4WFGA

Human traak k+ channel in a tl+ bound conductive conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 96
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfgA00
4R7CA 1ZWIC 2ATKC 3SYCA 2KB1A 4JTAB 1XL6A 2HVJC 4GX5A 2Q67A 4TWKA 3ASNC 4MVMA 2DWEC 3ABKC 3SPGA 3STLC 3OUFA 5KUMA 3T4ZA 4MVOA 3LDCA 1G4YB 5EK0A 4P2ZA 3KG2A 2Q68A 4WFEA 4G28B 2HG5C 2YEVA 5CBGA 1M57C 4UUJC 2EIKC 2NLJC 4DXWA 3IGAC 1OCZC 4PDMA 4CBCA 4JTDB 1QLEC 4JTCB 5BZBA 4P9OA 4MSWC 4LP8A 3ZJZA 5EC2C 3T1CA 5IY5C 2Q6AA 1M56C 4HZ3A 3LNMB 3F7YC 3GB7C 1BL8A 5CBHA 4XDKA 3LDEA 3K0GA 2DWDC 3FB5C 2A0LA 2HJFC 4P30A 2WLLB 2WLIA 3SPIA 2EINC 3WG7C 2ZD9A 4WFHA 2BOBC 2X6AA 2OCCC 3OR7C 4KFMA 3SYQA 4RUEA 3T2MA 4H33A 4MVZA 4MVQA 5EBWC 3UKMA 2BOCC 4MTFA 4R6ZA 3SYAA 2WLNA 4RAIA 3PJSK 4QE7A 1OCOC 4PA4A 1V55C 4XDJA 3E8FA 4BW5A 5KUKA 4MS2A 3RBZA 3VOUA 2EILC 2DYRC 3F5WC 3E8HA 3IFXA 4MVRA 5EBLC 2QKSA 4RO2A 4ZBMA 1JVMA 4H37A 3SYOA 2R9RB 2IH1C 2HFEC 2K1EA 3K04A 4QE9A 4X88A 4QNHB 4MTGA 3RW0A 2P7TC 4WFGA 2W0FC 4PA9A 5CBFA 3FB8C 3E8GA 4PDVA 3K06A 5E1AC 3ABLC 4GX0A 1K4DC 4MVSA 1S5HC 3SPHA 3OGCC 3X2QC 5J9PC 2X6BA 4I9WA 4WFFA 4F4LA 5B3SC 3STZC 4PDLA 3ABMC 3LDDA 4J9YB 3UM7A 3RVZA 4X89A 3SPJA 3AG3C 2A79B 4G27B 2WLLA 3BEHA 1R3KC 2AHYA 3LUTB 1R3JC 4OXSA 4X8AA 3ZRSA 3EFFK 1XL4A 3K0DA 4MTOA 4LCUC 4MVUA 2WLIB 4R50A 4HYOA 2WLHA 1OCRC 3SJQC 4P9PA 2ZXWC 3T4DA 1LNQA 3AG1C 3E8BA 5B1BC 1K4CC 3SYPA 2WLKA 2HVKC 3F7VC 2DYSC 3FB7C 2Q69A 3E83A 3OUSA 4MW3A 4MW8A 3RVYA 1KKDA 3K03A 3OR6C 5EBMC 2Y69C 3TCUA 4EKWA 3R65A 1ORQC 4PA6A 4LBEC 4R8CA 2ITDC 4PDRA 2JK5C 3AG2C 2H8PC 2QTOA 4PA7A 3ASOC 4RUFA 2WLMA 4GX2A 5B1AC 4XDLA 3TETA 2WLJA 2A9HA 3JYCA 2IH3C 3K08A 1J95A 4PA3A 3AG4C 1R3LC 1P7BA 5EC1C 3HPLC 1OCCC 2X6CA 1V54C 3E86A 4GX1A 2ITCC 1R3IC 4J9ZB 2EIMC 3E89A 3FB6C 3SPCA 2EIJC 2AHZA
chains in the Genus database with same CATH superfamily
3LNNA 3BY6A 4JYCA 4JTAB 3TXQA 2HVJC 2RNBA 3L9DA 4DK0A 1H8EG 5KMGB 4NXMO 2B9ZA 2ZXWB 3I5DA 1KP3A 3QNEA 2ZDIA 1FFXB 4YJ3A 4PDMA 1QLEC 5BZBA 2UU9B 1O9HA 1FXVA 1K92A 4NB5A 5EC2C 3APOA 4YIPA 3LNMB 5CBHA 3FAVA 1U96A 4D7TA 2ZT9B 2UXBB 3JATA 5FNVB 2DWDC 2CTRA 2KG7A 2YI9A 1IURA 4MVQA 4MTFA 4R6ZA 2CTWA 4RAIA 5DN6G 1YF2A 2YUAA 4DYLA 2EILC 1MG1A 4NTYA 3CJHB 2JJ1G 2HFEC 5E79Z 2YC0A 5KHGA 4PD4F 3JD2A 1I5YA 2PYJA 4PA9A 3MHHC 2A06H 1N4CA 4F4LA 1YTFB 1B04A 5LGUA 2E74B 2EIJB 3ABLB 3SPJA 3OGIB 1JPXA 5EZYA 1YIJV 1XL4A 1KD1W 1SQQH 4I55B 3U11A 2E3CA 1MMMA 4B7EA 1MNGA 1QR8A 4X9QA 1E1RG 3H1HH 4CH4A 4J41A 3K57A 1OCZB 1RM1B 1TAEA 3CC2V 3BHPA 1YZBA 3SJCC 3FD9A 5TISZ 1QR9A 2V1DA 1FFTB 1N32O 4I4TA 5BR8B 1OCCC 1ZSPA 2X6CA 3IC7A 1ZL8A 2CH7A 3FB6C 2Y0PA 4X64B 1VEWA 1VQ6V 1YEWA 4X1IB 3ASNC 4IHJA 1OCOB 3Q4HB 4DR3O 4MVOA 1EFRG 1SQXH 3KZIZ 2LP7A 2GHYA 3G71V 1QBZA 2EIKC 1NH2B 2P4VA 3OE7G 1S5LZ 1NZ6A 2ARHA 1N36B 3ZBHA 3F7YC 4DR6O 1VIBA 2IU3A 5LMUO 3ABUA 1IBLB 1YJNV 3OT7A 1I7FA 4Z1VA 1BE3H 4QIWF 5IWAO 2AZ2A 2Q7EA 1K7DA 3SYAA 2ZINA 2UXDO 2H94A 3JAWA 4LF9O 3P3PA 4JYYA 3VOUA 5B66Z 2QWOB 4LWSB 4JI8O 3OMAB 4H37A 5B1AB 3OMNB 3E22B 1B3QA 3AG4B 1NJIW 4JI3B 2EIMB 5JQGA 4O4HB 2OT5A 1NVPB 3LUTB 2RN9A 3ZRSA 4O2AA 3C90A 4O4LB 2WA3A 5EIBD 4DR2O 1H2GA 5B1BC 2OWOA 4MW3A 1WA8A 1IXMA 2AXTZ 1VP7A 2JK5C 2OTLV 4KL1A 4PA7A 4LFBO 2LGQA 1S72V 2LO1A 3STZC 2GBOA 2ZR2A 3ZHVA 4IL6Z 3QO5A 3E2EA 2EZPA 5LGNA 3H9VA 2VQFO 1S5JA 5LYJB 1KKCA 3T1YO 3CYOA 4TV9A 3I56V 3VQWA 2ZCEA 4P2ZA 2DYRB 1K5QA 2Q68A 4DV1O 4DV2O 1ZUQA 2ZE8A 3RWRD 1R1BA 2CE4A 2F23A 2YXHA 4DV5O 4LP8A 3ZJZA 2JS5A 2WA4A 1IBMO 1HNXO 1M56C 4I0XB 2O57A 4KHPB 2LFSA 5JH7B 3SR2C 3B8MA 5LXTA 2JGDB 1F23A 1SQVH 1PM9A 2XASA 4GKKO 3CHXA 4Q20A 3AG1B 4JI5B 2UXCB 5CA0A 1NTMH 2FKXA 2ZIMA 1XOUA 2Y69B 3EXAA 4ZHQA 3J80N 1PV0A 1R73A 3CRAA 4EFEA 4JI2O 4K0KO 1H2SB 4FMTA 1O9GA 2VS0A 2ZIOA 5JVDA 3RYCB 2CTQA 1XEQA 4B08A 4DRXA 4HNAB 5KA6A 4B3RO 2GSMB 1NT2B 3B77A 2C2AA 1Q81W 2X0LA 1I5XA 1XNRB 3SJAC 3QO7A 1YDXA 4KP4A 4IGGA 3OM3B 1SC5B 4B3MO 5GONA 4H0LB 4DR4B 3CCLV 2QTOA 1XMOB 1VMGA 5H2FZ 5EC1C 4BIUA 1R3LC 4ZOLB 5JCOA 3FYIB 1J5EO 4I9QA 2EIJC 2AHZA 3ABLC 3HKDA 2X7RB 3AEIA 2ADPA 3T1HB 5EK0A 1BSMA 2YEVA 3WB2A 1KYOF 5KLVH 5ITZB 4NTXA 3HKCB 3IGAC 1OCZC 4LFCB 1NTZH 1RM1C 1GRJA 5KAIZ 3X2QB 1SQBH 3B2EE 5B3SB 4LF4B 4XDKA 3WB1A 1AI7A 1K33A 2IU0A 2UXXA 1OCRB 2Q0AA 4H44B 4B3SB 2YICA 1Q8IA 2DYSB 4FLUA 3CPWU 1OCOC 3S3WA 1ZLZA 5KX5B 2UUBO 1K97A 2FYUH 5LOVA 1AROP 5J2TA 4X1KA 2OIEA 2R72A 3FB8C 3K79A 4BR6A 4JV5B 5J9PC 4DW1A 1HR0B 4UVAA 2BTQB 3BEHA 4OXSA 2B5UA 2K9PA 1AP5A 3SDLA 4JZGA 2YXLA 5BMVB 1Y74B 3BA9A 3E8BA 1K4CC 3SYPA 5IYZB 1WJZA 3DTUB 2HVKC 3F5TA 4O4JB 1THZA 4FLZA 1SQFA 3R65A 1MOFA 4JI6B 2QM8A 1R6NA 1NKDA 5B1AC 2EBOA 1AI4A 4U3JB 1AR5A 3DXRA 4XDLA 1FJGO 5H6QA 1JMKC 3AG4C 3M99B 1BHBA 5KA5A 4YHHB 4X62O 2EJ7A 2OYQA 2PI5A 3SPCA 2EIMC 3TJTA 2OTJV 4J9YB 1KU9A 3OD4A 1XREA 2Z3YA 3UO3A 5LP6B 3I55V 4DR5O 1SZTA 1VQMV 4TT3G 3RYFB 1Y76B 1DTOA 4DXWA 5CB4A 4JTDB 1FS0G 1EM1A 4FZ0A 2D2CB 3T1CA 2XHBA 4JI0B 4LNUB 2YDEA 3RYHB 3AG3B 2W0XA 2QJ1A 2P4KA 1YJ9V 3HB3B 3N2GA 1F4NA 1NS1A 2FB5A 4LC1A 3TGUH 1US6A 2X6AA 5EYPB 2GUZA 1N33B 3JASA 1VQ8V 1YSCA 4NTWA 1TUBA 3UKMA 4LFAO 3D36C 4QE7A 1IX9A 1PD3A 1LUVA 3JD4A 1X59A 2DYRC 2HEPA 2K1EA 4QE9A 4PV1B 1ROPA 2W0FC 3KCYA 4X65O 4YJ3B 2XAQA 3FYEB 2PY5A 4JPRA 2X6BA 4DV7O 2AZ0A 4G2KA 3FAVB 4O4IA 1XDCA 3ABKB 3JATB 2QA4V 4TOIA 2QEXV 2KG7B 2UUCB 3SJQC 3CCSV 5GTIZ 1PNMA 1VF7A 3AG1C 1WB7A 1QVGU 1Q3EA 2EULA 2Q69A 4GYCB 1AI5A 5HFLA 2Y69C 4LF5B 1ORQC 5GTHZ 4DV4B 2NR5A 1MSDA 2ZNJA 3L73H 1TVKA 2UXBO 2DE0X 3CS5A 2ITCC 4J80A 3BA8A 3ICXA 1H2MA 4DV3B 3MDSA 5EZYB 3T4ZA 3LDCA 1G4YB 4BAYA 1RP3B 4LF6O 4Z2WA 3RT3C 4EFBA 2L6LA 1Y66A 2Q4PA 4J7JA 1IBKO 4JTCB 3N2KA 3EVKA 4PI2A 3L71H 1YVWA 3VQVA 3UT5A 4DUZB 3A8TA 1RPRA 1VF6C 2JDIG 4I4TB 3FFQA 2P90A 3IC9A 4UCSA 4J10A 3SYQA 2CH7B 4H33A 3B40A 4IHJB 4EEQA 5A2QN 1WAZA 4UXNA 4CZZA 3ASOB 1NTKH 3TK1A 1K4DC 3OGCC 3X2QC 1YCIA 5B3SC 4JAAA 4J11A 5IYBO 2AHYA 1R3JC 5DEDA 1AI6A 4X64O 4QGPA 1H38A 3P3NA 3CRRA 1JFFA 1OCRC 1SZXA 4DO2A 1RPOA 1XNQB 1WB8A 2DN9A 1F4MA 3S3XA 2DYSC 4JYBA 1SRYA 4FK5C 3QO8A 4JAUA 4TV8A 4A5UB 2IM9A 3JAWB 4JI1B 3HKEA 3GWOA 1V9PA 2PTMA 5BXZA 3K08A 3LSUA 3K5NA 3WFVA 1JR9A 2N04A 3KCXA 1Q82W 1IBLO 3WB0A 1NI8A 1ZWIC 5JQGB 4GX5A 2V7QG 2QGNA 3SPGA 1FXKA 1R6TA 2HHHB 4O2AB 2Z5UA 3G6BA 4G28B 1WLEA 4QJFB 1GKFA 4X20A 3RYIA 3MHSC 2HKOA 1F51A 2QWRB 3BCCH 1KP2A 1WA8B 2Q6AA 4JI3O 1NQTA 5AG2A 4KXRA 2P6JA 4D7SA 3FB5C 2VQEB 3CCVV 2QKCA 4F6EA 3H1KH 4RUEA 1BS3A 4CS2A 1I94B 5LP6C 4OX9O 4BIZA 3O9OA 4DV6B 4PA4A 3U10A 2JEXA 1Z5WA 4TV9B 4BW9A 1FFXA 3JCUZ 5EBLC 3OTOO 3LSQA 2R9RB 2A3QA 3OAAG 1QHTA 5JJNB 3CE2A 1HNWO 3W7UA 4UCVA 4QNHB 5LMNB 1Q86W 4AHCA 3AG3C 1R3KC 2JEUA 2FMLA 1VQNV 1D5NA 2OIGA 4R50A 1DGSA 2WLHA 2XOKG 2F4VO 4YY3B 4ASUG 1LNQA 5CA0B 4EKWA 4TUYA 5JWPA 2EJRA 4Z1MG 1XILA 2P5OA 2F95B 4PDRA 4NVPA 3G4SV 4KHPO 4JGSA 2WLJA 2D3OW 1GO3F 3JARB 2ZR3A 2HJDA 3ZN0A 1ZAUA 4NXNO 4GT1A 4CC5A 2YIBD 3SYCA 3W7XA 1S77D 3JAKA 4JI5O 2UXCO 4DRXB 3ABKC 1QVFU 1FPOA 1NU1H 3KG2A 5CA1A 1G6UA 1P4RA 1HNZO 2YIBA 1AP6A 2E76B 4LF7B 5F2VO 3A0RA 2F66C 2HR3A 4P9OA 4MSWC 2IW5A 2GTSA 1VQ5V 3ZMVA 2ZE5A 4F6RB 1M93A 5GONB 4JI4B 1EZJA 2HJFC 1Y67A 4JF3A 4WFBV 3G67A 1NH2D 2ZD9A 1K8AW 2DQ3A 3C3SA 3CRQA 4KUMA 1KMIZ 3Q4HA 2CTPA 4GKJO 4X66B 3HKDB 4DV0B 2WLNA 5IJ9A 4IIJA 4J7KA 3SGIA 3F5WC 1L8DA 2IJJA 5FPOA 4PI0A 3VBBA 2YEVB 1Y6XA 2IJHA 1SESA 1N0JA 4WFGA 3OTFA 4JI8B 4XBFA 4JZ2A 4YJ2A 2CDYA 1H2LA 4OGQB 2PYLA 1FAFA 4GLXA 2R9AA 4D6TH 4X8AA 4MTOA 5L3EA 4RWUA 1UJWB 3UO2A 1FYJA 2ZXWC 1A32A 3O65A 1QU7A 5LGTA 3E35A 3F7VC 3TCUA 3FKSG 2Q9LA 4LBEC 1MZEA 4PJ0Z 2H8PC 1GN3A 3B09A 3ASOC 5LOVB 1M1KW 4LF4O 1E79G 4K35A 5J2TB 1KB9F 2F1MA 3DGEA 4X1KB 2VRZA 3CRCA 2M7WA 5A9GA 4LFBB 3E86A 1K34A 2F93B 2QWPB 3E89A 4FLYA 3HKBA 2ZM6B 2Q67A 4QPKA 4B3SO 3STLC 3OUFA 4DUYB 3HR0A 3P32A 3T1YB 4FIPC 1QNMA 3FX7A 1DF5A 1IXBA 4CBCA 4BWAA 4DR1O 2DOSA 3SJBC 1BZKA 2VWKA 1NR7A 5KHKA 2UUAB 1SQPH 4AI8A 4P30A 1AR1B 1W2BU 3OMIB 2WLLB 3DXRB 2JJ2G 2RQ6A 5LYJA 4FM2A 5H6RA 2G38A 3K59A 2RJZA 4DR7B 4UCRA 4GKKB 5JJJB 5IJ0A 4FVMA 5L3CA 3IFXA 2CGOA 1E1QG 3ZN1A 3CCEV 1BT8A 4ZBMA 3AG2B 5LHIA 2ETNA 2MW2B 4JI6O 2IH1C 2QWQB 3ZHQA 1D2DA 2R70A 5L3DA 4LH7A 5BY1A 4MTGA 3G6EV 1UPGA 5CB4B 1HWYA 1S5HC 1V54B 1IVSA 3W7TA 1AJNA 4YHHO 1CPYA 2XAGA 4CH6A 4K8ZA 3GVMA 5EIBC 1W0JG 1P7GA 4CC6A 4CH5A 2CAZC 2XAFA 3H1JH 1M57B 3CC4V 3JASB 4MW8A 1TUBB 4BIOA 5IY5B 4I7ZB 5D5PA 4B3TB 1AILA 1Z2GA 3DC6A 4RUFA 4FLWA 4FJCC 2IH3C 3W7SA 4EB6A 1PL0A 4GX1A 5J2UB 2W6IG 1R3IC 3A0HZ 1VF5B 1AJQA 4LH6A 3AK3A 2ATKC 1N33O 2KB1A 2LW7A 4O4IB 1RSOA 4U7NA 1V55B 3ZMSA 1F7YA 3JAMN 4CH3A 1J5EB 2QM7A 2F43G 4QPJA 4H13B 2JS3A 5B5EZ 2Y4TA 3JCZA 5D5QA 1HW7A 3VQXA 4E4EA 4UFZA 1OZ0A 2WPDG 1TVKB 3SPIA 1B06A 4FFBA 1CXZB 1NR1A 2WSSG 1EZVH 2KQXA 3PJSK 3ZIAG 4UB6Z 1XHZA 3ZHSA 4LF5O 2QKSA 3HKCA 4X88A 2YXYA 4DV4O 2P7TC 5E1AC 4MVSA 3N2KB 3SPHA 1WP8A 3UT5B 1VQOV 4AQYB 3JALA 1P84F 4DW0A 3K3WA 3CXHF 5JCOC 4DV3O 5HFMA 4OPHA 4LF8O 1Q6UA 3J81N 3KKYA 1BHAA 2L35A 3LSSA 1Q43A 3OR6C 5EBMC 1WNSA 4JI7B 4JYAB 4X1YA 3ZCCA 3H01A 3RGBA 1AR4A 1Y4MA 4DUZO 4WF9V 2BSKA 5DM6V 4J9ZB 2OCCB 4N23A 2PI4A 4MTXA 2CGNA 1BGYH 4R7CA 4MVMA 2EX3A 3D3QA 2ILMA 5B1OA 2AGAA 2QDOA 2UU9O 1JFFB 5CA3A 1URFA 4UCTA 2W6JG 4GUNA 4HZ3A 3JD3A 3HKEB 2P67A 1M90W 1XUQA 1B6QA 1K73W 3ETGA 3ZRWA 4MT8A 1SERA 4WFHA 1N34B 1Q7YW 4W4LA 2QR4A 3BRCA 4JASA 4BW5A 5KUKA 3K9SA 1MSWD 1FXKB 4MS2A 1PL4A 1Q6IA 4MVRA 1H2NA 4ZI7A 3M8AA 4X20B 3K06A 4ZIBA 4GX0A 3RYIB 2IJIA 4O2BA 5CN0A 3C3TA 1ZL8B 3QTCA 5K1PA 1XBLA 1DLBA 4LCUC 1M5IA 3H1LH 4GCZA 2HHHO 2XAHA 3D8CA 2HP8A 1P49A 2E75B 1BQZA 2E5LB 3OUSA 3E83A 3ZS8C 5BR8O 3D3IA 4R8CA 1SA0A 4FPPA 3ETEA 3AG2C 3ETDA 1IZ3A 1VQ9V 2AW9A 2A9HA 2JGUA 4WBNA 1N8RW 2WWWA 1V54C 2EINB 1QQCA 2DJVA 2VQEO 2Q8VA 1NBMG 4NYKA 1PNLA 4UV8A 1JQ0A 1XL6A 1L0NH 2MK3A 1I94O 3J7AU 3OFNG 1KECA 1XMQB 4DV6O 1GM7A 1FXHA 4K3AA 5CBGA 1N36O 1HDJA 1M57C 5FL7G 1KC8W 2GTAA 5IY5C 2XTAA 4LF6B 2YIDA 5LMNO 4TUYB 2Q0OC 3GB7C 3ABMB 2P22C 5LL6Y 2JIZG 4U7OA 4DK1A 1YHQV 1IBKB 3ZMUA 1ENVA 1DF4A 2WLIA 3CWBH 4WCEV 4I50A 4MVZA 4YY3O 3CCUV 4NXMB 1WPBA 3JAKB 1VQPV 3ZX6A 1V55C 3CRMA 5C8YA 2LGWA 5LA6A 4RO2A 5CA1B 3CP1A 2KKWA 1OV9A 5CBFA 4PDVA 2XUMA 5KHIA 4N21A 4WFFA 1JX9A 3OEHG 2PF4E 2ZQMA 5KMGA 3BPZA 3B4SA 3K0DA 3CD6V 1JCHA 1XI1A 2QTSA 4C7UA 4P9PA 1WPXA 1YXBA 2CK3G 2DMXA 5KHHA 3IJ4A 5IT9N 2JVDA 4LF7O 2LFRA 5IJ9B 4IIJB 3BAAA 5FNVA 2YSUB 5L3GA 1S0VA 5IDJA 2QE7G 1YI2V 4JI4O 4IYIA 5LXTB 3P30A 4GZRB 3WG7B 1BQ0A 4UV9A 5FLXN 4YJ2B 2BE3A 4B7KA 5KUMA 4X66O 1YTFD 4DV0O 2QSAA 2QM4A 5LHHA 5LBQA 3CJHA 1AVMA 4ZHQB 1JOYA 4UUJC 3K5LA 2M6YA 2ZDIC 1AB3A 3RN4A 2HLDG 1N0NA 5CMUA 3A2FA 1SF9A 1BL8A 1N32B 1K3EA 3CEIA 5JVDB 1YJWV 1KQSU 3ETQA 1GN2A 3K0GA 4I55A 1JA8A 2A0LA 3NXSA 2OCCC 3OR7C 4CS4A 4KFMA 3ZMTA 1Q5OA 3HKBB 1EN4A 1GAXA 3L75H 4DR3B 2B1GA 1GM8A 4IYHA 3E8FA 3K9AA 2WAMA 1K5SA 3B8NA 5KAFZ 1GN6A 2Q5ZA 4OX9B 1SETA 5K1XA 1HP8A 2DW4A 2Y48A 4UCOA 1FD9A 3E8GA 3OTOB 4DR6B 1HNWB 2YS8A 5IE9A 3RVZA 3JD1A 4X89A 3JSLA 4X1IA 2ZM6O 5LMUB 1U97A 5L3BA 1T5EA 1L1FA 3ZHRA 2XAJA 1XNRO 4IT5A 4DUYO 5IWAB 1Z5VA 2Q73A 2PZSA 1QCEA 2UXDB 3K5OA 2Q7HA 4LF9B 3JD0A 4DR4O 1XMOO 4ZKIA 2F4VB 1FXKC 2DQ0A 4PA6A 2Z0AA 5IJ0B 1GM9A 2ITDC 1ZTEA 4JAVA 1JJ2U 1GH6A 2WLMA 4HAMA 1LUWA 3K5MA 3N27A 2UUAO 1S76D 3PN1A 3T1HO 4FLTA 4NXNB 3IAYA 4DR7O 4LWSA 1NVPD 2BTOA 4DR2B 2Y4UA 4LFCO 4WFEA 1W0KG 2HG5C 3CCRV 3E22A 1W59A 1GN4A 3A0BZ 1HNZB 3ABTA 4O4HA 5FPRA 3JARA 2VWJA 4O4LA 3ZMZA 4W4KA 4Q6GA 4FZ1A 2EINC 4EB6B 1RFYA 1XHXA 2VQFB 2YIAA 3NR7A 1AJPA 1R6KA 2PUSA 1RSOB 2ODMA 3RBZA 4DV1B 4DV2B 2NNUA 2XNDG 1JJOA 1BCCH 4GKJB 2ZNIA 4JV5O 1H2KA 4RQFA 2EZOA 4B3TO 1GK9A 2GV9A 2NN4A 4U3FH 5B1NA 3RW0A 4DV5B 1HR0O 3CMEV 1IBMB 1HNXB 4F6RA 2B1IA 4I9WA 4PDLA 2FTKA 3ABMC 4PELA 5H9CA 1EN6A 2PGGA 3D36A 1OJHA 2IBZH 2N05A 4FFBB 2ADQB 3T4DA 4NR1A 4FLXA 1WN7A 4FM0A 3CB2A 3FB7C 1GTOA 3MD0A 4K8XA 3WU2Z 1QLEB 1PNKA 4WFAV 4NKGB 4AILC 3ZRXA 2ZE6A 4I0XA 5JH7A 4I5SA 4JI2B 4K0KB 1I08A 2P06A 4GX2A 2JGDA 4J42A 3THOA 3TETA 4J7ZA 3DC5A 3GWKC 3HPLC 4PHZA 3N2GB 1QLNA 1FKAO 1SQGA 1YITV 2UXNA 2RMKB 3JYCA 1KUQA 2GUZB 5LHGA 4B3RB 1S3JA 3H1IH 1DK1A 3JALB 2V4DA 4HBNA 2EILB 1VQLV 1Q90D 1UFIA 4JI0O 2NLJC 3QG5A 3ZHUA 3RYCA 4B3MB 1PPJH 4DR1B 4X1YB 4HNAA 2Q7GA 4AQYO 1XQ8A 2QKAA 2KSDA 2BSKB 3WG7C 2BOBC 3T2MA 5EBWC 3OW2U 2QWNB 4TQDA 2BOCC 1H8HG 2FL4A 4RQEA 2Y0IA 3CX5F 3E8HA 3L70H 3ZEDA 1VQ4V 2ZE7A 4JI7O 4JYAO 3EHBB 1VF6A 4ZOLA 1VQ7V 3K58A 1I0HA 1OCCB 3M7MX 2ZKOA 1TA8A 2UUCO 4ABMA 2A79B 2IJKA 2WLLA 3ML0A 4TQFA 1PKXA 3ASNB 3CCMV 1G1XB 3RFRA 4HYOA 4UB8Z 3ZRWB 1OHHG 3APQA 3CMAV 1CP9A 4L8JA 5ITZA 3AK1A 4L87A 3BVOA 5C93A 2EIKB 3ZHTA 2WLKA 2OCHA 2UUBB 1L0LH 1KKDA 3K03A 4FLVA 5GW7A 4FM1A 3TXSA 3ZRVA 4ZI7B 1J95A 4PA3A 3VQYA 2JRIA 2RCVA 5DECA 1CEZA 4O2BB 2LJ2A 4FFKA 1N34O 1BMFG 4TWKA 2DWEC 1KBHA 5KX5A 3BFRA 4CS3A 4UVBA 1ZX3A 1EN5A 1M4UA 1D5AA 2XT9A 3R66A 3U0ZA 3L74H 1COWG 1VARA 2A7WA 4ICGA 5IYCO 1K9MW 5L3FA 1TGOA 3L72H 3CXCU 2BTQA 3AG7A 1FJGB 1SA0B 1IDSA 3W7WA 3LDEA 4X62B 5J2UA 2CUGA 2LQTA 4WBNB 5BMVA 1Y74A 5JJEB 3MAQA 3OEEG 1GMGA 5IYZA 3UQ8A 5B1BB 3AK2A 3CCQV 4O4JA 4DR5B 1MABG 2E5LO 4XDJA 5H5NA 3CSXA 4YXWG 4TV8B 5IYDO 2LW1A 4U3JA 1JVMA 3SYOA 3K04A 2H3OA 2YI8A 2N74A 1PP9H 1Q6HA 4LR3A 3CC7V 3LDDA 3UM7A 4TSFG 2R9IA 4G27B 3UCSC 5LP6A 1WP7A 1MZFA 1XNQO 1LR1A 3EFFK 4MVUA 3BABA 2WLIB 1SKVA 2RDCA 1XMQO 3RYFA 4LFAB 1Y76A 4UVCA 4JI1O 3JSNA 4I50B 1MA1A 4E2LA 4UCUA 3RVYA 1SS3A 1G8MA 4LNUA 2GDSA 4LF8B 3G80A 5C8YB 1M56B 3RYHA 5LA6B 5KHJA 3QVNA 1M9NA 3DSQA 1TUEB 1EBOA 4X65B 2BCCH 1P7BA 4OPAA 4YIOA 5EYPA 4DV7B 3CCJV 1VQKV 3QF7A 1X4TA
chains in the Genus database with same CATH topology
3BY6A 4JYCA 4JTAB 2HVJC 2Z3YA 2Q67A 4QPKA 1H8EG 3STLC 3OUFA 5KUMA 1YTFD 3I55V 1SZTA 1VQMV 4TT3G 2ZXWB 3P32A 5LHHA 5LBQA 1KP3A 3QNEA 2ZDIA 4FIPC 1JOYA 1DF5A 4UUJC 1DTOA 4DXWA 2ZDIC 4CBCA 4PDMA 1M1KW 4JTDB 1QLEC 1FS0G 5BZBA 2HLDG 1FXVA 1K92A 5EC2C 5CMUA 3T1CA 3LNMB 1NR7A 5CBHA 1BL8A 1K3EA 1YJWV 3AG3B 1KQSU 3K0GA 2DWDC 2A0LA 4P30A 3HB3B 1AR1B 3OMIB 2WLLB 1F4NA 1YJ9V 2JJ2G 1W2BU 4LC1A 2X6AA 3NXSA 2OCCC 3OR7C 4KFMA 5H6RA 3ZMTA 1VQ8V 1YSCA 4MVQA 3UKMA 4MTFA 4R6ZA 4RAIA 2B1GA 4QE7A 5DN6G 1PD3A 1GM8A 3JD4A 3E8FA 3K9AA 2WAMA 1K5SA 5L3CA 2EILC 2DYRC 3B8NA 3IFXA 1MG1A 1E1QG 3ZN1A 3CCEV 5LHIA 4ZBMA 1SETA 3AG2B 2DW4A 2JJ1G 2IH1C 2HFEC 2K1EA 2Y48A 4QE9A 5L3DA 4MTGA 3G6EV 3JD2A 1ROPA 1I5YA 2W0FC 4PA9A 3MHHC 3E8GA 2XAQA 3FYEB 1HWYA 1S5HC 1V54B 3W7TA 4JPRA 2X6BA 1AJNA 4F4LA 1YTFB 1CPYA 2XAGA 3JD1A 4G2KA 2EIJB 3ABLB 4X89A 3RVZA 3SPJA 5LGUA 1JPXA 1YIJV 1XL4A 1W0JG 3ABKB 1KD1W 2QA4V 5L3BA 1L1FA 2QEXV 1QR8A 2XAJA 2XAFA 3SJQC 3CCSV 1PNMA 1E1RG 1M57B 3AG1C 3CC4V 1QVGU 1QCEA 4MW8A 2Q69A 1OCZB 3JD0A 1AI5A 5HFLA 1RM1B 4ZKIA 3CC2V 2Y69C 1FXKC 1ORQC 2DQ0A 4PA6A 5IY5B 1GM9A 2ITDC 4JAVA 1QR9A 2V1DA 1JJ2U 4RUFA 1FFTB 2WLMA 4HAMA 4FJCC 2IH3C 3W7SA 1S76D 1OCCC 2X6CA 3IC7A 1PL0A 4GX1A 2ITCC 1R3IC 2W6IG 3FB6C 1AJQA 2ATKC 2KB1A 1VQ6V 3ASNC 1OCOB 4U7NA 1V55B 3T4ZA 3ZMSA 4MVOA 2QM7A 3LDCA 1G4YB 1EFRG 2F43G 4QPJA 1NVPD 4BAYA 2LP7A 4WFEA 2GHYA 1W0KG 2HG5C 3G71V 3CCRV 1QBZA 2EIKC 1NH2B 3OE7G 1Y66A 4JTCB 3JCZA 3ABTA 3F7YC 1OZ0A 1RPRA 2JDIG 2WPDG 3SPIA 2IU3A 3ZMZA 2P90A 3ABUA 2EINC 1YJNV 3SYQA 1NR1A 2WSSG 4H33A 4QIWF 1K7DA 3SYAA 1AJPA 1R6KA 3PJSK 2H94A 3ZIAG 3RBZA 3VOUA 2NNUA 2XNDG 3OMAB 2QKSA 4UXNA 4RQFA 4H37A 2EZOA 3ASOB 4X88A 4CZZA 1GK9A 5B1AB 5B1NA 3OMNB 3RW0A 2P7TC 3CMEV 3AG4B 3TK1A 5E1AC 1NJIW 1K4DC 4MVSA 3SPHA 3OGCC 3X2QC 2B1IA 4I9WA 5B3SC 2EIMB 4PDLA 2FTKA 3ABMC 2OT5A 4PELA 1NVPB 5H9CA 1VQOV 5IYBO 3LUTB 2AHYA 3D36A 1R3JC 1AI6A 3ZRSA 1H38A 3K3WA 1OCRC 4DO2A 1RPOA 5HFMA 3T4DA 1H2GA 5B1BC 1BHAA 1F4MA 3FB7C 2DYSC 4JYBA 4MW3A 1GTOA 1SRYA 3MD0A 3QO8A 1QLEB 3LSSA 4FK5C 4JAUA 1PNKA 3OR6C 5EBMC 4WFAV 1IXMA 3ZRXA 3GWOA 2JK5C 3H01A 3ZCCA 4I5SA 2OTLV 4PA7A 4GX2A 3TETA 1Y4MA 4WF9V 1S72V 3K08A 3STZC 2ZR2A 3HPLC 5DM6V 3QO5A 3WFVA 1QLNA 3E2EA 2EZPA 4J9ZB 5LGNA 2OCCB 4N23A 1Q82W 1YITV 2UXNA 2PI4A 4MTXA 3JYCA 4R7CA 1ZWIC 5LHGA 4GX5A 1S3JA 2V7QG 4MVMA 3CYOA 3SPGA 1FXKA 3I56V 5B1OA 4P2ZA 2EILB 2DYRB 1K5QA 1VQLV 2Q68A 2Z5UA 4G28B 1WLEA 4QJFB 1GKFA 2NLJC 5CA3A 3MHSC 2HKOA 1F51A 2W6JG 4LP8A 3ZJZA 1KP2A 2Q6AA 1M56C 4HZ3A 3JD3A 1NQTA 2LFSA 2P67A 3B8MA 1M90W 2P6JA 3FB5C 1B6QA 1K73W 3ETGA 1F23A 3ZRWA 3CCVV 4MT8A 3WG7C 1SERA 2XASA 4WFHA 2BOBC 4Q20A 4RUEA 3T2MA 3AG1B 1Q7YW 5EBWC 3OW2U 2BOCC 4BIZA 1H8HG 4JASA 4PA4A 4BW5A 5KUKA 2JEXA 2Y69B 1MSWD 1FXKB 4MS2A 4RQEA 3E8HA 4MVRA 1VQ4V 5EBLC 3LSQA 3EHBB 2R9RB 1R73A 3OAAG 3W7UA 4QNHB 1VQ7V 4FMTA 3K06A 1OCCB 4GX0A 2IJIA 5CN0A 1Q86W 3AG3C 2A79B 2IJKA 2WLLA 1R3KC 3ML0A 1PKXA 3ASNB 3CCMV 2JEUA 1DLBA 4LCUC 5KA6A 2GSMB 1VQNV 4R50A 4GCZA 3B77A 4HYOA 2WLHA 3ZRWB 1OHHG 2XOKG 3CMAV 2XAHA 1CP9A 4ASUG 1LNQA 4L87A 2C2AA 1Q81W 5C93A 2X0LA 2EIKB 2WLKA 1I5XA 3OUSA 3E83A 1KKDA 3K03A 3QO7A 4EKWA 4KP4A 2EJRA 4Z1MG 3D3IA 3OM3B 5GW7A 4R8CA 4FPPA 4PDRA 3ETEA 3AG2C 3ETDA 3CCLV 2QTOA 1VQ9V 3ZRVA 3G4SV 4JGSA 2WLJA 2A9HA 1GO3F 2D3OW 2ZR3A 1J95A 4PA3A 5EC1C 1R3LC 3ZN0A 4BIUA 1N8RW 2WWWA 3FYIB 1V54C 2EINB 4GT1A 1CEZA 1NBMG 3ABLC 2AHZA 2EIJC 1PNLA 4UV8A 1JQ0A 3SYCA 3W7XA 1XL6A 1S77D 1BMFG 4TWKA 2X7RB 2DWEC 2MK3A 3ABKC 1QVFU 3OFNG 1KECA 3AEIA 1GM7A 4UVBA 5EK0A 3KG2A 1FXHA 2YEVA 5CBGA 1M57C 5FL7G 1P4RA 1KC8W 3IGAC 1OCZC 3A0RA 1RM1C 2HR3A 1COWG 4P9OA 4MSWC 2IW5A 5IY5C 1K9MW 5IYCO 3X2QB 5L3FA 1VQ5V 3ZMVA 5B3SB 3CXCU 3GB7C 3ABMB 2JIZG 4U7OA 1YHQV 4XDKA 3W7WA 3ZMUA 1AI7A 3LDEA 1ENVA 1DF4A 1EZJA 2HJFC 4JF3A 2WLIA 4WFBV 1K33A 2IU0A 2UXXA 4WCEV 2ZD9A 1NH2D 1K8AW 1OCRB 3OEEG 1GMGA 2DQ3A 5B1BB 4KUMA 4MVZA 3CCQV 3CCUV 2DYSB 2WLNA 1VQPV 1MABG 3CPWU 1OCOC 4XDJA 1V55C 4YXWG 1K97A 3F5WC 2IJJA 3VBBA 5IYDO 4RO2A 1AROP 1JVMA 3SYOA 2YEVB 3K04A 3CP1A 2IJHA 1SESA 4WFGA 5CBFA 3FB8C 4PDVA 4XBFA 3K79A 4N21A 5J9PC 4WFFA 1JX9A 3OEHG 3CC7V 3LDDA 3UM7A 4TSFG 2R9IA 4UVAA 4G27B 3BEHA 2ZQMA 4OXSA 4X8AA 3EFFK 3K0DA 3CD6V 4MTOA 1JCHA 5L3EA 2B5UA 1UJWB 4MVUA 2WLIB 4P9PA 1WPXA 2ZXWC 3E8BA 4UVCA 1K4CC 3SYPA 5LGTA 2CK3G 3DTUB 3E35A 2HVKC 3F7VC 4E2LA 3RVYA 5L3GA 1THZA 3TCUA 1G8MA 2LFRA 3R65A 3FKSG 1MOFA 4LBEC 1M56B 2QM8A 1R6NA 1M9NA 2H8PC 3ASOC 1TUEB 2YSUB 1NKDA 1E79G 1EBOA 2EBOA 1AI4A 4XDLA 5B1AC 5IDJA 1S0VA 2QE7G 3DGEA 5H6QA 1YI2V 3AG4C 3M99B 1P7BA 1BHBA 2M7WA 5KA5A 3P30A 3CCJV 1VQKV 3WG7B 3E86A 2PI5A 4UV9A 3SPCA 1K34A 2EIMC 3E89A 2OTJV 4J9YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7C A;  1ZWI C;  2ATK C;  3SYC A;  2KB1 A;  4JTA B;  1XL6 A;  2HVJ C;  4GX5 A;  2Q67 A;  4TWK A;  3ASN C;  4MVM A;  2DWE C;  3ABK C;  3SPG A;  3STL C;  3OUF A;  5KUM A;  3T4Z A;  4MVO A;  3LDC A;  1G4Y B;  5EK0 A;  4P2Z A;  3KG2 A;  2Q68 A;  4WFE A;  4G28 B;  2HG5 C;  2YEV A;  5CBG A;  1M57 C;  4UUJ C;  2EIK C;  2NLJ C;  4DXW A;  3IGA C;  1OCZ C;  4PDM A;  4CBC A;  4JTD B;  1QLE C;  4JTC B;  5BZB A;  4P9O A;  4MSW C;  4LP8 A;  3ZJZ A;  5EC2 C;  3T1C A;  5IY5 C;  2Q6A A;  1M56 C;  4HZ3 A;  3LNM B;  3F7Y C;  3GB7 C;  1BL8 A;  5CBH A;  4XDK A;  3LDE A;  3K0G A;  2DWD C;  3FB5 C;  2A0L A;  2HJF C;  4P30 A;  2WLL B;  2WLI A;  3SPI A;  2EIN C;  3WG7 C;  2ZD9 A;  4WFH A;  2BOB C;  2X6A A;  2OCC C;  3OR7 C;  4KFM A;  3SYQ A;  4RUE A;  3T2M A;  4H33 A;  4MVZ A;  4MVQ A;  5EBW C;  3UKM A;  2BOC C;  4MTF A;  4R6Z A;  3SYA A;  2WLN A;  4RAI A;  3PJS K;  4QE7 A;  1OCO C;  4PA4 A;  1V55 C;  4XDJ A;  3E8F A;  4BW5 A;  5KUK A;  4MS2 A;  3RBZ A;  3VOU A;  2EIL C;  2DYR C;  3F5W C;  3E8H A;  3IFX A;  4MVR A;  5EBL C;  2QKS A;  4RO2 A;  4ZBM A;  1JVM A;  4H37 A;  3SYO A;  2R9R B;  2IH1 C;  2HFE C;  2K1E A;  3K04 A;  4QE9 A;  4X88 A;  4QNH B;  4MTG A;  3RW0 A;  2P7T C;  4WFG A;  2W0F C;  4PA9 A;  5CBF A;  3FB8 C;  3E8G A;  4PDV A;  3K06 A;  5E1A C;  3ABL C;  4GX0 A;  1K4D C;  4MVS A;  1S5H C;  3SPH A;  3OGC C;  3X2Q C;  5J9P C;  2X6B A;  4I9W A;  4WFF A;  4F4L A;  5B3S C;  3STZ C;  4PDL A;  3ABM C;  3LDD A;  4J9Y B;  3UM7 A;  3RVZ A;  4X89 A;  3SPJ A;  3AG3 C;  2A79 B;  4G27 B;  2WLL A;  3BEH A;  1R3K C;  2AHY A;  3LUT B;  1R3J C;  4OXS A;  4X8A A;  3ZRS A;  3EFF K;  1XL4 A;  3K0D A;  4MTO A;  4LCU C;  4MVU A;  2WLI B;  4R50 A;  4HYO A;  2WLH A;  1OCR C;  3SJQ C;  4P9P A;  2ZXW C;  3T4D A;  1LNQ A;  3AG1 C;  3E8B A;  5B1B C;  1K4C C;  3SYP A;  2WLK A;  2HVK C;  3F7V C;  2DYS C;  3FB7 C;  2Q69 A;  3E83 A;  3OUS A;  4MW3 A;  4MW8 A;  3RVY A;  1KKD A;  3K03 A;  3OR6 C;  5EBM C;  2Y69 C;  3TCU A;  4EKW A;  3R65 A;  1ORQ C;  4PA6 A;  4LBE C;  4R8C A;  2ITD C;  4PDR A;  2JK5 C;  3AG2 C;  2H8P C;  2QTO A;  4PA7 A;  3ASO C;  4RUF A;  2WLM A;  4GX2 A;  5B1A C;  4XDL A;  3TET A;  2WLJ A;  2A9H A;  3JYC A;  2IH3 C;  3K08 A;  1J95 A;  4PA3 A;  3AG4 C;  1R3L C;  1P7B A;  5EC1 C;  3HPL C;  1OCC C;  2X6C A;  1V54 C;  3E86 A;  4GX1 A;  2ITC C;  1R3I C;  4J9Z B;  2EIM C;  3E89 A;  3FB6 C;  3SPC A;  2EIJ C;  2AHZ A; 
#chains in the Genus database with same CATH topology
 3LNN A;  3BY6 A;  4JYC A;  4JTA B;  3TXQ A;  2HVJ C;  2RNB A;  3L9D A;  4DK0 A;  1H8E G;  5KMG B;  4NXM O;  2B9Z A;  2ZXW B;  3I5D A;  1KP3 A;  3QNE A;  2ZDI A;  1FFX B;  4YJ3 A;  4PDM A;  1QLE C;  5BZB A;  2UU9 B;  1O9H A;  1FXV A;  1K92 A;  4NB5 A;  5EC2 C;  3APO A;  4YIP A;  3LNM B;  5CBH A;  3FAV A;  1U96 A;  4D7T A;  2ZT9 B;  2UXB B;  3JAT A;  5FNV B;  2DWD C;  2CTR A;  2KG7 A;  2YI9 A;  1IUR A;  4MVQ A;  4MTF A;  4R6Z A;  2CTW A;  4RAI A;  5DN6 G;  1YF2 A;  2YUA A;  4DYL A;  2EIL C;  1MG1 A;  4NTY A;  3CJH B;  2JJ1 G;  2HFE C;  5E79 Z;  2YC0 A;  5KHG A;  4PD4 F;  3JD2 A;  1I5Y A;  2PYJ A;  4PA9 A;  3MHH C;  2A06 H;  1N4C A;  4F4L A;  1YTF B;  1B04 A;  5LGU A;  2E74 B;  2EIJ B;  3ABL B;  3SPJ A;  3OGI B;  1JPX A;  5EZY A;  1YIJ V;  1XL4 A;  1KD1 W;  1SQQ H;  4I55 B;  3U11 A;  2E3C A;  1MMM A;  4B7E A;  1MNG A;  1QR8 A;  4X9Q A;  1E1R G;  3H1H H;  4CH4 A;  4J41 A;  3K57 A;  1OCZ B;  1RM1 B;  1TAE A;  3CC2 V;  3BHP A;  1YZB A;  3SJC C;  3FD9 A;  5TIS Z;  1QR9 A;  2V1D A;  1FFT B;  1N32 O;  4I4T A;  5BR8 B;  1OCC C;  1ZSP A;  2X6C A;  3IC7 A;  1ZL8 A;  2CH7 A;  3FB6 C;  2Y0P A;  4X64 B;  1VEW A;  1VQ6 V;  1YEW A;  4X1I B;  3ASN C;  4IHJ A;  1OCO B;  3Q4H B;  4DR3 O;  4MVO A;  1EFR G;  1SQX H;  3KZI Z;  2LP7 A;  2GHY A;  3G71 V;  1QBZ A;  2EIK C;  1NH2 B;  2P4V A;  3OE7 G;  1S5L Z;  1NZ6 A;  2ARH A;  1N36 B;  3ZBH A;  3F7Y C;  4DR6 O;  1VIB A;  2IU3 A;  5LMU O;  3ABU A;  1IBL B;  1YJN V;  3OT7 A;  1I7F A;  4Z1V A;  1BE3 H;  4QIW F;  5IWA O;  2AZ2 A;  2Q7E A;  1K7D A;  3SYA A;  2ZIN A;  2UXD O;  2H94 A;  3JAW A;  4LF9 O;  3P3P A;  4JYY A;  3VOU A;  5B66 Z;  2QWO B;  4LWS B;  4JI8 O;  3OMA B;  4H37 A;  5B1A B;  3OMN B;  3E22 B;  1B3Q A;  3AG4 B;  1NJI W;  4JI3 B;  2EIM B;  5JQG A;  4O4H B;  2OT5 A;  1NVP B;  3LUT B;  2RN9 A;  3ZRS A;  4O2A A;  3C90 A;  4O4L B;  2WA3 A;  5EIB D;  4DR2 O;  1H2G A;  5B1B C;  2OWO A;  4MW3 A;  1WA8 A;  1IXM A;  2AXT Z;  1VP7 A;  2JK5 C;  2OTL V;  4KL1 A;  4PA7 A;  4LFB O;  2LGQ A;  1S72 V;  2LO1 A;  3STZ C;  2GBO A;  2ZR2 A;  3ZHV A;  4IL6 Z;  3QO5 A;  3E2E A;  2EZP A;  5LGN A;  3H9V A;  2VQF O;  1S5J A;  5LYJ B;  1KKC A;  3T1Y O;  3CYO A;  4TV9 A;  3I56 V;  3VQW A;  2ZCE A;  4P2Z A;  2DYR B;  1K5Q A;  2Q68 A;  4DV1 O;  4DV2 O;  1ZUQ A;  2ZE8 A;  3RWR D;  1R1B A;  2CE4 A;  2F23 A;  2YXH A;  4DV5 O;  4LP8 A;  3ZJZ A;  2JS5 A;  2WA4 A;  1IBM O;  1HNX O;  1M56 C;  4I0X B;  2O57 A;  4KHP B;  2LFS A;  5JH7 B;  3SR2 C;  3B8M A;  5LXT A;  2JGD B;  1F23 A;  1SQV H;  1PM9 A;  2XAS A;  4GKK O;  3CHX A;  4Q20 A;  3AG1 B;  4JI5 B;  2UXC B;  5CA0 A;  1NTM H;  2FKX A;  2ZIM A;  1XOU A;  2Y69 B;  3EXA A;  4ZHQ A;  3J80 N;  1PV0 A;  1R73 A;  3CRA A;  4EFE A;  4JI2 O;  4K0K O;  1H2S B;  4FMT A;  1O9G A;  2VS0 A;  2ZIO A;  5JVD A;  3RYC B;  2CTQ A;  1XEQ A;  4B08 A;  4DRX A;  4HNA B;  5KA6 A;  4B3R O;  2GSM B;  1NT2 B;  3B77 A;  2C2A A;  1Q81 W;  2X0L A;  1I5X A;  1XNR B;  3SJA C;  3QO7 A;  1YDX A;  4KP4 A;  4IGG A;  3OM3 B;  1SC5 B;  4B3M O;  5GON A;  4H0L B;  4DR4 B;  3CCL V;  2QTO A;  1XMO B;  1VMG A;  5H2F Z;  5EC1 C;  4BIU A;  1R3L C;  4ZOL B;  5JCO A;  3FYI B;  1J5E O;  4I9Q A;  2EIJ C;  2AHZ A;  3ABL C;  3HKD A;  2X7R B;  3AEI A;  2ADP A;  3T1H B;  5EK0 A;  1BSM A;  2YEV A;  3WB2 A;  1KYO F;  5KLV H;  5ITZ B;  4NTX A;  3HKC B;  3IGA C;  1OCZ C;  4LFC B;  1NTZ H;  1RM1 C;  1GRJ A;  5KAI Z;  3X2Q B;  1SQB H;  3B2E E;  5B3S B;  4LF4 B;  4XDK A;  3WB1 A;  1AI7 A;  1K33 A;  2IU0 A;  2UXX A;  1OCR B;  2Q0A A;  4H44 B;  4B3S B;  2YIC A;  1Q8I A;  2DYS B;  4FLU A;  3CPW U;  1OCO C;  3S3W A;  1ZLZ A;  5KX5 B;  2UUB O;  1K97 A;  2FYU H;  5LOV A;  1ARO P;  5J2T A;  4X1K A;  2OIE A;  2R72 A;  3FB8 C;  3K79 A;  4BR6 A;  4JV5 B;  5J9P C;  4DW1 A;  1HR0 B;  4UVA A;  2BTQ B;  3BEH A;  4OXS A;  2B5U A;  2K9P A;  1AP5 A;  3SDL A;  4JZG A;  2YXL A;  5BMV B;  1Y74 B;  3BA9 A;  3E8B A;  1K4C C;  3SYP A;  5IYZ B;  1WJZ A;  3DTU B;  2HVK C;  3F5T A;  4O4J B;  1THZ A;  4FLZ A;  1SQF A;  3R65 A;  1MOF A;  4JI6 B;  2QM8 A;  1R6N A;  1NKD A;  5B1A C;  2EBO A;  1AI4 A;  4U3J B;  1AR5 A;  3DXR A;  4XDL A;  1FJG O;  5H6Q A;  1JMK C;  3AG4 C;  3M99 B;  1BHB A;  5KA5 A;  4YHH B;  4X62 O;  2EJ7 A;  2OYQ A;  2PI5 A;  3SPC A;  2EIM C;  3TJT A;  2OTJ V;  4J9Y B;  1KU9 A;  3OD4 A;  1XRE A;  2Z3Y A;  3UO3 A;  5LP6 B;  3I55 V;  4DR5 O;  1SZT A;  1VQM V;  4TT3 G;  3RYF B;  1Y76 B;  1DTO A;  4DXW A;  5CB4 A;  4JTD B;  1FS0 G;  1EM1 A;  4FZ0 A;  2D2C B;  3T1C A;  2XHB A;  4JI0 B;  4LNU B;  2YDE A;  3RYH B;  3AG3 B;  2W0X A;  2QJ1 A;  2P4K A;  1YJ9 V;  3HB3 B;  3N2G A;  1F4N A;  1NS1 A;  2FB5 A;  4LC1 A;  3TGU H;  1US6 A;  2X6A A;  5EYP B;  2GUZ A;  1N33 B;  3JAS A;  1VQ8 V;  1YSC A;  4NTW A;  1TUB A;  3UKM A;  4LFA O;  3D36 C;  4QE7 A;  1IX9 A;  1PD3 A;  1LUV A;  3JD4 A;  1X59 A;  2DYR C;  2HEP A;  2K1E A;  4QE9 A;  4PV1 B;  1ROP A;  2W0F C;  3KCY A;  4X65 O;  4YJ3 B;  2XAQ A;  3FYE B;  2PY5 A;  4JPR A;  2X6B A;  4DV7 O;  2AZ0 A;  4G2K A;  3FAV B;  4O4I A;  1XDC A;  3ABK B;  3JAT B;  2QA4 V;  4TOI A;  2QEX V;  2KG7 B;  2UUC B;  3SJQ C;  3CCS V;  5GTI Z;  1PNM A;  1VF7 A;  3AG1 C;  1WB7 A;  1QVG U;  1Q3E A;  2EUL A;  2Q69 A;  4GYC B;  1AI5 A;  5HFL A;  2Y69 C;  4LF5 B;  1ORQ C;  5GTH Z;  4DV4 B;  2NR5 A;  1MSD A;  2ZNJ A;  3L73 H;  1TVK A;  2UXB O;  2DE0 X;  3CS5 A;  2ITC C;  4J80 A;  3BA8 A;  3ICX A;  1H2M A;  4DV3 B;  3MDS A;  5EZY B;  3T4Z A;  3LDC A;  1G4Y B;  4BAY A;  1RP3 B;  4LF6 O;  4Z2W A;  3RT3 C;  4EFB A;  2L6L A;  1Y66 A;  2Q4P A;  4J7J A;  1IBK O;  4JTC B;  3N2K A;  3EVK A;  4PI2 A;  3L71 H;  1YVW A;  3VQV A;  3UT5 A;  4DUZ B;  3A8T A;  1RPR A;  1VF6 C;  2JDI G;  4I4T B;  3FFQ A;  2P90 A;  3IC9 A;  4UCS A;  4J10 A;  3SYQ A;  2CH7 B;  4H33 A;  3B40 A;  4IHJ B;  4EEQ A;  5A2Q N;  1WAZ A;  4UXN A;  4CZZ A;  3ASO B;  1NTK H;  3TK1 A;  1K4D C;  3OGC C;  3X2Q C;  1YCI A;  5B3S C;  4JAA A;  4J11 A;  5IYB O;  2AHY A;  1R3J C;  5DED A;  1AI6 A;  4X64 O;  4QGP A;  1H38 A;  3P3N A;  3CRR A;  1JFF A;  1OCR C;  1SZX A;  4DO2 A;  1RPO A;  1XNQ B;  1WB8 A;  2DN9 A;  1F4M A;  3S3X A;  2DYS C;  4JYB A;  1SRY A;  4FK5 C;  3QO8 A;  4JAU A;  4TV8 A;  4A5U B;  2IM9 A;  3JAW B;  4JI1 B;  3HKE A;  3GWO A;  1V9P A;  2PTM A;  5BXZ A;  3K08 A;  3LSU A;  3K5N A;  3WFV A;  1JR9 A;  2N04 A;  3KCX A;  1Q82 W;  1IBL O;  3WB0 A;  1NI8 A;  1ZWI C;  5JQG B;  4GX5 A;  2V7Q G;  2QGN A;  3SPG A;  1FXK A;  1R6T A;  2HHH B;  4O2A B;  2Z5U A;  3G6B A;  4G28 B;  1WLE A;  4QJF B;  1GKF A;  4X20 A;  3RYI A;  3MHS C;  2HKO A;  1F51 A;  2QWR B;  3BCC H;  1KP2 A;  1WA8 B;  2Q6A A;  4JI3 O;  1NQT A;  5AG2 A;  4KXR A;  2P6J A;  4D7S A;  3FB5 C;  2VQE B;  3CCV V;  2QKC A;  4F6E A;  3H1K H;  4RUE A;  1BS3 A;  4CS2 A;  1I94 B;  5LP6 C;  4OX9 O;  4BIZ A;  3O9O A;  4DV6 B;  4PA4 A;  3U10 A;  2JEX A;  1Z5W A;  4TV9 B;  4BW9 A;  1FFX A;  3JCU Z;  5EBL C;  3OTO O;  3LSQ A;  2R9R B;  2A3Q A;  3OAA G;  1QHT A;  5JJN B;  3CE2 A;  1HNW O;  3W7U A;  4UCV A;  4QNH B;  5LMN B;  1Q86 W;  4AHC A;  3AG3 C;  1R3K C;  2JEU A;  2FML A;  1VQN V;  1D5N A;  2OIG A;  4R50 A;  1DGS A;  2WLH A;  2XOK G;  2F4V O;  4YY3 B;  4ASU G;  1LNQ A;  5CA0 B;  4EKW A;  4TUY A;  5JWP A;  2EJR A;  4Z1M G;  1XIL A;  2P5O A;  2F95 B;  4PDR A;  4NVP A;  3G4S V;  4KHP O;  4JGS A;  2WLJ A;  2D3O W;  1GO3 F;  3JAR B;  2ZR3 A;  2HJD A;  3ZN0 A;  1ZAU A;  4NXN O;  4GT1 A;  4CC5 A;  2YIB D;  3SYC A;  3W7X A;  1S77 D;  3JAK A;  4JI5 O;  2UXC O;  4DRX B;  3ABK C;  1QVF U;  1FPO A;  1NU1 H;  3KG2 A;  5CA1 A;  1G6U A;  1P4R A;  1HNZ O;  2YIB A;  1AP6 A;  2E76 B;  4LF7 B;  5F2V O;  3A0R A;  2F66 C;  2HR3 A;  4P9O A;  4MSW C;  2IW5 A;  2GTS A;  1VQ5 V;  3ZMV A;  2ZE5 A;  4F6R B;  1M93 A;  5GON B;  4JI4 B;  1EZJ A;  2HJF C;  1Y67 A;  4JF3 A;  4WFB V;  3G67 A;  1NH2 D;  2ZD9 A;  1K8A W;  2DQ3 A;  3C3S A;  3CRQ A;  4KUM A;  1KMI Z;  3Q4H A;  2CTP A;  4GKJ O;  4X66 B;  3HKD B;  4DV0 B;  2WLN A;  5IJ9 A;  4IIJ A;  4J7K A;  3SGI A;  3F5W C;  1L8D A;  2IJJ A;  5FPO A;  4PI0 A;  3VBB A;  2YEV B;  1Y6X A;  2IJH A;  1SES A;  1N0J A;  4WFG A;  3OTF A;  4JI8 B;  4XBF A;  4JZ2 A;  4YJ2 A;  2CDY A;  1H2L A;  4OGQ B;  2PYL A;  1FAF A;  4GLX A;  2R9A A;  4D6T H;  4X8A A;  4MTO A;  5L3E A;  4RWU A;  1UJW B;  3UO2 A;  1FYJ A;  2ZXW C;  1A32 A;  3O65 A;  1QU7 A;  5LGT A;  3E35 A;  3F7V C;  3TCU A;  3FKS G;  2Q9L A;  4LBE C;  1MZE A;  4PJ0 Z;  2H8P C;  1GN3 A;  3B09 A;  3ASO C;  5LOV B;  1M1K W;  4LF4 O;  1E79 G;  4K35 A;  5J2T B;  1KB9 F;  2F1M A;  3DGE A;  4X1K B;  2VRZ A;  3CRC A;  2M7W A;  5A9G A;  4LFB B;  3E86 A;  1K34 A;  2F93 B;  2QWP B;  3E89 A;  4FLY A;  3HKB A;  2ZM6 B;  2Q67 A;  4QPK A;  4B3S O;  3STL C;  3OUF A;  4DUY B;  3HR0 A;  3P32 A;  3T1Y B;  4FIP C;  1QNM A;  3FX7 A;  1DF5 A;  1IXB A;  4CBC A;  4BWA A;  4DR1 O;  2DOS A;  3SJB C;  1BZK A;  2VWK A;  1NR7 A;  5KHK A;  2UUA B;  1SQP H;  4AI8 A;  4P30 A;  1AR1 B;  1W2B U;  3OMI B;  2WLL B;  3DXR B;  2JJ2 G;  2RQ6 A;  5LYJ A;  4FM2 A;  5H6R A;  2G38 A;  3K59 A;  2RJZ A;  4DR7 B;  4UCR A;  4GKK B;  5JJJ B;  5IJ0 A;  4FVM A;  5L3C A;  3IFX A;  2CGO A;  1E1Q G;  3ZN1 A;  3CCE V;  1BT8 A;  4ZBM A;  3AG2 B;  5LHI A;  2ETN A;  2MW2 B;  4JI6 O;  2IH1 C;  2QWQ B;  3ZHQ A;  1D2D A;  2R70 A;  5L3D A;  4LH7 A;  5BY1 A;  4MTG A;  3G6E V;  1UPG A;  5CB4 B;  1HWY A;  1S5H C;  1V54 B;  1IVS A;  3W7T A;  1AJN A;  4YHH O;  1CPY A;  2XAG A;  4CH6 A;  4K8Z A;  3GVM A;  5EIB C;  1W0J G;  1P7G A;  4CC6 A;  4CH5 A;  2CAZ C;  2XAF A;  3H1J H;  1M57 B;  3CC4 V;  3JAS B;  4MW8 A;  1TUB B;  4BIO A;  5IY5 B;  4I7Z B;  5D5P A;  4B3T B;  1AIL A;  1Z2G A;  3DC6 A;  4RUF A;  4FLW A;  4FJC C;  2IH3 C;  3W7S A;  4EB6 A;  1PL0 A;  4GX1 A;  5J2U B;  2W6I G;  1R3I C;  3A0H Z;  1VF5 B;  1AJQ A;  4LH6 A;  3AK3 A;  2ATK C;  1N33 O;  2KB1 A;  2LW7 A;  4O4I B;  1RSO A;  4U7N A;  1V55 B;  3ZMS A;  1F7Y A;  3JAM N;  4CH3 A;  1J5E B;  2QM7 A;  2F43 G;  4QPJ A;  4H13 B;  2JS3 A;  5B5E Z;  2Y4T A;  3JCZ A;  5D5Q A;  1HW7 A;  3VQX A;  4E4E A;  4UFZ A;  1OZ0 A;  2WPD G;  1TVK B;  3SPI A;  1B06 A;  4FFB A;  1CXZ B;  1NR1 A;  2WSS G;  1EZV H;  2KQX A;  3PJS K;  3ZIA G;  4UB6 Z;  1XHZ A;  3ZHS A;  4LF5 O;  2QKS A;  3HKC A;  4X88 A;  2YXY A;  4DV4 O;  2P7T C;  5E1A C;  4MVS A;  3N2K B;  3SPH A;  1WP8 A;  3UT5 B;  1VQO V;  4AQY B;  3JAL A;  1P84 F;  4DW0 A;  3K3W A;  3CXH F;  5JCO C;  4DV3 O;  5HFM A;  4OPH A;  4LF8 O;  1Q6U A;  3J81 N;  3KKY A;  1BHA A;  2L35 A;  3LSS A;  1Q43 A;  3OR6 C;  5EBM C;  1WNS A;  4JI7 B;  4JYA B;  4X1Y A;  3ZCC A;  3H01 A;  3RGB A;  1AR4 A;  1Y4M A;  4DUZ O;  4WF9 V;  2BSK A;  5DM6 V;  4J9Z B;  2OCC B;  4N23 A;  2PI4 A;  4MTX A;  2CGN A;  1BGY H;  4R7C A;  4MVM A;  2EX3 A;  3D3Q A;  2ILM A;  5B1O A;  2AGA A;  2QDO A;  2UU9 O;  1JFF B;  5CA3 A;  1URF A;  4UCT A;  2W6J G;  4GUN A;  4HZ3 A;  3JD3 A;  3HKE B;  2P67 A;  1M90 W;  1XUQ A;  1B6Q A;  1K73 W;  3ETG A;  3ZRW A;  4MT8 A;  1SER A;  4WFH A;  1N34 B;  1Q7Y W;  4W4L A;  2QR4 A;  3BRC A;  4JAS A;  4BW5 A;  5KUK A;  3K9S A;  1MSW D;  1FXK B;  4MS2 A;  1PL4 A;  1Q6I A;  4MVR A;  1H2N A;  4ZI7 A;  3M8A A;  4X20 B;  3K06 A;  4ZIB A;  4GX0 A;  3RYI B;  2IJI A;  4O2B A;  5CN0 A;  3C3T A;  1ZL8 B;  3QTC A;  5K1P A;  1XBL A;  1DLB A;  4LCU C;  1M5I A;  3H1L H;  4GCZ A;  2HHH O;  2XAH A;  3D8C A;  2HP8 A;  1P49 A;  2E75 B;  1BQZ A;  2E5L B;  3OUS A;  3E83 A;  3ZS8 C;  5BR8 O;  3D3I A;  4R8C A;  1SA0 A;  4FPP A;  3ETE A;  3AG2 C;  3ETD A;  1IZ3 A;  1VQ9 V;  2AW9 A;  2A9H A;  2JGU A;  4WBN A;  1N8R W;  2WWW A;  1V54 C;  2EIN B;  1QQC A;  2DJV A;  2VQE O;  2Q8V A;  1NBM G;  4NYK A;  1PNL A;  4UV8 A;  1JQ0 A;  1XL6 A;  1L0N H;  2MK3 A;  1I94 O;  3J7A U;  3OFN G;  1KEC A;  1XMQ B;  4DV6 O;  1GM7 A;  1FXH A;  4K3A A;  5CBG A;  1N36 O;  1HDJ A;  1M57 C;  5FL7 G;  1KC8 W;  2GTA A;  5IY5 C;  2XTA A;  4LF6 B;  2YID A;  5LMN O;  4TUY B;  2Q0O C;  3GB7 C;  3ABM B;  2P22 C;  5LL6 Y;  2JIZ G;  4U7O A;  4DK1 A;  1YHQ V;  1IBK B;  3ZMU A;  1ENV A;  1DF4 A;  2WLI A;  3CWB H;  4WCE V;  4I50 A;  4MVZ A;  4YY3 O;  3CCU V;  4NXM B;  1WPB A;  3JAK B;  1VQP V;  3ZX6 A;  1V55 C;  3CRM A;  5C8Y A;  2LGW A;  5LA6 A;  4RO2 A;  5CA1 B;  3CP1 A;  2KKW A;  1OV9 A;  5CBF A;  4PDV A;  2XUM A;  5KHI A;  4N21 A;  4WFF A;  1JX9 A;  3OEH G;  2PF4 E;  2ZQM A;  5KMG A;  3BPZ A;  3B4S A;  3K0D A;  3CD6 V;  1JCH A;  1XI1 A;  2QTS A;  4C7U A;  4P9P A;  1WPX A;  1YXB A;  2CK3 G;  2DMX A;  5KHH A;  3IJ4 A;  5IT9 N;  2JVD A;  4LF7 O;  2LFR A;  5IJ9 B;  4IIJ B;  3BAA A;  5FNV A;  2YSU B;  5L3G A;  1S0V A;  5IDJ A;  2QE7 G;  1YI2 V;  4JI4 O;  4IYI A;  5LXT B;  3P30 A;  4GZR B;  3WG7 B;  1BQ0 A;  4UV9 A;  5FLX N;  4YJ2 B;  2BE3 A;  4B7K A;  5KUM A;  4X66 O;  1YTF D;  4DV0 O;  2QSA A;  2QM4 A;  5LHH A;  5LBQ A;  3CJH A;  1AVM A;  4ZHQ B;  1JOY A;  4UUJ C;  3K5L A;  2M6Y A;  2ZDI C;  1AB3 A;  3RN4 A;  2HLD G;  1N0N A;  5CMU A;  3A2F A;  1SF9 A;  1BL8 A;  1N32 B;  1K3E A;  3CEI A;  5JVD B;  1YJW V;  1KQS U;  3ETQ A;  1GN2 A;  3K0G A;  4I55 A;  1JA8 A;  2A0L A;  3NXS A;  2OCC C;  3OR7 C;  4CS4 A;  4KFM A;  3ZMT A;  1Q5O A;  3HKB B;  1EN4 A;  1GAX A;  3L75 H;  4DR3 B;  2B1G A;  1GM8 A;  4IYH A;  3E8F A;  3K9A A;  2WAM A;  1K5S A;  3B8N A;  5KAF Z;  1GN6 A;  2Q5Z A;  4OX9 B;  1SET A;  5K1X A;  1HP8 A;  2DW4 A;  2Y48 A;  4UCO A;  1FD9 A;  3E8G A;  3OTO B;  4DR6 B;  1HNW B;  2YS8 A;  5IE9 A;  3RVZ A;  3JD1 A;  4X89 A;  3JSL A;  4X1I A;  2ZM6 O;  5LMU B;  1U97 A;  5L3B A;  1T5E A;  1L1F A;  3ZHR A;  2XAJ A;  1XNR O;  4IT5 A;  4DUY O;  5IWA B;  1Z5V A;  2Q73 A;  2PZS A;  1QCE A;  2UXD B;  3K5O A;  2Q7H A;  4LF9 B;  3JD0 A;  4DR4 O;  1XMO O;  4ZKI A;  2F4V B;  1FXK C;  2DQ0 A;  4PA6 A;  2Z0A A;  5IJ0 B;  1GM9 A;  2ITD C;  1ZTE A;  4JAV A;  1JJ2 U;  1GH6 A;  2WLM A;  4HAM A;  1LUW A;  3K5M A;  3N27 A;  2UUA O;  1S76 D;  3PN1 A;  3T1H O;  4FLT A;  4NXN B;  3IAY A;  4DR7 O;  4LWS A;  1NVP D;  2BTO A;  4DR2 B;  2Y4U A;  4LFC O;  4WFE A;  1W0K G;  2HG5 C;  3CCR V;  3E22 A;  1W59 A;  1GN4 A;  3A0B Z;  1HNZ B;  3ABT A;  4O4H A;  5FPR A;  3JAR A;  2VWJ A;  4O4L A;  3ZMZ A;  4W4K A;  4Q6G A;  4FZ1 A;  2EIN C;  4EB6 B;  1RFY A;  1XHX A;  2VQF B;  2YIA A;  3NR7 A;  1AJP A;  1R6K A;  2PUS A;  1RSO B;  2ODM A;  3RBZ A;  4DV1 B;  4DV2 B;  2NNU A;  2XND G;  1JJO A;  1BCC H;  4GKJ B;  2ZNI A;  4JV5 O;  1H2K A;  4RQF A;  2EZO A;  4B3T O;  1GK9 A;  2GV9 A;  2NN4 A;  4U3F H;  5B1N A;  3RW0 A;  4DV5 B;  1HR0 O;  3CME V;  1IBM B;  1HNX B;  4F6R A;  2B1I A;  4I9W A;  4PDL A;  2FTK A;  3ABM C;  4PEL A;  5H9C A;  1EN6 A;  2PGG A;  3D36 A;  1OJH A;  2IBZ H;  2N05 A;  4FFB B;  2ADQ B;  3T4D A;  4NR1 A;  4FLX A;  1WN7 A;  4FM0 A;  3CB2 A;  3FB7 C;  1GTO A;  3MD0 A;  4K8X A;  3WU2 Z;  1QLE B;  1PNK A;  4WFA V;  4NKG B;  4AIL C;  3ZRX A;  2ZE6 A;  4I0X A;  5JH7 A;  4I5S A;  4JI2 B;  4K0K B;  1I08 A;  2P06 A;  4GX2 A;  2JGD A;  4J42 A;  3THO A;  3TET A;  4J7Z A;  3DC5 A;  3GWK C;  3HPL C;  4PHZ A;  3N2G B;  1QLN A;  1FKA O;  1SQG A;  1YIT V;  2UXN A;  2RMK B;  3JYC A;  1KUQ A;  2GUZ B;  5LHG A;  4B3R B;  1S3J A;  3H1I H;  1DK1 A;  3JAL B;  2V4D A;  4HBN A;  2EIL B;  1VQL V;  1Q90 D;  1UFI A;  4JI0 O;  2NLJ C;  3QG5 A;  3ZHU A;  3RYC A;  4B3M B;  1PPJ H;  4DR1 B;  4X1Y B;  4HNA A;  2Q7G A;  4AQY O;  1XQ8 A;  2QKA A;  2KSD A;  2BSK B;  3WG7 C;  2BOB C;  3T2M A;  5EBW C;  3OW2 U;  2QWN B;  4TQD A;  2BOC C;  1H8H G;  2FL4 A;  4RQE A;  2Y0I A;  3CX5 F;  3E8H A;  3L70 H;  3ZED A;  1VQ4 V;  2ZE7 A;  4JI7 O;  4JYA O;  3EHB B;  1VF6 A;  4ZOL A;  1VQ7 V;  3K58 A;  1I0H A;  1OCC B;  3M7M X;  2ZKO A;  1TA8 A;  2UUC O;  4ABM A;  2A79 B;  2IJK A;  2WLL A;  3ML0 A;  4TQF A;  1PKX A;  3ASN B;  3CCM V;  1G1X B;  3RFR A;  4HYO A;  4UB8 Z;  3ZRW B;  1OHH G;  3APQ A;  3CMA V;  1CP9 A;  4L8J A;  5ITZ A;  3AK1 A;  4L87 A;  3BVO A;  5C93 A;  2EIK B;  3ZHT A;  2WLK A;  2OCH A;  2UUB B;  1L0L H;  1KKD A;  3K03 A;  4FLV A;  5GW7 A;  4FM1 A;  3TXS A;  3ZRV A;  4ZI7 B;  1J95 A;  4PA3 A;  3VQY A;  2JRI A;  2RCV A;  5DEC A;  1CEZ A;  4O2B B;  2LJ2 A;  4FFK A;  1N34 O;  1BMF G;  4TWK A;  2DWE C;  1KBH A;  5KX5 A;  3BFR A;  4CS3 A;  4UVB A;  1ZX3 A;  1EN5 A;  1M4U A;  1D5A A;  2XT9 A;  3R66 A;  3U0Z A;  3L74 H;  1COW G;  1VAR A;  2A7W A;  4ICG A;  5IYC O;  1K9M W;  5L3F A;  1TGO A;  3L72 H;  3CXC U;  2BTQ A;  3AG7 A;  1FJG B;  1SA0 B;  1IDS A;  3W7W A;  3LDE A;  4X62 B;  5J2U A;  2CUG A;  2LQT A;  4WBN B;  5BMV A;  1Y74 A;  5JJE B;  3MAQ A;  3OEE G;  1GMG A;  5IYZ A;  3UQ8 A;  5B1B B;  3AK2 A;  3CCQ V;  4O4J A;  4DR5 B;  1MAB G;  2E5L O;  4XDJ A;  5H5N A;  3CSX A;  4YXW G;  4TV8 B;  5IYD O;  2LW1 A;  4U3J A;  1JVM A;  3SYO A;  3K04 A;  2H3O A;  2YI8 A;  2N74 A;  1PP9 H;  1Q6H A;  4LR3 A;  3CC7 V;  3LDD A;  3UM7 A;  4TSF G;  2R9I A;  4G27 B;  3UCS C;  5LP6 A;  1WP7 A;  1MZF A;  1XNQ O;  1LR1 A;  3EFF K;  4MVU A;  3BAB A;  2WLI B;  1SKV A;  2RDC A;  1XMQ O;  3RYF A;  4LFA B;  1Y76 A;  4UVC A;  4JI1 O;  3JSN A;  4I50 B;  1MA1 A;  4E2L A;  4UCU A;  3RVY A;  1SS3 A;  1G8M A;  4LNU A;  2GDS A;  4LF8 B;  3G80 A;  5C8Y B;  1M56 B;  3RYH A;  5LA6 B;  5KHJ A;  3QVN A;  1M9N A;  3DSQ A;  1TUE B;  1EBO A;  4X65 B;  2BCC H;  1P7B A;  4OPA A;  4YIO A;  5EYP A;  4DV7 B;  3CCJ V;  1VQK V;  3QF7 A;  1X4T A; 
#chains in the Genus database with same CATH homology
 3BY6 A;  4JYC A;  4JTA B;  2HVJ C;  2Z3Y A;  2Q67 A;  4QPK A;  1H8E G;  3STL C;  3OUF A;  5KUM A;  1YTF D;  3I55 V;  1SZT A;  1VQM V;  4TT3 G;  2ZXW B;  3P32 A;  5LHH A;  5LBQ A;  1KP3 A;  3QNE A;  2ZDI A;  4FIP C;  1JOY A;  1DF5 A;  4UUJ C;  1DTO A;  4DXW A;  2ZDI C;  4CBC A;  4PDM A;  1M1K W;  4JTD B;  1QLE C;  1FS0 G;  5BZB A;  2HLD G;  1FXV A;  1K92 A;  5EC2 C;  5CMU A;  3T1C A;  3LNM B;  1NR7 A;  5CBH A;  1BL8 A;  1K3E A;  1YJW V;  3AG3 B;  1KQS U;  3K0G A;  2DWD C;  2A0L A;  4P30 A;  3HB3 B;  1AR1 B;  3OMI B;  2WLL B;  1F4N A;  1YJ9 V;  2JJ2 G;  1W2B U;  4LC1 A;  2X6A A;  3NXS A;  2OCC C;  3OR7 C;  4KFM A;  5H6R A;  3ZMT A;  1VQ8 V;  1YSC A;  4MVQ A;  3UKM A;  4MTF A;  4R6Z A;  4RAI A;  2B1G A;  4QE7 A;  5DN6 G;  1PD3 A;  1GM8 A;  3JD4 A;  3E8F A;  3K9A A;  2WAM A;  1K5S A;  5L3C A;  2EIL C;  2DYR C;  3B8N A;  3IFX A;  1MG1 A;  1E1Q G;  3ZN1 A;  3CCE V;  5LHI A;  4ZBM A;  1SET A;  3AG2 B;  2DW4 A;  2JJ1 G;  2IH1 C;  2HFE C;  2K1E A;  2Y48 A;  4QE9 A;  5L3D A;  4MTG A;  3G6E V;  3JD2 A;  1ROP A;  1I5Y A;  2W0F C;  4PA9 A;  3MHH C;  3E8G A;  2XAQ A;  3FYE B;  1HWY A;  1S5H C;  1V54 B;  3W7T A;  4JPR A;  2X6B A;  1AJN A;  4F4L A;  1YTF B;  1CPY A;  2XAG A;  3JD1 A;  4G2K A;  2EIJ B;  3ABL B;  4X89 A;  3RVZ A;  3SPJ A;  5LGU A;  1JPX A;  1YIJ V;  1XL4 A;  1W0J G;  3ABK B;  1KD1 W;  2QA4 V;  5L3B A;  1L1F A;  2QEX V;  1QR8 A;  2XAJ A;  2XAF A;  3SJQ C;  3CCS V;  1PNM A;  1E1R G;  1M57 B;  3AG1 C;  3CC4 V;  1QVG U;  1QCE A;  4MW8 A;  2Q69 A;  1OCZ B;  3JD0 A;  1AI5 A;  5HFL A;  1RM1 B;  4ZKI A;  3CC2 V;  2Y69 C;  1FXK C;  1ORQ C;  2DQ0 A;  4PA6 A;  5IY5 B;  1GM9 A;  2ITD C;  4JAV A;  1QR9 A;  2V1D A;  1JJ2 U;  4RUF A;  1FFT B;  2WLM A;  4HAM A;  4FJC C;  2IH3 C;  3W7S A;  1S76 D;  1OCC C;  2X6C A;  3IC7 A;  1PL0 A;  4GX1 A;  2ITC C;  1R3I C;  2W6I G;  3FB6 C;  1AJQ A;  2ATK C;  2KB1 A;  1VQ6 V;  3ASN C;  1OCO B;  4U7N A;  1V55 B;  3T4Z A;  3ZMS A;  4MVO A;  2QM7 A;  3LDC A;  1G4Y B;  1EFR G;  2F43 G;  4QPJ A;  1NVP D;  4BAY A;  2LP7 A;  4WFE A;  2GHY A;  1W0K G;  2HG5 C;  3G71 V;  3CCR V;  1QBZ A;  2EIK C;  1NH2 B;  3OE7 G;  1Y66 A;  4JTC B;  3JCZ A;  3ABT A;  3F7Y C;  1OZ0 A;  1RPR A;  2JDI G;  2WPD G;  3SPI A;  2IU3 A;  3ZMZ A;  2P90 A;  3ABU A;  2EIN C;  1YJN V;  3SYQ A;  1NR1 A;  2WSS G;  4H33 A;  4QIW F;  1K7D A;  3SYA A;  1AJP A;  1R6K A;  3PJS K;  2H94 A;  3ZIA G;  3RBZ A;  3VOU A;  2NNU A;  2XND G;  3OMA B;  2QKS A;  4UXN A;  4RQF A;  4H37 A;  2EZO A;  3ASO B;  4X88 A;  4CZZ A;  1GK9 A;  5B1A B;  5B1N A;  3OMN B;  3RW0 A;  2P7T C;  3CME V;  3AG4 B;  3TK1 A;  5E1A C;  1NJI W;  1K4D C;  4MVS A;  3SPH A;  3OGC C;  3X2Q C;  2B1I A;  4I9W A;  5B3S C;  2EIM B;  4PDL A;  2FTK A;  3ABM C;  2OT5 A;  4PEL A;  1NVP B;  5H9C A;  1VQO V;  5IYB O;  3LUT B;  2AHY A;  3D36 A;  1R3J C;  1AI6 A;  3ZRS A;  1H38 A;  3K3W A;  1OCR C;  4DO2 A;  1RPO A;  5HFM A;  3T4D A;  1H2G A;  5B1B C;  1BHA A;  1F4M A;  3FB7 C;  2DYS C;  4JYB A;  4MW3 A;  1GTO A;  1SRY A;  3MD0 A;  3QO8 A;  1QLE B;  3LSS A;  4FK5 C;  4JAU A;  1PNK A;  3OR6 C;  5EBM C;  4WFA V;  1IXM A;  3ZRX A;  3GWO A;  2JK5 C;  3H01 A;  3ZCC A;  4I5S A;  2OTL V;  4PA7 A;  4GX2 A;  3TET A;  1Y4M A;  4WF9 V;  1S72 V;  3K08 A;  3STZ C;  2ZR2 A;  3HPL C;  5DM6 V;  3QO5 A;  3WFV A;  1QLN A;  3E2E A;  2EZP A;  4J9Z B;  5LGN A;  2OCC B;  4N23 A;  1Q82 W;  1YIT V;  2UXN A;  2PI4 A;  4MTX A;  3JYC A;  4R7C A;  1ZWI C;  5LHG A;  4GX5 A;  1S3J A;  2V7Q G;  4MVM A;  3CYO A;  3SPG A;  1FXK A;  3I56 V;  5B1O A;  4P2Z A;  2EIL B;  2DYR B;  1K5Q A;  1VQL V;  2Q68 A;  2Z5U A;  4G28 B;  1WLE A;  4QJF B;  1GKF A;  2NLJ C;  5CA3 A;  3MHS C;  2HKO A;  1F51 A;  2W6J G;  4LP8 A;  3ZJZ A;  1KP2 A;  2Q6A A;  1M56 C;  4HZ3 A;  3JD3 A;  1NQT A;  2LFS A;  2P67 A;  3B8M A;  1M90 W;  2P6J A;  3FB5 C;  1B6Q A;  1K73 W;  3ETG A;  1F23 A;  3ZRW A;  3CCV V;  4MT8 A;  3WG7 C;  1SER A;  2XAS A;  4WFH A;  2BOB C;  4Q20 A;  4RUE A;  3T2M A;  3AG1 B;  1Q7Y W;  5EBW C;  3OW2 U;  2BOC C;  4BIZ A;  1H8H G;  4JAS A;  4PA4 A;  4BW5 A;  5KUK A;  2JEX A;  2Y69 B;  1MSW D;  1FXK B;  4MS2 A;  4RQE A;  3E8H A;  4MVR A;  1VQ4 V;  5EBL C;  3LSQ A;  3EHB B;  2R9R B;  1R73 A;  3OAA G;  3W7U A;  4QNH B;  1VQ7 V;  4FMT A;  3K06 A;  1OCC B;  4GX0 A;  2IJI A;  5CN0 A;  1Q86 W;  3AG3 C;  2A79 B;  2IJK A;  2WLL A;  1R3K C;  3ML0 A;  1PKX A;  3ASN B;  3CCM V;  2JEU A;  1DLB A;  4LCU C;  5KA6 A;  2GSM B;  1VQN V;  4R50 A;  4GCZ A;  3B77 A;  4HYO A;  2WLH A;  3ZRW B;  1OHH G;  2XOK G;  3CMA V;  2XAH A;  1CP9 A;  4ASU G;  1LNQ A;  4L87 A;  2C2A A;  1Q81 W;  5C93 A;  2X0L A;  2EIK B;  2WLK A;  1I5X A;  3OUS A;  3E83 A;  1KKD A;  3K03 A;  3QO7 A;  4EKW A;  4KP4 A;  2EJR A;  4Z1M G;  3D3I A;  3OM3 B;  5GW7 A;  4R8C A;  4FPP A;  4PDR A;  3ETE A;  3AG2 C;  3ETD A;  3CCL V;  2QTO A;  1VQ9 V;  3ZRV A;  3G4S V;  4JGS A;  2WLJ A;  2A9H A;  1GO3 F;  2D3O W;  2ZR3 A;  1J95 A;  4PA3 A;  5EC1 C;  1R3L C;  3ZN0 A;  4BIU A;  1N8R W;  2WWW A;  3FYI B;  1V54 C;  2EIN B;  4GT1 A;  1CEZ A;  1NBM G;  3ABL C;  2AHZ A;  2EIJ C;  1PNL A;  4UV8 A;  1JQ0 A;  3SYC A;  3W7X A;  1XL6 A;  1S77 D;  1BMF G;  4TWK A;  2X7R B;  2DWE C;  2MK3 A;  3ABK C;  1QVF U;  3OFN G;  1KEC A;  3AEI A;  1GM7 A;  4UVB A;  5EK0 A;  3KG2 A;  1FXH A;  2YEV A;  5CBG A;  1M57 C;  5FL7 G;  1P4R A;  1KC8 W;  3IGA C;  1OCZ C;  3A0R A;  1RM1 C;  2HR3 A;  1COW G;  4P9O A;  4MSW C;  2IW5 A;  5IY5 C;  1K9M W;  5IYC O;  3X2Q B;  5L3F A;  1VQ5 V;  3ZMV A;  5B3S B;  3CXC U;  3GB7 C;  3ABM B;  2JIZ G;  4U7O A;  1YHQ V;  4XDK A;  3W7W A;  3ZMU A;  1AI7 A;  3LDE A;  1ENV A;  1DF4 A;  1EZJ A;  2HJF C;  4JF3 A;  2WLI A;  4WFB V;  1K33 A;  2IU0 A;  2UXX A;  4WCE V;  2ZD9 A;  1NH2 D;  1K8A W;  1OCR B;  3OEE G;  1GMG A;  2DQ3 A;  5B1B B;  4KUM A;  4MVZ A;  3CCQ V;  3CCU V;  2DYS B;  2WLN A;  1VQP V;  1MAB G;  3CPW U;  1OCO C;  4XDJ A;  1V55 C;  4YXW G;  1K97 A;  3F5W C;  2IJJ A;  3VBB A;  5IYD O;  4RO2 A;  1ARO P;  1JVM A;  3SYO A;  2YEV B;  3K04 A;  3CP1 A;  2IJH A;  1SES A;  4WFG A;  5CBF A;  3FB8 C;  4PDV A;  4XBF A;  3K79 A;  4N21 A;  5J9P C;  4WFF A;  1JX9 A;  3OEH G;  3CC7 V;  3LDD A;  3UM7 A;  4TSF G;  2R9I A;  4UVA A;  4G27 B;  3BEH A;  2ZQM A;  4OXS A;  4X8A A;  3EFF K;  3K0D A;  3CD6 V;  4MTO A;  1JCH A;  5L3E A;  2B5U A;  1UJW B;  4MVU A;  2WLI B;  4P9P A;  1WPX A;  2ZXW C;  3E8B A;  4UVC A;  1K4C C;  3SYP A;  5LGT A;  2CK3 G;  3DTU B;  3E35 A;  2HVK C;  3F7V C;  4E2L A;  3RVY A;  5L3G A;  1THZ A;  3TCU A;  1G8M A;  2LFR A;  3R65 A;  3FKS G;  1MOF A;  4LBE C;  1M56 B;  2QM8 A;  1R6N A;  1M9N A;  2H8P C;  3ASO C;  1TUE B;  2YSU B;  1NKD A;  1E79 G;  1EBO A;  2EBO A;  1AI4 A;  4XDL A;  5B1A C;  5IDJ A;  1S0V A;  2QE7 G;  3DGE A;  5H6Q A;  1YI2 V;  3AG4 C;  3M99 B;  1P7B A;  1BHB A;  2M7W A;  5KA5 A;  3P30 A;  3CCJ V;  1VQK V;  3WG7 B;  3E86 A;  2PI5 A;  4UV9 A;  3SPC A;  1K34 A;  2EIM C;  3E89 A;  2OTJ V;  4J9Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...