2VQEO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqeO00
1D2DA 4DR5O 2ZM6O 2JRIA 5BXZA 1F7YA 4B3MO 4DUZO 1XMOO 1YZBA 4NXMO 1IBMO 4JI5O 4YHHO 2UXBO 2UUCO 5H5NA 3F5TA 1I94O 4B3RO 1NS1A 1N34O 4LFBO 1A32A 4B3SO 5IT9N 3J7AU 4JI7O 2UUBO 4X66O 3O65A 5FLXN 4DV6O 1N32O 4NXNO 1FJGO 5IWAO 4KHPO 1HNXO 1XEQA 4LF5O 4K0KO 4OPHA 2LW7A 5A2QN 3OTOO 2HHHO 4LFAO 4LFCO 3JAMN 4DR2O 4DR7O 2VQEO 3T1YO 4GKKO 4DV1O 4DR1O 4DV3O 1IBKO 3M8AA 1DK1A 4LF6O 4X64O 1G1XB 4DUYO 4OPAA 4X65O 2ZKOA 1HR0O 2UUAO 4JI1O 4DR3O 4JI3O 3T1HO 4DV2O 2F4VO 1R6TA 4LF8O 4JV5O 3R66A 4LF9O 4DR4O 4JI0O 4YY3O 1N33O 2DJVA 4DV5O 2FKXA 5LMUO 4LF7O 1HNZO 1AB3A 4DR6O 1IBLO 1FKAO 4AQYO 5BY1A 1KUQA 2VQFO 1R1BA 4DV0O 3RT3C 5LL6Y 5LMNO 1FYJA 2AGAA 4B3TO 4JI6O 2N74A 2Z0AA 3SDLA 1XNQO 2DOSA 3J80N 1AILA 4GKJO 1N36O 2UU9O 1J5EO 4JI8O 4JYAO 2E5LO 4JI4O 4A5UB 2UXCO 1XNRO 2UXDO 1HNWO 4X62O 4DV4O 4DV7O 5BR8O 3J81N 1XMQO 4JI2O 4OX9O 1X59A 4LF4O
chains in the Genus database with same CATH superfamily
2F4VB 2X7RB 5CA0A 5IJ0B 1X4TA 2ZM6O 2LFSA 2Q7GA 2XAQA 2QR4A 4QE9A 4CBCA 1IBMO 2HKOA 1AI7A 1PPJH 2UUCO 3IAYA 1VP7A 1PNKA 2UXNA 4UXNA 5HFLA 1NS1A 3HR0A 1VQ6V 1FXKA 2YIDA 3QVNA 1Q82W 1SZXA 3BA9A 3C90A 5LHIA 3QG5A 1MABG 4JZ2A 4D7TA 3RBZA 3VQYA 3ZS8C 1XHZA 3G6EV 2JGDB 1R3KC 4GZRB 1TVKA 3QF7A 2HR3A 1D5AA 3E35A 4Q6GA 4ZI7B 3RVZA 3R65A 3BAAA 1SQBH 1JQ0A 2WLIA 5DECA 2HJDA 4WFFA 4BAYA 4YJ2B 3FAVA 1SQXH 2Y4UA 3OEEG 3F5WC 1R6TA 2VS0A 4LFAB 5DM6V 2RCVA 1VQ9V 4JI5B 1AP5A 4EFBA 4JPRA 1H8HG 2W6JG 1XOUA 2MW2B 1XL4A 4U3JB 2FKXA 4UV8A 3P30A 1XI1A 3DTUB 5LOVA 3K03A 1NI8A 3F7YC 4DR6O 2FB5A 4DV6B 1BZKA 2QM7A 1HNXB 1KUQA 3OMAB 2F43G 1MNGA 3C3TA 2QE7G 1XUQA 2P90A 4DR1B 3H1HH 3KCXA 1U96A 2Z0AA 4JI6O 2CDYA 2OWOA 1WA8A 3E8HA 1CP9A 1IURA 1KKCA 4RQEA 1S5LZ 3B8MA 4MTOA 4X1YA 1TA8A 4TWKA 2QTOA 2YIAA 4JV5B 5KHIA 5C8YA 4J7ZA 2IJHA 3ZIAG 1P4RA 3F5TA 4HYOA 4GYCB 1N4CA 2ZE8A 4B3SO 1BHBA 1NTZH 4JI7O 3SPGA 3OTFA 3VQWA 1Q81W 3JASA 4LBEC 5IWAO 2QKCA 1WAZA 4K8ZA 3FB6C 5JWPA 1YF2A 5A2QN 4B3TB 3E22B 2VQEO 3ZEDA 3RYCB 4U3FH 2UXCB 1W59A 3CX5F 4ZIBA 1PM9A 4IHJA 1NVPD 3JAWB 4CC5A 2IJKA 4J7KA 3E8GA 4NXMB 3K08A 5BMVA 1S5HC 2K9PA 3SYPA 5LMUO 3K06A 4JTCB 1AI5A 1H8EG 3H9VA 5JCOA 1ZTEA 2XT9A 1E1RG 1NZ6A 1S76D 4MW3A 3L70H 5LMNO 3OTOB 3FB5C 1WP7A 3LNMB 5B1OA 2M6YA 1WNSA 2FL4A 1CEZA 1IZ3A 3ZHTA 1KBHA 4PDMA 4GKJO 5D5PA 4O4JB 2UU9O 3CRAA 3HKCB 2Q0AA 4X62O 4KP4A 2A06H 1EN5A 1RSOB 3CWBH 4DV2B 3B77A 2ZE6A 4J11A 3RYIB 3LDCA 3RYFB 4C7UA 3K5OA 3VOUA 3QTCA 1PNMA 3K0GA 1OV9A 4CS2A 1KB9F 1FFXA 4WCEV 2ARHA 1IVSA 1K34A 2Y0IA 5IYZA 4ZBMA 2ZM6B 5IY5C 5EC2C 4K0KO 2P4VA 4HAMA 2EILB 1Z5VA 1XBLA 1SQGA 3W7SA 2UUCB 2KSDA 4F6RA 4LP8A 4PI2A 5KA5A 1AVMA 4DK0A 2IJJA 1IBKO 4WF9V 1NVPB 2E5LB 5IDJA 2OCCB 1CXZB 4X65O 5EYPA 3FD9A 1W0KG 3C3SA 4JI1O 3HB3B 4UVCA 4DR3O 1Q8IA 1QQCA 1SC5B 4JI3O 2ATKC 2P06A 4LR3A 4I0XA 5FNVA 2N05A 4JYYA 3OMIB 1R3LC 2Y0PA 1N0JA 1I94B 1N33O 1Y66A 4B3RB 1N34B 3TXSA 5IYDO 1SA0B 1G4YB 2OIGA 2P67A 3THOA 2V1DA 4G27B 1R3IC 4IYIA 4Z2WA 4NXNB 1LNQA 1HW7A 3JD4A 4I50A 4X1IA 4IIJB 2YSUB 1Q6UA 2HHHB 1YXBA 1M56B 4DR2B 5L3EA 2JIZG 2GUZB 1VARA 2Q9LA 5IY5B 3G80A 1XNQO 3J80N 1AILA 2WLMA 2ZNJA 3CCEV 1GAXA 4PA3A 5FL7G 3T4DA 1MZFA 2QWQB 2GBOA 4IYHA 5EBWC 2NN4A 1SQVH 3D36C 2DW4A 2EZPA 2HVJC 1NTMH 3ZHVA 1SERA 1JJOA 4FIPC 4H37A 3FFQA 5B1BB 3AG3C 3CCJV 1XHXA 1BQZA 1A32A 5JH7B 1VQPV 3E8FA 4ZOLA 1BSMA 1QLEB 1P7BA 2Q7HA 3ABLB 5EBMC 5JVDA 1K33A 4QE7A 1TAEA 1U97A 2LW7A 1ZL8B 2Q67A 4DW1A 1SKVA 4LH7A 1AI6A 3ABKC 2EZOA 4LNUA 1GH6A 3L73H 2UXDB 1HNWB 5K1XA 4GT1A 4ASUG 2JGUA 2HG5C 2YEVA 5KHHA 4YIOA 3CCLV 2BTQA 1AR5A 4DR4O 2NLJC 5CB4B 1RM1C 4IT5A 2Q4PA 4B7EA 5E1AC 1L0NH 4L8JA 4H13B 4MTXA 3CMAV 4UCTA 3AG3B 1DF5A 2V7QG 2WPDG 4AHCA 3IFXA 3IGAC 2CK3G 5AG2A 1T5EA 1EZJA 2L35A 3JCZA 4DV3B 1NTKH 4LF6B 3N2KB 2DOSA 2YUAA 2JK5C 3RGBA 5JJEB 1GK9A 3G6BA 3OR7C 3T1HB 1YIJV 3LSUA 4FLYA 4LF4O 1KC8W 2E76B 4DR5O 1QNMA 4JAUA 4DRXA 4DUZO 2GTSA 4UVBA 1L0LH 4X1KA 4AILC 5IYBO 1URFA 4BW5A 3EXAA 5CBFA 3JD0A 1IBLB 3LDEA 3MD0A 3OEHG 3PJSK 4JYCA 3DXRB 1SZTA 3ABUA 3UQ8A 2OTJV 3SGIA 2W0XA 2A0LA 1VEWA 1LUVA 3E8BA 1IDSA 5H6QA 1AJQA 4I5SA 2LO1A 2X6CA 3N2GB 4TV8B 3W7TA 4GKKO 1PL4A 5IJ9B 3CSXA 1BMFG 1PNLA 3CCMV 4QJFB 2RQ6A 4CS4A 4OPAA 5GONA 1Y76B 3TXQA 2ZKOA 1VF6A 1OCRC 5LXTB 2PY5A 2QWNB 3I55V 2MK3A 2F1MA 1VQKV 4EFEA 4P9PA 1IBKB 2EULA 4LF9O 3QO5A 3RYHB 4LFBB 1ENVA 1FPOA 2G38A 2BOBC 1TUBA 2FTKA 5B1AB 2UUBB 3JATB 1AR4A 3N27A 2VWJA 1JFFA 1YVWA 1Q86W 1NJIW 3TGUH 4O4IB 5LP6C 1F4MA 2LJ2A 2QA4V 5GTHZ 2YC0A 2JEXA 3UO2A 1H2LA 2WLJA 3IC9A 4X20B 3T1CA 4NVPA 3ZRWB 1J95A 4GX5A 1COWG 4NTWA 3T4ZA 3CEIA 4J41A 4CH5A 3UKMA 2EIMC 5E79Z 2Q8VA 4EB6A 3GWKC 3K59A 1QCEA 2F23A 5J2TB 2P6JA 5LBQA 2YIBA 1NH2D 5IJ0A 3CD6V 4MVOA 1G6UA 1NKDA 4PD4F 3E2EA 2XAGA 1VF5B 4MVMA 2ITDC 1AI4A 1FD9A 2EJRA 2FMLA 1FJGO 4KHPO 4I4TB 2GSMB 2OT5A 4RO2A 3RWRD 4FPPA 3K58A 3BRCA 3T2MA 4AI8A 4GX1A 2JGDA 5LP6B 3JARB 1DGSA 1G1XB 2KG7B 4JI4B 4ZI7A 5L3CA 4G2KA 1SQFA 4X9QA 4MTFA 2ADPA 1W0JG 2LW1A 4CH4A 4YJ2A 4O2AB 4MVZA 3WB1A 4YHHB 4XBFA 3VQXA 4YY3O 2E75B 2EIMB 1Q6IA 3STZC 2VWKA 3MHHC 2F93B 1AB3A 5B66Z 5LYJB 1Z2GA 4U3JA 3HKDB 1THZA 1WB7A 4NYKA 3TETA 3ZN0A 5L3FA 2BCCH 4H44B 4DR4B 4DV1B 2QEXV 4PDRA 4CC6A 3ETQA 2Z3YA 2GTAA 1GN2A 1N36O 3JALB 3UCSC 3QO8A 1QR8A 3OT7A 3FX7A 1R3JC 4WFEA 1MSDA 3P3PA 2UUAB 5KA6A 5C93A 5KLVH 1NH2B 3K0DA 1N8RW 3KKYA 4I9WA 4JZGA 3CCQV 1TVKB 1N0NA 4GX0A 1R73A 5DN6G 2PF4E 1XILA 3GVMA 5KHGA 2F95B 4FLXA 1XMOO 2QTSA 4DV5B 2P4KA 2WLIB 2CAZC 4NTXA 1HNZB 5IT9N 1P84F 3J7AU 4AQYB 4GLXA 1NT2B 2AXTZ 2WLLB 1P7GA 4XDJA 1BHAA 1PP9H 1OCOC 1B06A 4OPHA 5EIBC 3OFNG 2AZ0A 4DR7O 3OGCC 1OZ0A 1VQ5V 3CRCA 1PKXA 2CTQA 2F66C 3E22A 1M5IA 2D2CB 3RYCA 2PTMA 1IX9A 3ZJZA 4MTGA 3U11A 4J10A 1ZAUA 2XAHA 3LUTB 2ZE5A 3LDDA 4UCSA 5D5QA 2YI8A 3JAWA 4GKKB 1QLNA 3AG4C 1BE3H 1I5YA 3CC7V 1GN3A 4X66B 2Y48A 4PELA 4MVQA 2KB1A 5B3SC 3CB2A 4NKGB 4DV0O 3CXCU 2WA4A 1VQ8V 1H2GA 1K97A 1MMMA 5JCOC 1YJNV 3T1YB 4LH6A 1KYOF 4J9ZB 3KCYA 3CCSV 3JCUZ 4L87A 1GKFA 4DUYB 1OCOB 4JI8O 4JYAO 3ZN1A 1GM8A 4DV7O 4O4JA 3HKCA 4OX9O 4TQFA 4LF8B 3P32A 3QO7A 4B3MO 1RSOA 1YTFD 3L71H 1UJWB 3RYIA 3S3WA 4E2LA 4R50A 3HKEB 2OIEA 3CCUV 3RYFA 1MZEA 2M7WA 4MVUA 1QHTA 4IHJB 4PDVA 4J80A 1K4DC 2A9HA 2R9IA 3B40A 1YSCA 4MS2A 1XREA 2VQFB 1N32O 2QWPB 2CH7B 4O4LB 3OW2U 3W7WA 1RFYA 3ZBHA 3HPLC 3GB7C 4ZHQB 2XTAA 4UCUA 1KMIZ 5B3SB 4TOIA 1CPYA 3SR2C 1ZWIC 4X64O 4F4LA 2QDOA 3RW0A 4FFBA 1RP3B 1PD3A 4DV4B 4K8XA 1FJGB 4JI2B 1HR0O 1JPXA 1K4CC 2ZQMA 1V54C 1ZUQA 3AK3A 1IBMB 3R66A 4Z1VA 1DLBA 1VQMV 4JI0O 4O4HB 3AG7A 1P49A 1SA0A 2B1GA 2WSSG 2FYUH 3VBBA 3O9OA 4TT3G 2IU3A 4X8AA 3L74H 2E3CA 2Y69C 3JYCA 3L72H 4RQFA 3BCCH 4HBNA 1RPRA 5J2UB 1H38A 1K7DA 2CTRA 3ZRXA 2KKWA 4G28B 3ETGA 4JAAA 4PA9A 2QWRB 1SRYA 2GUZA 3B8NA 2IW5A 4H33A 1J5EO 2E74B 1XNRO 2YXLA 1WN7A 3JAKB 3NXSA 5LA6B 1YTFB 5BR8O 5KMGB 3ZMUA 2WLKA 3WG7C 4DW0A 4X89A 3DC5A 5B5EZ 2ODMA 1MSWD 2AHZA 2DQ3A 2UXBO 5JJJB 3APOA 3A8TA 4O2BB 2PYLA 1K9MW 4JAVA 1L8DA 4DR6B 1W2BU 2XOKG 2ZXWC 3I56V 1V55C 2JS5A 4I0XB 5FLXN 2H8PC 4WFHA 2IM9A 3E83A 1GMGA 4LF5O 2K1EA 1B04A 5TISZ 4LWSB 2R9RB 4LFCO 1FXHA 2YXHA 1OJHA 3E89A 2GV9A 4YXWG 4JI6B 2EX3A 1ZL8A 3BY6A 4BIZA 3A0HZ 2ADQB 1VQLV 1YCIA 4H0LB 4P2ZA 5KX5B 1M93A 3I5DA 2F4VO 1K5QA 3ZMSA 3SYCA 2LFRA 4FZ0A 1SF9A 2LGQA 4R6ZA 1M4UA 2R9AA 3EFFK 1KKDA 2YI9A 1M1KW 4B3SB 2BSKB 3H1IH 4JI7B 1DF4A 2B5UA 5CB4A 4UB6Z 1FKAO 5IWAB 3D36A 2P22C 5KAIZ 2QSAA 1WLEA 5A9GA 2OTLV 2VQEB 3K9AA 2ZIOA 2Q7EA 3OR6C 2EIKC 3N2KA 4FFKA 4JGSA 1VQOV 2ZDIA 1WB8A 1WPXA 3B09A 1E1QG 2OYQA 4BIOA 2CTPA 1M57C 5BXZA 5EC1C 4JI5O 3CCRV 1DTOA 2ITCC 5LMUB 3BABA 4MVRA 1KP2A 3CRQA 5ITZB 4QIWF 3MAQA 4PA4A 1XQ8A 3K79A 1K8AW 5CA1A 1Q7YW 3ABKB 3O65A 3CJHB 4DV6O 2CTWA 1HNXO 2WWWA 1XEQA 5LMNB 4PA7A 3A2FA 3DXRA 3S3XA 5GTIZ 1RPOA 1L1FA 2Q73A 4PDLA 3OAAG 3JAMN 1MA1A 4CH3A 4DR1O 1Q3EA 1Y74B 3P3NA 4UV9A 4GKJB 4TV8A 3N2GA 2UU9B 3X2QC 5CN0A 5IJ9A 3UM7A 3M99B 4YJ3B 3ABTA 4X62B 1KECA 1VIBA 1VQ7V 4JTAB 1Y76A 3BVOA 3IJ4A 3NR7A 4HZ3A 1RM1B 2EIKB 4F6EA 2HJFC 4I9QA 1R6KA 1AJNA 3K5MA 5LXTA 4JV5O 3ASOC 4LF7O 2AW9A 5F2VO 3B2EE 2A79B 1SESA 4QGPA 3RYHA 1HR0B 3HKBB 3AG1C 2AZ2A 2YICA 2QJ1A 2RNBA 1WP8A 5H2FZ 2WA3A 3JATA 2IBZH 4K0KB 4D6TH 3ETDA 1TGOA 2ZNIA 3DGEA 4O4IA 1TUEB 1SETA 1O9GA 3CPWU 4B3TO 2N74A 4TUYB 3SDLA 4FVMA 3L9DA 4X20A 4X65B 2UXCO 2PI4A 3ZRWA 4JI1B 4DR3B 4JI3B 3Q4HB 1F4NA 3B4SA 2CUGA 1PV0A 1AR1B 4I7ZB 2LP7A 3OUFA 1F7YA 4I55A 3CMEV 2DWEC 5LGTA 2RJZA 4NXMO 1I7FA 1N33B 5H5NA 2DYSC 4HNAB 3H1KH 1J5EB 3SJQC 1FXVA 3PN1A 5BR8B 4W4KA 4GCZA 4FM1A 2VRZA 4NR1A 3UO3A 3ZHQA 3ZMTA 3K3WA 4TV9B 1R6NA 3AG1B 2ZIMA 3OTOO 4I4TA 2QKSA 3STLC 2JJ1G 1OCRB 5DEDA 1XNQB 3M8AA 1OCZC 3MHSC 5BZBA 5L3DA 5LP6A 3JARA 1PL0A 2KG7A 1FXKC 4DV2O 2YXYA 3UT5B 1KU9A 2OCHA 2WAMA 1AP6A 3APQA 4O2AA 3K04A 3OD4A 3LSSA 1I08A 1GTOA 1D5NA 4WFAV 4WBNB 2DYSB 1M90W 5LYJA 5JQGB 3HKDA 3SYOA 2XAJA 1GN4A 4E4EA 5KAFZ 2Q6AA 4JTDB 2XASA 3BA8A 4UFZA 3SJAC 3TJTA 5LGUA 2ZR3A 5EZYB 1Q5OA 2ZD9A 2E5LO 4QPJA 4KUMA 2WLHA 3JALA 5CA0B 2LGWA 1XMQO 5LGNA 1Q6HA 3SPIA 2X0LA 5L3BA 2Q68A 1OCZB 2CGOA 5EK0A 3RFRA 3SPJA 4U7OA 5LHGA 1FXKB 1I94O 5IYCO 4B3RO 1N34O 3ZCCA 1V9PA 1JR9A 2H94A 2YS8A 4MSWC 2PYJA 4NXNO 1KQSU 5EIBD 3RVYA 1JCHA 2P7TC 2WLLA 2HHHO 2Z5UA 4DR2O 2QKAA 3MDSA 2JJ2G 1Y4MA 3ZMZA 4CS3A 3CCVV 1DK1A 3IC7A 4J9YB 3FAVB 3OGIB 4LF4B 4K35A 2LQTA 4DR5B 1OCCC 5JJNB 4GUNA 2XHBA 4DUZB 1KP3A 1JX9A 1H2NA 3JSNA 5LOVB 3L75H 4DK1A 1AJPA 1LR1A 3CE2A 1QVFU 3H01A 5FPRA 1SQQH 1IXMA 3AG2C 5K1PA 5FPOA 2L6LA 2IU0A 1R1BA 3CRMA 3H1JH 2H3OA 3JSLA 4P9OA 2D3OW 2PI5A 4EEQA 1QBZA 1WA8B 4JF3A 4LF7B 4X1YB 4A5UB 2UXDO 1HNWO 1BL8A 3K9SA 1IXBA 2JS3A 5C8YB 1D2DA 2DWDC 2Q5ZA 4LF9B 1K5SA 3D8CA 4J7JA 2P5OA 1Y6XA 2RN9A 1OCCB 2GHYA 3LSQA 4QPKA 4TQDA 1FAFA 3HKEA 4KL1A 1MOFA 1OHHG 4B7KA 3QNEA 1VQ4V 3JASB 4FM2A 2WLNA 4PV1B 2Q69A 3JD1A 5IE9A 2IH3C 4FZ1A 3DC6A 2XUMA 3F7VC 4FMTA 2CH7A 2DN9A 4O4LA 2DYRC 3WFVA 3AG2B 2HP8A 4BW9A 4ZHQA 4DV3O 2DQ0A 3G71V 4LF6O 2EILC 1BCCH 4KXRA 4PI0A 4BR6A 3AG4B 3T1HO 5BMVB 4UVAA 3WB0A 4CZZA 1ZSPA 2GDSA 1EZVH 2AHYA 2OCCC 2PUSA 4FLZA 4QNHB 3EVKA 1VMGA 1JMKC 4IL6Z 3SJCC 1NQTA 2BE3A 3TCUA 4O4HA 1GM9A 2ZE7A 1IBLO 3BEHA 4FM0A 1JVMA 1F51A 3U0ZA 4KHPB 2KQXA 5EBLC 5H9CA 2Q0OC 1F23A 1K92A 1FYJA 3ZHUA 1H2KA 3CHXA 1YI2V 3ABMC 2AGAA 4GX2A 2R72A 5J2UA 2HEPA 1S3JA 3AEIA 3W7UA 1S72V 5KUMA 2W6IG 1M56C 2DYRB 3ZX6A 4UUJC 1B6QA 5LA6A 3JAKA 4XDLA 5KMGA 1BS3A 1YHQV 1YZBA 1I0HA 1FFXB 2HFEC 4IIJA 4RAIA 2QWOB 4YY3B 3OUSA 1WJZA 4FFBB 5J9PC 1B3QA 3CYOA 1FS0G 4LFBO 1K73W 2QGNA 3SYAA 4O2BA 5IYZB 1XMQB 2UUBO 3VQVA 3ZHRA 1QVGU 3WB2A 5B1BC 4FLUA 1GM7A 4FLVA 4KFMA 4F6RB 3A0RA 1YEWA 4CH6A 1NR1A 5LHHA 2N04A 1QLEC 2JDIG 3ABLC 1H2MA 4LWSA 4XDKA 2HLDG 4MVSA 4ABMA 5EYPB 1N36B 3W7XA 1V54B 3AK1A 4JYBA 3ABMB 1Z5WA 1Q90D 4BIUA 2EIJC 5JH7A 5FNVB 4B08A 5B1NA 3JD2A 2NNUA 1XMOB 5KX5A 2UXXA 4OGQB 3EHBB 1BGYH 3FB7C 2B1IA 4UCVA 2HVKC 1GO3F 1XDCA 2A7WA 2Y69B 5KHKA 1YDXA 4I50B 4X1IB 3KZIZ 3OMNB 3CP1A 2BSKA 4NB5A 4ICGA 4DYLA 1LUWA 3WU2Z 3CXHF 2CGNA 2BTOA 2IJIA 3CC4V 1NU1H 4DR7B 3BPZA 1YITV 4W4LA 5CBHA 3H1LH 3WG7B 1JJ2U 2R70A 1EFRG 4PJ0Z 4FLTA 4JI4O 2RMKB 2A3QA 2ZINA 2W0FC 4P30A 1O9HA 1X59A 1EBOA 1AROP 3LNNA 4UCRA 2JVDA 3ZHSA 2JRIA 2XAFA 2ZDIC 4TSFG 4IGGA 2BOCC 2EIJB 2ZXWB 4X88A 3RN4A 4YHHO 1V55B 1HWYA 3GWOA 4ZOLB 1EN4A 5GW7A 3SPHA 2EJ7A 2JEUA 1M9NA 3ASNC 4JASA 5JVDB 3G4SV 1KD1W 5ITZA 4DV0B 3ETEA 5CA3A 1G8MA 2O57A 2RDCA 3CJHA 2PGGA 1SQPH 4LFAO 4DXWA 5H6RA 4LNUB 4LCUC 4DV1O 1Q43A 3ML0A 3K5NA 4JI8B 4JYAB 2NR5A 1Y74A 4DV7B 4J42A 2UUAO 4YJ3A 1S5JA 2X6AA 2YEVB 4OX9B 1MG1A 3SJBC 1ZX3A 2BTQB 4B3MB 5KHJA 3OM3B 2YDEA 2EBOA 4RWUA 2DJVA 4DV5O 4UCOA 1QU7A 2ETNA 1JA8A 1HNZO 1VQNV 1I5XA 4R8CA 3ZRSA 2QM8A 4R7CA 1N32B 4AQYO 1BQ0A 1QR9A 3BHPA 3HKBA 4EKWA 3RT3C 3ASNB 5B1AC 3SYQA 4PHZA 1VF6C 4OXSA 2EINC 1SS3A 4BWAA 5CBGA 3ZRVA 1YJ9V 4X64B 5CMUA 5CA1B 3CRRA 1H2SB 1WPBA 3D3IA 3D3QA 1M57B 1EM1A 4FLWA 4TUYA 3DSQA 4D7SA 2QM4A 4U7NA 3SPCA 3J81N 4DRXB 4X1KB 4YIPA 2IH1C 3Q4HA 4MT8A 3BFRA 2YIBD 1US6A 4JI0B 1S0VA 2ILMA 4FK5C 1UPGA 4RUEA 2DMXA 1UFIA 3E86A 3M7MX 4HNAA 4N23A 4X66O 1K3EA 4LC1A 3K5LA 1ORQC 5L3GA 3X2QB 4MW8A 3FKSG 4PA6A 2V4DA 1E79G 1NR7A 1YJWV 3T1YO 4TV9A 2ZCEA 2CE4A 5J2TA 2C2AA 1GN6A 5GONB 2Y4TA 3AK2A 3CC2V 1Y67A 1VF7A 3FB8C 3U10A 4DUYO 3OE7G 1XNRB 2EINB 1S77D 3ICXA 3ASOB 3TK1A 1ROPA 2ZT9B 1HP8A 4LF8O 2ZR2A 2X6BA 2UXBB 3K57A 1NBMG 1XL6A 1JOYA 2XNDG 3UT5A 3FYIB 1TUBB 4FJCC 5HFMA 1JFFB 1EN6A 5KUKA 3JD3A 2DE0X 3FYEB 4Q20A 4I55B 5BY1A 1ZLZA 3KG2A 1GRJA 4DO2A 2VQFO 4WFBV 4LF5B 5LL6Y 4WBNA 3A0BZ 4LFCB 5JQGA 2PZSA 4N21A 4NTYA 3CS5A 3G67A 4ZKIA 1FFTB 3ZMVA 4RUFA 4WFGA 4Z1MG 1HDJA 4UB8Z 4EB6B 5EZYA 4DV4O 2B9ZA 4K3AA 4JI2O 1BT8A
chains in the Genus database with same CATH topology
1D2DA 4DR5O 2ZM6O 2JRIA 5BXZA 1F7YA 4B3MO 4DUZO 1XMOO 1YZBA 4NXMO 1IBMO 4JI5O 4YHHO 2UXBO 2UUCO 5H5NA 3F5TA 1I94O 4B3RO 1NS1A 1N34O 4LFBO 1A32A 4B3SO 5IT9N 3J7AU 4JI7O 2UUBO 4X66O 3O65A 5FLXN 4DV6O 1N32O 4NXNO 1FJGO 5IWAO 4KHPO 1HNXO 1XEQA 4LF5O 4K0KO 4OPHA 2LW7A 5A2QN 3OTOO 2HHHO 4LFAO 4LFCO 3JAMN 4DR2O 4DR7O 2VQEO 3T1YO 4GKKO 4DV1O 4DR1O 4DV3O 1IBKO 3M8AA 1DK1A 4LF6O 4X64O 1G1XB 4DUYO 4OPAA 4X65O 2ZKOA 1HR0O 2UUAO 4JI1O 4DR3O 4JI3O 3T1HO 4DV2O 2F4VO 1R6TA 4LF8O 4JV5O 3R66A 4LF9O 4DR4O 4JI0O 4YY3O 1N33O 2DJVA 4DV5O 2FKXA 5LMUO 4LF7O 1HNZO 1AB3A 4DR6O 1IBLO 1FKAO 4AQYO 5BY1A 1KUQA 2VQFO 1R1BA 4DV0O 3RT3C 5LL6Y 5LMNO 1FYJA 2AGAA 4B3TO 4JI6O 2N74A 2Z0AA 3SDLA 1XNQO 2DOSA 3J80N 1AILA 4GKJO 1N36O 2UU9O 1J5EO 4JI8O 4JYAO 2E5LO 4JI4O 4A5UB 2UXCO 1XNRO 2UXDO 1HNWO 4X62O 4DV4O 4DV7O 5BR8O 3J81N 1XMQO 4JI2O 4OX9O 1X59A 4LF4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2D A;  4DR5 O;  2ZM6 O;  2JRI A;  5BXZ A;  1F7Y A;  4B3M O;  4DUZ O;  1XMO O;  1YZB A;  4NXM O;  1IBM O;  4JI5 O;  4YHH O;  2UXB O;  2UUC O;  5H5N A;  3F5T A;  1I94 O;  4B3R O;  1NS1 A;  1N34 O;  4LFB O;  1A32 A;  4B3S O;  5IT9 N;  3J7A U;  4JI7 O;  2UUB O;  4X66 O;  3O65 A;  5FLX N;  4DV6 O;  1N32 O;  4NXN O;  1FJG O;  5IWA O;  4KHP O;  1HNX O;  1XEQ A;  4LF5 O;  4K0K O;  4OPH A;  2LW7 A;  5A2Q N;  3OTO O;  2HHH O;  4LFA O;  4LFC O;  3JAM N;  4DR2 O;  4DR7 O;  2VQE O;  3T1Y O;  4GKK O;  4DV1 O;  4DR1 O;  4DV3 O;  1IBK O;  3M8A A;  1DK1 A;  4LF6 O;  4X64 O;  1G1X B;  4DUY O;  4OPA A;  4X65 O;  2ZKO A;  1HR0 O;  2UUA O;  4JI1 O;  4DR3 O;  4JI3 O;  3T1H O;  4DV2 O;  2F4V O;  1R6T A;  4LF8 O;  4JV5 O;  3R66 A;  4LF9 O;  4DR4 O;  4JI0 O;  4YY3 O;  1N33 O;  2DJV A;  4DV5 O;  2FKX A;  5LMU O;  4LF7 O;  1HNZ O;  1AB3 A;  4DR6 O;  1IBL O;  1FKA O;  4AQY O;  5BY1 A;  1KUQ A;  2VQF O;  1R1B A;  4DV0 O;  3RT3 C;  5LL6 Y;  5LMN O;  1FYJ A;  2AGA A;  4B3T O;  4JI6 O;  2N74 A;  2Z0A A;  3SDL A;  1XNQ O;  2DOS A;  3J80 N;  1AIL A;  4GKJ O;  1N36 O;  2UU9 O;  1J5E O;  4JI8 O;  4JYA O;  2E5L O;  4JI4 O;  4A5U B;  2UXC O;  1XNR O;  2UXD O;  1HNW O;  4X62 O;  4DV4 O;  4DV7 O;  5BR8 O;  3J81 N;  1XMQ O;  4JI2 O;  4OX9 O;  1X59 A;  4LF4 O; 
#chains in the Genus database with same CATH topology
 2F4V B;  2X7R B;  5CA0 A;  5IJ0 B;  1X4T A;  2ZM6 O;  2LFS A;  2Q7G A;  2XAQ A;  2QR4 A;  4QE9 A;  4CBC A;  1IBM O;  2HKO A;  1AI7 A;  1PPJ H;  2UUC O;  3IAY A;  1VP7 A;  1PNK A;  2UXN A;  4UXN A;  5HFL A;  1NS1 A;  3HR0 A;  1VQ6 V;  1FXK A;  2YID A;  3QVN A;  1Q82 W;  1SZX A;  3BA9 A;  3C90 A;  5LHI A;  3QG5 A;  1MAB G;  4JZ2 A;  4D7T A;  3RBZ A;  3VQY A;  3ZS8 C;  1XHZ A;  3G6E V;  2JGD B;  1R3K C;  4GZR B;  1TVK A;  3QF7 A;  2HR3 A;  1D5A A;  3E35 A;  4Q6G A;  4ZI7 B;  3RVZ A;  3R65 A;  3BAA A;  1SQB H;  1JQ0 A;  2WLI A;  5DEC A;  2HJD A;  4WFF A;  4BAY A;  4YJ2 B;  3FAV A;  1SQX H;  2Y4U A;  3OEE G;  3F5W C;  1R6T A;  2VS0 A;  4LFA B;  5DM6 V;  2RCV A;  1VQ9 V;  4JI5 B;  1AP5 A;  4EFB A;  4JPR A;  1H8H G;  2W6J G;  1XOU A;  2MW2 B;  1XL4 A;  4U3J B;  2FKX A;  4UV8 A;  3P30 A;  1XI1 A;  3DTU B;  5LOV A;  3K03 A;  1NI8 A;  3F7Y C;  4DR6 O;  2FB5 A;  4DV6 B;  1BZK A;  2QM7 A;  1HNX B;  1KUQ A;  3OMA B;  2F43 G;  1MNG A;  3C3T A;  2QE7 G;  1XUQ A;  2P90 A;  4DR1 B;  3H1H H;  3KCX A;  1U96 A;  2Z0A A;  4JI6 O;  2CDY A;  2OWO A;  1WA8 A;  3E8H A;  1CP9 A;  1IUR A;  1KKC A;  4RQE A;  1S5L Z;  3B8M A;  4MTO A;  4X1Y A;  1TA8 A;  4TWK A;  2QTO A;  2YIA A;  4JV5 B;  5KHI A;  5C8Y A;  4J7Z A;  2IJH A;  3ZIA G;  1P4R A;  3F5T A;  4HYO A;  4GYC B;  1N4C A;  2ZE8 A;  4B3S O;  1BHB A;  1NTZ H;  4JI7 O;  3SPG A;  3OTF A;  3VQW A;  1Q81 W;  3JAS A;  4LBE C;  5IWA O;  2QKC A;  1WAZ A;  4K8Z A;  3FB6 C;  5JWP A;  1YF2 A;  5A2Q N;  4B3T B;  3E22 B;  2VQE O;  3ZED A;  3RYC B;  4U3F H;  2UXC B;  1W59 A;  3CX5 F;  4ZIB A;  1PM9 A;  4IHJ A;  1NVP D;  3JAW B;  4CC5 A;  2IJK A;  4J7K A;  3E8G A;  4NXM B;  3K08 A;  5BMV A;  1S5H C;  2K9P A;  3SYP A;  5LMU O;  3K06 A;  4JTC B;  1AI5 A;  1H8E G;  3H9V A;  5JCO A;  1ZTE A;  2XT9 A;  1E1R G;  1NZ6 A;  1S76 D;  4MW3 A;  3L70 H;  5LMN O;  3OTO B;  3FB5 C;  1WP7 A;  3LNM B;  5B1O A;  2M6Y A;  1WNS A;  2FL4 A;  1CEZ A;  1IZ3 A;  3ZHT A;  1KBH A;  4PDM A;  4GKJ O;  5D5P A;  4O4J B;  2UU9 O;  3CRA A;  3HKC B;  2Q0A A;  4X62 O;  4KP4 A;  2A06 H;  1EN5 A;  1RSO B;  3CWB H;  4DV2 B;  3B77 A;  2ZE6 A;  4J11 A;  3RYI B;  3LDC A;  3RYF B;  4C7U A;  3K5O A;  3VOU A;  3QTC A;  1PNM A;  3K0G A;  1OV9 A;  4CS2 A;  1KB9 F;  1FFX A;  4WCE V;  2ARH A;  1IVS A;  1K34 A;  2Y0I A;  5IYZ A;  4ZBM A;  2ZM6 B;  5IY5 C;  5EC2 C;  4K0K O;  2P4V A;  4HAM A;  2EIL B;  1Z5V A;  1XBL A;  1SQG A;  3W7S A;  2UUC B;  2KSD A;  4F6R A;  4LP8 A;  4PI2 A;  5KA5 A;  1AVM A;  4DK0 A;  2IJJ A;  1IBK O;  4WF9 V;  1NVP B;  2E5L B;  5IDJ A;  2OCC B;  1CXZ B;  4X65 O;  5EYP A;  3FD9 A;  1W0K G;  3C3S A;  4JI1 O;  3HB3 B;  4UVC A;  4DR3 O;  1Q8I A;  1QQC A;  1SC5 B;  4JI3 O;  2ATK C;  2P06 A;  4LR3 A;  4I0X A;  5FNV A;  2N05 A;  4JYY A;  3OMI B;  1R3L C;  2Y0P A;  1N0J A;  1I94 B;  1N33 O;  1Y66 A;  4B3R B;  1N34 B;  3TXS A;  5IYD O;  1SA0 B;  1G4Y B;  2OIG A;  2P67 A;  3THO A;  2V1D A;  4G27 B;  1R3I C;  4IYI A;  4Z2W A;  4NXN B;  1LNQ A;  1HW7 A;  3JD4 A;  4I50 A;  4X1I A;  4IIJ B;  2YSU B;  1Q6U A;  2HHH B;  1YXB A;  1M56 B;  4DR2 B;  5L3E A;  2JIZ G;  2GUZ B;  1VAR A;  2Q9L A;  5IY5 B;  3G80 A;  1XNQ O;  3J80 N;  1AIL A;  2WLM A;  2ZNJ A;  3CCE V;  1GAX A;  4PA3 A;  5FL7 G;  3T4D A;  1MZF A;  2QWQ B;  2GBO A;  4IYH A;  5EBW C;  2NN4 A;  1SQV H;  3D36 C;  2DW4 A;  2EZP A;  2HVJ C;  1NTM H;  3ZHV A;  1SER A;  1JJO A;  4FIP C;  4H37 A;  3FFQ A;  5B1B B;  3AG3 C;  3CCJ V;  1XHX A;  1BQZ A;  1A32 A;  5JH7 B;  1VQP V;  3E8F A;  4ZOL A;  1BSM A;  1QLE B;  1P7B A;  2Q7H A;  3ABL B;  5EBM C;  5JVD A;  1K33 A;  4QE7 A;  1TAE A;  1U97 A;  2LW7 A;  1ZL8 B;  2Q67 A;  4DW1 A;  1SKV A;  4LH7 A;  1AI6 A;  3ABK C;  2EZO A;  4LNU A;  1GH6 A;  3L73 H;  2UXD B;  1HNW B;  5K1X A;  4GT1 A;  4ASU G;  2JGU A;  2HG5 C;  2YEV A;  5KHH A;  4YIO A;  3CCL V;  2BTQ A;  1AR5 A;  4DR4 O;  2NLJ C;  5CB4 B;  1RM1 C;  4IT5 A;  2Q4P A;  4B7E A;  5E1A C;  1L0N H;  4L8J A;  4H13 B;  4MTX A;  3CMA V;  4UCT A;  3AG3 B;  1DF5 A;  2V7Q G;  2WPD G;  4AHC A;  3IFX A;  3IGA C;  2CK3 G;  5AG2 A;  1T5E A;  1EZJ A;  2L35 A;  3JCZ A;  4DV3 B;  1NTK H;  4LF6 B;  3N2K B;  2DOS A;  2YUA A;  2JK5 C;  3RGB A;  5JJE B;  1GK9 A;  3G6B A;  3OR7 C;  3T1H B;  1YIJ V;  3LSU A;  4FLY A;  4LF4 O;  1KC8 W;  2E76 B;  4DR5 O;  1QNM A;  4JAU A;  4DRX A;  4DUZ O;  2GTS A;  4UVB A;  1L0L H;  4X1K A;  4AIL C;  5IYB O;  1URF A;  4BW5 A;  3EXA A;  5CBF A;  3JD0 A;  1IBL B;  3LDE A;  3MD0 A;  3OEH G;  3PJS K;  4JYC A;  3DXR B;  1SZT A;  3ABU A;  3UQ8 A;  2OTJ V;  3SGI A;  2W0X A;  2A0L A;  1VEW A;  1LUV A;  3E8B A;  1IDS A;  5H6Q A;  1AJQ A;  4I5S A;  2LO1 A;  2X6C A;  3N2G B;  4TV8 B;  3W7T A;  4GKK O;  1PL4 A;  5IJ9 B;  3CSX A;  1BMF G;  1PNL A;  3CCM V;  4QJF B;  2RQ6 A;  4CS4 A;  4OPA A;  5GON A;  1Y76 B;  3TXQ A;  2ZKO A;  1VF6 A;  1OCR C;  5LXT B;  2PY5 A;  2QWN B;  3I55 V;  2MK3 A;  2F1M A;  1VQK V;  4EFE A;  4P9P A;  1IBK B;  2EUL A;  4LF9 O;  3QO5 A;  3RYH B;  4LFB B;  1ENV A;  1FPO A;  2G38 A;  2BOB C;  1TUB A;  2FTK A;  5B1A B;  2UUB B;  3JAT B;  1AR4 A;  3N27 A;  2VWJ A;  1JFF A;  1YVW A;  1Q86 W;  1NJI W;  3TGU H;  4O4I B;  5LP6 C;  1F4M A;  2LJ2 A;  2QA4 V;  5GTH Z;  2YC0 A;  2JEX A;  3UO2 A;  1H2L A;  2WLJ A;  3IC9 A;  4X20 B;  3T1C A;  4NVP A;  3ZRW B;  1J95 A;  4GX5 A;  1COW G;  4NTW A;  3T4Z A;  3CEI A;  4J41 A;  4CH5 A;  3UKM A;  2EIM C;  5E79 Z;  2Q8V A;  4EB6 A;  3GWK C;  3K59 A;  1QCE A;  2F23 A;  5J2T B;  2P6J A;  5LBQ A;  2YIB A;  1NH2 D;  5IJ0 A;  3CD6 V;  4MVO A;  1G6U A;  1NKD A;  4PD4 F;  3E2E A;  2XAG A;  1VF5 B;  4MVM A;  2ITD C;  1AI4 A;  1FD9 A;  2EJR A;  2FML A;  1FJG O;  4KHP O;  4I4T B;  2GSM B;  2OT5 A;  4RO2 A;  3RWR D;  4FPP A;  3K58 A;  3BRC A;  3T2M A;  4AI8 A;  4GX1 A;  2JGD A;  5LP6 B;  3JAR B;  1DGS A;  1G1X B;  2KG7 B;  4JI4 B;  4ZI7 A;  5L3C A;  4G2K A;  1SQF A;  4X9Q A;  4MTF A;  2ADP A;  1W0J G;  2LW1 A;  4CH4 A;  4YJ2 A;  4O2A B;  4MVZ A;  3WB1 A;  4YHH B;  4XBF A;  3VQX A;  4YY3 O;  2E75 B;  2EIM B;  1Q6I A;  3STZ C;  2VWK A;  3MHH C;  2F93 B;  1AB3 A;  5B66 Z;  5LYJ B;  1Z2G A;  4U3J A;  3HKD B;  1THZ A;  1WB7 A;  4NYK A;  3TET A;  3ZN0 A;  5L3F A;  2BCC H;  4H44 B;  4DR4 B;  4DV1 B;  2QEX V;  4PDR A;  4CC6 A;  3ETQ A;  2Z3Y A;  2GTA A;  1GN2 A;  1N36 O;  3JAL B;  3UCS C;  3QO8 A;  1QR8 A;  3OT7 A;  3FX7 A;  1R3J C;  4WFE A;  1MSD A;  3P3P A;  2UUA B;  5KA6 A;  5C93 A;  5KLV H;  1NH2 B;  3K0D A;  1N8R W;  3KKY A;  4I9W A;  4JZG A;  3CCQ V;  1TVK B;  1N0N A;  4GX0 A;  1R73 A;  5DN6 G;  2PF4 E;  1XIL A;  3GVM A;  5KHG A;  2F95 B;  4FLX A;  1XMO O;  2QTS A;  4DV5 B;  2P4K A;  2WLI B;  2CAZ C;  4NTX A;  1HNZ B;  5IT9 N;  1P84 F;  3J7A U;  4AQY B;  4GLX A;  1NT2 B;  2AXT Z;  2WLL B;  1P7G A;  4XDJ A;  1BHA A;  1PP9 H;  1OCO C;  1B06 A;  4OPH A;  5EIB C;  3OFN G;  2AZ0 A;  4DR7 O;  3OGC C;  1OZ0 A;  1VQ5 V;  3CRC A;  1PKX A;  2CTQ A;  2F66 C;  3E22 A;  1M5I A;  2D2C B;  3RYC A;  2PTM A;  1IX9 A;  3ZJZ A;  4MTG A;  3U11 A;  4J10 A;  1ZAU A;  2XAH A;  3LUT B;  2ZE5 A;  3LDD A;  4UCS A;  5D5Q A;  2YI8 A;  3JAW A;  4GKK B;  1QLN A;  3AG4 C;  1BE3 H;  1I5Y A;  3CC7 V;  1GN3 A;  4X66 B;  2Y48 A;  4PEL A;  4MVQ A;  2KB1 A;  5B3S C;  3CB2 A;  4NKG B;  4DV0 O;  3CXC U;  2WA4 A;  1VQ8 V;  1H2G A;  1K97 A;  1MMM A;  5JCO C;  1YJN V;  3T1Y B;  4LH6 A;  1KYO F;  4J9Z B;  3KCY A;  3CCS V;  3JCU Z;  4L87 A;  1GKF A;  4DUY B;  1OCO B;  4JI8 O;  4JYA O;  3ZN1 A;  1GM8 A;  4DV7 O;  4O4J A;  3HKC A;  4OX9 O;  4TQF A;  4LF8 B;  3P32 A;  3QO7 A;  4B3M O;  1RSO A;  1YTF D;  3L71 H;  1UJW B;  3RYI A;  3S3W A;  4E2L A;  4R50 A;  3HKE B;  2OIE A;  3CCU V;  3RYF A;  1MZE A;  2M7W A;  4MVU A;  1QHT A;  4IHJ B;  4PDV A;  4J80 A;  1K4D C;  2A9H A;  2R9I A;  3B40 A;  1YSC A;  4MS2 A;  1XRE A;  2VQF B;  1N32 O;  2QWP B;  2CH7 B;  4O4L B;  3OW2 U;  3W7W A;  1RFY A;  3ZBH A;  3HPL C;  3GB7 C;  4ZHQ B;  2XTA A;  4UCU A;  1KMI Z;  5B3S B;  4TOI A;  1CPY A;  3SR2 C;  1ZWI C;  4X64 O;  4F4L A;  2QDO A;  3RW0 A;  4FFB A;  1RP3 B;  1PD3 A;  4DV4 B;  4K8X A;  1FJG B;  4JI2 B;  1HR0 O;  1JPX A;  1K4C C;  2ZQM A;  1V54 C;  1ZUQ A;  3AK3 A;  1IBM B;  3R66 A;  4Z1V A;  1DLB A;  1VQM V;  4JI0 O;  4O4H B;  3AG7 A;  1P49 A;  1SA0 A;  2B1G A;  2WSS G;  2FYU H;  3VBB A;  3O9O A;  4TT3 G;  2IU3 A;  4X8A A;  3L74 H;  2E3C A;  2Y69 C;  3JYC A;  3L72 H;  4RQF A;  3BCC H;  4HBN A;  1RPR A;  5J2U B;  1H38 A;  1K7D A;  2CTR A;  3ZRX A;  2KKW A;  4G28 B;  3ETG A;  4JAA A;  4PA9 A;  2QWR B;  1SRY A;  2GUZ A;  3B8N A;  2IW5 A;  4H33 A;  1J5E O;  2E74 B;  1XNR O;  2YXL A;  1WN7 A;  3JAK B;  3NXS A;  5LA6 B;  1YTF B;  5BR8 O;  5KMG B;  3ZMU A;  2WLK A;  3WG7 C;  4DW0 A;  4X89 A;  3DC5 A;  5B5E Z;  2ODM A;  1MSW D;  2AHZ A;  2DQ3 A;  2UXB O;  5JJJ B;  3APO A;  3A8T A;  4O2B B;  2PYL A;  1K9M W;  4JAV A;  1L8D A;  4DR6 B;  1W2B U;  2XOK G;  2ZXW C;  3I56 V;  1V55 C;  2JS5 A;  4I0X B;  5FLX N;  2H8P C;  4WFH A;  2IM9 A;  3E83 A;  1GMG A;  4LF5 O;  2K1E A;  1B04 A;  5TIS Z;  4LWS B;  2R9R B;  4LFC O;  1FXH A;  2YXH A;  1OJH A;  3E89 A;  2GV9 A;  4YXW G;  4JI6 B;  2EX3 A;  1ZL8 A;  3BY6 A;  4BIZ A;  3A0H Z;  2ADQ B;  1VQL V;  1YCI A;  4H0L B;  4P2Z A;  5KX5 B;  1M93 A;  3I5D A;  2F4V O;  1K5Q A;  3ZMS A;  3SYC A;  2LFR A;  4FZ0 A;  1SF9 A;  2LGQ A;  4R6Z A;  1M4U A;  2R9A A;  3EFF K;  1KKD A;  2YI9 A;  1M1K W;  4B3S B;  2BSK B;  3H1I H;  4JI7 B;  1DF4 A;  2B5U A;  5CB4 A;  4UB6 Z;  1FKA O;  5IWA B;  3D36 A;  2P22 C;  5KAI Z;  2QSA A;  1WLE A;  5A9G A;  2OTL V;  2VQE B;  3K9A A;  2ZIO A;  2Q7E A;  3OR6 C;  2EIK C;  3N2K A;  4FFK A;  4JGS A;  1VQO V;  2ZDI A;  1WB8 A;  1WPX A;  3B09 A;  1E1Q G;  2OYQ A;  4BIO A;  2CTP A;  1M57 C;  5BXZ A;  5EC1 C;  4JI5 O;  3CCR V;  1DTO A;  2ITC C;  5LMU B;  3BAB A;  4MVR A;  1KP2 A;  3CRQ A;  5ITZ B;  4QIW F;  3MAQ A;  4PA4 A;  1XQ8 A;  3K79 A;  1K8A W;  5CA1 A;  1Q7Y W;  3ABK B;  3O65 A;  3CJH B;  4DV6 O;  2CTW A;  1HNX O;  2WWW A;  1XEQ A;  5LMN B;  4PA7 A;  3A2F A;  3DXR A;  3S3X A;  5GTI Z;  1RPO A;  1L1F A;  2Q73 A;  4PDL A;  3OAA G;  3JAM N;  1MA1 A;  4CH3 A;  4DR1 O;  1Q3E A;  1Y74 B;  3P3N A;  4UV9 A;  4GKJ B;  4TV8 A;  3N2G A;  2UU9 B;  3X2Q C;  5CN0 A;  5IJ9 A;  3UM7 A;  3M99 B;  4YJ3 B;  3ABT A;  4X62 B;  1KEC A;  1VIB A;  1VQ7 V;  4JTA B;  1Y76 A;  3BVO A;  3IJ4 A;  3NR7 A;  4HZ3 A;  1RM1 B;  2EIK B;  4F6E A;  2HJF C;  4I9Q A;  1R6K A;  1AJN A;  3K5M A;  5LXT A;  4JV5 O;  3ASO C;  4LF7 O;  2AW9 A;  5F2V O;  3B2E E;  2A79 B;  1SES A;  4QGP A;  3RYH A;  1HR0 B;  3HKB B;  3AG1 C;  2AZ2 A;  2YIC A;  2QJ1 A;  2RNB A;  1WP8 A;  5H2F Z;  2WA3 A;  3JAT A;  2IBZ H;  4K0K B;  4D6T H;  3ETD A;  1TGO A;  2ZNI A;  3DGE A;  4O4I A;  1TUE B;  1SET A;  1O9G A;  3CPW U;  4B3T O;  2N74 A;  4TUY B;  3SDL A;  4FVM A;  3L9D A;  4X20 A;  4X65 B;  2UXC O;  2PI4 A;  3ZRW A;  4JI1 B;  4DR3 B;  4JI3 B;  3Q4H B;  1F4N A;  3B4S A;  2CUG A;  1PV0 A;  1AR1 B;  4I7Z B;  2LP7 A;  3OUF A;  1F7Y A;  4I55 A;  3CME V;  2DWE C;  5LGT A;  2RJZ A;  4NXM O;  1I7F A;  1N33 B;  5H5N A;  2DYS C;  4HNA B;  3H1K H;  1J5E B;  3SJQ C;  1FXV A;  3PN1 A;  5BR8 B;  4W4K A;  4GCZ A;  4FM1 A;  2VRZ A;  4NR1 A;  3UO3 A;  3ZHQ A;  3ZMT A;  3K3W A;  4TV9 B;  1R6N A;  3AG1 B;  2ZIM A;  3OTO O;  4I4T A;  2QKS A;  3STL C;  2JJ1 G;  1OCR B;  5DED A;  1XNQ B;  3M8A A;  1OCZ C;  3MHS C;  5BZB A;  5L3D A;  5LP6 A;  3JAR A;  1PL0 A;  2KG7 A;  1FXK C;  4DV2 O;  2YXY A;  3UT5 B;  1KU9 A;  2OCH A;  2WAM A;  1AP6 A;  3APQ A;  4O2A A;  3K04 A;  3OD4 A;  3LSS A;  1I08 A;  1GTO A;  1D5N A;  4WFA V;  4WBN B;  2DYS B;  1M90 W;  5LYJ A;  5JQG B;  3HKD A;  3SYO A;  2XAJ A;  1GN4 A;  4E4E A;  5KAF Z;  2Q6A A;  4JTD B;  2XAS A;  3BA8 A;  4UFZ A;  3SJA C;  3TJT A;  5LGU A;  2ZR3 A;  5EZY B;  1Q5O A;  2ZD9 A;  2E5L O;  4QPJ A;  4KUM A;  2WLH A;  3JAL A;  5CA0 B;  2LGW A;  1XMQ O;  5LGN A;  1Q6H A;  3SPI A;  2X0L A;  5L3B A;  2Q68 A;  1OCZ B;  2CGO A;  5EK0 A;  3RFR A;  3SPJ A;  4U7O A;  5LHG A;  1FXK B;  1I94 O;  5IYC O;  4B3R O;  1N34 O;  3ZCC A;  1V9P A;  1JR9 A;  2H94 A;  2YS8 A;  4MSW C;  2PYJ A;  4NXN O;  1KQS U;  5EIB D;  3RVY A;  1JCH A;  2P7T C;  2WLL A;  2HHH O;  2Z5U A;  4DR2 O;  2QKA A;  3MDS A;  2JJ2 G;  1Y4M A;  3ZMZ A;  4CS3 A;  3CCV V;  1DK1 A;  3IC7 A;  4J9Y B;  3FAV B;  3OGI B;  4LF4 B;  4K35 A;  2LQT A;  4DR5 B;  1OCC C;  5JJN B;  4GUN A;  2XHB A;  4DUZ B;  1KP3 A;  1JX9 A;  1H2N A;  3JSN A;  5LOV B;  3L75 H;  4DK1 A;  1AJP A;  1LR1 A;  3CE2 A;  1QVF U;  3H01 A;  5FPR A;  1SQQ H;  1IXM A;  3AG2 C;  5K1P A;  5FPO A;  2L6L A;  2IU0 A;  1R1B A;  3CRM A;  3H1J H;  2H3O A;  3JSL A;  4P9O A;  2D3O W;  2PI5 A;  4EEQ A;  1QBZ A;  1WA8 B;  4JF3 A;  4LF7 B;  4X1Y B;  4A5U B;  2UXD O;  1HNW O;  1BL8 A;  3K9S A;  1IXB A;  2JS3 A;  5C8Y B;  1D2D A;  2DWD C;  2Q5Z A;  4LF9 B;  1K5S A;  3D8C A;  4J7J A;  2P5O A;  1Y6X A;  2RN9 A;  1OCC B;  2GHY A;  3LSQ A;  4QPK A;  4TQD A;  1FAF A;  3HKE A;  4KL1 A;  1MOF A;  1OHH G;  4B7K A;  3QNE A;  1VQ4 V;  3JAS B;  4FM2 A;  2WLN A;  4PV1 B;  2Q69 A;  3JD1 A;  5IE9 A;  2IH3 C;  4FZ1 A;  3DC6 A;  2XUM A;  3F7V C;  4FMT A;  2CH7 A;  2DN9 A;  4O4L A;  2DYR C;  3WFV A;  3AG2 B;  2HP8 A;  4BW9 A;  4ZHQ A;  4DV3 O;  2DQ0 A;  3G71 V;  4LF6 O;  2EIL C;  1BCC H;  4KXR A;  4PI0 A;  4BR6 A;  3AG4 B;  3T1H O;  5BMV B;  4UVA A;  3WB0 A;  4CZZ A;  1ZSP A;  2GDS A;  1EZV H;  2AHY A;  2OCC C;  2PUS A;  4FLZ A;  4QNH B;  3EVK A;  1VMG A;  1JMK C;  4IL6 Z;  3SJC C;  1NQT A;  2BE3 A;  3TCU A;  4O4H A;  1GM9 A;  2ZE7 A;  1IBL O;  3BEH A;  4FM0 A;  1JVM A;  1F51 A;  3U0Z A;  4KHP B;  2KQX A;  5EBL C;  5H9C A;  2Q0O C;  1F23 A;  1K92 A;  1FYJ A;  3ZHU A;  1H2K A;  3CHX A;  1YI2 V;  3ABM C;  2AGA A;  4GX2 A;  2R72 A;  5J2U A;  2HEP A;  1S3J A;  3AEI A;  3W7U A;  1S72 V;  5KUM A;  2W6I G;  1M56 C;  2DYR B;  3ZX6 A;  4UUJ C;  1B6Q A;  5LA6 A;  3JAK A;  4XDL A;  5KMG A;  1BS3 A;  1YHQ V;  1YZB A;  1I0H A;  1FFX B;  2HFE C;  4IIJ A;  4RAI A;  2QWO B;  4YY3 B;  3OUS A;  1WJZ A;  4FFB B;  5J9P C;  1B3Q A;  3CYO A;  1FS0 G;  4LFB O;  1K73 W;  2QGN A;  3SYA A;  4O2B A;  5IYZ B;  1XMQ B;  2UUB O;  3VQV A;  3ZHR A;  1QVG U;  3WB2 A;  5B1B C;  4FLU A;  1GM7 A;  4FLV A;  4KFM A;  4F6R B;  3A0R A;  1YEW A;  4CH6 A;  1NR1 A;  5LHH A;  2N04 A;  1QLE C;  2JDI G;  3ABL C;  1H2M A;  4LWS A;  4XDK A;  2HLD G;  4MVS A;  4ABM A;  5EYP B;  1N36 B;  3W7X A;  1V54 B;  3AK1 A;  4JYB A;  3ABM B;  1Z5W A;  1Q90 D;  4BIU A;  2EIJ C;  5JH7 A;  5FNV B;  4B08 A;  5B1N A;  3JD2 A;  2NNU A;  1XMO B;  5KX5 A;  2UXX A;  4OGQ B;  3EHB B;  1BGY H;  3FB7 C;  2B1I A;  4UCV A;  2HVK C;  1GO3 F;  1XDC A;  2A7W A;  2Y69 B;  5KHK A;  1YDX A;  4I50 B;  4X1I B;  3KZI Z;  3OMN B;  3CP1 A;  2BSK A;  4NB5 A;  4ICG A;  4DYL A;  1LUW A;  3WU2 Z;  3CXH F;  2CGN A;  2BTO A;  2IJI A;  3CC4 V;  1NU1 H;  4DR7 B;  3BPZ A;  1YIT V;  4W4L A;  5CBH A;  3H1L H;  3WG7 B;  1JJ2 U;  2R70 A;  1EFR G;  4PJ0 Z;  4FLT A;  4JI4 O;  2RMK B;  2A3Q A;  2ZIN A;  2W0F C;  4P30 A;  1O9H A;  1X59 A;  1EBO A;  1ARO P;  3LNN A;  4UCR A;  2JVD A;  3ZHS A;  2JRI A;  2XAF A;  2ZDI C;  4TSF G;  4IGG A;  2BOC C;  2EIJ B;  2ZXW B;  4X88 A;  3RN4 A;  4YHH O;  1V55 B;  1HWY A;  3GWO A;  4ZOL B;  1EN4 A;  5GW7 A;  3SPH A;  2EJ7 A;  2JEU A;  1M9N A;  3ASN C;  4JAS A;  5JVD B;  3G4S V;  1KD1 W;  5ITZ A;  4DV0 B;  3ETE A;  5CA3 A;  1G8M A;  2O57 A;  2RDC A;  3CJH A;  2PGG A;  1SQP H;  4LFA O;  4DXW A;  5H6R A;  4LNU B;  4LCU C;  4DV1 O;  1Q43 A;  3ML0 A;  3K5N A;  4JI8 B;  4JYA B;  2NR5 A;  1Y74 A;  4DV7 B;  4J42 A;  2UUA O;  4YJ3 A;  1S5J A;  2X6A A;  2YEV B;  4OX9 B;  1MG1 A;  3SJB C;  1ZX3 A;  2BTQ B;  4B3M B;  5KHJ A;  3OM3 B;  2YDE A;  2EBO A;  4RWU A;  2DJV A;  4DV5 O;  4UCO A;  1QU7 A;  2ETN A;  1JA8 A;  1HNZ O;  1VQN V;  1I5X A;  4R8C A;  3ZRS A;  2QM8 A;  4R7C A;  1N32 B;  4AQY O;  1BQ0 A;  1QR9 A;  3BHP A;  3HKB A;  4EKW A;  3RT3 C;  3ASN B;  5B1A C;  3SYQ A;  4PHZ A;  1VF6 C;  4OXS A;  2EIN C;  1SS3 A;  4BWA A;  5CBG A;  3ZRV A;  1YJ9 V;  4X64 B;  5CMU A;  5CA1 B;  3CRR A;  1H2S B;  1WPB A;  3D3I A;  3D3Q A;  1M57 B;  1EM1 A;  4FLW A;  4TUY A;  3DSQ A;  4D7S A;  2QM4 A;  4U7N A;  3SPC A;  3J81 N;  4DRX B;  4X1K B;  4YIP A;  2IH1 C;  3Q4H A;  4MT8 A;  3BFR A;  2YIB D;  1US6 A;  4JI0 B;  1S0V A;  2ILM A;  4FK5 C;  1UPG A;  4RUE A;  2DMX A;  1UFI A;  3E86 A;  3M7M X;  4HNA A;  4N23 A;  4X66 O;  1K3E A;  4LC1 A;  3K5L A;  1ORQ C;  5L3G A;  3X2Q B;  4MW8 A;  3FKS G;  4PA6 A;  2V4D A;  1E79 G;  1NR7 A;  1YJW V;  3T1Y O;  4TV9 A;  2ZCE A;  2CE4 A;  5J2T A;  2C2A A;  1GN6 A;  5GON B;  2Y4T A;  3AK2 A;  3CC2 V;  1Y67 A;  1VF7 A;  3FB8 C;  3U10 A;  4DUY O;  3OE7 G;  1XNR B;  2EIN B;  1S77 D;  3ICX A;  3ASO B;  3TK1 A;  1ROP A;  2ZT9 B;  1HP8 A;  4LF8 O;  2ZR2 A;  2X6B A;  2UXB B;  3K57 A;  1NBM G;  1XL6 A;  1JOY A;  2XND G;  3UT5 A;  3FYI B;  1TUB B;  4FJC C;  5HFM A;  1JFF B;  1EN6 A;  5KUK A;  3JD3 A;  2DE0 X;  3FYE B;  4Q20 A;  4I55 B;  5BY1 A;  1ZLZ A;  3KG2 A;  1GRJ A;  4DO2 A;  2VQF O;  4WFB V;  4LF5 B;  5LL6 Y;  4WBN A;  3A0B Z;  4LFC B;  5JQG A;  2PZS A;  4N21 A;  4NTY A;  3CS5 A;  3G67 A;  4ZKI A;  1FFT B;  3ZMV A;  4RUF A;  4WFG A;  4Z1M G;  1HDJ A;  4UB8 Z;  4EB6 B;  5EZY A;  4DV4 O;  2B9Z A;  4K3A A;  4JI2 O;  1BT8 A; 
#chains in the Genus database with same CATH homology
 1D2D A;  4DR5 O;  2ZM6 O;  2JRI A;  5BXZ A;  1F7Y A;  4B3M O;  4DUZ O;  1XMO O;  1YZB A;  4NXM O;  1IBM O;  4JI5 O;  4YHH O;  2UXB O;  2UUC O;  5H5N A;  3F5T A;  1I94 O;  4B3R O;  1NS1 A;  1N34 O;  4LFB O;  1A32 A;  4B3S O;  5IT9 N;  3J7A U;  4JI7 O;  2UUB O;  4X66 O;  3O65 A;  5FLX N;  4DV6 O;  1N32 O;  4NXN O;  1FJG O;  5IWA O;  4KHP O;  1HNX O;  1XEQ A;  4LF5 O;  4K0K O;  4OPH A;  2LW7 A;  5A2Q N;  3OTO O;  2HHH O;  4LFA O;  4LFC O;  3JAM N;  4DR2 O;  4DR7 O;  2VQE O;  3T1Y O;  4GKK O;  4DV1 O;  4DR1 O;  4DV3 O;  1IBK O;  3M8A A;  1DK1 A;  4LF6 O;  4X64 O;  1G1X B;  4DUY O;  4OPA A;  4X65 O;  2ZKO A;  1HR0 O;  2UUA O;  4JI1 O;  4DR3 O;  4JI3 O;  3T1H O;  4DV2 O;  2F4V O;  1R6T A;  4LF8 O;  4JV5 O;  3R66 A;  4LF9 O;  4DR4 O;  4JI0 O;  4YY3 O;  1N33 O;  2DJV A;  4DV5 O;  2FKX A;  5LMU O;  4LF7 O;  1HNZ O;  1AB3 A;  4DR6 O;  1IBL O;  1FKA O;  4AQY O;  5BY1 A;  1KUQ A;  2VQF O;  1R1B A;  4DV0 O;  3RT3 C;  5LL6 Y;  5LMN O;  1FYJ A;  2AGA A;  4B3T O;  4JI6 O;  2N74 A;  2Z0A A;  3SDL A;  1XNQ O;  2DOS A;  3J80 N;  1AIL A;  4GKJ O;  1N36 O;  2UU9 O;  1J5E O;  4JI8 O;  4JYA O;  2E5L O;  4JI4 O;  4A5U B;  2UXC O;  1XNR O;  2UXD O;  1HNW O;  4X62 O;  4DV4 O;  4DV7 O;  5BR8 O;  3J81 N;  1XMQ O;  4JI2 O;  4OX9 O;  1X59 A;  4LF4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...