3SPCA

Inward rectifier potassium channel kir2.2 in complex with dioctanoylglycerol pyrophosphate (dgpp)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
327
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
total genus 89
structure length 327
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spcA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spcA01
2Q68A 3ASNC 5EC1C 3UM7A 4G27B 1P7BA 2HG5C 3PJSK 4OXSA 3T4DA 2IH1C 3AG1C 3UKMA 4JTDB 3VOUA 2KB1A 5EBLC 3JYCA 4MVQA 4PDLA 4I9WA 2WLLA 4J9YB 1OCRC 3SPCA 2YEVA 4RUFA 4XDJA 4F4LA 4TWKA 1QLEC 2IH3C 2WLMA 3ASOC 3ATFA 5IY5C 1LNQA 4JTCB 5B1BC 2P7TC 3VSQA 4R8CA 1OCOC 4J9ZB 3SPIA 2WLIA 1M57C 4JTAB 3AG2C 3AGWA 2K1EA 4P2ZA 3HPLC 1U4FA 2E4FA 4MVSA 2ZXWC 3OUSA 4WFHA 1KKDA 4X89A 3SYAA 3AG4C 5EK0A 3TETA 3SPHA 5B3SC 3T4ZA 2ATKC 4R50A 3FB6C 2QTOA 3K6NA 3FB7C 2Y69C 2DYRC 2R9RB 3F7YC 4RO2A 5E1AC 2ITDC 5J9PC 1XL4A 4HYOA 3T2MA 3K0GA 4MW3A 3FB8C 4MVRA 1OCZC 2W0FC 4MVOA 3IFXA 4LP8A 5EC2C 3ZRSA 2EIMC 2X6AA 2ZD9A 4PDVA 4RUEA 3SYPA 4WFGA 4PA9A 2HVJC 4QNHB 2WLLB 3SJQC 1OCCC 4PA7A 2WLHA 5BZBA 4QE9A 2EINC 4GX2A 4MS2A 2AHZA 2EILC 4MSWC 4P9OA 3ATEA 3SYQA 3RVZA 2WLIB 3K06A 4XDLA 5KUMA 3E89A 3GB7C 3ATDA 4R7CA 1M56C 1R3KC 2WLJA 3E83A 2WLKA 2AHYA 3LUTB 4EKWA 2DWEC 2OCCC 3K03A 2EIJC 1N9PA 1ZWIC 4X88A 4MVUA 2A79B 4R6ZA 3STZC 3SYCA 3ZJZA 1R3LC 3ABLC 3ABKC 3SPJA 3X2QC 2Q67A 3E86A 3RW0A 5CBGA 3E8HA 5EBMC 5CBFA 2X6CA 4LBEC 3TCUA 3STLC 4BW5A 5KUKA 4PA6A 3K0DA 3SPGA 3K08A 4GX1A 1K4DC 4WFFA 4LCUC 2GIXA 3AT9A 3EFFK 4MW8A 3OR6C 4WFEA 3F7VC 3IGAC 4X8AA 4XDKA 5B1AC 3FB5C 2WLNA 1V54C 3LDEA 2A9HA 4PDMA 4MTOA 1S5HC 2BOBC 4MTFA 1U4EA 4P9PA 3ABMC 4GX5A 4G28B 4UUJC 2HVKC 3OUFA 4P30A 2A0LA 4HZ3A 4KFMA 3LNMB 1XL6A 4PA4A 3AUWB 3E8GA 3KG2A 4PDRA 1K4CC 4MTGA 3RVYA 2ITCC 1JVMA 4RAIA 3F5WC 2EIKC 3WG7C 2HJFC 2Q69A 2X6BA 4GX0A 3T1CA 5EBWC 2Q6AA 1R3IC 3E8FA 1BL8A 3LDCA 4H37A 4DXWA 1R3JC 2DYSC 4H33A 2NLJC 2QKSA 4MVZA 2HFEC 1G4YB 3OGCC 4QE7A 5CBHA 3ATBA 3AG3C 3BEHA 3OR7C 1V55C 2JK5C 1J95A 4ZBMA 3ATAA 4MVMA 3E8BA 3LDDA 2BOCC 2DWDC 4PA3A 3RBZA 3R65A 3SYOA 3K04A 3AT8A 1ORQC 4CBCA 2H8PC
chains in the Genus database with same CATH superfamily
2WNGA 2QZ5A 2FD6H 3MRBA 5FO2A 4UZSA 2IH1C 1YJDC 5J06A 1QACA 4OH2A 2WXGA 1OAUH 3NACH 5DK0B 2AQ1A 4HWEH 5BV7H 2A6KB 1HEZA 1T1WB 1PG7H 2IBBA 5HVHB 5K1PA 2XDHA 3S5ZA 3OM3B 4JAMB 4LVOB 2WSPA 1Q3EA 1MJJA 5CJQH 3K46A 4QPEA 3ZYOA 1DQIA 4B3TO 1ROCA 1HU8A 3K5NA 3K81A 2BY2A 5AW6B 3WS3B 4ZI7B 2BHUA 4TF4A 5F1KC 4FPPA 4JFDA 3K2KA 5GZNC 1ROPA 5IJVA 1E5ZA 1KTDB 4IIQC 2YAHA 5L8KB 2NUTB 3IN0A 3WGUB 2Q3AA 4POYA 3LZNA 4MMXC 4ZOLB 3WFVA 3BT2L 4OB5L 5DURB 1R24B 5CHNA 1GYCA 3L5JA 2VR7A 5TE4H 5I6XC 5JPMB 4X64O 2FQDA 4K9EL 4BJLA 5CCKH 3LPOA 3DETC 3HHMA 2VLLA 4PJGF 5BMVB 3KPRD 3ENEA 5AG9A 3ARBB 3V0EA 3UO1H 2K8QA 1KPVA 2R8SL 3N85L 4ELMA 4YY3O 2BSTA 3TCLB 1E9OB 4K7PY 4ODSH 3GRWA 1RPOA 1F4AA 3SJCC 2Q7YA 1IQDA 3ZYIA 3VXMB 3X1NA 1JZDC 3KPPB 1K5SA 5T33L 1KYOK 1NOLA 1MUJA 2IPUK 4AYMC 3OWRA 4PJFA 1RVFL 2R2HA 4PRPD 7FABL 2LR4A 3FTXA 1SN2A 5C0GA 4JY6B 3O3EB 2ZINA 2NY0C 1KCSH 5AG2A 1BJ1J 3SDYH 5E9DD 4UM9B 4IS6B 2FH8A 4OCLC 1EH9A 3KPRE 4DF9A 1S5JA 4FFVC 1CI3M 2Z34A 3S5YA 5J2TA 4O9HL 5EO0A 3GMLB 1Y18A 5DYFA 4KKCC 1ZSPA 2LFSA 1XGRA 1R3HA 2WWKT 1TMCB 3ZVVA 4CW1A 4WTQA 3SCMA 4M7JL 4AMWA 4WUKL 3K5LA 1HN1A 5AW4B 1C5CH 2XWCA 3GKZA 5KOMC 3BAYA 2IO5A 4HXBH 1E8WA 4JDTH 1S9WA 4PRPE 1WTLA 2BERA 4L4TB 1O75A 2GJRA 4J3OD 4N85A 4WWKB 1FFNA 3QAZC 1HZKA 4DKEL 3RZCC 1RSOA 1EZVX 2B7DT 1GRWA 1UHVA 2PO6A 1N0LA 4JZNA 5E9DE 4EI6A 3ZHKA 2QQLL 4EJ1C 4H40A 2EYTA 2NRDA 4WV1B 1N7MH 4OFYD 4QHPA 3UAJA 4X6EB 2XNAB 2YEZA 4GUOA 1GZQA 1TVKA 1GC1L 5F7DA 4EUPG 4BZ2L 2ZXCA 4A2EA 3RQ3A 2ILMA 3CRMA 1JHTA 4JRYB 4XPGH 4L29B 1HX0A 2F74A 2GG1A 2HJDA 1D9KA 3GMQA 3ATAA 1OZUA 4O02L 5DEJA 1KJ3L 4GKKO 2YS4A 4NXSA 1QWHA 5AOKA 2ZICA 5GSRA 4PJXB 4P8QA 1BD2B 4R2GB 5K1XA 4Z7QB 4GG6F 4JTDB 3IGUA 5CJXC 4HSCX 4TQHA 3D85B 3JWOL 1DVFC 5IK3B 4XDJA 1RLWA 1KFAH 4H88H 1CXHA 1B0GA 4TT3G 2XWTB 1U8HA 4G6JH 5F0MB 2OMXA 2RN9A 3BHPA 3B8MA 4KJPC 4MDIB 1MJ7L 5DHDA 2KI6A 4JANB 4JKPH 1J8HA 5KVFE 3RFZA 2RDCA 5DQ9A 2ZOOA 4DNLA 2HSIA 3FB7B 1NLDH 2EYSA 1YEEH 1ADQA 5FB8A 4H8QA 1UA7A 1RZFL 1WC7A 3ZRCC 3ULVD 4GY4A 4TUYA 5E1HB 3KJ6L 1KD1W 4FXGA 2PTTB 3F83A 4MBRA 2ZNJA 1AQKH 3ETSA 4WTXA 3WKPA 1A1MB 2X09A 2XWDA 1HNFA 1T7VA 2B15A 2NY7L 2XT9A 2D2CB 3S4SA 3LTVA 2MSPA 1F3DH 5ADPL 1W80A 5F2FA 4M3JA 2W88A 3BPLC 8FABA 3DO3A 4L5FE 4I2XB 5CZVH 3HKBB 1X5ZA 2VR9A 4CNIB 1RD6A 5DVKA 2OYQA 3ULVE 3IFLL 5HHQB 1H2MA 1QLEH 3VXUA 5HGHB 4N26A 1CC3A 4ZTEA 4EFEA 3LQZA 1OPGH 3EJCA 2FMLA 4R96B 2ZKYA 4DV0B 3SDXB 1HHHB 3DV6B 4JG0L 1XNQO 2GPZA 3PV6A 2WW8A 1DJYA 1HNXB 5CJBA 4FQIH 1IO4C 2Q8AL 1ZWIC 1G7QA 1TPXB 1OHZA 2VDOH 2ZP0T 3H3BC 3KYMA 2O5YH 1IC7L 4IKJA 4XP1H 5BXFA 5HP5A 1UJWB 1BFVL 3SGJC 2IJJA 5FF6A 4UT9L 3NFNA 2FB4L 3G3LA 3HZ3A 1G84A 1FDLH 3AREB 5EU5B 3AWGA 3AWFA 4QRSA 4OSUH 2LFGA 1E65A 4X98A 4XXCA 1WBZB 4Y4HB 2GITB 2QGBA 4PIRF 3LEVH 2BW4A 3OZLA 4Y1AE 1E3XA 5FM4A 2PF4E 1MH5B 2F58H 2J88H 4OVUA 1BQLL 2BVUA 3MLVH 4F6EA 4P4KC 1X5XA 2EDMA 3TWCL 4QAMB 3WG7B 1FYJA 1KXTA 5CWSB 1HHKA 4GKOA 4OF3A 5CGYC 3BZ4B 2P8LB 1U93A 1VQ9V 1U3HD 1FL6B 1A4CA 4GQZA 1SZNA 5INDA 1JPGA 3H9SB 2FJHA 2ZG3A 4DN3H 1MZFA 3IDIB 4LASH 5CLZA 5IDJA 3QZWB 5CCJA 4YSSA 3CN1A 2GJPA 5I8OH 3GJFK 3WTTA 5DEGA 5GONA 2VIRB 2HT3C 2FZ3A 3QJSB 3POCA 4YO0A 2H8PB 4HIIA 5IREA 4U0RC 3SSGA 3ZZLA 1T7XA 4DUXA 1G9NH 1ZY9A 5I71C 2JIZG 2YJQA 1CD9B 3BMWA 3EOTH 3HMWL 2C1OB 1CYWA 3FBQA 2ZOKB 5INCB 1N34B 1MQ8A 2V3FA 3GBLA 2X4QB 3N40P 4HWZA 3VJ6B 4I5BB 2N0MA 4ZUUA 1ITBB 4PJDE 2NR6A 1TT6A 2FX9L 4DUZO 1H19A 2NY2C 1E9PA 2BSSA 4XBGB 5IEHA 4LMQI 3FYIB 5ES4B 2WZ5A 2FYYA 1FC2D 3D3VA 3WNIA 1TZIB 2Y0IA 3L81A 5IY5C 4WENB 2BDNH 5JOPD 2P7TC 2DM3A 3LPPA 3MLUL 1S7SA 3RIFF 2HYMA 4RMRA 2O61B 3VCLA 3LX9A 1KYUA 5DHMC 1KENL 3ZMVA 1IBYA 1T1ZA 1WEJH 1EHXA 1SFHA 3QUKA 3W7WA 5EC2B 1KACB 4PJXF 5HPMB 3BUBA 2VLRD 2NQCA 2Z3YA 1OTTD 3HG1D 4CSTA 5J9PC 1HCYA 4PS3A 1I85C 2XPYA 4NB7A 3ZUNC 4ALAL 1YMMA 3FB8C 4AC2A 5JOPE 1J0ZA 1U95B 1YEKH 4NENA 5JMOC 1J05B 1TLKA 4HMDA 4OLVL 2D0FA 3G71V 1BEYL 1HH6B 2OS7A 2N05A 1S2EA 2FSEA 3VI4F 4RZKA 3QYMA 1M2VA 4M6ML 3D33A 1IAKA 4LHUD 1THCA 5G55A 4FK5C 1FH5L 2UV3A 1FORL 1HQ4A 4HZLB 2A6IA 1V8HA 1BAWA 4QF1A 1I1AA 5IQNA 4F91B 2ESVE 3DGDA 3QIWD 2VLRE 4J3OH 2WINB 3TBCA 2GUOA 1IBBA 3HG1E 3B6SA 1L7IH 1W72B 2DICA 4AZUA 5BRZA 3CFDA 1DANU 1JNNL 2VC2H 4ZXBD 1E4HA 4XNYL 5GIRA 1YSCA 2NY6C 1GGBL 2BNRB 1DQVA 3KE0A 4KZDH 2CO3A 1DN2A 3MTRA 3KPOA 4HYTB 5LXTB 4NWUH 3FUMA 1H2KA 1NR7A 4MAZA 1XGQB 1A9BB 4NO3B 2G9KA 3QARA 1OCWL 2JKWA 2YIHA 1U8IB 3O6KL 4X0KA 5CZXD 2L35A 1BBDH 3TH4T 3A47A 1Z9NA 2KQNA 4P59L 3ZMTA 4A5UB 2I60L 4QY8B 2PY5A 1RJLA 2BC4A 3GFUA 4FG0A 4XOCA 3SDXF 1F1GA 2FEEL 4MJ4A 1XMEB 4HKBA 3VNZA 5EBWB 3KBPA 5KA6A 5HGBB 4OQTL 1NKGA 1NPJA 1RIHL 3Q2VA 5ESAA 1UM4H 5FYKD 1QG3A 4MTGA 1UWYA 5A16A 2OFQA 1FHGA 3S97C 4YGVA 3RVXD 3WUWG 4IOSA 6CGTA 2WTOA 4L5FH 1CLCA 4YR6A 3TV8A 4PTUB 4PS4L 5KMGB 1HKLL 3NFSH 4JKMA 2QJ1A 2FATH 2X1WL 4HIQA 1MOEA 1E42A 4MMYA 5CINH 1ORQB 4P5TB 4X2UA 3ULVH 1IX9A 3BKCL 4TYUA 2CM5A 5DCCA 4Q20A 2J71A 2Z92B 4XMVA 4DV2O 4PGCB 2H94A 4E5XA 5I5JA 3BEVA 4GS7B 5ACLA 2PMZA 1BPVA 4IRJB 1TQCC 1T0MB 1AGFA 5EC1C 4GSXA 5EUKA 4YHHB 3HLAB 5FYKE 2K8MA 5DRXB 4LF7B 3IVKB 2ZKMX 4TOYL 1DFBH 2DJMA 1C5DB 3S88L 5EBLC 1M57B 1F4XL 5F6HI 5IW6A 2P5WD 4Z3JA 3M46A 2QKIA 3SY0B 3EXJA 3D4CA 3WIHA 3B2DC 1SDYA 1QBML 4KFZC 4J6IA 5EYPA 2VWJA 4LFHG 3SPIA 4QIWF 5HFLA 4Q6IB 2Q76B 4S1QL 5IQMA 1U8QA 2R29A 4HJGB 5DJXB 4NHCL 1I4FA 2NUPA 2VDMB 1OZTG 4JHBA 5B66Z 4Q58C 4LSPH 4HISA 3WFHB 4BZ2A 2B0SL 4ORGB 5EIQA 3VFVA 1YEHH 4BWTA 1NWOA 2XPGB 2ODHA 2P5WE 5GISL 5KVDE 4BQCA 2BOBA 2ZWZA 3O6FC 1T5WB 1QRNA 2F95B 3QFJA 1EANA 4FKEA 4HZAA 5CMAB 3G6BA 2NX5A 2VNCA 3BP6A 1J1OL 3A6BL 2CJTA 4Z7VB 5TF1L 3CFEB 3DRTB 3RIFK 3MOQA 2HJKB 4OZHF 3EDJA 2SODB 3BIAX 3RTQB 4C56A 4NAMA 2ADIB 3LOWA 1DQMH 4JI0O 1W6LA 5KYYB 1DQJA 1WFNA 1Q9LB 4KO5A 4BFGA 4Z76B 3W82A 4NFBA 3IETA 5TISZ 4F58H 1OAZL 4BK4A 5DJ2A 4FLSA 3MA7B 2JKIS 1KV3A 1NAML 1UOLA 1MFCL 4K15A 4RA3A 4X83A 1VQ8V 3I5DA 4C54A 2W38A 2VL5B 4L37A 4RQQB 2OR7A 1RMFL 2GQHA 4JFQB 3E86A 1LMIA 4OJCA 5C0BA 4PG9A 1KNOA 2LABA 5D5ME 2LOEA 4YEFA 3BPNC 5ALBH 3GMMB 4PMEA 4I0KA 2LU4A 5GS2D 3L8QA 3NN8A 3V6OC 2KZKA 1DTOA 2EDKA 3HHRB 3AUVA 3OJVC 2VZ1A 2A4EA 4G3YH 1GAFL 5I0WA 5I6OA 5A2CA 4WDIB 2ZX8A 4IIJA 2QTVA 1F45A 1DSFH 4JUTA 2NLJB 1NFAA 4XNZC 3NXSA 5IB1B 4HX1B 3GMRB 3FH5A 4XX1E 3WL9B 1RHFA 5M94B 1CXZB 1IGYA 1XHHA 3VI4E 2YD8A 4E2LA 1KLUA 2NQDA 4JHZA 3QDMD 2CZNA 2PYED 4FNSA 1OGSA 3OB0H 3A6OA 3CZFA 4JPSA 3I74A 5EN2A 4UT9A 3T77B 1DANT 1KB5H 5KAQF 5D8JL 2KPWA 2X4RA 1JZ4A 2O26U 2Q3ZA 2PXYA 3JWNE 1VKXB 2C3VB 4H1LA 5C07B 2IFFH 3PWJB 4KI5F 5KS9F 5DHYB 1HZLA 3MUGA 3T1HO 5JLZB 5IMKB 4Q6YA 3P30A 3V4PL 3VXTB 4HIXH 5ID0B 4HXAL 2YEVA 1G9MC 1KGYE 3FT4B 1T2JA 3QDME 2BSEA 3VI3B 2YC1A 2Z93B 2PYEE 3NGBB 3JD4A 1SYSA 2PWDA 4K8RC 3N55A 4G5ZH 3ESOA 1T5EA 5LGTA 3CC2V 1ZOXA 4MVSA 4OF0A 1AVAA 4ZAKD 5FLUA 1GTOA 2QHRL 3KNBA 35C8L 4A7VA 5ID1A 3OT7A 2F5BL 4A04A 4ZX4A 5BY1A 1Q0YH 2PUQT 5DGQA 3RUGA 1WQVT 1JPTL 1NC2B 3SJVD 3MRRB 4F7PB 4M5ZH 1J86A 4YZFE 5CIPH 1ZHNB 2DI7A 1RIUH 3T6VA 4G72B 5BW7A 5D4JA 3KZIZ 4RMUA 2EILB 4J8RA 5FK9A 2O6FA 1G7JA 4I4WA 3Q5TA 1LO0H 4NSKB 4WK0B 5LBGA 1QSFD 5C3LD 4P46A 3MCKA 3OAUH 2P9RA 4GOSA 2C3GA 4NPYB 3UTOA 3A4AA 3MFFA 3LS4L 4OGXH 1IRAY 1QEXA 3OEEG 3L3DA 3QJVB 2ICEB 4JKWA 3AY2A 1ZLWK 5DUPH 5IESH 2Q4PA 1Q9OA 3OKKB 3QHTC 4N20A 5JNYA 2ZPKL 3PNWB 5I2IA 2VWEC 1FNHA 1YEFH 1NEZB 3RVTC 1JZHA 3SJVE 1A7RH 1A64A 3ZE2E 2AW9A 1XVSA 2MCMA 5H94A 4E42A 5HGAB 3QIBC 1RFDL 5IQ9A 5J8OA 1F2QA 3WJMB 1U8MB 2UY7B 3WTXA 1QSFE 3X2QC 3SR2C 2NR5A 4W6XB 1JZ2A 5IVZB 2XVGA 3RNQB 3MLXH 3QNFA 3ZHVA 1Q0XL 1K4DC 4RWYL 5F0PB 1FXVA 1J5EO 3AC0A 4J2QA 4U6VH 5D7HA 1NFDE 3QO5A 1T21A 3VVVA 1JOYA 4PPTA 1QQDB 3E2HB 2G3ZA 4MA1B 5KVDH 1QBLH 5E08H 1R3LB 4PJHB 2A0LA 5EU3A 3RFRA 2CK3G 1MZEA 1WN7A 3MBEB 3BSZL 1SQXH 1Y67A 4ZJ9A 5I6KA 1OQXA 5ISZB 2VKXA 2J2ZA 3ARFC 5C8JA 5HI4C 3VQ2C 2Q6AA 3FB6A 4HUXB 1R6VA 3DPBB 3MRPB 4AC4A 2VQUA 3PPSA 3DXRA 5IROD 4WF9V 1DJSA 1JRHI 1XR9B 1PQZA 2Y2YA 1NI8A 4OZHE 4YHIA 1XEDA 4S1DD 1N64L 4DTGL 2H2SC 2NSXA 2JIXD 2H1LM 4P23A 1JGUL 4N0UB 5IUCA 4N3TA 3MCG1 3NK4A 4GRWE 5T1LD 3WN6A 5BVPL 2EO9A 2OA9A 4HKZA 2P06A 1OARH 4OGYL 4DP8X 1JK9A 4APQB 3M8OH 5SWQA 3I2CH 1UACL 3GSVA 2BWQA 3WO4B 4I9WA 1H9VA 2BCMA 3HC3H 4MNQB 1UB5A 1VGEH 3ZO0A 2H0JA 1Z2KA 1X5KA 3MX0B 4O2AA 1TKWA 2DAVA 5GSVB 4JZJB 4DW2L 2WLIA 1VQ7V 4F3FA 2BM3A 4FZEL 3CH8A 3SO3B 4Y9GA 4Z1PA 3TM6A 3X1EA 3D2UB 2HPTA 5IWLA 4I0CC 4JQIH 4J4PA 2VABB 3V7AG 4HOWA 1JOIA 2NXYC 1LO4L 2R69H 5JJJB 3MRDB 4AJWA 4WJ5A 4OFQA 3W11D 3TF4A 1AQ8A 1R34A 2AXFA 2C3XA 5CMUA 4G6ML 1FJGO 3K4DA 4JQXC 2ZJSL 3QCVL 4HIJB 4OZIA 5TE6H 4YJZL 3VI3F 1IZKA 4PDVA 3SE6A 1UZ8B 1E9QA 3IDYC 3W37A 4XB3A 1YC7A 3TJHD 4LC1A 1LE9B 2HT2C 3WJLC 5LHDA 4IBWA 3QDGB 4CL7A 2QSVA 3DX2A 1ZDQA 1W0VA 2GBVA 4GAJL 1OLLA 4JM2C 2XWBB 4HG4K 2TRHA 3MOBL 1S77D 1MG1A 1WA0X 5DU7A 4DK3A 2EIJB 4DP1X 4U6XB 3H01A 3ECUA 1QBZA 1NDTA 3PWPB 3IDNB 3EGXB 3HE6B 5ICZB 5FYJU 4NXMO 4RGMB 5KS9E 3DO7A 2I32A 3MBXL 4K8XA 5BCAA 3DIVA 1X4TA 3HCVA 1BXVA 3P3UA 3WNOA 4K94L 4CADB 2AJSH 3CSTA 4FQLH 2OMBA 4L1LA 2HPOA 4O5LH 4FNPA 1RHHA 4UDUA 1E5AA 5D1ZC 1WA8B 2FTKA 4LBEC 3PHOB 3SKNB 4D3CH 1LEKB 3JSLA 3O9OA 3O3DA 3K1KC 2YDEA 1J0IA 5GRUH 1XTLA 3GIZH 4TNEA 1SDDB 2VLJD 1NC4B 2AZAA 2GTAA 3JARB 2Y1AA 4G80A 3DC6A 3O2DA 4X7TA 5ACMA 3E35A 1AE6L 1OSEA 3IJ4A 2HA1A 2WUBH 4OR1A 2Q9LA 2A4CA 1ZSDA 2ITFA 4D8PB 2V9RA 5H35A 4F20A 1INQB 5HDRA 3T8XA 5E7BA 3KL0A 4FHKA 1BFOB 2Y6TE 2CBOA 5JDJA 3P77A 5F7WC 1I1RA 2I9LA 2YAMA 4I7ZC 4DHLA 2F53D 3U83A 4Z7OB 4F92B 2YPVA 3FU9A 2EDJA 2VLJE 1KCRL 3BHBB 2VAAA 3TBVA 3GXIA 1I8IB 1PYWB 4M8UA 4E5XG 3ABZA 2HTLD 4BFJA 1NCCL 1OK0A 1CDGA 1OAJA 1T0OA 3EJYC 1I5YA 4XODA 1YNTA 3WNLA 1ZLSL 4LSSH 4PJHF 4TSCL 2CK0H 2ITCB 4HC1H 2GI7A 4JZOA 3PDOA 1YMHB 5KG9B 2HKFL 2Q6WA 4BSWB 4NRYA 1CBJA 3D18A 3KR3L 4ZTPH 3VGBA 2QPFA 4OT1H 1M93A 1CL7H 2F53E 1F4NA 4TV9A 1EFXB 3NJFA 3HVDA 4R26L 4GAYA 3QA3A 4JFZH 4MX7A 3LNHA 1LE5A 1Q38A 5FUCE 5FW6A 4GQRA 2HG0A 3B9DA 5EH1A 3VTAA 3TZVA 3EBAA 3L1GA 4OKVB 1PV0A 3QUGA 4HFWA 4Q2ZA 3MUHL 4MB3A 5JYMA 2AJVH 3IMRA 3KJ4B 4W9IC 1Y07A 2XTSA 3AITA 4XAWH 5JJEB 1F90L 2VJXA 3KG5A 1IEBB 2RB8A 4ODUB 4YPGB 2EVFA 2VLKD 5EO1B 1DUYB 4JRXB 5J6SA 1S5HA 2UYLB 4KITB 5I26A 4LL4A 3LY6A 3ZTJG 4ZQKB 3GC3A 1PP9H 1PZSA 3EH3B 3MV8A 1PY9A 1DJXA 3I3DA 5DJ8A 5EO9B 5C09D 4HHGA 3LZOA 3QIUD 2MPVA 4L8CB 4ANUA 4AVKA 5E8DH 1EHAA 3N2GA 3BVNA 1ASPA 4DW0A 4BR6A 12E8L 1QUPA 1YVWA 4GRWH 3H42H 2X9WA 3PGFH 3D34A 1IKFH 5D2LE 5C3IA 3K3WA 3IXAB 4PJ9C 3BQVA 4JHWH 5F9WB 2VLKE 4Q7DA 1SXZA 1M56C 2A9ML 3NCYS 1T89A 2GJ6B 2BY0A 2AV1B 3HS0B 4K71B 2J43A 3W81A 1N0XH 4H4NA 5CD5C 3IJEB 4HIHB 2D3NA 4M48H 5D7IE 5IYDO 1OT1A 1E2ZA 4X8GA 1A6WL 1AP2B 2Z31A 5C09E 3BFRA 1YNLH 1TR7A 1PX4A 2IPTH 2YSTA 5D1XB 1XCQA 4NP4L 3TOPA 2FX7H 5LGNA 1IM9A 2QSQA 5HD8C 3S34H 2IDQA 1IKOP 4WZ9A 4P9PA 5I6MA 2OQJB 2VDNB 4DR6O 1OOWA 1SC5B 4OLUH 5FECA 1J88A 1CICC 4ZMLA 2ZSWB 1CFQB 4FQHA 1JV2B 3P0GB 2XLLA 3NZ8B 4MCZA 4P5KB 3TT1L 4PGJA 1AJNA 1Q72L 1V55B 2HRGA 4PLJD 4JM4H 4AL8C 1CLZL 5DMKA 4DPBX 5JIKA 2MHAB 3MV9A 5BRQA 2FEDD 3Q3GA 4OZGE 1SA0A 1V5JA 3WN5C 5MEQB 3B9KB 1ZMYA 1RZIB 3LZPA 5HGDA 1UQSB 4JR9H 4FLVA 1XF3A 4H1LG 3I55V 1HOCA 1LO5B 4O00A 5BZXA 2N0KA 2W07A 4NGHL 1U96A 2EADA 1MCRA 1NBQA 2YXMA 2YXVA 3QNZB 4NBYB 5DJAA 5DJZA 3HFML 3ZMEA 3WUZA 4XMZA 1MVUA 4GKJO 4KK8D 2BJML 5I1LA 4Z7OF 1ANUA 2XPZA 3EOBA 3WD5H 3UP6A 2LW1A 4X62B 2BHZA 3HNVH 2R56H 4KTEL 1MJ8H 3ZKSD 1CXLA 4GBXC 1WLHA 4PVBA 5LWYL 3EOAB 2K6WA 2MRYA 5CEXA 5DO2C 2FO4B 4JKKA 4JTAB 3HR5A 3L4TA 3OKMB 1BX2A 2XN9D 1I7RA 1WPCA 4TVPD 1RPRA 4EIGB 2IBGA 2AXHA 3TBWA 4D0DB 2DQIL 3KGUA 4AYEC 3BYTA 4JV5B 2EDFA 3K2UL 3FOMA 1INEL 4LCIL 1IC5H 3HB3D 5FUOH 3EGSB 3HBPA 3QJUB 5TDNA 4MJ5A 4JFYB 3BZFB 5K33A 1JGIA 3QXDA 5DS8A 2NNFA 3FPXA 1GZPA 2Y7NA 3FT1A 4PJFF 3ZDYB 1YN7A 4H44B 3RWFA 4Y2LA 2OW6A 4FQJH 1DVYA 1A4AA 2OZNA 2OCJA 2XN9E 3K8MA 4W70A 4FFZL 4BH7A 5A40E 2BSKA 4TVPE 1U8JA 3Q1SL 5A2FA 3EYQC 3IF1A 4W9CC 4ZX5A 1SF5A 1KN2H 3RU8H 3C60B 1YY8A 3GEWB 3A3YB 4XCNA 4QXVA 1DBML 4TSAL 1D5XB 2AJXL 2P5OA 4FDWA 4PM1A 4WWOA 3FUIA 1P4BH 3HKCA 2ZE6A 1CPUA 2I7SA 3II1A 3MGOA 4PJBB 4DT2A 1JCVA 2X4SB 5FO8B 3E8HA 1Q94A 1TSHA 3WEAA 4CMMB 5EZJA 2OJEA 3B9AA 2GIXA 4NUGL 1U8OB 2YGPA 5DZAA 1BAFH 2LLLA 5B1AC 3RJOA 3ZMNA 2CGRL 4EUPH 4MAUH 5T1KD 5KBDA 2BTOA 4A2FA 2GV9A 4R4BB 1HP8A 3RB7A 3P4OA 2LGNA 3B2VL 4W4OA 4NDMB 4H25B 4U3HA 2P47B 3RY5A 2DQJH 1WWWX 3K57A 2OX5A 2V2XB 2X0VA 5G5DB 1SQQH 3MBWA 5G2NA 5LOVA 2CXGA 3KWWA 4G1MA 3VD7A 4HPOL 1DL7H 3WNPA 3TT3H 4AG4L 5KHJA 5E70A 3GMNB 1YYMH 1IAIM 3NA9L 1JPST 3NPZB 4PCYA 1AHWA 3ZT7A 4DKAA 2E9WA 2EEDA 2Z65C 3CSYA 1KTBA 3GXNA 2OMZB 1CT8A 3OHXB 4DYLA 1UA6L 4HCGA 3DROB 3Q2NA 4O4IA 4IHJB 3A6CH 1HVXA 3UAFA 4JI1O 1WH0A 4KXCA 4TUJB 3JD2A 2W91A 4Y5XC 3C6LD 2BY3A 3GM8A 1IFGA 3MLZL 4OZFA 5F0JB 4ZTOH 5A2JH 4RUFA 2QADC 1AYOA 1XR8A 3BN9C 1Z2GA 1HK6A 4WEBL 1I7TB 2V8LA 1A6AB 1BM7A 3F65A 1EJFA 4RWHA 3FN0H 1G43A 2H3KA 2KLSA 3UT5B 1D5NA 3BPOC 3CDZA 2D9QB 4KHXL 3TEXA 5KYUB 2VR6A 5L3GA 4X5WA 2Y5TB 2HMID 4P2ZA 1I94B 1NIBA 4GW4A 4JFFB 3PGCB 3BAWA 4ONFH 5I30L 1UJ3A 3D06A 5FCUL 4GKZA 1FH2A 1SOKA 5TK4A 2F1EA 2YRBA 2NNAA 3ZMUA 3ISWA 3UTTD 4B7IA 1L0LH 5L9DL 2X7LA 4LCUA 5KW9H 3KXFE 3OZ9L 4HLZG 2GT9A 4KJQC 4HS6B 4LFHD 5E00B 3BVWA 4F33B 2WVUA 1D2OA 4YFDB 3T4AC 2H9GB 4B3RO 2N56A 1X9RA 2VXSH 3KVQA 4JE0A 1ZE3H 4YFLF 1KY6A 4B3EA 3GSNL 1AGEA 4JFDD 4Z8FL 2WCPA 3CBRA 1G7HB 2Z4TA 3CDGA 3IT8D 1VQ4V 2V4DA 1QVFU 4LFCO 1NGWA 2X70B 4ZFOL 3FQNA 5DT1H 1YCSA 1JV5B 5JCOC 1PS3A 3EIFA 4MS2A 1IURA 4X6BB 2WIIA 4CSPA 3UTTE 4AITA 2VXQL 3GXFA 2UXDO 2EDYA 3RVZA 4NQVA 2V17L 3IJ9A 4PJIB 5IOPA 1ZCRA 3GPEA 1EK3A 4GP5B 2DQHH 4TRPL 2DIEA 3REVA 4NLAA 4EVNA 3ISRA 1H3PL 1SHXA 4I3RL 4JFDE 4Y2DA 1P4RA 1O5PA 3VFOA 3ICXA 3WKYA 4D7BA 4HJ1A 4YSQA 1ZGLM 3ZDYF 2HT4D 3PP4L 1NGYB 1S8DA 4KY2A 4MSWB 1TYRA 2Z8VC 2IH1A 1RK1B 3OKNB 4KKAC 1MNUH 5L2KD 4XXWC 1CQYA 4AQAA 4DGWC 4DP5X 1RZJH 3FQ4A 2DBLH 3JT0A 3UIYA 5CFHA 3EJSA 5KJRL 1P6AB 1YDXA 4IU3A 4AQ1B 5KSUA 1NINA 1S7RB 4JGUA 3ZDZE 4ELME 1AR1B 3RWCB 3GSXA 4ZUTA 4NO0A 1P2CA 4D9LH 2F61A 4OTXL 3P9LB 1F00I 4PJBF 3SCMD 5E24E 2WO4A 4HUUB 1QFWM 1HL5A 4W93A 4R3SB 5GZNA 3T3MF 1FL5A 4PJFE 4LEXH 2K4AA 4IIQA 4O02B 3VU1A 3WIAA 1HHGA 1MCOL 4TVPH 4MVZA 3WSQH 3WEMA 3CMOH 4LSVH 4MMXA 5T5FH 2PO6D 32C2A 2H32B 5DFAA 4CC4C 5KEZA 1TNNA 1A25A 2Y5QA 2EJ1A 4KK6D 5SV4A 3RBZA 1XIWC 4W4NA 4Y1TA 3UAJD 2NZIA 5H6QA 1U36A 1VRSA 3LKQB 1ZT7B 1RV6X 3R4DA 2PCPA 4LKXA 1A6ZB 2G5BB 3IAQA 4JYYA 3ZGHA 1MLCA 2HJFB 1FI8C 1DBBH 2CQVA 4KKLC 5I19H 3V4VH 1R1BA 2I07B 1ND0B 2WJ5A 4FZ0A 3IFPB 4IDJH 1D9KD 4OFDA 4U4IA 5E1QA 4ZUSB 4ENEC 1SS3A 4OFKA 2VAJA 4C8XA 3LSOB 1IBDA 3X3FL 2Z7ZA 4DV6O 1P5UC 3PFUA 3QORD 4MB5A 4YL9A 1BVKA 1OCOC 5DFVC 5EZOH 1WS7A 2CNZA 4QHNA 1MIML 1SLXA 2HLFD 2J12B 1IBMB 2E4FA 3F7YB 3GSOB 2OK0L 1PZ5B 1XB8A 3KPNB 5J12C 4CRPA 1CDBA 3PY9A 1R3IH 1G6RL 3P3RA 5D6DA 3NK3A 3E22B 5DTFA 1MRCH 5ANMA 4QJFB 3IBOA 4PMFA 3L48A 3MGAA 1IEHA 3BAIA 5E8EB 3VXQA 4M1DL 3QUXD 4NUJB 3V0JA 1WIUA 3VQLA 3SODB 5DRNA 3VRJB 1FL3B 4D0CB 4F7MB 3HKDB 3IYLW 4DW1A 1X59A 4YSDA 2BSBA 3CWBH 3UBHA 5K9QG 4MMZC 4I3SH 1M71A 2L04A 4GAGL 3RZCA 2VR5A 2BP3A 2WXMA 1KCVH 1LL1A 2I69A 4P9OA 3IDGA 5AVRB 5AAMC 2B9BA 4WY7H 4NM4H 5B8CB 3JTTA 1A9EA 4L48A 1SBBA 1NOFA 2Q87A 3KYNB 1GSKA 1QABA 4R97C 5IR1A 1KJ2H 2ZOWA 2WOBA 2K70A 2VW6A 3RWHA 3PJSB 1P4LA 4F6RA 5D7LA 2EIBA 3DSNB 2EIDA 4L05A 1T20A 3CFNA 4UCSA 1MSPA 4IGBC 4HUVA 1ZGLP 2YLKA 4B53A 5CJXA 1G7LA 1KIUA 3PV7A 5K59F 5I1JL 2JWYA 4MA7H 4PJIF 4NKMA 1GY1A 1V3LA 2ZYIA 2EXWD 4R7VA 3QNXB 2OTWB 4MTFA 4WW1B 4PY7A 5CP7B 4JY5L 4ZFQA 4M3HA 3NAAL 3DMMA 4JGSA 1FNFA 2HVKC 1BSIA 3T71A 1X5LA 1FVCA 4B9FA 5LGJA 4QRQA 5EU4B 3CSBA 4YH6A 3HS9A 3MLYL 1SN0A 3NJMA 3LRMA 4H20H 1J5OL 4XN8A 5DJ0A 1EFQA 4N3UA 1L0QA 5EU6B 2QR0A 3EO0B 4DN4H 1YJWV 2B77A 2BHYA 5AUMA 1DLBA 1F4YL 1A6VL 4KHTL 4MAYB 3DUSB 4GQQA 3O6LH 2CAZC 1SXAA 4I77L 5BVJA 5I8CA 2NPLX 3CH1B 5J57B 1Y74B 1N0JA 2BZ7A 4DR7O 5ERWB 2WXJA 5ITFA 4F7CB 3SKMB 1E6JL 4U3JB 3ESNA 3U30C 4AYGA 4BIUA 1TQSA 3DC0A 5CILL 1BREA 3OKOA 4MLSA 3H9HB 3T09A 5CA0B 2P24B 4KHPO 2PGGA 1RIVH 3NJNA 5KSVA 1PF3A 1IC4H 1EHNA 2VM3A 2CJUL 2ZUXA 4GCZA 4JTCB 2ZM6O 4JDEB 5DSCB 2NR6D 2GK0B 8PAZA 5AB9A 5C0AB 5GS1B 2Y4UA 4ANKA 3SPVB 1LWHA 1MDTA 1ZWIA 1W15A 3C5ZC 3KW8A 4FQPA 3RL1A 3NIFE 1VARA 3U9WA 3OD3A 4KX7A 4QPJA 3D3VD 2RA1A 3ZRWA 1K73W 2WXIA 5DJCA 2UXBO 1LK3L 5GJSL 2UY6A 25C8L 3QXAB 4NKIL 2RALA 4JAUA 4TOIA 1TCMA 1CD8A 2X7RB 3GRWH 2JCCB 2V33A 3T1WA 5AOZA 3LKSA 4OV6F 2YAQA 3UTQB 5HHVL 1WNSA 1F11B 4MJHA 3ZRSA 4AEHL 5JW4M 4P4KA 3UOAB 2FNBA 5CR1A 4LIQL 4XZUA 1NICA 2ICCA 1H5BC 1JFFA 1K3ZA 1G9ML 3LB6D 3AU0A 2EYRA 3DYOA 3VYOA 5KSAB 3US1A 2BSCA 3B09A 3AW5A 3D3VE 3NYKA 4UZUA 5JO5B 4FMFA 3IS1X 4K8RL 3ZT6A 3QWOB 2IU3A 4FL4B 4QE9A 1CR9H 5LXGH 3ETTA 4KUMA 4ODWB 2WBXA 3EDFA 3U36B 5I0XA 3ILPB 2A7WA 4XC1L 1IZJA 4FIPC 1NDMB 5L2JB 4EFBA 4JFWA 1UEMA 3I3BA 5LCVA 1F3JB 1KYDA 1EZVY 2BCKA 3D5OF 1MWOA 4XE5B 1TJGH 2JH2A 2RAMA 1S9XB 1DLHA 2AV7A 1FYHB 4MD5A 1MRFL 2Q1EA 3V7AE 3DV4B 5AD0B 1KB9F 3RW0A 1J48A 2VQTA 5I74C 3FONB 3QUYD 3CXDL 3BP5A 5EBMC 1JF1A 1OK8A 3ZIYA 2BSRA 4NBXB 5IVXB 2R4RH 1MWAL 4HPYL 5SWZA 3FCUB 3VRLF 3OR6C 3GSNA 4YC2C 3ECWA 5EF0A 1P4IH 4DO4A 1NCDL 4JFPB 2Z1KA 4FXKC 1CDHA 1SJMA 4TNGA 3ABUA 1H8NA 2P7TA 6FABL 3HZYA 2JVUA 4I89A 4JRWA 2DQEH 4LQFH 2CUHA 2E3VA 1L7TH 1WUNT 4ZOCA 4GIOA 5D7JB 4YDLC 4BCYA 2O6DA 1VF5B 2ZZUT 2DD8L 2VQEO 3RYIB 2WYZA 1MNNA 3RVYA 3B83A 3VMNA 4J3OC 4ZNCD 3MRFA 4ETYA 2BNUA 3VH8B 3KAAA 5DUBA 5C2BL 1I85A 6PCYA 3APQA 1K34A 3WXVH 3LH2L 4Q9RH 1J95A 3FAVB 2WKLA 2ZSVA 4W4LA 3HR0A 3UIZA 1ADQH 4Q6GA 2HZHA 4EBQL 2LHAA 3CLFH 1BVOA 2KDGA 1PY0A 1OP5H 2A83A 4OCXH 1TOXA 2FECL 4FFBB 4OZFG 2IGFL 1B06A 4G8IB 1JHLH 4P2OB 4Z1MG 3KH3A 1BA9A 1PPJH 3OGCB 3FU7B 3VA2C 3SPCA 5T3ZD 3TYFB 3CVHL 1HNZB 4YHYC 5AKVA 1PSKL 4I50B 1FJ1B 4ZW7A 1URLA 1LP9B 3S37H 1OF0A 1AQMA 2VZTA 4YDJB 5AVQB 5IVOA 2ZXWC 2HFGL 2WVSA 5E2UH 1LD9B 1D2DA 4PB9L 1PZDA 1KGJA 4FP8L 2C1PB 4EZJA 2XUWA 1JZ5A 1SQFA 1JPXA 3FMGH 3SGDH 5EF3A 3ULVC 1IGCL 4NZ8A 2QGCA 1FCGA 5T3ZE 4URTB 4H0GA 4LH6A 1F4WL 1T2QL 3LN4B 5E6SB 2MNWA 3DI2B 1DFXA 4S11A 5AWNH 5IBUG 3TP4A 2DJ4A 2ZG1A 2JTDA 3UL4A 5EZLB 4HNAA 3VGDA 1UM5L 5D9SB 2YK1H 4UDTA 2CTPA 1QRND 4PV9B 3QFJD 4PYHA 5D72H 3KS0H 2NX5D 1NAMB 3CJHB 4XDLA 4PV1B 2XQBH 5EZIH 1CXFA 1SYVB 2R9IA 2D8KA 3NIDE 3UC0L 3OHMB 3VE0B 4JI4B 4IGGA 2RJMA 1F41A 2H45A 2HVJB 1GJIA 1M9WA 5FYJL 4LMQE 4Q52A 2IDCA 4KGJA 1M7UA 1V27A 2CRIA 4ISVB 3L08A 3FRPB 5EC1A 4ZDHA 1G1KA 2ENSA 2FIRT 3OB8A 4G6AD 1PKOA 1QRNE 3QFJE 2YWZA 2DOCA 2NX5E 4UUJB 4K55A 5EBLA 3U7YH 2H26B 3KPQA 3FB5C 1XMQB 3NCJL 3GDBA 1A4JB 1ET8A 3QPXH 4C56E 3FKSG 4NP9A 3GI8H 4HLEA 3DVGA 1NTDA 3EDEA 3OR7A 4HGKC 4LLQA 3WIFB 1B2YA 4KKRA 5KHKA 5CFAA 4LF4O 2WBKA 1NMCC 3IGKA 4JI7O 3PL6A 4HUKB 1XF5B 3IFNL 3O3UN 4FTVB 1UFGA 1I08A 1KBGL 1KB9K 1MCPH 1U3HC 4DOHB 4F7KA 2XZAH 1YIJV 2DL2A 4PD4J 5IVXF 1N19A 4JO4L 1R3JC 2BVTA 1XQ8A 1S7UB 5C0RH 1BZ7A 3BQUB 5C0BE 2J20A 5I1EH 1IQWL 2K0RA 2APFA 3RI5F 3O6FA 1SLVA 2Y4TA 1D5MA 2Q7NA 4N8UA 2WWWA 3WIIH 1A7PH 1VIWA 3KGTA 2VXTH 5GGRB 3V4PB 3F7QA 4J1UB 5IB3B 1Q90A 4Z5RB 4JL1A 1P7BA 1OQOA 3PJSK 4XP5L 2YD6A 1GW6A 5D2NC 3ROOB 1U8PB 1X7QA 1VESA 4DRXB 1XAKA 2PXYD 5CD3B 5LVEA 4LFBO 5GGTL 5ICXB 4A55A 1MCSA 5MHSD 1A14L 1R19A 3PRZA 2E7HA 5JPNC 3HHSB 2CDYA 3IDXH 3U9PH 4OZIF 4B97A 5IJ0B 2VR4A 3E7JA 3JAKB 1P9MC 4LCWA 3VFTB 3ILDA 1ACCA 1UXWB 3IDMA 1REIA 1KN4L 3O9WD 2PP8A 1PZCA 2R1YB 2YRZA 1XHZA 4XBPA 2RJZA 4AYSA 3MJGX 3JSNA 3SYAA 3P0VL 3MROB 3PG2A 4JI3O 3TXAA 4LLDA 3V6OA 5F2VO 2UXVA 4HJJL 4D9RD 5MHSE 2CBPA 2CH7B 4FZ8H 2J25A 2FR4A 2APVA 4FG2A 1OTTC 5FW7A 1RJYA 1AD0B 3BAAA 4AQYB 1YG9A 4DV1B 4EB6A 5E6IA 4BKTC 3MCLH 1LP9F 2AJ3B 3B3IB 3GB7A 3QJHA 3RX8A 3SJBC 4LFAB 4K8ZA 2ORBH 1PAMA 2YSSA 4R7LA 2J73A 3ARZA 3OKDA 2GDSA 1GA2A 3RGBA 4NZRH 4NZTH 3P9MB 2DQDH 1E1RG 4OB5H 4Y4FB 1NL0H 3VQMA 2ODMA 3PWLA 1A7QH 3MRLA 3PJLA 4FG6D 3B2XA 4P46D 4QT5B 5T8IA 4BWUA 2CJ3A 4A68A 2OTUB 3A2FA 1JPSL 4D9RE 4YEEA 4X4MA 3MOAH 3EGDB 2JKJA 3QIWC 1GN6A 2OSXA 5EPMA 2BXZA 3X1BA 2Y2TA 4RIRB 5LGHL 1BV8A 2GTWB 1Z5VA 4KKZA 5IW1A 3RUGE 2JQZA 1KPUA 3U2IA 4WU7B 4LLAA 1ORSA 5BS0B 1JZJA 5J13C 4H5SB 5D6CA 2O4EA 4GG8B 3BESR 1OW0C 4PW9A 3RWIA 1URIA 4YHNA 3WTWA 3MODL 3LSQA 3HA0A 4R5VA 4KK9D 3ZRVA 5F3BA 5JR1L 3LPWA 3MRIA 4FNLL 4W9LC 3F7LA 1BMFG 5CZXC 5T3ZH 1XHXA 4DPCX 4DKFH 4ZHQA 3ARGB 5JQGA 1AXTL 1ZK9A 2VDRH 4R7DB 2XX0A 5A3ID 3T08A 3QJOA 2OTJV 3N6YA 2XG4B 3LH8A 1BM3H 3N43B 4Z7UA 1Z9PA 2CDFB 5A2LH 4LCCB 3QHZL 4JN1H 2SEBA 5E03A 4RH4A 3WIHH 2ZKOA 1L6XA 3A21A 1ZVSB 1KG0A 3B56A 5JOFA 3QT2A 5C0IB 3NZSA 3PWNB 2QWRB 1RJZA 2I85A 1M7IB 2R29H 2BP8B 2EKSA 4PP2A 1H6FA 2P45B 3ULSB 3DX1A 4NC2B 2ICES 1WGVA 4LP8A 1USQA 4JKLA 5SV3A 3RWEA 1UCBH 3FQ2A 1GC1H 4ASUG 4BZ2H 1KLFB 5CEYA 2EP6A 4BEIA 2IGTA 4E9WA 2HG5C 1CWVA 2Z7YA 2YAFA 3IMWA 2LAGB 4Z95L 5D1ZI 3B37A 1DSWA 4P23D 1ET7A 2KL6A 1D2PA 1CYGA 1LGVA 1YAZA 4WW2B 3B9VA 4XMWA 2QM7A 3W5NA 4YDKH 1AZNA 4GMSL 5FYKU 3VGFA 3MTXA 4WCYH 5AVZB 1NH2B 2PTUA 2W65B 4LLUB 2E7BA 4Z7WA 3QF7A 1QSEA 4MT8A 2AS5M 3QIBA 3ZTJH 2EC8A 3C08H 3RI5K 4J3XA 2E86A 5F9OL 3RPIB 4WFHA 2Q86A 3M1BA 1NCIA 1FNEA 1XWVA 2E7LA 2IG2H 4FHBD 1Q81W 1U3ZA 3JATA 2CBMA 3C5JB 1X6LA 1K4DA 3V6FB 4LKCA 2EE0A 1AZRA 1FNGB 2FGWH 3BEWA 3D30A 3L3IB 3KDPB 5SX5H 4RFEA 5KZCD 3D39B 4DAGL 2UVFA 2EKJA 2LTQB 4LAJH 3X12A 3ZL2A 1S7TB 3F05A 1OCCC 1CB4A 3BUYB 2Z1PA 4ZMWA 4S0TD 5GGSY 4ZFFB 2NY7H 1WWBX 3ARFA 5JORA 4DQOL 3PAZA 1NIAA 2DYRB 3MRHB 5HYEA 3QRGH 3DVIA 3E1ZA 3TO2B 4HOXA 3STZB 3ME0A 4R7CA 2AZUA 2G60L 3K80A 4FCAA 4LSQH 1PZAA 2ZQKA 3EYUH 5C0ND 1E2WA 3K2MC 4X7CC 2UWEB 2DJUA 2R1WA 4R7NA 3VXMD 2E8YA 1BMGA 5TQ0L 4DGIH 1Q5OA 4K0KB 1UURA 1JGLH 3P3TA 3NESA 4WBNB 1K8DB 1K92A 5CCHE 2D7PA 5F8RC 2OYLA 4BKSC 1WFOA 2Q8AH 3E3QC 4UM9D 1WZ1L 3LEYL 4YBLC 2E3CA 1MHEA 5C0JB 1KTCA 2N01B 4UT9H 5HPOA 2X2IA 4JN2A 1WCBB 4NO2B 4RZCA 1YLBB 2XICA 3D3IA 1XSOA 3DLQR 4H1LH 5FGSA 4OJFL 3NSDA 1I1FA 3RYCB 3P30H 3PABA 3OGIB 1D5RA 1MXDA 3PWUB 1T4KA 2CALA 3JWNC 5E4EC 2WZPA 4YNYA 3C12A 4TV8B 4U7SA 43C9A 3DURB 3U46A 4AVJA 5IT2L 4N6QA 3IU3A 4NHUA 4EAEA 5TE7L 3OAZK 1J9TA 4JG1L 3UZEC 5IJKC 4P9HH 4N8CL 4X64B 2GVYA 2H6PB 1BLIA 4FA7B 2OI9B 2QLVB 1QP1A 4MXQD 3WJLA 1UT1A 2XSKA 4OLYH 4G8GB 3ZPDA 2P28B 1QR1B 2VO8A 4L8BA 4HCRL 2R7EA 1L6PA 4PLOB 1HE7A 4JM2A 4YY3B 1DHKA 4YN3A 2DQGL 1I8AA 2NTFB 4KAQL 3GXPA 3RDTB 3Q1EA 1BD2D 4NQEB 2JKSA 3N43F 4H13B 2WCSA 3DX9B 4YLBA 1PNDA 1TEGA 1GTFA 3INUL 2IWGA 3L6FB 3IFOA 4G8EB 1BQ5A 4BFIA 2F7PA 1QFHA 2GEEA 2NW3B 4ZO9A 3U6RB 4GRLB 4R4ND 3T2NL 4YE4H 3V6ZA 5L4JA 2Y69B 5CB4B 3WTUA 3BKJL 5D1ZA 3ZTNH 2VUYA 3MA9H 4LBEA 4RGND 3ZQWA 2X10A 4MWFA 3MLUH 3Q13A 1LWRA 3MJ8B 4ZAKC 4DEWA 5BQ7B 2C9SA 1F6AB 5DZ9A 2PABA 4XC3L 3K6NA 2JQMA 3Q5YA 1BD2E 1S3JA 1XGUA 2J44A 5E8NA 3W1ZA 4Z7QE 2VOTA 1LDPL 5AOIA 4WW2F 5JUEL 1PCXA 1GTNA 1WB7A 1CN4A 2AQNA 1CZ8H 1SY6L 4ENZA 3L73H 3NOIA 3C9NA 4MQ7B 3V2AR 4G8FB 1L9TA 1NR1A 1J0YA 1BMZA 2Z8RA 4HIEB 4ES8A 3O4OC 4RGNE 4HPHA 1Q9WB 1BEYH 4ODVH 1EGJA 3MV8D 1ETZB 4PRIB 3UYPB 2Q7HA 3PAUA 5DEFA 4XPHL 1JMKC 2VCOA 4M6MH 1SEBA 5GGVH 4KKBD 5C0CB 1GSMA 3S5LB 2JCWA 5DYOA 3VW3H 1FH5H 5FWRA 3FU8A 4O4LB 1E5BA 4P3CH 4R0LA 2ZCKL 1TNMA 4CVXA 2YPLB 1YZBA 4E0RB 4X1KB 2JNZA 3KH4A 3G6AA 4ABMA 4QO1A 5CN2A 1OE2A 3D12B 4F57L 3G5ZA 2FJGA 5AB2A 2BTQA 4DV7B 4CU6A 5I1KL 1K7DA 1YAIA 2X05A 2FD6L 1BZDA 4PYGA 3MV8E 3IGAC 1L5GB 1M7DA 1Z5YD 2Z31D 3QI9A 2PCFB 2JS3A 1B0RB 3NJXA 4Y4HD 1RL1A 3NACL 1HNXO 2ARHA 1HQRB 2J1YA 3J27A 4HWEL 3CHPA 1PG7L 3H3PL 3GZQA 5H2BA 2GY5A 4CSSA 3V9EA 3MRJB 4QRRB 1QNZH 2OWOA 2UWEF 3P40A 1SMOA 2N04A 4DR3B 2NY0B 1JGEA 1DE4A 3FQUB 1UPGA 2ZE7A 5B39B 4L9LB 3QEQA 4QHKI 3IN2A 1HXYB 1KXQA 5CJQL 1KIPB 3H9SD 3GT6A 1GO3F 3VQXA 5E8PB 5TDOA 3VFSA 5JW4Q 1AFVH 5K5YA 2FTAA 1V05A 4JY4B 1RIHH 2DYSC 1CGUA 4NCDA 2VZ3A 3TIEA 4CGUB 4PSRA 3JTSB 2EDNA 4UQBA 2QDOA 2C5DC 2JLPA 4EKJA 5IROC 2UZYB 3MV9D 4W9KC 4PWFA 5EV7A 4N2NA 1TZOA 3U4EA 5TE4L 3OJ2C 4CBCA 2RTTA 4U1MB 5DMIH 3T2LA 5T1DH 4RRPA 2MOQA 4I48A 4NNYA 4NTYA 4NQXA 4KNUA 5CCGE 5CCKL 3H9SE 4QUOA 3BRGC 4P57A 5TDPB 5IEKA 1F0LA 1MCHA 3C09C 4HLZH 5IVNA 3FFOA 5ANHA 2MIZA 1PZBA 4ZUVB 1XGPA 4ZBJA 3SBPA 2AITA 5AW1B 4DCQA 2CO2A 3R06A 3M88A 4LP5A 5IMOA 3NJLA 4ODSL 4TOYH 3DJ9A 4FJ6A 3DNKA 4U1SB 3MV9E 2ATKB 2K1EA 1CLYH 4H0IA 2EDEA 5AKTA 4CGTA 2QSAA 5T1JA 1PCSA 3JALA 4UM8B 4OM1L 4N4YB 4DGUA 3EO1A 1XH0A 5DECA 5SWSA 4Z0BH 1DVFB 2COVD 1KCSL 2VDKH 4GRMA 4PCTA 3RKDC 3SDYL 4YFEA 4NHCH 4WI2A 1UUNA 4ZUWA 2B4CC 2YMTA 3MNWA 2IAMB 3ARQA 2FRGP 3LNIA 3VA6A 2OTLV 3IXTA 3QFDB 2B0SH 2X6AA 3R19A 3RA7H 1DQTA 1JGVL 4M7LT 1CICA 3NSFA 5GISH 5B3JF 3T8MA 5A6MA 4HXBL 4JDTL 1GGCH 2YOCA 1WIOA 3BVXA 4DK0A 3TJHC 1VQOV 1HWYA 5TF1H 3A6BH 2ADPA 4ZOAA 5KVGE 3S3BB 3FAXA 3WN5A 3KCYA 4YGAB 3O2DH 4YHZH 1KPRA 3L2NA 3FFQA 2IALA 1WDAA 4M62H 3ZE0B 1MFAH 1XZ0B 1B4JH 3WENA 1WB8A 4YBQD 1S76D 3T0VA 4GI6A 4ODXB 1FGNH 1JZ7A 4BE5A 3IJ7A 3FULA 4W9DC 4XPGL 1VACB 2KKWA 2BNRD 3ZKQD 1JGDB 2F23A 2YPVH 4OGZA 5E2TH 3H1LH 1LUWA 3A4EA 5TH2B 1ZTXE 2JJ1G 4E68A 5ENWB 4JDVA 2ZT9B 4AJVA 4CMHC 3TFKD 4KO9A 3PP3K 1WJ3A 3VXRB 4C47A 4GBXA 1WICA 5E95B 3LIZL 3FU5A 1E67A 1KFAL 4H88L 4UBDC 2ZIDA 4Y7OC 2KC0A 4I9QA 3MKGA 4GW5B 4FNUA 2YBRA 4YSEA 5LG6A 1KXHA 5KANI 2FJSA 4APXA 3SQBB 3NQKA 1JRHH 4EZMA 1NLDL 2BNRE 2DIAA 1YEEL 1QUNA 2ZUSA 5KSBA 4HGWB 3DIFB 3IKKA 2CO1A 4AQ8A 3ARPA 2IXQB 3ZX1A 5ESQB 1C5BH 4P9ML 3NJIA 5D70H 4P5TD 1BOGB 2BIIA 1AH1A 4X6FA 5FUCC 4BKLB 4ICGA 3F7PC 2R2CA 2E9IA 1J5CA 1CTOA 2Y07H 3JV6A 4G27B 4BA8A 3JTBA 1TF4A 4IRJD 3D25A 3AS0A 5CZVL 4MRCA 2GK2A 1ZT4A 4PSPA 3OKYA 4JG5A 3HZMA 3Q2LA 4KX8A 4TULH 5KHGA 3ZSSA 4P4RB 3E8UH 4XOBA 4Y89A 3H3KA 3G80A 3OMNB 4P2QA 2YO3A 3C8DA 1JWMB 4NJAH 3C5SB 4JO2H 1TU2B 1OPGL 5C0FB 1M90W 4AJYV 5FV2A 2P5EB 2D7OA 5DRWB 1T5KA 4YHHO 4PRAA 5E1AB 4P06A 3MRKB 3NH7H 4FQIL 1SMDA 3K71B 5F9JB 4ZX6A 2VDOL 5IIEA 1AGBA 5B1JC 2MNJB 2O5YL 4PRDA 1UXSB 1T3FA 1ZA3B 4JPIB 4XP1L 3WXWL 1A0QH 4QXUL 2XG5A 5D5PA 4OI9A 2OMWB 5HDBE 5IY5B 2ZCLH 1R1CA 3G04A 1CFTA 2R4SH 3NUKA 3ORJA 1RSFA 4OSUL 4ZFOB 2YXWA 1ZHLA 4MCYA 5DMJB 1XUQA 4V33A 2FIKA 3S35X 3ML0A 1QX1A 2F58L 2BMKA 2Q8BH 3HG0A 2J88L 1OGAB 1T6BX 3MLVL 4N2EA 4DKDC 4K7FA 1OAQH 1PKQB 2X87A 4DZ8B 2G30A 5EEYA 1SJEA 1JUFB 4RBPK 1TYJA 4RNRB 4U6TA 1J9QA 4LNRB 1HS6A 2A74B 5DUBB 2QMKA 4DN3L 4ZYKA 3QIUC 5J9PB 1Z9LA 3FPYA 4W9FC 4XOEA 2CIIB 3CCVV 3FB8B 1T5XB 5I8OL 2WSKA 4L3CA 1QI5A 4WUUB 4DV2B 5DGRA 1IX2A 3TO4B 4ERSH 3E83A 2L7QA 5HI5D 3BZDA 5MENB 4LARH 1N9PA 1G9NL 3WTVA 4MNGA 4QTHB 1M1XA 4XXDB 1QASA 4WEMB 3EOTL 5CUSH 4Z7VE 1DBKH 3LKNA 4X99B 4Y2DD 3VGAC 1F6LL 1PVHA 3L3GB 3QVNA 3MJWA 2YUAA 1SY6A 3BWUC 3UZVA 4H0LC 4K3AA 3MKKA 1ZE3C 4GKSB 2NY6B 3ZE0F 1Y6KR 5IF0A 4TLKA 1Q9KA 3QO1B 1BLNA 1AB3A 1KT2A 1RULH 1YSOA 3NBNA 2BDNL 3HKFA 2GIMA 2AMGA 2HJLA 2FQGA 1H8EG 4X6DB 5TQ2H 1Y66A 5E5LA 5GGUA 3VG9C 1NQBA 1WEJL 3L5WB 3CQFA 1NBYB 1X4XA 2BVYA 2X9ZA 2WZAA 3TGXA 4UV9A 3VFWA 1ZTEA 1OV8A 5CBHA 5H5NA 2V5TA 3UJJL 4KTDH 1XB6A 2QL1A 4TUOA 4EKXA 2LQRA 2CJSA 1S9KC 1K72A 3BP4B 2AF2A 4G70B 4U1HA 3EBGA 1IC1A 1XGZA 3VB8A 3S8FB 4MXVF 1XBLA 3B7SA 3FTYA 2MCAA 4OF8A 5EWIH 4DTGH 1QVOA 2CKNA 3CB2A 2WLYA 3I50L 1WZMA 3SZ6A 3SBRA 1BEXA 4WSGA 2A73B 4GO9A 4HAFA 4NO5B 2CKBL 4NXNO 1D7BA 2WLMA 4D6TH 1S0VA 1ZTXH 4UU9B 3W9DA 1G6RB 4LLMA 5EORH 2QVIA 3A0HZ 1KXVA 1L7IL 2UXCB 1UACH 1XCTA 5E5RB 3T4YB 3ZT5A 5F7AA 3I02B 3EYVA 3EVKA 1JDAA 5I8EA 4F2MA 5E99H 3OFNG 1QBAA 1ZL8B 3SGEI 1T2XA 3GTVA 2CWRA 5KVFL 1CP9A 1MJUL 1ERNA 4KZDL 4NWUL 1RM1B 4JHAH 1IU1A 2EVIA 3AB0C 2YARA 3KPTA 1B0IA 2W0FC 1VIBA 1ZHKB 3HB3C 1NC2D 3LRSB 3F85A 3NCCB 4BRJA 3MREB 5BO0D 1BBDL 1HWWA 1URZA 1I9IH 3H4FA 1DJIA 1OAYH 3CC5B 4G6MH 4KKCD 2OAAA 1S7XB 3S36X 5A2BA 3O0LA 3CIAA 3P9WB 4FFTA 1DYZA 4JFSA 4ZSOA 3RPBA 2VRKA 3MSPA 2OCCB 2X3CA 4UIMA 4GNKB 3RRQA 1NGZA 4N6RB 4KRPB 5HVWA 2UXNA 3C6SB 4L5FL 4OD2A 4V2CB 1QA9A 3A8TA 4CC4A 1GGTA 5CN0A 3NFSL 3MOBH 1RP3B 5CINL 3SQOH 4NC0B 1YUHA 3ULVL 4FJYA 1KLGB 4Y5VB 4FI7A 1INDH 1XIWA 1MI5A 3VFRB 2C9XA 4I55A 2VM4A 3TNMB 2AMUA 3RE0A 4Z3IA 3JASA 2B5IC 1DSYA 5DLMH 5AVSB 1W59A 4LWSA 3BZEB 4DR2B 3T1FB 3VWKC 4NQDA 1ZK5A 2K7PA 3MAWA 5D7LD 4UXNA 3J81N 4HK3N 3VXNA 1UGNA 4C58B 2AXGB 2JGDA 3D2TA 1H6TA 3OE7G 4GT0A 3IDJB 1P5UA 4HBQA 4JPWH 5LB1A 3H56A 4UQIM 3VWJB 3ABMC 4TV3A 4BDVB 4J7RA 1I9JH 2ZCEA 4HKJA 4NLHA 1T83C 4IJ3B 4F2FA 1NFIB 1IAII 5FW8A 3ESMA 4GAFB 4HHWA 4CDGC 2QPUA 3G9VA 4OZFH 2L3BA 1AXIB 3DMMD 4K3EH 1AE6H 2QM4A 3O8XB 3OAWA 2IOMA 2P26A 2P80A 3HZVA 5JTWA 1SXCA 2A2QT 5D7LE 4LSPL 2Y36H 4G9FB 5E1GA 4D94A 1WTGT 1PLGH 2ZOLB 5FHBH 2B14A 3FQ1A 3M7FB 2QBWA 4NQCA 1YEHL 3AS1A 3W2DH 4I18B 4LLYB 4N1HB 1NZRA 1IAOA 1F86A 3VMOA 2COQA 2BOCC 5GXBB 4MMZA 5HYIA 3R65A 4RDQG 3RJQB 2GSGB 3BXNA 3GGWB 1KZQA 4I4TB 1G7MB 4Q9CA 1SZXA 2E74C 3TFBA 3KZ8A 4X6DF 2ICWB 2XV6B 3LIZA 1ZLSH 4YHOH 3J7HA 5C92A 2H3NB 1HSBB 2NOYA 4G7SB 2JJ2G 1DQML 4UTBA 3C6LC 1EBOA 4MNQD 3UQ8A 3KR3H 4JAAA 3QUZC 3RGVC 3LMJH 1OSZB 3BPCB 4QRFA 3K8KA 2YZ8A 4QHLB 4F58L 3HPLC 4R26H 5E1IA 4J39A 2ZDIC 2A3QA 1NBVH 3D4ZA 1D6EA 2H3XC 3O4LA 2ZE0A 4IGBA 2VUKA 1WZKA 2ZWLT 3T0EB 4NN7C 4N2BA 1J5EB 3ERXA 3KS0J 4JCWA 1EVUA 1A6TB 1KIQA 3QO8A 3QNYB 1L9QA 3IEAA 5ALBL 1ROWA 3FKUS 3TVMC 2LQTA 1AHKA 5LLIC 2ZKXA 4FS0A 2AI0L 4JRLA 4YIQB 2D3JA 4FA8A 1E79G 2EJ7A 4MNQE 3T5WA 5H37A 2OM5A 2HVKA 4RUEA 3I84A 1AQDA 4MJ2A 3V5DB 4GP4B 3B2EE 4KMTH 2BE3A 2OXHA 1FPTH 1YJDH 4MFHA 1HSAB 3N9GH 1DSFL 4LOVA 3NRFA 1BECA 2EO7A 5CGYD 1TVBA 3OX8A 1RP9A 2IH8A 4ZPTB 2YUVA 1SF9A 3GUFA 4QXGH 5G4NA 2GSMB 5LHGA 3BGMB 4R84A 2PZSA 4AQZA 4Y19B 2WLJA 5CBAB 4ZW8A 1DZBA 1UWEH 1MWAB 2HT3D 2KPNA 1ACZA 3P3YA 3EYOB 3TPUB 4OV5A 3QWQB 1K3IA 4X7SH 2HLAA 2NY3B 1I7ZA 1HL8A 1KIRB 4I85A 2D7QA 4B3SB 5B7EA 3TURA 1U3NA 3L95A 3PQYB 4HV8B 2NY1D 4GX1A 2HT4C 2IFFL 4CVZB 1VQLV 4FYSA 2OSYA 5JVDA 5ITBH 3RBSA 4FKHA 4TVSa 4JEGB 3QEUA 4E9LA 4AENA 1I82A 1Y0LA 3LDEA 2R2EB 1QFWI 3GM0A 1MREH 3L4ZA 4HIXL 4L0PB 3S3CB 4BXVA 1NC4D 3UROR 7TAAA 2X1OA 3GKWH 2AQRA 1KJMB 3SKOB 2NY2D 4GX5A 4DK6A 5SWZD 3C5ZA 4EN3C 3X2QB 3VQVA 2BSDA 1I3VA 1SJHB 4UI2A 4G5ZL 3VQ1C 1YNKH 2FEJA 4JO3H 1YDPA 5IMMB 4PFEA 4YLCA 2DL9A 2WBWB 1OB1A 3BH9A 1K6QH 1J8KA 3SCMC 3FQRA 2A38A 1J8RA 5HYSB 4JO5A 2R70A 5LYJB 3GSWA 4N9OB 2FLMA 3KHQA 3KWTA 1MKFA 1X44A 3TBTB 4O4HA 2DI9A 5IJ9A 1FNSH 4NZUH 4DGYH 1H5BA 3MV7A 1CLZH 1LEIA 3WKNA 5IWAB 1ED3A 1RZQA 3O65A 1CU4H 4IBTA 4M03A 4M5ZL 5SWZE 1IL1A 2PO6C 1RIUL 3ARWA 4Z7NB 3WY4A 3IRPX 1KBPA 3CVHB 1LO0L 4QI3A 3UAJC 2D3OW 2JQAA 3BO8A 4R90H 1LMKA 3OAUL 1JXDA 5I73B 1T1YB 2KB1A 2DWYA 2DV6A 1TTUA 3L7FA 1VPOH 4PJ5B 3S36H 4OGXL 3B2UD 3W57A 3KPRA 3FQXB 3CMEV 3ZMSA 4Z0XA 5J0BA 3KGSA 2V4LA 3I75A 4XOAA 5DUPL 5FOBB 5IESL 2W92A 4X5LA 1PTZA 4YHMH 5FYKL 2WMPB 1LR1A 1S5LZ 1J10A 1YEFL 4PR5B 1J1XH 3CZUB 1BWWA 1H38A 4LHQB 3UBFA 2J8UB 2BJMH 1A7RL 2EZ0D 2JJSC 1CFBA 1ZPUA 3QORC 3IS0X 4KTEH 5E2VH 4K7PH 2CUAA 4NQTA 1N5AA 2HLFC 4JREB 2J72A 2DI8A 4G42B 3O0RH 1PX8A 1TCRA 4L1HA 1EXGA 3MJ7A 4YHPA 1HEJC 4HUWB 4QTIH 3TJTA 3GS7A 3DKHA 3QQ3B 2HUHA 4PJAA 3AEIA 4HK0B 4U6VL 1QLRA 1FXKB 5E5MA 3VFUA 5I1HL 2X9YA 4RMQA 3NEOA 4C57C 2ED9A 3Q6FA 2J4WL 4QNHB 3BYYA 3QUXC 1PLBA 1DUZB 1DCEA 5F3HA 2WAQA 3IWVA 5KVDL 2MW2B 1P1ZA 1QBLL 3L3JA 2CKBA 4GZRB 4FXGC 4V1DB 3W7XA 3U6XA 1N10A 1D5ZB 5KYWB 2Z8WC 3U4BH 5IFJB 1EJOL 4B3VA 2Z35A 1J18A 4M5TA 4M3KB 3CLEH 3W7TA 3DOSA 4PELA 4OFYA 4AYFA 3MMEA 1KV7A 2WXRA 5KBMA 4N0FA 2BX5A 5I1AA 1K5WA 5F21B 1XT5A 4R6ZA 3QJFA 1ZT1B 3FTUA 4Y16A 3ABKC 4E9XA 2VE6B 2Z6FA 4YZWA 1OT4A 1FHNA 2P42B 1AXSA 4MQSB 1ZGLA 3N06B 2AJXH 1K97A 2IQ9L 5KOVC 1MSWD 3RHWF 4Z7UF 4B95C 4G8AC 1OARL 3VDAA 4MW8A 2YZ1A 3L2LA 4UYPA 1DCLA 3M8OL 1TQBC 3NCYP 1WFTA 3UH8A 1TUBA 5D1XD 3HC3L 4OGQC 3F2LA 1VGEL 4NUGH 4HH9A 3TXQA 4N2IA 3E80A 4PLKD 2YGQA 5FLVA 1THZA 1II4E 3BGFC 4PDRA 1IGJA 3RYFA 3S3WA 4PJEB 1EBAA 4PRHB 4X8JB 3B2VH 5FIEA 1XI1A 4NKDA 4NN5B 3N2JA 1EXUB 2W60B 1MPAH 4JQIL 2QKSA 2R69L 4B6ZA 3PL6D 5KANG 5D1XE 4ATTA 3RY6C 1BOYA 5FGRA 2Y1YA 4M7LL 2HP8A 1UH4A 3ARTA 1EEZB 4XVTH 5FYLD 2O5ZL 3L2MA 2CTQA 5TE6L 4CJ1A 3SE4A 3NA9H 4L18A 5JHLA 3O6FD 3TN0B 2ZXBA 4HVBA 2WNWA 2YUWA 1BHBA 4NYLA 1CGTA 4PB0H 2BO0A 4EOWL 2YPKB 2A9CA 3DBXA 3FUHA 4C4BA 1JXGA 1NEUA 3QR0A 1I1YB 3VQYA 3AAZB 3OXSB 1RURH 2C7UA 4LVHB 5FYLE 1GKOA 1DQKA 1O9ZA 5IHZB 4Z7NF 3TETA 1SGKA 4Z9KB 1ONQB 3II3A 2AJSL 1U8LB 4FQLL 4LCWD 3BDYH 4O5LL 5LCVH 4D3CL 4I0XA 1YQ2A 4X62O 1W8NA 3FB5A 4FQ1H 2V9QA 5CU9A 1V9PA 3X1GA 3GIZL 4P5SA 3FO9B 2XOTA 3H55A 4AM0A 3OF6A 3V4UH 4M6AA 5ITZA 2PWHA 5C08B 1NKDA 1XX9C 5B4MD 2J8UF 3BLKA 1YYCA 1ES0B 2YD3A 3SJQC 3GNMH 5HJ3B 5LGYA 4UZGA 3LB6C 4MA8L 1MRDH 2EINC 4JV5O 1BQHA 3GSNH 5E6ID 4ZOBA 4X7DC 3F6JA 2P3YA 4LCWE 3REWB 2AJYH 1R5WA 3QZNA 5F88A 3MN8A 3GSUB 1R3JA 3MO1B 4GXVH 4IIZA 3TBYB 1X5HA 1A2YB 3CFBA 2HFFA 1F3RB 1R5VA 1R6TA 5MEPA 4V11A 4J5VA 1UXMA 4B27A 3WE6B 4O2EA 2V17H 1SN5A 3IDUA 1IGTB 3V6OE 1AY1L 3MYJA 3IAYA 4ZFZA 1QHQA 4ZMOA 2QWPB 4OCSH 5AVVB 2JFCA 4LSSL 3AM8A 43CAA 2CK0L 4HC1L 1URFA 1H0DA 5D2NA 4CH5A 3DIDA 4PJ9B 3QUYC 3ARDB 4XO9A 4ZTPL 3TEYA 2X4UA 2NNRA 4PP1C 1K4CB 1D6VL 2QGDA 1LNUB 1K2DB 3MR9B 1P9MA 3Q43A 4HWNA 4Z3GA 5J89A 3CCSV 1WAEA 2Q0ZX 2Q20A 2C9RA 1EHLL 1CFNB 1UUSA 4X4ME 5J6GA 2HLDG 4A2DA 2X40A 1L9NA 4JL2A 4ZK8A 1RUKH 4U33A 2AJVL 1MABG 4XAWL 2FJFA 3RHWK 1FZMA 4DVBB 2G9HA 1WITA 5D4QA 4H8WC 1CFVL 2XKNB 3B7RL 4IKLA 5FGCE 2X3AA 1O6SB 5AAWA 1SVCP 1AIFB 5FX3A 4E2OA 1CD1B 3TCTA 4J2XA 3GIVA 2RFXA 4U1IB 2B1HH 3MLTA 4S1RH 4EZLA 3IRZA 4P2RB 4PJEF 1YCIA 4X1IA 2IWKA 5E8DL 5EU7E 3RURA 3SDAB 3DI3B 1QWNA 4AK1A 3H42L 1RZGA 1TTBA 3AXLB 3PGFL 4BV1A 4FULA 3D51A 1IKFL 5FNVA 5LN4A 3JYBA 4JHWL 4KMLB 4GQPH 1AMXA 1UM6H 1CXIA 3CHRA 3AG4C 2AHIA 1QSED 4M48L 4NNXA 5AW2B 1OW0A 1HYSC 2G3XA 3CZJA 1JHKH 1YNLL 4GSQA 4XCCH 1G0YR 2IPTL 4WFHD 1NVPD 1OANA 5H37G 5C9JA 3V0VA 2ZE5A 4OD1H 4QXTA 1LHZA 4EI5B 3ZMRA 2FX7L 3VFNA 1I94O 3FF7A 3S34L 5EIBD 3BCFA 5CJ8A 2VWEE 1J11A 1AS6A 1MHHA 3HI1A 4KUCD 4LL1A 4PJ8B 4WNJA 3MZTA 4M1DH 1WBXA 3WLBB 1HFUA 1FV1A 2C9VA 2GTZA 1RZ7L 4Z7WE 1QSEE 1GIGH 5E94A 3PIQA 2Y06H 3JAWB 1XREA 1VA9A 4UQ9A 5IQ7H 2DS4A 4WFHE 4U0QB 3H1KH 3DHUA 4GAGH 4JM4L 1S78D 1NMAL 5HI4D 3UCQA 1K3EA 1G87A 4CVWA 3JCZA 4UMSA 4QGPA 3G6DH 2B4CL 1ZANL 3K6SA 3SPJA 3N50A 3QSKB 4N2OA 1OXYA 4JR9L 4DGVH 5I1IH 1U8CB 4G9DA 5J1AB 3GLZA 3JCUZ 3K59A 5JYLA 2HG5A 4JFEB 5F7FA 1Y1UA 5MERB 5FYLH 4KROB 4Y5YC 1CDIA 1JL8A 2E5LB 4G6AC 4LF8B 3GMPB 3WFEL 1U41A 3S3PA 2A9HA 4BZYA 5I16B 1V7MH 4DK5A 1XFPA 3IBEA 4F15C 4IMLA 3WD5L 4RAVA 3HN3A 2WBJB 1IM3B 1G1XB 1MJ8L 2V37A 3APNA 5EOTA 1AR1D 2RQ6A 3GWKC 1MCIA 2RCSH 4JY5H 1OP3H 3NAAH 2AEQH 1JFHA 4KWUA 3TV3H 1HOEA 1MHCA 3DX7B 2G4EA 1IKNC 1MCFA 1CTMA 4PV8A 1EEYA 5TD4A 5E0FA 2DQFB 5FV1L 2AVGA 3KM2A 1NWPA 2XY1A 3NDYE 3QE5A 3QQDA 1IC5L 4WK2B 5EA0H 2NXYD 2Z0BA 5FUOL 3WEXA 2P8MA 1TENA 1JCKA 4DP2X 2IQAA 3CPWU 3DHPA 1WAAA 4DPRA 4PJ7A 3EYSH 5I9QC 2EX3A 2EEBA 1A6VH 2NSQA 5TFSH 2V2WB 1P6WA 4A2MA 3CXCU 1I8MB 3DGEA 1D3CA 2XV3A 4PS7A 4FQJL 4NT6A 3VD1A 3APFA 1AZUA 1S9VA 3IJYB 3NCXA 1A3ZA 2G5UA 1DQQB 1YO4A 3FCGA 1XF2A 3G5XB 4JM2D 5E8OB 1KF9B 4FQQA 3FTGB 5B1BC 1BBJA 4GP8B 2PXYC 4GSDL 1C08B 4KDTC 4MJIB 4MD4B 1JZGA 1NGXA 1DF4A 5D4IA 4XCEB 3LJ3A 5HHMB 4JI6B 1XCWA 2JB5H 1N18A 2NW2A 3P1VA 4P99A 1FUNA 1KEML 4UT7H 3P11H 2G0LA 2Y6SC 1P4BL 3AS2A 5CF3A 4GKLA 3ETBJ 1ID2A 1B0WA 3L5XL 3O9WC 4Y5XB 4UIKH 3FQTB 1PD6A 2Y0PA 3D52A 1FFPB 5FA4A 1AO7A 5D1ZD 1LK3H 4NKIH 4G1EB 3DUUA 1BAFL 2CCVA 1N33O 1M05B 1IBMO 4A7GA 4LZKA 4RMWA 4X4YB 2CR0A 3WBDA 4D9QD 3NA4A 4QNPE 3QNEA 2AK1H 4QR7A 5GGSA 2V2TB 2FO8A 5I76A 3LS5H 3LDBB 1H2GA 1ZLZA 5DS2A 4KJWD 4MBOA 1CE6B 1LDSA 3T0DA 1QMUA 2AJZB 2OZ4A 2DQJL 4Z18A 2IJKA 4P2AA 3ET9F 2DWEB 5CLWA 1KCLA 5IB4B 3T4AB 4TLTA 1DL7L 4WLCA 4K8RH 5FWQA 3UZEA 5ACZA 1HCVA 3TT3L 3UGXA 4FG6C 4LESA 5IJKA 4P46C 3SDCA 1T0NA 2IANB 1EERB 2VDPH 3N0AA 4M61B 4GINA 1HIMH 1ZV5A 1YYML 3C6EA 5C3TA 3QDMA 1W2BU 5IJBC 2X12A 4D9QE 4U1LB 5H6RA 3DX8A 1JJUA 3QZPA 1DVUA 3CZLA 5B38B 5BR8B 5DWUH 4FA6A 5BV7B 4JI2O 2IMNA 4Y9CA 2KS0A 1WA2X 2X44D 3A6CL 3HNTH 4XN1A 1AACA 3AADB 3QWRA 1A4KB 4NS0A 1AI1H 3MLWH 4H8UA 4TTGA 5DEDA 4S0HA 1KJVB 3CXDH 1AC0A 1HDMA 5IQOA 2W1NA 3PXLA 4MCMA 4ZTOL 2G5RA 4KK9C 2E27H 4KKNA 3HPJB 4G28B 1QEWA 2BNQB 3STBA 1GR7A 3FN0L 4NM8H 4QHUA 4H26B 3QI9D 1Q1PA 4JM0A 4KDVA 2HFEB 3G6JA 2V3DA 3FFDA 2O5XH 3TEUA 2O57A 1P7GA 3F5WC 2TAAA 2WHVA 3ILQD 4JDZB 4QHMB 5GS0D 1VADA 5A3IC 5FA3B 2BCCH 2V7QG 4V2BA 4HD5A 4NPJA 3QDJA 2F54A 4LEEA 3QEQD 2FHFA 5KW9L 1UENA 3MUZ1 4P5MA 5T1MA 3EFFB 3SJVA 3NVQA 3P4LA 4AQEB 5IG7A 3FTVA 2Y7MA 3LKRB 2VXSL 2B1AH 3FO1B 4B96A 5C2BH 1RPKA 2APBA 4UNTA 1RUPH 3E6FA 3FCSA 3UM7A 2QV4A 2N1KA 3ASOB 1QSFA 3JD1A 1PIFA 4X6CB 4QDGA 4W9HC 4TM9A 1IE5A 4DZBB 3W5MA 1CI5A 3N5AA 5D4HA 1I9RH 4I0PC 4O51A 3GZPA 2R1XB 4P23C 1U92B 3ETQA 3QEQE 3IJHB 1NUFA 3MUUA 3W0WB 2VSDA 3TBSA 5GHWH 1FZJB 5JXED 5HVHC 2DMBA 4NRZB 2ITDB 1KKDA 1JWSB 2WSDA 5HYJB 2XVLA 1OCZB 1T22A 3D0LB 5LNEA 2AK4A 4RQFA 3BUPA 2QTOA 1W91A 4XGZA 2NNUA 3OPUA 1OP4A 3RNKA 3EYFB 5ETUB 4BFOA 2WD0A 4LR3A 3RVWC 1OCOB 4AGMA 1GMEA 3PCYA 5SWSD 2DH2A 3CQPA 2DBLL 5DJDA 4C83A 2D2OA 1DEEB 4GO6B 3L45A 2OYKA 3DGGA 1FZKA 4CN6A 4WIQA 9CGTA 1UD2A 2XCMC 5HD8D 5J12B 1BQHG 4NKOB 3T8VA 1H15A 2XKSA 2OP4H 2A9NH 1GY2A 2MCPL 2CO7A 1YPZA 2AQQA 3PWVA 1GXEA 4WSJA 1JDDA 2E4TA 4D9LL 1CICD 3HI6H 3B40A 4OX9B 3RJDA 3P4MB 1T7WA 5GS3A 2JCCE 3ALPA 2GAZB 3HRZA 4DR7B 2CO4A 3MRQA 4IK7A 4LEXL 4UV7H 3ARBC 3NEEA 1LVEA 4TVPL 1S7WB 3HMXA 5IROA 5SWSE 3STLB 3WSQL 4PGEA 3K03A 3VQWA 1YTFD 1F8TH 3CMOL 4LSVL 3OJDA 4NNPH 5T5FL 3CCHA 4DEPB 4QLWA 2FQFA 5AKSA 2Q7GA 2LW3A 3CXHF 5DK3A 2WVVA 1LEGB 5CBFA 2AKRA 2ZUTA 2WKOA 5T1LA 3JVFC 5BUPA 5DA4A 4KVPA 3CPLB 1DBBL 4FEIA 2NT0A 3ZR5A 5FCSH 3V4VL 5IB5A 1B2WH 1AGCA 1H6UA 2ID5A 1NCAH 5MI0C 3AQDA 4IDJL 3T6ZA 1WP6A 1AR2A 1UYWH 2X28A 4W9GC 1X6NA 3QQ4B 5CKAA 2ZYHA 5EZOL 4DETA 4FABH 3W7UA 1KTRL 1UGKA 1GGUA 4QRUA 5D7JD 1HAUA 4NIYE 4AZ8A 2JV6A 4PREB 3S3DB 2FT7A 2AABH 1ZS8B 3V5HB 4KKQA 1R3IL 3N1QC 2G3MA 5CR8A 3UTSB 3ZL1A 1NJ9A 4ATWA 1MRCL 3CPUA 1E4WH 4QGYA 4WWKC 5E56A 5BJTA 5GQBA 3AQZA 1Z1WA 3MYZA 4B9JA 1CDUA 2DLEA 3THMH 2ZWNA 3KLAB 1MLBA 1B88A 1N12A 3R0MA 4WV1C 2ARJA 2YAEA 4FXLA 5JXAH 2OJZH 2WB7A 4YX2H 1IQWH 1QLEB 3ZCCA 1UB6B 3W9EA 4I3SL 1OZ0A 3L75H 4IEFB 4MXQC 1KEGH 5EOQH 1AR4A 4LF6O 3SGKC 2WPDG 2PI4A 2CCLA 1U30A 4YXLL 2Q2EB 4GUPA 5LXVA 1J0HA 1E50A 3ES6A 4NM4L 4PTTB 4R2GC 5DWPA 2VDOB 3ZDXE 4DR1O 4LSRL 5C97A 1N59B 1BQZA 1LK2B 4ONGH 5KSBE 3MI6A 4YXKH 2FL5B 1KJ2L 3UYOD 3OUSA 2R23A 1IEAA 2RQEA 4P2QD 1G7IA 4GXUN 1EGJH 3SY6A 4R4NC 3HBGA 4WWID 2UXXA 4X6CF 3CCJV 4S1SH 3U0TB 1KN4H 1HNZO