4WFGA

Human traak k+ channel in a tl+ bound conductive conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 96
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfgA00
4MVQA 4TWKA 5EBWC 1M56C 3IFXA 4MVRA 1M57C 2WLKA 1R3IC 4MVOA 3T1CA 4MVUA 5E1AC 2X6BA 1K4DC 3E8HA 4R7CA 4XDJA 3IGAC 4LBEC 4F4LA 2EIMC 2WLHA 2KB1A 2P7TC 2AHZA 3K0GA 3K04A 3ASNC 3F7VC 3LDEA 3OR7C 5BZBA 3SPHA 4R8CA 4MTFA 4R50A 4XDKA 1V54C 3RVZA 2ITCC 3SYPA 1LNQA 5CBHA 2ITDC 2DWDC 2OCCC 3OUFA 5KUKA 1G4YB 4MSWC 4PDVA 1R3LC 3PJSK 3SPGA 3FB8C 4BW5A 3F7YC 2HG5C 2BOBC 4MW3A 3E83A 2WLJA 4MTOA 1JVMA 4GX1A 2ATKC 4RUFA 3LDDA 4G27B 3ABKC 2W0FC 3ZJZA 3E8GA 2NLJC 1S5HC 3E86A 4P30A 4PA7A 2EINC 2WLIA 2EILC 4H37A 2WLLA 4RO2A 3OUSA 5KUMA 4WFHA 3FB7C 4ZBMA 1OCRC 4LCUC 4QE7A 3F5WC 3SPCA 5CBGA 1J95A 4GX0A 2K1EA 4OXSA 4P9OA 2QKSA 4JTCB 3T2MA 3ZRSA 3X2QC 2HVKC 4H33A 4XDLA 2A9HA 2EIJC 3JYCA 4PDMA 2ZXWC 3LNMB 4P2ZA 4G28B 2YEVA 4PA6A 5J9PC 1OCOC 3AG3C 4JTDB 1BL8A 3ABMC 2HFEC 3OGCC 5B1BC 3KG2A 2EIKC 3SYAA 3R65A 1OCZC 4WFGA 2HJFC 3T4DA 1K4CC 2Q69A 4MS2A 5IY5C 5CBFA 2A79B 4MW8A 3RBZA 3OR6C 2QTOA 2AHYA 3E8FA 4MVZA 3SPIA 3FB6C 1P7BA 2X6AA 4I9WA 4QE9A 4DXWA 2A0LA 2R9RB 2H8PC 3LUTB 4UUJC 3GB7C 1ZWIC 5EC2C 4RUEA 4KFMA 1V55C 3AG2C 4PA9A 4RAIA 3SYCA 2Q67A 1ORQC 4X89A 3RW0A 2IH1C 4MVSA 3K06A 5EC1C 2IH3C 3STLC 4EKWA 5B3SC 2HVJC 2WLNA 4PDLA 4HZ3A 2X6CA 3SPJA 4CBCA 2DYRC 4MTGA 2BOCC 3AG4C 4PA4A 3AG1C 4X8AA 1OCCC 3K03A 2Q68A 4GX2A 4J9ZB 2ZD9A 3BEHA 3UKMA 4P9PA 3TETA 3LDCA 1QLEC 2Q6AA 1R3KC 4MVMA 1XL6A 3SJQC 3VOUA 4PDRA 3HPLC 1R3JC 2WLMA 4GX5A 1XL4A 3SYQA 2DWEC 3E8BA 4WFEA 4X88A 2Y69C 3SYOA 3WG7C 1KKDA 3E89A 3EFFK 2JK5C 5EBLC 3T4ZA 4LP8A 4HYOA 3TCUA 3RVYA 5EK0A 4JTAB 4QNHB 4R6ZA 5B1AC 3K08A 3ASOC 3UM7A 4PA3A 2WLIB 2DYSC 2WLLB 4WFFA 5EBMC 4J9YB 3ABLC 3STZC 3FB5C 3K0DA
chains in the Genus database with same CATH superfamily
4MVQA 2P5OA 4LFBB 3AG4B 4LC1A 4O2AA 4MVUA 4Q20A 1AVMA 3QO7A 3J80N 4F4LA 4LR3A 3BA9A 3QG5A 3QVNA 4DV5O 1JPXA 3WG7B 4PV1B 3CCRV 2CH7A 1XILA 1V54B 3WB2A 4GLXA 2CTQA 4I9QA 1TVKA 1YVWA 1G4YB 2P67A 4JI7O 2QDOA 4J7KA 1JVMA 4UCTA 1PPJH 4JAVA 4UXNA 4JI1B 1OV9A 3JD0A 4ABMA 4GKJO 4DV3B 1RM1B 4W4KA 1VF7A 4TV8B 3TK1A 3E35A 4DW0A 5JWPA 3E2EA 2YXLA 2M6YA 2X7RB 1NJIW 4KHPB 1FD9A 5JCOA 4EB6B 2CGOA 5J9PC 1OCOC 1VQ5V 1NVPD 2LFSA 4DK1A 1Q7YW 2Q69A 2OTLV 4JI2B 1HNZO 1FXHA 4UUJC 3SJBC 3GB7C 3DSQA 5IDJA 4I55A 1LR1A 3RYCB 4EKWA 4YY3O 3HKCB 4DV2B 1LUWA 4YJ2B 5KHKA 2X0LA 3I55V 3A0HZ 1Q6IA 3SYQA 5JCOC 4I4TA 2Q4PA 2N74A 2ZKOA 3JCUZ 1NTZH 5KA6A 3ICXA 3JSNA 4FVMA 5LGUA 3K0DA 3JAMN 1QR8A 1AI4A 4MVRA 3ZCCA 5A2QN 1R3IC 2KG7B 2E74B 3FD9A 1XHXA 3CCMV 1HR0B 4TQFA 3P32A 3U11A 5LHIA 2DW4A 1VQNV 5DECA 3CSXA 4DR4O 3T1HB 3ZMVA 5C8YB 2JIZG 2CTRA 1XQ8A 3L72H 3I56V 2DYSB 3SPGA 3UT5A 4B3MO 3B2EE 2PF4E 4J42A 1XEQA 3ZJZA 3E8GA 4BAYA 2QSAA 5HFMA 1H2LA 4PI2A 2PY5A 2QR4A 3SPCA 1MSWD 3ZRXA 2KQXA 3CXHF 3X2QC 1YF2A 2UXDB 3UO3A 1GMGA 5H5NA 4LFAB 3THOA 5JH7B 2YXYA 1KU9A 1R6NA 4TV9A 4J7ZA 1GN6A 4LF6B 3GWKC 1EN4A 2WSSG 2GBOA 4DR1B 3K5MA 5CN0A 3AG2C 4JI6B 4HAMA 3AK1A 2R72A 2HVJC 4GX2A 3CCJV 4NXNO 4I0XB 3LDCA 3MAQA 2HKOA 4CC5A 3ABMB 3CC2V 4X1IA 2EIKB 4ZIBA 3DXRA 2CTPA 1KKDA 4O2AB 4O4LB 4TSFG 3BABA 4AQYB 4JASA 5EBMC 3K79A 4EEQA 4IGGA 1PKXA 1M57C 3L71H 4XDJA 2P4VA 1VQPV 1G1XB 2EIMC 1YSCA 3ZMSA 5LHHA 3WB0A 1AR1B 1MG1A 3F5TA 4N23A 4MTFA 5IT9N 1S76D 2ITCC 2ZR3A 3L75H 4FFBB 5JQGB 4PDVA 3FYEB 4NR1A 2ZT9B 3F7YC 4OGQB 5LHGA 2EJRA 2UXXA 4GZRB 2WLJA 3JALB 1FFXB 5EIBD 5IE9A 5JVDB 4RQFA 2NLJC 1R1BA 1H2NA 1WP8A 2EINC 4JV5B 1SZXA 1K92A 1QHTA 4X1KA 3CB2A 4LNUB 2K1EA 1YZBA 1VQMV 1QLNA 2PZSA 2Y4TA 5IJ0B 5GW7A 1N8RW 3ZEDA 2AZ0A 3KCYA 5GONA 2XAJA 2VRZA 4PA6A 4FFKA 3AG3C 3ZS8C 2W6JG 4MS2A 1VF5B 5HFLA 2X6AA 1IXBA 4DV7B 1Q8IA 2Y0PA 5EZYA 3JD3A 1QBZA 1KECA 4WBNA 4LFBO 1JMKC 2VWJA 2ARHA 2JJ1G 1VP7A 2QM7A 2DYRC 4DR3B 4P9PA 4JI8O 5LP6A 4WFAV 2JJ2G 5CB4B 1N4CA 3FFQA 1YI2V 2Y0IA 1QR9A 4J10A 3JD1A 4JPRA 5B1AB 1Y74B 3NR7A 3K58A 5CA1B 1ZUQA 1MA1A 4QPJA 1P49A 1IDSA 4DR2B 1GN4A 1JOYA 4JI1O 4I50B 3HKDA 4DV3O 2CGNA 2ZNJA 2OYQA 4BW9A 2O57A 3W7WA 5GTIZ 5LP6C 1VQ6V 2A06H 3KCXA 4R50A 2W6IG 4ZI7B 5H6RA 1PNLA 4TUYA 4FM0A 1LNQA 3ETDA 4HNAB 4KHPO 5CA3A 4DRXA 1ZSPA 2LGQA 1Y4MA 4PHZA 2YDEA 1FXKB 4TQDA 2EBOA 4GYCB 1WB7A 3L73H 2ATKC 4RUFA 5EIBC 1XMQB 3D36C 1R6KA 1KP2A 3OUSA 1Y66A 1IVSA 4B3SB 4DV2O 2PYLA 3CS5A 2AXTZ 5BR8B 2EZPA 3HKBB 1TAEA 1SESA 4ICGA 2R70A 2A7WA 3T2MA 3T1YO 3IAYA 4NXMO 4PDMA 1FJGB 2YXHA 2HR3A 2F1MA 4X20B 5B1BC 2NNUA 3OGIB 4HBNA 2HJFC 3OW2U 1K4CC 2EZOA 4LF4B 5CBFA 3HKEB 2QTOA 1PNMA 4I9WA 2JGUA 3Q4HB 5LL6Y 1Z2GA 5EYPB 5B66Z 5IYDO 4FIPC 3STLC 1I94B 3K9SA 1HR0O 3OM3B 4G2KA 3AG4C 3AG1C 3L74H 1H38A 2Q68A 2ZXWB 3B40A 3T1HO 1M4UA 4PDRA 2WLMA 3WG7C 4TV8A 4FZ0A 1Q82W 4LH7A 4JI5B 5CA0B 2NN4A 4QNHB 4R6ZA 1F23A 2H94A 3LSSA 4EB6A 3EVKA 4WFFA 1N32B 1R73A 4FLUA 3FB5C 4TWKA 2B1IA 4MVOA 1TA8A 5E1AC 4R7CA 2PUSA 3AG7A 1RP3B 1EBOA 2DMXA 2QM8A 4JYYA 1AI6A 1BS3A 3OMNB 4DV6B 3H1LH 4R8CA 3RYCA 3HKCA 3CPWU 2CTWA 4LFAO 4YJ2A 2OTJV 3JAWB 1SQBH 3PJSK 4LF6O 2OCHA 2IU0A 1CEZA 2F4VO 5K1PA 4DR1O 3S3WA 4LF7B 4U3JB 2EILB 3WB1A 4JI6O 3ASNB 3O9OA 2ADPA 3W7TA 5IJ9B 5J2UB 1EZVH 3CXCU 2VQEB 4UVAA 3IC7A 4GX0A 1N36B 3ZMTA 2Q7EA 2W0XA 3JATB 2QEXV 2XAHA 4UCOA 1QVGU 2BSKA 3OMAB 1B6QA 1YCIA 4WBNB 4LF5B 5LOVB 1QQCA 1NZ6A 1BL8A 2HFEC 4CC6A 4JYCA 3UO2A 1URFA 2Z3YA 4MW8A 2QGNA 1JFFB 2PTMA 2A0LA 2GSMB 2Q67A 4DV1B 2IBZH 5B3SC 2UUBB 3K06A 2YS8A 2CE4A 3SPJA 4UB8Z 2WPDG 1ZTEA 3W7SA 3K03A 4N21A 2NR5A 4QIWF 5H2FZ 4MVMA 4RWUA 4X1YB 3EFFK 3ZHTA 3KZIZ 2CDYA 1SQXH 5KX5B 4AI8A 5LMNB 2LQTA 1YITV 3ASOC 4PA3A 4O4IB 5JH7A 2DYSC 4X64B 4J9YB 2L35A 1NT2B 1YTFB 3UCSC 4TUYB 5EBWC 3JCZA 2WLKA 4XBFA 4JV5O 5B1NA 1XI1A 5JJNB 1MSDA 3JD2A 3SR2C 2IJKA 4DUZB 2IJHA 5K1XA 3P3NA 2IJJA 2Q0AA 4B3TB 1K9MW 2ETNA 4I0XA 3CWBH 1R3LC 3CMAV 1TUEB 3D3IA 4BR6A 4BWAA 3CC7V 3SJAC 1XMOB 2QTSA 3KKYA 4MW3A 3CCVV 1CP9A 4DO2A 4O4LA 1O9HA 4O2BB 3TJTA 1AI5A 2QKCA 1TUBB 4DV7O 3VQYA 4PA7A 3LSUA 4Q6GA 2PGGA 3APQA 4WFHA 3BPZA 4H0LB 5KAFZ 4DR3O 3ZMZA 2Q7GA 2QWRB 4NYKA 2HLDG 4JZGA 1PV0A 1H2SB 2QWPB 3ZRWB 1VF6C 1W59A 3ABMC 2R9IA 2WAMA 2EIKC 3R65A 4QJFB 2Y4UA 1BMFG 3ABKB 4FFBA 3ABTA 1DLBA 4JI4O 5JQGA 3SPIA 5EC2C 1X59A 1ZWIC 3DC6A 4RUEA 4DR2O 1V55C 3JALA 1FFXA 5JVDA 2Q8VA 2GHYA 5LGNA 2JGDB 2EIJB 3ETEA 4PELA 2ZD9A 2P4KA 3W7UA 3G71V 1R3KC 1OJHA 4LNUA 5B5EZ 4DR7B 1XL4A 4DYLA 3E89A 2JK5C 4D7SA 4NVPA 4E2LA 4LP8A 5IJ0A 2XNDG 3OEHG 1XNQB 3OEEG 4Z1VA 1VQ4V 3CCQV 3ABLC 4CH3A 4J7JA 3TXSA 1XMQO 1NTKH 1AJQA 5IYCO 1B3QA 2IJIA 4UVBA 1WPBA 4DW1A 5B1OA 5BR8O 3K04A 3H1JH 4O4JB 4FLVA 4LF9B 4IHJA 1XUQA 4AHCA 1OZ0A 3RVZA 1HNXO 2AW9A 1Q86W 5JJJB 1RFYA 1N34B 3CC4V 5L3EA 3BVOA 2UU9B 5CB4A 2VQFB 4LF4O 2ZNIA 4GX1A 1BQ0A 3JASB 4KP4A 3BY6A 2W0FC 1S5HC 1JR9A 1M1KW 2BSKB 1K8AW 1IURA 1H2GA 1F4NA 1Y74A 4Z1MG 5CA1A 3FB7C 2OIEA 1I94O 4ZKIA 2YSUB 2GTAA 1MZFA 5FPOA 1HDJA 4I50A 1BSMA 4PJ0Z 2JS5A 1BHBA 3WFVA 1FKAO 1THZA 4PI0A 1IBLB 1LUVA 4ZI7A 3JARB 1GM7A 4J80A 3KG2A 1OCZB 4HNAA 3B4SA 3C3SA 4Z2WA 1N32O 5KHJA 2AHYA 3H1KH 4QE9A 3QNEA 1FXKA 3HR0A 5A9GA 2BOCC 4PA4A 4MT8A 1OCCC 2B1GA 4DV6O 2FMLA 4DUYB 2ADQB 2DOSA 2P22C 2Z0AA 4FZ1A 1DK1A 4X88A 3HKBA 1GKFA 1NQTA 3RYHB 5IY5B 1W0JG 1L8DA 1Q6UA 5LA6B 3RYFB 2UXNA 1FAFA 4X20A 2PI5A 4LFCB 1YEWA 1US6A 5FNVB 4GKKB 4LF7O 2CUGA 3HKEA 1K97A 2HHHB 1XBLA 2VQEO 2Q7HA 2P7TC 3Q4HA 4K8ZA 1FPOA 1N36O 3CX5F 5EYPA 5BZBA 3OR7C 1BE3H 3CRAA 3SYPA 1IXMA 1SS3A 1IBKB 2OCCC 5KUKA 4LF5O 4MSWC 1SRYA 3FB8C 4FLXA 2LJ2A 4C7UA 4A5UB 2BOBC 1SA0B 2F66C 5CA0A 3ZMUA 1SQQH 3CJHB 4DV4B 4JYAO 4FLZA 2HEPA 5ITZB 3K57A 2UUBO 4FLWA 1I5YA 1JX9A 2V7QG 1ENVA 2OT5A 1KQSU 1Y6XA 4JTCB 1IX9A 3G67A 1JCHA 2ZXWC 3CCLV 1BHAA 1MABG 3EXAA 5BY1A 5LMNO 3MDSA 4X66B 1QCEA 2UXBB 3T4DA 3JAWA 2UUCB 3P3PA 4X64O 3FX7A 1O9GA 4KFMA 4RAIA 2UXCB 2E5LO 1VIBA 1UPGA 2XT9A 4PDLA 4HZ3A 4CBCA 3U0ZA 4B7EA 3UQ8A 2F43G 4U3JA 1M5IA 4YHHB 1I7FA 1AJPA 3VOUA 5IJ9A 5J2UA 1SC5B 3HPLC 3CE2A 2DWEC 5TISZ 1KUQA 3TGUH 3JATA 2ZIOA 3OTFA 1RSOB 3RYIB 3K08A 1Y76B 2WLIB 1XMOO 4YJ3B 1M9NA 5LOVA 3L9DA 3OFNG 4WCEV 4IHJB 2E75B 1MNGA 1M56C 3FYIB 1S72V 1BT8A 2EULA 2F93B 1QLEB 1JFFA 2D2CB 1F4MA 3G4SV 1SETA 4QPKA 2LO1A 3ASNC 1NR1A 3F7VC 1KMIZ 1OHHG 3MD0A 3N2KB 4K0KB 4I7ZB 4DV5B 3K5NA 4X1YA 1RPRA 4PD4F 4H44B 2Q5ZA 3K9AA 2OWOA 5KX5A 3LDDA 1IBMB 4O4IA 1SKVA 4JF3A 3RWRD 4FLYA 1W0KG 4GKJB 4FK5C 3ZRSA 3X2QB 4X65B 2YIAA 4TOIA 1GN3A 3RFRA 3A2FA 1M93A 1NS1A 1XREA 1WJZA 4GUNA 1EN6A 1T5EA 4JI2O 4UV9A 4FM1A 1GM9A 3R66A 2Q9LA 2A79B 3OR6C 3VQWA 5L3CA 3FB6C 1YJWV 3OAAG 4K3AA 1ORQC 4O2BA 1DTOA 1GTOA 1TUBA 2X6CA 1VQLV 1ZX3A 3K59A 4YY3B 4LF9O 1R3JC 1R6TA 1N34O 1GH6A 3K5OA 1FXVA 2D3OW 3GVMA 2UU9O 4K8XA 2JDIG 1Z5WA 4YIPA 3ZRWA 4LH6A 1AP6A 1E79G 2WLLB 1UJWB 2VQFO 4DV0B 2EJ7A 3ZRVA 1AP5A 4UCRA 3OT7A 2GTSA 3JAKB 1U97A 3FAVB 3AK2A 4U3FH 2EIMB 4ZOLB 1F7YA 3M8AA 2YEVB 2Y69B 1V54C 1XDCA 2AZ2A 3JSLA 2JGDA 3B8NA 4B3RB 1IBLO 3ABUA 3CCUV 5KHHA 5BMVB 3D8CA 3ABKC 1Q5OA 4JI3B 2LW7A 2EINB 3CCEV 1K5QA 1SERA 4UCSA 5L3DA 3OD4A 1RM1C 2UXDO 2KKWA 1MMMA 2QKSA 2YIBD 3ZHUA 5J2TB 4DUYO 2HVKC 4H33A 2EIJC 3LNMB 4P2ZA 4O4JA 3CYOA 4JTDB 4FLTA 1HWYA 4WFGA 5FPRA 3H9VA 4KXRA 3SGIA 4DK0A 2XOKG 4LFCO 4CH5A 2N04A 1KP3A 4X89A 3CCSV 3JASA 1PNKA 2WLNA 5FLXN 1E1RG 3H01A 1K7DA 3QO5A 1XHZA 5DN6G 1XL6A 3ML0A 2ZIMA 1ZL8B 3E8BA 4K35A 3G6BA 1IBKO 4AQYO 5EBLC 4LWSB 3TCUA 4JTAB 2CK3G 2XHBA 3UM7A 2XAFA 1VQOV 3B77A 1NH2B 1J5EB 4UV8A 3JARA 3CRMA 4DV4O 1K34A 3E22B 1DF5A 4LBEC 2V1DA 2OIGA 3K0GA 4BIUA 1F51A 1WB8A 1N33B 2YIBA 1K5SA 4H13B 5E79Z 1D5NA 2FTKA 3ZHQA 4RQEA 2MK3A 4X66O 3BRCA 4GCZA 1RPOA 2HG5C 3E83A 4MTOA 3RYHA 2FL4A 3DTUB 5LA6A 3RYFA 1Q3EA 4RO2A 2UXCO 4LCUC 5FNVA 2CAZC 2EX3A 2QM4A 1Q81W 4YHHO 3VQXA 1DF4A 3GWOA 1CXZB 3M99B 4AILC 3ZN0A 2XAQA 1AI7A 2WA3A 3SDLA 4JGSA 5IY5C 1JA8A 5KLVH 1Q6HA 1OCRB 2H8PC 1NU1H 2FB5A 3A0BZ 4ZHQB 5KMGB 3K5LA 4UFZA 3JD4A 1SA0A 5EC1C 1E1QG 3EHBB 3CJHA 2H3OA 1U96A 2QWNB 3AG1B 2YICA 5ITZA 4FMTA 3OTOB 2RN9A 3CRRA 3CRCA 4K0KO 1PM9A 4GX5A 2WA4A 2BE3A 4JI8B 3N2GB 1I5XA 1NR7A 1BZKA 3VQVA 4IT5A 2ZINA 4KL1A 3STZC 1IBMO 2G38A 2YI9A 3AK3A 2KB1A 4NTWA 1NBMG 2AHZA 3MHHC 1N0JA 4XDKA 1JJ2U 4X65O 2DWDC 1WAZA 4L87A 3L70H 4BIZA 4BW5A 1M90W 1KYOF 1GAXA 1VMGA 1A32A 1K73W 1GO3F 1RSOA 2VWKA 4G27B 4DR5B 3RYIA 1H2MA 4L8JA 5L3FA 4B3SO 4P30A 1Y76A 2JEXA 2JS3A 2WLIA 4YJ3A 5KUMA 1Y67A 2ZM6B 5LBQA 1DGSA 2ODMA 1JQ0A 4OXSA 2IW5A 1FJGO 1G8MA 3U10A 1GN2A 2ILMA 2A9HA 3B09A 4DR6B 2XTAA 1S5LZ 2E76B 3T1YB 4IIJB 2GDSA 3N2KA 5LXTB 1Q90D 5LYJB 4NXMB 4MTXA 5H6QA 4LF8B 2B5UA 4DV0O 4MVZA 3OE7G 2M7WA 1AROP 4PA9A 2IH1C 5B3SB 2IU3A 1I08A 4X62B 1XOUA 5LGTA 5C93A 3TETA 1S3JA 5IYZB 1QLEC 1EN5A 1SQPH 4NB5A 4JI5O 1KKCA 2WWWA 4F6RB 5CMUA 4JI0B 2QWQB 1SQFA 4B3RO 2ZE7A 3T4ZA 1YDXA 5EK0A 2RJZA 1VEWA 5B1AC 4EFBA 3ASOB 2LW1A 1ROPA 2ZCEA 3CP1A 4IYIA 1YXBA 1VQ8V 1WPXA 4CS4A 1AB3A 4JI3O 1V9PA 2QKAA 4B7KA 2PI4A 4KUMA 3IJ4A 2WLHA 2BTQB 3SPHA 5CBHA 2GUZB 5DM6V 3IC9A 1SQVH 5KAIZ 1FXKC 1AR4A 1Q43A 2UUAB 1D2DA 3A0RA 1BCCH 2F4VB 3BCCH 5IWAB 2WLLA 4ZBMA 3SJCC 3JAKA 4O4HA 1NKDA 5CBGA 3DGEA 4J11A 3FAVA 4CS2A 4D6TH 4ZOLA 2DQ0A 2F23A 2YEVA 3QTCA 1FS0G 2Z5UA 1KD1W 1GRJA 1S0VA 1QVFU 3NXSA 4F6EA 1J5EO 4DV1O 1BGYH 3E8FA 1P7BA 2QJ1A 1NH2D 2FKXA 1V55B 4CZZA 5D5QA 5BMVA 3G80A 2CH7B 1XNRB 4JYBA 4MTGA 2ZQMA 1TVKB 4OX9B 2Q6AA 4W4LA 1N33O 1OCOB 2VS0A 5LMUB 3BA8A 2ZE6A 3BAAA 3HB3B 2Y69C 1B06A 3RN4A 5J2TA 3G6EV 3RVYA 5KHIA 1WA8A 4OPAA 2Q0OC 1YTFD 3ABLB 1WNSA 2XUMA 3ZX6A 2B9ZA 1HNWB 3IFXA 4NTYA 3TXQA 4DUZO 1MOFA 4FJCC 5KHGA 5L3BA 4B3TO 3ZIAG 3LDEA 1L0NH 5H9CA 2XAGA 1EFRG 3ETGA 2DN9A 1SQGA 1ZL8A 3LNNA 4JZ2A 2ZDIA 1FFTB 4I55B 2DE0X 4LWSA 2P6JA 1HW7A 1Z5VA 4U7OA 3H1HH 2RNBA 4FPPA 2HJDA 2EILC 2HP8A 5JJEB 4NTXA 4UCVA 2JEUA 3APOA 3E22A 4I4TB 4P9OA 3OTOO 3AEIA 1VARA 4XDLA 4YIOA 1P7GA 4B08A 1FYJA 4JI7B 2QE7G 2K9PA 2ZDIC 1L1FA 1AILA 1H8HG 3RBZA 2DJVA 4X9QA 3ZHRA 1AJNA 2F95B 1EM1A 2R9RB 3WU2Z 4JI4B 3RW0A 4MVSA 2IH3C 1KB9F 4WFBV 3D36A 1D5AA 1N0NA 2FYUH 1W2BU 4DR7O 1OCCB 2BCCH 2A3QA 3SJQC 3OMIB 1P4RA 3UT5B 2PYJA 1QNMA 1XNQO 4YXWG 3QO8A 2ZR2A 2Q73A 1NVPB 4HYOA 1NTMH 3O65A 2ZE5A 2Y48A 3C90A 3ZHSA 3RT3C 1NI8A 3AG2B 1EZJA 3VBBA 4DR5O 4CS3A 2L6LA 1KBHA 1HNZB 4CH6A 2X6BA 1K4DC 3E8HA 2ZM6O 3IGAC 4UVCA 3PN1A 1ZAUA 4ZHQA 5KMGA 3LSQA 5GTHZ 2BTOA 2RMKB 4TV9B 4DR6O 4CH4A 2OCCB 3OUFA 2IM9A 2GV9A 1HNXB 4O4HB 4LF8O 1YJNV 3N2GA 1M57B 2LFRA 4WF9V 1S77D 1PD3A 3E86A 2JVDA 1K33A 1WN7A 4IL6Z 2C2AA 2E3CA 3A8TA 2RDCA 1OCRC 4OPHA 1K3EA 1SF9A 5KA5A 3ETQA 4X62O 5DEDA 1B04A 1J95A 4X1IB 3DXRB 4DR4B 1L0LH 3ZN1A 3JYCA 2AGAA 1CPYA 4JI0O 4JAUA 4G28B 1BQZA 2LP7A 1HP8A 3OGCC 1VQ7V 3SYAA 3I5DA 3J7AU 4B3MB 1JJOA 1MZEA 1PL4A 4E4EA 3W7XA 4ASUG 4DXWA 1S5JA 2XASA 3LUTB 3SYCA 4NKGB 4TT3G 1I0HA 5IYBO 2RQ6A 3BHPA 2DQ3A 3BEHA 1WA8B 3BFRA 1COWG 2KSDA 1P84F 4BIOA 3AG3B 1ZLZA 3J81N 1WP7A 4I5SA 1AR5A 3FKSG 2YIDA 3CHXA 1H2KA 2YI8A 4IYHA 4GKKO 2UUAO 3QF7A 2V4DA 2ZE8A 3S3XA 4IIJA 5LXTA 5LYJA 4X1KB 2HHHO 2R9AA 5F2VO 2DYRB 1M56B 5IWAO 3T1CA 5L3GA 4U7NA 3K3WA 1H8EG 3ZHVA 3CD6V 5GONB 3N27A 4NXNB 3P30A 1G6UA 3RGBA 2ITDC 2KG7A 3H1IH 2QWOB 2JRIA 5D5PA 3C3TA 1YHQV 5IYZA 2RCVA 3ZBHA 4F6RA 5EZYB 4UB6Z 1QU7A 2P06A 5C8YA 4J41A 3CEIA 4QGPA 5AG2A 3D3QA 2N05A 4H37A 1PL0A 5LP6B 4UCUA 4QE7A 3F5WC 3MHSC 1XNRO 4JYAB 4FM2A 4OX9O 3DC5A 4JAAA 5LMUO 1SZTA 2BTQA 3B8MA 1KC8W 2QA4V 1VQKV 2UXBO 2YUAA 2UUCO 1X4TA 3CMEV 1OCZC 2GUZA 2P90A 1UFIA 4GT1A 1WLEA 1VQ9V 3HKDB 1GK9A 1HNWO 5BXZA 2LGWA 1GM8A 4X8AA 4J9ZB 2E5LB 3UKMA 4DRXB 4EFEA 1YJ9V 3M7MX 5B1BB 3SYOA 4WFEA 4D7TA 5FL7G 1IZ3A 1PP9H 1TGOA 2MW2B 1VF6A 2YC0A 1YIJV 3CRQA
chains in the Genus database with same CATH topology
4MVQA 2B1IA 4TWKA 1M56C 3FYIB 3AG4B 4LC1A 4MVOA 4MVUA 5E1AC 4Q20A 4R7CA 1S72V 3QO7A 4KUMA 2PI4A 1QLEB 4F4LA 1EBOA 1F4MA 2WLHA 1SETA 3G4SV 2QM8A 4QPKA 1JPXA 3ASNC 3WG7B 1AI6A 1NR1A 3F7VC 3OMNB 3SPHA 4R8CA 3CCRV 1OHHG 1V54B 3MD0A 3CPWU 5CBHA 5DM6V 2OTJV 1G4YB 3PJSK 2P67A 1RPRA 1FXKC 2IU0A 1CEZA 3K9AA 3A0RA 1JVMA 3LDDA 4JAVA 2EILB 2WLLA 4UXNA 3ASNB 3JD0A 4ZBMA 4JF3A 3W7TA 3CXCU 1RM1B 4UVAA 1NKDA 3IC7A 3DGEA 5CBGA 4GX0A 3ZMTA 3TK1A 3E35A 1W0KG 4FK5C 2QEXV 3ZRSA 2XAHA 3X2QB 1QVGU 3E2EA 2X7RB 1NJIW 3OMAB 2DQ0A 1B6QA 2YEVA 5J9PC 3FB5C 1OCOC 1FS0G 2Z5UA 1BL8A 1KD1W 2HFEC 1VQ5V 1S0VA 4JYCA 1QVFU 4UV9A 1NVPD 2LFSA 3NXSA 1Q7YW 1GM9A 2Q69A 2Z3YA 2A79B 4MW8A 3OR6C 3E8FA 2OTLV 5L3CA 3FB6C 1P7BA 1YJWV 2A0LA 1FXHA 4UUJC 3GB7C 1NH2D 5IDJA 2GSMB 1V55B 4CZZA 3OAAG 2Q67A 1ORQC 5B3SC 3K06A 1DTOA 1GTOA 4EKWA 2X6CA 3SPJA 4JYBA 4MTGA 2ZQMA 2WPDG 3W7SA 1VQLV 3K03A 4N21A 2X0LA 4QIWF 3I55V 2Q6AA 4MVMA 1OCOB 1R3JC 3HB3B 3SYQA 2Y69C 3EFFK 1FXVA 2D3OW 3G6EV 3RVYA 2JDIG 1YITV 3ASOC 3ZRWA 4PA3A 1E79G 2DYSC 2WLLB 1UJWB 4J9YB 1YTFD 3ZRVA 3ABLB 5KA6A 1YTFB 5LGUA 3K0DA 1QR8A 5EBWC 1AI4A 3IFXA 4MVRA 3JCZA 2WLKA 4XBFA 1R3IC 3ZCCA 3CCMV 1MOFA 5B1NA 4FJCC 3JD2A 2EIMB 3P32A 2IJKA 5LHIA 2DW4A 1VQNV 5L3BA 3ZIAG 2IJHA 2YEVB 3LDEA 2Y69B 1V54C 3ZMVA 2JIZG 2IJJA 5H9CA 2XAGA 1K9MW 3B8NA 1EFRG 3ETGA 3ABUA 3I56V 1R3LC 2DYSB 3SPGA 3CMAV 1TUEB 3D3IA 3CC7V 3CCUV 2ZDIA 4MW3A 3CCVV 1FFTB 1CP9A 4DO2A 1AI5A 2P6JA 4U7OA 3ABKC 3ZJZA 3E8GA 4BAYA 4PA7A 2EINB 4FPPA 3CCEV 5HFMA 1K5QA 2EILC 1SERA 4WFHA 5L3DA 1RM1C 3SPCA 1MSWD 2JEUA 3ZRXA 4P9OA 2QKSA 3ZMZA 2HLDG 3AEIA 3X2QC 2HVKC 4H33A 1GMGA 4XDLA 2EIJC 3LNMB 4P2ZA 3ZRWB 3CYOA 4JTDB 3ABMC 2R9IA 2WAMA 1HWYA 1R6NA 2EIKC 2QE7G 3R65A 4QJFB 4WFGA 2ZDIC 3ABKB 1BMFG 1L1FA 3ABTA 1DLBA 1H8HG 2WSSG 3RBZA 2XOKG 1AJNA 3SPIA 2R9RB 5EC2C 1ZWIC 5CN0A 4RUEA 1V55C 3AG2C 1KP3A 4X89A 3RW0A 3CCSV 4HAMA 4MVSA 2IH3C 1PNKA 2GHYA 2HVJC 2WLNA 4WFBV 3D36A 5LGNA 1E1RG 3H01A 2EIJB 3ETEA 4GX2A 1OCCB 3CCJV 4PELA 1W2BU 2ZD9A 1K7DA 3LDCA 3QO5A 3W7UA 2HKOA 3G71V 1R3KC 3SJQC 1XL6A 5DN6G 3OMIB 1P4RA 3ABMB 3ML0A 3CC2V 2EIKB 1XL4A 3E8BA 4YXWG 1KKDA 3E89A 3QO8A 2JK5C 2ZR2A 5EBLC 1NVPB 4E2LA 4LP8A 4HYOA 3TCUA 2XNDG 2Y48A 4JTAB 3OEHG 4TSFG 2CK3G 3OEEG 3UM7A 2XAFA 1VQOV 3B77A 4JASA 3AG2B 1VQ4V 5EBMC 1NH2B 3CCQV 3ABLC 4UV8A 1EZJA 3VBBA 3K79A 1K34A 1PKXA 1M57C 1DF5A 2X6BA 1K4DC 1AJQA 3E8HA 5IYCO 4XDJA 1VQPV 3IGAC 4LBEC 2IJIA 4UVBA 2EIMC 1YSCA 4UVCA 5B1OA 3ZMSA 5LHHA 2V1DA 4BIUA 3K0GA 3K04A 1AR1B 1MG1A 1F51A 3LSQA 4N23A 4MTFA 1OZ0A 3RVZA 2ITCC 1S76D 2ZR3A 1K5SA 1Q86W 2OCCB 3OUFA 3CC4V 2FTKA 4PDVA 3FYEB 4RQEA 2MK3A 5L3EA 3F7YC 5LHGA 2EJRA 1RPOA 4GCZA 2HG5C 2UXXA 1YJNV 3E83A 2WLJA 4MTOA 1M57B 2LFRA 4GX1A 3DTUB 4KP4A 3BY6A 4RQFA 2W0FC 4WF9V 1S77D 2NLJC 1S5HC 1PD3A 3E86A 2EINC 1M1KW 1K8AW 1K33A 1F4NA 1H2GA 4Z1MG 2C2AA 4RO2A 3FB7C 1K92A 1OCRC 1K3EA 4ZKIA 4LCUC 5KA5A 1J95A 2YSUB 2K1EA 1Q81W 1VQMV 1QLNA 5GW7A 3ZN1A 1N8RW 1DF4A 3JYCA 2XAJA 3GWOA 1BHBA 3WFVA 1CPYA 4JAUA 1THZA 4G28B 4PA6A 3M99B 2LP7A 3AG3C 1GM7A 3OGCC 3KG2A 1VQ7V 3SYAA 1OCZB 3ZN0A 2XAQA 1AI7A 2W6JG 4JGSA 4MS2A 5IY5C 3W7XA 2AHYA 4ASUG 5HFLA 2X6AA 1OCRB 3QNEA 4QE9A 2XASA 4DXWA 2H8PC 1FXKA 3LUTB 3JD3A 1QBZA 1KECA 3SYCA 3JD4A 4TT3G 5EC1C 2JJ1G 5IYBO 1E1QG 3EHBB 2QM7A 2DYRC 2BOCC 2DQ3A 4PA4A 4MT8A 3AG1B 1OCCC 3BEHA 2B1GA 4P9PA 1COWG 4FMTA 3AG3B 4WFAV 4I5SA 4GX5A 2JJ2G 4X88A 1GKFA 1I5XA 1NR7A 1NQTA 1YI2V 3FKSG 5IY5B 1W0JG 1QR9A 3JD1A 4JPRA 5B1AB 2UXNA 2PI5A 3STZC 4QPJA 2DYRB 1M56B 3T1CA 1JOYA 5L3GA 4U7NA 3K3WA 1K97A 1H8EG 3CD6V 2KB1A 2P7TC 1NBMG 2AHZA 3W7WA 5BZBA 3MHHC 3OR7C 1VQ6V 4R50A 2W6IG 4XDKA 5H6RA 1JJ2U 1PNLA 3P30A 3SYPA 1LNQA 3ETDA 1IXMA 2ITDC 2DWDC 2OCCC 5CA3A 5KUKA 1YHQV 4L87A 4MSWC 1SRYA 4BIZA 3FB8C 4BW5A 1M90W 1Y4MA 1FXKB 2EBOA 2BOBC 1K73W 1GO3F 2ATKC 4RUFA 4G27B 3ZMUA 5L3FA 1R6KA 4P30A 2JEXA 2WLIA 4H37A 1KP2A 5KUMA 3OUSA 1PL0A 1Y66A 1I5YA 4QE7A 5LBQA 1JX9A 3F5WC 2V7QG 3MHSC 1ENVA 1JQ0A 2OT5A 4OXSA 2EZPA 2IW5A 1SESA 1KQSU 4JTCB 3T2MA 1G8MA 1SZTA 3B8MA 1JCHA 2A9HA 1KC8W 4PDMA 2ZXWC 3CCLV 2QA4V 1VQKV 2HR3A 1BHAA 1MABG 5B1BC 3CMEV 2NNUA 1OCZC 1QCEA 2P90A 4MTXA 5H6QA 2HJFC 4GT1A 1WLEA 3T4DA 2B5UA 1K4CC 2EZOA 3OW2U 5CBFA 2QTOA 1PNMA 3OE7G 4MVZA 1VQ9V 4I9WA 1GK9A 2M7WA 1AROP 4KFMA 4PA9A 4RAIA 2IH1C 4FIPC 3STLC 5B3SB 5IYDO 2IU3A 4PDLA 4HZ3A 4CBCA 1GM8A 3OM3B 4G2KA 2F43G 5LGTA 3AG4C 3AG1C 4X8AA 5C93A 3TETA 4J9ZB 2Q68A 2ZXWB 1H38A 3UKMA 1S3JA 1QLEC 1AJPA 3VOUA 1YJ9V 4PDRA 3HPLC 2WWWA 5B1BB 2WLMA 5CMUA 3WG7C 2DWEC 3SYOA 4WFEA 5FL7G 1Q82W 3T4ZA 5EK0A 4QNHB 4R6ZA 1F23A 5B1AC 2H94A 3K08A 3ASOB 2WLIB 3LSSA 1M9NA 1ROPA 4WFFA 1R73A 3CP1A 3OFNG 1VQ8V 1YIJV 1WPXA 4WCEV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVQ A;  4TWK A;  5EBW C;  1M56 C;  3IFX A;  4MVR A;  1M57 C;  2WLK A;  1R3I C;  4MVO A;  3T1C A;  4MVU A;  5E1A C;  2X6B A;  1K4D C;  3E8H A;  4R7C A;  4XDJ A;  3IGA C;  4LBE C;  4F4L A;  2EIM C;  2WLH A;  2KB1 A;  2P7T C;  2AHZ A;  3K0G A;  3K04 A;  3ASN C;  3F7V C;  3LDE A;  3OR7 C;  5BZB A;  3SPH A;  4R8C A;  4MTF A;  4R50 A;  4XDK A;  1V54 C;  3RVZ A;  2ITC C;  3SYP A;  1LNQ A;  5CBH A;  2ITD C;  2DWD C;  2OCC C;  3OUF A;  5KUK A;  1G4Y B;  4MSW C;  4PDV A;  1R3L C;  3PJS K;  3SPG A;  3FB8 C;  4BW5 A;  3F7Y C;  2HG5 C;  2BOB C;  4MW3 A;  3E83 A;  2WLJ A;  4MTO A;  1JVM A;  4GX1 A;  2ATK C;  4RUF A;  3LDD A;  4G27 B;  3ABK C;  2W0F C;  3ZJZ A;  3E8G A;  2NLJ C;  1S5H C;  3E86 A;  4P30 A;  4PA7 A;  2EIN C;  2WLI A;  2EIL C;  4H37 A;  2WLL A;  4RO2 A;  3OUS A;  5KUM A;  4WFH A;  3FB7 C;  4ZBM A;  1OCR C;  4LCU C;  4QE7 A;  3F5W C;  3SPC A;  5CBG A;  1J95 A;  4GX0 A;  2K1E A;  4OXS A;  4P9O A;  2QKS A;  4JTC B;  3T2M A;  3ZRS A;  3X2Q C;  2HVK C;  4H33 A;  4XDL A;  2A9H A;  2EIJ C;  3JYC A;  4PDM A;  2ZXW C;  3LNM B;  4P2Z A;  4G28 B;  2YEV A;  4PA6 A;  5J9P C;  1OCO C;  3AG3 C;  4JTD B;  1BL8 A;  3ABM C;  2HFE C;  3OGC C;  5B1B C;  3KG2 A;  2EIK C;  3SYA A;  3R65 A;  1OCZ C;  4WFG A;  2HJF C;  3T4D A;  1K4C C;  2Q69 A;  4MS2 A;  5IY5 C;  5CBF A;  2A79 B;  4MW8 A;  3RBZ A;  3OR6 C;  2QTO A;  2AHY A;  3E8F A;  4MVZ A;  3SPI A;  3FB6 C;  1P7B A;  2X6A A;  4I9W A;  4QE9 A;  4DXW A;  2A0L A;  2R9R B;  2H8P C;  3LUT B;  4UUJ C;  3GB7 C;  1ZWI C;  5EC2 C;  4RUE A;  4KFM A;  1V55 C;  3AG2 C;  4PA9 A;  4RAI A;  3SYC A;  2Q67 A;  1ORQ C;  4X89 A;  3RW0 A;  2IH1 C;  4MVS A;  3K06 A;  5EC1 C;  2IH3 C;  3STL C;  4EKW A;  5B3S C;  2HVJ C;  2WLN A;  4PDL A;  4HZ3 A;  2X6C A;  3SPJ A;  4CBC A;  2DYR C;  4MTG A;  2BOC C;  3AG4 C;  4PA4 A;  3AG1 C;  4X8A A;  1OCC C;  3K03 A;  2Q68 A;  4GX2 A;  4J9Z B;  2ZD9 A;  3BEH A;  3UKM A;  4P9P A;  3TET A;  3LDC A;  1QLE C;  2Q6A A;  1R3K C;  4MVM A;  1XL6 A;  3SJQ C;  3VOU A;  4PDR A;  3HPL C;  1R3J C;  2WLM A;  4GX5 A;  1XL4 A;  3SYQ A;  2DWE C;  3E8B A;  4WFE A;  4X88 A;  2Y69 C;  3SYO A;  3WG7 C;  1KKD A;  3E89 A;  3EFF K;  2JK5 C;  5EBL C;  3T4Z A;  4LP8 A;  4HYO A;  3TCU A;  3RVY A;  5EK0 A;  4JTA B;  4QNH B;  4R6Z A;  5B1A C;  3K08 A;  3ASO C;  3UM7 A;  4PA3 A;  2WLI B;  2DYS C;  2WLL B;  4WFF A;  5EBM C;  4J9Y B;  3ABL C;  3STZ C;  3FB5 C;  3K0D A; 
#chains in the Genus database with same CATH topology
 4MVQ A;  2P5O A;  4LFB B;  3AG4 B;  4LC1 A;  4O2A A;  4MVU A;  4Q20 A;  1AVM A;  3QO7 A;  3J80 N;  4F4L A;  4LR3 A;  3BA9 A;  3QG5 A;  3QVN A;  4DV5 O;  1JPX A;  3WG7 B;  4PV1 B;  3CCR V;  2CH7 A;  1XIL A;  1V54 B;  3WB2 A;  4GLX A;  2CTQ A;  4I9Q A;  1TVK A;  1YVW A;  1G4Y B;  2P67 A;  4JI7 O;  2QDO A;  4J7K A;  1JVM A;  4UCT A;  1PPJ H;  4JAV A;  4UXN A;  4JI1 B;  1OV9 A;  3JD0 A;  4ABM A;  4GKJ O;  4DV3 B;  1RM1 B;  4W4K A;  1VF7 A;  4TV8 B;  3TK1 A;  3E35 A;  4DW0 A;  5JWP A;  3E2E A;  2YXL A;  2M6Y A;  2X7R B;  1NJI W;  4KHP B;  1FD9 A;  5JCO A;  4EB6 B;  2CGO A;  5J9P C;  1OCO C;  1VQ5 V;  1NVP D;  2LFS A;  4DK1 A;  1Q7Y W;  2Q69 A;  2OTL V;  4JI2 B;  1HNZ O;  1FXH A;  4UUJ C;  3SJB C;  3GB7 C;  3DSQ A;  5IDJ A;  4I55 A;  1LR1 A;  3RYC B;  4EKW A;  4YY3 O;  3HKC B;  4DV2 B;  1LUW A;  4YJ2 B;  5KHK A;  2X0L A;  3I55 V;  3A0H Z;  1Q6I A;  3SYQ A;  5JCO C;  4I4T A;  2Q4P A;  2N74 A;  2ZKO A;  3JCU Z;  1NTZ H;  5KA6 A;  3ICX A;  3JSN A;  4FVM A;  5LGU A;  3K0D A;  3JAM N;  1QR8 A;  1AI4 A;  4MVR A;  3ZCC A;  5A2Q N;  1R3I C;  2KG7 B;  2E74 B;  3FD9 A;  1XHX A;  3CCM V;  1HR0 B;  4TQF A;  3P32 A;  3U11 A;  5LHI A;  2DW4 A;  1VQN V;  5DEC A;  3CSX A;  4DR4 O;  3T1H B;  3ZMV A;  5C8Y B;  2JIZ G;  2CTR A;  1XQ8 A;  3L72 H;  3I56 V;  2DYS B;  3SPG A;  3UT5 A;  4B3M O;  3B2E E;  2PF4 E;  4J42 A;  1XEQ A;  3ZJZ A;  3E8G A;  4BAY A;  2QSA A;  5HFM A;  1H2L A;  4PI2 A;  2PY5 A;  2QR4 A;  3SPC A;  1MSW D;  3ZRX A;  2KQX A;  3CXH F;  3X2Q C;  1YF2 A;  2UXD B;  3UO3 A;  1GMG A;  5H5N A;  4LFA B;  3THO A;  5JH7 B;  2YXY A;  1KU9 A;  1R6N A;  4TV9 A;  4J7Z A;  1GN6 A;  4LF6 B;  3GWK C;  1EN4 A;  2WSS G;  2GBO A;  4DR1 B;  3K5M A;  5CN0 A;  3AG2 C;  4JI6 B;  4HAM A;  3AK1 A;  2R72 A;  2HVJ C;  4GX2 A;  3CCJ V;  4NXN O;  4I0X B;  3LDC A;  3MAQ A;  2HKO A;  4CC5 A;  3ABM B;  3CC2 V;  4X1I A;  2EIK B;  4ZIB A;  3DXR A;  2CTP A;  1KKD A;  4O2A B;  4O4L B;  4TSF G;  3BAB A;  4AQY B;  4JAS A;  5EBM C;  3K79 A;  4EEQ A;  4IGG A;  1PKX A;  1M57 C;  3L71 H;  4XDJ A;  2P4V A;  1VQP V;  1G1X B;  2EIM C;  1YSC A;  3ZMS A;  5LHH A;  3WB0 A;  1AR1 B;  1MG1 A;  3F5T A;  4N23 A;  4MTF A;  5IT9 N;  1S76 D;  2ITC C;  2ZR3 A;  3L75 H;  4FFB B;  5JQG B;  4PDV A;  3FYE B;  4NR1 A;  2ZT9 B;  3F7Y C;  4OGQ B;  5LHG A;  2EJR A;  2UXX A;  4GZR B;  2WLJ A;  3JAL B;  1FFX B;  5EIB D;  5IE9 A;  5JVD B;  4RQF A;  2NLJ C;  1R1B A;  1H2N A;  1WP8 A;  2EIN C;  4JV5 B;  1SZX A;  1K92 A;  1QHT A;  4X1K A;  3CB2 A;  4LNU B;  2K1E A;  1YZB A;  1VQM V;  1QLN A;  2PZS A;  2Y4T A;  5IJ0 B;  5GW7 A;  1N8R W;  3ZED A;  2AZ0 A;  3KCY A;  5GON A;  2XAJ A;  2VRZ A;  4PA6 A;  4FFK A;  3AG3 C;  3ZS8 C;  2W6J G;  4MS2 A;  1VF5 B;  5HFL A;  2X6A A;  1IXB A;  4DV7 B;  1Q8I A;  2Y0P A;  5EZY A;  3JD3 A;  1QBZ A;  1KEC A;  4WBN A;  4LFB O;  1JMK C;  2VWJ A;  2ARH A;  2JJ1 G;  1VP7 A;  2QM7 A;  2DYR C;  4DR3 B;  4P9P A;  4JI8 O;  5LP6 A;  4WFA V;  2JJ2 G;  5CB4 B;  1N4C A;  3FFQ A;  1YI2 V;  2Y0I A;  1QR9 A;  4J10 A;  3JD1 A;  4JPR A;  5B1A B;  1Y74 B;  3NR7 A;  3K58 A;  5CA1 B;  1ZUQ A;  1MA1 A;  4QPJ A;  1P49 A;  1IDS A;  4DR2 B;  1GN4 A;  1JOY A;  4JI1 O;  4I50 B;  3HKD A;  4DV3 O;  2CGN A;  2ZNJ A;  2OYQ A;  4BW9 A;  2O57 A;  3W7W A;  5GTI Z;  5LP6 C;  1VQ6 V;  2A06 H;  3KCX A;  4R50 A;  2W6I G;  4ZI7 B;  5H6R A;  1PNL A;  4TUY A;  4FM0 A;  1LNQ A;  3ETD A;  4HNA B;  4KHP O;  5CA3 A;  4DRX A;  1ZSP A;  2LGQ A;  1Y4M A;  4PHZ A;  2YDE A;  1FXK B;  4TQD A;  2EBO A;  4GYC B;  1WB7 A;  3L73 H;  2ATK C;  4RUF A;  5EIB C;  1XMQ B;  3D36 C;  1R6K A;  1KP2 A;  3OUS A;  1Y66 A;  1IVS A;  4B3S B;  4DV2 O;  2PYL A;  3CS5 A;  2AXT Z;  5BR8 B;  2EZP A;  3HKB B;  1TAE A;  1SES A;  4ICG A;  2R70 A;  2A7W A;  3T2M A;  3T1Y O;  3IAY A;  4NXM O;  4PDM A;  1FJG B;  2YXH A;  2HR3 A;  2F1M A;  4X20 B;  5B1B C;  2NNU A;  3OGI B;  4HBN A;  2HJF C;  3OW2 U;  1K4C C;  2EZO A;  4LF4 B;  5CBF A;  3HKE B;  2QTO A;  1PNM A;  4I9W A;  2JGU A;  3Q4H B;  5LL6 Y;  1Z2G A;  5EYP B;  5B66 Z;  5IYD O;  4FIP C;  3STL C;  1I94 B;  3K9S A;  1HR0 O;  3OM3 B;  4G2K A;  3AG4 C;  3AG1 C;  3L74 H;  1H38 A;  2Q68 A;  2ZXW B;  3B40 A;  3T1H O;  1M4U A;  4PDR A;  2WLM A;  3WG7 C;  4TV8 A;  4FZ0 A;  1Q82 W;  4LH7 A;  4JI5 B;  5CA0 B;  2NN4 A;  4QNH B;  4R6Z A;  1F23 A;  2H94 A;  3LSS A;  4EB6 A;  3EVK A;  4WFF A;  1N32 B;  1R73 A;  4FLU A;  3FB5 C;  4TWK A;  2B1I A;  4MVO A;  1TA8 A;  5E1A C;  4R7C A;  2PUS A;  3AG7 A;  1RP3 B;  1EBO A;  2DMX A;  2QM8 A;  4JYY A;  1AI6 A;  1BS3 A;  3OMN B;  4DV6 B;  3H1L H;  4R8C A;  3RYC A;  3HKC A;  3CPW U;  2CTW A;  4LFA O;  4YJ2 A;  2OTJ V;  3JAW B;  1SQB H;  3PJS K;  4LF6 O;  2OCH A;  2IU0 A;  1CEZ A;  2F4V O;  5K1P A;  4DR1 O;  3S3W A;  4LF7 B;  4U3J B;  2EIL B;  3WB1 A;  4JI6 O;  3ASN B;  3O9O A;  2ADP A;  3W7T A;  5IJ9 B;  5J2U B;  1EZV H;  3CXC U;  2VQE B;  4UVA A;  3IC7 A;  4GX0 A;  1N36 B;  3ZMT A;  2Q7E A;  2W0X A;  3JAT B;  2QEX V;  2XAH A;  4UCO A;  1QVG U;  2BSK A;  3OMA B;  1B6Q A;  1YCI A;  4WBN B;  4LF5 B;  5LOV B;  1QQC A;  1NZ6 A;  1BL8 A;  2HFE C;  4CC6 A;  4JYC A;  3UO2 A;  1URF A;  2Z3Y A;  4MW8 A;  2QGN A;  1JFF B;  2PTM A;  2A0L A;  2GSM B;  2Q67 A;  4DV1 B;  2IBZ H;  5B3S C;  2UUB B;  3K06 A;  2YS8 A;  2CE4 A;  3SPJ A;  4UB8 Z;  2WPD G;  1ZTE A;  3W7S A;  3K03 A;  4N21 A;  2NR5 A;  4QIW F;  5H2F Z;  4MVM A;  4RWU A;  4X1Y B;  3EFF K;  3ZHT A;  3KZI Z;  2CDY A;  1SQX H;  5KX5 B;  4AI8 A;  5LMN B;  2LQT A;  1YIT V;  3ASO C;  4PA3 A;  4O4I B;  5JH7 A;  2DYS C;  4X64 B;  4J9Y B;  2L35 A;  1NT2 B;  1YTF B;  3UCS C;  4TUY B;  5EBW C;  3JCZ A;  2WLK A;  4XBF A;  4JV5 O;  5B1N A;  1XI1 A;  5JJN B;  1MSD A;  3JD2 A;  3SR2 C;  2IJK A;  4DUZ B;  2IJH A;  5K1X A;  3P3N A;  2IJJ A;  2Q0A A;  4B3T B;  1K9M W;  2ETN A;  4I0X A;  3CWB H;  1R3L C;  3CMA V;  1TUE B;  3D3I A;  4BR6 A;  4BWA A;  3CC7 V;  3SJA C;  1XMO B;  2QTS A;  3KKY A;  4MW3 A;  3CCV V;  1CP9 A;  4DO2 A;  4O4L A;  1O9H A;  4O2B B;  3TJT A;  1AI5 A;  2QKC A;  1TUB B;  4DV7 O;  3VQY A;  4PA7 A;  3LSU A;  4Q6G A;  2PGG A;  3APQ A;  4WFH A;  3BPZ A;  4H0L B;  5KAF Z;  4DR3 O;  3ZMZ A;  2Q7G A;  2QWR B;  4NYK A;  2HLD G;  4JZG A;  1PV0 A;  1H2S B;  2QWP B;  3ZRW B;  1VF6 C;  1W59 A;  3ABM C;  2R9I A;  2WAM A;  2EIK C;  3R65 A;  4QJF B;  2Y4U A;  1BMF G;  3ABK B;  4FFB A;  3ABT A;  1DLB A;  4JI4 O;  5JQG A;  3SPI A;  5EC2 C;  1X59 A;  1ZWI C;  3DC6 A;  4RUE A;  4DR2 O;  1V55 C;  3JAL A;  1FFX A;  5JVD A;  2Q8V A;  2GHY A;  5LGN A;  2JGD B;  2EIJ B;  3ETE A;  4PEL A;  2ZD9 A;  2P4K A;  3W7U A;  3G71 V;  1R3K C;  1OJH A;  4LNU A;  5B5E Z;  4DR7 B;  1XL4 A;  4DYL A;  3E89 A;  2JK5 C;  4D7S A;  4NVP A;  4E2L A;  4LP8 A;  5IJ0 A;  2XND G;  3OEH G;  1XNQ B;  3OEE G;  4Z1V A;  1VQ4 V;  3CCQ V;  3ABL C;  4CH3 A;  4J7J A;  3TXS A;  1XMQ O;  1NTK H;  1AJQ A;  5IYC O;  1B3Q A;  2IJI A;  4UVB A;  1WPB A;  4DW1 A;  5B1O A;  5BR8 O;  3K04 A;  3H1J H;  4O4J B;  4FLV A;  4LF9 B;  4IHJ A;  1XUQ A;  4AHC A;  1OZ0 A;  3RVZ A;  1HNX O;  2AW9 A;  1Q86 W;  5JJJ B;  1RFY A;  1N34 B;  3CC4 V;  5L3E A;  3BVO A;  2UU9 B;  5CB4 A;  2VQF B;  4LF4 O;  2ZNI A;  4GX1 A;  1BQ0 A;  3JAS B;  4KP4 A;  3BY6 A;  2W0F C;  1S5H C;  1JR9 A;  1M1K W;  2BSK B;  1K8A W;  1IUR A;  1H2G A;  1F4N A;  1Y74 A;  4Z1M G;  5CA1 A;  3FB7 C;  2OIE A;  1I94 O;  4ZKI A;  2YSU B;  2GTA A;  1MZF A;  5FPO A;  1HDJ A;  4I50 A;  1BSM A;  4PJ0 Z;  2JS5 A;  1BHB A;  3WFV A;  1FKA O;  1THZ A;  4PI0 A;  1IBL B;  1LUV A;  4ZI7 A;  3JAR B;  1GM7 A;  4J80 A;  3KG2 A;  1OCZ B;  4HNA A;  3B4S A;  3C3S A;  4Z2W A;  1N32 O;  5KHJ A;  2AHY A;  3H1K H;  4QE9 A;  3QNE A;  1FXK A;  3HR0 A;  5A9G A;  2BOC C;  4PA4 A;  4MT8 A;  1OCC C;  2B1G A;  4DV6 O;  2FML A;  4DUY B;  2ADQ B;  2DOS A;  2P22 C;  2Z0A A;  4FZ1 A;  1DK1 A;  4X88 A;  3HKB A;  1GKF A;  1NQT A;  3RYH B;  5IY5 B;  1W0J G;  1L8D A;  1Q6U A;  5LA6 B;  3RYF B;  2UXN A;  1FAF A;  4X20 A;  2PI5 A;  4LFC B;  1YEW A;  1US6 A;  5FNV B;  4GKK B;  4LF7 O;  2CUG A;  3HKE A;  1K97 A;  2HHH B;  1XBL A;  2VQE O;  2Q7H A;  2P7T C;  3Q4H A;  4K8Z A;  1FPO A;  1N36 O;  3CX5 F;  5EYP A;  5BZB A;  3OR7 C;  1BE3 H;  3CRA A;  3SYP A;  1IXM A;  1SS3 A;  1IBK B;  2OCC C;  5KUK A;  4LF5 O;  4MSW C;  1SRY A;  3FB8 C;  4FLX A;  2LJ2 A;  4C7U A;  4A5U B;  2BOB C;  1SA0 B;  2F66 C;  5CA0 A;  3ZMU A;  1SQQ H;  3CJH B;  4DV4 B;  4JYA O;  4FLZ A;  2HEP A;  5ITZ B;  3K57 A;  2UUB O;  4FLW A;  1I5Y A;  1JX9 A;  2V7Q G;  1ENV A;  2OT5 A;  1KQS U;  1Y6X A;  4JTC B;  1IX9 A;  3G67 A;  1JCH A;  2ZXW C;  3CCL V;  1BHA A;  1MAB G;  3EXA A;  5BY1 A;  5LMN O;  3MDS A;  4X66 B;  1QCE A;  2UXB B;  3T4D A;  3JAW A;  2UUC B;  3P3P A;  4X64 O;  3FX7 A;  1O9G A;  4KFM A;  4RAI A;  2UXC B;  2E5L O;  1VIB A;  1UPG A;  2XT9 A;  4PDL A;  4HZ3 A;  4CBC A;  3U0Z A;  4B7E A;  3UQ8 A;  2F43 G;  4U3J A;  1M5I A;  4YHH B;  1I7F A;  1AJP A;  3VOU A;  5IJ9 A;  5J2U A;  1SC5 B;  3HPL C;  3CE2 A;  2DWE C;  5TIS Z;  1KUQ A;  3TGU H;  3JAT A;  2ZIO A;  3OTF A;  1RSO B;  3RYI B;  3K08 A;  1Y76 B;  2WLI B;  1XMO O;  4YJ3 B;  1M9N A;  5LOV A;  3L9D A;  3OFN G;  4WCE V;  4IHJ B;  2E75 B;  1MNG A;  1M56 C;  3FYI B;  1S72 V;  1BT8 A;  2EUL A;  2F93 B;  1QLE B;  1JFF A;  2D2C B;  1F4M A;  3G4S V;  1SET A;  4QPK A;  2LO1 A;  3ASN C;  1NR1 A;  3F7V C;  1KMI Z;  1OHH G;  3MD0 A;  3N2K B;  4K0K B;  4I7Z B;  4DV5 B;  3K5N A;  4X1Y A;  1RPR A;  4PD4 F;  4H44 B;  2Q5Z A;  3K9A A;  2OWO A;  5KX5 A;  3LDD A;  1IBM B;  4O4I A;  1SKV A;  4JF3 A;  3RWR D;  4FLY A;  1W0K G;  4GKJ B;  4FK5 C;  3ZRS A;  3X2Q B;  4X65 B;  2YIA A;  4TOI A;  1GN3 A;  3RFR A;  3A2F A;  1M93 A;  1NS1 A;  1XRE A;  1WJZ A;  4GUN A;  1EN6 A;  1T5E A;  4JI2 O;  4UV9 A;  4FM1 A;  1GM9 A;  3R66 A;  2Q9L A;  2A79 B;  3OR6 C;  3VQW A;  5L3C A;  3FB6 C;  1YJW V;  3OAA G;  4K3A A;  1ORQ C;  4O2B A;  1DTO A;  1GTO A;  1TUB A;  2X6C A;  1VQL V;  1ZX3 A;  3K59 A;  4YY3 B;  4LF9 O;  1R3J C;  1R6T A;  1N34 O;  1GH6 A;  3K5O A;  1FXV A;  2D3O W;  3GVM A;  2UU9 O;  4K8X A;  2JDI G;  1Z5W A;  4YIP A;  3ZRW A;  4LH6 A;  1AP6 A;  1E79 G;  2WLL B;  1UJW B;  2VQF O;  4DV0 B;  2EJ7 A;  3ZRV A;  1AP5 A;  4UCR A;  3OT7 A;  2GTS A;  3JAK B;  1U97 A;  3FAV B;  3AK2 A;  4U3F H;  2EIM B;  4ZOL B;  1F7Y A;  3M8A A;  2YEV B;  2Y69 B;  1V54 C;  1XDC A;  2AZ2 A;  3JSL A;  2JGD A;  3B8N A;  4B3R B;  1IBL O;  3ABU A;  3CCU V;  5KHH A;  5BMV B;  3D8C A;  3ABK C;  1Q5O A;  4JI3 B;  2LW7 A;  2EIN B;  3CCE V;  1K5Q A;  1SER A;  4UCS A;  5L3D A;  3OD4 A;  1RM1 C;  2UXD O;  2KKW A;  1MMM A;  2QKS A;  2YIB D;  3ZHU A;  5J2T B;  4DUY O;  2HVK C;  4H33 A;  2EIJ C;  3LNM B;  4P2Z A;  4O4J A;  3CYO A;  4JTD B;  4FLT A;  1HWY A;  4WFG A;  5FPR A;  3H9V A;  4KXR A;  3SGI A;  4DK0 A;  2XOK G;  4LFC O;  4CH5 A;  2N04 A;  1KP3 A;  4X89 A;  3CCS V;  3JAS A;  1PNK A;  2WLN A;  5FLX N;  1E1R G;  3H01 A;  1K7D A;  3QO5 A;  1XHZ A;  5DN6 G;  1XL6 A;  3ML0 A;  2ZIM A;  1ZL8 B;  3E8B A;  4K35 A;  3G6B A;  1IBK O;  4AQY O;  5EBL C;  4LWS B;  3TCU A;  4JTA B;  2CK3 G;  2XHB A;  3UM7 A;  2XAF A;  1VQO V;  3B77 A;  1NH2 B;  1J5E B;  4UV8 A;  3JAR A;  3CRM A;  4DV4 O;  1K34 A;  3E22 B;  1DF5 A;  4LBE C;  2V1D A;  2OIG A;  3K0G A;  4BIU A;  1F51 A;  1WB8 A;  1N33 B;  2YIB A;  1K5S A;  4H13 B;  5E79 Z;  1D5N A;  2FTK A;  3ZHQ A;  4RQE A;  2MK3 A;  4X66 O;  3BRC A;  4GCZ A;  1RPO A;  2HG5 C;  3E83 A;  4MTO A;  3RYH A;  2FL4 A;  3DTU B;  5LA6 A;  3RYF A;  1Q3E A;  4RO2 A;  2UXC O;  4LCU C;  5FNV A;  2CAZ C;  2EX3 A;  2QM4 A;  1Q81 W;  4YHH O;  3VQX A;  1DF4 A;  3GWO A;  1CXZ B;  3M99 B;  4AIL C;  3ZN0 A;  2XAQ A;  1AI7 A;  2WA3 A;  3SDL A;  4JGS A;  5IY5 C;  1JA8 A;  5KLV H;  1Q6H A;  1OCR B;  2H8P C;  1NU1 H;  2FB5 A;  3A0B Z;  4ZHQ B;  5KMG B;  3K5L A;  4UFZ A;  3JD4 A;  1SA0 A;  5EC1 C;  1E1Q G;  3EHB B;  3CJH A;  2H3O A;  1U96 A;  2QWN B;  3AG1 B;  2YIC A;  5ITZ A;  4FMT A;  3OTO B;  2RN9 A;  3CRR A;  3CRC A;  4K0K O;  1PM9 A;  4GX5 A;  2WA4 A;  2BE3 A;  4JI8 B;  3N2G B;  1I5X A;  1NR7 A;  1BZK A;  3VQV A;  4IT5 A;  2ZIN A;  4KL1 A;  3STZ C;  1IBM O;  2G38 A;  2YI9 A;  3AK3 A;  2KB1 A;  4NTW A;  1NBM G;  2AHZ A;  3MHH C;  1N0J A;  4XDK A;  1JJ2 U;  4X65 O;  2DWD C;  1WAZ A;  4L87 A;  3L70 H;  4BIZ A;  4BW5 A;  1M90 W;  1KYO F;  1GAX A;  1VMG A;  1A32 A;  1K73 W;  1GO3 F;  1RSO A;  2VWK A;  4G27 B;  4DR5 B;  3RYI A;  1H2M A;  4L8J A;  5L3F A;  4B3S O;  4P30 A;  1Y76 A;  2JEX A;  2JS3 A;  2WLI A;  4YJ3 A;  5KUM A;  1Y67 A;  2ZM6 B;  5LBQ A;  1DGS A;  2ODM A;  1JQ0 A;  4OXS A;  2IW5 A;  1FJG O;  1G8M A;  3U10 A;  1GN2 A;  2ILM A;  2A9H A;  3B09 A;  4DR6 B;  2XTA A;  1S5L Z;  2E76 B;  3T1Y B;  4IIJ B;  2GDS A;  3N2K A;  5LXT B;  1Q90 D;  5LYJ B;  4NXM B;  4MTX A;  5H6Q A;  4LF8 B;  2B5U A;  4DV0 O;  4MVZ A;  3OE7 G;  2M7W A;  1ARO P;  4PA9 A;  2IH1 C;  5B3S B;  2IU3 A;  1I08 A;  4X62 B;  1XOU A;  5LGT A;  5C93 A;  3TET A;  1S3J A;  5IYZ B;  1QLE C;  1EN5 A;  1SQP H;  4NB5 A;  4JI5 O;  1KKC A;  2WWW A;  4F6R B;  5CMU A;  4JI0 B;  2QWQ B;  1SQF A;  4B3R O;  2ZE7 A;  3T4Z A;  1YDX A;  5EK0 A;  2RJZ A;  1VEW A;  5B1A C;  4EFB A;  3ASO B;  2LW1 A;  1ROP A;  2ZCE A;  3CP1 A;  4IYI A;  1YXB A;  1VQ8 V;  1WPX A;  4CS4 A;  1AB3 A;  4JI3 O;  1V9P A;  2QKA A;  4B7K A;  2PI4 A;  4KUM A;  3IJ4 A;  2WLH A;  2BTQ B;  3SPH A;  5CBH A;  2GUZ B;  5DM6 V;  3IC9 A;  1SQV H;  5KAI Z;  1FXK C;  1AR4 A;  1Q43 A;  2UUA B;  1D2D A;  3A0R A;  1BCC H;  2F4V B;  3BCC H;  5IWA B;  2WLL A;  4ZBM A;  3SJC C;  3JAK A;  4O4H A;  1NKD A;  5CBG A;  3DGE A;  4J11 A;  3FAV A;  4CS2 A;  4D6T H;  4ZOL A;  2DQ0 A;  2F23 A;  2YEV A;  3QTC A;  1FS0 G;  2Z5U A;  1KD1 W;  1GRJ A;  1S0V A;  1QVF U;  3NXS A;  4F6E A;  1J5E O;  4DV1 O;  1BGY H;  3E8F A;  1P7B A;  2QJ1 A;  1NH2 D;  2FKX A;  1V55 B;  4CZZ A;  5D5Q A;  5BMV A;  3G80 A;  2CH7 B;  1XNR B;  4JYB A;  4MTG A;  2ZQM A;  1TVK B;  4OX9 B;  2Q6A A;  4W4L A;  1N33 O;  1OCO B;  2VS0 A;  5LMU B;  3BA8 A;  2ZE6 A;  3BAA A;  3HB3 B;  2Y69 C;  1B06 A;  3RN4 A;  5J2T A;  3G6E V;  3RVY A;  5KHI A;  1WA8 A;  4OPA A;  2Q0O C;  1YTF D;  3ABL B;  1WNS A;  2XUM A;  3ZX6 A;  2B9Z A;  1HNW B;  3IFX A;  4NTY A;  3TXQ A;  4DUZ O;  1MOF A;  4FJC C;  5KHG A;  5L3B A;  4B3T O;  3ZIA G;  3LDE A;  1L0N H;  5H9C A;  2XAG A;  1EFR G;  3ETG A;  2DN9 A;  1SQG A;  1ZL8 A;  3LNN A;  4JZ2 A;  2ZDI A;  1FFT B;  4I55 B;  2DE0 X;  4LWS A;  2P6J A;  1HW7 A;  1Z5V A;  4U7O A;  3H1H H;  2RNB A;  4FPP A;  2HJD A;  2EIL C;  2HP8 A;  5JJE B;  4NTX A;  4UCV A;  2JEU A;  3APO A;  3E22 A;  4I4T B;  4P9O A;  3OTO O;  3AEI A;  1VAR A;  4XDL A;  4YIO A;  1P7G A;  4B08 A;  1FYJ A;  4JI7 B;  2QE7 G;  2K9P A;  2ZDI C;  1L1F A;  1AIL A;  1H8H G;  3RBZ A;  2DJV A;  4X9Q A;  3ZHR A;  1AJN A;  2F95 B;  1EM1 A;  2R9R B;  3WU2 Z;  4JI4 B;  3RW0 A;  4MVS A;  2IH3 C;  1KB9 F;  4WFB V;  3D36 A;  1D5A A;  1N0N A;  2FYU H;  1W2B U;  4DR7 O;  1OCC B;  2BCC H;  2A3Q A;  3SJQ C;  3OMI B;  1P4R A;  3UT5 B;  2PYJ A;  1QNM A;  1XNQ O;  4YXW G;  3QO8 A;  2ZR2 A;  2Q73 A;  1NVP B;  4HYO A;  1NTM H;  3O65 A;  2ZE5 A;  2Y48 A;  3C90 A;  3ZHS A;  3RT3 C;  1NI8 A;  3AG2 B;  1EZJ A;  3VBB A;  4DR5 O;  4CS3 A;  2L6L A;  1KBH A;  1HNZ B;  4CH6 A;  2X6B A;  1K4D C;  3E8H A;  2ZM6 O;  3IGA C;  4UVC A;  3PN1 A;  1ZAU A;  4ZHQ A;  5KMG A;  3LSQ A;  5GTH Z;  2BTO A;  2RMK B;  4TV9 B;  4DR6 O;  4CH4 A;  2OCC B;  3OUF A;  2IM9 A;  2GV9 A;  1HNX B;  4O4H B;  4LF8 O;  1YJN V;  3N2G A;  1M57 B;  2LFR A;  4WF9 V;  1S77 D;  1PD3 A;  3E86 A;  2JVD A;  1K33 A;  1WN7 A;  4IL6 Z;  2C2A A;  2E3C A;  3A8T A;  2RDC A;  1OCR C;  4OPH A;  1K3E A;  1SF9 A;  5KA5 A;  3ETQ A;  4X62 O;  5DED A;  1B04 A;  1J95 A;  4X1I B;  3DXR B;  4DR4 B;  1L0L H;  3ZN1 A;  3JYC A;  2AGA A;  1CPY A;  4JI0 O;  4JAU A;  4G28 B;  1BQZ A;  2LP7 A;  1HP8 A;  3OGC C;  1VQ7 V;  3SYA A;  3I5D A;  3J7A U;  4B3M B;  1JJO A;  1MZE A;  1PL4 A;  4E4E A;  3W7X A;  4ASU G;  4DXW A;  1S5J A;  2XAS A;  3LUT B;  3SYC A;  4NKG B;  4TT3 G;  1I0H A;  5IYB O;  2RQ6 A;  3BHP A;  2DQ3 A;  3BEH A;  1WA8 B;  3BFR A;  1COW G;  2KSD A;  1P84 F;  4BIO A;  3AG3 B;  1ZLZ A;  3J81 N;  1WP7 A;  4I5S A;  1AR5 A;  3FKS G;  2YID A;  3CHX A;  1H2K A;  2YI8 A;  4IYH A;  4GKK O;  2UUA O;  3QF7 A;  2V4D A;  2ZE8 A;  3S3X A;  4IIJ A;  5LXT A;  5LYJ A;  4X1K B;  2HHH O;  2R9A A;  5F2V O;  2DYR B;  1M56 B;  5IWA O;  3T1C A;  5L3G A;  4U7N A;  3K3W A;  1H8E G;  3ZHV A;  3CD6 V;  5GON B;  3N27 A;  4NXN B;  3P30 A;  1G6U A;  3RGB A;  2ITD C;  2KG7 A;  3H1I H;  2QWO B;  2JRI A;  5D5P A;  3C3T A;  1YHQ V;  5IYZ A;  2RCV A;  3ZBH A;  4F6R A;  5EZY B;  4UB6 Z;  1QU7 A;  2P06 A;  5C8Y A;  4J41 A;  3CEI A;  4QGP A;  5AG2 A;  3D3Q A;  2N05 A;  4H37 A;  1PL0 A;  5LP6 B;  4UCU A;  4QE7 A;  3F5W C;  3MHS C;  1XNR O;  4JYA B;  4FM2 A;  4OX9 O;  3DC5 A;  4JAA A;  5LMU O;  1SZT A;  2BTQ A;  3B8M A;  1KC8 W;  2QA4 V;  1VQK V;  2UXB O;  2YUA A;  2UUC O;  1X4T A;  3CME V;  1OCZ C;  2GUZ A;  2P90 A;  1UFI A;  4GT1 A;  1WLE A;  1VQ9 V;  3HKD B;  1GK9 A;  1HNW O;  5BXZ A;  2LGW A;  1GM8 A;  4X8A A;  4J9Z B;  2E5L B;  3UKM A;  4DRX B;  4EFE A;  1YJ9 V;  3M7M X;  5B1B B;  3SYO A;  4WFE A;  4D7T A;  5FL7 G;  1IZ3 A;  1PP9 H;  1TGO A;  2MW2 B;  1VF6 A;  2YC0 A;  1YIJ V;  3CRQ A; 
#chains in the Genus database with same CATH homology
 4MVQ A;  2B1I A;  4TWK A;  1M56 C;  3FYI B;  3AG4 B;  4LC1 A;  4MVO A;  4MVU A;  5E1A C;  4Q20 A;  4R7C A;  1S72 V;  3QO7 A;  4KUM A;  2PI4 A;  1QLE B;  4F4L A;  1EBO A;  1F4M A;  2WLH A;  1SET A;  3G4S V;  2QM8 A;  4QPK A;  1JPX A;  3ASN C;  3WG7 B;  1AI6 A;  1NR1 A;  3F7V C;  3OMN B;  3SPH A;  4R8C A;  3CCR V;  1OHH G;  1V54 B;  3MD0 A;  3CPW U;  5CBH A;  5DM6 V;  2OTJ V;  1G4Y B;  3PJS K;  2P67 A;  1RPR A;  1FXK C;  2IU0 A;  1CEZ A;  3K9A A;  3A0R A;  1JVM A;  3LDD A;  4JAV A;  2EIL B;  2WLL A;  4UXN A;  3ASN B;  3JD0 A;  4ZBM A;  4JF3 A;  3W7T A;  3CXC U;  1RM1 B;  4UVA A;  1NKD A;  3IC7 A;  3DGE A;  5CBG A;  4GX0 A;  3ZMT A;  3TK1 A;  3E35 A;  1W0K G;  4FK5 C;  2QEX V;  3ZRS A;  2XAH A;  3X2Q B;  1QVG U;  3E2E A;  2X7R B;  1NJI W;  3OMA B;  2DQ0 A;  1B6Q A;  2YEV A;  5J9P C;  3FB5 C;  1OCO C;  1FS0 G;  2Z5U A;  1BL8 A;  1KD1 W;  2HFE C;  1VQ5 V;  1S0V A;  4JYC A;  1QVF U;  4UV9 A;  1NVP D;  2LFS A;  3NXS A;  1Q7Y W;  1GM9 A;  2Q69 A;  2Z3Y A;  2A79 B;  4MW8 A;  3OR6 C;  3E8F A;  2OTL V;  5L3C A;  3FB6 C;  1P7B A;  1YJW V;  2A0L A;  1FXH A;  4UUJ C;  3GB7 C;  1NH2 D;  5IDJ A;  2GSM B;  1V55 B;  4CZZ A;  3OAA G;  2Q67 A;  1ORQ C;  5B3S C;  3K06 A;  1DTO A;  1GTO A;  4EKW A;  2X6C A;  3SPJ A;  4JYB A;  4MTG A;  2ZQM A;  2WPD G;  3W7S A;  1VQL V;  3K03 A;  4N21 A;  2X0L A;  4QIW F;  3I55 V;  2Q6A A;  4MVM A;  1OCO B;  1R3J C;  3HB3 B;  3SYQ A;  2Y69 C;  3EFF K;  1FXV A;  2D3O W;  3G6E V;  3RVY A;  2JDI G;  1YIT V;  3ASO C;  3ZRW A;  4PA3 A;  1E79 G;  2DYS C;  2WLL B;  1UJW B;  4J9Y B;  1YTF D;  3ZRV A;  3ABL B;  5KA6 A;  1YTF B;  5LGU A;  3K0D A;  1QR8 A;  5EBW C;  1AI4 A;  3IFX A;  4MVR A;  3JCZ A;  2WLK A;  4XBF A;  1R3I C;  3ZCC A;  3CCM V;  1MOF A;  5B1N A;  4FJC C;  3JD2 A;  2EIM B;  3P32 A;  2IJK A;  5LHI A;  2DW4 A;  1VQN V;  5L3B A;  3ZIA G;  2IJH A;  2YEV B;  3LDE A;  2Y69 B;  1V54 C;  3ZMV A;  2JIZ G;  2IJJ A;  5H9C A;  2XAG A;  1K9M W;  3B8N A;  1EFR G;  3ETG A;  3ABU A;  3I56 V;  1R3L C;  2DYS B;  3SPG A;  3CMA V;  1TUE B;  3D3I A;  3CC7 V;  3CCU V;  2ZDI A;  4MW3 A;  3CCV V;  1FFT B;  1CP9 A;  4DO2 A;  1AI5 A;  2P6J A;  4U7O A;  3ABK C;  3ZJZ A;  3E8G A;  4BAY A;  4PA7 A;  2EIN B;  4FPP A;  3CCE V;  5HFM A;  1K5Q A;  2EIL C;  1SER A;  4WFH A;  5L3D A;  1RM1 C;  3SPC A;  1MSW D;  2JEU A;  3ZRX A;  4P9O A;  2QKS A;  3ZMZ A;  2HLD G;  3AEI A;  3X2Q C;  2HVK C;  4H33 A;  1GMG A;  4XDL A;  2EIJ C;  3LNM B;  4P2Z A;  3ZRW B;  3CYO A;  4JTD B;  3ABM C;  2R9I A;  2WAM A;  1HWY A;  1R6N A;  2EIK C;  2QE7 G;  3R65 A;  4QJF B;  4WFG A;  2ZDI C;  3ABK B;  1BMF G;  1L1F A;  3ABT A;  1DLB A;  1H8H G;  2WSS G;  3RBZ A;  2XOK G;  1AJN A;  3SPI A;  2R9R B;  5EC2 C;  1ZWI C;  5CN0 A;  4RUE A;  1V55 C;  3AG2 C;  1KP3 A;  4X89 A;  3RW0 A;  3CCS V;  4HAM A;  4MVS A;  2IH3 C;  1PNK A;  2GHY A;  2HVJ C;  2WLN A;  4WFB V;  3D36 A;  5LGN A;  1E1R G;  3H01 A;  2EIJ B;  3ETE A;  4GX2 A;  1OCC B;  3CCJ V;  4PEL A;  1W2B U;  2ZD9 A;  1K7D A;  3LDC A;  3QO5 A;  3W7U A;  2HKO A;  3G71 V;  1R3K C;  3SJQ C;  1XL6 A;  5DN6 G;  3OMI B;  1P4R A;  3ABM B;  3ML0 A;  3CC2 V;  2EIK B;  1XL4 A;  3E8B A;  4YXW G;  1KKD A;  3E89 A;  3QO8 A;  2JK5 C;  2ZR2 A;  5EBL C;  1NVP B;  4E2L A;  4LP8 A;  4HYO A;  3TCU A;  2XND G;  2Y48 A;  4JTA B;  3OEH G;  4TSF G;  2CK3 G;  3OEE G;  3UM7 A;  2XAF A;  1VQO V;  3B77 A;  4JAS A;  3AG2 B;  1VQ4 V;  5EBM C;  1NH2 B;  3CCQ V;  3ABL C;  4UV8 A;  1EZJ A;  3VBB A;  3K79 A;  1K34 A;  1PKX A;  1M57 C;  1DF5 A;  2X6B A;  1K4D C;  1AJQ A;  3E8H A;  5IYC O;  4XDJ A;  1VQP V;  3IGA C;  4LBE C;  2IJI A;  4UVB A;  2EIM C;  1YSC A;  4UVC A;  5B1O A;  3ZMS A;  5LHH A;  2V1D A;  4BIU A;  3K0G A;  3K04 A;  1AR1 B;  1MG1 A;  1F51 A;  3LSQ A;  4N23 A;  4MTF A;  1OZ0 A;  3RVZ A;  2ITC C;  1S76 D;  2ZR3 A;  1K5S A;  1Q86 W;  2OCC B;  3OUF A;  3CC4 V;  2FTK A;  4PDV A;  3FYE B;  4RQE A;  2MK3 A;  5L3E A;  3F7Y C;  5LHG A;  2EJR A;  1RPO A;  4GCZ A;  2HG5 C;  2UXX A;  1YJN V;  3E83 A;  2WLJ A;  4MTO A;  1M57 B;  2LFR A;  4GX1 A;  3DTU B;  4KP4 A;  3BY6 A;  4RQF A;  2W0F C;  4WF9 V;  1S77 D;  2NLJ C;  1S5H C;  1PD3 A;  3E86 A;  2EIN C;  1M1K W;  1K8A W;  1K33 A;  1F4N A;  1H2G A;  4Z1M G;  2C2A A;  4RO2 A;  3FB7 C;  1K92 A;  1OCR C;  1K3E A;  4ZKI A;  4LCU C;  5KA5 A;  1J95 A;  2YSU B;  2K1E A;  1Q81 W;  1VQM V;  1QLN A;  5GW7 A;  3ZN1 A;  1N8R W;  1DF4 A;  3JYC A;  2XAJ A;  3GWO A;  1BHB A;  3WFV A;  1CPY A;  4JAU A;  1THZ A;  4G28 B;  4PA6 A;  3M99 B;  2LP7 A;  3AG3 C;  1GM7 A;  3OGC C;  3KG2 A;  1VQ7 V;  3SYA A;  1OCZ B;  3ZN0 A;  2XAQ A;  1AI7 A;  2W6J G;  4JGS A;  4MS2 A;  5IY5 C;  3W7X A;  2AHY A;  4ASU G;  5HFL A;  2X6A A;  1OCR B;  3QNE A;  4QE9 A;  2XAS A;  4DXW A;  2H8P C;  1FXK A;  3LUT B;  3JD3 A;  1QBZ A;  1KEC A;  3SYC A;  3JD4 A;  4TT3 G;  5EC1 C;  2JJ1 G;  5IYB O;  1E1Q G;  3EHB B;  2QM7 A;  2DYR C;  2BOC C;  2DQ3 A;  4PA4 A;  4MT8 A;  3AG1 B;  1OCC C;  3BEH A;  2B1G A;  4P9P A;  1COW G;  4FMT A;  3AG3 B;  4WFA V;  4I5S A;  4GX5 A;  2JJ2 G;  4X88 A;  1GKF A;  1I5X A;  1NR7 A;  1NQT A;  1YI2 V;  3FKS G;  5IY5 B;  1W0J G;  1QR9 A;  3JD1 A;  4JPR A;  5B1A B;  2UXN A;  2PI5 A;  3STZ C;  4QPJ A;  2DYR B;  1M56 B;  3T1C A;  1JOY A;  5L3G A;  4U7N A;  3K3W A;  1K97 A;  1H8E G;  3CD6 V;  2KB1 A;  2P7T C;  1NBM G;  2AHZ A;  3W7W A;  5BZB A;  3MHH C;  3OR7 C;  1VQ6 V;  4R50 A;  2W6I G;  4XDK A;  5H6R A;  1JJ2 U;  1PNL A;  3P30 A;  3SYP A;  1LNQ A;  3ETD A;  1IXM A;  2ITD C;  2DWD C;  2OCC C;  5CA3 A;  5KUK A;  1YHQ V;  4L87 A;  4MSW C;  1SRY A;  4BIZ A;  3FB8 C;  4BW5 A;  1M90 W;  1Y4M A;  1FXK B;  2EBO A;  2BOB C;  1K73 W;  1GO3 F;  2ATK C;  4RUF A;  4G27 B;  3ZMU A;  5L3F A;  1R6K A;  4P30 A;  2JEX A;  2WLI A;  4H37 A;  1KP2 A;  5KUM A;  3OUS A;  1PL0 A;  1Y66 A;  1I5Y A;  4QE7 A;  5LBQ A;  1JX9 A;  3F5W C;  2V7Q G;  3MHS C;  1ENV A;  1JQ0 A;  2OT5 A;  4OXS A;  2EZP A;  2IW5 A;  1SES A;  1KQS U;  4JTC B;  3T2M A;  1G8M A;  1SZT A;  3B8M A;  1JCH A;  2A9H A;  1KC8 W;  4PDM A;  2ZXW C;  3CCL V;  2QA4 V;  1VQK V;  2HR3 A;  1BHA A;  1MAB G;  5B1B C;  3CME V;  2NNU A;  1OCZ C;  1QCE A;  2P90 A;  4MTX A;  5H6Q A;  2HJF C;  4GT1 A;  1WLE A;  3T4D A;  2B5U A;  1K4C C;  2EZO A;  3OW2 U;  5CBF A;  2QTO A;  1PNM A;  3OE7 G;  4MVZ A;  1VQ9 V;  4I9W A;  1GK9 A;  2M7W A;  1ARO P;  4KFM A;  4PA9 A;  4RAI A;  2IH1 C;  4FIP C;  3STL C;  5B3S B;  5IYD O;  2IU3 A;  4PDL A;  4HZ3 A;  4CBC A;  1GM8 A;  3OM3 B;  4G2K A;  2F43 G;  5LGT A;  3AG4 C;  3AG1 C;  4X8A A;  5C93 A;  3TET A;  4J9Z B;  2Q68 A;  2ZXW B;  1H38 A;  3UKM A;  1S3J A;  1QLE C;  1AJP A;  3VOU A;  1YJ9 V;  4PDR A;  3HPL C;  2WWW A;  5B1B B;  2WLM A;  5CMU A;  3WG7 C;  2DWE C;  3SYO A;  4WFE A;  5FL7 G;  1Q82 W;  3T4Z A;  5EK0 A;  4QNH B;  4R6Z A;  1F23 A;  5B1A C;  2H94 A;  3K08 A;  3ASO B;  2WLI B;  3LSS A;  1M9N A;  1ROP A;  4WFF A;  1R73 A;  3CP1 A;  3OFN G;  1VQ8 V;  1YIJ V;  1WPX A;  4WCE V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...