4WFGA

Human traak k+ channel in a tl+ bound conductive conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfgA00
3AG1C 3E8BA 4R8CA 4PDRA 2OCCC 4MTOA 1BL8A 2P7TC 3SYOA 4QE9A 4LP8A 2DWEC 4PDVA 3E8HA 3IFXA 3PJSK 4QE7A 3RBZA 4EKWA 2Y69C 3E89A 4XDJA 2DWDC 4P2ZA 4H37A 4WFGA 2EINC 3K0GA 4MVOA 3K08A 4P30A 4R50A 4WFEA 3T4ZA 2HVJC 4H33A 3ASOC 4MW3A 3SYQA 5BZBA 4PA3A 3BEHA 5CBHA 3EFFK 2Q69A 2X6CA 4WFHA 2HFEC 4RUFA 2WLMA 3F7VC 1K4DC 4G27B 4XDKA 5KUMA 2R9RB 3KG2A 2A79B 3TCUA 2YEVA 4J9ZB 4LCUC 3WG7C 1M57C 4MTFA 5E1AC 1V54C 2BOBC 4R6ZA 4J9YB 4X88A 4RUEA 4GX5A 3SYAA 4PA4A 3SPJA 1ORQC 4X89A 1OCRC 2WLIB 3VOUA 4MS2A 2AHZA 3LDEA 4PDMA 5KUKA 4PA7A 3FB5C 3SPHA 1V55C 2WLKA 3SPIA 2WLLA 2EIJC 1P7BA 4GX2A 2H8PC 3RVYA 2A9HA 5EK0A 4PA6A 2QKSA 4ZBMA 5EBWC 4MVMA 4DXWA 2WLJA 3K04A 4I9WA 4MVSA 2HJFC 1G4YB 4MVUA 3OUFA 2ZXWC 3OR6C 4P9PA 3FB7C 5EBMC 3UM7A 1LNQA 1R3LC 2BOCC 4R7CA 2EIMC 2EIKC 4JTCB 2DYSC 5CBFA 2NLJC 3JYCA 3UKMA 4MSWC 4CBCA 4MTGA 5IY5C 5EC1C 2ITDC 4JTDB 3E8GA 2WLNA 4GX0A 3OGCC 2EILC 3T1CA 3R65A 4HZ3A 3RW0A 3F5WC 3ZJZA 1JVMA 3HPLC 4MVRA 3TETA 2Q6AA 3LDDA 3E83A 2Q68A 3LNMB 1OCCC 1R3KC 1OCZC 4JTAB 4TWKA 2ZD9A 4OXSA 3T4DA 3OR7C 3X2QC 2WLIA 4HYOA 3STLC 3AG4C 3ZRSA 4P9OA 1R3IC 3STZC 2X6AA 3LUTB 4MW8A 1S5HC 3K06A 4PA9A 5EBLC 3GB7C 1OCOC 2X6BA 2K1EA 4MVQA 4G28B 3AG2C 3SYPA 3F7YC 3IGAC 4QNHB 3T2MA 5B3SC 2WLHA 2Q67A 2WLLB 3OUSA 4PDLA 5J9PC 3FB6C 3SJQC 2IH1C 3E86A 3FB8C 3AG3C 3ASNC 3K03A 4F4LA 1R3JC 4RAIA 2DYRC 4XDLA 3ABLC 1XL4A 3SPCA 5CBGA 2A0LA 4BW5A 2AHYA 3LDCA 2W0FC 1ZWIC 1K4CC 4GX1A 5B1AC 3ABMC 4UUJC 2QTOA 4WFFA 3K0DA 2IH3C 5B1BC 1KKDA 2KB1A 3SYCA 1QLEC 4KFMA 3RVZA 2JK5C 2ITCC 1M56C 3ABKC 3E8FA 4LBEC 4RO2A 5EC2C 1XL6A 1J95A 2HG5C 2HVKC 3SPGA 2ATKC 4MVZA 4X8AA
chains in the Genus database with same CATH superfamily
3AG1C 3A8TA 3HR0A 1Y67A 4TV9B 3ICXA 1MMMA 3CRMA 4JI0O 4CS4A 4FFBA 3E89A 2DWDC 3WB1A 5JWPA 3ZMVA 1VQMV 4AILC 1FD9A 3BEHA 5CBHA 3JALB 4WBNB 4TUYB 4G27B 1HDJA 4LWSB 1NJIW 1PNKA 1AI5A 4B08A 1COWG 5GONA 1GK9A 3UO2A 1IBKB 3ZMZA 2XUMA 4JYYA 1XQ8A 2AHZA 3FAVB 4DR4B 1V55C 4H13B 1P7BA 4B7KA 4EB6A 3BHPA 5BR8B 4LF7O 4QPKA 3P32A 4ZBMA 3CB2A 4B3MO 3K04A 1FPOA 5IYCO 1ZUQA 1P4RA 1VIBA 4JI4O 3A0HZ 5B1OA 2UXDO 4DV4O 2V1DA 4R7CA 5CB4B 5CA1A 1TVKB 3K9AA 1V55B 3UKMA 5EC1C 1K33A 2ZDIA 2Z3YA 2ILMA 1NH2B 2F4VB 3CXHF 3CSXA 4K0KO 2F93B 4FZ1A 4E4EA 3CCVV 3AG4C 1GO3F 4MW8A 2LFRA 2L35A 3A0RA 3VQVA 4GZRB 3H1LH 1YTFB 4CH3A 1S76D 4DV6O 1Q6IA 4X66B 4JF3A 2IM9A 3LDCA 3AG4B 1NH2D 1H38A 3W7XA 2HP8A 1F4NA 1IBLB 4DV7B 4DR1O 1R1BA 4WFFA 1BZKA 5GONB 5L3FA 4U3FH 3L75H 1IBMO 1VF7A 1NTZH 3FKSG 5KX5A 2YXLA 3K5MA 1YTFD 1W0KG 2ZDIC 3ZX6A 2E3CA 2Q7EA 1YJWV 4MVOA 4R50A 3UT5A 5IJ9A 4DV1B 2CK3G 2AW9A 3ZHUA 4DV5O 3JAKA 3EFFK 3P3PA 1EN4A 5CA1B 2RNBA 1YCIA 2F1MA 1NR7A 2G38A 5F2VO 4J9YB 2WA4A 2UXBB 4RUEA 3ZHRA 1QNMA 2Y0PA 2E5LO 3SPJA 3CC7V 1YZBA 2EZPA 2O57A 5EK0A 4PA6A 2LGQA 2R70A 3CJHA 1P49A 5GTHZ 3OMAB 1PL4A 4JZGA 4J42A 1R6NA 1Y6XA 2QWOB 5IT9N 1L8DA 2BOCC 4PELA 2YIBA 5L3BA 2ITDC 2RJZA 4KHPB 2HLDG 3R65A 3FYIB 3OT7A 3ZHQA 5KX5B 3S3XA 5FNVA 1SZXA 3STZC 1XHXA 2AGAA 4PA9A 4MVQA 3ZRXA 1G1XB 3UT5B 4I0XA 5IJ9B 5LGNA 5IWAB 1Q90D 3JAKB 3E86A 1YVWA 3THOA 3JD2A 1TGOA 1WPBA 2R72A 2E74B 3OD4A 5KA6A 2W0FC 3DGEA 4ZKIA 1RFYA 1Q5OA 2XAQA 5DN6G 3T1HB 1BCCH 3TXSA 4O4HA 4JI3O 3MHSC 3AK1A 3CPWU 2HVKC 4XBFA 3DC5A 1AJQA 3E22A 4R8CA 4LF4O 4YXWG 4FLVA 4O4LA 4FLUA 3DXRA 2AZ0A 2VS0A 2UXBO 3CJHB 4JGSA 3T4ZA 1YSCA 3ZN1A 3AK3A 3JATA 4RQFA 4J41A 2KKWA 1V54B 2B1GA 1HP8A 3TCUA 1VQPV 1W59A 4LCUC 4GKKO 2GUZA 3B40A 3H1IH 1EN6A 4X88A 4TV8B 3QVNA 5FNVB 4UVCA 1OCRC 1M4UA 4FK5C 2F43G 2JEXA 2JJ2G 2A9HA 4I0XB 4IHJA 4LF8B 2YIBD 4N21A 4JASA 2QM7A 3OTFA 2N74A 4FZ0A 1OCRB 1K73W 3QO7A 2C2AA 2WA3A 4HAMA 4DR6B 4KL1A 4X64O 1YITV 3D36A 1H2NA 3HPLC 3E22B 1OCCC 2W6IG 1OCZC 4TWKA 4O4LB 1AR1B 3LUTB 3DXRB 2BTOA 4IGGA 3L71H 5LGUA 2Q67A 5J9PC 2A3QA 3FB6C 4DK1A 2BCCH 3FB8C 2CUGA 3CMEV 1H2SB 3GWOA 1OCCB 1OCZB 1S5JA 1TUBA 3QNEA 3QG5A 4DR3O 2GUZB 1QR9A 2IH3C 1B6QA 1KQSU 1H2KA 3OEHG 2PZSA 4PHZA 5KHJA 2VQFO 2Q9LA 2ZNIA 4FLZA 3BFRA 3RN4A 1I5XA 2P5OA 4X9QA 3CHXA 3D36C 4P2ZA 4KP4A 4P30A 2HVJC 4IHJB 1SQQH 4YIOA 4DYLA 1NS1A 3D8CA 4JI1O 5JVDB 4DRXA 1KU9A 3JD0A 2D2CB 4YJ2B 4DUYO 4X65O 3CCQV 3CCJV 2E76B 3JARA 4GX5A 3N27A 3ZN0A 2PI4A 1BGYH 4I9QA 1FXKA 3CRQA 5KUKA 4PA7A 2XHBA 3QO8A 2Q73A 3I55V 3G80A 1P7GA 1MZFA 1WPXA 1JFFA 2CE4A 4CS2A 1SRYA 3L70H 5A9GA 1R3LC 1Z5VA 1TUBB 4JTCB 5CBFA 1YDXA 5H9CA 2YXYA 2XAHA 3EVKA 3T1CA 4X20A 3ZJZA 4DR5B 1SF9A 2IU0A 1KP3A 4I4TA 2DW4A 4P9OA 1GM9A 2N04A 3SR2C 3WU2Z 3HKBB 3O9OA 5B3SC 3JD1A 3CMAV 1WP7A 4DR2B 3ASNC 1G8MA 3ETQA 1SQXH 2HJDA 2A0LA 4UXNA 1HR0O 1SQVH 4NXMO 4GX1A 4GKJB 2HEPA 1YI2V 2W6JG 3BAAA 3FD9A 3JARB 1PNMA 4I55A 1N36O 3ASNB 2QEXV 1NTMH 1K3EA 4PV1B 1Y66A 4QE9A 1OZ0A 1I0HA 3HKDA 1QR8A 1WAZA 2CH7B 4H33A 3ASOC 3EXAA 3G67A 3QO5A 4FFKA 2ZE8A 4J7ZA 3ZRWA 2DQ0A 3ZMUA 3A0BZ 5DEDA 1TAEA 2QWNB 1YJNV 1NVPB 4B7EA 3M8AA 2UUBB 2QA4V 2LQTA 1JJOA 1AI6A 5LHIA 5J2UA 1KUQA 3ASOB 1SA0A 4MTXA 1QBZA 3LDEA 3CC2V 3SPIA 5H5NA 3ZRVA 2UUAO 5DM6V 2JGDA 4ASUG 1XI1A 1OHHG 1SQBH 3K3WA 1YJ9V 2ZXWC 2EJ7A 3UM7A 3J81N 1Q6UA 4AQYO 2L6LA 4BW9A 4UVBA 5LHHA 5LA6B 4I55B 1Q82W 4LF5B 2PGGA 2Q6AA 1UFIA 4TV9A 3KZIZ 2HR3A 5L3CA 4FJCC 3B4SA 1GN6A 3DTUB 1N4CA 5H2FZ 1JR9A 3HKDB 5C93A 1VQ5V 1IURA 4OX9O 2WLHA 3OUSA 4WBNA 1GKFA 3QTCA 4TUYA 5J2TB 3AG3C 3ZRWB 2DYRC 2LJ2A 2JRIA 3APQA 4DK0A 4O4JB 3G4SV 4JYCA 1N34O 1ZWIC 4FM0A 4B3TB 4WF9V 1WJZA 2B9ZA 1HNZO 2UUCO 3U11A 3B77A 3RVZA 3ZS8C 2ZIOA 3AG3B 1HWYA 2DYRB 4PDRA 3Q4HA 4YJ3A 2AZ2A 1FFXA 1Y74B 2JGDB 5FPRA 3K08A 1Z2GA 4ICGA 2IJKA 2Q0OC 1GN2A 4B3RO 4JPRA 1VQLV 5TISZ 4RUFA 1WNSA 1BHAA 4DUZB 3GVMA 3CEIA 1T5EA 2R9RB 4FLYA 3RYFA 4JI6O 1K5SA 3G6EV 1LUWA 3S3WA 2DE0X 2FYUH 3K79A 1UJWB 1AJNA 1SERA 2Y0IA 2DJVA 3ETEA 3KKYA 4FLWA 4W4LA 4JYAB 4PI2A 4K3AA 3DC6A 4JI2O 2LGWA 4X62B 4MVMA 2Z0AA 3C3SA 3K5NA 2YDEA 2GBOA 4P9PA 4ZHQA 5BMVA 4JI8B 3JYCA 5IY5C 2HHHB 4DR7O 1PKXA 4C7UA 4CC6A 3JCZA 4DV3B 4UCVA 1GN4A 1J5EO 4LF6B 2XNDG 3Q4HB 4JTAB 4YJ3B 1FFXB 5CMUA 2X6BA 4GT1A 5LMUB 1ROPA 1PV0A 4QNHB 3TGUH 1KYOF 3E35A 2BTQB 5IY5B 1TUEB 3OGIB 2ZM6B 1AR4A 4FVMA 1VP7A 5IYBO 1CEZA 2QWRB 4LFBO 4RWUA 1M5IA 3RYFB 1RP3B 3SYCA 1Z5WA 4TQFA 3UQ8A 1DLBA 3CCLV 4JAVA 4DV0B 1D5NA 5FL7G 4JV5B 3KCXA 4DW1A 3W7SA 1KC8W 2QGNA 3PJSK 4XDJA 1HNWO 3K57A 1XMQB 3IAYA 4CH5A 2GSMB 5BZBA 1R73A 2P90A 4IYHA 3VQXA 3UO3A 4ZHQB 3K58A 2X6CA 5BMVB 3N2KB 4BWAA 4YHHB 5BXZA 4PA4A 1FJGB 2JIZG 4MS2A 3MD0A 4D7TA 5H6RA 2JS3A 1Q8IA 2EIJC 1IBKO 2HHHO 3RVYA 2PF4E 1G6UA 4DR4O 2W0XA 4KUMA 2KQXA 1NZ6A 5BR8O 4NR1A 1I08A 2ZQMA 2EIMC 3OE7G 2NLJC 2ADPA 4PI0A 2EIJB 4CBCA 4I7ZB 2ZINA 2RN9A 4QGPA 1XUQA 2YI8A 2IU3A 2ZKOA 4X1KB 1PD3A 4JZ2A 1AJPA 4QPJA 2F4VO 4IIJB 1S77D 2DN9A 4EFEA 1S5HC 2PTMA 2EIMB 4E2LA 1OCOC 5B1NA 2YC0A 5A2QN 1CXZB 2LP7A 1XBLA 1BSMA 4UFZA 1KECA 1SETA 5CA3A 1YIJV 4XDLA 1HW7A 4O2AB 5B1AC 3RYCB 4X66O 1S3JA 1OCOB 4TV8A 2KB1A 1I94B 1PP9H 2KSDA 4LBEC 1IBLO 2OWOA 2HG5C 4DV7O 1DF5A 3TJTA 3BCCH 1EFRG 2X7RB 1VQ4V 1H2GA 5B1AB 4QE7A 4U3JB 1AP5A 4UCUA 3OTOB 2CGNA 2R9IA 1VQ6V 4JI7B 4I5SA 3SYQA 3AG7A 4K35A 1NT2B 1Y76A 4UV8A 2Q69A 4DV1O 1PM9A 3MAQA 5LMNB 3AK2A 1E1QG 2ODMA 3R66A 1IZ3A 3WFVA 4DO2A 4JAAA 1V54C 1LUVA 1N33B 3H1HH 2NNUA 2ZE7A 2A06H 4X1YA 2VWKA 2V7QG 4CH4A 1SS3A 1NBMG 2PUSA 4GX2A 5CN0A 1NU1H 5KA5A 2ZNJA 1XNQB 4DXWA 5FLXN 2CTRA 3OAAG 2UXNA 1LNQA 1FYJA 5KAIZ 1S72V 1US6A 3CRCA 2UXXA 3C3TA 4D6TH 5JH7A 2Q68A 4KHPO 1R3KC 3T1YB 1S0VA 1BS3A 1O9GA 3GB7C 3F7YC 3IGAC 1I94O 5IDJA 5C8YB 2WLLB 4PDLA 3JCUZ 5EYPA 4F4LA 5JVDA 1Y76B 3HB3B 1KBHA 5IWAO 2LFSA 4NXNB 3CD6V 2Q8VA 4YJ2A 3B2EE 1NR1A 1KKCA 4O4IA 2OCCB 4X1YB 2OT5A 3M7MX 2ZIMA 4L8JA 3T1HO 1WN7A 4K8ZA 2P7TC 3SYOA 3E8HA 1XILA 1N32B 4H37A 2WAMA 4QJFB 4IYIA 4H0LB 5IJ0A 3E2EA 3JD3A 1BMFG 3VBBA 1QVFU 1DGSA 3CCRV 4CC5A 5B66Z 5LYJA 1K4DC 4KXRA 5JJNB 2A79B 4ZOLA 2CDYA 5JH7B 2XAJA 5FPOA 3HKBA 4X1IA 3UCSC 3SGIA 2H8PC 1Y4MA 1MNGA 2FKXA 1I5YA 5EBWC 4UCOA 5EYPB 3BRCA 2IW5A 5EBMC 4Z1MG 4IL6Z 2UXCB 1VEWA 2P06A 4LF8O 2JVDA 1I7FA 4J7KA 4O4IB 1GH6A 3WB0A 2EILC 3RYIA 4HZ3A 1NKDA 4DR6O 1VQOV 2NR5A 3J7AU 2ZD9A 4HYOA 2CH7A 3I5DA 4HNAA 1YEWA 5IJ0B 2D3OW 3SJQC 2EILB 4RAIA 1XEQA 5K1XA 5LYJB 1MG1A 2AHYA 1QLEB 2QSAA 4ZOLB 4EEQA 3ZIAG 4G2KA 3HKEB 4LR3A 1KKDA 5KHIA 4LFCB 2Y4UA 2VWJA 1SESA 4X8AA 1W0JG 3E8BA 3K5OA 4AI8A 4X1IB 2VQEB 2DWEC 5LOVA 2OIEA 1K9MW 5CA0A 4CZZA 3LNNA 4DV2B 3JASA 1RSOA 4H44B 3ZBHA 2XASA 2RQ6A 4J11A 5LA6A 5LXTA 1Q3EA 1URFA 5KUMA 1PPJH 4BIUA 3G6BA 3WG7C 3RYIB 2PYJA 2BOBC 4R6ZA 1XMOB 4Z1VA 4CH6A 2H3OA 4X89A 2QWQB 3IC9A 4B3SB 4BIZA 4HNAB 1IVSA 2QE7G 5J2TA 3CYOA 2QKSA 3BA8A 3WG7B 4O4JA 5LL6Y 3OR6C 3K5LA 1CPYA 2Q7GA 1SKVA 1VARA 3G71V 2OIGA 1K5QA 2H94A 4K8XA 3JAWB 3CX5F 4ZI7A 2JGUA 3ABUA 3E83A 1Y74A 4YY3B 2WLIA 2X0LA 5LOVB 4DR5O 1HNXB 3CRAA 2ZE5A 5CA0B 4G28B 2B5UA 4JI5B 3JASB 1RSOB 3D3IA 3F5TA 3RWRD 1E1RG 1VQKV 2LO1A 3FX7A 3NXSA 5LXTB 3CCEV 4DR2O 1L0NH 1DK1A 4DV2O 3LSQA 4A5UB 4Z2WA 4GKJO 4KFMA 1J95A 4JI0B 4MVZA 1IXBA 2QR4A 3LSUA 2OTJV 2QKAA 2F66C 4WFEA 1K34A 3CXCU 4UB6Z 4L87A 1XNRB 3L9DA 4PA3A 2ARHA 2WLMA 1IDSA 2YEVA 5DECA 1H2LA 2GV9A 4ZI7B 3JSNA 3PN1A 2UUBO 3L72H 3H1KH 2WLIB 4LF7B 4U7OA 2DOSA 4LNUA 3FB5C 2BTQA 4B3MB 5L3DA 2UXDB 4DV4B 5HFMA 2RCVA 4MVUA 1YHQV 4LF9B 3FB7C 1TA8A 1GTOA 2ZE6A 1KB9F 2PI5A 1H2MA 3OGCC 4GX0A 3ZHVA 2EJRA 3L73H 1H8EG 4OXSA 2P4KA 1EM1A 3STLC 4LF5O 2CTQA 1R3IC 1THZA 3K06A 2YI9A 5EBLC 4DV6B 2JS5A 3SYPA 5JCOA 3LSSA 4GYCB 3N2KA 4DR1B 5CBGA 5L3GA 2XAGA 5B1BB 1IBMB 5KAFZ 2YEVB 4ABMA 1EBOA 3MDSA 5KHHA 1EZJA 2LW7A 3AG1B 4FM1A 1X59A 4B3TO 1XNRO 2ITCC 1GM8A 3ETDA 1M56C 3N2GB 4LNUB 2XAFA 2QWPB 1UPGA 1QHTA 2GTAA 1N0JA 2YUAA 3IFXA 2WPDG 4DV5B 3O65A 1ZLZA 5KHGA 3K0GA 2FTKA 3H1JH 3ZMTA 2GTSA 2P22C 1M56B 3APOA 3B8NA 3U0ZA 4D7SA 1JOYA 2HFEC 3F7VC 4OPAA 1CP9A 1JCHA 3CCSV 4NTWA 2JDIG 3HKCB 2E5LB 3B09A 5JCOC 1M57C 4MTFA 4X1KA 5E1AC 5LBQA 1AILA 4DUZO 4LF9O 4NYKA 1ENVA 5LHGA 4MT8A 1FXVA 4IIJA 1BQ0A 3VOUA 2XTAA 3D3QA 2KG7A 2CTWA 1FAFA 1JA8A 1XREA 3K9SA 1B3QA 3AEIA 1M57B 4FFBB 4O2AA 2WLJA 1SQPH 1MA1A 4JYAO 4MVSA 2HJFC 2NN4A 2CAZC 4W4KA 3RYCA 2WSSG 3RGBA 4NVPA 4X62O 1OJHA 2EIKC 2JJ1G 4MSWC 3FYEB 1QLNA 4MTGA 1EZVH 4FPPA 4JTDB 4JI8O 3F5WC 4TT3G 4QIWF 4U3JA 3RT3C 4DV3O 3VQYA 3JD4A 2OTLV 1F4MA 4LF6O 2EIKB 1XDCA 2K1EA 1QCEA 1F7YA 2GHYA 1AROP 2EULA 4EB6B 1R6TA 2QM8A 1QU7A 3K03A 5LMUO 5B5EZ 3ABLC 2Q7HA 1XL4A 3SPCA 3BVOA 2RMKB 1YF2A 1K4CC 4JI3B 3RYHA 2ZM6O 1L0LH 3CP1A 4LC1A 4N23A 1H8HG 4LF4B 2Z5UA 4RO2A 1JPXA 1WA8A 4PJ0Z 2PY5A 3B8MA 2KG7B 3CC4V 3ABLB 3M99B 3GWKC 1IX9A 4O2BA 3SJBC 4DV0O 4PDVA 3CWBH 1QVGU 1VF6A 1MABG 3CCUV 4JV5O 4WFGA 2EINC 3EHBB 5KLVH 3P30A 1AB3A 4TQDA 1XMQO 5KMGA 4FM2A 1U97A 5ITZA 4GKKB 1KD1W 3KG2A 4UCTA 4J9ZB 1SQGA 3ZHTA 2EINB 2CTPA 4YHHO 1AI4A 4Q20A 4FLXA 3MHHC 1SQFA 3SPHA 5C8YA 2WLLA 1FJGO 5JJJB 1JX9A 2QDOA 4NKGB 3IJ4A 4I9WA 4GLXA 5D5PA 1G4YB 4X64B 3L74H 1VF6C 2LW1A 3RYHB 4GCZA 1K97A 1OV9A 3BPZA 2VRZA 1WA8B 3TETA 4LH6A 5BY1A 1Q6HA 4O2BB 1KP2A 1AVMA 4FMTA 1RM1C 1ZX3A 2AXTZ 2ZT9B 1GRJA 1LR1A 2B1IA 1K7DA 5KMGB 5ITZB 3ZHSA 2A7WA 4DR3B 4BW5A 1VF5B 2P6JA 3OEEG 4UCRA 1JJ2U 3H9VA 2F95B 2QM4A 2FB5A 2VQFB 1GMGA 1RM1B 1A32A 1Q43A 2IJIA 3ABTA 1AP6A 1B06A 5IYDO 3W7UA 2ATKC 1W2BU 1SZTA 5IE9A 1O9HA 2OCCC 4MTOA 1PL0A 1MSWD 1BL8A 3RBZA 4EKWA 2K9PA 2Y69C 3W7WA 2YIDA 1YXBA 4JI1B 1WB7A 3OTOO 4JI7O 4DUYB 4WFHA 4X65B 4FLTA 4XDKA 2E75B 3OW2U 1ZAUA 3I56V 2Y69B 4PD4F 2EZOA 5LMNO 1FFTB 1M93A 2GDSA 3BA9A 4O4HB 1VQ8V 1M9NA 1N33O 1NQTA 1MSDA 1GN3A 1KMIZ 4NTXA 1F23A 2MK3A 5HFLA 3JAMN 1GM7A 4YIPA 1XNQO 3OUFA 4F6EA 2UU9B 2BSKA 3JATB 1V9PA 3HKEA 4HBNA 2DYSC 3RW0A 5EZYA 1JVMA 4MVRA 3LNMB 2N05A 3T4DA 4EFBA 3X2QC 5AG2A 1L1FA 3VQWA 1Q86W 3T1YO 2DYSB 3SJAC 3AG2C 1D2DA 3T2MA 3A2FA 4WFAV 1HR0B 4NXMB 2YIAA 1SC5B 1R3JC 1WLEA 1NTKH 2Y4TA 2EBOA 3X2QB 1Q81W 3ABMC 3IC7A 4NXNO 1N36B 4WFBV 3AG2B 1P84F 1K92A 1AR5A 4UB8Z 1QLEC 1M1KW 2XT9A 5JQGA 3ABKC 1FS0G 3OFNG 3SPGA 1N8RW 1RPRA 2QKCA 1MOFA 2ZCEA 3ZMSA 1M90W 2P67A 2HKOA 3ABMB 1FXHA 1EN5A 4I50A 4JAUA 1E79G 4MW3A 1N32O 2M6YA 3ABKB 4IT5A 2ZR3A 2BSKB 3RFRA 5IYZA 4WCEV 3JSLA 3JAWA 4TSFG 3OMIB 2YICA 4OGQB 4LFAB 5EZYB 3SYAA 2UUAB 2ADQB 1VQ7V 2F23A 2UU9O 1ZTEA 3OM3B 4BAYA 3ZCCA 3CE2A 1JMKC 3DSQA 2ZR2A 3J80N 1FKAO 4BR6A 1MZEA 3P3NA 1ZL8A 4AQYB 4RQEA 4F6RA 3CRRA 5D5QA 1FXKC 2QJ1A 2UXCO 4Q6GA 4DRXB 2WLNA 5JQGB 1K8AW 4AHCA 3LDDA 5B3SB 1F51A 4OX9B 1S5LZ 2X6AA 4BIOA 3BY6A 5K1PA 1FXKB 3U10A 1U96A 1VMGA 4I50B 3W7TA 3NR7A 1VQNV 1BHBA 1N34B 2IH1C 3SJCC 2FL4A 3SDLA 1JFFB 1HNZB 5IYZB 2UUCB 4LH7A 1ZSPA 3ETGA 4UUJC 1BT8A 2FMLA 2YSUB 4J7JA 2IJHA 4DW0A 3E8FA 2QTSA 4UV9A 1X4TA 1XOUA 4X20B 1DTOA 2IJJA 2M7WA 4LFCO 4OPHA 4LP8A 4I4TB 5EIBC 3ZEDA 1D5AA 4LFAO 2CGOA 4B3RB 2R9AA 2YXHA 1WP8A 2VQEO 1ZL8B 1PNLA 1VQ9V 2XOKG 4F6RB 1DF4A 2MW2B 4JI6B 1NVPD 2Q4PA 5GW7A 4FIPC 2Q5ZA 4J80A 4CS3A 3QF7A 1ORQC 1RPOA 1JQ0A 1N0NA 2EX3A 5LP6A 2Q0AA 4PDMA 3ML0A 4JI2B 1XMOO 2WLKA 2Y48A 4B3SO 2ZXWB 2WWWA 2ETNA 5L3EA 3K59A 4ZIBA 2DMXA 3TXQA 3H01A 3CCMV 4TOIA 3CS5A 5EIBD 5E79Z 4DR7B 3JALA 5KHKA 2DQ3A 1J5EB 3TK1A 2PYLA 5H6QA 4LWSA 2BE3A 1AI7A 4NB5A 3WB2A 3E8GA 3N2GA 5LGTA 1BQZA 2P4VA 1BE3H 1R6KA 5GTIZ 4JI4B 3OR7C 5J2UB 3ZRSA 5JJEB 3BABA 4JYBA 1XHZA 1SA0B 1GAXA 3FAVA 2JEUA 1IXMA 3FFQA 4YY3O 1Q7YW 1HNXO 2YS8A 1B04A 2IBZH 1QQCA 5LP6C 4GUNA 2OYQA 2OCHA 4LFBB 4K0KB 4JI5O 3HKCA 3C90A 4UVAA 1NI8A 4U7NA 3OMNB 1WB8A 5CB4A 4UCSA 3KCYA 1TVKA 2QTOA 3K0DA 5B1BC 2V4DA 4J10A 4NTYA 2JK5C 5EC2C 1HNWB 1XL6A 2RDCA 5LP6B
chains in the Genus database with same CATH topology
3AG1C 2QEXV 3CC4V 1K3EA 3ABLB 3M99B 1Y66A 2P7TC 3SYOA 4QE9A 1QVGU 1OZ0A 4PDVA 3E8HA 1MABG 3CCUV 3E89A 2DWDC 4H37A 4WFGA 2EINC 1QR8A 2WAMA 3ZMVA 4QJFB 4H33A 3ASOC 3EHBB 1VQMV 3QO5A 3E2EA 3JD3A 1BMFG 3VBBA 1QVFU 3P30A 3BEHA 5CBHA 3CCRV 3ZRWA 2DQ0A 3ZMUA 1YJNV 1NVPB 1K4DC 4G27B 1KD1W 1NJIW 3KG2A 2QA4V 2A79B 1PNKA 4J9ZB 1AI5A 1COWG 2EINB 1AI6A 1GK9A 5LHIA 3ASOB 2XAJA 1AI4A 4Q20A 4MTXA 3ZMZA 1QBZA 3MHHC 2AHZA 3LDEA 3SPHA 1V55C 3CC2V 3SPIA 2WLLA 3ZRVA 1P7BA 2H8PC 1JX9A 1Y4MA 5DM6V 4QPKA 3P32A 4ZBMA 1I5YA 5EBWC 3K04A 4ASUG 4I9WA 1OHHG 5IYCO 1P4RA 3K3WA 2IW5A 1G4YB 1YJ9V 5EBMC 2ZXWC 4Z1MG 5B1OA 3UM7A 2V1DA 4R7CA 4GCZA 1K97A 4UVBA 3K9AA 1V55B 3UKMA 5LHHA 5EC1C 1K33A 2ZDIA 2Z3YA 2EILC 1Q82W 1NH2B 4HZ3A 1NKDA 3TETA 2Q6AA 1VQOV 2HR3A 5L3CA 2ZD9A 3CCVV 4HYOA 4FJCC 1KP2A 3AG4C 1GO3F 4MW8A 3DTUB 2LFRA 4FMTA 1RM1C 1VQ5V 5C93A 3A0RA 2WLHA 2D3OW 3OUSA 1YTFB 1GKFA 3SJQC 1S76D 2EILB 3AG3C 2B1IA 1K7DA 2DYRC 4RAIA 3ZRWB 4JF3A 3G4SV 1MG1A 4JYCA 4BW5A 2AHYA 2P6JA 3LDCA 1ZWIC 3OEEG 1QLEB 3AG4B 1NH2D 1H38A 4WF9V 3W7XA 1JJ2U 1F4NA 4WFFA 3ZIAG 1GMGA 1RM1B 4G2KA 1KKDA 5L3FA 3B77A 2IJIA 3RVZA 3ABTA 5IYDO 3W7UA 1SESA 2ATKC 3FKSG 1SZTA 4X8AA 1W2BU 3AG3B 1W0JG 1HWYA 3E8BA 2DYRB 4PDRA 2OCCC 4MTOA 1PL0A 1MSWD 1BL8A 2DWEC 1YTFD 1W0KG 2ZDIC 3RBZA 4EKWA 3W7WA 2Y69C 1K9MW 1YJWV 4MVOA 4R50A 4CZZA 3K08A 2CK3G 2IJKA 4JPRA 3EFFK 1VQLV 4WFHA 4RUFA 2XASA 4XDKA 1BHAA 5KUMA 2R9RB 3OW2U 4BIUA 1NR7A 3I56V 3WG7C 2Y69B 2EZOA 1K5SA 2BOBC 4J9YB 4R6ZA 1FFTB 3G6EV 4RUEA 3SPJA 3K79A 3CC7V 4X89A 1VQ8V 1UJWB 1AJNA 1SERA 1M9NA 1NQTA 3ETEA 4BIZA 2EZPA 2QE7G 1F23A 3CYOA 5EK0A 2MK3A 2QKSA 4PA6A 5HFLA 3WG7B 4MVMA 1GM7A 3OMAB 3OUFA 1R6NA 3OR6C 4P9PA 1CPYA 2BOCC 2DYSC 4PELA 3JYCA 3G71V 5L3BA 5IY5C 1K5QA 2H94A 2ITDC 1PKXA 2HLDG 3JCZA 3R65A 3RW0A 1JVMA 4MVRA 3FYIB 3ABUA 3E83A 3LNMB 2XNDG 4JTAB 3T4DA 3X2QC 2WLIA 2X0LA 1L1FA 3STZC 5CMUA 4PA9A 4MVQA 2X6BA 4GT1A 1Q86W 1ROPA 2DYSB 4G28B 3AG2C 3ZRXA 4QNHB 3T2MA 2B5UA 3E35A 5LGNA 5IY5B 4WFAV 1TUEB 3D3IA 3E86A 1E1RG 1VQKV 1R3JC 1WLEA 3JD2A 3NXSA 5IYBO 2EBOA 5KA6A 1CEZA 2W0FC 3CCEV 3X2QB 1Q81W 3DGEA 4ZKIA 3ABMC 3IC7A 2XAQA 5DN6G 3LSQA 4WFBV 3AG2B 1K92A 3SYCA 1M1KW 1QLEC 4KFMA 3MHSC 1DLBA 3ABKC 4JAVA 1FS0G 3OFNG 3CCLV 3CPWU 1J95A 2HVKC 3SPGA 4XBFA 4MVZA 5FL7G 1N8RW 1RPRA 1AJQA 4R8CA 4YXWG 1MOFA 3W7SA 2OTJV 1KC8W 3PJSK 4XDJA 3ZMSA 1M90W 2P67A 2HKOA 4WFEA 3ABMB 4JGSA 1FXHA 1K34A 3T4ZA 1YSCA 3CXCU 3ZN1A 4JAUA 1E79G 4MW3A 2GSMB 4L87A 5BZBA 1R73A 2P90A 4PA3A 3ABKB 4RQFA 2ZR3A 2X6CA 2WLMA 1V54B 2B1GA 4WCEV 4TSFG 3OMIB 3TCUA 1VQPV 2YEVA 4LCUC 4X88A 3SYAA 4PA4A 1VQ7V 1OCRC 4UVCA 2WLIB 2JIZG 4MS2A 3MD0A 4FK5C 5H6RA 4U7OA 3OM3B 2F43G 3FB5C 2JEXA 2JJ2G 2EIJC 4BAYA 3RVYA 3ZCCA 2A9HA 2ZR2A 5L3DA 4KUMA 4RQEA 5HFMA 4MVUA 4N21A 1YHQV 4JASA 3FB7C 2QM7A 1OCRB 1K73W 3QO7A 1GTOA 2C2AA 2EIMC 2ZQMA 1FXKC 3OE7G 2NLJC 4HAMA 2PI5A 2EIJB 4CBCA 1YITV 2WLNA 4GX0A 3OGCC 3D36A 1K8AW 2EJRA 3HPLC 2IU3A 3LDDA 1PD3A 1OCCC 1H8EG 2W6IG 1OCZC 4TWKA 4OXSA 1AJPA 3STLC 1F51A 4QPJA 5B3SB 1R3IC 2X6AA 1THZA 3LUTB 3BY6A 1AR1B 1S77D 1S5HC 3K06A 2EIMB 5EBLC 4E2LA 1OCOC 1FXKB 5B1NA 2LP7A 3SYPA 5LGUA 3W7TA 2Q67A 1VQNV 1BHBA 5J9PC 1KECA 1SETA 3FB6C 2IH1C 5CA3A 3FB8C 1YIJV 4XDLA 3LSSA 3CMEV 5CBGA 3GWOA 5L3GA 1OCCB 2XAGA 5B1BB 1OCZB 5B1AC 3ETGA 3QNEA 1S3JA 2YEVB 4UUJC 1EBOA 1OCOB 1EZJA 3AG1B 1QR9A 2IH3C 2KB1A 1B6QA 2YSUB 1KQSU 2IJHA 1GM8A 2ITCC 1M56C 3ETDA 3E8FA 3OEHG 4LBEC 2HG5C 4UV9A 1DF5A 1EFRG 2X7RB 2XAFA 1DTOA 2IJJA 2M7WA 1I5XA 4LP8A 1VQ4V 1H2GA 3IFXA 5B1AB 4QE7A 2WPDG 4P2ZA 2R9IA 4KP4A 1VQ6V 3K0GA 4P30A 4I5SA 2FTKA 2HVJC 3ZMTA 1PNLA 1VQ9V 3SYQA 2XOKG 1M56B 1DF4A 3B8NA 4UV8A 2Q69A 1JOYA 2HFEC 3F7VC 1NVPD 5GW7A 1CP9A 1E1QG 1JCHA 3JD0A 4FIPC 3CCSV 2JDIG 3WFVA 4DO2A 1M57C 4MTFA 5E1AC 3CCQV 5LBQA 1V54C 3CCJV 2NNUA 1ENVA 4GX5A 5LHGA 4MT8A 1FXVA 3ZN0A 2PI4A 1ORQC 1RPOA 3VOUA 1JQ0A 1FXKA 2V7QG 3ML0A 4PDMA 5KUKA 4PA7A 1NBMG 2WLKA 3QO8A 4GX2A 5CN0A 2Y48A 3I55V 5KA5A 3AEIA 2ZXWB 2WWWA 5L3EA 1M57B 4DXWA 2WLJA 3OAAG 4MVSA 2UXNA 2HJFC 3H01A 1SRYA 3CCMV 1LNQA 2WSSG 1R3LC 2EIKC 2DQ3A 4JTCB 5CBFA 2JJ1G 5H9CA 3TK1A 1S72V 5H6QA 2XAHA 4MSWC 3FYEB 1QLNA 4MTGA 1AI7A 4FPPA 3E8GA 4JTDB 2UXXA 5LGTA 3T1CA 3F5WC 3ZJZA 4TT3G 2IU0A 2Q68A 1R6KA 1R3KC 1KP3A 4QIWF 1S0VA 3OR7C 3ZRSA 2DW4A 4JYBA 4P9OA 3JD4A 2OTLV 1F4MA 1GM9A 2JEUA 2EIKB 3GB7C 1IXMA 2K1EA 1QCEA 3F7YC 2GHYA 1AROP 3IGAC 5B3SC 5IDJA 2WLLB 3JD1A 4PDLA 1Q7YW 3CMAV 2QM8A 3K03A 3ASNC 4F4LA 3ABLC 3HB3B 1G8MA 1XL4A 3SPCA 2LFSA 3CD6V 2A0LA 4UXNA 4UVAA 1K4CC 1NR1A 4GX1A 4U7NA 3OMNB 1YI2V 2W6JG 3CP1A 4LC1A 4N23A 2QTOA 3K0DA 5B1BC 1H8HG 2OCCB 2Z5UA 1PNMA 2JK5C 2OT5A 5EC2C 4RO2A 1XL6A 1JPXA 1WPXA 3B8MA 3ASNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 C;  3E8B A;  4R8C A;  4PDR A;  2OCC C;  4MTO A;  1BL8 A;  2P7T C;  3SYO A;  4QE9 A;  4LP8 A;  2DWE C;  4PDV A;  3E8H A;  3IFX A;  3PJS K;  4QE7 A;  3RBZ A;  4EKW A;  2Y69 C;  3E89 A;  4XDJ A;  2DWD C;  4P2Z A;  4H37 A;  4WFG A;  2EIN C;  3K0G A;  4MVO A;  3K08 A;  4P30 A;  4R50 A;  4WFE A;  3T4Z A;  2HVJ C;  4H33 A;  3ASO C;  4MW3 A;  3SYQ A;  5BZB A;  4PA3 A;  3BEH A;  5CBH A;  3EFF K;  2Q69 A;  2X6C A;  4WFH A;  2HFE C;  4RUF A;  2WLM A;  3F7V C;  1K4D C;  4G27 B;  4XDK A;  5KUM A;  2R9R B;  3KG2 A;  2A79 B;  3TCU A;  2YEV A;  4J9Z B;  4LCU C;  3WG7 C;  1M57 C;  4MTF A;  5E1A C;  1V54 C;  2BOB C;  4R6Z A;  4J9Y B;  4X88 A;  4RUE A;  4GX5 A;  3SYA A;  4PA4 A;  3SPJ A;  1ORQ C;  4X89 A;  1OCR C;  2WLI B;  3VOU A;  4MS2 A;  2AHZ A;  3LDE A;  4PDM A;  5KUK A;  4PA7 A;  3FB5 C;  3SPH A;  1V55 C;  2WLK A;  3SPI A;  2WLL A;  2EIJ C;  1P7B A;  4GX2 A;  2H8P C;  3RVY A;  2A9H A;  5EK0 A;  4PA6 A;  2QKS A;  4ZBM A;  5EBW C;  4MVM A;  4DXW A;  2WLJ A;  3K04 A;  4I9W A;  4MVS A;  2HJF C;  1G4Y B;  4MVU A;  3OUF A;  2ZXW C;  3OR6 C;  4P9P A;  3FB7 C;  5EBM C;  3UM7 A;  1LNQ A;  1R3L C;  2BOC C;  4R7C A;  2EIM C;  2EIK C;  4JTC B;  2DYS C;  5CBF A;  2NLJ C;  3JYC A;  3UKM A;  4MSW C;  4CBC A;  4MTG A;  5IY5 C;  5EC1 C;  2ITD C;  4JTD B;  3E8G A;  2WLN A;  4GX0 A;  3OGC C;  2EIL C;  3T1C A;  3R65 A;  4HZ3 A;  3RW0 A;  3F5W C;  3ZJZ A;  1JVM A;  3HPL C;  4MVR A;  3TET A;  2Q6A A;  3LDD A;  3E83 A;  2Q68 A;  3LNM B;  1OCC C;  1R3K C;  1OCZ C;  4JTA B;  4TWK A;  2ZD9 A;  4OXS A;  3T4D A;  3OR7 C;  3X2Q C;  2WLI A;  4HYO A;  3STL C;  3AG4 C;  3ZRS A;  4P9O A;  1R3I C;  3STZ C;  2X6A A;  3LUT B;  4MW8 A;  1S5H C;  3K06 A;  4PA9 A;  5EBL C;  3GB7 C;  1OCO C;  2X6B A;  2K1E A;  4MVQ A;  4G28 B;  3AG2 C;  3SYP A;  3F7Y C;  3IGA C;  4QNH B;  3T2M A;  5B3S C;  2WLH A;  2Q67 A;  2WLL B;  3OUS A;  4PDL A;  5J9P C;  3FB6 C;  3SJQ C;  2IH1 C;  3E86 A;  3FB8 C;  3AG3 C;  3ASN C;  3K03 A;  4F4L A;  1R3J C;  4RAI A;  2DYR C;  4XDL A;  3ABL C;  1XL4 A;  3SPC A;  5CBG A;  2A0L A;  4BW5 A;  2AHY A;  3LDC A;  2W0F C;  1ZWI C;  1K4C C;  4GX1 A;  5B1A C;  3ABM C;  4UUJ C;  2QTO A;  4WFF A;  3K0D A;  2IH3 C;  5B1B C;  1KKD A;  2KB1 A;  3SYC A;  1QLE C;  4KFM A;  3RVZ A;  2JK5 C;  2ITC C;  1M56 C;  3ABK C;  3E8F A;  4LBE C;  4RO2 A;  5EC2 C;  1XL6 A;  1J95 A;  2HG5 C;  2HVK C;  3SPG A;  2ATK C;  4MVZ A;  4X8A A; 
#chains in the Genus database with same CATH topology
 3AG1 C;  3A8T A;  3HR0 A;  1Y67 A;  4TV9 B;  3ICX A;  1MMM A;  3CRM A;  4JI0 O;  4CS4 A;  4FFB A;  3E89 A;  2DWD C;  3WB1 A;  5JWP A;  3ZMV A;  1VQM V;  4AIL C;  1FD9 A;  3BEH A;  5CBH A;  3JAL B;  4WBN B;  4TUY B;  4G27 B;  1HDJ A;  4LWS B;  1NJI W;  1PNK A;  1AI5 A;  4B08 A;  1COW G;  5GON A;  1GK9 A;  3UO2 A;  1IBK B;  3ZMZ A;  2XUM A;  4JYY A;  1XQ8 A;  2AHZ A;  3FAV B;  4DR4 B;  1V55 C;  4H13 B;  1P7B A;  4B7K A;  4EB6 A;  3BHP A;  5BR8 B;  4LF7 O;  4QPK A;  3P32 A;  4ZBM A;  3CB2 A;  4B3M O;  3K04 A;  1FPO A;  5IYC O;  1ZUQ A;  1P4R A;  1VIB A;  4JI4 O;  3A0H Z;  5B1O A;  2UXD O;  4DV4 O;  2V1D A;  4R7C A;  5CB4 B;  5CA1 A;  1TVK B;  3K9A A;  1V55 B;  3UKM A;  5EC1 C;  1K33 A;  2ZDI A;  2Z3Y A;  2ILM A;  1NH2 B;  2F4V B;  3CXH F;  3CSX A;  4K0K O;  2F93 B;  4FZ1 A;  4E4E A;  3CCV V;  3AG4 C;  1GO3 F;  4MW8 A;  2LFR A;  2L35 A;  3A0R A;  3VQV A;  4GZR B;  3H1L H;  1YTF B;  4CH3 A;  1S76 D;  4DV6 O;  1Q6I A;  4X66 B;  4JF3 A;  2IM9 A;  3LDC A;  3AG4 B;  1NH2 D;  1H38 A;  3W7X A;  2HP8 A;  1F4N A;  1IBL B;  4DV7 B;  4DR1 O;  1R1B A;  4WFF A;  1BZK A;  5GON B;  5L3F A;  4U3F H;  3L75 H;  1IBM O;  1VF7 A;  1NTZ H;  3FKS G;  5KX5 A;  2YXL A;  3K5M A;  1YTF D;  1W0K G;  2ZDI C;  3ZX6 A;  2E3C A;  2Q7E A;  1YJW V;  4MVO A;  4R50 A;  3UT5 A;  5IJ9 A;  4DV1 B;  2CK3 G;  2AW9 A;  3ZHU A;  4DV5 O;  3JAK A;  3EFF K;  3P3P A;  1EN4 A;  5CA1 B;  2RNB A;  1YCI A;  2F1M A;  1NR7 A;  2G38 A;  5F2V O;  4J9Y B;  2WA4 A;  2UXB B;  4RUE A;  3ZHR A;  1QNM A;  2Y0P A;  2E5L O;  3SPJ A;  3CC7 V;  1YZB A;  2EZP A;  2O57 A;  5EK0 A;  4PA6 A;  2LGQ A;  2R70 A;  3CJH A;  1P49 A;  5GTH Z;  3OMA B;  1PL4 A;  4JZG A;  4J42 A;  1R6N A;  1Y6X A;  2QWO B;  5IT9 N;  1L8D A;  2BOC C;  4PEL A;  2YIB A;  5L3B A;  2ITD C;  2RJZ A;  4KHP B;  2HLD G;  3R65 A;  3FYI B;  3OT7 A;  3ZHQ A;  5KX5 B;  3S3X A;  5FNV A;  1SZX A;  3STZ C;  1XHX A;  2AGA A;  4PA9 A;  4MVQ A;  3ZRX A;  1G1X B;  3UT5 B;  4I0X A;  5IJ9 B;  5LGN A;  5IWA B;  1Q90 D;  3JAK B;  3E86 A;  1YVW A;  3THO A;  3JD2 A;  1TGO A;  1WPB A;  2R72 A;  2E74 B;  3OD4 A;  5KA6 A;  2W0F C;  3DGE A;  4ZKI A;  1RFY A;  1Q5O A;  2XAQ A;  5DN6 G;  3T1H B;  1BCC H;  3TXS A;  4O4H A;  4JI3 O;  3MHS C;  3AK1 A;  3CPW U;  2HVK C;  4XBF A;  3DC5 A;  1AJQ A;  3E22 A;  4R8C A;  4LF4 O;  4YXW G;  4FLV A;  4O4L A;  4FLU A;  3DXR A;  2AZ0 A;  2VS0 A;  2UXB O;  3CJH B;  4JGS A;  3T4Z A;  1YSC A;  3ZN1 A;  3AK3 A;  3JAT A;  4RQF A;  4J41 A;  2KKW A;  1V54 B;  2B1G A;  1HP8 A;  3TCU A;  1VQP V;  1W59 A;  4LCU C;  4GKK O;  2GUZ A;  3B40 A;  3H1I H;  1EN6 A;  4X88 A;  4TV8 B;  3QVN A;  5FNV B;  4UVC A;  1OCR C;  1M4U A;  4FK5 C;  2F43 G;  2JEX A;  2JJ2 G;  2A9H A;  4I0X B;  4IHJ A;  4LF8 B;  2YIB D;  4N21 A;  4JAS A;  2QM7 A;  3OTF A;  2N74 A;  4FZ0 A;  1OCR B;  1K73 W;  3QO7 A;  2C2A A;  2WA3 A;  4HAM A;  4DR6 B;  4KL1 A;  4X64 O;  1YIT V;  3D36 A;  1H2N A;  3HPL C;  3E22 B;  1OCC C;  2W6I G;  1OCZ C;  4TWK A;  4O4L B;  1AR1 B;  3LUT B;  3DXR B;  2BTO A;  4IGG A;  3L71 H;  5LGU A;  2Q67 A;  5J9P C;  2A3Q A;  3FB6 C;  4DK1 A;  2BCC H;  3FB8 C;  2CUG A;  3CME V;  1H2S B;  3GWO A;  1OCC B;  1OCZ B;  1S5J A;  1TUB A;  3QNE A;  3QG5 A;  4DR3 O;  2GUZ B;  1QR9 A;  2IH3 C;  1B6Q A;  1KQS U;  1H2K A;  3OEH G;  2PZS A;  4PHZ A;  5KHJ A;  2VQF O;  2Q9L A;  2ZNI A;  4FLZ A;  3BFR A;  3RN4 A;  1I5X A;  2P5O A;  4X9Q A;  3CHX A;  3D36 C;  4P2Z A;  4KP4 A;  4P30 A;  2HVJ C;  4IHJ B;  1SQQ H;  4YIO A;  4DYL A;  1NS1 A;  3D8C A;  4JI1 O;  5JVD B;  4DRX A;  1KU9 A;  3JD0 A;  2D2C B;  4YJ2 B;  4DUY O;  4X65 O;  3CCQ V;  3CCJ V;  2E76 B;  3JAR A;  4GX5 A;  3N27 A;  3ZN0 A;  2PI4 A;  1BGY H;  4I9Q A;  1FXK A;  3CRQ A;  5KUK A;  4PA7 A;  2XHB A;  3QO8 A;  2Q73 A;  3I55 V;  3G80 A;  1P7G A;  1MZF A;  1WPX A;  1JFF A;  2CE4 A;  4CS2 A;  1SRY A;  3L70 H;  5A9G A;  1R3L C;  1Z5V A;  1TUB B;  4JTC B;  5CBF A;  1YDX A;  5H9C A;  2YXY A;  2XAH A;  3EVK A;  3T1C A;  4X20 A;  3ZJZ A;  4DR5 B;  1SF9 A;  2IU0 A;  1KP3 A;  4I4T A;  2DW4 A;  4P9O A;  1GM9 A;  2N04 A;  3SR2 C;  3WU2 Z;  3HKB B;  3O9O A;  5B3S C;  3JD1 A;  3CMA V;  1WP7 A;  4DR2 B;  3ASN C;  1G8M A;  3ETQ A;  1SQX H;  2HJD A;  2A0L A;  4UXN A;  1HR0 O;  1SQV H;  4NXM O;  4GX1 A;  4GKJ B;  2HEP A;  1YI2 V;  2W6J G;  3BAA A;  3FD9 A;  3JAR B;  1PNM A;  4I55 A;  1N36 O;  3ASN B;  2QEX V;  1NTM H;  1K3E A;  4PV1 B;  1Y66 A;  4QE9 A;  1OZ0 A;  1I0H A;  3HKD A;  1QR8 A;  1WAZ A;  2CH7 B;  4H33 A;  3ASO C;  3EXA A;  3G67 A;  3QO5 A;  4FFK A;  2ZE8 A;  4J7Z A;  3ZRW A;  2DQ0 A;  3ZMU A;  3A0B Z;  5DED A;  1TAE A;  2QWN B;  1YJN V;  1NVP B;  4B7E A;  3M8A A;  2UUB B;  2QA4 V;  2LQT A;  1JJO A;  1AI6 A;  5LHI A;  5J2U A;  1KUQ A;  3ASO B;  1SA0 A;  4MTX A;  1QBZ A;  3LDE A;  3CC2 V;  3SPI A;  5H5N A;  3ZRV A;  2UUA O;  5DM6 V;  2JGD A;  4ASU G;  1XI1 A;  1OHH G;  1SQB H;  3K3W A;  1YJ9 V;  2ZXW C;  2EJ7 A;  3UM7 A;  3J81 N;  1Q6U A;  4AQY O;  2L6L A;  4BW9 A;  4UVB A;  5LHH A;  5LA6 B;  4I55 B;  1Q82 W;  4LF5 B;  2PGG A;  2Q6A A;  1UFI A;  4TV9 A;  3KZI Z;  2HR3 A;  5L3C A;  4FJC C;  3B4S A;  1GN6 A;  3DTU B;  1N4C A;  5H2F Z;  1JR9 A;  3HKD B;  5C93 A;  1VQ5 V;  1IUR A;  4OX9 O;  2WLH A;  3OUS A;  4WBN A;  1GKF A;  3QTC A;  4TUY A;  5J2T B;  3AG3 C;  3ZRW B;  2DYR C;  2LJ2 A;  2JRI A;  3APQ A;  4DK0 A;  4O4J B;  3G4S V;  4JYC A;  1N34 O;  1ZWI C;  4FM0 A;  4B3T B;  4WF9 V;  1WJZ A;  2B9Z A;  1HNZ O;  2UUC O;  3U11 A;  3B77 A;  3RVZ A;  3ZS8 C;  2ZIO A;  3AG3 B;  1HWY A;  2DYR B;  4PDR A;  3Q4H A;  4YJ3 A;  2AZ2 A;  1FFX A;  1Y74 B;  2JGD B;  5FPR A;  3K08 A;  1Z2G A;  4ICG A;  2IJK A;  2Q0O C;  1GN2 A;  4B3R O;  4JPR A;  1VQL V;  5TIS Z;  4RUF A;  1WNS A;  1BHA A;  4DUZ B;  3GVM A;  3CEI A;  1T5E A;  2R9R B;  4FLY A;  3RYF A;  4JI6 O;  1K5S A;  3G6E V;  1LUW A;  3S3W A;  2DE0 X;  2FYU H;  3K79 A;  1UJW B;  1AJN A;  1SER A;  2Y0I A;  2DJV A;  3ETE A;  3KKY A;  4FLW A;  4W4L A;  4JYA B;  4PI2 A;  4K3A A;  3DC6 A;  4JI2 O;  2LGW A;  4X62 B;  4MVM A;  2Z0A A;  3C3S A;  3K5N A;  2YDE A;  2GBO A;  4P9P A;  4ZHQ A;  5BMV A;  4JI8 B;  3JYC A;  5IY5 C;  2HHH B;  4DR7 O;  1PKX A;  4C7U A;  4CC6 A;  3JCZ A;  4DV3 B;  4UCV A;  1GN4 A;  1J5E O;  4LF6 B;  2XND G;  3Q4H B;  4JTA B;  4YJ3 B;  1FFX B;  5CMU A;  2X6B A;  4GT1 A;  5LMU B;  1ROP A;  1PV0 A;  4QNH B;  3TGU H;  1KYO F;  3E35 A;  2BTQ B;  5IY5 B;  1TUE B;  3OGI B;  2ZM6 B;  1AR4 A;  4FVM A;  1VP7 A;  5IYB O;  1CEZ A;  2QWR B;  4LFB O;  4RWU A;  1M5I A;  3RYF B;  1RP3 B;  3SYC A;  1Z5W A;  4TQF A;  3UQ8 A;  1DLB A;  3CCL V;  4JAV A;  4DV0 B;  1D5N A;  5FL7 G;  4JV5 B;  3KCX A;  4DW1 A;  3W7S A;  1KC8 W;  2QGN A;  3PJS K;  4XDJ A;  1HNW O;  3K57 A;  1XMQ B;  3IAY A;  4CH5 A;  2GSM B;  5BZB A;  1R73 A;  2P90 A;  4IYH A;  3VQX A;  3UO3 A;  4ZHQ B;  3K58 A;  2X6C A;  5BMV B;  3N2K B;  4BWA A;  4YHH B;  5BXZ A;  4PA4 A;  1FJG B;  2JIZ G;  4MS2 A;  3MD0 A;  4D7T A;  5H6R A;  2JS3 A;  1Q8I A;  2EIJ C;  1IBK O;  2HHH O;  3RVY A;  2PF4 E;  1G6U A;  4DR4 O;  2W0X A;  4KUM A;  2KQX A;  1NZ6 A;  5BR8 O;  4NR1 A;  1I08 A;  2ZQM A;  2EIM C;  3OE7 G;  2NLJ C;  2ADP A;  4PI0 A;  2EIJ B;  4CBC A;  4I7Z B;  2ZIN A;  2RN9 A;  4QGP A;  1XUQ A;  2YI8 A;  2IU3 A;  2ZKO A;  4X1K B;  1PD3 A;  4JZ2 A;  1AJP A;  4QPJ A;  2F4V O;  4IIJ B;  1S77 D;  2DN9 A;  4EFE A;  1S5H C;  2PTM A;  2EIM B;  4E2L A;  1OCO C;  5B1N A;  2YC0 A;  5A2Q N;  1CXZ B;  2LP7 A;  1XBL A;  1BSM A;  4UFZ A;  1KEC A;  1SET A;  5CA3 A;  1YIJ V;  4XDL A;  1HW7 A;  4O2A B;  5B1A C;  3RYC B;  4X66 O;  1S3J A;  1OCO B;  4TV8 A;  2KB1 A;  1I94 B;  1PP9 H;  2KSD A;  4LBE C;  1IBL O;  2OWO A;  2HG5 C;  4DV7 O;  1DF5 A;  3TJT A;  3BCC H;  1EFR G;  2X7R B;  1VQ4 V;  1H2G A;  5B1A B;  4QE7 A;  4U3J B;  1AP5 A;  4UCU A;  3OTO B;  2CGN A;  2R9I A;  1VQ6 V;  4JI7 B;  4I5S A;  3SYQ A;  3AG7 A;  4K35 A;  1NT2 B;  1Y76 A;  4UV8 A;  2Q69 A;  4DV1 O;  1PM9 A;  3MAQ A;  5LMN B;  3AK2 A;  1E1Q G;  2ODM A;  3R66 A;  1IZ3 A;  3WFV A;  4DO2 A;  4JAA A;  1V54 C;  1LUV A;  1N33 B;  3H1H H;  2NNU A;  2ZE7 A;  2A06 H;  4X1Y A;  2VWK A;  2V7Q G;  4CH4 A;  1SS3 A;  1NBM G;  2PUS A;  4GX2 A;  5CN0 A;  1NU1 H;  5KA5 A;  2ZNJ A;  1XNQ B;  4DXW A;  5FLX N;  2CTR A;  3OAA G;  2UXN A;  1LNQ A;  1FYJ A;  5KAI Z;  1S72 V;  1US6 A;  3CRC A;  2UXX A;  3C3T A;  4D6T H;  5JH7 A;  2Q68 A;  4KHP O;  1R3K C;  3T1Y B;  1S0V A;  1BS3 A;  1O9G A;  3GB7 C;  3F7Y C;  3IGA C;  1I94 O;  5IDJ A;  5C8Y B;  2WLL B;  4PDL A;  3JCU Z;  5EYP A;  4F4L A;  5JVD A;  1Y76 B;  3HB3 B;  1KBH A;  5IWA O;  2LFS A;  4NXN B;  3CD6 V;  2Q8V A;  4YJ2 A;  3B2E E;  1NR1 A;  1KKC A;  4O4I A;  2OCC B;  4X1Y B;  2OT5 A;  3M7M X;  2ZIM A;  4L8J A;  3T1H O;  1WN7 A;  4K8Z A;  2P7T C;  3SYO A;  3E8H A;  1XIL A;  1N32 B;  4H37 A;  2WAM A;  4QJF B;  4IYI A;  4H0L B;  5IJ0 A;  3E2E A;  3JD3 A;  1BMF G;  3VBB A;  1QVF U;  1DGS A;  3CCR V;  4CC5 A;  5B66 Z;  5LYJ A;  1K4D C;  4KXR A;  5JJN B;  2A79 B;  4ZOL A;  2CDY A;  5JH7 B;  2XAJ A;  5FPO A;  3HKB A;  4X1I A;  3UCS C;  3SGI A;  2H8P C;  1Y4M A;  1MNG A;  2FKX A;  1I5Y A;  5EBW C;  4UCO A;  5EYP B;  3BRC A;  2IW5 A;  5EBM C;  4Z1M G;  4IL6 Z;  2UXC B;  1VEW A;  2P06 A;  4LF8 O;  2JVD A;  1I7F A;  4J7K A;  4O4I B;  1GH6 A;  3WB0 A;  2EIL C;  3RYI A;  4HZ3 A;  1NKD A;  4DR6 O;  1VQO V;  2NR5 A;  3J7A U;  2ZD9 A;  4HYO A;  2CH7 A;  3I5D A;  4HNA A;  1YEW A;  5IJ0 B;  2D3O W;  3SJQ C;  2EIL B;  4RAI A;  1XEQ A;  5K1X A;  5LYJ B;  1MG1 A;  2AHY A;  1QLE B;  2QSA A;  4ZOL B;  4EEQ A;  3ZIA G;  4G2K A;  3HKE B;  4LR3 A;  1KKD A;  5KHI A;  4LFC B;  2Y4U A;  2VWJ A;  1SES A;  4X8A A;  1W0J G;  3E8B A;  3K5O A;  4AI8 A;  4X1I B;  2VQE B;  2DWE C;  5LOV A;  2OIE A;  1K9M W;  5CA0 A;  4CZZ A;  3LNN A;  4DV2 B;  3JAS A;  1RSO A;  4H44 B;  3ZBH A;  2XAS A;  2RQ6 A;  4J11 A;  5LA6 A;  5LXT A;  1Q3E A;  1URF A;  5KUM A;  1PPJ H;  4BIU A;  3G6B A;  3WG7 C;  3RYI B;  2PYJ A;  2BOB C;  4R6Z A;  1XMO B;  4Z1V A;  4CH6 A;  2H3O A;  4X89 A;  2QWQ B;  3IC9 A;  4B3S B;  4BIZ A;  4HNA B;  1IVS A;  2QE7 G;  5J2T A;  3CYO A;  2QKS A;  3BA8 A;  3WG7 B;  4O4J A;  5LL6 Y;  3OR6 C;  3K5L A;  1CPY A;  2Q7G A;  1SKV A;  1VAR A;  3G71 V;  2OIG A;  1K5Q A;  2H94 A;  4K8X A;  3JAW B;  3CX5 F;  4ZI7 A;  2JGU A;  3ABU A;  3E83 A;  1Y74 A;  4YY3 B;  2WLI A;  2X0L A;  5LOV B;  4DR5 O;  1HNX B;  3CRA A;  2ZE5 A;  5CA0 B;  4G28 B;  2B5U A;  4JI5 B;  3JAS B;  1RSO B;  3D3I A;  3F5T A;  3RWR D;  1E1R G;  1VQK V;  2LO1 A;  3FX7 A;  3NXS A;  5LXT B;  3CCE V;  4DR2 O;  1L0N H;  1DK1 A;  4DV2 O;  3LSQ A;  4A5U B;  4Z2W A;  4GKJ O;  4KFM A;  1J95 A;  4JI0 B;  4MVZ A;  1IXB A;  2QR4 A;  3LSU A;  2OTJ V;  2QKA A;  2F66 C;  4WFE A;  1K34 A;  3CXC U;  4UB6 Z;  4L87 A;  1XNR B;  3L9D A;  4PA3 A;  2ARH A;  2WLM A;  1IDS A;  2YEV A;  5DEC A;  1H2L A;  2GV9 A;  4ZI7 B;  3JSN A;  3PN1 A;  2UUB O;  3L72 H;  3H1K H;  2WLI B;  4LF7 B;  4U7O A;  2DOS A;  4LNU A;  3FB5 C;  2BTQ A;  4B3M B;  5L3D A;  2UXD B;  4DV4 B;  5HFM A;  2RCV A;  4MVU A;  1YHQ V;  4LF9 B;  3FB7 C;  1TA8 A;  1GTO A;  2ZE6 A;  1KB9 F;  2PI5 A;  1H2M A;  3OGC C;  4GX0 A;  3ZHV A;  2EJR A;  3L73 H;  1H8E G;  4OXS A;  2P4K A;  1EM1 A;  3STL C;  4LF5 O;  2CTQ A;  1R3I C;  1THZ A;  3K06 A;  2YI9 A;  5EBL C;  4DV6 B;  2JS5 A;  3SYP A;  5JCO A;  3LSS A;  4GYC B;  3N2K A;  4DR1 B;  5CBG A;  5L3G A;  2XAG A;  5B1B B;  1IBM B;  5KAF Z;  2YEV B;  4ABM A;  1EBO A;  3MDS A;  5KHH A;  1EZJ A;  2LW7 A;  3AG1 B;  4FM1 A;  1X59 A;  4B3T O;  1XNR O;  2ITC C;  1GM8 A;  3ETD A;  1M56 C;  3N2G B;  4LNU B;  2XAF A;  2QWP B;  1UPG A;  1QHT A;  2GTA A;  1N0J A;  2YUA A;  3IFX A;  2WPD G;  4DV5 B;  3O65 A;  1ZLZ A;  5KHG A;  3K0G A;  2FTK A;  3H1J H;  3ZMT A;  2GTS A;  2P22 C;  1M56 B;  3APO A;  3B8N A;  3U0Z A;  4D7S A;  1JOY A;  2HFE C;  3F7V C;  4OPA A;  1CP9 A;  1JCH A;  3CCS V;  4NTW A;  2JDI G;  3HKC B;  2E5L B;  3B09 A;  5JCO C;  1M57 C;  4MTF A;  4X1K A;  5E1A C;  5LBQ A;  1AIL A;  4DUZ O;  4LF9 O;  4NYK A;  1ENV A;  5LHG A;  4MT8 A;  1FXV A;  4IIJ A;  1BQ0 A;  3VOU A;  2XTA A;  3D3Q A;  2KG7 A;  2CTW A;  1FAF A;  1JA8 A;  1XRE A;  3K9S A;  1B3Q A;  3AEI A;  1M57 B;  4FFB B;  4O2A A;  2WLJ A;  1SQP H;  1MA1 A;  4JYA O;  4MVS A;  2HJF C;  2NN4 A;  2CAZ C;  4W4K A;  3RYC A;  2WSS G;  3RGB A;  4NVP A;  4X62 O;  1OJH A;  2EIK C;  2JJ1 G;  4MSW C;  3FYE B;  1QLN A;  4MTG A;  1EZV H;  4FPP A;  4JTD B;  4JI8 O;  3F5W C;  4TT3 G;  4QIW F;  4U3J A;  3RT3 C;  4DV3 O;  3VQY A;  3JD4 A;  2OTL V;  1F4M A;  4LF6 O;  2EIK B;  1XDC A;  2K1E A;  1QCE A;  1F7Y A;  2GHY A;  1ARO P;  2EUL A;  4EB6 B;  1R6T A;  2QM8 A;  1QU7 A;  3K03 A;  5LMU O;  5B5E Z;  3ABL C;  2Q7H A;  1XL4 A;  3SPC A;  3BVO A;  2RMK B;  1YF2 A;  1K4C C;  4JI3 B;  3RYH A;  2ZM6 O;  1L0L H;  3CP1 A;  4LC1 A;  4N23 A;  1H8H G;  4LF4 B;  2Z5U A;  4RO2 A;  1JPX A;  1WA8 A;  4PJ0 Z;  2PY5 A;  3B8M A;  2KG7 B;  3CC4 V;  3ABL B;  3M99 B;  3GWK C;  1IX9 A;  4O2B A;  3SJB C;  4DV0 O;  4PDV A;  3CWB H;  1QVG U;  1VF6 A;  1MAB G;  3CCU V;  4JV5 O;  4WFG A;  2EIN C;  3EHB B;  5KLV H;  3P30 A;  1AB3 A;  4TQD A;  1XMQ O;  5KMG A;  4FM2 A;  1U97 A;  5ITZ A;  4GKK B;  1KD1 W;  3KG2 A;  4UCT A;  4J9Z B;  1SQG A;  3ZHT A;  2EIN B;  2CTP A;  4YHH O;  1AI4 A;  4Q20 A;  4FLX A;  3MHH C;  1SQF A;  3SPH A;  5C8Y A;  2WLL A;  1FJG O;  5JJJ B;  1JX9 A;  2QDO A;  4NKG B;  3IJ4 A;  4I9W A;  4GLX A;  5D5P A;  1G4Y B;  4X64 B;  3L74 H;  1VF6 C;  2LW1 A;  3RYH B;  4GCZ A;  1K97 A;  1OV9 A;  3BPZ A;  2VRZ A;  1WA8 B;  3TET A;  4LH6 A;  5BY1 A;  1Q6H A;  4O2B B;  1KP2 A;  1AVM A;  4FMT A;  1RM1 C;  1ZX3 A;  2AXT Z;  2ZT9 B;  1GRJ A;  1LR1 A;  2B1I A;  1K7D A;  5KMG B;  5ITZ B;  3ZHS A;  2A7W A;  4DR3 B;  4BW5 A;  1VF5 B;  2P6J A;  3OEE G;  4UCR A;  1JJ2 U;  3H9V A;  2F95 B;  2QM4 A;  2FB5 A;  2VQF B;  1GMG A;  1RM1 B;  1A32 A;  1Q43 A;  2IJI A;  3ABT A;  1AP6 A;  1B06 A;  5IYD O;  3W7U A;  2ATK C;  1W2B U;  1SZT A;  5IE9 A;  1O9H A;  2OCC C;  4MTO A;  1PL0 A;  1MSW D;  1BL8 A;  3RBZ A;  4EKW A;  2K9P A;  2Y69 C;  3W7W A;  2YID A;  1YXB A;  4JI1 B;  1WB7 A;  3OTO O;  4JI7 O;  4DUY B;  4WFH A;  4X65 B;  4FLT A;  4XDK A;  2E75 B;  3OW2 U;  1ZAU A;  3I56 V;  2Y69 B;  4PD4 F;  2EZO A;  5LMN O;  1FFT B;  1M93 A;  2GDS A;  3BA9 A;  4O4H B;  1VQ8 V;  1M9N A;  1N33 O;  1NQT A;  1MSD A;  1GN3 A;  1KMI Z;  4NTX A;  1F23 A;  2MK3 A;  5HFL A;  3JAM N;  1GM7 A;  4YIP A;  1XNQ O;  3OUF A;  4F6E A;  2UU9 B;  2BSK A;  3JAT B;  1V9P A;  3HKE A;  4HBN A;  2DYS C;  3RW0 A;  5EZY A;  1JVM A;  4MVR A;  3LNM B;  2N05 A;  3T4D A;  4EFB A;  3X2Q C;  5AG2 A;  1L1F A;  3VQW A;  1Q86 W;  3T1Y O;  2DYS B;  3SJA C;  3AG2 C;  1D2D A;  3T2M A;  3A2F A;  4WFA V;  1HR0 B;  4NXM B;  2YIA A;  1SC5 B;  1R3J C;  1WLE A;  1NTK H;  2Y4T A;  2EBO A;  3X2Q B;  1Q81 W;  3ABM C;  3IC7 A;  4NXN O;  1N36 B;  4WFB V;  3AG2 B;  1P84 F;  1K92 A;  1AR5 A;  4UB8 Z;  1QLE C;  1M1K W;  2XT9 A;  5JQG A;  3ABK C;  1FS0 G;  3OFN G;  3SPG A;  1N8R W;  1RPR A;  2QKC A;  1MOF A;  2ZCE A;  3ZMS A;  1M90 W;  2P67 A;  2HKO A;  3ABM B;  1FXH A;  1EN5 A;  4I50 A;  4JAU A;  1E79 G;  4MW3 A;  1N32 O;  2M6Y A;  3ABK B;  4IT5 A;  2ZR3 A;  2BSK B;  3RFR A;  5IYZ A;  4WCE V;  3JSL A;  3JAW A;  4TSF G;  3OMI B;  2YIC A;  4OGQ B;  4LFA B;  5EZY B;  3SYA A;  2UUA B;  2ADQ B;  1VQ7 V;  2F23 A;  2UU9 O;  1ZTE A;  3OM3 B;  4BAY A;  3ZCC A;  3CE2 A;  1JMK C;  3DSQ A;  2ZR2 A;  3J80 N;  1FKA O;  4BR6 A;  1MZE A;  3P3N A;  1ZL8 A;  4AQY B;  4RQE A;  4F6R A;  3CRR A;  5D5Q A;  1FXK C;  2QJ1 A;  2UXC O;  4Q6G A;  4DRX B;  2WLN A;  5JQG B;  1K8A W;  4AHC A;  3LDD A;  5B3S B;  1F51 A;  4OX9 B;  1S5L Z;  2X6A A;  4BIO A;  3BY6 A;  5K1P A;  1FXK B;  3U10 A;  1U96 A;  1VMG A;  4I50 B;  3W7T A;  3NR7 A;  1VQN V;  1BHB A;  1N34 B;  2IH1 C;  3SJC C;  2FL4 A;  3SDL A;  1JFF B;  1HNZ B;  5IYZ B;  2UUC B;  4LH7 A;  1ZSP A;  3ETG A;  4UUJ C;  1BT8 A;  2FML A;  2YSU B;  4J7J A;  2IJH A;  4DW0 A;  3E8F A;  2QTS A;  4UV9 A;  1X4T A;  1XOU A;  4X20 B;  1DTO A;  2IJJ A;  2M7W A;  4LFC O;  4OPH A;  4LP8 A;  4I4T B;  5EIB C;  3ZED A;  1D5A A;  4LFA O;  2CGO A;  4B3R B;  2R9A A;  2YXH A;  1WP8 A;  2VQE O;  1ZL8 B;  1PNL A;  1VQ9 V;  2XOK G;  4F6R B;  1DF4 A;  2MW2 B;  4JI6 B;  1NVP D;  2Q4P A;  5GW7 A;  4FIP C;  2Q5Z A;  4J80 A;  4CS3 A;  3QF7 A;  1ORQ C;  1RPO A;  1JQ0 A;  1N0N A;  2EX3 A;  5LP6 A;  2Q0A A;  4PDM A;  3ML0 A;  4JI2 B;  1XMO O;  2WLK A;  2Y48 A;  4B3S O;  2ZXW B;  2WWW A;  2ETN A;  5L3E A;  3K59 A;  4ZIB A;  2DMX A;  3TXQ A;  3H01 A;  3CCM V;  4TOI A;  3CS5 A;  5EIB D;  5E79 Z;  4DR7 B;  3JAL A;  5KHK A;  2DQ3 A;  1J5E B;  3TK1 A;  2PYL A;  5H6Q A;  4LWS A;  2BE3 A;  1AI7 A;  4NB5 A;  3WB2 A;  3E8G A;  3N2G A;  5LGT A;  1BQZ A;  2P4V A;  1BE3 H;  1R6K A;  5GTI Z;  4JI4 B;  3OR7 C;  5J2U B;  3ZRS A;  5JJE B;  3BAB A;  4JYB A;  1XHZ A;  1SA0 B;  1GAX A;  3FAV A;  2JEU A;  1IXM A;  3FFQ A;  4YY3 O;  1Q7Y W;  1HNX O;  2YS8 A;  1B04 A;  2IBZ H;  1QQC A;  5LP6 C;  4GUN A;  2OYQ A;  2OCH A;  4LFB B;  4K0K B;  4JI5 O;  3HKC A;  3C90 A;  4UVA A;  1NI8 A;  4U7N A;  3OMN B;  1WB8 A;  5CB4 A;  4UCS A;  3KCY A;  1TVK A;  2QTO A;  3K0D A;  5B1B C;  2V4D A;  4J10 A;  4NTY A;  2JK5 C;  5EC2 C;  1HNW B;  1XL6 A;  2RDC A;  5LP6 B; 
#chains in the Genus database with same CATH homology
 3AG1 C;  2QEX V;  3CC4 V;  1K3E A;  3ABL B;  3M99 B;  1Y66 A;  2P7T C;  3SYO A;  4QE9 A;  1QVG U;  1OZ0 A;  4PDV A;  3E8H A;  1MAB G;  3CCU V;  3E89 A;  2DWD C;  4H37 A;  4WFG A;  2EIN C;  1QR8 A;  2WAM A;  3ZMV A;  4QJF B;  4H33 A;  3ASO C;  3EHB B;  1VQM V;  3QO5 A;  3E2E A;  3JD3 A;  1BMF G;  3VBB A;  1QVF U;  3P30 A;  3BEH A;  5CBH A;  3CCR V;  3ZRW A;  2DQ0 A;  3ZMU A;  1YJN V;  1NVP B;  1K4D C;  4G27 B;  1KD1 W;  1NJI W;  3KG2 A;  2QA4 V;  2A79 B;  1PNK A;  4J9Z B;  1AI5 A;  1COW G;  2EIN B;  1AI6 A;  1GK9 A;  5LHI A;  3ASO B;  2XAJ A;  1AI4 A;  4Q20 A;  4MTX A;  3ZMZ A;  1QBZ A;  3MHH C;  2AHZ A;  3LDE A;  3SPH A;  1V55 C;  3CC2 V;  3SPI A;  2WLL A;  3ZRV A;  1P7B A;  2H8P C;  1JX9 A;  1Y4M A;  5DM6 V;  4QPK A;  3P32 A;  4ZBM A;  1I5Y A;  5EBW C;  3K04 A;  4ASU G;  4I9W A;  1OHH G;  5IYC O;  1P4R A;  3K3W A;  2IW5 A;  1G4Y B;  1YJ9 V;  5EBM C;  2ZXW C;  4Z1M G;  5B1O A;  3UM7 A;  2V1D A;  4R7C A;  4GCZ A;  1K97 A;  4UVB A;  3K9A A;  1V55 B;  3UKM A;  5LHH A;  5EC1 C;  1K33 A;  2ZDI A;  2Z3Y A;  2EIL C;  1Q82 W;  1NH2 B;  4HZ3 A;  1NKD A;  3TET A;  2Q6A A;  1VQO V;  2HR3 A;  5L3C A;  2ZD9 A;  3CCV V;  4HYO A;  4FJC C;  1KP2 A;  3AG4 C;  1GO3 F;  4MW8 A;  3DTU B;  2LFR A;  4FMT A;  1RM1 C;  1VQ5 V;  5C93 A;  3A0R A;  2WLH A;  2D3O W;  3OUS A;  1YTF B;  1GKF A;  3SJQ C;  1S76 D;  2EIL B;  3AG3 C;  2B1I A;  1K7D A;  2DYR C;  4RAI A;  3ZRW B;  4JF3 A;  3G4S V;  1MG1 A;  4JYC A;  4BW5 A;  2AHY A;  2P6J A;  3LDC A;  1ZWI C;  3OEE G;  1QLE B;  3AG4 B;  1NH2 D;  1H38 A;  4WF9 V;  3W7X A;  1JJ2 U;  1F4N A;  4WFF A;  3ZIA G;  1GMG A;  1RM1 B;  4G2K A;  1KKD A;  5L3F A;  3B77 A;  2IJI A;  3RVZ A;  3ABT A;  5IYD O;  3W7U A;  1SES A;  2ATK C;  3FKS G;  1SZT A;  4X8A A;  1W2B U;  3AG3 B;  1W0J G;  1HWY A;  3E8B A;  2DYR B;  4PDR A;  2OCC C;  4MTO A;  1PL0 A;  1MSW D;  1BL8 A;  2DWE C;  1YTF D;  1W0K G;  2ZDI C;  3RBZ A;  4EKW A;  3W7W A;  2Y69 C;  1K9M W;  1YJW V;  4MVO A;  4R50 A;  4CZZ A;  3K08 A;  2CK3 G;  2IJK A;  4JPR A;  3EFF K;  1VQL V;  4WFH A;  4RUF A;  2XAS A;  4XDK A;  1BHA A;  5KUM A;  2R9R B;  3OW2 U;  4BIU A;  1NR7 A;  3I56 V;  3WG7 C;  2Y69 B;  2EZO A;  1K5S A;  2BOB C;  4J9Y B;  4R6Z A;  1FFT B;  3G6E V;  4RUE A;  3SPJ A;  3K79 A;  3CC7 V;  4X89 A;  1VQ8 V;  1UJW B;  1AJN A;  1SER A;  1M9N A;  1NQT A;  3ETE A;  4BIZ A;  2EZP A;  2QE7 G;  1F23 A;  3CYO A;  5EK0 A;  2MK3 A;  2QKS A;  4PA6 A;  5HFL A;  3WG7 B;  4MVM A;  1GM7 A;  3OMA B;  3OUF A;  1R6N A;  3OR6 C;  4P9P A;  1CPY A;  2BOC C;  2DYS C;  4PEL A;  3JYC A;  3G71 V;  5L3B A;  5IY5 C;  1K5Q A;  2H94 A;  2ITD C;  1PKX A;  2HLD G;  3JCZ A;  3R65 A;  3RW0 A;  1JVM A;  4MVR A;  3FYI B;  3ABU A;  3E83 A;  3LNM B;  2XND G;  4JTA B;  3T4D A;  3X2Q C;  2WLI A;  2X0L A;  1L1F A;  3STZ C;  5CMU A;  4PA9 A;  4MVQ A;  2X6B A;  4GT1 A;  1Q86 W;  1ROP A;  2DYS B;  4G28 B;  3AG2 C;  3ZRX A;  4QNH B;  3T2M A;  2B5U A;  3E35 A;  5LGN A;  5IY5 B;  4WFA V;  1TUE B;  3D3I A;  3E86 A;  1E1R G;  1VQK V;  1R3J C;  1WLE A;  3JD2 A;  3NXS A;  5IYB O;  2EBO A;  5KA6 A;  1CEZ A;  2W0F C;  3CCE V;  3X2Q B;  1Q81 W;  3DGE A;  4ZKI A;  3ABM C;  3IC7 A;  2XAQ A;  5DN6 G;  3LSQ A;  4WFB V;  3AG2 B;  1K92 A;  3SYC A;  1M1K W;  1QLE C;  4KFM A;  3MHS C;  1DLB A;  3ABK C;  4JAV A;  1FS0 G;  3OFN G;  3CCL V;  3CPW U;  1J95 A;  2HVK C;  3SPG A;  4XBF A;  4MVZ A;  5FL7 G;  1N8R W;  1RPR A;  1AJQ A;  4R8C A;  4YXW G;  1MOF A;  3W7S A;  2OTJ V;  1KC8 W;  3PJS K;  4XDJ A;  3ZMS A;  1M90 W;  2P67 A;  2HKO A;  4WFE A;  3ABM B;  4JGS A;  1FXH A;  1K34 A;  3T4Z A;  1YSC A;  3CXC U;  3ZN1 A;  4JAU A;  1E79 G;  4MW3 A;  2GSM B;  4L87 A;  5BZB A;  1R73 A;  2P90 A;  4PA3 A;  3ABK B;  4RQF A;  2ZR3 A;  2X6C A;  2WLM A;  1V54 B;  2B1G A;  4WCE V;  4TSF G;  3OMI B;  3TCU A;  1VQP V;  2YEV A;  4LCU C;  4X88 A;  3SYA A;  4PA4 A;  1VQ7 V;  1OCR C;  4UVC A;  2WLI B;  2JIZ G;  4MS2 A;  3MD0 A;  4FK5 C;  5H6R A;  4U7O A;  3OM3 B;  2F43 G;  3FB5 C;  2JEX A;  2JJ2 G;  2EIJ C;  4BAY A;  3RVY A;  3ZCC A;  2A9H A;  2ZR2 A;  5L3D A;  4KUM A;  4RQE A;  5HFM A;  4MVU A;  4N21 A;  1YHQ V;  4JAS A;  3FB7 C;  2QM7 A;  1OCR B;  1K73 W;  3QO7 A;  1GTO A;  2C2A A;  2EIM C;  2ZQM A;  1FXK C;  3OE7 G;  2NLJ C;  4HAM A;  2PI5 A;  2EIJ B;  4CBC A;  1YIT V;  2WLN A;  4GX0 A;  3OGC C;  3D36 A;  1K8A W;  2EJR A;  3HPL C;  2IU3 A;  3LDD A;  1PD3 A;  1OCC C;  1H8E G;  2W6I G;  1OCZ C;  4TWK A;  4OXS A;  1AJP A;  3STL C;  1F51 A;  4QPJ A;  5B3S B;  1R3I C;  2X6A A;  1THZ A;  3LUT B;  3BY6 A;  1AR1 B;  1S77 D;  1S5H C;  3K06 A;  2EIM B;  5EBL C;  4E2L A;  1OCO C;  1FXK B;  5B1N A;  2LP7 A;  3SYP A;  5LGU A;  3W7T A;  2Q67 A;  1VQN V;  1BHB A;  5J9P C;  1KEC A;  1SET A;  3FB6 C;  2IH1 C;  5CA3 A;  3FB8 C;  1YIJ V;  4XDL A;  3LSS A;  3CME V;  5CBG A;  3GWO A;  5L3G A;  1OCC B;  2XAG A;  5B1B B;  1OCZ B;  5B1A C;  3ETG A;  3QNE A;  1S3J A;  2YEV B;  4UUJ C;  1EBO A;  1OCO B;  1EZJ A;  3AG1 B;  1QR9 A;  2IH3 C;  2KB1 A;  1B6Q A;  2YSU B;  1KQS U;  2IJH A;  1GM8 A;  2ITC C;  1M56 C;  3ETD A;  3E8F A;  3OEH G;  4LBE C;  2HG5 C;  4UV9 A;  1DF5 A;  1EFR G;  2X7R B;  2XAF A;  1DTO A;  2IJJ A;  2M7W A;  1I5X A;  4LP8 A;  1VQ4 V;  1H2G A;  3IFX A;  5B1A B;  4QE7 A;  2WPD G;  4P2Z A;  2R9I A;  4KP4 A;  1VQ6 V;  3K0G A;  4P30 A;  4I5S A;  2FTK A;  2HVJ C;  3ZMT A;  1PNL A;  1VQ9 V;  3SYQ A;  2XOK G;  1M56 B;  1DF4 A;  3B8N A;  4UV8 A;  2Q69 A;  1JOY A;  2HFE C;  3F7V C;  1NVP D;  5GW7 A;  1CP9 A;  1E1Q G;  1JCH A;  3JD0 A;  4FIP C;  3CCS V;  2JDI G;  3WFV A;  4DO2 A;  1M57 C;  4MTF A;  5E1A C;  3CCQ V;  5LBQ A;  1V54 C;  3CCJ V;  2NNU A;  1ENV A;  4GX5 A;  5LHG A;  4MT8 A;  1FXV A;  3ZN0 A;  2PI4 A;  1ORQ C;  1RPO A;  3VOU A;  1JQ0 A;  1FXK A;  2V7Q G;  3ML0 A;  4PDM A;  5KUK A;  4PA7 A;  1NBM G;  2WLK A;  3QO8 A;  4GX2 A;  5CN0 A;  2Y48 A;  3I55 V;  5KA5 A;  3AEI A;  2ZXW B;  2WWW A;  5L3E A;  1M57 B;  4DXW A;  2WLJ A;  3OAA G;  4MVS A;  2UXN A;  2HJF C;  3H01 A;  1SRY A;  3CCM V;  1LNQ A;  2WSS G;  1R3L C;  2EIK C;  2DQ3 A;  4JTC B;  5CBF A;  2JJ1 G;  5H9C A;  3TK1 A;  1S72 V;  5H6Q A;  2XAH A;  4MSW C;  3FYE B;  1QLN A;  4MTG A;  1AI7 A;  4FPP A;  3E8G A;  4JTD B;  2UXX A;  5LGT A;  3T1C A;  3F5W C;  3ZJZ A;  4TT3 G;  2IU0 A;  2Q68 A;  1R6K A;  1R3K C;  1KP3 A;  4QIW F;  1S0V A;  3OR7 C;  3ZRS A;  2DW4 A;  4JYB A;  4P9O A;  3JD4 A;  2OTL V;  1F4M A;  1GM9 A;  2JEU A;  2EIK B;  3GB7 C;  1IXM A;  2K1E A;  1QCE A;  3F7Y C;  2GHY A;  1ARO P;  3IGA C;  5B3S C;  5IDJ A;  2WLL B;  3JD1 A;  4PDL A;  1Q7Y W;  3CMA V;  2QM8 A;  3K03 A;  3ASN C;  4F4L A;  3ABL C;  3HB3 B;  1G8M A;  1XL4 A;  3SPC A;  2LFS A;  3CD6 V;  2A0L A;  4UXN A;  4UVA A;  1K4C C;  1NR1 A;  4GX1 A;  4U7N A;  3OMN B;  1YI2 V;  2W6J G;  3CP1 A;  4LC1 A;  4N23 A;  2QTO A;  3K0D A;  5B1B C;  1H8H G;  2OCC B;  2Z5U A;  1PNM A;  2JK5 C;  2OT5 A;  5EC2 C;  4RO2 A;  1XL6 A;  1JPX A;  1WPX A;  3B8M A;  3ASN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...