3SPCA

Inward rectifier potassium channel kir2.2 in complex with dioctanoylglycerol pyrophosphate (dgpp)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
327
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 89
structure length 327
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spcA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spcA01
3AG3C 3SJQC 4GX0A 4R50A 3AG2C 4G27B 4P9PA 4PDRA 3FB5C 2ITDC 4G28B 4PA3A 2A79B 5CBHA 5KUKA 2EILC 3IGAC 3ATBA 2A0LA 4EKWA 4RUFA 2ITCC 3RBZA 4RUEA 1K4DC 2ATKC 4F4LA 2BOCC 2WLMA 4XDKA 4WFGA 2W0FC 4R7CA 2WLNA 4KFMA 5EC2C 2GIXA 4X8AA 2EIKC 3EFFK 3FB7C 3K0GA 3E8HA 4R8CA 3SYAA 1OCOC 2DWEC 4MTGA 4P30A 2AHYA 4PA4A 2JK5C 2HG5C 3E8BA 4MW3A 4ZBMA 3UKMA 3X2QC 3AT9A 3ABLC 3SYCA 3SYPA 3AG4C 3ASOC 1OCZC 4MTOA 3T1CA 4MVSA 4XDJA 4LP8A 3ATAA 2Q6AA 1M56C 5EBLC 3JYCA 2DYRC 3ZJZA 5EC1C 3ASNC 2X6BA 1P7BA 4DXWA 4PDMA 3AG1C 1LNQA 3K06A 3RVYA 2WLHA 2H8PC 2WLIB 1R3IC 2HFEC 2IH3C 5EBMC 3LNMB 4GX1A 4X88A 1U4EA 1QLEC 1M57C 2AHZA 2DYSC 1V55C 3OR7C 3SPJA 4JTDB 1OCCC 1ORQC 1XL4A 3OUSA 2A9HA 4PDLA 5B1AC 1OCRC 3RVZA 4MS2A 1JVMA 4QE9A 2HVKC 5B3SC 4MVOA 1R3KC 3VSQA 4MTFA 1ZWIC 2X6CA 3SPGA 4OXSA 3KG2A 3K03A 2K1EA 2BOBC 3SYOA 5EBWC 1KKDA 3K08A 3LDDA 4MVRA 4GX2A 2X6AA 3TETA 1N9PA 2Q67A 2WLLB 4MVQA 1J95A 3VOUA 2WLIA 3IFXA 4MVUA 4X89A 4HZ3A 2NLJC 4H37A 3ATFA 1BL8A 3ATEA 4BW5A 3LDCA 5B1BC 4JTAB 2OCCC 3E83A 3SYQA 4P9OA 4MVZA 2QKSA 3UM7A 3OUFA 4R6ZA 5BZBA 2Q68A 2YEVA 4GX5A 5CBFA 2ZXWC 3ATDA 3AT8A 3E8GA 4J9YB 3PJSK 3TCUA 2KB1A 1V54C 3BEHA 2HJFC 1K4CC 2DWDC 3STLC 3AGWA 4MVMA 2WLLA 4WFHA 4J9ZB 3FB6C 4MW8A 3GB7C 4LCUC 3SPHA 3K6NA 3F7YC 3HPLC 2IH1C 4MSWC 4RAIA 3OR6C 2EIMC 5J9PC 4LBEC 3ABMC 4UUJC 4CBCA 3E89A 3ZRSA 3AUWB 4WFEA 4P2ZA 4TWKA 3T4ZA 2WLKA 1U4FA 4JTCB 1XL6A 2EIJC 3FB8C 4PA9A 4WFFA 5CBGA 4XDLA 3LDEA 2ZD9A 2E4FA 3E86A 3LUTB 3OGCC 3WG7C 3ABKC 4PDVA 4QNHB 3T4DA 2HVJC 3RW0A 2WLJA 1R3JC 4QE7A 4I9WA 3F5WC 3F7VC 3SPCA 4PA6A 2EINC 5E1AC 3E8FA 3STZC 1S5HC 2R9RB 3K0DA 3R65A 3T2MA 4PA7A 2Y69C 2QTOA 4H33A 3K04A 4HYOA 5EK0A 2Q69A 2P7TC 5KUMA 4RO2A 1G4YB 3SPIA 5IY5C 1R3LC
chains in the Genus database with same CATH superfamily
3VVVA 3LXUX 2PP8A 3IMVA 4LDOB 5D6DC 1A3QA 1SN0A 1MNUH 1S3RA 4FX5A 1XF3B 1KJMB 1HQ4A 1E4WH 1F11B 2OW6A 2XZAH 5G2NA 5KVEE 1CFVH 3W3BA 3A8TA 3LKNA 2FO8A 3X13B 5JH7A 4KUCD 2PPFA 5EZJB 3BIKA 1AZUA 1UVQB 4GQ9H 1SM3H 1KXVA 3D2UD 1A9BB 4UDUA 1TCMA 3FO1B 1ZLSH 4YSPA 4PRDA 5CFAA 4JJHA 1TCRA 3KCYA 4MTOA 1S7VB 1V3LA 2R0LL 2DPKA 2ADFL 1RP8A 4NNPH 2ZF9A 2WY3B 5EBLC 3CVHH 5TE7L 4ZMWA 3T08A 5AVXB 4BR6A 1MUJA 1GRJA 4ZFFB 4DP5X 4MXWL 3THMH 3D36C 1FN4B 4Q74A 5LP6B 5J6GB 2I9TB 4UWQB 3FCTB 4HC1H 2GVYA 4GX1A 4ZFOB 1M7DB 1KB5A 2EAEA 2ZM6O 2X4QB 3F7VB 4WWKB 1ZUQA 3NFSH 1BBJA 1QLFA 2ZXEB 1RIUL 4FRWA 2X7LA 4DW1A 2DMBA 4H8UA 3JARB 3LQAH 4ACTA 4XVUD 4MMYA 1B06A 1L9PA 2R9HD 3WFZA 4LP4A 2VAAB 2FLRT 2AQ1A 3BAYA 5KYUA 2VMCA 2XG5B 5CINL 2E75C 4ZI8A 4K3EH 5B1KA 1KYFA 2BOLA 1ZDQA 3GMPB 3GSQB 4ODXB 2ADJB 2FJFA 4F8TA 3FB7A 1IB5A 1JTOA 4HK0B 1DVXA 3DHUA 1QPKA 1OSEA 1FC1A 1C5BL 1E2ZA 1OAKH 3ZT6A 2EVJA 2BVOB 4PI0A 1PLGL 4IYKA 1IKFL 1U8MB 1KBHA 1AIFB 1S5IL 2DD8L 3OAYK 1KTCA 3UABA 3B6SA 5KTEH 4LFBO 3FRPA 3E6HA 1RPRA 1TJMA 1E42A 3MX0B 3IVKA 3D4YA 2Y22A 4X62O 1QFOA 3JAKB 1EJOH 3GZPA 1FYJA 2PR9A 3DYOA 2V7NB 3IDNB 3CDCA 5EEYA 3O2WL 5EV7A 4MXQD 4X4YA 4MA8H 3ARED 3VRIA 1X5ZA 1R5VA 3WB1A 1OTUD 1Y7VA 2BIOA 2V9RA 3TBYB 3VXUD 3X17A 1IBDA 4Z8FH 4K3AA 1YCSA 1F56A 4DQAA 3CN0A 4C56B 2FYVA 4HS6A 3HI5H 2AS5M 4AMKL 2BVPA 2ZT9C 1NI8A 2BERA 5DK2B 5SWQB 2DWSA 2EH8H 5I16A 1B0WA 1J12A 4JPQA 1T5KA 3BH9A 3L3OB 3L95B 2XI9A 3ZTEA 3DK2A 5ACZA 1VGKA 4PU2A 1FGNH 4TF4A 5B39A 4CC4A 2F58H 4Z7UF 4AQ1A 1F7YA 1G1XB 3DUSA 1LD9B 2VNCA 3ZUNC 4WWOA 4MLSA 4HIHA 3G5VB 1G6RL 3B3IB 5HGHA 4DEPC 1SF5A 3Q1SL 4NNXB 4X4MA 5C07B 5ITFA 3KXFA 4XP1L 2Z8RA 2F61A 1UM5H 2WZ6A 2XASA 3CPLA 1VQ4V 4PRIA 4TVPH 2NNRA 3COOA 3BP4A 4FI7A 3QIWA 2XN9A 5AVSB 4TUOB 1NT2B 1KLFB 4ZK8A 5FS5A 1TU2A 1UM4L 3RGVD 1H8HG 4HUUA 4AZ8A 1FO0H 1AQDA 1UEMA 3ARQA 1BXVA 3QPQC 2WN3A 4BXVA 5HHVH 1AGBB 3S96A 5L0QB 2QSAA 3JSSA 2GSMB 3PPSA 2WPDG 3R0NA 5PCYA 3W11C 4X7TB 3W56A 3P73A 1SOSA 3OHXC 2D2CC 4OZ4B 3D39A 4PJIB 3UBXB 4GRLD 1B2YA 1RMFL 2BNUA 3D9AH 3MLYH 4A1RA 2K1MA 2CUHA 4NO5A 3O4OB 2LQTA 2NY0B 1PNCA 4PJ8A 4DR6B 2EDEA 4RWYL 1B4JH 5DC4B 5EUOF 4BKSC 1UFGA 1BHGA 1HYSD 1AE6L 1M57C 1X4TA 1Y6XA 1QA9B 1YNKL 2IGFL 2PXYB 3M7FB 4K3JL 1IQDB 1D9KD 4M48H 5FYLH 1AP6A 2W0PA 3U9PL 3TH4T 3VB8A 3ZE1E 3ARBB 1QVFU 1GL4B 1H3XA 4G6AC 4L2YA 4WJKB 3O9WC 1UH3A 5I1DA 1P4BL 2OMYA 2P7TB 1PJWA 3MAWA 2L7QA 4JY6B 5IREA 4DR4O 1AYOA 1M3JA 1Y6NR 3NESA 4KHPO 3WJJC 4Z7NB 1PLBA 2NR6C 3TA3A 2ERJC 4WU7A 4U1IA 3J80N 3BY6A 5LMUO 1NUGA 1PG7L 2R1WA 4P2OB 1J7VR 3Q0HA 4PWJA 5ICXB 3VQWA 1Q1JH 4JB9L 5DD6A 3SPVB 1IGCH 4L4TE 1RZFH 2OK0H 4JZ2A 3RTQA 1FRGL 1L7TH 2R27A 3P3YA 1DJGA 4ZOBA 3ARGD 3CSFA 5J89A 3ZN1A 1V54C 3NGBB 2WJ5A 1LMIA 3KLAB 5DUPL 1CQKA 2A83A 4AL8C 2W91A 4WI9A 2ZOTA 3WHE0 5FFLA 3OKKB 4PJEA 1HH6B 3MHHC 4P57B 2M26A 5H8DA 1GHFL 3CSXA 3C6LA 3PF2A 3W5NA 1XAUA 1HR0O 2PWFA 3SPHA 3GBEA 3MMEA 2XQBH 1YZBA 4BUHA 2QLYA 3CNKA 1JJUA 2VRQA 4AMWA 3L7EB 1UWXH 2JDIG 4UUJC 2HLFC 4NQVA 1LEGB 5GW7A 4OIIH 3MSPA 4QRTB 1YG9A 3VD9A 2X1OA 3EGXA 3EO9H 1I94B 1AKPA 3T6WA 4MJ6A 5KBMA 1WHOA 2YSUB 3NZSA 4UCVA 4KK9D 4N86A 4I2XE 4PCYA 5ANME 2ZPKL 4Z7IA 2PCPA 2HMIC 5DD5L 2A4CA 3JV0A 3ZMVA 3HN5A 1FXKA 1HHKA 4XCCL 3VCLB 4CNIB 3HMWH 2OAAA 1YMHA 1A6PA 1RSOB 4ODTH 5DJ6A 3PGCA 2GQHA 3U4KA 2EEBA 3K04A 2NX5A 5EK0A 3OC5A 1NDMB 3BPNC 4IEFB 4LBAA 4U3XA 4I0PD 1K73W 2OQJA 3DO7B 4PJAA 1OK0A 1FLRL 3WFBH 3MUJA 5FX3A 3U2SB 1MHEA 1I9JL 3TGXA 2XWJA 4UCUA 1K5WA 3J7HA 5C0BD 3CCUV 5ACMA 1G4RA 5AWNH 1XMOB 3JV6B 4MLIA 3LRLA 2ZSWA 4MX7A 1ZCRA 2PYEA 2ZSVB 2QPUA 3ES6B 2A6IA 3N0PB 3RBGA 4UTCA 3RE0A 1RFDL 4MZ3A 5JNYB 4B3EA 5IUSA 2VJ0A 3VI3A 4CW1A 1CUOA 1T2JA 1BG9A 3VXSB 2R8SL 5D7JB 1NINA 2D7TL 3IN0A 2A5UA 2DQJL 3NCYP 4X5XA 5IJVB 2FCBA 5LA6A 1FIGH 1NICA 1XQ4A 4O58L 5EU6D 3KLDA 5F1KC 1LO5A 5JIMA 2ZAHA 3C2SA 1NBVH 1MF2H 1D5IL 3HHMA 4HFWB 5F93C 5C09B 5JHBA 4GRWF 4N0UB 5CD5D 2VIRB 4EFBA 3KYKL 1GC1C 6PAZA 2IFFL 4U2ZA 2QV4A 5CLXA 3DETD 5HI5D 3WKPA 5FDYA 3TS8A 4C83B 2WKOF 2K3TA 4N5ED 1PP9H 2CIKB 5ISZD 2K4WA 3MZGB 1P5UA 4Z7VA 4X7CC 1E9PA 2E9JA 3CC5B 4P4RA 2OL3A 5IFJA 2B08A 3GXMA 2XTAA 5KA5A 3HZMB 4M5YH 4LR3A 4G8IB 1VFBB 1G6RA 1FD9A 1OCWH 5MI0C 5GJTL 3KLHC 1GM8A 1GCFA 2HVJA 1VQLV 4YAQB 3RA7L 1QLEB 3GJFA 4WFGE 1DEEB 1KC5H 5AYTA 4X9YA 4NHUA 3QG6A 1EHKB 3DX4A 2EP6A 5IW1B 4JO3H 1N64H 1R6TA 2UXBB 4QTHA 3TM6A 4X7SL 1FFXB 3PWNA 2XZQL 1QUPA 3KLQA 4GUPB 1OPGL 2WOYA 3TTYA 1VKXA 3BO8A 4PV8A 4P46B 3REVB 3A4AA 3MV8A 5GISL 3E1ZA 4Y5XA 1A1NB 4GIPD 4JZJB 2O30A 3VFWA 3VWKC 2X4SA 4LFHG 4ODUA 1SEBB 1B6UA 2DH2A 1HXMA 4WFFD 5BQDA 3PL6D 2ZE7A 1KCKA 3NCJL 1KYOF 1UZGA 1ID2A 5AW1B 2DWXA 1KBBA 1RHFA 2OSYA 1PL0A 2YJLA 3FT4A 3LUTB 4WWID 1CG9A 3SD5A 3FN0L 2X4PA 4GSDH 5JYMA 1I7ZA 1NPNA 1L0YA 2QGDA 3NR7A 1BXXA 8CGTA 4NN5B 2DQGH 4OFDA 2WUCL 2QPSA 3H01A 4QRFA 4XPBL 3Q8FA 4EF3A 1YPZB 5CR1A 1D5MA 1NCCL 2VLLA 1WAEA 4FXKA 2Y1AA 5CEZH 2KT6A 2HWZL 4WKXA 2QM7A 2HFFB 2ZE0A 3TIEA 1DN0A 4DK6A 1EGJL 3T2LA 4N0CD 3B2DC 4N2GA 4IBTA 5T1KD 1IBMO 1UCBH 3QDJE 3U82B 5IHZB 3NIFF 4NZ8A 2H26A 2R56L 3FKUS 3IFOB 5JLZA 1A8ZA 2VYRE 4WI7A 4YZWA 1QRNE 4G6ML 2VLKA 3T65A 4BUQA 3G4SV 1MFCL 2O5XL 5I6XC 1CXIA 3NT0A 2UWEA 4W81A 4EQ2A 2P42B 2DWEC 7FABH 4M7KL 4W1TA 2D3LA 4ELDA 3TWYA 1U8JB 2RJZA 3VMOA 2G9HB 3BH8A 1QNIA 4UV7L 2R4SL 4XN1A 5I1GH 3E22A 1K72A 1LO3H 1KGIA 2ZKOA 3N42F 1DL7H 3JBG7 2XAJA 4FQ2H 1ADQA 3I9GL 1XWVA 4GAGL 2HKFH 4S2SB 5IMOB 1OSPL 2BNRE 1G9MC 4UZGA 1V55C 1T04A 3P4OA 4MMZC 1EFQA 2IPKA 5KVFL 3P3PA 2D0HA 1CLZL 1AQHA 1OWRM 4PSRA 1NEUA 2FLBT 4Q9RL 4P07A 4IKLA 2DN7A 1DVQA 2P9RA 4QRAA 2G9KA 4NZUH 5C0CB 2NYKA 3T09A 3VD0A 2Y7NA 2IAMA 5C1MB 2XWCA 5KG9B 1E8XA 1UM6L 2APBA 1O6SA 2HJLB 3B8SA 1S8DB 4GAJH 2BFGA 2ICCA 5DC0A 5F9OH 3V7MA 1F23A 3JYBA 4FQXB 4LVOC 3HUJB 3Q8AA 2P5EE 1HCYA 4IBUA 1KECA 2VLRA 3P1VA 2QSQA 2FRGP 1HILB 3EHBD 4HA1A 5EOTA 3CSTA 3QPXL 5JA8B 3DXAA 3L5WA 1Z5LB 4FLYA 1A7QH 3GJEA 4JLRB 2NUTB 3TFKC 1MG2C 1P9MA 2ZXCA 3OX8A 2X42A 3QJXA 1T66C 2R70A 3RVWD 3DSFL 4CVZA 3FTSA 5JHDE 2JF1A 1ED3B 1PM9A 1K7DA 2WLKA 5B5EZ 1HHJA 2ARJB 2WIIA 3LN9A 3ZIYA 2J2ZB 3H4HA 5IM7B 4F2ME 5HGBA 3DX1A 4Y4KD 3E86A 2VH5L 3V6OC 4H2CA 4HGWA 4NENB 4OM1H 4PDVA 1UYWL 4XXDB 5MENA 4XP9H 1RIHH 1KLGA 4RGND 3FKSG 4M5SA 1QAWA 2JCCA 3PNWB 1NMAH 5AKTA 5ID0B 1MRDL 1MG3C 3KPNA 3UTQB 4JM4H 1ADWA 4X6EA 4AEHH 1QQDA 2ETNA 1F4MA 4FYRA 3AG3C 4HFUL 4D9LH 3C2AH 2MOQA 3KD4A 1A7NL 1R24A 3RP1A 2AJSL 1AH1A 3IFLH 1WG3A 2BLFA 4P5TC 5TF1H 1M2VB 2FB5A 4TV8B 1CGYA 1ZA3B 1K3ZA 2LTQB 3CSPA 3WSQL 3A67H 3ZMEA 1XX9C 3FB6A 4M93B 4Q6YA 4X0NA 1HEJC 3IAPA 4P23A 5I1KH 1B0GB 2Z91A 1PQZB 3LTVA 2A9DA 5IHUH 3Q3GB 3SYCA 3BRCA 1T0PB 2BSSB 3MOAH 4JJOA 4JZOB 4NXNO 1BJMA 2VLME 2ZIDA 3R0MA 4XVJH 4F58L 3S98A 3P4NB 1E43A 1I7TA 1BVNP 2A73B 3ASNC 1IGML 4YBLB 4Q9CA 2IMMA 5I30L 4U3JA 2H6OA 4XNZC 2WMPB 2AFNA 1V5JA 5JPMC 4JNXA 2OMTA 1MHPL 2CALA 4OKDA 5LGNA 4HWZB 3GZQA 2YS8A 1M42A 1TKWB 2I60L 2HTLC 2OJEA 2UZIH 4WK0B 1EVTC 3TBTB 2AJYH 3H1JH 4PLJC 1NPUA 1U8OA 2K8MA 4I7ZC 5FYJH 4PJXE 1OP3H 3SYOA 3HMXL 2O6EA 4KMLB 1K9TA 3BJLA 2H32H 4EIBA 3WFEH 2JB6B 2F6AA 1NEZB 2OSLB 4DRXA 1FNEB 2X2UA 4J4PC 4YXHH 5KAQG 5JCOA 4KI1A 4NERA 4KTEL 1Q7YW 4DNLA 5IMKB 1AR1B 1ZT4A 2QT6A 5I9QC 1N8ZB 4OGAC 2AJUL 1BQUA 1XZ0B 3H7BA 3ARZA 2JRIA 4FFZH 4I9WE 4RMWA 4YSOA 5C0JB 1BIIB 1SQPH 3LQAC 3SDYH 2J12B 3AAZB 3HNSL 3VFMA 2AI0H 1N19A 2OMXA 2X88A 5HVHB 1YEFL 3Q9QA 5F72S 3M7MX 3MBXL 3ARXA 3MRMB 4DVBA 1XUQA 5EO9B 2EIMC 1A2YB 4AOFA 4BFEA 1A1MB 3EG9B 2JTDA 3IDYB 4I50B 4JR9H 2JI1A 4AEIH 1SN5A 5GONB 1I7RB 3B4SA 1AY1H 5BV7C 3MLXL 2EDNA 3N2GA 3QT2A 4MAYA 2AK4B 2ZAGA 1SBBA 2WBJB 1RUPL 3CH8A 1CT8A 1OAQL 2HJFB 5ALCL 1R3KB 5DXWA 3NK4A 2AGJL 3OLDA 3WNJA 1EXGA 1Z0MA 1LUVA 1JG9A 2WZ0A 3HLAA 3QO1A 3RRQA 3KPPB 1I75A 2CA3A 3MJ9L 3GGWB 1BMWA 4QJ4B 4BYHA 1NC4A 4GMSH 3II1A 4X4ZA 3TBSA 4EN2A 5AW2B 1XDCA 3JD0A 2WQVA 5E5UB 3UC0L 1U6AL 4JFFE 3EYUH 2LVCA 3UO8B 1NMBH 1WUZA 3S36L 2VABB 2IG2H 3C8KB 2A74B 3ESUF 1Q0XH 3MLWH 1JHKH 5D5ME 5B3JF 5EEVA 1N0JA 4IRSC 3VGAC 2ENQA 1WS7A 3KGSA 4OCXH 5AZEH 3HKZA 2UUAO 3UTPD 3ESMA 3IS0X 2HT3D 4Y8AA 1NCGA 1JNHB 1XEDA 4J7RA 1QVOA 1TQBC 5HGAA 4IDJH 3P40A 4OY9A 2EIKC 2DWDB 2XX0A 2Z31C 4IOSA 4PLKC 3FQ1A 4OF3A 3VXRA 5JTWA 2Y2YA 2A9CA 3BPOB 3Q6FA 2NDFA 2JIXA 5JH7B 2IH1B 3BZDA 1QBLL 3BIKB 2EEXA 1TZGL 5L7XL 1TF4A 2JJVA 4PJFE 5IW3A 1VIWA 1MOFA 1J48A 4GQQA 1TCRB 4N2HA 1G0XA 2WWMC 2WSSG 3Q44A 4HHGA 4B41A 3STZA 3DC5A 4F9LA 3V0WL 4O2CA 4ZSOE 3D05A 5HPMA 1GRWA 3V4VL 3WIFA 2HKOA 1SEQH 4LFHD 2CGYA 1MUJB 1MW2A 4HUWA 1XL4A 4KKNA 2C4FU 1OCRC 1XH1A 2M83A 4DO6A 4J8QA 4WI3A 4Z95L 5D6DA 3MLSL 1XGTA 1PAZA 4RETB 1AQMA 3BP6B 1GYAA 1PPJH 1BQ5A 3ARPA 4NPYA 4OTXH 1BBJB 1QLFB 3RYHA 1OF2B 1TQVA 2X7LB 1T22B 5E9AA 4WKZA 1GXEA 3OT7A 3ELAT 4MMYB 4LGSB 1G9NH 1UB5B 4AL8L 3MRJA 4Y1TA 5GSVA 3WFCL 5AENA 4YHNA 4ABUA 3TASA 3QRGL 1C7TA 3VWJC 3P0YH 2OMVA 5HI4C 1WD9A 1WB7A 1WBZA 4MGXA 4YHIA 1YDXA 2QEJA 5ICZA 3FB7B 5L3DA 2X6UA 1J1XL 1YYLL 3HI1B 2IOOA 3QJVB 4H88L 3UAAA 4NN6B 2PABA 4XPGH 4AMXA 3D36A 2CTRA 3FRPB 4LSRH 3E6HB 4MJIB 1Z2GA 3ECVA 4BFOA 4F8PA 1URZA 4ZMLA 4B9PA 2CLZA 2E86A 4DV7O 3S5ZA 4LCYB 5E4OA 5LBGA 4HAKA 1FZJB 2ZWKA 4WO4D 3TEXA 4HOWA 4X4YB 5DMYA 5IB1B 3F01A 5KN5B 4ZNEE 2FEJA 4TNFA 2NY2C 3RHWF 3VRIB 1R5VB 2YXFA 2CXKA 3FL7A 3GHPA 5IOKA 4S1QH 3QNXB 3U4EA 2UU9B 1XBDA 1CXEA 4HS6B 1IM9A 2PNDA 3HHSB 2BVPB 3GI9H 3Q8EA 5ESQA 1NL0L 3WDHA 1QBZA 4GRMB 3NCEB 4LLUA 5FOJA 3BGMA 3BH9B 2DQDH 1ANUA 1FSKB 2CDGB 1OTSD 3X3FH 3CLEH 1Q94A 5ACZB 1OTTD 1PKQB 1I0HA 4HZAA 3CFUA 4PFEA 3SSGA 1G4YB 1OAZH 4LGPB 5B21A 4YHYB 5C71A 2IWFA 4A7SA 3HMXA 3DUSB 1RM1B 1W72A 3P11H 2QWQB 4IGBA 2WBKA 4NWUH 2M2DA 1L9OA 2XTJE 1BW8A 5HGHB 1FWXA 2PR4L 5ITFB 4TOYH 4PV9A 2EILC 2A99A 3KXFB 3AS3A 1ETB1 1KC8W 5EU4B 1SGKA 4OJAA 1QHPA 3CPLB 4ZD3L 2VDQL 3LX9A 1GS8A 2HKAA 3BP4B 4KFMA 3HG1A 3LPGA 2BFVH 1VCBC 5IJ0A 4QNPE 1FJ1B 4X9BA 3T3ME 4MTGA 1TU2B 3L5HA 5HYSG 4K0OA 1QHTA 1T0NA 1DQLL 1KCVH 1LWJA 1ZSDA 4H0IA 4HUUB 4X6DE 4YX2L 1DLBA 1AQDB 4LIQH 4O5LL 5I74B 3ZDYB 2GK2A 3QZWA 3VI4A 4UTAL 4HSQA 2DYRC 1RY7B 3S96B 2KC0A 4JHBA 2R69L 3G7TA 3K57A 3HAEG 3P73B 5E2VL 5D1ZI 3D39B 2RD0A 1ZA6A 3GMMA 2KYIA 5ACLA 3V6BR 5ITZB 1CDIA 5IBUG 1U8PA 5F8RC 4NO5B 4G6KL 4ANVA 1VEPA 4H44B 5B3SC 4FXTA 2VC2L 1VZGA 5F0PB 2XNAA 4ZAKD 2C9XA 2ZP9A 4KJQC 2WO2B 3MJ9A 4CA4A 2CA4A 5CO1A 3KMDA 2F68X 3FB5B 3NJMA 5FIEA 3IDJA 5A6MA 5I1DB 1KFAH 5ITBL 3CVCA 3FHQA 4EBQL 3QWRA 1X5FA 3WO4C 3NSXA 1ND0A 2FTAA 3S2CA 4NPKA 1EN4A 5JJJB 3TA3B 4IS6A 2YIBD 4U1IB 2X9YA 2DM4A 4Y2DC 3B2MA 2QVMA 2R0WL 4UTBL 2IH9A 3OHXA 3ZE1F 3MRQA 3JWNG 3N91A 5BPPA 2YQGA 2WV3A 3OZ9L 2E4TA 4JPWH 2D2OA 5F7EL 3S3DB 4DV4B 1DQDH 1IBGH 1U91A 4JRWA 4MB1A 3ROOA 4CMHB 5IYCO 3NA4A 5GGTL 4JDZA 1ZV9A 2XC8A 2J56A 3QGVA 5LXTA 5J9PC 3CHPA 3EBAA 3C6LB 3AG1B 4PB0H 5ADOH 3L72H 4HH9A 3TF7C 4TSCH 3MMEB 4MNGE 2E5EA 4F8NA 2V7HA 1PSKL 1OGPA 1NJIW 4NQVB 5FO7B 4ZFGL 5HBBA 3UO2A 4I0CC 3KG5A 5H35A 1WA2X 2AW9A 2DIAA 1P49A 1DBML 3EGXB 3WJJA 2NR6A 2IC2A 3NCCB 3A47A 4MJ6B 2AEPL 1TXKA 4PW3A 4XPAH 4OFKA 3MOQA 4NQUA 4Y5YC 5GRZA 1CXKA 4LOUC 4U0RB 4KROC 5DJ6B 1T6VN 2CAKA 1BV8A 3U0ZA 4P2YA 5SWSA 2NX5B 4I89A 4BRVA 2MPAH 2WXFA 2YAOA 2IDSA 4GKZA 4W9GC 3A22A 4PJHE 2ADQB 1FNAA 1SRYA 4K7FB 1KXTB 4NS0A 5DQDL 1JHLH 1CXHA 1MHEB 3HRZC 3N41B 1F4NA 1AVMA 3SYAA 4FHKA 4UUJA 3A6OA 3D3VA 2JK5C 4MX7B 2EE2A 2LABA 3B9KD 3TBWA 5BS0B 4PY7B 4N1HB 5IGXH 2WWKT 3QG7L 1FFTB 2A6IB 4MJHA 5L4IA 1L9TA 4DEWA 4X65O 1F1GA 1OPOA 2YD1A 3VI3B 5BRZD 4JGMA 3MODH 1KCWA 3NSDA 1OGAE 3C5SB 1IC4H 2OA9A 4LHUA 4F37K 3QO7A 2VS0A 5EU7C 2FWLB 4LPVA 3R4RA 4X88A 4JDTL 4B0MB 4Z7OF 1M4KA 1F8TL 5HHQA 5E4EC 3LH2L 3MPCA 5HHNB 4X7FC 5FOBA 3BESR 4NPJA 1SY6L 4ZTEA 4TQDA 5CCJA 3UYRH 5KX5B 5HDRA 1J9SA 2DEYX 3QA3A 2RHEA 4ZUUA 5B7FA 4M7LT 4JFSA 4PP1C 1QACA 1F6FB 1BZ8A 2R2EB 1RXLA 3KWWA 3S6CA 5LVEA 4P2QD 2BNQA 2WVSA 2DI8A 3GXPA 1E9PB 4WV1B 5JIDA 3ZHKA 5DI8A 1E5YA 1XMOO 4HT1H 3MNVA 1LP9E 4R6ZA 2Z3FA 3ASWA 3BZ5A 5ICUA 1G6RB 2EDYA 4HXBH 4LNRA 1P4LA 3CHSA 1B9KA 3S4SG 3QFJB 4GQPH 3OKDB 1I3UA 2WBXA 1WWBX 4D9QE 3WXWH 3VDBA 2KBGA 1BD2A 1BE3H 1ZLDA 2XY1A 3GJFB 3NZ8A 4ZXBD 3TN0D 1OE3A 4MQSB 1ZXKA 2IQAA 4HWNA 4U7OA 3QG6B 3QI9D 4NHUB 3ZMNA 2AHIA 2QM4A 1GMEA 4G8AC 4KMTL 3FAVA 2XV3A 1DO5A 4XX1G 4CUCA 3PWNB 4EB6A 5CM1A 3BZEA 4TM9A 1AHMA 4WENB 2WVUA 4P2RD 3SQOH 1WPXA 4UTAA 4F15C 1MPAH 1G94A 2NXYB 4BH7A 5KS9A 1EUUA 2OP4H 3OKLB 1O9GA 4Y5XB 1TTBA 2CCLA 4FI8A 5DO8A 1FNSL 4GZRB 2XXGA 4P05A 5F71A 3TO4C 3MV7A 4KDVA 4PW9A 4QHNA 2VDLH 4I5BA 5D7KE 1ACYL 2R2HA 3FT4B 5HPOA 1G9HA 4RFNC 4D0CB 1CG9B 1DBBH 2EQDA 1QFWH 4LK4A 3ISRA 1I7ZB 2OYPA 3IGKA 4KZCA 3QZNA 3CU7A 3S5LG 5B39G 2HFEA 4NO3A 4DUVA 3QO5A 3IGLA 5B1BB 1AXIB 2UXNA 2VLLB 1T03L 4NQEE 5J13B 4OD1H 3V4UL 1DN0B 4P3CH 3TVMA 3I55V 2Q7NA 3QTCA 3D52A 5IROD 4IKJA 1U8IA 1A14L 2D9QB 5KMGA 2EECA 4R7LA 5D2NE 1DJWA 2Z65C 3CXDL 1I1RA 3EUDA 3H3KA 4KV5F 4MBOA 3WIIL 5FF6A 4ZS7H 4E42A 4NRYA 3MRDA 4IJTA 3UX9B 2A6JA 3MJWA 2ICWJ 3G08A 1YMME 5AYUL 5F96L 3BPCA 2X4RA 4OGQC 1EXUA 4F9PA 2A3TA 3IBOA 4QYOA 1YSCA 1NGWB 3CXFA 3K2IA 3LD8C 3HC4H 3OWRA 3QUZA 4OZHE 5DEGA 4PVBA 5MEPA 2UWEB 4TUUA 5D1XC 2ADPA 1UD8A 3FQ2A 2IQ9L 1GZPA 1IILE 5GGTA 3BD4A 1JZEA 2VDKL 4OZIA 1CU4L 2P24A 3F64A 2BW4A 1P0SE 3HFML 3HG0A 1QZNA 3DGGB 3TONA 1QSVA 2W0FB 4R2GD 1WIUA 2NY5H 3O3UN 1B90A 4FQIH 1U4EA 4KDTC 2ZNXA 1TMCB 1RPUA 2LLLA 2HKHL 2X89A 4FQ1H 1MH5A 5C3TA 3TEUA 1MN4A 2N56A 2G2RB 2QMJA 3DARA 1T04B 3OGOE 1PKXA 2IPKB 4OXSA 1M9NA 5CJOH 3GSUB 3KWUA 1AI1L 1NOFA 4APXA 4JFYA 5DHVH 3HTLX 1CE1H 4HVBA 1ZT1A 4KRLB 2IAMB 1WEJH 5SV3A 4G1EA 1HIML 1VQMV 4R83A 3RFZC 1AANA 4BBWA 4PH8A 1O6SB 3TV8A 2FSEB 4CS4A 3W0WE 5C0DA 3SBQA 4FFYL 3I9AA 1SQQH 3B37A 5D7HA 4BCYA 1KDJA 4WFHD 2K45A 3NJLA 5BV7L 3L3IA 4G8EA 2JJ2G 1S9YA 1BZOA 1Z2KA 3CC2V 2V9UA 2ZOKA 3EJZC 4P49A 5EOTB 3OSVA 2C3GA 4DPBX 3L5WB 2YN5A 2X2JA 1LK3L 3RIAF 4GUCA 4MMZA 4NNYA 2WAQA 1GYVA 3EF7A 3M86A 2B9AA 2WTRA 1AO7A 3OX8B 2XA8L 3X11B 3WBDA 3EOTH 5E8DH 4V2BA 1XF5B 3GDBA 1ET7A 3IJSB 3V6FA 3W7WA 4HCRH 4CVZB 1SC5B 3K4ZA 4PUBL 5BO1L 3VAEA 4WZ9A 5DHYB 2CMRH 1PNMA 1C1EH 2WIIB 1R6NA 3B9DA 2PCYA 2ZQKA 1QHQA 3EJJX 4ELMF 3DHMA 1KGCE 1RJLA 3FCGA 5GSRB 5E1AC 2V5YA 3E8FA 3FTYA 4IU3B 5HGBB 2JI2A 4HGWB 2PP9A 1T1YA 1SY6A 1UOVA 3EOYG 5MENB 4MAUH 1KLGB 4I48B 2V37A 3DTUB 1P4IL 4NM8L 2UXDO 4PLNC 5A2QN 1CLCA 1UGNA 3P0GB 1X7TA 3KPNB 4G5ZL 3QYCA 4ZUTA 1SS3A 2XZZA 3L5XH 4J2QA 1PX4A 3VA2C 5G4NA 2ZKXA 1CMOA 4X6EB 3KZ8A 1EZLA 1QQDB 4DP2X 2J5WA 4Y1AD 2TSAA 2Z93A 2ATKC 2C7FA 5LN8A 5FYKE 4KRNA 4UT9H 1R24B 4ZI7A 2O6FA 5C08A 3THOA 3GRWH 2MEJB 4LL9A 1BZ9A 1FAFA 2DMHA 3ZTCC 2J6WA 4WSGA 4Z0BH 2G3MA 2VMJA 3FB6B 3KKYA 3EYSH 1IKNC 2NNFA 3VTAA 4HKJA 3WTVA 2E7LC 3O65A 4P23B 2Z91B 4APQD 1E4KC 2FT8A 2NW2B 4MB5A 4WWPA 5I15H 1X4XA 2X09A 4G9FA 2HLAA 1KG0B 1V10A 1QSFA 1K4DB 3KHQA 4S1RH 5E6IC 3OZLA 1SZNA 1ES0A 1LDPL 3ML9A 3WG7B 3O6LL 1S7TB 1GCYA 2ZOLA 3LEXA 1BF5A 4NEHB 1JOIA 2OIGA 2DBLL 4OB5L 4U3JB 4IQHA 2G3ZA 2Z34A 2IBZY 4XODA 3ZR6A 2YA1A 5DEDA 1A6UL 1WK0A 4NI6A 1JNNH 1OLZA 2WXJA 4HAFA 4AQAA 5E0QA 4PSPA 4HSAC 2IPTL 3MU3A 1BOGA 5E8PA 2OJEB 1S7XA 3QUMH 1PLCA 4HIXL 2WLLB 3SCMD 4ODHH 1FYTD 5HYFA 1U8OB 5IKCA 1TQUA 2R15A 5DZAA 1WPBA 4YHHO 4CL7A 4N1CA 4QRRD 3SYQA 3K8MA 3DMMD 4A37A 4PREB 3MXWL 3DVGA 4UAOB 1TJGH 5E79Z 4D3CL 1E7UA 2ED9A 4HPYL 3CFKA 3ZE0F 5D7LA 1AB3A 1KBGH 1ZT4B 1ORSB 3L3DA 4H5SB 2WLZA 2V5SA 2RFXB 3F84A 4YH6A 4PJXF 2XVKA 3H7BB 3Q5TA 5D1ZB 5I6NA 3ZE2E 5DVKA 4M6ML 1ACXA 1SXNA 2JJTC 4JUSA 3I02A 3VG0L 2NY7L 4M4RA 5F7HA 3C8HA 2Z4QA 4XPTL 4ORZC 5JPMA 3PXHA 3EFFA 3QDGB 3WMQA 1J0IA 2X1PA 4OLWL 3HKBA 3OR6C 1G9NC 5E2UL 2C9AA 1IEBA 2H3NB 3MV9E 4P4KC 1A6TA 2DI9A 1XL6A 4G43B 1F8TH 1UACL 4Z7UB 2FYYA 4LASH 3ZTNH 5KSUB 1C08A 4H1LB 4K7PH 5IQ7H 3VD4A 1ZHLB 3MTXA 3AACA 1Q9WA 2YEQA 3IWUA 3L5JA 1E67A 2BHUA 1YNTA 1YNLH 3CVHA 3C75A 3FCSB 1T0OA 4J4PA 1K92A 2WIMA 1DF4A 3RU8H 1RERA 4PJGA 4U1GC 2GJJA 5L8KB 4HC1A 4FZEL 4M1CC 1AQ8A 3P69A 3LQMA 4UDTA 4AXWB 1HN1A 5KVEH 4E2LA 4NQDA 5EDSA 1NC4B 1IGYA 4K2UH 4FNLL 4HX1B 2CE6A 5GJSL 1F4XH 3SGJA 3Q5OA 3L9EA 1T4KA 2BJML 2OULB 4XE5B 4BQCA 4FM2A 3O11A 5H5NA 2WLMA 2GG1A 2BZ7A 4ZFZA 4U6VH 2WXPA 2VQ1A 4XN9A 1OAJA 4CS3A 2GTZB 5DR5L 2Z92A 4KKZA 1V3JA 1RHHA 3LIZH 1CN4A 4BV1A 1D5XB 3T6VA 4BZ1H 1U95A 4MZ2A 4U7NA 4QRUB 1HDMA 3HN8A 1Q0EA 5EUOB 4J42A 3QJFB 1KMIZ 4HEPA 2NY1B 4AGMA 3QNYA 1H15A 5D5MF 1Z3GH 3FT0A 3Q6FB 2YXLA 5KSVA 1Z5HA 2JVUA 4FFWC 3V7AG 2B5IC 3K46A 4A6YH 4I4WA 2AV1A 2VDRL 1FV1B 3B7TA 3BHBB 4G8FA 5HGDA 3G9VA 2FECL 4M6NH 1HZHH 4QWWD 3STZB 1GKFA 3IPEA 4O2CB 3M99B 4J6RL 5HPMB 2DQCH 3F6IA 3WIFB 3ZDXB 5L4FA 4G71B 2HT2C 3QEHA 4HUWB 1YQVH 5CBAA 5CAYB 4I3SL 4PJFF 2DWYA 3SDCB 3KYOB 2O93L 1XGTB 2Q67A 1OD9A 1F45A 1IAIL 3IBEA 4NPYB 1MAMH 4KI5E 4AYFA 1BQLH 2Z31A 5JDJA 1A1OB 3C60C 4XT1C 4CADA 4P9OA 5DD0L 3L73H 5DUJA 4GO8A 4YDNA 4XVTH 3OPZH 2XWEA 4YHNB 4DW0A 2OMVB 3QYMA 2OJ1A 2O5ZL 1WBZB 3D18A 1EAOA 2V9QA 3FC8A 4YHIB 3SQRA 1Q6IA 5ICZB 1ZVHA 1F90L 4Y2LA 4G8GD 3NDZE 1N5AA 4RZCB 3TIDA 3VGBA 3E8VA 25C8L 3MLZH 4QAWA 5EBLB 4R96B 5TK2A 1UA3A 5LCVH 3KR3H 4OGZA 3KVQA 3ABTA 2NXZD 5A43C 2MQGA 4O9HL 3RPBA 1OAUL 2BSRA 5DRZA 2BIPA 43CAA 3CCJV 3DJZA 2CLZB 1OGTB 3G9AB 2ZNIA 1OALA 5AB0A 3BPLC 3L4CA 3D8MA 3GI8H 4NYLA 5DUML 4QE7A 1SVZA 4X20A 1OK8A 2DV6A 2FVNA 4X4XA 1KIUB 4OLVH 1H2GA 2AABH 1PZ2A 5C9JA 1WISA 5DC2A 4X1KA 3L4WA 5E1GA 3QUYD 3C5JB 5I75C 1JYWA 1INDL 4OR1A 2E75B 1A4AA 2I07A 4TQFA 2GAZB 3L4YA 3BGMB 3WJLC 5C8JA 2DJ4A 3T04D 3VXMA 1FKAO 3IGAC 4YE4H 1WB8A 2CLVB 2ZWSA 4WWNA 5HHOE 5KJRH 1I1FA 4ZHQB 5SV4A 3BUIA 1TEFA 2GIXA 1NBCA 5JQ6H 3RVTD 1JRHH 4LLAA 4L48A 2H2PD 4OCMC 2AEOA 1NBYA 5TK4A 3JSNA 3SE9H 5IMLA 3HG1B 5J0BA 1JZDC 1NGYA 5IJ0B 4GRWB 5IT2H 4JM2D 3MR9B 1OP3K 4XDJA 4E9YA 2LP7A 2WYZA 2FD6L 4DP8X 4PD4K 3KW8A 3SD2A 3GMQA 2O61A 1T0NB 5C92A 1ZSDB 4DUZO 1KXHA 1YEIL 5JR1L 2ZT9B 3RTQD 4ALAH 4OJFH 1AG6A 3VI4B 4ZMYA 3II2A 3ICXA 1JHTB 4XRCA 1RVFH 3OR7C 2YPLD 4M8UA 4HV8A 4QNPF 3TBBA 1QSED 2A9HA 4UU9B 5FM5O 3RKDC 1ZA6B 2MMXA 3GMMB 2KLTA 3HJ0A 3UQ8A 4BINA 4MVOA 1Z7JA 3U36A 2IADB 4X6DF 4I77H 5CJXC 1U8PB 3S37H 2FSDA 1KJVA 5HI3D 1XH2A 3PHSA 4DEPB 4FI6A 1SOXA 4DW2L 5EOCJ 4FLTA 1W0YT 4ZUSA 2EIEA 5FHBL 4MVRA 1ZEAL 2KH2B 1JGEA 1OM9A 1JPEA 2NY6C 4L3EB 5D70L 4O2BB 5INDB 2XNAB 4MA3A 1I8AA 5C0AD 1YEHH 4AJYV 2OTUA 3BVNA 2Y0IA 2EDQA 5GS1C 2OCCC 1WJ3A 1Y67A 4FFTA 3T1YB 2ARHA 1IZKA 2GJ6E 1ORQB 4FQLL 1R4XA 2QFPA 3FT3B 2AQRA 4RDQF 5IFAL 4XO9A 2H1LM 5FYKD 3REWA 1PTZA 1ND0B 4PJ5A 1ZVSA 4QHUB 4LEOB 4ONFH 4U2YA 2VWKA 4W9HC 3A4FA 4UILL 4IS6B 5DFWH 4OCNC 1DBKL 2AQ2A 5DUBA 4YGAB 5ILTL 3WHXA 3IFNH 2D2CB 3OHXB 4FMTA 2NY4D 4FTVD 5E9DB 2N4IA 3H42L 1G0DA 1W8EA 1TR7A 3K5RA 2WUBL 3TJPA 5B22A 4QJFB 2F54D 1U91B 1TGOA 3QQNA 5JHMA 2PYED 4UT7L 1N33O 4PBVC 1M57B 5T33L 4CSSA 2JE8A 1U8NA 4PGBB 3WN5A 3VTTA 3LMJL 4G70B 4HH9B 2XVGA 3AADB 1MZFA 3O9WB 4BZ2H 5EUKA 4HF5H 2V7HB 1EQWA 3NIFB 2X3BA 2V3EA 3JTBA 4Y4HD 1G9EA 1MCWM 2Q7GA 5H35B 1KENL 3ZHRA 3DRQA 4F93B 2Q69A 1YAZA 2ERJB 2Q73A 1JX9A 1Q90A 1TTFA 2OV0A 3ULVD 4O02H 4Y2DA 1EHXA 3LPFA 4LCIH 4YY3B 3ELQA 4RBPH 1H2LA 2OJZL 4D3CH 4N2DA 3L1OL 5DJYA 2B9BA 5GRUH 4Q9QH 2XFXA 2NSXA 1FZMA 4XVUC 3SDXA 1RSFA 2R9HC 1KDIA 4HUNB 4JDVB 1RUMH 2OR9H 1V54B 4KKAD 4QHPA 1ZK9A 4DHLA 2OYQA 1L5GA 4ZTOL 4GO9A 3UYOD 3CE2A 5J9PA 3JALB 1GY2A 3NOIA 3RWCA 3D69A 3ETGA 4U3SA 4ONGL 3NJNA 2BMKA 3AY4C 1EMTL 2FBRA 2JV6A 1ZTXE 3N42B 2D03H 2H0JA 4E5XB 3FONA 3OLIA 2FH8A 1KYDA 4JEGB 3IDXH 4KGLA 4UUJB 2X6VA 2PYFA 3ESPA 4YGVB 3NIDE 1HL4A 1E27B 1J1OL 2CK2A 4BZYA 5HYJD 5JORA 2I25N 1JVOA 1ETZA 2BXZA 4MQTB 4PGDA 4ZOLA 2OMBA 1D2PA 4MXQC 5JJNB 4F2FA 4QOKE 5GGQH 2YOAA 3AREC 3LPOA 4ANXA 1XCXA 4YHPA 1OTUC 2Q20A 4OBRA 3UMNA 1IC5L 4HEME 4B9JA 2XXFA 4PJ7E 1YI2V 5EF1A 4WUUD 1I82A 1CZ8H 3BPNB 3I2CH 4I4TA 1HKLL 3QQ3A 4HBCL 2EEAA 4WHTA 5FOBB 3LDDA 2MOVA 3DUHA 4GI8A 1TUBA 3RWHA 3LXAA 4HPHA 3RWRD 2PZSA 2V5TA 2Y36H 3I6LE 3QA3B 4QXTA 3HRZA 4OLXL 5EO1A 4ATTA 5FYKU 4KXZI 4UOW1 4ZUVB 2AITA 5IVXE 3G5XA 5KHKA 1TAEA 2JK5A 5KLVH 3VA6A 2BNQB 5EZLA 3F3HA 5FK9A 4DUXA 1HNXO 1YYMH 3WFVA 2K78A 4MBRA 1CI3M 2V6HA 1G7MB 3GM0A 4U1JA 3UTSA 1IAMA 4RAUA 1L3NA 3MYJA 4YHZL 5BVPL 3ZU8A 3MNVB 4YUEH 1R0AL 1PV0A 3LQZA 1D3CA 4KY1H 4LNRB 2RN9A 5LYJA 3STLC 1P4LB 3D85D 4KITB 3T6QC 4PN6A 4WI2A 4I85A 3OG4B 4NGHL 5EZOH 2FJHA 3H9HA 3NZ8B 3IJYA 5HHME 1IL1A 3FNKA 2VDQB 1K8DB 2XIDA 3GC3A 3RGVC 1UH2A 3RVVC 1WBYA 4CH3A 4WLCA 2VLKD 4GS7C 3WIHL 1FH5H 4EB6B 2QMKA 2FNBA 4MNQA 1KCSL 1F1DA 1SPDA 4XCFH 4PAZA 3VXOB 1UPGA 2GTSA 1XGUA 2A7BA 3VYOA 4BH7B 5CZKA 5KS9B 5CEYB 4R9HA 1EBPA 2YMXL 5DYFA 3FFQA 4GRLC 4L37A 3AXIA 2XUMA 3VMPA 1BVKA 3D0LA 3B1TA 4G6FD 4BSWA 3QEQD 4I5BB 4P9MH 4LF7O 1HHHA 5LDUA 5MI0B 2R2HB 1HYSC 5E23A 4E41B 3HE7D 2JEXA 1D9KC 2VC2B 5GZOA 3UH8A 2IO5A 4JO4L 5AB9A 3GBMH 1E6JL 2A77H 3BEVA 4WFBV 4NO3B 3X3GH 4WW1B 3SGDH 4BQBA 5A3ID 4XNXH 3RX8A 1LO0L 4OI7A 2CXGA 1U8IB 3K71A 5KMGB 4LSTL 4GIAA 4CJ0A 3W9EA 3RGHA 4JI6O 1YEEH 3FAXA 3VWKB 3G08B 5T1DL 4DK5A 1SOQA 5J7CC 2BDNH 2X4RB 5BZWA 3TO4A 4DF9A 1RUKL 3KLSA 2WWWA 4QYOB 5DEGB 3ARGC 4XN8A 4M9PA 1JXKA 2X2IA 1QTYT 4BW9A 5I23A 5FUCC 5EB9A 3B40A 1DP0A 1CK0H 3QZWG 1GZPB 4FNQA 4G59C 4X80L 4KUCF 3O2DH 2P24B 4KVNL 4N26A 4ZJ9A 3LPWA 4W9EC 4CC1A 1J5CA 2CK0L 5I19H 5CJQH 2D31B 3NSCA 3NJFA 4LEXH 5KJ4A 4OZHF 3L2LA 3QWOA 4C56E 2DM7A 2ZWZA 4P5RA 3A21A 1FDLL 3QORA 2FIKA 3IAQA 1J1PH 5EBWC 5A2LH 1J0KA 3EYOA 4YMPA 1YIJV 4KHXL 1AS8A 2H9GA 2ESVD 4KK9C 1LO2L 3IU3B 1ZPLA 4APXB 1RZKH 4JFYB 2WNWA 3ZR5A 3J27A 5L6YH 1P7QD 1ECYA 1J10A 5AW7B 3K1KC 1WZLA 3NH7L 5I6XB 2B4CH 4FLZA 5D1XA 1UWGL 2XIIA 2FECI 1WRFA 2DWEB 4MNHA 5AOIA 5SWZA 4I0PC 3DXRB 1S7SA 2UXTA 4W70A 1E2VA 5E70A 1BBDL 1UWEL 3EO0A 1P84J 1IT9H 5C0DB 2ITDA 2K0RA 4H25B 3VU2A 1N2RB 3EOBA 4O2AB 1CGVA 1I7UA 2AEQH 2YBGA 1XVSA 4GW4A 4PTTA 5M95B 3DIVA 4KDTA 2C34A 3L3IB 1IAII 1G7IA 4G8EB 1S9YB 1KXQE 5A7BA 4P2ZA 1LL1A 2ZCHH 4X64B 5CCGE 1ZIBA 2VDOL 4K5LA 4ZDHA 4NNYB 3FDWA 3LN4A 1NCBH 3MHZA 4MMZB 3Q43A 2F7PA 2EDJA 2WTRB 4PJIE 3T0ED 1AO7B 4QNHB 2EDHA 1GKOA 1I4FA 4OCWH 3GBLA 3ZO9A 4F3FA 4BDVA 4JFVA 1DQKA 4YHLL 2N7AA 1KIRB 3K8KA 4DZ8A 4H8HA 4G83A 3RFZA 4IW4C 5CD5C 1XV8A 2Y6TE 3D4CA 1ZT7A 5EN2A 1TJIH 1UT9A 1DK1A 2OXHA 2VWEC 1E1RG 3DETC 5CSGA 5HI5C 1QPPA 1JPSH 4KJYA 4LVOB 1IAOA 1EHLH 3RBZA 1QNZH 3UIYA 5JXEA 3CRAA 2BOCC 3E3QE 3WLWD 3LHPH 4HIJA 1PPIA 2H32A 2Y5TB 4Z7NE 1QR8A 3K0GA 4GFTB 4AI7A 2OTPA 3UTTA 2QQLH 2WCGA 3QB7C 4ZI7B 1FI8C 4KO9A 2IOIA 3DX9A 5C08B 4LCWA 1BZ9B 5IEHA 1YUKB 4DCQA 4HKJB 1AR4A 1TVKA 4DR3O 1BVNT 4PGEB 3FUFA 32C2B 5E1AA 4W4KA 4OLYH 4LOEA 1C12A 4AKPA 5I8CA 3DV6A 2BC4B 4G9FB 4TSBH 3FFDA 4JTDB 1QSFB 1ES0B 4LHUG 2XV0A 4QE9A 1EUTA 3QVAA 4IOIA 3CDGB 5DD1H 5LG6A 3KEHA 2ZOLB 3LEXB 1CR9L 3PL6C 3QDMD 2NT0A 4TSAH 5FPOA 1GGCH 2J25A 3LVTA 1A7PH 2ZYSA 2B1HH 4OJYA 2GI0A 3L1OH 4RH4A 1Q9LA 4O4JA 1CTMA 3UJJH 1BHBA 5AOJA 4DPAX 1WUNT 2ATKA 1RK7A 1OY3B 1OARL 5DHMC 3QUHA 3L3GB 3VOUA 1WZKA 3MRBA 4P5TB 4PB9H 3ZYZA 1BOGB 1PZBA 1S7QA 1SUJA 3PNRB 4PP2A 4AEFA 2E27L 4JPKL 3KYMA 5GRJH 5IKCB 4FYTA 4HJJH 2E7LA 4GG6E 3JQOB 1BREA 5D7SL 1QFUH 4YVNA 1M7UA 1E4KA 1G6VK 1USQA 1AGCA 3O41A 4YDZA 4ADGA 4N0CC 1NU1H 2AQNA 3NZHH 2EC9U 2YUZA 5DJXB 1MCOL 3CFKB 3T0VA 5D7LB 1BYPA 4LDLB 4OIBA 5E08L 3ASNB 2LT9A 3OF6A 5FM5M 3VU1A 2Q86B 3I02B 1G4MA 4XNZB 3GWOA 1AMYA 2MJWA 4HMDA 1U4FA 4YIQA 4IOFD 3EFFB 1B4LA 1ET5A 2HFTA 3O0LA 4NBZB 5HY9B 4QGTA 3HKBB 4JG1L 4XBFA 1JAEA 4FFBA 3VXSE 2UUBB 1IEBB 1EX0A 2JI3A 3F8UB 4BUGA 4OZGF 2VDKB 3ZE2F 2FYYB 1C08B 4PJ9A 4M6OH 2KQNA 1K8IB 3VGDA 4TNVF 4NTWA 2HRGA 3GHEL 1Q9WB 3WI9A 1YN6A 5C09E 4OFIA 3CX5F 4JI0O 5MERA 4N0UE 3GUTB 3N50A 3O3DB 3CVHB 4MWFA 4Z78A 1J18A 1N4XH 1TO5A 3H6AA 5LOVA 4IKNA 1Z9OA 4OSUH 5K9OB 4HNAB 2C3XA 2W65B 4K3DL 4UT6L 3Q4HA 2PI5A 4YHZH 5I9QB 1YEKH 3EIFA 2IANA 4UFZA 2WNKA 3EJTA 4Y7MA 1HAWA 2VN7A 4ZOEA 4BWTA 2JJTA 2V7QG 2DY2A 3M6DA 4I3RH 4JI7B 4K9JA 4Z3EA 2WGNB 4LKXA 5D96C 2WO3B 1KYUA 3RWEA 4PRNA 5L2KB 2L35A 3O11B 4X2UA 3UZVA 3TEWA 3HPJA 2VR9A 2BS8A 1L7IL 4MJ5A 4GB9A 5T3ZE 2EIMB 4RWHA 2Z92B 2J5LB 3AXHA 3RY5A 2GUZB 1E5BA 2CO7B 1RHHB 4X1YA 1VQ8V 1MQ8A 1PY4A 1U95B 4WUKL 4ZTPH 3EHBC 2GJRA 2LGNA 4WHDA 4A38A 1XF2B 5BV7B 2AZ2A 4MD4A 5EORH 1M9SA 4YIPA 3QNYB 4N2AA 1UJWB 1H15B 3TBCA 4H26A 5JIHA 5I1EH 5KSVB 5I6KA 2Y24A 5IW6B 5AG2A 3O6KL 1J0ZA 4C59B 2BRQA 3RVWC 5CU5A 2F9BT 3MROA 3V6ZA 5JOPE 2AV1B 5L2JA 4H2AA 1TEGA 3MJ7A 3LZLA 5I0WA 5K9JL 3ME0B 3GBNL 4MRCA 1GA2A 1J5OL 3B1UA 4DK3A 5TDNA 4F2EA 3DWTA 4Y4KC 2QPEB 1INQB 3T1WA 2UX7A 2OZ4L 5JUEH 3QEHB 2N1KA 4WEBH 4JN1L 4RGNC 4IRSB 3VGAB 1UJ3C 1SJHB 4XAWL 1M71A 3UCRA 5CIPH 1YPZE 4NN7B 1X44A 2AXGB 3D4GA 1IM9D 1TQBB 5DRXA 2EIKB 2Z31B 1N6VA 4X98A 3FBQA 1JGVL 1EO8L 2MCAA 3MGOA 3KVPA 5T3XD 3US0A 2JKSA 4U3HA 5D8JH 4XMPL 4OVVA 4UB0L 2XUWA 1VPOH 1RP3B 2YEZA 2YRPA 3SKMA 1KKCA 3IEAA 3V9EA 3D18B 3JD1A 2YR3A 2GSIA 3MO1A 2AXWA 1N5AB 3MBED 5KZCB 3TIDB 4HCGA 2H5UA 2X0UA 3MRLA 4JVWA 4O4IB 3EOAA 3EYFA 1W16A 4KUZL 4LVNC 2QTVA 1T89C 1EZVX 1DFBL 4X5RA 1OCRB 2O4EA 1EO7A 1W15A 4LDEB 3QZMA 5DRZB 1HL8A 3MLPA 4JFHD 1JZ6A 2BP5M 4OCSL 5EZIH 1TZIB 1X9RA 5DJDB 3BLPX 5TDPB 1N0LA 4NYLB 1W0KG 5LHIA 1QKZL 4J7ZA 3C60A 15C8L 4H33A 1IE4A 4J41A 4X4XB 3NTCL 1EO5A 3NMEA 4JO2H 4MZIA 4R5VA 5ANMB 5FGRA 5EN2B 1ZTMA 1IJ9A 5C8YA 3KCWA 2ZTBA 12E8H 4HAGA 5C6TH 3VWJB 2UXCO 1WFTA 3GMLA 1NFIA 1L8DA 1A5FL 5KUKA 2W9EL 3GNML 5D4QA 1XGYL 5C0CE 4CC6A 1MFEL 5C8JB 4GYBA 1M1SA 1OQXA 5E2WH 5C07D 2QDWA 1I1AA 4YDKL 1HEHC 1MY5A 2DQUL 2JKRM 1OCOC 3PDGA 1OEZW 4HWBL 4XWOD 2XYBA 3WFDL 1T21B 1NSNL 1XMQB 4YDLC 3HUJE 3S3XA 3S0PA 4ZMVA 1LTXA 3NPSC 4WCYH 4AYMC 3QWRD 1WF5A 1D2DA 2NY3D 1IQWL 4Z7OB 2Y5EA 1D7CA 1JF1B 2ZOOA 4MJ4A 2K8QA 2NY2B 4K0KB 3HZKB 5IMLB 1CPYA 1NGYB 1AR2A 4X7DC 4JI1O 3B8NA 4JDEA 4EXKA 4O4HA 3N1GC 4LAQL 2YC1A 1JPXA 5L4JA 5M7QA 1NOLA 1DLFH 5TFSL 2LR4A 4G7RB 2CHDA 3RVZA 3O4LA 1H3GA 2W9LA 3KPQA 2DKMA 4XH2A 3TPUA 1ONQB 2DM2A 5IUCA 1C16A 1YYCA 3IGAA 2XPYA 3FO9A 4JHWL 2BSEA 2Y48A 1RH8A 4RMUA 3PWPD 2XKNB 2WO4A 3C12A 4NQCA 4UIMA 3ZGHA 2CGRL 1KJVB 1KGUA 3HNTL 4UZUA 3ZL2A 1KN4L 4XC1H 2EILB 2OWOA 4ZUSB 3F6JA 4YHOL 1AZZC 1S76D 3W39A 2EX3A 2YUVA 4UQ3B 2QKSA 4W4NA 2K4AA 5D93C 1FNGA 1W0VA 4FZ1A 4MA3B 5J6HB 3R4DA 5D2LA 2OTUB 4NQTA 3BVNB 3BH4A 3PJSK 5LGUA 5EEWA 2GBOA 1Q5OA 3JWNH 2EXYD 2UY7A 3QARA 3U25A 4F5CA 5KSAC 3QRFM 3KGUA 1MCWW 3CJHA 1SLXA 1CD1B 4U4BA 3REWB 4J3OH 4PJ5B 2ZUQC 4DUWA 2N0MA 5SWSD 4ZG1A 2DYRB 4MSWC 2JQAA 3BRFA 3OR7A 2B9ZA 3AITA 2HT3C 5DUBB 3SY0A 4E9LA 3NEOA 4B96A 1A9EA 3ZRSA 2CSPA 4TWKA 5IDJA 1MQKH 4YDJA 5D1QA 1MHCB 1MOEA 3U0TB 1JZJA 3RDTD 2P5WD 5CJXA 4DO2A 1NM9A 1N7MH 3H1LH 5K59E 3BKMH 3W9DB 3D3VD 3MFGB 5B3SB 5FW7A 1MHHA 5HVFB 1WT5C 2RDCA 4FNRA 5L3GA 4WDIB 3ARFA 2Q8AH 4K3HA 1Q8IA 2P8MA 3R65A 1JF6A 2ARJQ 2YD0A 2VGLM 5GS1A 2P5OA 3FTWA 1EN5A 2VDRB 4GOSA 2EICA 4UOZA 5EUKB 4LHUD 2C9SA 5A2AA 1DSFL 1TDQA 2IBBA 3IKCA 2MCPL 3MLTB 1L9MA 2P4AB 4XXCC 3PHQA 2R9AA 1Y66A 1OIOA 3V0JA 5I66B 4EKWA 4AWJC 3VYNA 1JN6B 4QRSA 5DJYB 1OB1A 5KBPA 3BT0A 3VG9C 3IXAA 5BZDB 3SDXB 4YLBA 4YK4C 4JY4A 1I3VA 2HZHA 4JFDA 2FWOA 2GFBB 1L5GB 3WD5H 4X6BA 2JB5L 5J9PB 2F53D 2OFQA 1N10A 5DT1L 4U3SB 1NAMH 1QFHA 3IYLW 4QKTA 2CO6A 3QWQB 4TLUA 1MCPH 3FONB 3G6JE 1A25A 1YHPA 3LH9A 4TPRH 5DWUH 1E3ZA 1OW0C 3TEZA 1BD2D 2PYFB 2DRUA 4OUOA 5C0IA 5F3BB 2F08A 2KQMA 2I7SA 5I0XA 4PCTA 5JORB 3OXRB 1ETZB 2KQXA 4IBQA 4I5SA 1H2MA 3AU0A 4ZOLB 4Y5YB 4WO4C 5HHXH 4RAVB 4K15A 3ARDA 1QR9A 3DOSB 3OJDB 4ZZKA 5JHLH 1TTRA 2R2BA 4A7QA 3PQYB 4YHPB 3TOPA 3FO2B 4KROB 2IJJA 1SHMA 5DFVD 3MREA 1X59A 3QHFH 2AK4E 4YY3O 2FBJL 4PG2C 4X6CA 3WMSA 1S2EA 1WA0X 5E1QA 1H8LA 1X5KA 2C9RA 1YJDH 1CBVH 4FQCL 1BFSA 1GN2A 4ZIBA 5JW4R 4MJJA 3HG3A 3AY4A 3ABZA 1E9OB 1EDYA 3FFCD 2XTSA 1OTSC 4DR7B 3HRZB 4FLRA 4OUUA 5EO1B 1AQKH 4G6JH 4PJ7F 1CYWA 3G6AA 3P4MA 3QRBA 3CX2A 3G5XB 2JK5B 3CWGA 2B2XH 4E0RA 5FK9B 1B88A 4K23L 5D7IE 2YMOA 2SEBA 2Q1EA 1GN6A 2K3HA 5IBTH 4HUKB 4ONHA 1FG2A 4RAUB 3MYJB 3P9LA 2Q6WB 3UTSB 2EUWA 4TQHA 4BCXA 2WQUA 1AHWC 5LUMA 3LQZB 1YEDA 5LYJB 3TP4A 5IJCC 4J3SA 1XBRA 3TVMD 3AREA 5IVXF 3VXUA 1MCCA 4GBXD 4ELMB 2QPFA 3IJYB 2BPBA 4UNIA 2FL5A 4OBSA 1WO2A 5CLTA 2FGWL 1QBMH 5DLML 3GMRA 4WSJA 5E4EB 4QD2E 4YXLH 5EOCH 5JHDB 3QUZD 5CCKL 4LSQL 2OCHA 2WNXA 5AKSA 4FQQB 2F19L 3CN1A 1AVAA 1JGIA 4HYOA 1QATA 3GHBL 3VH8B 1MFDH 4L37B 3VDAA 2E7CA 1MABG 3A2FA 1WJZA 4QXWA 3KJ6L 5J3HC 1O6VA 1TG8A 4R50A 3D0LB 4TRPL 1HXYA 3JTSB 3WEXB 4OCYH 3STLA 5CP7A 4ZAKC 1LWHA 4K4KA 2X89D 3QXAB 4UZSA 1MRFH 2DLFH 5FUZL 4N8PA 2VRAA 1TO4A 3B9VA 2YZ8A 2QQQA 3HI6H 4NJAL 4XMPH 4TT3G 5DHVA 2RACA 3H9SB 3RGVA 4JFWA 1AI5A 2F5AL 3BEVB 4IKIA 1O7DC 5GZND 3OKMB 5CLYA 5ADPH 4IHOA 5ERWB 3UPRA 3LRSB 5KVGE 1FFNA 3SOTA 4KXCA 4K9EH 4EOWL 3L9DA 1MCHA 1TOXA 1A6WL 1PIFA 2MPVA 2VXQL 2GIYA 4LPYA 1B0RB 5IVOA 5TQ0L 4HWEH 1KEMH 4N0YH 5FECA 1FPTL 3BWUC 1UFIA 4L1TA 2E3CA 3OG6B 3ISYA 4GRLA 4M02A 4OD3L 1HZKA 1T7YA 1UEYA 3CLWA 3BCFA 4OI9A 5BZWB 2J4WH 4F7EA 1RFYA 4GQRA 1IBFA 1CLYL 2G4GA 3P9MA 4PS3A 4B7KA 1KLUA 1YECL 3WTWA 3EH2A 3QZOA 2NCEA 4EUPH 5HFLA 3N85H 4KZ0A 4RFNB 1YY9D 2VW7A 3BAKA 3IPBA 3GIZH 3T3PE 4FVMA 4AH2B 3BDYH 4NC1E 4KKPA 2NNXA 3K03A 1CPUA 4HCRA 3K08A 5MP6L 4N4YB 2VL4A 3WNKA 3CC7V 3JCZA 2HX9A 3PAVA 5FM8A 3ZE0B 4Q9BA 5DRNA 1KGYE 3ZDZF 4NZFA 5EU3A 2NTFA 1T5XB 3TF4A 1VEWA 1NGQH 3EYOB 2GHYA 3K59A 3W7UA 3RJQB 4PJCA 4KKCD 3O2VL 1BM3H 2F7RA 4UV4L 1PKQE 2F43G 2ZXWC 1MFAL 4D9RD 1CVRA 5H2BA 1PAMA 3BPZA 1YN7A 2KB1A 3ZIAG 3VQYA 3I3BA 1IFGA 3N1MC 4JFZH 1NCWL 3ARGA 3LD8B 4KH2A 4N8CH 4X9HA 2UUDH 4IIQC 4IRJB 5CJ5A 4KKRA 5D1XB 4ZRGA 1UOKA 5AKVA 3KXFE 4M4PA 3CC4V 1NFDA 1ZHNB 4NZTL 3EO0B 3U0WH 1PBYA 4OGYL 4UT9A 2W9DH 1BVLA 3GRWA 4CU7A 4RBPK 4PA9A 3VXPA 4XCNA 2NNAA 1SA0A 3WL9A 1G7IB 1MCSA 1XSKA 4FL4C 3ZDYE 3B2PA 5BQ7B 5KSBF 5EBWA 1JF5A 4HJ0D 3SHSA 2HHHB 4XNUH 5ICYA 2X4NB 1CDJA 4Z3JA 1OM3L 4ZDHB 4GJTB 3EJYD 2KMWA 3G04B 3HIZA 3UYPA 2BSBA 2RCSH 5EF0A 3D39E 3QHZH 4U1NA 3ZHLA 2XOKG 1OVZA 5JQGA 3TYFA 1I4FB 1NWOA 1WAAA 1KD1W 5CGYC 1EZUA 4ES9A 2JMRA 1W0WA 5A2JH 4YHKH 4BDVB 4F3FB 3Q2VA 5SX4H 2ZXBA 1YITV 2J1XA 1CD0A 3FH5A 1I5YA 5FYKH 4DZ8B 4TXVB 3RILA 3RFZB 2EZ0D 3OJ2C 5H4YA 4KRPB 1ZT7B 3D33A 4LSSL 3NABH 4PJIF 5KHGA 1FNLA 1M05B 2DQHH 2VQ4A 4G3YH 4LPWA 3IT8D 4PJDA 2IU0A 2ED7A 1R3HA 4LRNL 2KL6A 4AYID 1BGXH 4KJYB 4RQFA 5FLVA 1IAOB 3KH4A 1F3JA 4NUGH 2PUQT 2ZX5A 1EH9A 4FP8L 4QKXB 4ACPA 2QQKH 2GV9A 1LEIA 3IJHA 3M8OL 4KQ3H 3CVDA 4HIJB 2DQ0A 4YSSA 1E4XL 1HEZA 4JF3A 4HMEA 3UTTB 3ETBF 3S97C 5I18H 3ZRVA 1EANA 2CNYA 4ZXBC 5E2TL 3N43B 1QFWI 4X64O 5AUMA 3TN0C 4DQOL 2Z0AA 2LFEA 3H4FA 1J8SA 1GZHC 5EU6A 1B2WL 3QI9C 2ATAA 2FX8L 3K06A 5BR8O 3PN1A 4UXNA 3GD1C 2O5YH 3DTDA 3O8XD 4DCQB 1N67A 1VGEH 4OLUH 4AX3A 4Z7NF 2AHZA 3DGDA 4F57L 1TVKB 1CBJA 1C7SA 4R84A 3NG5A 5E1AB 3C5ZA 3VMNA 3O6MH 3KPLB 5JYLA 1C12B 3DV6B 1RV6X 2D9CA 3CZUB 1RUAL 2VZOA 5ID1A 4QGPA 2XX1A 1KYAA 3PJSA 2L7EA 3HKFA 4IOIB 3QP3A 1X9UA 1JD9A 4K5NA 4BW5A 1Q9LB 4O4JB 2BVEA 3LV3B 1P2CA 2PPEA 4DFIA 1HP8A 2ATKB 2XFGB 3U1PA 4LSPL 4NUJA 1IMHC 2CE4A 1RPKA 1BDYA 3OKYA 2WYIA 2P1YA 4JO8A 1S7QB 3BRDA 5JW4Q 3CZGA 1J5EB 4EI6A 2D7NA 2JB5H 4N21A 3LEVL 4DP0X 1UFUA 2NX5E 5C0ND 1H8NA 2EE3A 3K2UH 5LNEA 2EDOA 5FV2A 2X6MA 4JW3A 2YOCA 4KTDL 5IROC 4JPVH 3P0VL 4X5QA 4OLZH 4YSTA 3CFCH 1JGLH 1IV8A 5CD3A 2KLSA 3VE0A 3ABMC 2JKXA 5E6IB 1JMZA 2PETA 3LIZA 2EEFA 4Y19D 1E28B 1YY8B 1NTKH 4WFFA 4GXUN 3WXVH 1Q0YH 4BZ1A 5BS0E 3FU8A 4GG6F 4J2XA 4CILA 1DJYA 3KL0A 4OV6F 4X4KA 3BWUF 1BVOA 2X87A 4BELD 1T0MA 4YIQB 1UXSA 1SRDA 3VI3E 4HXAH 2A06H 3CBKB 4D0DB 1W8OA 5GIRA 1LE5A 3E8UL 1ROCA 1SYVA 4YVUA 5TDOB 3G80A 5LWYH 4HSCX 3CCEV 1DVFD 2VITA 3IGUA 4G42B 3OTOO 5ES4B 1Y18A 3WU1A 4I18C 4A6YA 4R2GC 4AEEA 5CZVL 2LGQA 3TH2T 2YD6A 1O75A 4LT7A 4RVBA 1YN6B 5CF3A 4ANUA 3TGUH 5MERB 1A4KA 3ZL4L 2ZOUA 1Q72H 4MWFB 3VW3H 5CBHA 1XB8A 4LCVA 4L4VD 5T1KA 1MZEA 1ODAA 2HN7A 2VLJD 4M8RA 1KTJA 7TAAA 4ZPVA 1WP8A 3LAFA 2IANB 2E74C 1JGDB 3INUH 2Q9LA 5D5PA 2XTJB 4XP6L 1L6ZA 1WTGT 4J3BA 2J8OA 1KB9J 3ZIMA 1QQCA 2EDFA 1RURH 2EXTA 2J57A 5KANI 3OR6B 1M4UA 1JNLL 2MWCA 2FJGA 3TT3H 4PRNB 3WNLA 3SKJH 4UVAA 5JDSA 4P4KB 3UZVB 1FL3A 3HPJB 4EN3C 5T5NG 1VRSA 4UV9A 1S3KL 3WJMB 4MJ5B 2VXVH 3T1HB 2FHFA 2VISA 2XWZA 4YDVA 4X6DB 2WXHA 1Z5YD 3FPXA 1DVYA 1BF8A 4X1YB 1A22B 3DX6A 1BWMA 1OANA 5H6RA 5LBQA 1CDYA 4ES8A 1AFVH 3LS5H 4TVPD 2LAGB 4NKDA 5CBEA 5IG7A 4MD4B 4LKCA 5LCVA 1DQQB 1N6QH 1FJGO 4H0GA 4GAFB 1KCLA 3MV8E 4NOBA 4H26B 4PPTA 4MVBD 3UGUA 4AV4A 5IHBA 4U1GB 4U1SB 1TTAA 3GPEA 1IFRA 1HTYA 2VDOB 5F7LB 1UT1A 5FB8B 1NJ9A 3V6ZB 3MROB 4K7PY 1TVHA 3WNNA 1UD5A 5E8OA 3MJ7B 3VQ2C 1TQTA 3QUXB 3LH8A 3QAQA 4KQ4L 1UB6A 1J88A 3FTUA 4UQAA 1DUZA 1M7XA 5TDNB 4ODSL 4NB5A 3RDTC 4XMTA 3OAYH 5IJ9B 1SETA 2F95B 2CTPA 1OAYH 1ETA1 3UGXA 2YEVA 1DYZA 2QQNL 4Q6KA 2BW5A 3V4PH 1JUFA 1M71B 3CFJB 4JKNA 3TCUA 5HHPB 5LAPA 4F7KA 2H1XA 3JWOH 1QW8A 2ORBL 5DRXB 5JQIB 3AGWA 1X5MA 4QT5A 3HVNA 1JPFA 2HFGH 4QPJA 1B3IA 5FYLD 3MGOB 2VQEB 3GZKA 2CH7A 4Y4FB 3D12B 1IGIL 4M3JA 4QXUL 3VXMD 4ZZFA 4A7GA 1E8WA 2BCCH 1WCQA 3K72B 1HKFA 2B5IB 1ZKAA 3SKMB 1EFXB 4U1HB 5AW9B 3L81A 3NCYS 3JVFC 4HS8L 1AJ7L 2UWEE 3CLFH 1DJHA 4MJID 1VQOV 3MRLB 4APQC 3EOAB 5CJ8A 3M1OA 3JWNC 4NRXB 5E99L 2YXVA 5DTFA 4WI0A 4OCRH 3DX7A 1UJ3A 3G67A 2AV7A 2CRZA 5LLIC 2JJ1G 4N25A 4PJ6A 5KVDE 4ABWA 4B7LA 2ZICA 4TV3A 4YHMH 2Q9OA 3CHOA 2MKWA 1KJ2L 3CVIH 1T3FA 4TUJB 2Q4PA 4C4BA 5C8YB 4JFEB 1JPTH 1JBJA 2R83A 1KTRL 3GWKC 4QRPB 4MMXC 4NKOA 2Y1ZA 5F7FA 2E6JA 3BKYH 2AZ0A 3RWIB 3QDAA 2CGOA 3DX8A 1HDJA 3SCMC 3W1ZA 2PCFA 1MCLA 1QABA 1XHHA 4JI4O 4GSRA 1KIQA 1IUZA 1BPLB 3LS4H 5JMOC 4R5XA 3DMMC 1T89A 2R29H 3MGTB 5DVNA 5LXGL 1I9RH 4V11A 3F05A 2KERA 3HKCA 4WBNB 2LU7A 2D0FA 3CPUA 3QH3B 4HUVB 1KMGA 3KPOA 3RPKA 2EYRA 5F9JB 5B38B 3Q6GL 3OAAG 1FGVL 1ZIAA 1LILA 4GXVH 2VLRE 3BPLB 4FLHA 1J8HD 5C0RH 3DXAE 2C9VA 3DO3A 4NWTH 2LFRA 4JDEB 5GTHZ 3ZHNA 3MUGA 2WXQA 4FFKA 2YC1B 4K55A 5I75B 4KZEL 4I2XA 2FX7L 4GKNA 2VN6A 3HUJF 1UUNA 5F2VO 1CD9B 3FTGA 3O4LB 3WKYA 4YEFA 1KN2H 2XJLA 4YBQD 1A7BA 3BQVA 4XH2B 5LQBL 3TPUB 1SMDA 1KTLB 1NPJA 4PMFA 5F44A 3F65A 4R3SB 3IGAB 3HC3L 4BZ2A 1JD7A 2DJMA 4PW4A 2ZX8A 4NQCB 1WC7B 4LGRB 1SF9A 1K8AW 4UIMB 5MENE 2WSDA 4ZT1A 1DBAL 1M1XA 3MAQA 3CK0L 3RI5F 5HJ3B 5LB1A 4DGVH 2HJKA 2ZM6B 5KW9H 3V0VA 1TTCA 4F6EA 3CFEA 5J1AB 7CGTA 3CCVV 4N8UA 2YPVL 1NLBH 3CSBA 4P9HH 2VR7A 5D2LB 3TWCL 3NSJA 3QULA 3H9ZA 1NCAL 2APWA 4OAWB 1PG7W 4TUYA 2QVIA 1AGDA 2VCOA 4JFOA 4AUUA 1QTPA 4K0KO 3ZN0A 3CJHB 1PZ5B 3DPBA 5EWIL 3QG5A 3QNFA 3E9TA 3CRQA 1MLBA 3U4BL 3OR7B 2VR4A 2XWXA 3SY0B 2JELL 1MI5B 1A9EB 1U3JA 1IC7H 4XCEA 3WN6A 3M88A 5F3HA 1SXZA 3D25A 4YDJB 4LLVB 4UNVA 2OSWA 5FO8A 2DEWX 5J1SC 1NDGB 1Q1PA 1KF9B 4QF1A 4ZBJA 5F0JB 5BJTA 1GYWA 4OZFH 5DK0A 2MTAA 5HJGA 1MHHB 2NY6B 3SEPA 4FQJL 3ZHQA 1GY1A 3IE4A 1UD3A 4Q4IA 1DDHB 2P8MB 3WHE1 4DN3L 2OCCB 2YPKB 4QWWC 3ARSA 5I1IH 4MS6A 5DRWB 3G5ZA 1NCNA 3APDA 5IEKB 5K59F 1SQBH 2V17L 2H94A 4PRHD 4ZW7A 5FHAL 4XMLH 1GS7A 2RB8A 5J12B 4WFGA 1ZTXH 4ZO8A 4MSWA 3T2NL 3PHQB 3OAUL 1II4E 3ULUE 3GMNA 1E6OH 3L9RB 4J3VA 2OR7A 4HD9A 4XPHL 5AVTB 4FCHA 3KPRD 1A6VH 1YJ9V 4WNQA 4LARH 5DS8A 3SJAC 2ZAIA 3AM8C 4JY4B 3ZYJA 1OB0A 4ICWA 1K5NB 2FWOB 3D2UB 1MWAH 4H4NA 2QA4V 1WT5A 1H3WM 4OQTH 4X6BB 3RAJH 4BWUA 5CEZD 5KEZA 4DKFL 3AU1B 3QCVH 3CP1A 4H20L 2WLHA 1J8RA 5DJZB 3BSGA 5DD3L 1PMYA 2R51A 2F23A 1Z9PA 2CO6B 5IYDO 4I3GA 3DIFA 3BD5A 4G7YH 4XNYH 3VFGH 4RGOL 4NI3A 1F6AB 4FZ8H 4BE6A 1YC7A 2NXZC 2HVKC 3AGVA 2HB0A 1UADC 2VUKA 4KFZC 4XXCA 4Z7UE 5AOLA 1E4JA 2H7WA 1E4XI 2C2AA 4IDLA 4N2MA 1DQMH 3AMKA 2YIAA 2BVYA 3R7QA 1DVSA 2YK1L 2VDML 4A2LA 3BEWB 1SXCA 3G6JF 2R2BB 2XV2A 4Z1MG 1C5CL 2V4DA 3MREB 3N44B 3SJVD 3J2PA 2GJZA 4BRJA 1TNNA 3QUYC 2L6LA 1N0NA 2VDLB 3QDJA 4X6CB 5CN2A 5GS2D 5C70A 3BLBA 4KNUA 5B7MA 1VQNV 2QKIB 5T1MA 1KP3A 3CDFA 1TEYA 2EIZA 3EBIA 4W6XB 4DV0O 1QRNA 5C7XL 2WVVA 3QO0A 2QKAA 1UQSA 4XGZA 2YIHA 4W9DC 4I1PA 2R0KH 4XX5A 1H3PL 1OW0A 2APSA 2CKBL 2V8LA 5GRVK 1A3RL 4M8QB 4XP5L 4JO1H 5H2FZ 1AP2A 5GZOD 4E0RB 3FQTA 3CDZB 4KHPB 1Y1UA 2J88H 3QFJD 2SEBB 2XRAH 4UINH 3JWDH 1TYJA 1FG2B 3TL5A 4BKLA 4PYHA 3B9AA 5LMUB 3RVTC 1SMOA 2H2PC 1YEDB 5AVZB 5K39A 3GINA 4WO4A 5IOPA 6FABL 2BP8B 1MFBL 3AREB 3VXUB 5EUOE 2FT7A 2OMWA 4IT5A 4ZQTA 5FGBA 4W6WB 4JM2C 2FL5B 3FT2B 1HINH 1UZ8A 2QGBA 3GMRB 4N6RB 4L5FH 2J6EH 1P6FA 3MN8A 3RTQC 5C2UB 4HOZA 1FNHA 2AJVL 2UXVA 3FO0H 1VF6C 1ZVNA 3H7LA 1V05A 4HYTB 3U9UA 5IHWA 1IARB 3O2DA 2E5LO 3O6FD 3I74A 2KUTA 3HKDB 1G7PB 3QCTL 5FLXN 2HAZA 1Z66A 3ZDXE 5T3XH 1BFVH 1T1XB 1ZLWH 1QO3A 3CC1A 4DR7O 3Q2LA 5HI3C 3DSQA 3GQFA 4H13C 4L8CA 1HXYB 1AHWA 3OXSB 3QEUA 3OMNB 1PZDA 3I6KA 5IVZA 4R0LC 2P5EA 3QORD 1FCGA 4B5EA 5CP7B 4B9CA 3Q06A 1RULL 3QJHB 4KY2A 2ZXAA 4BFIB 4PYGA 2A4EA 2X12A 3BD3A 4BIUA 1EHNA 1HHIA 3DX2A 4NUQA 5LAXA 1CGSH 3RGVB 4B97A 1PCSA 3BLKA 4IHOB 3ILPA 2B59B 3V4LA 3CMOH 4EI0A 5HP5A 5AYQA 2Q8BL 4GS7B 3S34L 1SQFA 1FFNB 2L04A 1BQHB 3MXVH 5CLZA 3BYTA 2WLIB 3TH3T 4D6TH 3CHRA 4FLQA 2NY4C 5L88L 2DYSC 1OE1A 1XDTT 4GRLB 1OCCC 1GPOL 1JZ7A 2W60A 5C2BL 4JPIA 1YVWA 1A3LH 1TVDA 4WI8A 3X12B 4F7EB 3F58L 3PWJB 3K6IA 3P9MB 4M1GL 2RCVA 4PV1C 4UQ2A 5D72H 3U7WH 3SPGA 5DFAA 4A7VA 2DTMH 2YKKA 1GVIA 1G1OA 3GWJA 4XVSH 4B3RO 3L5IA 4ZAKA 1BG1A 1RZ7L 1D9KB 5F0LB 3B2EE 2ZE8A 3IFXA 4P59H 4M62L 5EZPA 2B3IA 3BHPA 1LQBC 2W0KA 3QPKA 1E5CA 1THAA 1XTLA 2CD0A 2ILLA 3O3EB 3JASA 2BTQA 2YKLL 4GKOA 4Y4HC 4CVXA 2Q3ZA 5EU3B 4GKKO 2NTFB 1AXTH 5DMIH 5D71L 3T3PF 2CKNA 3U0PB 3ULVC 1Y74A 4ZW5A 2J21A 3L3HA 2WZPD 1MJJA 2Q0OC 2PY5A 1WYJA 5GS3A 1YEGH 4BJLA 5IF0A 1MCKA 2JGDA 2CQVA 4J9ZB 3R66A 3MKKA 2IEPA 4L1LA 5T5FH 4QTIH 3L9YA 5TE6H 3S88L 1VLXA 4IJ3C 2EDLA 4O4LA 3ARGB 4ISVA 4PWKA 4AJ0A 2BIMA 2DQEL 4KKAC 4OZGB 1NCUA 1F1AA 5FYJD 1VB9A 5JXED 2WJ7A 3EJCA 2P5PA 4NHCH 4AYSA 3CZLA 3ZX6A 4K73A 3PLYA 4DKEH 1D5AA 4NM4L 5BZZA 1JGUH 3HG1E 1BVLB 1RSYA 2CCVA 2VJXA 4GRWE 4AGLA 1G7LB 2HVJC 5I1JH 1O9HA 5LHHA 4H0LC 1VQ9V 2NPLX 3VXPB 4LPTA 1DLHB 2ADGA 4UNTA 3WL9B 2IPUK 3P77B 4NQSB 3VI4E 4LVHC 5FW8A 5ICYB 2CTWA 4FG2A 4Z77A 4RO2A 2CIIA 2ZYHA 1OAXL 5CUSL 4H8WL 3SDAB 3UYPB 1JOYA 5K1NA 1FZKA 3WY2A 1K6QH 3TYFB 1YEJH 3B5TA 2R0ZL 3MQIA 2B3RA 4LEEA 4QDGA 3O45A 4IIQA 1NTZH 1BCIA 2WWOA 3P3NA 2Q5ZA 3P30L 4J12A 4X0KA 4EMZA 1ZTEA 3VBBA 4I0PB 4H7VA 3D0AA 4L3EE 2WINB 1R19A 4XMKL 5EC2C 4F20A 1GW0A 4MT8A 1SDDA 3D50A 1N0XL 4TUKL 2YGNA 4JFUA 3K4AA 1NBZB 1R3HB 4JE4B 3NAAH 5A2FA 5C0BB 4JKMA 1XH3A 4QI3A 2ICWA 43C9A 1JFFA 1F3JB 3T77A 1LEIB 3B9KA 4KBPA 4DN4H 1AG0A 4QCIA 4Q97A 2WK2A 3AFLA 4R7DA 1IBMB 4WW2C 5BRZA 5AVVB 1XGPA 3TT1L 1FE8H 2YAPA 3GZOA 2WW8A 1MEXH 4I87A 4O2EB 3U2IA 2HHHO 1IGJB 1MIML 5AUMB 3ZL1A 1KBVA 1BX2A 1NUNB 1WZ1H 5EU6B 3HPLA 3RL1A 3FMGL 3U7YL 4HK3J 4XC3L 3S35L 3GKWH 4TV9A 4UIKL