3L72H

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l72H00
1P84F 4PD4F 1PP9H 3H1LH 3TGUH 3L72H 2BCCH 3H1KH 1SQVH 3CWBH 1SQPH 5KLVH 1SQXH 3L75H 1NTKH 1NU1H 1KYOF 3H1JH 3L70H 1NTMH 1BCCH 1EZVH 1PPJH 3L74H 2FYUH 3CX5F 1BGYH 1NTZH 3CXHF 3BCCH 1SQBH 1SQQH 1L0LH 3H1IH 3L71H 2IBZH 4D6TH 3L73H 1KB9F 2A06H 1L0NH 4U3FH 3H1HH 1BE3H
chains in the Genus database with same CATH superfamily
4YJ3A 4UCVA 1KYOF 4J9YB 1K7DA 4EKWA 1OCOB 3ZHVA 2IU3A 3TXSA 2YS8A 3X2QB 2D2CB 1L1FA 1FYJA 3C3TA 3BPZA 2ZNJA 3KCXA 4KXRA 3TK1A 1QR9A 2CGOA 2K1EA 4JZ2A 4IHJA 4FLZA 3ASNB 1HNWB 4YY3O 2JIZG 4IIJB 2HHHO 1H8EG 1BL8A 3NR7A 5EZYA 2ZINA 3HKCB 1D2DA 2VWKA 5LOVA 3ZHRA 4J7KA 4GT1A 4B08A 5IDJA 3T1HO 3WG7C 1VQMV 1J5EO 5C93A 1F23A 4BIOA 1EN4A 3E8HA 3ZMZA 2ZR3A 1TVKB 2JDIG 1WP8A 1YJWV 5B3SB 2F4VB 1SETA 5LXTB 1B04A 4GX0A 4DR2B 4NXMO 4FLUA 2JGDB 2UU9O 3CHXA 3SPCA 3F7VC 2IH1C 2ZDIC 4ICGA 2E5LO 1VF6A 4ZBMA 1K5QA 3SYQA 3ZS8C 4IYIA 4X1KB 3D8CA 1Y6XA 2E3CA 3JCUZ 3CCMV 2LJ2A 1GAXA 3FFQA 4KFMA 3R65A 3RYFB 2R9AA 2BTQA 1H8HG 5L3FA 4TUYA 1SKVA 4JYAB 5LBQA 5FPRA 4MTGA 1EN5A 2PYJA 3WG7B 3K5NA 1K92A 3OMAB 3UCSC 3GWKC 5BY1A 2IM9A 3AK1A 4JPRA 1IDSA 1Y4MA 4X20B 1NQTA 3JCZA 1GO3F 1I94O 5KAIZ 4LFBB 3JD1A 1PNLA 4FFBA 3S3XA 2K9PA 3K03A 3T1YB 3CE2A 2VRZA 2JGUA 3ABKC 1NH2B 3AG2B 1FFXB 2Q8VA 4NTXA 4O4HA 2UXDB 4W4KA 4YIPA 4DR4B 3QO7A 2F1MA 4LFCO 1AR4A 3VOUA 1OJHA 3K57A 2IJHA 3K58A 4PDMA 5B1BC 2EIJC 2F93B 4MW3A 4K8XA 2XAFA 1UFIA 5JQGB 3H1KH 5BR8B 4GUNA 5L3CA 3CC7V 4OGQB 4LH7A 1ZX3A 4JF3A 3L71H 5IYCO 3MD0A 1LUWA 4PA3A 4I55A 1K4CC 1F4MA 5KAFZ 2ZCEA 3CCEV 3HR0A 1IZ3A 2EZOA 2WLMA 4U7NA 2BOBC 4TV9A 1HR0O 2KKWA 3HKEB 3UT5A 5ITZB 3E8FA 1YJ9V 2HKOA 1VF7A 1OV9A 3RW0A 3JYCA 4FZ1A 4D7SA 2D3OW 4MTOA 5B1BB 4PDRA 2EIJB 4LF6B 1XMOB 3ZHSA 1F7YA 3K3WA 4ZKIA 3CC2V 4GX5A 4MW8A 3MAQA 3VBBA 3FB8C 4JI7O 3CCSV 4WFFA 3RYHB 1K34A 2R9IA 3IFXA 2FL4A 1L0LH 1SF9A 1N4CA 2QM8A 3CSXA 4GZRB 4U3FH 3E35A 4DV5O 4UUJC 4G27B 5GONA 2ZXWC 5JH7A 2WLIB 2DYRC 1ZTEA 3SYAA 2WA3A 1AILA 3F7YC 4U3JB 4PA4A 4LR3A 4FZ0A 2JJ1G 3I55V 4QPJA 1JA8A 1Q5OA 5J2TB 1IBLO 3OFNG 3C90A 4HBNA 1K3EA 3K79A 3DXRB 4F6EA 3PN1A 4O2BA 3D3IA 3L9DA 3TXQA 5LA6B 2CUGA 1NS1A 4I4TB 4PV1B 1GM9A 3JALA 2QM7A 2OCCC 3SDLA 2UXNA 3T4DA 2JGDA 2IW5A 1GTOA 5B1OA 4NXNO 2DQ0A 5K1PA 1EM1A 4UV9A 4GKJB 4WFAV 4LBEC 2GUZB 4C7UA 4JGSA 1SC5B 4X1KA 4LF9B 4H37A 2C2AA 3S3WA 2UUCO 2ZXWB 5IY5B 3RYFA 5LL6Y 2OT5A 3SYOA 2YSUB 5IT9N 1ZL8A 1B6QA 2UUBO 5KHGA 2OYQA 5JVDB 3IC7A 1KBHA 4BAYA 4PA7A 3H9VA 2OWOA 1QQCA 4O2AA 1XHZA 1BMFG 1DGSA 2OCCB 1P49A 1B06A 4JAVA 3B4SA 5CBHA 3FYIB 3H1JH 2A3QA 3L70H 3ZMSA 5KHIA 1OCRB 3A0HZ 4DR6O 2ZDIA 3CRRA 4DW0A 4X8AA 1EFRG 2YXHA 3EHBB 1FFXA 1MOFA 2LFSA 4FLXA 1XNRO 4JI4B 4FM0A 1V9PA 5FLXN 1LNQA 4B3SO 1SQXH 1VQLV 1HNXB 1TAEA 3Q4HA 1N34B 2JVDA 4J7JA 1BGYH 4FPPA 4ABMA 3E86A 3E8BA 1IBKO 4MVRA 1SA0B 2B5UA 4UFZA 5FNVA 4K0KO 4JV5O 1IBMB 4TT3G 3IJ4A 2BTOA 1AI5A 1FFTB 2V1DA 1Q6IA 4AI8A 1XREA 2XNDG 3SPGA 1DTOA 2JS5A 3ICXA 2WLJA 4L87A 4LF8B 4JI5B 1HW7A 2MK3A 1BS3A 3ASOC 4B3TB 1M90W 2ITCC 1TUEB 4YJ3B 2QWNB 1E1QG 1VQ4V 2KQXA 1G1XB 1K8AW 3E89A 4JI8O 4JZGA 4LF5B 3AG3B 1PM9A 2N04A 1SRYA 3T1CA 4J42A 2P6JA 5B1AC 1GN2A 4KUMA 2HVKC 3CCLV 3RYHA 4D6TH 3L73H 4GYCB 3CCJV 3H1HH 3EXAA 5LMUB 3LUTB 5EC1C 4EB6B 3K04A 3TETA 4X65O 1N36O 4DK1A 5EYPA 4LFAB 1AI4A 1VQKV 1VQ8V 1M56B 4I9QA 2ZM6O 3BY6A 4QPKA 4WCEV 1ENVA 2Q0OC 3JD0A 1F4NA 5LOVB 2QJ1A 3ZHQA 1MSDA 3BCCH 4P2ZA 1XEQA 1I5YA 1TUBA 1Z5WA 2XUMA 2UXBO 1BE3H 4DUYB 2UUAB 5LA6A 3M7MX 2Q4PA 4ZHQA 3N27A 2VQEB 2Q7HA 2R72A 4Q20A 2NNUA 1N33O 1K9MW 2JEXA 2E76B 2WLHA 5B1AB 3OEHG 5D5PA 4DO2A 4D7TA 2PY5A 1NR1A 3IGAC 1RM1C 1RP3B 1E1RG 4DR1O 2ZD9A 5DEDA 4JI1B 5LGUA 3JATA 3VQXA 2BE3A 2BTQB 2Q69A 4BIZA 3W7SA 2FTKA 2CTPA 1HNZB 2UXCO 5E79Z 3CJHA 2A9HA 1L8DA 4X62B 4DV0O 1I08A 1AR5A 1H2MA 2DQ3A 5JVDA 3G4SV 2QWPB 1ZAUA 2OCHA 2HP8A 3CRAA 2AHZA 2A06H 3ZRVA 4LF4O 3RN4A 5L3GA 1KP2A 1SESA 4LCUC 3UQ8A 3A2FA 3H1LH 2CE4A 4DRXB 1SZTA 3DC5A 3DTUB 4I5SA 3BA9A 4OXSA 4R6ZA 4DR7O 2LFRA 3ABMC 1FJGO 1WLEA 1NJIW 3CRMA 3I56V 3N2KA 3WB0A 1KKDA 1PV0A 2FKXA 4FLYA 3UO3A 5B5EZ 2ADQB 2Y48A 1GKFA 2Y69C 2VQFO 4MVSA 2QKCA 5HFMA 5K1XA 1OCZB 3JAWA 5CB4B 4XDKA 2DYSC 2JRIA 3AG4C 1KKCA 2ZE5A 2P5OA 4FJCC 1NH2D 4CS4A 1SA0A 4I55B 4U7OA 1HNWO 4DV1O 4O4IB 2W6JG 5J2UA 3ETEA 1QNMA 1M93A 4CH6A 3U0ZA 2E74B 2Q67A 4FM1A 4DV3O 4OX9B 3P32A 1AROP 5H6RA 2V7QG 3QG5A 2O57A 3QVNA 4YHHB 3CEIA 4DK0A 4Q6GA 3BA8A 2DW4A 4EFBA 4PI2A 5IE9A 2F4VO 5JCOC 1V55B 2Y69B 5L3DA 4FLWA 5KLVH 1WB8A 1MZEA 3ZEDA 4MVOA 4RQFA 1NBMG 3SGIA 1VQOV 4X66O 3AG4B 4UCRA 4AQYO 4MSWC 3IAYA 2Y0IA 4MS2A 1JQ0A 1L0NH 3JD3A 3JASA 3RBZA 5JH7B 5GONB 4TOIA 5LYJA 1VARA 4EB6A 3OAAG 5J9PC 4WF9V 2IU0A 3ZHUA 2P4VA 1XUQA 1S5LZ 2XTAA 4JYAO 4P30A 2GV9A 1MZFA 4CZZA 4DR3O 4LWSA 2QWOB 3K5LA 2YDEA 4IT5A 4O2BB 1IVSA 2P06A 2LGWA 5KA6A 2W0XA 4KHPB 3JALB 3O65A 1H2SB 2QA4V 5LGNA 4FM2A 4I7ZB 2HVJC 2ARHA 1V54C 4GX2A 3VQVA 3JD2A 4B3RB 1Q86W 3D36C 5EIBC 2IBZH 1M1KW 4FMTA 1K4DC 4TQFA 1NR7A 3ML0A 3BHPA 3FB6C 3G80A 1ZL8B 1M4UA 3K9SA 4NVPA 4JI2O 1R3KC 5GTIZ 1K5SA 1BZKA 3OMNB 4ZOLB 3JD4A 4UCTA 2X7RB 5KUKA 1BQ0A 4O2AB 5BXZA 4GX1A 4TV8A 3BRCA 4YY3B 3F5TA 2GTSA 2HHHB 3OUFA 3TGUH 5TISZ 1AVMA 4DRXA 2ZIMA 4JI6O 4WFHA 3ZRXA 1QBZA 4X1YA 3ZMTA 4PJ0Z 3T2MA 2ETNA 2CH7A 3T1HB 2JS3A 5JJJB 3WB1A 2QTOA 1J5EB 1M9NA 1ZWIC 2DOSA 4LF6O 4CC5A 1MSWD 4NXMB 4DXWA 2UU9B 1FXHA 2X6BA 3WB2A 4GCZA 3ABUA 3EFFK 2HFEC 2QWQB 5BZBA 4FLVA 3Q4HB 1FPOA 1G6UA 2E5LB 3OEEG 2CAZC 5CB4A 3ZMUA 2AZ2A 1JFFB 3J7AU 4DV7O 3ZRWA 5FNVB 4KP4A 2QWRB 3HKDB 4B7EA 2F95B 3RT3C 2ILMA 3OE7G 4O4IA 2GDSA 2BCCH 3T4ZA 1YTFB 4RUFA 2G38A 1VQ7V 2A0LA 3MHSC 3ABLC 4J10A 3ABKB 2HR3A 1X4TA 2XAQA 4JI3B 1YHQV 3APOA 3U10A 5A2QN 2YUAA 2ADPA 2M7WA 1KB9F 1KU9A 2RDCA 1NVPD 3ZBHA 1FS0G 3CB2A 2YI9A 5IJ0A 4J41A 2E75B 3CRCA 1HDJA 3TCUA 1I94B 4Z1MG 1OZ0A 3ETGA 1A32A 1JVMA 1Y66A 2H3OA 3SPIA 5KUMA 1R1BA 4UV8A 4CH4A 1UPGA 4LFCB 1FKAO 5LMNO 4NKGB 5EYPB 1DF4A 5F2VO 5CA0A 4E4EA 4WFGA 1S77D 4DUZO 4PA6A 4G28B 1JCHA 4OPHA 3KCYA 3OTOO 1QLEC 1FXKC 4PA9A 1JX9A 1MNGA 1TUBB 1AP5A 1HWYA 2OTJV 1BSMA 4ZHQB 1YJNV 1PP9H 4CH5A 5JCOA 1CP9A 3QTCA 4CBCA 3J80N 2RN9A 4JAUA 1QVGU 4GLXA 2AHYA 5H5NA 4GKKO 1HR0B 3L74H 2F23A 4UVBA 2R70A 1AB3A 4QE7A 5LHHA 1JPXA 3NXSA 4DV4O 3VQWA 4NTWA 5EC2C 1P84F 3JATB 4P9PA 5FPOA 5H9CA 2ATKC 2DYRB 2RMKB 4DYLA 1PL4A 3RGBA 3ZIAG 2X6AA 3CJHB 4FK5C 2DJVA 2B1GA 3SPJA 2WLKA 3RYCA 4JI7B 1FXKB 1NTZH 3CXHF 2QKSA 4B3MO 4ZOLA 1XNQO 1SQFA 2WPDG 1R6KA 4O4LA 5JJEB 2CGNA 1YSCA 2KSDA 4WFBV 4PDLA 5EK0A 4DV5B 1XMQO 5KX5A 2YC0A 3OT7A 3SJCC 4LF7B 1PNMA 2VWJA 4LF8O 2HG5C 3SYCA 3M8AA 2QGNA 2EINC 1IBLB 5LP6C 3N2KB 3CRQA 3D36A 2Y4TA 4N23A 1WJZA 1YVWA 3ZRSA 3E83A 2CTWA 4F4LA 4PELA 5DECA 3CWBH 3JAWB 4WBNA 5FL7G 5A9GA 4NXNB 2NR5A 2P7TC 4UXNA 1NVPB 2Q5ZA 1LR1A 1JFFA 4KL1A 1SQGA 2N05A 3W7UA 3HKDA 5J2UB 1O9GA 4BW9A 2UUCB 3ZCCA 1CEZA 4RAIA 1H2GA 1R3JC 3K5MA 1PD3A 2H94A 3K08A 1VF5B 1KC8W 4G2KA 4MTFA 1S3JA 3AK2A 4LNUA 4DR5O 3M99B 5LP6B 1M57C 1GH6A 4JYBA 2GTAA 1VP7A 1Q90D 4NYKA 3CMEV 3FYEB 5IYZA 2F43G 2UUAO 1N8RW 2WLLA 4MT8A 3CYOA 4UCSA 2WAMA 2Y0PA 2EIKC 1Z5VA 4DR6B 1I5XA 4A5UB 3LNMB 2BSKB 4QNHB 3OGIB 3CS5A 3JASB 1XNRB 5LYJB 4ZI7B 2EZPA 4Z1VA 5AG2A 4B3SB 3K5OA 3CCRV 2JK5C 2KG7A 1QU7A 1VMGA 4JI0B 3PJSK 2HEPA 3HKBA 4PI0A 5CN0A 1XHXA 2L35A 4LWSB 3ASOB 1WB7A 1D5AA 1M57B 1DK1A 1IXMA 1Y74B 4W4LA 4HNAB 4JYYA 4K0KB 4JV5B 2YEVA 1Z2GA 4RUEA 1DF5A 4DV2O 4UCUA 2Z5UA 1FXVA 2L6LA 2DWDC 3P3PA 3SJBC 3QO8A 2MW2B 3OM3B 3STLC 2EIKB 2Q68A 2EJRA 4YJ2A 2ZE6A 5B1NA 4EEQA 3FD9A 1US6A 2N74A 4DV6O 3OGCC 5JJNB 3OD4A 3N2GA 1N32O 3EVKA 1AP6A 1GM7A 1Q81W 4J7ZA 4O4JB 3CMAV 1P7BA 3UKMA 4JI8B 1MABG 5CBGA 3E22A 3CX5F 3JAMN 2PTMA 1H38A 1YEWA 1FXKA 2DN9A 1OCCC 3SJAC 4FLTA 1WPBA 4TV8B 1N0JA 4XDLA 3DC6A 4X65B 1N36B 4H44B 5GW7A 4X1YB 3BAAA 3LSQA 3E2EA 4LH6A 1EZVH 5IWAO 2PF4E 2CH7B 4JYCA 1EBOA 5CA1A 4X64O 4LC1A 1SZXA 1RM1B 3SJQC 4HYOA 3RWRD 1K33A 2UXBB 1TGOA 4L8JA 1N33B 2H8PC 4K35A 4K8ZA 1THZA 2WSSG 4ZIBA 5KHJA 3B8MA 5CA3A 1SS3A 1RPOA 3C3SA 4XDJA 3ZRWB 1OCCB 4JTCB 2NN4A 4MVQA 4DR1B 4I50A 1FAFA 3FAVA 4RO2A 4FFKA 3QO5A 2QEXV 1SERA 3ZJZA 1RFYA 2UXXA 1NKDA 1U97A 1U96A 2UXCB 1H2LA 3KKYA 4DV0B 4J9ZB 1OCOC 2NLJC 3ABMB 1VQ5V 2ODMA 2QSAA 3SR2C 2RCVA 5GTHZ 1ZLZA 3GWOA 5LP6A 1W0JG 3RFRA 4LF4B 3ASNC 5IJ0B 4N21A 4DR2O 3BFRA 3RYIB 4MVUA 5IJ9A 2OIEA 2VS0A 5EBLC 4DR7B 1JOYA 3JAKA 3O9OA 1YTFD 1FJGB 2DYSB 1PKXA 1URFA 4NTYA 1KECA 2BSKA 2YI8A 4BW5A 4UVAA 5B3SC 5LHGA 5CA0B 4ZI7A 2VQFB 1AI7A 1WN7A 3L75H 1BT8A 4F6RA 5KA5A 1COWG 2CDYA 4J11A 3ETQA 3CCQV 1YZBA 2DWEC 2GBOA 3A8TA 5KMGA 2WWWA 2EJ7A 1Y74A 3LNNA 2XHBA 4CS2A 4HNAA 4DV1B 5EBMC 3RVZA 1P4RA 3A0RA 1VQ9V 3A0BZ 3B09A 3L72H 4DV3B 5DM6V 3FX7A 3OTFA 4YXWG 4LFBO 2WLNA 1Q82W 3T1YO 1N0NA 3SYPA 3UO2A 4UB6Z 2UXDO 4DR4O 3AK3A 2CTQA 2X0LA 4CH3A 1XQ8A 2PI4A 1F51A 5KHHA 1Q6UA 1XDCA 4O4JA 5BR8O 1KUQA 1DLBA 1AJQA 4NR1A 4EFEA 5B66Z 4X66B 4H33A 1AI6A 3RYCB 3AG2C 2ZR2A 4AQYB 3ZMVA 3STZC 2LW1A 2X6CA 4O4LB 1Y76A 1UJWB 3AG7A 4I0XA 5HFLA 1B3QA 2QKAA 5KX5B 2RQ6A 3FB5C 3JSNA 4OPAA 3AEIA 2ZT9B 3B77A 2M6YA 4DR3B 1NI8A 2QM4A 4JI3O 1V54B 3K0GA 2XAGA 3G6EV 1JJOA 2Q73A 2CTRA 1AJPA 1W0KG 3CPWU 5L3BA 1R6TA 3I5DA 1XMOO 2QDOA 3APQA 2FB5A 3OMIB 2ZNIA 2ZQMA 2QTSA 2JEUA 4WBNB 2Z0AA 5LGTA 4JTDB 1JR9A 3D3QA 3KZIZ 3ZHTA 2HJDA 1S5JA 2YIDA 2W6IG 4XBFA 3WU2Z 1YIJV 3LDCA 4I9WA 4JASA 3GVMA 1TA8A 2ZE8A 3JSLA 1X59A 1SQVH 1BHAA 1PNKA 5BMVA 4JI2B 3ZN1A 5C8YB 4X1IA 2LQTA 3SPHA 5IYBO 4LNUB 2Q7GA 3G71V 4IGGA 2AGAA 3H1IH 4RQEA 5IYZB 3LDDA 3W7TA 1R73A 2WLLB 3U11A 3P30A 4AHCA 3W7WA 4BWAA 3RYIA 4TQDA 4JI6B 2IJKA 1KQSU 4H13B 4CC6A 4GKJO 3LDEA 1R3LC 3DGEA 4UCOA 5L3EA 2FMLA 4Z2WA 3IC9A 4PHZA 1XBLA 3CCVV 1IX9A 2PI5A 4LF9O 4HAMA 1EZJA 2YIBA 2P4KA 1CXZB 2HLDG 1K73W 2EBOA 1RSOB 1Q8IA 2R9RB 2KG7B 1Q3EA 4NB5A 3F5WC 2KB1A 2W0FC 3HKBB 2ZIOA 1WPXA 4BIUA 4LP8A 3ABLB 4JAAA 4IL6Z 4HZ3A 2ZKOA 1YDXA 4DV7B 2OIGA 4YIOA 3GB7C 2YEVB 4FIPC 1BQZA 1GN6A 2P90A 5IY5C 4WFEA 4R8CA 1YF2A 4IIJA 1W59A 1D5NA 2B1IA 4LF7O 1W2BU 4IYHA 3ABTA 3LSSA 3HKCA 2RJZA 4YJ2B 3N2GB 1EN6A 1J95A 1GM8A 4JTAB 4MTXA 4JI4O 1TVKA 2YICA 4MVMA 2CK3G 1QCEA 5LXTA 1S76D 1NU1H 1T5EA 3E22B 1OCRC 1HNXO 1N34O 3P3NA 1QLEB 2Q7EA 5KHKA 1SQQH 4MVZA 2XASA 1IBMO 3HB3B 1WA8B 1M5IA 3FKSG 1XOUA 3ETDA 2LW7A 3MHHC 5LMNB 5H2FZ 2GHYA 2ZE7A 2WA4A 3K9AA 1Q6HA 4DUZB 4FVMA 5LHIA 1E79G 1KP3A 1WNSA 3HPLC 1BCCH 4JI5O 3OTOB 4DW1A 1R3IC 2FYUH 4B3TO 5CA1B 1G8MA 1FD9A 2LP7A 2QR4A 1JJ2U 1MG1A 2ITDC 3TJTA 2PGGA 4X88A 1Q43A 2YXLA 3FB7C 1NZ6A 4TWKA 1VIBA 4X20A 1XI1A 4E2LA 2Q6AA 1Y67A 4BR6A 4LF5O 4P9OA 3CD6V 1I0HA 1K97A 3JARB 1NT2B 4GKKB 1KD1W 3CC4V 3OUSA 1VQNV 4UVCA 3W7XA 4I50B 3FAVB 1QLNA 4DV4B 5H6QA 5LMUO 3G67A 1AJNA 3BVOA 4LFAO 4J80A 1S5HC 3AG3C 5JQGA 4JI0O 3K59A 5DN6G 2UUBB 1YCIA 3DSQA 5C8YA 2DMXA 2YIAA 2XAJA 2EINB 4B3MB 1P7GA 1XNQB 3R66A 3B40A 4QJFB 4DUYO 2EULA 1IURA 1XMQB 2VQEO 4QE9A 3J81N 5IJ9B 2OTLV 3K0DA 1M56C 2Q9LA 3CCUV 1GK9A 3JAKB 3HKEA 1O9HA 3K06A 5ITZA 3ZX6A 2IJIA 2Q0AA 3OR6C 1XL6A 4JI1O 1ORQC 2EILC 4R50A 1RSOA 2PYLA 5CMUA 1HNZO 4F6RB 1Q7YW 4X62O 1VF6C 2DE0X 3B8NA 3BABA 5KMGB 1IBKB 4IHJB 4AILC 3BEHA 2Z3YA 4TSFG 3VQYA 2WLIA 1G4YB 1PL0A 5E1AC 1I7FA 2YIBD 5EZYB 4U3JA 2XT9A 1NTKH 2YXYA 2LGQA 2BOCC 2V4DA 3UM7A 1NTMH 2GSMB 4QGPA 1YITV 5J2TA 4X9QA 4DR5B 2LO1A 1SQBH 3DXRA 2AXTZ 4CS3A 1BHBA 4I4TA 1MMMA 2EILB 3ZN0A 4X89A 3B2EE 2Y4UA 2EIMC 1JMKC 1ROPA 2XOKG 1VQPV 1Y76B 2AW9A 2AZ0A 4I0XB 3QF7A 2GUZA 2A7WA 1GMGA 4PD4F 1WA8A 1S0VA 2PZSA 1H2NA 4OX9O 4TUYB 1ZSPA 1OCZC 5JWPA 1QVFU 2ZM6B 4YHHO 1R6NA 1YI2V 2A79B 2IJJA 3E8GA 2QE7G 1QR8A 4H0LB 4DV2B 1IXBA 2EX3A 3OW2U 1CPYA 1SQPH 1RPRA 4UB8Z 1LUVA 4FFBB 2EIMB 1VEWA 4O4HB 3KG2A 3JARA 1GRJA 4QIWF 1KMIZ 1AR1B 1MA1A 1YXBA 3AG1C 1WAZA 5CBFA 4DV6B 1N32B 3CP1A 2P67A 1XL4A 4ASUG 3THOA 4K3AA 1V55C 5EBWC 2IH3C 1QHTA 5EIBD 1XILA 5IYDO 3CXCU 5BMVB 2HJFC 4PDVA 3WFVA 4RWUA 4X1IB 2F66C 3H01A 1H2KA 1VQ6V 1OHHG 3X2QC 3LSUA 2B9ZA 2XAHA 4B7KA 3RVYA 4KHPO 1ZUQA 2P22C 1GN3A 2PUSA 1HP8A 3G6BA 3QNEA 4TV9B 1S72V 5D5QA 1PPJH 3UT5B 5IWAB 4B3RO 4X64B 3AG1B 2RNBA 3OR7C 4R7CA 3MDSA 2JJ2G 1WP7A 1GN4A
chains in the Genus database with same CATH topology
1P84F 4PD4F 1PP9H 3H1LH 3TGUH 3L72H 2BCCH 3H1KH 1SQVH 3CWBH 1SQPH 5KLVH 1SQXH 3L75H 1NTKH 1NU1H 1KYOF 3H1JH 3L70H 1NTMH 1BCCH 1EZVH 1PPJH 3L74H 2FYUH 3CX5F 1BGYH 1NTZH 3CXHF 3BCCH 1SQBH 1SQQH 1L0LH 3H1IH 3L71H 2IBZH 4D6TH 3L73H 1KB9F 2A06H 1L0NH 4U3FH 3H1HH 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  4PD4 F;  1PP9 H;  3H1L H;  3TGU H;  3L72 H;  2BCC H;  3H1K H;  1SQV H;  3CWB H;  1SQP H;  5KLV H;  1SQX H;  3L75 H;  1NTK H;  1NU1 H;  1KYO F;  3H1J H;  3L70 H;  1NTM H;  1BCC H;  1EZV H;  1PPJ H;  3L74 H;  2FYU H;  3CX5 F;  1BGY H;  1NTZ H;  3CXH F;  3BCC H;  1SQB H;  1SQQ H;  1L0L H;  3H1I H;  3L71 H;  2IBZ H;  4D6T H;  3L73 H;  1KB9 F;  2A06 H;  1L0N H;  4U3F H;  3H1H H;  1BE3 H; 
#chains in the Genus database with same CATH topology
 4YJ3 A;  4UCV A;  1KYO F;  4J9Y B;  1K7D A;  4EKW A;  1OCO B;  3ZHV A;  2IU3 A;  3TXS A;  2YS8 A;  3X2Q B;  2D2C B;  1L1F A;  1FYJ A;  3C3T A;  3BPZ A;  2ZNJ A;  3KCX A;  4KXR A;  3TK1 A;  1QR9 A;  2CGO A;  2K1E A;  4JZ2 A;  4IHJ A;  4FLZ A;  3ASN B;  1HNW B;  4YY3 O;  2JIZ G;  4IIJ B;  2HHH O;  1H8E G;  1BL8 A;  3NR7 A;  5EZY A;  2ZIN A;  3HKC B;  1D2D A;  2VWK A;  5LOV A;  3ZHR A;  4J7K A;  4GT1 A;  4B08 A;  5IDJ A;  3T1H O;  3WG7 C;  1VQM V;  1J5E O;  5C93 A;  1F23 A;  4BIO A;  1EN4 A;  3E8H A;  3ZMZ A;  2ZR3 A;  1TVK B;  2JDI G;  1WP8 A;  1YJW V;  5B3S B;  2F4V B;  1SET A;  5LXT B;  1B04 A;  4GX0 A;  4DR2 B;  4NXM O;  4FLU A;  2JGD B;  2UU9 O;  3CHX A;  3SPC A;  3F7V C;  2IH1 C;  2ZDI C;  4ICG A;  2E5L O;  1VF6 A;  4ZBM A;  1K5Q A;  3SYQ A;  3ZS8 C;  4IYI A;  4X1K B;  3D8C A;  1Y6X A;  2E3C A;  3JCU Z;  3CCM V;  2LJ2 A;  1GAX A;  3FFQ A;  4KFM A;  3R65 A;  3RYF B;  2R9A A;  2BTQ A;  1H8H G;  5L3F A;  4TUY A;  1SKV A;  4JYA B;  5LBQ A;  5FPR A;  4MTG A;  1EN5 A;  2PYJ A;  3WG7 B;  3K5N A;  1K92 A;  3OMA B;  3UCS C;  3GWK C;  5BY1 A;  2IM9 A;  3AK1 A;  4JPR A;  1IDS A;  1Y4M A;  4X20 B;  1NQT A;  3JCZ A;  1GO3 F;  1I94 O;  5KAI Z;  4LFB B;  3JD1 A;  1PNL A;  4FFB A;  3S3X A;  2K9P A;  3K03 A;  3T1Y B;  3CE2 A;  2VRZ A;  2JGU A;  3ABK C;  1NH2 B;  3AG2 B;  1FFX B;  2Q8V A;  4NTX A;  4O4H A;  2UXD B;  4W4K A;  4YIP A;  4DR4 B;  3QO7 A;  2F1M A;  4LFC O;  1AR4 A;  3VOU A;  1OJH A;  3K57 A;  2IJH A;  3K58 A;  4PDM A;  5B1B C;  2EIJ C;  2F93 B;  4MW3 A;  4K8X A;  2XAF A;  1UFI A;  5JQG B;  3H1K H;  5BR8 B;  4GUN A;  5L3C A;  3CC7 V;  4OGQ B;  4LH7 A;  1ZX3 A;  4JF3 A;  3L71 H;  5IYC O;  3MD0 A;  1LUW A;  4PA3 A;  4I55 A;  1K4C C;  1F4M A;  5KAF Z;  2ZCE A;  3CCE V;  3HR0 A;  1IZ3 A;  2EZO A;  2WLM A;  4U7N A;  2BOB C;  4TV9 A;  1HR0 O;  2KKW A;  3HKE B;  3UT5 A;  5ITZ B;  3E8F A;  1YJ9 V;  2HKO A;  1VF7 A;  1OV9 A;  3RW0 A;  3JYC A;  4FZ1 A;  4D7S A;  2D3O W;  4MTO A;  5B1B B;  4PDR A;  2EIJ B;  4LF6 B;  1XMO B;  3ZHS A;  1F7Y A;  3K3W A;  4ZKI A;  3CC2 V;  4GX5 A;  4MW8 A;  3MAQ A;  3VBB A;  3FB8 C;  4JI7 O;  3CCS V;  4WFF A;  3RYH B;  1K34 A;  2R9I A;  3IFX A;  2FL4 A;  1L0L H;  1SF9 A;  1N4C A;  2QM8 A;  3CSX A;  4GZR B;  4U3F H;  3E35 A;  4DV5 O;  4UUJ C;  4G27 B;  5GON A;  2ZXW C;  5JH7 A;  2WLI B;  2DYR C;  1ZTE A;  3SYA A;  2WA3 A;  1AIL A;  3F7Y C;  4U3J B;  4PA4 A;  4LR3 A;  4FZ0 A;  2JJ1 G;  3I55 V;  4QPJ A;  1JA8 A;  1Q5O A;  5J2T B;  1IBL O;  3OFN G;  3C90 A;  4HBN A;  1K3E A;  3K79 A;  3DXR B;  4F6E A;  3PN1 A;  4O2B A;  3D3I A;  3L9D A;  3TXQ A;  5LA6 B;  2CUG A;  1NS1 A;  4I4T B;  4PV1 B;  1GM9 A;  3JAL A;  2QM7 A;  2OCC C;  3SDL A;  2UXN A;  3T4D A;  2JGD A;  2IW5 A;  1GTO A;  5B1O A;  4NXN O;  2DQ0 A;  5K1P A;  1EM1 A;  4UV9 A;  4GKJ B;  4WFA V;  4LBE C;  2GUZ B;  4C7U A;  4JGS A;  1SC5 B;  4X1K A;  4LF9 B;  4H37 A;  2C2A A;  3S3W A;  2UUC O;  2ZXW B;  5IY5 B;  3RYF A;  5LL6 Y;  2OT5 A;  3SYO A;  2YSU B;  5IT9 N;  1ZL8 A;  1B6Q A;  2UUB O;  5KHG A;  2OYQ A;  5JVD B;  3IC7 A;  1KBH A;  4BAY A;  4PA7 A;  3H9V A;  2OWO A;  1QQC A;  4O2A A;  1XHZ A;  1BMF G;  1DGS A;  2OCC B;  1P49 A;  1B06 A;  4JAV A;  3B4S A;  5CBH A;  3FYI B;  3H1J H;  2A3Q A;  3L70 H;  3ZMS A;  5KHI A;  1OCR B;  3A0H Z;  4DR6 O;  2ZDI A;  3CRR A;  4DW0 A;  4X8A A;  1EFR G;  2YXH A;  3EHB B;  1FFX A;  1MOF A;  2LFS A;  4FLX A;  1XNR O;  4JI4 B;  4FM0 A;  1V9P A;  5FLX N;  1LNQ A;  4B3S O;  1SQX H;  1VQL V;  1HNX B;  1TAE A;  3Q4H A;  1N34 B;  2JVD A;  4J7J A;  1BGY H;  4FPP A;  4ABM A;  3E86 A;  3E8B A;  1IBK O;  4MVR A;  1SA0 B;  2B5U A;  4UFZ A;  5FNV A;  4K0K O;  4JV5 O;  1IBM B;  4TT3 G;  3IJ4 A;  2BTO A;  1AI5 A;  1FFT B;  2V1D A;  1Q6I A;  4AI8 A;  1XRE A;  2XND G;  3SPG A;  1DTO A;  2JS5 A;  3ICX A;  2WLJ A;  4L87 A;  4LF8 B;  4JI5 B;  1HW7 A;  2MK3 A;  1BS3 A;  3ASO C;  4B3T B;  1M90 W;  2ITC C;  1TUE B;  4YJ3 B;  2QWN B;  1E1Q G;  1VQ4 V;  2KQX A;  1G1X B;  1K8A W;  3E89 A;  4JI8 O;  4JZG A;  4LF5 B;  3AG3 B;  1PM9 A;  2N04 A;  1SRY A;  3T1C A;  4J42 A;  2P6J A;  5B1A C;  1GN2 A;  4KUM A;  2HVK C;  3CCL V;  3RYH A;  4D6T H;  3L73 H;  4GYC B;  3CCJ V;  3H1H H;  3EXA A;  5LMU B;  3LUT B;  5EC1 C;  4EB6 B;  3K04 A;  3TET A;  4X65 O;  1N36 O;  4DK1 A;  5EYP A;  4LFA B;  1AI4 A;  1VQK V;  1VQ8 V;  1M56 B;  4I9Q A;  2ZM6 O;  3BY6 A;  4QPK A;  4WCE V;  1ENV A;  2Q0O C;  3JD0 A;  1F4N A;  5LOV B;  2QJ1 A;  3ZHQ A;  1MSD A;  3BCC H;  4P2Z A;  1XEQ A;  1I5Y A;  1TUB A;  1Z5W A;  2XUM A;  2UXB O;  1BE3 H;  4DUY B;  2UUA B;  5LA6 A;  3M7M X;  2Q4P A;  4ZHQ A;  3N27 A;  2VQE B;  2Q7H A;  2R72 A;  4Q20 A;  2NNU A;  1N33 O;  1K9M W;  2JEX A;  2E76 B;  2WLH A;  5B1A B;  3OEH G;  5D5P A;  4DO2 A;  4D7T A;  2PY5 A;  1NR1 A;  3IGA C;  1RM1 C;  1RP3 B;  1E1R G;  4DR1 O;  2ZD9 A;  5DED A;  4JI1 B;  5LGU A;  3JAT A;  3VQX A;  2BE3 A;  2BTQ B;  2Q69 A;  4BIZ A;  3W7S A;  2FTK A;  2CTP A;  1HNZ B;  2UXC O;  5E79 Z;  3CJH A;  2A9H A;  1L8D A;  4X62 B;  4DV0 O;  1I08 A;  1AR5 A;  1H2M A;  2DQ3 A;  5JVD A;  3G4S V;  2QWP B;  1ZAU A;  2OCH A;  2HP8 A;  3CRA A;  2AHZ A;  2A06 H;  3ZRV A;  4LF4 O;  3RN4 A;  5L3G A;  1KP2 A;  1SES A;  4LCU C;  3UQ8 A;  3A2F A;  3H1L H;  2CE4 A;  4DRX B;  1SZT A;  3DC5 A;  3DTU B;  4I5S A;  3BA9 A;  4OXS A;  4R6Z A;  4DR7 O;  2LFR A;  3ABM C;  1FJG O;  1WLE A;  1NJI W;  3CRM A;  3I56 V;  3N2K A;  3WB0 A;  1KKD A;  1PV0 A;  2FKX A;  4FLY A;  3UO3 A;  5B5E Z;  2ADQ B;  2Y48 A;  1GKF A;  2Y69 C;  2VQF O;  4MVS A;  2QKC A;  5HFM A;  5K1X A;  1OCZ B;  3JAW A;  5CB4 B;  4XDK A;  2DYS C;  2JRI A;  3AG4 C;  1KKC A;  2ZE5 A;  2P5O A;  4FJC C;  1NH2 D;  4CS4 A;  1SA0 A;  4I55 B;  4U7O A;  1HNW O;  4DV1 O;  4O4I B;  2W6J G;  5J2U A;  3ETE A;  1QNM A;  1M93 A;  4CH6 A;  3U0Z A;  2E74 B;  2Q67 A;  4FM1 A;  4DV3 O;  4OX9 B;  3P32 A;  1ARO P;  5H6R A;  2V7Q G;  3QG5 A;  2O57 A;  3QVN A;  4YHH B;  3CEI A;  4DK0 A;  4Q6G A;  3BA8 A;  2DW4 A;  4EFB A;  4PI2 A;  5IE9 A;  2F4V O;  5JCO C;  1V55 B;  2Y69 B;  5L3D A;  4FLW A;  5KLV H;  1WB8 A;  1MZE A;  3ZED A;  4MVO A;  4RQF A;  1NBM G;  3SGI A;  1VQO V;  4X66 O;  3AG4 B;  4UCR A;  4AQY O;  4MSW C;  3IAY A;  2Y0I A;  4MS2 A;  1JQ0 A;  1L0N H;  3JD3 A;  3JAS A;  3RBZ A;  5JH7 B;  5GON B;  4TOI A;  5LYJ A;  1VAR A;  4EB6 A;  3OAA G;  5J9P C;  4WF9 V;  2IU0 A;  3ZHU A;  2P4V A;  1XUQ A;  1S5L Z;  2XTA A;  4JYA O;  4P30 A;  2GV9 A;  1MZF A;  4CZZ A;  4DR3 O;  4LWS A;  2QWO B;  3K5L A;  2YDE A;  4IT5 A;  4O2B B;  1IVS A;  2P06 A;  2LGW A;  5KA6 A;  2W0X A;  4KHP B;  3JAL B;  3O65 A;  1H2S B;  2QA4 V;  5LGN A;  4FM2 A;  4I7Z B;  2HVJ C;  2ARH A;  1V54 C;  4GX2 A;  3VQV A;  3JD2 A;  4B3R B;  1Q86 W;  3D36 C;  5EIB C;  2IBZ H;  1M1K W;  4FMT A;  1K4D C;  4TQF A;  1NR7 A;  3ML0 A;  3BHP A;  3FB6 C;  3G80 A;  1ZL8 B;  1M4U A;  3K9S A;  4NVP A;  4JI2 O;  1R3K C;  5GTI Z;  1K5S A;  1BZK A;  3OMN B;  4ZOL B;  3JD4 A;  4UCT A;  2X7R B;  5KUK A;  1BQ0 A;  4O2A B;  5BXZ A;  4GX1 A;  4TV8 A;  3BRC A;  4YY3 B;  3F5T A;  2GTS A;  2HHH B;  3OUF A;  3TGU H;  5TIS Z;  1AVM A;  4DRX A;  2ZIM A;  4JI6 O;  4WFH A;  3ZRX A;  1QBZ A;  4X1Y A;  3ZMT A;  4PJ0 Z;  3T2M A;  2ETN A;  2CH7 A;  3T1H B;  2JS3 A;  5JJJ B;  3WB1 A;  2QTO A;  1J5E B;  1M9N A;  1ZWI C;  2DOS A;  4LF6 O;  4CC5 A;  1MSW D;  4NXM B;  4DXW A;  2UU9 B;  1FXH A;  2X6B A;  3WB2 A;  4GCZ A;  3ABU A;  3EFF K;  2HFE C;  2QWQ B;  5BZB A;  4FLV A;  3Q4H B;  1FPO A;  1G6U A;  2E5L B;  3OEE G;  2CAZ C;  5CB4 A;  3ZMU A;  2AZ2 A;  1JFF B;  3J7A U;  4DV7 O;  3ZRW A;  5FNV B;  4KP4 A;  2QWR B;  3HKD B;  4B7E A;  2F95 B;  3RT3 C;  2ILM A;  3OE7 G;  4O4I A;  2GDS A;  2BCC H;  3T4Z A;  1YTF B;  4RUF A;  2G38 A;  1VQ7 V;  2A0L A;  3MHS C;  3ABL C;  4J10 A;  3ABK B;  2HR3 A;  1X4T A;  2XAQ A;  4JI3 B;  1YHQ V;  3APO A;  3U10 A;  5A2Q N;  2YUA A;  2ADP A;  2M7W A;  1KB9 F;  1KU9 A;  2RDC A;  1NVP D;  3ZBH A;  1FS0 G;  3CB2 A;  2YI9 A;  5IJ0 A;  4J41 A;  2E75 B;  3CRC A;  1HDJ A;  3TCU A;  1I94 B;  4Z1M G;  1OZ0 A;  3ETG A;  1A32 A;  1JVM A;  1Y66 A;  2H3O A;  3SPI A;  5KUM A;  1R1B A;  4UV8 A;  4CH4 A;  1UPG A;  4LFC B;  1FKA O;  5LMN O;  4NKG B;  5EYP B;  1DF4 A;  5F2V O;  5CA0 A;  4E4E A;  4WFG A;  1S77 D;  4DUZ O;  4PA6 A;  4G28 B;  1JCH A;  4OPH A;  3KCY A;  3OTO O;  1QLE C;  1FXK C;  4PA9 A;  1JX9 A;  1MNG A;  1TUB B;  1AP5 A;  1HWY A;  2OTJ V;  1BSM A;  4ZHQ B;  1YJN V;  1PP9 H;  4CH5 A;  5JCO A;  1CP9 A;  3QTC A;  4CBC A;  3J80 N;  2RN9 A;  4JAU A;  1QVG U;  4GLX A;  2AHY A;  5H5N A;  4GKK O;  1HR0 B;  3L74 H;  2F23 A;  4UVB A;  2R70 A;  1AB3 A;  4QE7 A;  5LHH A;  1JPX A;  3NXS A;  4DV4 O;  3VQW A;  4NTW A;  5EC2 C;  1P84 F;  3JAT B;  4P9P A;  5FPO A;  5H9C A;  2ATK C;  2DYR B;  2RMK B;  4DYL A;  1PL4 A;  3RGB A;  3ZIA G;  2X6A A;  3CJH B;  4FK5 C;  2DJV A;  2B1G A;  3SPJ A;  2WLK A;  3RYC A;  4JI7 B;  1FXK B;  1NTZ H;  3CXH F;  2QKS A;  4B3M O;  4ZOL A;  1XNQ O;  1SQF A;  2WPD G;  1R6K A;  4O4L A;  5JJE B;  2CGN A;  1YSC A;  2KSD A;  4WFB V;  4PDL A;  5EK0 A;  4DV5 B;  1XMQ O;  5KX5 A;  2YC0 A;  3OT7 A;  3SJC C;  4LF7 B;  1PNM A;  2VWJ A;  4LF8 O;  2HG5 C;  3SYC A;  3M8A A;  2QGN A;  2EIN C;  1IBL B;  5LP6 C;  3N2K B;  3CRQ A;  3D36 A;  2Y4T A;  4N23 A;  1WJZ A;  1YVW A;  3ZRS A;  3E83 A;  2CTW A;  4F4L A;  4PEL A;  5DEC A;  3CWB H;  3JAW B;  4WBN A;  5FL7 G;  5A9G A;  4NXN B;  2NR5 A;  2P7T C;  4UXN A;  1NVP B;  2Q5Z A;  1LR1 A;  1JFF A;  4KL1 A;  1SQG A;  2N05 A;  3W7U A;  3HKD A;  5J2U B;  1O9G A;  4BW9 A;  2UUC B;  3ZCC A;  1CEZ A;  4RAI A;  1H2G A;  1R3J C;  3K5M A;  1PD3 A;  2H94 A;  3K08 A;  1VF5 B;  1KC8 W;  4G2K A;  4MTF A;  1S3J A;  3AK2 A;  4LNU A;  4DR5 O;  3M99 B;  5LP6 B;  1M57 C;  1GH6 A;  4JYB A;  2GTA A;  1VP7 A;  1Q90 D;  4NYK A;  3CME V;  3FYE B;  5IYZ A;  2F43 G;  2UUA O;  1N8R W;  2WLL A;  4MT8 A;  3CYO A;  4UCS A;  2WAM A;  2Y0P A;  2EIK C;  1Z5V A;  4DR6 B;  1I5X A;  4A5U B;  3LNM B;  2BSK B;  4QNH B;  3OGI B;  3CS5 A;  3JAS B;  1XNR B;  5LYJ B;  4ZI7 B;  2EZP A;  4Z1V A;  5AG2 A;  4B3S B;  3K5O A;  3CCR V;  2JK5 C;  2KG7 A;  1QU7 A;  1VMG A;  4JI0 B;  3PJS K;  2HEP A;  3HKB A;  4PI0 A;  5CN0 A;  1XHX A;  2L35 A;  4LWS B;  3ASO B;  1WB7 A;  1D5A A;  1M57 B;  1DK1 A;  1IXM A;  1Y74 B;  4W4L A;  4HNA B;  4JYY A;  4K0K B;  4JV5 B;  2YEV A;  1Z2G A;  4RUE A;  1DF5 A;  4DV2 O;  4UCU A;  2Z5U A;  1FXV A;  2L6L A;  2DWD C;  3P3P A;  3SJB C;  3QO8 A;  2MW2 B;  3OM3 B;  3STL C;  2EIK B;  2Q68 A;  2EJR A;  4YJ2 A;  2ZE6 A;  5B1N A;  4EEQ A;  3FD9 A;  1US6 A;  2N74 A;  4DV6 O;  3OGC C;  5JJN B;  3OD4 A;  3N2G A;  1N32 O;  3EVK A;  1AP6 A;  1GM7 A;  1Q81 W;  4J7Z A;  4O4J B;  3CMA V;  1P7B A;  3UKM A;  4JI8 B;  1MAB G;  5CBG A;  3E22 A;  3CX5 F;  3JAM N;  2PTM A;  1H38 A;  1YEW A;  1FXK A;  2DN9 A;  1OCC C;  3SJA C;  4FLT A;  1WPB A;  4TV8 B;  1N0J A;  4XDL A;  3DC6 A;  4X65 B;  1N36 B;  4H44 B;  5GW7 A;  4X1Y B;  3BAA A;  3LSQ A;  3E2E A;  4LH6 A;  1EZV H;  5IWA O;  2PF4 E;  2CH7 B;  4JYC A;  1EBO A;  5CA1 A;  4X64 O;  4LC1 A;  1SZX A;  1RM1 B;  3SJQ C;  4HYO A;  3RWR D;  1K33 A;  2UXB B;  1TGO A;  4L8J A;  1N33 B;  2H8P C;  4K35 A;  4K8Z A;  1THZ A;  2WSS G;  4ZIB A;  5KHJ A;  3B8M A;  5CA3 A;  1SS3 A;  1RPO A;  3C3S A;  4XDJ A;  3ZRW B;  1OCC B;  4JTC B;  2NN4 A;  4MVQ A;  4DR1 B;  4I50 A;  1FAF A;  3FAV A;  4RO2 A;  4FFK A;  3QO5 A;  2QEX V;  1SER A;  3ZJZ A;  1RFY A;  2UXX A;  1NKD A;  1U97 A;  1U96 A;  2UXC B;  1H2L A;  3KKY A;  4DV0 B;  4J9Z B;  1OCO C;  2NLJ C;  3ABM B;  1VQ5 V;  2ODM A;  2QSA A;  3SR2 C;  2RCV A;  5GTH Z;  1ZLZ A;  3GWO A;  5LP6 A;  1W0J G;  3RFR A;  4LF4 B;  3ASN C;  5IJ0 B;  4N21 A;  4DR2 O;  3BFR A;  3RYI B;  4MVU A;  5IJ9 A;  2OIE A;  2VS0 A;  5EBL C;  4DR7 B;  1JOY A;  3JAK A;  3O9O A;  1YTF D;  1FJG B;  2DYS B;  1PKX A;  1URF A;  4NTY A;  1KEC A;  2BSK A;  2YI8 A;  4BW5 A;  4UVA A;  5B3S C;  5LHG A;  5CA0 B;  4ZI7 A;  2VQF B;  1AI7 A;  1WN7 A;  3L75 H;  1BT8 A;  4F6R A;  5KA5 A;  1COW G;  2CDY A;  4J11 A;  3ETQ A;  3CCQ V;  1YZB A;  2DWE C;  2GBO A;  3A8T A;  5KMG A;  2WWW A;  2EJ7 A;  1Y74 A;  3LNN A;  2XHB A;  4CS2 A;  4HNA A;  4DV1 B;  5EBM C;  3RVZ A;  1P4R A;  3A0R A;  1VQ9 V;  3A0B Z;  3B09 A;  3L72 H;  4DV3 B;  5DM6 V;  3FX7 A;  3OTF A;  4YXW G;  4LFB O;  2WLN A;  1Q82 W;  3T1Y O;  1N0N A;  3SYP A;  3UO2 A;  4UB6 Z;  2UXD O;  4DR4 O;  3AK3 A;  2CTQ A;  2X0L A;  4CH3 A;  1XQ8 A;  2PI4 A;  1F51 A;  5KHH A;  1Q6U A;  1XDC A;  4O4J A;  5BR8 O;  1KUQ A;  1DLB A;  1AJQ A;  4NR1 A;  4EFE A;  5B66 Z;  4X66 B;  4H33 A;  1AI6 A;  3RYC B;  3AG2 C;  2ZR2 A;  4AQY B;  3ZMV A;  3STZ C;  2LW1 A;  2X6C A;  4O4L B;  1Y76 A;  1UJW B;  3AG7 A;  4I0X A;  5HFL A;  1B3Q A;  2QKA A;  5KX5 B;  2RQ6 A;  3FB5 C;  3JSN A;  4OPA A;  3AEI A;  2ZT9 B;  3B77 A;  2M6Y A;  4DR3 B;  1NI8 A;  2QM4 A;  4JI3 O;  1V54 B;  3K0G A;  2XAG A;  3G6E V;  1JJO A;  2Q73 A;  2CTR A;  1AJP A;  1W0K G;  3CPW U;  5L3B A;  1R6T A;  3I5D A;  1XMO O;  2QDO A;  3APQ A;  2FB5 A;  3OMI B;  2ZNI A;  2ZQM A;  2QTS A;  2JEU A;  4WBN B;  2Z0A A;  5LGT A;  4JTD B;  1JR9 A;  3D3Q A;  3KZI Z;  3ZHT A;  2HJD A;  1S5J A;  2YID A;  2W6I G;  4XBF A;  3WU2 Z;  1YIJ V;  3LDC A;  4I9W A;  4JAS A;  3GVM A;  1TA8 A;  2ZE8 A;  3JSL A;  1X59 A;  1SQV H;  1BHA A;  1PNK A;  5BMV A;  4JI2 B;  3ZN1 A;  5C8Y B;  4X1I A;  2LQT A;  3SPH A;  5IYB O;  4LNU B;  2Q7G A;  3G71 V;  4IGG A;  2AGA A;  3H1I H;  4RQE A;  5IYZ B;  3LDD A;  3W7T A;  1R73 A;  2WLL B;  3U11 A;  3P30 A;  4AHC A;  3W7W A;  4BWA A;  3RYI A;  4TQD A;  4JI6 B;  2IJK A;  1KQS U;  4H13 B;  4CC6 A;  4GKJ O;  3LDE A;  1R3L C;  3DGE A;  4UCO A;  5L3E A;  2FML A;  4Z2W A;  3IC9 A;  4PHZ A;  1XBL A;  3CCV V;  1IX9 A;  2PI5 A;  4LF9 O;  4HAM A;  1EZJ A;  2YIB A;  2P4K A;  1CXZ B;  2HLD G;  1K73 W;  2EBO A;  1RSO B;  1Q8I A;  2R9R B;  2KG7 B;  1Q3E A;  4NB5 A;  3F5W C;  2KB1 A;  2W0F C;  3HKB B;  2ZIO A;  1WPX A;  4BIU A;  4LP8 A;  3ABL B;  4JAA A;  4IL6 Z;  4HZ3 A;  2ZKO A;  1YDX A;  4DV7 B;  2OIG A;  4YIO A;  3GB7 C;  2YEV B;  4FIP C;  1BQZ A;  1GN6 A;  2P90 A;  5IY5 C;  4WFE A;  4R8C A;  1YF2 A;  4IIJ A;  1W59 A;  1D5N A;  2B1I A;  4LF7 O;  1W2B U;  4IYH A;  3ABT A;  3LSS A;  3HKC A;  2RJZ A;  4YJ2 B;  3N2G B;  1EN6 A;  1J95 A;  1GM8 A;  4JTA B;  4MTX A;  4JI4 O;  1TVK A;  2YIC A;  4MVM A;  2CK3 G;  1QCE A;  5LXT A;  1S76 D;  1NU1 H;  1T5E A;  3E22 B;  1OCR C;  1HNX O;  1N34 O;  3P3N A;  1QLE B;  2Q7E A;  5KHK A;  1SQQ H;  4MVZ A;  2XAS A;  1IBM O;  3HB3 B;  1WA8 B;  1M5I A;  3FKS G;  1XOU A;  3ETD A;  2LW7 A;  3MHH C;  5LMN B;  5H2F Z;  2GHY A;  2ZE7 A;  2WA4 A;  3K9A A;  1Q6H A;  4DUZ B;  4FVM A;  5LHI A;  1E79 G;  1KP3 A;  1WNS A;  3HPL C;  1BCC H;  4JI5 O;  3OTO B;  4DW1 A;  1R3I C;  2FYU H;  4B3T O;  5CA1 B;  1G8M A;  1FD9 A;  2LP7 A;  2QR4 A;  1JJ2 U;  1MG1 A;  2ITD C;  3TJT A;  2PGG A;  4X88 A;  1Q43 A;  2YXL A;  3FB7 C;  1NZ6 A;  4TWK A;  1VIB A;  4X20 A;  1XI1 A;  4E2L A;  2Q6A A;  1Y67 A;  4BR6 A;  4LF5 O;  4P9O A;  3CD6 V;  1I0H A;  1K97 A;  3JAR B;  1NT2 B;  4GKK B;  1KD1 W;  3CC4 V;  3OUS A;  1VQN V;  4UVC A;  3W7X A;  4I50 B;  3FAV B;  1QLN A;  4DV4 B;  5H6Q A;  5LMU O;  3G67 A;  1AJN A;  3BVO A;  4LFA O;  4J80 A;  1S5H C;  3AG3 C;  5JQG A;  4JI0 O;  3K59 A;  5DN6 G;  2UUB B;  1YCI A;  3DSQ A;  5C8Y A;  2DMX A;  2YIA A;  2XAJ A;  2EIN B;  4B3M B;  1P7G A;  1XNQ B;  3R66 A;  3B40 A;  4QJF B;  4DUY O;  2EUL A;  1IUR A;  1XMQ B;  2VQE O;  4QE9 A;  3J81 N;  5IJ9 B;  2OTL V;  3K0D A;  1M56 C;  2Q9L A;  3CCU V;  1GK9 A;  3JAK B;  3HKE A;  1O9H A;  3K06 A;  5ITZ A;  3ZX6 A;  2IJI A;  2Q0A A;  3OR6 C;  1XL6 A;  4JI1 O;  1ORQ C;  2EIL C;  4R50 A;  1RSO A;  2PYL A;  5CMU A;  1HNZ O;  4F6R B;  1Q7Y W;  4X62 O;  1VF6 C;  2DE0 X;  3B8N A;  3BAB A;  5KMG B;  1IBK B;  4IHJ B;  4AIL C;  3BEH A;  2Z3Y A;  4TSF G;  3VQY A;  2WLI A;  1G4Y B;  1PL0 A;  5E1A C;  1I7F A;  2YIB D;  5EZY B;  4U3J A;  2XT9 A;  1NTK H;  2YXY A;  2LGQ A;  2BOC C;  2V4D A;  3UM7 A;  1NTM H;  2GSM B;  4QGP A;  1YIT V;  5J2T A;  4X9Q A;  4DR5 B;  2LO1 A;  1SQB H;  3DXR A;  2AXT Z;  4CS3 A;  1BHB A;  4I4T A;  1MMM A;  2EIL B;  3ZN0 A;  4X89 A;  3B2E E;  2Y4U A;  2EIM C;  1JMK C;  1ROP A;  2XOK G;  1VQP V;  1Y76 B;  2AW9 A;  2AZ0 A;  4I0X B;  3QF7 A;  2GUZ A;  2A7W A;  1GMG A;  4PD4 F;  1WA8 A;  1S0V A;  2PZS A;  1H2N A;  4OX9 O;  4TUY B;  1ZSP A;  1OCZ C;  5JWP A;  1QVF U;  2ZM6 B;  4YHH O;  1R6N A;  1YI2 V;  2A79 B;  2IJJ A;  3E8G A;  2QE7 G;  1QR8 A;  4H0L B;  4DV2 B;  1IXB A;  2EX3 A;  3OW2 U;  1CPY A;  1SQP H;  1RPR A;  4UB8 Z;  1LUV A;  4FFB B;  2EIM B;  1VEW A;  4O4H B;  3KG2 A;  3JAR A;  1GRJ A;  4QIW F;  1KMI Z;  1AR1 B;  1MA1 A;  1YXB A;  3AG1 C;  1WAZ A;  5CBF A;  4DV6 B;  1N32 B;  3CP1 A;  2P67 A;  1XL4 A;  4ASU G;  3THO A;  4K3A A;  1V55 C;  5EBW C;  2IH3 C;  1QHT A;  5EIB D;  1XIL A;  5IYD O;  3CXC U;  5BMV B;  2HJF C;  4PDV A;  3WFV A;  4RWU A;  4X1I B;  2F66 C;  3H01 A;  1H2K A;  1VQ6 V;  1OHH G;  3X2Q C;  3LSU A;  2B9Z A;  2XAH A;  4B7K A;  3RVY A;  4KHP O;  1ZUQ A;  2P22 C;  1GN3 A;  2PUS A;  1HP8 A;  3G6B A;  3QNE A;  4TV9 B;  1S72 V;  5D5Q A;  1PPJ H;  3UT5 B;  5IWA B;  4B3R O;  4X64 B;  3AG1 B;  2RNB A;  3OR7 C;  4R7C A;  3MDS A;  2JJ2 G;  1WP7 A;  1GN4 A; 
#chains in the Genus database with same CATH homology
 1P84 F;  4PD4 F;  1PP9 H;  3H1L H;  3TGU H;  3L72 H;  2BCC H;  3H1K H;  1SQV H;  3CWB H;  1SQP H;  5KLV H;  1SQX H;  3L75 H;  1NTK H;  1NU1 H;  1KYO F;  3H1J H;  3L70 H;  1NTM H;  1BCC H;  1EZV H;  1PPJ H;  3L74 H;  2FYU H;  3CX5 F;  1BGY H;  1NTZ H;  3CXH F;  3BCC H;  1SQB H;  1SQQ H;  1L0L H;  3H1I H;  3L71 H;  2IBZ H;  4D6T H;  3L73 H;  1KB9 F;  2A06 H;  1L0N H;  4U3F H;  3H1H H;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...