3SPCA

Inward rectifier potassium channel kir2.2 in complex with dioctanoylglycerol pyrophosphate (dgpp)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
327
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDKPDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inward-rectifier K+ channel Kir2.2
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 89
structure length 327
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spcA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spcA01
4TWKA 1ORQC 2HJFC 2WLKA 3LNMB 2X6BA 4HYOA 4PA3A 2BOCC 4LBEC 4MVMA 4P9OA 2A0LA 2ZD9A 1S5HC 5J9PC 3FB8C 4MVSA 3IGAC 3T1CA 2IH3C 3F7YC 3STLC 3ZRSA 4R50A 1XL6A 1R3KC 3STZC 1R3IC 4X8AA 3SPIA 2HG5C 2H8PC 4MVQA 5EBMC 3ATBA 2WLIA 3AT8A 1M57C 3AUWB 2WLIB 1QLEC 2W0FC 4J9YB 4QE9A 5EBLC 1P7BA 5B1AC 1U4EA 4XDLA 3ATFA 1J95A 2EIKC 4JTDB 3AG1C 3K0GA 3OR6C 3T4ZA 2P7TC 1XL4A 3E8HA 4MVZA 4EKWA 2HFEC 3GB7C 1KKDA 3LDEA 2WLLA 2Q6AA 1OCZC 2Q69A 4GX2A 3AG3C 3OGCC 3SYCA 4MTFA 3AG2C 3TCUA 2R9RB 3FB6C 5B3SC 5KUKA 1N9PA 3ATAA 2KB1A 2NLJC 4MS2A 4PA6A 5EC1C 3RW0A 3E86A 4PDMA 2QKSA 3ABMC 4OXSA 3X2QC 3PJSK 3SPGA 4X89A 4PDLA 4PDVA 4H37A 4XDJA 3R65A 2E4FA 3VSQA 3ATDA 3K03A 4WFFA 4R8CA 1K4CC 5BZBA 3WG7C 3AGWA 3ABKC 3ATEA 4R6ZA 4MVOA 2EILC 3RBZA 1BL8A 4CBCA 4X88A 1G4YB 2K1EA 3T2MA 3F5WC 4P9PA 3UM7A 1R3LC 3OUFA 4MVUA 2ATKC 3LUTB 4HZ3A 4MVRA 3OR7C 4RUFA 3K06A 3OUSA 1V54C 4J9ZB 2DWDC 4MSWC 2QTOA 5CBFA 3E8FA 3K0DA 5EK0A 3VOUA 3FB7C 4QE7A 3SYAA 1V55C 4JTAB 2EINC 2EIMC 1M56C 2YEVA 3E8BA 3IFXA 3T4DA 3SYQA 1U4FA 2Y69C 2ZXWC 3E83A 2A9HA 4MW3A 4PA9A 3UKMA 1ZWIC 3RVZA 4KFMA 3F7VC 3HPLC 2Q68A 4PA7A 4DXWA 4WFHA 2AHZA 3AG4C 3SPCA 3AT9A 5B1BC 3TETA 2DWEC 4F4LA 2GIXA 4WFEA 5E1AC 2OCCC 4GX1A 3SYPA 4QNHB 3E8GA 3SJQC 1JVMA 2EIJC 2X6CA 4RUEA 2WLNA 2WLMA 4MTGA 3K08A 5EC2C 5KUMA 4PA4A 3RVYA 2ITCC 4G27B 4GX0A 4P30A 4PDRA 2Q67A 4RAIA 2WLJA 2WLHA 2DYRC 4G28B 4BW5A 4RO2A 5CBGA 2IH1C 3ASNC 4LP8A 4UUJC 3ZJZA 4WFGA 3KG2A 1OCRC 4GX5A 4JTCB 3LDCA 4MTOA 2BOBC 2ITDC 5IY5C 2JK5C 4H33A 3JYCA 3EFFK 3SYOA 2HVKC 3E89A 4R7CA 3BEHA 4ZBMA 2AHYA 3K04A 4P2ZA 3SPHA 2A79B 2X6AA 4I9WA 5EBWC 3LDDA 3K6NA 1R3JC 1K4DC 1OCOC 3SPJA 4MW8A 4LCUC 2DYSC 2HVJC 4XDKA 5CBHA 3ASOC 3ABLC 2WLLB 1OCCC 1LNQA 3FB5C
chains in the Genus database with same CATH superfamily
1DANT 4K15A 2Y6TE 3JALA 2Z8WC 3O6FD 3JD4A 1XGTA 2VDQB 5LQBL 3JTTA 4HWBH 4YHLH 3RT3C 1TDQA 3NQKA 4DJMA 1BEYL 4KUZL 3DX2A 4JAMA 4L1TA 3K59A 3G04A 2PETA 3G5YA 4WSGA 1MFVA 1XZWA 3D09A 5A2AA 3CRMA 2RFXB 1JHLL 5AB9A 3MO1B 4G1MB 4NP9A 4NC1E 4XVTL 4DR1O 5HJBA 3SE3A 1OW0A 1MELA 3EZJB 5JQIB 2WXIA 1O9GA 2NY1C 4PG9A 1V3MA 3IXTB 3OKLB 1YY9D 3NPSB 3O9OA 4GKLA 5JHLH 5BUPA 4LKXB 3L71H 3BUIA 2QSTA 3TCUA 1YNTA 2EE0A 2J73A 2QQQA 1VQMV 1F11B 3E2EA 1X4YA 2EEXA 4HJTA 2BNRE 4JQVA 3HTLX 3RZCD 4NAMA 4BWTA 1FGVL 5CP3A 2QVMA 3UTTE 3ATDA 5B8CA 3DXAE 2JS3A 4AYFB 3S6CA 3DTXB 2ZUQC 1Q9KB 4E5XB 3QNXA 3EH1A 4Y9EA 5J1AB 1ZSHA 5EOCJ 4DRXB 4H8WH 1G5GA 1OSYA 2XOKG 5D7EA 5SWQB 2WZ0A 1WBZB 1FS0G 1ZS2A 3LUTB 4P46C 1VACA 2L7QA 2MNJB 3KWWB 4HBQA 4TUJB 3UAJA 1F3DJ 5DZLA 2FEDC 2FHFA 5L8JB 2P5ED 3GZOA 4G7YL 5DYOB 1I7UB 2A38A 1CC3A 3PWUA 4O9HH 4NUMA 1LEGA 5FO7A 1HL5A 2V2WB 5BQ7A 5D7LE 3HJEA 3ML0A 1HZHH 5DI8B 4M5SA 3IMUA 3LHPH 3VXTB 1I0HA 2GQHA 2UZPA 5KVGE 1PZ3A 2Q4PA 4F8QA 3EJTA 5AVQB 2J20A 4XT1C 2H0FA 2ATKA 4LVEA 3UTSB 3QNYB 3Q1EA 5F3BB 2ZUYA 3FT2A 3DOIA 3FU7A 3MV7E 3DKHA 4PJ6A 5CZRA 2EE6A 5G55A 3FN3A 1R1CA 1YN7A 4PRPD 3JARB 1SDDA 5C2UB 2Y5TA 5E9NA 4CKQA 2ZCHH 2F4VO 3NN8B 3HE6D 3M8OL 1K97A 3RNKA 1BQZA 3WHE1 4GSXA 4HOXA 3H54A 3ARDC 3UYPB 3TCLA 3BAWA 3L73H 2EKSB 2FHBA 3BAJA 2QHLA 2W6IG 5IB2B 1FPTL 3HG1E 4G1EA 4ZSOB 35C8L 4WHYH 2AK4D 4GUPA 4GW1A 4OLEA 1UENA 4JZOB 1HYSD 2JDIG 4KVPA 3UC0H 3KCWA 3PUUA 2CGRL 2EIZB 3TVMA 2NN4A 2ZCLH 4YDKL 1XHZA 1UQSA 3JWDL 3RYHB 4I3RL 1XF2B 1OTSD 3L9BA 2CAZC 4NGHH 1WO2A 4C55A 2BP0A 3CCEV 1SN0A 4OUUB 5EUOE 2YAHA 3GI8H 3EUDA 5K59E 3GSVB 2BOCC 1U8JB 1GS6X 3BSZH 4XHJC 1HEZA 2EC9T 3KPOB 4FMVA 2VN5A 1I7TA 4UV4H 4PJBA 4NC0B 4UILH 5KVMC 1DVUA 3L13A 1MEXH 4M93B 2VAAA 2XPYA 2VDLL 5DQJB 4U1LA 1AFVH 2BHZA 5EOTA 3BWSA 4RGOH 2FLRT 3AT8A 4BR6A 3KXFA 5CZKA 1LO2L 2DQ6A 5IJ9A 4TV9B 1IVLA 1I9JL 1A0QL 1MI5D 2AABH 3LXBA 3MJGX 3V52H 5C6TL 3PJNA 4EQ2A 5ES4B 3B9KA 1YEJL 5JUEH 1T5EA 5AALA 2Q7NA 1F3JB 1P4LA 4D3CL 5DYFA 4MB1A 2J5WA 1V05A 5LAPA 2XXFA 3GZPA 5GSVA 4ZW5A 2JKIS 1N6UA 4XMKH 3ULVH 5DZNA 1KJVB 3KPMA 3QNEA 1WG3A 1C16B 3DJRA 4NERA 1JYVA 3OZ9H 2W38A 4H37A 4IOFD 1H3TA 5ACMA 2ZE8A 4EIBA 4FFVC 4Z7NF 2VN6A 1NWPA 2WLYA 1DTUA 2BCCH 1DUZA 5IZ7A 1HS6A 2NW2A 1A5FL 3FQRA 1Z32X 1W0JG 5EA0L 3ZE1B 4NQDA 2FSEB 3VXRA 5CINL 1E90A 1TXKA 1VF7A 4UM9B 2HAZA 1XDCA 3WY3A 5SWZE 3QH3A 5SX5H 4PJEA 4X4ME 3OAZH 3U7AA 2FL5A 1GK9A 43CAA 5HGHB 1G6VK 2EC8A 1TNMA 4GZRB 1PFCA 1E43A 1WBYB 2JB6B 3J07A 4XBMA 1X4XA 2QR4A 3AM8A 3PYCA 1WTLA 3SDCA 3PL6D 4GSRA 2FX7L 3EJUA 2HRPL 3BZFB 4ODUB 4JV5B 1AZNA 3BP5B 3WKYA 3MLWH 3HB3B 1JFQL 1Y1UA 1T6BX 4DKFL 4EIGB 4KK6C 2F8XC 5A9GA 4PS7A 3DDFA 5B39A 1G7QB 2XTJD 1L3WA 5IVZB 1OCCB 3ZIMA 2ERJB 1SETA 2G2NA 5F8RC 1JHKL 4JRYA 4X6DE 1HHKA 3ZMUA 5JORB 3ULUL 4BW9A 5E4OA 3DK2A 2NTFB 3NZ8B 4ZTOH 1BM3L 1WAZA 1OP9A 3QCUL 2UZYA 3VX1A 1QRNA 1OCRC 1EBPA 3ZKNC 3O3UN 2G5RA 1NBVL 1NC4A 1UH2A 2ITDC 1XWVA 2HVKB 3HVDA 3I9GH 3P9LB 1AO7E 4IKKA 4HFUL 4QXTA 5EV7A 4YX2L 4X0KA 1Y66A 2D3JA 1Q8IA 4YPGB 1YNKL 3G6JB 3D52A 2XQBL 2VDRL 3NCJL 3W0WB 3TXQA 4JM4L 2V5TA 3RVUD 1A6TA 5LMUO 2DQGH 1X7SA 1S7XA 3F64A 3VQLA 2J7LA 3V4VL 1CFMA 5DO8A 3VGGA 1N0JA 1L6XA 4D94A 2X7LA 1M71A 1MF2H 1TNNA 3GMPB 5I1JH 3RFRA 4L8BB 2CCLA 4AKPA 2CLZA 1F5WA 4G3YL 2YPVL 3RNQB 2WLIA 1P7GA 3RWDB 3VXNB 5BR8O 5E08H 1S7UB 5B8CC 1XEQA 3TT3H 1L4IA 2FT8A 3FAVB 5DK0B 4OZ4B 3CMAV 1NAKH 4WAFA 2XG4B 4G8GA 4WY7H 3PDDA 1ITCA 4PIBA 3CVDA 2GEQA 2NY1B 5EF3A 1SJXA 3B2MA 2E56A 3JWOH 3PNRB 3MUY1 4C56D 1YG9A 4NZDA 2Q69A 3ARGA 3CFQA 4O5LL 1JNNH 5I8OL 1V55B 2CTPA 3CN3A 4MQSB 2EIMB 4BZ2L 3UAJC 2IFFL 2C26A 2ZOTA 3MRRA 4FNTA 4ZUUA 4PJ8D 2XZQL 2EE9A 3H8NA 3V6OA 2VO5A 3S0PA 3U0WL 3U6XA 3X1NA 3EOBA 2ZUQB 4WEBH 1W16A 1F4AA 4A2LA 1MUJB 3MRNA 3JATA 4MCZA 1RMFL 4RMSA 3SQRA 4AH2A 4B97A 4PD4J 2DQTH 4N1HB 1OP3H 1XCXA 3MOBL 1XB3A 4JBSA 3WIAA 1NMBH 2J1WA 2ATKC 3N42B 4BH8A 3LZQA 2MPAL 4EPSA 1UWGH 2WQXA 3FQNA 1GZQB 4FLOA 4X65B 3VI3E 3KDMB 2VMEA 1EA9C 1IGIH 4Y5YA 2X88A 5TQ2L 2ZP9A 3OB0K 4MJIA 4FFWC 3FQYA 3ARQA 3UCQA 3WGUB 4Q9QL 4E2OA 2YIBA 1E2WA 2YBGA 2DE0X 1ZWIC 4RFNC 5F70A 4DUYO 1T4KB 3PHOB 4YSPA 5D2LB 2NY4D 4L1LA 5ALBH 4I0KA 2BSCA 5GRVK 3WIFA 1PZDA 3EFOB 1DQIA 3OLGA 3UGXA 1KXTA 4LEBA 3TVMC 1BFSA 1CFSA 4PA4A 1INEH 4LPXA 1C1EH 1UOLA 4UYPA 1IDSA 1MAKA 3BYTA 2VXVL 5HHNA 2BSTA 5IVXF 4OGAD 5JDSA 3AQYA 3ARDB 2FATH 3BHBA 1NM4A 4JTCB 1NOAA 2GUOB 5D1ZI 5DJ8B 4UCRA 2Q76B 1F4WL 2XBDA 1JRHH 1Q38A 4GI8A 4G71B 3P54A 4N22A 5EDSA 5BUAA 3CS5A 2YSSA 3KGUA 4PRHA 2VXUH 3MA7B 4PB0H 3W37A 2ICEC 3GNML 4G8IB 3WEMA 1VP7A 2DLFL 2CO2A 5A40E 1CLYH 1BWMA 5FM8A 2AK4E 2X10A 4UDUA 3LDDA 4F3FA 2BY0A 5JHDB 1WAAF 4YK4C 4PJXB 4XN5A 2Y22A 5DUPH 1IXMA 2Y24A 2A0LA 2VL5A 3KYKL 4XMZA 2CO6A 1JGIA 2BOCB 3GSNA 3B9KC 3QDHA 4P2RD 4X8CA 4BFIB 4JQXC 2LU4A 1YF2A 4TNVK 4ZXBA 5IP4A 3U0ZA 3NAAH 1HILB 3RG1C 3BCCH 5M95B 2QKIA 5I5JA 1KJ2H 2XV2A 1UB5A 1VEWA 2CTRA 1TQVA 4GW5A 4QHKJ 5TDNB 3TO4D 1MFAH 5G4NA 3O8XA 4WQOA 1QX1A 1LXMA 3WE6B 2UXCO 3GS4A 2CO7B 5M7QA 1FZOB 3QIWD 5BO1L 5K1PA 2BW5A 1CDJA 2EIKC 1B3JA 1K4DA 1XH3B 5E6RB 5T3ZL 3LN4A 5ICZA 5B1KA 3WJJC 5C07A 1JUFB 2D2CC 4W68A 3RLSA 1X5ZA 1P4IH 3N27A 1HT6A 4J3OH 4JM2A 4Y0GA 2C3VA 4RBPH 1E4XL 3TF4A 4YE4H 1INQB 3LH8A 4ODHL 3TYFB 2HKAA 1DBMH 3KWUA 4ESKA 5I5IA 2QT6A 2ZXWB 3PWPD 4JHZA 4EDWL 4R8WL 4Q8BA 4PA6A 1WA1X 2AJVH 1EZJA 3MLXH 4UT9L 2VIRA 3MCLH 3AM8C 3KS0J 3I02B 3SDCC 3NYKA 4NPYB 3S5LA 4ZI8A 5HDBE 1WZMA 3WIHL 1T5KA 5AYTA 3MBEA 3DYPA 3FU9A 2ZT9C 4G59C 1B04A 3CXDH 4QRUA 4FM0A 4K2UH 2YQ3A 3BHPA 1UVQB 2QA4V 2NNAB 1ZTXH 2Q3ZA 1IEBB 4JJHA 5JOPD 1BPVA 2A77L 4P23A 5GS3A 4X99A 1R3IH 4NZRL 2GFBB 1KIPB 3GBEA 1B6QA 3R18A 1L6ZA 4DO5A 2G0LA 5I30H 3IS1X 2Z7WA 3QUZA 5DRXA 3IN0A 4LAJH 4LFAB 1LILA 1NFDA 5EZOH 3GUTB 4H0LC 4MD5A 3GRBA 4ZMNA 3SPCA 4UTCA 2EX3A 2F5BH 4XTRD 3D48R 4FZEL 4U6YB 3KWTA 5LN4A 2C9XA 2J1KA 1Q1JL 1GM9A 3H3BC 5IJCC 5KTEH 4RETB 4WWID 1QTPA 1MCDA 4NOFA 4FM2A 3VFOA 2FUQA 3QORA 4G28B 1HNFA 1MQKL 2VWEC 2Y1ZA 3T65A 2XTJE 4L3AA 1O6TA 1OCRB 3JALB 1F18A 1SHMA 4LHJB 4IBWA 1S78D 1GKEA 1XGTB 5IJ0A 3JTTB 1VCAA 4WEUD 2MHAA 2B5UA 2FIKA 3U4BL 2HTKC 1KCBA 4AYBA 4NNXA 4TSBL 3PXJA 5CM1A 4U1GB 4JAMB 3OSVA 3HS0A 1BZEA 2GUZA 3G04B 3G5YB 5JJJB 4HCRA 1FVEA 5IBLD 3SDAA 1R47A 1N5AA 1O7DE 3TH3T 5EC2A 3FTZA 2AXFA 1P6FA 2FNWA 2K9PA 3SPJA 1NSNL 3APMA 2ETWA 4PG9B 3ZOAA 2AF2A 4K71B 3ARGC 4CGUB 1CO1A 1AI5A 1VFOA 4M7LL 3IT8D 2VSKB 1CQYA 1XXDC 1YNTB 4NI3A 5KSAC 1BECA 1IAKA 3D3QA 4M6AA 4IBSA 1GIGL 4X5WA 2QGDA 5B8CB 4ZK8A 3FO0H 1NPJA 3CX2A 4O4YL 1BT8A 3MHHC 3QNXB 3MRQB 2YD1A 4LHUG 4PH8A 4TNGA 4B3MB 6TAAA 3H9HA 4K9EH 2APSA 2YC1A 2Z35A 2CTWA 4LASL 4AEHH 1VACB 2WPGA 3K46A 2EDLA 3VXRE 1F4MA 3VYNA 3S35H 4HBCH 3K5LA 2ZJSL 3GT6A 4RISH 3PWUB 1X5XA 1LWJA 2Y06H 3Q9PA 1FCCA 4PJEE 1QWUA 4Y8AA 2D4DA 5FGCE 3WNIA 4Y5YC 5KVGH 5EBMA 5FO7B 2O5XH 1HKFA 5BQ7B 4FFYA 3EOYG 3EH2A 3UO1L 1X4TA 5DMYA 4MXVF 1M7DA 5HI3C 2LR4A 3X1FA 5IHUL 2LGWA 1CGTA 1IILE 2IWFA 3EDKA 3H4HA 3HUJA 5EU7E 5CGBA 3RFZC 2LLLA 5D4QA 4ZMZA 2BIQA 4LSVL 3ZRCC 4DW2H 4KTYA 2ATKB 2BHUA 2DWDA 2V3EA 3HNVH 4KVCH 3FT2B 4YJ2A 1XH2A 3FU7B 2QPUA 3QQXA 4KRPC 4F6RA 1YEKL 2FEJA 1SDDB 3OTOB 1OE2A 3RVXD 2Y5TB 4K8RD 1TQSA 2F8VA 1S8DA 3KG5A 1KTLA 2WQRA 4JB9L 3RNKB 1Z5HA 3GGWA 4TNFA 5L6YL 2IQAB 3TCLB 3WTUA 4V2BA 1TG8A 3BCFA 3D6GA 4J4PA 4RFNB 1QRNE 4G1EB 2WAQA 1SFDA 2H0EA 4GUPB 4HK3N 1Q6UA 1ZHKB 1UZGA 4E41D 3FZUC 4N9GA 5DQDH 3T1FB 3U1SL 5EZLA 5BZXA 3C6SB 4JGUA 3TVMB 5ADPL 2LU3A 1UQSB 1YMMA 5F7YC 1J5OH 1FL6A 4RIRA 3QAQA 1Y67A 2BP0B 3QUYC 4HIXL 4R0LC 4TQHA 4OVUA 2FT6A 4BW5A 2WBJA 1X5KA 3I3EA 2PYFA 3IAPA 2AMGA 3OAAG 1HEZB 3ZRFC 4H20L 4OD1H 2VLKD 1I7TB 2DH2A 3F7PC 4ZXBC 4PJBB 2EDKA 1VSCA 1T2QL 4ZFZA 5LBVA 3L4YA 5KYWA 1EX0A 4U1LB 3IGFA 5DEFA 4LLVA 3KXFB 3O8XC 3U83A 5AYUL 4MT8A 2VDKH 2EIEA 5IJ9B 1UZ6E 4JQIH 4FYSA 2XA8L 4GRMA 4YK4B 4AHCA 4Y7MA 4UAOB 1PD6A 1K4DC 5KA5A 4PFEA 3R1GH 1GYWA 3CFUA 4XWOC 2YJQA 4FFZA 4JZNA 1HR0B 1VARA 3B9KB 1FORL 3UTPD 4XOBA 6FABL 5B38A 2YBRA 1P4LB 4JM2C 3QZNA 2A9DA 4MA1C 2QGCA 3DJ9A 1SJHA 5C3TA 3HI5H 4LEEA 5GSVB 4JHUA 4KZDH 5FC9A 3KPMB 4P2RE 4IU2A 3LTVA 2ALWA 3MLZH 3N44B 3V6OE 4DW0A 2ZYRA 3P4OB 4AEIH 1KTDA 1UG9A 3MFFA 4TPRH 2GBAA 1DUZB 2NW2B 2B4CL 5SV4A 3MBEC 3FQRB 1OJHA 3VNZA 4MVZA 4U1MA 2BFVL 3OGCA 4MNQD 3CN1A 4NQDB 3TTSA 5I24A 5DECA 5AW0B 5L3CA 2Y7OA 4RGND 2AKRA 2DY2A 2NX5E 4HPOH 4YWGL 3OKOA 1P4RA 2OP4L 3QH3B 4HWUA 2OT5A 3DARA 3IB4A 4P23C 5HYIA 3VDCA 3ZN6A 2XN9A 4JVWA 4FA7B 43CAB 4PGBA 5KUKA 4LVHC 4F8TA 4MCYA 4DN3H 5CSBA 2NCMA 4X1IA 1B4LA 1DBAL 3D39D 3SDCB 4MJIE 3DYMA 3QUZC 4Y1TA 2YLKA 3PWPE 2ZT9B 4GOSA 5J4MA 4CAGA 4UZUA 4I0XA 1CI3M 4X64B 4FA8A 5B39B 3K0YA 1CJYA 2YAEA 4H1LG 5L2JA 2AEOA 1Q90A 4JMXA 3VQ1C 5FV1L 2JCCA 4JRYB 2GHZA 2Z64C 2HKHL 2NQCA 3LZFL 1Q82W 1D7FA 1KGJA 2ZXAA 4NOBA 5IMOA 3EFDH 2H47C 3L1FA 3QORC 4W4NA 4YSRA 2UZYB 1R5IA 2KL6A 1LO4L 4MDJA 4B5ZA 3GINA 2KS0A 3L1GA 1VQ7V 1NC4B 4H0LB 2GTAA 4EIUA 1QSED 1QCEA 4BFKA 3SGDI 4DSYA 4OTXH 1FNAA 4QXTB 4X0KB 3BGMA 3RBSA 4PRHE 1QU7A 3JSNA 4GQ9H 1OF2A 2BHYA 5GRJL 3SDAC 1F51A 1A6TB 4XMWA 1S7XB 5EC2C 4N0YH 3T2NH 2ETNA 3N3EA 1MZYA 5DD0H 1S7QB 4N86A 4TXVB 5F9JA 5DJXA 1J8HA 2X7LB 1M71B 4TUKL 2ZDIA 3EHBC 4K94L 5G2NA 1W80A 2Z3YA 4KI5C 4GX5A 2MNUA 4N8UA 2CLZB 3CSGA 3U0PA 2PPEA 1YZBA 1NLBL 3BAAA 3JYCA 1EBAA 4KDTC 1GMEA 1JDDA 4DGVH 5E94A 1J0IA 2ILMA 2KUTA 2WK2A 3GJEA 2CDYA 1OTTD 1A4AA 1UASA 3NFSH 1HHJA 1MDTA 4G8GB 5A2KH 2OMTA 5D7IF 2PXYD 4CC4A 4FMFA 3ZTNL 3KL5A 4B9YA 1SF9A 4YHIA 3ARGB 5LXTA 3VAEA 1NKOA 1AR4A 4N2NA 4XBEH 2QPSA 3N85H 4BIZA 3VXOA 4ZUUB 3MRRB 4OCNC 1JWMA 4IHOA 5GGQH 3EOBB 5TFSH 5EBMC 2CHDA 2GJRA 3T71A 3GTNA 5JW3H 2Q0AA 3MRNB 4JHAH 3JATB 4OZIE 1D5IH 2F7QA 4BQBA 4MCZB 5AFAA 3RGBA 3OJMB 1MMMA 1JI1A 1KTBA 2BPBA 3SDXF 4Z3TA 3L9RA 1U93B 2A4ZA 5FHAL 3ZKMC 4YXWG 4B7EA 1CP9A 2RACA 4EB6A 5HFLA 1LYQA 4BH8B 1N12A 4L2YA 1G43A 2EZOA 1G9MH 1MHCA 3FH5A 3KW7A 3VW3L 4YSUA 3FQNB 3WFEH 4PJ5D 5FYKD 4YQXL 4Y5YB 1NCBH 1GN4A 4KO6A 4MJIB 5C97A 4DR4B 1MVUA 5LGTA 1XO8A 2YKKA 4WF9V 1KXVA 5E2WL 3ZTDC 3FXIC 4HLZH 4J4PC 4B0MM 1J0ZA 3PAUA 2GITA 2BS9A 5IBTL 1Y18B 4JG0H 1HESA 3HMXA 4KROC 3WIFB 5AWNH 4WNQA 1QQDA 3WTVA 1G4YB 3S3PA 5D1XA 1S3RA 4CDHA 4NKDA 1KXTB 4PJ7A 4PJCE 2YGNA 1A66A 1EJFA 3HI6L 1CFSB 1BFVH 2I25N 4KRPB 4DIXA 1OAXH 1BZ9A 3DDGA 3PDGA 4KNQA 1KLUA 1WPCA 5D1QA 1J9QA 1Y6NR 2BSTB 5HHNB 4OAWA 3MV8E 5JDSB 5IFAH 3MROA 3BHBB 2JS5A 2CJUH 1ML0A 3K74B 1N3NA 5DT1L 1GJIA 4Q97A 4OZFH 3EYUH 4LQ1A 1K4CA 5LBSL 4KXDA 2YSSB 4PRHB 4LFAO 5BS0D 1KB9F 3T2LA 4O4JA 4DVRL 4B96A 4ZD3H 3A0HZ 1A25A 1KN4L 2ZKOA 4X80L 3VQWA 3QBTB 4QTFA 1DJXA 2D4FA 4JFED 4UDUB 4M5ZH 3S3CB 3AG3B 4E41E 4F3FB 5AG9A 1YJDL 2WLMA 3K3QA 4BZYA 1A3LL 4IGBD 2WLJA 2VL5B 5EZPA 2W0KA 2CO6B 2NYYC 3IU4H 4FHJA 3ZZSA 2EECA 4Z2WA 4OLWH 4ZXBB 2FR4A 5E9DD 2OJZH 1OAQH 1EGJL 5C0BA 5CP3H 2QKIB 4IYHA 1OARH 1HNXB 1UB5B 4WSKA 5AL0A 2WBKA 3PHSA 1YDXA 1INDH 1LK3L 3O8XB 3QDGA 1S72V 4M7ZC 2VLKE 4U3FH 4G6JH 4YDMA 2BZCA 4NIYE 5I19H 1I1RA 4HW6A 3ZBMA 1DZBA 1BLIA 4WGWB 1K4DB 4HEPG 5ICZB 1J9SA 3CHRA 2XWBA 3LN4B 5CILH 5C07B 3UIZA 1J1XH 4A6YA 4YHKL 1WLHA 4PYGA 2KPNA 3NDZE 3PGFL 4GXVL 1LNQA 4JM2B 3HC3H 4O02A 4MA1B 5DUJA 4CZZA 4HUWA 3RIAK 4J7KA 1JV2A 3QFDA 2ADQB 3Q8CA 5CCHE 3UTPE 3VI4E 5KS9F 4LOVA 1R1BA 1WAPA 5GRWA 5D6DA 2VIRB 2NXZC 2ZOOA 1R19A 4GBXD 5GTHZ 1N10A 4QRRA 4HT1H 3S5LB 2JNZA 3EBAA 4XE5B 1O5DT 5CEYA 1U4EA 4PLJC 2QSVA 4NXSA 3MBEB 3ZO0A 3UMTA 5DLML 3L3JA 5I6LA 1T1ZA 4QRUB 3LJ3A 2F53D 5TQ0L 4OJFL 3VFPA 4FZ1A 4GRWE 5H37H 4RDBA 1KB5L 4P23B 4E2LA 4YHPA 4Y2OA 2ICWI 4X99B 5KYYA 4JRWA 2EDMA 3E1ZA 4LVHB 2QKCA 4QPKA 4YXHH 2L7JA 2VLRE 4EJ1C 2QKSA 1ETA1 2BS8A 3QUZB 2DD8L 5DRXB 2VUYA 5DZJA 5KSVA 1NFDB 1OHQA 4S1DC 2EZPA 2R2HA 1N4XH 1HL4A 4MD5B 5CMUA 5LHGA 4ODTL 3OPZH 2CMRH 1A3RL 3NABL 1JYNA 4MRCA 3ILQD 3WEAA 2WSPA 1QUNA 2ARHA 5LHIA 5CGYD 4QOKD 2L35A 3QPXL 1DVQA 4DK1A 4Z7OF 1XOUA 1FCGA 2WA4A 1WFUA 3OHMB 4Z7UF 3VFOB 2NNXA 1X44A 1QLRB 5D4HA 3QORB 3T65B 5I15L 3NRQA 1EEYA 3GS7A 3MLSL 4JR9L 1TYEB 5LXVA 1U96A 5GGUA 3KPSD 2ZDIC 5IJ0B 4KRNA 4HALA 4ZUSA 4CMMA 2MHAB 2FIKB 2G2PA 3R7QA 5JTWA 4N2OA 3FCUB 1U8PA 3MRHA 1HQ4A 4Q14A 1UWYA 4JFDA 3DX1A 4BZ1L 1FVEB 2XFXA 1YPZE 4HU2A 3LZPA 3SDAB 4KX8A 5CSGA 1M5IA 1A32A 5E1GA 2OZNA 5EC2B 3TJPA 1XGQA 1AZVA 1M1XA 3NH7L 2IOIA 4CC4C 1U33A 3WFZA 2FHCA 2QSCH 3RX7A 3CHOA 4M5YL 5BOPA 4PS4L 2P5PA 4GQPH 3B9VA 5D55A 1PLBA 1AR1C 1SKVA 5LGUA 1IAKB 1QBLH 3TJHC 5HDLA 1OOAA 4LIQE 5AAPA 4NUQA 4IMLA 4LCWD 3AMKA 4PBVC 3O41A 4J6RL 1GTOA 4AI7A 2ZINA 1TETL 3M1CA 4XP9H 5GGTH 5DHVH 1IGCH 2COVD 3CFEA 3H9HB 5DD5L 1KYAA 2YC1B 2F8OA 2Z35B 3I50L 4MXQD 1E50A 3AW5A 3ETBJ 3KZ8A 2JI1A 3QZOA 1HR0O 2XAFA 1REIA 3POHA 4Y4KA 2LAGB 1U8MA 3CRCA 5FL7G 5B3NA 4FHBD 4PGCA 3C9NA 1MRFL 4DH2A 3OB0H 1A7RH 5EBMB 4CVWA 1BXVA 3D3VD 1CGWA 1WWBX 3DGGA 4KY1H 2MOGA 2EULA 1KXVC 1WZ1H 1BAWA 1M7DB 3JV0A 2DQFA 3L1OH 2Q10A 4P4RA 5D1ZD 3EGDA 4JO2L 2CO1A 1UFIA 3HUJB 3BWAA 4HC1A 1SA0A 4LCUA 2B59A 3GI9L 2OKMA 2E7CA 2DQ3A 3IEAA 1BJ1J 2DWDB 3ZYZA 3IJEA 2WLLA 4YJ2B 4HFWA 5E8EA 3AWGA 4F9PA 1UFGA 2XG5A 1YN6A 2AITA 4B3SB 3FRPG 1UWXK 2DJ4A 1S8DB 2OR9L 1XCQA 1KTLB 2GDSA 2Q7HA 1M4KA 1WZLA 3GGWB 4IRJA 4M1CC 1RZJH 3V0WL 1SDYA 2E0PA 1HAWA 1HINH 2EP6A 4CBPA 4GYCB 4PJ5E 2H0JA 2BHFA 2ED7A 4JAAA 4R97B 5FYKE 5DVMA 1K4CC 3AXLA 4KROB 1ZLDA 4N9GB 4Q6GA 1DQMH 5CCGE 5EZLB 2P80A 3MVSA 3T77A 2E4TA 3G4SV 2OMZA 5K1NA 2IADA 1TTBA 4X64O 2LLGA 4X50A 1X9LA 2EDJA 3RVTD 1YMMB 3ET9F 5SWSD 1FL6B 3GEWB 4RIRB 7PCYA 1CGUA 3ARRA 1HI6A 4RRPG 1BV8A 4TTDD 4UT6A 3K5OA 2F1BA 4YXLH 3VXME 1BMWA 2WBJB 1KCRH 2PYFB 2OZ4A 2CBTA 3IFXA 1YEIL 1PGRB 5GGVY 2W5PA 5KYWB 1P7KA 4F8PA 1IAIL 5DEFB 1GYUA 3FFCD 4WFEA 1EZVY 2NSQA 4TVPD 3Q8BA 2ESVE 4HJ0D 4N2GA 3AWEA 3VXUA 2K4WA 4ZMPA 4E0RA 5BS0E 3Q2WA 4QLWA 4IBTA 5MHSD 1TJMA 4JZNB 4PWKA 4AM0Q 3MRKB 1ZCRA 4JFEE 2YBRB 5B38B 4LF7B 2IH1C 2XV3A 1OALA 4JI0B 1RQ5A 5KVDL 1SJHB 1UATA 4YZWA 3ZL2A 4PTUA 3IJ9A 4KKNA 2X4SA 3BMWA 4JS7A 4IU2B 4U0QB 3P3TA 3EDJA 3VGAC 4J3BA 4ODBD 4M7ZB 5F21B 4K3EH 3JTSA 5D6DC 5E9DE 1QHOA 1KTDB 3BVOA 1V7NH 2F2HA 3MFFB 1B4RA 2GSGA 3S98A 4N85A 3TXSA 1IB5A 1JWSA 2O6DA 3DHMA 3QFGA 4X5PA 1VF5C 4YHLL 1A02N 4U1MB 1FXKA 3OGCB 2AMUA 3JWNG 2DAVA 2AKRB 2EDYA 2DN7A 4LFBB 3OKOB 3ELAT 3IGLA 1WC7A 5FW7A 2XN9B 4ABQA 5E03A 4PGBB 1IARB 2DIJA 2W9EH 2E8ZA 3K4ZA 3W11C 4YGVA 3U7WH 4J3OC 2M2DA 4FERA 1K3EA 1R24A 3DTDA 4X1IB 4OLVH 1BJ8A 3O2VH 2D7TH 2VN4A 4P9MH 2YOAA 2CK0L 2D8KA 2UWEA 3ARED 4I0XB 4F37K 4B6ZA 4DV3B 4JCMA 4OFDA 4QF1B 1YUHA 1DQVA 5IYZA 3CD6V 2VW4A 4B9CA 3TM6A 5L2JB 1Q5OA 4PJ7E 3PRZA 2JCCB 2IJJA 4H7VA 4OF5A 3HE7A 3W3BA 4H8HA 4QPEA 5IMOB 2F53E 4RRPM 2XTSA 4H8WL 3OMIB 3BKJH 3A4DA 1R5IB 4BKLA 2O61A 4ANVA 4MDJB 1MY5A 4PMFA 3X2QC 2DOCA 4OXSA 2Q9LA 4DR4O 3SPGA 4QD2E 3DC6A 3ZRXA 5MI0B 4B53A 3K03A 1KBGH 2EEAA 1W0YT 4YMPA 3BGMB 5F7EH 4ES8A 4FS0A 1D9KC 4P5TA 1NIBA 1LK2A 4XE0A 4OLZH 1HCZA 4O9HL 1OF2B 3RL1A 1S76D 1HU8A 2WXMA 5E6ZA 3GSNH 3PGDA 5CKGA 5DDHA 5ITFB 1HZHL 4S1RH 3LHPL 5F9JB 1GTNA 1BP3B 2IH9A 1GC1H 4R7DA 5DJXB 1J8HB 4DUVA 3WS6C 1IGJA 2WQUA 1NEZA 1M56C 3L4CA 3UTZA 4NHUA 2X2HA 2NOYA 3U0PB 5AVYB 1OCWH 1U8HA 4AIXA 4ZUTA 2D3OW 3TA3D 1YEGH 2YA0A 2ZCHL 2DWEC 2VJXA 1SBSH 2J8UF 3KPSE 4GRLD 4N2KA 2C3GA 3BW9A 5E94B 1G1XB 3GJEB 1HHJB 5CJ8A 5B21A 1MCLA 1FC2D 4NC1C 3DSNA 4Z3JA 2OMTB 1OGAA 2F7RA 3TL5A 5HDQL 5AZEH 1XMWA 4YHIB 5FNVA 3H6AA 5LXTB 2WB1A 3CTTA 4LDOB 3O3BA 4Y2DD 3B8SA 2ZCLL 4OIAA 4E9XA 4Y4KC 3VXOB 4ASUG 1AR1B 2K9FB 1JWMB 2P8MA 4IHOB 1EANA 1TQTA 2DQHH 3BUDA 4NGHL 4Z7IA 3S97C 3Q6FA 3GRWH 4TLSA 2WMPA 4PJGF 4FNSA 1GAFL 3GI8L 5F7LB 2ZE0A 4MAYA 2BSSA 3E9UA 3MODH 2FECI 2R0LH 3OD4A 2IPKA 4UILL 2QSQA 4LCWE 3L9RB 4NZTH 1MEXL 2GCYA 4J80A 4LCUC 1RFYA 1AFVL 1ZVNA 4EB6B 2L6LA 1FZJA 4DN4L 3Q2VA 4PI2A 4X4XB 2CUAA 5BRQA 1EZSA 3GQFA 1PNLA 4K9EC 1GOHA 2W60A 2BH0A 2H8PA 1MVUB 1FFPB 3V52L 4XI5C 4I88A 4K8ZA 4I1RA 1VDGA 5JUEL 3HIZA 2D7OA 3SDYH 4NQVA 2GITB 1XBDA 2BSRA 4XN4A 4JI1B 3QE5A 5IJKA 3A23A 1DSYA 4XMKL 3D3VE 4WNQB 1QQDB 3ULVL 2IGLA 5D1XB 4P07A 4NKDB 4UT7H 5FK9A 3KLLA 3OZ9L 3NA9H 1CZ8H 1BZ9B 2DLHA 1KLUB 3O3AA 1T7ZA 2C7UA 2YAOA 4K8RH 5D1QB 4EMZA 4B9GA 4OAWB 3MROB 1TITA 3VFTA 1XCTA 2VZ3A 3N1PC 1K4CB 4ZMXA 1NT2B 1P2CA 3NIGE 5DK3A 5AVTB 4O4JB 2KC0A 5CN2A 1KGYE 4R4FH 4FTDA 1Z2GA 2CAKA 4FNRA 3ZDYE 3DGCR 4JFDE 4JL2A 2Z31D 3RKPA 3ABTA 1OB1A 4W70A 2PUQT 1JXJA 2AV1A 3AT0A 4FEMA 4KTEL 1PFOA 4O00A 4EXKA 5CGMA 3VSUA 4H0HB 4UOW1 4FNQA 5SWSE 1CL7I 1L8DA 2FR4B 4PRPA 5DVKA 3CHPA 5C0BB 3FSZA 1BOGA 5D8JH 3OMAB 3HE6A 4OLUH 4FAAB 2M1KA 3ZN1A 3QISA 1FFRA 3QDGB 3TO2B 5JPNA 4JN2A 3C6LC 4MJ4A 4UZSA 5CP7A 1JVMA 3JCZA 2OL3A 4N90D 2XWBB 3GBDA 4MHHI 3I9GL 3FFCE 3S7GA 3L75H 4A6YB 1FXKC 4MA8H 2LOEA 4O02B 5SX4H 4HUWB 1IBLB 4LDEB 1HWHB 1GN2A 2XYBA 1JV2B 3QFDB 1GO3F 5MEND 3VGAB 4KXCA 3SO5A 1BDYA 1VQ5V 2K45A 5JPMA 5L2KD 5GZNC 5AAWC 4IS6A 4OGXH 4QRRB 4ZO8A 1KMGA 1MF2L 1NGYA 1YQ2A 4GRWH 5CEYB 4I7ZC 5IDJA 4FLZA 4ELME 3L3JB 4DGYL 1Y0LA 1T1ZB 3FQXA 1KNOA 3VFPB 4YSAA 4DR7B 1MI5A 2NY3D 4YHPB 1U3JA 4DESA 2ZM6O 4J10A 1E1RG 4NWTH 1NBCA 5KJ4A 2VZSA 2YS8A 1NAKL 4A7GA 5KYYB 1JZ6A 4KDWA 3CBRA 3BD4A 3ZQ9A 5FYKU 1KCWA 3ZRSA 1CDUA 3JWOL 4DCQA 5I28A 5KSVB 3ZY7A 2OFQA 1JNNL 3BPCA 2R2HB 2B3IA 5JMRA 4NRZA 2OCFD 2VSCA 1QUNB 3QYNA 3BKYH 2EEFA 3EOTL 4XAKD 2AGAA 2AQNA 2EADA 1I5XA 2NY2C 2HX9A 4IU3A 1IQWL 1URLA 1J5DA 4WEBL 1BVLB 3NSYA 2X0VA 2W65A 1EEYB 3INUL 2QGEA 2ALAA 2DQTL 5GGUB 3X1GA 4M4PA 4EDXA 4ZUSB 4CMMB 1NMBL 2HSIA 4FMTA 4G11A 1U8PB 3MRHB 4JREC 1HQ4B 4U49A 2VITA 4OI8A 5EEUA 2KZ1B 4L8CA 4DT2A 4PRID 1OHHG 4JFDB 3OR6A 5CXPA 1E65A 3PL6A 1IGIL 1N64H 1KN2H 2CSPA 3GB7A 4G8FA 1IBHA 2ZNJA 3N2GA 2RQ6A 4QMEA 1XGQB 1HFUA 1M1XB 1H0DA 3EJYD 4CJ0A 4C4KO 1SYVA 1Q0YH 4N0CD 3CN0A 3AXIA 5C93A 1M1KW 4EXPX 4LIQH 1M56B 1WFIA 3APDA 4AVHA 5C3LD 1X5HA 1IC5H 4HS8H 3G9VA 4NPKA 5E5MA 2X53A 1INEL 4TN9A 1C1EL 2AQPA 3D85B 2MNWA 3ILPA 1Z9PA 4PRBA 4IMLB 5LG6A 3O41B 3O6FC 3RDTD 4XAWH 5L8KB 2VQFO 1C5DA 3N04A 1M1SA 4MAYC 2AQ1A 3FDWA 3OFNG 2TSAA 3CFEB 4YIPA 1JRHL 4HKZA 4H0IA 4LSQH 3P4NB 2UXDO 4KXZH 4A55A 2VXUL 1ZANH 4PB0L 1UGNA 3PQYE 4FC3E 1TVDA 4DO4A 1ICTA 1NANH 4Y4KB 1CLYL 1EJOH 1I1AA 5KBLA 1JPTL 4OF0A 1U8MB 4JI0O 1IJNA 4JJOA 1AIZA 1GRJA 3C90A 4PGCB 3C9NB 3BGFC 1L7IH 4PY7A 5DUPL 3DGGB 4HK3J 4HNAA 2ICWA 2R7EA 2X28A 4JI7B 2EXSA 4RX4D 2DQFB 4JFPA 4P4RB 3EGDB 4L4JA 3X3FH 4X6CE 3NAAL 2X9ZA 4TRPH 3BWAB 4YHHB 1SA0B 3RZCC 4LCUB 2B59B 3S35X 1JK8A 1R3JC 3VU2A 5IJKC 4JKKA 5IVOA 1MFAL 3FT9A 3IJEB 2ZXGA 3ABLC 2WLLB 4NQCD 5LNEA 1TO5A 2XG5B 4N8VG 4JGJA 1YN6B 2DQEH 2P8PB 1VRSA 4N6RA 1OY3B 4LFBO 4HWZA 3DUSA 5FYKH 1TGOA 4S1SL 1XCQB 1ZA3A 2JV6A 1QNMA 3ECVA 1KCVH 3O2DH 3T1CA 1JF1B 4IRJB 4LU5H 4MS6A 5TE7L 3ZE1F 5IJVB 4H2CA 2AAVA 1FG2A 1P4IL 1B3IA 2H3XC 2YIHA 1PTZA 2W95A 4YE4L 3AXLB 2OSWA 1DBML 4Z7VE 3T77B 4AVKA 1K73W 2OMZB 1EVTC 3PIQA 2AJVL 2IADB 3QA3A 3MLXL 3MCLL 5EIIG 4JI2O 2BOLA 5LDUA 1T5XB 1WNSA 3LDEA 1PS3A 1HI6B 1E2VA 2CHWA 3JSLA 3SIKA 5HY9A 3ESVF 4GEJA 2GJZA 5HI5D 3CPUA 3CXDL 4K2UL 3WB2A 4MS2A 1QASA 4L1HA 3TT1H 5KSBE 1XGRA 1FNHA 2WN2A 2QADD 2YXFA 1P7KB 3HE6C 3WCYA 1R3IL 1TR7A 4R6ZA 3D0LA 4XNYL 5JPNC 4N0FA 4A68A 2KDYA 1RZ7L 2A6JA 4FLVA 4ZW8A 3Q01A 4PJAA 5I30L 1Z9NA 4E0RB 1HYSC 1IBMB 2WNGA 2EO7A 2YICA 1IC7H 2F5BL 4LRIA 2V7QG 3IYLW 3G6JF 1TTCA 4HJGB 4B9PA 4WK2B 1ZIBA 1H9VA 2DLGA 4FADA 1PNMA 3WDHA 3FT1A 4PTUB 3G5ZA 4IJ3B 3QC5X 3QQ4B 4GFXA 4UV7H 2R1YB 2PYEB 2X4SB 1UM6L 2BSED 1K5SA 4FFBA 5L88H 8PAZA 1JD9A 3JTSB 4PJIE 1E6JH 3UGEA 4I3SH 4D6TH 2FJHA 3PNWA 1A3ZA 5BZDA 2GSGB 4DPBX 1JPGA 1YVLA 2DBJA 3UBXA 1JWSB 1VLXA 1RSYA 4N6QA 1V5JA 1BFOA 2EVGA 1FXKB 1TMQA 3CK0L 3QDJD 3GUFA 3COOA 3DX6A 3PREA 4I0PA 4HISA 4ZT1A 1BVZA 1KPVA 1VPOH 3H55A 1WC7B 3K57A 1MHEA 1JVKA 1Z3RA 4QTIH 3ZHSA 1RUPH 1KUQA 3MMEA 4YGVB 3VA2C 3ZTJH 4Z3EA 5J5EA 1H8LA 4M8RA 4G72B 5C8JA 3ZDXE 2RH0A 4GG6E 3O6LL 4I7ZB 1SQBH 2B8OT 3KJ4B 2D9QB 2UWEB 1IFHH 5DURB 4I13B 1J0YA 2YD3A 4KZ0A 5L2KE 2IANA 2FYUH 3QIWA 3OZLA 4IOFC 1N0LB 1YUHB 5BRZB 5IYZB 1MJJA 4XDKA 4LSDA 3CVHA 3GRGA 1NPUA 5FHBL 3UACA 3FH8A 3Q0HA 3TJEH 3HE7B 1E1QG 2EH7H 4YOKA 1WFJA 4RMTA 3TBTA 3WE1A 3ES6A 3LRLA 4BKLB 5I1LA 2GKIA 4POUB 1KYUA 2VDOB 4X8JA 3N42F 3BWUC 1MDAA 3KPNA 3BP6A 5BOJA 4AEHL 2QVIA 3QUMH 2IBGA 1Z5YD 2EKJA 3S35L 3L5XH 3TX4A 2JGDA 4W6YB 4PELA 5B1AC 2Q9OA 3IDYC 4HBCL 5FX3A 4RISL 4P5TB 2Y06L 1LK2B 1Q0EA 3DIVA 1N36B 3OR6C 4BINA 2NY2B 3PL6C 5KVGL 1DQDL 4JFZH 4RMQA 3RL1B 4RZCA 3GB7C 3WTWA 3CAFA 4EUPG 1L0LH 1G0XA 1ORQA 3PGDB 1WA0X 2CBPA 2AV7A 5D2LF 2DQJL 1KTJA 3ZN0A 2C4FU 3A67H 3E3QC 3QIBA 1AG0A 5DS1A 2R69A 2VISA 4MA3A 3VFSA 1PW3A 1PG7X 3KHOA 1IGJB 3NP3A 3PG2A 1NEZB 1KFAH 3ARFA 5B3SC 4RSYA 2X89D 3OVUB 3STZA 5E4AA 5ICUA 3UTZB 4DW2L 4GUNA 1QR4A 3HNVL 4JREB 4NHUB 4O2EA 4KVCL 3WFDH 3QXWA 1B88A 2CHZA 2VJ8A 4NHCH 4QYAA 5DTFA 5JXED 1U8HB 4ZUTB 3QG6A 3LSUA 1TFPA 1YC7A 4TOIA 1WBXA 2PMZA 2P7TA 3BW9B 3EADA 4HUCA 4KJPD 1P84K 5GJSH 2ZICA 5KOVC 1MA1A 4PRIE 4PJFE 3DSNB 2F54A 1OGAB 3MUUA 3H1JH 3B9DA 4B9ZA 1URZA 1TQCC 5DQDL 5FNVB 2ORBH 3F6LA 3RVUC 1UA6H 3O3BB 2VERN 4Y4FA 5KYXA 1XSOA 3RUGA 3V0GA 1I1AC 3K80A 4PCSA 1J5OL 2P8MB 4PJXF 3OF6A 2WO2B 1NWOA 3Q6FB 4AC2A 3FN9A 3DXRA 2WMPB 3O6FB 4GUOA 4KRMB 3KEDA 2Z3FA 4MAYB 1TVKA 2BSSB 3HBQA 3L5JA 3QO5A 2ZQMA 1XUQA 4MQXD 4OD1L 5EU3A 5F89A 2GCYB 1PKQE 2WW8A 3FCSA 1QFWI 4RSVA 4ETYA 1R17A 3SSGA 1FZJB 4A2FA 3CU7A 1CF8L 1VFMA 3TK1A 4WW2A 4OQTA 2JWYA 2XKSA 1E27A 2VDKL 2KYIA 1BG1A 3ZW3A 3R4RA 3B5HA 4JQIL 4E42A 1JL8A 1UWXH 2W60B 2H8PB 3VE0A 4TV3A 4K3HA 3R1GL 4AXWA 1KENL 2FX8L 4N2HA 2UU9B 2ZXBA 3II2A 3ULUD 4ORGA 3TV8A 3BEHA 3Q4HA 3PP4L 4PJ8C 3BFOA 4FVMA 4TULH 4DKDC 2GC4C 1ZY9A 3HI5L 1SYSA 4NM8H 3W7SA 3LH2H 4KZDL 1VEOA 5EU7C 4OCWL 5FK9B 3BO8B 3MLZL 3ABLB 2QEXV 4JI5O 3GIVA 2P67A 1FN4A 2OJEA 4AEIL 1TOXA 4HU8A 4QRSA 4DR7O 1TUBA 4TPRL 3O3AB 2C7UB 3JVGA 5AYQA 3D4YA 3PABB 4IBUA 3CCVV 3VD2A 1FNSH 2VDMB 1OWRM 3VFTB 1JZ2A 1XCTB 2QTSA 1AP2A 4GMTH 4XGZA 5GS0D 2HG5C 4HYTB 1RLWA 1P2CB 5HHPA 2IBZY 4PRDA 3G71V 1TZ8A 3JD2A 1RZJC 3SKJH 2QDVA 3OT7A 5BRPA 3I3BA 4W9DC 3RY5A 5DC0A 2BVYA 4HV8A 5AVXB 4DN3L 3APCA 2CDGA 1OB1B 1WUZA 3GK8H 4LRNL 4MYWB 2AV1B 2QGBA 4N23A 2VMDA 4KO7A 1G9EA 1DVSA 2FTAA 3F00A 4UWQB 5CF3A 3TEYA 2APVA 2B1HH 4LRIC 5I75C 5JMOC 3FB6C 1A14H 4PRPB 4KI1A 2IWGA 2WXGA 2HT2D 1ZHNB 2MW2B 1BOGB 5FIEA 3TFKD 3HE6B 4LSRH 5T1LA 2LQTA 3KLSA 1JZDC 2BVOA 1V7MH 2JLLA 1EEZA 5JPNB 1HEHC 3EFDL 4JN2B 2F95B 2OBGA 3MA9H 2AJSH 3QIUD 4CU8A 5CP7B 3DX7A 3L5WA 5KAQG 2OL3B 4WWPA 2OWOA 4OFPA 1KLGA 1YEHH 3O81A 1PG7L 2WXJA 4OTXL 1O5PA 4GQRA 4IOSA 2WN3A 2W07A 5FCSH 4YHOH 4DP1X 4PSRA 1XR9A 4ODVH 3FX7A 4MD4A 2LW1A 1I85A 2JJSA 4N0YL 3E8UH 5CD5D 3SEPA 4WLCA 4Y5VA 3T2NL 3V0VA 3WUWG 3E1F1 4KC3B 5DD0L 4WF7A 4IS6B 5KW9L 3MV9A 3DMMD 3B37A 4A2MA 2DW5A 3D2TA 4NENA 4P3WA 3SKNA 2DH3A 1YNTF 2WCPA 4EF3A 3TO4C 1Y0LB 2WLNA 3FQXB 5HXMA 1TJIH 1KNOB 3QIWC 4KKQA 3CRAA 2EABA 4DGVL 1MI5B 3L17A 4TSAH 1RJZA 2VTFA 2ENPA 2A6DA 3FU6A 2EVHA 2KH2B 4E9TA 2YXYA 5F7DA 3NFSL 1SZXA 2CNZA 3P73A 4JFSA 4CVUA 2MQ0A 1FAFA 2K0RA 2WVTA 4DCQB 1CD1A 3ARVA 1Z9OA 2YD9A 3KLKA 4K55A 2OAAA 3WL9A 3IJ4A 5IWAB 4LF5B 3BPCB 2AZAA 4XBEL 1B6UA 1XD0A 3N85L 4ZBMA 1WS8A 4NRZB 1T80A 2RB8A 3K04A 4IYKA 2QTEA 3EYOA 4DV0B 4U1KB 1HSBB 2A4EA 4ISVA 4XNMA 1UYWH 2ZWKA 1SRDA 1P5VA 5GGQL 4IU3B 3WJLA 2G3MA 3K5SA 2ZOUA 3SO3C 3VXSD 3QDMD 4HPHA 1ORQC 4DGIH 1CT8B 1H2LA 4U3XA 3QIBC 1D5IL 2W65B 1K6QH 4PWJA 4AX3A 9PCYA 1KCUH 4UB0H 5IFHL 3WENA 4IRSA 3RL2A 5E8PA 1AYOA 1WDAA 4EDXB 1OZ0A 3STZC 3G6DL 4M56A 3W82A 3BIBX 2BDNH 1NDMA 1T89C 4FA6A 1G9ML 2VITB 3IDYB 5B1AB 3CMGA 4L8CB 3WFEL 1MCHA 3D39A 3OR6B 1LD9A 3PL6B 4GUCA 3QHFH 4WI2A 3GB7B 2P7TC 1TZOA 3N2GB 1NCTA 3T6QC 1XILA 1UXMA 2WVVA 1H0DB 3IAGC 5HHOA 1AY1L 1SYVB 3RJQB 5HYEA 1DBKH 1XIWD 1ZIAA 1KSRA 2GBUA 2Z93A 4JG0L 3I9AA 4Q6KA 4CN6A 5AWNL 1NICA 4M3JA 2R9RB 2VERA 1ZV5A 2KB1A 1MCCA 3B7RL 4Y4FC 3WXWH 1JA8A 5E5MB 4BK5A 1N6QH 3ABMC 3MN8A 5JIHA 1EFQA 3KLQA 4AW4A 5IF0A 3GPSA 4WI5A 3ILPB 5C1MB 1MXGA 4PRBB 1P1ZA 3I6SA 5DVPA 2V4LA 4HCIA 3KL3A 1QSEA 4NZFA 1C5DB 5IFAL 3ARZA 2WWKT 2CJUL 2Y1YA 4PJBF 5KHHA 3QRLA 4YFEA 4HKZB 1D6EA 1QFUL 2PABA 3EYUL 1IBFA 1TYRA 4RWYL 5AD0A 1BFTA 4HEMA 4Z1VA 5IBLC 4NUJA 2EDNA 4ZUWA 1EO8H 4ZD3L 2E7MA 3VACA 4CS3A 4UCSA 2J72A 2WUCH 1I1AB 3HMWH 4TVUA 3ZL1A 3NRPA 3KVDD 3CDYA 4M5ZL 2ZOKA 3VQXA 1U4FA 2PCFA 2YMXH 4LLWA 3GS0A 4MMZA 4PY7B 4DVBA 2DLTA 4LPVA 4HNAB 3RGVD 2ICWB 2R7EB 3IU4L 4XWGL 3OAYK 1V8HA 3ZYOA 3O0LA 4JFPB 3VFWA 4B7KA 1CIDA 2OJZL 4F80A 4ODWA 1OAQL 2Z8VC 4HH9A 1OARL 4K5PA 1JK8B 3N44F 5BZWA 2VWJA 3FO9A 2VCOA 4LSUL 4EI5A 1INDL 2IANE 3CN4A 4RAIA 4UQEA 4G6JL 2MKLC 2AVFA 2BXYA 1UHVA 4FLUA 4JFVA 4N6RB 3RJDA 4HWZB 3DUSB 3UJTH 3IJSA 4GAGL 2YDEA 2OTJV 1S4IA 2OMYA 5CILL 4MTOA 1PZ2A 4QNPF 5DZVA 1J1XL 4NKQB 1NU1H 1U95A 1FG2B 4Y19E 3ZDWA 3HC3L 1RIUL 4PJ8B 1ESOA 1Q9OA 1VJSA 1KLFA 2JJTA 1JTTA 4Y1AD 5HYJD 2XAHA 1JDAA 1TVBA 1YAZA 3BN3B 3PIQB 3QA3B 5F0JB 3U0TA 4Q6IA 4TL5A 3ISYA 4DFHA 4HT1L 4P9HC 3T3MB 1OKEA 1IZJA 2IH3A 2NY0D 5MP6H 5KX5A 5HY9B 3FQUA 2GJZB 1CFVL 3LOWA 4CILA 2YGPA 1W8NA 1VEMA 2HG5B 4M7LT 5D96C 3K2IA 4YAQA 3RVXC 5DD1H 1JS4A 2FWUA 4K8RC 3X3GL 5JLZA 1XGRB 3UT5A 1ZHLA 2ZUUA 2YPLA 3D0LB 3CZNA 4N0FB 4XODA 5IK3A 4D9QE 5C0CE 4YXHL 3SD5A 4PJAB 1TZHB 2VDPH 2UUCB 3BUYA 1SMDA 1THZA 4LLDA 8FABA 2WBXA 4LR3A 2HJFA 1N4XL 4RMRA 2BVTA 2L04A 3OPZL 1BD2D 2V37A 3P2TA 4FI8A 5I75B 4OD2A 3FB6B 1J86A 1L9NA 3OC8A 3UABA 4N2IA 1CPUA 2JFCA 3UDWC 4ZX4A 4GAFB 5C2BH 2QWRB 2OK0L 2P06A 1I85C 1ZSPA 4FFBB 3BAKA 4NT6A 3WN5A 4Y5VC 1T04A 4DKTA 1T1YA 2FJHB 3PNWB 5BZDB 2Z92A 1U21A 5GXBB 1IC4L 2J8HA 3UBXB 2HKFL 4JO1H 3CNKA 2JIXA 1BFOB 3UYOD 2FO1A 5D7KD 1BMGA 3DX6B 2APFA 1KPRA 4I0PB 3FHQA 2Y0PA 1U2HA 4M8QA 5JHAA 1KPVB 1G9HA 4BQ6A 4AMKH 5C3IA 4YLBA 2C9RA 4P06A 5LGYA 4Z7NE 4IGBA 2PWDA 1LO0H 1MHEB 3QNZA 2R70A 5DO2C 3EW3B 4KMLB 2YD0A 4PA9A 2PCXA 4MA7L 2BWQA 4WO4A 3MLRH 4I1NB 2CLRA 1UD3A 3CCHA 3DNKA 2B9ZA 3MJ6A 3GSWA 1ET7A 4BH7A 3T04D 1QBLL 3QIWB 1JPSL 2DM2A 1Y76A 4GI6A 2J6EA 4WKXA 4YDNA 1MJJB 1JIBA 3IDXH 1BQSA 3EF4A 3CVHB 4J3UA 4XXCA 1TJHH 2DIAA 1XGUA 3TBTB 1T7YA 4XP9L 5GGTL 3IRCA 1F1GA 1THAA 3ES6B 2LW3A 5FYLL 1IGCL 1UD6A 2JK5A 5I1LB 2OCJA 4MMYA 4RGNC 2R27A 4IRSC 4N2EA 4X8JB 4XPTH 2YZ1A 5EPMA 3KPNB 3BP6B 4ZX5A 3LMJL 4R7CA 3ETBF 4UANA 2CR6A 3UROR 2JGDB 1NQBA 3DBSA 3BVUA 5FB8A 3DC5A 4QXUL 4ZW7A 1OCZB 1S7WA 4EN3D 2W81C 2YD8A 4RZCB 3BLKA 2L7EA 4KY1L 2FGWH 1ORQB 3GJFA 1WZ1L 2AV7B 2GYSA 2ZF8A 3QIBB 3U9UA 1A6UH 1XNQB 2VISB 4MA3B 4DTGH 3VFSB 4HG4J 3ARFB 3STZB 2HFGH 2LP7A 4O2EB 2AANA 1RZQA 4WWKD 1K85A 3QWRA 4BK5C 5DTFB 4AT6A 1EHLH 5FM5M 1E30A 2X87A 5H9CA 2VMCA 3QG6B 4GAYA 4I18A 5CA1A 2KKWA 1WBXB 1FLRH 2P7TB 1GYAA 3RWRD 2J3SA 4HS3B 1T2JA 3E8HA 1WS7A 2B2XH 4EOWL 4FTVA 2CCWA 3O0RH 1ED3A 2F54B 3MACH 1KGIA 4JI4B 2NY5C 1IGFH 1DQML 5MEPA 3BLBA 3FOLA 2QHRL 4S0SD 4NKOA 2O5YH 2V5RA 1AKJA 3S2CA 4CW1A 3EXLA 4Y4FB 5KYXB 3PDOA 3NZSA 3RUGB 3H7BA 1B4JL 4QRPD 1BVOA 3FU0A 4X89A 4YXLL 1H3PL 1W6WA 3APFA 3DXRB 3BXNA 4MMZC 1QHTA 5KG9A 2AJYH 1KCRL 2XV6B 3QFJE 1TVKB 1WZAA 1TSHA 4N25A 5L9DH 4UNTA 1YYML 3MNDA 4OX9B 4QJ5B 4FCAA 1H2SB 5EU3B 4ADGA 5F89B 3LRGA 2QWPB 1S7RB 4FDWA 3TN0D 1OTTC 1CE1L 4WW2B 4YSTA 1OVZA 4B9IA 4PV8A 2NLJA 4M3KB 2HYMA 1ZAGA 4DP4X 4JKLA 4E42B 1Y7VA 4NB7A 3VE0B 4DP2X 4OW6A 4AXWB 3QJTB 1J9TA 4JM2F 3QZMA 3DO4A 4N21A 1FO0H 2ED9A 2GPZA 2KZWA 3A22A 3M86A 4MXWL 4ORGB 3Q4HB 2CJ3A 3WY4A 1AJ7L 2HUHA 1K9MW 1P9MA 3IC7A 1F90H 1L7TL 1SYSB 2JJTC 2I69A 1NCIA 2COQA 1MG2C 2Y07H 2UUAB 4GX0A 3GIVB 4K3EL 1FN4B 4EEQA 2BCMA 3GHPA 1W72A 3ZL4H 1TUBB 1A22B 3AZUA 1ZT4A 3KYAA 3MZGB 4P2OD 4LOFA 3APNA 3L2NA 4WV1C 2OYKA 4BXVA 5T1JA 5KAQF 2P5WE 4FJCC 4LWSA 1I94B 1AP2B 2QLVB 4NKMA 3DOHA 4XGZB 5C70A 4ZTEA 3QT2A 2YD4A 4LLYA 5HHPB 1J8RA 4PRDB 3I6GA 4LF5O 5LGHH 3WXVH 4WFAV 3RY6C 5B7FA 4FP8L 1G7MA 3NEXA 2D3VA 1XQ8A 2X6AA 2HWZH 2W9EL 5F2FA 5F7MC 3JYBA 3RA7H 4DV0O 1BEYH 4HV8B 4U4IA 2CDGB 4DV6B 4OLVL 1NFDF 3O2VL 2D7TL 4L3FA 4L4VA 5D7SL 2GB2A 2QFRA 3CH8A 5I26A 4Y1AE 2HJFC 1THCA 5I1EL 2FB4H 3VYOA 5DFVD 3IETA 4J23A 4W9FC 3IAYA 1HE7A 5DK2A 1O75A 5BV7H 2J5LC 3EO9H 1IVTA 3EKCA 5T1LB 1I8AA 1WAAE 5GZOD 3JD0A 3CSBA 4PGZA 1EEZB 1ZVSA 5CBEA 3WN5C 4BKTC 3KWXA 3BKJL 4G9FA 2CGZA 4D2NA 5JR1H 1PY4A 2DWSA 1JJUA 3DX7B 2V9RA 5GS2H 3P32A 3M17A 3AB0C 1KLGB 1A6WH 2ZR2A 1KBGL 1T6VN 5FLUA 1XR9B 4OLZL 4J3OG 3NIFB 1JZIA 2ENJA 3ESUF 4UNIA 4G6KH 4NKIL 4IGBC 4MD4B 2V6HA 1Q4NX 1BD2E 2Y7SA 3GSNL 5CLTA 3TBSA 4I77L 4Y5VB 4NBZB 4S1RL 2VC2H 3FTYA 3GSOA 3GM8A 4XVSH 3HHMA 3T6WA 3V0VB 4MZ2A 3ABKC 1GC1L 3MV9B 4G7YH 2BWIA 4KI5F 4OGYH 4LF4B 5DMGC 4YDLC 1H8OA 1ASOA 4NENB 3SKNB 3L4TA 3OKEA 3ZHUA 4QRQA 3CDZA 3E2HC 4L5FE 1E79G 3V4PA 2BIHA 3P2BA 4LCYA 1N8ZB 1OCWL 3QJFA 3II1A 3QUXD 1ZK5A 1KBKA 2GTZA 1YEGL 4ANKA 1RJZB 1WLEA 1SBSL 2A6DB 3EYFB 3MOQA 5IQOA 4XXCC 3PAZA 2EINC 1YMHA 4FHKA 5D7KE 3P73B 5F7DB 4FYTA 3T4DA 5I9QC 5HGAA 2N4IA 4HUXA 1CD1B 1OO2A 2H32A 2CIKA 4QAWA 1NAMH 3C5JA 1A47A 4HKBA 2OTWA 4XO5A 3IAQA 3FU8A 1P6AB 5E1AC 1Z3GH 4JZGA 4FX5A 3EYOB 5AW2B 3LKSA 4GBXC 4Z7WB 3KLHD 2DWXA 3O2WH 5CB4B 1I53A 2DQHL 4ISVB 4R26L 35C8H 4XCNA 1P5VB 4XNMB 3GRWL 1SF5A 1PZ5A 4M7KH 3FF7A 4LT7A 4O2BA 2BTOA 1KIQA 2ZG2A 4P2QA 3SE4A 4RO2A 4MNQB 3HUJF 1UJ3A 1SPDA 4IRSB 5EF1A 3JWDH 3RL2B 4I3RH 4NZTL 5E8PB 5K93A 2I7OA 4OCYH 4HJIA 2F1AA 3D36C 2NUPB 5D7JD 1NDMB 3V79C 4DV7B 5KVFL 2LVCA 3OMNB 3MDSA 2FEEL 3KE0A 4S1QL 5DZOA 3D39B 1Z0MA 1PPIA 1LD9B 3D08A 3V7MA 2YZ8A 4I18C 3PPSA 4PLKC 3RWFA 3TZVA 5JA9A 4NQEA 3QG5A 4I87A 2YFOA 1A6ZA 2WVVB 4JY4A 1JGLH 1AS6A 4R5XA 5HHOB 3ILQC 3B5TA 3VH8G 3V10A 5TISZ 5KJ7E 1BQ0A 4ZMOA 5CGYC 1RL1A 2YXWA 2Z93B 4IK6A 4LVNC 1I9JH 4IBQA 3BH8A 4UT7L 2E7LA 1QR1A 1QFOA 4WFHD 3NZHH 4P2AA 3WYRA 4A7SA 2ADJA 4UDTA 1YEJH 3NA9L 1CZ8L 5IF0B 3WEOA 1TJXA 1RZKC 4JFFD 1P1ZB 4AEEA 4HIIA 5EBLC 4M6NH 3VDAA 1SM3H 3N1GC 1QSEB 2MOVA 4Y7OC 5CIPA 2MKWA 1NEUA 4KK5D 1MJUH 2YSTA 1WCBA 4NVPA 2R56H 3OAWA 3ZZ1A 1D6EB 1EM1A 2UUCO 5IWLC 5AD0B 1SOKA 3VU1A 4NUJB 5F7WC 2FTKA 3P77A 1OD7A 2Y72A 1A5FH 2XZAL 4K3DH 1XT5A 5EA0H 4G83A 2NLJC 2WAHA 3CJJA 2IMNA 4L8SA 2ZOKB 1T3FA 2WYZA 3UERA 1JZ5A 2PCFB 2Q7AA 4LLWB 1UXLA 4MMZB 5KVEE 4L3EA 3SY0A 5C8YA 4DVBB 2YPKA 4H13C 2E6QA 2YGVA 1EUUA 4X9FA 4YBQC 4HQQH 4MVOA 1OM9A 3VFWB 4G43A 1ZPUA 3TA3A 4ODWB 4BCZA 2ADFL 1QSFE 4U7KA 1CGXA 4HH9B 4CKVX 5D8JL 3SE6A 5E7BA 3H9VA 5BZWB 4FYRA 3ZCCA 3FO9B 2ZXDA 4EI5B 1J11A 1TCMA 1TU2A 1AI6A 3GMLA 4DKFH 4Y88A 5T3XL 5ID0A 2IO5A 1D5NA 4L9LA 4MXVE 3F04A 4UCTA 3HHRB 1PAMA 3IJSB 4MXQC 4AQYO 4J6IA 2OMYB 2GK2A 3K8KA 5FKAA 3JASA 4KX7A 3RPKA 3UKMA 1U95B 4MA8L 1S2EA 1BM3H 2JQZA 1Q9OB 3K7UA 4F2MB 1KLFB 5I73C 3B1TA 5C7XL 1R6VA 4NS0A 3AABA 5E5UB 5EZYA 1TVBB 1Z9LA 3U0TB 4Q6IB 3L3DA 1CTOA 4QHKI 1S9WA 2LABA 2O72A 4X66B 4OGXL 5HVFB 3NJLA 4AGMA 1KCKA 2F61A 2IH3B 4Z9KB 5C08A 5KX5B 3UAEA 3V7AE 3FQUB 1O9VA 3NCJH 7FABH 4JM4H 4WUUD 1ULVA 5DF0A 1PKXA 1E3XA 4WTWA 4NZJA 4R84A 1IFRA 1BQKA 3CXCU 1Z2KA 2FQFA 2XX0A 3QUHA 5GS0H 2JCCF 4CH4A 4YAQB 4Z0BH 1X5LA 5JLZB 5JW4R 3T1WA 3UT5B 1ZHLB 3S36H 2GI7A 2HCZX 4NWTL 4DUZB 1ES0B 4WJG3 3VBBA 2YPLB 4LHUA 5IK3B 1YI2V 1DUYA 1KB9K 2WXKA 2ARJA 1N32O 2OR8A 3BUYB 2VUKA 2YPVH 4CDGC 4LLDB 8FABB 3CSTA 2HJFB 1NOLA 5D2NE 2DYPA 4JHWL 2KLSA 3RVTC 4OD2B 5GJTL 3HNSH 1XNQO 4RWYH 3BKYL 4D0CA 2YXVA 1L9QA 3GTVA 5ABAA 4TTDC 4RLDA 5E8DH 3HAEB 2P47B 4Z3FA 1AACA 4NT6B 4AM0B 4F24A 1DBJH 5I8OH 3WN5B 4HGWA 4CH3A 2XACC 3BFRA 1T04B 1T1YB 4L4TD 4MTMA 4YEEA 1VZHA 3K5MA 2MPVA 2WWMD 4Q4EA 2DM3A 2Z92B 4O2FA 1MAJA 4N3UA 4AJVA 3U0WH 3AB0B 2R39A 3IFLH 4JI6B 5DXWA 5LCVH 2UVEA 5HHME 4JUTA 2V5MA 4Z1PA 3RDJA 1KPRB 1B0IA 2ZWNA 4R5VA 4M8QB 5AW1B 1CXZB 4XNXL 4HJ0C 1Q6HA 4PG2A 3NPZB 3L4XA 1N64L 1JGVH 1KN2L 3PWLA 2P90A 4ZOLA 4IGBB 4L48A 3IF1A 4NO2A 3QNZB 4XN8A 1XVSA 5E4IA 2QWOB 2VQEB 1GZHC 5F0PB 2Y1VA 4DGWC 2EE2A 3D51A 3KBFA 1URIA 3NCEB 3ABKB 1Q0YL 4WO4B 2YOCA 4XH2A 3NK3A 3WKML 4J11A 3WG7C 2CLRB 1NFIA 1NCGA 4LIQL 3CCHB 1AB3A 3E2HB 3VXUE 5LGJA 1A8JH 2IV8A 3GSWB 1IC5L 1QI5A 4HS8L 4BH7B 4R5TA 1BG9A 1PBYA 3T2MA 3EYQD 1Y76B 1T20A 2VB5A 4IYIA 3SD2A 3RN4A 1FP5A 3B7SA 1LUWA 4J9ZB 4LPWA 3FAXA 4XAWL 3E8FA 4XN1A 4OCXH 3VFGH 3CB2A 1GGTA 1XGUB 3SE4C 1PAZA 5I9QB 4F7PA 1CVSC 4HXBH 1UJ3C 2AJUL 1VHPA 1CWVA 2D03H 2PNDA 4LSQL 4MMYB 4LLUA 1ZANL 3ZYIA 5MENA 4FLTA 1HNWB 4DXWA 3U9PH 4G80A 1JCHA 3LZRA 1EJOL 2O1AA 4Z5RA 3D0VA 5DJCA 4DEPB 5FB8B 1ZLVK 3DI2B 4L2LA 1S7WB 3BPOC 1L7IL 1RJLA 3T0ED 3WTTA 1KF9B 4MSWA 3ZKXC 3TZVC 1QEWA 1PLAA 3AREC 1DQKA 3GJFB 5AVZB 3U9UB 3QQ3A 1GRWA 3SR2C 3X3FL 4R7XA 1IX9A 2BRRH 2H3OA 4P3CH 4TRPL 1S0VA 3H42L 1HKLH 4TYUA 4WFBV 4WFFD 5J2TA 1L0YA 1QLEB 3KYKH 4HSCX 3SYOA 1U3ZA 3EJZD 1I94O 2I5YL 4UQ9A 3TWYA 4AT6B 3IM1A 4GAYB 5CA0B 4I18B 4P2ZA 5CA1B 1KCVL 1O6SA 5L7XH 4LU5L 3BRFA 2QDOA 3FTGA 3WNPA 5A2IH 4FTVB 1J12A 4WUKL 1MSDA 4UVBA 1ED3B 1LQBC 1U2CA 2XHNA 2DMHA 3P30A 4ZMYA 1I1YA 4LVNB 5MEPB 3FOLB 1MREL 2F74A 4NKOB 4YHYB 1AKJB 4CW1B 3PDOB 4JI3B 3SN6N 3H7BB 1VIBA 1P4UA 1G7PA 4G70B 4L8SC 1AILA 1E4XH 5D7IE 2XFGB 1BF5A 4ODHH 5CU9A 1SFHA 3BXNB 3JUZA 1RPKA 1N5YL 1MFDH 1LLAA 4AIOA 4WFHE 1UM5H 1EDYA 3OAYH 4EDWH 5EIVA 3O65A 1MWAA 3T6VA 3BQUD 1V3KA 2XQ0A 3TT1L 3DTUB 3NSDA 4H1LA 3TA3C 3OTFA 3N41B 2IQ9H 2XUWA 1CGSL 4PWEA 5I16A 3F7KA 3SBWA 1G6RB 2VDNB 4NXNO 2DQMA 3NSJA 3CMOH 2I26N 2VUOA 3H3PH 3RILA 1KULA 1CTMA 3SJAC 2W80C 4PV8B 4XPGH 2NLJB 1GM7A 2H41A 4L9LC 2NNFA 1RZ8B 1CQKA 1HW7A 2ZWYA 4IRZA 3SDXE 5IW6A 2ZX6A 4UQ3A 4H13B 3GSXA 1ZSDA 3QCTH 4Y2DC 2AJ3B 1T5WB 3VXUB 2UXFA 2YJLA 1D7BA 2YRLA 4HLZG 4PGEA 5EH1A 4OB5H 3RBZA 1E67A 1WITA 4LF4O 4F20A 1NC2D 1E8YA 6PAZA 3RDTA 3T6XA 5F6HJ 4OFVA 5MERA 4OQ1A 1BQHG 3F84A 4GXUN 3ARBA 2FQDA 2PPAA 5E2JA 4I3SL 4OZGA 5EK0A 3MRMA 3WO3B 1CS6A 3RVVD 1ZT4B 2X4UA 3WKNA 1Q1JH 3Q6GL 4Y9BA 5JXAH 2IGFH 2Z8SA 1RK0A 1QKZH 3CCQV 1TTRA 4LWSB 4NKMB 5E1IA 4F9LA 1CL7H 3GHEH 1MQKH 3P02A 2WCSA 1VPOL 3A8TA 3L3OA 4LLYB 2P8LA 3E35A 2WA3A 1CLOH 3I6GB 2H26A 4WJKB 4DV4O 3GMMA 1G7MB 5CZXD 3E7JA 4QTIL 2OMVA 4KHXL 1RUPL 4NQSA 3U4BH 4FXKC 4B3TB 3NIDB 3CHSA 4L4VB 4TSBH 3R19A 2WXLA 3HBPA 2DPKA 2GUYA 3EDEA 3ASNC 3ETGA 1IFHL 3IMBA 1NZRA 1UUNA 5KZCD 4F7EA 3ALXA 3IETB 4LCVA 1DJHA 4NQCA 3DX3A 3IC9A 3FH7A 4Z76A 5I0VA 2EZ0C 5DK2B 3B83A 4KPHH 4B9JA 3TJEL 2EH7L 4AGPA 4DV7O 1ZVSB 5CBEB 1KELL 1RK1A 1AI4A 5AENA 2PPCA 3ESNA 4G9FB 4WTQA 4FQQA 3NIGF 3AY4C 4QY8A 1LNUA 4NO0D 4HPYH 2HXAA 3M17B 2V1DA 5E8OA 4P5MA 4Z77A 3WKPA 3MLPA 4JGNA 3IBEA 3MRJA 4NI6A 3R66A 3L5XL 3LNMB 2XTLA 3B3BA 2CM5A 4O4LA 1JFFB 2JB5H 2Z31C 3STLA 1RJYA 3B9EA 1R3KA 2QTVA 3NR7A 4J3VA 4JFZL 1BZOA 2W0XA 1EJ6A 1NBQA 4KFZC 4BRVA 4PR5A 1RVFH 1KGCE 5T5FH 3TBSB 3ISWA 3G08A 3W7UA 2OLDA 1WICA 2FLMA 3A67L 3GSOB 4L5FH 4DNLA 2OSXA 1UTDA 1M57C 1O0VA 1H2MA 2EICA 1EHNA 4L3EE 3M7FB 3BZ4A 1NJ9A 4W1TA 5E70A 1KFAL 2V0AA 5FGBA 3OKEB 3L6FA 5A6MA 1U8KA 4QRQB 3CDZB 1XL4A 3PUCA 2QQKH 3CWGA 1SQFA 3MRPA 4MVBC 4LCYB 4X5QA 1H9DA 2Q20A 3QJFB 3HFFA 2H0PA 4L4TE 1NA8A 3C5ZA 1PEZA 1X5GA 1XCWA 3IDGA 4XC3H 4DP6X 2GTZB 3INOA 5H37G 5EDXA 1XH0A 5CO1A 4YLCA 4S0HA 1M6UA 4A6YL 1YMHB 5AG2A 5GJSL 1ZJBA 4A7QA 5HGAB 1PVHA 4HUXB 3NSFA 1OE1A 4PDVA 1C9SA 2H32B 3WG7B 2PWGA 1IURA 2JIZG 1FLTX 2CIKB 2LU5A 3C5JB 3OJ2C 2XN1A 2OTWB 2OTLV 1UA6L 1GW0A 5PCYA 1BGXL 5L6YH 2BSEA 2PPDA 2R0ZH 2XBTA 3HC4H 5L4JA 1AOZA 2C3WA 5I76A 1TYJA 3ZR6A 1JVOA 3VFUA 2ZUTA 1VESA 3N2JA 4I4WA 4XCNB 4OGQB 5J56B 1PZ5B 1LEIA 4P2QB 4MSWC 4O2BB 1KIQB 3GDBA 1UXSA 4YSOA 4GP5B 1HJCA 1UJ3B 4I85A 3V4UH 1ZLEA 5ADPH 4LCCC 3LZOA 1IFGA 2R4RH 2ZX5A 3F01A 4FFTA 3VFMA 2WSSG 2X3BA 3DX9A 4Z7OE 4MJ2A 4IGGA 4ELDA 1A4CA 4HXAH 4Z7UE 2O93L 5DR5H 5JHMA 5AAMC 2W59A 4XX1G 4H20H 3J81N 2QPDB 2VMJA 2YXLA 2E75C 3RWFB 3TZVB 4F33A 4NQEB 4MNGA 1A6ZB 4ELKA 4JY4B 1IAOA 5TDOA 4X66O 3BWZA 4L0PB 4TULL 5B3JF 1MOEA 1HWWA 1LQSR 4LF6B 3KBEA 2QR0A 3LH2L 3KG2A 2CD0A 3JV6A 4H8UA 4IEFA 2BNQA 1ENVA 3BH8B 4TUOA 5FV2A 1QR1B 3LKRA 1MFMA 1MOFA 1HWGB 2ADJB 5IT2H 4UDTB 4ZG1A 1ASQA 1FORH 1AR2A 4FXGA 4QRTA 2A83A 4HIIB 4WFFE 2XQYK 4DUZO 5CIPB 4A66A 3C5XA 2SEBA 2ZKWA 2WO3B 2IFGA 1HSAA 4MW8A 3G5XA 1WCBB 4GMTL 3ZBHA 3O4LD 3KCYA 1MCJA 4LBEA 1XI1A 2ENQA 3WFBL 1GCYA 5LJYH 3SBWC 3SKJL 4P9OA 3P77B 3G7TA 3S3XA 2B4CH 4C83A 4QGTA 4QJ4B 1D5AA 3EJYC 4XRCA 5C0FA 3L4VA 4L8SB 3ZKSD 1T3FB 4N0CC 1FL3B 3EJPA 25C8H 4YWGH 4L3EB 3SY0B 5C8YB 2EILB 2YPKB 2B1HL 1AHKA 2E9JA 1PZUB 4G43B 1A14L 5JXEA 5CGTA 3TA3B 32C2A 2C5DC 1ZPLA 1J7VR 4GAJH 3IXTA 5JOEA 4LSRL 4QCIA 3B9AA 1NIEA 4JI6O 4K7FA 3RDTC 1TU2B 5AOKA 4N8CL 3GMLB 2IDTA 5E99L 4LKXA 3QCVH 5ID0B 4ZMLA 3ARBC 3OLEA 1P1VA 3MA9L 2AJSL 5T1KD 4L9LB 2KQMA 5TTRA 5ISZD 1F11A 4DAGH 4PDMA 3SQOH 2VQEO 4Y2DB 5FKAB 1I9IH 3LZFH 1Q9KA 3R8QA 1EFXA 4R4ND 4F9LC 4DRXA 3L3OC 2FBOJ 4ODVL 2XBZA 5E5LA 5SWQA 2EH8H 5EZYB 5DJ0A 2G3ZA 3CZKA 3E8UL 5I5MA 3DSFH 3NZUA 3SGKC 2X09A 2QDWA 3L3DB 1S9WB 2NXYB 1AZUA 5CBFA 2UWEF 2E9BA 5C08B 1YHQV 4OPHA 5GRJH 5I6NA 5D4IA 1NR1A 1TAEA 1PPJH 1TJIL 3O9WD 1ADQA 4K3JL 5JVDB 4CVXA 5F96H 3VXTA 1ID2A 2LLNA 4TSAL 1OP3K 2WPDG 4DPCX 1GXEA 4LHUB 1QPKA 4HD5A 3HZMA 1G9NH 1DUYB 3QNYA 3C60A 5F3BA 2ARJB 2J44A 5KUMA 2JMRA 1BIHA 4XMXA 4PDRA 3LXUX 2Z1KA 2GK0A 3CQQA 3KPRE 4MD0A 4Y4HA 4TF4A 5KANI 4UTBH 2DYPB 2VM3A 3DGDA 3VB9A 3RX8A 2ICCA 4D0CB 2IDSA 3L81A 3V8CA 3F7VA 3GLEA 4U33A 4CVZA 1H8NA 3ZTNH 1GHFH 4LHQB 3VUAA 4DGIL 3F3HA 5HI5C 4K4KA 4HGWB 4NN5C 2OZ4L 3V4VA 1K6QL 2XWTA 1WT5A 1KCUL 4Y8DC 4UB0L 3ZMEA 4AE0A 3VJ6A 4WI4A 1XF2A 4O2FB 2R9AA 5FGBC 2QADC 1MG3C 2BDNL 3FSVA 2XWEA 4RUEA 1NCCL 4Q6YA 4ZAKA 3BDXA 5T5NF 4NCDA 2Z31B 1U58A 3B2VH 2FRGP 3AS0A 4HJSA 1U3HA 2JVUA 3FRPA 4JAUA 3MYJA 3Q8FA 3QHFL 3R0NA 2D2OA 4MVSA 4ZOLB 3PWLB 4NO2B 1U36A 3IF1B 4ZW6A 1NTZH 4JY6A 2W0FA 1D2DA 4MS8D 3E80A 3K72B 5IROD 4XH2B 3VW3H 3Q44A 1BX2A 2X0LA 1NFIB 4BGLA 3HFMH 3LNIA 1YEDA 3MJ7B 3DHUA 2I9LA 4ADIA 5LGJB 2K7PA 5HVHC 2ZWLT 3T4ZA 3WXWL 5IMKA 3V0HA 1M7XA 1W0VA 1CE6A 3VRLF 1N6QL 1W72H 4RRPA 1QACA 1F3JA 1T20B 2PLTA 3MBXH 2IPUK 5AW9B 1BQ5A 4G82A 4JKWA 4LSTL 3QRFM 5H4YA 4FG6D 4F7PB 2QQNH 3JXAA 3O6MH 5CN0A 1SNRA 3HI6H 2MQCA 4ERSH 3TWCH 5J2UB 4E4EA 3A4FA 4LLUB 3CPWU 1DSFH 5MENB 1IVSA 1I7ZA 4K73A 1EO8L 1PEWA 2O6PA 3ATEA 3K1DA 2P5OA 2WUCL 5E95B 2F58L 3UTSD 4YNYA 3D0VB 1E7UA 5DJCB 1B6DA 3HLAB 5DT1H 3EO0A 2ED6A 4LARL 2EYRB 2YMXL 3RURA 3LQAH 1J1PL 1RJLB 4ZI7A 1M05A 1UXWA 4MSWB 1QEWB 2Q5ZA 1XEUA 4DVRH 3QQ3B 1KN4H 2PI4A 3HJ0A 4IKJA 1WBYA 4LCCB 4X80H 4QUOA 4I1PA 1BZDA 2RBLA 2JJ1G 5J2TB 3VGHA 1IZKA 1KTCA 2GABA 3L4UA 1W2KT 3BP5A 4NN6C 2I7SA 4NUGH 4YSSA 2IWKA 3EBIA 3HRZA 1FYTE 1QI4A 3JWDC 4FXGC 1YJNV 2R8SL 2L8AA 1G7QA 1U8QA 2WZ5A 2VRKA 5IVZA 1O6SB 2EJ1A 2ZAHA 4IIQC 3BVTA 2HP4A 3C09C 3FTGB 3O4OC 1WFTA 4D7TA 4W6WB 3RWEA 4J7RA 4PCKA 1I1YB 5HP5A 2DJUA 4QKTA 2ZZUT 2CO4A