3L72H

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l72H00
2FYUH 1SQPH 3H1JH 3CWBH 3BCCH 4D6TH 5KLVH 3L70H 1NU1H 3H1IH 3L75H 1BE3H 2A06H 1L0NH 3H1HH 1NTKH 3TGUH 4PD4F 1NTMH 3CX5F 3L72H 1SQQH 1EZVH 3H1KH 3L74H 4U3FH 3L71H 2IBZH 1SQBH 1P84F 1PP9H 1BGYH 1KB9F 1BCCH 3CXHF 1KYOF 1L0LH 1SQVH 1PPJH 3L73H 2BCCH 1NTZH 3H1LH 1SQXH
chains in the Genus database with same CATH superfamily
4LF8B 2Q4PA 2X6BA 3E83A 4CH4A 4CH5A 1Y6XA 3AG3C 4TQFA 2ILMA 2CTWA 4MTGA 5AG2A 3JALB 1QR9A 1FAFA 3HKCB 3L74H 1KQSU 1VQKV 5LXTB 2CGOA 3T1HB 4DW1A 3ZIAG 3K08A 4TV8A 1K8AW 1OCCC 4H0LB 4DXWA 1V54B 4PA7A 4WFHA 4MTOA 3G6EV 1Q6IA 3CXCU 4XDLA 3OD4A 3K06A 1YF2A 4RAIA 1SS3A 4LFBO 5JWPA 3D3QA 5KA5A 1ZX3A 4LH7A 3APQA 1GMGA 1Q81W 2EX3A 1XMQB 2YICA 1BT8A 5JJJB 1AR1B 1ZAUA 4N21A 4LF7B 4FJCC 4DV1B 1L8DA 4I4TA 4DR7O 4J11A 1I5YA 1ZL8B 1Q3EA 1HDJA 4PD4F 2ZE5A 4B08A 5CMUA 4UFZA 4IYHA 2VWJA 1OHHG 3AG3B 4DR3B 5IYDO 3LDDA 4WBNA 2NR5A 1S76D 3D36C 2Q7HA 3JATB 1F4NA 5LA6B 3ZRXA 3L70H 3JAMN 3J7AU 3G80A 5L3DA 4DR1B 1OCCB 4TUYB 4KP4A 4LF9O 2JGUA 3K9SA 1W59A 4YJ3A 2RNBA 4JI2B 4UB8Z 1RP3B 4K35A 3B8NA 3C3TA 4IGGA 2QGNA 1R3KC 4JI5O 4X62O 4BW9A 5CBGA 4JI1B 2HVKC 2KG7A 3WU2Z 4DO2A 1TVKB 3K03A 4DV7B 1AP5A 1Q82W 1VQ9V 3CSXA 3U0ZA 2YIBD 4DW0A 2ZM6O 3CS5A 1N0NA 1JJ2U 3SPCA 2YUAA 2BOCC 3OW2U 5IDJA 1YCIA 4G2KA 3E2EA 4FLUA 2R72A 1LR1A 1XNQB 4CH6A 3ZN0A 3OE7G 1NVPB 3QF7A 4IT5A 2XAFA 1M5IA 1HW7A 1S72V 3JARB 5JH7A 3Q4HB 3CX5F 1PL4A 2Q67A 3SPJA 4JPRA 3ZN1A 2G38A 4B3SO 2P6JA 1XMOO 1VP7A 3ZX6A 5KHJA 2AZ2A 4AI8A 1YTFD 1Q86W 3BA9A 3SPIA 2UXCB 3WFVA 3OFNG 3FB5C 3H1HH 1E1RG 1QCEA 4LFAO 2B5UA 2F1MA 5IJ9A 4TV9A 3IAYA 3SJAC 3W7XA 2IU3A 3K9AA 4JZ2A 4DV2B 4O4HA 3SJCC 3K0GA 1AJQA 2XT9A 1NR1A 1RSOB 1AJNA 5FL7G 4FLZA 1I94B 2BOBC 1N0JA 4TWKA 5EIBD 1PL0A 2IM9A 2WLHA 3UT5A 2ZR3A 4I9QA 3G4SV 2CK3G 4MVSA 3UQ8A 4PV1B 2P22C 1MOFA 3RN4A 4YJ2B 1K97A 3A8TA 4X1IB 5FNVA 5KUKA 2LGWA 2DYSC 4JASA 1ZWIC 4D7TA 3JD3A 2Y0IA 3TGUH 2VS0A 5IYZB 4U7NA 3WB2A 4GLXA 1P4RA 2H94A 1H2LA 2QM4A 3QTCA 1NQTA 2YXHA 1KKCA 4UCVA 4KFMA 2JRIA 3W7TA 4UVCA 1VQPV 2Q7GA 2FYUH 1AI7A 2LFRA 4DYLA 5KLVH 5IT9N 2CDYA 1PV0A 2H8PC 4JYAB 2QE7G 5KHHA 4YHHO 3ETGA 4IL6Z 5L3EA 1TUBA 3K5LA 4DR5B 2DWEC 1WA8A 3ZRVA 4I5SA 4YIPA 1HNXB 1X59A 1H2KA 2IU0A 1GN2A 2KSDA 4JTAB 4LC1A 1P7GA 3WB0A 4LBEC 3T1YO 2ZCEA 1KECA 5GONB 1OCOC 2EILC 1R6NA 3MHHC 1XQ8A 5LXTA 1MSWD 3K04A 3JASA 5KAIZ 2DYSB 4MVUA 5F2VO 5CN0A 3TK1A 4X20B 1G1XB 4PA3A 1EFRG 3ABTA 4H44B 2KB1A 3AG7A 1DTOA 3N2GB 4Z1MG 2WLLA 1WPXA 4DR4B 3CC4V 2ZNJA 1Y74A 1XREA 3CCQV 2ZIMA 3JD4A 1Z2GA 1VQ7V 3DC6A 1QNMA 4J42A 1AROP 3ETQA 4A5UB 3OMAB 4B3MB 4TV8B 4P9OA 1S77D 2LW7A 4NB5A 5KHGA 3ZMTA 2DJVA 4G27B 4OGQB 2F93B 4NXMB 1NH2D 3T2MA 1MZEA 2QA4V 2OTJV 1RPOA 3B2EE 1R3JC 2UUBB 5LMNB 4DUYB 4JI6B 1IURA 5JQGA 3CMAV 4AHCA 2XAQA 2Z3YA 4F4LA 3JAWA 4I4TB 2UXNA 2WLIA 3ICXA 1YVWA 1PNMA 2E3CA 3F5WC 1K5QA 3JYCA 2GTAA 1OCZC 2RJZA 4L8JA 2WWWA 2QEXV 3BY6A 1H38A 4U3JA 4JI0O 4Z2WA 5L3BA 3IJ4A 4WBNB 2Q8VA 1XBLA 4JYYA 4JAVA 1M90W 1R1BA 1RFYA 3JCUZ 2B1IA 4PELA 4LFBB 2YXYA 1SQGA 3ABUA 4PA9A 2A79B 1SQVH 4MVMA 4QGPA 4YJ3B 4JI3O 1S3JA 2OCCC 1IBMB 2OWOA 3AG2C 3EVKA 2Y48A 2KG7B 4JI4O 4CS2A 4E4EA 1JVMA 3N2KA 1OCRC 1NT2B 2XOKG 2L35A 2IJJA 4AQYB 2JEUA 3CCSV 1HP8A 1NR7A 2RCVA 3K5MA 1VIBA 2HEPA 3JD2A 1OCZB 4NVPA 4JV5B 4X89A 2QM8A 4QPKA 1H2MA 2XUMA 4ZIBA 2XASA 2WA4A 5JH7B 1VQ8V 2V4DA 2VRZA 1DF4A 1R73A 2PYJA 4JI5B 4B7KA 2OYQA 3A0RA 2MK3A 1ZUQA 3E8HA 3CCUV 1URFA 3EFFK 4GX5A 3FFQA 3HKDA 4B7EA 1QLNA 2F23A 2QKCA 2ZM6B 2OCCB 1PP9H 4NR1A 1JQ0A 4RO2A 1L0LH 1XOUA 1MNGA 5IJ9B 3JCZA 4J7JA 3TXQA 2IW5A 4B3TB 3B4SA 4O4HB 4O4JA 5DM6V 5C8YA 1KC8W 2A06H 1GK9A 2EZPA 2YDEA 3ETDA 1ORQC 2RMKB 2EIMB 1Y66A 2BCCH 2BE3A 4DV5B 1Z5VA 1XMOB 1GKFA 1XHXA 3D8CA 4J9YB 1VQLV 5FNVB 5B1NA 5EK0A 4ZI7A 1IBLO 4FMTA 4X8AA 4WFGA 4ZHQA 1AP6A 4X65O 4LFAB 3T4DA 2WLKA 5KUMA 4DK1A 4IIJA 5LGNA 1TA8A 4GT1A 2GDSA 1GH6A 2VQFB 2RQ6A 2QWPB 1K4DC 2E76B 5EIBC 2GV9A 2R9RB 4TOIA 2R9AA 3OT7A 4X20A 2FB5A 5KAFZ 3CYOA 5BR8O 3S3WA 3L9DA 4OX9O 1FJGB 2Y69B 1SKVA 4IYIA 2F43G 4FM0A 1MA1A 5BXZA 1N33O 2B1GA 2AXTZ 1WA8B 4MTFA 1AJPA 4GKJO 5FLXN 4Q6GA 2GSMB 1FXKA 2DE0X 3RYFA 4KHPO 1A32A 1YTFB 4W4KA 4J80A 2WSSG 5L3FA 1P7BA 1VQNV 3JASB 4GCZA 4UUJC 2GUZA 4MW3A 4WFEA 3CCJV 2FTKA 1NU1H 2PGGA 3CC2V 3K79A 1H2NA 1GTOA 1WN7A 3ZRSA 2WLLB 3F7VC 1MABG 4GX2A 1Q6UA 5GTIZ 3LUTB 2A7WA 4YHHB 5J2UA 3G71V 1OZ0A 1R3IC 1Y74B 1PM9A 1VARA 3TCUA 1EZJA 4FLXA 3B8MA 4UCRA 3FD9A 4Q20A 4EFEA 2QWNB 4FM2A 2JS3A 5L3GA 3SYPA 1Z5WA 2FMLA 3AK3A 4X1KA 2E74B 3JD1A 3VQVA 4N23A 4QE9A 5JQGB 2DYRC 1YEWA 3DXRA 4Z1VA 1OJHA 3JAWB 4X88A 1NTZH 2WLIB 4FK5C 2QTSA 4I7ZB 1BQ0A 4O4LB 2Q7EA 4D7SA 1Q8IA 1FD9A 4QJFB 2V1DA 1ZTEA 2A3QA 4U3JB 3K5OA 1KBHA 1MSDA 3KKYA 2GTSA 3CJHA 3R65A 1WNSA 2UUCO 1GRJA 2JGDA 3QO5A 3FX7A 3ZMVA 3VQXA 2JK5C 2JJ2G 2UXXA 4BAYA 4LFCO 2XAGA 3E86A 2DQ3A 1L1FA 1M93A 3SJBC 2PI4A 5C93A 1I0HA 4LF5O 1XNRO 4FVMA 4H33A 2X6AA 4CS3A 3G6BA 3QVNA 4DV4O 2RDCA 1VQ4V 1H2SB 4RWUA 5GTHZ 4JTCB 1JOYA 1K5SA 3N2KB 4JI8O 3OMNB 3SYAA 4WCEV 3M7MX 1IBKB 2DYRB 2HVJC 1IZ3A 4ZBMA 1CPYA 1S5HC 2FL4A 4IHJB 4F6RA 4LF4O 4DR6O 3CC7V 2AZ0A 4BR6A 2EBOA 2UU9B 2P4VA 3OEHG 4FZ1A 3DSQA 3UKMA 4JZGA 4JI3B 2CUGA 3MD0A 2M7WA 1V9PA 4KL1A 1NH2B 1KU9A 5B5EZ 3FYEB 5EZYA 3LDEA 1M57C 3BFRA 3KCXA 3HKDB 1W2BU 4QPJA 4R8CA 1SRYA 3ZRWA 3FB7C 5H5NA 2ZR2A 2OCHA 2YIAA 3M99B 2DQ0A 4ASUG 1NTKH 3FAVA 4DUZO 4O4JB 5CA0A 5EBWC 4O2BB 5C8YB 2YIBA 5LOVA 2IJIA 4L87A 5JJEB 4B3RB 4I50A 2KQXA 4OXSA 5J9PC 3K58A 2HLDG 2VQEB 1EM1A 3W7SA 2V7QG 1RM1C 4K8ZA 1LUVA 3LDCA 1FXKC 2ATKC 2IH3C 3P30A 1P49A 3T1HO 3E8BA 1NTMH 1Y76A 5KHIA 2ETNA 4ZI7B 1BS3A 2QWQB 3EXAA 1YZBA 4ZHQB 2DW4A 1SQXH 4C7UA 3BRCA 2UXBB 1Q7YW 4IIJB 1M57B 3OR6C 1EN4A 2YXLA 1XMQO 3AG4C 4DR2O 5B1AC 5D5QA 2WLNA 3KZIZ 3AG1C 1YJ9V 2PY5A 5LMUO 3L72H 2LO1A 1MZFA 4LF7O 4QIWF 3U10A 1KB9F 2B9ZA 2E5LO 3U11A 3O9OA 3TETA 4FLYA 3CRCA 1FS0G 4DV6B 4K0KO 2O57A 2JEXA 4K8XA 4NYKA 2QTOA 3OTOB 1EN6A 2UXDB 1M4UA 1RM1B 1Q43A 4X65B 3FKSG 1FXKB 2DMXA 3RYFB 3RW0A 1G6UA 5B1OA 1XHZA 2W0XA 4UCOA 1JX9A 4DR1O 4JI7O 3BCCH 2IH1C 4PDVA 2WA3A 3W7WA 5LYJA 1I7FA 1WB7A 5B66Z 4JGSA 1MG1A 2GUZB 4R50A 1YIJV 1DF5A 5TISZ 2Y4TA 5GW7A 2QKSA 1KP2A 3AK1A 1D2DA 4AILC 3UO2A 4JI1O 3AG4B 1BCCH 1UFIA 4OX9B 2Y0PA 4NTXA 5B1AB 1N34B 2EILB 1OCOB 1E79G 4UCSA 1F23A 3CEIA 3AG1B 4BIOA 1G4YB 2A9HA 2YSUB 3RYIA 4FLWA 1N33B 5J2UB 1PNLA 1N8RW 3QO7A 1J5EB 1XDCA 2Q73A 4LCUC 4GKJB 1HR0O 2ADQB 2WPDG 4LH6A 1NS1A 1F7YA 3B77A 1PKXA 4O4LA 3HPLC 1SESA 3SJQC 3CPWU 1XILA 1LUWA 4JAAA 2XAHA 3ZMSA 3ASNC 3HKBA 2W6JG 3H01A 1KD1W 1Q5OA 2ZE6A 4X1KB 4EB6A 4JAUA 1COWG 1SA0A 1OV9A 2UXCO 1SF9A 3CE2A 3LNMB 4GYCB 1WJZA 3OM3B 3VQWA 3DXRB 1EBOA 1FXHA 2R9IA 4J7ZA 3ZEDA 4CH3A 4DR7B 2AHZA 4TT3G 2P06A 1H2GA 4PJ0Z 1N32O 2YEVA 4HNAA 2BSKA 5IWAO 1YITV 1FXVA 3OTFA 4F6EA 1I94O 1JFFB 1WAZA 1BL8A 4X66O 3CJHB 1IX9A 4O4IA 3K57A 1JJOA 4JYBA 2JGDB 4ZKIA 4IHJA 3MAQA 1AI6A 2HKOA 1GO3F 2HJFC 1CXZB 2EIJC 2PF4E 3GWKC 4PDRA 4LF9B 5BMVA 4O2AA 4XBFA 5A9GA 3ASNB 2IJHA 2OIGA 3L73H 4QE7A 5EC1C 2ZD9A 4ZOLA 4ICGA 5EYPA 4X62B 3OMIB 4D6TH 3BA8A 5K1XA 4H13B 4FLVA 3LSUA 2XAJA 4UV8A 3AEIA 5E79Z 1QHTA 2P5OA 2N04A 3E22A 4KXRA 4RQFA 3OEEG 1NJIW 1KKDA 1HWYA 1IXBA 1WLEA 2NLJC 3AG2B 1HNZO 2LFSA 3B40A 4F6RB 4UVAA 2ZT9B 1X4TA 1K4CC 5CA1A 2F66C 1AR4A 1NZ6A 3JAKB 4JYAO 3J80N 4NKGB 4O2BA 1OCRB 3SYOA 1AI4A 2QDOA 2N74A 3FYIB 2F4VO 4CBCA 3DC5A 1AVMA 2DN9A 4LF5B 2Q6AA 4DV0O 3RT3C 3STZC 4PA4A 2P7TC 1Q90D 4GKKO 5EZYB 1EN5A 4TSFG 4W4LA 4B3SB 1K34A 2EIJB 2Q69A 2LGQA 4PI0A 1CP9A 4EKWA 4FM1A 4JI8B 2K1EA 4LWSB 3ZRWB 3SPGA 2JDIG 3QG5A 1JR9A 1QLEC 5CB4A 4EEQA 2LJ2A 3FAVB 4MVQA 2EJRA 3MHSC 5CA0B 1ZSPA 1M1KW 2UUAO 3JSLA 5LOVB 2BTQA 4UCTA 2N05A 4I50B 1VMGA 5LHIA 2W0FC 1GN3A 5JCOA 1YI2V 1K92A 1R6TA 3RBZA 2EZOA 1THZA 1I5XA 5FPRA 5LL6Y 1Y76B 4J9ZB 3LSQA 4JTDB 5K1PA 4KUMA 1GN4A 3DGEA 3HR0A 3WB1A 2QM7A 4GUNA 4CZZA 1Y4MA 1BQZA 1L0NH 4NXMO 3K5NA 3VBBA 5LGTA 4LF6O 1G8MA 5ITZA 3E8FA 4DUZB 2UUBO 5LMNO 3SGIA 4GX0A 4NXNO 2C2AA 2CH7B 2AHYA 3SYQA 1YHQV 3H9VA 1QLEB 4BW5A 1O9HA 3BHPA 2CAZC 3VQYA 2OIEA 3PJSK 3MDSA 3CMEV 3K0DA 2HJDA 1FFXA 1AI5A 1BZKA 1SQBH 2W6IG 1WP8A 4WFFA 4WFAV 1BSMA 3ZJZA 2QKAA 2PUSA 4P2ZA 2CTRA 1SERA 3OUSA 1IXMA 5KHKA 1Y67A 1YJWV 1YXBA 4NTYA 2AW9A 4I0XA 5HFMA 3T1YB 3M8AA 1FFTB 1QR8A 3O65A 4DR2B 2YS8A 4DV3O 4FLTA 4U3FH 2XNDG 5LYJB 5LMUB 1VQ5V 2Q0OC 5BZBA 2QSAA 1PPJH 3R66A 1IBMO 4BIUA 2E5LB 1HNWO 3CCRV 2GBOA 5L3CA 1SZTA 1VF6A 3N27A 2PI5A 3E8GA 2OTLV 1N36O 1BE3H 4FFKA 4ABMA 3GB7C 3CB2A 4TQDA 1B06A 2ITCC 4DK0A 3RYIB 1GM7A 4MW8A 1PNKA 3IC7A 4K0KB 3L71H 1N4CA 1BGYH 4AQYO 3AK2A 4PA6A 1AILA 4NTWA 4HBNA 4JV5O 4MT8A 4MVZA 2YIDA 1SZXA 4JI7B 5IJ0A 2PZSA 1JFFA 3GWOA 1H8HG 3CP1A 4HAMA 3ASOC 3HKBB 2M6YA 1GN6A 4BWAA 3ETEA 3A2FA 2CGNA 2QWRB 4J7KA 2HHHO 3RYHA 3F5TA 4EB6B 5LHHA 1SA0B 1KUQA 1GAXA 5KA6A 1HR0B 1VQMV 2OT5A 4LNUA 2XTAA 3ZHSA 4RUFA 1BHBA 4B3TO 4YY3O 4WF9V 4YXWG 1BHAA 3QNEA 2YEVB 4HNAB 2BSKB 5DN6G 3E89A 2HFEC 4UVBA 3H1IH 2DWDC 3QO8A 4JI0B 3APOA 4O4IB 5LHGA 3IC9A 5H6RA 5CA3A 4DV5O 1P84F 3CRQA 2X6CA 2JS5A 3TXSA 3JAKA 2L6LA 4EFBA 2ZXWC 1NBMG 1MMMA 3C3SA 5KX5B 3SR2C 5LP6A 5BMVB 4O2AB 5LBQA 4X64O 4JYCA 3ASOB 4K3AA 1I08A 3RYCA 4ZOLB 5EYPB 3ABKC 2WLMA 2A0LA 4I55B 2VQFO 4JI4B 3X2QC 5CBFA 3NR7A 1N32B 1VEWA 2ODMA 3E22B 5IWAB 4LWSA 3H1JH 3CCLV 4X1YA 4X66B 3GVMA 3RFRA 4OPAA 5EC2C 1FJGO 4J10A 3ZHTA 5JCOC 2PTMA 2P4KA 3BABA 3OGCC 2YC0A 5CA1B 2ZQMA 1UPGA 4PHZA 2P90A 4LP8A 2LP7A 3KG2A 2PYLA 3HKEA 4LF8O 1VQ6V 4BIZA 4E2LA 3HB3B 3ZHRA 1D5NA 1VQOV 5JVDA 3FB6C 4GX1A 1K73W 1XUQA 3RVZA 4YIOA 5KMGA 4H37A 3ABMC 5CBHA 2ZXWB 3TJTA 2Q5ZA 4UB6Z 3STLC 2H3OA 3CCVV 2CTQA 2CE4A 3JD0A 3BPZA 2ADPA 2X7RB 2LW1A 1FPOA 1KYOF 1DGSA 2YI9A 1ENVA 5H6QA 3H1LH 1Q6HA 5CB4B 4FZ0A 3ABKB 1JA8A 5D5PA 4RQEA 1HNZB 3P32A 3CRRA 4DRXA 5IYBO 3X2QB 2HR3A 2ARHA 2CTPA 2DOSA 5J2TA 4MTXA 4CS4A 1LNQA 2CH7A 2BTQB 4FFBB 3H1KH 4MS2A 1E1QG 1V55C 3C90A 2F4VB 4DV1O 3CRMA 4DV0B 1IDSA 5BY1A 3JALA 1S5JA 3I5DA 4GKKB 2KKWA 3HKCA 1TUEB 2ZNIA 1K9MW 5HFLA 2ZE8A 1NVPD 1JCHA 4DR3O 2Z5UA 3CCMV 2K9PA 2ZDIA 5EBLC 2JIZG 4OPHA 1IBLB 2NN4A 3ABMB 4MVRA 3A0BZ 1US6A 3ZHUA 1W0JG 1GM8A 1S5LZ 5ITZB 1M56C 1VF6C 3W7UA 4I9WA 4R7CA 2XHBA 2GHYA 4JF3A 4UXNA 4PDMA 1R6KA 4JI2O 4XDKA 2UUAB 1UJWB 2QR4A 5IYCO 3CHXA 3I56V 2VWKA 2ZE7A 2IBZH 4X9QA 1YDXA 3SYCA 3CRAA 1ZL8A 3D3IA 3LNNA 3ML0A 1QQCA 5BR8B 2NNUA 1SETA 1FFXB 2MW2B 1KMIZ 2ZKOA 4HYOA 4DV7O 3ABLC 3RVYA 2D2CB 1JMKC 2EIKC 1V55B 3P3PA 1VF5B 1O9GA 1D5AA 2EULA 2Q0AA 3IGAC 1KP3A 1DK1A 3JATA 1WPBA 1TAEA 2LQTA 5LA6A 4WFBV 4I0XB 2ZINA 4LF6B 1QBZA 1XNQO 3BAAA 4KHPB 1FYJA 4GZRB 4RUEA 4TUYA 3BEHA 4UV9A 3JSNA 4NXNB 5B3SC 4G28B 5B1BC 3B09A 1IVSA 3L75H 1TGOA 3OUFA 4FPPA 3ZMUA 1M56B 2AGAA 5IE9A 3CD6V 1AR5A 1TVKA 3S3XA 3VOUA 1IBKO 3ZBHA 2ITDC 4UCUA 1AB3A 2WLJA 1NKDA 1BMFG 1K3EA 4CC5A 4XDJA 4DV2O 2UU9O 1WB8A 3ABLB 2EIKB 5IJ0B 4DV3B 2P67A 5LP6C 3JARA 3ZCCA 3D36A 2YI8A 3Q4HA 3CWBH 2F95B 4U7OA 2D3OW 1HNWB 3K59A 3LSSA 4P9PA 1YJNV 3OGIB 3FB8C 3RYHB 3ZHVA 4MVOA 1N36B 3THOA 4FIPC 3EHBB 5B3SB 1RPRA 5KX5A 5B1BB 3P3NA 3PN1A 3I55V 5E1AC 4J41A 2QJ1A 1T5EA 1SQPH 1B04A 3DTUB 3SPHA 4LNUB 1XI1A 2EINC 2EIMC 1XL4A 4HZ3A 5IY5C 4I55A 3J81N 1F4MA 1RSOA 4P30A 1YSCA 1EZVH 3BVOA 4B3RO 1B6QA 5JJNB 5DEDA 1J95A 2E75B 2Q9LA 3ZMZA 2IJKA 2VQEO 1VF7A 1JPXA 1GM9A 2UUCB 1DLBA 5EBMC 3K3WA 1QU7A 3RGBA 3NXSA 1R3LC 2HHHB 2R70A 1XL6A 3KCYA 4YJ2A 5LP6B 3CCEV 4X1IA 4DR5O 1QVGU 4LFCB 3UM7A 1K33A 1SQQH 2JJ1G 3ZHQA 2BTOA 1F51A 3SDLA 1HNXO 1K7DA 3RYCB 3IFXA 3WG7C 2JVDA 2UXBO 3T1CA 4TV9B 3F7YC 2Z0AA 2Y4UA 1XNRB 4MSWC 1U96A 4PI2A 2Y69C 5IYZA 2WAMA 4YY3B 4DV4B 1M9NA 1H8EG 3OAAG 1NI8A 5H2FZ 1W0KG 4LR3A 1SQFA 1QVFU 3OR7C 2EJ7A 4QNHB 4X1YB 1XEQA 4PDLA 3RWRD 5DECA 3UT5B 2EINB 4CC6A 5IY5B 4LF4B 4DR6B 1WP7A 4DV6O 5FPOA 4DR4O 3UCSC 3OTOO 3HKEB 4FFBA 2Q68A 2UXDO 3A0HZ 1V54C 5JVDB 4X64B 1CEZA 2ZDIC 3UO3A 5KMGB 4R6ZA 3E35A 2FKXA 2X0LA 1SC5B 1U97A 5A2QN 2RN9A 5GONA 4B3MO 3G67A 2HP8A 2ZIOA 2QWOB 2HG5C 3T4ZA 1S0VA 3WG7B 5LGUA 3ZS8C 1PD3A 1N34O 1ZLZA 3N2GA 4DRXB 1B3QA 3CXHF 5J2TB 5H9CA 4DUYO 1FKAO 4JI6O 1TUBB 1J5EO 1ROPA
chains in the Genus database with same CATH topology
2FYUH 1SQPH 3H1JH 3CWBH 3BCCH 4D6TH 5KLVH 3L70H 1NU1H 3H1IH 3L75H 1BE3H 2A06H 1L0NH 3H1HH 1NTKH 3TGUH 4PD4F 1NTMH 3CX5F 3L72H 1SQQH 1EZVH 3H1KH 3L74H 4U3FH 3L71H 2IBZH 1SQBH 1P84F 1PP9H 1BGYH 1KB9F 1BCCH 3CXHF 1KYOF 1L0LH 1SQVH 1PPJH 3L73H 2BCCH 1NTZH 3H1LH 1SQXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU H;  1SQP H;  3H1J H;  3CWB H;  3BCC H;  4D6T H;  5KLV H;  3L70 H;  1NU1 H;  3H1I H;  3L75 H;  1BE3 H;  2A06 H;  1L0N H;  3H1H H;  1NTK H;  3TGU H;  4PD4 F;  1NTM H;  3CX5 F;  3L72 H;  1SQQ H;  1EZV H;  3H1K H;  3L74 H;  4U3F H;  3L71 H;  2IBZ H;  1SQB H;  1P84 F;  1PP9 H;  1BGY H;  1KB9 F;  1BCC H;  3CXH F;  1KYO F;  1L0L H;  1SQV H;  1PPJ H;  3L73 H;  2BCC H;  1NTZ H;  3H1L H;  1SQX H; 
#chains in the Genus database with same CATH topology
 4LF8 B;  2Q4P A;  2X6B A;  3E83 A;  4CH4 A;  4CH5 A;  1Y6X A;  3AG3 C;  4TQF A;  2ILM A;  2CTW A;  4MTG A;  5AG2 A;  3JAL B;  1QR9 A;  1FAF A;  3HKC B;  3L74 H;  1KQS U;  1VQK V;  5LXT B;  2CGO A;  3T1H B;  4DW1 A;  3ZIA G;  3K08 A;  4TV8 A;  1K8A W;  1OCC C;  4H0L B;  4DXW A;  1V54 B;  4PA7 A;  4WFH A;  4MTO A;  3G6E V;  1Q6I A;  3CXC U;  4XDL A;  3OD4 A;  3K06 A;  1YF2 A;  4RAI A;  1SS3 A;  4LFB O;  5JWP A;  3D3Q A;  5KA5 A;  1ZX3 A;  4LH7 A;  3APQ A;  1GMG A;  1Q81 W;  2EX3 A;  1XMQ B;  2YIC A;  1BT8 A;  5JJJ B;  1AR1 B;  1ZAU A;  4N21 A;  4LF7 B;  4FJC C;  4DV1 B;  1L8D A;  4I4T A;  4DR7 O;  4J11 A;  1I5Y A;  1ZL8 B;  1Q3E A;  1HDJ A;  4PD4 F;  2ZE5 A;  4B08 A;  5CMU A;  4UFZ A;  4IYH A;  2VWJ A;  1OHH G;  3AG3 B;  4DR3 B;  5IYD O;  3LDD A;  4WBN A;  2NR5 A;  1S76 D;  3D36 C;  2Q7H A;  3JAT B;  1F4N A;  5LA6 B;  3ZRX A;  3L70 H;  3JAM N;  3J7A U;  3G80 A;  5L3D A;  4DR1 B;  1OCC B;  4TUY B;  4KP4 A;  4LF9 O;  2JGU A;  3K9S A;  1W59 A;  4YJ3 A;  2RNB A;  4JI2 B;  4UB8 Z;  1RP3 B;  4K35 A;  3B8N A;  3C3T A;  4IGG A;  2QGN A;  1R3K C;  4JI5 O;  4X62 O;  4BW9 A;  5CBG A;  4JI1 B;  2HVK C;  2KG7 A;  3WU2 Z;  4DO2 A;  1TVK B;  3K03 A;  4DV7 B;  1AP5 A;  1Q82 W;  1VQ9 V;  3CSX A;  3U0Z A;  2YIB D;  4DW0 A;  2ZM6 O;  3CS5 A;  1N0N A;  1JJ2 U;  3SPC A;  2YUA A;  2BOC C;  3OW2 U;  5IDJ A;  1YCI A;  4G2K A;  3E2E A;  4FLU A;  2R72 A;  1LR1 A;  1XNQ B;  4CH6 A;  3ZN0 A;  3OE7 G;  1NVP B;  3QF7 A;  4IT5 A;  2XAF A;  1M5I A;  1HW7 A;  1S72 V;  3JAR B;  5JH7 A;  3Q4H B;  3CX5 F;  1PL4 A;  2Q67 A;  3SPJ A;  4JPR A;  3ZN1 A;  2G38 A;  4B3S O;  2P6J A;  1XMO O;  1VP7 A;  3ZX6 A;  5KHJ A;  2AZ2 A;  4AI8 A;  1YTF D;  1Q86 W;  3BA9 A;  3SPI A;  2UXC B;  3WFV A;  3OFN G;  3FB5 C;  3H1H H;  1E1R G;  1QCE A;  4LFA O;  2B5U A;  2F1M A;  5IJ9 A;  4TV9 A;  3IAY A;  3SJA C;  3W7X A;  2IU3 A;  3K9A A;  4JZ2 A;  4DV2 B;  4O4H A;  3SJC C;  3K0G A;  1AJQ A;  2XT9 A;  1NR1 A;  1RSO B;  1AJN A;  5FL7 G;  4FLZ A;  1I94 B;  2BOB C;  1N0J A;  4TWK A;  5EIB D;  1PL0 A;  2IM9 A;  2WLH A;  3UT5 A;  2ZR3 A;  4I9Q A;  3G4S V;  2CK3 G;  4MVS A;  3UQ8 A;  4PV1 B;  2P22 C;  1MOF A;  3RN4 A;  4YJ2 B;  1K97 A;  3A8T A;  4X1I B;  5FNV A;  5KUK A;  2LGW A;  2DYS C;  4JAS A;  1ZWI C;  4D7T A;  3JD3 A;  2Y0I A;  3TGU H;  2VS0 A;  5IYZ B;  4U7N A;  3WB2 A;  4GLX A;  1P4R A;  2H94 A;  1H2L A;  2QM4 A;  3QTC A;  1NQT A;  2YXH A;  1KKC A;  4UCV A;  4KFM A;  2JRI A;  3W7T A;  4UVC A;  1VQP V;  2Q7G A;  2FYU H;  1AI7 A;  2LFR A;  4DYL A;  5KLV H;  5IT9 N;  2CDY A;  1PV0 A;  2H8P C;  4JYA B;  2QE7 G;  5KHH A;  4YHH O;  3ETG A;  4IL6 Z;  5L3E A;  1TUB A;  3K5L A;  4DR5 B;  2DWE C;  1WA8 A;  3ZRV A;  4I5S A;  4YIP A;  1HNX B;  1X59 A;  1H2K A;  2IU0 A;  1GN2 A;  2KSD A;  4JTA B;  4LC1 A;  1P7G A;  3WB0 A;  4LBE C;  3T1Y O;  2ZCE A;  1KEC A;  5GON B;  1OCO C;  2EIL C;  1R6N A;  3MHH C;  1XQ8 A;  5LXT A;  1MSW D;  3K04 A;  3JAS A;  5KAI Z;  2DYS B;  4MVU A;  5F2V O;  5CN0 A;  3TK1 A;  4X20 B;  1G1X B;  4PA3 A;  1EFR G;  3ABT A;  4H44 B;  2KB1 A;  3AG7 A;  1DTO A;  3N2G B;  4Z1M G;  2WLL A;  1WPX A;  4DR4 B;  3CC4 V;  2ZNJ A;  1Y74 A;  1XRE A;  3CCQ V;  2ZIM A;  3JD4 A;  1Z2G A;  1VQ7 V;  3DC6 A;  1QNM A;  4J42 A;  1ARO P;  3ETQ A;  4A5U B;  3OMA B;  4B3M B;  4TV8 B;  4P9O A;  1S77 D;  2LW7 A;  4NB5 A;  5KHG A;  3ZMT A;  2DJV A;  4G27 B;  4OGQ B;  2F93 B;  4NXM B;  1NH2 D;  3T2M A;  1MZE A;  2QA4 V;  2OTJ V;  1RPO A;  3B2E E;  1R3J C;  2UUB B;  5LMN B;  4DUY B;  4JI6 B;  1IUR A;  5JQG A;  3CMA V;  4AHC A;  2XAQ A;  2Z3Y A;  4F4L A;  3JAW A;  4I4T B;  2UXN A;  2WLI A;  3ICX A;  1YVW A;  1PNM A;  2E3C A;  3F5W C;  1K5Q A;  3JYC A;  2GTA A;  1OCZ C;  2RJZ A;  4L8J A;  2WWW A;  2QEX V;  3BY6 A;  1H38 A;  4U3J A;  4JI0 O;  4Z2W A;  5L3B A;  3IJ4 A;  4WBN B;  2Q8V A;  1XBL A;  4JYY A;  4JAV A;  1M90 W;  1R1B A;  1RFY A;  3JCU Z;  2B1I A;  4PEL A;  4LFB B;  2YXY A;  1SQG A;  3ABU A;  4PA9 A;  2A79 B;  1SQV H;  4MVM A;  4QGP A;  4YJ3 B;  4JI3 O;  1S3J A;  2OCC C;  1IBM B;  2OWO A;  3AG2 C;  3EVK A;  2Y48 A;  2KG7 B;  4JI4 O;  4CS2 A;  4E4E A;  1JVM A;  3N2K A;  1OCR C;  1NT2 B;  2XOK G;  2L35 A;  2IJJ A;  4AQY B;  2JEU A;  3CCS V;  1HP8 A;  1NR7 A;  2RCV A;  3K5M A;  1VIB A;  2HEP A;  3JD2 A;  1OCZ B;  4NVP A;  4JV5 B;  4X89 A;  2QM8 A;  4QPK A;  1H2M A;  2XUM A;  4ZIB A;  2XAS A;  2WA4 A;  5JH7 B;  1VQ8 V;  2V4D A;  2VRZ A;  1DF4 A;  1R73 A;  2PYJ A;  4JI5 B;  4B7K A;  2OYQ A;  3A0R A;  2MK3 A;  1ZUQ A;  3E8H A;  3CCU V;  1URF A;  3EFF K;  4GX5 A;  3FFQ A;  3HKD A;  4B7E A;  1QLN A;  2F23 A;  2QKC A;  2ZM6 B;  2OCC B;  1PP9 H;  4NR1 A;  1JQ0 A;  4RO2 A;  1L0L H;  1XOU A;  1MNG A;  5IJ9 B;  3JCZ A;  4J7J A;  3TXQ A;  2IW5 A;  4B3T B;  3B4S A;  4O4H B;  4O4J A;  5DM6 V;  5C8Y A;  1KC8 W;  2A06 H;  1GK9 A;  2EZP A;  2YDE A;  3ETD A;  1ORQ C;  2RMK B;  2EIM B;  1Y66 A;  2BCC H;  2BE3 A;  4DV5 B;  1Z5V A;  1XMO B;  1GKF A;  1XHX A;  3D8C A;  4J9Y B;  1VQL V;  5FNV B;  5B1N A;  5EK0 A;  4ZI7 A;  1IBL O;  4FMT A;  4X8A A;  4WFG A;  4ZHQ A;  1AP6 A;  4X65 O;  4LFA B;  3T4D A;  2WLK A;  5KUM A;  4DK1 A;  4IIJ A;  5LGN A;  1TA8 A;  4GT1 A;  2GDS A;  1GH6 A;  2VQF B;  2RQ6 A;  2QWP B;  1K4D C;  2E76 B;  5EIB C;  2GV9 A;  2R9R B;  4TOI A;  2R9A A;  3OT7 A;  4X20 A;  2FB5 A;  5KAF Z;  3CYO A;  5BR8 O;  3S3W A;  3L9D A;  4OX9 O;  1FJG B;  2Y69 B;  1SKV A;  4IYI A;  2F43 G;  4FM0 A;  1MA1 A;  5BXZ A;  1N33 O;  2B1G A;  2AXT Z;  1WA8 B;  4MTF A;  1AJP A;  4GKJ O;  5FLX N;  4Q6G A;  2GSM B;  1FXK A;  2DE0 X;  3RYF A;  4KHP O;  1A32 A;  1YTF B;  4W4K A;  4J80 A;  2WSS G;  5L3F A;  1P7B A;  1VQN V;  3JAS B;  4GCZ A;  4UUJ C;  2GUZ A;  4MW3 A;  4WFE A;  3CCJ V;  2FTK A;  1NU1 H;  2PGG A;  3CC2 V;  3K79 A;  1H2N A;  1GTO A;  1WN7 A;  3ZRS A;  2WLL B;  3F7V C;  1MAB G;  4GX2 A;  1Q6U A;  5GTI Z;  3LUT B;  2A7W A;  4YHH B;  5J2U A;  3G71 V;  1OZ0 A;  1R3I C;  1Y74 B;  1PM9 A;  1VAR A;  3TCU A;  1EZJ A;  4FLX A;  3B8M A;  4UCR A;  3FD9 A;  4Q20 A;  4EFE A;  2QWN B;  4FM2 A;  2JS3 A;  5L3G A;  3SYP A;  1Z5W A;  2FML A;  3AK3 A;  4X1K A;  2E74 B;  3JD1 A;  3VQV A;  4N23 A;  4QE9 A;  5JQG B;  2DYR C;  1YEW A;  3DXR A;  4Z1V A;  1OJH A;  3JAW B;  4X88 A;  1NTZ H;  2WLI B;  4FK5 C;  2QTS A;  4I7Z B;  1BQ0 A;  4O4L B;  2Q7E A;  4D7S A;  1Q8I A;  1FD9 A;  4QJF B;  2V1D A;  1ZTE A;  2A3Q A;  4U3J B;  3K5O A;  1KBH A;  1MSD A;  3KKY A;  2GTS A;  3CJH A;  3R65 A;  1WNS A;  2UUC O;  1GRJ A;  2JGD A;  3QO5 A;  3FX7 A;  3ZMV A;  3VQX A;  2JK5 C;  2JJ2 G;  2UXX A;  4BAY A;  4LFC O;  2XAG A;  3E86 A;  2DQ3 A;  1L1F A;  1M93 A;  3SJB C;  2PI4 A;  5C93 A;  1I0H A;  4LF5 O;  1XNR O;  4FVM A;  4H33 A;  2X6A A;  4CS3 A;  3G6B A;  3QVN A;  4DV4 O;  2RDC A;  1VQ4 V;  1H2S B;  4RWU A;  5GTH Z;  4JTC B;  1JOY A;  1K5S A;  3N2K B;  4JI8 O;  3OMN B;  3SYA A;  4WCE V;  3M7M X;  1IBK B;  2DYR B;  2HVJ C;  1IZ3 A;  4ZBM A;  1CPY A;  1S5H C;  2FL4 A;  4IHJ B;  4F6R A;  4LF4 O;  4DR6 O;  3CC7 V;  2AZ0 A;  4BR6 A;  2EBO A;  2UU9 B;  2P4V A;  3OEH G;  4FZ1 A;  3DSQ A;  3UKM A;  4JZG A;  4JI3 B;  2CUG A;  3MD0 A;  2M7W A;  1V9P A;  4KL1 A;  1NH2 B;  1KU9 A;  5B5E Z;  3FYE B;  5EZY A;  3LDE A;  1M57 C;  3BFR A;  3KCX A;  3HKD B;  1W2B U;  4QPJ A;  4R8C A;  1SRY A;  3ZRW A;  3FB7 C;  5H5N A;  2ZR2 A;  2OCH A;  2YIA A;  3M99 B;  2DQ0 A;  4ASU G;  1NTK H;  3FAV A;  4DUZ O;  4O4J B;  5CA0 A;  5EBW C;  4O2B B;  5C8Y B;  2YIB A;  5LOV A;  2IJI A;  4L87 A;  5JJE B;  4B3R B;  4I50 A;  2KQX A;  4OXS A;  5J9P C;  3K58 A;  2HLD G;  2VQE B;  1EM1 A;  3W7S A;  2V7Q G;  1RM1 C;  4K8Z A;  1LUV A;  3LDC A;  1FXK C;  2ATK C;  2IH3 C;  3P30 A;  1P49 A;  3T1H O;  3E8B A;  1NTM H;  1Y76 A;  5KHI A;  2ETN A;  4ZI7 B;  1BS3 A;  2QWQ B;  3EXA A;  1YZB A;  4ZHQ B;  2DW4 A;  1SQX H;  4C7U A;  3BRC A;  2UXB B;  1Q7Y W;  4IIJ B;  1M57 B;  3OR6 C;  1EN4 A;  2YXL A;  1XMQ O;  3AG4 C;  4DR2 O;  5B1A C;  5D5Q A;  2WLN A;  3KZI Z;  3AG1 C;  1YJ9 V;  2PY5 A;  5LMU O;  3L72 H;  2LO1 A;  1MZF A;  4LF7 O;  4QIW F;  3U10 A;  1KB9 F;  2B9Z A;  2E5L O;  3U11 A;  3O9O A;  3TET A;  4FLY A;  3CRC A;  1FS0 G;  4DV6 B;  4K0K O;  2O57 A;  2JEX A;  4K8X A;  4NYK A;  2QTO A;  3OTO B;  1EN6 A;  2UXD B;  1M4U A;  1RM1 B;  1Q43 A;  4X65 B;  3FKS G;  1FXK B;  2DMX A;  3RYF B;  3RW0 A;  1G6U A;  5B1O A;  1XHZ A;  2W0X A;  4UCO A;  1JX9 A;  4DR1 O;  4JI7 O;  3BCC H;  2IH1 C;  4PDV A;  2WA3 A;  3W7W A;  5LYJ A;  1I7F A;  1WB7 A;  5B66 Z;  4JGS A;  1MG1 A;  2GUZ B;  4R50 A;  1YIJ V;  1DF5 A;  5TIS Z;  2Y4T A;  5GW7 A;  2QKS A;  1KP2 A;  3AK1 A;  1D2D A;  4AIL C;  3UO2 A;  4JI1 O;  3AG4 B;  1BCC H;  1UFI A;  4OX9 B;  2Y0P A;  4NTX A;  5B1A B;  1N34 B;  2EIL B;  1OCO B;  1E79 G;  4UCS A;  1F23 A;  3CEI A;  3AG1 B;  4BIO A;  1G4Y B;  2A9H A;  2YSU B;  3RYI A;  4FLW A;  1N33 B;  5J2U B;  1PNL A;  1N8R W;  3QO7 A;  1J5E B;  1XDC A;  2Q73 A;  4LCU C;  4GKJ B;  1HR0 O;  2ADQ B;  2WPD G;  4LH6 A;  1NS1 A;  1F7Y A;  3B77 A;  1PKX A;  4O4L A;  3HPL C;  1SES A;  3SJQ C;  3CPW U;  1XIL A;  1LUW A;  4JAA A;  2XAH A;  3ZMS A;  3ASN C;  3HKB A;  2W6J G;  3H01 A;  1KD1 W;  1Q5O A;  2ZE6 A;  4X1K B;  4EB6 A;  4JAU A;  1COW G;  1SA0 A;  1OV9 A;  2UXC O;  1SF9 A;  3CE2 A;  3LNM B;  4GYC B;  1WJZ A;  3OM3 B;  3VQW A;  3DXR B;  1EBO A;  1FXH A;  2R9I A;  4J7Z A;  3ZED A;  4CH3 A;  4DR7 B;  2AHZ A;  4TT3 G;  2P06 A;  1H2G A;  4PJ0 Z;  1N32 O;  2YEV A;  4HNA A;  2BSK A;  5IWA O;  1YIT V;  1FXV A;  3OTF A;  4F6E A;  1I94 O;  1JFF B;  1WAZ A;  1BL8 A;  4X66 O;  3CJH B;  1IX9 A;  4O4I A;  3K57 A;  1JJO A;  4JYB A;  2JGD B;  4ZKI A;  4IHJ A;  3MAQ A;  1AI6 A;  2HKO A;  1GO3 F;  2HJF C;  1CXZ B;  2EIJ C;  2PF4 E;  3GWK C;  4PDR A;  4LF9 B;  5BMV A;  4O2A A;  4XBF A;  5A9G A;  3ASN B;  2IJH A;  2OIG A;  3L73 H;  4QE7 A;  5EC1 C;  2ZD9 A;  4ZOL A;  4ICG A;  5EYP A;  4X62 B;  3OMI B;  4D6T H;  3BA8 A;  5K1X A;  4H13 B;  4FLV A;  3LSU A;  2XAJ A;  4UV8 A;  3AEI A;  5E79 Z;  1QHT A;  2P5O A;  2N04 A;  3E22 A;  4KXR A;  4RQF A;  3OEE G;  1NJI W;  1KKD A;  1HWY A;  1IXB A;  1WLE A;  2NLJ C;  3AG2 B;  1HNZ O;  2LFS A;  3B40 A;  4F6R B;  4UVA A;  2ZT9 B;  1X4T A;  1K4C C;  5CA1 A;  2F66 C;  1AR4 A;  1NZ6 A;  3JAK B;  4JYA O;  3J80 N;  4NKG B;  4O2B A;  1OCR B;  3SYO A;  1AI4 A;  2QDO A;  2N74 A;  3FYI B;  2F4V O;  4CBC A;  3DC5 A;  1AVM A;  2DN9 A;  4LF5 B;  2Q6A A;  4DV0 O;  3RT3 C;  3STZ C;  4PA4 A;  2P7T C;  1Q90 D;  4GKK O;  5EZY B;  1EN5 A;  4TSF G;  4W4L A;  4B3S B;  1K34 A;  2EIJ B;  2Q69 A;  2LGQ A;  4PI0 A;  1CP9 A;  4EKW A;  4FM1 A;  4JI8 B;  2K1E A;  4LWS B;  3ZRW B;  3SPG A;  2JDI G;  3QG5 A;  1JR9 A;  1QLE C;  5CB4 A;  4EEQ A;  2LJ2 A;  3FAV B;  4MVQ A;  2EJR A;  3MHS C;  5CA0 B;  1ZSP A;  1M1K W;  2UUA O;  3JSL A;  5LOV B;  2BTQ A;  4UCT A;  2N05 A;  4I50 B;  1VMG A;  5LHI A;  2W0F C;  1GN3 A;  5JCO A;  1YI2 V;  1K92 A;  1R6T A;  3RBZ A;  2EZO A;  1THZ A;  1I5X A;  5FPR A;  5LL6 Y;  1Y76 B;  4J9Z B;  3LSQ A;  4JTD B;  5K1P A;  4KUM A;  1GN4 A;  3DGE A;  3HR0 A;  3WB1 A;  2QM7 A;  4GUN A;  4CZZ A;  1Y4M A;  1BQZ A;  1L0N H;  4NXM O;  3K5N A;  3VBB A;  5LGT A;  4LF6 O;  1G8M A;  5ITZ A;  3E8F A;  4DUZ B;  2UUB O;  5LMN O;  3SGI A;  4GX0 A;  4NXN O;  2C2A A;  2CH7 B;  2AHY A;  3SYQ A;  1YHQ V;  3H9V A;  1QLE B;  4BW5 A;  1O9H A;  3BHP A;  2CAZ C;  3VQY A;  2OIE A;  3PJS K;  3MDS A;  3CME V;  3K0D A;  2HJD A;  1FFX A;  1AI5 A;  1BZK A;  1SQB H;  2W6I G;  1WP8 A;  4WFF A;  4WFA V;  1BSM A;  3ZJZ A;  2QKA A;  2PUS A;  4P2Z A;  2CTR A;  1SER A;  3OUS A;  1IXM A;  5KHK A;  1Y67 A;  1YJW V;  1YXB A;  4NTY A;  2AW9 A;  4I0X A;  5HFM A;  3T1Y B;  3M8A A;  1FFT B;  1QR8 A;  3O65 A;  4DR2 B;  2YS8 A;  4DV3 O;  4FLT A;  4U3F H;  2XND G;  5LYJ B;  5LMU B;  1VQ5 V;  2Q0O C;  5BZB A;  2QSA A;  1PPJ H;  3R66 A;  1IBM O;  4BIU A;  2E5L B;  1HNW O;  3CCR V;  2GBO A;  5L3C A;  1SZT A;  1VF6 A;  3N27 A;  2PI5 A;  3E8G A;  2OTL V;  1N36 O;  1BE3 H;  4FFK A;  4ABM A;  3GB7 C;  3CB2 A;  4TQD A;  1B06 A;  2ITC C;  4DK0 A;  3RYI B;  1GM7 A;  4MW8 A;  1PNK A;  3IC7 A;  4K0K B;  3L71 H;  1N4C A;  1BGY H;  4AQY O;  3AK2 A;  4PA6 A;  1AIL A;  4NTW A;  4HBN A;  4JV5 O;  4MT8 A;  4MVZ A;  2YID A;  1SZX A;  4JI7 B;  5IJ0 A;  2PZS A;  1JFF A;  3GWO A;  1H8H G;  3CP1 A;  4HAM A;  3ASO C;  3HKB B;  2M6Y A;  1GN6 A;  4BWA A;  3ETE A;  3A2F A;  2CGN A;  2QWR B;  4J7K A;  2HHH O;  3RYH A;  3F5T A;  4EB6 B;  5LHH A;  1SA0 B;  1KUQ A;  1GAX A;  5KA6 A;  1HR0 B;  1VQM V;  2OT5 A;  4LNU A;  2XTA A;  3ZHS A;  4RUF A;  1BHB A;  4B3T O;  4YY3 O;  4WF9 V;  4YXW G;  1BHA A;  3QNE A;  2YEV B;  4HNA B;  2BSK B;  5DN6 G;  3E89 A;  2HFE C;  4UVB A;  3H1I H;  2DWD C;  3QO8 A;  4JI0 B;  3APO A;  4O4I B;  5LHG A;  3IC9 A;  5H6R A;  5CA3 A;  4DV5 O;  1P84 F;  3CRQ A;  2X6C A;  2JS5 A;  3TXS A;  3JAK A;  2L6L A;  4EFB A;  2ZXW C;  1NBM G;  1MMM A;  3C3S A;  5KX5 B;  3SR2 C;  5LP6 A;  5BMV B;  4O2A B;  5LBQ A;  4X64 O;  4JYC A;  3ASO B;  4K3A A;  1I08 A;  3RYC A;  4ZOL B;  5EYP B;  3ABK C;  2WLM A;  2A0L A;  4I55 B;  2VQF O;  4JI4 B;  3X2Q C;  5CBF A;  3NR7 A;  1N32 B;  1VEW A;  2ODM A;  3E22 B;  5IWA B;  4LWS A;  3H1J H;  3CCL V;  4X1Y A;  4X66 B;  3GVM A;  3RFR A;  4OPA A;  5EC2 C;  1FJG O;  4J10 A;  3ZHT A;  5JCO C;  2PTM A;  2P4K A;  3BAB A;  3OGC C;  2YC0 A;  5CA1 B;  2ZQM A;  1UPG A;  4PHZ A;  2P90 A;  4LP8 A;  2LP7 A;  3KG2 A;  2PYL A;  3HKE A;  4LF8 O;  1VQ6 V;  4BIZ A;  4E2L A;  3HB3 B;  3ZHR A;  1D5N A;  1VQO V;  5JVD A;  3FB6 C;  4GX1 A;  1K73 W;  1XUQ A;  3RVZ A;  4YIO A;  5KMG A;  4H37 A;  3ABM C;  5CBH A;  2ZXW B;  3TJT A;  2Q5Z A;  4UB6 Z;  3STL C;  2H3O A;  3CCV V;  2CTQ A;  2CE4 A;  3JD0 A;  3BPZ A;  2ADP A;  2X7R B;  2LW1 A;  1FPO A;  1KYO F;  1DGS A;  2YI9 A;  1ENV A;  5H6Q A;  3H1L H;  1Q6H A;  5CB4 B;  4FZ0 A;  3ABK B;  1JA8 A;  5D5P A;  4RQE A;  1HNZ B;  3P32 A;  3CRR A;  4DRX A;  5IYB O;  3X2Q B;  2HR3 A;  2ARH A;  2CTP A;  2DOS A;  5J2T A;  4MTX A;  4CS4 A;  1LNQ A;  2CH7 A;  2BTQ B;  4FFB B;  3H1K H;  4MS2 A;  1E1Q G;  1V55 C;  3C90 A;  2F4V B;  4DV1 O;  3CRM A;  4DV0 B;  1IDS A;  5BY1 A;  3JAL A;  1S5J A;  3I5D A;  4GKK B;  2KKW A;  3HKC A;  1TUE B;  2ZNI A;  1K9M W;  5HFL A;  2ZE8 A;  1NVP D;  1JCH A;  4DR3 O;  2Z5U A;  3CCM V;  2K9P A;  2ZDI A;  5EBL C;  2JIZ G;  4OPH A;  1IBL B;  2NN4 A;  3ABM B;  4MVR A;  3A0B Z;  1US6 A;  3ZHU A;  1W0J G;  1GM8 A;  1S5L Z;  5ITZ B;  1M56 C;  1VF6 C;  3W7U A;  4I9W A;  4R7C A;  2XHB A;  2GHY A;  4JF3 A;  4UXN A;  4PDM A;  1R6K A;  4JI2 O;  4XDK A;  2UUA B;  1UJW B;  2QR4 A;  5IYC O;  3CHX A;  3I56 V;  2VWK A;  2ZE7 A;  2IBZ H;  4X9Q A;  1YDX A;  3SYC A;  3CRA A;  1ZL8 A;  3D3I A;  3LNN A;  3ML0 A;  1QQC A;  5BR8 B;  2NNU A;  1SET A;  1FFX B;  2MW2 B;  1KMI Z;  2ZKO A;  4HYO A;  4DV7 O;  3ABL C;  3RVY A;  2D2C B;  1JMK C;  2EIK C;  1V55 B;  3P3P A;  1VF5 B;  1O9G A;  1D5A A;  2EUL A;  2Q0A A;  3IGA C;  1KP3 A;  1DK1 A;  3JAT A;  1WPB A;  1TAE A;  2LQT A;  5LA6 A;  4WFB V;  4I0X B;  2ZIN A;  4LF6 B;  1QBZ A;  1XNQ O;  3BAA A;  4KHP B;  1FYJ A;  4GZR B;  4RUE A;  4TUY A;  3BEH A;  4UV9 A;  3JSN A;  4NXN B;  5B3S C;  4G28 B;  5B1B C;  3B09 A;  1IVS A;  3L75 H;  1TGO A;  3OUF A;  4FPP A;  3ZMU A;  1M56 B;  2AGA A;  5IE9 A;  3CD6 V;  1AR5 A;  1TVK A;  3S3X A;  3VOU A;  1IBK O;  3ZBH A;  2ITD C;  4UCU A;  1AB3 A;  2WLJ A;  1NKD A;  1BMF G;  1K3E A;  4CC5 A;  4XDJ A;  4DV2 O;  2UU9 O;  1WB8 A;  3ABL B;  2EIK B;  5IJ0 B;  4DV3 B;  2P67 A;  5LP6 C;  3JAR A;  3ZCC A;  3D36 A;  2YI8 A;  3Q4H A;  3CWB H;  2F95 B;  4U7O A;  2D3O W;  1HNW B;  3K59 A;  3LSS A;  4P9P A;  1YJN V;  3OGI B;  3FB8 C;  3RYH B;  3ZHV A;  4MVO A;  1N36 B;  3THO A;  4FIP C;  3EHB B;  5B3S B;  1RPR A;  5KX5 A;  5B1B B;  3P3N A;  3PN1 A;  3I55 V;  5E1A C;  4J41 A;  2QJ1 A;  1T5E A;  1SQP H;  1B04 A;  3DTU B;  3SPH A;  4LNU B;  1XI1 A;  2EIN C;  2EIM C;  1XL4 A;  4HZ3 A;  5IY5 C;  4I55 A;  3J81 N;  1F4M A;  1RSO A;  4P30 A;  1YSC A;  1EZV H;  3BVO A;  4B3R O;  1B6Q A;  5JJN B;  5DED A;  1J95 A;  2E75 B;  2Q9L A;  3ZMZ A;  2IJK A;  2VQE O;  1VF7 A;  1JPX A;  1GM9 A;  2UUC B;  1DLB A;  5EBM C;  3K3W A;  1QU7 A;  3RGB A;  3NXS A;  1R3L C;  2HHH B;  2R70 A;  1XL6 A;  3KCY A;  4YJ2 A;  5LP6 B;  3CCE V;  4X1I A;  4DR5 O;  1QVG U;  4LFC B;  3UM7 A;  1K33 A;  1SQQ H;  2JJ1 G;  3ZHQ A;  2BTO A;  1F51 A;  3SDL A;  1HNX O;  1K7D A;  3RYC B;  3IFX A;  3WG7 C;  2JVD A;  2UXB O;  3T1C A;  4TV9 B;  3F7Y C;  2Z0A A;  2Y4U A;  1XNR B;  4MSW C;  1U96 A;  4PI2 A;  2Y69 C;  5IYZ A;  2WAM A;  4YY3 B;  4DV4 B;  1M9N A;  1H8E G;  3OAA G;  1NI8 A;  5H2F Z;  1W0K G;  4LR3 A;  1SQF A;  1QVF U;  3OR7 C;  2EJ7 A;  4QNH B;  4X1Y B;  1XEQ A;  4PDL A;  3RWR D;  5DEC A;  3UT5 B;  2EIN B;  4CC6 A;  5IY5 B;  4LF4 B;  4DR6 B;  1WP7 A;  4DV6 O;  5FPO A;  4DR4 O;  3UCS C;  3OTO O;  3HKE B;  4FFB A;  2Q68 A;  2UXD O;  3A0H Z;  1V54 C;  5JVD B;  4X64 B;  1CEZ A;  2ZDI C;  3UO3 A;  5KMG B;  4R6Z A;  3E35 A;  2FKX A;  2X0L A;  1SC5 B;  1U97 A;  5A2Q N;  2RN9 A;  5GON A;  4B3M O;  3G67 A;  2HP8 A;  2ZIO A;  2QWO B;  2HG5 C;  3T4Z A;  1S0V A;  3WG7 B;  5LGU A;  3ZS8 C;  1PD3 A;  1N34 O;  1ZLZ A;  3N2G A;  4DRX B;  1B3Q A;  3CXH F;  5J2T B;  5H9C A;  4DUY O;  1FKA O;  4JI6 O;  1TUB B;  1J5E O;  1ROP A; 
#chains in the Genus database with same CATH homology
 2FYU H;  1SQP H;  3H1J H;  3CWB H;  3BCC H;  4D6T H;  5KLV H;  3L70 H;  1NU1 H;  3H1I H;  3L75 H;  1BE3 H;  2A06 H;  1L0N H;  3H1H H;  1NTK H;  3TGU H;  4PD4 F;  1NTM H;  3CX5 F;  3L72 H;  1SQQ H;  1EZV H;  3H1K H;  3L74 H;  4U3F H;  3L71 H;  2IBZ H;  1SQB H;  1P84 F;  1PP9 H;  1BGY H;  1KB9 F;  1BCC H;  3CXH F;  1KYO F;  1L0L H;  1SQV H;  1PPJ H;  3L73 H;  2BCC H;  1NTZ H;  3H1L H;  1SQX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...