4WFGA

Human traak k+ channel in a tl+ bound conductive conformation
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
253
Chain Sequence
RSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
total genus 96
structure length 253
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4wfgA00
2Q6AA 2X6AA 2HFEC 3ASNC 1QLEC 3F7YC 3RVZA 3LUTB 3SYOA 5IY5C 1R3IC 4MTFA 4BW5A 3SPCA 4X88A 5BZBA 5CBHA 3TCUA 4MVQA 4PA7A 4HYOA 3ASOC 4EKWA 2WLJA 5J9PC 2KB1A 2P7TC 3AG1C 4OXSA 3ZJZA 4MW8A 4QE7A 5KUKA 5CBGA 5B1AC 2HVJC 1JVMA 3OGCC 3FB8C 3UKMA 2K1EA 3OR7C 4PDLA 3FB5C 2HVKC 1OCZC 4P2ZA 3OR6C 3TETA 4XDJA 4PA6A 4LP8A 1S5HC 5EC2C 3RBZA 3ZRSA 4PA9A 4WFHA 2EIJC 3K0GA 3E89A 4MS2A 3SYPA 2A0LA 4H33A 3LNMB 2HJFC 4MVUA 4RUEA 4F4LA 1KKDA 2WLIB 4RAIA 3SPJA 1G4YB 3JYCA 2OCCC 4PDMA 4QNHB 3SYQA 3RVYA 5KUMA 3RW0A 5CBFA 4RUFA 3KG2A 3AG3C 4MVSA 2ITDC 1P7BA 4R6ZA 4XDLA 4MVZA 4R7CA 2W0FC 5EK0A 3ABKC 4H37A 3T1CA 4LCUC 3K08A 4MVOA 2DWEC 3FB6C 1R3KC 4GX2A 3E8HA 4GX5A 4P9PA 4QE9A 3AG2C 4WFEA 1OCRC 5B1BC 3STLC 2R9RB 2BOBC 2AHYA 4MSWC 3SYCA 2DWDC 3T4ZA 2EILC 1M56C 3WG7C 3R65A 4P30A 2QKSA 1OCCC 2Y69C 3X2QC 3HPLC 4JTCB 3STZC 2X6BA 3AG4C 2EIKC 4MTOA 4DXWA 3LDEA 4R8CA 4R50A 2Q67A 3EFFK 2YEVA 4ZBMA 3E8FA 5E1AC 1ORQC 3T4DA 3GB7C 4PDVA 4TWKA 4X89A 2ATKC 4RO2A 4I9WA 2NLJC 2Q69A 4JTDB 3VOUA 4WFGA 3SPGA 3IFXA 5EBLC 1LNQA 2HG5C 4XDKA 5EC1C 2WLLA 3OUFA 2WLLB 2A9HA 2EIMC 3K03A 2A79B 4KFMA 1R3LC 2DYSC 2IH3C 3LDCA 4GX0A 1K4CC 2ZD9A 3E86A 3OUSA 3T2MA 2IH1C 3E8GA 3SPHA 1ZWIC 1K4DC 4J9ZB 2JK5C 2BOCC 2WLNA 3IGAC 4LBEC 4CBCA 3ABLC 1J95A 5EBWC 4WFFA 2WLHA 1XL4A 4UUJC 2WLMA 1OCOC 1BL8A 2EINC 3PJSK 4G28B 4MW3A 3E8BA 4GX1A 4PA3A 5B3SC 3SPIA 4P9OA 3E83A 3SYAA 1M57C 2ITCC 4J9YB 1V55C 4MVRA 2H8PC 4G27B 3ABMC 2ZXWC 1R3JC 4HZ3A 3LDDA 2QTOA 4MTGA 2WLIA 3K0DA 4PA4A 4X8AA 3UM7A 2DYRC 4PDRA 4MVMA 3F7VC 1XL6A 4JTAB 2WLKA 3BEHA 3F5WC 2Q68A 3K04A 5EBMC 3K06A 3FB7C 3SJQC 2AHZA 1V54C 2X6CA
chains in the Genus database with same CATH superfamily
1TUEB 2Q6AA 5B1AB 2ZXWB 4B3MB 1G6UA 1N4CA 3APOA 4CZZA 4K0KO 4NXNO 1XQ8A 2EULA 1XEQA 1K9MW 5FL7G 1BE3H 5ITZB 1K34A 1URFA 2ZE5A 3JARB 1GKFA 2EJRA 2Q7HA 2K1EA 1Q8IA 5JWPA 2B5UA 4ZHQB 1H38A 3ZHSA 4GUNA 4DUYB 5EIBD 4X1IB 2F4VB 5KLVH 4X1YB 2QWRB 1L0NH 2JS3A 5H9CA 3ZN1A 4XDLA 1PP9H 1AR5A 3W7WA 2RQ6A 1Q90D 4GX5A 5BMVA 2PI4A 1SA0B 1JMKC 4PI0A 5LL6Y 4FMTA 2QA4V 2JEXA 3BHPA 2EILB 4GCZA 4AI8A 1Q5OA 4PDVA 3T4DA 3IJ4A 4O4LB 3A8TA 5EZYB 1R6TA 4WFGA 3RYFB 2EIKB 2YXLA 3N2KB 1WA8A 3AG7A 2HHHB 2ZM6O 1K5SA 2ZE8A 1R6NA 4CBCA 1I7FA 4DR7B 2EINC 4B3SO 4EFEA 2Z0AA 3CJHB 5KMGB 3BA8A 2VQEO 2QJ1A 3HB3B 1V54B 3RYHB 2VWJA 3ABMC 1KKCA 2XAHA 3AK1A 3TJTA 2N74A 3K5NA 4Z1VA 4YJ2A 2IU0A 4EB6B 4I50B 5F2VO 3B4SA 4LFAO 2ZR2A 1HDJA 2AW9A 3ASNC 3F7YC 4DK1A 2NR5A 5ITZA 5LXTB 2CTRA 1R3IC 2ZIMA 5GTHZ 3THOA 2PY5A 3RT3C 4X64B 1H2SB 5LHGA 1AJNA 4QE7A 4UCTA 1YJ9V 3UKMA 2LP7A 5IJ9A 1TVKA 4FZ0A 3SYPA 1EZJA 4NB5A 2HHHO 4CS4A 3ABKB 1VIBA 2JJ2G 1H2LA 5KA5A 2BTQA 2WSSG 2CUGA 2ZNJA 4QPJA 4TV9A 2HLDG 3CRMA 1HR0B 4MVZA 1FPOA 1NI8A 1H8EG 4H37A 5HFMA 3BRCA 2VQEB 4ZHQA 1OCRC 5K1XA 2R9RB 3T4ZA 1NQTA 1SQBH 2A06H 1XDCA 2QKSA 3HKEB 5FNVB 1VF6C 2IJHA 3LSUA 4JTCB 1HNXB 1FYJA 1WB7A 2XAQA 1FXKB 2YIBA 5LHHA 4LFBO 1R6KA 1H2GA 4JI1O 5C93A 3CCRV 3QO8A 2OCHA 1VF6A 3E2EA 2Q69A 2YUAA 2HG5C 3OUFA 2EIMC 3OD4A 4JI0B 1P84F 1R3LC 4JZ2A 1NKDA 2PZSA 2IH1C 3QVNA 1IURA 4O4IA 4GKKO 3L72H 2K9PA 3K57A 1AJQA 3OMNB 4BIUA 3SPIA 4NXMO 1T5EA 3E35A 3CMEV 4XBFA 2ZXWC 4JI8O 4JYAO 4DUZB 3IC9A 3K0DA 1WLEA 1M5IA 2DYRC 3BY6A 4DV4O 2QEXV 1SQVH 2AZ0A 1XNRB 1MSWD 2UUAO 3RYCB 3ZHVA 4DV6B 1TGOA 4PI2A 4X62O 3CS5A 2NNUA 4X88A 3D8CA 4IT5A 2CAZC 1KD1W 1ZTEA 4I4TA 2WLJA 3CXCU 4W4KA 3AG1C 2P7TC 5CA1A 3CC4V 1YI2V 1K97A 5KAIZ 3S3XA 4LF9O 5LHIA 2E3CA 2QWQB 4U3FH 3CP1A 3RWRD 3UQ8A 4X1KB 1Z5WA 2V1DA 1ZL8A 1SF9A 2L35A 2Q0OC 3K9AA 2HJFC 4I7ZB 2V7QG 5TISZ 4O4HB 3RW0A 5D5QA 5B1OA 3JAKB 1DF5A 1VQOV 4LNUA 1IX9A 3D3IA 1JX9A 1Z5VA 5IYZB 4LC1A 3R65A 2ZDIA 1FKAO 1VQ8V 2HR3A 1SQQH 1F23A 5L3FA 3OW2U 4J7ZA 3ZRVA 4LF9B 1P4RA 2F66C 2XOKG 2P90A 3K5OA 3L9DA 2ATKC 4H0LB 1AR4A 3ETEA 5CA3A 2JVDA 4DV7O 5GW7A 2XAJA 3FAVB 2ZM6B 4DK0A 1WNSA 1P7GA 3E8GA 3SPHA 1V55B 1R73A 4TQFA 2QKAA 4U3JB 4WF9V 4CC6A 1HW7A 3UT5B 4PA3A 4DYLA 4DUZO 4IYIA 3P3PA 3E22B 1Q86W 1FFXA 2ADQB 5H5NA 3ZIAG 2QWNB 3BA9A 4MTGA 1Y76B 1OCOB 4MVMA 1IZ3A 4PDRA 3BPZA 3SJQC 1BHBA 2A3QA 5GTIZ 3SYOA 2KSDA 1G1XB 3CSXA 3TK1A 5IWAB 5FLXN 4EKWA 2E74B 2EIJB 4OXSA 4UV8A 1YIJV 5B1AC 2Y4UA 3RGBA 3L74H 2HVKC 3CCUV 3JD4A 1YVWA 2UUBB 4IL6Z 4EFBA 4O4HA 4DV3B 3JARA 5A2QN 4UCOA 3H1HH 4MTXA 3APQA 1ZLZA 2B9ZA 3B2EE 3OMIB 4MVSA 5LGTA 3CRAA 4Q20A 4R6ZA 4GZRB 5KHKA 5JJNB 3FB6C 1PD3A 1KP3A 4FPPA 4O2AB 4X66O 4DR1O 1I94O 1O9GA 3JSLA 1RM1C 3CRCA 1B6QA 2AXTZ 4PV1B 1US6A 3OEEG 3ZMUA 1AP5A 1QNMA 5LP6B 1FS0G 2CH7B 5IJ9B 2QM4A 3QF7A 4GYCB 1VQNV 2Y69B 4J42A 5IWAO 4KHPB 3JALB 5LYJB 2A79B 2QTSA 5B3SB 3JASB 2JGDB 4U7NA 3BCCH 3IGAC 1NVPD 4OGQB 4J7KA 2E5LB 3F5TA 3NR7A 1P49A 4BW9A 3HKEA 3CCQV 2EZPA 2EINB 5CMUA 2P06A 3G4SV 3Q4HB 1NH2B 1FJGB 1COWG 3SDLA 3OMAB 4OX9O 2M6YA 1SRYA 4FFBA 4JASA 4EEQA 2UXCO 5JQGB 1FXKA 3A0BZ 3SPCA 3QO7A 3ZBHA 4FZ1A 1MG1A 3RYIA 4HYOA 5L3GA 5J9PC 1RSOA 1PKXA 2YIBD 5JH7A 3KKYA 5AG2A 2EZOA 1MSDA 4O4IB 1VQLV 1NU1H 4O2BA 4B3RB 2YDEA 2QKCA 1GN3A 4JI5B 1S5HC 3OM3B 1Q6HA 3JD0A 3M99B 4F4LA 4X1IA 3N2GA 3SR2C 4PDMA 2QWOB 2UXXA 3C3TA 1XNRO 2LFSA 3KG2A 1E1QG 2ITDC 3L73H 2ZDIC 1N33O 2LW7A 1JOYA 1Q6IA 4WFEA 3C3SA 2OTLV 5KX5B 4FK5C 4P30A 4F6RB 3U0ZA 3VQXA 2YI8A 3P32A 4YHHO 4A5UB 1GK9A 2X0LA 2KKWA 3J81N 1HNWB 2PYJA 1MZFA 1FJGO 1CEZA 2RJZA 1KECA 3E8FA 5E1AC 1RM1B 4RO2A 3AK2A 3ZMSA 3VOUA 1FAFA 4DV3O 1VEWA 1YZBA 2OT5A 3IFXA 3K03A 2D2CB 1VQPV 3TGUH 2WA4A 1K4DC 4LR3A 3ABLC 5H2FZ 3EHBB 5IJ0B 1OCOC 4CH4A 5LP6A 2EIMB 3O9OA 4D6TH 3E83A 1B04A 3ZRWA 2XNDG 4B08A 3JALA 4DV6O 2WLIA 2KG7A 1Q43A 4DV5O 5DM6V 1MABG 3D36C 3OAAG 4CC5A 3H1LH 4X20B 2JIZG 4UB8Z 1Q82W 1IBMO 4MW8A 5CBGA 4TV8A 2HVJC 4FJCC 5D5PA 4GT1A 4I4TB 3OR6C 2XHBA 5E79Z 4RWUA 1AI6A 3E89A 2PYLA 2FYUH 1JA8A 3FX7A 5CA0A 5B1BB 5KUMA 4LFCB 3E22A 1MMMA 4DR5O 1NH2D 1WN7A 2GV9A 4RQFA 4O4JB 2QR4A 4I55B 1CXZB 4GX2A 1NJIW 2ZKOA 2ARHA 1XUQA 2DWDC 3M7MX 1QVGU 3OTOO 1OCCC 5FNVA 3CD6V 1VQ5V 4Z1MG 4JYCA 4MTOA 3CMAV 4LF4B 1DLBA 4R8CA 4JI3B 3RFRA 4TOIA 3N27A 2PF4E 1GM8A 1AILA 1L8DA 2YIAA 3HKBA 2WLLA 1D2DA 2ZD9A 4JI0O 1YDXA 1JJ2U 4PD4F 2A7WA 3JD3A 3MAQA 2UU9O 1DGSA 1YEWA 1ZUQA 1IBMB 2YC0A 1QBZA 3ZMTA 5KHGA 5CB4A 4NXMB 4UVCA 2H8PC 3P30A 1WA8B 4HZ3A 3VQWA 4GLXA 3WB1A 2F43G 1S76D 3WB0A 4JI3O 2UXNA 4N21A 2Z3YA 4ZI7B 1Y76A 3U11A 4JZGA 4WBNA 3T1HB 3P3NA 3ML0A 4UVAA 2F1MA 1M1KW 2IJIA 5LA6B 1F4MA 2P6JA 1PM9A 2DW4A 1YJWV 2R9IA 2ZQMA 4H33A 3G80A 4K3AA 1KKDA 2DMXA 4MVUA 4TUYA 1GM7A 3OTFA 5J2TB 1GAXA 2Y4TA 4IHJA 3IC7A 4LF7O 3W7SA 5CBFA 3DTUB 1QU7A 2IW5A 1YHQV 2GUZA 1VP7A 1K92A 3T1CA 1GN2A 1W59A 3T1HO 3CWBH 1GTOA 4YHHB 4D7SA 5JQGA 1VMGA 2OWOA 3LDEA 1UJWB 4R50A 4LF8O 3ABUA 3HKBB 4ZBMA 5L3EA 3GB7C 5JH7B 1AROP 2FMLA 2B1GA 4JTDB 2DQ0A 4NXNB 5H6RA 1LR1A 3EVKA 4KP4A 1YITV 2IH3C 2RMKB 1F4NA 4CH3A 2FB5A 5H6QA 4JI4O 3GWKC 3JATA 3M8AA 3SJAC 1S72V 3RYFA 2RNBA 1WJZA 3GWOA 3E8BA 4GX1A 3O65A 5B3SC 1XHZA 4P9OA 1ZX3A 2QE7G 1FXVA 4L8JA 4RQEA 4F6RA 1IBLO 2Z5UA 4UV9A 3CC7V 4PA4A 2N05A 1AVMA 2RN9A 1N32O 5A9GA 1SKVA 4Z2WA 5EBMC 4UXNA 1J5EO 3VBBA 3FFQA 4OPHA 1JQ0A 3LUTB 3B8NA 3A0RA 5LA6A 3TCUA 1KMIZ 4ZOLB 5IT9N 5DECA 2Y48A 2XASA 2R70A 2CK3G 1HR0O 3C90A 4P2ZA 3UT5A 4JGSA 1PL0A 3ZRSA 1WAZA 1D5AA 3CRRA 1K8AW 2EJ7A 4YY3O 2BSKB 1BQ0A 4OPAA 4LWSB 1X4TA 4DR2B 4LFCO 5JJEB 1SZTA 2V4DA 5KMGA 1IDSA 4H13B 1K7DA 3ABKC 1FXHA 4YJ2B 4X66B 5JJJB 4UCSA 5FPRA 2IJJA 2YSUB 3HPLC 2GSMB 2IJKA 3EXAA 1WP8A 1KB9F 1VQ7V 3ZRWB 4CH6A 2CH7A 1ORQC 4LNUB 1Q7YW 1A32A 3H1JH 2CGNA 2GDSA 4XDKA 1H8HG 2ZT9B 1X59A 1TVKB 3PN1A 2PTMA 3OGIB 4J9ZB 2VQFB 2JEUA 1E79G 1XNQO 4LH6A 1S0VA 3SYAA 4KHPO 3HKDA 1Y74A 3DGEA 4MVRA 4LFAB 5J2TA 1R3JC 3ABLB 3W7TA 3OT7A 3MHSC 5LGUA 1VF5B 1U97A 3MDSA 2Y0IA 1AR1B 3K04A 3J7AU 4G2KA 1EFRG 3K06A 2AHZA 1N34O 3UO3A 3DXRB 3VQYA 4DW1A 3G6BA 2P4VA 3FD9A 3LSSA 4X65O 3SJCC 4O4JA 1ENVA 4BR6A 1OCZC 4DV2O 4AHCA 4LP8A 3CXHF 1VQ9V 3WB2A 5CB4B 4QGPA 4RUEA 1BQZA 2AZ2A 4DV7B 1NS1A 1QR9A 1M9NA 3B40A 3Q4HA 1THZA 1QR8A 5EYPA 4ZIBA 4FM2A 3JAWB 2N04A 4HAMA 2Q0AA 2DWEC 3MD0A 4JAVA 2BOBC 2AHYA 4F6EA 3WG7C 4NTYA 3JAKA 2JS5A 3ZS8C 2XTAA 2Y69C 4DV4B 1PV0A 3AG4C 2OIGA 3ZCCA 3W7UA 3EFFK 2YEVA 3B09A 1QCEA 4QJFB 2BTOA 1IBKB 1XILA 4HNAA 4NR1A 2XT9A 4O2AA 4LF7B 1I5XA 1FFXB 1ZWIC 4LBEC 1GMGA 4JI8B 5IYCO 2C2AA 3ABTA 3PJSK 4MW3A 5CA1B 1UPGA 2MW2B 2Q7GA 1QVFU 3I55V 2G38A 1W0JG 4ABMA 4TSFG 5KHHA 1QLNA 4UCVA 1M93A 1SQPH 2IM9A 1O9HA 3FKSG 4X9QA 4JYAB 2KQXA 2BCCH 4ASUG 4X65B 4FLXA 3TXQA 2HEPA 1Q3EA 2LJ2A 4X20A 1YF2A 3HKDB 3KCYA 1YCIA 1EN5A 2WWWA 1KYOF 1RPRA 1KBHA 3FB8C 3VQVA 1MZEA 1TAEA 2UXBO 4E2LA 3ETGA 2PI5A 3CCSV 1BCCH 2EIJC 4FLUA 2D3OW 3JATB 5LOVA 2LGWA 2WLIB 4RAIA 2E76B 3RVYA 2W6JG 2ZE6A 3BFRA 1S5JA 3I56V 1YSCA 1JCHA 2LQTA 1OCCB 1HNZB 5LMNO 3DC5A 2UXDB 1K73W 5KHJA 5EK0A 5L3BA 2Q5ZA 5FPOA 5B1BC 2CGOA 5LMUO 3STLC 3R66A 4MSWC 4FLVA 1PNKA 3T1YO 2LGQA 3D36A 4ICGA 2ILMA 2X6BA 4LF4O 4DXWA 1R1BA 4PELA 1Y67A 3RYCA 1CP9A 3JAWA 3S3WA 1FD9A 3SPGA 1GRJA 5EBLC 1WPXA 2BTQB 3ZMVA 5CA0B 5LP6C 4QPKA 4GX0A 1N36O 1EN4A 3G6EV 1EN6A 3WU2Z 1XL4A 1RPOA 3CRQA 2YEVB 4DR2O 1K5QA 3JD2A 4B7KA 5LMUB 2ZE7A 1VQ4V 4FIPC 4JYYA 4G27B 5KHIA 5JVDA 4AILC 3LDDA 4DV1B 2EX3A 4UFZA 4CS2A 3B77A 3W7XA 1SZXA 5IJ0A 2P5OA 4DV5B 1UFIA 2DE0X 3QO5A 1W0KG 3K58A 1AP6A 5GONB 2QWPB 3N2KA 3K5MA 4PDLA 2GBOA 4I5SA 2X7RB 1SQGA 3T1YB 2XAFA 3RBZA 3K0GA 2RCVA 3H9VA 2A0LA 3AK3A 3ZHUA 1SC5B 1G4YB 5BMVB 2PUSA 4FLTA 1H2NA 4DV1O 2UUCO 5HFLA 2O57A 4YJ3A 4I0XA 4DR6O 5B66Z 3UCSC 2NN4A 3G67A 4TQDA 5DEDA 3ZHQA 4PJ0Z 4QE9A 4CS3A 4P9PA 1HWYA 2W0XA 4FM1A 3K5LA 4LFBB 1KP2A 1XNQB 2GTSA 1MOFA 4JI4B 2WAMA 3NXSA 4N23A 1S5LZ 2MK3A 2JGUA 2HKOA 3FAVA 1YXBA 3L75H 3OUSA 1N32B 5C8YA 5J2UB 3OE7G 2WLNA 5EZYA 1KQSU 4WFFA 2RDCA 4J10A 4G28B 1EZVH 3UO2A 4EB6A 1AI5A 4DW0A 5LOVB 3ZEDA 1ZSPA 4C7UA 1OV9A 4JV5B 1XL6A 2FTKA 4BIOA 1Y74B 4FLZA 1J5EB 2OIEA 2ODMA 3H1IH 5IY5C 4JAUA 2DYRB 1XMQB 2L6LA 2R9AA 2UXCB 2H3OA 4DV2B 4L87A 3K9SA 1BT8A 1BMFG 3CCEV 4HNAB 1XMOO 1GH6A 2OCCB 2F23A 3MHHC 1PL4A 3AG1B 4J41A 1NTZH 1KC8W 1NR7A 3CEIA 1OCZB 4UCRA 4YIPA 1OZ0A 1GN4A 1P7BA 5BR8B 3ZHTA 1XBLA 3D3QA 2YICA 4B7EA 1AJPA 2ZCEA 2YXHA 3AG2C 3K79A 3AG3B 3HKCB 4MT8A 5JVDB 3X2QC 4X1KA 3JD1A 2VS0A 4YJ3B 3WG7B 5C8YB 5J2UA 3QTCA 4LWSA 3CHXA 2ZNIA 1NR1A 1WPBA 2LO1A 1RSOB 4FLYA 2OYQA 1Q6UA 1JPXA 3K59A 2UUBO 3J80N 1D5NA 5LXTA 4X64O 3DSQA 4O2BB 4NTWA 1NZ6A 4H44B 1HNZO 1VF7A 3CC2V 2QTOA 1V9PA 3I5DA 4GKJB 1VARA 1XHXA 1Y6XA 1WP7A 2X6CA 2X6AA 3RVZA 4MTFA 5BZBA 3ETQA 4JAAA 1I94B 1N8RW 4MVQA 1PNMA 3A2FA 4PA7A 3JAMN 4BWAA 3ASOC 2JGDA 1DK1A 5KUKA 3U10A 1DF4A 3CX5F 3QNEA 5IDJA 3OR7C 4GKKB 4AQYB 2CE4A 4XDJA 1SQXH 4YIOA 1MA1A 4MS2A 1BSMA 3CYOA 1M90W 5BXZA 4DUYO 1XMOB 1RP3B 4J7JA 3JYCA 2OCCC 4ZOLA 4I9QA 4X1YA 2ZINA 1VQ6V 3ZRXA 3B8MA 1H2MA 1NTKH 2Y0PA 1LUWA 3SGIA 4DO2A 4JI2O 1Y4MA 4J11A 4FFBB 1SERA 2FL4A 3DC6A 3DXRA 3BAAA 5KX5A 4UVBA 4UCUA 5KAFZ 2BSKA 3RYHA 1XREA 5JCOC 3GVMA 2UUCB 3OEHG 2XUMA 1N0JA 1PPJH 3AG2B 4DR7O 4K0KB 3OTOB 1FFTB 4TWKA 4DRXB 1JJOA 2NLJC 2DJVA 4FFKA 2LW1A 1FXKC 5GONA 1H2KA 3N2GB 4JI6O 1TUBB 1YJNV 2A9HA 2JDIG 2DYSC 2Q8VA 2QGNA 1K4CC 4JF3A 2AGAA 2Q7EA 4ZI7A 2DQ3A 1J95A 1EBOA 4UUJC 5JCOA 4GKJO 1DTOA 2GTAA 3BABA 4J80A 4NYKA 3CPWU 5CN0A 3ASNB 2OTJV 2UXDO 4U3JA 3CCMV 4LF5O 3ICXA 4FM0A 1I08A 4JTAB 2WLKA 3BEHA 1ROPA 2JRIA 2Q68A 2H94A 5IYDO 2ZIOA 4B3TB 1JFFA 5IYBO 1V54C 3ETDA 3JSNA 3K3WA 2HFEC 1XOUA 4BW5A 1YTFB 4YXWG 2YIDA 4I0XB 3HKCA 2KB1A 3ZJZA 4K35A 3FYIB 1HNWO 4JPRA 1F51A 4KUMA 1JVMA 1Q81W 3OGCC 2UXBB 2F95B 1BHAA 5EC2C 3JASA 4PA9A 3KZIZ 4K8ZA 4DR3B 3SPJA 2FKXA 3JCZA 4JV5O 4RUFA 4IIJA 1M56B 2P22C 1SA0A 4DR4O 2VWKA 2F4VO 1OJHA 3AG4B 4I55A 2DOSA 2F93B 1SETA 1XMQO 2EBOA 2QM8A 4X62B 4PHZA 4O4LA 1HNXO 2EIKC 4D7TA 3ZMZA 2QSAA 3RYIB 2Q67A 5EYPB 1BS3A 1N0NA 4X89A 3AEIA 2CTWA 2YI9A 4WFBV 3FYEB 4DR1B 4DR3O 1LNQA 2P4KA 2W6IG 2WLLB 5B1NA 1F7YA 3TXSA 3LDCA 1IBKO 4LF6B 1AI4A 1AI7A 1JR9A 3CJHA 1IVSA 2IBZH 2Q73A 1U96A 2BE3A 5EBWC 1BL8A 2DYSB 3ZHRA 3ZN0A 4BAYA 1M57C 1KUQA 5IE9A 1I0HA 1Y66A 4NVPA 4B3TO 3F7VC 4IHJB 4HBNA 4OX9B 1QLEC 2LFRA 5CBHA 4DR5B 4QIWF 1AB3A 4IYHA 4CH5A 2UUAB 4AQYO 4LF8B 2JJ1G 3TETA 5L3CA 1Z2GA 1B3QA 4DRXA 1LUVA 4WFHA 2DN9A 2CDYA 1TUBA 3LNMB 4TUYB 4W4LA 4B3SB 3BVOA 1L0LH 3QG5A 5LGNA 2VQFO 4FVMA 5B5EZ 4JI2B 2M7WA 2Q9LA 4JI7O 2E75B 2GHYA 1WB8A 1NTMH 2W0FC 1K3EA 1SS3A 4LCUC 1R3KC 3E8HA 3SYCA 1YTFD 1M56C 2ADPA 2ETNA 4Q6GA 2UU9B 1BZKA 5LBQA 2QDOA 4U7OA 1S77D 4FLWA 4I50A 1JFFB 4TV9B 1E1RG 1W2BU 1EM1A 3CCJV 1CPYA 1NBMG 3H1KH 3CCVV 3HR0A 3T2MA 3E86A 4JYBA 1NVPB 3CCLV 3L70H 1K33A 4JI7B 2JK5C 2BOCC 2WA3A 2Q4PA 1NT2B 2WLHA 4ZKIA 2KG7B 4LH7A 3LSQA 4NKGB 2ITCC 4NTXA 1V55C 1G8MA 2PGGA 2HP8A 4DV0B 1N34B 4UB6Z 4JI5O 1QHTA 2CTQA 1SQFA 1ZAUA 3CB2A 1VQMV 3F5WC 1OHHG 3G71V 3FB7C 4TV8B 3L71H 1N36B 3KCXA 4JI1B 5KA6A 4B3RO 1IXMA 5IY5B 4LF6O 2IU3A 3FB5C 4KXRA 4PA6A 1L1FA 4QNHB 2YXYA 3SYQA 3IAYA 1GM9A 5EIBC 4BIZA 3AG3C 4TT3G 4KL1A 4JI6B 1IXBA 3X2QB 2XAGA 1BGYH 4R7CA 1SESA 3K08A 4MVOA 1KU9A 1MNGA 2ZR3A 2EILC 1RFYA 2R72A 3LNNA 1B06A 3A0HZ 3STZC 4WBNB 2P67A 3OFNG 1OCRB 1VQKV 3H01A 5BR8O 2VRZA 4LF5B 5K1PA 4B3MO 2QM7A 4I9WA 4YY3B 1S3JA 5EC1C 3WFVA 5LYJA 1QQCA 4KFMA 1M57B 3ZX6A 5IYZA 1TA8A 1XI1A 1ZL8B 4DR4B 3ABMB 5L3DA 2CTPA 4IGGA 3SJBC 5BY1A 1M4UA 2WLMA 4DV0O 1GN6A 2HJDA 2E5LO 1IBLB 3RN4A 4WFAV 3JCUZ 2GUZB 4IIJB 4J9YB 2WPDG 1N33B 4E4EA 5DN6G 1QLEB 3UM7A 4X8AA 1GO3F 4K8XA 4WCEV 3ASOB 3CE2A 5LMNB 1PNLA 4DR6B 2YS8A 1HP8A 2B1IA 1I5YA
chains in the Genus database with same CATH topology
1TUEB 2Q6AA 2X6AA 4JASA 2ZXWB 5B1AB 3RVZA 1FXKA 4MTFA 5BZBA 3SPCA 3QO7A 1N8RW 4CZZA 1MG1A 4MVQA 1PNMA 4HYOA 4PA7A 3ASOC 5L3GA 5J9PC 1K9MW 3LSSA 5FL7G 1PKXA 5KUKA 1K34A 2EZOA 1DF4A 1ENVA 1GKFA 2EJRA 3QNEA 5IDJA 2K1EA 3OR7C 1VQLV 1OCZC 4XDJA 4LP8A 1S5HC 2B5UA 3OM3B 1H38A 4MS2A 3CYOA 1VQ9V 3JD0A 1M90W 4RUEA 3M99B 4F4LA 1QR9A 3JYCA 2OCCC 4PDMA 1M9NA 2UXXA 1THZA 1VQ6V 3ZRXA 2LFSA 3B8MA 3KG2A 1QR8A 4DO2A 5H9CA 1E1QG 1Y4MA 2ITDC 3ZN1A 4XDLA 2ZDIC 1SERA 4HAMA 3W7WA 1JOYA 2DWEC 3MD0A 4GX5A 4JAVA 2PI4A 4WFEA 2BOBC 2OTLV 2AHYA 4FK5C 4UVBA 3WG7C 4P30A 4FMTA 2Y69C 2QA4V 3P32A 3AG4C 1GK9A 2X0LA 2JEXA 3OEHG 1CEZA 3ZCCA 3AG2B 1KECA 3W7UA 3EFFK 2YEVA 1QCEA 3E8FA 2EILB 5E1AC 4QJFB 4GCZA 1FFTB 4PDVA 3T4DA 4TWKA 1RM1B 4RO2A 2NLJC 3ZMSA 3VOUA 1FXKC 4WFGA 2EIKB 2OT5A 3IFXA 1YJNV 2A9HA 2JDIG 3K03A 2DYSC 1VQPV 1K4CC 1I5XA 4JF3A 2DQ3A 1K5SA 1ZWIC 1K4DC 1R6NA 4LBEC 1GMGA 4CBCA 3ABLC 1J95A 1EBOA 5IYCO 3EHBB 4UUJC 1OCOC 2C2AA 2EINC 3ABTA 3PJSK 4MW3A 1DTOA 2EIMB 3CPWU 3E83A 1QVFU 5CN0A 3I55V 3ZRWA 2XNDG 3HB3B 1V54B 3ASNB 2OTJV 3CCMV 3ABMC 1W0JG 2XAHA 2WLIA 4TSFG 1QLNA 4JTAB 2WLKA 3BEHA 1ROPA 2IU0A 5DM6V 2Q68A 1MABG 2H94A 5IYDO 2ZR2A 3FKSG 1I5YA 5IYBO 3ASNC 1V54C 3ETDA 3F7YC 3K3WA 2HFEC 3OAAG 4ASUG 1R3IC 4BW5A 1YTFB 4YXWG 2JIZG 1Q82W 2KB1A 2WWWA 3ZJZA 5LHGA 1AJNA 3FYIB 4MW8A 4QE7A 5CBGA 1RPRA 4JPRA 1F51A 4KUMA 2HVJC 1YJ9V 1JVMA 1Q81W 3OGCC 4FJCC 3FB8C 3UKMA 2LP7A 4GT1A 3OR6C 2AHZA 4E2LA 1BHAA 5EC2C 3ETGA 2PI5A 1AI6A 4PA9A 2EIJC 3CCSV 3E89A 2D3OW 3SYPA 1EZJA 2WLIB 4RAIA 3ABKB 3SPJA 2JJ2G 5KA5A 2WSSG 3JCZA 2W6JG 5B1BB 4QPJA 5KUMA 3RVYA 4RUFA 3I56V 2HLDG 1M56B 1YSCA 1JCHA 1NH2D 1OCCB 4MVZA 4RQFA 1H8EG 3AG4B 1K73W 5EK0A 4H37A 5L3BA 5HFMA 4GX2A 1NJIW 1SETA 5B1BC 1OCRC 3STLC 2R9RB 2EBOA 4MSWC 2DWDC 2QM8A 3T4ZA 1QVGU 1NQTA 2QKSA 1PNKA 1OCCC 2IJHA 4JTCB 3CD6V 3D36A 2X6BA 2XAQA 1VQ5V 1FXKB 4Z1MG 2EIKC 4JYCA 4MTOA 4DXWA 3ZMZA 5LHHA 3CMAV 1DLBA 4R8CA 4PELA 2Q67A 1R6KA 1H2GA 1CP9A 5C93A 3CCRV 4X89A 3QO8A 3E2EA 3AEIA 2Q69A 4WFBV 3FYEB 3SPGA 1GM8A 5EBLC 1LNQA 1WPXA 2HG5C 3ZMVA 2W6IG 2WLLA 2WLLB 3OUFA 2EIMC 5B1NA 1R3LC 3LDCA 1NKDA 4QPKA 4GX0A 2ZD9A 2IH1C 1JJ2U 1AI4A 1AI7A 3G6EV 3JD3A 5EBWC 1XL4A 1RPOA 1BL8A 1AJQA 2YEVB 3OMNB 1QBZA 1K5QA 3JD2A 2DYSB 3ZMTA 4BIUA 3SPIA 3ZN0A 4BAYA 1VQ4V 3E35A 1M57C 4FIPC 3CMEV 4UVCA 2H8PC 3P30A 4G27B 4XBFA 2ZXWC 1Y66A 4HZ3A 3LDDA 3K0DA 1WLEA 2DYRC 3BY6A 2QEXV 2F43G 3F7VC 1S76D 1MSWD 3B77A 2UXNA 4N21A 3W7XA 2Z3YA 1QLEC 2LFRA 2NNUA 4X88A 5CBHA 1KD1W 4QIWF 3ML0A 3QO5A 1W0KG 2WLJA 3CXCU 3AG1C 2P7TC 4UVAA 3CC4V 1YI2V 1M1KW 2IJIA 1K97A 1F4MA 2P6JA 4PDLA 2JJ1G 4I5SA 5LHIA 2X7RB 3TETA 5L3CA 2DW4A 1YJWV 2XAFA 3RBZA 2R9IA 3CP1A 4WFHA 3K0GA 2ZQMA 2V1DA 2A0LA 4H33A 3K9AA 3LNMB 2HJFC 4MVUA 1KKDA 2V7QG 1GM7A 1G4YB 5LGNA 3IC7A 3RW0A 5CBFA 3W7SA 3DTUB 5B1OA 2IW5A 1YHQV 5HFLA 1DF5A 1VQOV 2M7WA 2GHYA 3D3IA 1K92A 2W0FC 1K3EA 3T1CA 4LCUC 4QE9A 1R3KC 1JX9A 3E8HA 4P9PA 1HWYA 3SYCA 1YTFD 4LC1A 1M56C 3R65A 2ZDIA 1GTOA 1KP2A 5LBQA 1VQ8V 2HR3A 4U7OA 1F23A 1MOFA 5L3FA 3OW2U 1S77D 2WAMA 3ZRVA 3LDEA 1UJWB 4R50A 1P4RA 3ABUA 2XOKG 3NXSA 4ZBMA 2P90A 5L3EA 4N23A 3GB7C 1E1RG 1W2BU 1AROP 2ATKC 2B1GA 2MK3A 4JTDB 2DQ0A 3CCJV 5H6RA 1CPYA 3ETEA 5CA3A 1NBMG 5GW7A 2XAJA 3CCVV 2HKOA 4KP4A 1YITV 2IH3C 3E86A 4JYBA 1F4NA 3OUSA 5H6QA 3T2MA 3E8GA 1NVPB 3CCLV 1V55B 1R73A 3SPHA 1K33A 3OE7G 2JK5C 2BOCC 2WLNA 1S72V 1KQSU 4WF9V 4WFFA 2WLHA 4ZKIA 3GWOA 4G28B 3E8BA 4GX1A 4PA3A 3LSQA 5B3SC 4P9OA 1Q86W 2ITCC 2QE7G 1AI5A 1FXVA 1V55C 1G8MA 3ZIAG 4RQEA 2Z5UA 4MTGA 4UV9A 3CC7V 4PA4A 4PDRA 1OCOB 4MVMA 1XL6A 1VQMV 3F5WC 2FTKA 1OHHG 3G71V 5EBMC 4UXNA 3FB7C 3SJQC 3VBBA 1BHBA 5IY5C 1JQ0A 3LUTB 3SYOA 4JAUA 3B8NA 3A0RA 2DYRB 3TK1A 3TCUA 5KA6A 4EKWA 2EIJB 1IXMA 4OXSA 4L87A 2Y48A 2XASA 1BMFG 2CK3G 4UV8A 5B1AC 5IY5B 3CCEV 1YIJV 2IU3A 2OCCB 2HVKC 3FB5C 3CCUV 4P2ZA 3JD4A 3MHHC 4JGSA 1PL0A 4PA6A 3ZRSA 3AG1B 1KC8W 1K8AW 1NR7A 1L1FA 4MTXA 1OCZB 4QNHB 3SYQA 1SZTA 1GM9A 1OZ0A 4BIZA 3AG3C 4TT3G 3OMIB 4MVSA 3X2QB 5LGTA 1P7BA 4Q20A 4R6ZA 2XAGA 4R7CA 1K7DA 3ABKC 1SESA 3K08A 1AJPA 4MVOA 3FB6C 1PD3A 1FXHA 1KP3A 3AG2C 4FPPA 2ZR3A 3K79A 2EILC 3AG3B 1RM1C 4MT8A 3X2QC 2IJJA 1B6QA 2YSUB 3HPLC 3STZC 3JD1A 2GSMB 2IJKA 3OEEG 2P67A 3OFNG 3ZMUA 1VQ7V 1OCRB 1VQKV 3H01A 3ZRWB 1FS0G 3WG7B 1ORQC 1Q7YW 1VQNV 2Y69B 2QM7A 4I9WA 1S3JA 1NR1A 5EC1C 4XDKA 3WFVA 1H8HG 2A79B 4KFMA 5B3SB 1M57B 4U7NA 4J9ZB 3IGAC 1JPXA 3ABMB 5L3DA 1NVPD 2JEUA 1E79G 2WLMA 1S0VA 4WFAV 3SYAA 4J9YB 3DGEA 4MVRA 2WPDG 5DN6G 1QLEB 3CCQV 1R3JC 3ABLB 3CC2V 3W7TA 2QTOA 3UM7A 4X8AA 3MHSC 2EZPA 5LGUA 2EINB 1GO3F 5CMUA 3G4SV 1NH2B 1AR1B 4WCEV 3ASOB 3K04A 4G2KA 1COWG 1EFRG 1PNLA 3K06A 3OMAB 2B1IA 1SRYA 2X6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q6A A;  2X6A A;  2HFE C;  3ASN C;  1QLE C;  3F7Y C;  3RVZ A;  3LUT B;  3SYO A;  5IY5 C;  1R3I C;  4MTF A;  4BW5 A;  3SPC A;  4X88 A;  5BZB A;  5CBH A;  3TCU A;  4MVQ A;  4PA7 A;  4HYO A;  3ASO C;  4EKW A;  2WLJ A;  5J9P C;  2KB1 A;  2P7T C;  3AG1 C;  4OXS A;  3ZJZ A;  4MW8 A;  4QE7 A;  5KUK A;  5CBG A;  5B1A C;  2HVJ C;  1JVM A;  3OGC C;  3FB8 C;  3UKM A;  2K1E A;  3OR7 C;  4PDL A;  3FB5 C;  2HVK C;  1OCZ C;  4P2Z A;  3OR6 C;  3TET A;  4XDJ A;  4PA6 A;  4LP8 A;  1S5H C;  5EC2 C;  3RBZ A;  3ZRS A;  4PA9 A;  4WFH A;  2EIJ C;  3K0G A;  3E89 A;  4MS2 A;  3SYP A;  2A0L A;  4H33 A;  3LNM B;  2HJF C;  4MVU A;  4RUE A;  4F4L A;  1KKD A;  2WLI B;  4RAI A;  3SPJ A;  1G4Y B;  3JYC A;  2OCC C;  4PDM A;  4QNH B;  3SYQ A;  3RVY A;  5KUM A;  3RW0 A;  5CBF A;  4RUF A;  3KG2 A;  3AG3 C;  4MVS A;  2ITD C;  1P7B A;  4R6Z A;  4XDL A;  4MVZ A;  4R7C A;  2W0F C;  5EK0 A;  3ABK C;  4H37 A;  3T1C A;  4LCU C;  3K08 A;  4MVO A;  2DWE C;  3FB6 C;  1R3K C;  4GX2 A;  3E8H A;  4GX5 A;  4P9P A;  4QE9 A;  3AG2 C;  4WFE A;  1OCR C;  5B1B C;  3STL C;  2R9R B;  2BOB C;  2AHY A;  4MSW C;  3SYC A;  2DWD C;  3T4Z A;  2EIL C;  1M56 C;  3WG7 C;  3R65 A;  4P30 A;  2QKS A;  1OCC C;  2Y69 C;  3X2Q C;  3HPL C;  4JTC B;  3STZ C;  2X6B A;  3AG4 C;  2EIK C;  4MTO A;  4DXW A;  3LDE A;  4R8C A;  4R50 A;  2Q67 A;  3EFF K;  2YEV A;  4ZBM A;  3E8F A;  5E1A C;  1ORQ C;  3T4D A;  3GB7 C;  4PDV A;  4TWK A;  4X89 A;  2ATK C;  4RO2 A;  4I9W A;  2NLJ C;  2Q69 A;  4JTD B;  3VOU A;  4WFG A;  3SPG A;  3IFX A;  5EBL C;  1LNQ A;  2HG5 C;  4XDK A;  5EC1 C;  2WLL A;  3OUF A;  2WLL B;  2A9H A;  2EIM C;  3K03 A;  2A79 B;  4KFM A;  1R3L C;  2DYS C;  2IH3 C;  3LDC A;  4GX0 A;  1K4C C;  2ZD9 A;  3E86 A;  3OUS A;  3T2M A;  2IH1 C;  3E8G A;  3SPH A;  1ZWI C;  1K4D C;  4J9Z B;  2JK5 C;  2BOC C;  2WLN A;  3IGA C;  4LBE C;  4CBC A;  3ABL C;  1J95 A;  5EBW C;  4WFF A;  2WLH A;  1XL4 A;  4UUJ C;  2WLM A;  1OCO C;  1BL8 A;  2EIN C;  3PJS K;  4G28 B;  4MW3 A;  3E8B A;  4GX1 A;  4PA3 A;  5B3S C;  3SPI A;  4P9O A;  3E83 A;  3SYA A;  1M57 C;  2ITC C;  4J9Y B;  1V55 C;  4MVR A;  2H8P C;  4G27 B;  3ABM C;  2ZXW C;  1R3J C;  4HZ3 A;  3LDD A;  2QTO A;  4MTG A;  2WLI A;  3K0D A;  4PA4 A;  4X8A A;  3UM7 A;  2DYR C;  4PDR A;  4MVM A;  3F7V C;  1XL6 A;  4JTA B;  2WLK A;  3BEH A;  3F5W C;  2Q68 A;  3K04 A;  5EBM C;  3K06 A;  3FB7 C;  3SJQ C;  2AHZ A;  1V54 C;  2X6C A; 
#chains in the Genus database with same CATH topology
 1TUE B;  2Q6A A;  5B1A B;  2ZXW B;  4B3M B;  1G6U A;  1N4C A;  3APO A;  4CZZ A;  4K0K O;  4NXN O;  1XQ8 A;  2EUL A;  1XEQ A;  1K9M W;  5FL7 G;  1BE3 H;  5ITZ B;  1K34 A;  1URF A;  2ZE5 A;  3JAR B;  1GKF A;  2EJR A;  2Q7H A;  2K1E A;  1Q8I A;  5JWP A;  2B5U A;  4ZHQ B;  1H38 A;  3ZHS A;  4GUN A;  4DUY B;  5EIB D;  4X1I B;  2F4V B;  5KLV H;  4X1Y B;  2QWR B;  1L0N H;  2JS3 A;  5H9C A;  3ZN1 A;  4XDL A;  1PP9 H;  1AR5 A;  3W7W A;  2RQ6 A;  1Q90 D;  4GX5 A;  5BMV A;  2PI4 A;  1SA0 B;  1JMK C;  4PI0 A;  5LL6 Y;  4FMT A;  2QA4 V;  2JEX A;  3BHP A;  2EIL B;  4GCZ A;  4AI8 A;  1Q5O A;  4PDV A;  3T4D A;  3IJ4 A;  4O4L B;  3A8T A;  5EZY B;  1R6T A;  4WFG A;  3RYF B;  2EIK B;  2YXL A;  3N2K B;  1WA8 A;  3AG7 A;  2HHH B;  2ZM6 O;  1K5S A;  2ZE8 A;  1R6N A;  4CBC A;  1I7F A;  4DR7 B;  2EIN C;  4B3S O;  4EFE A;  2Z0A A;  3CJH B;  5KMG B;  3BA8 A;  2VQE O;  2QJ1 A;  3HB3 B;  1V54 B;  3RYH B;  2VWJ A;  3ABM C;  1KKC A;  2XAH A;  3AK1 A;  3TJT A;  2N74 A;  3K5N A;  4Z1V A;  4YJ2 A;  2IU0 A;  4EB6 B;  4I50 B;  5F2V O;  3B4S A;  4LFA O;  2ZR2 A;  1HDJ A;  2AW9 A;  3ASN C;  3F7Y C;  4DK1 A;  2NR5 A;  5ITZ A;  5LXT B;  2CTR A;  1R3I C;  2ZIM A;  5GTH Z;  3THO A;  2PY5 A;  3RT3 C;  4X64 B;  1H2S B;  5LHG A;  1AJN A;  4QE7 A;  4UCT A;  1YJ9 V;  3UKM A;  2LP7 A;  5IJ9 A;  1TVK A;  4FZ0 A;  3SYP A;  1EZJ A;  4NB5 A;  2HHH O;  4CS4 A;  3ABK B;  1VIB A;  2JJ2 G;  1H2L A;  5KA5 A;  2BTQ A;  2WSS G;  2CUG A;  2ZNJ A;  4QPJ A;  4TV9 A;  2HLD G;  3CRM A;  1HR0 B;  4MVZ A;  1FPO A;  1NI8 A;  1H8E G;  4H37 A;  5HFM A;  3BRC A;  2VQE B;  4ZHQ A;  1OCR C;  5K1X A;  2R9R B;  3T4Z A;  1NQT A;  1SQB H;  2A06 H;  1XDC A;  2QKS A;  3HKE B;  5FNV B;  1VF6 C;  2IJH A;  3LSU A;  4JTC B;  1HNX B;  1FYJ A;  1WB7 A;  2XAQ A;  1FXK B;  2YIB A;  5LHH A;  4LFB O;  1R6K A;  1H2G A;  4JI1 O;  5C93 A;  3CCR V;  3QO8 A;  2OCH A;  1VF6 A;  3E2E A;  2Q69 A;  2YUA A;  2HG5 C;  3OUF A;  2EIM C;  3OD4 A;  4JI0 B;  1P84 F;  1R3L C;  4JZ2 A;  1NKD A;  2PZS A;  2IH1 C;  3QVN A;  1IUR A;  4O4I A;  4GKK O;  3L72 H;  2K9P A;  3K57 A;  1AJQ A;  3OMN B;  4BIU A;  3SPI A;  4NXM O;  1T5E A;  3E35 A;  3CME V;  4XBF A;  2ZXW C;  4JI8 O;  4JYA O;  4DUZ B;  3IC9 A;  3K0D A;  1WLE A;  1M5I A;  2DYR C;  3BY6 A;  4DV4 O;  2QEX V;  1SQV H;  2AZ0 A;  1XNR B;  1MSW D;  2UUA O;  3RYC B;  3ZHV A;  4DV6 B;  1TGO A;  4PI2 A;  4X62 O;  3CS5 A;  2NNU A;  4X88 A;  3D8C A;  4IT5 A;  2CAZ C;  1KD1 W;  1ZTE A;  4I4T A;  2WLJ A;  3CXC U;  4W4K A;  3AG1 C;  2P7T C;  5CA1 A;  3CC4 V;  1YI2 V;  1K97 A;  5KAI Z;  3S3X A;  4LF9 O;  5LHI A;  2E3C A;  2QWQ B;  4U3F H;  3CP1 A;  3RWR D;  3UQ8 A;  4X1K B;  1Z5W A;  2V1D A;  1ZL8 A;  1SF9 A;  2L35 A;  2Q0O C;  3K9A A;  2HJF C;  4I7Z B;  2V7Q G;  5TIS Z;  4O4H B;  3RW0 A;  5D5Q A;  5B1O A;  3JAK B;  1DF5 A;  1VQO V;  4LNU A;  1IX9 A;  3D3I A;  1JX9 A;  1Z5V A;  5IYZ B;  4LC1 A;  3R65 A;  2ZDI A;  1FKA O;  1VQ8 V;  2HR3 A;  1SQQ H;  1F23 A;  5L3F A;  3OW2 U;  4J7Z A;  3ZRV A;  4LF9 B;  1P4R A;  2F66 C;  2XOK G;  2P90 A;  3K5O A;  3L9D A;  2ATK C;  4H0L B;  1AR4 A;  3ETE A;  5CA3 A;  2JVD A;  4DV7 O;  5GW7 A;  2XAJ A;  3FAV B;  2ZM6 B;  4DK0 A;  1WNS A;  1P7G A;  3E8G A;  3SPH A;  1V55 B;  1R73 A;  4TQF A;  2QKA A;  4U3J B;  4WF9 V;  4CC6 A;  1HW7 A;  3UT5 B;  4PA3 A;  4DYL A;  4DUZ O;  4IYI A;  3P3P A;  3E22 B;  1Q86 W;  1FFX A;  2ADQ B;  5H5N A;  3ZIA G;  2QWN B;  3BA9 A;  4MTG A;  1Y76 B;  1OCO B;  4MVM A;  1IZ3 A;  4PDR A;  3BPZ A;  3SJQ C;  1BHB A;  2A3Q A;  5GTI Z;  3SYO A;  2KSD A;  1G1X B;  3CSX A;  3TK1 A;  5IWA B;  5FLX N;  4EKW A;  2E74 B;  2EIJ B;  4OXS A;  4UV8 A;  1YIJ V;  5B1A C;  2Y4U A;  3RGB A;  3L74 H;  2HVK C;  3CCU V;  3JD4 A;  1YVW A;  2UUB B;  4IL6 Z;  4EFB A;  4O4H A;  4DV3 B;  3JAR A;  5A2Q N;  4UCO A;  3H1H H;  4MTX A;  3APQ A;  1ZLZ A;  2B9Z A;  3B2E E;  3OMI B;  4MVS A;  5LGT A;  3CRA A;  4Q20 A;  4R6Z A;  4GZR B;  5KHK A;  5JJN B;  3FB6 C;  1PD3 A;  1KP3 A;  4FPP A;  4O2A B;  4X66 O;  4DR1 O;  1I94 O;  1O9G A;  3JSL A;  1RM1 C;  3CRC A;  1B6Q A;  2AXT Z;  4PV1 B;  1US6 A;  3OEE G;  3ZMU A;  1AP5 A;  1QNM A;  5LP6 B;  1FS0 G;  2CH7 B;  5IJ9 B;  2QM4 A;  3QF7 A;  4GYC B;  1VQN V;  2Y69 B;  4J42 A;  5IWA O;  4KHP B;  3JAL B;  5LYJ B;  2A79 B;  2QTS A;  5B3S B;  3JAS B;  2JGD B;  4U7N A;  3BCC H;  3IGA C;  1NVP D;  4OGQ B;  4J7K A;  2E5L B;  3F5T A;  3NR7 A;  1P49 A;  4BW9 A;  3HKE A;  3CCQ V;  2EZP A;  2EIN B;  5CMU A;  2P06 A;  3G4S V;  3Q4H B;  1NH2 B;  1FJG B;  1COW G;  3SDL A;  3OMA B;  4OX9 O;  2M6Y A;  1SRY A;  4FFB A;  4JAS A;  4EEQ A;  2UXC O;  5JQG B;  1FXK A;  3A0B Z;  3SPC A;  3QO7 A;  3ZBH A;  4FZ1 A;  1MG1 A;  3RYI A;  4HYO A;  5L3G A;  5J9P C;  1RSO A;  1PKX A;  2YIB D;  5JH7 A;  3KKY A;  5AG2 A;  2EZO A;  1MSD A;  4O4I B;  1VQL V;  1NU1 H;  4O2B A;  4B3R B;  2YDE A;  2QKC A;  1GN3 A;  4JI5 B;  1S5H C;  3OM3 B;  1Q6H A;  3JD0 A;  3M99 B;  4F4L A;  4X1I A;  3N2G A;  3SR2 C;  4PDM A;  2QWO B;  2UXX A;  3C3T A;  1XNR O;  2LFS A;  3KG2 A;  1E1Q G;  2ITD C;  3L73 H;  2ZDI C;  1N33 O;  2LW7 A;  1JOY A;  1Q6I A;  4WFE A;  3C3S A;  2OTL V;  5KX5 B;  4FK5 C;  4P30 A;  4F6R B;  3U0Z A;  3VQX A;  2YI8 A;  3P32 A;  4YHH O;  4A5U B;  1GK9 A;  2X0L A;  2KKW A;  3J81 N;  1HNW B;  2PYJ A;  1MZF A;  1FJG O;  1CEZ A;  2RJZ A;  1KEC A;  3E8F A;  5E1A C;  1RM1 B;  4RO2 A;  3AK2 A;  3ZMS A;  3VOU A;  1FAF A;  4DV3 O;  1VEW A;  1YZB A;  2OT5 A;  3IFX A;  3K03 A;  2D2C B;  1VQP V;  3TGU H;  2WA4 A;  1K4D C;  4LR3 A;  3ABL C;  5H2F Z;  3EHB B;  5IJ0 B;  1OCO C;  4CH4 A;  5LP6 A;  2EIM B;  3O9O A;  4D6T H;  3E83 A;  1B04 A;  3ZRW A;  2XND G;  4B08 A;  3JAL A;  4DV6 O;  2WLI A;  2KG7 A;  1Q43 A;  4DV5 O;  5DM6 V;  1MAB G;  3D36 C;  3OAA G;  4CC5 A;  3H1L H;  4X20 B;  2JIZ G;  4UB8 Z;  1Q82 W;  1IBM O;  4MW8 A;  5CBG A;  4TV8 A;  2HVJ C;  4FJC C;  5D5P A;  4GT1 A;  4I4T B;  3OR6 C;  2XHB A;  5E79 Z;  4RWU A;  1AI6 A;  3E89 A;  2PYL A;  2FYU H;  1JA8 A;  3FX7 A;  5CA0 A;  5B1B B;  5KUM A;  4LFC B;  3E22 A;  1MMM A;  4DR5 O;  1NH2 D;  1WN7 A;  2GV9 A;  4RQF A;  4O4J B;  2QR4 A;  4I55 B;  1CXZ B;  4GX2 A;  1NJI W;  2ZKO A;  2ARH A;  1XUQ A;  2DWD C;  3M7M X;  1QVG U;  3OTO O;  1OCC C;  5FNV A;  3CD6 V;  1VQ5 V;  4Z1M G;  4JYC A;  4MTO A;  3CMA V;  4LF4 B;  1DLB A;  4R8C A;  4JI3 B;  3RFR A;  4TOI A;  3N27 A;  2PF4 E;  1GM8 A;  1AIL A;  1L8D A;  2YIA A;  3HKB A;  2WLL A;  1D2D A;  2ZD9 A;  4JI0 O;  1YDX A;  1JJ2 U;  4PD4 F;  2A7W A;  3JD3 A;  3MAQ A;  2UU9 O;  1DGS A;  1YEW A;  1ZUQ A;  1IBM B;  2YC0 A;  1QBZ A;  3ZMT A;  5KHG A;  5CB4 A;  4NXM B;  4UVC A;  2H8P C;  3P30 A;  1WA8 B;  4HZ3 A;  3VQW A;  4GLX A;  3WB1 A;  2F43 G;  1S76 D;  3WB0 A;  4JI3 O;  2UXN A;  4N21 A;  2Z3Y A;  4ZI7 B;  1Y76 A;  3U11 A;  4JZG A;  4WBN A;  3T1H B;  3P3N A;  3ML0 A;  4UVA A;  2F1M A;  1M1K W;  2IJI A;  5LA6 B;  1F4M A;  2P6J A;  1PM9 A;  2DW4 A;  1YJW V;  2R9I A;  2ZQM A;  4H33 A;  3G80 A;  4K3A A;  1KKD A;  2DMX A;  4MVU A;  4TUY A;  1GM7 A;  3OTF A;  5J2T B;  1GAX A;  2Y4T A;  4IHJ A;  3IC7 A;  4LF7 O;  3W7S A;  5CBF A;  3DTU B;  1QU7 A;  2IW5 A;  1YHQ V;  2GUZ A;  1VP7 A;  1K92 A;  3T1C A;  1GN2 A;  1W59 A;  3T1H O;  3CWB H;  1GTO A;  4YHH B;  4D7S A;  5JQG A;  1VMG A;  2OWO A;  3LDE A;  1UJW B;  4R50 A;  4LF8 O;  3ABU A;  3HKB B;  4ZBM A;  5L3E A;  3GB7 C;  5JH7 B;  1ARO P;  2FML A;  2B1G A;  4JTD B;  2DQ0 A;  4NXN B;  5H6R A;  1LR1 A;  3EVK A;  4KP4 A;  1YIT V;  2IH3 C;  2RMK B;  1F4N A;  4CH3 A;  2FB5 A;  5H6Q A;  4JI4 O;  3GWK C;  3JAT A;  3M8A A;  3SJA C;  1S72 V;  3RYF A;  2RNB A;  1WJZ A;  3GWO A;  3E8B A;  4GX1 A;  3O65 A;  5B3S C;  1XHZ A;  4P9O A;  1ZX3 A;  2QE7 G;  1FXV A;  4L8J A;  4RQE A;  4F6R A;  1IBL O;  2Z5U A;  4UV9 A;  3CC7 V;  4PA4 A;  2N05 A;  1AVM A;  2RN9 A;  1N32 O;  5A9G A;  1SKV A;  4Z2W A;  5EBM C;  4UXN A;  1J5E O;  3VBB A;  3FFQ A;  4OPH A;  1JQ0 A;  3LUT B;  3B8N A;  3A0R A;  5LA6 A;  3TCU A;  1KMI Z;  4ZOL B;  5IT9 N;  5DEC A;  2Y48 A;  2XAS A;  2R70 A;  2CK3 G;  1HR0 O;  3C90 A;  4P2Z A;  3UT5 A;  4JGS A;  1PL0 A;  3ZRS A;  1WAZ A;  1D5A A;  3CRR A;  1K8A W;  2EJ7 A;  4YY3 O;  2BSK B;  1BQ0 A;  4OPA A;  4LWS B;  1X4T A;  4DR2 B;  4LFC O;  5JJE B;  1SZT A;  2V4D A;  5KMG A;  1IDS A;  4H13 B;  1K7D A;  3ABK C;  1FXH A;  4YJ2 B;  4X66 B;  5JJJ B;  4UCS A;  5FPR A;  2IJJ A;  2YSU B;  3HPL C;  2GSM B;  2IJK A;  3EXA A;  1WP8 A;  1KB9 F;  1VQ7 V;  3ZRW B;  4CH6 A;  2CH7 A;  1ORQ C;  4LNU B;  1Q7Y W;  1A32 A;  3H1J H;  2CGN A;  2GDS A;  4XDK A;  1H8H G;  2ZT9 B;  1X59 A;  1TVK B;  3PN1 A;  2PTM A;  3OGI B;  4J9Z B;  2VQF B;  2JEU A;  1E79 G;  1XNQ O;  4LH6 A;  1S0V A;  3SYA A;  4KHP O;  3HKD A;  1Y74 A;  3DGE A;  4MVR A;  4LFA B;  5J2T A;  1R3J C;  3ABL B;  3W7T A;  3OT7 A;  3MHS C;  5LGU A;  1VF5 B;  1U97 A;  3MDS A;  2Y0I A;  1AR1 B;  3K04 A;  3J7A U;  4G2K A;  1EFR G;  3K06 A;  2AHZ A;  1N34 O;  3UO3 A;  3DXR B;  3VQY A;  4DW1 A;  3G6B A;  2P4V A;  3FD9 A;  3LSS A;  4X65 O;  3SJC C;  4O4J A;  1ENV A;  4BR6 A;  1OCZ C;  4DV2 O;  4AHC A;  4LP8 A;  3CXH F;  1VQ9 V;  3WB2 A;  5CB4 B;  4QGP A;  4RUE A;  1BQZ A;  2AZ2 A;  4DV7 B;  1NS1 A;  1QR9 A;  1M9N A;  3B40 A;  3Q4H A;  1THZ A;  1QR8 A;  5EYP A;  4ZIB A;  4FM2 A;  3JAW B;  2N04 A;  4HAM A;  2Q0A A;  2DWE C;  3MD0 A;  4JAV A;  2BOB C;  2AHY A;  4F6E A;  3WG7 C;  4NTY A;  3JAK A;  2JS5 A;  3ZS8 C;  2XTA A;  2Y69 C;  4DV4 B;  1PV0 A;  3AG4 C;  2OIG A;  3ZCC A;  3W7U A;  3EFF K;  2YEV A;  3B09 A;  1QCE A;  4QJF B;  2BTO A;  1IBK B;  1XIL A;  4HNA A;  4NR1 A;  2XT9 A;  4O2A A;  4LF7 B;  1I5X A;  1FFX B;  1ZWI C;  4LBE C;  1GMG A;  4JI8 B;  5IYC O;  2C2A A;  3ABT A;  3PJS K;  4MW3 A;  5CA1 B;  1UPG A;  2MW2 B;  2Q7G A;  1QVF U;  3I55 V;  2G38 A;  1W0J G;  4ABM A;  4TSF G;  5KHH A;  1QLN A;  4UCV A;  1M93 A;  1SQP H;  2IM9 A;  1O9H A;  3FKS G;  4X9Q A;  4JYA B;  2KQX A;  2BCC H;  4ASU G;  4X65 B;  4FLX A;  3TXQ A;  2HEP A;  1Q3E A;  2LJ2 A;  4X20 A;  1YF2 A;  3HKD B;  3KCY A;  1YCI A;  1EN5 A;  2WWW A;  1KYO F;  1RPR A;  1KBH A;  3FB8 C;  3VQV A;  1MZE A;  1TAE A;  2UXB O;  4E2L A;  3ETG A;  2PI5 A;  3CCS V;  1BCC H;  2EIJ C;  4FLU A;  2D3O W;  3JAT B;  5LOV A;  2LGW A;  2WLI B;  4RAI A;  2E76 B;  3RVY A;  2W6J G;  2ZE6 A;  3BFR A;  1S5J A;  3I56 V;  1YSC A;  1JCH A;  2LQT A;  1OCC B;  1HNZ B;  5LMN O;  3DC5 A;  2UXD B;  1K73 W;  5KHJ A;  5EK0 A;  5L3B A;  2Q5Z A;  5FPO A;  5B1B C;  2CGO A;  5LMU O;  3STL C;  3R66 A;  4MSW C;  4FLV A;  1PNK A;  3T1Y O;  2LGQ A;  3D36 A;  4ICG A;  2ILM A;  2X6B A;  4LF4 O;  4DXW A;  1R1B A;  4PEL A;  1Y67 A;  3RYC A;  1CP9 A;  3JAW A;  3S3W A;  1FD9 A;  3SPG A;  1GRJ A;  5EBL C;  1WPX A;  2BTQ B;  3ZMV A;  5CA0 B;  5LP6 C;  4QPK A;  4GX0 A;  1N36 O;  1EN4 A;  3G6E V;  1EN6 A;  3WU2 Z;  1XL4 A;  1RPO A;  3CRQ A;  2YEV B;  4DR2 O;  1K5Q A;  3JD2 A;  4B7K A;  5LMU B;  2ZE7 A;  1VQ4 V;  4FIP C;  4JYY A;  4G27 B;  5KHI A;  5JVD A;  4AIL C;  3LDD A;  4DV1 B;  2EX3 A;  4UFZ A;  4CS2 A;  3B77 A;  3W7X A;  1SZX A;  5IJ0 A;  2P5O A;  4DV5 B;  1UFI A;  2DE0 X;  3QO5 A;  1W0K G;  3K58 A;  1AP6 A;  5GON B;  2QWP B;  3N2K A;  3K5M A;  4PDL A;  2GBO A;  4I5S A;  2X7R B;  1SQG A;  3T1Y B;  2XAF A;  3RBZ A;  3K0G A;  2RCV A;  3H9V A;  2A0L A;  3AK3 A;  3ZHU A;  1SC5 B;  1G4Y B;  5BMV B;  2PUS A;  4FLT A;  1H2N A;  4DV1 O;  2UUC O;  5HFL A;  2O57 A;  4YJ3 A;  4I0X A;  4DR6 O;  5B66 Z;  3UCS C;  2NN4 A;  3G67 A;  4TQD A;  5DED A;  3ZHQ A;  4PJ0 Z;  4QE9 A;  4CS3 A;  4P9P A;  1HWY A;  2W0X A;  4FM1 A;  3K5L A;  4LFB B;  1KP2 A;  1XNQ B;  2GTS A;  1MOF A;  4JI4 B;  2WAM A;  3NXS A;  4N23 A;  1S5L Z;  2MK3 A;  2JGU A;  2HKO A;  3FAV A;  1YXB A;  3L75 H;  3OUS A;  1N32 B;  5C8Y A;  5J2U B;  3OE7 G;  2WLN A;  5EZY A;  1KQS U;  4WFF A;  2RDC A;  4J10 A;  4G28 B;  1EZV H;  3UO2 A;  4EB6 A;  1AI5 A;  4DW0 A;  5LOV B;  3ZED A;  1ZSP A;  4C7U A;  1OV9 A;  4JV5 B;  1XL6 A;  2FTK A;  4BIO A;  1Y74 B;  4FLZ A;  1J5E B;  2OIE A;  2ODM A;  3H1I H;  5IY5 C;  4JAU A;  2DYR B;  1XMQ B;  2L6L A;  2R9A A;  2UXC B;  2H3O A;  4DV2 B;  4L87 A;  3K9S A;  1BT8 A;  1BMF G;  3CCE V;  4HNA B;  1XMO O;  1GH6 A;  2OCC B;  2F23 A;  3MHH C;  1PL4 A;  3AG1 B;  4J41 A;  1NTZ H;  1KC8 W;  1NR7 A;  3CEI A;  1OCZ B;  4UCR A;  4YIP A;  1OZ0 A;  1GN4 A;  1P7B A;  5BR8 B;  3ZHT A;  1XBL A;  3D3Q A;  2YIC A;  4B7E A;  1AJP A;  2ZCE A;  2YXH A;  3AG2 C;  3K79 A;  3AG3 B;  3HKC B;  4MT8 A;  5JVD B;  3X2Q C;  4X1K A;  3JD1 A;  2VS0 A;  4YJ3 B;  3WG7 B;  5C8Y B;  5J2U A;  3QTC A;  4LWS A;  3CHX A;  2ZNI A;  1NR1 A;  1WPB A;  2LO1 A;  1RSO B;  4FLY A;  2OYQ A;  1Q6U A;  1JPX A;  3K59 A;  2UUB O;  3J80 N;  1D5N A;  5LXT A;  4X64 O;  3DSQ A;  4O2B B;  4NTW A;  1NZ6 A;  4H44 B;  1HNZ O;  1VF7 A;  3CC2 V;  2QTO A;  1V9P A;  3I5D A;  4GKJ B;  1VAR A;  1XHX A;  1Y6X A;  1WP7 A;  2X6C A;  2X6A A;  3RVZ A;  4MTF A;  5BZB A;  3ETQ A;  4JAA A;  1I94 B;  1N8R W;  4MVQ A;  1PNM A;  3A2F A;  4PA7 A;  3JAM N;  4BWA A;  3ASO C;  2JGD A;  1DK1 A;  5KUK A;  3U10 A;  1DF4 A;  3CX5 F;  3QNE A;  5IDJ A;  3OR7 C;  4GKK B;  4AQY B;  2CE4 A;  4XDJ A;  1SQX H;  4YIO A;  1MA1 A;  4MS2 A;  1BSM A;  3CYO A;  1M90 W;  5BXZ A;  4DUY O;  1XMO B;  1RP3 B;  4J7J A;  3JYC A;  2OCC C;  4ZOL A;  4I9Q A;  4X1Y A;  2ZIN A;  1VQ6 V;  3ZRX A;  3B8M A;  1H2M A;  1NTK H;  2Y0P A;  1LUW A;  3SGI A;  4DO2 A;  4JI2 O;  1Y4M A;  4J11 A;  4FFB B;  1SER A;  2FL4 A;  3DC6 A;  3DXR A;  3BAA A;  5KX5 A;  4UVB A;  4UCU A;  5KAF Z;  2BSK A;  3RYH A;  1XRE A;  5JCO C;  3GVM A;  2UUC B;  3OEH G;  2XUM A;  1N0J A;  1PPJ H;  3AG2 B;  4DR7 O;  4K0K B;  3OTO B;  1FFT B;  4TWK A;  4DRX B;  1JJO A;  2NLJ C;  2DJV A;  4FFK A;  2LW1 A;  1FXK C;  5GON A;  1H2K A;  3N2G B;  4JI6 O;  1TUB B;  1YJN V;  2A9H A;  2JDI G;  2DYS C;  2Q8V A;  2QGN A;  1K4C C;  4JF3 A;  2AGA A;  2Q7E A;  4ZI7 A;  2DQ3 A;  1J95 A;  1EBO A;  4UUJ C;  5JCO A;  4GKJ O;  1DTO A;  2GTA A;  3BAB A;  4J80 A;  4NYK A;  3CPW U;  5CN0 A;  3ASN B;  2OTJ V;  2UXD O;  4U3J A;  3CCM V;  4LF5 O;  3ICX A;  4FM0 A;  1I08 A;  4JTA B;  2WLK A;  3BEH A;  1ROP A;  2JRI A;  2Q68 A;  2H94 A;  5IYD O;  2ZIO A;  4B3T B;  1JFF A;  5IYB O;  1V54 C;  3ETD A;  3JSN A;  3K3W A;  2HFE C;  1XOU A;  4BW5 A;  1YTF B;  4YXW G;  2YID A;  4I0X B;  3HKC A;  2KB1 A;  3ZJZ A;  4K35 A;  3FYI B;  1HNW O;  4JPR A;  1F51 A;  4KUM A;  1JVM A;  1Q81 W;  3OGC C;  2UXB B;  2F95 B;  1BHA A;  5EC2 C;  3JAS A;  4PA9 A;  3KZI Z;  4K8Z A;  4DR3 B;  3SPJ A;  2FKX A;  3JCZ A;  4JV5 O;  4RUF A;  4IIJ A;  1M56 B;  2P22 C;  1SA0 A;  4DR4 O;  2VWK A;  2F4V O;  1OJH A;  3AG4 B;  4I55 A;  2DOS A;  2F93 B;  1SET A;  1XMQ O;  2EBO A;  2QM8 A;  4X62 B;  4PHZ A;  4O4L A;  1HNX O;  2EIK C;  4D7T A;  3ZMZ A;  2QSA A;  3RYI B;  2Q67 A;  5EYP B;  1BS3 A;  1N0N A;  4X89 A;  3AEI A;  2CTW A;  2YI9 A;  4WFB V;  3FYE B;  4DR1 B;  4DR3 O;  1LNQ A;  2P4K A;  2W6I G;  2WLL B;  5B1N A;  1F7Y A;  3TXS A;  3LDC A;  1IBK O;  4LF6 B;  1AI4 A;  1AI7 A;  1JR9 A;  3CJH A;  1IVS A;  2IBZ H;  2Q73 A;  1U96 A;  2BE3 A;  5EBW C;  1BL8 A;  2DYS B;  3ZHR A;  3ZN0 A;  4BAY A;  1M57 C;  1KUQ A;  5IE9 A;  1I0H A;  1Y66 A;  4NVP A;  4B3T O;  3F7V C;  4IHJ B;  4HBN A;  4OX9 B;  1QLE C;  2LFR A;  5CBH A;  4DR5 B;  4QIW F;  1AB3 A;  4IYH A;  4CH5 A;  2UUA B;  4AQY O;  4LF8 B;  2JJ1 G;  3TET A;  5L3C A;  1Z2G A;  1B3Q A;  4DRX A;  1LUV A;  4WFH A;  2DN9 A;  2CDY A;  1TUB A;  3LNM B;  4TUY B;  4W4L A;  4B3S B;  3BVO A;  1L0L H;  3QG5 A;  5LGN A;  2VQF O;  4FVM A;  5B5E Z;  4JI2 B;  2M7W A;  2Q9L A;  4JI7 O;  2E75 B;  2GHY A;  1WB8 A;  1NTM H;  2W0F C;  1K3E A;  1SS3 A;  4LCU C;  1R3K C;  3E8H A;  3SYC A;  1YTF D;  1M56 C;  2ADP A;  2ETN A;  4Q6G A;  2UU9 B;  1BZK A;  5LBQ A;  2QDO A;  4U7O A;  1S77 D;  4FLW A;  4I50 A;  1JFF B;  4TV9 B;  1E1R G;  1W2B U;  1EM1 A;  3CCJ V;  1CPY A;  1NBM G;  3H1K H;  3CCV V;  3HR0 A;  3T2M A;  3E86 A;  4JYB A;  1NVP B;  3CCL V;  3L70 H;  1K33 A;  4JI7 B;  2JK5 C;  2BOC C;  2WA3 A;  2Q4P A;  1NT2 B;  2WLH A;  4ZKI A;  2KG7 B;  4LH7 A;  3LSQ A;  4NKG B;  2ITC C;  4NTX A;  1V55 C;  1G8M A;  2PGG A;  2HP8 A;  4DV0 B;  1N34 B;  4UB6 Z;  4JI5 O;  1QHT A;  2CTQ A;  1SQF A;  1ZAU A;  3CB2 A;  1VQM V;  3F5W C;  1OHH G;  3G71 V;  3FB7 C;  4TV8 B;  3L71 H;  1N36 B;  3KCX A;  4JI1 B;  5KA6 A;  4B3R O;  1IXM A;  5IY5 B;  4LF6 O;  2IU3 A;  3FB5 C;  4KXR A;  4PA6 A;  1L1F A;  4QNH B;  2YXY A;  3SYQ A;  3IAY A;  1GM9 A;  5EIB C;  4BIZ A;  3AG3 C;  4TT3 G;  4KL1 A;  4JI6 B;  1IXB A;  3X2Q B;  2XAG A;  1BGY H;  4R7C A;  1SES A;  3K08 A;  4MVO A;  1KU9 A;  1MNG A;  2ZR3 A;  2EIL C;  1RFY A;  2R72 A;  3LNN A;  1B06 A;  3A0H Z;  3STZ C;  4WBN B;  2P67 A;  3OFN G;  1OCR B;  1VQK V;  3H01 A;  5BR8 O;  2VRZ A;  4LF5 B;  5K1P A;  4B3M O;  2QM7 A;  4I9W A;  4YY3 B;  1S3J A;  5EC1 C;  3WFV A;  5LYJ A;  1QQC A;  4KFM A;  1M57 B;  3ZX6 A;  5IYZ A;  1TA8 A;  1XI1 A;  1ZL8 B;  4DR4 B;  3ABM B;  5L3D A;  2CTP A;  4IGG A;  3SJB C;  5BY1 A;  1M4U A;  2WLM A;  4DV0 O;  1GN6 A;  2HJD A;  2E5L O;  1IBL B;  3RN4 A;  4WFA V;  3JCU Z;  2GUZ B;  4IIJ B;  4J9Y B;  2WPD G;  1N33 B;  4E4E A;  5DN6 G;  1QLE B;  3UM7 A;  4X8A A;  1GO3 F;  4K8X A;  4WCE V;  3ASO B;  3CE2 A;  5LMN B;  1PNL A;  4DR6 B;  2YS8 A;  1HP8 A;  2B1I A;  1I5Y A; 
#chains in the Genus database with same CATH homology
 1TUE B;  2Q6A A;  2X6A A;  4JAS A;  2ZXW B;  5B1A B;  3RVZ A;  1FXK A;  4MTF A;  5BZB A;  3SPC A;  3QO7 A;  1N8R W;  4CZZ A;  1MG1 A;  4MVQ A;  1PNM A;  4HYO A;  4PA7 A;  3ASO C;  5L3G A;  5J9P C;  1K9M W;  3LSS A;  5FL7 G;  1PKX A;  5KUK A;  1K34 A;  2EZO A;  1DF4 A;  1ENV A;  1GKF A;  2EJR A;  3QNE A;  5IDJ A;  2K1E A;  3OR7 C;  1VQL V;  1OCZ C;  4XDJ A;  4LP8 A;  1S5H C;  2B5U A;  3OM3 B;  1H38 A;  4MS2 A;  3CYO A;  1VQ9 V;  3JD0 A;  1M90 W;  4RUE A;  3M99 B;  4F4L A;  1QR9 A;  3JYC A;  2OCC C;  4PDM A;  1M9N A;  2UXX A;  1THZ A;  1VQ6 V;  3ZRX A;  2LFS A;  3B8M A;  3KG2 A;  1QR8 A;  4DO2 A;  5H9C A;  1E1Q G;  1Y4M A;  2ITD C;  3ZN1 A;  4XDL A;  2ZDI C;  1SER A;  4HAM A;  3W7W A;  1JOY A;  2DWE C;  3MD0 A;  4GX5 A;  4JAV A;  2PI4 A;  4WFE A;  2BOB C;  2OTL V;  2AHY A;  4FK5 C;  4UVB A;  3WG7 C;  4P30 A;  4FMT A;  2Y69 C;  2QA4 V;  3P32 A;  3AG4 C;  1GK9 A;  2X0L A;  2JEX A;  3OEH G;  1CEZ A;  3ZCC A;  3AG2 B;  1KEC A;  3W7U A;  3EFF K;  2YEV A;  1QCE A;  3E8F A;  2EIL B;  5E1A C;  4QJF B;  4GCZ A;  1FFT B;  4PDV A;  3T4D A;  4TWK A;  1RM1 B;  4RO2 A;  2NLJ C;  3ZMS A;  3VOU A;  1FXK C;  4WFG A;  2EIK B;  2OT5 A;  3IFX A;  1YJN V;  2A9H A;  2JDI G;  3K03 A;  2DYS C;  1VQP V;  1K4C C;  1I5X A;  4JF3 A;  2DQ3 A;  1K5S A;  1ZWI C;  1K4D C;  1R6N A;  4LBE C;  1GMG A;  4CBC A;  3ABL C;  1J95 A;  1EBO A;  5IYC O;  3EHB B;  4UUJ C;  1OCO C;  2C2A A;  2EIN C;  3ABT A;  3PJS K;  4MW3 A;  1DTO A;  2EIM B;  3CPW U;  3E83 A;  1QVF U;  5CN0 A;  3I55 V;  3ZRW A;  2XND G;  3HB3 B;  1V54 B;  3ASN B;  2OTJ V;  3CCM V;  3ABM C;  1W0J G;  2XAH A;  2WLI A;  4TSF G;  1QLN A;  4JTA B;  2WLK A;  3BEH A;  1ROP A;  2IU0 A;  5DM6 V;  2Q68 A;  1MAB G;  2H94 A;  5IYD O;  2ZR2 A;  3FKS G;  1I5Y A;  5IYB O;  3ASN C;  1V54 C;  3ETD A;  3F7Y C;  3K3W A;  2HFE C;  3OAA G;  4ASU G;  1R3I C;  4BW5 A;  1YTF B;  4YXW G;  2JIZ G;  1Q82 W;  2KB1 A;  2WWW A;  3ZJZ A;  5LHG A;  1AJN A;  3FYI B;  4MW8 A;  4QE7 A;  5CBG A;  1RPR A;  4JPR A;  1F51 A;  4KUM A;  2HVJ C;  1YJ9 V;  1JVM A;  1Q81 W;  3OGC C;  4FJC C;  3FB8 C;  3UKM A;  2LP7 A;  4GT1 A;  3OR6 C;  2AHZ A;  4E2L A;  1BHA A;  5EC2 C;  3ETG A;  2PI5 A;  1AI6 A;  4PA9 A;  2EIJ C;  3CCS V;  3E89 A;  2D3O W;  3SYP A;  1EZJ A;  2WLI B;  4RAI A;  3ABK B;  3SPJ A;  2JJ2 G;  5KA5 A;  2WSS G;  3JCZ A;  2W6J G;  5B1B B;  4QPJ A;  5KUM A;  3RVY A;  4RUF A;  3I56 V;  2HLD G;  1M56 B;  1YSC A;  1JCH A;  1NH2 D;  1OCC B;  4MVZ A;  4RQF A;  1H8E G;  3AG4 B;  1K73 W;  5EK0 A;  4H37 A;  5L3B A;  5HFM A;  4GX2 A;  1NJI W;  1SET A;  5B1B C;  1OCR C;  3STL C;  2R9R B;  2EBO A;  4MSW C;  2DWD C;  2QM8 A;  3T4Z A;  1QVG U;  1NQT A;  2QKS A;  1PNK A;  1OCC C;  2IJH A;  4JTC B;  3CD6 V;  3D36 A;  2X6B A;  2XAQ A;  1VQ5 V;  1FXK B;  4Z1M G;  2EIK C;  4JYC A;  4MTO A;  4DXW A;  3ZMZ A;  5LHH A;  3CMA V;  1DLB A;  4R8C A;  4PEL A;  2Q67 A;  1R6K A;  1H2G A;  1CP9 A;  5C93 A;  3CCR V;  4X89 A;  3QO8 A;  3E2E A;  3AEI A;  2Q69 A;  4WFB V;  3FYE B;  3SPG A;  1GM8 A;  5EBL C;  1LNQ A;  1WPX A;  2HG5 C;  3ZMV A;  2W6I G;  2WLL A;  2WLL B;  3OUF A;  2EIM C;  5B1N A;  1R3L C;  3LDC A;  1NKD A;  4QPK A;  4GX0 A;  2ZD9 A;  2IH1 C;  1JJ2 U;  1AI4 A;  1AI7 A;  3G6E V;  3JD3 A;  5EBW C;  1XL4 A;  1RPO A;  1BL8 A;  1AJQ A;  2YEV B;  3OMN B;  1QBZ A;  1K5Q A;  3JD2 A;  2DYS B;  3ZMT A;  4BIU A;  3SPI A;  3ZN0 A;  4BAY A;  1VQ4 V;  3E35 A;  1M57 C;  4FIP C;  3CME V;  4UVC A;  2H8P C;  3P30 A;  4G27 B;  4XBF A;  2ZXW C;  1Y66 A;  4HZ3 A;  3LDD A;  3K0D A;  1WLE A;  2DYR C;  3BY6 A;  2QEX V;  2F43 G;  3F7V C;  1S76 D;  1MSW D;  3B77 A;  2UXN A;  4N21 A;  3W7X A;  2Z3Y A;  1QLE C;  2LFR A;  2NNU A;  4X88 A;  5CBH A;  1KD1 W;  4QIW F;  3ML0 A;  3QO5 A;  1W0K G;  2WLJ A;  3CXC U;  3AG1 C;  2P7T C;  4UVA A;  3CC4 V;  1YI2 V;  1M1K W;  2IJI A;  1K97 A;  1F4M A;  2P6J A;  4PDL A;  2JJ1 G;  4I5S A;  5LHI A;  2X7R B;  3TET A;  5L3C A;  2DW4 A;  1YJW V;  2XAF A;  3RBZ A;  2R9I A;  3CP1 A;  4WFH A;  3K0G A;  2ZQM A;  2V1D A;  2A0L A;  4H33 A;  3K9A A;  3LNM B;  2HJF C;  4MVU A;  1KKD A;  2V7Q G;  1GM7 A;  1G4Y B;  5LGN A;  3IC7 A;  3RW0 A;  5CBF A;  3W7S A;  3DTU B;  5B1O A;  2IW5 A;  1YHQ V;  5HFL A;  1DF5 A;  1VQO V;  2M7W A;  2GHY A;  3D3I A;  1K92 A;  2W0F C;  1K3E A;  3T1C A;  4LCU C;  4QE9 A;  1R3K C;  1JX9 A;  3E8H A;  4P9P A;  1HWY A;  3SYC A;  1YTF D;  4LC1 A;  1M56 C;  3R65 A;  2ZDI A;  1GTO A;  1KP2 A;  5LBQ A;  1VQ8 V;  2HR3 A;  4U7O A;  1F23 A;  1MOF A;  5L3F A;  3OW2 U;  1S77 D;  2WAM A;  3ZRV A;  3LDE A;  1UJW B;  4R50 A;  1P4R A;  3ABU A;  2XOK G;  3NXS A;  4ZBM A;  2P90 A;  5L3E A;  4N23 A;  3GB7 C;  1E1R G;  1W2B U;  1ARO P;  2ATK C;  2B1G A;  2MK3 A;  4JTD B;  2DQ0 A;  3CCJ V;  5H6R A;  1CPY A;  3ETE A;  5CA3 A;  1NBM G;  5GW7 A;  2XAJ A;  3CCV V;  2HKO A;  4KP4 A;  1YIT V;  2IH3 C;  3E86 A;  4JYB A;  1F4N A;  3OUS A;  5H6Q A;  3T2M A;  3E8G A;  1NVP B;  3CCL V;  1V55 B;  1R73 A;  3SPH A;  1K33 A;  3OE7 G;  2JK5 C;  2BOC C;  2WLN A;  1S72 V;  1KQS U;  4WF9 V;  4WFF A;  2WLH A;  4ZKI A;  3GWO A;  4G28 B;  3E8B A;  4GX1 A;  4PA3 A;  3LSQ A;  5B3S C;  4P9O A;  1Q86 W;  2ITC C;  2QE7 G;  1AI5 A;  1FXV A;  1V55 C;  1G8M A;  3ZIA G;  4RQE A;  2Z5U A;  4MTG A;  4UV9 A;  3CC7 V;  4PA4 A;  4PDR A;  1OCO B;  4MVM A;  1XL6 A;  1VQM V;  3F5W C;  2FTK A;  1OHH G;  3G71 V;  5EBM C;  4UXN A;  3FB7 C;  3SJQ C;  3VBB A;  1BHB A;  5IY5 C;  1JQ0 A;  3LUT B;  3SYO A;  4JAU A;  3B8N A;  3A0R A;  2DYR B;  3TK1 A;  3TCU A;  5KA6 A;  4EKW A;  2EIJ B;  1IXM A;  4OXS A;  4L87 A;  2Y48 A;  2XAS A;  1BMF G;  2CK3 G;  4UV8 A;  5B1A C;  5IY5 B;  3CCE V;  1YIJ V;  2IU3 A;  2OCC B;  2HVK C;  3FB5 C;  3CCU V;  4P2Z A;  3JD4 A;  3MHH C;  4JGS A;  1PL0 A;  4PA6 A;  3ZRS A;  3AG1 B;  1KC8 W;  1K8A W;  1NR7 A;  1L1F A;  4MTX A;  1OCZ B;  4QNH B;  3SYQ A;  1SZT A;  1GM9 A;  1OZ0 A;  4BIZ A;  3AG3 C;  4TT3 G;  3OMI B;  4MVS A;  3X2Q B;  5LGT A;  1P7B A;  4Q20 A;  4R6Z A;  2XAG A;  4R7C A;  1K7D A;  3ABK C;  1SES A;  3K08 A;  1AJP A;  4MVO A;  3FB6 C;  1PD3 A;  1FXH A;  1KP3 A;  3AG2 C;  4FPP A;  2ZR3 A;  3K79 A;  2EIL C;  3AG3 B;  1RM1 C;  4MT8 A;  3X2Q C;  2IJJ A;  1B6Q A;  2YSU B;  3HPL C;  3STZ C;  3JD1 A;  2GSM B;  2IJK A;  3OEE G;  2P67 A;  3OFN G;  3ZMU A;  1VQ7 V;  1OCR B;  1VQK V;  3H01 A;  3ZRW B;  1FS0 G;  3WG7 B;  1ORQ C;  1Q7Y W;  1VQN V;  2Y69 B;  2QM7 A;  4I9W A;  1S3J A;  1NR1 A;  5EC1 C;  4XDK A;  3WFV A;  1H8H G;  2A79 B;  4KFM A;  5B3S B;  1M57 B;  4U7N A;  4J9Z B;  3IGA C;  1JPX A;  3ABM B;  5L3D A;  1NVP D;  2JEU A;  1E79 G;  2WLM A;  1S0V A;  4WFA V;  3SYA A;  4J9Y B;  3DGE A;  4MVR A;  2WPD G;  5DN6 G;  1QLE B;  3CCQ V;  1R3J C;  3ABL B;  3CC2 V;  3W7T A;  2QTO A;  3UM7 A;  4X8A A;  3MHS C;  2EZP A;  5LGU A;  2EIN B;  1GO3 F;  5CMU A;  3G4S V;  1NH2 B;  1AR1 B;  4WCE V;  3ASO B;  3K04 A;  4G2K A;  1COW G;  1EFR G;  1PNL A;  3K06 A;  3OMA B;  2B1I A;  1SRY A;  2X6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...