1BHAA

Three-dimensional structure of (1-71) bacterioopsin solubilized in methanol-chloroform and sds micelles determined by 15n-1h heteronuclear nmr spectroscopy
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
67
Chain Sequence
AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords BACTERIORHODOPSIN
publication title Three-dimensional structure of (1-71)bacterioopsin solubilized in methanol/chloroform and SDS micelles determined by 15N-1H heteronuclear NMR spectroscopy.
pubmed doi rcsb
source organism Halobacterium salinarum
total genus 23
structure length 67
sequence length 69
ec nomenclature
pdb deposition date 1993-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.170 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1bhaA00
1BHBA 1BHAA
chains in the Genus database with same CATH superfamily
4JI5O 2FMLA 4JI1O 4DXWA 1X4TA 4FFBB 4DV2O 5IJ0A 4R50A 4XDLA 4FZ0A 3OUFA 4GZRB 2EZPA 2ZT9B 1WAZA 2H94A 4AQYO 1OCOB 1OCRB 1SQQH 3DC6A 3EVKA 5B66Z 2VQFO 4PDLA 3C3TA 1P7GA 5JCOA 4I7ZB 2UXDO 5LOVA 2AHYA 4FM0A 4UUJC 3OFNG 3WB2A 1QVFU 4UCRA 5BR8B 5KHJA 5LGTA 3H1JH 3W7XA 2AW9A 3CCQV 4DR1O 2ZE7A 3ZBHA 2W6JG 4JYAO 1WNSA 2XTAA 3HPLC 1JX9A 2CAZC 4OPAA 4UV9A 4KP4A 2ADQB 1RP3B 1MSDA 2IJKA 4TV8A 3CCMV 1KD1W 4DR5O 4BIOA 4TT3G 3E22A 2ZNIA 4X65B 3ZRXA 2HR3A 1XEQA 3CCEV 2E5LO 2W6IG 5K1PA 3CC4V 1B6QA 2HKOA 2YSUB 3W7SA 5JJJB 1AR5A 4TUYA 5IYCO 5H6RA 4I9QA 2PY5A 3G4SV 1OHHG 2FB5A 3ASNC 4D7SA 1U97A 4LF4B 3QTCA 1TGOA 2W0FC 1VP7A 4F6EA 2Q7HA 2EJ7A 1BZKA 5IWAO 3CCRV 2UXXA 5E1AC 3ASOC 1GN6A 3FFQA 2Q6AA 4CBCA 1W59A 4LP8A 4JGSA 1N32B 3KZIZ 1OCZC 4I50A 1XOUA 1S0VA 4Q20A 4IIJA 1NR7A 2ZR3A 1OV9A 5CA0B 2OCCB 2CTPA 4DV0B 4CC6A 4MTXA 3ABLC 4B3SO 3OT7A 2P4KA 4U3JB 2WLMA 1Y66A 2HP8A 3K59A 1WP7A 2UUBB 5KX5B 2JEXA 3E8BA 2X0LA 4LNUA 2A7WA 4X8AA 3SPJA 1PNMA 1QLNA 1NT2B 1NVPD 5KLVH 2XHBA 5JQGA 2EIJC 1XDCA 1I0HA 3E8FA 2AGAA 1VQNV 3SYPA 3JD0A 4YY3O 2YIAA 1LNQA 5ITZB 3JATA 4QE9A 1MZEA 2B1GA 2EX3A 4GUNA 2JGUA 3TXQA 1K4DC 3T4DA 3U11A 1OZ0A 4P9PA 3G6BA 1MA1A 2YI8A 4DV6O 1MZFA 4MT8A 2FYUH 2Y69C 4K3AA 2AZ0A 1OCCC 2IU0A 4JI7O 3P3NA 1I94O 1DGSA 5LMNB 1F7YA 1EN4A 3ASNB 3SPCA 1QNMA 4CH3A 4O2BA 1PNKA 5JVDB 1S77D 4DR3B 1S72V 1R3JC 2PF4E 4FLWA 3ASOB 3OAAG 3A8TA 3K5LA 2DQ0A 4PHZA 4U7OA 4JZ2A 1OCZB 3E35A 4R8CA 1KUQA 4X1KB 3IC7A 1FJGB 1ZUQA 4G27B 2R9IA 3PJSK 4LH7A 1IBKB 4HNAB 3UT5B 2IW5A 4NXMO 1R3KC 3DXRB 2QWOB 4J9YB 5LBQA 1JCHA 4ZHQA 1XHXA 2LW1A 1AILA 4B3MO 4WBNA 5JCOC 3F5TA 2P90A 2MK3A 4DRXB 4KXRA 4CS4A 3W7UA 2UXCO 4WFEA 2CGNA 2VWKA 1JVMA 4EB6B 4X1IA 1IDSA 4F6RB 5JH7B 1MG1A 2D2CB 4UB8Z 2QDOA 1HNZO 3CMEV 4H13B 1ROPA 4PD4F 3ETGA 5GONA 1GK9A 2EIJB 2RNBA 2ETNA 2QKAA 4NR1A 2UUCB 2R72A 5LHGA 3S3XA 4DR2B 3RWRD 1YHQV 2KSDA 2BOCC 2ZE5A 2Y4TA 1WB7A 1N0JA 5EIBD 3MHSC 4OXSA 2A79B 2KG7B 1ZL8A 3H01A 5EC1C 4LFBB 2XAHA 3CD6V 1Y76B 4J10A 4NTWA 2QM8A 1Q3EA 3L70H 4I5SA 1JR9A 2YUAA 4R7CA 3CC2V 3L72H 2EINB 5C8YB 4JI8O 1MMMA 5LXTA 4Z1VA 4K35A 1JFFA 3ZN0A 3ABMC 4IYHA 1V54C 1OCCB 3CX5F 4C7UA 3JD4A 3QO8A 4EEQA 2F1MA 1AI5A 5KAFZ 1BHAA 3E8GA 3L71H 4JTDB 3ZMZA 4EFEA 5H5NA 4B3RB 1YSCA 3T1HB 1GMGA 5CN0A 4MTFA 2YXLA 2ZKOA 4PV1B 3E8HA 1XUQA 5LGUA 3OTOB 2L6LA 3QVNA 4UVBA 1YITV 1FKAO 1M56C 1TUBA 1NR1A 3H1IH 4I9WA 1SA0A 1BHBA 4TSFG 4DV5B 4K8ZA 4G28B 2Q9LA 1YJNV 3SJQC 4DUYO 1N34B 1F51A 2JEUA 1AJPA 4QPKA 2M6YA 3ZHRA 3AK1A 2Q73A 2EULA 4NTXA 4GKJO 3K79A 2XASA 3MDSA 2PI5A 2Z5UA 4QGPA 5FL7G 1YJWV 1Y4MA 3JD2A 4OX9O 3T4ZA 1XBLA 3ABUA 3H1HH 4J7JA 4CS3A 1I5YA 3RYIA 4DUZO 2XUMA 2VS0A 2ITCC 3LDDA 1HDJA 3CPWU 4I55A 3KCYA 1IBMO 4Z2WA 1EM1A 3ZHVA 4NXNO 4TV8B 4YJ3B 2OYQA 3ZMSA 1Q6HA 1XMQO 3ABTA 2BCCH 3E22B 4NYKA 4LFCO 4JYBA 2XOKG 3DC5A 4HAMA 3ZRSA 2F66C 5CB4B 2UXNA 4MVSA 4PA9A 4TUYB 4J80A 3OMAB 3G71V 1D2DA 4QNHB 2OIGA 4EKWA 3ABMB 3UT5A 1V54B 1IBLB 2A3QA 4XBFA 4TWKA 4MS2A 2UXBB 1E1QG 3W7TA 1FD9A 2DOSA 5LMUB 1PD3A 4PDMA 4MW3A 2P4VA 3NR7A 2WAMA 5EBMC 3D8CA 1ZLZA 1O9GA 3K0GA 2JJ2G 1URFA 4HYOA 4DV3B 3VQXA 4IIJB 2WLIB 4X88A 1M56B 1H2NA 5L3EA 4JI2B 3STZC 1SZTA 2IM9A 2YICA 5KHIA 2Q0AA 1P49A 2JS3A 1QCEA 3K9SA 1DF5A 2JGDA 3AG4B 2F93B 3JD3A 3ZS8C 4LF6O 4QPJA 3K08A 3ML0A 1Y76A 3MD0A 5EYPA 5CMUA 1VQKV 4AHCA 3I56V 4FLXA 3BA8A 3CC7V 2UUAO 1SZXA 4NTYA 4JI3O 1S5LZ 4TV9A 2PGGA 5JQGB 1QBZA 4JI4B 4ZBMA 1FXVA 2GV9A 3SYOA 1KECA 2JK5C 1N36O 1LUVA 1UPGA 5EK0A 5CBHA 3JATB 4LF5B 1SQFA 4P9OA 2QEXV 2ZDIA 4R6ZA 5LHHA 4ZI7A 1KYOF 1CEZA 4WFBV 1JOYA 2QE7G 3RFRA 5KMGB 2LFSA 3CCVV 1US6A 1AVMA 3H9VA 4KL1A 1F23A 4KHPB 2WA4A 4WFAV 4DO2A 5BR8O 2WLLA 4PELA 3UKMA 5DECA 2HVJC 3BHPA 4O2BB 1EZVH 1G6UA 1MNGA 1GM9A 2M7WA 4WFFA 3T1YB 1BS3A 2WLJA 4RWUA 4AI8A 4DV1O 3FAVA 5KHGA 2EJRA 3IJ4A 2EILC 3MHHC 4L87A 3LSUA 3OM3B 3R66A 3SJAC 2QWRB 3ZX6A 3JAWA 4X65O 2DW4A 2HHHO 2PTMA 4FFKA 4DR7B 3UQ8A 1COWG 1RPRA 2IBZH 5KHHA 4FLZA 5L3DA 5H2FZ 1WA8A 3ZIAG 4NB5A 1O9HA 1YCIA 1K7DA 2VWJA 5JJNB 3JASA 4YJ3A 3QNEA 4ZHQB 3U0ZA 3THOA 4LF4O 1R1BA 3D3QA 3VBBA 4WBNB 2CK3G 1I5XA 1XREA 3J81N 3CEIA 4UFZA 1Z5VA 1Q81W 3OUSA 4X9QA 4P30A 5CB4A 4X1IB 1H8HG 3JYCA 1ZTEA 4CZZA 2ZIOA 2P22C 4X1YB 5GONB 5IT9N 4LFAB 1NH2D 3IC9A 4O4JA 5K1XA 5FLXN 4W4KA 2QJ1A 1ZL8B 1H2MA 3X2QC 4DV0O 3CCJV 4JTAB 4GKKB 1GH6A 4FJCC 4JI6B 3CCSV 1YI2V 3A0BZ 4LF9B 2YC0A 5B5EZ 5LXTB 2UUBO 1NS1A 1ZSPA 1JJ2U 1JFFB 2WLIA 4PDRA 2OIEA 3G6EV 4GX1A 1SS3A 1THZA 1K73W 2H3OA 1P7BA 2CTQA 2FTKA 2V1DA 1BQ0A 1VQ8V 1AP5A 2Y4UA 4MVRA 4MVMA 5B1OA 1PL0A 4UB6Z 2Q69A 2PUSA 2V4DA 1NQTA 3F5WC 2OTJV 3L74H 4LCUC 4J7ZA 4ZKIA 3MAQA 3JCZA 2EILB 2YIBA 1FS0G 1TUBB 4FLYA 2JVDA 3BAAA 1SA0B 2ZQMA 4DR4B 2D3OW 1K97A 2A0LA 2JS5A 5CA3A 3SJCC 3WG7C 4H0LB 2Q4PA 4UXNA 2K9PA 4LH6A 5LMNO 4JI0B 1IVSA 4NVPA 2OTLV 4LF8B 2EINC 4UCUA 1R6NA 3K0DA 4DR3O 5KMGA 2X7RB 2LQTA 5JWPA 4DV7B 4IGGA 1NH2B 3RYIB 1K34A 1D5AA 2EIMC 2ITDC 4I55B 4D6TH 1KU9A 5LGNA 1FJGO 1R3LC 1CXZB 2ZDIC 4J11A 4GX5A 1BE3H 4O4HA 1IBKO 3D36A 2JRIA 1F4NA 3RYCA 3GWKC 1FFTB 2WLKA 2RDCA 3HKDA 3X2QB 1SETA 1J5EB 4X64O 1SERA 1M93A 3AG3B 1K3EA 1EN5A 4JASA 1QVGU 4Z1MG 2DYSC 5LP6B 3CSXA 3FYIB 3ABKC 3VQWA 3BABA 3GWOA 3QF7A 1ZWIC 2GDSA 2MW2B 5J2UA 1VQLV 5TISZ 2HJFC 3N2KA 2CE4A 5IYZA 4GCZA 2CUGA 1NVPB 4IT5A 3HKCA 2CTWA 4DR2O 4MVZA 3AG2C 1TAEA 2KB1A 1I7FA 2LO1A 1AR1B 5L3BA 3SDLA 2HEPA 3F7VC 4X1YA 3BPZA 3CE2A 4O2AB 2ZM6B 1N8RW 4RUFA 5EIBC 2GTAA 3OE7G 4LF7B 4J9ZB 1V55C 1LUWA 5LA6B 2DE0X 4J42A 2QGNA 5L3CA 2JGDB 5DM6V 2N74A 3ZRVA 3WG7B 2Q7GA 3AEIA 3ZHSA 2QWQB 5EYPB 5FPOA 4OGQB 1N33B 4B7KA 1WP8A 4Q6GA 1NJIW 3IAYA 4YHHB 4TV9B 4B3RO 2BTQA 3T1HO 4QE7A 1W0JG 2P67A 1VEWA 3HKEA 2AHZA 3HKBA 1HNZB 1R3IC 4X62B 3SYAA 3OTOO 4TQDA 3N2GB 2EIMB 3BRCA 1QR9A 3J80N 4FMTA 4DV5O 3TK1A 1HNWB 1UJWB 2VRZA 4ZI7B 1BCCH 2Q5ZA 1N34O 4UCOA 1W2BU 1NTKH 2F95B 4JAVA 3FKSG 1QQCA 3ETQA 3LNMB 3Q4HA 3FB7C 2DYSB 2QTSA 4FPPA 3QG5A 3ABKB 2WLLB 4U7NA 3AG4C 2PZSA 1H2KA 4JAAA 1XNQB 4X66B 2CDYA 1YZBA 1IURA 1Y74A 1IXMA 2XAJA 1GAXA 3LDEA 2Q67A 4PDVA 2NLJC 3FAVB 3CRMA 1SQVH 1M1KW 4YIPA 3RYFA 1QLEB 4MVOA 4BWAA 3AG2B 5EZYA 3FB8C 3JAWB 4DK0A 2RQ6A 2YIBD 2OWOA 1U96A 3S3WA 3EHBB 3STLC 1AR4A 1K33A 4I0XA 1WPXA 2L35A 4BAYA 1FPOA 4X89A 3BY6A 1WA8B 1M57C 3BCCH 1NZ6A 2A06H 3JASB 1XILA 1R6TA 1V55B 3JAKA 1QU7A 1XL6A 4K0KB 5L3GA 3KKYA 4ZIBA 2W0XA 4MW8A 4DR6B 1IBLO 5L3FA 2UXBO 3M8AA 2O57A 2P06A 2AXTZ 3CYOA 1NU1H 3RGBA 1JQ0A 5LP6A 1YIJV 2P6JA 5A2QN 5LMUO 2NR5A 1WPBA 3JAMN 1IX9A 5J2TA 1K9MW 5EBWC 3JSNA 2JJ1G 3ZHUA 2EZOA 5A9GA 2XAGA 4YXWG 3AK2A 4O4JB 2YXHA 2ATKC 3L73H 1AP6A 4DV3O 1FFXA 2N04A 2LW7A 5IYBO 3D36C 4FM2A 1V9PA 1VF7A 2VQEB 1KC8W 1SF9A 4JI2O 4KFMA 2HLDG 4LBEC 1JA8A 3SPHA 1N0NA 2UU9B 1VMGA 4NKGB 2QR4A 1GO3F 2Z3YA 3LUTB 1GN4A 1Q7YW 4O2AA 3OGCC 1FAFA 1KP2A 3JALA 3SGIA 1W0KG 1ZAUA 2KKWA 3OMIB 4GLXA 5CA1A 3RVZA 2CGOA 2WA3A 4QIWF 5LA6A 1R6KA 1EZJA 4JI4O 2Y0IA 3QO7A 1Z2GA 1T5EA 1GKFA 1AJQA 1JPXA 1HNXB 3P3PA 1RPOA 4JYYA 4LF5O 3RBZA 4RQFA 4PA3A 1FXKA 1HR0B 1K92A 4MTOA 4CH5A 2EBOA 5BZBA 4DV4B 3CB2A 5D5QA 1XQ8A 1XNRB 4WCEV 3T1CA 2DYRC 1XMOB 2V7QG 3UO2A 2ZE6A 5BMVB 3CXHF 3N2GA 3K3WA 3JARB 3CHXA 4KHPO 1M57B 3APQA 3B8MA 2QA4V 5GW7A 2PYLA 5KAIZ 3ZMUA 1BQZA 5KUKA 1BGYH 4UVCA 4RUEA 4N21A 5KA5A 3G80A 2A9HA 5HFLA 4B3TB 2X6CA 3FYEB 1JMKC 3T1YO 5DN6G 3BEHA 4O4IB 3CRRA 3OMNB 1Z5WA 3K9AA 5J9PC 1B3QA 5LL6Y 3APOA 1TVKB 3OTFA 3B09A 1PM9A 2G38A 3CRCA 4X20A 1K5QA 1Q5OA 2LJ2A 5GTIZ 1K8AW 2F23A 1TA8A 4G2KA 4DR7O 4O4HB 3VOUA 2GHYA 1NTMH 2YIDA 4FLUA 5KHKA 2GUZA 2QM4A 3RYCB 4BW9A 1B06A 3HKDB 3FX7A 5KUMA 4JV5B 4IHJA 2ZCEA 2F4VB 4PI0A 1NI8A 1X59A 5B1BC 2YS8A 1S3JA 2Y0PA 5IJ9A 4O4LA 2ARHA 3CJHA 2BTOA 3OR7C 2XNDG 3JCUZ 3ZHTA 1IXBA 5C93A 2QWNB 4JI5B 3L75H 4JI1B 3ZN1A 1VQ6V 4DV2B 5F2VO 5CBGA 2IU3A 1BMFG 3JD1A 2BSKA 2XAQA 5J2UB 1QR8A 2KQXA 3N2KB 4LFAO 4W4LA 5IYZB 4AQYB 3A0HZ 3OEHG 1VQ7V 1Y67A 3BA9A 5GTHZ 3HKCB 2F43G 4PI2A 3E89A 2VQFB 4DV1B 3RVYA 2UXDB 1EN6A 2ZE8A 3ZEDA 1MABG 3AG7A 2C2AA 5CBFA 1VQ5V 2WWWA 4N23A 1UFIA 3PN1A 1SC5B 4FIPC 1N32O 4GKKO 4DR1B 4JI6O 4MVUA 5H9CA 2HHHB 3AG1C 1M9NA 4DW1A 4JYAB 2YEVA 4LF9O 2Q7EA 2DYRB 3FD9A 2HJDA 5BXZA 3CRAA 1AI6A 2IH1C 3O9OA 4DR5B 4CH6A 1YJ9V 3AG3C 1DF4A 4J41A 3ICXA 5E79Z 2ZD9A 5LP6C 3TJTA 3T2MA 2E5LB 4ZOLA 2YXYA 1RSOA 2B9ZA 1GRJA 1CP9A 1PP9H 3ZJZA 4E4EA 4XDKA 2BTQB 2ZXWC 5EBLC 3RN4A 2Z0AA 3HKEB 2NN4A 3HKBB 3ZRWA 1GN2A 3D3IA 2E3CA 2PI4A 5IWAB 4BIZA 2IH3C 3DSQA 1VQ9V 3TGUH 2R9RB 1H2SB 5FNVB 3K5OA 3RYHA 3SYQA 4TQFA 4DR4O 4FLVA 4IYIA 2DJVA 1YDXA 4FZ1A 4UCSA 4WF9V 2CH7A 4JI0O 1PPJH 5B1BB 3Q4HB 4LF8O 1Q82W 1G4YB 1E1RG 1Q90D 2BOBC 5FPRA 1P84F 5BMVA 3JARA 2ZIMA 4DW0A 3JSLA 4DV7O 5H6QA 3ETEA 4YJ2B 3FB6C 3L9DA 4B3SB 2LP7A 5IDJA 1GTOA 1Y74B 4MTGA 2BE3A 3DTUB 1Q6IA 3NXSA 1GM8A 3TETA 1FXKC 3RW0A 1NTZH 3G67A 1M4UA 1IZ3A 3LDCA 1BT8A 1DTOA 1RM1C 4UVAA 1AI7A 1YXBA 3RYFB 4O4IA 1EFRG 5EZYB 2RJZA 3SYCA 1PKXA 4I4TA 1VQPV 1MOFA 2LGWA 4H37A 4I0XB 1J5EO 1TVKA 1VQMV 4ASUG 2ODMA 1VIBA 3OW2U 4YY3B 3AG1B 1YF2A 2QKSA 1HW7A 4K8XA 2GTSA 3JAKB 4UCTA 4DRXA 1VF6C 2RMKB 4AILC 4CS2A 4FFBA 1I08A 2PYJA 4PA4A 3KCXA 4DV6B 3E2EA 4CC5A 3K58A 4DK1A 4PJ0Z 5J2TB 2OT5A 1S76D 4JI7B 3EFFK 2ZXWB 1I94B 4HBNA 1VF5B 3LSSA 1J95A 3W7WA 4A5UB 4ICGA 4OPHA 1FFXB 2ZM6O 3WU2Z 2WSSG 1AJNA 1YEWA 1VQ4V 2QSAA 2R70A 2UUCO 2Q8VA 4HZ3A 3BFRA 4LF7O 5B1NA 1QLEC 3UCSC 1KBHA 1TUEB 3U10A 4JPRA 4X64B 3WB0A 4LFBO 1G8MA 3RT3C 1BSMA 3ABLB 2Y48A 5AG2A 3JALB 4BW5A 1SQPH 1N33O 5CA1B 4H33A 4YHHO 5IE9A 2IJHA 3O65A 2B1IA 4NXMB 3UM7A 3A2FA 3LSQA 4IL6Z 1AB3A 4X62O 3AK3A 4E2LA 4XDJA 4B3MB 3UO3A 3WFVA 4WFHA 2WPDG 1KB9F 1FXKB 2UXCB 4LC1A 2E76B 2N05A 1RM1B 3B77A 3C3SA 2Q0OC 5B1AC 3ZHQA 1HNWO 3CWBH 4L8JA 4U3FH 5B3SC 1GM7A 1H38A 3OGIB 3K03A 4FLTA 5LHIA 4EFBA 3N27A 1KKCA 4D7TA 4RO2A 4J7KA 5BY1A 3M7MX 2K1EA 2GSMB 1HP8A 3FB5C 4JTCB 5FNVA 2Q68A 2Y69B 1F4MA 3B40A 5CA0A 3SJBC 4RQEA 4LWSB 4MVQA 1XNQO 3K5MA 4FK5C 4X66O 1G1XB 1NBMG 1WLEA 4U3JA 2XAFA 1ENVA 2OCHA 1SQGA 1S5HC 4JI8B 2DQ3A 1WJZA 2LFRA 1Y6XA 5KX5A 1DK1A 1E79G 1K5SA 5IYDO 2YI9A 3C90A 4UCVA 3CXCU 4WFGA 4X20B 1NKDA 1KKDA 1Q8IA 4YJ2A 1SKVA 5JJEB 1HWYA 1KMIZ 1L8DA 4RAIA 4JF3A 2QM7A 2GUZB 1QHTA 4B08A 3B8NA 3VQVA 5LYJB 5ITZA 3EXAA 3ZMVA 3VQYA 5IJ0B 1XHZA 1P4RA 3I55V 4IHJB 2ILMA 1AROP 4TOIA 4K0KO 3F7YC 3K5NA 3CCLV 3KG2A 5IJ9B 3SPGA 4O4LB 4JZGA 4DR6O 3CJHB 3LNNA 2JIZG 3OEEG 1WB8A 3P30A 2P5OA 2ZR2A 5LOVB 4GX2A 2EIKC 2BSKB 4DUYB 1VQOV 1VARA 3CCUV 4DYLA 1SQBH 3CS5A 1ZX3A 1JJOA 1YVWA 2WLNA 1M5IA 4GKJB 2E74B 2NNUA 5JVDA 1DLBA 4YIOA 2RN9A 3I5DA 2VQEO 2B5UA 1PNLA 5EC2C 3HB3B 1D5NA 4OX9B 5B1AB 1K4CC 2UU9O 3GB7C 4BIUA 1SESA 5IY5C 4JAUA 4DUZB 3A0RA 5B3SB 2YEVB 1KP3A 2CTRA 4X1KA 2DMXA 2JDIG 1IBMB 3IGAC 4H44B 4NXNB 3E83A 1PV0A 2YDEA 1L1FA 3E86A 2R9AA 3ZMTA 2AZ2A 1XMQB 1AI4A 2GBOA 4PA7A 4HNAA 5KA6A 3H1LH 1YTFD 3ZCCA 1EBOA 3SR2C 1PL4A 4LFCB 2ZNJA 1A32A 1OCOC 1OCRC 1ORQC 2HG5C 1RFYA 4ZOLB 1RSOB 1L0NH 3DXRA 1R73A 1WN7A 2RCVA 1GN3A 1SRYA 1N4CA 2FL4A 2ZINA 1S5JA 1HNXO 4UV8A 2FKXA 4PA6A 1HR0O 4B7EA 3GVMA 3ZRWB 3DGEA 4EB6A 4QJFB 1BL8A 4DV4O 2IJIA 4I50B 4P2ZA 4F6RA 2X6BA 5JH7A 1XI1A 4LR3A 4CH4A 1XNRO 3ETDA 3SPIA 4JYCA 5DEDA 1FYJA 1XMOO 3CP1A 1SQXH 1H2LA 3RYHB 4ABMA 3WB1A 4FM1A 2QKCA 3TXSA 2XT9A 4KUMA 1Q86W 1H2GA 2DN9A 3K06A 3J7AU 1KQSU 3QO5A 3K57A 2CH7B 2HFEC 2KG7A 3P32A 2ADPA 2E75B 3M99B 3CRQA 4GT1A 3CMAV 4LNUB 4B3TO 2DWDC 3B2EE 5C8YA 1LR1A 2QWPB 2LGQA 2P7TC 4BR6A 1M90W 3HR0A 2WLHA 3B4SA 2EIKB 5HFMA 3R65A 1MSWD 4LF6B 1VF6A 1FXHA 1Q43A 4LWSA 3TCUA 3OD4A 1L0LH 4F4LA 4FVMA 3H1KH 2UUAB 1CPYA 2HVKC 4JI3B 4GX0A 4MSWC 1B04A 1XL4A 3OR6C 4GYCB 4I4TB 4JV5O 2F4VO 2QTOA 1Q6UA 5IY5B 2IJJA 1N36B 5D5PA 2DWEC 3K04A 3IFXA 3BVOA 1H8EG 1OJHA 2X6AA 2OCCC 1YTFB 2H8PC 5LYJA
chains in the Genus database with same CATH topology
4JYBA 2XOKG 5B1BB 4DXWA 4HAMA 3ZRSA 1Q82W 1G4YB 4R50A 5L3CA 4XDLA 5DM6V 1E1RG 3ZRVA 2BOBC 2UXNA 4MVSA 3WG7B 3OUFA 4PA9A 2EZPA 3AEIA 3OMAB 3G71V 2H94A 1OCOB 1OCRB 5H6QA 3ETEA 4QNHB 3FB6C 4EKWA 3ABMB 1V54B 2LP7A 1NJIW 5IDJA 1GTOA 4MTGA 4PDLA 4XBFA 3DTUB 4TWKA 3NXSA 4MS2A 1GM8A 2AHYA 4UUJC 3OFNG 1FXKC 3RW0A 3TETA 4QE7A 1W0JG 1QVFU 1E1QG 2P67A 3W7TA 3LDCA 1DTOA 1RM1C 2AHZA 1PD3A 5LGTA 1R3IC 4UVAA 1AI7A 4PDMA 4MW3A 3SYAA 3W7XA 3CCQV 2W6JG 1EFRG 2WAMA 3SYCA 1PKXA 5EBMC 2EIMB 3HPLC 1QR9A 1JX9A 1VQPV 1MOFA 3K0GA 4UV9A 4H37A 4FMTA 3TK1A 1VQMV 2JJ2G 4KP4A 4ASUG 1UJWB 2IJKA 4HYOA 3OW2U 3CCMV 3AG1B 2WLIB 1KD1W 4X88A 2QKSA 1M56B 1W2BU 4TT3G 5L3EA 3ZRXA 3STZC 1SZTA 2HR3A 3CCEV 4JAVA 3FKSG 1QCEA 2W6IG 3LNMB 3FB7C 2DYSB 1DF5A 3CC4V 1B6QA 2HKOA 3AG4B 2YSUB 3W7SA 4FPPA 3JD3A 5IYCO 4QPJA 3ABKB 1V55C 3K08A 4PA4A 3ML0A 5H6RA 2WLLB 4U7NA 3MD0A 5CMUA 3E2EA 3G4SV 1VQKV 3AG4C 1OHHG 3ASNC 3I56V 3CC7V 2W0FC 2OT5A 1S76D 1IXMA 3EFFK 2XAJA 1QBZA 2ZXWB 3LDEA 2Q67A 4PDVA 4ZBMA 3CCRV 2NLJC 2UXXA 3LSSA 1J95A 5E1AC 1FXVA 3W7WA 3SYOA 1KECA 2JK5C 3ASOC 2Q6AA 1M1KW 4CBCA 4LP8A 1QLEB 4JGSA 2WSSG 4MVOA 5EK0A 1OCZC 3AG2B 3FB8C 1AJNA 5CBHA 1VQ4V 4HZ3A 4P9OA 5B1NA 3EHBB 1QLEC 1S0VA 2QEXV 3STLC 1K33A 2ZDIA 1TUEB 4R6ZA 1WPXA 5LHHA 4BAYA 4Q20A 4JPRA 4X89A 3BY6A 1NR7A 1M57C 1CEZA 1G8MA 3ABLB 2ZR3A 2Y48A 4WFBV 2OCCB 1JOYA 2QE7G 1V55B 2LFSA 4MTXA 1XL6A 4BW5A 3CCVV 5L3GA 3ABLC 4MW8A 1F23A 4H33A 2WLMA 1Y66A 5L3FA 2IJHA 4WFAV 2B1IA 3CYOA 2JEXA 4DO2A 2WLLA 3UM7A 3E8BA 1JQ0A 4PELA 2X0LA 3UKMA 2P6JA 2HVJC 3LSQA 1YIJV 4X8AA 3SPJA 1PNMA 4E2LA 1QLNA 4XDJA 1NVPD 1K9MW 5EBWC 1GM9A 2JJ1G 2M7WA 3WFVA 4WFHA 2EZOA 2WPDG 1FXKB 2XAGA 2EIJC 4WFFA 2WLJA 4LC1A 4YXWG 1RM1B 3B77A 2EJRA 5B1AC 2ATKC 3E8FA 2EILC 3MHHC 1VQNV 4L87A 3OM3B 3JD0A 3SYPA 5IYBO 1LNQA 5B3SC 4QE9A 1KC8W 1GM7A 1H38A 2B1GA 3K03A 4KFMA 5LHIA 2DW4A 2HLDG 4LBEC 3SPHA 1COWG 4RO2A 1RPRA 1K4DC 2K1EA 2GSMB 3T4DA 5L3DA 1OZ0A 3FB5C 4P9PA 3ZIAG 4JTCB 1K7DA 1GO3F 2Q68A 2Y69B 2Z3YA 3LUTB 1F4MA 1Q7YW 4RQEA 3OGCC 1KP2A 3QNEA 1W0KG 4MT8A 4MVQA 2Y69C 3VBBA 3OMIB 4FK5C 1OCCC 2IU0A 1NBMG 1WLEA 3RVZA 2XAFA 1ENVA 2CK3G 1I5XA 4QIWF 1R6KA 1S5HC 1EZJA 2DQ3A 2LFRA 1Q81W 3OUSA 4P30A 3QO7A 1E79G 3ASNB 1K5SA 3SPCA 1H8HG 1GKFA 5IYDO 3JYCA 1AJQA 1PNKA 4CZZA 1JPXA 1S77D 3CXCU 4WFGA 1NKDA 1S72V 1RPOA 1R3JC 3RBZA 4RQFA 4PA3A 1KKDA 1FXKA 1K92A 1NH2D 4MTOA 2EBOA 1HWYA 3ASOB 3OAAG 5BZBA 4RAIA 4JF3A 2DQ0A 2QM7A 4U7OA 3B8NA 1OCZB 3E35A 4R8CA 3ZMVA 4WCEV 1P4RA 3T1CA 2DYRC 3I55V 3X2QC 2V7QG 3IC7A 1AROP 3CCJV 4JTAB 4G27B 2R9IA 3F7YC 3K3WA 4FJCC 3KG2A 3CCLV 3CCSV 1YI2V 3SPGA 3PJSK 1M57B 3B8MA 2QA4V 5GW7A 2JIZG 3OEEG 3ZMUA 2IW5A 5KUKA 3P30A 4UVCA 4RUEA 1R3KC 4N21A 1JJ2U 2ZR2A 2WLIA 4PDRA 5KA5A 4J9YB 5LBQA 1JCHA 4GX2A 2A9HA 3G6EV 4GX1A 5HFLA 2EIKC 1VQOV 2P90A 1THZA 2MK3A 1K73W 2X6CA 3FYEB 3CCUV 3W7UA 1P7BA 5DN6G 3BEHA 2FTKA 2V1DA 4WFEA 3OMNB 1VQ8V 1JVMA 2WLNA 3K9AA 5J9PC 2NNUA 4MVRA 4MVMA 5B1OA 1PL0A 2Q69A 1NQTA 1DLBA 1MG1A 3CMEV 3F5WC 2OTJV 1ROPA 3ETGA 2B5UA 4LCUC 1GK9A 1K5QA 2EIJB 4ZKIA 1PNLA 1K8AW 5EC2C 3HB3B 4G2KA 5B1AB 1K4CC 3JCZA 2EILB 3GB7C 3VOUA 1SESA 2GHYA 1FS0G 4BIUA 5IY5C 5LHGA 4JAUA 1YHQV 2BOCC 3A0RA 5B3SB 2YEVB 1KP3A 3MHSC 2A79B 4OXSA 2ZQMA 5KUMA 2JDIG 3H01A 3IGAC 5EC1C 2XAHA 3CD6V 3E83A 5B1BC 2D3OW 1K97A 1L1FA 1S3JA 2A0LA 3E86A 3ZMTA 2QM8A 5CA3A 1AI4A 4I5SA 3WG7C 4R7CA 4PA7A 5KA6A 4UXNA 3CC2V 3OR7C 2XNDG 2EINB 1YTFD 3ZCCA 5C93A 1EBOA 1OCOC 1OCRC 1ORQC 2HG5C 3ZN1A 3ZN0A 1VQ6V 2OTLV 3ABMC 1R73A 2EINC 5CBGA 1V54C 2IU3A 1R6NA 3K0DA 1BMFG 1OCCB 3JD1A 1SRYA 2XAQA 4UV8A 2X7RB 3JD4A 3QO8A 1QR8A 4PA6A 1VQ7V 3OEHG 3ZRWB 1NH2B 3DGEA 4QJFB 1AI5A 1BL8A 2IJIA 2F43G 3E89A 1K34A 4P2ZA 1BHAA 3E8GA 2X6BA 3RVYA 4JTDB 3ZMZA 1YSCA 3ETDA 1GMGA 5CN0A 2EIMC 1MABG 2ITDC 2C2AA 4JYCA 4MTFA 3SPIA 5CBFA 5LGNA 3CP1A 1VQ5V 2WWWA 1R3LC 4N23A 2ZDIC 4FIPC 3E8HA 4GX5A 5LGUA 4KUMA 1Q86W 4MVUA 5H9CA 1H2GA 4UVBA 3K06A 3AG1C 1YITV 1M9NA 3D36A 1M56C 1F4NA 2YEVA 1NR1A 1FFTB 3QO5A 1KQSU 2DYRB 4I9WA 2WLKA 3X2QB 1SETA 2HFEC 4TSFG 1BHBA 1SERA 3P32A 3AG3B 4G28B 1K3EA 4JASA 1QVGU 1YJNV 3M99B 4Z1MG 1AI6A 2IH1C 3SJQC 2DYSC 4GT1A 3CMAV 1YJ9V 3AG3C 1F51A 1DF4A 2JEUA 1AJPA 4QPKA 3FYIB 3ABKC 2DWDC 2ZD9A 3T2MA 2P7TC 1M90W 2WLHA 3GWOA 3K79A 2EIKB 1CP9A 1ZWIC 3ZJZA 2XASA 5HFMA 3R65A 4XDKA 1MSWD 2PI5A 1VQLV 2ZXWC 5EBLC 1FXHA 2HJFC 2Z5UA 3TCUA 5FL7G 1YJWV 1Y4MA 3JD2A 3T4ZA 4GCZA 3ABUA 3ZRWA 1NVPB 4F4LA 1I5YA 1CPYA 2HVKC 3D3IA 4MVZA 4GX0A 4MSWC 2ITCC 1XL4A 3AG2C 2PI4A 3LDDA 2KB1A 3OR6C 3CPWU 4BIZA 2IH3C 1VQ9V 1AR1B 5L3BA 2R9RB 2QTOA 3F7VC 3SYQA 5IY5B 2IJJA 1N8RW 4RUFA 3ZMSA 2DWEC 3K04A 3ABTA 3IFXA 3OE7G 1H8EG 2X6AA 2OCCC 4WF9V 4J9ZB 1YTFB 2H8PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHB A;  1BHA A; 
#chains in the Genus database with same CATH topology
 4JI5 O;  2FML A;  4JI1 O;  4DXW A;  1X4T A;  4FFB B;  4DV2 O;  5IJ0 A;  4R50 A;  4XDL A;  4FZ0 A;  3OUF A;  4GZR B;  2EZP A;  2ZT9 B;  1WAZ A;  2H94 A;  4AQY O;  1OCO B;  1OCR B;  1SQQ H;  3DC6 A;  3EVK A;  5B66 Z;  2VQF O;  4PDL A;  3C3T A;  1P7G A;  5JCO A;  4I7Z B;  2UXD O;  5LOV A;  2AHY A;  4FM0 A;  4UUJ C;  3OFN G;  3WB2 A;  1QVF U;  4UCR A;  5BR8 B;  5KHJ A;  5LGT A;  3H1J H;  3W7X A;  2AW9 A;  3CCQ V;  4DR1 O;  2ZE7 A;  3ZBH A;  2W6J G;  4JYA O;  1WNS A;  2XTA A;  3HPL C;  1JX9 A;  2CAZ C;  4OPA A;  4UV9 A;  4KP4 A;  2ADQ B;  1RP3 B;  1MSD A;  2IJK A;  4TV8 A;  3CCM V;  1KD1 W;  4DR5 O;  4BIO A;  4TT3 G;  3E22 A;  2ZNI A;  4X65 B;  3ZRX A;  2HR3 A;  1XEQ A;  3CCE V;  2E5L O;  2W6I G;  5K1P A;  3CC4 V;  1B6Q A;  2HKO A;  2YSU B;  3W7S A;  5JJJ B;  1AR5 A;  4TUY A;  5IYC O;  5H6R A;  4I9Q A;  2PY5 A;  3G4S V;  1OHH G;  2FB5 A;  3ASN C;  4D7S A;  1U97 A;  4LF4 B;  3QTC A;  1TGO A;  2W0F C;  1VP7 A;  4F6E A;  2Q7H A;  2EJ7 A;  1BZK A;  5IWA O;  3CCR V;  2UXX A;  5E1A C;  3ASO C;  1GN6 A;  3FFQ A;  2Q6A A;  4CBC A;  1W59 A;  4LP8 A;  4JGS A;  1N32 B;  3KZI Z;  1OCZ C;  4I50 A;  1XOU A;  1S0V A;  4Q20 A;  4IIJ A;  1NR7 A;  2ZR3 A;  1OV9 A;  5CA0 B;  2OCC B;  2CTP A;  4DV0 B;  4CC6 A;  4MTX A;  3ABL C;  4B3S O;  3OT7 A;  2P4K A;  4U3J B;  2WLM A;  1Y66 A;  2HP8 A;  3K59 A;  1WP7 A;  2UUB B;  5KX5 B;  2JEX A;  3E8B A;  2X0L A;  4LNU A;  2A7W A;  4X8A A;  3SPJ A;  1PNM A;  1QLN A;  1NT2 B;  1NVP D;  5KLV H;  2XHB A;  5JQG A;  2EIJ C;  1XDC A;  1I0H A;  3E8F A;  2AGA A;  1VQN V;  3SYP A;  3JD0 A;  4YY3 O;  2YIA A;  1LNQ A;  5ITZ B;  3JAT A;  4QE9 A;  1MZE A;  2B1G A;  2EX3 A;  4GUN A;  2JGU A;  3TXQ A;  1K4D C;  3T4D A;  3U11 A;  1OZ0 A;  4P9P A;  3G6B A;  1MA1 A;  2YI8 A;  4DV6 O;  1MZF A;  4MT8 A;  2FYU H;  2Y69 C;  4K3A A;  2AZ0 A;  1OCC C;  2IU0 A;  4JI7 O;  3P3N A;  1I94 O;  1DGS A;  5LMN B;  1F7Y A;  1EN4 A;  3ASN B;  3SPC A;  1QNM A;  4CH3 A;  4O2B A;  1PNK A;  5JVD B;  1S77 D;  4DR3 B;  1S72 V;  1R3J C;  2PF4 E;  4FLW A;  3ASO B;  3OAA G;  3A8T A;  3K5L A;  2DQ0 A;  4PHZ A;  4U7O A;  4JZ2 A;  1OCZ B;  3E35 A;  4R8C A;  1KUQ A;  4X1K B;  3IC7 A;  1FJG B;  1ZUQ A;  4G27 B;  2R9I A;  3PJS K;  4LH7 A;  1IBK B;  4HNA B;  3UT5 B;  2IW5 A;  4NXM O;  1R3K C;  3DXR B;  2QWO B;  4J9Y B;  5LBQ A;  1JCH A;  4ZHQ A;  1XHX A;  2LW1 A;  1AIL A;  4B3M O;  4WBN A;  5JCO C;  3F5T A;  2P90 A;  2MK3 A;  4DRX B;  4KXR A;  4CS4 A;  3W7U A;  2UXC O;  4WFE A;  2CGN A;  2VWK A;  1JVM A;  4EB6 B;  4X1I A;  1IDS A;  4F6R B;  5JH7 B;  1MG1 A;  2D2C B;  4UB8 Z;  2QDO A;  1HNZ O;  3CME V;  4H13 B;  1ROP A;  4PD4 F;  3ETG A;  5GON A;  1GK9 A;  2EIJ B;  2RNB A;  2ETN A;  2QKA A;  4NR1 A;  2UUC B;  2R72 A;  5LHG A;  3S3X A;  4DR2 B;  3RWR D;  1YHQ V;  2KSD A;  2BOC C;  2ZE5 A;  2Y4T A;  1WB7 A;  1N0J A;  5EIB D;  3MHS C;  4OXS A;  2A79 B;  2KG7 B;  1ZL8 A;  3H01 A;  5EC1 C;  4LFB B;  2XAH A;  3CD6 V;  1Y76 B;  4J10 A;  4NTW A;  2QM8 A;  1Q3E A;  3L70 H;  4I5S A;  1JR9 A;  2YUA A;  4R7C A;  3CC2 V;  3L72 H;  2EIN B;  5C8Y B;  4JI8 O;  1MMM A;  5LXT A;  4Z1V A;  4K35 A;  1JFF A;  3ZN0 A;  3ABM C;  4IYH A;  1V54 C;  1OCC B;  3CX5 F;  4C7U A;  3JD4 A;  3QO8 A;  4EEQ A;  2F1M A;  1AI5 A;  5KAF Z;  1BHA A;  3E8G A;  3L71 H;  4JTD B;  3ZMZ A;  4EFE A;  5H5N A;  4B3R B;  1YSC A;  3T1H B;  1GMG A;  5CN0 A;  4MTF A;  2YXL A;  2ZKO A;  4PV1 B;  3E8H A;  1XUQ A;  5LGU A;  3OTO B;  2L6L A;  3QVN A;  4UVB A;  1YIT V;  1FKA O;  1M56 C;  1TUB A;  1NR1 A;  3H1I H;  4I9W A;  1SA0 A;  1BHB A;  4TSF G;  4DV5 B;  4K8Z A;  4G28 B;  2Q9L A;  1YJN V;  3SJQ C;  4DUY O;  1N34 B;  1F51 A;  2JEU A;  1AJP A;  4QPK A;  2M6Y A;  3ZHR A;  3AK1 A;  2Q73 A;  2EUL A;  4NTX A;  4GKJ O;  3K79 A;  2XAS A;  3MDS A;  2PI5 A;  2Z5U A;  4QGP A;  5FL7 G;  1YJW V;  1Y4M A;  3JD2 A;  4OX9 O;  3T4Z A;  1XBL A;  3ABU A;  3H1H H;  4J7J A;  4CS3 A;  1I5Y A;  3RYI A;  4DUZ O;  2XUM A;  2VS0 A;  2ITC C;  3LDD A;  1HDJ A;  3CPW U;  4I55 A;  3KCY A;  1IBM O;  4Z2W A;  1EM1 A;  3ZHV A;  4NXN O;  4TV8 B;  4YJ3 B;  2OYQ A;  3ZMS A;  1Q6H A;  1XMQ O;  3ABT A;  2BCC H;  3E22 B;  4NYK A;  4LFC O;  4JYB A;  2XOK G;  3DC5 A;  4HAM A;  3ZRS A;  2F66 C;  5CB4 B;  2UXN A;  4MVS A;  4PA9 A;  4TUY B;  4J80 A;  3OMA B;  3G71 V;  1D2D A;  4QNH B;  2OIG A;  4EKW A;  3ABM B;  3UT5 A;  1V54 B;  1IBL B;  2A3Q A;  4XBF A;  4TWK A;  4MS2 A;  2UXB B;  1E1Q G;  3W7T A;  1FD9 A;  2DOS A;  5LMU B;  1PD3 A;  4PDM A;  4MW3 A;  2P4V A;  3NR7 A;  2WAM A;  5EBM C;  3D8C A;  1ZLZ A;  1O9G A;  3K0G A;  2JJ2 G;  1URF A;  4HYO A;  4DV3 B;  3VQX A;  4IIJ B;  2WLI B;  4X88 A;  1M56 B;  1H2N A;  5L3E A;  4JI2 B;  3STZ C;  1SZT A;  2IM9 A;  2YIC A;  5KHI A;  2Q0A A;  1P49 A;  2JS3 A;  1QCE A;  3K9S A;  1DF5 A;  2JGD A;  3AG4 B;  2F93 B;  3JD3 A;  3ZS8 C;  4LF6 O;  4QPJ A;  3K08 A;  3ML0 A;  1Y76 A;  3MD0 A;  5EYP A;  5CMU A;  1VQK V;  4AHC A;  3I56 V;  4FLX A;  3BA8 A;  3CC7 V;  2UUA O;  1SZX A;  4NTY A;  4JI3 O;  1S5L Z;  4TV9 A;  2PGG A;  5JQG B;  1QBZ A;  4JI4 B;  4ZBM A;  1FXV A;  2GV9 A;  3SYO A;  1KEC A;  2JK5 C;  1N36 O;  1LUV A;  1UPG A;  5EK0 A;  5CBH A;  3JAT B;  4LF5 B;  1SQF A;  4P9O A;  2QEX V;  2ZDI A;  4R6Z A;  5LHH A;  4ZI7 A;  1KYO F;  1CEZ A;  4WFB V;  1JOY A;  2QE7 G;  3RFR A;  5KMG B;  2LFS A;  3CCV V;  1US6 A;  1AVM A;  3H9V A;  4KL1 A;  1F23 A;  4KHP B;  2WA4 A;  4WFA V;  4DO2 A;  5BR8 O;  2WLL A;  4PEL A;  3UKM A;  5DEC A;  2HVJ C;  3BHP A;  4O2B B;  1EZV H;  1G6U A;  1MNG A;  1GM9 A;  2M7W A;  4WFF A;  3T1Y B;  1BS3 A;  2WLJ A;  4RWU A;  4AI8 A;  4DV1 O;  3FAV A;  5KHG A;  2EJR A;  3IJ4 A;  2EIL C;  3MHH C;  4L87 A;  3LSU A;  3OM3 B;  3R66 A;  3SJA C;  2QWR B;  3ZX6 A;  3JAW A;  4X65 O;  2DW4 A;  2HHH O;  2PTM A;  4FFK A;  4DR7 B;  3UQ8 A;  1COW G;  1RPR A;  2IBZ H;  5KHH A;  4FLZ A;  5L3D A;  5H2F Z;  1WA8 A;  3ZIA G;  4NB5 A;  1O9H A;  1YCI A;  1K7D A;  2VWJ A;  5JJN B;  3JAS A;  4YJ3 A;  3QNE A;  4ZHQ B;  3U0Z A;  3THO A;  4LF4 O;  1R1B A;  3D3Q A;  3VBB A;  4WBN B;  2CK3 G;  1I5X A;  1XRE A;  3J81 N;  3CEI A;  4UFZ A;  1Z5V A;  1Q81 W;  3OUS A;  4X9Q A;  4P30 A;  5CB4 A;  4X1I B;  1H8H G;  3JYC A;  1ZTE A;  4CZZ A;  2ZIO A;  2P22 C;  4X1Y B;  5GON B;  5IT9 N;  4LFA B;  1NH2 D;  3IC9 A;  4O4J A;  5K1X A;  5FLX N;  4W4K A;  2QJ1 A;  1ZL8 B;  1H2M A;  3X2Q C;  4DV0 O;  3CCJ V;  4JTA B;  4GKK B;  1GH6 A;  4FJC C;  4JI6 B;  3CCS V;  1YI2 V;  3A0B Z;  4LF9 B;  2YC0 A;  5B5E Z;  5LXT B;  2UUB O;  1NS1 A;  1ZSP A;  1JJ2 U;  1JFF B;  2WLI A;  4PDR A;  2OIE A;  3G6E V;  4GX1 A;  1SS3 A;  1THZ A;  1K73 W;  2H3O A;  1P7B A;  2CTQ A;  2FTK A;  2V1D A;  1BQ0 A;  1VQ8 V;  1AP5 A;  2Y4U A;  4MVR A;  4MVM A;  5B1O A;  1PL0 A;  4UB6 Z;  2Q69 A;  2PUS A;  2V4D A;  1NQT A;  3F5W C;  2OTJ V;  3L74 H;  4LCU C;  4J7Z A;  4ZKI A;  3MAQ A;  3JCZ A;  2EIL B;  2YIB A;  1FS0 G;  1TUB B;  4FLY A;  2JVD A;  3BAA A;  1SA0 B;  2ZQM A;  4DR4 B;  2D3O W;  1K97 A;  2A0L A;  2JS5 A;  5CA3 A;  3SJC C;  3WG7 C;  4H0L B;  2Q4P A;  4UXN A;  2K9P A;  4LH6 A;  5LMN O;  4JI0 B;  1IVS A;  4NVP A;  2OTL V;  4LF8 B;  2EIN C;  4UCU A;  1R6N A;  3K0D A;  4DR3 O;  5KMG A;  2X7R B;  2LQT A;  5JWP A;  4DV7 B;  4IGG A;  1NH2 B;  3RYI B;  1K34 A;  1D5A A;  2EIM C;  2ITD C;  4I55 B;  4D6T H;  1KU9 A;  5LGN A;  1FJG O;  1R3L C;  1CXZ B;  2ZDI C;  4J11 A;  4GX5 A;  1BE3 H;  4O4H A;  1IBK O;  3D36 A;  2JRI A;  1F4N A;  3RYC A;  3GWK C;  1FFT B;  2WLK A;  2RDC A;  3HKD A;  3X2Q B;  1SET A;  1J5E B;  4X64 O;  1SER A;  1M93 A;  3AG3 B;  1K3E A;  1EN5 A;  4JAS A;  1QVG U;  4Z1M G;  2DYS C;  5LP6 B;  3CSX A;  3FYI B;  3ABK C;  3VQW A;  3BAB A;  3GWO A;  3QF7 A;  1ZWI C;  2GDS A;  2MW2 B;  5J2U A;  1VQL V;  5TIS Z;  2HJF C;  3N2K A;  2CE4 A;  5IYZ A;  4GCZ A;  2CUG A;  1NVP B;  4IT5 A;  3HKC A;  2CTW A;  4DR2 O;  4MVZ A;  3AG2 C;  1TAE A;  2KB1 A;  1I7F A;  2LO1 A;  1AR1 B;  5L3B A;  3SDL A;  2HEP A;  3F7V C;  4X1Y A;  3BPZ A;  3CE2 A;  4O2A B;  2ZM6 B;  1N8R W;  4RUF A;  5EIB C;  2GTA A;  3OE7 G;  4LF7 B;  4J9Z B;  1V55 C;  1LUW A;  5LA6 B;  2DE0 X;  4J42 A;  2QGN A;  5L3C A;  2JGD B;  5DM6 V;  2N74 A;  3ZRV A;  3WG7 B;  2Q7G A;  3AEI A;  3ZHS A;  2QWQ B;  5EYP B;  5FPO A;  4OGQ B;  1N33 B;  4B7K A;  1WP8 A;  4Q6G A;  1NJI W;  3IAY A;  4YHH B;  4TV9 B;  4B3R O;  2BTQ A;  3T1H O;  4QE7 A;  1W0J G;  2P67 A;  1VEW A;  3HKE A;  2AHZ A;  3HKB A;  1HNZ B;  1R3I C;  4X62 B;  3SYA A;  3OTO O;  4TQD A;  3N2G B;  2EIM B;  3BRC A;  1QR9 A;  3J80 N;  4FMT A;  4DV5 O;  3TK1 A;  1HNW B;  1UJW B;  2VRZ A;  4ZI7 B;  1BCC H;  2Q5Z A;  1N34 O;  4UCO A;  1W2B U;  1NTK H;  2F95 B;  4JAV A;  3FKS G;  1QQC A;  3ETQ A;  3LNM B;  3Q4H A;  3FB7 C;  2DYS B;  2QTS A;  4FPP A;  3QG5 A;  3ABK B;  2WLL B;  4U7N A;  3AG4 C;  2PZS A;  1H2K A;  4JAA A;  1XNQ B;  4X66 B;  2CDY A;  1YZB A;  1IUR A;  1Y74 A;  1IXM A;  2XAJ A;  1GAX A;  3LDE A;  2Q67 A;  4PDV A;  2NLJ C;  3FAV B;  3CRM A;  1SQV H;  1M1K W;  4YIP A;  3RYF A;  1QLE B;  4MVO A;  4BWA A;  3AG2 B;  5EZY A;  3FB8 C;  3JAW B;  4DK0 A;  2RQ6 A;  2YIB D;  2OWO A;  1U96 A;  3S3W A;  3EHB B;  3STL C;  1AR4 A;  1K33 A;  4I0X A;  1WPX A;  2L35 A;  4BAY A;  1FPO A;  4X89 A;  3BY6 A;  1WA8 B;  1M57 C;  3BCC H;  1NZ6 A;  2A06 H;  3JAS B;  1XIL A;  1R6T A;  1V55 B;  3JAK A;  1QU7 A;  1XL6 A;  4K0K B;  5L3G A;  3KKY A;  4ZIB A;  2W0X A;  4MW8 A;  4DR6 B;  1IBL O;  5L3F A;  2UXB O;  3M8A A;  2O57 A;  2P06 A;  2AXT Z;  3CYO A;  1NU1 H;  3RGB A;  1JQ0 A;  5LP6 A;  1YIJ V;  2P6J A;  5A2Q N;  5LMU O;  2NR5 A;  1WPB A;  3JAM N;  1IX9 A;  5J2T A;  1K9M W;  5EBW C;  3JSN A;  2JJ1 G;  3ZHU A;  2EZO A;  5A9G A;  2XAG A;  4YXW G;  3AK2 A;  4O4J B;  2YXH A;  2ATK C;  3L73 H;  1AP6 A;  4DV3 O;  1FFX A;  2N04 A;  2LW7 A;  5IYB O;  3D36 C;  4FM2 A;  1V9P A;  1VF7 A;  2VQE B;  1KC8 W;  1SF9 A;  4JI2 O;  4KFM A;  2HLD G;  4LBE C;  1JA8 A;  3SPH A;  1N0N A;  2UU9 B;  1VMG A;  4NKG B;  2QR4 A;  1GO3 F;  2Z3Y A;  3LUT B;  1GN4 A;  1Q7Y W;  4O2A A;  3OGC C;  1FAF A;  1KP2 A;  3JAL A;  3SGI A;  1W0K G;  1ZAU A;  2KKW A;  3OMI B;  4GLX A;  5CA1 A;  3RVZ A;  2CGO A;  2WA3 A;  4QIW F;  5LA6 A;  1R6K A;  1EZJ A;  4JI4 O;  2Y0I A;  3QO7 A;  1Z2G A;  1T5E A;  1GKF A;  1AJQ A;  1JPX A;  1HNX B;  3P3P A;  1RPO A;  4JYY A;  4LF5 O;  3RBZ A;  4RQF A;  4PA3 A;  1FXK A;  1HR0 B;  1K92 A;  4MTO A;  4CH5 A;  2EBO A;  5BZB A;  4DV4 B;  3CB2 A;  5D5Q A;  1XQ8 A;  1XNR B;  4WCE V;  3T1C A;  2DYR C;  1XMO B;  2V7Q G;  3UO2 A;  2ZE6 A;  5BMV B;  3CXH F;  3N2G A;  3K3W A;  3JAR B;  3CHX A;  4KHP O;  1M57 B;  3APQ A;  3B8M A;  2QA4 V;  5GW7 A;  2PYL A;  5KAI Z;  3ZMU A;  1BQZ A;  5KUK A;  1BGY H;  4UVC A;  4RUE A;  4N21 A;  5KA5 A;  3G80 A;  2A9H A;  5HFL A;  4B3T B;  2X6C A;  3FYE B;  1JMK C;  3T1Y O;  5DN6 G;  3BEH A;  4O4I B;  3CRR A;  3OMN B;  1Z5W A;  3K9A A;  5J9P C;  1B3Q A;  5LL6 Y;  3APO A;  1TVK B;  3OTF A;  3B09 A;  1PM9 A;  2G38 A;  3CRC A;  4X20 A;  1K5Q A;  1Q5O A;  2LJ2 A;  5GTI Z;  1K8A W;  2F23 A;  1TA8 A;  4G2K A;  4DR7 O;  4O4H B;  3VOU A;  2GHY A;  1NTM H;  2YID A;  4FLU A;  5KHK A;  2GUZ A;  2QM4 A;  3RYC B;  4BW9 A;  1B06 A;  3HKD B;  3FX7 A;  5KUM A;  4JV5 B;  4IHJ A;  2ZCE A;  2F4V B;  4PI0 A;  1NI8 A;  1X59 A;  5B1B C;  2YS8 A;  1S3J A;  2Y0P A;  5IJ9 A;  4O4L A;  2ARH A;  3CJH A;  2BTO A;  3OR7 C;  2XND G;  3JCU Z;  3ZHT A;  1IXB A;  5C93 A;  2QWN B;  4JI5 B;  3L75 H;  4JI1 B;  3ZN1 A;  1VQ6 V;  4DV2 B;  5F2V O;  5CBG A;  2IU3 A;  1BMF G;  3JD1 A;  2BSK A;  2XAQ A;  5J2U B;  1QR8 A;  2KQX A;  3N2K B;  4LFA O;  4W4L A;  5IYZ B;  4AQY B;  3A0H Z;  3OEH G;  1VQ7 V;  1Y67 A;  3BA9 A;  5GTH Z;  3HKC B;  2F43 G;  4PI2 A;  3E89 A;  2VQF B;  4DV1 B;  3RVY A;  2UXD B;  1EN6 A;  2ZE8 A;  3ZED A;  1MAB G;  3AG7 A;  2C2A A;  5CBF A;  1VQ5 V;  2WWW A;  4N23 A;  1UFI A;  3PN1 A;  1SC5 B;  4FIP C;  1N32 O;  4GKK O;  4DR1 B;  4JI6 O;  4MVU A;  5H9C A;  2HHH B;  3AG1 C;  1M9N A;  4DW1 A;  4JYA B;  2YEV A;  4LF9 O;  2Q7E A;  2DYR B;  3FD9 A;  2HJD A;  5BXZ A;  3CRA A;  1AI6 A;  2IH1 C;  3O9O A;  4DR5 B;  4CH6 A;  1YJ9 V;  3AG3 C;  1DF4 A;  4J41 A;  3ICX A;  5E79 Z;  2ZD9 A;  5LP6 C;  3TJT A;  3T2M A;  2E5L B;  4ZOL A;  2YXY A;  1RSO A;  2B9Z A;  1GRJ A;  1CP9 A;  1PP9 H;  3ZJZ A;  4E4E A;  4XDK A;  2BTQ B;  2ZXW C;  5EBL C;  3RN4 A;  2Z0A A;  3HKE B;  2NN4 A;  3HKB B;  3ZRW A;  1GN2 A;  3D3I A;  2E3C A;  2PI4 A;  5IWA B;  4BIZ A;  2IH3 C;  3DSQ A;  1VQ9 V;  3TGU H;  2R9R B;  1H2S B;  5FNV B;  3K5O A;  3RYH A;  3SYQ A;  4TQF A;  4DR4 O;  4FLV A;  4IYI A;  2DJV A;  1YDX A;  4FZ1 A;  4UCS A;  4WF9 V;  2CH7 A;  4JI0 O;  1PPJ H;  5B1B B;  3Q4H B;  4LF8 O;  1Q82 W;  1G4Y B;  1E1R G;  1Q90 D;  2BOB C;  5FPR A;  1P84 F;  5BMV A;  3JAR A;  2ZIM A;  4DW0 A;  3JSL A;  4DV7 O;  5H6Q A;  3ETE A;  4YJ2 B;  3FB6 C;  3L9D A;  4B3S B;  2LP7 A;  5IDJ A;  1GTO A;  1Y74 B;  4MTG A;  2BE3 A;  3DTU B;  1Q6I A;  3NXS A;  1GM8 A;  3TET A;  1FXK C;  3RW0 A;  1NTZ H;  3G67 A;  1M4U A;  1IZ3 A;  3LDC A;  1BT8 A;  1DTO A;  1RM1 C;  4UVA A;  1AI7 A;  1YXB A;  3RYF B;  4O4I A;  1EFR G;  5EZY B;  2RJZ A;  3SYC A;  1PKX A;  4I4T A;  1VQP V;  1MOF A;  2LGW A;  4H37 A;  4I0X B;  1J5E O;  1TVK A;  1VQM V;  4ASU G;  2ODM A;  1VIB A;  3OW2 U;  4YY3 B;  3AG1 B;  1YF2 A;  2QKS A;  1HW7 A;  4K8X A;  2GTS A;  3JAK B;  4UCT A;  4DRX A;  1VF6 C;  2RMK B;  4AIL C;  4CS2 A;  4FFB A;  1I08 A;  2PYJ A;  4PA4 A;  3KCX A;  4DV6 B;  3E2E A;  4CC5 A;  3K58 A;  4DK1 A;  4PJ0 Z;  5J2T B;  2OT5 A;  1S76 D;  4JI7 B;  3EFF K;  2ZXW B;  1I94 B;  4HBN A;  1VF5 B;  3LSS A;  1J95 A;  3W7W A;  4A5U B;  4ICG A;  4OPH A;  1FFX B;  2ZM6 O;  3WU2 Z;  2WSS G;  1AJN A;  1YEW A;  1VQ4 V;  2QSA A;  2R70 A;  2UUC O;  2Q8V A;  4HZ3 A;  3BFR A;  4LF7 O;  5B1N A;  1QLE C;  3UCS C;  1KBH A;  1TUE B;  3U10 A;  4JPR A;  4X64 B;  3WB0 A;  4LFB O;  1G8M A;  3RT3 C;  1BSM A;  3ABL B;  2Y48 A;  5AG2 A;  3JAL B;  4BW5 A;  1SQP H;  1N33 O;  5CA1 B;  4H33 A;  4YHH O;  5IE9 A;  2IJH A;  3O65 A;  2B1I A;  4NXM B;  3UM7 A;  3A2F A;  3LSQ A;  4IL6 Z;  1AB3 A;  4X62 O;  3AK3 A;  4E2L A;  4XDJ A;  4B3M B;  3UO3 A;  3WFV A;  4WFH A;  2WPD G;  1KB9 F;  1FXK B;  2UXC B;  4LC1 A;  2E76 B;  2N05 A;  1RM1 B;  3B77 A;  3C3S A;  2Q0O C;  5B1A C;  3ZHQ A;  1HNW O;  3CWB H;  4L8J A;  4U3F H;  5B3S C;  1GM7 A;  1H38 A;  3OGI B;  3K03 A;  4FLT A;  5LHI A;  4EFB A;  3N27 A;  1KKC A;  4D7T A;  4RO2 A;  4J7K A;  5BY1 A;  3M7M X;  2K1E A;  2GSM B;  1HP8 A;  3FB5 C;  4JTC B;  5FNV A;  2Q68 A;  2Y69 B;  1F4M A;  3B40 A;  5CA0 A;  3SJB C;  4RQE A;  4LWS B;  4MVQ A;  1XNQ O;  3K5M A;  4FK5 C;  4X66 O;  1G1X B;  1NBM G;  1WLE A;  4U3J A;  2XAF A;  1ENV A;  2OCH A;  1SQG A;  1S5H C;  4JI8 B;  2DQ3 A;  1WJZ A;  2LFR A;  1Y6X A;  5KX5 A;  1DK1 A;  1E79 G;  1K5S A;  5IYD O;  2YI9 A;  3C90 A;  4UCV A;  3CXC U;  4WFG A;  4X20 B;  1NKD A;  1KKD A;  1Q8I A;  4YJ2 A;  1SKV A;  5JJE B;  1HWY A;  1KMI Z;  1L8D A;  4RAI A;  4JF3 A;  2QM7 A;  2GUZ B;  1QHT A;  4B08 A;  3B8N A;  3VQV A;  5LYJ B;  5ITZ A;  3EXA A;  3ZMV A;  3VQY A;  5IJ0 B;  1XHZ A;  1P4R A;  3I55 V;  4IHJ B;  2ILM A;  1ARO P;  4TOI A;  4K0K O;  3F7Y C;  3K5N A;  3CCL V;  3KG2 A;  5IJ9 B;  3SPG A;  4O4L B;  4JZG A;  4DR6 O;  3CJH B;  3LNN A;  2JIZ G;  3OEE G;  1WB8 A;  3P30 A;  2P5O A;  2ZR2 A;  5LOV B;  4GX2 A;  2EIK C;  2BSK B;  4DUY B;  1VQO V;  1VAR A;  3CCU V;  4DYL A;  1SQB H;  3CS5 A;  1ZX3 A;  1JJO A;  1YVW A;  2WLN A;  1M5I A;  4GKJ B;  2E74 B;  2NNU A;  5JVD A;  1DLB A;  4YIO A;  2RN9 A;  3I5D A;  2VQE O;  2B5U A;  1PNL A;  5EC2 C;  3HB3 B;  1D5N A;  4OX9 B;  5B1A B;  1K4C C;  2UU9 O;  3GB7 C;  4BIU A;  1SES A;  5IY5 C;  4JAU A;  4DUZ B;  3A0R A;  5B3S B;  2YEV B;  1KP3 A;  2CTR A;  4X1K A;  2DMX A;  2JDI G;  1IBM B;  3IGA C;  4H44 B;  4NXN B;  3E83 A;  1PV0 A;  2YDE A;  1L1F A;  3E86 A;  2R9A A;  3ZMT A;  2AZ2 A;  1XMQ B;  1AI4 A;  2GBO A;  4PA7 A;  4HNA A;  5KA6 A;  3H1L H;  1YTF D;  3ZCC A;  1EBO A;  3SR2 C;  1PL4 A;  4LFC B;  2ZNJ A;  1A32 A;  1OCO C;  1OCR C;  1ORQ C;  2HG5 C;  1RFY A;  4ZOL B;  1RSO B;  1L0N H;  3DXR A;  1R73 A;  1WN7 A;  2RCV A;  1GN3 A;  1SRY A;  1N4C A;  2FL4 A;  2ZIN A;  1S5J A;  1HNX O;  4UV8 A;  2FKX A;  4PA6 A;  1HR0 O;  4B7E A;  3GVM A;  3ZRW B;  3DGE A;  4EB6 A;  4QJF B;  1BL8 A;  4DV4 O;  2IJI A;  4I50 B;  4P2Z A;  4F6R A;  2X6B A;  5JH7 A;  1XI1 A;  4LR3 A;  4CH4 A;  1XNR O;  3ETD A;  3SPI A;  4JYC A;  5DED A;  1FYJ A;  1XMO O;  3CP1 A;  1SQX H;  1H2L A;  3RYH B;  4ABM A;  3WB1 A;  4FM1 A;  2QKC A;  3TXS A;  2XT9 A;  4KUM A;  1Q86 W;  1H2G A;  2DN9 A;  3K06 A;  3J7A U;  1KQS U;  3QO5 A;  3K57 A;  2CH7 B;  2HFE C;  2KG7 A;  3P32 A;  2ADP A;  2E75 B;  3M99 B;  3CRQ A;  4GT1 A;  3CMA V;  4LNU B;  4B3T O;  2DWD C;  3B2E E;  5C8Y A;  1LR1 A;  2QWP B;  2LGQ A;  2P7T C;  4BR6 A;  1M90 W;  3HR0 A;  2WLH A;  3B4S A;  2EIK B;  5HFM A;  3R65 A;  1MSW D;  4LF6 B;  1VF6 A;  1FXH A;  1Q43 A;  4LWS A;  3TCU A;  3OD4 A;  1L0L H;  4F4L A;  4FVM A;  3H1K H;  2UUA B;  1CPY A;  2HVK C;  4JI3 B;  4GX0 A;  4MSW C;  1B04 A;  1XL4 A;  3OR6 C;  4GYC B;  4I4T B;  4JV5 O;  2F4V O;  2QTO A;  1Q6U A;  5IY5 B;  2IJJ A;  1N36 B;  5D5P A;  2DWE C;  3K04 A;  3IFX A;  3BVO A;  1H8E G;  1OJH A;  2X6A A;  2OCC C;  1YTF B;  2H8P C;  5LYJ A; 
#chains in the Genus database with same CATH homology
 4JYB A;  2XOK G;  5B1B B;  4DXW A;  4HAM A;  3ZRS A;  1Q82 W;  1G4Y B;  4R50 A;  5L3C A;  4XDL A;  5DM6 V;  1E1R G;  3ZRV A;  2BOB C;  2UXN A;  4MVS A;  3WG7 B;  3OUF A;  4PA9 A;  2EZP A;  3AEI A;  3OMA B;  3G71 V;  2H94 A;  1OCO B;  1OCR B;  5H6Q A;  3ETE A;  4QNH B;  3FB6 C;  4EKW A;  3ABM B;  1V54 B;  2LP7 A;  1NJI W;  5IDJ A;  1GTO A;  4MTG A;  4PDL A;  4XBF A;  3DTU B;  4TWK A;  3NXS A;  4MS2 A;  1GM8 A;  2AHY A;  4UUJ C;  3OFN G;  1FXK C;  3RW0 A;  3TET A;  4QE7 A;  1W0J G;  1QVF U;  1E1Q G;  2P67 A;  3W7T A;  3LDC A;  1DTO A;  1RM1 C;  2AHZ A;  1PD3 A;  5LGT A;  1R3I C;  4UVA A;  1AI7 A;  4PDM A;  4MW3 A;  3SYA A;  3W7X A;  3CCQ V;  2W6J G;  1EFR G;  2WAM A;  3SYC A;  1PKX A;  5EBM C;  2EIM B;  3HPL C;  1QR9 A;  1JX9 A;  1VQP V;  1MOF A;  3K0G A;  4UV9 A;  4H37 A;  4FMT A;  3TK1 A;  1VQM V;  2JJ2 G;  4KP4 A;  4ASU G;  1UJW B;  2IJK A;  4HYO A;  3OW2 U;  3CCM V;  3AG1 B;  2WLI B;  1KD1 W;  4X88 A;  2QKS A;  1M56 B;  1W2B U;  4TT3 G;  5L3E A;  3ZRX A;  3STZ C;  1SZT A;  2HR3 A;  3CCE V;  4JAV A;  3FKS G;  1QCE A;  2W6I G;  3LNM B;  3FB7 C;  2DYS B;  1DF5 A;  3CC4 V;  1B6Q A;  2HKO A;  3AG4 B;  2YSU B;  3W7S A;  4FPP A;  3JD3 A;  5IYC O;  4QPJ A;  3ABK B;  1V55 C;  3K08 A;  4PA4 A;  3ML0 A;  5H6R A;  2WLL B;  4U7N A;  3MD0 A;  5CMU A;  3E2E A;  3G4S V;  1VQK V;  3AG4 C;  1OHH G;  3ASN C;  3I56 V;  3CC7 V;  2W0F C;  2OT5 A;  1S76 D;  1IXM A;  3EFF K;  2XAJ A;  1QBZ A;  2ZXW B;  3LDE A;  2Q67 A;  4PDV A;  4ZBM A;  3CCR V;  2NLJ C;  2UXX A;  3LSS A;  1J95 A;  5E1A C;  1FXV A;  3W7W A;  3SYO A;  1KEC A;  2JK5 C;  3ASO C;  2Q6A A;  1M1K W;  4CBC A;  4LP8 A;  1QLE B;  4JGS A;  2WSS G;  4MVO A;  5EK0 A;  1OCZ C;  3AG2 B;  3FB8 C;  1AJN A;  5CBH A;  1VQ4 V;  4HZ3 A;  4P9O A;  5B1N A;  3EHB B;  1QLE C;  1S0V A;  2QEX V;  3STL C;  1K33 A;  2ZDI A;  1TUE B;  4R6Z A;  1WPX A;  5LHH A;  4BAY A;  4Q20 A;  4JPR A;  4X89 A;  3BY6 A;  1NR7 A;  1M57 C;  1CEZ A;  1G8M A;  3ABL B;  2ZR3 A;  2Y48 A;  4WFB V;  2OCC B;  1JOY A;  2QE7 G;  1V55 B;  2LFS A;  4MTX A;  1XL6 A;  4BW5 A;  3CCV V;  5L3G A;  3ABL C;  4MW8 A;  1F23 A;  4H33 A;  2WLM A;  1Y66 A;  5L3F A;  2IJH A;  4WFA V;  2B1I A;  3CYO A;  2JEX A;  4DO2 A;  2WLL A;  3UM7 A;  3E8B A;  1JQ0 A;  4PEL A;  2X0L A;  3UKM A;  2P6J A;  2HVJ C;  3LSQ A;  1YIJ V;  4X8A A;  3SPJ A;  1PNM A;  4E2L A;  1QLN A;  4XDJ A;  1NVP D;  1K9M W;  5EBW C;  1GM9 A;  2JJ1 G;  2M7W A;  3WFV A;  4WFH A;  2EZO A;  2WPD G;  1FXK B;  2XAG A;  2EIJ C;  4WFF A;  2WLJ A;  4LC1 A;  4YXW G;  1RM1 B;  3B77 A;  2EJR A;  5B1A C;  2ATK C;  3E8F A;  2EIL C;  3MHH C;  1VQN V;  4L87 A;  3OM3 B;  3JD0 A;  3SYP A;  5IYB O;  1LNQ A;  5B3S C;  4QE9 A;  1KC8 W;  1GM7 A;  1H38 A;  2B1G A;  3K03 A;  4KFM A;  5LHI A;  2DW4 A;  2HLD G;  4LBE C;  3SPH A;  1COW G;  4RO2 A;  1RPR A;  1K4D C;  2K1E A;  2GSM B;  3T4D A;  5L3D A;  1OZ0 A;  3FB5 C;  4P9P A;  3ZIA G;  4JTC B;  1K7D A;  1GO3 F;  2Q68 A;  2Y69 B;  2Z3Y A;  3LUT B;  1F4M A;  1Q7Y W;  4RQE A;  3OGC C;  1KP2 A;  3QNE A;  1W0K G;  4MT8 A;  4MVQ A;  2Y69 C;  3VBB A;  3OMI B;  4FK5 C;  1OCC C;  2IU0 A;  1NBM G;  1WLE A;  3RVZ A;  2XAF A;  1ENV A;  2CK3 G;  1I5X A;  4QIW F;  1R6K A;  1S5H C;  1EZJ A;  2DQ3 A;  2LFR A;  1Q81 W;  3OUS A;  4P30 A;  3QO7 A;  1E79 G;  3ASN B;  1K5S A;  3SPC A;  1H8H G;  1GKF A;  5IYD O;  3JYC A;  1AJQ A;  1PNK A;  4CZZ A;  1JPX A;  1S77 D;  3CXC U;  4WFG A;  1NKD A;  1S72 V;  1RPO A;  1R3J C;  3RBZ A;  4RQF A;  4PA3 A;  1KKD A;  1FXK A;  1K92 A;  1NH2 D;  4MTO A;  2EBO A;  1HWY A;  3ASO B;  3OAA G;  5BZB A;  4RAI A;  4JF3 A;  2DQ0 A;  2QM7 A;  4U7O A;  3B8N A;  1OCZ B;  3E35 A;  4R8C A;  3ZMV A;  4WCE V;  1P4R A;  3T1C A;  2DYR C;  3I55 V;  3X2Q C;  2V7Q G;  3IC7 A;  1ARO P;  3CCJ V;  4JTA B;  4G27 B;  2R9I A;  3F7Y C;  3K3W A;  4FJC C;  3KG2 A;  3CCL V;  3CCS V;  1YI2 V;  3SPG A;  3PJS K;  1M57 B;  3B8M A;  2QA4 V;  5GW7 A;  2JIZ G;  3OEE G;  3ZMU A;  2IW5 A;  5KUK A;  3P30 A;  4UVC A;  4RUE A;  1R3K C;  4N21 A;  1JJ2 U;  2ZR2 A;  2WLI A;  4PDR A;  5KA5 A;  4J9Y B;  5LBQ A;  1JCH A;  4GX2 A;  2A9H A;  3G6E V;  4GX1 A;  5HFL A;  2EIK C;  1VQO V;  2P90 A;  1THZ A;  2MK3 A;  1K73 W;  2X6C A;  3FYE B;  3CCU V;  3W7U A;  1P7B A;  5DN6 G;  3BEH A;  2FTK A;  2V1D A;  4WFE A;  3OMN B;  1VQ8 V;  1JVM A;  2WLN A;  3K9A A;  5J9P C;  2NNU A;  4MVR A;  4MVM A;  5B1O A;  1PL0 A;  2Q69 A;  1NQT A;  1DLB A;  1MG1 A;  3CME V;  3F5W C;  2OTJ V;  1ROP A;  3ETG A;  2B5U A;  4LCU C;  1GK9 A;  1K5Q A;  2EIJ B;  4ZKI A;  1PNL A;  1K8A W;  5EC2 C;  3HB3 B;  4G2K A;  5B1A B;  1K4C C;  3JCZ A;  2EIL B;  3GB7 C;  3VOU A;  1SES A;  2GHY A;  1FS0 G;  4BIU A;  5IY5 C;  5LHG A;  4JAU A;  1YHQ V;  2BOC C;  3A0R A;  5B3S B;  2YEV B;  1KP3 A;  3MHS C;  2A79 B;  4OXS A;  2ZQM A;  5KUM A;  2JDI G;  3H01 A;  3IGA C;  5EC1 C;  2XAH A;  3CD6 V;  3E83 A;  5B1B C;  2D3O W;  1K97 A;  1L1F A;  1S3J A;  2A0L A;  3E86 A;  3ZMT A;  2QM8 A;  5CA3 A;  1AI4 A;  4I5S A;  3WG7 C;  4R7C A;  4PA7 A;  5KA6 A;  4UXN A;  3CC2 V;  3OR7 C;  2XND G;  2EIN B;  1YTF D;  3ZCC A;  5C93 A;  1EBO A;  1OCO C;  1OCR C;  1ORQ C;  2HG5 C;  3ZN1 A;  3ZN0 A;  1VQ6 V;  2OTL V;  3ABM C;  1R73 A;  2EIN C;  5CBG A;  1V54 C;  2IU3 A;  1R6N A;  3K0D A;  1BMF G;  1OCC B;  3JD1 A;  1SRY A;  2XAQ A;  4UV8 A;  2X7R B;  3JD4 A;  3QO8 A;  1QR8 A;  4PA6 A;  1VQ7 V;  3OEH G;  3ZRW B;  1NH2 B;  3DGE A;  4QJF B;  1AI5 A;  1BL8 A;  2IJI A;  2F43 G;  3E89 A;  1K34 A;  4P2Z A;  1BHA A;  3E8G A;  2X6B A;  3RVY A;  4JTD B;  3ZMZ A;  1YSC A;  3ETD A;  1GMG A;  5CN0 A;  2EIM C;  1MAB G;  2ITD C;  2C2A A;  4JYC A;  4MTF A;  3SPI A;  5CBF A;  5LGN A;  3CP1 A;  1VQ5 V;  2WWW A;  1R3L C;  4N23 A;  2ZDI C;  4FIP C;  3E8H A;  4GX5 A;  5LGU A;  4KUM A;  1Q86 W;  4MVU A;  5H9C A;  1H2G A;  4UVB A;  3K06 A;  3AG1 C;  1YIT V;  1M9N A;  3D36 A;  1M56 C;  1F4N A;  2YEV A;  1NR1 A;  1FFT B;  3QO5 A;  1KQS U;  2DYR B;  4I9W A;  2WLK A;  3X2Q B;  1SET A;  2HFE C;  4TSF G;  1BHB A;  1SER A;  3P32 A;  3AG3 B;  4G28 B;  1K3E A;  4JAS A;  1QVG U;  1YJN V;  3M99 B;  4Z1M G;  1AI6 A;  2IH1 C;  3SJQ C;  2DYS C;  4GT1 A;  3CMA V;  1YJ9 V;  3AG3 C;  1F51 A;  1DF4 A;  2JEU A;  1AJP A;  4QPK A;  3FYI B;  3ABK C;  2DWD C;  2ZD9 A;  3T2M A;  2P7T C;  1M90 W;  2WLH A;  3GWO A;  3K79 A;  2EIK B;  1CP9 A;  1ZWI C;  3ZJZ A;  2XAS A;  5HFM A;  3R65 A;  4XDK A;  1MSW D;  2PI5 A;  1VQL V;  2ZXW C;  5EBL C;  1FXH A;  2HJF C;  2Z5U A;  3TCU A;  5FL7 G;  1YJW V;  1Y4M A;  3JD2 A;  3T4Z A;  4GCZ A;  3ABU A;  3ZRW A;  1NVP B;  4F4L A;  1I5Y A;  1CPY A;  2HVK C;  3D3I A;  4MVZ A;  4GX0 A;  4MSW C;  2ITC C;  1XL4 A;  3AG2 C;  2PI4 A;  3LDD A;  2KB1 A;  3OR6 C;  3CPW U;  4BIZ A;  2IH3 C;  1VQ9 V;  1AR1 B;  5L3B A;  2R9R B;  2QTO A;  3F7V C;  3SYQ A;  5IY5 B;  2IJJ A;  1N8R W;  4RUF A;  3ZMS A;  2DWE C;  3K04 A;  3ABT A;  3IFX A;  3OE7 G;  1H8E G;  2X6A A;  2OCC C;  4WF9 V;  4J9Z B;  1YTF B;  2H8P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...