1BHAA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
molecule tags Photoreceptor
molecule keywords BACTERIORHODOPSIN
total genus 23
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhaA00
1BHAA 1BHBA
chains in the Genus database with same CATH superfamily
2ZKOA 3ZCCA 4QE9A 1EN4A 2QDOA 3K03A 2V1DA 3OR7C 2UU9B 4RQEA 4JF3A 1HR0B 5GONB 1RSOA 4DV5O 3BVOA 1S5HC 2JVDA 4CH5A 1HNWO 2VQFB 3BCCH 4N23A 2QWQB 3CMEV 4J9ZB 1L0LH 4JYAO 4I0XA 2GUZA 3JD0A 3K5MA 5HFMA 5EYPA 1MA1A 3BRCA 1AR1B 1ZTEA 2UXCB 4JGSA 5B1OA 4JPRA 4DR3O 1KECA 3P3NA 4TV8A 4GX1A 3SYOA 3CPWU 5LMNO 5FNVB 3CCSV 3ZEDA 4F6RB 1KB9F 3T1CA 1I94B 2IU0A 3LDEA 4IT5A 1KKDA 2WA3A 1JJ2U 5LYJB 3ETDA 2Q73A 1Q81W 1N0JA 3K9AA 4FPPA 4UCOA 1RFYA 1SA0A 1B04A 2R9RB 3JAWA 2EILB 3M99B 3STZC 4TOIA 3B2EE 4L87A 4EEQA 1W2BU 4YJ3B 4X1YB 3SPCA 4QPKA 4D6TH 4LWSA 1P7GA 3W7WA 4DR1O 4TSFG 5L3GA 1K3EA 4TV9B 4DR5B 5KHHA 3RYFB 5J2UA 1GH6A 3IAYA 1ZLZA 3QO5A 4GKJB 1CEZA 4K0KO 3ETGA 4JAAA 5AG2A 2LGWA 3OMNB 3AG7A 3SYPA 4FFBB 4I55B 2M7WA 3THOA 2BTOA 2QTOA 2Y69B 3E8HA 3G67A 4MTFA 3OUSA 4R50A 2YUAA 5LGTA 4GKKB 2EX3A 4QJFB 1EFRG 4ZHQA 5LMUO 3H1HH 2Q7GA 4D7TA 5CA1A 3C3SA 2OCCC 3G6BA 4A5UB 3NR7A 1XUQA 3ZRXA 2IH1C 4MTXA 5LP6B 1JA8A 2YIBA 4MW8A 1FAFA 2OYQA 3D36C 5KMGA 3M7MX 1YZBA 2P22C 1YEWA 4YXWG 2IJKA 3ZRWA 4NXNO 5BXZA 3T2MA 4WFGA 3DXRB 2DQ0A 3S3XA 2AW9A 3JATA 4DR1B 2A79B 1W0KG 5BR8B 2VWJA 2WWWA 1SQBH 4ZOLB 5EBLC 1MABG 4MTOA 1VQ7V 2KB1A 1YSCA 3UQ8A 5BMVA 4KHPO 2HHHO 1R6TA 3EFFK 1SERA 5IYCO 2UXCO 4DV4O 4XDKA 1K7DA 2XAFA 4GLXA 1GO3F 1BCCH 3TXQA 4FLXA 1N33O 3CRCA 2VWKA 3IJ4A 4UV9A 2WLIA 1G8MA 2V7QG 3E8GA 4JI5O 4J41A 2H8PC 4EFBA 1SZTA 3SJQC 1TAEA 4LF4O 4DUYO 1GN4A 2CTWA 1CXZB 2CUGA 3OMIB 1BMFG 1Q90D 2QM7A 2X0LA 4NXNB 2QWRB 3MHSC 5L3CA 1F4NA 3I55V 2M6YA 1EN5A 5C93A 3ZIAG 1D5AA 2Z3YA 2VS0A 2F23A 5LGNA 2QM8A 1BQZA 1ZL8B 1NH2D 4DR5O 4W4KA 5KX5A 4X64O 2HFEC 4AHCA 1Q6HA 4OX9O 2CGOA 2XAHA 2W6JG 1Y67A 4TT3G 3CJHB 5JJJB 1NTMH 2B1IA 1EBOA 4DV4B 3CCUV 1K33A 3VQVA 1IBKB 4EB6A 4OXSA 1FFXB 2VRZA 3RN4A 4RUEA 5JJEB 1PNMA 4R6ZA 1XOUA 2ZXWB 5IYBO 1M5IA 4U3JB 1FPOA 2CH7B 1GM7A 4CH4A 2P6JA 3FAVA 5LXTB 3UT5A 5JWPA 4GCZA 3A0RA 3ZX6A 2K1EA 3K08A 4DRXA 1JVMA 3JCZA 3RFRA 3K06A 2EZOA 1BL8A 2YSUB 1R3JC 1NI8A 5IJ9A 1IXBA 5BR8O 2DYRB 2LJ2A 2QKAA 3GWOA 3OD4A 1YHQV 3QTCA 5B3SC 1YTFD 3AK3A 4PA6A 3L72H 3ABLB 1IVSA 5B1BB 4FLTA 2R70A 2N04A 1OCOB 3AEIA 4DR7B 1MMMA 1HR0O 1H2KA 1VF7A 1AR5A 3N2GB 1DK1A 1I5XA 4UXNA 1H2MA 5DECA 3BAAA 4MVUA 4DV1O 1OCZC 3X2QB 5CA3A 1WPBA 2Q67A 2DJVA 3KZIZ 2Q7EA 4LBEC 1JCHA 1XHZA 4I50B 3K5NA 4PELA 3CRRA 3ASOC 5IYZA 1TUEB 1IURA 4KL1A 4PA9A 3SYAA 1E79G 4LH7A 2QWOB 1I0HA 2DYSB 4RO2A 2ADPA 3G80A 4JTDB 4DR3B 2E5LB 1WAZA 4B7EA 4DV7O 1VF6C 1FKAO 1S0VA 4DUZB 4BIOA 1EZJA 2BE3A 3OTFA 1FD9A 3FX7A 1VQ9V 2O57A 2OT5A 2P4KA 4FLWA 1RM1C 1YITV 4DR7O 1L1FA 2YS8A 4FFKA 2BTQB 1OHHG 3ZRVA 4DR6B 1BHAA 1M57C 4X62O 3P32A 1M57B 1YI2V 1QHTA 3T4DA 3OW2U 2UUCO 4MVOA 2A0LA 4TUYB 3ZJZA 4JI0B 1YJWV 5GTHZ 2ITDC 5LL6Y 5CA0B 1XL6A 3RYCB 3E22A 4JI3B 3A8TA 4X9QA 1MOFA 3ZHQA 2ZR2A 5KHGA 1VQ5V 4BWAA 2P67A 1TVKB 4NTYA 2DN9A 4IHJB 3JARA 4Z1VA 4ZBMA 4FLUA 3E86A 4B7KA 3P30A 2R72A 5KAFZ 2E76B 1NR7A 3H1IH 3K5OA 2NLJC 2B5UA 3F7VC 4ZI7B 3DTUB 2HVJC 3WB1A 1R1BA 5CB4A 4KUMA 2EINC 4UB8Z 2HR3A 4G27B 3ZHSA 3AG4C 2XASA 3IGAC 1JJOA 1Q6IA 1SESA 2EIJC 3CCLV 2JGDA 4JI3O 3SPGA 4JZGA 2ZT9B 3PN1A 4KHPB 2FYUH 3LSSA 5J9PC 2YIBD 3HKEB 5B1AB 4C7UA 2HHHB 3LDCA 2LW1A 4R8CA 1E1QG 3A0BZ 2QJ1A 4DR2B 3K0GA 3T4ZA 1GK9A 4YJ2B 1AI7A 1XNQB 1XMOO 1VQMV 2GUZB 2ZIMA 3T1YO 3WG7C 2KG7B 3OAAG 3RBZA 2WAMA 1GAXA 4IL6Z 4JAUA 3ZMSA 5H9CA 4OPAA 3M8AA 5EYPB 2UUBO 4P30A 4EFEA 4F4LA 4X65O 2F43G 3ZMUA 2UXXA 2NR5A 4RQFA 2ZE6A 1THZA 5LYJA 3B40A 2RQ6A 2YC0A 4UCUA 3ZHRA 1KC8W 4KP4A 3F5WC 4HNAB 4B3RB 1WB7A 2CDYA 3SYQA 4I7ZB 1BQ0A 5F2VO 3LNNA 2Q0AA 2Q69A 3E83A 3B77A 2BCCH 3RYHB 1P49A 1US6A 4LWSB 2LGQA 4RWUA 3HKBA 5E1AC 1FYJA 2DW4A 2EIKC 4JI4O 1Q3EA 3PJSK 4TV9A 1XMOB 1LUVA 3K3WA 1YCIA 4MT8A 3RYFA 3OEHG 1N33B 4PDMA 2GDSA 4LFBB 4JI5B 2P7TC 5BY1A 1DGSA 5B3SB 4DV6O 2JJ1G 4CC5A 3ABLC 2LP7A 4DYLA 1NJIW 2UUBB 4MVSA 3OT7A 1TGOA 4OPHA 1OCOC 1SKVA 3GB7C 4DW1A 1H2NA 4DK1A 2Y0PA 4NTXA 4JAVA 5B66Z 4U7NA 3ABKC 1JOYA 5A9GA 2DQ3A 1OCZB 3X2QC 5EZYB 3K79A 2P5OA 1VIBA 1M90W 4CZZA 3E35A 1M9NA 3I56V 3T1HO 2XTAA 2BSKB 2KQXA 4ICGA 5CBGA 5KA5A 3JATB 2JK5C 2X6CA 4H13B 1QNMA 1IBKO 4EKWA 3FFQA 4H37A 3B09A 2WLNA 3RYIB 4LFAO 2ZIOA 3DC6A 4DV1B 1VQNV 1WN7A 1AJNA 3Q4HB 1WA8B 3CRMA 1U96A 4QE7A 3J81N 5LA6B 3LSQA 1K73W 2EIMC 1KYOF 1XQ8A 4TWKA 1VQLV 2XHBA 4JASA 4UVCA 5H2FZ 2K9PA 2DMXA 1OCRC 4BIZA 2E5LO 3W7SA 1OCRB 4B3MB 1KP2A 3JALB 3TETA 3LDDA 2PYJA 1SQPH 1HNXB 1AP5A 2UUAB 2KKWA 2XAQA 1Y74B 5C8YB 1BT8A 4DV0B 3APQA 2RDCA 2VQEB 1F51A 3U11A 1RP3B 4GYCB 2ARHA 3KCXA 3N2KA 1N8RW 4NXMO 2QGNA 4FM2A 4O4HB 1KBHA 1YIJV 5KX5B 3JYCA 1V9PA 4JTCB 4GKKO 1LUWA 1QLEC 3ZS8C 3AG3B 4WF9V 5B5EZ 2L35A 4I4TB 5TISZ 4PA7A 3CJHA 1UJWB 3HKCB 4O4JB 2JIZG 4RUFA 4U7OA 1EZVH 4IIJB 3NXSA 4O2BA 2AZ2A 2UXDB 4X20B 4DUYB 1VF6A 3IC7A 3BY6A 1NKDA 2YI9A 1V54C 3ZN0A 1S77D 1M1KW 4YY3B 3W7TA 2ZINA 2ZM6B 2ZDIC 2WSSG 2JDIG 4LFCB 2H94A 2Q0OC 5GTIZ 4X88A 1YDXA 2QTSA 3BA8A 4DXWA 4IYHA 4AI8A 4CH3A 3CCJV 4B3SB 2OWOA 1PM9A 1DTOA 3P3PA 4GZRB 2LW7A 4DUZO 3WU2Z 5LXTA 4CS3A 3UT5B 5L3EA 1AJQA 1DF5A 1R6KA 3OMAB 3E8FA 4K8ZA 4JI1B 4UFZA 4LF5O 1I7FA 1NT2B 2Q68A 5IJ9B 3OR6C 2Q4PA 1WP8A 4DR6O 1GMGA 1WPXA 3KCYA 4X62B 1F23A 3CX5F 1M93A 1R3KC 4JV5B 4JYCA 4FMTA 1YXBA 4X1IB 2WLLB 2BOCC 4JI0O 3HB3B 3F5TA 4PV1B 4PJ0Z 1CP9A 4OGQB 5H6RA 2OCHA 3K0DA 3N2GA 2FB5A 2JS5A 4UB6Z 1WJZA 1GN6A 1JR9A 1AP6A 4LF7O 4O4LA 3UO3A 3A2FA 2E74B 5LOVB 3CRQA 4FIPC 5EIBD 1IBLO 1AI4A 1Y66A 3L74H 4I9QA 4O2AA 1W0JG 2OIGA 4H33A 3ZBHA 1K34A 4JI7O 3JASB 1ORQC 1U97A 5B1NA 1Y6XA 4LF5B 1NTZH 4D7SA 3J7AU 5J2TB 2Q6AA 1JPXA 5IDJA 3H1KH 2QR4A 5JH7A 5CN0A 3W7UA 3JAKB 3CC2V 1TUBB 4UUJC 4FLYA 1KMIZ 3HKDA 5CBHA 1YTFB 5KHIA 4JYAB 1SETA 1MZFA 3CCVV 3RVZA 4HBNA 3CCRV 4QNHB 1AJPA 3MAQA 3ZMTA 2AXTZ 1YJ9V 3CCMV 2EILC 3L73H 4LF8O 5BZBA 4X1KB 3SYCA 4BW5A 3CCEV 2JGUA 4LF7B 2X6BA 2ILMA 4B3SO 5CA0A 4PI0A 1VQ4V 2HJFC 4X66O 3E22B 1VF5B 3D3IA 1HNZO 2QEXV 1VEWA 1QLNA 4O4IB 2ZNJA 1RSOB 3JD2A 1M56B 1GM9A 5IJ0B 4WCEV 1BHBA 3BEHA 3EVKA 3ICXA 3JARB 4JI6B 1DF4A 1FXHA 1OZ0A 1Q43A 2D2CB 4N21A 1SQGA 2PZSA 2IJJA 5ITZA 2QKCA 2LFSA 1K9MW 1WLEA 4DK0A 4PD4F 3AG1B 5LHIA 2UUCB 4FLZA 5JQGB 3D3QA 3SDLA 2JJ2G 3E8BA 4WFEA 5FNVA 4K3AA 4AQYB 4F6RA 2A06H 1AROP 3FKSG 4JI2B 5IT9N 2PYLA 5GW7A 5B1AC 1BGYH 2Y69C 3L9DA 2IBZH 3DSQA 2AHYA 1QR9A 1SA0B 4UVAA 1D5NA 4I0XB 1KU9A 3FB5C 1PNLA 4FK5C 4JI7B 1V55C 2YICA 3EHBB 5EC1C 5LP6C 2EJRA 4X1YA 4NKGB 1IX9A 4HZ3A 3WB2A 4YJ2A 4DV2O 2X7RB 4KFMA 1S5LZ 1PV0A 4JI8B 4MSWC 4R7CA 4I9WA 2P90A 1K5QA 3CRAA 4GX2A 1IXMA 2WLMA 1VQKV 2ZNIA 2IU3A 4FFBA 4TQFA 1BSMA 1Z5VA 1QVGU 4WBNB 5FLXN 4G2KA 4AQYO 2N74A 4OX9B 2EZPA 2A3QA 2X6AA 3R65A 2WPDG 1Y76A 2VQEO 4J11A 5CA1B 5LHHA 5LP6A 3G71V 1J95A 2IM9A 2XUMA 5KAIZ 1AVMA 2HLDG 5EBMC 3E2EA 5LMNB 1GKFA 1O9GA 1S3JA 4BW9A 4ASUG 5KMGB 1I94O 4J7ZA 4WFHA 1PD3A 2EJ7A 3VQXA 4LF9B 3KKYA 3DXRA 4DR4O 3SPHA 3HKBB 2GSMB 3BHPA 1G6UA 2QWNB 4FJCC 4HAMA 3RT3C 2IJHA 1K97A 2Q7HA 5KUKA 5JVDA 1H8HG 3H01A 1IZ3A 4Z1MG 3CC4V 1SRYA 1JFFB 2G38A 5BMVB 1QR8A 2ODMA 4NTWA 1HNWB 5HFLA 4BR6A 2XAGA 3ABKB 2W0FC 1XI1A 1W59A 2RN9A 2YXHA 1JMKC 3D8CA 4Q20A 1QCEA 2CE4A 1ZSPA 1JX9A 1X4TA 4K0KB 2WLIB 5H5NA 1GN3A 4ZKIA 3VQYA 2YDEA 2DYSC 3ETEA 4MVZA 5FL7G 1UFIA 5EZYA 2WLJA 2PI5A 2ZE7A 2FTKA 3L75H 2BSKA 1XREA 1SQXH 1B6QA 1GN2A 3H9VA 2GTAA 1BS3A 2UXDO 3ZRSA 1URFA 4NVPA 4UCVA 2NN4A 4MS2A 4JI8O 3CYOA 3GVMA 2PI4A 2A7WA 4K8XA 2FKXA 1UPGA 2HP8A 5LA6A 3JD1A 4QIWF 2D3OW 4Z2WA 2HG5C 4EB6B 1S5JA 1G4YB 3H1JH 2DOSA 5B1BC 1LR1A 1VMGA 3ASOB 1N34B 3JSNA 1KQSU 2ITCC 5IY5C 3ABTA 1B3QA 1AI5A 4U3JA 1N32B 4UV8A 4PDRA 4FVMA 4CS2A 3JSLA 3U10A 4LFAB 3AG3C 5E79Z 1QVFU 4MTGA 3OGCC 3VOUA 3N2KB 4DV3B 4DV6B 1M56C 1FXKB 3JD3A 3ABMB 4PHZA 3ABMC 1RM1B 3B4SA 1H2SB 3WFVA 2YI8A 1E1RG 1FFTB 3HPLC 3K57A 2JS3A 1VQ8V 4O4JA 4GT1A 1PKXA 2AGAA 4O2BB 5LHGA 4X20A 2CTQA 3AG4B 2CH7A 3AG1C 4X66B 2JEXA 1AILA 1XNRO 2LO1A 2QWPB 1HNXO 1HP8A 2DWDC 4J10A 2GHYA 2ZCEA 3BA9A 4DV0O 1FJGB 4ZIBA 4B3TO 4DRXB 1Q5OA 4HYOA 2BOBC 2HVKC 4AILC 2EIMB 3W7XA 2YEVA 2P06A 2WA4A 4PDLA 1ZUQA 5KHKA 1IBMO 1Y4MA 2KSDA 3K04A 3MHHC 3TXSA 3OFNG 5IYZB 1NVPD 1NH2B 3VBBA 3UO2A 1F4MA 2IJIA 3SR2C 3LUTB 2CK3G 2WLHA 4H44B 3JCUZ 1K92A 2UXNA 4UCSA 2UXBO 3K9SA 1MSDA 1R3LC 2P4VA 3LSUA 5DN6G 4GUNA 1NZ6A 1NVPB 1I08A 4YIOA 2E3CA 4JI2O 1PP9H 1J5EB 4MVQA 2W0XA 1XDCA 4UCTA 1XHXA 1P7BA 4B3MO 3DGEA 1XNRB 4I50A 1AI6A 4LNUB 4X64B 3CMAV 1K4DC 4MVMA 2LQTA 2QM4A 2Q9LA 3SJCC 3QG5A 1S72V 4O4LB 2GBOA 1WNSA 1KKCA 3ML0A 4TUYA 3G4SV 2WLKA 3OUFA 3ZMZA 2Z0AA 2EBOA 3RYCA 3OTOB 3FYIB 2F66C 2ETNA 4DV5B 3MD0A 3K58A 1IDSA 2GV9A 3ZN1A 3FB7C 4LCUC 4E4EA 1EM1A 4BAYA 3IC9A 2JRIA 2Z5UA 2ZR3A 1MG1A 1O9HA 4G28B 2XT9A 2F4VB 1Z5WA 5J2TA 3L71H 3CEIA 4WFAV 4XDJA 5KA6A 4J42A 3AK2A 5JH7B 5EIBC 4LF6B 2QA4V 4JI4B 3RVYA 2YIAA 4PA3A 3QF7A 3DC5A 2HEPA 1GM8A 4P9PA 4JTAB 1KD1W 2YXYA 4NYKA 3RWRD 5GONA 3CC7V 4LF9O 4X1KA 5IWAB 4XDLA 4YHHO 4JI1O 4MW3A 2ZQMA 2MK3A 4DV2B 3I5DA 1AB3A 3O65A 2OTJV 1D2DA 4IGGA 4JZ2A 1IBMB 1K8AW 2JGDB 4O4IA 3ZMVA 4U3FH 2EIKB 3SJBC 3QNEA 2H3OA 4CS4A 1OV9A 4LC1A 1Q82W 1RPOA 1L0NH 4PI2A 2E75B 4TQDA 4YIPA 1VARA 3CSXA 1A32A 1X59A 3TJTA 1PNKA 4TV8B 3KG2A 5CB4B 1HDJA 2RNBA 2KG7A 2Y4TA 1Z2GA 3L70H 1XILA 1MNGA 5KHJA 4LF8B 1J5EO 1COWG 4CBCA 2IW5A 3FD9A 1R3IC 3JAWB 2Q8VA 1H2GA 1FS0G 1WP7A 1HW7A 3LNMB 5IWAO 3JD4A 3HKEA 4YJ3A 1GRJA 3R66A 3APOA 1N36O 5JJNB 4LF4B 3CWBH 4FM0A 3CE2A 4PA4A 5CMUA 3OTOO 2UU9O 5A2QN 5IY5B 1K5SA 1M4UA 1QBZA 2W6IG 5J2UB 1ZWIC 1CPYA 4WFFA 1NS1A 1QLEB 3ASNC 5FPOA 3E89A 2RCVA 4I55A 3ZHTA 1PL4A 3OM3B 3OGIB 4UCRA 3TCUA 3JAMN 3RGBA 4ZHQB 4P9OA 1GTOA 4E2LA 3T1HB 4J7JA 1F7YA 5L3FA 1YVWA 4NXMB 4LF6O 4HNAA 4WBNA 5FPRA 1WB8A 1N32O 5IE9A 3CXCU 3CD6V 3TK1A 4CC6A 4P2ZA 1XMQB 3ZRWB 1VQ6V 1Y76B 3RYHA 2OCCB 4YHHB 3IFXA 4H0LB 2EULA 4J80A 3FYEB 3CS5A 2GTSA 1VQOV 3J80N 3K59A 4ZOLA 4YY3O 2F93B 2XNDG 3N27A 1SQFA 2ZE8A 4X65B 1ENVA 5KLVH 4ABMA 3HR0A 4DO2A 2F1MA 1P4RA 3ABUA 3BABA 3WG7B 3VQWA 1NQTA 1XL4A 3EXAA 5JVDB 2DE0X 2ZXWC 3UKMA 4FM1A 1JFFA 3A0HZ 3RYIA 1V54B 3ZHVA 5LGUA 3BFRA 1N34O 3SPIA 3Q4HA 3CB2A 2N05A 1XNQO 2A9HA 1SQVH 4NB5A 1AR4A 2QE7G 4W4LA 4FZ1A 3BPZA 2F95B 1SQQH 1PL0A 3G6EV 2OIEA 1MSWD 2Y4UA 1Q7YW 1Q6UA 4JYYA 1SS3A 5DEDA 5LBQA 1ZL8A 2OTLV 2ADQB 1QU7A 1Y74A 2Y48A 4LFCO 3C3TA 4J7KA 1MZEA 1WA8A 1VQPV 4FZ0A 1OCCC 4LR3A 3O9OA 1OCCB 3SGIA 2DYRC 2IH3C 4B3RO 2R9IA 1NR1A 1H8EG 1NBMG 3RW0A 5JCOC 4UVBA 4X8AA 1EN6A 2B9ZA 2ZE5A 1FFXA 4GKJO 1PPJH 2HJDA 4MVRA 5KUMA 4IIJA 5L3BA 3JALA 1H38A 1SC5B 2DWEC 3FAVB 2FL4A 2PF4E 3CXHF 1XMQO 5C8YA 2ZDIA 4IYIA 3SJAC 1ZX3A 4JV5O 4DR4B 3D36A 5K1XA 2XOKG 4NR1A 4O4HA 2F4VO 3S3WA 3AG2C 3AG2B 4PDVA 1K4CC 5JCOA 4JYBA 1TA8A 1XEQA 4I4TA 3U0ZA 1R73A 3HKCA 4L8JA 1KP3A 4DW0A 1FXKA 3ETQA 2ATKC 4DV7B 1N4CA 4F6EA 2AHZA 3FB6C 1BZKA 4XBFA 3SPJA 2UUAO 2YXLA 3GWKC 1XBLA 3TGUH 2FMLA 2QSAA 4X1IA 2L6LA 2JEUA 2WLLA 1L8DA 3CHXA 1S76D 1T5EA 1N0NA 3B8MA 1SZXA 2YIDA 4I5SA 4FLVA 4RAIA 3AK1A 2VQFO 5L3DA 4GX0A 1KUQA 1NU1H 3MDSA 3B8NA 2YEVB 1LNQA 4GX5A 1DLBA 1FXKC 5CBFA 3F7YC 3CCQV 1H2LA 4O2AB 2MW2B 5DM6V 2PY5A 5EC2C 2ZM6O 1BE3H 2RMKB 3QO7A 1G1XB 2ZD9A 4KXRA 1I5YA 2PGGA 4BIUA 4DR2O 2NNUA 2PUSA 3ASNB 1FXVA 1RPRA 3K5LA 2QKSA 2CGNA 3T1YB 1HNZB 2BTQA 2C2AA 1Q86W 2EIJB 4QPJA 5K1PA 5H6QA 1NTKH 2XAJA 1N36B 1VP7A 5LOVA 2CTPA 3UM7A 3JAKA 2Q5ZA 3H1LH 3CP1A 4JI6O 2Y0IA 2AZ0A 3HKDB 4LNUA 2EINB 1P84F 3ZHUA 1HWYA 1Q8IA 1ZAUA 1R6NA 5IYDO 3JASA 1JQ0A 2HKOA 2RJZA 1SF9A 4K35A 2PTMA 3QO8A 4CH6A 3UCSC 5D5QA 4DV3O 1TVKA 2UXBB 4QGPA 4IHJA 5EBWC 4LP8A 1OJHA 1B06A 4J9YB 2V4DA 1YJNV 3C90A 3STLC 4WFBV 2LFRA 5D5PA 3WB0A 4B08A 1QQCA 5IJ0A 1TUBA 3OE7G 4ZI7A 1IBLB 2R9AA 1YF2A 5LMUB 1V55B 2B1GA 5ITZB 4LFBO 3OEEG 2CTRA 1FJGO 4Q6GA 4B3TB 4X89A 2CAZC 5EK0A 3FB8C 4LH6A 3QVNA 5JQGA 1ROPA
chains in the Genus database with same CATH topology
2HVJC 2OTJV 1FXHA 3ZCCA 1OZ0A 4QE9A 3OR7C 3K03A 2V1DA 4N21A 2IJJA 4RQEA 4JF3A 1K8AW 3ZMVA 4KUMA 2EINC 2EIKB 2LFSA 1K9MW 1WLEA 1S5HC 3QNEA 2HR3A 4G27B 3AG4C 3AG1B 5LHIA 4N23A 2XASA 4LC1A 1Q82W 1RPOA 3CMEV 3IGAC 4J9ZB 1SESA 2JJ2G 2EIJC 3E8BA 1PNKA 3KG2A 3CCLV 4WFEA 3SPGA 1AROP 3FKSG 3JD0A 3LSSA 5J9PC 5B1AB 3LDCA 1COWG 5GW7A 5B1AC 5HFMA 4R8CA 1E1QG 1AR1B 2Y69C 4JGSA 4JPRA 5B1OA 4CBCA 2IW5A 3K0GA 1GK9A 3T4ZA 1KECA 3SYOA 3CPWU 4GX1A 1AI7A 1R3IC 1QR9A 2AHYA 4UVAA 3CCSV 1VQMV 3T1CA 1H2GA 3WG7C 3FB5C 1FS0G 3LDEA 3OAAG 2IU0A 3RBZA 1KKDA 1PNLA 2WAMA 4JAUA 4FK5C 1V55C 3LNMB 3JD4A 3ZMSA 1JJ2U 5H9CA 3ETDA 3EHBB 5EC1C 2EJRA 1Q81W 4HZ3A 3K9AA 4FPPA 2X7RB 4PA4A 2R9RB 4KFMA 2EILB 3M99B 5CMUA 4P30A 3STZC 5IY5B 4F4LA 1K5SA 2F43G 1QBZA 2W6IG 4MSWC 3ZMUA 1ZWIC 2UXXA 4I9WA 4R7CA 4RQFA 2P90A 1K5QA 1CPYA 4L87A 1W2BU 4GX2A 1IXMA 1THZA 2WLMA 4WFFA 1VQKV 3SPCA 4QPKA 1QLEB 3ASNC 2IU3A 1KC8W 3E89A 4KP4A 3W7WA 3F5WC 1QVGU 4TSFG 3SYQA 5L3GA 3OM3B 1K3EA 3TCUA 4G2KA 2Q69A 3QO5A 2EZPA 1CEZA 2X6AA 3R65A 1GTOA 4P9OA 3E83A 2WPDG 4E2LA 3B77A 3ETGA 5LHHA 3OMNB 3SYPA 5L3FA 5E1AC 2M7WA 3G71V 1J95A 2DW4A 2QTOA 2Y69B 2EIKC 3E8HA 2HLDG 5EBMC 3PJSK 3E2EA 4MTFA 1GKFA 3CXCU 3K3WA 3CD6V 4MT8A 3OUSA 3OEHG 4R50A 5LGTA 1S3JA 4PDMA 3TK1A 4ASUG 4QJFB 1EFRG 4P2ZA 4WFHA 3ZRWB 1PD3A 1VQ6V 2OCCB 2P7TC 2OCCC 3SPHA 3IFXA 3ZRXA 2IH1C 4MTXA 5B3SB 2GSMB 2JJ1G 3ABLC 2LP7A 1NJIW 4FJCC 4HAMA 3FYEB 4MW8A 4MVSA 1VQOV 2IJHA 1K97A 5KUKA 1H8HG 2XNDG 3H01A 4YXWG 1OCOC 2IJKA 3GB7C 3ZRWA 1ENVA 4Z1MG 3CC4V 3T2MA 1SRYA 4WFGA 4JAVA 1QR8A 4U7NA 4DO2A 5HFLA 2DQ0A 1P4RA 3ABUA 3WG7B 3ABKC 2XAGA 1JOYA 3ABKB 2W0FC 2A79B 1W0KG 2DQ3A 2WWWA 1NQTA 1XL4A 1OCZB 5EBLC 3X2QC 4Q20A 1MABG 2ZXWC 1QCEA 3K79A 4MTOA 3UKMA 1VQ7V 2KB1A 1YSCA 1M90W 1JX9A 1V54B 2WLIB 4CZZA 3E35A 1M9NA 3I56V 5CBGA 5LGUA 4ZKIA 3SPIA 3EFFK 5KA5A 1SERA 5IYCO 2JK5C 2DYSC 4XDKA 2X6CA 3ETEA 1K7DA 2XAFA 4MVZA 5FL7G 1GO3F 2A9HA 2WLJA 4EKWA 2PI5A 4H37A 2FTKA 2WLNA 2QE7G 4UV9A 3E8GA 1G8MA 2V7QG 2WLIA 1VQNV 1AJNA 2H8PC 1B6QA 1PL0A 1SZTA 3SJQC 3ZRSA 3G6EV 4QE7A 1MSWD 1Q7YW 3LSQA 1K73W 3OMIB 2EIMC 1BMFG 4MS2A 5LBQA 2QM7A 2X0LA 2OTLV 3MHSC 4TWKA 1VQLV 3CYOA 2Y48A 2PI4A 4JASA 5L3CA 4UVCA 1F4NA 3I55V 1VQPV 1OCRC 4BIZA 1OCCC 1OCRB 3W7SA 5C93A 3ZIAG 1OCCB 1KP2A 2DYRC 2Z3YA 2IH3C 2R9IA 3TETA 1NR1A 3JD1A 3LDDA 1H8EG 1NBMG 5LGNA 2QM8A 4QIWF 3RW0A 1NH2D 4UVBA 4X8AA 2HFEC 2D3OW 2XAQA 2HG5C 1G4YB 5B1BC 2XAHA 2W6JG 1F51A 3ASOB 4TT3G 4MVRA 1KQSU 5KUMA 2B1IA 1N8RW 1EBOA 2ITCC 5IY5C 5L3BA 3ABTA 3CCUV 1K33A 1H38A 1AI5A 2DWEC 4UV8A 4PDRA 1YIJV 3JYCA 4JTCB 4OXSA 1QLEC 2ZDIA 3AG3B 4WF9V 4RUEA 3AG3C 1QVFU 4MTGA 1PNMA 4PA7A 1UJWB 3OGCC 4R6ZA 2JIZG 4RUFA 3D36A 3VOUA 4U7OA 3NXSA 1M56C 1FXKB 2ZXWB 5IYBO 3JD3A 2XOKG 3IC7A 3BY6A 1NKDA 3ABMB 1GM7A 3ABMC 1RM1B 1V54C 3AG2C 2P6JA 3ZN0A 1S77D 1M1KW 3AG2B 4PDVA 3WFVA 1E1RG 3W7TA 1K4CC 4GCZA 3A0RA 1FFTB 3HPLC 2ZDIC 2WSSG 4JYBA 2JDIG 2H94A 4X88A 1R73A 2K1EA 1VQ8V 1KP3A 3K08A 4GT1A 1JVMA 1PKXA 4DXWA 3JCZA 1FXKA 5LHGA 3CCJV 2ATKC 3K06A 2EZOA 3AG4B 1BL8A 3AG1C 2YSUB 1DTOA 1R3JC 2JEXA 2AHZA 3FB6C 2DYRB 4XBFA 3SPJA 3GWOA 2DWDC 5L3EA 1AJQA 1YHQV 2GHYA 5B3SC 1YTFD 1DF5A 1R6KA 3OMAB 4PA6A 3ABLB 3E8FA 5B1BB 4HYOA 2BOBC 2HVKC 2EIMB 3W7XA 2JEUA 2WLLA 2YEVA 2Q68A 1OCOB 1S76D 3AEIA 3OR6C 4PDLA 1Y4MA 3K04A 3MHHC 3B8MA 3OFNG 1GMGA 1WPXA 1NVPD 1NH2B 4I5SA 3VBBA 1F4MA 4RAIA 1I5XA 1F23A 4UXNA 5L3DA 4GX0A 2IJIA 1R3KC 3LUTB 2CK3G 2WLHA 4JYCA 4FMTA 4MVUA 1K92A 3B8NA 1OCZC 2UXNA 2WLLB 2YEVB 3X2QB 1LNQA 2BOCC 2Q67A 4GX5A 5CA3A 3HB3B 1R3LC 1DLBA 1FXKC 4LBEC 1JCHA 5CBFA 1CP9A 5DN6G 3F7YC 3CCQV 4PELA 3ASOC 5H6RA 5DM6V 5EC2C 1TUEB 1NVPB 3K0DA 4PA9A 3SYAA 1E79G 2DYSB 4RO2A 3QO7A 4MVQA 2ZD9A 1I5YA 4JTDB 4BIUA 1P7BA 4FIPC 2NNUA 3DGEA 1AI4A 3ASNB 1S0VA 1Y66A 1FXVA 1EZJA 1RPRA 1W0JG 1AI6A 2QKSA 2C2AA 4H33A 1Q86W 1K34A 3CMAV 1K4DC 1VQ9V 2EIJB 4MVMA 4QPJA 1ORQC 2OT5A 5B1NA 5H6QA 2XAJA 1S72V 1RM1C 3ML0A 3G4SV 3UM7A 2WLKA 3OUFA 3ZMZA 3CP1A 1YITV 2EBOA 1L1FA 2EINB 1OHHG 1HWYA 3ZRVA 3FYIB 2Q6AA 1R6NA 1BHAA 5IYDO 3MD0A 1M57C 1JQ0A 2HKOA 3P32A 1M57B 3ZN1A 1JPXA 3FB7C 5IDJA 1YI2V 3T4DA 3OW2U 3QO8A 4MVOA 2A0LA 4LCUC 3ZJZA 5CN0A 3W7UA 3CC2V 1YJWV 4BAYA 2ITDC 2Z5UA 2ZR3A 1XL6A 4LP8A 4UUJC 5EBWC 1MG1A 4G28B 4J9YB 5CBHA 1YTFB 1YJNV 1SETA 3CCVV 1MOFA 3RVZA 3STLC 3CCRV 4QNHB 4WFBV 1AJPA 4WFAV 3ZMTA 1YJ9V 4XDJA 5KA6A 3CCMV 2EILC 2LFRA 5BZBA 2ZR2A 3SYCA 1VQ5V 4BW5A 2P67A 3CCEV 2X6BA 2QA4V 3OE7G 1VQ4V 2HJFC 4ZBMA 3RVYA 4PA3A 3E86A 3D3IA 2QEXV 1GM8A 4P9PA 4JTAB 1KD1W 1QLNA 3P30A 1V55B 2B1GA 3CC7V 3JD2A 1M56B 3OEEG 4XDLA 1GM9A 1NR7A 4X89A 4WCEV 1BHBA 3BEHA 2NLJC 2B5UA 5EK0A 4MW3A 2ZQMA 3FB8C 3F7VC 2MK3A 3DTUB 1ROPA 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHA A;  1BHB A; 
#chains in the Genus database with same CATH topology
 2ZKO A;  3ZCC A;  4QE9 A;  1EN4 A;  2QDO A;  3K03 A;  2V1D A;  3OR7 C;  2UU9 B;  4RQE A;  4JF3 A;  1HR0 B;  5GON B;  1RSO A;  4DV5 O;  3BVO A;  1S5H C;  2JVD A;  4CH5 A;  1HNW O;  2VQF B;  3BCC H;  4N23 A;  2QWQ B;  3CME V;  4J9Z B;  1L0L H;  4JYA O;  4I0X A;  2GUZ A;  3JD0 A;  3K5M A;  5HFM A;  5EYP A;  1MA1 A;  3BRC A;  1AR1 B;  1ZTE A;  2UXC B;  4JGS A;  5B1O A;  4JPR A;  4DR3 O;  1KEC A;  3P3N A;  4TV8 A;  4GX1 A;  3SYO A;  3CPW U;  5LMN O;  5FNV B;  3CCS V;  3ZED A;  4F6R B;  1KB9 F;  3T1C A;  1I94 B;  2IU0 A;  3LDE A;  4IT5 A;  1KKD A;  2WA3 A;  1JJ2 U;  5LYJ B;  3ETD A;  2Q73 A;  1Q81 W;  1N0J A;  3K9A A;  4FPP A;  4UCO A;  1RFY A;  1SA0 A;  1B04 A;  2R9R B;  3JAW A;  2EIL B;  3M99 B;  3STZ C;  4TOI A;  3B2E E;  4L87 A;  4EEQ A;  1W2B U;  4YJ3 B;  4X1Y B;  3SPC A;  4QPK A;  4D6T H;  4LWS A;  1P7G A;  3W7W A;  4DR1 O;  4TSF G;  5L3G A;  1K3E A;  4TV9 B;  4DR5 B;  5KHH A;  3RYF B;  5J2U A;  1GH6 A;  3IAY A;  1ZLZ A;  3QO5 A;  4GKJ B;  1CEZ A;  4K0K O;  3ETG A;  4JAA A;  5AG2 A;  2LGW A;  3OMN B;  3AG7 A;  3SYP A;  4FFB B;  4I55 B;  2M7W A;  3THO A;  2BTO A;  2QTO A;  2Y69 B;  3E8H A;  3G67 A;  4MTF A;  3OUS A;  4R50 A;  2YUA A;  5LGT A;  4GKK B;  2EX3 A;  4QJF B;  1EFR G;  4ZHQ A;  5LMU O;  3H1H H;  2Q7G A;  4D7T A;  5CA1 A;  3C3S A;  2OCC C;  3G6B A;  4A5U B;  3NR7 A;  1XUQ A;  3ZRX A;  2IH1 C;  4MTX A;  5LP6 B;  1JA8 A;  2YIB A;  4MW8 A;  1FAF A;  2OYQ A;  3D36 C;  5KMG A;  3M7M X;  1YZB A;  2P22 C;  1YEW A;  4YXW G;  2IJK A;  3ZRW A;  4NXN O;  5BXZ A;  3T2M A;  4WFG A;  3DXR B;  2DQ0 A;  3S3X A;  2AW9 A;  3JAT A;  4DR1 B;  2A79 B;  1W0K G;  5BR8 B;  2VWJ A;  2WWW A;  1SQB H;  4ZOL B;  5EBL C;  1MAB G;  4MTO A;  1VQ7 V;  2KB1 A;  1YSC A;  3UQ8 A;  5BMV A;  4KHP O;  2HHH O;  1R6T A;  3EFF K;  1SER A;  5IYC O;  2UXC O;  4DV4 O;  4XDK A;  1K7D A;  2XAF A;  4GLX A;  1GO3 F;  1BCC H;  3TXQ A;  4FLX A;  1N33 O;  3CRC A;  2VWK A;  3IJ4 A;  4UV9 A;  2WLI A;  1G8M A;  2V7Q G;  3E8G A;  4JI5 O;  4J41 A;  2H8P C;  4EFB A;  1SZT A;  3SJQ C;  1TAE A;  4LF4 O;  4DUY O;  1GN4 A;  2CTW A;  1CXZ B;  2CUG A;  3OMI B;  1BMF G;  1Q90 D;  2QM7 A;  2X0L A;  4NXN B;  2QWR B;  3MHS C;  5L3C A;  1F4N A;  3I55 V;  2M6Y A;  1EN5 A;  5C93 A;  3ZIA G;  1D5A A;  2Z3Y A;  2VS0 A;  2F23 A;  5LGN A;  2QM8 A;  1BQZ A;  1ZL8 B;  1NH2 D;  4DR5 O;  4W4K A;  5KX5 A;  4X64 O;  2HFE C;  4AHC A;  1Q6H A;  4OX9 O;  2CGO A;  2XAH A;  2W6J G;  1Y67 A;  4TT3 G;  3CJH B;  5JJJ B;  1NTM H;  2B1I A;  1EBO A;  4DV4 B;  3CCU V;  1K33 A;  3VQV A;  1IBK B;  4EB6 A;  4OXS A;  1FFX B;  2VRZ A;  3RN4 A;  4RUE A;  5JJE B;  1PNM A;  4R6Z A;  1XOU A;  2ZXW B;  5IYB O;  1M5I A;  4U3J B;  1FPO A;  2CH7 B;  1GM7 A;  4CH4 A;  2P6J A;  3FAV A;  5LXT B;  3UT5 A;  5JWP A;  4GCZ A;  3A0R A;  3ZX6 A;  2K1E A;  3K08 A;  4DRX A;  1JVM A;  3JCZ A;  3RFR A;  3K06 A;  2EZO A;  1BL8 A;  2YSU B;  1R3J C;  1NI8 A;  5IJ9 A;  1IXB A;  5BR8 O;  2DYR B;  2LJ2 A;  2QKA A;  3GWO A;  3OD4 A;  1YHQ V;  3QTC A;  5B3S C;  1YTF D;  3AK3 A;  4PA6 A;  3L72 H;  3ABL B;  1IVS A;  5B1B B;  4FLT A;  2R70 A;  2N04 A;  1OCO B;  3AEI A;  4DR7 B;  1MMM A;  1HR0 O;  1H2K A;  1VF7 A;  1AR5 A;  3N2G B;  1DK1 A;  1I5X A;  4UXN A;  1H2M A;  5DEC A;  3BAA A;  4MVU A;  4DV1 O;  1OCZ C;  3X2Q B;  5CA3 A;  1WPB A;  2Q67 A;  2DJV A;  3KZI Z;  2Q7E A;  4LBE C;  1JCH A;  1XHZ A;  4I50 B;  3K5N A;  4PEL A;  3CRR A;  3ASO C;  5IYZ A;  1TUE B;  1IUR A;  4KL1 A;  4PA9 A;  3SYA A;  1E79 G;  4LH7 A;  2QWO B;  1I0H A;  2DYS B;  4RO2 A;  2ADP A;  3G80 A;  4JTD B;  4DR3 B;  2E5L B;  1WAZ A;  4B7E A;  4DV7 O;  1VF6 C;  1FKA O;  1S0V A;  4DUZ B;  4BIO A;  1EZJ A;  2BE3 A;  3OTF A;  1FD9 A;  3FX7 A;  1VQ9 V;  2O57 A;  2OT5 A;  2P4K A;  4FLW A;  1RM1 C;  1YIT V;  4DR7 O;  1L1F A;  2YS8 A;  4FFK A;  2BTQ B;  1OHH G;  3ZRV A;  4DR6 B;  1BHA A;  1M57 C;  4X62 O;  3P32 A;  1M57 B;  1YI2 V;  1QHT A;  3T4D A;  3OW2 U;  2UUC O;  4MVO A;  2A0L A;  4TUY B;  3ZJZ A;  4JI0 B;  1YJW V;  5GTH Z;  2ITD C;  5LL6 Y;  5CA0 B;  1XL6 A;  3RYC B;  3E22 A;  4JI3 B;  3A8T A;  4X9Q A;  1MOF A;  3ZHQ A;  2ZR2 A;  5KHG A;  1VQ5 V;  4BWA A;  2P67 A;  1TVK B;  4NTY A;  2DN9 A;  4IHJ B;  3JAR A;  4Z1V A;  4ZBM A;  4FLU A;  3E86 A;  4B7K A;  3P30 A;  2R72 A;  5KAF Z;  2E76 B;  1NR7 A;  3H1I H;  3K5O A;  2NLJ C;  2B5U A;  3F7V C;  4ZI7 B;  3DTU B;  2HVJ C;  3WB1 A;  1R1B A;  5CB4 A;  4KUM A;  2EIN C;  4UB8 Z;  2HR3 A;  4G27 B;  3ZHS A;  3AG4 C;  2XAS A;  3IGA C;  1JJO A;  1Q6I A;  1SES A;  2EIJ C;  3CCL V;  2JGD A;  4JI3 O;  3SPG A;  4JZG A;  2ZT9 B;  3PN1 A;  4KHP B;  2FYU H;  3LSS A;  5J9P C;  2YIB D;  3HKE B;  5B1A B;  4C7U A;  2HHH B;  3LDC A;  2LW1 A;  4R8C A;  1E1Q G;  3A0B Z;  2QJ1 A;  4DR2 B;  3K0G A;  3T4Z A;  1GK9 A;  4YJ2 B;  1AI7 A;  1XNQ B;  1XMO O;  1VQM V;  2GUZ B;  2ZIM A;  3T1Y O;  3WG7 C;  2KG7 B;  3OAA G;  3RBZ A;  2WAM A;  1GAX A;  4IL6 Z;  4JAU A;  3ZMS A;  5H9C A;  4OPA A;  3M8A A;  5EYP B;  2UUB O;  4P30 A;  4EFE A;  4F4L A;  4X65 O;  2F43 G;  3ZMU A;  2UXX A;  2NR5 A;  4RQF A;  2ZE6 A;  1THZ A;  5LYJ A;  3B40 A;  2RQ6 A;  2YC0 A;  4UCU A;  3ZHR A;  1KC8 W;  4KP4 A;  3F5W C;  4HNA B;  4B3R B;  1WB7 A;  2CDY A;  3SYQ A;  4I7Z B;  1BQ0 A;  5F2V O;  3LNN A;  2Q0A A;  2Q69 A;  3E83 A;  3B77 A;  2BCC H;  3RYH B;  1P49 A;  1US6 A;  4LWS B;  2LGQ A;  4RWU A;  3HKB A;  5E1A C;  1FYJ A;  2DW4 A;  2EIK C;  4JI4 O;  1Q3E A;  3PJS K;  4TV9 A;  1XMO B;  1LUV A;  3K3W A;  1YCI A;  4MT8 A;  3RYF A;  3OEH G;  1N33 B;  4PDM A;  2GDS A;  4LFB B;  4JI5 B;  2P7T C;  5BY1 A;  1DGS A;  5B3S B;  4DV6 O;  2JJ1 G;  4CC5 A;  3ABL C;  2LP7 A;  4DYL A;  1NJI W;  2UUB B;  4MVS A;  3OT7 A;  1TGO A;  4OPH A;  1OCO C;  1SKV A;  3GB7 C;  4DW1 A;  1H2N A;  4DK1 A;  2Y0P A;  4NTX A;  4JAV A;  5B66 Z;  4U7N A;  3ABK C;  1JOY A;  5A9G A;  2DQ3 A;  1OCZ B;  3X2Q C;  5EZY B;  3K79 A;  2P5O A;  1VIB A;  1M90 W;  4CZZ A;  3E35 A;  1M9N A;  3I56 V;  3T1H O;  2XTA A;  2BSK B;  2KQX A;  4ICG A;  5CBG A;  5KA5 A;  3JAT B;  2JK5 C;  2X6C A;  4H13 B;  1QNM A;  1IBK O;  4EKW A;  3FFQ A;  4H37 A;  3B09 A;  2WLN A;  3RYI B;  4LFA O;  2ZIO A;  3DC6 A;  4DV1 B;  1VQN V;  1WN7 A;  1AJN A;  3Q4H B;  1WA8 B;  3CRM A;  1U96 A;  4QE7 A;  3J81 N;  5LA6 B;  3LSQ A;  1K73 W;  2EIM C;  1KYO F;  1XQ8 A;  4TWK A;  1VQL V;  2XHB A;  4JAS A;  4UVC A;  5H2F Z;  2K9P A;  2DMX A;  1OCR C;  4BIZ A;  2E5L O;  3W7S A;  1OCR B;  4B3M B;  1KP2 A;  3JAL B;  3TET A;  3LDD A;  2PYJ A;  1SQP H;  1HNX B;  1AP5 A;  2UUA B;  2KKW A;  2XAQ A;  1Y74 B;  5C8Y B;  1BT8 A;  4DV0 B;  3APQ A;  2RDC A;  2VQE B;  1F51 A;  3U11 A;  1RP3 B;  4GYC B;  2ARH A;  3KCX A;  3N2K A;  1N8R W;  4NXM O;  2QGN A;  4FM2 A;  4O4H B;  1KBH A;  1YIJ V;  5KX5 B;  3JYC A;  1V9P A;  4JTC B;  4GKK O;  1LUW A;  1QLE C;  3ZS8 C;  3AG3 B;  4WF9 V;  5B5E Z;  2L35 A;  4I4T B;  5TIS Z;  4PA7 A;  3CJH A;  1UJW B;  3HKC B;  4O4J B;  2JIZ G;  4RUF A;  4U7O A;  1EZV H;  4IIJ B;  3NXS A;  4O2B A;  2AZ2 A;  2UXD B;  4X20 B;  4DUY B;  1VF6 A;  3IC7 A;  3BY6 A;  1NKD A;  2YI9 A;  1V54 C;  3ZN0 A;  1S77 D;  1M1K W;  4YY3 B;  3W7T A;  2ZIN A;  2ZM6 B;  2ZDI C;  2WSS G;  2JDI G;  4LFC B;  2H94 A;  2Q0O C;  5GTI Z;  4X88 A;  1YDX A;  2QTS A;  3BA8 A;  4DXW A;  4IYH A;  4AI8 A;  4CH3 A;  3CCJ V;  4B3S B;  2OWO A;  1PM9 A;  1DTO A;  3P3P A;  4GZR B;  2LW7 A;  4DUZ O;  3WU2 Z;  5LXT A;  4CS3 A;  3UT5 B;  5L3E A;  1AJQ A;  1DF5 A;  1R6K A;  3OMA B;  3E8F A;  4K8Z A;  4JI1 B;  4UFZ A;  4LF5 O;  1I7F A;  1NT2 B;  2Q68 A;  5IJ9 B;  3OR6 C;  2Q4P A;  1WP8 A;  4DR6 O;  1GMG A;  1WPX A;  3KCY A;  4X62 B;  1F23 A;  3CX5 F;  1M93 A;  1R3K C;  4JV5 B;  4JYC A;  4FMT A;  1YXB A;  4X1I B;  2WLL B;  2BOC C;  4JI0 O;  3HB3 B;  3F5T A;  4PV1 B;  4PJ0 Z;  1CP9 A;  4OGQ B;  5H6R A;  2OCH A;  3K0D A;  3N2G A;  2FB5 A;  2JS5 A;  4UB6 Z;  1WJZ A;  1GN6 A;  1JR9 A;  1AP6 A;  4LF7 O;  4O4L A;  3UO3 A;  3A2F A;  2E74 B;  5LOV B;  3CRQ A;  4FIP C;  5EIB D;  1IBL O;  1AI4 A;  1Y66 A;  3L74 H;  4I9Q A;  4O2A A;  1W0J G;  2OIG A;  4H33 A;  3ZBH A;  1K34 A;  4JI7 O;  3JAS B;  1ORQ C;  1U97 A;  5B1N A;  1Y6X A;  4LF5 B;  1NTZ H;  4D7S A;  3J7A U;  5J2T B;  2Q6A A;  1JPX A;  5IDJ A;  3H1K H;  2QR4 A;  5JH7 A;  5CN0 A;  3W7U A;  3JAK B;  3CC2 V;  1TUB B;  4UUJ C;  4FLY A;  1KMI Z;  3HKD A;  5CBH A;  1YTF B;  5KHI A;  4JYA B;  1SET A;  1MZF A;  3CCV V;  3RVZ A;  4HBN A;  3CCR V;  4QNH B;  1AJP A;  3MAQ A;  3ZMT A;  2AXT Z;  1YJ9 V;  3CCM V;  2EIL C;  3L73 H;  4LF8 O;  5BZB A;  4X1K B;  3SYC A;  4BW5 A;  3CCE V;  2JGU A;  4LF7 B;  2X6B A;  2ILM A;  4B3S O;  5CA0 A;  4PI0 A;  1VQ4 V;  2HJF C;  4X66 O;  3E22 B;  1VF5 B;  3D3I A;  1HNZ O;  2QEX V;  1VEW A;  1QLN A;  4O4I B;  2ZNJ A;  1RSO B;  3JD2 A;  1M56 B;  1GM9 A;  5IJ0 B;  4WCE V;  1BHB A;  3BEH A;  3EVK A;  3ICX A;  3JAR B;  4JI6 B;  1DF4 A;  1FXH A;  1OZ0 A;  1Q43 A;  2D2C B;  4N21 A;  1SQG A;  2PZS A;  2IJJ A;  5ITZ A;  2QKC A;  2LFS A;  1K9M W;  1WLE A;  4DK0 A;  4PD4 F;  3AG1 B;  5LHI A;  2UUC B;  4FLZ A;  5JQG B;  3D3Q A;  3SDL A;  2JJ2 G;  3E8B A;  4WFE A;  5FNV A;  4K3A A;  4AQY B;  4F6R A;  2A06 H;  1ARO P;  3FKS G;  4JI2 B;  5IT9 N;  2PYL A;  5GW7 A;  5B1A C;  1BGY H;  2Y69 C;  3L9D A;  2IBZ H;  3DSQ A;  2AHY A;  1QR9 A;  1SA0 B;  4UVA A;  1D5N A;  4I0X B;  1KU9 A;  3FB5 C;  1PNL A;  4FK5 C;  4JI7 B;  1V55 C;  2YIC A;  3EHB B;  5EC1 C;  5LP6 C;  2EJR A;  4X1Y A;  4NKG B;  1IX9 A;  4HZ3 A;  3WB2 A;  4YJ2 A;  4DV2 O;  2X7R B;  4KFM A;  1S5L Z;  1PV0 A;  4JI8 B;  4MSW C;  4R7C A;  4I9W A;  2P90 A;  1K5Q A;  3CRA A;  4GX2 A;  1IXM A;  2WLM A;  1VQK V;  2ZNI A;  2IU3 A;  4FFB A;  4TQF A;  1BSM A;  1Z5V A;  1QVG U;  4WBN B;  5FLX N;  4G2K A;  4AQY O;  2N74 A;  4OX9 B;  2EZP A;  2A3Q A;  2X6A A;  3R65 A;  2WPD G;  1Y76 A;  2VQE O;  4J11 A;  5CA1 B;  5LHH A;  5LP6 A;  3G71 V;  1J95 A;  2IM9 A;  2XUM A;  5KAI Z;  1AVM A;  2HLD G;  5EBM C;  3E2E A;  5LMN B;  1GKF A;  1O9G A;  1S3J A;  4BW9 A;  4ASU G;  5KMG B;  1I94 O;  4J7Z A;  4WFH A;  1PD3 A;  2EJ7 A;  3VQX A;  4LF9 B;  3KKY A;  3DXR A;  4DR4 O;  3SPH A;  3HKB B;  2GSM B;  3BHP A;  1G6U A;  2QWN B;  4FJC C;  4HAM A;  3RT3 C;  2IJH A;  1K97 A;  2Q7H A;  5KUK A;  5JVD A;  1H8H G;  3H01 A;  1IZ3 A;  4Z1M G;  3CC4 V;  1SRY A;  1JFF B;  2G38 A;  5BMV B;  1QR8 A;  2ODM A;  4NTW A;  1HNW B;  5HFL A;  4BR6 A;  2XAG A;  3ABK B;  2W0F C;  1XI1 A;  1W59 A;  2RN9 A;  2YXH A;  1JMK C;  3D8C A;  4Q20 A;  1QCE A;  2CE4 A;  1ZSP A;  1JX9 A;  1X4T A;  4K0K B;  2WLI B;  5H5N A;  1GN3 A;  4ZKI A;  3VQY A;  2YDE A;  2DYS C;  3ETE A;  4MVZ A;  5FL7 G;  1UFI A;  5EZY A;  2WLJ A;  2PI5 A;  2ZE7 A;  2FTK A;  3L75 H;  2BSK A;  1XRE A;  1SQX H;  1B6Q A;  1GN2 A;  3H9V A;  2GTA A;  1BS3 A;  2UXD O;  3ZRS A;  1URF A;  4NVP A;  4UCV A;  2NN4 A;  4MS2 A;  4JI8 O;  3CYO A;  3GVM A;  2PI4 A;  2A7W A;  4K8X A;  2FKX A;  1UPG A;  2HP8 A;  5LA6 A;  3JD1 A;  4QIW F;  2D3O W;  4Z2W A;  2HG5 C;  4EB6 B;  1S5J A;  1G4Y B;  3H1J H;  2DOS A;  5B1B C;  1LR1 A;  1VMG A;  3ASO B;  1N34 B;  3JSN A;  1KQS U;  2ITC C;  5IY5 C;  3ABT A;  1B3Q A;  1AI5 A;  4U3J A;  1N32 B;  4UV8 A;  4PDR A;  4FVM A;  4CS2 A;  3JSL A;  3U10 A;  4LFA B;  3AG3 C;  5E79 Z;  1QVF U;  4MTG A;  3OGC C;  3VOU A;  3N2K B;  4DV3 B;  4DV6 B;  1M56 C;  1FXK B;  3JD3 A;  3ABM B;  4PHZ A;  3ABM C;  1RM1 B;  3B4S A;  1H2S B;  3WFV A;  2YI8 A;  1E1R G;  1FFT B;  3HPL C;  3K57 A;  2JS3 A;  1VQ8 V;  4O4J A;  4GT1 A;  1PKX A;  2AGA A;  4O2B B;  5LHG A;  4X20 A;  2CTQ A;  3AG4 B;  2CH7 A;  3AG1 C;  4X66 B;  2JEX A;  1AIL A;  1XNR O;  2LO1 A;  2QWP B;  1HNX O;  1HP8 A;  2DWD C;  4J10 A;  2GHY A;  2ZCE A;  3BA9 A;  4DV0 O;  1FJG B;  4ZIB A;  4B3T O;  4DRX B;  1Q5O A;  4HYO A;  2BOB C;  2HVK C;  4AIL C;  2EIM B;  3W7X A;  2YEV A;  2P06 A;  2WA4 A;  4PDL A;  1ZUQ A;  5KHK A;  1IBM O;  1Y4M A;  2KSD A;  3K04 A;  3MHH C;  3TXS A;  3OFN G;  5IYZ B;  1NVP D;  1NH2 B;  3VBB A;  3UO2 A;  1F4M A;  2IJI A;  3SR2 C;  3LUT B;  2CK3 G;  2WLH A;  4H44 B;  3JCU Z;  1K92 A;  2UXN A;  4UCS A;  2UXB O;  3K9S A;  1MSD A;  1R3L C;  2P4V A;  3LSU A;  5DN6 G;  4GUN A;  1NZ6 A;  1NVP B;  1I08 A;  4YIO A;  2E3C A;  4JI2 O;  1PP9 H;  1J5E B;  4MVQ A;  2W0X A;  1XDC A;  4UCT A;  1XHX A;  1P7B A;  4B3M O;  3DGE A;  1XNR B;  4I50 A;  1AI6 A;  4LNU B;  4X64 B;  3CMA V;  1K4D C;  4MVM A;  2LQT A;  2QM4 A;  2Q9L A;  3SJC C;  3QG5 A;  1S72 V;  4O4L B;  2GBO A;  1WNS A;  1KKC A;  3ML0 A;  4TUY A;  3G4S V;  2WLK A;  3OUF A;  3ZMZ A;  2Z0A A;  2EBO A;  3RYC A;  3OTO B;  3FYI B;  2F66 C;  2ETN A;  4DV5 B;  3MD0 A;  3K58 A;  1IDS A;  2GV9 A;  3ZN1 A;  3FB7 C;  4LCU C;  4E4E A;  1EM1 A;  4BAY A;  3IC9 A;  2JRI A;  2Z5U A;  2ZR3 A;  1MG1 A;  1O9H A;  4G28 B;  2XT9 A;  2F4V B;  1Z5W A;  5J2T A;  3L71 H;  3CEI A;  4WFA V;  4XDJ A;  5KA6 A;  4J42 A;  3AK2 A;  5JH7 B;  5EIB C;  4LF6 B;  2QA4 V;  4JI4 B;  3RVY A;  2YIA A;  4PA3 A;  3QF7 A;  3DC5 A;  2HEP A;  1GM8 A;  4P9P A;  4JTA B;  1KD1 W;  2YXY A;  4NYK A;  3RWR D;  5GON A;  3CC7 V;  4LF9 O;  4X1K A;  5IWA B;  4XDL A;  4YHH O;  4JI1 O;  4MW3 A;  2ZQM A;  2MK3 A;  4DV2 B;  3I5D A;  1AB3 A;  3O65 A;  2OTJ V;  1D2D A;  4IGG A;  4JZ2 A;  1IBM B;  1K8A W;  2JGD B;  4O4I A;  3ZMV A;  4U3F H;  2EIK B;  3SJB C;  3QNE A;  2H3O A;  4CS4 A;  1OV9 A;  4LC1 A;  1Q82 W;  1RPO A;  1L0N H;  4PI2 A;  2E75 B;  4TQD A;  4YIP A;  1VAR A;  3CSX A;  1A32 A;  1X59 A;  3TJT A;  1PNK A;  4TV8 B;  3KG2 A;  5CB4 B;  1HDJ A;  2RNB A;  2KG7 A;  2Y4T A;  1Z2G A;  3L70 H;  1XIL A;  1MNG A;  5KHJ A;  4LF8 B;  1J5E O;  1COW G;  4CBC A;  2IW5 A;  3FD9 A;  1R3I C;  3JAW B;  2Q8V A;  1H2G A;  1FS0 G;  1WP7 A;  1HW7 A;  3LNM B;  5IWA O;  3JD4 A;  3HKE A;  4YJ3 A;  1GRJ A;  3R66 A;  3APO A;  1N36 O;  5JJN B;  4LF4 B;  3CWB H;  4FM0 A;  3CE2 A;  4PA4 A;  5CMU A;  3OTO O;  2UU9 O;  5A2Q N;  5IY5 B;  1K5S A;  1M4U A;  1QBZ A;  2W6I G;  5J2U B;  1ZWI C;  1CPY A;  4WFF A;  1NS1 A;  1QLE B;  3ASN C;  5FPO A;  3E89 A;  2RCV A;  4I55 A;  3ZHT A;  1PL4 A;  3OM3 B;  3OGI B;  4UCR A;  3TCU A;  3JAM N;  3RGB A;  4ZHQ B;  4P9O A;  1GTO A;  4E2L A;  3T1H B;  4J7J A;  1F7Y A;  5L3F A;  1YVW A;  4NXM B;  4LF6 O;  4HNA A;  4WBN A;  5FPR A;  1WB8 A;  1N32 O;  5IE9 A;  3CXC U;  3CD6 V;  3TK1 A;  4CC6 A;  4P2Z A;  1XMQ B;  3ZRW B;  1VQ6 V;  1Y76 B;  3RYH A;  2OCC B;  4YHH B;  3IFX A;  4H0L B;  2EUL A;  4J80 A;  3FYE B;  3CS5 A;  2GTS A;  1VQO V;  3J80 N;  3K59 A;  4ZOL A;  4YY3 O;  2F93 B;  2XND G;  3N27 A;  1SQF A;  2ZE8 A;  4X65 B;  1ENV A;  5KLV H;  4ABM A;  3HR0 A;  4DO2 A;  2F1M A;  1P4R A;  3ABU A;  3BAB A;  3WG7 B;  3VQW A;  1NQT A;  1XL4 A;  3EXA A;  5JVD B;  2DE0 X;  2ZXW C;  3UKM A;  4FM1 A;  1JFF A;  3A0H Z;  3RYI A;  1V54 B;  3ZHV A;  5LGU A;  3BFR A;  1N34 O;  3SPI A;  3Q4H A;  3CB2 A;  2N05 A;  1XNQ O;  2A9H A;  1SQV H;  4NB5 A;  1AR4 A;  2QE7 G;  4W4L A;  4FZ1 A;  3BPZ A;  2F95 B;  1SQQ H;  1PL0 A;  3G6E V;  2OIE A;  1MSW D;  2Y4U A;  1Q7Y W;  1Q6U A;  4JYY A;  1SS3 A;  5DED A;  5LBQ A;  1ZL8 A;  2OTL V;  2ADQ B;  1QU7 A;  1Y74 A;  2Y48 A;  4LFC O;  3C3T A;  4J7K A;  1MZE A;  1WA8 A;  1VQP V;  4FZ0 A;  1OCC C;  4LR3 A;  3O9O A;  1OCC B;  3SGI A;  2DYR C;  2IH3 C;  4B3R O;  2R9I A;  1NR1 A;  1H8E G;  1NBM G;  3RW0 A;  5JCO C;  4UVB A;  4X8A A;  1EN6 A;  2B9Z A;  2ZE5 A;  1FFX A;  4GKJ O;  1PPJ H;  2HJD A;  4MVR A;  5KUM A;  4IIJ A;  5L3B A;  3JAL A;  1H38 A;  1SC5 B;  2DWE C;  3FAV B;  2FL4 A;  2PF4 E;  3CXH F;  1XMQ O;  5C8Y A;  2ZDI A;  4IYI A;  3SJA C;  1ZX3 A;  4JV5 O;  4DR4 B;  3D36 A;  5K1X A;  2XOK G;  4NR1 A;  4O4H A;  2F4V O;  3S3W A;  3AG2 C;  3AG2 B;  4PDV A;  1K4C C;  5JCO A;  4JYB A;  1TA8 A;  1XEQ A;  4I4T A;  3U0Z A;  1R73 A;  3HKC A;  4L8J A;  1KP3 A;  4DW0 A;  1FXK A;  3ETQ A;  2ATK C;  4DV7 B;  1N4C A;  4F6E A;  2AHZ A;  3FB6 C;  1BZK A;  4XBF A;  3SPJ A;  2UUA O;  2YXL A;  3GWK C;  1XBL A;  3TGU H;  2FML A;  2QSA A;  4X1I A;  2L6L A;  2JEU A;  2WLL A;  1L8D A;  3CHX A;  1S76 D;  1T5E A;  1N0N A;  3B8M A;  1SZX A;  2YID A;  4I5S A;  4FLV A;  4RAI A;  3AK1 A;  2VQF O;  5L3D A;  4GX0 A;  1KUQ A;  1NU1 H;  3MDS A;  3B8N A;  2YEV B;  1LNQ A;  4GX5 A;  1DLB A;  1FXK C;  5CBF A;  3F7Y C;  3CCQ V;  1H2L A;  4O2A B;  2MW2 B;  5DM6 V;  2PY5 A;  5EC2 C;  2ZM6 O;  1BE3 H;  2RMK B;  3QO7 A;  1G1X B;  2ZD9 A;  4KXR A;  1I5Y A;  2PGG A;  4BIU A;  4DR2 O;  2NNU A;  2PUS A;  3ASN B;  1FXV A;  1RPR A;  3K5L A;  2QKS A;  2CGN A;  3T1Y B;  1HNZ B;  2BTQ A;  2C2A A;  1Q86 W;  2EIJ B;  4QPJ A;  5K1P A;  5H6Q A;  1NTK H;  2XAJ A;  1N36 B;  1VP7 A;  5LOV A;  2CTP A;  3UM7 A;  3JAK A;  2Q5Z A;  3H1L H;  3CP1 A;  4JI6 O;  2Y0I A;  2AZ0 A;  3HKD B;  4LNU A;  2EIN B;  1P84 F;  3ZHU A;  1HWY A;  1Q8I A;  1ZAU A;  1R6N A;  5IYD O;  3JAS A;  1JQ0 A;  2HKO A;  2RJZ A;  1SF9 A;  4K35 A;  2PTM A;  3QO8 A;  4CH6 A;  3UCS C;  5D5Q A;  4DV3 O;  1TVK A;  2UXB B;  4QGP A;  4IHJ A;  5EBW C;  4LP8 A;  1OJH A;  1B06 A;  4J9Y B;  2V4D A;  1YJN V;  3C90 A;  3STL C;  4WFB V;  2LFR A;  5D5P A;  3WB0 A;  4B08 A;  1QQC A;  5IJ0 A;  1TUB A;  3OE7 G;  4ZI7 A;  1IBL B;  2R9A A;  1YF2 A;  5LMU B;  1V55 B;  2B1G A;  5ITZ B;  4LFB O;  3OEE G;  2CTR A;  1FJG O;  4Q6G A;  4B3T B;  4X89 A;  2CAZ C;  5EK0 A;  3FB8 C;  4LH6 A;  3QVN A;  5JQG A;  1ROP A; 
#chains in the Genus database with same CATH homology
 2HVJ C;  2OTJ V;  1FXH A;  3ZCC A;  1OZ0 A;  4QE9 A;  3OR7 C;  3K03 A;  2V1D A;  4N21 A;  2IJJ A;  4RQE A;  4JF3 A;  1K8A W;  3ZMV A;  4KUM A;  2EIN C;  2EIK B;  2LFS A;  1K9M W;  1WLE A;  1S5H C;  3QNE A;  2HR3 A;  4G27 B;  3AG4 C;  3AG1 B;  5LHI A;  4N23 A;  2XAS A;  4LC1 A;  1Q82 W;  1RPO A;  3CME V;  3IGA C;  4J9Z B;  1SES A;  2JJ2 G;  2EIJ C;  3E8B A;  1PNK A;  3KG2 A;  3CCL V;  4WFE A;  3SPG A;  1ARO P;  3FKS G;  3JD0 A;  3LSS A;  5J9P C;  5B1A B;  3LDC A;  1COW G;  5GW7 A;  5B1A C;  5HFM A;  4R8C A;  1E1Q G;  1AR1 B;  2Y69 C;  4JGS A;  4JPR A;  5B1O A;  4CBC A;  2IW5 A;  3K0G A;  1GK9 A;  3T4Z A;  1KEC A;  3SYO A;  3CPW U;  4GX1 A;  1AI7 A;  1R3I C;  1QR9 A;  2AHY A;  4UVA A;  3CCS V;  1VQM V;  3T1C A;  1H2G A;  3WG7 C;  3FB5 C;  1FS0 G;  3LDE A;  3OAA G;  2IU0 A;  3RBZ A;  1KKD A;  1PNL A;  2WAM A;  4JAU A;  4FK5 C;  1V55 C;  3LNM B;  3JD4 A;  3ZMS A;  1JJ2 U;  5H9C A;  3ETD A;  3EHB B;  5EC1 C;  2EJR A;  1Q81 W;  4HZ3 A;  3K9A A;  4FPP A;  2X7R B;  4PA4 A;  2R9R B;  4KFM A;  2EIL B;  3M99 B;  5CMU A;  4P30 A;  3STZ C;  5IY5 B;  4F4L A;  1K5S A;  2F43 G;  1QBZ A;  2W6I G;  4MSW C;  3ZMU A;  1ZWI C;  2UXX A;  4I9W A;  4R7C A;  4RQF A;  2P90 A;  1K5Q A;  1CPY A;  4L87 A;  1W2B U;  4GX2 A;  1IXM A;  1THZ A;  2WLM A;  4WFF A;  1VQK V;  3SPC A;  4QPK A;  1QLE B;  3ASN C;  2IU3 A;  1KC8 W;  3E89 A;  4KP4 A;  3W7W A;  3F5W C;  1QVG U;  4TSF G;  3SYQ A;  5L3G A;  3OM3 B;  1K3E A;  3TCU A;  4G2K A;  2Q69 A;  3QO5 A;  2EZP A;  1CEZ A;  2X6A A;  3R65 A;  1GTO A;  4P9O A;  3E83 A;  2WPD G;  4E2L A;  3B77 A;  3ETG A;  5LHH A;  3OMN B;  3SYP A;  5L3F A;  5E1A C;  2M7W A;  3G71 V;  1J95 A;  2DW4 A;  2QTO A;  2Y69 B;  2EIK C;  3E8H A;  2HLD G;  5EBM C;  3PJS K;  3E2E A;  4MTF A;  1GKF A;  3CXC U;  3K3W A;  3CD6 V;  4MT8 A;  3OUS A;  3OEH G;  4R50 A;  5LGT A;  1S3J A;  4PDM A;  3TK1 A;  4ASU G;  4QJF B;  1EFR G;  4P2Z A;  4WFH A;  3ZRW B;  1PD3 A;  1VQ6 V;  2OCC B;  2P7T C;  2OCC C;  3SPH A;  3IFX A;  3ZRX A;  2IH1 C;  4MTX A;  5B3S B;  2GSM B;  2JJ1 G;  3ABL C;  2LP7 A;  1NJI W;  4FJC C;  4HAM A;  3FYE B;  4MW8 A;  4MVS A;  1VQO V;  2IJH A;  1K97 A;  5KUK A;  1H8H G;  2XND G;  3H01 A;  4YXW G;  1OCO C;  2IJK A;  3GB7 C;  3ZRW A;  1ENV A;  4Z1M G;  3CC4 V;  3T2M A;  1SRY A;  4WFG A;  4JAV A;  1QR8 A;  4U7N A;  4DO2 A;  5HFL A;  2DQ0 A;  1P4R A;  3ABU A;  3WG7 B;  3ABK C;  2XAG A;  1JOY A;  3ABK B;  2W0F C;  2A79 B;  1W0K G;  2DQ3 A;  2WWW A;  1NQT A;  1XL4 A;  1OCZ B;  5EBL C;  3X2Q C;  4Q20 A;  1MAB G;  2ZXW C;  1QCE A;  3K79 A;  4MTO A;  3UKM A;  1VQ7 V;  2KB1 A;  1YSC A;  1M90 W;  1JX9 A;  1V54 B;  2WLI B;  4CZZ A;  3E35 A;  1M9N A;  3I56 V;  5CBG A;  5LGU A;  4ZKI A;  3SPI A;  3EFF K;  5KA5 A;  1SER A;  5IYC O;  2JK5 C;  2DYS C;  4XDK A;  2X6C A;  3ETE A;  1K7D A;  2XAF A;  4MVZ A;  5FL7 G;  1GO3 F;  2A9H A;  2WLJ A;  4EKW A;  2PI5 A;  4H37 A;  2FTK A;  2WLN A;  2QE7 G;  4UV9 A;  3E8G A;  1G8M A;  2V7Q G;  2WLI A;  1VQN V;  1AJN A;  2H8P C;  1B6Q A;  1PL0 A;  1SZT A;  3SJQ C;  3ZRS A;  3G6E V;  4QE7 A;  1MSW D;  1Q7Y W;  3LSQ A;  1K73 W;  3OMI B;  2EIM C;  1BMF G;  4MS2 A;  5LBQ A;  2QM7 A;  2X0L A;  2OTL V;  3MHS C;  4TWK A;  1VQL V;  3CYO A;  2Y48 A;  2PI4 A;  4JAS A;  5L3C A;  4UVC A;  1F4N A;  3I55 V;  1VQP V;  1OCR C;  4BIZ A;  1OCC C;  1OCR B;  3W7S A;  5C93 A;  3ZIA G;  1OCC B;  1KP2 A;  2DYR C;  2Z3Y A;  2IH3 C;  2R9I A;  3TET A;  1NR1 A;  3JD1 A;  3LDD A;  1H8E G;  1NBM G;  5LGN A;  2QM8 A;  4QIW F;  3RW0 A;  1NH2 D;  4UVB A;  4X8A A;  2HFE C;  2D3O W;  2XAQ A;  2HG5 C;  1G4Y B;  5B1B C;  2XAH A;  2W6J G;  1F51 A;  3ASO B;  4TT3 G;  4MVR A;  1KQS U;  5KUM A;  2B1I A;  1N8R W;  1EBO A;  2ITC C;  5IY5 C;  5L3B A;  3ABT A;  3CCU V;  1K33 A;  1H38 A;  1AI5 A;  2DWE C;  4UV8 A;  4PDR A;  1YIJ V;  3JYC A;  4JTC B;  4OXS A;  1QLE C;  2ZDI A;  3AG3 B;  4WF9 V;  4RUE A;  3AG3 C;  1QVF U;  4MTG A;  1PNM A;  4PA7 A;  1UJW B;  3OGC C;  4R6Z A;  2JIZ G;  4RUF A;  3D36 A;  3VOU A;  4U7O A;  3NXS A;  1M56 C;  1FXK B;  2ZXW B;  5IYB O;  3JD3 A;  2XOK G;  3IC7 A;  3BY6 A;  1NKD A;  3ABM B;  1GM7 A;  3ABM C;  1RM1 B;  1V54 C;  3AG2 C;  2P6J A;  3ZN0 A;  1S77 D;  1M1K W;  3AG2 B;  4PDV A;  3WFV A;  1E1R G;  3W7T A;  1K4C C;  4GCZ A;  3A0R A;  1FFT B;  3HPL C;  2ZDI C;  2WSS G;  4JYB A;  2JDI G;  2H94 A;  4X88 A;  1R73 A;  2K1E A;  1VQ8 V;  1KP3 A;  3K08 A;  4GT1 A;  1JVM A;  1PKX A;  4DXW A;  3JCZ A;  1FXK A;  5LHG A;  3CCJ V;  2ATK C;  3K06 A;  2EZO A;  3AG4 B;  1BL8 A;  3AG1 C;  2YSU B;  1DTO A;  1R3J C;  2JEX A;  2AHZ A;  3FB6 C;  2DYR B;  4XBF A;  3SPJ A;  3GWO A;  2DWD C;  5L3E A;  1AJQ A;  1YHQ V;  2GHY A;  5B3S C;  1YTF D;  1DF5 A;  1R6K A;  3OMA B;  4PA6 A;  3ABL B;  3E8F A;  5B1B B;  4HYO A;  2BOB C;  2HVK C;  2EIM B;  3W7X A;  2JEU A;  2WLL A;  2YEV A;  2Q68 A;  1OCO B;  1S76 D;  3AEI A;  3OR6 C;  4PDL A;  1Y4M A;  3K04 A;  3MHH C;  3B8M A;  3OFN G;  1GMG A;  1WPX A;  1NVP D;  1NH2 B;  4I5S A;  3VBB A;  1F4M A;  4RAI A;  1I5X A;  1F23 A;  4UXN A;  5L3D A;  4GX0 A;  2IJI A;  1R3K C;  3LUT B;  2CK3 G;  2WLH A;  4JYC A;  4FMT A;  4MVU A;  1K92 A;  3B8N A;  1OCZ C;  2UXN A;  2WLL B;  2YEV B;  3X2Q B;  1LNQ A;  2BOC C;  2Q67 A;  4GX5 A;  5CA3 A;  3HB3 B;  1R3L C;  1DLB A;  1FXK C;  4LBE C;  1JCH A;  5CBF A;  1CP9 A;  5DN6 G;  3F7Y C;  3CCQ V;  4PEL A;  3ASO C;  5H6R A;  5DM6 V;  5EC2 C;  1TUE B;  1NVP B;  3K0D A;  4PA9 A;  3SYA A;  1E79 G;  2DYS B;  4RO2 A;  3QO7 A;  4MVQ A;  2ZD9 A;  1I5Y A;  4JTD B;  4BIU A;  1P7B A;  4FIP C;  2NNU A;  3DGE A;  1AI4 A;  3ASN B;  1S0V A;  1Y66 A;  1FXV A;  1EZJ A;  1RPR A;  1W0J G;  1AI6 A;  2QKS A;  2C2A A;  4H33 A;  1Q86 W;  1K34 A;  3CMA V;  1K4D C;  1VQ9 V;  2EIJ B;  4MVM A;  4QPJ A;  1ORQ C;  2OT5 A;  5B1N A;  5H6Q A;  2XAJ A;  1S72 V;  1RM1 C;  3ML0 A;  3G4S V;  3UM7 A;  2WLK A;  3OUF A;  3ZMZ A;  3CP1 A;  1YIT V;  2EBO A;  1L1F A;  2EIN B;  1OHH G;  1HWY A;  3ZRV A;  3FYI B;  2Q6A A;  1R6N A;  1BHA A;  5IYD O;  3MD0 A;  1M57 C;  1JQ0 A;  2HKO A;  3P32 A;  1M57 B;  3ZN1 A;  1JPX A;  3FB7 C;  5IDJ A;  1YI2 V;  3T4D A;  3OW2 U;  3QO8 A;  4MVO A;  2A0L A;  4LCU C;  3ZJZ A;  5CN0 A;  3W7U A;  3CC2 V;  1YJW V;  4BAY A;  2ITD C;  2Z5U A;  2ZR3 A;  1XL6 A;  4LP8 A;  4UUJ C;  5EBW C;  1MG1 A;  4G28 B;  4J9Y B;  5CBH A;  1YTF B;  1YJN V;  1SET A;  3CCV V;  1MOF A;  3RVZ A;  3STL C;  3CCR V;  4QNH B;  4WFB V;  1AJP A;  4WFA V;  3ZMT A;  1YJ9 V;  4XDJ A;  5KA6 A;  3CCM V;  2EIL C;  2LFR A;  5BZB A;  2ZR2 A;  3SYC A;  1VQ5 V;  4BW5 A;  2P67 A;  3CCE V;  2X6B A;  2QA4 V;  3OE7 G;  1VQ4 V;  2HJF C;  4ZBM A;  3RVY A;  4PA3 A;  3E86 A;  3D3I A;  2QEX V;  1GM8 A;  4P9P A;  4JTA B;  1KD1 W;  1QLN A;  3P30 A;  1V55 B;  2B1G A;  3CC7 V;  3JD2 A;  1M56 B;  3OEE G;  4XDL A;  1GM9 A;  1NR7 A;  4X89 A;  4WCE V;  1BHB A;  3BEH A;  2NLJ C;  2B5U A;  5EK0 A;  4MW3 A;  2ZQM A;  3FB8 C;  3F7V C;  2MK3 A;  3DTU B;  1ROP A;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...