2VQEO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqeO00
4YY3O 3SDLA 4K0KO 2FKXA 3M8AA 1IBLO 4LFBO 3JAMN 4X66O 4LF7O 5LMUO 4DUZO 4LFCO 2VQEO 4B3RO 4DR1O 4DR6O 1N33O 1N34O 1AILA 4JI3O 1XMOO 4DV7O 2VQFO 2UXCO 1I94O 1A32A 2DJVA 4OPHA 1FYJA 4JI6O 1R6TA 1XEQA 1XMQO 1YZBA 4DV3O 4LF4O 5BR8O 3J80N 1N36O 4LF9O 4DR4O 4GKJO 1D2DA 1X59A 4DUYO 4DV0O 1FKAO 4DR7O 4DR3O 4NXMO 4JI0O 3O65A 4LF8O 4NXNO 4OX9O 1HNXO 1IBMO 5LMNO 2UXDO 1XNQO 1R1BA 4DR5O 1DK1A 2Z0AA 1N32O 2N74A 1FJGO 5FLXN 4DV5O 4JI1O 4LFAO 2F4VO 4DV1O 4B3MO 5H5NA 4YHHO 4DV2O 4JI4O 4DR2O 1NS1A 4B3TO 3RT3C 4LF5O 1AB3A 2AGAA 5A2QN 4X62O 5IT9N 1HNZO 5LL6Y 4JI2O 4JYAO 3T1HO 3F5TA 2JRIA 4OPAA 2UUAO 4JV5O 2UUCO 1KUQA 4JI5O 2LW7A 4AQYO 1IBKO 4KHPO 4JI8O 5BXZA 3J81N 1XNRO 4B3SO 2UXBO 4DV4O 2DOSA 2E5LO 3T1YO 3J7AU 3OTOO 4X65O 1F7YA 4DV6O 4GKKO 5BY1A 4A5UB 1HR0O 4X64O 2UU9O 5IWAO 1J5EO 4LF6O 1HNWO 2ZM6O 2HHHO 2ZKOA 2UUBO 1G1XB 4JI7O 3R66A
chains in the Genus database with same CATH superfamily
3G67A 5JVDA 5AG2A 4MVOA 1SQBH 4YHHB 2QSAA 4O4IB 4O2AB 3EHBB 1D5AA 1LUVA 1O9HA 5GW7A 5J2TB 1LNQA 1N33O 1B04A 3K04A 3K9SA 3L70H 2PYJA 4OGQB 3N27A 4LCUC 5FPOA 3CC4V 1FYJA 2R9IA 3DSQA 1OHHG 2F1MA 5KHKA 4KXRA 3LDCA 1F4NA 2LW1A 3CE2A 2X0LA 1VARA 1NT2B 4DUYO 4K8ZA 5LMUB 1L1FA 2JK5C 3CHXA 3ZRXA 2NNUA 1LUWA 1AVMA 2M7WA 2PI5A 1EBOA 1IBMO 4KP4A 1JX9A 1AR1B 2CTQA 3IC7A 3UM7A 4DV1O 4B3MO 5H5NA 5F2VO 1M90W 2X7RB 4X20A 3AK3A 1Z5VA 2GSMB 2JEXA 5K1XA 2P5OA 4Q6GA 2Q7GA 5GONA 3ZN1A 3I55V 1EN4A 1Y67A 1MSWD 2N04A 1NTZH 3CRQA 4LFCB 3RVYA 4Z1VA 3NXSA 3ZRSA 3AG2C 2VRZA 3JAWB 3B77A 4NTWA 4QGPA 4JI3B 1YJWV 2UXDB 1YITV 1GM9A 3FKSG 4WBNB 3OM3B 5TISZ 4EKWA 1YDXA 3ABLB 1YCIA 3E83A 4PDVA 1M57C 1R6KA 1EN6A 1GM7A 4DR7B 4IL6Z 3WFVA 4QE7A 4JF3A 1FXHA 1OCZC 4JASA 4O4HA 1QLEC 3RYFA 4NTYA 5JJEB 3OE7G 2P90A 3OD4A 4K0KO 4Q20A 5CBHA 2YDEA 1XBLA 4UCSA 2Q68A 3K5MA 5DEDA 3RYCB 4QIWF 4YJ2A 1NI8A 3CCLV 4GX1A 1AR4A 2IJKA 3H1HH 2QR4A 2YI8A 3L71H 4NR1A 3L75H 5KHIA 4O4LA 2PGGA 1VQ7V 3PN1A 5B1BC 1OCRB 1S3JA 3B8MA 2QKAA 4J41A 5FL7G 1L0LH 4NXMO 1M5IA 4BR6A 1M9NA 2CGNA 2QA4V 1XUQA 4QPJA 1JPXA 2KSDA 3ZMSA 2HHHB 3UT5A 3P32A 4RUEA 2ZE7A 1KKCA 1COWG 5IY5B 1HDJA 1AB3A 5L3GA 1OCCC 4FLVA 3H1KH 1WAZA 1ZSPA 3BABA 5JH7B 1ZL8A 1RM1C 1NQTA 3ZMZA 1PM9A 3I5DA 2CTRA 2B1IA 3ZS8C 1XREA 4HZ3A 2G38A 3CC2V 4B3SO 3THOA 3GVMA 3APQA 3JAKB 3T1YO 3J7AU 3MD0A 1QVGU 5IJ9B 5BR8B 4DRXB 4X1YB 2ZNJA 3CRCA 2OCCC 4JI2B 2AZ0A 3SGIA 3PJSK 2EINB 4NVPA 4MT8A 4MTFA 1FAFA 1YIJV 3SYPA 4I4TA 2ARHA 4GUNA 2P4KA 5KMGB 3IGAC 2H94A 3QO5A 2YIAA 4CH3A 1N32B 2QDOA 1FJGB 2JGDA 4JI1B 4WCEV 1E79G 5IYZA 3ASNB 5D5PA 1PNMA 4RQEA 5B3SC 2PZSA 4P2ZA 4B3RO 1YF2A 5LP6A 4UCRA 4R7CA 3IAYA 1ZAUA 1FXVA 3AG1C 3ZX6A 1WJZA 4DV7O 4PA9A 5LHHA 2CH7B 4IIJA 1GTOA 1HWYA 3K5LA 2BOCC 2LGWA 1IBKB 3JATB 2QEXV 2K9PA 3JARB 1WPXA 2XAHA 1Q43A 1Z5WA 1B06A 4DR3O 1WP8A 1VQ8V 3O65A 3JD0A 4I50A 5H9CA 1P84F 1L8DA 2FYUH 4QPKA 4WFEA 1H2SB 4ASUG 4IHJB 2Z0AA 4FFBB 3FB8C 4ZIBA 3K5NA 4FM1A 3SR2C 4YY3B 5KAFZ 4B3TO 2AGAA 1K5QA 2QWPB 5KUMA 3DC6A 4AI8A 3FB5C 1K34A 3VQVA 4JV5O 4K35A 3VBBA 5E79Z 1IX9A 4BWAA 5CA1A 1GO3F 1I94B 4LWSB 3SYOA 1BS3A 1PNLA 3VQXA 3C3TA 5LYJA 1K9MW 3HKCA 4LF4B 2N05A 3ZHRA 4LF9B 4GKJB 3STZC 2YIDA 2W0FC 1T5EA 2XHBA 1AI6A 2ZM6O 4LF8B 2WWWA 3ABUA 3FYIB 3L72H 5ITZB 3QVNA 4AQYB 1TGOA 4GCZA 3G4SV 2ZNIA 4R8CA 4N23A 3HR0A 5LP6C 3N2KB 1K4CC 4FLUA 3T4DA 3ZHTA 4DV2B 4J9YB 4JPRA 2CGOA 2YXYA 1GM8A 4DR6O 2HJDA 4LF6B 4JAUA 2W0XA 4U3FH 1PNKA 1J95A 1VQPV 1B6QA 1SF9A 4K3AA 1H8EG 2JDIG 4TQDA 3ASNC 3OMAB 2AHYA 2ETNA 3F5WC 3E86A 4O4JA 1RFYA 2WLIA 1GMGA 2RQ6A 5H6RA 1BT8A 5EZYA 3JSLA 1D2DA 2V4DA 2ZXWC 3DC5A 4UVBA 1H2LA 4JI0O 2LFSA 4MS2A 4KUMA 4UXNA 3LNNA 4NKGB 5EK0A 5LMNO 3K9AA 2EULA 4CS3A 3FAVB 4X88A 3CCRV 4YHHO 1MZFA 1DLBA 1SQXH 3JASA 4Z2WA 3OW2U 2ZCEA 2B1GA 3CD6V 5IE9A 5IJ0A 1ENVA 5H2FZ 3FD9A 1NJIW 2UUCO 3DXRB 1K33A 3ZCCA 1H8HG 2DOSA 2ODMA 1ORQC 4X9QA 3HKDA 2UXXA 4C7UA 1P7GA 2XUMA 1SS3A 3SYCA 3QO8A 1I08A 5DECA 3CRMA 2DYSC 4D6TH 3Q4HB 2Y69C 3D36A 3IC9A 3HKBA 4DV0B 3BHPA 3ZBHA 1Q90D 4ZI7B 5BMVA 4RUFA 1XDCA 3G71V 2DMXA 1AI7A 4OXSA 4GX5A 4QE9A 5K1PA 2HLDG 1K8AW 2BTQA 4LFCO 5B1OA 4FZ0A 1KKDA 4JTDB 2VWJA 1XQ8A 4JYAB 1OV9A 4TV9A 4JI3O 3ZRWB 1N8RW 1V55B 1S5LZ 4CH4A 2IJHA 3HB3B 4TWKA 1WNSA 4CS2A 1R6TA 2RN9A 4TSFG 1ZLZA 4I9QA 2YXHA 4YXWG 5LOVA 4I9WA 2Q9LA 4HNAB 3GB7C 4X8AA 4NB5A 2D3OW 1GN4A 3LSSA 2EILC 4DR7O 4X1KB 4UCOA 4UCTA 1XILA 3OFNG 4HAMA 3SJQC 1NTKH 1FXKA 3TK1A 1BE3H 1H2NA 2Q73A 4JI7B 2Q4PA 4JTCB 3ZMVA 4MW3A 4YJ3A 3FYEB 2XAFA 1TAEA 1DGSA 3RYIA 4EEQA 2QM4A 1KMIZ 3CCJV 4WFGA 1N34B 1Q7YW 5KUKA 4PA3A 4P9OA 5KAIZ 5KA6A 1JCHA 4KHPO 1KU9A 2YXLA 2YEVB 3LSQA 2K1EA 1F7YA 1NR1A 2JIZG 4BIZA 4A5UB 3OR6C 3C90A 3AG4B 5LXTA 2HHHO 2ZINA 5H6QA 1EFRG 4JI5B 3KCXA 3CCQV 1M1KW 4MTGA 2ITCC 2P7TC 2HP8A 4X65B 4JI4B 2Z3YA 4LF5B 2JVDA 5KHJA 3K57A 4X62B 2UU9B 1EM1A 4LR3A 1W2BU 3LNMB 2KG7B 3KCYA 4UCVA 2BSKA 4X1IB 4I7ZB 4F6EA 1V54C 1JVMA 4RO2A 4LC1A 3K3WA 5CB4A 1QU7A 4NTXA 1QR9A 2GUZB 4P30A 2P06A 5BR8O 1BGYH 5CBFA 1FXKC 2M6YA 2ADQB 4I0XA 4JYYA 4PD4F 1CPYA 1DF5A 2WLHA 3ABKC 4TUYA 1QLNA 1KP2A 1M56C 1R3JC 1N32O 2QGNA 4B08A 1FJGO 1K7DA 4JI1O 1H2GA 1NBMG 5EC1C 1YEWA 4K8XA 5A2QN 3OUFA 2P22C 3AG7A 4X66B 2ZIMA 2YICA 2EIMB 3F5TA 5L3BA 4O2AA 5LA6B 1BHAA 2Y0IA 2C2AA 4FFKA 4FMTA 4X20B 5J2TA 1PPJH 3EVKA 1IBKO 2PI4A 5GONB 2VQFB 3TJTA 1XNRO 4QJFB 2YSUB 4AHCA 3RWRD 3ABMB 5KLVH 1AROP 3T1CA 2PYLA 1HR0O 2QWOB 1B3QA 1DF4A 5B1AB 5IYBO 4CBCA 5DM6V 3ETQA 2DE0X 4PJ0Z 3AG3C 2YC0A 1JFFA 3B2EE 2WLJA 3H01A 2IJIA 4PDRA 4FK5C 3FX7A 3R66A 4U7NA 4YY3O 1QBZA 1MSDA 4DV5B 1QCEA 3CMEV 3STLC 1YI2V 3G6EV 2WLMA 3ZEDA 3K79A 1P7BA 2WLLA 1DTOA 1XMOO 4UV8A 4YIOA 1I94O 2F93B 1WA8A 1A32A 1QQCA 3MDSA 3K59A 2LQTA 5LGUA 4ICGA 4LF4O 1M93A 3W7WA 4DV6B 4LF9O 4GKJO 4FIPC 2F95B 5IYDO 1X59A 4H33A 4WBNA 1U97A 3S3WA 1WB8A 3ASOB 4O4LB 4LF8O 1W59A 2RCVA 3CXHF 1VQKV 4PI0A 1R1BA 4DO2A 1AP6A 4LBEC 3CPWU 3ZMTA 3UCSC 2Y0PA 1Q86W 4DV2O 4PA4A 4N21A 4J7JA 4WFBV 3ZN0A 2F66C 2JJ1G 3BEHA 3X2QB 3BA9A 2YS8A 2YIBD 3RYCA 2LP7A 1Q5OA 1Y76A 3F7YC 5BXZA 4WFHA 2R9AA 2EX3A 3ABTA 2BE3A 4JI6B 1TUBB 1H2MA 1JOYA 5L3FA 1ZL8B 2HFEC 5JCOC 1N0JA 5BZBA 2Z5UA 4JYCA 2E74B 3LUTB 1HW7A 2ATKC 2CDYA 2HEPA 3OMNB 1K97A 1KC8W 1OJHA 2A7WA 1FFXA 2HVKC 3SJCC 1GAXA 1F4MA 5B66Z 3CCVV 4FM0A 3TGUH 3RVZA 4DR1O 1SQVH 1UJWB 4UB8Z 3ZRVA 2IW5A 4EB6A 2UUAB 5IYZB 2L6LA 1XHXA 2DJVA 1P4RA 4UVAA 3ABLC 4PI2A 5C8YB 3F7VC 5J2UA 3CCMV 3LDDA 3IJ4A 4GKKB 4ZKIA 3LDEA 4DV0O 4MW8A 3K08A 5IJ9A 5IWAB 2XASA 1NKDA 4X1YA 3OT7A 3A2FA 4I55A 1R73A 1IZ3A 1TVKB 2Q7EA 2L35A 2UUBB 3EXAA 2CE4A 3M7MX 5KMGA 2EBOA 1G6UA 2OYQA 1GN2A 3U0ZA 2P6JA 1AR5A 2DWDC 2IBZH 4JYAO 1GN3A 2A06H 5E1AC 2DW4A 3UKMA 1CP9A 2LW7A 2CK3G 3W7UA 1OCRC 3BRCA 1NH2B 4XDKA 4D7SA 4DV4O 1NTMH 4E2LA 3UO3A 4JTAB 1VF7A 3X2QC 4FLXA 3JATA 3APOA 3JARA 2O57A 2ZQMA 4RQFA 2ZKOA 1GRJA 3RBZA 2ZD9A 1XNQB 5IY5C 4F6RA 4JI7O 1Y74B 2QWNB 3RGBA 4LFAB 3WG7B 4UV9A 4O2BB 3MHHC 1S77D 1QNMA 4JYBA 4DR2B 2A79B 1OCOB 2JS3A 2YI9A 2JJ2G 3WU2Z 4PDMA 3OR7C 1NR7A 3A8TA 1N34O 3T1HB 4PA7A 3SJAC 5JJNB 2HVJC 2EIKB 3CJHA 2ZIOA 1X4TA 4FVMA 2DYRB 3CRAA 4JGSA 2E5LB 1SRYA 2XT9A 3MHSC 3CRRA 2EINC 4X64B 1E1RG 3H9VA 4OX9O 3HKEB 4MVQA 4O4JB 1VQOV 1HNWB 3A0BZ 3ZHVA 5FLXN 4Z1MG 5ITZA 4JI4O 1NS1A 2QWRB 1BMFG 4LF5O 4ZOLB 4X62O 1UPGA 3N2KA 4LFBB 4U7OA 1R3LC 1XHZA 2A9HA 3WB2A 2AXTZ 2JEUA 3JASB 3CCSV 1QVFU 3C3SA 4J80A 2GDSA 2V1DA 4TV8A 3CX5F 1N0NA 4IT5A 1MZEA 4DR4B 4DXWA 2WA3A 1QR8A 1NH2D 3RYHB 1WB7A 3KG2A 2QM7A 3JD3A 1JMKC 2ZDIC 1JJ2U 1Q3EA 1EN5A 4L87A 4TOIA 1SA0B 4ZHQA 1Q8IA 3SDLA 2FKXA 2F4VB 1FPOA 3HKBB 2AZ2A 2EIJB 2Q8VA 2XAJA 4R50A 5KA5A 3CEIA 4X66O 1NVPB 5LMUO 1I5YA 3W7TA 3CB2A 1RSOA 4ZBMA 3TXQA 1YTFB 2VQFO 3BA8A 1VQLV 4P9PA 3ZHSA 3DXRA 4W4KA 4JAAA 4FLZA 1RP3B 1WLEA 3ZMUA 4BIUA 2BOBC 3SJBC 2PF4E 2MW2B 2BTOA 5JQGB 1I5XA 4PHZA 1G4YB 2CTWA 2GTSA 3Q4HA 1Q6HA 2QJ1A 3E22A 2DYRC 4LH6A 4U3JA 4B7KA 2UXDO 3RFRA 5LOVB 4DV5O 2FB5A 2EZPA 2JGUA 1WP7A 4FJCC 2QE7G 1VQ4V 2Q0OC 1K73W 1IBLB 4XDLA 2R70A 2LFRA 2WSSG 3K0GA 4DUZB 2VQEB 2ZR3A 4CH5A 3CSXA 3FB6C 2QTOA 4FPPA 5LGNA 4DYLA 2P67A 4UCUA 1NZ6A 2CTPA 3ZRWA 2WLKA 3H1IH 4YJ3B 4GX0A 1JA8A 4MVMA 4BIOA 4DV6O 3RYIB 4UUJC 1P49A 4DW0A 1MG1A 1Y6XA 1SETA 3UO2A 5KX5A 2GHYA 4HNAA 4HYOA 3B40A 2B9ZA 2NN4A 2LJ2A 2IH3C 4JV5B 1XI1A 2WAMA 3VQWA 2NR5A 1KB9F 2E3CA 3WB0A 4PA6A 1IXMA 5LXTB 4MVRA 5FPRA 5EYPB 2OT5A 2Q69A 1HNZB 3L74H 2EZOA 3K03A 4MTXA 2ZM6B 3D8CA 3AG2B 1VF5B 4LH7A 2F43G 4TQFA 5FNVB 2E76B 4IYIA 3CC7V 4OPHA 4JI6O 2Q7HA 2UXBB 1YZBA 2D2CB 1KQSU 3OTOB 3JALA 3J80N 3N2GA 3ETDA 2CAZC 4GLXA 1YTFD 3K58A 2QKCA 3CWBH 1M57B 1AP5A 4DR6B 4DK0A 5CB4B 4J42A 5CA0A 1SQFA 2W6IG 5JVDB 4FZ1A 1R3KC 4CZZA 1QLEB 4J7ZA 1K5SA 4I0XB 2WLNA 4LNUA 1H38A 2HKOA 5LL6Y 4JI2O 1W0KG 1M4UA 3W7XA 2HJFC 1V55C 1GN6A 5GTHZ 1JQ0A 2UUAO 1KUQA 3FB7C 2KKWA 5B5EZ 2KG7A 2OIEA 3D3QA 1TA8A 4FM2A 4X1IA 3TCUA 1CEZA 4GKKO 5B1BB 4CS4A 4DV3B 3M99B 2GUZA 4L8JA 1N36B 5IWAO 1SKVA 1Q81W 3SYAA 2VWKA 1VMGA 3ETEA 4IYHA 4O4IA 5IYCO 4NXNB 2XNDG 3E8BA 4CC5A 1VQ6V 3CYOA 2UUCB 1L0NH 4TT3G 1HNXB 2UUBO 4J9ZB 4DR5B 1G1XB 2B5UA 5L3CA 2WPDG 1MABG 1SERA 3ZIAG 4WF9V 5LHIA 4X89A 1QHTA 2YIBA 1SESA 1JFFB 4JAVA 3LSUA 1OCCB 2Q5ZA 3A0HZ 3ETGA 1K92A 2DQ3A 3JCZA 1S76D 4RAIA 1RM1B 5JCOA 3CXCU 5LA6A 2X6AA 3R65A 4JI8B 4EFEA 4D7TA 1ZX3A 2WLLB 3CCUV 5JJJB 4H37A 3JCUZ 3ZHQA 1FKAO 3AG4C 1ZTEA 2XOKG 3BVOA 4O4HB 1R3IC 1WA8B 3RYFB 4WFAV 2OCCB 5LGTA 1V9PA 1XNQO 2XAQA 1PL0A 2Y48A 1KP3A 1H2KA 1GH6A 1YXBA 3JAWA 4LFAO 1KYOF 4XBFA 1BSMA 4H0LB 4DR2O 5L3DA 2XAGA 3RT3C 2RJZA 5B1NA 4MTOA 1YVWA 4YJ2B 3GWOA 4LF7B 3E35A 5C93A 1SQGA 5B3SB 3T1HO 3A0RA 2JRIA 4OPAA 1WN7A 4GX2A 3K5OA 2A0LA 5KHGA 4AQYO 4I5SA 3AG1B 2UXCB 5EC2C 2E5LO 2AHZA 4JZ2A 5CA3A 1XMQB 2PY5A 4X64O 1ZUQA 1R6NA 1XL6A 5EBWC 1XOUA 4LF6O 1Y76B 1AJQA 2EJ7A 5KHHA 1YJ9V 3UT5B 1SZXA 1OZ0A 1HNWO 2X6CA 2NLJC 1EZVH 4WFFA 4KHPB 1SQQH 4DK1A 4J10A 1JR9A 2EJRA 3M8AA 3OUSA 5IDJA 2RMKB 4LFBO 3JAMN 2EIMC 4YIPA 1AILA 3QO7A 1FFXB 1BL8A 1CXZB 1YHQV 4G28B 3ABMC 3U10A 1K3EA 5B1AC 3QF7A 4DR4O 3ICXA 3B09A 2OWOA 3SPJA 4EB6B 1TUBA 1IURA 3P3NA 2IJJA 4I4TB 1J5EB 1Z2GA 1IXBA 3DGEA 2QTSA 1MA1A 2JGDB 1DK1A 5J2UB 5JH7A 1N4CA 3BFRA 2F4VO 1VQ9V 1SZTA 1URFA 3T4ZA 5CMUA 3WB1A 5LP6B 3H1LH 3SPGA 1K4DC 4LP8A 4I55B 3L9DA 3AK2A 3JAKA 4IIJB 1F51A 3UQ8A 3HPLC 1UFIA 4DRXA 2YUAA 1N33B 3RN4A 2QKSA 3I56V 3ML0A 2LGQA 3SPHA 1AJNA 5BY1A 3VOUA 2IH1C 3KKYA 4I50B 4J7KA 2XTAA 3ASOC 5C8YA 4DUYB 5CN0A 1VIBA 2DQ0A 2HG5C 2X6BA 1Q6UA 2V7QG 2ZXWB 1IBMB 4CC6A 2PUSA 2Y4TA 1XNRB 3CMAV 4R6ZA 1TVKA 2CH7A 1VEWA 4DV1B 4B3MB 2HR3A 1IBLO 1VQMV 2ITDC 2P4VA 4FLYA 1PP9H 3ZHUA 3B8NA 1HR0B 4DUZO 2VQEO 2GTAA 1KBHA 4GZRB 2ZE8A 4QNHB 3QNEA 4F6RB 5CA1B 1AJPA 2R9RB 4XDJA 2MK3A 5LYJB 1FFTB 3H1JH 3HKCB 1Q6IA 3SPIA 4IHJA 2H3OA 4FFBA 3OGCC 2ZDIA 4UVCA 3JD4A 2DN9A 4H44B 3FFQA 3GWKC 3E89A 3CJHB 2DYSB 2Y69B 4MSWC 3P30A 2ZT9B 2FL4A 1XMOB 2QWQB 1Y66A 2ZE6A 1AI4A 1NU1H 3KZIZ 1S5JA 2UXNA 4K0KB 2AW9A 1Y74A 1SQPH 5IT9N 2Q6AA 1HNZO 4LWSA 2WA4A 4O2BA 3OEEG 4FLWA 2QM8A 5LHGA 1D5NA 4EFBA 1IVSA 3VQYA 4JI5O 2WLIB 4GT1A 1O9GA 1FS0G 4UB6Z 2UXBO 5EZYB 4FLTA 5EBMC 3T2MA 3OTOO 4X65O 1GKFA 2UU9O 3K0DA 5A9GA 4UFZA 3CCEV 3OTFA 4JZGA 4NXMB 4RWUA 3JYCA 2EILB 2F23A 3W7SA 2CUGA 4TV8B 4BW5A 3TXSA 3HKEA 3EFFK 4KFMA 4J11A 1VQNV 2PTMA 5IJ0B 1W0JG 3L73H 3RW0A 4H13B 4CH6A 4DW1A 1S5HC 3P3PA 1VQ5V 4ZOLA 4ZHQB 2BCCH 3IFXA 1HP8A 2VS0A 4F4LA 3HKDB 3OEHG 1S72V 4E4EA 3SYQA 5HFLA 1XEQA 1TUEB 4B3SB 4DV3O 1BHBA 5LBQA 3T1YB 3FAVA 1N36O 1RSOB 5J9PC 2E75B 1IDSA 3ZJZA 3BCCH 4DR1B 1KECA 4PV1B 4NXNO 5BMVB 1EZJA 4BW9A 1HNXO 5EIBD 1Y4MA 4DR5O 5EIBC 3RYHA 3WG7C 3CP1A 1I7FA 1PV0A 3K06A 2KQXA 4PDLA 2OIGA 1KD1W 1I0HA 2BTQB 1RPRA 5JWPA 1OCOC 2ZR2A 1SA0A 2W6JG 3B4SA 2FTKA 1PL4A 4TV9B 2Y4UA 1BQZA 3E22B 4U3JB 2FMLA 3BY6A 2Q67A 2EIKC 3E8FA 4B3RB 2GV9A 3OMIB 3AEIA 1US6A 1MMMA 4DV7B 4B7EA 4JI8O 3BPZA 1V54B 4ZI7A 1WPBA 2IM9A 1JJOA 2RDCA 1BZKA 3E8GA 2DWEC 3DTUB 3AK1A 3NR7A 2JS5A 2IU3A 1FXKB 4MVSA 4DR3B 5EBLC 3OGIB 3G80A 5L3EA 3E2EA 5JQGA 1S0VA 1VF6A 1XL4A 2OTJV 4AILC 1AI5A 1MNGA 3ABKB 3D3IA 1M56B 4DV4B 2GBOA 1RPOA 5KX5B 5GTIZ 3QG5A 4B3TB 4LF7O 4KL1A 4NYKA 3G6BA 4IGGA 4GYCB 2H8PC 3TETA 1YSCA 3O9OA 2UXCO 3OAAG 1ZWIC 4X1KA 4ABMA 1XMQO 4G2KA 5CBGA 2OTLV 1SC5B 4HBNA 4PELA 1VP7A 1F23A 4G27B 1YJNV 2ILMA 1FD9A 2KB1A 3D36C 3AG3B 2N74A 3JALB 1NVPD 3N2GB 3JD2A 2EIJC 2ADPA 3JSNA 5DN6G 2YEVA 3S3XA 5CA0B 1U96A 2BSKB 1ROPA 4MVUA 3JD1A 3CS5A 5EYPA 4W4LA 4OX9B 1G8MA 5D5QA 3SPCA 4LNUB 1OCZB 1PKXA 3J81N 2LO1A 1MOFA 1BQ0A 1PD3A 1THZA 2A3QA 3U11A 5FNVA 4BAYA 1VF6C 3MAQA 2OCHA 1E1QG 3BAAA 1J5EO 4TUYB 4MVZA 1BCCH 1GK9A 2ZE5A 3E8HA 2Q0AA 2R72A 5HFMA 4JI0B 1Q82W 2IU0A 3QTCA 1LR1A 5LMNB 2RNBA
chains in the Genus database with same CATH topology
4YY3O 3SDLA 4K0KO 2FKXA 3M8AA 1IBLO 4LFBO 3JAMN 4X66O 4LF7O 5LMUO 4DUZO 4LFCO 2VQEO 4B3RO 4DR1O 4DR6O 1N33O 1N34O 1AILA 4JI3O 1XMOO 4DV7O 2VQFO 2UXCO 1I94O 1A32A 2DJVA 4OPHA 1FYJA 4JI6O 1R6TA 1XEQA 1XMQO 1YZBA 4DV3O 4LF4O 5BR8O 3J80N 1N36O 4LF9O 4DR4O 4GKJO 1D2DA 1X59A 4DUYO 4DV0O 1FKAO 4DR7O 4DR3O 4NXMO 4JI0O 3O65A 4LF8O 4NXNO 4OX9O 1HNXO 1IBMO 5LMNO 2UXDO 1XNQO 1R1BA 4DR5O 1DK1A 2Z0AA 1N32O 2N74A 1FJGO 5FLXN 4DV5O 4JI1O 4LFAO 2F4VO 4DV1O 4B3MO 5H5NA 4YHHO 4DV2O 4JI4O 4DR2O 1NS1A 4B3TO 3RT3C 4LF5O 1AB3A 2AGAA 5A2QN 4X62O 5IT9N 1HNZO 5LL6Y 4JI2O 4JYAO 3T1HO 3F5TA 2JRIA 4OPAA 2UUAO 4JV5O 2UUCO 1KUQA 4JI5O 2LW7A 4AQYO 1IBKO 4KHPO 4JI8O 5BXZA 3J81N 1XNRO 4B3SO 2UXBO 4DV4O 2DOSA 2E5LO 3T1YO 3J7AU 3OTOO 4X65O 1F7YA 4DV6O 4GKKO 5BY1A 4A5UB 1HR0O 4X64O 2UU9O 5IWAO 1J5EO 4LF6O 1HNWO 2ZM6O 2HHHO 2ZKOA 2UUBO 1G1XB 4JI7O 3R66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 O;  3SDL A;  4K0K O;  2FKX A;  3M8A A;  1IBL O;  4LFB O;  3JAM N;  4X66 O;  4LF7 O;  5LMU O;  4DUZ O;  4LFC O;  2VQE O;  4B3R O;  4DR1 O;  4DR6 O;  1N33 O;  1N34 O;  1AIL A;  4JI3 O;  1XMO O;  4DV7 O;  2VQF O;  2UXC O;  1I94 O;  1A32 A;  2DJV A;  4OPH A;  1FYJ A;  4JI6 O;  1R6T A;  1XEQ A;  1XMQ O;  1YZB A;  4DV3 O;  4LF4 O;  5BR8 O;  3J80 N;  1N36 O;  4LF9 O;  4DR4 O;  4GKJ O;  1D2D A;  1X59 A;  4DUY O;  4DV0 O;  1FKA O;  4DR7 O;  4DR3 O;  4NXM O;  4JI0 O;  3O65 A;  4LF8 O;  4NXN O;  4OX9 O;  1HNX O;  1IBM O;  5LMN O;  2UXD O;  1XNQ O;  1R1B A;  4DR5 O;  1DK1 A;  2Z0A A;  1N32 O;  2N74 A;  1FJG O;  5FLX N;  4DV5 O;  4JI1 O;  4LFA O;  2F4V O;  4DV1 O;  4B3M O;  5H5N A;  4YHH O;  4DV2 O;  4JI4 O;  4DR2 O;  1NS1 A;  4B3T O;  3RT3 C;  4LF5 O;  1AB3 A;  2AGA A;  5A2Q N;  4X62 O;  5IT9 N;  1HNZ O;  5LL6 Y;  4JI2 O;  4JYA O;  3T1H O;  3F5T A;  2JRI A;  4OPA A;  2UUA O;  4JV5 O;  2UUC O;  1KUQ A;  4JI5 O;  2LW7 A;  4AQY O;  1IBK O;  4KHP O;  4JI8 O;  5BXZ A;  3J81 N;  1XNR O;  4B3S O;  2UXB O;  4DV4 O;  2DOS A;  2E5L O;  3T1Y O;  3J7A U;  3OTO O;  4X65 O;  1F7Y A;  4DV6 O;  4GKK O;  5BY1 A;  4A5U B;  1HR0 O;  4X64 O;  2UU9 O;  5IWA O;  1J5E O;  4LF6 O;  1HNW O;  2ZM6 O;  2HHH O;  2ZKO A;  2UUB O;  1G1X B;  4JI7 O;  3R66 A; 
#chains in the Genus database with same CATH topology
 3G67 A;  5JVD A;  5AG2 A;  4MVO A;  1SQB H;  4YHH B;  2QSA A;  4O4I B;  4O2A B;  3EHB B;  1D5A A;  1LUV A;  1O9H A;  5GW7 A;  5J2T B;  1LNQ A;  1N33 O;  1B04 A;  3K04 A;  3K9S A;  3L70 H;  2PYJ A;  4OGQ B;  3N27 A;  4LCU C;  5FPO A;  3CC4 V;  1FYJ A;  2R9I A;  3DSQ A;  1OHH G;  2F1M A;  5KHK A;  4KXR A;  3LDC A;  1F4N A;  2LW1 A;  3CE2 A;  2X0L A;  1VAR A;  1NT2 B;  4DUY O;  4K8Z A;  5LMU B;  1L1F A;  2JK5 C;  3CHX A;  3ZRX A;  2NNU A;  1LUW A;  1AVM A;  2M7W A;  2PI5 A;  1EBO A;  1IBM O;  4KP4 A;  1JX9 A;  1AR1 B;  2CTQ A;  3IC7 A;  3UM7 A;  4DV1 O;  4B3M O;  5H5N A;  5F2V O;  1M90 W;  2X7R B;  4X20 A;  3AK3 A;  1Z5V A;  2GSM B;  2JEX A;  5K1X A;  2P5O A;  4Q6G A;  2Q7G A;  5GON A;  3ZN1 A;  3I55 V;  1EN4 A;  1Y67 A;  1MSW D;  2N04 A;  1NTZ H;  3CRQ A;  4LFC B;  3RVY A;  4Z1V A;  3NXS A;  3ZRS A;  3AG2 C;  2VRZ A;  3JAW B;  3B77 A;  4NTW A;  4QGP A;  4JI3 B;  1YJW V;  2UXD B;  1YIT V;  1GM9 A;  3FKS G;  4WBN B;  3OM3 B;  5TIS Z;  4EKW A;  1YDX A;  3ABL B;  1YCI A;  3E83 A;  4PDV A;  1M57 C;  1R6K A;  1EN6 A;  1GM7 A;  4DR7 B;  4IL6 Z;  3WFV A;  4QE7 A;  4JF3 A;  1FXH A;  1OCZ C;  4JAS A;  4O4H A;  1QLE C;  3RYF A;  4NTY A;  5JJE B;  3OE7 G;  2P90 A;  3OD4 A;  4K0K O;  4Q20 A;  5CBH A;  2YDE A;  1XBL A;  4UCS A;  2Q68 A;  3K5M A;  5DED A;  3RYC B;  4QIW F;  4YJ2 A;  1NI8 A;  3CCL V;  4GX1 A;  1AR4 A;  2IJK A;  3H1H H;  2QR4 A;  2YI8 A;  3L71 H;  4NR1 A;  3L75 H;  5KHI A;  4O4L A;  2PGG A;  1VQ7 V;  3PN1 A;  5B1B C;  1OCR B;  1S3J A;  3B8M A;  2QKA A;  4J41 A;  5FL7 G;  1L0L H;  4NXM O;  1M5I A;  4BR6 A;  1M9N A;  2CGN A;  2QA4 V;  1XUQ A;  4QPJ A;  1JPX A;  2KSD A;  3ZMS A;  2HHH B;  3UT5 A;  3P32 A;  4RUE A;  2ZE7 A;  1KKC A;  1COW G;  5IY5 B;  1HDJ A;  1AB3 A;  5L3G A;  1OCC C;  4FLV A;  3H1K H;  1WAZ A;  1ZSP A;  3BAB A;  5JH7 B;  1ZL8 A;  1RM1 C;  1NQT A;  3ZMZ A;  1PM9 A;  3I5D A;  2CTR A;  2B1I A;  3ZS8 C;  1XRE A;  4HZ3 A;  2G38 A;  3CC2 V;  4B3S O;  3THO A;  3GVM A;  3APQ A;  3JAK B;  3T1Y O;  3J7A U;  3MD0 A;  1QVG U;  5IJ9 B;  5BR8 B;  4DRX B;  4X1Y B;  2ZNJ A;  3CRC A;  2OCC C;  4JI2 B;  2AZ0 A;  3SGI A;  3PJS K;  2EIN B;  4NVP A;  4MT8 A;  4MTF A;  1FAF A;  1YIJ V;  3SYP A;  4I4T A;  2ARH A;  4GUN A;  2P4K A;  5KMG B;  3IGA C;  2H94 A;  3QO5 A;  2YIA A;  4CH3 A;  1N32 B;  2QDO A;  1FJG B;  2JGD A;  4JI1 B;  4WCE V;  1E79 G;  5IYZ A;  3ASN B;  5D5P A;  1PNM A;  4RQE A;  5B3S C;  2PZS A;  4P2Z A;  4B3R O;  1YF2 A;  5LP6 A;  4UCR A;  4R7C A;  3IAY A;  1ZAU A;  1FXV A;  3AG1 C;  3ZX6 A;  1WJZ A;  4DV7 O;  4PA9 A;  5LHH A;  2CH7 B;  4IIJ A;  1GTO A;  1HWY A;  3K5L A;  2BOC C;  2LGW A;  1IBK B;  3JAT B;  2QEX V;  2K9P A;  3JAR B;  1WPX A;  2XAH A;  1Q43 A;  1Z5W A;  1B06 A;  4DR3 O;  1WP8 A;  1VQ8 V;  3O65 A;  3JD0 A;  4I50 A;  5H9C A;  1P84 F;  1L8D A;  2FYU H;  4QPK A;  4WFE A;  1H2S B;  4ASU G;  4IHJ B;  2Z0A A;  4FFB B;  3FB8 C;  4ZIB A;  3K5N A;  4FM1 A;  3SR2 C;  4YY3 B;  5KAF Z;  4B3T O;  2AGA A;  1K5Q A;  2QWP B;  5KUM A;  3DC6 A;  4AI8 A;  3FB5 C;  1K34 A;  3VQV A;  4JV5 O;  4K35 A;  3VBB A;  5E79 Z;  1IX9 A;  4BWA A;  5CA1 A;  1GO3 F;  1I94 B;  4LWS B;  3SYO A;  1BS3 A;  1PNL A;  3VQX A;  3C3T A;  5LYJ A;  1K9M W;  3HKC A;  4LF4 B;  2N05 A;  3ZHR A;  4LF9 B;  4GKJ B;  3STZ C;  2YID A;  2W0F C;  1T5E A;  2XHB A;  1AI6 A;  2ZM6 O;  4LF8 B;  2WWW A;  3ABU A;  3FYI B;  3L72 H;  5ITZ B;  3QVN A;  4AQY B;  1TGO A;  4GCZ A;  3G4S V;  2ZNI A;  4R8C A;  4N23 A;  3HR0 A;  5LP6 C;  3N2K B;  1K4C C;  4FLU A;  3T4D A;  3ZHT A;  4DV2 B;  4J9Y B;  4JPR A;  2CGO A;  2YXY A;  1GM8 A;  4DR6 O;  2HJD A;  4LF6 B;  4JAU A;  2W0X A;  4U3F H;  1PNK A;  1J95 A;  1VQP V;  1B6Q A;  1SF9 A;  4K3A A;  1H8E G;  2JDI G;  4TQD A;  3ASN C;  3OMA B;  2AHY A;  2ETN A;  3F5W C;  3E86 A;  4O4J A;  1RFY A;  2WLI A;  1GMG A;  2RQ6 A;  5H6R A;  1BT8 A;  5EZY A;  3JSL A;  1D2D A;  2V4D A;  2ZXW C;  3DC5 A;  4UVB A;  1H2L A;  4JI0 O;  2LFS A;  4MS2 A;  4KUM A;  4UXN A;  3LNN A;  4NKG B;  5EK0 A;  5LMN O;  3K9A A;  2EUL A;  4CS3 A;  3FAV B;  4X88 A;  3CCR V;  4YHH O;  1MZF A;  1DLB A;  1SQX H;  3JAS A;  4Z2W A;  3OW2 U;  2ZCE A;  2B1G A;  3CD6 V;  5IE9 A;  5IJ0 A;  1ENV A;  5H2F Z;  3FD9 A;  1NJI W;  2UUC O;  3DXR B;  1K33 A;  3ZCC A;  1H8H G;  2DOS A;  2ODM A;  1ORQ C;  4X9Q A;  3HKD A;  2UXX A;  4C7U A;  1P7G A;  2XUM A;  1SS3 A;  3SYC A;  3QO8 A;  1I08 A;  5DEC A;  3CRM A;  2DYS C;  4D6T H;  3Q4H B;  2Y69 C;  3D36 A;  3IC9 A;  3HKB A;  4DV0 B;  3BHP A;  3ZBH A;  1Q90 D;  4ZI7 B;  5BMV A;  4RUF A;  1XDC A;  3G71 V;  2DMX A;  1AI7 A;  4OXS A;  4GX5 A;  4QE9 A;  5K1P A;  2HLD G;  1K8A W;  2BTQ A;  4LFC O;  5B1O A;  4FZ0 A;  1KKD A;  4JTD B;  2VWJ A;  1XQ8 A;  4JYA B;  1OV9 A;  4TV9 A;  4JI3 O;  3ZRW B;  1N8R W;  1V55 B;  1S5L Z;  4CH4 A;  2IJH A;  3HB3 B;  4TWK A;  1WNS A;  4CS2 A;  1R6T A;  2RN9 A;  4TSF G;  1ZLZ A;  4I9Q A;  2YXH A;  4YXW G;  5LOV A;  4I9W A;  2Q9L A;  4HNA B;  3GB7 C;  4X8A A;  4NB5 A;  2D3O W;  1GN4 A;  3LSS A;  2EIL C;  4DR7 O;  4X1K B;  4UCO A;  4UCT A;  1XIL A;  3OFN G;  4HAM A;  3SJQ C;  1NTK H;  1FXK A;  3TK1 A;  1BE3 H;  1H2N A;  2Q73 A;  4JI7 B;  2Q4P A;  4JTC B;  3ZMV A;  4MW3 A;  4YJ3 A;  3FYE B;  2XAF A;  1TAE A;  1DGS A;  3RYI A;  4EEQ A;  2QM4 A;  1KMI Z;  3CCJ V;  4WFG A;  1N34 B;  1Q7Y W;  5KUK A;  4PA3 A;  4P9O A;  5KAI Z;  5KA6 A;  1JCH A;  4KHP O;  1KU9 A;  2YXL A;  2YEV B;  3LSQ A;  2K1E A;  1F7Y A;  1NR1 A;  2JIZ G;  4BIZ A;  4A5U B;  3OR6 C;  3C90 A;  3AG4 B;  5LXT A;  2HHH O;  2ZIN A;  5H6Q A;  1EFR G;  4JI5 B;  3KCX A;  3CCQ V;  1M1K W;  4MTG A;  2ITC C;  2P7T C;  2HP8 A;  4X65 B;  4JI4 B;  2Z3Y A;  4LF5 B;  2JVD A;  5KHJ A;  3K57 A;  4X62 B;  2UU9 B;  1EM1 A;  4LR3 A;  1W2B U;  3LNM B;  2KG7 B;  3KCY A;  4UCV A;  2BSK A;  4X1I B;  4I7Z B;  4F6E A;  1V54 C;  1JVM A;  4RO2 A;  4LC1 A;  3K3W A;  5CB4 A;  1QU7 A;  4NTX A;  1QR9 A;  2GUZ B;  4P30 A;  2P06 A;  5BR8 O;  1BGY H;  5CBF A;  1FXK C;  2M6Y A;  2ADQ B;  4I0X A;  4JYY A;  4PD4 F;  1CPY A;  1DF5 A;  2WLH A;  3ABK C;  4TUY A;  1QLN A;  1KP2 A;  1M56 C;  1R3J C;  1N32 O;  2QGN A;  4B08 A;  1FJG O;  1K7D A;  4JI1 O;  1H2G A;  1NBM G;  5EC1 C;  1YEW A;  4K8X A;  5A2Q N;  3OUF A;  2P22 C;  3AG7 A;  4X66 B;  2ZIM A;  2YIC A;  2EIM B;  3F5T A;  5L3B A;  4O2A A;  5LA6 B;  1BHA A;  2Y0I A;  2C2A A;  4FFK A;  4FMT A;  4X20 B;  5J2T A;  1PPJ H;  3EVK A;  1IBK O;  2PI4 A;  5GON B;  2VQF B;  3TJT A;  1XNR O;  4QJF B;  2YSU B;  4AHC A;  3RWR D;  3ABM B;  5KLV H;  1ARO P;  3T1C A;  2PYL A;  1HR0 O;  2QWO B;  1B3Q A;  1DF4 A;  5B1A B;  5IYB O;  4CBC A;  5DM6 V;  3ETQ A;  2DE0 X;  4PJ0 Z;  3AG3 C;  2YC0 A;  1JFF A;  3B2E E;  2WLJ A;  3H01 A;  2IJI A;  4PDR A;  4FK5 C;  3FX7 A;  3R66 A;  4U7N A;  4YY3 O;  1QBZ A;  1MSD A;  4DV5 B;  1QCE A;  3CME V;  3STL C;  1YI2 V;  3G6E V;  2WLM A;  3ZED A;  3K79 A;  1P7B A;  2WLL A;  1DTO A;  1XMO O;  4UV8 A;  4YIO A;  1I94 O;  2F93 B;  1WA8 A;  1A32 A;  1QQC A;  3MDS A;  3K59 A;  2LQT A;  5LGU A;  4ICG A;  4LF4 O;  1M93 A;  3W7W A;  4DV6 B;  4LF9 O;  4GKJ O;  4FIP C;  2F95 B;  5IYD O;  1X59 A;  4H33 A;  4WBN A;  1U97 A;  3S3W A;  1WB8 A;  3ASO B;  4O4L B;  4LF8 O;  1W59 A;  2RCV A;  3CXH F;  1VQK V;  4PI0 A;  1R1B A;  4DO2 A;  1AP6 A;  4LBE C;  3CPW U;  3ZMT A;  3UCS C;  2Y0P A;  1Q86 W;  4DV2 O;  4PA4 A;  4N21 A;  4J7J A;  4WFB V;  3ZN0 A;  2F66 C;  2JJ1 G;  3BEH A;  3X2Q B;  3BA9 A;  2YS8 A;  2YIB D;  3RYC A;  2LP7 A;  1Q5O A;  1Y76 A;  3F7Y C;  5BXZ A;  4WFH A;  2R9A A;  2EX3 A;  3ABT A;  2BE3 A;  4JI6 B;  1TUB B;  1H2M A;  1JOY A;  5L3F A;  1ZL8 B;  2HFE C;  5JCO C;  1N0J A;  5BZB A;  2Z5U A;  4JYC A;  2E74 B;  3LUT B;  1HW7 A;  2ATK C;  2CDY A;  2HEP A;  3OMN B;  1K97 A;  1KC8 W;  1OJH A;  2A7W A;  1FFX A;  2HVK C;  3SJC C;  1GAX A;  1F4M A;  5B66 Z;  3CCV V;  4FM0 A;  3TGU H;  3RVZ A;  4DR1 O;  1SQV H;  1UJW B;  4UB8 Z;  3ZRV A;  2IW5 A;  4EB6 A;  2UUA B;  5IYZ B;  2L6L A;  1XHX A;  2DJV A;  1P4R A;  4UVA A;  3ABL C;  4PI2 A;  5C8Y B;  3F7V C;  5J2U A;  3CCM V;  3LDD A;  3IJ4 A;  4GKK B;  4ZKI A;  3LDE A;  4DV0 O;  4MW8 A;  3K08 A;  5IJ9 A;  5IWA B;  2XAS A;  1NKD A;  4X1Y A;  3OT7 A;  3A2F A;  4I55 A;  1R73 A;  1IZ3 A;  1TVK B;  2Q7E A;  2L35 A;  2UUB B;  3EXA A;  2CE4 A;  3M7M X;  5KMG A;  2EBO A;  1G6U A;  2OYQ A;  1GN2 A;  3U0Z A;  2P6J A;  1AR5 A;  2DWD C;  2IBZ H;  4JYA O;  1GN3 A;  2A06 H;  5E1A C;  2DW4 A;  3UKM A;  1CP9 A;  2LW7 A;  2CK3 G;  3W7U A;  1OCR C;  3BRC A;  1NH2 B;  4XDK A;  4D7S A;  4DV4 O;  1NTM H;  4E2L A;  3UO3 A;  4JTA B;  1VF7 A;  3X2Q C;  4FLX A;  3JAT A;  3APO A;  3JAR A;  2O57 A;  2ZQM A;  4RQF A;  2ZKO A;  1GRJ A;  3RBZ A;  2ZD9 A;  1XNQ B;  5IY5 C;  4F6R A;  4JI7 O;  1Y74 B;  2QWN B;  3RGB A;  4LFA B;  3WG7 B;  4UV9 A;  4O2B B;  3MHH C;  1S77 D;  1QNM A;  4JYB A;  4DR2 B;  2A79 B;  1OCO B;  2JS3 A;  2YI9 A;  2JJ2 G;  3WU2 Z;  4PDM A;  3OR7 C;  1NR7 A;  3A8T A;  1N34 O;  3T1H B;  4PA7 A;  3SJA C;  5JJN B;  2HVJ C;  2EIK B;  3CJH A;  2ZIO A;  1X4T A;  4FVM A;  2DYR B;  3CRA A;  4JGS A;  2E5L B;  1SRY A;  2XT9 A;  3MHS C;  3CRR A;  2EIN C;  4X64 B;  1E1R G;  3H9V A;  4OX9 O;  3HKE B;  4MVQ A;  4O4J B;  1VQO V;  1HNW B;  3A0B Z;  3ZHV A;  5FLX N;  4Z1M G;  5ITZ A;  4JI4 O;  1NS1 A;  2QWR B;  1BMF G;  4LF5 O;  4ZOL B;  4X62 O;  1UPG A;  3N2K A;  4LFB B;  4U7O A;  1R3L C;  1XHZ A;  2A9H A;  3WB2 A;  2AXT Z;  2JEU A;  3JAS B;  3CCS V;  1QVF U;  3C3S A;  4J80 A;  2GDS A;  2V1D A;  4TV8 A;  3CX5 F;  1N0N A;  4IT5 A;  1MZE A;  4DR4 B;  4DXW A;  2WA3 A;  1QR8 A;  1NH2 D;  3RYH B;  1WB7 A;  3KG2 A;  2QM7 A;  3JD3 A;  1JMK C;  2ZDI C;  1JJ2 U;  1Q3E A;  1EN5 A;  4L87 A;  4TOI A;  1SA0 B;  4ZHQ A;  1Q8I A;  3SDL A;  2FKX A;  2F4V B;  1FPO A;  3HKB B;  2AZ2 A;  2EIJ B;  2Q8V A;  2XAJ A;  4R50 A;  5KA5 A;  3CEI A;  4X66 O;  1NVP B;  5LMU O;  1I5Y A;  3W7T A;  3CB2 A;  1RSO A;  4ZBM A;  3TXQ A;  1YTF B;  2VQF O;  3BA8 A;  1VQL V;  4P9P A;  3ZHS A;  3DXR A;  4W4K A;  4JAA A;  4FLZ A;  1RP3 B;  1WLE A;  3ZMU A;  4BIU A;  2BOB C;  3SJB C;  2PF4 E;  2MW2 B;  2BTO A;  5JQG B;  1I5X A;  4PHZ A;  1G4Y B;  2CTW A;  2GTS A;  3Q4H A;  1Q6H A;  2QJ1 A;  3E22 A;  2DYR C;  4LH6 A;  4U3J A;  4B7K A;  2UXD O;  3RFR A;  5LOV B;  4DV5 O;  2FB5 A;  2EZP A;  2JGU A;  1WP7 A;  4FJC C;  2QE7 G;  1VQ4 V;  2Q0O C;  1K73 W;  1IBL B;  4XDL A;  2R70 A;  2LFR A;  2WSS G;  3K0G A;  4DUZ B;  2VQE B;  2ZR3 A;  4CH5 A;  3CSX A;  3FB6 C;  2QTO A;  4FPP A;  5LGN A;  4DYL A;  2P67 A;  4UCU A;  1NZ6 A;  2CTP A;  3ZRW A;  2WLK A;  3H1I H;  4YJ3 B;  4GX0 A;  1JA8 A;  4MVM A;  4BIO A;  4DV6 O;  3RYI B;  4UUJ C;  1P49 A;  4DW0 A;  1MG1 A;  1Y6X A;  1SET A;  3UO2 A;  5KX5 A;  2GHY A;  4HNA A;  4HYO A;  3B40 A;  2B9Z A;  2NN4 A;  2LJ2 A;  2IH3 C;  4JV5 B;  1XI1 A;  2WAM A;  3VQW A;  2NR5 A;  1KB9 F;  2E3C A;  3WB0 A;  4PA6 A;  1IXM A;  5LXT B;  4MVR A;  5FPR A;  5EYP B;  2OT5 A;  2Q69 A;  1HNZ B;  3L74 H;  2EZO A;  3K03 A;  4MTX A;  2ZM6 B;  3D8C A;  3AG2 B;  1VF5 B;  4LH7 A;  2F43 G;  4TQF A;  5FNV B;  2E76 B;  4IYI A;  3CC7 V;  4OPH A;  4JI6 O;  2Q7H A;  2UXB B;  1YZB A;  2D2C B;  1KQS U;  3OTO B;  3JAL A;  3J80 N;  3N2G A;  3ETD A;  2CAZ C;  4GLX A;  1YTF D;  3K58 A;  2QKC A;  3CWB H;  1M57 B;  1AP5 A;  4DR6 B;  4DK0 A;  5CB4 B;  4J42 A;  5CA0 A;  1SQF A;  2W6I G;  5JVD B;  4FZ1 A;  1R3K C;  4CZZ A;  1QLE B;  4J7Z A;  1K5S A;  4I0X B;  2WLN A;  4LNU A;  1H38 A;  2HKO A;  5LL6 Y;  4JI2 O;  1W0K G;  1M4U A;  3W7X A;  2HJF C;  1V55 C;  1GN6 A;  5GTH Z;  1JQ0 A;  2UUA O;  1KUQ A;  3FB7 C;  2KKW A;  5B5E Z;  2KG7 A;  2OIE A;  3D3Q A;  1TA8 A;  4FM2 A;  4X1I A;  3TCU A;  1CEZ A;  4GKK O;  5B1B B;  4CS4 A;  4DV3 B;  3M99 B;  2GUZ A;  4L8J A;  1N36 B;  5IWA O;  1SKV A;  1Q81 W;  3SYA A;  2VWK A;  1VMG A;  3ETE A;  4IYH A;  4O4I A;  5IYC O;  4NXN B;  2XND G;  3E8B A;  4CC5 A;  1VQ6 V;  3CYO A;  2UUC B;  1L0N H;  4TT3 G;  1HNX B;  2UUB O;  4J9Z B;  4DR5 B;  1G1X B;  2B5U A;  5L3C A;  2WPD G;  1MAB G;  1SER A;  3ZIA G;  4WF9 V;  5LHI A;  4X89 A;  1QHT A;  2YIB A;  1SES A;  1JFF B;  4JAV A;  3LSU A;  1OCC B;  2Q5Z A;  3A0H Z;  3ETG A;  1K92 A;  2DQ3 A;  3JCZ A;  1S76 D;  4RAI A;  1RM1 B;  5JCO A;  3CXC U;  5LA6 A;  2X6A A;  3R65 A;  4JI8 B;  4EFE A;  4D7T A;  1ZX3 A;  2WLL B;  3CCU V;  5JJJ B;  4H37 A;  3JCU Z;  3ZHQ A;  1FKA O;  3AG4 C;  1ZTE A;  2XOK G;  3BVO A;  4O4H B;  1R3I C;  1WA8 B;  3RYF B;  4WFA V;  2OCC B;  5LGT A;  1V9P A;  1XNQ O;  2XAQ A;  1PL0 A;  2Y48 A;  1KP3 A;  1H2K A;  1GH6 A;  1YXB A;  3JAW A;  4LFA O;  1KYO F;  4XBF A;  1BSM A;  4H0L B;  4DR2 O;  5L3D A;  2XAG A;  3RT3 C;  2RJZ A;  5B1N A;  4MTO A;  1YVW A;  4YJ2 B;  3GWO A;  4LF7 B;  3E35 A;  5C93 A;  1SQG A;  5B3S B;  3T1H O;  3A0R A;  2JRI A;  4OPA A;  1WN7 A;  4GX2 A;  3K5O A;  2A0L A;  5KHG A;  4AQY O;  4I5S A;  3AG1 B;  2UXC B;  5EC2 C;  2E5L O;  2AHZ A;  4JZ2 A;  5CA3 A;  1XMQ B;  2PY5 A;  4X64 O;  1ZUQ A;  1R6N A;  1XL6 A;  5EBW C;  1XOU A;  4LF6 O;  1Y76 B;  1AJQ A;  2EJ7 A;  5KHH A;  1YJ9 V;  3UT5 B;  1SZX A;  1OZ0 A;  1HNW O;  2X6C A;  2NLJ C;  1EZV H;  4WFF A;  4KHP B;  1SQQ H;  4DK1 A;  4J10 A;  1JR9 A;  2EJR A;  3M8A A;  3OUS A;  5IDJ A;  2RMK B;  4LFB O;  3JAM N;  2EIM C;  4YIP A;  1AIL A;  3QO7 A;  1FFX B;  1BL8 A;  1CXZ B;  1YHQ V;  4G28 B;  3ABM C;  3U10 A;  1K3E A;  5B1A C;  3QF7 A;  4DR4 O;  3ICX A;  3B09 A;  2OWO A;  3SPJ A;  4EB6 B;  1TUB A;  1IUR A;  3P3N A;  2IJJ A;  4I4T B;  1J5E B;  1Z2G A;  1IXB A;  3DGE A;  2QTS A;  1MA1 A;  2JGD B;  1DK1 A;  5J2U B;  5JH7 A;  1N4C A;  3BFR A;  2F4V O;  1VQ9 V;  1SZT A;  1URF A;  3T4Z A;  5CMU A;  3WB1 A;  5LP6 B;  3H1L H;  3SPG A;  1K4D C;  4LP8 A;  4I55 B;  3L9D A;  3AK2 A;  3JAK A;  4IIJ B;  1F51 A;  3UQ8 A;  3HPL C;  1UFI A;  4DRX A;  2YUA A;  1N33 B;  3RN4 A;  2QKS A;  3I56 V;  3ML0 A;  2LGQ A;  3SPH A;  1AJN A;  5BY1 A;  3VOU A;  2IH1 C;  3KKY A;  4I50 B;  4J7K A;  2XTA A;  3ASO C;  5C8Y A;  4DUY B;  5CN0 A;  1VIB A;  2DQ0 A;  2HG5 C;  2X6B A;  1Q6U A;  2V7Q G;  2ZXW B;  1IBM B;  4CC6 A;  2PUS A;  2Y4T A;  1XNR B;  3CMA V;  4R6Z A;  1TVK A;  2CH7 A;  1VEW A;  4DV1 B;  4B3M B;  2HR3 A;  1IBL O;  1VQM V;  2ITD C;  2P4V A;  4FLY A;  1PP9 H;  3ZHU A;  3B8N A;  1HR0 B;  4DUZ O;  2VQE O;  2GTA A;  1KBH A;  4GZR B;  2ZE8 A;  4QNH B;  3QNE A;  4F6R B;  5CA1 B;  1AJP A;  2R9R B;  4XDJ A;  2MK3 A;  5LYJ B;  1FFT B;  3H1J H;  3HKC B;  1Q6I A;  3SPI A;  4IHJ A;  2H3O A;  4FFB A;  3OGC C;  2ZDI A;  4UVC A;  3JD4 A;  2DN9 A;  4H44 B;  3FFQ A;  3GWK C;  3E89 A;  3CJH B;  2DYS B;  2Y69 B;  4MSW C;  3P30 A;  2ZT9 B;  2FL4 A;  1XMO B;  2QWQ B;  1Y66 A;  2ZE6 A;  1AI4 A;  1NU1 H;  3KZI Z;  1S5J A;  2UXN A;  4K0K B;  2AW9 A;  1Y74 A;  1SQP H;  5IT9 N;  2Q6A A;  1HNZ O;  4LWS A;  2WA4 A;  4O2B A;  3OEE G;  4FLW A;  2QM8 A;  5LHG A;  1D5N A;  4EFB A;  1IVS A;  3VQY A;  4JI5 O;  2WLI B;  4GT1 A;  1O9G A;  1FS0 G;  4UB6 Z;  2UXB O;  5EZY B;  4FLT A;  5EBM C;  3T2M A;  3OTO O;  4X65 O;  1GKF A;  2UU9 O;  3K0D A;  5A9G A;  4UFZ A;  3CCE V;  3OTF A;  4JZG A;  4NXM B;  4RWU A;  3JYC A;  2EIL B;  2F23 A;  3W7S A;  2CUG A;  4TV8 B;  4BW5 A;  3TXS A;  3HKE A;  3EFF K;  4KFM A;  4J11 A;  1VQN V;  2PTM A;  5IJ0 B;  1W0J G;  3L73 H;  3RW0 A;  4H13 B;  4CH6 A;  4DW1 A;  1S5H C;  3P3P A;  1VQ5 V;  4ZOL A;  4ZHQ B;  2BCC H;  3IFX A;  1HP8 A;  2VS0 A;  4F4L A;  3HKD B;  3OEH G;  1S72 V;  4E4E A;  3SYQ A;  5HFL A;  1XEQ A;  1TUE B;  4B3S B;  4DV3 O;  1BHB A;  5LBQ A;  3T1Y B;  3FAV A;  1N36 O;  1RSO B;  5J9P C;  2E75 B;  1IDS A;  3ZJZ A;  3BCC H;  4DR1 B;  1KEC A;  4PV1 B;  4NXN O;  5BMV B;  1EZJ A;  4BW9 A;  1HNX O;  5EIB D;  1Y4M A;  4DR5 O;  5EIB C;  3RYH A;  3WG7 C;  3CP1 A;  1I7F A;  1PV0 A;  3K06 A;  2KQX A;  4PDL A;  2OIG A;  1KD1 W;  1I0H A;  2BTQ B;  1RPR A;  5JWP A;  1OCO C;  2ZR2 A;  1SA0 A;  2W6J G;  3B4S A;  2FTK A;  1PL4 A;  4TV9 B;  2Y4U A;  1BQZ A;  3E22 B;  4U3J B;  2FML A;  3BY6 A;  2Q67 A;  2EIK C;  3E8F A;  4B3R B;  2GV9 A;  3OMI B;  3AEI A;  1US6 A;  1MMM A;  4DV7 B;  4B7E A;  4JI8 O;  3BPZ A;  1V54 B;  4ZI7 A;  1WPB A;  2IM9 A;  1JJO A;  2RDC A;  1BZK A;  3E8G A;  2DWE C;  3DTU B;  3AK1 A;  3NR7 A;  2JS5 A;  2IU3 A;  1FXK B;  4MVS A;  4DR3 B;  5EBL C;  3OGI B;  3G80 A;  5L3E A;  3E2E A;  5JQG A;  1S0V A;  1VF6 A;  1XL4 A;  2OTJ V;  4AIL C;  1AI5 A;  1MNG A;  3ABK B;  3D3I A;  1M56 B;  4DV4 B;  2GBO A;  1RPO A;  5KX5 B;  5GTI Z;  3QG5 A;  4B3T B;  4LF7 O;  4KL1 A;  4NYK A;  3G6B A;  4IGG A;  4GYC B;  2H8P C;  3TET A;  1YSC A;  3O9O A;  2UXC O;  3OAA G;  1ZWI C;  4X1K A;  4ABM A;  1XMQ O;  4G2K A;  5CBG A;  2OTL V;  1SC5 B;  4HBN A;  4PEL A;  1VP7 A;  1F23 A;  4G27 B;  1YJN V;  2ILM A;  1FD9 A;  2KB1 A;  3D36 C;  3AG3 B;  2N74 A;  3JAL B;  1NVP D;  3N2G B;  3JD2 A;  2EIJ C;  2ADP A;  3JSN A;  5DN6 G;  2YEV A;  3S3X A;  5CA0 B;  1U96 A;  2BSK B;  1ROP A;  4MVU A;  3JD1 A;  3CS5 A;  5EYP A;  4W4L A;  4OX9 B;  1G8M A;  5D5Q A;  3SPC A;  4LNU B;  1OCZ B;  1PKX A;  3J81 N;  2LO1 A;  1MOF A;  1BQ0 A;  1PD3 A;  1THZ A;  2A3Q A;  3U11 A;  5FNV A;  4BAY A;  1VF6 C;  3MAQ A;  2OCH A;  1E1Q G;  3BAA A;  1J5E O;  4TUY B;  4MVZ A;  1BCC H;  1GK9 A;  2ZE5 A;  3E8H A;  2Q0A A;  2R72 A;  5HFM A;  4JI0 B;  1Q82 W;  2IU0 A;  3QTC A;  1LR1 A;  5LMN B;  2RNB A; 
#chains in the Genus database with same CATH homology
 4YY3 O;  3SDL A;  4K0K O;  2FKX A;  3M8A A;  1IBL O;  4LFB O;  3JAM N;  4X66 O;  4LF7 O;  5LMU O;  4DUZ O;  4LFC O;  2VQE O;  4B3R O;  4DR1 O;  4DR6 O;  1N33 O;  1N34 O;  1AIL A;  4JI3 O;  1XMO O;  4DV7 O;  2VQF O;  2UXC O;  1I94 O;  1A32 A;  2DJV A;  4OPH A;  1FYJ A;  4JI6 O;  1R6T A;  1XEQ A;  1XMQ O;  1YZB A;  4DV3 O;  4LF4 O;  5BR8 O;  3J80 N;  1N36 O;  4LF9 O;  4DR4 O;  4GKJ O;  1D2D A;  1X59 A;  4DUY O;  4DV0 O;  1FKA O;  4DR7 O;  4DR3 O;  4NXM O;  4JI0 O;  3O65 A;  4LF8 O;  4NXN O;  4OX9 O;  1HNX O;  1IBM O;  5LMN O;  2UXD O;  1XNQ O;  1R1B A;  4DR5 O;  1DK1 A;  2Z0A A;  1N32 O;  2N74 A;  1FJG O;  5FLX N;  4DV5 O;  4JI1 O;  4LFA O;  2F4V O;  4DV1 O;  4B3M O;  5H5N A;  4YHH O;  4DV2 O;  4JI4 O;  4DR2 O;  1NS1 A;  4B3T O;  3RT3 C;  4LF5 O;  1AB3 A;  2AGA A;  5A2Q N;  4X62 O;  5IT9 N;  1HNZ O;  5LL6 Y;  4JI2 O;  4JYA O;  3T1H O;  3F5T A;  2JRI A;  4OPA A;  2UUA O;  4JV5 O;  2UUC O;  1KUQ A;  4JI5 O;  2LW7 A;  4AQY O;  1IBK O;  4KHP O;  4JI8 O;  5BXZ A;  3J81 N;  1XNR O;  4B3S O;  2UXB O;  4DV4 O;  2DOS A;  2E5L O;  3T1Y O;  3J7A U;  3OTO O;  4X65 O;  1F7Y A;  4DV6 O;  4GKK O;  5BY1 A;  4A5U B;  1HR0 O;  4X64 O;  2UU9 O;  5IWA O;  1J5E O;  4LF6 O;  1HNW O;  2ZM6 O;  2HHH O;  2ZKO A;  2UUB O;  1G1X B;  4JI7 O;  3R66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...