1BHAA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
67
Chain Sequence
b'AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIORHODOPSIN
molecule tags Photoreceptor
source organism Halobacterium salinarum
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
total genus 23
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhaA00
1BHBA 1BHAA
chains in the Genus database with same CATH superfamily
4X9QA 1OCCB 5CMUA 4WBNB 5KHIA 5L3FA 4O2AA 5B1BB 2ADPA 5LP6B 3JALB 1NT2B 4PHZA 4J7KA 2HFEC 1H8EG 4DV0O 3K04A 4MVOA 4MVUA 4EFEA 4I55B 3UM7A 4PELA 2RJZA 2WA3A 3DXRB 3JSNA 3CCRV 5IYZA 3A8TA 2F23A 1HNWO 1BGYH 2QM4A 2P5OA 3AG4B 2WPDG 3SPCA 3UT5B 1SETA 4IIJB 4B3MB 1MSWD 2QSAA 1JVMA 1YF2A 1VF7A 4GZRB 5CBGA 3ICXA 4GT1A 3P3NA 4DR4B 4O4LA 4IT5A 5L3GA 1QR8A 3BHPA 3CHXA 2RCVA 3L72H 2XHBA 4JAAA 3JAKB 4ZKIA 3K5MA 2UUBO 3DXRA 3W7SA 2O57A 3CD6V 2DQ3A 3SJAC 1D5NA 3LNMB 1A32A 1F23A 3H1HH 4D6TH 3DTUB 3WU2Z 3QF7A 2AXTZ 4K8XA 3K0GA 3ABMC 4JYBA 1KMIZ 4P30A 5IYZB 4JI1O 3UO2A 2VQEO 2ZINA 1N32O 3I5DA 2QWQB 4LF4O 2A06H 4PV1B 3IFXA 1NZ6A 3HKDA 1BCCH 3CCEV 3BRCA 2YSUB 1FXKC 4QGPA 1NH2D 2YS8A 3L71H 4LWSA 5BY1A 1K4DC 2HG5C 4JYYA 1Y74A 5L3EA 1XMOB 4DRXB 2UXCB 3FB8C 5IJ0A 2WLNA 3OEHG 1AR5A 1BHBA 1GN4A 1H38A 3FB5C 2EIKB 1K33A 1M9NA 1KKCA 3I55V 2N04A 4YHHB 1OCZB 2ARHA 4MTOA 2ZNIA 4FMTA 2ATKC 1US6A 4NTXA 1M5IA 3KCXA 4CBCA 1DK1A 2QM8A 4UFZA 2QE7G 4I55A 4I50A 1EM1A 2Q0AA 2HEPA 1VQ4V 2A79B 3OR7C 3JALA 4DV4B 2ZQMA 2ZNJA 4DUYB 4I0XB 2QR4A 3ASOC 1W2BU 2E5LO 5CA0B 4FM0A 4JV5B 3K9AA 4JTDB 1FXVA 1LR1A 4JI5O 2YUAA 5H5NA 4I50B 2XTAA 3HKCA 2A9HA 2EIKC 1ENVA 3KKYA 2UXBB 2UUBB 4DO2A 4D7SA 4B7KA 2V4DA 1AJNA 4UV9A 3CS5A 3WB1A 5JJEB 1KYOF 1YCIA 1YITV 2PY5A 3H1KH 2RNBA 3M8AA 3VBBA 4O4LB 2LW7A 3MHSC 1QCEA 2X6AA 2ETNA 5FNVA 3RWRD 4ZHQA 2JS5A 1XNRO 2PGGA 4G2KA 4MW3A 3JASB 2IJKA 4YJ2B 1SZXA 3FB6C 3MDSA 4J41A 1N34O 2AGAA 1MA1A 3EHBB 1YJ9V 4MTXA 4TSFG 4NKGB 3RN4A 3B4SA 1HNWB 2QTSA 4TT3G 1K5SA 1JQ0A 4FLYA 4X8AA 1XNQO 2VQEB 1WA8B 4DV0B 1VQLV 5LGUA 2EIMC 4JAUA 1Q5OA 4YIPA 1U97A 4FK5C 4X1IA 2BOCC 1RSOA 4GCZA 1EN4A 3L70H 1B6QA 4GKJB 4DUYO 1TUBB 4RQFA 4X66O 1FD9A 2EBOA 3B77A 4X66B 2FMLA 4FLXA 4Z1MG 1URFA 1ROPA 1Q81W 1XILA 1WB8A 3TJTA 1EBOA 1SQBH 5BMVB 4DYLA 2ZDIC 4FFKA 4H33A 1P49A 2JJ1G 2KG7B 1VARA 4YJ2A 5EBLC 1P84F 2CTQA 4PA9A 3IJ4A 2X6CA 1XHXA 5KUKA 4B3MO 1VIBA 3PN1A 4QIWF 2NR5A 2ZKOA 3CE2A 3E8BA 1HNXO 3ETGA 2AHZA 4MVZA 4U7NA 4PDVA 4B3RO 4U7OA 4X65O 4MVRA 4XBFA 2JS3A 2RMKB 4QPKA 1H2GA 4TV9B 4DV2O 2IH3C 4LF8O 2W6IG 4UCRA 1XUQA 3OMAB 4PA4A 1KUQA 1VMGA 3ZCCA 3N2KB 5H6RA 4E2LA 3P3PA 1N4CA 1EZVH 2LFRA 5LHIA 2GTSA 4HYOA 3OFNG 2HKOA 3HR0A 3BA8A 3U11A 3FAVB 4JYAO 1RM1C 1SQVH 4DW1A 1VEWA 1Q6IA 1S77D 3OAAG 4TV9A 4O4JA 5EK0A 3GWKC 3R66A 1S0VA 2GBOA 3OMNB 5JH7A 1J5EB 1Y6XA 2UUCB 2F4VB 4QJFB 3KG2A 4J42A 2QWPB 3ZRXA 5IJ0B 2RDCA 4X1YB 1O9HA 5B66Z 1I0HA 5C8YA 1XQ8A 4DV2B 1U96A 2BCCH 4MVMA 4PD4F 2Z0AA 4DV7B 2ITDC 1IXMA 4DK0A 3HB3B 3VQVA 1ORQC 1QU7A 5EYPB 3K79A 4LFBB 3ABKB 3HKBA 3N2GA 1F7YA 1QHTA 2WAMA 2DMXA 3B40A 4WFFA 2Y48A 1FKAO 3VQXA 2H3OA 4JI3O 1YHQV 3K59A 4J80A 1PP9H 3ZS8C 3ABLB 5LMNB 1R73A 2JGDA 1SESA 3JCUZ 1KKDA 5DM6V 5IJ9B 3OT7A 1EN6A 1DF4A 4GX0A 3ZHSA 3MAQA 2NN4A 4U3JA 1I5XA 4L8JA 1PM9A 3FYEB 2DYRB 4DV6O 5LYJA 2OIGA 5BR8B 3QO5A 2P6JA 5C93A 4R50A 3GWOA 3BFRA 2YC0A 5LL6Y 1ZL8B 5CN0A 5IY5C 2ZE8A 3SPJA 1KP2A 3LDEA 3RGBA 2EIMB 1XNQB 5FPRA 4MVSA 4X88A 1WA8A 2XAQA 3SYQA 3JARB 3FAVA 4PDMA 5A9GA 4O2AB 1H2SB 1YZBA 3E8GA 2F1MA 1ZL8A 3CJHA 1RFYA 4PA6A 1XI1A 1S5JA 2Q67A 5AG2A 5ITZB 4ZI7B 4FPPA 5E79Z 1GAXA 2XUMA 1S72V 1QVFU 2WWWA 3RYIA 5F2VO 3AK1A 4ZHQB 1MZEA 2HHHB 1JCHA 4DR3O 1XL6A 4LF9B 1FXKB 2KSDA 1EZJA 1AILA 4LFCB 3SPHA 3ABUA 2WA4A 1IBMB 5IYCO 3IC9A 4DRXA 3OUSA 1IDSA 2EX3A 5CA3A 1Q43A 2UU9B 2IJIA 1WNSA 4NXNB 3U10A 5J9PC 2D3OW 3OR6C 4RUFA 1JFFB 4CS4A 3OTFA 5IDJA 2GTAA 2HP8A 4NXMO 1LNQA 3CEIA 2Y4TA 4GX5A 1Y74B 5L3CA 1CP9A 3X2QB 3ZBHA 4QNHB 2WLHA 4J9YB 3W7UA 4B3SO 4QE7A 1JPXA 4JAVA 4QPJA 3AG4C 4EB6B 1Q6UA 1AI6A 2GV9A 3W7XA 4HAMA 4DV3O 2WLLA 2ITCC 5LHGA 1XHZA 4DR2O 1K8AW 4N23A 1KC8W 4OXSA 4FLUA 4WFGA 2GDSA 3OM3B 3ABKC 1SA0A 4DV6B 4AI8A 1D2DA 3RYHA 4J9ZB 4TWKA 4OX9B 1V9PA 1GM7A 4X62O 1NR1A 1TVKB 1FJGO 1XL4A 4F6EA 1WB7A 4RWUA 1N36B 2JRIA 4IIJA 2XAFA 1M4UA 3SPGA 3K0DA 5JJNB 3G6EV 4PI0A 1MSDA 3ASNC 2JVDA 1RPOA 1KQSU 3A0BZ 1GTOA 1M1KW 4JI0O 5KAFZ 2ZDIA 1N33O 3B09A 4LP8A 4YY3O 4KUMA 2WLIB 4BW5A 3JYCA 1AB3A 1VQ7V 4E4EA 1AI4A 2LQTA 2Q8VA 3RVYA 1KP3A 1H2MA 2OCHA 1PNKA 2JDIG 4Q6GA 1WPXA 1IVSA 4B3RB 5CB4B 3E89A 3CXHF 3A0RA 2PF4E 2ZM6B 4BIUA 3HKCB 1QNMA 4FFBB 3L75H 2P67A 1W0JG 1NVPD 4GKKB 3W7WA 3J81N 4DR2B 3FYIB 4DUZB 1V55B 2W0FC 1OCRB 4X89A 4OPAA 1X4TA 2W0XA 2YXHA 1NI8A 1YVWA 2ILMA 4YIOA 5BXZA 2BTQB 5JCOC 3STLC 1VQKV 4BIZA 2UXDO 2PUSA 1PV0A 4LNUA 4JASA 4NXMB 3G71V 4PI2A 5A2QN 1JA8A 2UU9O 4FIPC 4W4KA 5EIBD 4DR3B 4U3FH 2WLIA 1SQGA 1YEWA 4MTGA 4TUYB 1R6KA 1TA8A 3W7TA 2A0LA 5B1BC 5LP6C 2XAJA 2YEVA 1PL4A 1IBLO 4IHJA 1HNZB 1RM1B 1YSCA 1GH6A 1VP7A 1FJGB 3OW2U 4K0KB 3E2EA 2K1EA 1L8DA 4LF6B 1TGOA 4O2BA 3EFFK 3HPLC 3D8CA 4FJCC 3EXAA 3OMIB 3T1YB 5EBWC 2LFSA 5H9CA 5DECA 2H8PC 3N2GB 3CWBH 2EILC 2KQXA 2RN9A 1FFXB 2ZXWB 4RUEA 4K3AA 3CRRA 4YJ3A 1XOUA 4WFEA 5E1AC 1JOYA 1M57C 1PNLA 4P9OA 4FLTA 4UCSA 2ZM6O 3CPWU 3CB2A 5LHHA 1GN6A 3L9DA 4N21A 4JI4B 2XOKG 3DSQA 4LF6O 1NTMH 1Y67A 1FXKA 3B8MA 1YIJV 1GM8A 4GKJO 3IAYA 2D2CB 2OYQA 1SQFA 5LBQA 1JFFA 4R8CA 3THOA 4DR5O 2Y69C 1DLBA 2FKXA 1O9GA 2BOBC 3BA9A 3SGIA 4NTYA 5FL7G 3APOA 1CPYA 1M56C 4LFBO 3E35A 2CUGA 3NR7A 2UXNA 5J2UB 1G1XB 4J11A 1SERA 1Y4MA 5IYBO 2JGUA 4EKWA 3CCLV 4TQDA 2CK3G 4CC5A 4DW0A 4OX9O 3ML0A 2HR3A 4I9WA 5KX5A 3APQA 2DYSB 5IWAB 2JJ2G 5IYDO 5DN6G 3VQYA 5JQGA 4O4IA 1R3KC 4WBNA 1IX9A 4ASUG 3T2MA 4DV7O 5FLXN 2FL4A 3ZHRA 1P4RA 2Q6AA 4UB8Z 4DV5B 2R72A 3C3SA 3T1HB 2Y69B 4ABMA 3AG1B 5JJJB 3STZC 1ZSPA 2E3CA 1ZUQA 4JI2B 2G38A 2BSKB 3AG1C 1VQ9V 2YICA 4GX1A 2CH7A 4R7CA 2P90A 3OGIB 3E86A 3ZIAG 4CC6A 5CBFA 5BMVA 3CXCU 5KHJA 4GX2A 4JI0B 1VF6C 3HKEB 4AHCA 1NH2B 3RVZA 2ZR3A 5LMNO 3SYPA 3ZRSA 5JQGB 4GYCB 4PA7A 2EIJB 2EZOA 4MW8A 2P7TC 3A0HZ 3JD0A 4X20A 2XAGA 4XDJA 1QLEB 5TISZ 1L0LH 4LF8B 2JEXA 2WLKA 5B1NA 2CDYA 3H1IH 4DV3B 1AROP 2ODMA 1NQTA 2VQFB 1J95A 4LH6A 1I7FA 1XBLA 2CH7B 3RW0A 2QKAA 3GVMA 2ZIOA 3OTOO 2RQ6A 1FFTB 3BABA 4HNAB 3WFVA 2K9PA 3UCSC 3UT5A 1WP8A 4IL6Z 4MT8A 2XT9A 1ZLZA 3RYCB 1H8HG 4TV8A 3AG2C 1FYJA 2OTLV 4FLVA 4JV5O 4UVAA 5LXTA 3OEEG 1FXHA 1NR7A 2OTJV 3K03A 2HJFC 3WG7C 4XDLA 1ZTEA 1Z5WA 1NJIW 4CS2A 1WLEA 4LFCO 1JJ2U 4NR1A 1M57B 1Q7YW 3AK3A 3WB2A 4L87A 2HHHO 2Q0OC 2VS0A 5DEDA 2F66C 2ADQB 4C7UA 2M6YA 2FB5A 4X64B 4JTAB 5LGNA 3D3QA 4DR1B 5EBMC 3AK2A 1OCCC 4TQFA 4LWSB 3L74H 1XNRB 3JATA 3ETDA 5LGTA 1HW7A 4G27B 1GM9A 2Q7GA 3RT3C 4UCOA 5JCOA 3SYOA 2IU0A 4X65B 5KLVH 2HJDA 4UCVA 1VQNV 4IHJB 2CTRA 5CBHA 1M56B 3K08A 2BTOA 1I5YA 4MS2A 3E8HA 3FD9A 2YI9A 1UFIA 4DK1A 4X1KB 2F93B 2UXBO 2R9AA 2ZE5A 3ZHUA 2JGDB 4JYCA 3KZIZ 4JI5B 3KCYA 2QGNA 1F51A 3T4ZA 5KHGA 3CRAA 4ZOLB 2IU3A 4PDRA 4LC1A 4AQYB 2DJVA 1K3EA 5GTIZ 4PJ0Z 1AVMA 3CC4V 4JI2O 3WB0A 5ITZA 5LMUO 3JAMN 1K4CC 3ZMSA 1EN5A 1XEQA 1Y76B 5KMGB 3SPIA 3RYFA 2UXDB 2EILB 4LR3A 3OE7G 3ABLC 4JZ2A 4LBEC 3S3XA 4I4TB 1OCRC 3TCUA 5EIBC 2P4VA 1IURA 1KB9F 3LSQA 4R6ZA 3VQWA 5IE9A 5L3DA 1HR0O 2L6LA 2IJJA 4Z1VA 1NU1H 2DE0X 4TOIA 4CH5A 5HFLA 2Z5UA 2H94A 1TUEB 4TUYA 1MNGA 3LNNA 1OJHA 2C2AA 2VQFO 3QTCA 3K58A 5KAIZ 2QWRB 1F4NA 1HNXB 2KB1A 1N34B 3AG3B 2R9RB 3OUFA 1V54C 2LGQA 1B06A 4O4IB 4KL1A 5IJ9A 3TETA 2EINC 1KU9A 4JZGA 3EVKA 5LXTB 3K5NA 2EIJC 1HR0B 4IGGA 4JI1B 2F4VO 2IBZH 3N27A 4WCEV 5CA1A 2MK3A 4CH4A 5JH7B 4JF3A 5EC2C 1NVPB 3HKEA 1N8RW 2GSMB 2QWOB 2Q68A 1SA0B 1ZAUA 1YI2V 1OZ0A 4F6RA 2EJRA 5H6QA 3ZEDA 4WFAV 3IC7A 1DTOA 2UUAB 3LSSA 4J10A 3FX7A 4EFBA 3CRQA 5CA1B 1DF5A 5B3SB 3FFQA 4X20B 3F5WC 2LW1A 4J7JA 4JTCB 3OTOB 1SZTA 4FZ0A 1YXBA 2YIBA 1W0KG 1H2LA 3LDCA 1YJNV 3F5TA 4LFAB 1AR4A 3ZJZA 2CE4A 2A3QA 4YHHO 4OGQB 1HNZO 2LGWA 1GN3A 4KFMA 2HVKC 1N0JA 4X1KA 1HP8A 4NTWA 5L3BA 3G80A 2Z3YA 2BSKA 3QVNA 2EZPA 3T1CA 3JCZA 5GTHZ 5JVDB 4RO2A 5HFMA 2B5UA 3ZX6A 2B1IA 2ZR2A 3TK1A 1VQMV 1G8MA 4ZBMA 2ZIMA 1OCOB 3AEIA 3BY6A 3ZN0A 1ZWIC 2YDEA 2UUAO 4EEQA 1PPJH 3A2FA 1QQCA 1RSOB 3SDLA 3K9SA 5GONB 3E83A 1FPOA 1R6TA 2OCCC 1GK9A 2PI4A 1SQPH 2Q9LA 2VWJA 2YEVB 2DWDC 1QVGU 2QJ1A 3AG7A 3SYCA 2XNDG 3BAAA 4LNUB 1QLNA 4FM1A 4DR4O 5J2UA 4PA3A 4DV1O 1P7GA 3Q4HA 1MOFA 3CRMA 5EC1C 5K1XA 2ZT9B 1VQ8V 3JAWA 5JWPA 2WLJA 2N05A 1VQ6V 1SQQH 1T5EA 1BE3H 4LF5B 2YXYA 1XREA 3G6BA 4UCTA 2QA4V 4O2BB 1I94B 2QWNB 2ZD9A 2UXCO 3JARA 1XMOO 3JD3A 3H9VA 4FFBA 5LP6A 3MD0A 4ZOLA 2DQ0A 3P30A 4KHPB 1D5AA 2XASA 4DV1B 2F43G 5D5QA 3CMEV 1IBLB 2PYLA 4LF4B 3HKBB 4JI7B 5EYPA 2OT5A 5KA5A 1L0NH 4LF7B 5KHKA 2AZ2A 2GUZB 1NBMG 1Q90D 3ETEA 3CYOA 3H1LH 1LUVA 1HDJA 4CH6A 1B04A 4BWAA 2Q7EA 3TGUH 4XDKA 4X1YA 1R1BA 4JI4O 1MG1A 5LMUB 4QE9A 2YIAA 4JGSA 3RYFB 3U0ZA 2Y4UA 2N74A 3D36C 1Q82W 1TUBA 1WJZA 4I9QA 1V54B 2R70A 2ZCEA 3CRCA 1GKFA 5J2TA 1JR9A 3S3WA 2PI5A 3JATB 4JI8B 3TXQA 1BQ0A 2DWEC 1SRYA 1R6NA 2F95B 4WF9V 1J5EO 4BR6A 4HZ3A 4NXNO 2ZE7A 1Y66A 1SKVA 4EB6A 4AILC 4CH3A 1BT8A 3T1YO 4GUNA 5GW7A 2Q69A 4B7EA 2QKSA 1EFRG 2B1GA 2BE3A 2NLJC 1WN7A 3ABTA 1K97A 1KECA 3HKDB 1OCZC 4BIOA 4MSWC 1S5LZ 1R3IC 3ZHTA 3O65A 3JAWB 3PJSK 3ZHVA 2EULA 1TVKA 3BCCH 4TV8B 3Q4HB 5KA6A 4DR6O 4BAYA 2DW4A 4DR7O 1WAZA 4FLZA 1AJPA 3J7AU 1IZ3A 1VQ5V 3RYHB 2WSSG 3AG2B 1VF6A 3RFRA 1UPGA 4ZIBA 3H1JH 3QNEA 3JD1A 1K92A 1RP3B 4W4LA 2AW9A 1K73W 1BL8A 5K1PA 3G67A 1COWG 4UV8A 4UVCA 3SJQC 4UXNA 3JSLA 4P2ZA 1MMMA 2Q7HA 4A5UB 5LA6A 1E79G 4B3SB 2E76B 3G4SV 1PL0A 3F7YC 4GKKO 5BR8O 1BHAA 2X7RB 5IWAO 4KXRA 3RYCA 3ZRWB 3CP1A 2OWOA 1RPRA 1VQOV 5IT9N 1X59A 5BZBA 3AG3C 1NS1A 1KD1W 3SJBC 5IY5B 4K0KO 1QBZA 2V7QG 3MHHC 4P9PA 1Y76A 5KMGA 3D3IA 2GUZA 4YY3B 1E1RG 2P4KA 1K5QA 4B08A 5H2FZ 2LP7A 3ZMVA 1R3LC 3I56V 3M99B 4UCUA 3B2EE 2XAHA 3CC2V 1VQPV 1H2NA 2KKWA 2LO1A 3QO7A 3CCMV 1XMQB 3IGAC 4KHPO 4I4TA 1XDCA 1YJWV 1WP7A 1Q3EA 1KBHA 5KX5B 2EJ7A 3ASNB 4B3TB 1SF9A 1BSMA 4AQYO 4LF5O 2IW5A 1BMFG 2ZXWC 3CCJV 2CGOA 3ZHQA 4H0LB 1DGSA 4JPRA 3UQ8A 3SJCC 3CCQV 4DUZO 3T4DA 4NB5A 5B1AC 4I5SA 3K3WA 3OGCC 4LH7A 1FS0G 3D36A 3LDDA 4NYKA 2QEXV 3ZRWA 3JAKA 3J80N 3FB7C 2OCCB 1TAEA 2VWKA 2AHYA 3ZRVA 2M7WA 3E8FA 4DR7B 3N2KA 3BVOA 3ETQA 1Q8IA 1N33B 1QR9A 2LJ2A 4CZZA 1HWYA 2DN9A 5B3SC 4FVMA 2X6BA 1YTFD 3CSXA 1PNMA 1THZA 5JVDA 1AR1B 1IBMO 5C8YB 3DC5A 1I08A 3OD4A 2PZSA 2YXLA 4GLXA 1F4MA 4NVPA 5CB4A 1N0NA 4LF9O 2YI8A 2Q4PA 4H44B 1MZFA 1AI7A 4Z2WA 3H01A 2PYJA 1IBKO 4RQEA 2YIBD 4UUJC 3GB7C 1ZX3A 3QO8A 3R65A 4MVQA 3M7MX 4H13B 1GO3F 3BPZA 4BW9A 4IYIA 3C3TA 1K34A 5J2TB 2IM9A 2QTOA 4WFBV 3DGEA 5EZYA 4U3JB 5KUMA 5LOVB 4I0XA 2UXXA 4LCUC 3P32A 4MTFA 5B5EZ 2QDOA 3QG5A 1H2KA 3X2QC 1M90W 1K7DA 2B9ZA 4I7ZB 3ZMZA 3TXSA 2DOSA 3ZMTA 3LUTB 1S5HC 1G6UA 4WFHA 2UUCO 2CTPA 1OV9A 1GN2A 2FTKA 4O4JB 2L35A 4O4HA 2CTWA 1P7BA 2KG7A 4UVBA 5D5PA 1SQXH 1K9MW 1LUWA 1IBKB 1PD3A 2P22C 1W59A 3L73H 1MABG 2BTQA 2HLDG 1OHHG 4DXWA 1XMQO 3FKSG 2Q73A 2MW2B 4J7ZA 1N36O 3CX5F 2DYSC 3LSUA 3B8NA 1AJQA 1AI5A 3RYIB 3K57A 4X62B 3CC7V 2CGNA 2GHYA 3F7VC 3JD4A 3BEHA 4PDLA 5KHHA 1L1FA 5LOVA 2OIEA 4F4LA 5EZYB 1NTZH 1AP5A 1JX9A 1IXBA 1YDXA 1NTKH 2FYUH 1PKXA 2YIDA 4IYHA 4O4HB 3CMAV 1Z2GA 3CCVV 2ZE6A 1JJOA 4F6RB 1BS3A 4HBNA 4UB6Z 2DYRC 2VRZA 3DC6A 2Q5ZA 3K06A 1NKDA 2E74B 1AP6A 4DV5O 4H37A 3T1HO 2CAZC 4KP4A 1E1QG 3RBZA 4JI8O 5LA6B 4CS3A 1YTFB 5LYJB 4OPHA 2E5LB 3K5OA 2Y0PA 3C90A 3CJHB 4FLWA 3ZMUA 2JIZG 2P06A 2QM7A 2A7WA 4DV4O 4YJ3B 3E22A 3UO3A 4FZ1A 2R9IA 4ICGA 3ASOB 4X1IB 1SC5B 1CXZB 1QLEC 5GONA 3JD2A 4DR6B 4G28B 1GMGA 1Z5VA 3SR2C 3SYAA 1FAFA 4LF7O 5CA0A 4JI3B 2NNUA 1CEZA 1VF5B 2JK5C 5B1OA 4JI7O 2AZ0A 2JEUA 1Q86W 3VOUA 1I94O 1SS3A 4K8ZA 4DR5B 2WLLB 4FM2A 4JI6O 1V55C 1S3JA 4LFAO 2V1DA 1BQZA 1R3JC 1GRJA 4ZI7A 2Y0IA 2IH1C 3JASA 3NXSA 2IJHA 1BZKA 4JI6B 2E75B 3CCUV 1WPBA 2QKCA 5B1AB 4RAIA 2WLMA 5FNVB 2HVJC 3UKMA 4DR1O 4HNAA 4D7TA 1N32B 2PTMA 4X64O 3K5LA 1UJWB 1S76D 3WG7B 2W6JG 3E22B 3CCSV 1JMKC 2X0LA 5FPOA 4K35A 1Q6HA 1OCOC 1FFXA 4Q20A 4B3TO 1M93A 3O9OA 1B3QA 3ABMB 2EINB 3ZN1A 4YXWG 4JYAB 1G4YB
chains in the Genus database with same CATH topology
5CN0A 2Q69A 1OCCB 5IY5C 1AROP 5CMUA 2QKSA 1NQTA 3SPJA 1EFRG 2B1GA 5L3FA 1J95A 1KP2A 5B1BB 2NLJC 3LDEA 3ABTA 2EIMB 1K97A 1KECA 2HFEC 1H8EG 1OCZC 3K04A 3RW0A 4MVOA 4MSWC 4MVSA 4MVUA 3UM7A 4X88A 1FFTB 3WFVA 4PELA 1R3IC 3SYQA 2XAQA 3PJSK 4MT8A 4PDMA 3CCRV 1H8HG 3AG2C 3E8GA 2OTLV 5KA6A 4BAYA 2DW4A 4PA6A 4UVAA 1AJPA 2Q67A 3OEEG 1FXHA 1NR7A 1VQ5V 2OTJV 3AG4B 2WSSG 2WPDG 3AG2B 4FPPA 3K03A 3SPCA 2HJFC 3WG7C 1S72V 4XDLA 1QVFU 3QNEA 1NJIW 3JD1A 1K92A 2WWWA 1SETA 1WLEA 1K73W 1MSWD 1JJ2U 1BL8A 1M57B 1COWG 1Q7YW 4UV8A 4UVCA 1JVMA 3SJQC 4UXNA 1JCHA 5CBGA 1XL6A 4L87A 4P2ZA 1FXKB 4GT1A 5L3GA 1QR8A 1E79G 1EZJA 3G4SV 4JTAB 3F7YC 1PL0A 5LGNA 3SPHA 1BHAA 2X7RB 3ABUA 4ZKIA 5EBMC 3ZRWB 3CP1A 1OCCC 3W7SA 5IYCO 1RPRA 1VQOV 3OUSA 3CD6V 2DQ3A 5BZBA 5CA3A 3AG3C 3LNMB 3ETDA 5LGTA 1KD1W 4G27B 1F23A 2IJIA 5IY5B 1GM9A 1QBZA 5J9PC 2D3OW 3SYOA 2IU0A 3OR6C 2V7QG 3DTUB 3MHHC 4P9PA 4RUFA 1VQNV 3D3IA 5CBHA 5GW7A 3K0GA 5IDJA 3ABMC 4JYBA 1M56B 3K08A 4P30A 1E1RG 1I5YA 4MS2A 1LNQA 3E8HA 1K5QA 4GX5A 2LP7A 5L3CA 1CP9A 3ZMVA 3X2QB 1R3LC 3I56V 4QNHB 3M99B 2WLHA 4J9YB 3W7UA 4QE7A 3IFXA 1JPXA 4JAVA 4JYCA 4QPJA 3AG4C 3CCEV 2YSUB 1AI6A 1F51A 2XAHA 3T4ZA 1FXKC 3CC2V 3W7XA 4HAMA 1NH2D 2WLLA 1VQPV 2ITCC 5LHGA 2IU3A 4PDRA 3QO7A 1K8AW 4LC1A 3CCMV 3IGAC 4N23A 1K4DC 2HG5C 1KC8W 4OXSA 1K3EA 5L3EA 4WFGA 1YJWV 3OM3B 3FB8C 3ABKC 2WLNA 3OEHG 1BHBA 3CC4V 1H38A 3FB5C 2EIKB 3ASNB 4J9ZB 1K33A 1M9NA 3I55V 4TWKA 1K4CC 3ZMSA 2IW5A 1GM7A 3SPIA 2EILB 1BMFG 1NR1A 1OCZB 4MTOA 2ZXWC 3CCJV 3OE7G 3ABLC 2ATKC 4FMTA 4LBEC 4JPRA 1XL4A 4CBCA 1OCRC 3TCUA 3CCQV 2QM8A 3LSQA 4R6ZA 5L3DA 2QE7G 3T4DA 2XAFA 5B1AC 4I5SA 3SPGA 3K3WA 3K0DA 3OGCC 2IJJA 3G6EV 1VQ4V 2A79B 3OR7C 3ASNC 1RPOA 1FS0G 3D36A 1KQSU 1GTOA 3LDDA 1M1KW 2QEXV 3ZRWA 2ZDIA 2ZQMA 5HFLA 2Z5UA 2H94A 3FB7C 1TUEB 4LP8A 4KUMA 2WLIB 4BW5A 2OCCB 2C2AA 3JYCA 1VQ7V 1AI4A 3ASOC 2AHYA 3ZRVA 1W2BU 3RVYA 1KP3A 2M7WA 3E8FA 1F4NA 1PNKA 3K9AA 2JDIG 1WPXA 4JTDB 2KB1A 1FXVA 1QR9A 3AG3B 3E89A 2R9RB 3OUFA 4CZZA 1V54C 1HWYA 5B3SC 3A0RA 2X6BA 4BIUA 1YTFD 2A9HA 1PNMA 2EIKC 1ENVA 1THZA 2P67A 3TETA 4DO2A 1W0JG 2EINC 1AR1B 1NVPD 2EIJC 3W7WA 1AJNA 3FYIB 4UV9A 1V55B 1F4MA 4WCEV 1YITV 2W0FC 1OCRB 4X89A 3VBBA 2MK3A 3MHSC 1QCEA 2X6AA 4JF3A 1AI7A 5EC2C 1NVPB 3STLC 3H01A 1VQKV 1N8RW 2GSMB 4BIZA 4RQEA 2Q68A 1YI2V 4UUJC 4JASA 3GB7C 3QO8A 4G2KA 4MW3A 1OZ0A 2IJKA 3FB6C 2EJRA 3R65A 4MVQA 5H6QA 4WFAV 3IC7A 1GO3F 1DTOA 3LSSA 3EHBB 1YJ9V 3G71V 1K34A 4MTXA 4TSFG 4FIPC 2QTOA 1DF5A 4WFBV 3DGEA 4TT3G 1K5SA 5B3SB 1JQ0A 2WLIA 5KUMA 4MTGA 2UXXA 4LCUC 1R6KA 3P32A 4MTFA 4X8AA 3W7TA 2A0LA 3F5WC 5B1BC 2XAJA 4JTCB 2YEVA 1SZTA 3X2QC 1K7DA 1M90W 3ZMZA 1VQLV 1RM1B 5LGUA 2EIMC 4JAUA 3ZMTA 1W0KG 3LUTB 4FK5C 1S5HC 4WFHA 1YSCA 2BOCC 3LDCA 1YJNV 3OW2U 3E2EA 2FTKA 4GCZA 2K1EA 1P7BA 1B6QA 3ZJZA 3EFFK 4UVBA 3HPLC 4FJCC 4RQFA 3OMIB 2EBOA 3B77A 1K9MW 5EBWC 1PD3A 2LFSA 4KFMA 1MABG 2HVKC 5H9CA 2HLDG 2H8PC 1OHHG 4Z1MG 1ROPA 4DXWA 1Q81W 5L3BA 2EILC 1EBOA 3FKSG 2ZXWB 2DYSC 4RUEA 2ZDIC 4H33A 2JJ1G 2Z3YA 3B8NA 1AJQA 2EZPA 5EBLC 3T1CA 4PA9A 1AI5A 3JCZA 5E1AC 4WFEA 1JOYA 1M57C 2X6CA 3CC7V 2GHYA 3JD4A 3F7VC 1PNLA 3BEHA 4P9OA 4PDLA 4RO2A 5KUKA 5HFMA 3CPWU 1L1FA 5LHHA 2B5UA 2B1IA 4QIWF 2ZR2A 3TK1A 1VQMV 1G8MA 4ZBMA 4F4LA 4N21A 3E8BA 2XOKG 1OCOB 3ETGA 1JX9A 1FXKA 2AHZA 3B8MA 4MVZA 3AEIA 4PDVA 4U7NA 1GM8A 1YIJV 3BY6A 4U7OA 1PKXA 4MVRA 1ZWIC 3ZN0A 4XBFA 3CMAV 5LBQA 4QPKA 4R8CA 3CCVV 1H2GA 2IH3C 3E83A 2DYRC 2W6IG 2Y69C 1DLBA 2OCCC 3K06A 3OMAB 2BOBC 1GK9A 4PA4A 1NKDA 2PI4A 5FL7G 2YEVB 2DWDC 1QVGU 4H37A 3ZCCA 4E2LA 5H6RA 1CPYA 3SYCA 2XNDG 1M56C 3E35A 2LFRA 4KP4A 1QLNA 1E1QG 3RBZA 5LHIA 2UXNA 4HYOA 4PA3A 1SERA 1Y4MA 3OFNG 1YTFB 1MOFA 2HKOA 5EC1C 5IYBO 4EKWA 3CCLV 2CK3G 1VQ8V 1RM1C 3ML0A 2WLJA 1VQ6V 2HR3A 1S77D 4I9WA 2JIZG 3ZMUA 3OAAG 2QM7A 2QA4V 2DYSB 2ZD9A 3JD3A 5EK0A 2JJ2G 5IYDO 5DN6G 1S0VA 3MD0A 2R9IA 1R3KC 2DQ0A 3ASOB 3P30A 3T2MA 2XASA 4ASUG 1QLEC 3OMNB 3JD2A 2F43G 4G28B 1GMGA 1P4RA 2Q6AA 3SYAA 4QJFB 3KG2A 3CMEV 2NNUA 1CEZA 2Y69B 2JK5C 3ZRXA 5B1OA 3AG1B 3STZC 2JEUA 1Q86W 2OT5A 3VOUA 5KA5A 2WLLB 1NBMG 4MVMA 3AG1C 1VQ9V 3ETEA 1V55C 1S3JA 3CYOA 2V1DA 4GX1A 1R3JC 4R7CA 2ITDC 1IXMA 2P90A 3E86A 3ZIAG 5CBFA 3HB3B 2IH1C 4XDKA 3NXSA 3CXCU 1ORQC 2IJHA 4GX2A 3K79A 1MG1A 3CCUV 4QE9A 3ABKB 4JGSA 5B1AB 4RAIA 2WLMA 2WAMA 4WFFA 2Y48A 2HVJC 3UKMA 1NH2B 1YHQV 1UJWB 1Q82W 1S76D 3WG7B 1V54B 3RVZA 2ZR3A 1GKFA 3ABLB 3SYPA 2W6JG 2PI5A 3ZRSA 1R73A 1SESA 2DWEC 3CCSV 1SRYA 4PA7A 1R6NA 2X0LA 2EIJB 2EZOA 4MW8A 4HZ3A 4WF9V 1Y66A 1KKDA 5DM6V 1OCOC 2P7TC 3JD0A 1DF4A 4GX0A 4Q20A 2XAGA 4XDJA 1QLEB 1I5XA 2JEXA 3FYEB 3ABMB 2WLKA 2EINB 3ZN1A 2DYRB 4YXWG 5B1NA 3QO5A 2P6JA 1G4YB 5C93A 4R50A 3GWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHB A;  1BHA A; 
#chains in the Genus database with same CATH topology
 4X9Q A;  1OCC B;  5CMU A;  4WBN B;  5KHI A;  5L3F A;  4O2A A;  5B1B B;  2ADP A;  5LP6 B;  3JAL B;  1NT2 B;  4PHZ A;  4J7K A;  2HFE C;  1H8E G;  4DV0 O;  3K04 A;  4MVO A;  4MVU A;  4EFE A;  4I55 B;  3UM7 A;  4PEL A;  2RJZ A;  2WA3 A;  3DXR B;  3JSN A;  3CCR V;  5IYZ A;  3A8T A;  2F23 A;  1HNW O;  1BGY H;  2QM4 A;  2P5O A;  3AG4 B;  2WPD G;  3SPC A;  3UT5 B;  1SET A;  4IIJ B;  4B3M B;  1MSW D;  2QSA A;  1JVM A;  1YF2 A;  1VF7 A;  4GZR B;  5CBG A;  3ICX A;  4GT1 A;  3P3N A;  4DR4 B;  4O4L A;  4IT5 A;  5L3G A;  1QR8 A;  3BHP A;  3CHX A;  2RCV A;  3L72 H;  2XHB A;  4JAA A;  3JAK B;  4ZKI A;  3K5M A;  2UUB O;  3DXR A;  3W7S A;  2O57 A;  3CD6 V;  2DQ3 A;  3SJA C;  1D5N A;  3LNM B;  1A32 A;  1F23 A;  3H1H H;  4D6T H;  3DTU B;  3WU2 Z;  3QF7 A;  2AXT Z;  4K8X A;  3K0G A;  3ABM C;  4JYB A;  1KMI Z;  4P30 A;  5IYZ B;  4JI1 O;  3UO2 A;  2VQE O;  2ZIN A;  1N32 O;  3I5D A;  2QWQ B;  4LF4 O;  2A06 H;  4PV1 B;  3IFX A;  1NZ6 A;  3HKD A;  1BCC H;  3CCE V;  3BRC A;  2YSU B;  1FXK C;  4QGP A;  1NH2 D;  2YS8 A;  3L71 H;  4LWS A;  5BY1 A;  1K4D C;  2HG5 C;  4JYY A;  1Y74 A;  5L3E A;  1XMO B;  4DRX B;  2UXC B;  3FB8 C;  5IJ0 A;  2WLN A;  3OEH G;  1AR5 A;  1BHB A;  1GN4 A;  1H38 A;  3FB5 C;  2EIK B;  1K33 A;  1M9N A;  1KKC A;  3I55 V;  2N04 A;  4YHH B;  1OCZ B;  2ARH A;  4MTO A;  2ZNI A;  4FMT A;  2ATK C;  1US6 A;  4NTX A;  1M5I A;  3KCX A;  4CBC A;  1DK1 A;  2QM8 A;  4UFZ A;  2QE7 G;  4I55 A;  4I50 A;  1EM1 A;  2Q0A A;  2HEP A;  1VQ4 V;  2A79 B;  3OR7 C;  3JAL A;  4DV4 B;  2ZQM A;  2ZNJ A;  4DUY B;  4I0X B;  2QR4 A;  3ASO C;  1W2B U;  2E5L O;  5CA0 B;  4FM0 A;  4JV5 B;  3K9A A;  4JTD B;  1FXV A;  1LR1 A;  4JI5 O;  2YUA A;  5H5N A;  4I50 B;  2XTA A;  3HKC A;  2A9H A;  2EIK C;  1ENV A;  3KKY A;  2UXB B;  2UUB B;  4DO2 A;  4D7S A;  4B7K A;  2V4D A;  1AJN A;  4UV9 A;  3CS5 A;  3WB1 A;  5JJE B;  1KYO F;  1YCI A;  1YIT V;  2PY5 A;  3H1K H;  2RNB A;  3M8A A;  3VBB A;  4O4L B;  2LW7 A;  3MHS C;  1QCE A;  2X6A A;  2ETN A;  5FNV A;  3RWR D;  4ZHQ A;  2JS5 A;  1XNR O;  2PGG A;  4G2K A;  4MW3 A;  3JAS B;  2IJK A;  4YJ2 B;  1SZX A;  3FB6 C;  3MDS A;  4J41 A;  1N34 O;  2AGA A;  1MA1 A;  3EHB B;  1YJ9 V;  4MTX A;  4TSF G;  4NKG B;  3RN4 A;  3B4S A;  1HNW B;  2QTS A;  4TT3 G;  1K5S A;  1JQ0 A;  4FLY A;  4X8A A;  1XNQ O;  2VQE B;  1WA8 B;  4DV0 B;  1VQL V;  5LGU A;  2EIM C;  4JAU A;  1Q5O A;  4YIP A;  1U97 A;  4FK5 C;  4X1I A;  2BOC C;  1RSO A;  4GCZ A;  1EN4 A;  3L70 H;  1B6Q A;  4GKJ B;  4DUY O;  1TUB B;  4RQF A;  4X66 O;  1FD9 A;  2EBO A;  3B77 A;  4X66 B;  2FML A;  4FLX A;  4Z1M G;  1URF A;  1ROP A;  1Q81 W;  1XIL A;  1WB8 A;  3TJT A;  1EBO A;  1SQB H;  5BMV B;  4DYL A;  2ZDI C;  4FFK A;  4H33 A;  1P49 A;  2JJ1 G;  2KG7 B;  1VAR A;  4YJ2 A;  5EBL C;  1P84 F;  2CTQ A;  4PA9 A;  3IJ4 A;  2X6C A;  1XHX A;  5KUK A;  4B3M O;  1VIB A;  3PN1 A;  4QIW F;  2NR5 A;  2ZKO A;  3CE2 A;  3E8B A;  1HNX O;  3ETG A;  2AHZ A;  4MVZ A;  4U7N A;  4PDV A;  4B3R O;  4U7O A;  4X65 O;  4MVR A;  4XBF A;  2JS3 A;  2RMK B;  4QPK A;  1H2G A;  4TV9 B;  4DV2 O;  2IH3 C;  4LF8 O;  2W6I G;  4UCR A;  1XUQ A;  3OMA B;  4PA4 A;  1KUQ A;  1VMG A;  3ZCC A;  3N2K B;  5H6R A;  4E2L A;  3P3P A;  1N4C A;  1EZV H;  2LFR A;  5LHI A;  2GTS A;  4HYO A;  3OFN G;  2HKO A;  3HR0 A;  3BA8 A;  3U11 A;  3FAV B;  4JYA O;  1RM1 C;  1SQV H;  4DW1 A;  1VEW A;  1Q6I A;  1S77 D;  3OAA G;  4TV9 A;  4O4J A;  5EK0 A;  3GWK C;  3R66 A;  1S0V A;  2GBO A;  3OMN B;  5JH7 A;  1J5E B;  1Y6X A;  2UUC B;  2F4V B;  4QJF B;  3KG2 A;  4J42 A;  2QWP B;  3ZRX A;  5IJ0 B;  2RDC A;  4X1Y B;  1O9H A;  5B66 Z;  1I0H A;  5C8Y A;  1XQ8 A;  4DV2 B;  1U96 A;  2BCC H;  4MVM A;  4PD4 F;  2Z0A A;  4DV7 B;  2ITD C;  1IXM A;  4DK0 A;  3HB3 B;  3VQV A;  1ORQ C;  1QU7 A;  5EYP B;  3K79 A;  4LFB B;  3ABK B;  3HKB A;  3N2G A;  1F7Y A;  1QHT A;  2WAM A;  2DMX A;  3B40 A;  4WFF A;  2Y48 A;  1FKA O;  3VQX A;  2H3O A;  4JI3 O;  1YHQ V;  3K59 A;  4J80 A;  1PP9 H;  3ZS8 C;  3ABL B;  5LMN B;  1R73 A;  2JGD A;  1SES A;  3JCU Z;  1KKD A;  5DM6 V;  5IJ9 B;  3OT7 A;  1EN6 A;  1DF4 A;  4GX0 A;  3ZHS A;  3MAQ A;  2NN4 A;  4U3J A;  1I5X A;  4L8J A;  1PM9 A;  3FYE B;  2DYR B;  4DV6 O;  5LYJ A;  2OIG A;  5BR8 B;  3QO5 A;  2P6J A;  5C93 A;  4R50 A;  3GWO A;  3BFR A;  2YC0 A;  5LL6 Y;  1ZL8 B;  5CN0 A;  5IY5 C;  2ZE8 A;  3SPJ A;  1KP2 A;  3LDE A;  3RGB A;  2EIM B;  1XNQ B;  5FPR A;  4MVS A;  4X88 A;  1WA8 A;  2XAQ A;  3SYQ A;  3JAR B;  3FAV A;  4PDM A;  5A9G A;  4O2A B;  1H2S B;  1YZB A;  3E8G A;  2F1M A;  1ZL8 A;  3CJH A;  1RFY A;  4PA6 A;  1XI1 A;  1S5J A;  2Q67 A;  5AG2 A;  5ITZ B;  4ZI7 B;  4FPP A;  5E79 Z;  1GAX A;  2XUM A;  1S72 V;  1QVF U;  2WWW A;  3RYI A;  5F2V O;  3AK1 A;  4ZHQ B;  1MZE A;  2HHH B;  1JCH A;  4DR3 O;  1XL6 A;  4LF9 B;  1FXK B;  2KSD A;  1EZJ A;  1AIL A;  4LFC B;  3SPH A;  3ABU A;  2WA4 A;  1IBM B;  5IYC O;  3IC9 A;  4DRX A;  3OUS A;  1IDS A;  2EX3 A;  5CA3 A;  1Q43 A;  2UU9 B;  2IJI A;  1WNS A;  4NXN B;  3U10 A;  5J9P C;  2D3O W;  3OR6 C;  4RUF A;  1JFF B;  4CS4 A;  3OTF A;  5IDJ A;  2GTA A;  2HP8 A;  4NXM O;  1LNQ A;  3CEI A;  2Y4T A;  4GX5 A;  1Y74 B;  5L3C A;  1CP9 A;  3X2Q B;  3ZBH A;  4QNH B;  2WLH A;  4J9Y B;  3W7U A;  4B3S O;  4QE7 A;  1JPX A;  4JAV A;  4QPJ A;  3AG4 C;  4EB6 B;  1Q6U A;  1AI6 A;  2GV9 A;  3W7X A;  4HAM A;  4DV3 O;  2WLL A;  2ITC C;  5LHG A;  1XHZ A;  4DR2 O;  1K8A W;  4N23 A;  1KC8 W;  4OXS A;  4FLU A;  4WFG A;  2GDS A;  3OM3 B;  3ABK C;  1SA0 A;  4DV6 B;  4AI8 A;  1D2D A;  3RYH A;  4J9Z B;  4TWK A;  4OX9 B;  1V9P A;  1GM7 A;  4X62 O;  1NR1 A;  1TVK B;  1FJG O;  1XL4 A;  4F6E A;  1WB7 A;  4RWU A;  1N36 B;  2JRI A;  4IIJ A;  2XAF A;  1M4U A;  3SPG A;  3K0D A;  5JJN B;  3G6E V;  4PI0 A;  1MSD A;  3ASN C;  2JVD A;  1RPO A;  1KQS U;  3A0B Z;  1GTO A;  1M1K W;  4JI0 O;  5KAF Z;  2ZDI A;  1N33 O;  3B09 A;  4LP8 A;  4YY3 O;  4KUM A;  2WLI B;  4BW5 A;  3JYC A;  1AB3 A;  1VQ7 V;  4E4E A;  1AI4 A;  2LQT A;  2Q8V A;  3RVY A;  1KP3 A;  1H2M A;  2OCH A;  1PNK A;  2JDI G;  4Q6G A;  1WPX A;  1IVS A;  4B3R B;  5CB4 B;  3E89 A;  3CXH F;  3A0R A;  2PF4 E;  2ZM6 B;  4BIU A;  3HKC B;  1QNM A;  4FFB B;  3L75 H;  2P67 A;  1W0J G;  1NVP D;  4GKK B;  3W7W A;  3J81 N;  4DR2 B;  3FYI B;  4DUZ B;  1V55 B;  2W0F C;  1OCR B;  4X89 A;  4OPA A;  1X4T A;  2W0X A;  2YXH A;  1NI8 A;  1YVW A;  2ILM A;  4YIO A;  5BXZ A;  2BTQ B;  5JCO C;  3STL C;  1VQK V;  4BIZ A;  2UXD O;  2PUS A;  1PV0 A;  4LNU A;  4JAS A;  4NXM B;  3G71 V;  4PI2 A;  5A2Q N;  1JA8 A;  2UU9 O;  4FIP C;  4W4K A;  5EIB D;  4DR3 B;  4U3F H;  2WLI A;  1SQG A;  1YEW A;  4MTG A;  4TUY B;  1R6K A;  1TA8 A;  3W7T A;  2A0L A;  5B1B C;  5LP6 C;  2XAJ A;  2YEV A;  1PL4 A;  1IBL O;  4IHJ A;  1HNZ B;  1RM1 B;  1YSC A;  1GH6 A;  1VP7 A;  1FJG B;  3OW2 U;  4K0K B;  3E2E A;  2K1E A;  1L8D A;  4LF6 B;  1TGO A;  4O2B A;  3EFF K;  3HPL C;  3D8C A;  4FJC C;  3EXA A;  3OMI B;  3T1Y B;  5EBW C;  2LFS A;  5H9C A;  5DEC A;  2H8P C;  3N2G B;  3CWB H;  2EIL C;  2KQX A;  2RN9 A;  1FFX B;  2ZXW B;  4RUE A;  4K3A A;  3CRR A;  4YJ3 A;  1XOU A;  4WFE A;  5E1A C;  1JOY A;  1M57 C;  1PNL A;  4P9O A;  4FLT A;  4UCS A;  2ZM6 O;  3CPW U;  3CB2 A;  5LHH A;  1GN6 A;  3L9D A;  4N21 A;  4JI4 B;  2XOK G;  3DSQ A;  4LF6 O;  1NTM H;  1Y67 A;  1FXK A;  3B8M A;  1YIJ V;  1GM8 A;  4GKJ O;  3IAY A;  2D2C B;  2OYQ A;  1SQF A;  5LBQ A;  1JFF A;  4R8C A;  3THO A;  4DR5 O;  2Y69 C;  1DLB A;  2FKX A;  1O9G A;  2BOB C;  3BA9 A;  3SGI A;  4NTY A;  5FL7 G;  3APO A;  1CPY A;  1M56 C;  4LFB O;  3E35 A;  2CUG A;  3NR7 A;  2UXN A;  5J2U B;  1G1X B;  4J11 A;  1SER A;  1Y4M A;  5IYB O;  2JGU A;  4EKW A;  3CCL V;  4TQD A;  2CK3 G;  4CC5 A;  4DW0 A;  4OX9 O;  3ML0 A;  2HR3 A;  4I9W A;  5KX5 A;  3APQ A;  2DYS B;  5IWA B;  2JJ2 G;  5IYD O;  5DN6 G;  3VQY A;  5JQG A;  4O4I A;  1R3K C;  4WBN A;  1IX9 A;  4ASU G;  3T2M A;  4DV7 O;  5FLX N;  2FL4 A;  3ZHR A;  1P4R A;  2Q6A A;  4UB8 Z;  4DV5 B;  2R72 A;  3C3S A;  3T1H B;  2Y69 B;  4ABM A;  3AG1 B;  5JJJ B;  3STZ C;  1ZSP A;  2E3C A;  1ZUQ A;  4JI2 B;  2G38 A;  2BSK B;  3AG1 C;  1VQ9 V;  2YIC A;  4GX1 A;  2CH7 A;  4R7C A;  2P90 A;  3OGI B;  3E86 A;  3ZIA G;  4CC6 A;  5CBF A;  5BMV A;  3CXC U;  5KHJ A;  4GX2 A;  4JI0 B;  1VF6 C;  3HKE B;  4AHC A;  1NH2 B;  3RVZ A;  2ZR3 A;  5LMN O;  3SYP A;  3ZRS A;  5JQG B;  4GYC B;  4PA7 A;  2EIJ B;  2EZO A;  4MW8 A;  2P7T C;  3A0H Z;  3JD0 A;  4X20 A;  2XAG A;  4XDJ A;  1QLE B;  5TIS Z;  1L0L H;  4LF8 B;  2JEX A;  2WLK A;  5B1N A;  2CDY A;  3H1I H;  4DV3 B;  1ARO P;  2ODM A;  1NQT A;  2VQF B;  1J95 A;  4LH6 A;  1I7F A;  1XBL A;  2CH7 B;  3RW0 A;  2QKA A;  3GVM A;  2ZIO A;  3OTO O;  2RQ6 A;  1FFT B;  3BAB A;  4HNA B;  3WFV A;  2K9P A;  3UCS C;  3UT5 A;  1WP8 A;  4IL6 Z;  4MT8 A;  2XT9 A;  1ZLZ A;  3RYC B;  1H8H G;  4TV8 A;  3AG2 C;  1FYJ A;  2OTL V;  4FLV A;  4JV5 O;  4UVA A;  5LXT A;  3OEE G;  1FXH A;  1NR7 A;  2OTJ V;  3K03 A;  2HJF C;  3WG7 C;  4XDL A;  1ZTE A;  1Z5W A;  1NJI W;  4CS2 A;  1WLE A;  4LFC O;  1JJ2 U;  4NR1 A;  1M57 B;  1Q7Y W;  3AK3 A;  3WB2 A;  4L87 A;  2HHH O;  2Q0O C;  2VS0 A;  5DED A;  2F66 C;  2ADQ B;  4C7U A;  2M6Y A;  2FB5 A;  4X64 B;  4JTA B;  5LGN A;  3D3Q A;  4DR1 B;  5EBM C;  3AK2 A;  1OCC C;  4TQF A;  4LWS B;  3L74 H;  1XNR B;  3JAT A;  3ETD A;  5LGT A;  1HW7 A;  4G27 B;  1GM9 A;  2Q7G A;  3RT3 C;  4UCO A;  5JCO A;  3SYO A;  2IU0 A;  4X65 B;  5KLV H;  2HJD A;  4UCV A;  1VQN V;  4IHJ B;  2CTR A;  5CBH A;  1M56 B;  3K08 A;  2BTO A;  1I5Y A;  4MS2 A;  3E8H A;  3FD9 A;  2YI9 A;  1UFI A;  4DK1 A;  4X1K B;  2F93 B;  2UXB O;  2R9A A;  2ZE5 A;  3ZHU A;  2JGD B;  4JYC A;  3KZI Z;  4JI5 B;  3KCY A;  2QGN A;  1F51 A;  3T4Z A;  5KHG A;  3CRA A;  4ZOL B;  2IU3 A;  4PDR A;  4LC1 A;  4AQY B;  2DJV A;  1K3E A;  5GTI Z;  4PJ0 Z;  1AVM A;  3CC4 V;  4JI2 O;  3WB0 A;  5ITZ A;  5LMU O;  3JAM N;  1K4C C;  3ZMS A;  1EN5 A;  1XEQ A;  1Y76 B;  5KMG B;  3SPI A;  3RYF A;  2UXD B;  2EIL B;  4LR3 A;  3OE7 G;  3ABL C;  4JZ2 A;  4LBE C;  3S3X A;  4I4T B;  1OCR C;  3TCU A;  5EIB C;  2P4V A;  1IUR A;  1KB9 F;  3LSQ A;  4R6Z A;  3VQW A;  5IE9 A;  5L3D A;  1HR0 O;  2L6L A;  2IJJ A;  4Z1V A;  1NU1 H;  2DE0 X;  4TOI A;  4CH5 A;  5HFL A;  2Z5U A;  2H94 A;  1TUE B;  4TUY A;  1MNG A;  3LNN A;  1OJH A;  2C2A A;  2VQF O;  3QTC A;  3K58 A;  5KAI Z;  2QWR B;  1F4N A;  1HNX B;  2KB1 A;  1N34 B;  3AG3 B;  2R9R B;  3OUF A;  1V54 C;  2LGQ A;  1B06 A;  4O4I B;  4KL1 A;  5IJ9 A;  3TET A;  2EIN C;  1KU9 A;  4JZG A;  3EVK A;  5LXT B;  3K5N A;  2EIJ C;  1HR0 B;  4IGG A;  4JI1 B;  2F4V O;  2IBZ H;  3N27 A;  4WCE V;  5CA1 A;  2MK3 A;  4CH4 A;  5JH7 B;  4JF3 A;  5EC2 C;  1NVP B;  3HKE A;  1N8R W;  2GSM B;  2QWO B;  2Q68 A;  1SA0 B;  1ZAU A;  1YI2 V;  1OZ0 A;  4F6R A;  2EJR A;  5H6Q A;  3ZED A;  4WFA V;  3IC7 A;  1DTO A;  2UUA B;  3LSS A;  4J10 A;  3FX7 A;  4EFB A;  3CRQ A;  5CA1 B;  1DF5 A;  5B3S B;  3FFQ A;  4X20 B;  3F5W C;  2LW1 A;  4J7J A;  4JTC B;  3OTO B;  1SZT A;  4FZ0 A;  1YXB A;  2YIB A;  1W0K G;  1H2L A;  3LDC A;  1YJN V;  3F5T A;  4LFA B;  1AR4 A;  3ZJZ A;  2CE4 A;  2A3Q A;  4YHH O;  4OGQ B;  1HNZ O;  2LGW A;  1GN3 A;  4KFM A;  2HVK C;  1N0J A;  4X1K A;  1HP8 A;  4NTW A;  5L3B A;  3G80 A;  2Z3Y A;  2BSK A;  3QVN A;  2EZP A;  3T1C A;  3JCZ A;  5GTH Z;  5JVD B;  4RO2 A;  5HFM A;  2B5U A;  3ZX6 A;  2B1I A;  2ZR2 A;  3TK1 A;  1VQM V;  1G8M A;  4ZBM A;  2ZIM A;  1OCO B;  3AEI A;  3BY6 A;  3ZN0 A;  1ZWI C;  2YDE A;  2UUA O;  4EEQ A;  1PPJ H;  3A2F A;  1QQC A;  1RSO B;  3SDL A;  3K9S A;  5GON B;  3E83 A;  1FPO A;  1R6T A;  2OCC C;  1GK9 A;  2PI4 A;  1SQP H;  2Q9L A;  2VWJ A;  2YEV B;  2DWD C;  1QVG U;  2QJ1 A;  3AG7 A;  3SYC A;  2XND G;  3BAA A;  4LNU B;  1QLN A;  4FM1 A;  4DR4 O;  5J2U A;  4PA3 A;  4DV1 O;  1P7G A;  3Q4H A;  1MOF A;  3CRM A;  5EC1 C;  5K1X A;  2ZT9 B;  1VQ8 V;  3JAW A;  5JWP A;  2WLJ A;  2N05 A;  1VQ6 V;  1SQQ H;  1T5E A;  1BE3 H;  4LF5 B;  2YXY A;  1XRE A;  3G6B A;  4UCT A;  2QA4 V;  4O2B B;  1I94 B;  2QWN B;  2ZD9 A;  2UXC O;  3JAR A;  1XMO O;  3JD3 A;  3H9V A;  4FFB A;  5LP6 A;  3MD0 A;  4ZOL A;  2DQ0 A;  3P30 A;  4KHP B;  1D5A A;  2XAS A;  4DV1 B;  2F43 G;  5D5Q A;  3CME V;  1IBL B;  2PYL A;  4LF4 B;  3HKB B;  4JI7 B;  5EYP A;  2OT5 A;  5KA5 A;  1L0N H;  4LF7 B;  5KHK A;  2AZ2 A;  2GUZ B;  1NBM G;  1Q90 D;  3ETE A;  3CYO A;  3H1L H;  1LUV A;  1HDJ A;  4CH6 A;  1B04 A;  4BWA A;  2Q7E A;  3TGU H;  4XDK A;  4X1Y A;  1R1B A;  4JI4 O;  1MG1 A;  5LMU B;  4QE9 A;  2YIA A;  4JGS A;  3RYF B;  3U0Z A;  2Y4U A;  2N74 A;  3D36 C;  1Q82 W;  1TUB A;  1WJZ A;  4I9Q A;  1V54 B;  2R70 A;  2ZCE A;  3CRC A;  1GKF A;  5J2T A;  1JR9 A;  3S3W A;  2PI5 A;  3JAT B;  4JI8 B;  3TXQ A;  1BQ0 A;  2DWE C;  1SRY A;  1R6N A;  2F95 B;  4WF9 V;  1J5E O;  4BR6 A;  4HZ3 A;  4NXN O;  2ZE7 A;  1Y66 A;  1SKV A;  4EB6 A;  4AIL C;  4CH3 A;  1BT8 A;  3T1Y O;  4GUN A;  5GW7 A;  2Q69 A;  4B7E A;  2QKS A;  1EFR G;  2B1G A;  2BE3 A;  2NLJ C;  1WN7 A;  3ABT A;  1K97 A;  1KEC A;  3HKD B;  1OCZ C;  4BIO A;  4MSW C;  1S5L Z;  1R3I C;  3ZHT A;  3O65 A;  3JAW B;  3PJS K;  3ZHV A;  2EUL A;  1TVK A;  3BCC H;  4TV8 B;  3Q4H B;  5KA6 A;  4DR6 O;  4BAY A;  2DW4 A;  4DR7 O;  1WAZ A;  4FLZ A;  1AJP A;  3J7A U;  1IZ3 A;  1VQ5 V;  3RYH B;  2WSS G;  3AG2 B;  1VF6 A;  3RFR A;  1UPG A;  4ZIB A;  3H1J H;  3QNE A;  3JD1 A;  1K92 A;  1RP3 B;  4W4L A;  2AW9 A;  1K73 W;  1BL8 A;  5K1P A;  3G67 A;  1COW G;  4UV8 A;  4UVC A;  3SJQ C;  4UXN A;  3JSL A;  4P2Z A;  1MMM A;  2Q7H A;  4A5U B;  5LA6 A;  1E79 G;  4B3S B;  2E76 B;  3G4S V;  1PL0 A;  3F7Y C;  4GKK O;  5BR8 O;  1BHA A;  2X7R B;  5IWA O;  4KXR A;  3RYC A;  3ZRW B;  3CP1 A;  2OWO A;  1RPR A;  1VQO V;  5IT9 N;  1X59 A;  5BZB A;  3AG3 C;  1NS1 A;  1KD1 W;  3SJB C;  5IY5 B;  4K0K O;  1QBZ A;  2V7Q G;  3MHH C;  4P9P A;  1Y76 A;  5KMG A;  3D3I A;  2GUZ A;  4YY3 B;  1E1R G;  2P4K A;  1K5Q A;  4B08 A;  5H2F Z;  2LP7 A;  3ZMV A;  1R3L C;  3I56 V;  3M99 B;  4UCU A;  3B2E E;  2XAH A;  3CC2 V;  1VQP V;  1H2N A;  2KKW A;  2LO1 A;  3QO7 A;  3CCM V;  1XMQ B;  3IGA C;  4KHP O;  4I4T A;  1XDC A;  1YJW V;  1WP7 A;  1Q3E A;  1KBH A;  5KX5 B;  2EJ7 A;  3ASN B;  4B3T B;  1SF9 A;  1BSM A;  4AQY O;  4LF5 O;  2IW5 A;  1BMF G;  2ZXW C;  3CCJ V;  2CGO A;  3ZHQ A;  4H0L B;  1DGS A;  4JPR A;  3UQ8 A;  3SJC C;  3CCQ V;  4DUZ O;  3T4D A;  4NB5 A;  5B1A C;  4I5S A;  3K3W A;  3OGC C;  4LH7 A;  1FS0 G;  3D36 A;  3LDD A;  4NYK A;  2QEX V;  3ZRW A;  3JAK A;  3J80 N;  3FB7 C;  2OCC B;  1TAE A;  2VWK A;  2AHY A;  3ZRV A;  2M7W A;  3E8F A;  4DR7 B;  3N2K A;  3BVO A;  3ETQ A;  1Q8I A;  1N33 B;  1QR9 A;  2LJ2 A;  4CZZ A;  1HWY A;  2DN9 A;  5B3S C;  4FVM A;  2X6B A;  1YTF D;  3CSX A;  1PNM A;  1THZ A;  5JVD A;  1AR1 B;  1IBM O;  5C8Y B;  3DC5 A;  1I08 A;  3OD4 A;  2PZS A;  2YXL A;  4GLX A;  1F4M A;  4NVP A;  5CB4 A;  1N0N A;  4LF9 O;  2YI8 A;  2Q4P A;  4H44 B;  1MZF A;  1AI7 A;  4Z2W A;  3H01 A;  2PYJ A;  1IBK O;  4RQE A;  2YIB D;  4UUJ C;  3GB7 C;  1ZX3 A;  3QO8 A;  3R65 A;  4MVQ A;  3M7M X;  4H13 B;  1GO3 F;  3BPZ A;  4BW9 A;  4IYI A;  3C3T A;  1K34 A;  5J2T B;  2IM9 A;  2QTO A;  4WFB V;  3DGE A;  5EZY A;  4U3J B;  5KUM A;  5LOV B;  4I0X A;  2UXX A;  4LCU C;  3P32 A;  4MTF A;  5B5E Z;  2QDO A;  3QG5 A;  1H2K A;  3X2Q C;  1M90 W;  1K7D A;  2B9Z A;  4I7Z B;  3ZMZ A;  3TXS A;  2DOS A;  3ZMT A;  3LUT B;  1S5H C;  1G6U A;  4WFH A;  2UUC O;  2CTP A;  1OV9 A;  1GN2 A;  2FTK A;  4O4J B;  2L35 A;  4O4H A;  2CTW A;  1P7B A;  2KG7 A;  4UVB A;  5D5P A;  1SQX H;  1K9M W;  1LUW A;  1IBK B;  1PD3 A;  2P22 C;  1W59 A;  3L73 H;  1MAB G;  2BTQ A;  2HLD G;  1OHH G;  4DXW A;  1XMQ O;  3FKS G;  2Q73 A;  2MW2 B;  4J7Z A;  1N36 O;  3CX5 F;  2DYS C;  3LSU A;  3B8N A;  1AJQ A;  1AI5 A;  3RYI B;  3K57 A;  4X62 B;  3CC7 V;  2CGN A;  2GHY A;  3F7V C;  3JD4 A;  3BEH A;  4PDL A;  5KHH A;  1L1F A;  5LOV A;  2OIE A;  4F4L A;  5EZY B;  1NTZ H;  1AP5 A;  1JX9 A;  1IXB A;  1YDX A;  1NTK H;  2FYU H;  1PKX A;  2YID A;  4IYH A;  4O4H B;  3CMA V;  1Z2G A;  3CCV V;  2ZE6 A;  1JJO A;  4F6R B;  1BS3 A;  4HBN A;  4UB6 Z;  2DYR C;  2VRZ A;  3DC6 A;  2Q5Z A;  3K06 A;  1NKD A;  2E74 B;  1AP6 A;  4DV5 O;  4H37 A;  3T1H O;  2CAZ C;  4KP4 A;  1E1Q G;  3RBZ A;  4JI8 O;  5LA6 B;  4CS3 A;  1YTF B;  5LYJ B;  4OPH A;  2E5L B;  3K5O A;  2Y0P A;  3C90 A;  3CJH B;  4FLW A;  3ZMU A;  2JIZ G;  2P06 A;  2QM7 A;  2A7W A;  4DV4 O;  4YJ3 B;  3E22 A;  3UO3 A;  4FZ1 A;  2R9I A;  4ICG A;  3ASO B;  4X1I B;  1SC5 B;  1CXZ B;  1QLE C;  5GON A;  3JD2 A;  4DR6 B;  4G28 B;  1GMG A;  1Z5V A;  3SR2 C;  3SYA A;  1FAF A;  4LF7 O;  5CA0 A;  4JI3 B;  2NNU A;  1CEZ A;  1VF5 B;  2JK5 C;  5B1O A;  4JI7 O;  2AZ0 A;  2JEU A;  1Q86 W;  3VOU A;  1I94 O;  1SS3 A;  4K8Z A;  4DR5 B;  2WLL B;  4FM2 A;  4JI6 O;  1V55 C;  1S3J A;  4LFA O;  2V1D A;  1BQZ A;  1R3J C;  1GRJ A;  4ZI7 A;  2Y0I A;  2IH1 C;  3JAS A;  3NXS A;  2IJH A;  1BZK A;  4JI6 B;  2E75 B;  3CCU V;  1WPB A;  2QKC A;  5B1A B;  4RAI A;  2WLM A;  5FNV B;  2HVJ C;  3UKM A;  4DR1 O;  4HNA A;  4D7T A;  1N32 B;  2PTM A;  4X64 O;  3K5L A;  1UJW B;  1S76 D;  3WG7 B;  2W6J G;  3E22 B;  3CCS V;  1JMK C;  2X0L A;  5FPO A;  4K35 A;  1Q6H A;  1OCO C;  1FFX A;  4Q20 A;  4B3T O;  1M93 A;  3O9O A;  1B3Q A;  3ABM B;  2EIN B;  3ZN1 A;  4YXW G;  4JYA B;  1G4Y B; 
#chains in the Genus database with same CATH homology
 5CN0 A;  2Q69 A;  1OCC B;  5IY5 C;  1ARO P;  5CMU A;  2QKS A;  1NQT A;  3SPJ A;  1EFR G;  2B1G A;  5L3F A;  1J95 A;  1KP2 A;  5B1B B;  2NLJ C;  3LDE A;  3ABT A;  2EIM B;  1K97 A;  1KEC A;  2HFE C;  1H8E G;  1OCZ C;  3K04 A;  3RW0 A;  4MVO A;  4MSW C;  4MVS A;  4MVU A;  3UM7 A;  4X88 A;  1FFT B;  3WFV A;  4PEL A;  1R3I C;  3SYQ A;  2XAQ A;  3PJS K;  4MT8 A;  4PDM A;  3CCR V;  1H8H G;  3AG2 C;  3E8G A;  2OTL V;  5KA6 A;  4BAY A;  2DW4 A;  4PA6 A;  4UVA A;  1AJP A;  2Q67 A;  3OEE G;  1FXH A;  1NR7 A;  1VQ5 V;  2OTJ V;  3AG4 B;  2WSS G;  2WPD G;  3AG2 B;  4FPP A;  3K03 A;  3SPC A;  2HJF C;  3WG7 C;  1S72 V;  4XDL A;  1QVF U;  3QNE A;  1NJI W;  3JD1 A;  1K92 A;  2WWW A;  1SET A;  1WLE A;  1K73 W;  1MSW D;  1JJ2 U;  1BL8 A;  1M57 B;  1COW G;  1Q7Y W;  4UV8 A;  4UVC A;  1JVM A;  3SJQ C;  4UXN A;  1JCH A;  5CBG A;  1XL6 A;  4L87 A;  4P2Z A;  1FXK B;  4GT1 A;  5L3G A;  1QR8 A;  1E79 G;  1EZJ A;  3G4S V;  4JTA B;  3F7Y C;  1PL0 A;  5LGN A;  3SPH A;  1BHA A;  2X7R B;  3ABU A;  4ZKI A;  5EBM C;  3ZRW B;  3CP1 A;  1OCC C;  3W7S A;  5IYC O;  1RPR A;  1VQO V;  3OUS A;  3CD6 V;  2DQ3 A;  5BZB A;  5CA3 A;  3AG3 C;  3LNM B;  3ETD A;  5LGT A;  1KD1 W;  4G27 B;  1F23 A;  2IJI A;  5IY5 B;  1GM9 A;  1QBZ A;  5J9P C;  2D3O W;  3SYO A;  2IU0 A;  3OR6 C;  2V7Q G;  3DTU B;  3MHH C;  4P9P A;  4RUF A;  1VQN V;  3D3I A;  5CBH A;  5GW7 A;  3K0G A;  5IDJ A;  3ABM C;  4JYB A;  1M56 B;  3K08 A;  4P30 A;  1E1R G;  1I5Y A;  4MS2 A;  1LNQ A;  3E8H A;  1K5Q A;  4GX5 A;  2LP7 A;  5L3C A;  1CP9 A;  3ZMV A;  3X2Q B;  1R3L C;  3I56 V;  4QNH B;  3M99 B;  2WLH A;  4J9Y B;  3W7U A;  4QE7 A;  3IFX A;  1JPX A;  4JAV A;  4JYC A;  4QPJ A;  3AG4 C;  3CCE V;  2YSU B;  1AI6 A;  1F51 A;  2XAH A;  3T4Z A;  1FXK C;  3CC2 V;  3W7X A;  4HAM A;  1NH2 D;  2WLL A;  1VQP V;  2ITC C;  5LHG A;  2IU3 A;  4PDR A;  3QO7 A;  1K8A W;  4LC1 A;  3CCM V;  3IGA C;  4N23 A;  1K4D C;  2HG5 C;  1KC8 W;  4OXS A;  1K3E A;  5L3E A;  4WFG A;  1YJW V;  3OM3 B;  3FB8 C;  3ABK C;  2WLN A;  3OEH G;  1BHB A;  3CC4 V;  1H38 A;  3FB5 C;  2EIK B;  3ASN B;  4J9Z B;  1K33 A;  1M9N A;  3I55 V;  4TWK A;  1K4C C;  3ZMS A;  2IW5 A;  1GM7 A;  3SPI A;  2EIL B;  1BMF G;  1NR1 A;  1OCZ B;  4MTO A;  2ZXW C;  3CCJ V;  3OE7 G;  3ABL C;  2ATK C;  4FMT A;  4LBE C;  4JPR A;  1XL4 A;  4CBC A;  1OCR C;  3TCU A;  3CCQ V;  2QM8 A;  3LSQ A;  4R6Z A;  5L3D A;  2QE7 G;  3T4D A;  2XAF A;  5B1A C;  4I5S A;  3SPG A;  3K3W A;  3K0D A;  3OGC C;  2IJJ A;  3G6E V;  1VQ4 V;  2A79 B;  3OR7 C;  3ASN C;  1RPO A;  1FS0 G;  3D36 A;  1KQS U;  1GTO A;  3LDD A;  1M1K W;  2QEX V;  3ZRW A;  2ZDI A;  2ZQM A;  5HFL A;  2Z5U A;  2H94 A;  3FB7 C;  1TUE B;  4LP8 A;  4KUM A;  2WLI B;  4BW5 A;  2OCC B;  2C2A A;  3JYC A;  1VQ7 V;  1AI4 A;  3ASO C;  2AHY A;  3ZRV A;  1W2B U;  3RVY A;  1KP3 A;  2M7W A;  3E8F A;  1F4N A;  1PNK A;  3K9A A;  2JDI G;  1WPX A;  4JTD B;  2KB1 A;  1FXV A;  1QR9 A;  3AG3 B;  3E89 A;  2R9R B;  3OUF A;  4CZZ A;  1V54 C;  1HWY A;  5B3S C;  3A0R A;  2X6B A;  4BIU A;  1YTF D;  2A9H A;  1PNM A;  2EIK C;  1ENV A;  1THZ A;  2P67 A;  3TET A;  4DO2 A;  1W0J G;  2EIN C;  1AR1 B;  1NVP D;  2EIJ C;  3W7W A;  1AJN A;  3FYI B;  4UV9 A;  1V55 B;  1F4M A;  4WCE V;  1YIT V;  2W0F C;  1OCR B;  4X89 A;  3VBB A;  2MK3 A;  3MHS C;  1QCE A;  2X6A A;  4JF3 A;  1AI7 A;  5EC2 C;  1NVP B;  3STL C;  3H01 A;  1VQK V;  1N8R W;  2GSM B;  4BIZ A;  4RQE A;  2Q68 A;  1YI2 V;  4UUJ C;  4JAS A;  3GB7 C;  3QO8 A;  4G2K A;  4MW3 A;  1OZ0 A;  2IJK A;  3FB6 C;  2EJR A;  3R65 A;  4MVQ A;  5H6Q A;  4WFA V;  3IC7 A;  1GO3 F;  1DTO A;  3LSS A;  3EHB B;  1YJ9 V;  3G71 V;  1K34 A;  4MTX A;  4TSF G;  4FIP C;  2QTO A;  1DF5 A;  4WFB V;  3DGE A;  4TT3 G;  1K5S A;  5B3S B;  1JQ0 A;  2WLI A;  5KUM A;  4MTG A;  2UXX A;  4LCU C;  1R6K A;  3P32 A;  4MTF A;  4X8A A;  3W7T A;  2A0L A;  3F5W C;  5B1B C;  2XAJ A;  4JTC B;  2YEV A;  1SZT A;  3X2Q C;  1K7D A;  1M90 W;  3ZMZ A;  1VQL V;  1RM1 B;  5LGU A;  2EIM C;  4JAU A;  3ZMT A;  1W0K G;  3LUT B;  4FK5 C;  1S5H C;  4WFH A;  1YSC A;  2BOC C;  3LDC A;  1YJN V;  3OW2 U;  3E2E A;  2FTK A;  4GCZ A;  2K1E A;  1P7B A;  1B6Q A;  3ZJZ A;  3EFF K;  4UVB A;  3HPL C;  4FJC C;  4RQF A;  3OMI B;  2EBO A;  3B77 A;  1K9M W;  5EBW C;  1PD3 A;  2LFS A;  4KFM A;  1MAB G;  2HVK C;  5H9C A;  2HLD G;  2H8P C;  1OHH G;  4Z1M G;  1ROP A;  4DXW A;  1Q81 W;  5L3B A;  2EIL C;  1EBO A;  3FKS G;  2ZXW B;  2DYS C;  4RUE A;  2ZDI C;  4H33 A;  2JJ1 G;  2Z3Y A;  3B8N A;  1AJQ A;  2EZP A;  5EBL C;  3T1C A;  4PA9 A;  1AI5 A;  3JCZ A;  5E1A C;  4WFE A;  1JOY A;  1M57 C;  2X6C A;  3CC7 V;  2GHY A;  3JD4 A;  3F7V C;  1PNL A;  3BEH A;  4P9O A;  4PDL A;  4RO2 A;  5KUK A;  5HFM A;  3CPW U;  1L1F A;  5LHH A;  2B5U A;  2B1I A;  4QIW F;  2ZR2 A;  3TK1 A;  1VQM V;  1G8M A;  4ZBM A;  4F4L A;  4N21 A;  3E8B A;  2XOK G;  1OCO B;  3ETG A;  1JX9 A;  1FXK A;  2AHZ A;  3B8M A;  4MVZ A;  3AEI A;  4PDV A;  4U7N A;  1GM8 A;  1YIJ V;  3BY6 A;  4U7O A;  1PKX A;  4MVR A;  1ZWI C;  3ZN0 A;  4XBF A;  3CMA V;  5LBQ A;  4QPK A;  4R8C A;  3CCV V;  1H2G A;  2IH3 C;  3E83 A;  2DYR C;  2W6I G;  2Y69 C;  1DLB A;  2OCC C;  3K06 A;  3OMA B;  2BOB C;  1GK9 A;  4PA4 A;  1NKD A;  2PI4 A;  5FL7 G;  2YEV B;  2DWD C;  1QVG U;  4H37 A;  3ZCC A;  4E2L A;  5H6R A;  1CPY A;  3SYC A;  2XND G;  1M56 C;  3E35 A;  2LFR A;  4KP4 A;  1QLN A;  1E1Q G;  3RBZ A;  5LHI A;  2UXN A;  4HYO A;  4PA3 A;  1SER A;  1Y4M A;  3OFN G;  1YTF B;  1MOF A;  2HKO A;  5EC1 C;  5IYB O;  4EKW A;  3CCL V;  2CK3 G;  1VQ8 V;  1RM1 C;  3ML0 A;  2WLJ A;  1VQ6 V;  2HR3 A;  1S77 D;  4I9W A;  2JIZ G;  3ZMU A;  3OAA G;  2QM7 A;  2QA4 V;  2DYS B;  2ZD9 A;  3JD3 A;  5EK0 A;  2JJ2 G;  5IYD O;  5DN6 G;  1S0V A;  3MD0 A;  2R9I A;  1R3K C;  2DQ0 A;  3ASO B;  3P30 A;  3T2M A;  2XAS A;  4ASU G;  1QLE C;  3OMN B;  3JD2 A;  2F43 G;  4G28 B;  1GMG A;  1P4R A;  2Q6A A;  3SYA A;  4QJF B;  3KG2 A;  3CME V;  2NNU A;  1CEZ A;  2Y69 B;  2JK5 C;  3ZRX A;  5B1O A;  3AG1 B;  3STZ C;  2JEU A;  1Q86 W;  2OT5 A;  3VOU A;  5KA5 A;  2WLL B;  1NBM G;  4MVM A;  3AG1 C;  1VQ9 V;  3ETE A;  1V55 C;  1S3J A;  3CYO A;  2V1D A;  4GX1 A;  1R3J C;  4R7C A;  2ITD C;  1IXM A;  2P90 A;  3E86 A;  3ZIA G;  5CBF A;  3HB3 B;  2IH1 C;  4XDK A;  3NXS A;  3CXC U;  1ORQ C;  2IJH A;  4GX2 A;  3K79 A;  1MG1 A;  3CCU V;  4QE9 A;  3ABK B;  4JGS A;  5B1A B;  4RAI A;  2WLM A;  2WAM A;  4WFF A;  2Y48 A;  2HVJ C;  3UKM A;  1NH2 B;  1YHQ V;  1UJW B;  1Q82 W;  1S76 D;  3WG7 B;  1V54 B;  3RVZ A;  2ZR3 A;  1GKF A;  3ABL B;  3SYP A;  2W6J G;  2PI5 A;  3ZRS A;  1R73 A;  1SES A;  2DWE C;  3CCS V;  1SRY A;  4PA7 A;  1R6N A;  2X0L A;  2EIJ B;  2EZO A;  4MW8 A;  4HZ3 A;  4WF9 V;  1Y66 A;  1KKD A;  5DM6 V;  1OCO C;  2P7T C;  3JD0 A;  1DF4 A;  4GX0 A;  4Q20 A;  2XAG A;  4XDJ A;  1QLE B;  1I5X A;  2JEX A;  3FYE B;  3ABM B;  2WLK A;  2EIN B;  3ZN1 A;  2DYR B;  4YXW G;  5B1N A;  3QO5 A;  2P6J A;  1G4Y B;  5C93 A;  4R50 A;  3GWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...