1I94 B;  3SYP A;  1MSD A;  5FPO A;  4ZBM A;  4JZ2 A;  5IYB O;  1RSO B;  4K8Z A;  1GMG A;  3N2G B;  3E8F A;  4B3R O;  3ABL B;  3EVK A;  3F7V C;  1V55 B;  3VQY A;  4LFA O;  2XAH A;  3P32 A;  1QLE B;  2UU9 B;  3QVN A;  3OE7 G;  2ZE5 A;  2UXB B;  3PJS K;  3OMI B;  3T4Z A;  4HZ3 A;  1VQ9 V;  1M57 B;  4H13 B;  2ZIM A;  1LUV A;  2DYS C;  4P30 A;  1AJQ A;  1NR1 A;  3CP1 A;  3K9A A;  1RFY A;  1Q82 W;  1FJG B;  1VQL V;  2QKC A;  4UXN A;  3KG2 A;  1IBK O;  1Y6X A;  5KAI Z;  5JQG A;  2LJ2 A;  3X2Q C;  4RUE A;  1K92 A;  1V54 C;  4ZOL A;  1JVM A;  5E1A C;  2WLK A;  2XOK G;  4MTG A;  2IH1 C;  5KHG A;  5LGU A;  1Q8I A;  3CWB H;  5LHH A;  2YUA A;  1R3K C;  2Q6A A;  3CYO A;  5DED A;  2GDS A;  4ZIB A;  4JI4 O;  4GUN A;  2HJD A;  5IJ0 B;  5J2T A;  3AK1 A;  1S72 V;  5EBL C;  3BA9 A;  3K03 A;  3W7W A;  3HKC A;  1PV0 A;  3JCZ A;  1EFR G;  2YI9 A;  3APQ A;  3N2K A;  3RW0 A;  4CS3 A;  3ZRS A;  2CH7 A;  2P4V A;  3ZHS A;  1PNK A;  4TOI A;  3CHX A;  4UCR A;  3CE2 A;  4DW0 A;  2EIJ C;  1SC5 B;  3IAY A;  4IL6 Z;  3BEH A;  4YXW G;  1XDC A;  1YVW A;  1K9M W;  4DUY B;  1N34 B;  4JYA B;  2V7Q G;  1AJP A;  4JI5 O;  3WFV A;  4FLZ A;  2WWW A;  4FLW A;  2AHY A;  2CTP A;  1VIB A;  4JYC A;  5IJ9 A;  4JYY A;  2ZR3 A;  4B7E A;  1B04 A;  1PL0 A;  2RDC A;  3CMA V;  4DV3 B;  2K9P A;  3S3X A;  1L0L H;  1UFI A;  1JFF B;  2DE0 X;  1FXH A;  1VEW A;  1VMG A;  1Q6U A;  5B1B C;  5FPR A;  3A8T A;  1PP9 H;  4PA7 A;  4GX1 A;  4NTX A;  3K57 A;  3WU2 Z;  1NTM H;  3ASO B;  4NR1 A;  3JSN A;  3W7U A;  1WP7 A;  4UCU A;  2O57 A;  2DOS A;  5EIB C;  5LMU O;  3CS5 A;  1FAF A;  4HNA B;  4FZ1 A;  2XAS A;  4Z1V A;  1HDJ A;  1DTO A;  1LNQ A;  2B5U A;  2ZR2 A;  3CME V;  1M90 W;  1MNG A;  2XT9 A;  3ZED A;  1UPG A;  3H1J H;  1V9P A;  4O4I A;  5LOV B;  2Q4P A;  3LDD A;  3KZI Z;  3LNM B;  4CS4 A;  4DUZ O;  2FYU H;  3ZRW A;  3SYO A;  3B40 A;  2X6A A;  2BSK B;  5BR8 O;  2GBO A;  1YIJ V;  4LWS B;  3ASN B;  5CB4 B;  4OX9 O;  4LF6 O;  2EJR A;  1K5Q A;  4B3M O;  2AHZ A;  3WG7 B;  1N32 O;  2QWQ B;  2EIM C;  1FD9 A;  2EIN C;  2JGU A;  2N74 A;  3SJB C;  1JQ0 A;  4K0K O;  2R70 A;  2EIL C;  5D5P A;  4L8J A;  2H94 A;  3L71 H;  1SA0 B;  1Y4M A;  4JI7 B;  3ZMT A;  3RYI A;  3ZHT A;  3CCV V;  2BOC C;  2CTR A;  2GTA A;  3E83 A;  2N05 A;  4FZ0 A;  4MT8 A;  5LHG A;  3ABM B;  4DR3 B;  1S5H C;  1HNW O;  5BMV A;  1HNX B;  3CSX A;  2VRZ A;  4G27 B;  4PI2 A;  1H2K A;  1JA8 A;  1R1B A;  2CTW A;  1Q90 D;  5JVD A;  1XMQ O;  3ABK B;  3JAM N;  3OEE G;  1AR4 A;  4W4K A;  4YJ2 B;  3RGB A;  2ZE7 A;  3T1H O;  2Y4T A;  1IVS A;  5FNV A;  4BWA A;  2HJF C;  5JWP A;  5B5E Z;  1I7F A;  4R7C A;  1AR1 B;  5DN6 G;  4JAA A;  5IWA O;  1FXK B;  5EC2 C;  2EZP A;  1U96 A;  1H2N A;  3OW2 U;  1YJ9 V;  4NXN O;  4UFZ A;  3ABU A;  1BQ0 A;  2IW5 A;  4PJ0 Z;  3UCS C;  2NN4 A;  2F4V B;  3HKB A;  4LF5 B;  2QE7 G;  3LNN A;  4KHP B;  5CA1 A;  2XND G;  4DV0 O;  5A2Q N;  1B3Q A;  1SQB H;  5JJJ B;  3AK2 A;  5L3D A;  4QE9 A;  5B1A C;  1CP9 A;  1I08 A;  1ROP A;  2LGQ A;  4I0X B;  3HKE A;  1KMI Z;  1H8H G;  2RNB A;  5GON A;  2CTQ A;  2Y69 C;  1KU9 A;  3BA8 A;  4ICG A;  2QM7 A;  2E3C A;  4IGG A;  1IBM O;  4FIP C;  1HR0 O;  1BSM A;  3HB3 B;  4H33 A;  4TSF G;  2A9H A;  2E74 B;  1Z2G A;  2Q68 A;  4UVA A;  3UO2 A;  1TA8 A;  1MZF A;  2QTS A;  3SPJ A;  4J7Z A;  1N36 B;  2ZIN A;  3EFF K;  3AG4 B;  1VP7 A;  1XNR O;  1XRE A;  2KKW A;  1IX9 A;  3PN1 A;  3P3N A;  1NI8 A;  1PD3 A;  4J9Z B;  3JAW B;  4RQE A;  1H2S B;  1H8E G;  4MVR A;  3ML0 A;  2LFS A;  4R50 A;  1WLE A;  4DRX A;  3L75 H;  1VQ6 V;  1BCC H;  4F6R B;  1IBL B;  3ZHR A;  4MSW C;  3RYH B;  5JJN B;  2WA3 A;  3W7X A;  1P4R A;  4D7T A;  4O4H A;  5A9G A;  1FYJ A;  2W0X A;  3TXQ A;  1G4Y B;  3FD9 A;  2R9A A;  3ABT A;  3FB8 C;  1ZL8 B;  4MS2 A;  2IJJ A;  5GTI Z;  3CJH B;  4BW9 A;  4X1I B;  2VWJ A;  4YHH B;  5J2U A;  5KA5 A;  4LCU C;  3CRM A;  1FFX A;  3QF7 A;  2ZDI C;  2E5L O;  3OAA G;  1XMO O;  3LSU A;  2DWD C;  1EN5 A;  5L3E A;  1ZUQ A;  1VQO V;  2Q67 A;  3ZHU A;  5CN0 A;  3A0H Z;  4DO2 A;  3L72 H;  1T5E A;  4LFC O;  1M9N A;  2DQ0 A;  3D3I A;  3APO A;  4FFB B;  3K5N A;  3B77 A;  1JCH A;  4O2A B;  2DJV A;  3CXH F;  2EBO A;  4GKK O;  4DR5 B;  3MAQ A;  3CRR A;  2UUB B;  2FTK A;  1OCR C;  3I5D A;  1RSO A;  4YY3 O;  3N2G A;  2YXY A;  5JH7 A;  4DV6 O;  4QPK A;  4DV5 B;  2ZXW C;  1J5E O;  4NXM O;  3T1Y B;  4X64 B;  3VQW A;  1D5A A;  1WB7 A;  2C2A A;  3K3W A;  1IXB A;  1KP3 A;  2A7W A;  3P30 A;  3W7S A;  4QE7 A;  4PA9 A;  2ITD C;  4U7O A;  1QHT A;  3OT7 A;  1KQS U;  4DV7 O;  3ZHV A;  1ORQ C;  2OCC B;  2Q5Z A;  3VQX A;  1Q5O A;  3MHS C;  3O9O A;  3JAL B;  2VQF O;  1GKF A;  2HKO A;  1WAZ A;  3VQV A;  4GCZ A;  4PV1 B;  4WBN B;  3J80 N;  2AZ0 A;  4PA3 A;  5C8Y B;  3BPZ A;  3T2M A;  4DR6 O;  2YI8 A;  2UXC B;  1WP8 A;  1NVP B;  1R73 A;  1CXZ B;  1VF6 C;  2IJI A;  4CBC A;  4PA6 A;  2EX3 A;  2HG5 C;  1F7Y A;  4RUF A;  2UXD O;  2JJ1 G;  3F5T A;  4I9Q A;  1OCC B;  1M56 C;  3QNE A;  2VQE B;  3B09 A;  2ZIO A;  5IJ0 A;  3RYC B;  5IDJ A;  3CPW U;  1OCO C;  3AG7 A;  2BCC H;  4JI6 B;  1XOU A;  4NYK A;  5EK0 A;  5GW7 A;  3ICX A;  3K58 A;  1K7D A;  1YZB A;  2PGG A;  4O4J B;  4J7K A;  3GWO A;  5KUM A;  1NR7 A;  3JAR B;  1JJ2 U;  3JAS B;  3SDL A;  4RO2 A;  1SER A;  1G6U A;  4J41 A;  1THZ A;  3L70 H;  3HKD B;  3QO8 A;  3K59 A;  2OIE A;  1S77 D;  3ZJZ A;  2QKA A;  4CH4 A;  5H5N A;  3ETE A;  4X8A A;  3RN4 A;  3LUT B;  1VQ8 V;  4F4L A;  3M8A A;  4TQD A;  4TV9 B;  4X62 O;  1BT8 A;  2WSS G;  5H6R A;  3ABL C;  1NTK H;  1L0N H;  1V55 C;  1QR9 A;  3Q4H B;  4U3J A;  1GN4 A;  2UUA O;  1JFF A;  2CE4 A;  4OPA A;  2P7T C;  3AG1 B;  2WAM A;  4XDL A;  1D2D A;  4LNU B;  4EEQ A;  4JAU A;  5H6Q A;  4B08 A;  1M57 C;  4LF9 O;  2QJ1 A;  1XHZ A;  1Y67 A;  1I0H A;  4O2B B;  2N04 A;  1J95 A;  3P3P A;  4HNA A;  1PM9 A;  1AI5 A;  2F66 C;  3UKM A;  1R6K A;  1FS0 G;  2WLJ A;  4DV1 B;  3D3Q A;  4WFH A;  1FKA O;  3ZBH A;  3KCX A;  4FK5 C;  1Q81 W;  2ZCE A;  4DR2 O;  2IJK A;  1EN6 A;  3A0R A;  3RYF B;  1Q3E A;  2A79 B;  2HHH O;  2YXL A;  2UU9 O;  2ARH A;  4B3R B;  1Q6H A;  4LFA B;  5LOV A;  5CA0 B;  3ETG A;  3JCU Z;  3C3T A;  3QG5 A;  4HAM A;  2IU0 A;  4ZHQ B;  1KBH A;  2BSK A;  2Q0A A;  1JPX A;  2X7R B;  2YC0 A;  4LWS A;  5CB4 A;  4JTC B;  4WFF A;  1SRY A;  4R8C A;  4I55 B;  4TUY B;  2CGN A;  3S3W A;  3G67 A;  2BOB C;  2IBZ H;  4UCT A;  1SZT A;  4IIJ B;  1FJG O;  1FFT B;  2BTQ B;  5KHJ A;  2Q7G A;  2PYJ A;  1R3I C;  1PKX A;  4OGQ B;  4GKJ O;  3CX5 F;  4GT1 A;  1I5X A;  1SA0 A;  2JVD A;  4MVU A;  4R6Z A;  1IBK B;  3FB6 C;  5H2F Z;  1NS1 A;  2GTS A;  3FAV B;  5EYP B;  1OJH A;  4PI0 A;  4F6E A;  2IJH A;  1QVF U;  3MDS A;  4K35 A;  1GO3 F;  1AI7 A;  1ZX3 A;  4JI4 B;  2XAF A;  3HPL C;  4YJ2 A;  3CCJ V;  3H1I H;  4DR4 O;  1HNZ O;  3QO7 A;  3TXS A;  5IYD O;  3FKS G;  1LR1 A;  4JGS A;  3LDC A;  1MZE A;  4X88 A;  4KFM A;  1NTZ H;  2A06 H;  2YEV B;  3LSS A;  5BXZ A;  3J7A U;  1FXK A;  1SQP H;  3ZMZ A;  4CZZ A;  3EHB B;  4OXS A;  3CCM V;  4JI5 B;  2PI5 A;  4PA4 A;  1W0J G;  3R66 A;  4RWU A;  2KSD A;  4Q20 A;  4B3T O;  2YS8 A;  4FVM A;  4I5S A;  4LC1 A;  1H2L A;  4I0X A;  2YXH A;  4BIZ A;  3E8B A;  3JSL A;  1NBM G;  3F5W C;  1VQN V;  1NKD A;  2DWE C;  3K0D A;  1K73 W;  3SPC A;  1R3J C;  3O65 A;  3TJT A;  4PDR A;  1AR5 A;  1VAR A;  2WLM A;  5KHK A;  2X6B A;  1SZX A;  4AQY O;  4MTF A;  2RMK B;  2XAQ A;  3F7Y C;  3D8C A;  5J9P C;  3ASN C;  4GX2 A;  4LF7 O;  4PD4 F;  1WA8 B;  3AK3 A;  4D6T H;  1GH6 A;  4CH3 A;  4DV2 O;  4JYB A;  3HR0 A;  2LW7 A;  3K04 A;  4JTA B;  5LMU B;  4L87 A;  1KC8 W;  1NJI W;  2WLH A;  1Y76 B;  5EIB D;  2A0L A;  3H9V A;  4GX0 A;  2DYR B;  1KYO F;  4E4E A;  5L3C A;  2IH3 C;  1O9G A;  2LO1 A;  1BHB A;  3JAW A;  2EJ7 A;  1HP8 A;  4ASU G;  5FLX N;  3H1K H;  1GM8 A;  1VF7 A;  2F43 G;  4F6R A;  1EBO A;  4J11 A;  1COW G;  4UCS A;  3RYH A;  4P9P A;  3BHP A;  1BZK A;  4X1Y A;  3G71 V;  5BR8 B;  4NKG B;  2B9Z A;  1ZL8 A;  4OX9 B;  4LF6 B;  3CJH A;  4X1I A;  4B3M B;  2BE3 A;  3G80 A;  4LFB O;  1N32 B;  4E2L A;  1FXK C;  2QWR B;  4PHZ A;  2JS3 A;  1Y74 A;  4K0K B;  2WA4 A;  5LYJ B;  1H2G A;  3FX7 A;  5CA3 A;  4MVS A;  2F1M A;  3VOU A;  3K08 A;  2FKX A;  5EZY B;  3JYC A;  4X66 O;  3DSQ A;  4KL1 A;  4J80 A;  4JI1 B;  1FXV A;  3RBZ A;  4B7K A;  1HNW B;  5KA6 A;  3CD6 V;  5KUK A;  2YSU B;  1WB8 A;  4FFB A;  3GWK C;  4EB6 A;  3BY6 A;  2Y48 A;  5J2T B;  3G6B A;  1QU7 A;  1GK9 A;  1XMQ B;  5E79 Z;  1TVK B;  2ZNI A;  1O9H A;  1BQZ A;  1N0N A;  1H38 A;  1QQC A;  5KX5 B;  5L3B A;  5BY1 A;  2PYL A;  3E8G A;  4QGP A;  2EIL B;  1YXB A;  5IWA B;  3SJQ C;  4JAS A;  2KB1 A;  1W2B U;  4DV4 O;  4X65 O;  4NXN B;  2JGD B;  4EKW A;  3WB0 A;  5CBG A;  1NH2 D;  3CCL V;  5ITZ B;  3JAL A;  3ZIA G;  4DV0 B;  4LBE C;  3AG4 C;  4WBN A;  1AB3 A;  1RPO A;  1OHH G;  4Q6G A;  3CRC A;  5C8Y A;  1M1K W;  1PL4 A;  5LXT B;  1YEW A;  1XQ8 A;  1F23 A;  1KEC A;  3STL C;  2DW4 A;  1EM1 A;  4JI0 O;  5CBH A;  3CCR V;  2E76 B;  1IDS A;  2PTM A;  5IE9 A;  1IBM B;  1ZAU A;  2UUC O;  2D2C B;  2GHY A;  1XL4 A;  3UO3 A;  2PZS A;  3AG3 C;  3RYC A;  1AI6 A;  1OV9 A;  3CB2 A;  4BR6 A;  1XL6 A;  5B3S C;  2Q7H A;  3E35 A;  2VS0 A;  4B3S O;  3LDE A;  4LF8 O;  4UVC A;  4IYI A;  5C93 A;  2EIK B;  4DK1 A;  3FB7 C;  5B1A B;  2ZQM A;  5K1X A;  5L3F A;  5LHI A;  2ZKO A;  3SGI A;  3TK1 A;  3JAR A;  1SQV H;  5KHI A;  3JAS A;  1KKD A;  4O4I B;  3ZX6 A;  4P2Z A;  2ZD9 A;  3DC6 A;  1KB9 F;  2ADP A;  3HKD A;  3R65 A;  3ZRW B;  2CDY A;  1NT2 B;  5IYC O;  1MA1 A;  2MK3 A;  5KMG B;  1RM1 B;  1Z5W A;  3ZMU A;  1OCZ B;  1Y66 A;  4JTD B;  1KP2 A;  2P22 C;  3OUF A;  1EZV H;  4TV9 A;  1GTO A;  3I56 V;  4UB6 Z;  2YDE A;  4DYL A;  3L74 H;  5GTH Z;  4RQF A;  5EBW C;  1JR9 A;  3AG2 C;  1IXM A;  3JD0 A;  3B2E E;  4LNU A;  3OM3 B;  2XAG A;  2NR5 A;  1XMO B;  2ATK C;  2OCC C;  1TGO A;  5LP6 B;  2WLN A;  1YF2 A;  4I7Z B;  1ZTE A;  2L6L A;  4LFC B;  2W6J G;  4FM1 A;  3ZHQ A;  5JVD B;  1XEQ A;  1N33 B;  3OUS A;  3M7M X;  3G4S V;  4LH7 A;  1GM7 A;  2JEX A;  3KCY A;  4GKK B;  4YJ3 B;  3T1Y O;  3RYF A;  2ZM6 B;  2QEX V;  1PNM A;  3SPI A;  4YY3 B;  4X20 B;  4DV6 B;  1F4M A;  1J5E B;  1RP3 B;  4NXM B;  2GUZ B;  3IJ4 A;  5CA0 A;  1M4U A;  2UXN A;  4IT5 A;  1E79 G;  1URF A;  4ZHQ A;  1JJO A;  2QSA A;  3BCC H;  5B1O A;  1AP6 A;  1NVP D;  1NQT A;  1VQK V;  2QWN B;  3NXS A;  1K97 A;  2P4K A;  4DV7 B;  2LGW A;  3ZMV A;  4I55 A;  1WPB A;  4TUY A;  4U3F H;  1X4T A;  4I4T B;  4ZKI A;  4IIJ A;  2OCH A;  2OIG A;  2BTQ A;  2VQF B;  5LL6 Y;  2Q73 A;  5IT9 N;  4MW8 A;  1MAB G;  4WCE V;  4UB8 Z;  3HKE B;  2QWO B;  1MMM A;  2IM9 A;  1BL8 A;  3CCQ V;  2HVK C;  3RVZ A;  5DM6 V;  2VQE O;  3FAV A;  5EYP A;  2X6C A;  5LMN O;  2UXD B;  4WFA V;  4HYO A;  2CK3 G;  4DR1 O;  4JV5 O;  3OTO O;  4FMT A;  1KKC A;  1SQQ H;  2NNU A;  5IY5 B;  1K5S A;  4QIW F;  3ZN0 A;  1P7B A;  4DXW A;  4LF4 O;  2WLI B;  1GM9 A;  2RCV A;  2ZNJ A;  4GX5 A;  5LBQ A;  2ZE6 A;  4I50 B;  5KAF Z;  3AG1 C;  3JAT B;  2P5O A;  3WB2 A;  3D36 A;  1ZLZ A;  4FM0 A;  4IHJ B;  5H9C A;  1NU1 H;  2F23 A;  3UQ8 A;  1WN7 A;  4ZI7 B;  2WLL B;  5B1N A;  4UUJ C;  1YIT V;  4H44 B;  1M56 B;  2Q0O C;  1QLE C;  4JI8 O;  1XNQ O;  1LUW A;  1XBL A;  4DR7 O;  1OCO B;  1YTF D;  3BFR A;  4X62 B;  1Q6I A;  4X1K B;  5EBM C;  3W7T A;  2HLD G;  1DF4 A;  5J2U B;  4JI3 O;  4JI2 B;  2OT5 A;  3IC9 A;  1SKV A;  1YDX A;  2EUL A;  1YJW V;  2V4D A;  1NZ6 A;  1P84 F;  1BE3 H;  4MVQ A;  3H1H H;  1GRJ A;  4LF9 B;  3E2E A;  3ETQ A;  2W0F C;  1WA8 A;  4TV8 B;  1F51 A;  2OWO A;  1JX9 A;  1I94 O;  5LA6 B;  1VF5 B;  2XUM A;  2GSM B;  3BAB A;  1I5Y A;  1D5N A;  1L8D A;  1Y76 A;  3C90 A;  2P90 A;  1MOF A;  1R3L C;  2PI4 A;  1TUB B;  4H0L B;  2JRI A;  2UXB O;  3ZS8 C;  4KP4 A;  1UJW B;  5JH7 B;  2DMX A;  3OEH G;  4KUM A;  4DR2 B;  2JDI G;  3B8N A;  1K4C C;  3SJA C;  4NB5 A;  3GB7 C;  4GYC B;  2HHH B;  1K33 A;  4KXR A;  4PEL A;  5BZB A;  2L35 A;  2P06 A;  1EN4 A;  3BAA A;  3SPG A;  1IUR A;  3OMN B;  2HFE C;  1ZSP A;  4LH6 A;  3L9D A;  4N23 A;  4NVP A;  3CXC U;  3D36 C;  4AHC A;  1K4D C;  4RAI A;  2ITC C;  1QLN A;  2Z3Y A;  4GKJ B;  5LYJ A;  1XIL A;  2D3O W;  2FL4 A;  3AEI A;  1XHX A;  4FLT A;  5EZY A;  3DTU B;  1OZ0 A;  4FM2 A;  2LW1 A;  1TAE A;  4LR3 A;  1JOY A;  2JS5 A;  2QR4 A;  5JCO A;  4C7U A;  1Q43 A;  4FFK A;  2DYS B;  1ENV A;  4A5U B;  1TVK A;  1X59 A;  3LSQ A;  1RPR A;  4DUY O;  4DR4 B;  1HNZ B;  1N34 O;  4JYA O;  1G1X B;  1U97 A;  2KG7 B;  4P9O A;  3X2Q B;  3ASO C;  1KD1 W;  3QTC A;  1V54 B;  1AI4 A;  5KX5 A;  2YID A;  4J42 A;  2E75 B;  3CCS V;  1SQG A;  4JAV A;  1XUQ A;  3JAK B;  2XAJ A;  1BMF G;  2JGD A;  5IYZ B;  4O4L B;  1DF5 A;  4DV3 O;  5ITZ A;  5JJE B;  1VQ7 V;  2PUS A;  2CGO A;  4WFG A;  1AJN A;  2Y4U A;  2QDO A;  4FJC C;  4B3T B;  3JD2 A;  2DYR C;  2AZ2 A;  4IYH A;  5LXT A;  4YIO A;  3E22 B;  3CC2 V;  1DK1 A;  4DK0 A;  5AG2 A;  3UT5 B;  2R9R B; 
#chains in the Genus database with same CATH homology
 1NTZ H;  2A06 H;  3L75 H;  4U3F H;  1P84 F;  3L73 H;  2FYU H;  1NTK H;  1BCC H;  1L0N H;  3L71 H;  4PD4 F;  1EZV H;  3H1K H;  1SQP H;  1BE3 H;  1PPJ H;  3CXH F;  3H1L H;  3H1H H;  1BGY H;  2BCC H;  1SQV H;  3CX5 F;  4D6T H;  3CWB H;  1PP9 H;  3L70 H;  1SQQ H;  3H1I H;  1NTM H;  1SQB H;  1KB9 F;  3L74 H;  3BCC H;  3TGU H;  3H1J H;  5KLV H;  1NU1 H;  3L72 H;  1SQX H;  2IBZ H;  1KYO F;  1L0L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...