4WFGA

Human traak k+ channel in a tl+ bound conductive conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 96
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfgA00
1S5HC 4MTOA 4BW5A 3IGAC 1G4YB 1K4DC 3AG2C 4MVSA 4MVUA 4PDLA 4R7CA 2DYSC 3T4DA 5CBFA 3SPCA 4XDLA 3EFFK 4R8CA 4ZBMA 3LDCA 1OCCC 3ZRSA 2X6AA 1OCZC 2IH1C 4WFGA 4P30A 3T2MA 3K08A 3K0GA 2IH3C 2R9RB 4R6ZA 3SJQC 2EILC 4HZ3A 4MS2A 4WFEA 4X89A 2BOBC 3SPGA 4QE9A 4QNHB 3OR7C 3E89A 3R65A 2ZXWC 3E8GA 1ORQC 2WLKA 4HYOA 2YEVA 5EBLC 4CBCA 2WLMA 5B3SC 2A0LA 3E8FA 3ASOC 4RO2A 4LP8A 3WG7C 4RAIA 2AHZA 2NLJC 3E83A 3SYPA 5CBGA 1M56C 2HFEC 3K0DA 1R3LC 4PA4A 5E1AC 3RVZA 4X8AA 3F5WC 3GB7C 5EBWC 4RUEA 4P9PA 3OUSA 4P2ZA 4OXSA 3T4ZA 1V55C 1R3IC 3JYCA 3ABKC 4MVMA 4PDVA 2AHYA 4GX0A 4JTAB 2Q69A 2DYRC 4LBEC 3STZC 3F7YC 1OCOC 2H8PC 2W0FC 2A9HA 1R3KC 3E8HA 5B1AC 2HVJC 4MVOA 4RUFA 1P7BA 4XDKA 4MVZA 2KB1A 1LNQA 4TWKA 2X6CA 4GX1A 2HG5C 3SPHA 3OR6C 2WLLA 4PA9A 1J95A 3AG4C 1BL8A 4J9YB 4EKWA 3OUFA 3K03A 2Q67A 4PDRA 1KKDA 4G28B 4WFFA 3SPIA 3TCUA 3SYQA 2WLIA 5EBMC 4MSWC 2EIKC 4GX5A 3BEHA 3K06A 4MTGA 4UUJC 3K04A 1V54C 2HVKC 4MW8A 1R3JC 3AG1C 2JK5C 4P9OA 2OCCC 5B1BC 2WLHA 3LUTB 3X2QC 1K4CC 4DXWA 3TETA 5EC1C 5KUKA 4JTCB 3PJSK 3HPLC 4X88A 1OCRC 3UM7A 2BOCC 2X6BA 3RVYA 3VOUA 2A79B 3STLC 3F7VC 4MVQA 2WLLB 5EK0A 3SYAA 3OGCC 3E8BA 3FB5C 3LDDA 5BZBA 1JVMA 1ZWIC 4F4LA 2EINC 2EIJC 3KG2A 3FB8C 3IFXA 4XDJA 1XL4A 4GX2A 4J9ZB 4I9WA 4JTDB 3AG3C 3UKMA 3ZJZA 4PA7A 4PA6A 3T1CA 2Q68A 4MTFA 2HJFC 2EIMC 5EC2C 2K1EA 3ABMC 3FB7C 1XL6A 4H37A 3LNMB 2ITCC 4LCUC 4G27B 2ATKC 3SYCA 1QLEC 3RBZA 3ABLC 2DWDC 2WLIB 3ASNC 3SYOA 3SPJA 2WLNA 4KFMA 2QTOA 2Q6AA 3FB6C 4PA3A 4R50A 4WFHA 4QE7A 5KUMA 2QKSA 3RW0A 5CBHA 5IY5C 4PDMA 2ZD9A 4MVRA 2ITDC 2WLJA 2Y69C 1M57C 2DWEC 5J9PC 3LDEA 3E86A 4H33A 4MW3A 2P7TC
chains in the Genus database with same CATH superfamily
1XEQA 3CRMA 3T4DA 4YY3O 5CBFA 4DR2B 4GKJB 2OTJV 3T2MA 4LF8B 1IXBA 1QVFU 3C3SA 1PNMA 1N34B 1AI4A 1WPBA 4JPRA 1XMOB 1BZKA 2JIZG 5L3GA 4AQYO 1PL0A 2DYRB 4BR6A 4XBFA 3U10A 1JX9A 2AHZA 1M56C 4LF5O 1KB9F 3AEIA 1R3LC 3RVZA 4X8AA 5KHHA 1SQFA 5KA5A 4PDVA 3JYCA 4LF4B 3GWOA 1VQ4V 3SJBC 1XI1A 1I94B 4IYHA 5IYZB 1P7BA 4I4TA 2F43G 3DC6A 1GAXA 2HEPA 3OR6C 3QO8A 4O4HB 1OCOB 1KBHA 2V1DA 2ZINA 3B40A 4LF7B 4I4TB 3QNEA 5KMGB 4ZI7A 1VQOV 1JFFA 5B66Z 2YICA 2O57A 2GUZA 1YTFB 3K06A 4MTGA 1QR9A 4U7NA 4FLWA 4UV8A 4P9OA 1DTOA 2UUBB 4JI0O 2GDSA 3N2KA 4ZOLA 4QIWF 2E5LO 3ZRVA 1GN3A 2YI9A 4PJ0Z 1QBZA 1Q6IA 1H2MA 4WFBV 4J42A 1M5IA 1VF7A 2EINC 4I50A 3FB8C 1WPXA 3K5OA 3OT7A 1Q81W 1N32O 1QR8A 4KFMA 1K73W 1Q6UA 1XOUA 4TV9A 1WJZA 2HJDA 5JQGA 4KP4A 1RSOB 4O4JA 3TXQA 4LH7A 1NBMG 4U3JA 1FPOA 5FLXN 3ZX6A 3SDLA 1QVGU 3IC9A 1Z5VA 1IVSA 2L6LA 2WAMA 1FD9A 2AXTZ 5IWAB 1AJQA 5GTHZ 1DLBA 3WG7C 3E83A 5CBGA 4GKJO 1GM9A 2CTQA 1NR1A 4NTXA 3JD2A 4F6EA 2E3CA 2ZNIA 4DUZO 1GM8A 1IBMO 4AQYB 2X0LA 2WWWA 4O4JB 1U96A 3FFQA 2XAGA 4I7ZB 1Q90D 2R72A 1F23A 5H6QA 3VBBA 1NT2B 3CSXA 4DV4B 1V54B 1W59A 1BL8A 1FYJA 3H1LH 4GCZA 2HKOA 2EZPA 2QM8A 3G6BA 5J2UA 5B1BC 1GRJA 1K4CC 4X1IB 4FFBA 1OCRC 2CTRA 1VQPV 3GVMA 1OJHA 2Q7EA 2YEVB 2Z3YA 3CE2A 1M4UA 4QJFB 3IFXA 5IWAO 4FLVA 4JZGA 4X1YA 3N2KB 2OCHA 3EXAA 4NR1A 4ASUG 1LUWA 1R6NA 2XAQA 5B1NA 5JQGB 1TA8A 4JI5B 3W7SA 2UUAO 3T1YB 2F95B 3D36C 5LGNA 4QPKA 1PKXA 3IGAC 1I0HA 1T5EA 5CB4B 4FK5C 2XNDG 2X6AA 1OCZC 1H8EG 3OTOO 2A06H 2OIEA 1P4RA 4X89A 5J2TB 5L3EA 3R65A 3SR2C 1Q5OA 3ETGA 2HP8A 4FMTA 1CP9A 5B3SC 1E79G 4RO2A 2NLJC 2EULA 4FLXA 1ENVA 2QE7G 5EBWC 5LMUO 2JEUA 4P9PA 1VF5B 4I0XA 2JGUA 1HNXB 1KD1W 4KHPB 3S3WA 3ABUA 2W0FC 1QLEB 4BAYA 5EIBC 4JGSA 1VQLV 3RYIB 3ZN0A 1IBKB 3K79A 1RPRA 2ZCEA 3B4SA 4CS3A 3I56V 4WCEV 1NTKH 4YJ3B 3JAKB 1X4TA 4J10A 3THOA 4EFBA 4JI8O 5K1PA 2HVKC 4IHJA 4DR3O 3LUTB 4UXNA 1I5YA 4JTCB 1GN2A 3AG1B 2AZ0A 2B5UA 5ITZA 1GM7A 1IZ3A 1SA0A 4FFBB 3A0HZ 1K7DA 4CH6A 5CA3A 1FXKA 3W7TA 4DV3B 1OZ0A 1XMQO 4JI2O 4LF9B 1GN4A 3JD4A 5LMNB 1RSOA 1XHXA 1X59A 1H2KA 4GT1A 3E86A 1L8DA 1KUQA 1K4DC 3OTFA 4B08A 4W4LA 1IBLB 1EFRG 3K08A 4O2BB 5JWPA 4QGPA 4Z1VA 2XHBA 3TXSA 2VWKA 3E89A 1UPGA 2FL4A 4F6RA 2EX3A 2AZ2A 1YZBA 1VQ8V 3SYPA 3ZMZA 4TQDA 1HR0O 2PYJA 1B04A 3JCZA 1YSCA 1TUEB 3VQYA 3F7YC 1VARA 3AG7A 5KA6A 5CA1B 1XNQO 2VRZA 3CMEV 1H38A 1N8RW 1WN7A 4DV3O 2UXCB 1YCIA 2WLLA 5B1BB 5BMVA 4LF9O 4K8XA 4YJ2A 2W6JG 3K03A 2Q67A 5LMUB 1KKDA 5IDJA 3TGUH 1F4NA 3W7UA 3SYQA 2HHHB 1SESA 1V54C 4YIPA 3CMAV 4LNUB 1JJOA 5IY5B 1WB8A 3RWRD 1ZUQA 3X2QC 4DR4B 3APQA 1JOYA 3QTCA 4U3FH 5LXTB 5H5NA 2N74A 3AK2A 3CXHF 1EZVH 2P90A 5D5PA 3E22B 3FB5C 4GUNA 4F4LA 5J2TA 3N2GB 1TGOA 4JI8B 4J9ZB 2A7WA 2JDIG 4LF6B 3CD6V 3P3PA 2YXHA 5CB4A 1XL6A 4G27B 1VMGA 2WLIB 3FB6C 5IY5C 4PV1B 1KKCA 5IJ9B 4MW3A 4MTOA 4MTXA 1H8HG 1RPOA 4PDLA 2UXCO 1YJ9V 3DSQA 2XAHA 3ZHRA 2CK3G 4ICGA 2ZKOA 1BQZA 5EZYB 3HKEA 4FM1A 4CH5A 1SQVH 1H2SB 3GWKC 1URFA 3OR7C 3N27A 4FZ0A 1QHTA 3SGIA 1H2LA 1VQ7V 4JI7B 3G6EV 2EIKB 1EN6A 3LSSA 2OTLV 3EVKA 3RYFB 3S3XA 3H1KH 4TT3G 4GX0A 2YIAA 4JYBA 5B1AC 3B09A 1PV0A 1UFIA 3FD9A 4JF3A 2DW4A 2UXNA 1AJPA 4KXRA 1WLEA 4DR7B 2GTSA 1BE3H 3ZRWB 2KG7B 1Y74B 3H1IH 1SQXH 3CJHB 1R3JC 1W0JG 1VEWA 4UV9A 3D36A 3DGEA 1I5XA 5IJ0B 2PTMA 2IJIA 2LO1A 1NS1A 3FKSG 5BMVB 5BZBA 4DO2A 1ZWIC 4I55A 1K5SA 3LNNA 2HHHO 4GX2A 2JS5A 2Y0PA 1K97A 2N04A 4UVAA 1NZ6A 3OTOB 4FZ1A 2UXBO 1ROPA 1FJGO 1VP7A 3ASNC 1MZFA 2YC0A 3ABLB 1IURA 3MHSC 3OW2U 4MVRA 2ITDC 4O2AA 4JV5O 1SS3A 2PUSA 2P7TC 3HKCA 2BTQB 3AG2C 5L3FA 2IH1C 3HKBA 3CC4V 1E1QG 4DRXA 1NTMH 3CCRV 3CC7V 2ZR2A 2ZIMA 1HNZB 3CRCA 1YHQV 4LFAB 3ASOC 1RP3B 1N33B 1NI8A 2HFEC 2EJRA 5B5EZ 1VIBA 1N4CA 2QKCA 4X20B 5CA1A 1M1KW 3A0RA 4MVMA 3HR0A 3OAAG 1Q6HA 1XNRB 2GUZB 4TV8A 2YUAA 5A2QN 4B3TB 2NN4A 1NVPB 1S3JA 2R9IA 3ZEDA 1OCZB 5AG2A 3ZIAG 1V55B 1K5QA 5IE9A 2FTKA 5IYCO 4L8JA 2CGNA 4DV1O 1PNLA 3HKEB 2G38A 2Y0IA 4JYYA 2QR4A 2EBOA 3MHHC 2WLHA 3TJTA 4HAMA 1SQQH 4E4EA 1NTZH 2W0XA 4X62O 2ZXWB 3JATA 1YIJV 1M90W 1IDSA 4UVCA 5GONB 5IJ9A 3D3IA 5H2FZ 2Y4UA 4X64B 1G1XB 5C93A 3LDDA 1ZL8A 3RYIA 3ZRXA 2YDEA 3UKMA 2Z5UA 1WAZA 1AI6A 3E2EA 5LYJA 2Q68A 3BRCA 1SQPH 2YIBD 3JD3A 2IU0A 4ZHQA 5JCOA 3K59A 4PA3A 4DUZB 3A8TA 3HB3B 4X65B 1Q43A 2IJKA 4K0KB 5HFLA 2ZNJA 1G4YB 2D3OW 3VQXA 1FXVA 1DK1A 3K9AA 1MABG 2CE4A 3CRRA 4IHJB 2E76B 3K0GA 1VQ5V 2LFSA 3CS5A 3SJQC 1O9HA 2QM7A 4BW9A 3JAMN 4YJ3A 2LFRA 5LOVA 3U11A 2XASA 4J7ZA 2UU9B 4D6TH 3E8FA 5EIBD 1ZLZA 1XMQB 2DQ0A 2JJ1G 2LW7A 2MK3A 1AI5A 5E1AC 2X7RB 1NR7A 3GB7C 2PI4A 4RUEA 3T4ZA 4DK1A 2OT5A 2CH7B 2H8PC 3BFRA 2ZM6O 2WPDG 2V7QG 4FJCC 4NXMO 2PZSA 3QO5A 1VQMV 2KB1A 1RM1B 2DN9A 2X6CA 4TQFA 3KZIZ 1QLNA 3JD0A 4K3AA 4PDRA 1P49A 1I7FA 4IIJA 3G67A 3FYEB 2H3OA 5FPOA 4DV2B 4X66B 3P32A 1OV9A 3OEEG 3G4SV 2PI5A 2BCCH 1SRYA 3LSQA 4X88A 4YJ2B 4MVQA 2XAJA 3MDSA 1D5NA 1AP5A 4I9WA 1LR1A 2DYSB 3K57A 2D2CB 3M7MX 5LYJB 3K5MA 4NTYA 2P5OA 1BHAA 4JAAA 1WA8A 3RBZA 2WLNA 1CXZB 4QE7A 2QKSA 2Q8VA 2ZM6B 2VWJA 2W6IG 3D3QA 3LDEA 3OEHG 5LOVB 4DW0A 5IJ0A 2P6JA 5IYDO 3JATB 2DYSC 3SPCA 2ZE8A 2NR5A 1WB7A 4ZBMA 1SZTA 1GH6A 2LJ2A 5J2UB 4DR5O 4B3SO 2R9RB 4AHCA 1Y74A 4MS2A 1S0VA 4LFCO 3JAKA 3QG5A 4X65O 5L3CA 4OGQB 1SETA 2OYQA 3RT3C 4B3RO 3L72H 1M56B 2UUCB 3F5WC 2QM4A 5JVDB 4OXSA 3ETDA 5CA0A 5KX5B 2DYRC 3KCXA 3J7AU 4EB6B 1TUBA 1R3KC 5FPRA 4X20A 4DUYO 4OX9B 2QWNB 1LNQA 4LH6A 4GX1A 3H1HH 3ZHVA 1MSDA 2YXYA 2N05A 2EZOA 2BSKA 2EJ7A 4UCUA 4BWAA 4DW1A 1FAFA 4MSWC 2P06A 2P4KA 3K04A 1EM1A 1H2GA 4DRXB 5JH7B 1S77D 4CZZA 2BOCC 4WBNA 3ZS8C 1DF4A 5EK0A 1YITV 4FM2A 4AILC 1MA1A 1JVMA 4DV7B 4WBNB 4BIUA 4J41A 3RFRA 3IC7A 2Q4PA 4UCVA 4NXNO 2DQ3A 3L74H 3SYCA 3SYOA 1US6A 3C3TA 5EYPA 1D5AA 4LF7O 4Q20A 1Y6XA 2GTAA 1IX9A 2H94A 3K5LA 2IW5A 1HNZO 4IGGA 1S5HC 2IU3A 3L73H 4JYCA 3ZHQA 1HWYA 4JI2B 3FX7A 4J80A 3DXRA 5KX5A 2QSAA 5B1OA 4GKKO 3BY6A 4QE9A 5H6RA 3WFVA 4ZI7B 2ZXWC 4FLTA 2GBOA 3G71V 1S5JA 3MD0A 4B3TO 4IT5A 3FAVB 4LFBB 4RAIA 4DR1O 3IJ4A 1HNWB 4U7OA 2CDYA 1N32B 3CC2V 4P2ZA 2Z0AA 1V55C 4K8ZA 5K1XA 3LSUA 1HP8A 4JV5B 1Z2GA 1LUVA 4D7TA 3CWBH 4K35A 4XDKA 3B2EE 3CX5F 1R73A 1BS3A 1WP7A 1G8MA 2HR3A 1U97A 4DV6O 3SJAC 5KHJA 1J5EO 1WA8B 4UUJC 5LHHA 4YIOA 2JK5C 4YY3B 4DUYB 4A5UB 2Q9LA 3PJSK 3UM7A 2PF4E 3CCLV 3BAAA 2A3QA 2UUAB 3ABKB 4JAVA 2HLDG 2EIJC 1L1FA 5BR8B 4JTDB 3AG2B 5CMUA 3UO2A 1KQSU 3CCMV 2EIMC 3JAWA 3JSNA 3FB7C 2QWQB 4LCUC 2RN9A 3ABLC 2DWDC 2F1MA 4TUYB 4J7KA 1SC5B 1B06A 1GKFA 3ZMTA 4C7UA 4H33A 1HDJA 2AGAA 1MOFA 3RN4A 3ZN1A 1JJ2U 1Y66A 4R6ZA 2JGDB 4MT8A 2RMKB 1S5LZ 1Z5WA 1JFFB 2WLKA 4ZKIA 3O9OA 4JI1B 1FS0G 2A0LA 2UXDB 1I08A 1EN4A 3ICXA 3BA9A 1CPYA 3K0DA 3AG3B 1ZSPA 4YHHO 3U0ZA 5HFMA 1TVKB 2WA4A 1FKAO 4MVZA 1KP2A 4LFBO 4JI7O 3QF7A 3OD4A 3CCSV 4F6RB 1PL4A 1Y67A 2Q7HA 2RJZA 4FM0A 3UT5A 3RYCA 4G28B 4TUYA 5EBMC 2F4VB 2EIKC 5CN0A 5JJEB 1BGYH 4JASA 1R6KA 3SJCC 4EFEA 3H1JH 1ZL8B 2QA4V 5DECA 2FB5A 3ZMUA 1FFXB 4J11A 2WLLB 5GTIZ 3H9VA 5KLVH 4JYAB 3E8BA 1HNXO 2KKWA 3L75H 1L0NH 1XL4A 1KC8W 4NXMB 2VS0A 3ZCCA 1JMKC 5C8YA 2ETNA 1RM1C 1M9NA 2K1EA 1QU7A 2ITCC 5LL6Y 1JPXA 3CRQA 3OMIB 3RYHB 3SPJA 1XDCA 1WNSA 5L3DA 3D8CA 1XBLA 1OHHG 1VQ6V 2M6YA 3JARB 3PN1A 2RDCA 2DWEC 5IYBO 3ETEA 1BCCH 4X1IA 4MVUA 1TUBB 3W7XA 3JALB 4CC5A 3KKYA 5BXZA 4WFGA 4P30A 4PI0A 5C8YB 5JVDA 4CH4A 1XREA 2EILC 4QNHB 4U3JB 3ZHSA 3ZMSA 1G6UA 3L71H 3WB2A 4DV1B 3JCUZ 3X2QB 4D7SA 5TISZ 4LR3A 1VQKV 4Q6GA 3B8NA 1Y4MA 3WB1A 4JI3B 2GHYA 4UB6Z 4PA4A 2YI8A 3J81N 5KHGA 2FYUH 3OUSA 3Q4HA 4JYAO 4X64O 2LQTA 1B3QA 2IJHA 4O4LB 2DMXA 5DM6V 1NQTA 4DR6O 1Q86W 3CB2A 3JALA 1KP3A 4JZ2A 2IBZH 1KECA 3E8HA 1H2NA 3K9SA 3F5TA 4DR4O 3UT5B 3RYCB 1QNMA 4HBNA 1N33O 1SQGA 1W2BU 1IBLO 3AG4C 1AILA 3CCUV 2CTWA 2QWPB 3SPIA 3BHPA 1Q8IA 5EYPB 4ZOLB 2JJ2G 3AG4B 3AK3A 4AI8A 2YS8A 1AI7A 1KU9A 1A32A 4O4IA 2UUCO 1AR1B 4X1KA 1KYOF 3RVYA 3F7VC 4DYLA 1BHBA 1FFXA 5A9GA 4FLZA 1N0NA 4O4HA 2F4VO 5IYZA 1CEZA 3OM3B 2E75B 4I9QA 5JH7A 2JGDA 3HKDB 3DXRB 1JCHA 2QKAA 4PELA 3CEIA 4IIJB 1K92A 4RQFA 2RNBA 4TSFG 4DV0B 4DV5B 1PM9A 2BSKB 2EILB 2Y69C 5KAFZ 3J80N 3OGIB 4R7CA 1AVMA 3ZBHA 4R8CA 1HNWO 2CH7A 1K33A 2JVDA 1GN6A 2IH3C 4NYKA 2JRIA 4LF4O 3CP1A 1NJIW 3T1YO 1BT8A 1I94O 4HYOA 4DR3B 4LF6O 2RCVA 1V9PA 4X1KB 4LP8A 1XHZA 2Q0OC 2ZE6A 1BQ0A 2CAZC 4DR7O 4JAUA 4JTAB 1XUQA 3R66A 3ASNB 2BE3A 1BSMA 3CCQV 5LGUA 1MSWD 2HVJC 4UVBA 2UUBO 1EZJA 1E1RG 2E5LB 4TWKA 5FNVA 2ZQMA 5E79Z 2L35A 1S72V 4N21A 2LP7A 5LHIA 1AR5A 4J9YB 3OUFA 1N34O 3KCYA 5JCOC 1F7YA 3L70H 4I5SA 4O4LA 3Q4HB 4CS4A 5B3SB 5DEDA 3CCEV 1RFYA 4RQEA 1KMIZ 2V4DA 4DR5B 3N2GA 1N36B 4PD4F 2X6BA 2UXBB 3VOUA 4UCRA 1SERA 2VQFB 1DGSA 3QVNA 1PNKA 5LP6A 3AG3C 4NB5A 3CRAA 2WA3A 1NKDA 2Q7GA 4LNUA 5EC2C 3T1HB 4YXWG 4UB8Z 3BCCH 4H37A 5B1AB 3VQWA 4GLXA 2ATKC 1P84F 2QTOA 3CYOA 1J5EB 1VF6C 4PDMA 1Y76B 2WLJA 1PD3A 4O2AB 1AB3A 3ABTA 3IAYA 3RYHA 4OX9O 4MVSA 4JI0B 1GMGA 5KAIZ 3LDCA 2C2AA 5H9CA 2AW9A 2F93B 2Q5ZA 2GSMB 2K9PA 2CUGA 1F51A 5LMNO 4DV5O 1OCRB 5KMGA 1YJWV 3VQVA 4CBCA 2ZIOA 3P30A 4N23A 2R9AA 1F4MA 1N36O 1JQ0A 4B3SB 3CCJV 1AJNA 4FIPC 1FJGB 4FFKA 2QEXV 3ABKC 3HKBB 2Q69A 3ETQA 3JASA 4LBEC 2A9HA 4B7EA 2IM9A 2XAFA 4L87A 1W0KG 3T1HO 2XUMA 2YIDA 3ZMVA 3G80A 1YTFD 4WFFA 1YF2A 3P3NA 4ZHQB 3M99B 4FVMA 2Y69B 1TVKA 5CA0B 1PPJH 3K58A 1SF9A 4PHZA 4IYIA 4GKKB 2E74B 3UO3A 2QDOA 1IBMB 4K0KO 4XDJA 1THZA 5LGTA 2ADPA 1K34A 5KHKA 5L3BA 1D2DA 5EZYA 2KG7A 2FKXA 1IXMA 4LF5B 3B77A 5LA6A 2B1IA 2Q6AA 4KL1A 3RW0A 3EHBB 3TK1A 2WSSG 2UU9O 4FLYA 4EB6A 4ZIBA 3EFFK 3JAWB 3JSLA 2EINB 4I0XB 1Q7YW 3CCVV 2ZE5A 4E2LA 3I5DA 4JI6O 1PP9H 2F66C 4UCOA 5EBLC 2YIBA 1K8AW 4DR2O 1QQCA 1FFTB 1HW7A 4LF8O 3DTUB 1R3IC 2ARHA 3JASB 1OCOC 1EN5A 2UXXA 4DV2O 4HNAA 2DOSA 1JA8A 1FXHA 5KHIA 1YEWA 3NXSA 1ZAUA 5D5QA 2JS3A 4WFAV 1R6TA 3WU2Z 2QWOB 3OE7G 4O4IB 4GX5A 3BEHA 3K3WA 3M8AA 2XT9A 1YVWA 3O65A 3AG1C 2NNUA 2LGWA 1XQ8A 1DF5A 2ODMA 4CC6A 2A79B 4DV6B 1YXBA 2XOKG 3BA8A 2B1GA 3E35A 4DV0O 2QTSA 1QCEA 4H0LB 4H13B 5JJNB 5LXTA 4H44B 2IJJA 1NH2B 2ZE7A 4JI1O 4EEQA 4LFAO 1K9MW 2UXDO 3HKDA 4PA6A 3T1CA 4MTFA 4B3MO 3ABMC 3LNMB 2PYLA 1QLEC 4UFZA 3I55V 1SZXA 3HKCB 5CBHA 5KUMA 2BTOA 4LWSA 5JJJB 4PI2A 1M57C 1SKVA 5J9PC 4R50A 4X66O 4BW5A 5BR8O 2GV9A 2YXLA 2KSDA 4B3RB 4XDLA 1OCCC 2Y4TA 2ZDIC 1HR0B 4DV4O 4IL6Z 3OFNG 2DJVA 2DE0X 3ZHUA 1M93A 2OCCB 1Y76A 4JI4B 5GONA 1NH2D 1N0JA 3JARA 1B6QA 1MZEA 2PGGA 1BMFG 2KQXA 1AR4A 1WP8A 1P7GA 3ML0A 3DC5A 4MVOA 5LP6C 1MG1A 2F23A 2HG5C 5BY1A 4B3MB 3A2FA 1AROP 3C90A 4YHHB 4EKWA 2VQEO 5DN6G 1S76D 2RQ6A 3TCUA 2WLIA 3BVOA 1MNGA 2M7WA 4LFCB 1ZTEA 1XNRO 2ZT9B 1EBOA 2Q73A 1YDXA 4MW8A 2PY5A 1Q3EA 2XTAA 1AP6A 2CGOA 3RYFA 1FXKB 3L9DA 2ILMA 3TETA 5EC1C 4DK0A 4UCTA 3HPLC 2EIMB 4I50B 1YI2V 3STLC 4RWUA 4CH3A 5FNVB 1VQNV 3SYAA 3CPWU 4LWSB 3ZHTA 4BIZA 2EIJB 3QO7A 1UJWB 3W7WA 4JI4O 2ZR3A 4PA7A 3MAQA 4JI3O 4X62B 4UCSA 3K5NA 3OMAB 2OIGA 4TOIA 1XMOO 2QGNA 3APOA 2BTQA 4WFHA 2ZD9A 1L0LH 4DR6B 3JD1A 4RUFA 2P22C 3A0BZ 1JR9A 5LHGA 1VQ9V 4TV8B 1IBKO 5GW7A 3WG7B 4DR1B 3ZRSA 3RGBA 1COWG 4NTWA 3FYIB 4GYCB 4NVPA 2VQEB 2VQFO 2FMLA 4HZ3A 4WFEA 3SPGA 4JI5O 2BOBC 1GK9A 4X9QA 3BABA 4DV7O 1SQBH 3E8GA 1ORQC 3E22A 2B9ZA 2P4VA 4QPJA 2YEVA 3BPZA 5IT9N 4CS2A 1FXKC 5LBQA 2ZDIA 2WLMA 4B7KA 2LGQA 4NXNB 3WB0A 3H01A 4Z1MG 2AHYA 4WF9V 1GTOA 4O2BA 3STZC 1NVPD 1Q82W 1GO3F 1NU1H 4OPAA 1ZX3A 2YSUB 5LP6B 4J7JA 1K3EA 4OPHA 3SPHA 4PA9A 1J95A 1O9GA 1XILA 2LW1A 3UCSC 2CTPA 2ADQB 3AK1A 2Q0AA 1VF6A 2P67A 4NKGB 3CHXA 2Y48A 4FPPA 4KHPO 3NR7A 4X1YB 2OCCC 4GZRB 4LC1A 4BIOA 4DXWA 4G2KA 2QWRB 5KUKA 4I55B 4W4KA 1SA0B 5ITZB 3UQ8A 2MW2B 1MMMA 3OGCC 3OMNB 1TAEA 3KG2A 4Z2WA 5FL7G 1OCCB 4HNAB 4FLUA 5F2VO 5LA6B 3ZJZA 3CJHA 3ASOB 2JEXA 1M57B 2HJFC 3B8MA 2R70A 4ABMA 1YJNV 3ZRWA 3CXCU 1R1BA 2OWOA 4KUMA 2QJ1A 3ABMB 4JI6B 3FAVA 4TV9B 1XNQB
chains in the Genus database with same CATH topology
1S5HC 2IU3A 4MTOA 4MVSA 4JYCA 1H8HG 1RPOA 4MTXA 4PDLA 3T4DA 5CBFA 1GMGA 1YJ9V 2XAHA 2OTJV 3LDCA 2C2AA 5H9CA 3T2MA 1HWYA 2CK3G 1QVFU 2GSMB 1PNMA 5B1OA 1AI4A 1F51A 4JPRA 3BY6A 4QE9A 3OR7C 5H6RA 3WFVA 2JIZG 5L3GA 1OCRB 2ZXWC 1PL0A 2DYRB 3G71V 3MD0A 4XBFA 1YJWV 1JX9A 4CBCA 1VQ7V 3P30A 4N23A 4RAIA 2AHZA 1F4MA 1M56C 3G6EV 1JQ0A 3AEIA 2EIKB 1R3LC 4U7OA 3RVZA 3CCJV 1AJNA 3LSSA 4X8AA 4FIPC 2OTLV 5KA5A 3CC2V 2QEXV 4P2ZA 1V55C 3JYCA 4PDVA 3ABKC 3GWOA 4TT3G 4GX0A 1VQ4V 2Q69A 4LBEC 2A9HA 4JYBA 5B1AC 1P7BA 2XAFA 4XDKA 4L87A 1R73A 2F43G 3OR6C 3QO8A 4JF3A 1G8MA 1W0KG 1OCOB 2DW4A 2HR3A 2V1DA 2UXNA 1AJPA 1WLEA 3ZMVA 1YTFD 3QNEA 1VQOV 4WFFA 3ZRWB 3M99B 1YTFB 3K06A 4MTGA 2Y69B 4UUJC 1QR9A 5LHHA 1R3JC 4U7NA 4UV8A 2JK5C 1W0JG 4P9OA 1DTOA 4UV9A 3D36A 3DGEA 4QIWF 1I5XA 3ZRVA 3PJSK 3UM7A 1QBZA 2IJIA 3CCLV 3FKSG 5BZBA 4WFBV 3ABKB 4JAVA 4DO2A 1ZWIC 2HLDG 2EINC 2EIJC 3FB8C 1L1FA 1K5SA 4XDJA 1THZA 5LGTA 4GX2A 1K34A 4JTDB 1WPXA 1K97A 3AG2B 5L3BA 4UVAA 5CMUA 1KQSU 1Q81W 1IXMA 3CCMV 2EIMC 3FB7C 3B77A 4LCUC 1ROPA 3ABLC 2DWDC 2B1IA 3ASNC 1QR8A 4KFMA 2Q6AA 3ABLB 3MHSC 3RW0A 3EHBB 1K73W 3OW2U 4MVRA 1GKFA 2ITDC 3TK1A 2WSSG 3ZMTA 4H33A 2P7TC 4KP4A 3AG2C 1NBMG 3EFFK 1MOFA 5L3FA 2IH1C 2EINB 3CC4V 1E1QG 3ZN1A 1Q7YW 1JJ2U 1Y66A 3CCRV 1QVGU 4R6ZA 4MT8A 3CCVV 3CC7V 2WAMA 4E2LA 2ZR2A 2WLKA 4ZKIA 1AJQA 1YHQV 1FS0G 5EBLC 2A0LA 1DLBA 3WG7C 3ASOC 1K8AW 3E83A 5CBGA 2HFEC 1CPYA 1GM9A 1FFTB 2EJRA 3AG3B 3K0DA 1M1KW 1NR1A 3DTUB 5HFMA 3A0RA 3JD2A 1R3IC 4MVMA 3OAAG 1GM8A 1OCOC 2X0LA 2WWWA 2UXXA 1NVPB 1S3JA 4MVZA 2XAGA 1FXHA 2R9IA 3NXSA 1KP2A 1OCZB 1F23A 5H6QA 3VBBA 3ZIAG 4WFAV 3CCSV 1V54B 1BL8A 1V55B 1K5QA 4G28B 2FTKA 5IYCO 5EBMC 2EIKC 3OE7G 4GX5A 3BEHA 3K3WA 4GCZA 5CN0A 1PNLA 2HKOA 2EZPA 2QM8A 3AG1C 2EBOA 4JASA 5B1BC 3MHHC 2WLHA 1R6KA 1K4CC 2NNUA 4HAMA 1DF5A 2ZXWB 1YIJV 1OCRC 1VQPV 2QA4V 1M90W 2A79B 3ZMUA 4UVCA 2XOKG 2B1GA 3E35A 2WLLB 3D3IA 1QCEA 5C93A 2YEVB 3E8BA 2Z3YA 3LDDA 4QJFB 3IFXA 3ZRXA 1XL4A 2IJJA 1NH2B 1KC8W 3UKMA 2Z5UA 1K9MW 3ZCCA 1AI6A 4PA6A 3E2EA 3T1CA 1RM1C 2Q68A 1M9NA 4MTFA 2K1EA 3ABMC 3LNMB 2ITCC 3JD3A 2IU0A 1R6NA 2XAQA 1QLEC 4ASUG 1JPXA 3OMIB 5B1NA 3I55V 3SPJA 5L3DA 5CBHA 4PA3A 5KUMA 1OHHG 3W7SA 1VQ6V 3HB3B 1M57C 2IJKA 2DWEC 5IYBO 5J9PC 5LGNA 4QPKA 4R50A 1PKXA 5HFLA 3IGAC 1G4YB 3ETEA 4BW5A 2D3OW 4MVUA 1FXVA 3K9AA 3W7XA 4XDLA 1MABG 4FK5C 1OCCC 2XNDG 2X6AA 1OCZC 1H8EG 4P30A 4WFGA 2ZDIC 3K0GA 1VQ5V 3OFNG 2LFSA 1P4RA 3SJQC 2EILC 2QM7A 4X89A 4QNHB 5L3EA 3R65A 3ZMSA 2LFRA 3ETGA 2XASA 4FMTA 3X2QB 2OCCB 1CP9A 1VQKV 3B8NA 5B3SC 1E79G 1Y4MA 3E8FA 4RO2A 1NH2D 1B6QA 2NLJC 2GHYA 2DQ0A 1ENVA 2JJ1G 2MK3A 1AI5A 2QE7G 4PA4A 2X7RB 5E1AC 1BMFG 1NR7A 3GB7C 5EBWC 4RUEA 2JEUA 2PI4A 4P9PA 3OUSA 3T4ZA 2OT5A 2IJHA 1KD1W 5DM6V 1NQTA 1Q86W 2H8PC 3ABUA 2W0FC 1KP3A 1QLEB 4BAYA 2WPDG 2V7QG 4FJCC 1KECA 3E8HA 4JGSA 3ML0A 4MVOA 1VQLV 3QO5A 3ZN0A 1MG1A 1VQMV 2KB1A 1RM1B 2X6CA 2HG5C 3K79A 1RPRA 1QLNA 1W2BU 3JD0A 3AG4C 3CCUV 1AROP 3I56V 4EKWA 5DN6G 4WCEV 4PDRA 1S76D 3SPIA 3TCUA 2WLIA 2M7WA 2JJ2G 1EBOA 3FYEB 2HVKC 4MW8A 3AG4B 3P32A 1FXKB 1AI7A 3OEEG 3LUTB 4UXNA 3G4SV 1I5YA 2PI5A 3TETA 1SRYA 3LSQA 5EC1C 4JTCB 4X88A 3HPLC 2EIMB 3AG1B 1AR1B 1YI2V 3RVYA 2B5UA 3STLC 3F7VC 4MVQA 1BHBA 1GM7A 1VQNV 3SYAA 2XAJA 3CPWU 4BIZA 2EIJB 1K7DA 1CEZA 3OM3B 3QO7A 1UJWB 4I9WA 5CA3A 2DYSB 1FXKA 3W7TA 3W7WA 1OZ0A 2ZR3A 4PA7A 1JCHA 4PELA 1BHAA 1K92A 3OMAB 4RQFA 3RBZA 3JD4A 2WLNA 4TSFG 4WFHA 4QE7A 2QKSA 2EILB 2ZD9A 2Y69C 3JD1A 4GT1A 2W6IG 3LDEA 3E86A 4RUFA 3OEHG 5LHGA 1VQ9V 1K4DC 2P6JA 5IYDO 4R7CA 2DYSC 5GW7A 3SPCA 3WG7B 4R8CA 4ZBMA 1SZTA 3ZRSA 1COWG 1EFRG 1K33A 3K08A 3FYIB 2IH3C 2R9RB 4HZ3A 4MS2A 4WFEA 3SPGA 2BOBC 3CP1A 1GK9A 1S0VA 3E89A 1NJIW 3E8GA 1ORQC 5L3CA 4HYOA 4QPJA 2YEVA 1SETA 1FXKC 5LBQA 2ZDIA 2WLMA 4LP8A 1VQ8V 3SYPA 3ZMZA 1M56B 3F5WC 3H01A 4JAUA 4OXSA 3ETDA 3JCZA 1YSCA 4Z1MG 2AHYA 1TUEB 4JTAB 4WF9V 1GTOA 2DYRC 3STZC 3F7YC 1NVPD 1Q82W 1GO3F 5KA6A 3ASNB 3CMEV 1H38A 1R3KC 3CCQV 2YSUB 5LGUA 1MSWD 2HVJC 4UVBA 1N8RW 1EZJA 1E1RG 1LNQA 1K3EA 4TWKA 4GX1A 3SPHA 2WLLA 4PA9A 2ZQMA 1J95A 5B1BB 1S72V 4N21A 2LP7A 5LHIA 2EZOA 4J9YB 3OUFA 2W6JG 3K03A 2Q67A 1KKDA 5IDJA 1F4NA 3W7UA 3SYQA 2P67A 4MSWC 2Y48A 1SESA 4FPPA 3K04A 1V54C 4I5SA 3CMAV 1H2GA 5B3SB 5IY5B 2OCCC 3CCEV 3X2QC 4RQEA 4LC1A 1S77D 4DXWA 1JOYA 4G2KA 5KUKA 4CZZA 2BOCC 2X6BA 3VOUA 1DF4A 1SERA 2P90A 5EK0A 1YITV 3OGCC 3FB5C 3OMNB 1JVMA 4F4LA 3KG2A 5FL7G 1OCCB 1PNKA 4J9ZB 4BIUA 3AG3C 2JDIG 3IC7A 3ZJZA 1NKDA 3ASOB 2JEXA 3CD6V 1M57B 2HJFC 3B8MA 5EC2C 4YXWG 4H37A 1XL6A 5B1AB 1YJNV 2DQ3A 4G27B 2ATKC 3SYCA 3SYOA 3ZRWA 3CXCU 2WLIB 4KUMA 2QTOA 3CYOA 4Q20A 3FB6C 5IY5C 4PDMA 3ABMB 2H94A 2WLJA 2IW5A 1PD3A 3ABTA 4MW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5H C;  4MTO A;  4BW5 A;  3IGA C;  1G4Y B;  1K4D C;  3AG2 C;  4MVS A;  4MVU A;  4PDL A;  4R7C A;  2DYS C;  3T4D A;  5CBF A;  3SPC A;  4XDL A;  3EFF K;  4R8C A;  4ZBM A;  3LDC A;  1OCC C;  3ZRS A;  2X6A A;  1OCZ C;  2IH1 C;  4WFG A;  4P30 A;  3T2M A;  3K08 A;  3K0G A;  2IH3 C;  2R9R B;  4R6Z A;  3SJQ C;  2EIL C;  4HZ3 A;  4MS2 A;  4WFE A;  4X89 A;  2BOB C;  3SPG A;  4QE9 A;  4QNH B;  3OR7 C;  3E89 A;  3R65 A;  2ZXW C;  3E8G A;  1ORQ C;  2WLK A;  4HYO A;  2YEV A;  5EBL C;  4CBC A;  2WLM A;  5B3S C;  2A0L A;  3E8F A;  3ASO C;  4RO2 A;  4LP8 A;  3WG7 C;  4RAI A;  2AHZ A;  2NLJ C;  3E83 A;  3SYP A;  5CBG A;  1M56 C;  2HFE C;  3K0D A;  1R3L C;  4PA4 A;  5E1A C;  3RVZ A;  4X8A A;  3F5W C;  3GB7 C;  5EBW C;  4RUE A;  4P9P A;  3OUS A;  4P2Z A;  4OXS A;  3T4Z A;  1V55 C;  1R3I C;  3JYC A;  3ABK C;  4MVM A;  4PDV A;  2AHY A;  4GX0 A;  4JTA B;  2Q69 A;  2DYR C;  4LBE C;  3STZ C;  3F7Y C;  1OCO C;  2H8P C;  2W0F C;  2A9H A;  1R3K C;  3E8H A;  5B1A C;  2HVJ C;  4MVO A;  4RUF A;  1P7B A;  4XDK A;  4MVZ A;  2KB1 A;  1LNQ A;  4TWK A;  2X6C A;  4GX1 A;  2HG5 C;  3SPH A;  3OR6 C;  2WLL A;  4PA9 A;  1J95 A;  3AG4 C;  1BL8 A;  4J9Y B;  4EKW A;  3OUF A;  3K03 A;  2Q67 A;  4PDR A;  1KKD A;  4G28 B;  4WFF A;  3SPI A;  3TCU A;  3SYQ A;  2WLI A;  5EBM C;  4MSW C;  2EIK C;  4GX5 A;  3BEH A;  3K06 A;  4MTG A;  4UUJ C;  3K04 A;  1V54 C;  2HVK C;  4MW8 A;  1R3J C;  3AG1 C;  2JK5 C;  4P9O A;  2OCC C;  5B1B C;  2WLH A;  3LUT B;  3X2Q C;  1K4C C;  4DXW A;  3TET A;  5EC1 C;  5KUK A;  4JTC B;  3PJS K;  3HPL C;  4X88 A;  1OCR C;  3UM7 A;  2BOC C;  2X6B A;  3RVY A;  3VOU A;  2A79 B;  3STL C;  3F7V C;  4MVQ A;  2WLL B;  5EK0 A;  3SYA A;  3OGC C;  3E8B A;  3FB5 C;  3LDD A;  5BZB A;  1JVM A;  1ZWI C;  4F4L A;  2EIN C;  2EIJ C;  3KG2 A;  3FB8 C;  3IFX A;  4XDJ A;  1XL4 A;  4GX2 A;  4J9Z B;  4I9W A;  4JTD B;  3AG3 C;  3UKM A;  3ZJZ A;  4PA7 A;  4PA6 A;  3T1C A;  2Q68 A;  4MTF A;  2HJF C;  2EIM C;  5EC2 C;  2K1E A;  3ABM C;  3FB7 C;  1XL6 A;  4H37 A;  3LNM B;  2ITC C;  4LCU C;  4G27 B;  2ATK C;  3SYC A;  1QLE C;  3RBZ A;  3ABL C;  2DWD C;  2WLI B;  3ASN C;  3SYO A;  3SPJ A;  2WLN A;  4KFM A;  2QTO A;  2Q6A A;  3FB6 C;  4PA3 A;  4R50 A;  4WFH A;  4QE7 A;  5KUM A;  2QKS A;  3RW0 A;  5CBH A;  5IY5 C;  4PDM A;  2ZD9 A;  4MVR A;  2ITD C;  2WLJ A;  2Y69 C;  1M57 C;  2DWE C;  5J9P C;  3LDE A;  3E86 A;  4H33 A;  4MW3 A;  2P7T C; 
#chains in the Genus database with same CATH topology
 1XEQ A;  3CRM A;  3T4D A;  4YY3 O;  5CBF A;  4DR2 B;  4GKJ B;  2OTJ V;  3T2M A;  4LF8 B;  1IXB A;  1QVF U;  3C3S A;  1PNM A;  1N34 B;  1AI4 A;  1WPB A;  4JPR A;  1XMO B;  1BZK A;  2JIZ G;  5L3G A;  4AQY O;  1PL0 A;  2DYR B;  4BR6 A;  4XBF A;  3U10 A;  1JX9 A;  2AHZ A;  1M56 C;  4LF5 O;  1KB9 F;  3AEI A;  1R3L C;  3RVZ A;  4X8A A;  5KHH A;  1SQF A;  5KA5 A;  4PDV A;  3JYC A;  4LF4 B;  3GWO A;  1VQ4 V;  3SJB C;  1XI1 A;  1I94 B;  4IYH A;  5IYZ B;  1P7B A;  4I4T A;  2F43 G;  3DC6 A;  1GAX A;  2HEP A;  3OR6 C;  3QO8 A;  4O4H B;  1OCO B;  1KBH A;  2V1D A;  2ZIN A;  3B40 A;  4LF7 B;  4I4T B;  3QNE A;  5KMG B;  4ZI7 A;  1VQO V;  1JFF A;  5B66 Z;  2YIC A;  2O57 A;  2GUZ A;  1YTF B;  3K06 A;  4MTG A;  1QR9 A;  4U7N A;  4FLW A;  4UV8 A;  4P9O A;  1DTO A;  2UUB B;  4JI0 O;  2GDS A;  3N2K A;  4ZOL A;  4QIW F;  2E5L O;  3ZRV A;  1GN3 A;  2YI9 A;  4PJ0 Z;  1QBZ A;  1Q6I A;  1H2M A;  4WFB V;  4J42 A;  1M5I A;  1VF7 A;  2EIN C;  4I50 A;  3FB8 C;  1WPX A;  3K5O A;  3OT7 A;  1Q81 W;  1N32 O;  1QR8 A;  4KFM A;  1K73 W;  1Q6U A;  1XOU A;  4TV9 A;  1WJZ A;  2HJD A;  5JQG A;  4KP4 A;  1RSO B;  4O4J A;  3TXQ A;  4LH7 A;  1NBM G;  4U3J A;  1FPO A;  5FLX N;  3ZX6 A;  3SDL A;  1QVG U;  3IC9 A;  1Z5V A;  1IVS A;  2L6L A;  2WAM A;  1FD9 A;  2AXT Z;  5IWA B;  1AJQ A;  5GTH Z;  1DLB A;  3WG7 C;  3E83 A;  5CBG A;  4GKJ O;  1GM9 A;  2CTQ A;  1NR1 A;  4NTX A;  3JD2 A;  4F6E A;  2E3C A;  2ZNI A;  4DUZ O;  1GM8 A;  1IBM O;  4AQY B;  2X0L A;  2WWW A;  4O4J B;  1U96 A;  3FFQ A;  2XAG A;  4I7Z B;  1Q90 D;  2R72 A;  1F23 A;  5H6Q A;  3VBB A;  1NT2 B;  3CSX A;  4DV4 B;  1V54 B;  1W59 A;  1BL8 A;  1FYJ A;  3H1L H;  4GCZ A;  2HKO A;  2EZP A;  2QM8 A;  3G6B A;  5J2U A;  5B1B C;  1GRJ A;  1K4C C;  4X1I B;  4FFB A;  1OCR C;  2CTR A;  1VQP V;  3GVM A;  1OJH A;  2Q7E A;  2YEV B;  2Z3Y A;  3CE2 A;  1M4U A;  4QJF B;  3IFX A;  5IWA O;  4FLV A;  4JZG A;  4X1Y A;  3N2K B;  2OCH A;  3EXA A;  4NR1 A;  4ASU G;  1LUW A;  1R6N A;  2XAQ A;  5B1N A;  5JQG B;  1TA8 A;  4JI5 B;  3W7S A;  2UUA O;  3T1Y B;  2F95 B;  3D36 C;  5LGN A;  4QPK A;  1PKX A;  3IGA C;  1I0H A;  1T5E A;  5CB4 B;  4FK5 C;  2XND G;  2X6A A;  1OCZ C;  1H8E G;  3OTO O;  2A06 H;  2OIE A;  1P4R A;  4X89 A;  5J2T B;  5L3E A;  3R65 A;  3SR2 C;  1Q5O A;  3ETG A;  2HP8 A;  4FMT A;  1CP9 A;  5B3S C;  1E79 G;  4RO2 A;  2NLJ C;  2EUL A;  4FLX A;  1ENV A;  2QE7 G;  5EBW C;  5LMU O;  2JEU A;  4P9P A;  1VF5 B;  4I0X A;  2JGU A;  1HNX B;  1KD1 W;  4KHP B;  3S3W A;  3ABU A;  2W0F C;  1QLE B;  4BAY A;  5EIB C;  4JGS A;  1VQL V;  3RYI B;  3ZN0 A;  1IBK B;  3K79 A;  1RPR A;  2ZCE A;  3B4S A;  4CS3 A;  3I56 V;  4WCE V;  1NTK H;  4YJ3 B;  3JAK B;  1X4T A;  4J10 A;  3THO A;  4EFB A;  4JI8 O;  5K1P A;  2HVK C;  4IHJ A;  4DR3 O;  3LUT B;  4UXN A;  1I5Y A;  4JTC B;  1GN2 A;  3AG1 B;  2AZ0 A;  2B5U A;  5ITZ A;  1GM7 A;  1IZ3 A;  1SA0 A;  4FFB B;  3A0H Z;  1K7D A;  4CH6 A;  5CA3 A;  1FXK A;  3W7T A;  4DV3 B;  1OZ0 A;  1XMQ O;  4JI2 O;  4LF9 B;  1GN4 A;  3JD4 A;  5LMN B;  1RSO A;  1XHX A;  1X59 A;  1H2K A;  4GT1 A;  3E86 A;  1L8D A;  1KUQ A;  1K4D C;  3OTF A;  4B08 A;  4W4L A;  1IBL B;  1EFR G;  3K08 A;  4O2B B;  5JWP A;  4QGP A;  4Z1V A;  2XHB A;  3TXS A;  2VWK A;  3E89 A;  1UPG A;  2FL4 A;  4F6R A;  2EX3 A;  2AZ2 A;  1YZB A;  1VQ8 V;  3SYP A;  3ZMZ A;  4TQD A;  1HR0 O;  2PYJ A;  1B04 A;  3JCZ A;  1YSC A;  1TUE B;  3VQY A;  3F7Y C;  1VAR A;  3AG7 A;  5KA6 A;  5CA1 B;  1XNQ O;  2VRZ A;  3CME V;  1H38 A;  1N8R W;  1WN7 A;  4DV3 O;  2UXC B;  1YCI A;  2WLL A;  5B1B B;  5BMV A;  4LF9 O;  4K8X A;  4YJ2 A;  2W6J G;  3K03 A;  2Q67 A;  5LMU B;  1KKD A;  5IDJ A;  3TGU H;  1F4N A;  3W7U A;  3SYQ A;  2HHH B;  1SES A;  1V54 C;  4YIP A;  3CMA V;  4LNU B;  1JJO A;  5IY5 B;  1WB8 A;  3RWR D;  1ZUQ A;  3X2Q C;  4DR4 B;  3APQ A;  1JOY A;  3QTC A;  4U3F H;  5LXT B;  5H5N A;  2N74 A;  3AK2 A;  3CXH F;  1EZV H;  2P90 A;  5D5P A;  3E22 B;  3FB5 C;  4GUN A;  4F4L A;  5J2T A;  3N2G B;  1TGO A;  4JI8 B;  4J9Z B;  2A7W A;  2JDI G;  4LF6 B;  3CD6 V;  3P3P A;  2YXH A;  5CB4 A;  1XL6 A;  4G27 B;  1VMG A;  2WLI B;  3FB6 C;  5IY5 C;  4PV1 B;  1KKC A;  5IJ9 B;  4MW3 A;  4MTO A;  4MTX A;  1H8H G;  1RPO A;  4PDL A;  2UXC O;  1YJ9 V;  3DSQ A;  2XAH A;  3ZHR A;  2CK3 G;  4ICG A;  2ZKO A;  1BQZ A;  5EZY B;  3HKE A;  4FM1 A;  4CH5 A;  1SQV H;  1H2S B;  3GWK C;  1URF A;  3OR7 C;  3N27 A;  4FZ0 A;  1QHT A;  3SGI A;  1H2L A;  1VQ7 V;  4JI7 B;  3G6E V;  2EIK B;  1EN6 A;  3LSS A;  2OTL V;  3EVK A;  3RYF B;  3S3X A;  3H1K H;  4TT3 G;  4GX0 A;  2YIA A;  4JYB A;  5B1A C;  3B09 A;  1PV0 A;  1UFI A;  3FD9 A;  4JF3 A;  2DW4 A;  2UXN A;  1AJP A;  4KXR A;  1WLE A;  4DR7 B;  2GTS A;  1BE3 H;  3ZRW B;  2KG7 B;  1Y74 B;  3H1I H;  1SQX H;  3CJH B;  1R3J C;  1W0J G;  1VEW A;  4UV9 A;  3D36 A;  3DGE A;  1I5X A;  5IJ0 B;  2PTM A;  2IJI A;  2LO1 A;  1NS1 A;  3FKS G;  5BMV B;  5BZB A;  4DO2 A;  1ZWI C;  4I55 A;  1K5S A;  3LNN A;  2HHH O;  4GX2 A;  2JS5 A;  2Y0P A;  1K97 A;  2N04 A;  4UVA A;  1NZ6 A;  3OTO B;  4FZ1 A;  2UXB O;  1ROP A;  1FJG O;  1VP7 A;  3ASN C;  1MZF A;  2YC0 A;  3ABL B;  1IUR A;  3MHS C;  3OW2 U;  4MVR A;  2ITD C;  4O2A A;  4JV5 O;  1SS3 A;  2PUS A;  2P7T C;  3HKC A;  2BTQ B;  3AG2 C;  5L3F A;  2IH1 C;  3HKB A;  3CC4 V;  1E1Q G;  4DRX A;  1NTM H;  3CCR V;  3CC7 V;  2ZR2 A;  2ZIM A;  1HNZ B;  3CRC A;  1YHQ V;  4LFA B;  3ASO C;  1RP3 B;  1N33 B;  1NI8 A;  2HFE C;  2EJR A;  5B5E Z;  1VIB A;  1N4C A;  2QKC A;  4X20 B;  5CA1 A;  1M1K W;  3A0R A;  4MVM A;  3HR0 A;  3OAA G;  1Q6H A;  1XNR B;  2GUZ B;  4TV8 A;  2YUA A;  5A2Q N;  4B3T B;  2NN4 A;  1NVP B;  1S3J A;  2R9I A;  3ZED A;  1OCZ B;  5AG2 A;  3ZIA G;  1V55 B;  1K5Q A;  5IE9 A;  2FTK A;  5IYC O;  4L8J A;  2CGN A;  4DV1 O;  1PNL A;  3HKE B;  2G38 A;  2Y0I A;  4JYY A;  2QR4 A;  2EBO A;  3MHH C;  2WLH A;  3TJT A;  4HAM A;  1SQQ H;  4E4E A;  1NTZ H;  2W0X A;  4X62 O;  2ZXW B;  3JAT A;  1YIJ V;  1M90 W;  1IDS A;  4UVC A;  5GON B;  5IJ9 A;  3D3I A;  5H2F Z;  2Y4U A;  4X64 B;  1G1X B;  5C93 A;  3LDD A;  1ZL8 A;  3RYI A;  3ZRX A;  2YDE A;  3UKM A;  2Z5U A;  1WAZ A;  1AI6 A;  3E2E A;  5LYJ A;  2Q68 A;  3BRC A;  1SQP H;  2YIB D;  3JD3 A;  2IU0 A;  4ZHQ A;  5JCO A;  3K59 A;  4PA3 A;  4DUZ B;  3A8T A;  3HB3 B;  4X65 B;  1Q43 A;  2IJK A;  4K0K B;  5HFL A;  2ZNJ A;  1G4Y B;  2D3O W;  3VQX A;  1FXV A;  1DK1 A;  3K9A A;  1MAB G;  2CE4 A;  3CRR A;  4IHJ B;  2E76 B;  3K0G A;  1VQ5 V;  2LFS A;  3CS5 A;  3SJQ C;  1O9H A;  2QM7 A;  4BW9 A;  3JAM N;  4YJ3 A;  2LFR A;  5LOV A;  3U11 A;  2XAS A;  4J7Z A;  2UU9 B;  4D6T H;  3E8F A;  5EIB D;  1ZLZ A;  1XMQ B;  2DQ0 A;  2JJ1 G;  2LW7 A;  2MK3 A;  1AI5 A;  5E1A C;  2X7R B;  1NR7 A;  3GB7 C;  2PI4 A;  4RUE A;  3T4Z A;  4DK1 A;  2OT5 A;  2CH7 B;  2H8P C;  3BFR A;  2ZM6 O;  2WPD G;  2V7Q G;  4FJC C;  4NXM O;  2PZS A;  3QO5 A;  1VQM V;  2KB1 A;  1RM1 B;  2DN9 A;  2X6C A;  4TQF A;  3KZI Z;  1QLN A;  3JD0 A;  4K3A A;  4PDR A;  1P49 A;  1I7F A;  4IIJ A;  3G67 A;  3FYE B;  2H3O A;  5FPO A;  4DV2 B;  4X66 B;  3P32 A;  1OV9 A;  3OEE G;  3G4S V;  2PI5 A;  2BCC H;  1SRY A;  3LSQ A;  4X88 A;  4YJ2 B;  4MVQ A;  2XAJ A;  3MDS A;  1D5N A;  1AP5 A;  4I9W A;  1LR1 A;  2DYS B;  3K57 A;  2D2C B;  3M7M X;  5LYJ B;  3K5M A;  4NTY A;  2P5O A;  1BHA A;  4JAA A;  1WA8 A;  3RBZ A;  2WLN A;  1CXZ B;  4QE7 A;  2QKS A;  2Q8V A;  2ZM6 B;  2VWJ A;  2W6I G;  3D3Q A;  3LDE A;  3OEH G;  5LOV B;  4DW0 A;  5IJ0 A;  2P6J A;  5IYD O;  3JAT B;  2DYS C;  3SPC A;  2ZE8 A;  2NR5 A;  1WB7 A;  4ZBM A;  1SZT A;  1GH6 A;  2LJ2 A;  5J2U B;  4DR5 O;  4B3S O;  2R9R B;  4AHC A;  1Y74 A;  4MS2 A;  1S0V A;  4LFC O;  3JAK A;  3QG5 A;  4X65 O;  5L3C A;  4OGQ B;  1SET A;  2OYQ A;  3RT3 C;  4B3R O;  3L72 H;  1M56 B;  2UUC B;  3F5W C;  2QM4 A;  5JVD B;  4OXS A;  3ETD A;  5CA0 A;  5KX5 B;  2DYR C;  3KCX A;  3J7A U;  4EB6 B;  1TUB A;  1R3K C;  5FPR A;  4X20 A;  4DUY O;  4OX9 B;  2QWN B;  1LNQ A;  4LH6 A;  4GX1 A;  3H1H H;  3ZHV A;  1MSD A;  2YXY A;  2N05 A;  2EZO A;  2BSK A;  2EJ7 A;  4UCU A;  4BWA A;  4DW1 A;  1FAF A;  4MSW C;  2P06 A;  2P4K A;  3K04 A;  1EM1 A;  1H2G A;  4DRX B;  5JH7 B;  1S77 D;  4CZZ A;  2BOC C;  4WBN A;  3ZS8 C;  1DF4 A;  5EK0 A;  1YIT V;  4FM2 A;  4AIL C;  1MA1 A;  1JVM A;  4DV7 B;  4WBN B;  4BIU A;  4J41 A;  3RFR A;  3IC7 A;  2Q4P A;  4UCV A;  4NXN O;  2DQ3 A;  3L74 H;  3SYC A;  3SYO A;  1US6 A;  3C3T A;  5EYP A;  1D5A A;  4LF7 O;  4Q20 A;  1Y6X A;  2GTA A;  1IX9 A;  2H94 A;  3K5L A;  2IW5 A;  1HNZ O;  4IGG A;  1S5H C;  2IU3 A;  3L73 H;  4JYC A;  3ZHQ A;  1HWY A;  4JI2 B;  3FX7 A;  4J80 A;  3DXR A;  5KX5 A;  2QSA A;  5B1O A;  4GKK O;  3BY6 A;  4QE9 A;  5H6R A;  3WFV A;  4ZI7 B;  2ZXW C;  4FLT A;  2GBO A;  3G71 V;  1S5J A;  3MD0 A;  4B3T O;  4IT5 A;  3FAV B;  4LFB B;  4RAI A;  4DR1 O;  3IJ4 A;  1HNW B;  4U7O A;  2CDY A;  1N32 B;  3CC2 V;  4P2Z A;  2Z0A A;  1V55 C;  4K8Z A;  5K1X A;  3LSU A;  1HP8 A;  4JV5 B;  1Z2G A;  1LUV A;  4D7T A;  3CWB H;  4K35 A;  4XDK A;  3B2E E;  3CX5 F;  1R73 A;  1BS3 A;  1WP7 A;  1G8M A;  2HR3 A;  1U97 A;  4DV6 O;  3SJA C;  5KHJ A;  1J5E O;  1WA8 B;  4UUJ C;  5LHH A;  4YIO A;  2JK5 C;  4YY3 B;  4DUY B;  4A5U B;  2Q9L A;  3PJS K;  3UM7 A;  2PF4 E;  3CCL V;  3BAA A;  2A3Q A;  2UUA B;  3ABK B;  4JAV A;  2HLD G;  2EIJ C;  1L1F A;  5BR8 B;  4JTD B;  3AG2 B;  5CMU A;  3UO2 A;  1KQS U;  3CCM V;  2EIM C;  3JAW A;  3JSN A;  3FB7 C;  2QWQ B;  4LCU C;  2RN9 A;  3ABL C;  2DWD C;  2F1M A;  4TUY B;  4J7K A;  1SC5 B;  1B06 A;  1GKF A;  3ZMT A;  4C7U A;  4H33 A;  1HDJ A;  2AGA A;  1MOF A;  3RN4 A;  3ZN1 A;  1JJ2 U;  1Y66 A;  4R6Z A;  2JGD B;  4MT8 A;  2RMK B;  1S5L Z;  1Z5W A;  1JFF B;  2WLK A;  4ZKI A;  3O9O A;  4JI1 B;  1FS0 G;  2A0L A;  2UXD B;  1I08 A;  1EN4 A;  3ICX A;  3BA9 A;  1CPY A;  3K0D A;  3AG3 B;  1ZSP A;  4YHH O;  3U0Z A;  5HFM A;  1TVK B;  2WA4 A;  1FKA O;  4MVZ A;  1KP2 A;  4LFB O;  4JI7 O;  3QF7 A;  3OD4 A;  3CCS V;  4F6R B;  1PL4 A;  1Y67 A;  2Q7H A;  2RJZ A;  4FM0 A;  3UT5 A;  3RYC A;  4G28 B;  4TUY A;  5EBM C;  2F4V B;  2EIK C;  5CN0 A;  5JJE B;  1BGY H;  4JAS A;  1R6K A;  3SJC C;  4EFE A;  3H1J H;  1ZL8 B;  2QA4 V;  5DEC A;  2FB5 A;  3ZMU A;  1FFX B;  4J11 A;  2WLL B;  5GTI Z;  3H9V A;  5KLV H;  4JYA B;  3E8B A;  1HNX O;  2KKW A;  3L75 H;  1L0N H;  1XL4 A;  1KC8 W;  4NXM B;  2VS0 A;  3ZCC A;  1JMK C;  5C8Y A;  2ETN A;  1RM1 C;  1M9N A;  2K1E A;  1QU7 A;  2ITC C;  5LL6 Y;  1JPX A;  3CRQ A;  3OMI B;  3RYH B;  3SPJ A;  1XDC A;  1WNS A;  5L3D A;  3D8C A;  1XBL A;  1OHH G;  1VQ6 V;  2M6Y A;  3JAR B;  3PN1 A;  2RDC A;  2DWE C;  5IYB O;  3ETE A;  1BCC H;  4X1I A;  4MVU A;  1TUB B;  3W7X A;  3JAL B;  4CC5 A;  3KKY A;  5BXZ A;  4WFG A;  4P30 A;  4PI0 A;  5C8Y B;  5JVD A;  4CH4 A;  1XRE A;  2EIL C;  4QNH B;  4U3J B;  3ZHS A;  3ZMS A;  1G6U A;  3L71 H;  3WB2 A;  4DV1 B;  3JCU Z;  3X2Q B;  4D7S A;  5TIS Z;  4LR3 A;  1VQK V;  4Q6G A;  3B8N A;  1Y4M A;  3WB1 A;  4JI3 B;  2GHY A;  4UB6 Z;  4PA4 A;  2YI8 A;  3J81 N;  5KHG A;  2FYU H;  3OUS A;  3Q4H A;  4JYA O;  4X64 O;  2LQT A;  1B3Q A;  2IJH A;  4O4L B;  2DMX A;  5DM6 V;  1NQT A;  4DR6 O;  1Q86 W;  3CB2 A;  3JAL A;  1KP3 A;  4JZ2 A;  2IBZ H;  1KEC A;  3E8H A;  1H2N A;  3K9S A;  3F5T A;  4DR4 O;  3UT5 B;  3RYC B;  1QNM A;  4HBN A;  1N33 O;  1SQG A;  1W2B U;  1IBL O;  3AG4 C;  1AIL A;  3CCU V;  2CTW A;  2QWP B;  3SPI A;  3BHP A;  1Q8I A;  5EYP B;  4ZOL B;  2JJ2 G;  3AG4 B;  3AK3 A;  4AI8 A;  2YS8 A;  1AI7 A;  1KU9 A;  1A32 A;  4O4I A;  2UUC O;  1AR1 B;  4X1K A;  1KYO F;  3RVY A;  3F7V C;  4DYL A;  1BHB A;  1FFX A;  5A9G A;  4FLZ A;  1N0N A;  4O4H A;  2F4V O;  5IYZ A;  1CEZ A;  3OM3 B;  2E75 B;  4I9Q A;  5JH7 A;  2JGD A;  3HKD B;  3DXR B;  1JCH A;  2QKA A;  4PEL A;  3CEI A;  4IIJ B;  1K92 A;  4RQF A;  2RNB A;  4TSF G;  4DV0 B;  4DV5 B;  1PM9 A;  2BSK B;  2EIL B;  2Y69 C;  5KAF Z;  3J80 N;  3OGI B;  4R7C A;  1AVM A;  3ZBH A;  4R8C A;  1HNW O;  2CH7 A;  1K33 A;  2JVD A;  1GN6 A;  2IH3 C;  4NYK A;  2JRI A;  4LF4 O;  3CP1 A;  1NJI W;  3T1Y O;  1BT8 A;  1I94 O;  4HYO A;  4DR3 B;  4LF6 O;  2RCV A;  1V9P A;  4X1K B;  4LP8 A;  1XHZ A;  2Q0O C;  2ZE6 A;  1BQ0 A;  2CAZ C;  4DR7 O;  4JAU A;  4JTA B;  1XUQ A;  3R66 A;  3ASN B;  2BE3 A;  1BSM A;  3CCQ V;  5LGU A;  1MSW D;  2HVJ C;  4UVB A;  2UUB O;  1EZJ A;  1E1R G;  2E5L B;  4TWK A;  5FNV A;  2ZQM A;  5E79 Z;  2L35 A;  1S72 V;  4N21 A;  2LP7 A;  5LHI A;  1AR5 A;  4J9Y B;  3OUF A;  1N34 O;  3KCY A;  5JCO C;  1F7Y A;  3L70 H;  4I5S A;  4O4L A;  3Q4H B;  4CS4 A;  5B3S B;  5DED A;  3CCE V;  1RFY A;  4RQE A;  1KMI Z;  2V4D A;  4DR5 B;  3N2G A;  1N36 B;  4PD4 F;  2X6B A;  2UXB B;  3VOU A;  4UCR A;  1SER A;  2VQF B;  1DGS A;  3QVN A;  1PNK A;  5LP6 A;  3AG3 C;  4NB5 A;  3CRA A;  2WA3 A;  1NKD A;  2Q7G A;  4LNU A;  5EC2 C;  3T1H B;  4YXW G;  4UB8 Z;  3BCC H;  4H37 A;  5B1A B;  3VQW A;  4GLX A;  2ATK C;  1P84 F;  2QTO A;  3CYO A;  1J5E B;  1VF6 C;  4PDM A;  1Y76 B;  2WLJ A;  1PD3 A;  4O2A B;  1AB3 A;  3ABT A;  3IAY A;  3RYH A;  4OX9 O;  4MVS A;  4JI0 B;  1GMG A;  5KAI Z;  3LDC A;  2C2A A;  5H9C A;  2AW9 A;  2F93 B;  2Q5Z A;  2GSM B;  2K9P A;  2CUG A;  1F51 A;  5LMN O;  4DV5 O;  1OCR B;  5KMG A;  1YJW V;  3VQV A;  4CBC A;  2ZIO A;  3P30 A;  4N23 A;  2R9A A;  1F4M A;  1N36 O;  1JQ0 A;  4B3S B;  3CCJ V;  1AJN A;  4FIP C;  1FJG B;  4FFK A;  2QEX V;  3ABK C;  3HKB B;  2Q69 A;  3ETQ A;  3JAS A;  4LBE C;  2A9H A;  4B7E A;  2IM9 A;  2XAF A;  4L87 A;  1W0K G;  3T1H O;  2XUM A;  2YID A;  3ZMV A;  3G80 A;  1YTF D;  4WFF A;  1YF2 A;  3P3N A;  4ZHQ B;  3M99 B;  4FVM A;  2Y69 B;  1TVK A;  5CA0 B;  1PPJ H;  3K58 A;  1SF9 A;  4PHZ A;  4IYI A;  4GKK B;  2E74 B;  3UO3 A;  2QDO A;  1IBM B;  4K0K O;  4XDJ A;  1THZ A;  5LGT A;  2ADP A;  1K34 A;  5KHK A;  5L3B A;  1D2D A;  5EZY A;  2KG7 A;  2FKX A;  1IXM A;  4LF5 B;  3B77 A;  5LA6 A;  2B1I A;  2Q6A A;  4KL1 A;  3RW0 A;  3EHB B;  3TK1 A;  2WSS G;  2UU9 O;  4FLY A;  4EB6 A;  4ZIB A;  3EFF K;  3JAW B;  3JSL A;  2EIN B;  4I0X B;  1Q7Y W;  3CCV V;  2ZE5 A;  4E2L A;  3I5D A;  4JI6 O;  1PP9 H;  2F66 C;  4UCO A;  5EBL C;  2YIB A;  1K8A W;  4DR2 O;  1QQC A;  1FFT B;  1HW7 A;  4LF8 O;  3DTU B;  1R3I C;  2ARH A;  3JAS B;  1OCO C;  1EN5 A;  2UXX A;  4DV2 O;  4HNA A;  2DOS A;  1JA8 A;  1FXH A;  5KHI A;  1YEW A;  3NXS A;  1ZAU A;  5D5Q A;  2JS3 A;  4WFA V;  1R6T A;  3WU2 Z;  2QWO B;  3OE7 G;  4O4I B;  4GX5 A;  3BEH A;  3K3W A;  3M8A A;  2XT9 A;  1YVW A;  3O65 A;  3AG1 C;  2NNU A;  2LGW A;  1XQ8 A;  1DF5 A;  2ODM A;  4CC6 A;  2A79 B;  4DV6 B;  1YXB A;  2XOK G;  3BA8 A;  2B1G A;  3E35 A;  4DV0 O;  2QTS A;  1QCE A;  4H0L B;  4H13 B;  5JJN B;  5LXT A;  4H44 B;  2IJJ A;  1NH2 B;  2ZE7 A;  4JI1 O;  4EEQ A;  4LFA O;  1K9M W;  2UXD O;  3HKD A;  4PA6 A;  3T1C A;  4MTF A;  4B3M O;  3ABM C;  3LNM B;  2PYL A;  1QLE C;  4UFZ A;  3I55 V;  1SZX A;  3HKC B;  5CBH A;  5KUM A;  2BTO A;  4LWS A;  5JJJ B;  4PI2 A;  1M57 C;  1SKV A;  5J9P C;  4R50 A;  4X66 O;  4BW5 A;  5BR8 O;  2GV9 A;  2YXL A;  2KSD A;  4B3R B;  4XDL A;  1OCC C;  2Y4T A;  2ZDI C;  1HR0 B;  4DV4 O;  4IL6 Z;  3OFN G;  2DJV A;  2DE0 X;  3ZHU A;  1M93 A;  2OCC B;  1Y76 A;  4JI4 B;  5GON A;  1NH2 D;  1N0J A;  3JAR A;  1B6Q A;  1MZE A;  2PGG A;  1BMF G;  2KQX A;  1AR4 A;  1WP8 A;  1P7G A;  3ML0 A;  3DC5 A;  4MVO A;  5LP6 C;  1MG1 A;  2F23 A;  2HG5 C;  5BY1 A;  4B3M B;  3A2F A;  1ARO P;  3C90 A;  4YHH B;  4EKW A;  2VQE O;  5DN6 G;  1S76 D;  2RQ6 A;  3TCU A;  2WLI A;  3BVO A;  1MNG A;  2M7W A;  4LFC B;  1ZTE A;  1XNR O;  2ZT9 B;  1EBO A;  2Q73 A;  1YDX A;  4MW8 A;  2PY5 A;  1Q3E A;  2XTA A;  1AP6 A;  2CGO A;  3RYF A;  1FXK B;  3L9D A;  2ILM A;  3TET A;  5EC1 C;  4DK0 A;  4UCT A;  3HPL C;  2EIM B;  4I50 B;  1YI2 V;  3STL C;  4RWU A;  4CH3 A;  5FNV B;  1VQN V;  3SYA A;  3CPW U;  4LWS B;  3ZHT A;  4BIZ A;  2EIJ B;  3QO7 A;  1UJW B;  3W7W A;  4JI4 O;  2ZR3 A;  4PA7 A;  3MAQ A;  4JI3 O;  4X62 B;  4UCS A;  3K5N A;  3OMA B;  2OIG A;  4TOI A;  1XMO O;  2QGN A;  3APO A;  2BTQ A;  4WFH A;  2ZD9 A;  1L0L H;  4DR6 B;  3JD1 A;  4RUF A;  2P22 C;  3A0B Z;  1JR9 A;  5LHG A;  1VQ9 V;  4TV8 B;  1IBK O;  5GW7 A;  3WG7 B;  4DR1 B;  3ZRS A;  3RGB A;  1COW G;  4NTW A;  3FYI B;  4GYC B;  4NVP A;  2VQE B;  2VQF O;  2FML A;  4HZ3 A;  4WFE A;  3SPG A;  4JI5 O;  2BOB C;  1GK9 A;  4X9Q A;  3BAB A;  4DV7 O;  1SQB H;  3E8G A;  1ORQ C;  3E22 A;  2B9Z A;  2P4V A;  4QPJ A;  2YEV A;  3BPZ A;  5IT9 N;  4CS2 A;  1FXK C;  5LBQ A;  2ZDI A;  2WLM A;  4B7K A;  2LGQ A;  4NXN B;  3WB0 A;  3H01 A;  4Z1M G;  2AHY A;  4WF9 V;  1GTO A;  4O2B A;  3STZ C;  1NVP D;  1Q82 W;  1GO3 F;  1NU1 H;  4OPA A;  1ZX3 A;  2YSU B;  5LP6 B;  4J7J A;  1K3E A;  4OPH A;  3SPH A;  4PA9 A;  1J95 A;  1O9G A;  1XIL A;  2LW1 A;  3UCS C;  2CTP A;  2ADQ B;  3AK1 A;  2Q0A A;  1VF6 A;  2P67 A;  4NKG B;  3CHX A;  2Y48 A;  4FPP A;  4KHP O;  3NR7 A;  4X1Y B;  2OCC C;  4GZR B;  4LC1 A;  4BIO A;  4DXW A;  4G2K A;  2QWR B;  5KUK A;  4I55 B;  4W4K A;  1SA0 B;  5ITZ B;  3UQ8 A;  2MW2 B;  1MMM A;  3OGC C;  3OMN B;  1TAE A;  3KG2 A;  4Z2W A;  5FL7 G;  1OCC B;  4HNA B;  4FLU A;  5F2V O;  5LA6 B;  3ZJZ A;  3CJH A;  3ASO B;  2JEX A;  1M57 B;  2HJF C;  3B8M A;  2R70 A;  4ABM A;  1YJN V;  3ZRW A;  3CXC U;  1R1B A;  2OWO A;  4KUM A;  2QJ1 A;  3ABM B;  4JI6 B;  3FAV A;  4TV9 B;  1XNQ B; 
#chains in the Genus database with same CATH homology
 1S5H C;  2IU3 A;  4MTO A;  4MVS A;  4JYC A;  1H8H G;  1RPO A;  4MTX A;  4PDL A;  3T4D A;  5CBF A;  1GMG A;  1YJ9 V;  2XAH A;  2OTJ V;  3LDC A;  2C2A A;  5H9C A;  3T2M A;  1HWY A;  2CK3 G;  1QVF U;  2GSM B;  1PNM A;  5B1O A;  1AI4 A;  1F51 A;  4JPR A;  3BY6 A;  4QE9 A;  3OR7 C;  5H6R A;  3WFV A;  2JIZ G;  5L3G A;  1OCR B;  2ZXW C;  1PL0 A;  2DYR B;  3G71 V;  3MD0 A;  4XBF A;  1YJW V;  1JX9 A;  4CBC A;  1VQ7 V;  3P30 A;  4N23 A;  4RAI A;  2AHZ A;  1F4M A;  1M56 C;  3G6E V;  1JQ0 A;  3AEI A;  2EIK B;  1R3L C;  4U7O A;  3RVZ A;  3CCJ V;  1AJN A;  3LSS A;  4X8A A;  4FIP C;  2OTL V;  5KA5 A;  3CC2 V;  2QEX V;  4P2Z A;  1V55 C;  3JYC A;  4PDV A;  3ABK C;  3GWO A;  4TT3 G;  4GX0 A;  1VQ4 V;  2Q69 A;  4LBE C;  2A9H A;  4JYB A;  5B1A C;  1P7B A;  2XAF A;  4XDK A;  4L87 A;  1R73 A;  2F43 G;  3OR6 C;  3QO8 A;  4JF3 A;  1G8M A;  1W0K G;  1OCO B;  2DW4 A;  2HR3 A;  2V1D A;  2UXN A;  1AJP A;  1WLE A;  3ZMV A;  1YTF D;  3QNE A;  1VQO V;  4WFF A;  3ZRW B;  3M99 B;  1YTF B;  3K06 A;  4MTG A;  2Y69 B;  4UUJ C;  1QR9 A;  5LHH A;  1R3J C;  4U7N A;  4UV8 A;  2JK5 C;  1W0J G;  4P9O A;  1DTO A;  4UV9 A;  3D36 A;  3DGE A;  4QIW F;  1I5X A;  3ZRV A;  3PJS K;  3UM7 A;  1QBZ A;  2IJI A;  3CCL V;  3FKS G;  5BZB A;  4WFB V;  3ABK B;  4JAV A;  4DO2 A;  1ZWI C;  2HLD G;  2EIN C;  2EIJ C;  3FB8 C;  1L1F A;  1K5S A;  4XDJ A;  1THZ A;  5LGT A;  4GX2 A;  1K34 A;  4JTD B;  1WPX A;  1K97 A;  3AG2 B;  5L3B A;  4UVA A;  5CMU A;  1KQS U;  1Q81 W;  1IXM A;  3CCM V;  2EIM C;  3FB7 C;  3B77 A;  4LCU C;  1ROP A;  3ABL C;  2DWD C;  2B1I A;  3ASN C;  1QR8 A;  4KFM A;  2Q6A A;  3ABL B;  3MHS C;  3RW0 A;  3EHB B;  1K73 W;  3OW2 U;  4MVR A;  1GKF A;  2ITD C;  3TK1 A;  2WSS G;  3ZMT A;  4H33 A;  2P7T C;  4KP4 A;  3AG2 C;  1NBM G;  3EFF K;  1MOF A;  5L3F A;  2IH1 C;  2EIN B;  3CC4 V;  1E1Q G;  3ZN1 A;  1Q7Y W;  1JJ2 U;  1Y66 A;  3CCR V;  1QVG U;  4R6Z A;  4MT8 A;  3CCV V;  3CC7 V;  2WAM A;  4E2L A;  2ZR2 A;  2WLK A;  4ZKI A;  1AJQ A;  1YHQ V;  1FS0 G;  5EBL C;  2A0L A;  1DLB A;  3WG7 C;  3ASO C;  1K8A W;  3E83 A;  5CBG A;  2HFE C;  1CPY A;  1GM9 A;  1FFT B;  2EJR A;  3AG3 B;  3K0D A;  1M1K W;  1NR1 A;  3DTU B;  5HFM A;  3A0R A;  3JD2 A;  1R3I C;  4MVM A;  3OAA G;  1GM8 A;  1OCO C;  2X0L A;  2WWW A;  2UXX A;  1NVP B;  1S3J A;  4MVZ A;  2XAG A;  1FXH A;  2R9I A;  3NXS A;  1KP2 A;  1OCZ B;  1F23 A;  5H6Q A;  3VBB A;  3ZIA G;  4WFA V;  3CCS V;  1V54 B;  1BL8 A;  1V55 B;  1K5Q A;  4G28 B;  2FTK A;  5IYC O;  5EBM C;  2EIK C;  3OE7 G;  4GX5 A;  3BEH A;  3K3W A;  4GCZ A;  5CN0 A;  1PNL A;  2HKO A;  2EZP A;  2QM8 A;  3AG1 C;  2EBO A;  4JAS A;  5B1B C;  3MHH C;  2WLH A;  1R6K A;  1K4C C;  2NNU A;  4HAM A;  1DF5 A;  2ZXW B;  1YIJ V;  1OCR C;  1VQP V;  2QA4 V;  1M90 W;  2A79 B;  3ZMU A;  4UVC A;  2XOK G;  2B1G A;  3E35 A;  2WLL B;  3D3I A;  1QCE A;  5C93 A;  2YEV B;  3E8B A;  2Z3Y A;  3LDD A;  4QJF B;  3IFX A;  3ZRX A;  1XL4 A;  2IJJ A;  1NH2 B;  1KC8 W;  3UKM A;  2Z5U A;  1K9M W;  3ZCC A;  1AI6 A;  4PA6 A;  3E2E A;  3T1C A;  1RM1 C;  2Q68 A;  1M9N A;  4MTF A;  2K1E A;  3ABM C;  3LNM B;  2ITC C;  3JD3 A;  2IU0 A;  1R6N A;  2XAQ A;  1QLE C;  4ASU G;  1JPX A;  3OMI B;  5B1N A;  3I55 V;  3SPJ A;  5L3D A;  5CBH A;  4PA3 A;  5KUM A;  1OHH G;  3W7S A;  1VQ6 V;  3HB3 B;  1M57 C;  2IJK A;  2DWE C;  5IYB O;  5J9P C;  5LGN A;  4QPK A;  4R50 A;  1PKX A;  5HFL A;  3IGA C;  1G4Y B;  3ETE A;  4BW5 A;  2D3O W;  4MVU A;  1FXV A;  3K9A A;  3W7X A;  4XDL A;  1MAB G;  4FK5 C;  1OCC C;  2XND G;  2X6A A;  1OCZ C;  1H8E G;  4P30 A;  4WFG A;  2ZDI C;  3K0G A;  1VQ5 V;  3OFN G;  2LFS A;  1P4R A;  3SJQ C;  2EIL C;  2QM7 A;  4X89 A;  4QNH B;  5L3E A;  3R65 A;  3ZMS A;  2LFR A;  3ETG A;  2XAS A;  4FMT A;  3X2Q B;  2OCC B;  1CP9 A;  1VQK V;  3B8N A;  5B3S C;  1E79 G;  1Y4M A;  3E8F A;  4RO2 A;  1NH2 D;  1B6Q A;  2NLJ C;  2GHY A;  2DQ0 A;  1ENV A;  2JJ1 G;  2MK3 A;  1AI5 A;  2QE7 G;  4PA4 A;  2X7R B;  5E1A C;  1BMF G;  1NR7 A;  3GB7 C;  5EBW C;  4RUE A;  2JEU A;  2PI4 A;  4P9P A;  3OUS A;  3T4Z A;  2OT5 A;  2IJH A;  1KD1 W;  5DM6 V;  1NQT A;  1Q86 W;  2H8P C;  3ABU A;  2W0F C;  1KP3 A;  1QLE B;  4BAY A;  2WPD G;  2V7Q G;  4FJC C;  1KEC A;  3E8H A;  4JGS A;  3ML0 A;  4MVO A;  1VQL V;  3QO5 A;  3ZN0 A;  1MG1 A;  1VQM V;  2KB1 A;  1RM1 B;  2X6C A;  2HG5 C;  3K79 A;  1RPR A;  1QLN A;  1W2B U;  3JD0 A;  3AG4 C;  3CCU V;  1ARO P;  3I56 V;  4EKW A;  5DN6 G;  4WCE V;  4PDR A;  1S76 D;  3SPI A;  3TCU A;  2WLI A;  2M7W A;  2JJ2 G;  1EBO A;  3FYE B;  2HVK C;  4MW8 A;  3AG4 B;  3P32 A;  1FXK B;  1AI7 A;  3OEE G;  3LUT B;  4UXN A;  3G4S V;  1I5Y A;  2PI5 A;  3TET A;  1SRY A;  3LSQ A;  5EC1 C;  4JTC B;  4X88 A;  3HPL C;  2EIM B;  3AG1 B;  1AR1 B;  1YI2 V;  3RVY A;  2B5U A;  3STL C;  3F7V C;  4MVQ A;  1BHB A;  1GM7 A;  1VQN V;  3SYA A;  2XAJ A;  3CPW U;  4BIZ A;  2EIJ B;  1K7D A;  1CEZ A;  3OM3 B;  3QO7 A;  1UJW B;  4I9W A;  5CA3 A;  2DYS B;  1FXK A;  3W7T A;  3W7W A;  1OZ0 A;  2ZR3 A;  4PA7 A;  1JCH A;  4PEL A;  1BHA A;  1K92 A;  3OMA B;  4RQF A;  3RBZ A;  3JD4 A;  2WLN A;  4TSF G;  4WFH A;  4QE7 A;  2QKS A;  2EIL B;  2ZD9 A;  2Y69 C;  3JD1 A;  4GT1 A;  2W6I G;  3LDE A;  3E86 A;  4RUF A;  3OEH G;  5LHG A;  1VQ9 V;  1K4D C;  2P6J A;  5IYD O;  4R7C A;  2DYS C;  5GW7 A;  3SPC A;  3WG7 B;  4R8C A;  4ZBM A;  1SZT A;  3ZRS A;  1COW G;  1EFR G;  1K33 A;  3K08 A;  3FYI B;  2IH3 C;  2R9R B;  4HZ3 A;  4MS2 A;  4WFE A;  3SPG A;  2BOB C;  3CP1 A;  1GK9 A;  1S0V A;  3E89 A;  1NJI W;  3E8G A;  1ORQ C;  5L3C A;  4HYO A;  4QPJ A;  2YEV A;  1SET A;  1FXK C;  5LBQ A;  2ZDI A;  2WLM A;  4LP8 A;  1VQ8 V;  3SYP A;  3ZMZ A;  1M56 B;  3F5W C;  3H01 A;  4JAU A;  4OXS A;  3ETD A;  3JCZ A;  1YSC A;  4Z1M G;  2AHY A;  1TUE B;  4JTA B;  4WF9 V;  1GTO A;  2DYR C;  3STZ C;  3F7Y C;  1NVP D;  1Q82 W;  1GO3 F;  5KA6 A;  3ASN B;  3CME V;  1H38 A;  1R3K C;  3CCQ V;  2YSU B;  5LGU A;  1MSW D;  2HVJ C;  4UVB A;  1N8R W;  1EZJ A;  1E1R G;  1LNQ A;  1K3E A;  4TWK A;  4GX1 A;  3SPH A;  2WLL A;  4PA9 A;  2ZQM A;  1J95 A;  5B1B B;  1S72 V;  4N21 A;  2LP7 A;  5LHI A;  2EZO A;  4J9Y B;  3OUF A;  2W6J G;  3K03 A;  2Q67 A;  1KKD A;  5IDJ A;  1F4N A;  3W7U A;  3SYQ A;  2P67 A;  4MSW C;  2Y48 A;  1SES A;  4FPP A;  3K04 A;  1V54 C;  4I5S A;  3CMA V;  1H2G A;  5B3S B;  5IY5 B;  2OCC C;  3CCE V;  3X2Q C;  4RQE A;  4LC1 A;  1S77 D;  4DXW A;  1JOY A;  4G2K A;  5KUK A;  4CZZ A;  2BOC C;  2X6B A;  3VOU A;  1DF4 A;  1SER A;  2P90 A;  5EK0 A;  1YIT V;  3OGC C;  3FB5 C;  3OMN B;  1JVM A;  4F4L A;  3KG2 A;  5FL7 G;  1OCC B;  1PNK A;  4J9Z B;  4BIU A;  3AG3 C;  2JDI G;  3IC7 A;  3ZJZ A;  1NKD A;  3ASO B;  2JEX A;  3CD6 V;  1M57 B;  2HJF C;  3B8M A;  5EC2 C;  4YXW G;  4H37 A;  1XL6 A;  5B1A B;  1YJN V;  2DQ3 A;  4G27 B;  2ATK C;  3SYC A;  3SYO A;  3ZRW A;  3CXC U;  2WLI B;  4KUM A;  2QTO A;  3CYO A;  4Q20 A;  3FB6 C;  5IY5 C;  4PDM A;  3ABM B;  2H94 A;  2WLJ A;  2IW5 A;  1PD3 A;  3ABT A;  4MW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...