3SPCA

Inward rectifier potassium channel kir2.2 in complex with dioctanoylglycerol pyrophosphate (dgpp)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
332
structure length
327
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDKPDMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords Inward-rectifier K+ channel Kir2.2
total genus 89
structure length 327
sequence length 332
ec nomenclature
pdb deposition date 2011-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3spcA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3spcA01
3STZC 3SYQA 2EILC 2WLKA 3WG7C 2Q6AA 4PDRA 4R6ZA 1OCCC 4H33A 4DXWA 1V54C 2IH1C 4PA9A 2WLHA 2E4FA 2EINC 1BL8A 4G27B 4PA3A 3SPGA 1N9PA 2HG5C 4QNHB 1K4DC 2X6BA 2BOBC 2H8PC 3HPLC 2GIXA 3LDEA 2DYSC 3E8BA 2QTOA 3TCUA 4UUJC 3TETA 3RVYA 4QE9A 4XDKA 2A79B 4ZBMA 3E8GA 3K0DA 4PA6A 4MVQA 4HYOA 4X8AA 2AHYA 3SYAA 2DWDC 4J9ZB 5BZBA 4MS2A 3VOUA 2Q67A 4PA4A 3SPHA 3E83A 4X88A 4TWKA 3RW0A 5CBGA 1ORQC 2KB1A 3E8FA 4R50A 2HVKC 4MTGA 5EBMC 3OUSA 4PDLA 3AGWA 2EIKC 3T4DA 3AG1C 3PJSK 4GX1A 3K03A 1R3IC 4XDLA 4JTDB 3AT9A 5EBWC 3VSQA 1LNQA 4RO2A 5B3SC 4PDMA 4R7CA 3STLC 1XL4A 3K6NA 3OR6C 3ZRSA 2HFEC 3R65A 1R3LC 3UM7A 2WLLB 3ASOC 4GX5A 3K08A 4RAIA 3F5WC 2JK5C 2Q68A 4R8CA 2W0FC 4LP8A 1K4CC 3X2QC 1OCRC 3LNMB 2WLIB 1XL6A 1P7BA 4HZ3A 3LDDA 2NLJC 2Q69A 3IGAC 4P9PA 3AUWB 3FB6C 3OUFA 3ATDA 4JTAB 4MW3A 1U4FA 3GB7C 4WFFA 3EFFK 4MVZA 3BEHA 3ATEA 5J9PC 4MTFA 3E8HA 1JVMA 1OCZC 2BOCC 2R9RB 3IFXA 1OCOC 4MTOA 1ZWIC 4H37A 1S5HC 2Y69C 3SPCA 4RUFA 4X89A 2ZXWC 2HVJC 4MVMA 3E86A 2A0LA 2WLIA 2X6AA 4MSWC 1R3JC 4JTCB 1QLEC 3ZJZA 4KFMA 3AG3C 4GX0A 4MW8A 4MVOA 3ABMC 4WFHA 3T1CA 3AG2C 5CBHA 3T4ZA 5KUKA 2IH3C 3SYPA 2ITDC 5CBFA 4XDJA 3FB8C 3SPJA 1M56C 3ABKC 3F7YC 2EIMC 4WFGA 5KUMA 3OGCC 2ATKC 1R3KC 3LUTB 4J9YB 2WLMA 3ASNC 2AHZA 3ABLC 3K06A 3ATAA 4P2ZA 4PA7A 4I9WA 3ATBA 5EC2C 2A9HA 2YEVA 3KG2A 4MVSA 2HJFC 3SJQC 3T2MA 5B1BC 4F4LA 2P7TC 2OCCC 4LCUC 4BW5A 1G4YB 2WLJA 1J95A 2DWEC 3SYCA 3LDCA 3F7VC 3FB5C 4EKWA 2ZD9A 4P30A 1U4EA 5B1AC 4WFEA 5EK0A 5IY5C 4QE7A 2DYRC 4GX2A 3ATFA 1KKDA 3RBZA 5EBLC 3SYOA 3K0GA 5EC1C 3UKMA 4MVRA 3E89A 2QKSA 4G28B 3AG4C 3K04A 4P9OA 4LBEC 3OR7C 4MVUA 2WLNA 4OXSA 3FB7C 1M57C 3RVZA 2WLLA 1V55C 3AT8A 4PDVA 4RUEA 3SPIA 2K1EA 2ITCC 4CBCA 5E1AC 3JYCA 2EIJC 2X6CA
chains in the Genus database with same CATH superfamily
2H5UA 2YD3A 5D55A 3DSFH 5EFIA 3U83A 3ZMNA 4OIIL 2ETNA 2KDGA 4ORGB 2KKQA 3WY1A 2XX0A 2L3BA 2ICWJ 3OW2U 5HHOB 4UAOB 3EJCA 3JWDH 4Y2DD 3RBSA 4IGGA 4A55A 3UCQA 4DPRA 4LNVA 3MJ8B 3D3VA 1BT8A 4YXLH 1R17A 4JFUA 3K71A 1JGEB 4X7DC 4ODUA 1MDTA 1DJZA 2G30A 4K0KB 2XUMA 5LMNB 3C9NB 3OKYA 4HH9B 2QQLH 3AACA 3MRPA 5IB5A 4S1SL 1ZGLP 3RVTC 4ACPA 4PY8J 4FABH 5BVPL 2DKUA 2XC8A 4Y19B 3V0GA 5FF6A 1A64A 3DMMA 4HUVB 1FG2B 2YXFA 2OK0H 3PJSK 1IIKA 3JD0A 4C57C 5JPMB 3MLUH 3LEXA 4DP0X 1TA8A 1DQQB 2FO4B 5EIIG 5TPWL 1B04A 1AGBA 4NN5C 3E1F1 4DV2O 2E7CA 3PF2A 5C2BH 3JTBA 2VNCA 4DGYH 4ZAKA 5KW9L 1YDPA 3VW3H 4C83A 1QLFA 2R9AA 3GLAA 3H3KA 1KLFB 4XPBL 3QPQD 1MCEA 5IBUG 2WAHA 3BFOA 3HAEB 4TLTA 5F9WB 2JELL 1JTPA 1JXJA 2ZOWA 5L3BA 5MP6L 2C4FT 2JFCA 3DWTA 3QIUA 2YQBA 5IGXH 1BWMA 3HKDA 5B1JC 4MHHI 4JW3A 1BQ0A 3LAFA 1G7LB 5E23A 3MRHA 1HWHB 4MBOA 4OCXH 2QPFA 1N10A 3UEZA 5D1QA 3TEUA 1V7NL 1JNLH 5BW7A 1OLZA 4ZXBC 1RPUA 5CIPA 3PU7A 4AIOA 4Z3EA 4O4JA 4Z1MG 4AYDC 5E6ID 3WJLA 5AG2A 2H26A 3QCVL 4PBVC 5ACZA 3G9AB 4J4PA 5KJ7E 2VXTL 4JDTL 3BWUF 2IOIA 3MV7B 5FWRA 4P99A 1LP9B 4GI6A 1HR0B 1CWVA 4PA7A 1JF5A 2FD6L 1UURA 2MCMA 1XSKA 3UEQA 4Y2DA 3ZE2B 2NSXA 3WS6A 3TURA 4F2EA 1OT4A 2IJHA 3OKKA 1YC8A 2VO5A 5G4OA 4DR3O 5A6IA 4JY6A 3IDIB 4KK5C 1XF2A 1G7MB 1E2ZA 4NQDA 4IRJB 1JZ4A 3FB7C 1DBBL 3GM8A 2DE0X 1OAZH 4YIPA 1PKXA 1XSOA 3BWAA 3ZDZF 2Z1KA 5D1QE 2YXVA 3AY4C 3H53A 3VCLB 4X1IA 4GKSB 5HSFA 2H2SD 2P8LA 5JTWA 5CD5C 3T3PE 3ZE1F 3CCMV 2XAGA 1F45A 3Q48A 1G9NH 5E6IB 4QXVA 4ZI8A 4N90E 32C2B 1IM3A 3QQXA 1FFOA 2DWSA 3PREA 4PB9L 3GMQA 4JFOB 1IXMA 3EO0B 1H8LA 1BIIB 4HUUA 2X4QA 3LIZL 3FT0A 4G6KL 4IU2A 3NJGA 4FFTA 3K58A 2EKJA 2Z8RA 5LMNO 5E8OA 2VZ3A 2J43A 4XXWA 1ID5I 1EO8H 4A63A 4UDUB 3BWSA 5FO7B 3T2LA 3BHPA 3HFFA 1I1AD 5A3ID 4JPKL 3CLFL 4DVBA 2E86A 3WNKA 2AZ0A 5DHYA 1T5WB 4M48H 2MOGA 4FLOA 3LNEA 4PWEA 3RAJL 1KT2B 1BG1A 1J9QA 3MV7E 3KPMB 1XR8B 4UNIA 1B0GB 3LY6A 4E9SA 4AILC 4HMDA 2VUKA 2PR4L 1WT5A 1YA5A 4HPOL 3K80A 3PWJB 1JZGA 1YEHH 3F5WC 5GONB 3QJRB 4HKJA 3BAKA 4X4XA 2CGRL 1KJ2H 2ED7A 3BO8B 4P2OC 2E5EA 2X88A 1E5BA 4LARH 5JA9A 2JIZG 1TVHA 2IBGA 4TS6A 5IUCA 1TJIL 3CFKB 5JR1L 1EA9C 3B1TA 4N25A 1S8DB 5E03A 2GSIB 3FHAA 1KENH 3EYSH 4ZJ9A 4B7EA 1E27B 1CFBA 2NLJB 4H20H 2APBA 3ABTA 2W0XA 4TNGA 3V0FA 1XOUA 1CL7I 3D34A 2M6YA 3VTMA 4Z7VE 4YWGH 4DKEH 2I60H 4DEUA 5GGTL 1ZV9A 1LDPH 5SWZD 3ULVE 2DQHH 5LWYH 2H3NA 3VACA 1ZHNA 3N50A 1KOAA 3OWRA 1FN4B 1WWWX 3RWGB 2Y36H 3FFQA 1IM9B 4AQ1A 4WDIA 4QRRA 2FKXA 2B4CC 3VM5A 2EQDA 1RMFH 4UQ2B 4KZDL 4MFHA 1I3VA 4JGMA 1GZQB 4WHCA 3ZDYF 2TRHA 5JOFA 3ABKC 3OZKA 3VJ6B 1KC5H 3TA4D 4MJ6A 3PGDA 5DVLA 2WKOA 3G6DL 3D52A 4ELKA 2HAZA 2ZX8A 2AMGA 3KXFA 3BP6A 4YQXH 3HG1D 1I9JL 1WFOA 3MGOA 2FBJH 3D25B 1QFWM 4JFED 4XVJL 4LBEA 2JKNA 1VFUA 2RCSL 2IPKA 2C7UB 3FF7A 4IIQA 2WW8A 3FTGB 3BH4A 5I8CB 4EDWH 1JZEA 2F8IA 3QUYA 4KNTA 2EC8A 3MODH 4JFFE 4OZIE 1II4E 5GGRB 3C2SA 3OLGA 1T0PB 1YN6B 4LPCA 5JIIA 1MEXL 3UAAA 2ZWYA 1PV0A 1MCCA 3IETA 3CDGA 1ZE3H 5EUOB 2YD2A 2ZSWB 1N6QL 4K8ZA 4NNXA 4X0KA 3T4AA 1JXGA 4PPTA 3HZVA 2YD6A 2V37A 4XOBA 3O4LB 4R7VA 4QXTA 4KKLC 4L48A 3UDWA 1KELH 4FM0A 2Q2EB 4FD0A 2QPDB 4XMZA 5KN5A 3QCUL 5IG7A 1MWAA 3CCLV 4Y16A 2Z3FA 4WRLA 3WUWG 5GPRA 2VLRE 4K0OA 1RFYA 4L1HA 5TE7L 2XYCA 4RMUA 4ZOCA 4CMHC 4NO5A 4OJAA 2DAVA 3LZLA 3P3PA 4KMQA 3T6VA 4YSUA 3ILDA 3ZYJA 2EX3A 4W68A 2VQ4A 1T6VN 4Q9RH 3IBOA 2R9HC 3VG0H 3U1SL 1YECL 5GGSB 3MR9B 5HHPB 2E6PA 5DWUH 3HOGA 3ZUCA 4MCMA 1TETH 4MTGA 2AF2A 5K1PA 5IQ7L 2CE4A 1VQ4V 3ZIMA 3ABLB 4KKRA 1YEWA 3V5DA 2HLAA 5J11C 1TNNA 3HAEG 1S9YA 1WBYA 3FB8B 3QC6X 3PPEA 5IMLA 4R5XA 3K6NA 3SCMA 1R3LC 2BWDA 2ZIOA 1SZTA 1XH3B 3S2CA 4P59H 4FG4A 3NH7L 3AWGA 4HS8H 4RMSA 4A7GF 1DBJL 3T3PB 1MZYA 2WKLA 4WFFD 5FV2A 3TA3B 2X4UB 1LEGA 4JM2A 4K2UL 1E27A 1ZT7A 3D3IA 4LLDA 5EBGA 4UTAL 2EE2A 3U7YL 5IJVA 4K71B 1DVZA 4QTHB 3N44F 3KYNA 2R72A 4NXNB 1IBDA 2BZDA 2RTTA 4LPYA 4J2QA 3ZDYE 1YY8B 1JGDB 3M07A 2BMKB 4HU2A 4KK5D 5FYJD 4EN3C 4KZDH 5I5MA 1AG0A 3BESR 4HWZB 3FMGL 4Y9BA 3ARYA 5IZ7A 5BRZA 2AJVL 4AEIH 3BN9C 1QHTA 2VQEB 5J06A 4MQ7A 3AG2C 1YEGH 1BZ7A 3MCLL 2ADFH 3OKEA 4HIPA 2IH3C 5HVWA 4IU3A 1L6PA 4NQDE 2ITDC 5D93B 3UYRH 1ZL8A 2JV6A 4U6TA 5HFLA 4B9CA 4E9TA 4GEIA 6TAAA 3QI9C 3AMLA 3F58H 3QA3A 4CC6A 2VXUL 4P23B 4YHHB 2BCMA 5KA6A 3FB6B 3BZ5A 3QULA 2UX6A 4FERA 4KQ3L 4OKVA 1AFVH 4JL1A 2Q8BH 5E7BA 3Q8CA 4GP8B 2AXJA 3KPOB 4Y0GA 4HULB 5KYYA 1FSKB 1A4KB 2B77A 2IJ0C 3L3DA 3PJSB 1CD1B 4TUKL 3SDDC 3U36A 4R3SB 1QEWB 3Q2LA 1HNZB 4TMPA 4Q6IB 4MDIA 4WFAV 3MROB 1JWSA 4U1GC 4MA8H 5I6XB 1KCLA 2OX5B 3W0WE 1AYRA 4NRYA 12E8H 1LO2H 1Z0MA 2J1KA 4PJBE 3E38A 5K39A 2A6DB 2BSBA 3CK0L 3HG1A 3OEHG 4JO4H 4XMPL 1EHLL 1OAKL 3V6ZB 2YAFA 4KU1A 4NSKB 4OZHE 1XVSA 3P2TA 5F0JB 4KZ0A 4EQ2A 5LG6A 4P57A 5HGDB 3MBXH 1XX9C 1ETA1 5F9OH 3R8BB 2OQJA 4BQ6A 3UTZB 4WU7B 3QIWA 2IH1A 2QM7A 2NNUA 1U33A 3BXNB 2VDML 4MBRA 5CN1A 5DDHA 4JI7B 1O6SB 5E56A 1ZKAA 3RVYA 3STZA 3RWDA 5AOKA 4F2FA 3A4DA 5D6CB 3NJIA 4X1KA 2OMTA 3EYOA 3ZTNH 4EPSA 4HC1A 4JJOA 1WZAA 1WLEA 5F1KC 3WAJA 3S98A 1GYAA 1IEAB 4APQD 1CLOH 1OEZW 3H56A 3H6AA 5IMLB 5F7UA 4XPBH 1VFMA 4Z7VA 3O4OB 2XVLA 3MGOB 3EGXA 1AHWC 5TDOA 2EXWD 1T83C 2ZCHH 3COOA 2OI9C 1MZZA 2A0LD 5FFLA 4KXCA 5T3ZH 2HFEC 2CSPA 1V5JA 4B5EA 4U6XA 3VXQA 3UGUA 4NKMA 4HUKB 4YFLI 5BMFH 3FTSA 3O11B 2NLJC 3FTWA 3WXVL 1WPBA 4GKJB 3L5XH 4QOKB 2ENSA 2WWKO 3P9LA 4HJUA 2XETA 2NYYC 3VNYA 4L4TB 3NTCH 4UYPA 4WSGA 3W81A 3WNMA 3LPGA 2OW6A 3TFBA 1CPYA 2G5BB 3GJFK 4PJGB 3ZMVA 5JLZB 1WFNA 2BC4A 5D70H 1BZOA 4FHKA 2HX7A 3EYUH 1IL1A 4F20A 3O2DL 3KLQA 2PYJA 4S0HA 5AYQA 3KYKH 1OY3B 3OZ9L 1NC4D 2VDQL 4NN6B 4P48A 4PP2B 4YHLH 4YAQA 4LDLB 2BVYA 1MG2C 3BWUC 3QJFB 3QTCA 2NY3C 3C8DA 2MOQA 2WBJB 4U7OA 4G5ZL 1UWEL 4HXAH 3UAEA 5E1GA 4D7SA 1SBSL 2CHWA 4ZW5A 1Y76A 4DAGL 2W92A 3T65A 4XCFH 1JA8A 1U3YA 2YI9A 1U8QA 5DZJA 1JI2A 4ICGA 1RLWA 3PAUA 4P2ZA 1BQRA 3FQ4A 1C08A 3ARBA 3O6MH 1EM1A 2RNBA 4ERSL 4MXVE 1M1KW 3GZOA 3N1GC 2JI2A 2ZE5A 3CS5A 2MCPH 1C12B 1UEYA 2O1AA 2OTUB 2WN3A 3HJ0A 4XTRD 1AI1L 3LN9A 3K4AA 5I73C 2AP2A 2R4SH 2A9MH 2HYMA 4WWKD 3JCUZ 1NEZG 1OP3K 2WOBA 2HFTA 1KJMA 5HGAA 1IE5A 2V17H 3HR5B 2YIAA 2A2QT 3E6FA 3QZNA 4JFXB 4JJ5A 2H2PC 3QJQB 4YDVA 5HHXH 1MRDL 4GYCB 3W9DB 2HHHO 2VXSH 4LHJB 4M62H 1O5DT 4OAWA 1CE6B 5EO9B 4KKCD 4R83A 2R56H 3WTSA 1S7TB 5IW1A 3FYEB 4CBCA 1F02I 1QWUA 5IROC 2WVVA 1PW3A 2ZCEA 5BVJB 5JHDE 3ULVH 2R8SL 5IBLD 2C9XA 1L9MA 3VH8G 3UBGA 3HNTH 4PJ9D 3JSLA 3FHQA 4ZUSB 3RU8H 3BX7C 2WAMA 5J3HC 1FGNL 3P9WB 3WCYA 5F9JA 2NSQA 3B9KC 4M48L 3E3QE 3FFCE 4LLVB 5F0LB 4BZYA 1FL5A 1AR1C 1ZPUA 2VISB 5CWSA 4WNQB 5FDWA 1KJ2B 4QTIL 4FFBB 4KTGA 3QSKB 2CIKB 3ILPB 4FADA 2NNCA 2COVD 4LRNH 3VXPB 4FZ8L 2MFNA 4BHUA 5CA0B 2YIDA 3S3WA 4Y9FA 5FO2A 1C5DB 3WO4C 3KBEA 4D0CA 2FO1A 4Q7DA 1E90A 4BFKA 3STLC 1AD0B 4KV5E 1DQMH 4O9HL 3WN5A 1Q9KA 5A2JH 4PS8A 4X65B 2MHAB 1VKXA 5JW4N 5I18L 3CEIA 4AQAA 3IM1A 4TRPH 4PJ8A 5ABZA 3L5WA 5AFAA 2W1NA 4M7LT 4P4RB 4PV9B 5EU5B 3EXAA 1VFAB 2Y0PA 1G4RA 1UD2A 2A1WL 1T83A 2HPOA 4GRLC 2AJZB 2YAMA 3LRLA 4IBQA 2DN7A 4OGAC 4Q2ZA 1MAML 2E5LB 4BCZA 4EIUA 1ZS8B 2F53A 2QPEB 1KB5L 4BQCA 1KYOJ 4WGWB 2W9DH 5B3SB 4JFFD 4C56D 2IAMA 4CZZA 1W6WA 2QR0A 5J1AA 5LN4A 1HXYA 1L9NA 4YZFF 2DLIA 3ZHQA 1FIEA 2WLZA 2IH3A 3E86A 35C8L 4AYID 5CGYC 3CC1A 2ZXQA 5J0BA 3RGVC 1J5EB 2QSCL 1SXSA 4HLZG 2FWLB 3WL9B 3OAUH 3F12A 3L72H 4ANWA 1A7BA 1SA0B 5I8CA 1KBVA 2FYYA 4L8CA 2P8PA 4RQEA 2FD6H 2F95B 3FU7A 2FBJL 3CFCL 4BDVA 2HJLA 1IBMO 5B38G 5B8CA 4PRIB 4S10A 5IK3A 3DO7A 1SERA 4J6RH 1V7NH 2FIKA 5HDBB 4XP4H 4U2ZA 3ULVF 3RYFB 4WVRA 3BVTA 4OQTA 1Q9OA 4JFDA 5A16A 4OUOA 3EKCA 2XWTA 1FYTB 5KEZA 3CZSA 1NGPL 3AW5A 3IDYC 5DRNA 4YX2L 1QP1A 3CN4A 4KKBD 4HFUH 4DGVH 2NQCA 5AB0A 4HD9A 4OLXH 5MHSE 4HSQA 1OXYA 2Q20A 3EOBA 2EZOA 3HMXH 4U1MA 1JNHA 3TZVB 4X9YA 4BAYA 1T21A 2DWYA 4XR8C 2LFRA 3RVZA 4J4PC 2D0HA 4PJXE 1SVCP 3AQDA 4RUEA 3OGCA 4L8BA 3UJIH 3VE0B 5I0VA 5JHDB 1OHZA 3MYJB 3EVKA 4PGEB 5DJ6A 3VXOA 1CK0H 4FMTA 4EFEA 4DV7B 5DQ9B 3K59A 2PWFA 4AYBA 5ESAA 1IO4C 1FBIH 3F05A 3P30A 1T89A 3E7JA 3FAXA 1ADQH 3GMNB 4TQDA 1OSZA 2WYIA 1BMZA 2CKBL 5KSAD 4GLRH 2DN9A 3CCUV 3VB8A 2E7LC 1R24B 3QAQA 4Z76B 5I28A 3JD4A 4DUYO 1JCKA 1IAII 4C4BA 4N23A 1E6JH 3MRDB 3OAWA 1FP5A 2NCMA 1HX0A 4L4JA 3HZYB 1UM5L 2GIYA 4OX9B 1JMZA 1HWWA 4NWTL 4ES9A 1CDIA 2VJ8A 2RD0A 2X4PB 2YKLL 1JX9A 4R50A 3AABA 1R1BA 5C8YB 1P7HL 3SQOH 1SQ2N 3AGVA 4JM2C 4LLWB 4PJ9A 1TEFA 2CO6A 4DKTA 3BAEL 3BISA 3BZFA 3CFEA 3GMRA 3QR2A 1NTDA 3LN5A 2LGQA 5LJYH 5IE9A 4JPQA 4FEMA 4WTWA 5I6LA 2WLLB 1XGQB 2N0KA 4P2RB 4W9EC 4JFQB 1G0DA 1ZS8A 2F53B 5DJZB 3FNKA 1NGXA 3KPRA 2EP6A 4I50A 1NCCL 4PJFF 4AMXA 4ODUB 2W9EH 3E6FB 4JQVC 3ULUE 1ZAGA 4TSAL 3JSNA 4ALAL 4LFCO 5EA0H 1HXYB 1KYAA 1Y6KR 5EOTB 1QTSA 4JBSA 1YNLL 2QFPA 4NO5B 2WUCH 3FOMA 2OZ4A 2X7RB 3ECWA 1SYVB 3FO2A 5D72L 5HHMD 1NS1A 2Z92B 3K9AA 4PTUA 5C08D 3FTZA 2NSMA 2F54A 1IC4H 3IFLL 3LRKA 3SD2A 4L1TA 2OFQA 4FZ0A 4JG1L 4KNUA 3T8XB 3CMGA 3RWJA 4PJCA 1KENL 1LXMA 3EYSL 4APXB 5IOPA 1BV8A 2OSLA 1UACL 5DQDH 5LGKA 4QJ3B 5C97A 5DJAA 5HGBA 1TYRA 3BT2L 4M61B 1CT8B 1IC7H 2XJKA 1MCJA 2XICA 2VISA 1ND0B 2VDOB 3DURA 3L4UA 3BSZA 4PYGA 5CXPA 5GRJH 1ZT4A 3S4SB 4X4ZA 5BOZG 2IC2A 5D9SA 4EDWL 1NGPH 5BXFA 2CR3A 1E3ZA 4JFYB 1YEEH 3VXPA 3TU6A 3QQ9D 3LDBB 1R19A 3EH1A 5AW2B 5J5EA 3NQKA 3ABGA 3DK0A 1XGYH 1MCPH 3L13A 4GAYA 1Q7YW 4KI5C 1A6ZA 4H2CA 5M94B 3QCVH 3B2XA 3G6DH 3HE6B 5GGRA 1JOIA 1TT6A 4F7MB 2MHAA 3DC0A 3P3NA 1QUPA 1G9EA 4JI4O 1KKDA 2CDGB 5AVWB 2ZF9A 5ISZA 3A0HZ 4XVJH 1QSEB 2V33A 2HUHA 2C4FU 1RVFH 3UO1H 3QXAB 4YHZH 1ZLZA 5JWPA 4H13B 1VLXA 3OT7A 3ASWA 3LZOA 2UXBO 3TH3T 1Y1DA 5C6TL 4G3YH 4EUPG 4O4LB 4HU8A 1R1CA 3DXRB 1RZ8A 2VABB 4LCYB 1R5VB 2PCXA 2CK2A 1XGUB 1W16A 4NAJA 5ID1A 4X20B 5KBNC 2APVA 4F2MA 1KB9F 2CMRH 4NM8L 1QR9A 1VMGA 3RBGA 2LU3A 2DM4A 4MSWA 2UY6A 3N42B 5I1AB 2CTWA 1PKOA 1W8NA 5G4MA 2QVKA 3D85D 1DQQA 4CRPA 2W0LA 1RPOA 2C9VA 4QRPB 3HG0A 4FQQA 5C70A 2HLFD 4V2CB 3GUTB 1OARH 1K85A 4AL8L 4FXGC 1SM3H 4PWHA 1OGAE 4WO4D 1GM8A 4XBEH 4PDLA 4XAWH 4GEJA 2VQTA 4BSWA 1G6RA 5IMMA 1BVLB 1S78C 1Q9OB 1JV2A 4JFDB 2FWOA 2IANA 1OM3L 3U1QA 3QIUB 1C16A 4ANKA 3KHQA 3MO1A 1JGLH 3VXMD 4QY8A 5JH7B 3ZKNC 3VVVA 1RSYA 1SOXA 2JTDA 5B7FA 3IGFA 3D5OF 1S0VA 4BCYA 3KBPA 3ATDA 1WAZA 4TV8B 2HVKA 4HH8A 1MFVA 2C9AA 4M3KB 2WYHA 1WAPA 4B97A 4G9DB 5D70L 3CCSV 4PVBA 3QFGA 3KLSA 3CDCA 1DLHA 5HI4C 3AROA 4FI7A 5JW4R 2A73A 4YO0B 4HWZA 4PVMA 1BQKA 3US1A 3ZBMA 1I1AB 5GQBA 4PJ6A 3BAJA 1CGTA 3PL6A 4LEEA 3C08L 2QWNB 1R5WA 1IBKO 1E1QG 2ZX9A 4NENA 5D1QC 5EWIL 4KO6A 5CILL 1VEWA 3U0ZA 3TBVB 5CBAA 3DX8B 5CZVH 5FHAL 4LMQI 5IYBO 5ANMA 3VI4A 3HS9A 4HKXB 1T0NA 1VGEL 3OR6B 1JGIA 3SE3A 4X6DB 2FQGA 2DQHL 2L35A 4PJXA 5LWYL 3QH3B 3IF1B 1B0RA 4HJTA 3HE7B 2R1YB 3I9AA 2IG2L 4WWPA 2P80A 3BKML 5I6MA 5EO9A 4UCRA 3RRQA 4IRJA 4NIKB 1OK8A 2PNDA 3S8FB 2E76B 2JVDA 1KXVA 4WENB 3VGFA 1WFTA 1F97A 4M29A 4UAOC 2G5RA 3DVGA 1RVFL 4XI5D 3G6JA 1JPTL 1ZHNB 1S5HB 4P2QA 3R8QA 1I1YB 4JGJA 3OTTA 1AI4A 3VFPB 3CC2V 4WWKC 4Y5VB 1V3MA 3EYFB 3QFJA 5EN2A 1TUPA 1SDDB 1UVQB 4K9EC 3RGHA 2W81C 3ZHKA 2B2XH 3LPOA 3LHAA 3VX1A 4HUUB 5I6KA 3RU8L 4PDVA 2YXHA 1Q0XL 4E9WA 3X3GL 1GGIL 4DRXA 3DSQA 3H4FA 4A39A 1UHVA 3M6DA 4MMYA 4YSSA 3SPVB 5J2UA 2PZSA 1CL7L 1F1DA 2CKNA 2JKXA 1XMQO 4G6MH 4MA8L 4C59B 4XRCA 5T1KD 1M4KA 1TUEB 3E35A 3GMLA 3UTZA 5FCSH 4JLRB 1NM4A 2VQFO 3T8XA 1TENA 4BWUA 1OQXA 4QWWD 4IMLA 3VB9A 5C0JA 2NY0C 2WXJA 3SE8H 5I1CL 2MKWA 1INEH 2O5XL 3FT1A 4ZAKD 1P4LA 2AKRB 4F3FA 5HJGA 2XTAA 4NFDA 3PXHA 2YEZA 3JWOL 5EU5A 5DD0L 3JALB 1O6TA 3F7YB 5GONA 1WS7A 2CKBH 5D7EA 2WQWA 5TDNA 1R5IB 1YMMD 3F83A 5DFTA 3E22B 1HYRC 1BEXA 5KAFZ 3FQNA 2D0GA 1TKWB 5I6XC 4ENZA 4N2IA 1WPXA 3MYZA 1OZTG 1F7YA 1PY9A 2HKAA 3MV8E 3RY5A 3DGCR 3JARB 3NJLA 2QLVB 1Q9WA 1UOKA 3WY2A 3TO2B 1TIUA 1FNFA 1MCWM 5GRWA 3QP3A 4BXVA 1JS4A 4JGUA 1XNQO 1MHHB 5E8NB 3UL4A 4URKA 3KBFA 1QMUA 2ZXCA 4PJ0Z 1JPSH 3TTYA 4EZLA 4DOHE 5LCVL 4ZG1A 5G2NA 5FKPA 5ITFB 3OM3B 1CB4A 5ITBL 5DUBB 4TOYH 2WXKA 4AVKA 3FRPB 3OF6D 5CILH 4LSSL 4F2ME 4X98B 4AVHA 3ARWA 1UG9A 4KTDL 1WWCA 1KV7A 3NJFA 4W4OC 2JH2A 5CJ8A 1R6KA 5E2UH 2GC7C 4FFKA 3IJSB 3IFNL 3PDOB 2ZPKH 3UAJD 4Z7QE 5IQ9A 1UD4A 5AW1B 1JGUH 1A7RL 2FLRT 4I4WB 1IGCH 3CZEA 3BFQG 2KYIA 3GFUA 2Y3AA 5DTFB 4MJID 2IWFA 2CTPA 1NUNB 2Y72A 2NTSP 2EULA 4ZQTA 4GKKO 5DCCA 1UZGA 3Q2CA 3RX7A 4PRIE 3QWNA 3QEQE 2QPSA 2R2HA 3CFJB 4KKLD 4KO7A 4X80L 5IJVB 5A40E 1T4KB 3VQYA 2IOMA 2IV8A 3C90A 3LPFA 1TFPA 4PTTB 5EEXA 1GC1L 1KXQA 5KHHA 2GUYA 3IKKA 2VH5L 1ED3A 4ANUA 3RHWK 3FTXA 1G7QB 2D7NA 5JHAA 1DVSA 1HXMA 5HVFB 1WV7T 3ZMUA 1TVDA 2VUOA 2DWEC 4NQXB 3D4YA 2VW7A 3TF4A 5IHUL 2AW9A 3V0WL 4F37F 3EO1B 1P84F 4K0KO 1ZAUA 1S7RB 4QE7A 1MWAH 1QLRA 1EN5A 3MACL 2WXQA 3QCUH 4YLBA 5FLXN 43CAA 2FECL 5CP7A 2DEWX 2IADB 2MCPL 4ZI7B 4IEFB 4U6YA 5GGUB 2HLDG 1J8HB 1CICA 4U3JA 1KGYE 1FYHB 2B1AH 4FA8A 1MQKL 3H3BC 5TE7H 2N4IA 4J3XA 1NUDA 3X1FA 4OJEH 3W9EB 5C0IA 2K6YA 3LKNB 3SKJH 2XIIA 2R0ZL 2X6CA 1EFXD 4HCGA 3W39B 1O7VA 2DLGA 3HS0B 5CEXA 1OCRB 1Q1PA 2P8PB 4P4KA 1DSFH 2EC9T 4YO0A 4DPCX 3TS8A 4YSDA 1KP3A 15C8L 2JEUA 4NO0D 2WVSA 3FW6A 1CD9B 4HPYL 3QZPA 4L4TD 1FFXA 3N5AA 5E4EB 3SIKA 1KN2H 5C3TA 1IJNA 2ZJSH 4HZ1A 4OCRH 4R7DA 3WTWA 2H8PC 1NH2B 1IXBA 3VUAA 2A77H 1PEZA 4LHUB 2VLKD 5GZND 2EIDA 4Q74A 3W2DL 4ZFOA 5I1JH 1UWXK 2JCCF 2NYZA 2ADQB 1MLBB 1ZLWK 1INDL 4AW7A 1FGNH 3ZOAA 5FDYA 1F11B 5B5EZ 4L2LA 3E8VA 4WEBL 3VRIB 1D9KA 1PX8A 1UB6A 4YXWG 2NR6A 2XG4B 5BS0D 4MLSA 4NKOA 1NGWA 3ARDB 3AT9A 3BD4A 3S37H 3V4VA 5T5NG 4BIOA 3WFHB 4XCEA 2DS4A 1JI1A 1TVBB 5FYKH 1NCHA 2XN0A 4M43L 5D1XB 4W93A 3L7FB 1SEBB 4RAIA 1VZIA 3UTPE 3A4AA 3HG5A 3L9RA 2YUXA 3U10A 1M5IA 2AJZA 3D7PA 3CVIL 4X6EA 3PP3K 4XBPB 3EYFA 2IDTA 4HIHA 1XGTA 4ZOBA 3GB7C 4Y4KA 2EEDA 4X2UA 1JZ8A 4LCWA 1URZA 2X9XA 3W57A 3E8HA 1IBLO 4K8RD 3AQYA 2VSMB 5IYZB 4GW5A 4LSRH 1OCOC 4X9QA 5FYKD 5GS0C 3FN0L 1A9BB 5CKGA 4O2BA 4ZBJA 4F1SA 1SLUA 4M03A 4E5XA 1UXSB 1NT2B 1I9EA 1MFAH 3W5MA 1U3HA 3K5SA 2FT7A 1O7DE 5K1XA 5EU6B 4V1DA 1MFNA 5DYOA 3T1CA 1D5BB 2DQEL 1JXDA 4OD3H 3H6JA 1RUKL 2DQIH 2I7OA 4HJJH 5TQ0L 1G6VK 3WKNA 3OXSB 4YY3O 2NY5H 4O58H 5EO0B 1GOGA 4HQQH 4F3FB 1BPLB 4MJHA 5CEYA 4GSUA 3UTTA 1Y6XA 5KUMA 3O2DH 4R3SA 1IBKB 5JHBA 4YX2H 1NDTA 1XGZA 2CGNA 1T7ZA 2FEEL 2WNXA 3T1FA 4NZUL 3ZQWA 1XMEB 4QHNB 4BFFA 4C58B 4QWWC 1GZPA 2OL3H 1NFIA 4OIFA 1RAMA 1HHGB 2P7TC 4I50B 4J11A 1JHTA 3F7LA 3LPPA 1SGKA 5SWSB 4JV5O 1DQIA 4S1DD 3OTOO 2DV6A 2EH7L 2Z64C 3FB5B 1VACB 4X5QA 4PJGE 4J3OD 4LCVA 4F2MB 1HH9B 2OXHB 3BPOB 3QRGL 4MNQE 1ZT1A 3ULUC 1QLEB 4X64O 5MENB 2EXYD 5JVDA 3LPWA 1EIBA 4LCIL 4GBXB 4I89A 3BSZL 4LASL 3LIUA 5D96B 3TIDB 2V3FA 4TVUA 3U9UA 4LPWA 4OV6F 1WP8A 3JYCA 4JO1L 1IDSA 1CEZA 1VGKA 3MKKA 4MCNA 4DO6A 4YSEA 1S6NA 4LF8B 4OF8A 2XPZA 2EINC 4J3UA 4MNGE 3ZLQC 4X4MA 2E8YA 2ARJA 3ARGD 5DEDA 1RZFH 1TJHL 3P02A 5LA6A 2FX9H 4HOMA 3WLWD 4YHMH 5E2VH 4DR5O 4KC3B 4M7LL 1MFBH 3E3QC 1CL7H 5AVRB 5B38A 1NTKH 1CLVA 1QKZL 4FHJA 4GAYB 5G5DB 3KR3H 2WVUA 1DE4B 2VDRH 4MS8D 5T3ZL 2ZIDA 5IFHL 3L8QA 1MNGA 2O5ZH 4PSPA 1X9UA 4FLWA 2FJUB 2O5XH 3OAYK 3RJOA 2AFNA 4WW1B 5BNXD 5DXWA 3F2LA 4JPIA 4NERA 4J4PD 5MI0C 4XBFA 2YKLH 5E5MB 2ED8A 3P0GB 2AJUL 4TLSA 5D7LE 5DZNA 1HEZB 3CJHA 1CQKA 2APSA 2KH2B 3MD0A 1R5WB 4HZLA 4N1CA 4NENB 5GZNA 5JMOC 2X9YA 4Y88A 3SDAA 2YOCA 3OAAG 2JKTM 3PAYA 1ZWIB 1FFPB 4XMKL 5F96L 2CBOA 1K8AW 1CR9H 3B2VH 4P2YA 4I55B 1OVZA 5DFVC 4X6FA 1JGVL 4HEME 3IDXL 4MTMA 2ADYA 4MZRA 1I85C 4U1HA 4UQEA 4P9HH 4JI7O 2A1WH 2FLMA 4JUSA 2F54B 1LO4L 3L3KB 1EFXB 4NC0B 3HS0A 3APDA 1KPRB 4RQQA 4BZ2L 4FFZA 3HC4H 5K33A 4ALAC 3PV6A 4XCNA 1J8HD 5B3JF 3AM8A 2OSYA 1SJMA 1WZMA 2VZTA 1MN4A 2FAUA 4ISVB 3T4AB 2FTKA 4JV5B 1XF4A 3ZPDA 5A7BA 3S37X 2QHLA 5IMMB 4FX5A 3IFLH 3NP3A 1E7UA 1V8HA 5JCOA 2IDFA 5CZXC 2VR9A 3NJJA 3ASNC 2B9ZA 2K4AA 5PCYA 4P5SA 1L7TH 1R3IH 3H7BB 2X70B 4Z5RB 1XHHA 3EAKA 3ZN0A 2VLLB 3VFVA 4TQEL 5I1EH 3RDJA 1E4KC 2CO7A 3FCTB 3UROR 3IGKA 1S5JA 3WEXA 2QADC 2CGZA 1OWWA 3EDJA 4JY4A 4Y2NA 4DQOL 3PWPA 3NIDF 1J9RA 1RK0B 1G9ML 4GBXA 4NNPH 4XNXH 1FNAA 2UUAO 1A1OB 1TZIA 2X3BA 3K74B 4N2AA 4X6EB 1KPUA 2CUMA 3O6KH 4PJFA 1K7DA 3B43A 2AMUA 3JWOC 3QDME 2F4VB 2EECA 3LKQA 4PVLA 3JAWB 4CVUA 2EILB 4CVXA 2AV7B 3INOA 1XXDC 2G9HB 4OLVH 5EHFA 4ZKIA 1C1EH 3D85B 4OLZH 4UM9B 5CLWA 3ZO9A 2RIKA 4HIEB 5CO1A 4YFLF 2OSWA 3VI4B 1EO8L 1VF5B 2ZD0A 4JI2B 4N22A 3ZGIA 2ZKWA 1BQLH 1H6UA 2X05A 4AM0A 3CVHB 4QJ5B 4XCYB 3M8OL 1T66D 2BJMH 1RURL 4M1GH 5ACLA 2WA3A 5J8OA 3VD2A 5C07B 4AQEA 1U8NB 4KUCD 3HN8A 1QX1A 4U1MB 5HI5D 4F7EA 1NGYB 5E8NA 3IKCA 1I4FA 1A1MB 4MS2A 3KYNB 4JFTA 5EUOF 1WEJH 2P5WE 3H9SA 1TTGA 4GIPD 1ZLWH 4FG6C 3QO5A 4R6UA 2HVKC 5EZOH 1Q94A 3NJXA 4FLSA 4F93B 2QMJA 3LS5L 4MA3A 3VFTA 1XHZA 5JJJB 1OAJA 2H4EA 5DSCA 5HI5C 1PYWB 3OG6B 1TVKA 2NNAA 1N5YL 1BJ1H 5JQGB 2EZ0C 3CX5K 5JQ6H 2CAZC 3P4NB 1GC1C 3QEQD 4N20A 1WA8B 3VTAA 3IXTB 5KANI 1B3QA 2NCEA 2IFFL 2RA1A 4WUUD 4IHJB 3JYBA 3ZT6A 1ZK5A 1RLBA 3RVXC 3DOIA 3T6QC 1SFDA 2XA3A 1ZT1B 5IB4A 3MLRL 5GGVL 3DOSA 4XPFH 3FT2B 2F8VA 1LILA 2VERA 3IAYA 4FXGA 4ODVL 2H0PA 1LTXA 5KYWA 3IMVA 3OAUL 4IRSC 3T71A 1R34A 4KGJA 4X4ME 4K8RH 4NQCB 4D3CL 2ODIA 3JASA 3M86A 1HOCB 3KPOA 1HI6B 2NY4C 5CEZD 1LP9F 4LLWA 1NBYA 1P9MA 2QKIC 2XKNB 4OB5L 2FQEA 3K6IA 4HJ1A 3S4SG 3BGAA 2DOSA 3O6LL 3VDCA 4K9EH 2UUCO 3L73H 3ETEA 1NANH 1PD6A 4NQXA 3CFBA 2OX5A 5F7EH 3UJJL 1CYXA 4G1EA 1JHKH 3VFWB 1ZDSA 4LDCA 2X1QA 5DLLA 2ZDIC 2BNRA 2P7TB 1ZJBA 3O45A 1S4IA 3RWIB 4PD4F 4J9YB 4Y2OA 1JMXA 1IC0A 3TJHD 3D87B 3G5YB 4OM1H 5FEBA 5AW4B 4UCUA 1FS0G 5E8EB 1F6LL 4M93C 1P4IL 3EFDH 3B83A 2X0LA 4ORGA 2D2OA 3NSDA 2BMKA 1PDKA 5EUKB 3LZRA 3GSNL 2KL6A 4JI5B 4QRUB 2Y4SA 5FO8A 3QCTH 5IY5C 4DVRH 5ACZB 5AZEH 1JYVA 4J1UA 4PGDB 4PJCF 4RAVA 1XCTB 1HCVA 4MMZA 1NIFA 3DTXA 1RZKC 3MFFB 3UZEA 1FXVA 1YC7A 1Z2KA 2C7FA 2DH3A 4WJG3 3GSNB 2AEIT 2EEAA 3QIBD 4JFYA 1F13A 1U8MA 3JWDC 3QHFL 5FUZL 1URIA 5C0CE 5LAXB 2VR6A 3IWVA 5C09B 5F70A 3W2DH 4X4KA 4UV7H 5EEZA 4E41D 3AVEA 4N8VG 3EYVB 1DLBA 4HT1L 2DWDB 2NTFA 2FJHA 4B3SO 3IKCB 2H41A 3NMEA 4O4YL 3L9YA 4F92B 3IJEB 2BSKA 1H6TA 3GZKA 3SQOL 2P46B 5IQNA 2CK0L 1WB7A 3E0GA 4L1DA 3CGTA 4YDLC 2C1OB 4K5NA 4YHYB 4TQFA 4Q6IA 1RPRA 1U91A 3WOVA 1NFDF 1YPZE 3QJZA 3BUDA 4ZMNA 3IAGC 4XBGB 3RUGA 5AG9A 3ETBJ 3IRZA 4NRXA 2ZE7A 3VRLE 2OIEA 4XC3H 3N43B 3CVIH 1LLAA 2K9UA 1MCOH 1OARL 2YMXL 2YPKB 1Z9PA 3IDJA 4K3DL 3DNKA 2JCCE 3GPEA 2OZ4H 3J81N 1F18A 4LOUC 2LQRA 3FT2A 4OR1A 1ICTA 5DVKA 1IAMA 2SODB 3BQUC 3RN4A 3ZDXE 1SF3A 1OAQL 1ZGLA 3QE5A 4NZJA 4DR1O 3V5KA 2F8XC 3CSBA 2YOAA 2HKOA 1QFWH 2DJ4A 4G8IB 3ZXAC 2A9AA 3NN8A 1EAOA 3VI3A 1FGVL 4ZXBD 1ZLDA 3IGAB 4G8FA 3G6JF 1GSMA 2XAFA 1P5UC 5HYSG 3N9GH 2AQ2A 2BOLA 2CDEA 4XPTH 5C09E 2HMID 1XEQA 1V10A 3KEDA 4CVZB 1BD2A 2HTLC 4L0PB 5D7IA 2FWUA 5FM8A 1IGYB 5L6YH 1GH7A 4GRMA 5JHLA 2EADA 3R18A 1H0DA 3DJZA 1C5CL 1HH9A 4JZNB 4JZJA 1X7TA 2AVGA 4ELMB 1IX9A 4PGCA 2H6PA 3LSQA 2HT3C 4FQ1H 4KQ0A 4DP9X 4ZW7A 4FM1A 5I8EA 3IDGB 4F8NA 4TSBH 3HVNA 2YEVA 1A1NA 2XZZA 3TEYA 1G7PB 4LH6A 3TPUB 1GKOA 3CHSA 3H0TA 4BK4A 4ZZKA 1JUFA 3RNKB 3EOAB 3K7UA 3BRCA 4RAVB 3BZ4A 4Z0BL 1FNHA 2A6JB 4JVUA 4FI8A 1NCAL 2V5RA 3PGDB 3RPIA 4C4KO 2D03H 1QBZA 1RZKH 4NGHL 4Y9EA 1ZA6A 3IRCA 1ENVA 1DZBA 1L6XA 4HWUA 3OR7C 2VDNH 1DVFC 4DP2X 1YZBA 1TQVA 2NNXA 2YUVA 3FKUS 4NM4L 4OIBA 5E51A 4BH7B 3F04A 3WLBB 3IF1A 4K07A 4KUCF 4U0RC 4V1DB 3OTFA 1MWAL 3ESUF 5DHYB 4ZSOA 4UF7C 3JQOB 3STZC 3OPUA 1N59B 1PM9A 2LU4A 1INQB 5BS0A 3BE1H 5JORA 2IH1C 1ZX3A 2Y0IA 3OLDA 3T04D 3HNVH 3QG5A 3QJVB 3DVIA 4FQIL 5KBMA 1N9PA 4HOXA 2WWNA 5CSZB 2VM3A 2W0FB 3MV9B 4HF5H 2ZF8A 3LDEA 4OM0H 4H5SB 5IMKB 1OGTA 1DEEA 1S7XB 3VD3A 2JGUA 3FAVA 1F58H 3HEIB 3GIVA 1HQ4B 4XOAA 3IMRA 4U0QB 4BUGA 3O3EA 2OR7A 4LBAA 4OCSL 4EI5B 4IHOB 4OFDA 1S8DA 2UXCO 4HPOH 5E1AA 5C0AE 4ZMQA 1V55B 2XY1A 1CE6A 3HRPA 5IB5B 5KYXA 3WTXA 1R73A 1FI8C 4KPHL 5KS9A 5D71H 5AKTA 1E6JL 2WZAA 1UB5B 3L95A 3HKEA 4Q9QL 5AWNL 1T0MB 4JHWL 4L4VB 4MD5B 1PNDA 1BA9A 2JB6A 2W6IG 5BZDA 2WSKA 5IM7A 1FCCA 2VN6A 3PLYA 5GGSA 3VFGL 2W0FC 4V1DD 1QSZA 4LSRL 4L8SB 1TF4A 5I16B 5C0CB 3NZHL 1YSCA 1OE1A 1SZNA 1VZGA 4KVNH 5D7HA 5FECB 3BVNB 3LSOA 1BQHA 3SKMB 3WTVA 3ZMRA 3HE7C 5FA3A 5JW5A 4EBQH 3CVBA 3RIFK 2B9BA 1JWUA 2LW7A 2X2IA 3KPQB 1RZ7H 1R6NA 4MD4B 5FGCE 2F5BH 1M6OA 2XBZA 3WIIL 4AIZB 5C09A 2B16A 3VXUE 4CDHA 5KZCB 4F8QA 4J3OF 4J3VA 4KK9D 1GGBH 2K7QA 4JMNA 1N3NA 1N0XL 1NLBL 3H1ZA 1SHSA 3MRLB 5D1QB 4RMWA 1ZT7B 3EADA 4LLDB 4P2RE 3VD7A 5CBHA 3H2QA 2R9IA 5CJBA 1U2CA 5EYPB 5IMOA 4MAZA 4M9OA 5HBBA 1VQ8V 2BSKB 4EKXA 1AJPA 3FMGH 3ZZSA 4HDIA 3VAEA 2FATL 5HDRA 3S88L 1S5HA 1M56B 2YLKA 3RTLA 1HHIB 3DV4B 2G75B 4DZ8B 2X0UA 3QJTB 3MODL 1SQQH 5LMUB 1G9MH 3D18B 4JCWA 4TULL 2E7BA 1JDCA 3BD3A 2QEXV 2DJUA 3H2WA 3T0WA 4JVWA 3KDMA 4YFDB 2H32B 1R24A 3SDAC 2X4OB 1BXXA 5F72S 5D2NE 4Q0XL 3R4RA 2UWEA 2QJ1A 4JFWA 4TTDD 3VXMB 2EJ7A 3I6SA 3KXFD 3E89A 4QGTA 3ULVL 4HBCH 2UY7B 1BF5A 5ANME 3L54A 2GITA 3AK1A 2JIXD 1O9VA 3TO4A 1MNUH 1UCBH 4O2AA 4YBQD 1JWMB 1T1YB 1DVXA 4PJEE 4PB9H 5SWSE 4HOWA 4KKCC 1ORQA 5I82A 4D0DB 1MFCL 1H8OA 1L7IH 2YEZB 2N3JA 3KH3A 2VZOA 3AQXA 1ZV2A 1OE3A 3MROA 5L4MA 5E08H 1OGTB 1MQKH 5FGCB 3GXUB 1PZAA 4ANVA 1JPST 5T3ZD 1JIBA 2O6EA 2XFXA 3E8BA 2NY1C 3VGBA 1QATA 1RIVH 1HN1A 1YJDC 3AK2A 2RR3A 2IADA 4GRMB 4P3WA 5LP6B 4PJDE 3V6ZA 1ZE3C 1GGCL 3P0YL 4OF7A 2HG0A 1FG9C 2FJGB 4P46A 4TWKA 4P06A 1X44A 4DVBB 4X6CF 4OZHA 2HFGH 5D7KD 1D7BA 5JA8B 1VQMV 2BERA 3MLWH 4OVVA 3EJYD 5CEXB 2AXFB 5F96H 1OSPL 1KGWA 4O4HB 2B1IA 4PB0H 4DKFL 2Y7QB 4L0ZA 3A0BZ 4NQUA 4P5RA 1CMOA 4FAAB 1YAIA 1GHFH 2Y48A 2PW1B 2Q7AA 2RHEA 4D94A 4X8JA 3PYCA 4JFDD 5DMKB 3WFDH 5IQ9B 5I23A 3LXCA 4XPGL 5FYLD 1DDHB 3GYRA 2VLJA 4E0RB 2X6MA 4OGAD 5MEOA 2UWEF 4IIJA 5FYKU 5A6MA 3BZEA 4Y19D 1D6VH 2Z0UA 4ZOEA 3QAZC 3NFNA 4JY5L 5T1DH 1EZVY 2WLIA 2EIBA 2DWEB 1DEDA 4FG0A 1IAIH 1T20A 2VDQB 4KJWD 1VFBB 4HEPA 2WQXA 3IWUA 3QZOA 2CKBB 4J8RA 3P9LB 4BWAA 1DLFH 1N0LA 2WQUA 3VFRA 3NCWA 2XQBL 4DV4B 2WM0A 2H47C 1FO0B 1KFAL 3MRQB 1YEDA 3SKUD 4PJ5A 3VFTB 1N67A 2Z65C 3I6GB 5HXMA 1F56A 3PHOB 4N0UA 2DM2A 3TBCA 4YH6A 4WNJA 3SBWA 4MQXC 2A6DA 2ORBH 1NI8A 2Q73A 3I56V 1DN0B 1F4XH 4I18B 2CLRA 5AB9A 3WNJA 5EC2C 2ZOOA 1WE5A 5E4OA 2BP3A 1KTLA 4GAAA 3GXNA 3O8XD 2PCYA 3I75B 2V7QG 1KBBA 6FABL 3FFCB 5IM7B 4H0LC 3ATFA 4YBLC 2F61A 5DFWH 2E9IA 1QHPA 3EBAA 1G7JB 1OAKH 1UM6H 3STZB 1WAAE 2EBOA 2P5WA 1AMXA 1Q0YL 4ZMLA 2VLRD 3WJJC 5IHZB 3CDGB 4FVMA 4ODHH 2CALA 2YGVA 2VOTA 1FXKB 1BEYH 3RX9A 1OAYL 4DQOH 3QNXA 1IARB 4MQXD 4B3SB 1BJ8A 3WLWC 5SX4I 4RGOH 4ZFOB 5KSVA 5C0BE 2NT1A 4NCDA 3ZZLA 1N36O 3HR5A 3D39E 4W6WB 2E4FA 4QY8B 2WPGA 3U6RB 5LKNA 1E9OA 2ZG2A 4Y2OB 3U9WA 5F7DB 3UT5A 1YYLL 3MRNA 2X38A 4O5LH 5H37G 2QSTA 4BCXA 5EZOL 1IC1A 3D0AA 3GSUA 1NGYA 1MUJA 4FZEL 1CDYA 2UYLA 3NCYP 4TUOA 1HR0O 3S96A 4S1RH 4WI4A 2OTJV 5ADPL 5I19H 2ZCHL 1UYWH 3V7AE 3B1UA 1EHAA 1S2EA 3FQ1A 1KBHA 3WS3A 4M43H 4OV5B 3QDGD 1HHIA 3DV4A 4PJFE 5E2VL 4YHML 3C09C 1RURH 4M1GL 5E99L 1AY1H 3CRRA 4JRYB 5FKAA 4HIHB 1HXKA 2G5BA 3GBNL 1R0AL 1MH5A 1WAAA 1FL5B 1GPOH 4ODWA 2J2ZB 4U1JA 4UNTA 1KBPA 1ET8A 3IMWA 1QBML 1KUQA 5BO1H 2WUCL 4D3CH 1JPFB 4WO4A 3D25A 2EYSA 2B0SH 4PCTA 3IVKB 5EIIB 3EJYC 4NJAH 3B2DC 1DQML 2X1XR 5CFHA 4HGWB 2PWHA 4X4YB 5DEFB 3PP4L 4XNQB 4PQXA 2OIGA 5H2BB 1B4RA 5EPMB 3TWYA 2ZXDA 1Q9KB 5HYQB 1P7KA 4Y5YA 1Z9MA 4N0UE 1C9SA 1PTZA 3CFQA 4MMXB 2CRIA 1DBML 3FO0L 1MHPL 1UZ6E 1X9QA 4MA1B 5E2TL 1X3DA 1JJ2U 2FQDA 4F91B 3MLZL 2YARA 2NXZD 4HIXL 5L4FA 5DM6V 2HRPH 1FV1B 1KTKE 5GJSH 3JD3A 1OTSD 5FA4A 3S36H 1RK1A 2Z35B 4BKSC 1QBBA 5CJ5A 2NXYC 4XDJA 1W72B 4ZX5A 2BWQA 4YVUA 1U41A 1OF0A 4GSDL 1XAKA 3QQ9C 5FK9A 4DYLA 2NXZC 3P3SA 5BZWA 1J9TA 1YEGL 2WZ0A 3MCLH 5DZPA 4DZBA 5I1IL 1QI4A 2IDQA 4KI5D 2G3ZA 4F4LA 5CLZA 5AOZA 4CU7A 1EFXA 1BMFG 4ZAKC 5IWAB 3TJEH 5FO8B 1FPOA 1KBWA 4D7TA 1R46A 4W6YB 4XCNB 4JHUA 5D1XE 1I31A 2B59B 4Z6AT 1A6UH 4PG2C 3K2UL 3LSUA 4TT3G 2XQYG 4NDMA 4MDIB 4CN4A 2EDHA 1AZBA 3B7YA 1RM1C 5C71A 3W82A 5I8KL 4Q6YA 5EU6D 4RA0C 1OGAB 5T5FA 1QSFE 1URLA 3BJ91 4EI5A 1O7SA 4BELD 4O4YH 3TNNA 2VLLA 3I3BA 4TV3A 1PX3A 1FIGH 2G0LA 2E75C 2BW5A 2MCG1 4LF3B 3MGTB 3PGFH 1KB3A 4LT7A 4YSCA 4WJ5B 4KX9A 2BHYA 1KIUB 1ILSA 1AB3A 4KPHH 1UATA 5FKPB 1UTDA 1U3HC 2DD8H 2ED9A 3T1HO 3QQDB 3BH9B 1G7HA 4IIZA 2J5WA 1G7PA 1IX2A 1NDGA 1O6SA 2Z7ZA 2ITFA 3QO8A 2XACC 2HVJA 5FKAB 5KYUB 4X98A 3RUGB 4CH3A 3FU6A 3A21A 4JN1L 4KHXL 4LLAA 4R4NC 3VFOB 2BIQA 2A77L 1AQDA 4KDWA 2J2ZA 1RIVL 2XOTA 2OJZH 3H8NA 4NC1E 4WO4C 4Z95H 1RUML 3WELA 1RKRA 1YPZF 3U9PH 2YAHA 2JXMA 2QL1A 3U1SH 3GGWB 5SWQB 2WXGA 3FQUB 5HPOA 1BF2A 1KJ3H 4X6DF 2AI0L 4UAHA 2FIRT 2N74A 3QPQC 1U21A 1U93B 3FO9B 4K7PH 2IQAB 5CGMA 3BSGA 1WWAX 4H20L 2NW2B 4AQEB 2YIHA 1LEKB 2ALAA 1ZVSB 1JBJA 2WB7A 3HCVA 4FXKC 5D4JA 1FA4A 1P7KB 1AZCA 1YDPB 4H8PA 3B34A 2B3RA 4AQZA 2AJYL 3ZDXF 4QXUL 1PKQE 4Y9GA 5GGQH 4GKJO 1S9YB 4FQ2H 1UWYA 1QVOA 5EIVA 3M88A 1P0SE 5C92A 1KP2A 4N87A 2FB4H 3KXFE 1EZLA 3V10A 4ODTL 1D5AA 3MLYL 5BOJA 4MSWC 4QHMA 1BG9A 1C5CH 3WB1A 1O7DC 4KFMA 5IB1B 1S7RA 2B14A 3OJ2C 5FYJH 4GAFB 4FFZL 3QJHA 4XNAA 4CGTA 1BYOA 4XP4L 2WTPA 3VMOA 4K8XA 2I5YL 3GI8H 4KOCA 1J8HA 1BQSA 1H0DB 4GP4B 3UX9B 1N4CA 1Q90D 1I9JH 2AZAA 5A6LA 2WOYA 4X42A 3K5OA 3RDTB 4YZWA 3BGFB 2HJKA 4G7VL 5IB2A 2CDYA 1LWJA 1C7SA 4BFBD 4DV1O 4AT6A 3BIKA 1BVNT 1B0GA 1IBGH 2O6DA 5CBEA 1A7NH 1CICC 2XSKA 2A74A 2Y0SA 3G80A 2WCGA 4JPWH 2IXQB 5D1ZB 5LHDA 4JQIL 4YOKA 2EIZA 4MAYD 5CAYB 2FT8A 4M62L 1HIMH 4R4FH 3RPIB 1X5MA 1Q4NX 4F58H 1F4XL 2QMKA 2ZT9C 2VXUH 4KTYA 1B90A 1FNEA 2QV4A 2VZSA 1NFDA 1RP8A 4JR9H 3N42F 3QB7C 2EYSB 2PF4E 2VLRB 4M00A 4XNUH 4EZKA 3TEZA 3IVKA 4MQSB 4B9JA 3HZKA 2D2CB 4MAYC 2J56A 3V6FB 4O2FA 3UCSC 2VDKL 4IYKA 1JRHI 4HAKA 4UCOA 5KVEL 4IT5A 3FFCD 1KBGL 6CGTA 3BA8A 2BJML 2WZ6A 1NL0L 4AYFA 1U95B 2DD8L 3TN0A 2H94A 1SJEA 1KIUA 2ZCLH 1F1AA 4ELDA 1K92A 2R23A 3SDXB 4LAQH 3QWOB 2PP7A 1K6QH 5IW6B 3Q9PA 4WSJA 3TM6A 1RSOA 2QQNH 5TF1L 2NY1D 3HB3B 3RZCC 5DZLA 5AB1A 4K7PX 3JD1A 1JK8B 1S77D 4B96A 2X4OA 4HS3B 3TLRA 3HHSB 4U7MA 4P2AA 4P57B 3H9HA 2FR4A 4NLHA 4N2HA 3U2JA 4MMZC 5CMAB 1SM3L 2QKAA 1ILUA 4JI6O 1U8QB 3MRRB 2FWSA 1MI5A 2CXGA 1T20B 4KGLA 1ZLVH 1ZA3A 2XKNA 1R0AH 3FONB 3OKOB 4NUPA 1H8SA 2KZWA 1CU4L 3TH2T 1KXQE 1OTUC 4JTAB 3APNA 2VDLH 1JYXA 4PV8A 3TASA 4I0PA 4LB8A 2NZ1A 5BXFB 3FBKA 4PV1C 2D7PA 1WICA 3ETGA 4ANXA 4LF6B 5IB1A 3ZMEA 5C0AA 1QLEH 4FNPA 4AIZA 4X89A 3ARUA 5F7EL 1KFAH 3UJJH 3TF7C 5IVZA 3MHZA 3TNNB 3UYRL 4F57L 3MRJB 2MCAA 5A2BA 2WZPA 5GS0L 1R3JC 1M3JA 4NO3A 3I74A 1AS7A 2RJMA 1I1FA 3HI1B 5IWLC 1ETZA 1N12A 1W80A 1S7TA 2Y6SD 5HGGS 3LKRA 1V27A 2AABL 4X62B 2UXGA 3PGCA 4ONHA 4P46B 4R4BA 3QGVA 4OQTH 2IALB 2BIOA 4XNMB 2HG5A 3A5VA 1BAWA 4AIXA 1LE9B 1FO0H 1A7NL 1CBJA 1KIPA 4L8CB 1DL7L 2IMNA 4HCRH 1NLDL 4NHCH 5T8IA 3TBBA 2J8UF 2YBRB 4P3CL 3DROA 2F08A 1BAFH 2VDQH 5T5FH 2O5NA 4POZC 4YJ2A 4P3DA 5ECJE 2HJFC 1KCRH 3K81A 2BDNL 3A24A 4PSRA 3CE1A 4LPVA 3LKOA 2LW3A 4ZMYA 3J80N 2IM9A 3LZFH 3DUUB 1M9NA 4J42A 4IBSA 1RJLA 4U1NB 1NKDA 1NTMH 3HZKB 4FLZA 4L4VE 4RETB 1I7RA 5EC1C 2R0ZH 1FC1A 4J12A 4QPEA 5DEGB 4A7GA 5FB8A 2DBLH 4KKAC 4O2EA 4R7NA 2J6WA 2R1WA 1LO3L 5LNEA 2H3OA 5K9OA 3CRCA 3B37A 1MW2A 4LGRB 4ELMA 1KEMH 1S9WB 3VRJB 4L1SA 3RWCA 1PQZB 4IKLA 5K69A 4H26B 3BUTA 3WIAA 1YEDB 4FZEH 1SBBA 4MGXA 2OAAA 3SKNA 5LDSA 4QGYA 3U11A 3QWOA 4KY2A 2IJJA 2IU0A 1HEZA 1ZLSL 1I9RL 2Y06L 3ECQA 1RJZB 4R90L 3F5TA 5AOJA 1FZMB 3KPNA 5D7IE 5BVPH 2KPWA 1M9WA 1Y7VA 4I0CC 3CPLA 4WKXA 2OK0L 3GHBH 1MLCB 4H8QA 1SDAB 2VDMB 4A2MA 4R9HA 3AAZB 4IRSB 4HXBL 4L3EA 2ZCZA 3WJMA 3WFEH 5C2BL 4RWHA 3P73B 1X4XA 4B3RB 4LOEA 3II3A 5BZZA 3F6IA 1N70A 2WSSG 1E9PB 4PMFA 3LNFA 1RXLA 4UCVA 4ABMA 1TJGL 3I3DA 1CD1A 1PCSA 1WBYB 3P1VA 4I0PB 2CIIB 3O3DA 5KAQF 1X7QB 1H3TA 3AUWB 3H9ZA 1KPVB 1PU0A 1NFDB 5GSRA 4MW3A 3NPSC 1L0QA 5ESQA 4PGJA 2HP8A 1DVTA 5E2TH 4LLYB 2BNRD 3GXDA 1TYJA 2F5AH 3DHPA 3MAQA 4K3JH 4PLKD 4UU9A 5EOTA 4ZO7A 1HJCA 5I75C 4A7TA 1NGZA 4GRWE 1G6RL 3RJQB 3HKEB 1MG3C 4A7VA 3K6FA 2B1HH 5E5UB 5F7KC 3X12A 1N0LB 1XI1A 2WUBL 2QV2A 4E2LA 3BCCH 1S7UA 4KP4A 3ELQA 4MJIB 5H4YA 3OE7G 5IROD 2YI8A 1G1OA 1XT5A 4FKEA 5T1DL 2AQ1A 3GPSA 4YIQB 4QRBA 1FLTX 4KAQH 4Q9BA 3X11B 3UGXA 2ZKMX 2P24B 1B2WL 3HPJA 4H44C 4LSDA 3PABB 1AI1H 4LIQL 1XGRA 2WWKT 3D05A 1MFMA 2ADFL 1UACH 3LH9A 4ZHQB 1WD8A 4JM4L 3QQ4B 2B7DT 1KTLB 3BI9X 4PW3A 3RTQB 1WUZA 5FUOH 1M6OB 2DBLL 2X2UA 1AI7A 3B7TA 4KDTC 1MWOA 4N3UA 1DBBH 3RZCD 4FLUA 3LDCA 2F7PA 4J6RL 2YS8A 4X7CC 5DA0B 1N3NB 4UZGA 4DCQA 2JJVA 1S3KL 3MFGB 5B8CB 2WV3A 1KECA 4KUZL 1VARA 3BDYH 3NYKA 2BVTA 1JYNA 2DLEA 2XN9E 2YPLA 2YRLA 2SEBB 1ZRUA 3DXAE 4NX0A 4X0NA 1TCRA 3GRWA 1JZIA 5EH1A 1SJVA 1JD9A 1YN7B 2B1AL 2DIAA 4I9WE 5KHGA 1J18A 2VDRL 1D5XA 1YPZA 12E8L 2R1XA 5I15H 3I9GL 5LL6Y 1L9SA 3K6DA 4JO3L 4DN4L 1WBXB 1P5UA 3T2NL 1NPJA 3J8F7 1H2MA 3GBNH 2FE0A 2FX8H 2Y07L 3QEGH 4Q56A 3UH8A 4MVQA 2A6KA 5E4IA 4BH8A 4OFVA 2YICA 4YK4B 1A21A 1JSYA 3FRPA 2ZNIA 1SOQA 5I26A 3RWFA 1XCQA 4N0CC 1RHHA 2GSGB 4UQIM 3BQUA 1QG3A 4NDMB 4AX3A 4LARL 4FCHA 3VD5A 3NIGB 4EEQA 1TJIH 1J8KA 4KXBA 2ZXBA 1EXUB 3K46A 4GKNB 5E2WH 1C16B 2DLHA 3OKKB 4K5OA 4KOBA 2ADPA 3RILA 1ZGLM 4N28A 4J7ZA 2BNRB 1UA3A 2Q6WB 2XG5A 1P7BA 2E7MA 2D7OA 4GYBA 3BUBA 5TQ2H 4UQ3B 5HPMA 2A7WA 1TQTA 4N8CL 1ANUA 3ZR6A 3ZYOA 2ARHA 3Q1SL 2GQHA 2XASA 5HYQA 4JM0A 1IGCL 1A25A 4GG6A 2JVUA 1TZAA 3UC0H 2YIBA 2FHBA 2ESVA 2OMXB 3OF6A 4J3WA 5E5LA 3SBRA 3V4PB 2C9PA 2P48B 5C0RH 5I0YA 2X2YA 3KM1A 3F7RA 3HE6C 3OMZA 3DX0A 5CKAA 3I5DA 1QFWL 3PP4H 1AROP 5FWQA 5CGYD 5ALBH 5BXZA 1G0XA 4ZT1A 3ARRA 4UNVA 4JGNA 3CMOH 4E4EA 2PR9A 1SMDA 3O2VL 2GBVA 2G2RB 3U2IA 1U8JB 1UZ6F 3MFFA 3L3OC 2J1WA 1EHNA 5I17A 4X50A 4JANA 3WG7B 5ANMB 5D7SL 1J48A 5DRZB 2AS5M 4WBNA 2MQCA 1BS3A 1RUPH 3SQBA 3US9A 1LO0H 4DW2H 2DW5A 3KNBB 1IBFA 4OQTL 4P9MH 4WV1B 5HVHC 4H88L 4QHUA 2ZQMA 2XZQH 1N5AB 2QE7G 2VT0A 3GDBA 4WI5A 4AGLA 1BJ1J 1G4YB 3LNDA 2OSLB 3UGEA 5BR8B 4M7ZC 3J07A 1U8CA 1UENA 4TKWA 3G6JB 4EN3B 5I1IH 1KBKA 3MZTA 4NB5A 2NY1B 2PO6D 2X3AA 5F6HJ 4DP7X 4KH9A 4UOW0 3GKWH 3BGMA 4LH7A 1JV2B 2BRRL 1UC6A 2XVKA 5I8OL 4TM9A 1A6PA 2DPKA 4JFEE 3DHJA 5LGJB 1W0YT 3LZFL 4NIYE 4DR6B 3KLHD 4OBSA 2ZQKA 3TK1A 5GGRY 4M5YL 3LH2L 2K1EA 1OAUH 3CZLA 4PG9A 4DN4H 2BS71 4IL6Z 4XOCA 3ARDA 4JRXA 4U05A 7FABL 4KNQA 1ZMYA 2WVVB 1BZKA 3KLDA 3C8HA 2GT9B 4NWUH 1TZHB 3ZY7A 2BOBC 1IURA 1P9MC 3HG2A 2ADGB 3CCJV 1NCWH 5C86A 1B4TA 4JUTA 3DGEA 3ZL2A 1VGKB 4Q14A 5GISH 1RHHB 1ZA3B 5JPMC 1RZ8B 1FNGA 3CHOA 4RMVA 1WH0A 3QNXB 4MXQC 3LB6D 5C0GB 4LF8O 2HX9A 2M2DA 3L4XA 4G6KH 4ELKB 3AGWA 4YXHH 4Z7OF 1T2JA 2Q4PA 2HX8A 4GX1A 2O61A 1BVNP 1J12A 2PI4A 4ZZFA 3OJVC 1C5DA 3B8YA 3GXTA 4HETA 2CA4A 4YR6A 3BN9D 4N0FB 4XXDA 1RFDL 2DIBA 3II1A 3LV3B 5FFGA 3TT3L 5E99H 3CXHF 4GB9A 2DWEA 3FTYA 5FYLH 1M2VA 4J3TA 4GUNA 5GS0H 1OTTC 1NBZB 2XZAL 4RGMB 3DYOA 3PFQA 4DGIH 4PYHA 4OV5A 4OF3A 2VDPB 2BOCC 1NMAH 4DT2A 1MCRA 2XQ0A 4IBYA 4JHAL 4MTOA 1U6AL 3I6GA 2G3NA 3DPBA 3GC3A 4F9PC 1WIOA 3SDAB 5D93C 1AQMA 2Y3NA 2PLTA 3FQWA 4ONGL 4LKCB 1DN0A 4I18A 1LE5B 4CKQA 4GLRI 3DARA 3AS3A 4X80H 4XX1G 1SQPH 5LO7A 2QWOB 2Y5TB 4U4BA 4NUJA 4IMKC 4QXGL 1GC1H 2UXTA 3MRDA 5ABDE 4Q4IA 3RVWD 5MENA 2GYSA 3QG7H 3ULUL 4DP1X 1U96A 1AGFA 2BDNH 3MNWA 3O6FB 2FYYB 3QPKA 3DX9B 4WI8A 3U9UB 1DVYA 1QR1B 4I7ZB 2XXFA 3H4HA 5HHVL 4XN4A 5JQIB 4CC4A 4I3SH 1J88A 2H32H 3IYLW 2DDQH 1UD3A 1DVFA 1UM6L 5AZUA 5DO8A 1CZ8L 1HHKB 4PWFA 4XPAL 4J5VA 4TVPD 1L6ZA 5EC1A 2EABA 4U6VL 3VU2A 2N1KA 4W9ZA 3H1LH 4WFEA 1CI3M 1R3LB 3SODB 1GS7A 1UJWB 1CF8L 4X5LA 1IM3B 3ZDYB 1YVWA 2R7EB 2EIJB 1W72A 1NC4B 4GKZB 1GS8A 1G6UA 3GHEL 3TYFB 1SHXA 4RZCA 4WF9V 5CP3H 5BZWB 1A7QH 4LU5H 1HT6A 4HAFA 1MMMA 2VLKE 1VQOV 4UV9A 5I1HL 5GRVK 2JSFA 2Y7LA 4PTUB 3P2BA 4RMTA 2YN3A 5FW7A 3O6FD 2V3EA 3HPLA 4OW6A 5KYNA 4DKDC 3GLZA 4D0BB 2HG5C 1A14H 4ZNEE 3EYQD 2NY7L 2Y4TA 4CMHB 1BHBA 2ICCA 5DQJB 4JKKA 2ZG3A 3JV4B 1KJVA 4ORZC 3D6GA 3V4VH 4IYIA 1KCSH 4QE9A 2OCHA 3PDOA 2MEJB 3SOBH 4DESA 4NQTA 5DEZA 5J9PC 1G5AA 4F8TA 2QBWA 4K35A 1FVDA 1F2QA 4PI0A 2I85A 3BUPA 4FXLA 4UT6L 4LAJH 2Y1AA 1BPVA 4PJEB 3SQBB 1KXHA 1QRKA 4DR3B 1JVOA 1SFHA 2H2PD 2YGNA 4AMWA 1L3WA 4M9PA 2RDCA 5BQDA 4YC2C 3GTVA 1RZJH 2FX7L 3TT1H 5KJRL 2NLJA 2CTRA 2OJ1A 3DI2B 3GF8A 3RKDD 3PV6B 5TE4L 2Q0OC 1ACZA 4BIUA 5D1XA 3CFEB 1EGJA 1M93A 5IHLB 3JWNC 1T22B 2GVYA 3A0RA 1FZJB 1BBDL 3BH9A 3NAAL 1HL9A 3CTTA 3G5XA 4H26A 5AKRA 3S5LG 2QA4V 3DVNB 3KPSB 5LNGA 3E22A 3GBML 1XNRB 4HG4J 1CXHA 1KJ3L 2WWOA 3L4VA 1BHAA 5E2WL 1MSWD 2ZDIA 2BTOA 4I48B 1DFBH 1FNSL 4WFBV 4OX9O 2F1EA 3CFIC 3HB3C 4QRQA 3RZCB 2QGEA 4OZIB 2HRHA 2EH8L 5CMUA 2VDLL 4A2HA 1FXHA 1A65A 4JTCB 1K5QA 1OCCB 2Y5TA 4FI6A 4JDVB 1LD9A 5AVSB 3DGDA 4DUYB 2ZUSA 3IDUA 4F37K 3TTSA 2NUTA 1JAEA 2UXNA 3O4LE 2P5ED 2VMEA 2WXLA 4IJ3C 2X0VA 4S2SB 4XO4A 1I0HA 1OB1B 4DP4X 1E9PA 5SX4H 2IDUA 4XC1L 3FT3B 2VJXA 4WI3A 4D0DA 2ITEA 5J13C 5LN8A 5AVYB 4BFNA 4HNAA 4RBPK 5KMGB 3DVFA 4TVPH 3LSOB 1E8ZA 4HD5A 1QR4A 4ZDHB 4HIEA 1QEXA 3F6JA 2OR9H 4LLMA 3O0LA 2Z0AA 3KPQA 2Y1VA 4FQHB 1LJMA 5KHIA 1QASA 4M02A 5JYLA 2V8MA 3LNNA 5DHVA 3ARFA 3VXRE 4OAWB 3EBGA 1WWBX 1PP9H 3MLXL 4JX0A 4BKTC 5C2UB 5LVEA 3VD4A 1MDAA 4LRIA 3ECUA 5C6WH 4B3TO 1T3FA 1UD5A 1PF3A 2GTSA 5DHDA 1JVLA 2EACA 5H37A 5C8JB 4L05A 4OZHB 5KSAA 3BAXA 2WXFA 4I0XA 1RZGB 5AZEL 2JE8A 4BH8B 4HMEA 3S2AA 1FH5H 3G6AB 4UT7H 1KCWA 3LQAL 3N2JA 3ZTCC 3Q9QA 3NSJA 2GJRA 1IGJB 1VEMA 1MVUA 3GHBL 4UFZA 1AGEB 4DV7O 1QLRB 3L4YA 3SOTA 4LNUB 1AQDB 2VDKH 2A6IA 1ET7A 1X5KA 4HXBH 2K4WA 3DMMD 4N68A 4RLDA 2LP7A 1AZNA 4NFBA 1R9FA 1TETL 3HW7A 5ID1B 2DL2A 3ZX1A 1MLCA 1N32B 3NK3A 5AALA 4GRLD 4EE2A 4WY7L 4BUQA 2Q7YB 4WTXA 2UY6B 5I1AA 3BY6A 1UKTA 4U7SA 2PR4H 3QNEA 3DX9A 1E79G 3EYVA 4GP5B 5LBGA 3TO4B 4Z3JA 1DUYB 2V5YA 2WO2B 2CGRH 4GQZA 5DZ9A 5KVFE 2GC4C 3FH5A 2DL9A 2WB1A 4F15C 3V0VA 5A2KH 5F3HA 1ZANH 2ZWNA 3K3WA 1PFCA 4L37B 5TK4A 2O5YH 3UM7A 4WEBH 5EF2A 1QWHA 1WHPA 3DVNA 4XNYL 4DV6O 2EDOA 1BAGA 1CXEA 1B88A 3LHPH 5B7MA 5ISZD 3L6FB 3ML9A 4KK8D 1U3HD 5C6PB 2A9NH 4Z7NE 1XCXA 3P4OB 1S7VB 2G2RA 1U58A 4CNIA 1A3LL 1D7FA 3CFNA 4JM2F 2C3XA 4RZCB 5DUMH 2PF6A 4BIKA 2R15A 2YPVA 3QEQA 5IOPB 4ELMF 2VL4A 1B4JH 1V9PA 3ROLA 2ZXWC 1EJ8A 4KO9A 3L5XL 4WKZA 2WWWA 2R69H 3CFCH 3GJFH 4PRBB 4XXCA 4DK5A 4KZEL 4JZ2A 5LBQA 4AJWA 5CA3A 3QNFA 4AI8A 1NMAL 2EDLA 1YUKB 1Z0NA 3WFCH 4MAUL 3A2FA 1AQ8A 4HK3J 3FT3A 3GXIA 4JM4H 2FNWA 4APQA 4DKEL 2BXYA 1Q8MA 4X9FA 3FX7A 5F7LB 4JAMA 1FWXA 1F3DH 1WIPA 5EOCH 5AYTA 3VXRA 4K73A 3MNDA 2IAND 1JFFA 1HNYA 1Q38A 2FRGP 3AS0A 3L9EA 2VLKA 2OM5A 4G1MB 5IHUH 2ATAA 4FQHA 4L5FH 2UXDO 3FOLA 5I5JA 4I9WA 1G9NC 3PDDA 2B4CH 4IIQB 4NBYB 4AOFA 1HAUA 5CN0A 1DBKL 4LSQL 2NX5D 1DO5A 5H5NA 1UZ8B 3QDMD 2Q86A 2VKXA 2VXTH 5EBLA 4DCQB 1UCBL 2F66C 2NTFB 4GUPA 4BFEA 2ZX6A 3D09A 4HJGA 2GJ6A 4AIEA 2ZSWA 1SJEB 1XH0A 2AQRA 4UCFA 2OMYA 2JQMA 3J2PA 1ASOA 4XMWA 1A4AA 2X4SA 2E7DA 2HUEA 5HD8D 5B1AB 2PXYB 4KO5A 4O02A 5DJ6B 4PGEA 4GO6B 4W81A 1EERB 4L0YA 1UXWB 2ITCC 2FEDC 2V2XA 4W6XB 2UUAB 5DS1A 4EN2A 2OA9A 1KSRA 1U30A 5AW3B 2EILC 1Y74B 4OQ1A 5G4NA 4CSSA 4UDTA 3RZCA 3ABZA 3V5HA 2WLHA 2BNQA 2Y5EA 2P5WD 1UFIA 3KJ4B 2EE0A 2IDCA 3BAWA 5JOPD 2G3XA 1Y6MR 3BH8B 3HPLC 1JZHA 2NYYD 4O51B 3BKJL 4X7EC 4B3EA 3K72B 5EZYA 5T3XD 3Q05A 2X4TA 1J5OH 1VADB 4JYAB 3LVTA 4ZXBB 5TDPB 2VWEC 2NY0D 1CYGA 1H3GA 1DUYA 5BZBA 2H1PL 2Z7UA 5DYFA 4JI0B 5JQ6L 2OJEA 1BOYA 1IM9D 2CLVB 2N0MA 5G55A 3H9SB 3M8OH 3RB7A 3FUEA 3V0VB 2X41A 2OZ4L 3CN1A 3JALA 1M2OA 1ZHBA 3JV6B 2RQ8A 3OR7B 4RVBA 5KW9H 5IJKA 2KQXA 1N2RB 4ZDHA 1UPGA 4E9XA 1EHXA 4JPVH 1WEJL 4MT8A 2IPTH 3CBRA 4P2OA 1F5WA 4XPTL 4CS4A 4JI8B 3QYMA 1OT1A 3L45A 1PL3A 5I5IA 3GMQB 1WTGT 4UB8Z 3H3PH 4IHOA 4Z95L 4P9HC 4D2NA 4ZI7A 1BM3L 3EOBB 3FS9A 3GHPA 4HFWB 3L95B 3C5XA 1FDLH 3WIFB 1XSJA 4KZEH 2DJSA 4DZBB 4I7ZC 5C9KA 4OD1H 5KS9E 4WCEV 1VQ6V 1BGYH 1OGSA 1E5ZA 1KJ2L 5ITFA 3O9OA 5DI8B 5AVVB 4CW1A 1CFMA 1TZIB 1N33O 2UV3A 3I84A 3ULUD 2QADB 1MZEA 4AV4A 5JQHC 5ITBH 2VO8A 2B59A 2GW5A 5LBSH 1KTDA 2OW7A 2VZUA 4KMTH 5C1MB 3ZQ9A 2PYEB 4E68A 2YD1A 1EHKB 1OSZB 1BQHB 4XPHL 2D31A 4JAMB 4GKOA 3SBPA 4LHUG 2VW6A 1SVZA 5EZJB 4OY9A 4NYKA 2Q2LA 2OMUB 2QSCH 1FJGB 3T09A 4N2OA 1TLKA 2WQVA 1KYFA 2ZIMA 2OMBA 3T4YB 4JY6B 2LFGA 3SGKA 5LDUA 3ZMTA 1RUQH 4WWID 3ULSA 3HHRB 4B41A 1I7ZB 4UB6Z 5DEFA 4X66O 1MELA 3O41B 4KBPA 4PFEA 5C0DA 2E0PA 2F7OA 3JTSA 2MWCA 4OSUH 2E3CA 5EYPA 3IPFA 1CFVL 4XB7A 2P90A 3VCLA 3IMTA 3PJSA 3F58L 2Z4TA 4NM4H 5TISZ 3GZQA 4QKXB 4M4RB 4ZUWA 2YKKA 2APXA 4HWNA 3NUKA 4JFFA 4AZ8B 1BMWA 1TGOA 2OCCB 2P3YA 4OGYL 1NAKL 4E41E 4KK9C 1ZUQA 2LGWA 3DXRA 2EDRA 3JV4A 4FQJL 4LL4A 4TQPA 5ALCL 1M7XA 5EULV 3MTXA 4MNHB 1NZ6A 5DJXA 1J86A 3SE4C 4HFUL 5F9OL 4M6MH 1CLZL 2DTML 4AGQA 1RU9H 5E9DA 5HHQA 1A3QA 3QUMB 4X20A 5T1LA 3T0AA 4O5LL 3UCRA 1XZ0A 1JF1B 4KJPD 3ZE0B 5J1SC 1S78D 3PWLB 4CGUB 3W1ZA 2W6JG 5LAXA 2ZKHH 3EBIA 1NFKA 2BOBA 4QTIH 4NBZB 5EOQH 2P4VA 3UTSE 3CWGA 4JFZH 4BD4A 1PLGL 3CIAA 4WU7A 1CGXA 5JXAL 1DJIA 4FZ8H 5HHOE 1NH2D 1BD2E 3S5LA 1S9XB 3C5SB 3UZVA 1L9OA 4H8WC 1NBYB 1X7SA 4XMXA 3R4DA 3BOVA 4ZQKA 2AV7A 4RRPM 3MJ7B 3T0ED 1I3GH 2FHFA 5JNYB 3MCKB 2EYRA 3QG6A 3T3MB 1AP6A 4CAGA 1IAIM 2VXQL 2YQ2A 4G1MA 3DIDA 5IYCO 1DUZA 1N68A 2WD0A 4Y1AB 3O4LD 5IF0B 5I24A 3HUJF 1BM3H 5KZCD 5F2FA 2UZIH 2XG4A 1E8XA 1IKOP 3N06B 4DN3H 2DMGA 4YS4A 4GW4B 3OJMB 4RDBA 1OGAD 2JLLA 2F4VO 1F4WH 2ZR3A 3MRFB 5D5PA 3W11C 2G2NA 5TPWH 4WU5A 3O8XB 1LDSA 3PE9A 4J28A 2BK8A 1Q94B 5TF0A 3NCXA 3CZFB 4PD4K 4FGMA 4ZTOH 1BYNA 4MJ5A 1PG7X 5DD6B 3TT3H 3DO4A 5GJTL 5LG1A 3DIFA 1A47A 5ES4B 2IXQA 3SGKC 1GN6A 1XF1A 1KEGL 2Y1YA 4YHLL 3P32A 3LEVH 4WNQA 2ODMA 1XGUA 3L3IB 3NFPA 2K9FB 3WBDA 3OLEA 5CB4B 4I2XB 1NOFA 2MK3A 3S3PA 4R26H 4P5TC 5FX3A 4PJXB 4G80A 4CA4A 4C56A 5IKCB 2DDQL 3SJAC 3TA3A 1HL5A 2WGNB 1CXIA 1ZTXH 3S7GA 3UAJA 3LN4B 4LESA 3V9EA 4R96B 3KYKL 1Z3GL 1RUKH 4JZJB 4WCYL 2CWRA 3B3IA 5CJXA 4V33A 4EF3A 3ZDXB 1GN3A 3MRKA 4PRAB 1YAZA 4UOJA 2VKWA 1NLDH 2Z91A 3PJLA 3PWNA 3QDMB 3ETQA 3D0VB 5DVPA 2E5LO 5J6GA 2Q7GA 1WDAA 2YZ1A 4I4TB 2DQUL 5IHHA 1RU9L 4TN9A 1JTOA 1MCPL 5E0FA 3C60D 3NCEB 2R4RH 4LSQH 1J1XH 4BK8A 5I17B 4NBXB 1ZA6B 5DN6G 4B50A 4OZGA 1QACA 1EJ6A 2QGDA 2RJZA 3GSNH 3V4PH 1K3EA 4MDRA 2JKIS 4PRPB 1VQ9V 2A9ML 2X10A 4TUYB 2PPDA 3A67L 4LP5A 3PNRB 4EKJA 2QGNA 3PWVB 2B1GA 3Q43A 3ABLC 4QRSA 1BFVH 2FO4A 3ABKB 3GINA 4I13B 4Q4EA 2VDNL 5FGRA 3KPPA 3AT0A 2F7IA 1I1AC 3MUJA 3QUZA 5C0JB 4RGNE 2VC2H 3QIBB 4G2AA 4ZAKB 1XCQB 3IE4A 5KVFH 3L3DB 3NJNA 4TTGA 2GUZA 3FUMA 4KK6C 1GZHC 5GTIZ 3CDZA 3R0MA 1YTFD 4LF5O 1E67A 2A79B 4JGSA 2YGQA 3GXPA 1YHQV 5EOCJ 4BFJA 1HWYA 1DUZB 4PRPD 3BAEH 4PJEA 1ZSHA 3RW0A 2I07B 4UT9A 5DRNB 4FDWA 1AQKL 4CNIB 2IPUK 3C6SA 3C60B 4GNKB 1LEIA 2E27L 2OULB 3WFDL 1NAMA 1SHMA 3D1MC 1NTZH 3DETD 1M9SA 3IDNB 4M1CD 3V9FA 4JKPH 2YDEA 2GT9A 2CKBA 2Z31C 4IKJA 4N2DA 5EBMB 2ZWSA 4V2BA 5BUPA 4G82A 2NR6D 2FO8A 2DYPA 1A6WL 2CNYA