1BHAA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIORHODOPSIN
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
molecule tags Photoreceptor
total genus 23
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhaA00
1BHBA 1BHAA
chains in the Genus database with same CATH superfamily
1I08A 3T1HO 2QM4A 4FVMA 3H1HH 5DECA 2UXNA 4X66O 1RM1B 1M57B 4TT3G 1G4YB 5BMVB 5LMUB 3UO3A 3RFRA 1AI6A 4NB5A 3LDDA 3W7WA 1FXVA 4X1IA 3ZHVA 3K58A 2WLLA 3DC6A 4E2LA 1W2BU 4ZKIA 1GM8A 5LA6A 1YEWA 1BHAA 3A0RA 3IC7A 1WPXA 4B3SO 4MTOA 2LW7A 2JGDA 1SQGA 1P84F 2CTWA 2YI8A 2E75B 5CMUA 3VQWA 3N2KB 1NVPB 4IHJB 1Y74B 1XNQB 1SZXA 1K4DC 2WAMA 5B3SC 2IJJA 3FYIB 1QVFU 1VF6C 3G71V 3STZC 3BAAA 4X9QA 5CA1B 2CTRA 1NI8A 1F23A 4RAIA 4LF6B 4TV8B 3X2QC 1S77D 2BSKA 4DRXB 2PF4E 2V7QG 2PI4A 3ZN0A 1WNSA 2UXCO 4U3JA 2W0FC 4HNAA 3E83A 5EBMC 1OCZB 1BMFG 4B3RB 3P3NA 4OPAA 1AR1B 3FYEB 5DM6V 2QKAA 4X8AA 5FLXN 3ASNB 2UUCB 3SPJA 3K5LA 4B08A 4G28B 4JI3O 5IJ0B 1K97A 1FFXB 4JI4O 1IBLB 3BY6A 1JA8A 2Y4UA 2Q4PA 2DW4A 4JASA 1Q5OA 2F93B 3K59A 4UB6Z 3AG1B 4UB8Z 1XDCA 3ZX6A 1OCOC 4NXNO 1S76D 3TETA 1T5EA 2DWDC 5IYBO 4MTGA 4X88A 2XT9A 1FXKB 4UCRA 5FL7G 2AHZA 2VQEO 2PY5A 3HKBB 4H13B 4CH3A 1Y6XA 3NXSA 3C3SA 1GK9A 4FZ1A 3HKDB 2V1DA 4JI0B 4FFBA 2IM9A 1N8RW 3H1IH 1BZKA 4NXMB 3KG2A 4O2BA 4MVOA 2QEXV 3N2GA 4P9PA 5F2VO 2KG7B 4O4JB 2N05A 4I9QA 1U96A 2GV9A 2VQFO 5JQGA 5KAFZ 4EB6B 3L74H 3L75H 5L3GA 1N34B 3ZMUA 3RYHA 2HLDG 2ZXWB 1XMQB 2UUBB 2WWWA 4RQFA 2PYLA 1TUBA 2QWOB 3B2EE 3OR6C 4TV9B 4DR4O 1HNZO 5JJJB 1Q8IA 5L3EA 1AVMA 3OAAG 2ZD9A 1UJWB 5B1OA 3ZRVA 5LXTB 3LNNA 4JYYA 3OUFA 1M1KW 3P30A 4B3MB 3CP1A 1I0HA 5CA3A 3JD4A 1Y67A 1S5LZ 2W6IG 2Q6AA 1YHQV 1EZJA 5LP6B 2FYUH 4DR2O 1CEZA 1K34A 3JASA 4QGPA 2WLNA 1VF5B 2QE7G 4DV1O 4FIPC 4LP8A 4KFMA 3ZMSA 1EN4A 1V54B 1N32B 2JEUA 2DYRB 5JH7B 5BZBA 3SYOA 3E8BA 3ZRXA 1IVSA 1A32A 2HEPA 3T1YB 1BQZA 2ZNJA 3ZHTA 2EIMC 4X1KA 3MDSA 4JYCA 1MSWD 4J7ZA 4ZOLA 1NQTA 2E3CA 1R1BA 3PN1A 3CCQV 2LO1A 3CRRA 3I56V 4GLXA 4JV5B 3H1LH 2YIAA 2Z0AA 4I55B 4UCOA 2BTQB 4L8JA 4QJFB 1HWYA 2OCCB 4KXRA 5IWAO 5L3DA 2PGGA 1TVKB 1VARA 3T1HB 2IU3A 1NR7A 2XAHA 1IURA 2L35A 3MD0A 4X66B 2YIBD 2PUSA 1VQ6V 3P32A 4DV0O 1KB9F 1RFYA 1WA8B 1YDXA 4EFEA 3JAKA 3WB2A 1VQLV 3QVNA 4LF4O 4D7SA 2WA3A 2DJVA 3B09A 4UVBA 1RPRA 5FPOA 1YTFB 3RYCB 1H2GA 2XTAA 5KLVH 3VOUA 3AK2A 1NH2D 1E1QG 2R9RB 4B3SB 3ML0A 4R7CA 1L0NH 1ROPA 1E79G 1SERA 1YJWV 1NTKH 4QPKA 3A8TA 5BMVA 4PI0A 4NVPA 3DXRB 4BIOA 1OJHA 2F4VO 3ZN1A 2UU9O 3OUSA 2OCHA 4MVMA 3Q4HB 4YHHO 5E1AC 3CCRV 2P22C 1Z5WA 5A9GA 1COWG 2EINB 4RO2A 1M56C 3AG4B 3UT5B 1JMKC 1VQKV 2BCCH 2HVJC 1KD1W 5EC1C 4W4LA 2WLIB 2UXCB 4GX0A 1EM1A 2AXTZ 2GTAA 3K9AA 5H6QA 2ZE5A 4UV8A 3K0GA 4FLVA 3K06A 2B5UA 3CRQA 1VQOV 4BAYA 3C90A 3N2KA 4MW3A 1VQNV 2X0LA 4UCVA 4PDVA 4IHJA 1Y74A 1SRYA 2QA4V 1YZBA 2K9PA 1ZWIC 3CCEV 1XILA 4OX9O 4DR7O 3CC4V 4JI3B 4ZI7B 5CA1A 1Q86W 4WFHA 4JI4B 1HNWO 4IGGA 3QF7A 4DRXA 1K33A 4NXNB 1KMIZ 3OT7A 3KCYA 3CE2A 3E89A 1E1RG 2VQEB 2UXXA 1XHZA 4LBEC 2HJFC 4FM0A 1GMGA 5IDJA 1K7DA 2ITCC 2Q9LA 1S0VA 5DN6G 1GN6A 4CS3A 4W4KA 1SETA 2CGNA 3OM3B 5IJ0A 3OGIB 1NBMG 1FFXA 2ARHA 4X62O 2HHHB 2HP8A 4EEQA 1AB3A 4LFCO 2Z3YA 2P5OA 1I7FA 2EJ7A 1H2LA 2YXLA 3LSSA 1JX9A 3CMAV 2VQFB 3OEHG 1IXBA 4ICGA 2NLJC 3JAWB 3RT3C 1FXKA 2LJ2A 4DYLA 3HKBA 2DMXA 1Q3EA 2JK5C 1FYJA 1TA8A 2DYSB 2E5LB 2YXHA 3SGIA 4WCEV 4O2AB 1WPBA 2Z5UA 2QM7A 1JJ2U 4DR4B 3IJ4A 4JPRA 1VP7A 3GB7C 1VQ4V 5LYJB 2RMKB 2K1EA 2F66C 4CH6A 1N33B 1RM1C 3MHSC 1JFFB 5B1BC 1GM9A 1Q81W 2KG7A 4O4JA 1KC8W 2ZR2A 2MW2B 3U11A 1DF4A 2CE4A 4JAVA 4DW1A 4BW9A 2XOKG 3K9SA 4EB6A 4MSWC 2YIDA 4DR2B 5LGUA 1S5HC 1K73W 1W0JG 4DV1B 5EK0A 1GN4A 2B1GA 1QQCA 3AK1A 3FB7C 2P6JA 2CGOA 2X7RB 4TV9A 2ZIMA 2N04A 2NN4A 3CRMA 1PL0A 5KUMA 4UCTA 4GX1A 4P30A 4WFGA 1VQ9V 5LXTA 3GVMA 2M7WA 3W7XA 3MAQA 4KL1A 2EILB 3JD1A 3WG7B 4Q20A 3HB3B 4K8ZA 5KMGB 2RNBA 3GWKC 3CCUV 5LP6A 2O57A 4IIJB 4PA3A 5B1AB 4LF5O 4FMTA 1VMGA 2C2AA 4YJ3B 1WAZA 5KHGA 3IGAC 5IWAB 3ASOB 4DXWA 3ETQA 3ZHRA 3CJHB 3APQA 5JH7A 1JCHA 1OCZC 4LWSB 4PDRA 5J2TB 3JD3A 3RVYA 4GZRB 3VBBA 4IYIA 1YXBA 3OR7C 3D3IA 1I5XA 2MK3A 2X6AA 3CD6V 3ASNC 3ZRSA 1YIJV 3U10A 1J5EO 1P4RA 4XDJA 4I55A 5L3CA 4LF4B 1Q90D 5EYPB 1YSCA 2BTQA 3A2FA 5KHIA 1FS0G 2ADQB 4I0XB 3AG1C 2QSAA 1ZL8B 3RW0A 1MZFA 4EFBA 4RQEA 1TVKA 3O9OA 1AI4A 3E2EA 4D7TA 1N0JA 4JZ2A 3IFXA 4PDLA 1XMOO 4J9YB 2JJ2G 1EN6A 2FKXA 3FB6C 2GSMB 4FLXA 2F4VB 1VF7A 2UU9B 1WA8A 4C7UA 2JEXA 4YHHB 2ZCEA 3BHPA 3CB2A 4O4IB 4DV2O 1X4TA 3SYAA 4F6RB 3ABKB 3N27A 1SQXH 3T1CA 3RYCA 5IYZB 4AHCA 4U7OA 1R3KC 3QO5A 1KP2A 3SPCA 3LSUA 2LFSA 1K4CC 3CYOA 1CP9A 1MABG 1G1XB 1PPJH 5D5QA 1THZA 3VQVA 2B9ZA 4E4EA 5TISZ 1M90W 1H8HG 3DXRA 2RJZA 1YJNV 2ZDIC 4DO2A 1ENVA 4JAUA 4I4TB 3ZMVA 1KYOF 3Q4HA 3RGBA 1JPXA 1ZX3A 1KECA 2HVKC 3E86A 1OV9A 3UT5A 1HNWB 4K0KB 2QTOA 3RN4A 5EZYB 1MNGA 1HDJA 2AW9A 1YJ9V 2WLIA 2ITDC 5LP6C 2CK3G 5KHJA 4NR1A 1DGSA 1WP7A 5A2QN 5LHHA 1AP6A 2JGUA 5B66Z 1M93A 5IY5C 1SQFA 1AROP 4UVAA 4FLWA 1HNXO 1XOUA 1F7YA 1V54C 2CH7B 1NU1H 2DYRC 1H38A 1BGYH 3U0ZA 4X62B 5J9PC 2IJKA 2Q68A 5LMNO 1XUQA 4TQFA 4LFCB 2ZE8A 4DV6O 2FTKA 3BEHA 1FD9A 3G6BA 3E8FA 3S3XA 1J95A 3ABLC 2YUAA 3L9DA 3B40A 1OZ0A 2OCCC 4F6EA 3K79A 3AG7A 4LFBO 1MZEA 2Y48A 2LQTA 2EZOA 3KKYA 2GUZB 3ETGA 1N0NA 4MW8A 4LCUC 1ZUQA 3RYFB 1AR5A 4TSFG 2JRIA 4F4LA 4UFZA 1PNKA 2WPDG 2EIKB 1XBLA 2X6CA 1Q6IA 2ILMA 3QTCA 2B1IA 1BT8A 1LR1A 1QR9A 2RN9A 3JAWA 2YXYA 2EZPA 3SYCA 4PELA 1WB7A 5IYDO 2OTLV 4WFAV 3CPWU 5BR8O 4O2AA 1YF2A 3ETDA 3LNMB 5FNVB 2BE3A 4DR3O 2CAZC 4MVRA 3MHHC 1H2MA 1V55B 5LYJA 1SA0B 3ABUA 4JI2O 1JFFA 3ZHSA 2RDCA 1HR0B 3CS5A 4HAMA 3P3PA 2JS3A 1NT2B 4H0LB 5KX5B 4NTYA 3CSXA 1R3LC 1F4MA 3OEEG 1IBKB 1Y76B 1Z2GA 4J9ZB 4PHZA 2IJIA 4LF5B 3AG4C 4CH4A 3J80N 2IW5A 5CBHA 2F95B 1D5NA 2P4KA 3B8MA 4Q6GA 4X65B 3E22B 4O4HB 4LNUB 4NKGB 4UCUA 4X64O 3AG2B 1FPOA 1X59A 1IDSA 4X20B 4MVZA 1M9NA 3IC9A 1QHTA 2KSDA 1YTFD 5KMGA 3W7SA 5LHIA 1J5EB 4FM2A 4R50A 3ZEDA 2CTPA 3CCVV 2H8PC 4YJ3A 5ITZB 4GX2A 2H3OA 4OXSA 3UKMA 1KBHA 1MOFA 2ZE7A 3H9VA 1KU9A 1F4NA 3CJHA 3JCUZ 2UXBB 2E74B 5EC2C 3F7VC 4TOIA 3LDCA 2R9AA 3VQXA 4R6ZA 3APOA 4LWSA 2YI9A 5J2TA 4DUYO 1XMOB 1TUEB 3ZRWB 5KHHA 4LH6A 5GW7A 4LF7O 4BW5A 4JTAB 1OCOB 1URFA 3AK3A 4JI1O 4PV1B 2GTSA 4KP4A 4MS2A 3ICXA 1LUVA 3BA9A 4DV2B 1KKCA 4LC1A 5EYPA 1S3JA 5FPRA 3ZIAG 2QM8A 2UUAO 2YEVB 2AZ0A 4I0XA 3RWRD 2KQXA 3JATB 1ZL8A 1SESA 3OE7G 4WFFA 5IE9A 5IYCO 4QIWF 2NNUA 1UFIA 3CXHF 4FJCC 4GCZA 1KP3A 4FLUA 1N36O 4CS2A 2WLKA 3BA8A 3JSLA 1H8EG 4JI6O 3C3TA 1NKDA 4FPPA 2HFEC 1GTOA 3JSNA 4X1YB 3PJSK 4UXNA 5CB4B 4O4IA 3TCUA 1K8AW 4F6RA 3ABTA 1NZ6A 4I7ZB 3GWOA 5IYZA 4J42A 2BOCC 3QO7A 5E79Z 1M5IA 1DK1A 4JAAA 2ZIOA 3TXQA 2XHBA 4X89A 1S72V 1HNXB 4I4TA 4JI5O 2A0LA 3CRAA 3DGEA 2Q7EA 3SJQC 2CTQA 2YICA 2Y69B 3UM7A 5GTIZ 3D3QA 4QPJA 4YY3O 5LMNB 2Y0IA 2XAFA 4JYBA 1VIBA 3T2MA 4DV6B 2EILC 5EZYA 4DV7O 4TWKA 2YSUB 4TV8A 4WFEA 3JD0A 4DR1O 1W0KG 3ZMTA 4MVSA 2QWNB 1SS3A 1VQPV 1Q43A 5B1AC 1XNQO 1Q7YW 4LFBB 3ABMC 3JARB 3SJAC 2OWOA 3BRCA 2CH7A 4B3TO 1QLEC 3OD4A 4K3AA 4EKWA 4J7KA 4LF6O 4FLZA 2ZINA 2ZM6O 4O4LB 1RSOB 4CH5A 3VQYA 4J7JA 1K3EA 1ZSPA 1MG1A 3LUTB 4ZHQB 5BR8B 3FB5C 4CBCA 1PM9A 3QG5A 1B3QA 4MVUA 2GUZA 3CCJV 4DR3B 4I9WA 3FKSG 4JTCB 1L0LH 3J81N 3HKDA 2ZE6A 5JJEB 4A5UB 1HNZB 3RYFA 1LUWA 4H37A 2JDIG 5JVDB 4JI2B 2OT5A 3DSQA 3IAYA 3OTFA 1M57C 1SQBH 5KUKA 1FJGO 2XAJA 3G80A 4RWUA 1BL8A 3CRCA 1R6NA 2Q0AA 2V4DA 5B1NA 1OHHG 3ABKC 3LSQA 5K1PA 3FFQA 3JALB 2Q8VA 3SYPA 4J11A 5FNVA 2OYQA 2ADPA 3FD9A 1DF5A 4AI8A 1SA0A 2WLMA 2R70A 5GTHZ 4X64B 4MTXA 3RVZA 1IBMO 4FLYA 4K8XA 5KX5A 5H2FZ 4B7EA 3F7YC 4NTXA 1GN3A 3TGUH 4I5SA 1Y76A 3G67A 3M8AA 2QJ1A 5KA6A 1XMQO 3O65A 1V9PA 5CBGA 3G4SV 2EJRA 3UO2A 4ZBMA 1AJPA 2CDYA 1OCCB 3E22A 4O4HA 4LNUA 1XHXA 4JGSA 5CBFA 4DUYB 3BFRA 2VWJA 3RYIB 4LF7B 1EZVH 2Q5ZA 1QBZA 4X20A 4YJ2B 3BVOA 4JI1B 4DUZO 2XASA 2EULA 3K0DA 5HFMA 2M6YA 4DV0B 2ZKOA 2F23A 4RUEA 1UPGA 5J2UB 4GKKO 4AQYO 1GH6A 1NTMH 2UUAB 5ITZA 1CXZB 1R3IC 5H9CA 3M7MX 1Y4MA 3AG3B 3B77A 1B6QA 2QR4A 5HFLA 3SR2C 4IL6Z 1Z5VA 4YIOA 4DV3O 3W7TA 1XQ8A 5C8YB 1NVPD 1RP3B 2DQ0A 5LGNA 1RPOA 3ZRWA 4L87A 4DR6O 1FXKC 4H44B 4JI6B 3JAKB 4J41A 1K5SA 4FFKA 2BOBC 4KHPO 5LOVB 5GONB 1ORQC 2EIJB 1K92A 3HPLC 1HP8A 2YEVA 2E76B 1YITV 4Z1MG 3JATA 3NR7A 3BCCH 2EIKC 1IXMA 2ZQMA 1KQSU 1VQ5V 5KAIZ 4I50B 2RQ6A 3EXAA 3DTUB 5B1BB 1GRJA 1F51A 2PZSA 4FZ0A 3SJBC 3FAVB 3HR0A 4GKJO 2ZXWC 4JI5B 3QO8A 1SQVH 2Q67A 1V55C 4X1YA 5LGTA 3BABA 5CB4A 4OX9B 1EBOA 4DR7B 1WN7A 4YY3B 1YCIA 3ZHQA 1JVMA 2LGWA 4PA9A 3CHXA 2KKWA 1PNMA 4DV7B 2P4VA 1WB8A 4TUYB 2D3OW 3JAMN 4DR1B 2JVDA 1TAEA 2GHYA 1ZLZA 1L1FA 3B4SA 4D6TH 1I94O 2LW1A 2DOSA 3OTOO 2Q73A 2AGAA 1OCRB 2Q7GA 5BY1A 4J80A 2YIBA 3F5WC 4B3TB 2OIEA 2FL4A 1SKVA 3CX5F 1WP8A 1BSMA 2P67A 3HKEB 3AG2C 2ZM6B 2Y0PA 4ZI7A 3B8NA 2EBOA 1U97A 1NS1A 3CCMV 1S5JA 5L3FA 4Z2WA 1PP9H 1QR8A 4UV9A 3E35A 1EFRG 4JYAO 5LBQA 1AJQA 4JTDB 3E8GA 1PNLA 3JARA 1GN2A 4U7NA 1P49A 3UQ8A 5DEDA 4XDLA 4LF8O 3G6EV 2JS5A 1G8MA 1H2KA 4O4LA 1FXHA 1G6UA 1RSOA 4DV4O 4IT5A 1VQ7V 3L71H 1R6KA 3D8CA 4CC6A 2X6BA 4CZZA 1FJGB 4BWAA 2PTMA 2ETNA 3K5OA 2P90A 3ETEA 4ZHQA 4J10A 3OMAB 4IYHA 1QLNA 4U3FH 4LF9O 4HZ3A 2DWEC 4DR5O 2A79B 4JF3A 5H6RA 4UCSA 4AILC 3OMIB 3STLC 3OGCC 4PD4F 3ZCCA 2HHHO 4PA6A 5EBWC 3W7UA 3CXCU 5JVDA 2XUMA 3K5NA 4UVCA 3R66A 1IBMB 2VWKA 4JI7O 2EX3A 2FMLA 1SQPH 3F5TA 3TK1A 2Q69A 2E5LO 1SF9A 3RBZA 3JALA 4N23A 3E8HA 1P7BA 2EINC 4PA7A 3JCZA 2YS8A 5JWPA 4RUFA 5B5EZ 4GUNA 3SPGA 4PJ0Z 1JQ0A 5L3BA 5B3SB 3FX7A 2ZNIA 4MT8A 1N33O 3CMEV 4P9OA 4N21A 4XBFA 4HYOA 1AP5A 1SZTA 3KCXA 3X2QB 1O9GA 4DUZB 2JJ1G 2P7TC 3CC2V 2HKOA 3K04A 1JJOA 2Q0OC 2Y69C 1I5YA 3L73H 4GKKB 4AQYB 5IY5B 3K57A 2DQ3A 3H1JH 1BHBA 4IIJA 2OIGA 3QNEA 3D36A 2PYJA 2XAGA 1XNRO 1TGOA 2ATKC 1BQ0A 4DV5O 4DV3B 2HG5C 3T4ZA 2A06H 5C93A 5JCOA 1GO3F 3RYIA 4LFAO 4DR6B 3JD2A 1SQQH 3TXSA 5EBLC 3WB1A 5KHKA 4YJ2A 3ABLB 1ZAUA 1IZ3A 3SDLA 1JR9A 4KHPB 2H94A 3SPHA 5J2UA 2QDOA 3ZS8C 2ODMA 1NJIW 2QTSA 5CA0B 1MMMA 3HKCB 2NR5A 4ASUG 5IJ9B 3ZHUA 4JI8O 1VEWA 4DK1A 4WBNB 5C8YA 2YC0A 3K03A 2Q7HA 2QKCA 2YDEA 1FAFA 1QU7A 5KA5A 1QCEA 2D2CB 5D5PA 1GM7A 3JYCA 2DYSC 2Y4TA 3EVKA 4GYCB 4GKJB 1FKAO 4UUJC 2AZ2A 4H33A 1GKFA 5LOVA 5GONA 4X1IB 2W0XA 1Q6UA 2UXDO 2A3QA 2WLLB 5JJNB 5LA6B 2GDSA 4FK5C 1XL4A 4GX5A 3KZIZ 5AG2A 4TQDA 3EHBB 4I50A 2JGDB 4FM1A 3CEIA 3M99B 1I94B 4QE9A 2WA4A 3CCLV 3OTOB 3FAVA 5CN0A 5LMUO 4FLTA 3OW2U 1D5AA 4OPHA 2XAQA 2HJDA 2F43G 5LL6Y 1CPYA 1JOYA 4NYKA 2BSKB 4QNHB 3UCSC 4TUYA 3OFNG 1FFTB 4HBNA 3WG7C 4U3JB 3CCSV 1H2NA 4HNAB 1YVWA 2ZT9B 4JYAB 2FB5A 1NH2B 4DW0A 3R65A 2N74A 4CC5A 2EIMB 3D36C 3K08A 1YI2V 3WFVA 1NTZH 1OCCC 2IH1C 3ASOC 4LF8B 2L6LA 4K0KO 2G38A 1M4UA 3HKEA 5JCOC 1L8DA 1PV0A 3I5DA 2RCVA 1DTOA 4DV4B 2R9IA 2OTJV 4OGQB 3K5MA 3ZJZA 2VS0A 2QGNA 2QWPB 2KB1A 4B3RO 2QWRB 1R3JC 2R72A 4JZGA 4LF9B 3AG3C 1K9MW 1O9HA 4WF9V 4DR5B 4CS4A 4BIUA 2UUCO 1LNQA 1R73A 4FFBB 3H01A 4G2KA 1BS3A 1Q82W 3WU2Z 1B06A 1IBLO 1VQ8V 5LHGA 2GBOA 4O2BB 3N2GB 4YIPA 4JI7B 3J7AU 3TJTA 5H5NA 5JQGB 4DK0A 2DE0X 4G27B 2EIJC 3RYHB 1QNMA 1MA1A 1Q6HA 1AI5A 4R8CA 3T4DA 1XEQA 1QVGU 1TUBB 1AI7A 2JIZG 5K1XA 3A0BZ 1WLEA 4JI0O 1US6A 1H2SB 4XDKA 1XREA 1M56B 4NXMO 1KKDA 4GT1A 4Z1VA 3CWBH 2QWQB 1BCCH 2A9HA 3A0HZ 1R6TA 2ZR3A 4B7KA 2PI5A 2LP7A 2IJHA 4PDMA 2LGQA 2IBZH 1AILA 1KUQA 1D2DA 2HR3A 3JASB 1XL6A 4WFBV 1EN5A 1N34O 1NR1A 2ZDIA 4NTWA 4LR3A 2UUBO 5EIBC 4LH7A 1N4CA 2W6JG 1XNRB 5IT9N 4DV5B 1K5QA 4PA4A 3EFFK 3OMNB 1VF6A 4K35A 2F1MA 4BR6A 2LFRA 4LFAB 2WLJA 1HR0O 1SC5B 1P7GA 3SJCC 4X1KB 2CUGA 4B3MO 1OCRC 1AR4A 3SPIA 5BXZA 1IBKO 4ZOLB 2WLHA 3DC5A 2WSSG 3CC7V 3H1KH 3FB8C 3SYQA 3THOA 3ZBHA 3ABMB 3K3WA 3I55V 1B04A 2P06A 4X65O 2IH3C 3L70H 4JI8B 1QLEB 2QKSA 4P2ZA 1N32O 2IU0A 1XI1A 4MTFA 2AHYA 1WJZA 1IX9A 4PI2A 3LDEA 3T1YO 1N36B 1AJNA 1HW7A 1DLBA 1PKXA 1W59A 4ABMA 3S3WA 3L72H 1PD3A 1MSDA 4YXWG 4BIZA 5EIBD 2VRZA 4JV5O 2XNDG 2BTOA 1PL4A 4ZIBA 1Y66A 2UXDB 1GAXA 3ZMZA 1VQMV 2A7WA 4MVQA 5CA0A 4QE7A 3HKCA 2UXBO 3WB0A 1BE3H 1ZTEA 5IJ9A 2DN9A 4KUMA 3AEIA 4WBNA 3BPZA
chains in the Genus database with same CATH topology
4FJCC 4GCZA 1KP3A 4HZ3A 2Z5UA 2DWEC 2A79B 2QM7A 1JJ2U 4JF3A 5H6RA 1RM1B 2UXNA 2WLKA 3OMIB 3STLC 1H8EG 4JPRA 3OGCC 1M57B 4TT3G 1G4YB 3GB7C 3ZCCA 1VQ4V 1NKDA 4PA6A 5EBWC 3W7UA 4FPPA 2HFEC 2K1EA 1GTOA 3CXCU 1AI6A 1RM1C 3MHSC 3LDDA 4UVCA 5B1BC 3PJSK 4UXNA 3W7WA 1GM9A 1Q81W 1FXVA 3TCUA 1K8AW 1KC8W 2ZR2A 3ABTA 2WLLA 4E2LA 1W2BU 4ZKIA 1GM8A 1DF4A 4JAVA 2XOKG 3GWOA 3TK1A 2Q69A 1BHAA 3A0RA 3IC7A 4MSWC 2BOCC 3QO7A 1WPXA 5LGUA 1S5HC 3RBZA 4MTOA 1K73W 4N23A 3E8HA 1P7BA 1W0JG 2EINC 3JCZA 2B1GA 4PA7A 5EK0A 3FB7C 4RUFA 2P6JA 5CMUA 2X7RB 3SPGA 1JQ0A 1PL0A 4X89A 5KUMA 5L3BA 5B3SB 1NVPB 1S72V 4MT8A 4GX1A 3CMEV 4P9OA 4P30A 4WFGA 4N21A 1VQ9V 4XBFA 4HYOA 1K4DC 2WAMA 2A0LA 5B3SC 2M7WA 2IJJA 3W7XA 3DGEA 1SZTA 3SJQC 3FYIB 2EILB 3X2QB 2Y69B 3G71V 1QVFU 3STZC 3JD1A 3UM7A 3WG7B 4Q20A 2JJ1G 2P7TC 4QPJA 3CC2V 2HKOA 3HB3B 3K04A 2XAFA 4JYBA 1F23A 4RAIA 3CCUV 3T2MA 3X2QC 2EILC 1S77D 2Y69C 1I5YA 5IY5B 2V7QG 2PI4A 4TWKA 2YSUB 4WFEA 2DQ3A 3JD0A 3ZN0A 4PA3A 5B1AB 4FMTA 1W0KG 3ZMTA 1BHBA 2C2AA 3QNEA 3D36A 3IGAC 2W0FC 4MVSA 3E83A 3ASOB 5EBMC 4DXWA 1OCZB 2XAGA 1BMFG 1VQPV 5B1AC 2ATKC 1Q7YW 1AR1B 2HG5C 3FYEB 5DM6V 3T4ZA 3ABMC 1JCHA 4X8AA 1OCZC 5C93A 4PDRA 1GO3F 3ASNB 3JD3A 3RVYA 3JD2A 3SPJA 3VBBA 4G28B 3OR7C 5EBLC 3D3IA 1QLEC 1K97A 1I5XA 3ABLB 2MK3A 4EKWA 2X6AA 3CD6V 3ASNC 3ZRSA 1YIJV 3BY6A 2H94A 2DW4A 3SPHA 4JASA 1P4RA 4XDJA 5L3CA 3AG1B 1K3EA 1OCOC 1YSCA 1S76D 3TETA 5IYBO 2DWDC 1NJIW 4MTGA 4X88A 1FS0G 1MG1A 3AG1C 4ASUG 3LUTB 3RW0A 1FXKB 5FL7G 2AHZA 4RQEA 3FB5C 4CBCA 1AI4A 3K03A 3NXSA 3E2EA 4MVUA 3CCJV 1GK9A 4I9WA 3IFXA 4PDLA 3FKSG 2V1DA 4J9YB 4JTCB 5KA5A 1QCEA 2JJ2G 1GM7A 1N8RW 3JYCA 3FB6C 2GSMB 2DYSC 4H37A 2JDIG 2OT5A 4UUJC 3KG2A 2JEXA 4MVOA 4H33A 2QEXV 1GKFA 4P9PA 1M57C 3SYAA 2WLLB 3ABKB 5KUKA 2XAJA 3T1CA 1BL8A 1R6NA 4FK5C 4U7OA 1R3KC 3QO5A 1KP2A 1XL4A 4GX5A 5B1NA 3SPCA 1OHHG 2LFSA 3ABKC 1K4CC 3LSQA 3EHBB 5L3GA 3ZMUA 2HLDG 1CP9A 3CYOA 2ZXWB 1MABG 2WWWA 4RQFA 3M99B 3SYPA 3OR6C 1THZA 4QE9A 5L3EA 3CCLV 3OAAG 1M90W 2ZD9A 1H8HG 2NNUA 1UJWB 1DF5A 5B1OA 5CN0A 2WLMA 1YJNV 3ZRVA 2ZDIC 3OW2U 4DO2A 1ENVA 4JAUA 3OUFA 2XAQA 1M1KW 3ZMVA 3P30A 4MTXA 2F43G 1JPXA 3CP1A 1KECA 2HVKC 3RVZA 1CPYA 3E86A 5CA3A 3JD4A 1JOYA 3F7YC 2W6IG 2Q6AA 2QTOA 1YHQV 4I5SA 1EZJA 4QNHB 5KA6A 1YJ9V 2WLIA 3OFNG 1CEZA 1K34A 1FFTB 5CBGA 2WLNA 3WG7C 3G4SV 2EJRA 3CCSV 2ITDC 2QE7G 4FIPC 2CK3G 4LP8A 4ZBMA 1AJPA 4KFMA 3ZMSA 5LHHA 1OCCB 1NH2B 3R65A 1V54B 5IY5C 2JEUA 2EIMB 2DYRB 1AROP 4JGSA 3K08A 4UVAA 5BZBA 5CBFA 3WFVA 1YI2V 3SYOA 3E8BA 3ZRXA 1OCCC 2IH1C 3ASOC 1V54C 2EIMC 2DYRC 4JYCA 1H38A 1QBZA 1MSWD 2XASA 5J9PC 2IJKA 1NQTA 2Q68A 3K0DA 5HFMA 3CCQV 3I56V 1DTOA 2R9IA 2OTJV 2FTKA 4RUEA 3BEHA 3E8FA 1J95A 3ABLC 4QJFB 1HWYA 2OCCB 3ZJZA 1R3IC 5H9CA 1Y4MA 3AG3B 3B77A 1B6QA 5HFLA 2KB1A 1OZ0A 1R3JC 5L3DA 2OCCC 3K79A 3W7TA 2Y48A 3AG3C 1NVPD 1K9MW 2DQ0A 2EZOA 2IU3A 1NR7A 5LGNA 1RPOA 4WF9V 2XAHA 3ZRWA 3MD0A 4L87A 4BIUA 3ETGA 1LNQA 4MW8A 1FXKC 1R73A 4LCUC 1VQ6V 3H01A 3P32A 4G2KA 1Q82W 1K5SA 2BOBC 4TSFG 1VQ8V 5LHGA 4F4LA 1VQLV 1PNKA 1ORQC 2WPDG 2EIKB 2EIJB 1K92A 3HPLC 2X6CA 2YEVA 4UVBA 1YITV 1RPRA 2B1IA 4Z1MG 1YTFB 1H2GA 1QR9A 3VOUA 1NH2D 4G27B 2EIKC 2EZPA 1IXMA 2EIJC 1E1QG 2R9RB 2ZQMA 4PELA 3SYCA 5IYDO 1KQSU 3ML0A 4R7CA 4WFAV 1VQ5V 2OTLV 3CPWU 1ROPA 1E79G 1AI5A 1SERA 3ETDA 4R8CA 3LNMB 3DTUB 3T4DA 1YJWV 1QVGU 5B1BB 1F51A 1AI7A 2JIZG 4MVRA 1WLEA 3MHHC 1V55B 4QPKA 2ZXWC 4XDKA 3ZN1A 3OUSA 3QO8A 3ABUA 1M56B 2Q67A 1V55C 4MVMA 1KKDA 4GT1A 5LGTA 5E1AC 4HAMA 3CCRV 1COWG 1EBOA 2A9HA 2EINB 4RO2A 1M56C 2ZR3A 2PI5A 3AG4B 1R3LC 1F4MA 2LP7A 1JVMA 2IJHA 3OEEG 4PA9A 4PDMA 1PNMA 1VQKV 2HVJC 4J9ZB 1KD1W 2D3OW 5EC1C 2IJIA 2WLIB 3AG4C 4GX0A 2HR3A 1XL6A 3K9AA 4WFBV 5H6QA 1NR1A 2ZDIA 4UV8A 2GHYA 3K0GA 2IW5A 5CBHA 3K06A 2B5UA 2W6JG 1L1FA 1VQOV 4BAYA 3B8MA 4MW3A 1VQNV 1K5QA 2X0LA 4PA4A 3EFFK 4PDVA 3OMNB 1SRYA 1OCRB 2QA4V 2LFRA 1ZWIC 2WLJA 3AG2B 3F5WC 3CCEV 3CC4V 1OCRC 4MVZA 3SPIA 1Q86W 1M9NA 4WFHA 2P67A 3AG2C 2WLHA 1YTFD 2WSSG 3W7SA 3CC7V 3B8NA 5LHIA 4R50A 1K33A 3FB8C 3SYQA 2EBOA 3I55V 3ABMB 3K3WA 3CCVV 2H8PC 3CCMV 5L3FA 1QR8A 4GX2A 3E89A 4UV9A 4OXSA 3UKMA 2IH3C 3E35A 1EFRG 1E1RG 1MOFA 2UXXA 1F4NA 1QLEB 5LBQA 4LBEC 2QKSA 2HJFC 5EC2C 4P2ZA 3F7VC 2IU0A 3LDCA 1GMGA 5IDJA 2AHYA 1AJQA 4JTDB 3E8GA 1PNLA 4MTFA 1K7DA 2ITCC 3LDEA 4R6ZA 4U7NA 1S0VA 1TUEB 5DN6G 3ZRWB 1AJNA 5GW7A 1SETA 1DLBA 1PKXA 4BW5A 4JTAB 1OCOB 4XDLA 3OM3B 1NBMG 1PD3A 3G6EV 1G8MA 4YXWG 4BIZA 4KP4A 1FXHA 4MS2A 1VQ7V 1R6KA 2Z3YA 2XNDG 4LC1A 1Y66A 1S3JA 3ZIAG 3ZMZA 2X6BA 1VQMV 4CZZA 2QM8A 3LSSA 2YEVB 1JX9A 3CMAV 4MVQA 4QE7A 3OEHG 2P90A 2NLJC 3ETEA 1FXKA 1SESA 3OE7G 4WFFA 3OMAB 2JK5C 5IYCO 4QIWF 2DYSB 4KUMA 3AEIA 1QLNA 4WCEV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHB A;  1BHA A; 
#chains in the Genus database with same CATH topology
 1I08 A;  3T1H O;  2QM4 A;  4FVM A;  3H1H H;  5DEC A;  2UXN A;  4X66 O;  1RM1 B;  1M57 B;  4TT3 G;  1G4Y B;  5BMV B;  5LMU B;  3UO3 A;  3RFR A;  1AI6 A;  4NB5 A;  3LDD A;  3W7W A;  1FXV A;  4X1I A;  3ZHV A;  3K58 A;  2WLL A;  3DC6 A;  4E2L A;  1W2B U;  4ZKI A;  1GM8 A;  5LA6 A;  1YEW A;  1BHA A;  3A0R A;  3IC7 A;  1WPX A;  4B3S O;  4MTO A;  2LW7 A;  2JGD A;  1SQG A;  1P84 F;  2CTW A;  2YI8 A;  2E75 B;  5CMU A;  3VQW A;  3N2K B;  1NVP B;  4IHJ B;  1Y74 B;  1XNQ B;  1SZX A;  1K4D C;  2WAM A;  5B3S C;  2IJJ A;  3FYI B;  1QVF U;  1VF6 C;  3G71 V;  3STZ C;  3BAA A;  4X9Q A;  5CA1 B;  2CTR A;  1NI8 A;  1F23 A;  4RAI A;  4LF6 B;  4TV8 B;  3X2Q C;  1S77 D;  2BSK A;  4DRX B;  2PF4 E;  2V7Q G;  2PI4 A;  3ZN0 A;  1WNS A;  2UXC O;  4U3J A;  2W0F C;  4HNA A;  3E83 A;  5EBM C;  1OCZ B;  1BMF G;  4B3R B;  3P3N A;  4OPA A;  1AR1 B;  3FYE B;  5DM6 V;  2QKA A;  4X8A A;  5FLX N;  3ASN B;  2UUC B;  3SPJ A;  3K5L A;  4B08 A;  4G28 B;  4JI3 O;  5IJ0 B;  1K97 A;  1FFX B;  4JI4 O;  1IBL B;  3BY6 A;  1JA8 A;  2Y4U A;  2Q4P A;  2DW4 A;  4JAS A;  1Q5O A;  2F93 B;  3K59 A;  4UB6 Z;  3AG1 B;  4UB8 Z;  1XDC A;  3ZX6 A;  1OCO C;  4NXN O;  1S76 D;  3TET A;  1T5E A;  2DWD C;  5IYB O;  4MTG A;  4X88 A;  2XT9 A;  1FXK B;  4UCR A;  5FL7 G;  2AHZ A;  2VQE O;  2PY5 A;  3HKB B;  4H13 B;  4CH3 A;  1Y6X A;  3NXS A;  3C3S A;  1GK9 A;  4FZ1 A;  3HKD B;  2V1D A;  4JI0 B;  4FFB A;  2IM9 A;  1N8R W;  3H1I H;  1BZK A;  4NXM B;  3KG2 A;  4O2B A;  4MVO A;  2QEX V;  3N2G A;  4P9P A;  5F2V O;  2KG7 B;  4O4J B;  2N05 A;  4I9Q A;  1U96 A;  2GV9 A;  2VQF O;  5JQG A;  5KAF Z;  4EB6 B;  3L74 H;  3L75 H;  5L3G A;  1N34 B;  3ZMU A;  3RYH A;  2HLD G;  2ZXW B;  1XMQ B;  2UUB B;  2WWW A;  4RQF A;  2PYL A;  1TUB A;  2QWO B;  3B2E E;  3OR6 C;  4TV9 B;  4DR4 O;  1HNZ O;  5JJJ B;  1Q8I A;  5L3E A;  1AVM A;  3OAA G;  2ZD9 A;  1UJW B;  5B1O A;  3ZRV A;  5LXT B;  3LNN A;  4JYY A;  3OUF A;  1M1K W;  3P30 A;  4B3M B;  3CP1 A;  1I0H A;  5CA3 A;  3JD4 A;  1Y67 A;  1S5L Z;  2W6I G;  2Q6A A;  1YHQ V;  1EZJ A;  5LP6 B;  2FYU H;  4DR2 O;  1CEZ A;  1K34 A;  3JAS A;  4QGP A;  2WLN A;  1VF5 B;  2QE7 G;  4DV1 O;  4FIP C;  4LP8 A;  4KFM A;  3ZMS A;  1EN4 A;  1V54 B;  1N32 B;  2JEU A;  2DYR B;  5JH7 B;  5BZB A;  3SYO A;  3E8B A;  3ZRX A;  1IVS A;  1A32 A;  2HEP A;  3T1Y B;  1BQZ A;  2ZNJ A;  3ZHT A;  2EIM C;  4X1K A;  3MDS A;  4JYC A;  1MSW D;  4J7Z A;  4ZOL A;  1NQT A;  2E3C A;  1R1B A;  3PN1 A;  3CCQ V;  2LO1 A;  3CRR A;  3I56 V;  4GLX A;  4JV5 B;  3H1L H;  2YIA A;  2Z0A A;  4I55 B;  4UCO A;  2BTQ B;  4L8J A;  4QJF B;  1HWY A;  2OCC B;  4KXR A;  5IWA O;  5L3D A;  2PGG A;  1TVK B;  1VAR A;  3T1H B;  2IU3 A;  1NR7 A;  2XAH A;  1IUR A;  2L35 A;  3MD0 A;  4X66 B;  2YIB D;  2PUS A;  1VQ6 V;  3P32 A;  4DV0 O;  1KB9 F;  1RFY A;  1WA8 B;  1YDX A;  4EFE A;  3JAK A;  3WB2 A;  1VQL V;  3QVN A;  4LF4 O;  4D7S A;  2WA3 A;  2DJV A;  3B09 A;  4UVB A;  1RPR A;  5FPO A;  1YTF B;  3RYC B;  1H2G A;  2XTA A;  5KLV H;  3VOU A;  3AK2 A;  1NH2 D;  1E1Q G;  2R9R B;  4B3S B;  3ML0 A;  4R7C A;  1L0N H;  1ROP A;  1E79 G;  1SER A;  1YJW V;  1NTK H;  4QPK A;  3A8T A;  5BMV A;  4PI0 A;  4NVP A;  3DXR B;  4BIO A;  1OJH A;  2F4V O;  3ZN1 A;  2UU9 O;  3OUS A;  2OCH A;  4MVM A;  3Q4H B;  4YHH O;  5E1A C;  3CCR V;  2P22 C;  1Z5W A;  5A9G A;  1COW G;  2EIN B;  4RO2 A;  1M56 C;  3AG4 B;  3UT5 B;  1JMK C;  1VQK V;  2BCC H;  2HVJ C;  1KD1 W;  5EC1 C;  4W4L A;  2WLI B;  2UXC B;  4GX0 A;  1EM1 A;  2AXT Z;  2GTA A;  3K9A A;  5H6Q A;  2ZE5 A;  4UV8 A;  3K0G A;  4FLV A;  3K06 A;  2B5U A;  3CRQ A;  1VQO V;  4BAY A;  3C90 A;  3N2K A;  4MW3 A;  1VQN V;  2X0L A;  4UCV A;  4PDV A;  4IHJ A;  1Y74 A;  1SRY A;  2QA4 V;  1YZB A;  2K9P A;  1ZWI C;  3CCE V;  1XIL A;  4OX9 O;  4DR7 O;  3CC4 V;  4JI3 B;  4ZI7 B;  5CA1 A;  1Q86 W;  4WFH A;  4JI4 B;  1HNW O;  4IGG A;  3QF7 A;  4DRX A;  1K33 A;  4NXN B;  1KMI Z;  3OT7 A;  3KCY A;  3CE2 A;  3E89 A;  1E1R G;  2VQE B;  2UXX A;  1XHZ A;  4LBE C;  2HJF C;  4FM0 A;  1GMG A;  5IDJ A;  1K7D A;  2ITC C;  2Q9L A;  1S0V A;  5DN6 G;  1GN6 A;  4CS3 A;  4W4K A;  1SET A;  2CGN A;  3OM3 B;  5IJ0 A;  3OGI B;  1NBM G;  1FFX A;  2ARH A;  4X62 O;  2HHH B;  2HP8 A;  4EEQ A;  1AB3 A;  4LFC O;  2Z3Y A;  2P5O A;  1I7F A;  2EJ7 A;  1H2L A;  2YXL A;  3LSS A;  1JX9 A;  3CMA V;  2VQF B;  3OEH G;  1IXB A;  4ICG A;  2NLJ C;  3JAW B;  3RT3 C;  1FXK A;  2LJ2 A;  4DYL A;  3HKB A;  2DMX A;  1Q3E A;  2JK5 C;  1FYJ A;  1TA8 A;  2DYS B;  2E5L B;  2YXH A;  3SGI A;  4WCE V;  4O2A B;  1WPB A;  2Z5U A;  2QM7 A;  1JJ2 U;  4DR4 B;  3IJ4 A;  4JPR A;  1VP7 A;  3GB7 C;  1VQ4 V;  5LYJ B;  2RMK B;  2K1E A;  2F66 C;  4CH6 A;  1N33 B;  1RM1 C;  3MHS C;  1JFF B;  5B1B C;  1GM9 A;  1Q81 W;  2KG7 A;  4O4J A;  1KC8 W;  2ZR2 A;  2MW2 B;  3U11 A;  1DF4 A;  2CE4 A;  4JAV A;  4DW1 A;  4BW9 A;  2XOK G;  3K9S A;  4EB6 A;  4MSW C;  2YID A;  4DR2 B;  5LGU A;  1S5H C;  1K73 W;  1W0J G;  4DV1 B;  5EK0 A;  1GN4 A;  2B1G A;  1QQC A;  3AK1 A;  3FB7 C;  2P6J A;  2CGO A;  2X7R B;  4TV9 A;  2ZIM A;  2N04 A;  2NN4 A;  3CRM A;  1PL0 A;  5KUM A;  4UCT A;  4GX1 A;  4P30 A;  4WFG A;  1VQ9 V;  5LXT A;  3GVM A;  2M7W A;  3W7X A;  3MAQ A;  4KL1 A;  2EIL B;  3JD1 A;  3WG7 B;  4Q20 A;  3HB3 B;  4K8Z A;  5KMG B;  2RNB A;  3GWK C;  3CCU V;  5LP6 A;  2O57 A;  4IIJ B;  4PA3 A;  5B1A B;  4LF5 O;  4FMT A;  1VMG A;  2C2A A;  4YJ3 B;  1WAZ A;  5KHG A;  3IGA C;  5IWA B;  3ASO B;  4DXW A;  3ETQ A;  3ZHR A;  3CJH B;  3APQ A;  5JH7 A;  1JCH A;  1OCZ C;  4LWS B;  4PDR A;  5J2T B;  3JD3 A;  3RVY A;  4GZR B;  3VBB A;  4IYI A;  1YXB A;  3OR7 C;  3D3I A;  1I5X A;  2MK3 A;  2X6A A;  3CD6 V;  3ASN C;  3ZRS A;  1YIJ V;  3U10 A;  1J5E O;  1P4R A;  4XDJ A;  4I55 A;  5L3C A;  4LF4 B;  1Q90 D;  5EYP B;  1YSC A;  2BTQ A;  3A2F A;  5KHI A;  1FS0 G;  2ADQ B;  4I0X B;  3AG1 C;  2QSA A;  1ZL8 B;  3RW0 A;  1MZF A;  4EFB A;  4RQE A;  1TVK A;  3O9O A;  1AI4 A;  3E2E A;  4D7T A;  1N0J A;  4JZ2 A;  3IFX A;  4PDL A;  1XMO O;  4J9Y B;  2JJ2 G;  1EN6 A;  2FKX A;  3FB6 C;  2GSM B;  4FLX A;  2F4V B;  1VF7 A;  2UU9 B;  1WA8 A;  4C7U A;  2JEX A;  4YHH B;  2ZCE A;  3BHP A;  3CB2 A;  4O4I B;  4DV2 O;  1X4T A;  3SYA A;  4F6R B;  3ABK B;  3N27 A;  1SQX H;  3T1C A;  3RYC A;  5IYZ B;  4AHC A;  4U7O A;  1R3K C;  3QO5 A;  1KP2 A;  3SPC A;  3LSU A;  2LFS A;  1K4C C;  3CYO A;  1CP9 A;  1MAB G;  1G1X B;  1PPJ H;  5D5Q A;  1THZ A;  3VQV A;  2B9Z A;  4E4E A;  5TIS Z;  1M90 W;  1H8H G;  3DXR A;  2RJZ A;  1YJN V;  2ZDI C;  4DO2 A;  1ENV A;  4JAU A;  4I4T B;  3ZMV A;  1KYO F;  3Q4H A;  3RGB A;  1JPX A;  1ZX3 A;  1KEC A;  2HVK C;  3E86 A;  1OV9 A;  3UT5 A;  1HNW B;  4K0K B;  2QTO A;  3RN4 A;  5EZY B;  1MNG A;  1HDJ A;  2AW9 A;  1YJ9 V;  2WLI A;  2ITD C;  5LP6 C;  2CK3 G;  5KHJ A;  4NR1 A;  1DGS A;  1WP7 A;  5A2Q N;  5LHH A;  1AP6 A;  2JGU A;  5B66 Z;  1M93 A;  5IY5 C;  1SQF A;  1ARO P;  4UVA A;  4FLW A;  1HNX O;  1XOU A;  1F7Y A;  1V54 C;  2CH7 B;  1NU1 H;  2DYR C;  1H38 A;  1BGY H;  3U0Z A;  4X62 B;  5J9P C;  2IJK A;  2Q68 A;  5LMN O;  1XUQ A;  4TQF A;  4LFC B;  2ZE8 A;  4DV6 O;  2FTK A;  3BEH A;  1FD9 A;  3G6B A;  3E8F A;  3S3X A;  1J95 A;  3ABL C;  2YUA A;  3L9D A;  3B40 A;  1OZ0 A;  2OCC C;  4F6E A;  3K79 A;  3AG7 A;  4LFB O;  1MZE A;  2Y48 A;  2LQT A;  2EZO A;  3KKY A;  2GUZ B;  3ETG A;  1N0N A;  4MW8 A;  4LCU C;  1ZUQ A;  3RYF B;  1AR5 A;  4TSF G;  2JRI A;  4F4L A;  4UFZ A;  1PNK A;  2WPD G;  2EIK B;  1XBL A;  2X6C A;  1Q6I A;  2ILM A;  3QTC A;  2B1I A;  1BT8 A;  1LR1 A;  1QR9 A;  2RN9 A;  3JAW A;  2YXY A;  2EZP A;  3SYC A;  4PEL A;  1WB7 A;  5IYD O;  2OTL V;  4WFA V;  3CPW U;  5BR8 O;  4O2A A;  1YF2 A;  3ETD A;  3LNM B;  5FNV B;  2BE3 A;  4DR3 O;  2CAZ C;  4MVR A;  3MHH C;  1H2M A;  1V55 B;  5LYJ A;  1SA0 B;  3ABU A;  4JI2 O;  1JFF A;  3ZHS A;  2RDC A;  1HR0 B;  3CS5 A;  4HAM A;  3P3P A;  2JS3 A;  1NT2 B;  4H0L B;  5KX5 B;  4NTY A;  3CSX A;  1R3L C;  1F4M A;  3OEE G;  1IBK B;  1Y76 B;  1Z2G A;  4J9Z B;  4PHZ A;  2IJI A;  4LF5 B;  3AG4 C;  4CH4 A;  3J80 N;  2IW5 A;  5CBH A;  2F95 B;  1D5N A;  2P4K A;  3B8M A;  4Q6G A;  4X65 B;  3E22 B;  4O4H B;  4LNU B;  4NKG B;  4UCU A;  4X64 O;  3AG2 B;  1FPO A;  1X59 A;  1IDS A;  4X20 B;  4MVZ A;  1M9N A;  3IC9 A;  1QHT A;  2KSD A;  1YTF D;  5KMG A;  3W7S A;  5LHI A;  1J5E B;  4FM2 A;  4R50 A;  3ZED A;  2CTP A;  3CCV V;  2H8P C;  4YJ3 A;  5ITZ B;  4GX2 A;  2H3O A;  4OXS A;  3UKM A;  1KBH A;  1MOF A;  2ZE7 A;  3H9V A;  1KU9 A;  1F4N A;  3CJH A;  3JCU Z;  2UXB B;  2E74 B;  5EC2 C;  3F7V C;  4TOI A;  3LDC A;  2R9A A;  3VQX A;  4R6Z A;  3APO A;  4LWS A;  2YI9 A;  5J2T A;  4DUY O;  1XMO B;  1TUE B;  3ZRW B;  5KHH A;  4LH6 A;  5GW7 A;  4LF7 O;  4BW5 A;  4JTA B;  1OCO B;  1URF A;  3AK3 A;  4JI1 O;  4PV1 B;  2GTS A;  4KP4 A;  4MS2 A;  3ICX A;  1LUV A;  3BA9 A;  4DV2 B;  1KKC A;  4LC1 A;  5EYP A;  1S3J A;  5FPR A;  3ZIA G;  2QM8 A;  2UUA O;  2YEV B;  2AZ0 A;  4I0X A;  3RWR D;  2KQX A;  3JAT B;  1ZL8 A;  1SES A;  3OE7 G;  4WFF A;  5IE9 A;  5IYC O;  4QIW F;  2NNU A;  1UFI A;  3CXH F;  4FJC C;  4GCZ A;  1KP3 A;  4FLU A;  1N36 O;  4CS2 A;  2WLK A;  3BA8 A;  3JSL A;  1H8E G;  4JI6 O;  3C3T A;  1NKD A;  4FPP A;  2HFE C;  1GTO A;  3JSN A;  4X1Y B;  3PJS K;  4UXN A;  5CB4 B;  4O4I A;  3TCU A;  1K8A W;  4F6R A;  3ABT A;  1NZ6 A;  4I7Z B;  3GWO A;  5IYZ A;  4J42 A;  2BOC C;  3QO7 A;  5E79 Z;  1M5I A;  1DK1 A;  4JAA A;  2ZIO A;  3TXQ A;  2XHB A;  4X89 A;  1S72 V;  1HNX B;  4I4T A;  4JI5 O;  2A0L A;  3CRA A;  3DGE A;  2Q7E A;  3SJQ C;  2CTQ A;  2YIC A;  2Y69 B;  3UM7 A;  5GTI Z;  3D3Q A;  4QPJ A;  4YY3 O;  5LMN B;  2Y0I A;  2XAF A;  4JYB A;  1VIB A;  3T2M A;  4DV6 B;  2EIL C;  5EZY A;  4DV7 O;  4TWK A;  2YSU B;  4TV8 A;  4WFE A;  3JD0 A;  4DR1 O;  1W0K G;  3ZMT A;  4MVS A;  2QWN B;  1SS3 A;  1VQP V;  1Q43 A;  5B1A C;  1XNQ O;  1Q7Y W;  4LFB B;  3ABM C;  3JAR B;  3SJA C;  2OWO A;  3BRC A;  2CH7 A;  4B3T O;  1QLE C;  3OD4 A;  4K3A A;  4EKW A;  4J7K A;  4LF6 O;  4FLZ A;  2ZIN A;  2ZM6 O;  4O4L B;  1RSO B;  4CH5 A;  3VQY A;  4J7J A;  1K3E A;  1ZSP A;  1MG1 A;  3LUT B;  4ZHQ B;  5BR8 B;  3FB5 C;  4CBC A;  1PM9 A;  3QG5 A;  1B3Q A;  4MVU A;  2GUZ A;  3CCJ V;  4DR3 B;  4I9W A;  3FKS G;  4JTC B;  1L0L H;  3J81 N;  3HKD A;  2ZE6 A;  5JJE B;  4A5U B;  1HNZ B;  3RYF A;  1LUW A;  4H37 A;  2JDI G;  5JVD B;  4JI2 B;  2OT5 A;  3DSQ A;  3IAY A;  3OTF A;  1M57 C;  1SQB H;  5KUK A;  1FJG O;  2XAJ A;  3G80 A;  4RWU A;  1BL8 A;  3CRC A;  1R6N A;  2Q0A A;  2V4D A;  5B1N A;  1OHH G;  3ABK C;  3LSQ A;  5K1P A;  3FFQ A;  3JAL B;  2Q8V A;  3SYP A;  4J11 A;  5FNV A;  2OYQ A;  2ADP A;  3FD9 A;  1DF5 A;  4AI8 A;  1SA0 A;  2WLM A;  2R70 A;  5GTH Z;  4X64 B;  4MTX A;  3RVZ A;  1IBM O;  4FLY A;  4K8X A;  5KX5 A;  5H2F Z;  4B7E A;  3F7Y C;  4NTX A;  1GN3 A;  3TGU H;  4I5S A;  1Y76 A;  3G67 A;  3M8A A;  2QJ1 A;  5KA6 A;  1XMQ O;  3O65 A;  1V9P A;  5CBG A;  3G4S V;  2EJR A;  3UO2 A;  4ZBM A;  1AJP A;  2CDY A;  1OCC B;  3E22 A;  4O4H A;  4LNU A;  1XHX A;  4JGS A;  5CBF A;  4DUY B;  3BFR A;  2VWJ A;  3RYI B;  4LF7 B;  1EZV H;  2Q5Z A;  1QBZ A;  4X20 A;  4YJ2 B;  3BVO A;  4JI1 B;  4DUZ O;  2XAS A;  2EUL A;  3K0D A;  5HFM A;  2M6Y A;  4DV0 B;  2ZKO A;  2F23 A;  4RUE A;  1UPG A;  5J2U B;  4GKK O;  4AQY O;  1GH6 A;  1NTM H;  2UUA B;  5ITZ A;  1CXZ B;  1R3I C;  5H9C A;  3M7M X;  1Y4M A;  3AG3 B;  3B77 A;  1B6Q A;  2QR4 A;  5HFL A;  3SR2 C;  4IL6 Z;  1Z5V A;  4YIO A;  4DV3 O;  3W7T A;  1XQ8 A;  5C8Y B;  1NVP D;  1RP3 B;  2DQ0 A;  5LGN A;  1RPO A;  3ZRW A;  4L87 A;  4DR6 O;  1FXK C;  4H44 B;  4JI6 B;  3JAK B;  4J41 A;  1K5S A;  4FFK A;  2BOB C;  4KHP O;  5LOV B;  5GON B;  1ORQ C;  2EIJ B;  1K92 A;  3HPL C;  1HP8 A;  2YEV A;  2E76 B;  1YIT V;  4Z1M G;  3JAT A;  3NR7 A;  3BCC H;  2EIK C;  1IXM A;  2ZQM A;  1KQS U;  1VQ5 V;  5KAI Z;  4I50 B;  2RQ6 A;  3EXA A;  3DTU B;  5B1B B;  1GRJ A;  1F51 A;  2PZS A;  4FZ0 A;  3SJB C;  3FAV B;  3HR0 A;  4GKJ O;  2ZXW C;  4JI5 B;  3QO8 A;  1SQV H;  2Q67 A;  1V55 C;  4X1Y A;  5LGT A;  3BAB A;  5CB4 A;  4OX9 B;  1EBO A;  4DR7 B;  1WN7 A;  4YY3 B;  1YCI A;  3ZHQ A;  1JVM A;  2LGW A;  4PA9 A;  3CHX A;  2KKW A;  1PNM A;  4DV7 B;  2P4V A;  1WB8 A;  4TUY B;  2D3O W;  3JAM N;  4DR1 B;  2JVD A;  1TAE A;  2GHY A;  1ZLZ A;  1L1F A;  3B4S A;  4D6T H;  1I94 O;  2LW1 A;  2DOS A;  3OTO O;  2Q73 A;  2AGA A;  1OCR B;  2Q7G A;  5BY1 A;  4J80 A;  2YIB A;  3F5W C;  4B3T B;  2OIE A;  2FL4 A;  1SKV A;  3CX5 F;  1WP8 A;  1BSM A;  2P67 A;  3HKE B;  3AG2 C;  2ZM6 B;  2Y0P A;  4ZI7 A;  3B8N A;  2EBO A;  1U97 A;  1NS1 A;  3CCM V;  1S5J A;  5L3F A;  4Z2W A;  1PP9 H;  1QR8 A;  4UV9 A;  3E35 A;  1EFR G;  4JYA O;  5LBQ A;  1AJQ A;  4JTD B;  3E8G A;  1PNL A;  3JAR A;  1GN2 A;  4U7N A;  1P49 A;  3UQ8 A;  5DED A;  4XDL A;  4LF8 O;  3G6E V;  2JS5 A;  1G8M A;  1H2K A;  4O4L A;  1FXH A;  1G6U A;  1RSO A;  4DV4 O;  4IT5 A;  1VQ7 V;  3L71 H;  1R6K A;  3D8C A;  4CC6 A;  2X6B A;  4CZZ A;  1FJG B;  4BWA A;  2PTM A;  2ETN A;  3K5O A;  2P90 A;  3ETE A;  4ZHQ A;  4J10 A;  3OMA B;  4IYH A;  1QLN A;  4U3F H;  4LF9 O;  4HZ3 A;  2DWE C;  4DR5 O;  2A79 B;  4JF3 A;  5H6R A;  4UCS A;  4AIL C;  3OMI B;  3STL C;  3OGC C;  4PD4 F;  3ZCC A;  2HHH O;  4PA6 A;  5EBW C;  3W7U A;  3CXC U;  5JVD A;  2XUM A;  3K5N A;  4UVC A;  3R66 A;  1IBM B;  2VWK A;  4JI7 O;  2EX3 A;  2FML A;  1SQP H;  3F5T A;  3TK1 A;  2Q69 A;  2E5L O;  1SF9 A;  3RBZ A;  3JAL A;  4N23 A;  3E8H A;  1P7B A;  2EIN C;  4PA7 A;  3JCZ A;  2YS8 A;  5JWP A;  4RUF A;  5B5E Z;  4GUN A;  3SPG A;  4PJ0 Z;  1JQ0 A;  5L3B A;  5B3S B;  3FX7 A;  2ZNI A;  4MT8 A;  1N33 O;  3CME V;  4P9O A;  4N21 A;  4XBF A;  4HYO A;  1AP5 A;  1SZT A;  3KCX A;  3X2Q B;  1O9G A;  4DUZ B;  2JJ1 G;  2P7T C;  3CC2 V;  2HKO A;  3K04 A;  1JJO A;  2Q0O C;  2Y69 C;  1I5Y A;  3L73 H;  4GKK B;  4AQY B;  5IY5 B;  3K57 A;  2DQ3 A;  3H1J H;  1BHB A;  4IIJ A;  2OIG A;  3QNE A;  3D36 A;  2PYJ A;  2XAG A;  1XNR O;  1TGO A;  2ATK C;  1BQ0 A;  4DV5 O;  4DV3 B;  2HG5 C;  3T4Z A;  2A06 H;  5C93 A;  5JCO A;  1GO3 F;  3RYI A;  4LFA O;  4DR6 B;  3JD2 A;  1SQQ H;  3TXS A;  5EBL C;  3WB1 A;  5KHK A;  4YJ2 A;  3ABL B;  1ZAU A;  1IZ3 A;  3SDL A;  1JR9 A;  4KHP B;  2H94 A;  3SPH A;  5J2U A;  2QDO A;  3ZS8 C;  2ODM A;  1NJI W;  2QTS A;  5CA0 B;  1MMM A;  3HKC B;  2NR5 A;  4ASU G;  5IJ9 B;  3ZHU A;  4JI8 O;  1VEW A;  4DK1 A;  4WBN B;  5C8Y A;  2YC0 A;  3K03 A;  2Q7H A;  2QKC A;  2YDE A;  1FAF A;  1QU7 A;  5KA5 A;  1QCE A;  2D2C B;  5D5P A;  1GM7 A;  3JYC A;  2DYS C;  2Y4T A;  3EVK A;  4GYC B;  4GKJ B;  1FKA O;  4UUJ C;  2AZ2 A;  4H33 A;  1GKF A;  5LOV A;  5GON A;  4X1I B;  2W0X A;  1Q6U A;  2UXD O;  2A3Q A;  2WLL B;  5JJN B;  5LA6 B;  2GDS A;  4FK5 C;  1XL4 A;  4GX5 A;  3KZI Z;  5AG2 A;  4TQD A;  3EHB B;  4I50 A;  2JGD B;  4FM1 A;  3CEI A;  3M99 B;  1I94 B;  4QE9 A;  2WA4 A;  3CCL V;  3OTO B;  3FAV A;  5CN0 A;  5LMU O;  4FLT A;  3OW2 U;  1D5A A;  4OPH A;  2XAQ A;  2HJD A;  2F43 G;  5LL6 Y;  1CPY A;  1JOY A;  4NYK A;  2BSK B;  4QNH B;  3UCS C;  4TUY A;  3OFN G;  1FFT B;  4HBN A;  3WG7 C;  4U3J B;  3CCS V;  1H2N A;  4HNA B;  1YVW A;  2ZT9 B;  4JYA B;  2FB5 A;  1NH2 B;  4DW0 A;  3R65 A;  2N74 A;  4CC5 A;  2EIM B;  3D36 C;  3K08 A;  1YI2 V;  3WFV A;  1NTZ H;  1OCC C;  2IH1 C;  3ASO C;  4LF8 B;  2L6L A;  4K0K O;  2G38 A;  1M4U A;  3HKE A;  5JCO C;  1L8D A;  1PV0 A;  3I5D A;  2RCV A;  1DTO A;  4DV4 B;  2R9I A;  2OTJ V;  4OGQ B;  3K5M A;  3ZJZ A;  2VS0 A;  2QGN A;  2QWP B;  2KB1 A;  4B3R O;  2QWR B;  1R3J C;  2R72 A;  4JZG A;  4LF9 B;  3AG3 C;  1K9M W;  1O9H A;  4WF9 V;  4DR5 B;  4CS4 A;  4BIU A;  2UUC O;  1LNQ A;  1R73 A;  4FFB B;  3H01 A;  4G2K A;  1BS3 A;  1Q82 W;  3WU2 Z;  1B06 A;  1IBL O;  1VQ8 V;  5LHG A;  2GBO A;  4O2B B;  3N2G B;  4YIP A;  4JI7 B;  3J7A U;  3TJT A;  5H5N A;  5JQG B;  4DK0 A;  2DE0 X;  4G27 B;  2EIJ C;  3RYH B;  1QNM A;  1MA1 A;  1Q6H A;  1AI5 A;  4R8C A;  3T4D A;  1XEQ A;  1QVG U;  1TUB B;  1AI7 A;  2JIZ G;  5K1X A;  3A0B Z;  1WLE A;  4JI0 O;  1US6 A;  1H2S B;  4XDK A;  1XRE A;  1M56 B;  4NXM O;  1KKD A;  4GT1 A;  4Z1V A;  3CWB H;  2QWQ B;  1BCC H;  2A9H A;  3A0H Z;  1R6T A;  2ZR3 A;  4B7K A;  2PI5 A;  2LP7 A;  2IJH A;  4PDM A;  2LGQ A;  2IBZ H;  1AIL A;  1KUQ A;  1D2D A;  2HR3 A;  3JAS B;  1XL6 A;  4WFB V;  1EN5 A;  1N34 O;  1NR1 A;  2ZDI A;  4NTW A;  4LR3 A;  2UUB O;  5EIB C;  4LH7 A;  1N4C A;  2W6J G;  1XNR B;  5IT9 N;  4DV5 B;  1K5Q A;  4PA4 A;  3EFF K;  3OMN B;  1VF6 A;  4K35 A;  2F1M A;  4BR6 A;  2LFR A;  4LFA B;  2WLJ A;  1HR0 O;  1SC5 B;  1P7G A;  3SJC C;  4X1K B;  2CUG A;  4B3M O;  1OCR C;  1AR4 A;  3SPI A;  5BXZ A;  1IBK O;  4ZOL B;  2WLH A;  3DC5 A;  2WSS G;  3CC7 V;  3H1K H;  3FB8 C;  3SYQ A;  3THO A;  3ZBH A;  3ABM B;  3K3W A;  3I55 V;  1B04 A;  2P06 A;  4X65 O;  2IH3 C;  3L70 H;  4JI8 B;  1QLE B;  2QKS A;  4P2Z A;  1N32 O;  2IU0 A;  1XI1 A;  4MTF A;  2AHY A;  1WJZ A;  1IX9 A;  4PI2 A;  3LDE A;  3T1Y O;  1N36 B;  1AJN A;  1HW7 A;  1DLB A;  1PKX A;  1W59 A;  4ABM A;  3S3W A;  3L72 H;  1PD3 A;  1MSD A;  4YXW G;  4BIZ A;  5EIB D;  2VRZ A;  4JV5 O;  2XND G;  2BTO A;  1PL4 A;  4ZIB A;  1Y66 A;  2UXD B;  1GAX A;  3ZMZ A;  1VQM V;  2A7W A;  4MVQ A;  5CA0 A;  4QE7 A;  3HKC A;  2UXB O;  3WB0 A;  1BE3 H;  1ZTE A;  5IJ9 A;  2DN9 A;  4KUM A;  3AEI A;  4WBN A;  3BPZ A; 
#chains in the Genus database with same CATH homology
 4FJC C;  4GCZ A;  1KP3 A;  4HZ3 A;  2Z5U A;  2DWE C;  2A79 B;  2QM7 A;  1JJ2 U;  4JF3 A;  5H6R A;  1RM1 B;  2UXN A;  2WLK A;  3OMI B;  3STL C;  1H8E G;  4JPR A;  3OGC C;  1M57 B;  4TT3 G;  1G4Y B;  3GB7 C;  3ZCC A;  1VQ4 V;  1NKD A;  4PA6 A;  5EBW C;  3W7U A;  4FPP A;  2HFE C;  2K1E A;  1GTO A;  3CXC U;  1AI6 A;  1RM1 C;  3MHS C;  3LDD A;  4UVC A;  5B1B C;  3PJS K;  4UXN A;  3W7W A;  1GM9 A;  1Q81 W;  1FXV A;  3TCU A;  1K8A W;  1KC8 W;  2ZR2 A;  3ABT A;  2WLL A;  4E2L A;  1W2B U;  4ZKI A;  1GM8 A;  1DF4 A;  4JAV A;  2XOK G;  3GWO A;  3TK1 A;  2Q69 A;  1BHA A;  3A0R A;  3IC7 A;  4MSW C;  2BOC C;  3QO7 A;  1WPX A;  5LGU A;  1S5H C;  3RBZ A;  4MTO A;  1K73 W;  4N23 A;  3E8H A;  1P7B A;  1W0J G;  2EIN C;  3JCZ A;  2B1G A;  4PA7 A;  5EK0 A;  3FB7 C;  4RUF A;  2P6J A;  5CMU A;  2X7R B;  3SPG A;  1JQ0 A;  1PL0 A;  4X89 A;  5KUM A;  5L3B A;  5B3S B;  1NVP B;  1S72 V;  4MT8 A;  4GX1 A;  3CME V;  4P9O A;  4P30 A;  4WFG A;  4N21 A;  1VQ9 V;  4XBF A;  4HYO A;  1K4D C;  2WAM A;  2A0L A;  5B3S C;  2M7W A;  2IJJ A;  3W7X A;  3DGE A;  1SZT A;  3SJQ C;  3FYI B;  2EIL B;  3X2Q B;  2Y69 B;  3G71 V;  1QVF U;  3STZ C;  3JD1 A;  3UM7 A;  3WG7 B;  4Q20 A;  2JJ1 G;  2P7T C;  4QPJ A;  3CC2 V;  2HKO A;  3HB3 B;  3K04 A;  2XAF A;  4JYB A;  1F23 A;  4RAI A;  3CCU V;  3T2M A;  3X2Q C;  2EIL C;  1S77 D;  2Y69 C;  1I5Y A;  5IY5 B;  2V7Q G;  2PI4 A;  4TWK A;  2YSU B;  4WFE A;  2DQ3 A;  3JD0 A;  3ZN0 A;  4PA3 A;  5B1A B;  4FMT A;  1W0K G;  3ZMT A;  1BHB A;  2C2A A;  3QNE A;  3D36 A;  3IGA C;  2W0F C;  4MVS A;  3E83 A;  3ASO B;  5EBM C;  4DXW A;  1OCZ B;  2XAG A;  1BMF G;  1VQP V;  5B1A C;  2ATK C;  1Q7Y W;  1AR1 B;  2HG5 C;  3FYE B;  5DM6 V;  3T4Z A;  3ABM C;  1JCH A;  4X8A A;  1OCZ C;  5C93 A;  4PDR A;  1GO3 F;  3ASN B;  3JD3 A;  3RVY A;  3JD2 A;  3SPJ A;  3VBB A;  4G28 B;  3OR7 C;  5EBL C;  3D3I A;  1QLE C;  1K97 A;  1I5X A;  3ABL B;  2MK3 A;  4EKW A;  2X6A A;  3CD6 V;  3ASN C;  3ZRS A;  1YIJ V;  3BY6 A;  2H94 A;  2DW4 A;  3SPH A;  4JAS A;  1P4R A;  4XDJ A;  5L3C A;  3AG1 B;  1K3E A;  1OCO C;  1YSC A;  1S76 D;  3TET A;  5IYB O;  2DWD C;  1NJI W;  4MTG A;  4X88 A;  1FS0 G;  1MG1 A;  3AG1 C;  4ASU G;  3LUT B;  3RW0 A;  1FXK B;  5FL7 G;  2AHZ A;  4RQE A;  3FB5 C;  4CBC A;  1AI4 A;  3K03 A;  3NXS A;  3E2E A;  4MVU A;  3CCJ V;  1GK9 A;  4I9W A;  3IFX A;  4PDL A;  3FKS G;  2V1D A;  4J9Y B;  4JTC B;  5KA5 A;  1QCE A;  2JJ2 G;  1GM7 A;  1N8R W;  3JYC A;  3FB6 C;  2GSM B;  2DYS C;  4H37 A;  2JDI G;  2OT5 A;  4UUJ C;  3KG2 A;  2JEX A;  4MVO A;  4H33 A;  2QEX V;  1GKF A;  4P9P A;  1M57 C;  3SYA A;  2WLL B;  3ABK B;  5KUK A;  2XAJ A;  3T1C A;  1BL8 A;  1R6N A;  4FK5 C;  4U7O A;  1R3K C;  3QO5 A;  1KP2 A;  1XL4 A;  4GX5 A;  5B1N A;  3SPC A;  1OHH G;  2LFS A;  3ABK C;  1K4C C;  3LSQ A;  3EHB B;  5L3G A;  3ZMU A;  2HLD G;  1CP9 A;  3CYO A;  2ZXW B;  1MAB G;  2WWW A;  4RQF A;  3M99 B;  3SYP A;  3OR6 C;  1THZ A;  4QE9 A;  5L3E A;  3CCL V;  3OAA G;  1M90 W;  2ZD9 A;  1H8H G;  2NNU A;  1UJW B;  1DF5 A;  5B1O A;  5CN0 A;  2WLM A;  1YJN V;  3ZRV A;  2ZDI C;  3OW2 U;  4DO2 A;  1ENV A;  4JAU A;  3OUF A;  2XAQ A;  1M1K W;  3ZMV A;  3P30 A;  4MTX A;  2F43 G;  1JPX A;  3CP1 A;  1KEC A;  2HVK C;  3RVZ A;  1CPY A;  3E86 A;  5CA3 A;  3JD4 A;  1JOY A;  3F7Y C;  2W6I G;  2Q6A A;  2QTO A;  1YHQ V;  4I5S A;  1EZJ A;  4QNH B;  5KA6 A;  1YJ9 V;  2WLI A;  3OFN G;  1CEZ A;  1K34 A;  1FFT B;  5CBG A;  2WLN A;  3WG7 C;  3G4S V;  2EJR A;  3CCS V;  2ITD C;  2QE7 G;  4FIP C;  2CK3 G;  4LP8 A;  4ZBM A;  1AJP A;  4KFM A;  3ZMS A;  5LHH A;  1OCC B;  1NH2 B;  3R65 A;  1V54 B;  5IY5 C;  2JEU A;  2EIM B;  2DYR B;  1ARO P;  4JGS A;  3K08 A;  4UVA A;  5BZB A;  5CBF A;  3WFV A;  1YI2 V;  3SYO A;  3E8B A;  3ZRX A;  1OCC C;  2IH1 C;  3ASO C;  1V54 C;  2EIM C;  2DYR C;  4JYC A;  1H38 A;  1QBZ A;  1MSW D;  2XAS A;  5J9P C;  2IJK A;  1NQT A;  2Q68 A;  3K0D A;  5HFM A;  3CCQ V;  3I56 V;  1DTO A;  2R9I A;  2OTJ V;  2FTK A;  4RUE A;  3BEH A;  3E8F A;  1J95 A;  3ABL C;  4QJF B;  1HWY A;  2OCC B;  3ZJZ A;  1R3I C;  5H9C A;  1Y4M A;  3AG3 B;  3B77 A;  1B6Q A;  5HFL A;  2KB1 A;  1OZ0 A;  1R3J C;  5L3D A;  2OCC C;  3K79 A;  3W7T A;  2Y48 A;  3AG3 C;  1NVP D;  1K9M W;  2DQ0 A;  2EZO A;  2IU3 A;  1NR7 A;  5LGN A;  1RPO A;  4WF9 V;  2XAH A;  3ZRW A;  3MD0 A;  4L87 A;  4BIU A;  3ETG A;  1LNQ A;  4MW8 A;  1FXK C;  1R73 A;  4LCU C;  1VQ6 V;  3H01 A;  3P32 A;  4G2K A;  1Q82 W;  1K5S A;  2BOB C;  4TSF G;  1VQ8 V;  5LHG A;  4F4L A;  1VQL V;  1PNK A;  1ORQ C;  2WPD G;  2EIK B;  2EIJ B;  1K92 A;  3HPL C;  2X6C A;  2YEV A;  4UVB A;  1YIT V;  1RPR A;  2B1I A;  4Z1M G;  1YTF B;  1H2G A;  1QR9 A;  3VOU A;  1NH2 D;  4G27 B;  2EIK C;  2EZP A;  1IXM A;  2EIJ C;  1E1Q G;  2R9R B;  2ZQM A;  4PEL A;  3SYC A;  5IYD O;  1KQS U;  3ML0 A;  4R7C A;  4WFA V;  1VQ5 V;  2OTL V;  3CPW U;  1ROP A;  1E79 G;  1AI5 A;  1SER A;  3ETD A;  4R8C A;  3LNM B;  3DTU B;  3T4D A;  1YJW V;  1QVG U;  5B1B B;  1F51 A;  1AI7 A;  2JIZ G;  4MVR A;  1WLE A;  3MHH C;  1V55 B;  4QPK A;  2ZXW C;  4XDK A;  3ZN1 A;  3OUS A;  3QO8 A;  3ABU A;  1M56 B;  2Q67 A;  1V55 C;  4MVM A;  1KKD A;  4GT1 A;  5LGT A;  5E1A C;  4HAM A;  3CCR V;  1COW G;  1EBO A;  2A9H A;  2EIN B;  4RO2 A;  1M56 C;  2ZR3 A;  2PI5 A;  3AG4 B;  1R3L C;  1F4M A;  2LP7 A;  1JVM A;  2IJH A;  3OEE G;  4PA9 A;  4PDM A;  1PNM A;  1VQK V;  2HVJ C;  4J9Z B;  1KD1 W;  2D3O W;  5EC1 C;  2IJI A;  2WLI B;  3AG4 C;  4GX0 A;  2HR3 A;  1XL6 A;  3K9A A;  4WFB V;  5H6Q A;  1NR1 A;  2ZDI A;  4UV8 A;  2GHY A;  3K0G A;  2IW5 A;  5CBH A;  3K06 A;  2B5U A;  2W6J G;  1L1F A;  1VQO V;  4BAY A;  3B8M A;  4MW3 A;  1VQN V;  1K5Q A;  2X0L A;  4PA4 A;  3EFF K;  4PDV A;  3OMN B;  1SRY A;  1OCR B;  2QA4 V;  2LFR A;  1ZWI C;  2WLJ A;  3AG2 B;  3F5W C;  3CCE V;  3CC4 V;  1OCR C;  4MVZ A;  3SPI A;  1Q86 W;  1M9N A;  4WFH A;  2P67 A;  3AG2 C;  2WLH A;  1YTF D;  2WSS G;  3W7S A;  3CC7 V;  3B8N A;  5LHI A;  4R50 A;  1K33 A;  3FB8 C;  3SYQ A;  2EBO A;  3I55 V;  3ABM B;  3K3W A;  3CCV V;  2H8P C;  3CCM V;  5L3F A;  1QR8 A;  4GX2 A;  3E89 A;  4UV9 A;  4OXS A;  3UKM A;  2IH3 C;  3E35 A;  1EFR G;  1E1R G;  1MOF A;  2UXX A;  1F4N A;  1QLE B;  5LBQ A;  4LBE C;  2QKS A;  2HJF C;  5EC2 C;  4P2Z A;  3F7V C;  2IU0 A;  3LDC A;  1GMG A;  5IDJ A;  2AHY A;  1AJQ A;  4JTD B;  3E8G A;  1PNL A;  4MTF A;  1K7D A;  2ITC C;  3LDE A;  4R6Z A;  4U7N A;  1S0V A;  1TUE B;  5DN6 G;  3ZRW B;  1AJN A;  5GW7 A;  1SET A;  1DLB A;  1PKX A;  4BW5 A;  4JTA B;  1OCO B;  4XDL A;  3OM3 B;  1NBM G;  1PD3 A;  3G6E V;  1G8M A;  4YXW G;  4BIZ A;  4KP4 A;  1FXH A;  4MS2 A;  1VQ7 V;  1R6K A;  2Z3Y A;  2XND G;  4LC1 A;  1Y66 A;  1S3J A;  3ZIA G;  3ZMZ A;  2X6B A;  1VQM V;  4CZZ A;  2QM8 A;  3LSS A;  2YEV B;  1JX9 A;  3CMA V;  4MVQ A;  4QE7 A;  3OEH G;  2P90 A;  2NLJ C;  3ETE A;  1FXK A;  1SES A;  3OE7 G;  4WFF A;  3OMA B;  2JK5 C;  5IYC O;  4QIW F;  2DYS B;  4KUM A;  3AEI A;  1QLN A;  4WCE V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...