3CXHF

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 28
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cxhF00
1BGYH 1KB9F 1SQQH 2A06H 3H1IH 1BCCH 4U3FH 3L73H 5KLVH 1NTMH 1SQXH 3L74H 1L0NH 1SQPH 1NTZH 2BCCH 3H1JH 2FYUH 3BCCH 3L70H 1BE3H 3L71H 3CWBH 1PP9H 1P84F 3TGUH 1SQBH 1SQVH 3L72H 1PPJH 1EZVH 3H1LH 3L75H 3H1HH 1KYOF 3H1KH 3CX5F 1NTKH 1NU1H 1L0LH 3CXHF 4D6TH 4PD4F 2IBZH
chains in the Genus database with same CATH superfamily
5IJ9A 2W6IG 4QNHB 1L1FA 3CPWU 5JVDB 4FFBB 1JJOA 4DUYB 5IT9N 3FAVA 2LQTA 5LGUA 5H9CA 2UUBO 3D3IA 3ASNB 4R6ZA 2EINC 4DK0A 5DEDA 3AG7A 1ZL8A 2CGNA 2ZNIA 3OW2U 4MS2A 1Q6UA 4DRXB 1XHXA 4H33A 4ZOLB 5IYDO 2QDOA 1VQ7V 4PA9A 4G2KA 2R70A 1ZWIC 3D3QA 1N32O 2ZE5A 2X6CA 4J42A 1PNLA 4PA3A 2ADQB 2EIJB 1B06A 1KKDA 1US6A 2P06A 3ZMVA 3LDDA 1OCZB 4KHPB 1LR1A 1TVKA 5A2QN 5LGTA 1VQMV 1IBKO 2Q7EA 3ABLC 3A0HZ 4UUJC 1F4MA 1R3IC 4DUZB 1E79G 4JYAO 3HKDA 2RQ6A 2Y69C 1GN4A 3B8NA 2QM8A 2E76B 2UUCB 2EILB 3U11A 4RQFA 1XL4A 2M6YA 2JGDB 4LWSB 2LW1A 1FFXA 4CS2A 2F4VB 5B1OA 5L3BA 3RYCA 2Y0PA 3LSUA 3OFNG 4QE7A 1J95A 3F7YC 4GCZA 5C8YB 4KFMA 2IU0A 4IHJA 5FL7G 4GX5A 2P90A 5BXZA 3BA8A 4X20B 2F1MA 2L6LA 5IJ0A 4DV0O 4J9ZB 2UU9B 1PM9A 3RYHB 4X9QA 3D36C 1GM7A 4UCTA 1FXKC 4ZBMA 4QPJA 2DMXA 3BA9A 4O4JB 2ZXWB 4TV8A 1Y66A 4DR4B 2E5LB 1WJZA 1KD1W 1JA8A 3M8AA 1BQ0A 1S5HC 3KZIZ 3ABKB 4DV7B 4DV3O 3CCLV 3I5DA 4AQYO 3DTUB 1QLEC 1IZ3A 5IWAB 1GAXA 5GONA 3CC2V 1SETA 2RCVA 3J80N 2WWWA 3FB6C 4HBNA 1K7DA 5DECA 1SQFA 5EYPB 1KP3A 1JJ2U 3GWOA 3OD4A 3OTOO 1YVWA 1B6QA 3SYPA 4DR2O 3ASOB 5B1BB 3VBBA 3HKBB 3G6EV 4B7KA 1W0JG 4LF5O 4PD4F 1GM9A 1BCCH 3SR2C 4X1YA 1SA0B 5BMVA 1XNQO 1M90W 1AI6A 5LP6C 4PHZA 1JPXA 3PN1A 3H1LH 5L3GA 3W7SA 3JCUZ 1R73A 1UFIA 3ZMZA 1B04A 1XI1A 1DGSA 2X7RB 2ZNJA 2YXLA 2DYSB 3E35A 1W2BU 1PNMA 2Z5UA 1E1RG 3JCZA 3L72H 3OT7A 1FJGB 1UJWB 2Y69B 3ETQA 2ETNA 2K1EA 4LC1A 3P30A 4NXNO 4MW3A 4J9YB 3JARB 5EIBC 1HNWB 2O57A 3K06A 4U3FH 2QWRB 3F5TA 1O9HA 3X2QC 3RYIA 4RAIA 3KCYA 1XMQO 1PP9H 5LHIA 3CJHB 2DWDC 4LR3A 3K3WA 1WPBA 2MK3A 5KA6A 1MSDA 2EZOA 2IJKA 4OX9B 1S72V 4O4IA 3TETA 1OCOC 2ZCEA 2BSKA 4YJ2A 1HP8A 4G28B 4X1KA 4YJ3B 3O65A 2QTOA 1NVPD 4AI8A 5CA1A 2FYUH 4YXWG 1WB8A 4J7JA 3JD4A 2RDCA 3W7XA 1HNZO 1CEZA 3SYAA 1KECA 1R6KA 1F23A 4YY3B 4UCRA 4L87A 3JASB 2NNUA 1F4NA 1NVPB 2OWOA 5J2UB 2WLNA 1K34A 4DR3B 2AGAA 3EXAA 4B3TB 1I08A 5B3SB 5LGNA 3MAQA 4JI6O 3RYFB 2ZKOA 3OEHG 1U96A 2UXDB 2AHYA 2CGOA 1N33O 4X64B 2Q0OC 3K5LA 2ZINA 3RVZA 4JAVA 4OPAA 1SZXA 5LMUO 4J7KA 1S5LZ 4ASUG 4LF4O 1BSMA 2KG7A 2HJDA 1Y76B 2WLMA 4ZI7A 2HG5C 3S3XA 3K9AA 4LNUA 1NH2D 1FXKA 1KC8W 5LP6B 3IC9A 1IBLB 4P2ZA 4BAYA 5LA6A 3TJTA 1KP2A 4JASA 4TT3G 3C90A 1BL8A 5H6RA 1MA1A 2PYJA 2KSDA 1NH2B 4DO2A 3CXCU 1XNRO 4K35A 4X65O 1N4CA 5CA0A 3W7WA 2Q9LA 1COWG 2WLJA 2YS8A 2UUAB 1QR9A 1Q82W 4IIJA 4N23A 2ZM6O 4UV8A 3E86A 4U7NA 2WLIA 1YTFD 4FLUA 4DR6O 3H1JH 1J5EO 3TXQA 3ABTA 1JFFB 2Q5ZA 4WBNA 4PDVA 2ZDIA 4PA6A 1ZSPA 4X66O 4Q6GA 4EB6B 2EBOA 3HKCA 3R66A 3LDCA 4LP8A 4MVRA 1S5JA 1XMOB 1EBOA 4GX2A 4K0KO 2ODMA 1YTFB 3E2EA 4BIZA 4I9QA 2EIKC 2DWEC 2LFSA 2XAGA 4OPHA 5AG2A 4ZHQA 1IBMO 3JATA 1OV9A 2VQFB 2K9PA 3VQWA 1D5NA 4FZ0A 1NR1A 2W0FC 5FNVA 3OMIB 3G6BA 4JPRA 3EFFK 2ATKC 1M93A 1Q90D 1Q8IA 2BE3A 2PYLA 2ITDC 3SPJA 3CB2A 4CS4A 2CTQA 3E89A 1K92A 4MTXA 1B3QA 5GW7A 5BR8B 4E4EA 1VEWA 3QNEA 3LDEA 2JVDA 2OTLV 5J2TB 3CE2A 5EZYA 3TXSA 4O4LB 2P6JA 5IY5C 2VQEO 4HYOA 1MZEA 1MABG 4J11A 3AG4C 1FFTB 3JAWA 4TOIA 1I5YA 4E2LA 3ZJZA 2PI5A 4TSFG 3C3SA 1I7FA 4UVCA 2JEXA 3ZIAG 5ITZA 4DV5B 1HDJA 2YIDA 2YIBA 1YJNV 5D5PA 3OUFA 2R9IA 5LYJA 4DV1O 2ZT9B 5LOVA 4XBFA 4LFBB 1NT2B 1M5IA 4JYBA 3LNMB 3RVYA 1FXVA 3SYCA 3ZMUA 4UV9A 2E3CA 1CP9A 2LJ2A 2XAFA 3A0BZ 1GRJA 3OUSA 2C2AA 5EC2C 3SJBC 1TAEA 1TUEB 1VQ9V 2H94A 4K8ZA 4MT8A 2XTAA 4CS3A 3CCEV 2JEUA 2QKAA 3R65A 2ARHA 2YSUB 5H2FZ 1MSWD 1VF5B 2YIAA 3T2MA 3ZRWB 4FM0A 5KX5A 2V7QG 1K4CC 5IJ9B 4MSWC 3K08A 2QJ1A 4JI1B 4U7OA 4X62B 2HHHB 3FAVB 3SYOA 4JGSA 1M9NA 4RUFA 4BW5A 4WCEV 1H2LA 2MW2B 3IJ4A 1ZL8B 3T1HB 1DF4A 4Q20A 1MZFA 1PPJH 3FD9A 3STLC 4LF6B 2EIKB 2FTKA 1N36B 1XDCA 1GTOA 1QHTA 1HR0O 2ZE7A 3CHXA 1K5SA 3GWKC 3G71V 4DV6B 3L74H 2HVJC 3PJSK 3G67A 1TVKB 2BOBC 3CP1A 1AB3A 1K5QA 3DC6A 2CDYA 3CCMV 4DV5O 3ZHRA 4FLYA 3HKDB 3Q4HA 4QPKA 4U3JA 4FK5C 1TGOA 1ZUQA 2GSMB 1S3JA 1AP5A 4JI2B 4JI4B 4MVOA 1M56C 1YJWV 4O4HA 1FFXB 1HNXO 1V55C 4FJCC 3RYCB 1K33A 1AVMA 2FKXA 5IY5B 2P4KA 5HFMA 4BR6A 2RNBA 3AG4B 4IHJB 4GKJO 3UM7A 3AK3A 3ZHTA 4JYYA 5IJ0B 1BQZA 4B3SO 5JJJB 4B08A 5B66Z 1GN3A 1FKAO 2EIMC 1IXBA 1VF7A 2A0LA 4WFFA 4DR5O 3CD6V 4HNAA 4TV8B 4JI3B 1RPOA 5JCOA 2QKCA 3K9SA 2EJ7A 4DV4B 4I0XA 5FPRA 2HP8A 5CBHA 2LO1A 2GV9A 1SERA 4I50A 3E8HA 4N21A 2ZR3A 5GONB 3WG7C 4LF6O 1QNMA 4MVUA 4GT1A 3CC4V 3CMEV 5BZBA 4D6TH 4GLXA 4D7TA 1HWYA 3I55V 5E1AC 5JH7A 1A32A 2LP7A 3DXRA 5LXTA 3K59A 4I5SA 4B3RO 4FLTA 4MW8A 1VP7A 1NI8A 5GTIZ 1Y74A 3G80A 3CCQV 4ZIBA 4X1YB 3OGCC 5BMVB 3K0DA 1BS3A 3N2KA 4BIUA 4X8AA 4DUYO 1CXZB 3ABMC 2Y0IA 3AG3C 3QO8A 5JWPA 3HPLC 2NR5A 1THZA 1MNGA 2Q68A 4I55A 1MMMA 1PV0A 3JD0A 4I4TA 2HEPA 4UCSA 4X1IA 2YEVA 3ZHQA 5JQGA 1PL4A 4W4LA 1WA8A 4QJFB 4LF7B 3ZHSA 4GKKB 1G8MA 4KHPO 3ZN0A 2IW5A 3SPCA 3K58A 3K5OA 4Z1MG 4JZGA 4DUZO 5GTHZ 2QEXV 3RYIB 3N2GA 5H6QA 1RM1C 1QU7A 2B5UA 1L0LH 2ZDIC 4JV5B 1PKXA 4IT5A 2A79B 3J7AU 4UCVA 4DW0A 1VARA 2UUCO 2EINB 1W0KG 2X0LA 1YF2A 2YC0A 1TUBA 4B3MB 4JI7B 4H0LB 4UB8Z 3ETEA 4BIOA 3UT5A 4ZKIA 1AJPA 5CBGA 4NXMB 2F4VO 4O4IB 4UXNA 1YXBA 2BSKB 1GM8A 4YJ2B 1K4DC 4P30A 4X1KB 1G1XB 2V1DA 2XOKG 4YHHB 1DTOA 2DQ0A 1WP7A 1M1KW 2IU3A 5CA1B 4UVAA 3RFRA 3HKEA 3BAAA 2ZQMA 3F5WC 1R3KC 3ABLB 2UU9O 2OCCC 1I94B 2NLJC 1EN4A 3FYIB 4KUMA 1BHBA 1ENVA 1N0JA 2Q67A 3L75H 4O2BA 5KAIZ 2QA4V 1KYOF 2XAHA 5IYZA 4CH5A 4EFEA 1AJQA 4DR4O 2E5LO 2A06H 3BVOA 1K8AW 1YITV 1SKVA 3JYCA 4DV7O 1ROPA 4LF9B 4PI2A 4DYLA 2IJHA 1EN6A 1V9PA 2ITCC 1YZBA 3K79A 1OHHG 3BABA 5IWAO 3OMAB 3OTFA 4L8JA 3T1YB 4DR1B 2QSAA 1GK9A 3LSSA 4CH4A 2F43G 2VRZA 2KG7B 4KP4A 1OCCC 2EZPA 1NQTA 4ZI7B 4WF9V 3G4SV 4LNUB 3ZEDA 1FXKB 3CEIA 1FAFA 4MTFA 2AXTZ 1I5XA 1SQVH 4CH6A 1N0NA 3ABMB 2CAZC 3AG3B 1QVFU 5DM6V 2PGGA 5LA6B 4LFCB 4YIOA 3ML0A 5H5NA 4GYCB 2ZE6A 1OJHA 4OXSA 3VOUA 3JSNA 1ZX3A 5KHKA 4JZ2A 1QLEB 2LW7A 2ADPA 3N27A 4JI8B 5CA0B 1R1BA 3B2EE 3QF7A 1Q43A 1WP8A 4IIJB 2CTPA 1R6TA 1K9MW 5FLXN 2A7WA 2AHZA 2Z0AA 3CCSV 2QGNA 2WLIB 3OR7C 2DW4A 3DGEA 2GDSA 3F7VC 3O9OA 5CB4A 4KXRA 4F6RA 4PA4A 3WB0A 1WAZA 3BFRA 3LUTB 1NTZH 1RM1B 4WBNB 3ZHVA 3ZMSA 2H3OA 1FJGO 3RN4A 3CWBH 3HKCB 3ICXA 5CMUA 1FXHA 1R3JC 4QE9A 3KKYA 3OR6C 1HNWO 4TV9A 4B7EA 3SDLA 1H2MA 4ZHQB 3NR7A 2PF4E 3JATB 1WNSA 2X6AA 4IYHA 4MTGA 5L3FA 2BTOA 4P9PA 1AP6A 3SGIA 5FNVB 3CRAA 1FPOA 2ZD9A 2DN9A 1RSOA 4OX9O 2GHYA 1AILA 3H1KH 5B1AC 5EIBD 4HAMA 3T1CA 1XOUA 2OCCB 2QWPB 1IVSA 3BPZA 3OM3B 3SPGA 1P49A 3GVMA 3CSXA 4FLVA 2Q8VA 3JAKA 4K8XA 1S76D 5EZYB 1H2NA 3ZRSA 2YIBD 4A5UB 1WLEA 1I0HA 4FZ1A 1H8EG 3X2QB 1M57C 2WLKA 4YY3O 2QTSA 3CYOA 3JD2A 1Y4MA 3CXHF 3JAWB 4OGQB 4LFAB 3FX7A 1N34B 4DR3O 4B3TO 4X88A 2UXDO 4NR1A 3E8BA 5ITZB 4X64O 1BZKA 1OCOB 1PNKA 5LYJB 4LF8B 4EEQA 5LOVB 2H8PC 2AZ0A 2XAQA 2PY5A 1K73W 5JCOC 3ZN1A 1GN6A 4UVBA 3OEEG 2A3QA 4R7CA 5C93A 4DV2B 2QR4A 1ZLZA 1MG1A 5EBMC 1BE3H 1NBMG 3NXSA 2Q7HA 2WLLA 3JALA 2WA4A 2A9HA 1IBLO 3CCVV 3L9DA 3ZBHA 4NTXA 1VQLV 2HKOA 5KX5B 2DQ3A 3RBZA 1GH6A 4H37A 3ZS8C 1IXMA 5K1XA 3CS5A 1EZVH 2JIZG 1XL6A 2UUAO 3AG2C 1GN2A 5HFLA 1P4RA 3GB7C 4R8CA 3ZX6A 4R50A 1QCEA 4O2AA 3C3TA 3E8FA 4W4KA 2QM7A 3WFVA 1XEQA 4JI0B 1JOYA 1F51A 4UCUA 2CTRA 2IM9A 4TUYA 2UXBB 2UXCB 1XMOO 1Z5VA 4D7SA 3CRCA 2CH7A 2GUZA 3AK2A 4FVMA 1G6UA 1ZTEA 3W7TA 3Q4HB 4U3JB 2VQFO 2YI8A 5B5EZ 4EFBA 2QE7G 2VWKA 1WB7A 4ABMA 4JTDB 3A0RA 4O4HB 2R9RB 4Z1VA 4GX0A 5KHJA 4DV2O 1YEWA 3B09A 1M57B 4LH6A 2XASA 1ZAUA 4WFEA 5BR8O 1RP3B 1KMIZ 2PTMA 1N32B 2LGQA 1YIJV 1BT8A 1URFA 5LL6Y 2Q7GA 3K5NA 5KMGA 2CE4A 4AHCA 5KA5A 5KHHA 1IBKB 2OIEA 2HLDG 4LCUC 2ZIMA 5DN6G 3HR0A 1YHQV 2RN9A 4HNAB 1VF6C 1VQ6V 4JYAB 2PZSA 3P32A 3VQVA 4I0XB 4JYCA 3KG2A 2WSSG 1JMKC 2Y4UA 1AI7A 5FPOA 4LFBO 4MVQA 2QKSA 1GKFA 3P3PA 3STZC 4I50B 2N05A 2F95B 1KU9A 1YCIA 2IH1C 4GZRB 4IYIA 3ETDA 2NN4A 2EX3A 2FB5A 1FYJA 1EFRG 2JRIA 5LHGA 2JJ2G 4FM2A 4CZZA 3IAYA 5JH7B 5B1NA 4DV0B 3DXRB 4FLXA 5LXTB 3ZMTA 5CBFA 2KQXA 5L3CA 4F6EA 4I7ZB 3ASOC 5B1BC 4UCOA 1SQXH 3RWRD 2ZIOA 1Y74B 4LH7A 2GBOA 2YI9A 2BCCH 1H2GA 3AEIA 3M7MX 5IYBO 3AG2B 3E22A 4DV3B 4PV1B 3N2KB 1SF9A 4JI1O 2YDEA 1Q7YW 4X62O 5EC1C 3JD3A 2HHHO 3THOA 2JGUA 2EULA 4AQYB 4Z2WA 1VMGA 3K03A 5KUKA 3JD1A 2JK5C 3T1HO 4I55B 5E79Z 2KB1A 2V4DA 5CN0A 1L0NH 2BTQA 4CBCA 4MVMA 4I4TB 1EM1A 2YICA 4X1IB 3ZRVA 1BMFG 1T5EA 2YEVB 5JQGB 4FLZA 2Y48A 2DYSC 2X6BA 1N36O 2CK3G 3OTOB 1WA8B 1PD3A 4DR2B 1AI4A 3AK1A 3BRCA 4DV6O 3M99B 4RWUA 3OGIB 3OE7G 5J9PC 4LF5B 3H01A 4RUEA 2AW9A 2JDIG 2ZE8A 3N2GB 3WU2Z 1XNQB 2N04A 1YDXA 4PDRA 1K97A 5JVDA 4FFBA 3FB5C 1RFYA 3CRRA 1TUBB 4NB5A 1XUQA 2B9ZA 4JI2O 4JI4O 4CH3A 3UQ8A 3UT5B 3EHBB 4J7ZA 1JR9A 3ZRXA 2P5OA 1XBLA 3IFXA 4DRXA 1R3LC 4ZOLA 5EBLC 1SC5B 2L35A 1XILA 3CX5F 3HKEB 3RT3C 1Z5WA 2JS5A 2PI4A 1VQOV 1BGYH 1KB9F 2CTWA 2FMLA 4NXNB 4J10A 1SQGA 2YUAA 4JTAB 1AJNA 1SQPH 1VQPV 4O2BB 2W6JG 3H9VA 1HW7A 2D3OW 1VIBA 2XHBA 5IYZB 2G38A 2P4VA 4JI3O 4LBEC 4XDKA 5KHIA 1XMQB 4PJ0Z 3QO7A 4DV4O 1M56B 1RPRA 5B3SC 1V55B 4NTWA 1NJIW 1G4YB 2JGDA 4LWSA 5KLVH 2OIGA 1O9GA 3QTCA 3B4SA 1YI2V 3WB2A 1GMGA 1IURA 2ZR2A 2Q6AA 3K57A 1VQ5V 5C8YA 3VQXA 1Y6XA 3CC7V 1NR7A 3A8TA 4PI0A 3ETGA 4X20A 3FB7C 2EIMB 3QO5A 2IBZH 1CPYA 1HNZB 4TWKA 4FFKA 4PELA 3VQYA 3RYHA 2D2CB 2XAJA 4IL6Z 1F7YA 1JX9A 1VF6A 4UFZA 1Q81W 1GO3F 4O4JA 1R6NA 5KAFZ 4JI6B 4MVZA 2B1IA 3DSQA 4HZ3A 2QWNB 3CCRV 4JF3A 1N33B 1QQCA 3SPHA 2VWJA 1SQQH 4TQFA 3WG7B 2F93B 5LHHA 3D8CA 3UCSC 5LMUB 3B8MA 3FB8C 2OYQA 3OMNB 4LF4B 1L8DA 1VQ8V 1VQ4V 5CB4B 4F6RB 2F23A 1WN7A 4DK1A 1NU1H 5EYPA 1IX9A 3CRQA 3E8GA 4LF7O 4GKKO 4P9OA 1SRYA 1JVMA 3HKBA 5IYCO 2WLHA 1LNQA 2GTAA 4PDMA 2BOCC 3LSQA 2Q69A 2WA3A 4IGGA 1PL0A 2QWQB 3TK1A 4TV9B 1D5AA 4KL1A 5LMNB 3DC5A 2Z3YA 4JV5O 1SA0A 1K3EA 3JSLA 4NTYA 1XNRB 1IDSA 4JI7O 1ORQC 2OT5A 4B3MO 3RW0A 4ICGA 4X65B 2ILMA 1XHZA 1Y67A 1KKCA 2AZ2A 3U0ZA 4I9WA 1RSOB 4NXMO 2ZM6B 2R9AA 2DYRC 5L3EA 3FKSG 4FLWA 1WPXA 2RJZA 1SQBH 4DR6B 1X4TA 3QG5A 1J5EB 4YHHO 2HVKC 3UO2A 4X66B 2Y4TA 3JAKB 4K0KB 3J81N 1I94O 4CC6A 3CMAV 3JARA 4BWAA 3IGAC 5CA3A 1SS3A 1JCHA 3E83A 2HJFC 1IBMB 3APOA 1S77D 4AILC 1QR8A 3CJHA 2LGWA 1AROP 4LF9O 3B77A 2HFEC 3P3NA 3BEHA 1JQ0A 4C7UA 4GX1A 3L71H 4NKGB 1Q6IA 3I56V 4DR1O 3T1YO 4BW9A 3FYEB 2Q0AA 4YJ3A 3D36A 3H1HH 4J41A 2M7WA 4G27B 5EK0A 1QVGU 4EKWA 1KQSU 5TISZ 5K1PA 3AG1C 3L73H 1P7BA 3SPIA 5LMNO 2WLLB 3JALB 3TCUA 2VQEB 4FMTA 1P7GA 3RGBA 3K5MA 3JASA 1XQ8A 5F2VO 3MHHC 4NVPA 2OCHA 4WFAV 4LFCO 3SJCC 5J2UA 3UO3A 1VQKV 1BHAA 3RYFA 1MOFA 3CCUV 5EBWC 1FD9A 1DF5A 3BHPA 2RMKB 1AI5A 2WPDG 4WFBV 4DV1B 1KBHA 4JI8O 2QM4A 2UXNA 5IE9A 1Z2GA 2E74B 1E1QG 1OCCB 1UPGA 1M4UA 2P22C 1SESA 4DXWA 4H13B 4X89A 3S3WA 3HB3B 1Y76A 4O2AB 2VS0A 4XDJA 2YXYA 5JJEB 2YXHA 1H2KA 5LP6A 4TUYB 3ZHUA 4WFGA 1NZ6A 1OCRC 4MVSA 3IC7A 2CH7B 5D5QA 2GUZB 1DK1A 2KKWA 1QLNA 2DYRB 5LBQA 4CC5A 4PA7A 2N74A 4YIPA 5JJNB 5IDJA 4NYKA 2GTSA 1D2DA 1V54C 5KUMA 3BY6A 3SJQC 3L70H 4FM1A 2IH3C 4JAAA 5L3DA 4JI5B 1YSCA 3K04A 4XDLA 3K0GA 1S0VA 3ASNC 1JFFA 2UXXA 4UB6Z 1HR0B 4EB6A 3ZCCA 3CCJV 4QGPA 5KMGB 1Q6HA 2CUGA 1LUVA 1AR4A 4MTOA 2OTJV 4LFAO 1YJ9V 1NTKH 4J80A 3APQA 2F66C 2EIJC 4DR7B 1N34O 2JJ1G 1OCZC 3FFQA 4WFHA 1Q3EA 4GUNA 2Q4PA 1NS1A 1TA8A 2DE0X 1VQNV 5B1AB 5KHGA 2QWOB 4LF8O 2IJJA 1HNXB 3AG1B 1Q5OA 1X59A 3A2FA 2UUBB 3KCXA 1QBZA 3EVKA 2EILC 3MDSA 1H2SB 4GKJB 3H1IH 2B1GA 3B40A 4TQDA 2EJRA 2PUSA 5J2TA 3U10A 4JTCB 4FIPC 4B3SB 4JAUA 1LUWA 4O4LA 1P84F 4RO2A 3UKMA 4PDLA 1XREA 3LNNA 1AR5A 2XUMA 4DR5B 1N8RW 2E75B 1H8HG 3SJAC 4F4LA 1AR1B 2P67A 2JS3A 2W0XA 3JAMN 1KUQA 3E22B 1NTMH 3WB1A 4JI5O 3SYQA 1U97A 3T4DA 3BCCH 4K3AA 2ZXWC 4DW1A 2DJVA 3OAAG 1W59A 3MD0A 3MHSC 4RQEA 2P7TC 1EN5A 2BTQB 3CRMA 3ABKC 1OZ0A 5BY1A 1OCRB 1NKDA 2WAMA 1Q86W 4H44B 1FS0G 2Q73A 2HR3A 3T4ZA 1H38A 1EZJA 5A9GA 4JI0O 2LFRA 2R72A 2IJIA 3W7UA 3TGUH 2FL4A 2UXBO 1DLBA 3ABUA 2UXCO 2XT9A 4B3RB 4FPPA 4DR7O 1SZTA 2DOSA 1V54B 4QIWF 3ZRWA 3QVNA 2XNDG
chains in the Genus database with same CATH topology
1BGYH 1KB9F 1SQQH 2A06H 3H1IH 1BCCH 4U3FH 3L73H 5KLVH 1NTMH 1SQXH 3L74H 1L0NH 1SQPH 1NTZH 2BCCH 3H1JH 2FYUH 3BCCH 3L70H 1BE3H 3L71H 3CWBH 1PP9H 1P84F 3TGUH 1SQBH 1SQVH 3L72H 1PPJH 1EZVH 3H1LH 3L75H 3H1HH 1KYOF 3H1KH 3CX5F 1NTKH 1NU1H 1L0LH 3CXHF 4D6TH 4PD4F 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  1KB9 F;  1SQQ H;  2A06 H;  3H1I H;  1BCC H;  4U3F H;  3L73 H;  5KLV H;  1NTM H;  1SQX H;  3L74 H;  1L0N H;  1SQP H;  1NTZ H;  2BCC H;  3H1J H;  2FYU H;  3BCC H;  3L70 H;  1BE3 H;  3L71 H;  3CWB H;  1PP9 H;  1P84 F;  3TGU H;  1SQB H;  1SQV H;  3L72 H;  1PPJ H;  1EZV H;  3H1L H;  3L75 H;  3H1H H;  1KYO F;  3H1K H;  3CX5 F;  1NTK H;  1NU1 H;  1L0L H;  3CXH F;  4D6T H;  4PD4 F;  2IBZ H; 
#chains in the Genus database with same CATH topology
 5IJ9 A;  2W6I G;  4QNH B;  1L1F A;  3CPW U;  5JVD B;  4FFB B;  1JJO A;  4DUY B;  5IT9 N;  3FAV A;  2LQT A;  5LGU A;  5H9C A;  2UUB O;  3D3I A;  3ASN B;  4R6Z A;  2EIN C;  4DK0 A;  5DED A;  3AG7 A;  1ZL8 A;  2CGN A;  2ZNI A;  3OW2 U;  4MS2 A;  1Q6U A;  4DRX B;  1XHX A;  4H33 A;  4ZOL B;  5IYD O;  2QDO A;  1VQ7 V;  4PA9 A;  4G2K A;  2R70 A;  1ZWI C;  3D3Q A;  1N32 O;  2ZE5 A;  2X6C A;  4J42 A;  1PNL A;  4PA3 A;  2ADQ B;  2EIJ B;  1B06 A;  1KKD A;  1US6 A;  2P06 A;  3ZMV A;  3LDD A;  1OCZ B;  4KHP B;  1LR1 A;  1TVK A;  5A2Q N;  5LGT A;  1VQM V;  1IBK O;  2Q7E A;  3ABL C;  3A0H Z;  4UUJ C;  1F4M A;  1R3I C;  4DUZ B;  1E79 G;  4JYA O;  3HKD A;  2RQ6 A;  2Y69 C;  1GN4 A;  3B8N A;  2QM8 A;  2E76 B;  2UUC B;  2EIL B;  3U11 A;  4RQF A;  1XL4 A;  2M6Y A;  2JGD B;  4LWS B;  2LW1 A;  1FFX A;  4CS2 A;  2F4V B;  5B1O A;  5L3B A;  3RYC A;  2Y0P A;  3LSU A;  3OFN G;  4QE7 A;  1J95 A;  3F7Y C;  4GCZ A;  5C8Y B;  4KFM A;  2IU0 A;  4IHJ A;  5FL7 G;  4GX5 A;  2P90 A;  5BXZ A;  3BA8 A;  4X20 B;  2F1M A;  2L6L A;  5IJ0 A;  4DV0 O;  4J9Z B;  2UU9 B;  1PM9 A;  3RYH B;  4X9Q A;  3D36 C;  1GM7 A;  4UCT A;  1FXK C;  4ZBM A;  4QPJ A;  2DMX A;  3BA9 A;  4O4J B;  2ZXW B;  4TV8 A;  1Y66 A;  4DR4 B;  2E5L B;  1WJZ A;  1KD1 W;  1JA8 A;  3M8A A;  1BQ0 A;  1S5H C;  3KZI Z;  3ABK B;  4DV7 B;  4DV3 O;  3CCL V;  3I5D A;  4AQY O;  3DTU B;  1QLE C;  1IZ3 A;  5IWA B;  1GAX A;  5GON A;  3CC2 V;  1SET A;  2RCV A;  3J80 N;  2WWW A;  3FB6 C;  4HBN A;  1K7D A;  5DEC A;  1SQF A;  5EYP B;  1KP3 A;  1JJ2 U;  3GWO A;  3OD4 A;  3OTO O;  1YVW A;  1B6Q A;  3SYP A;  4DR2 O;  3ASO B;  5B1B B;  3VBB A;  3HKB B;  3G6E V;  4B7K A;  1W0J G;  4LF5 O;  4PD4 F;  1GM9 A;  1BCC H;  3SR2 C;  4X1Y A;  1SA0 B;  5BMV A;  1XNQ O;  1M90 W;  1AI6 A;  5LP6 C;  4PHZ A;  1JPX A;  3PN1 A;  3H1L H;  5L3G A;  3W7S A;  3JCU Z;  1R73 A;  1UFI A;  3ZMZ A;  1B04 A;  1XI1 A;  1DGS A;  2X7R B;  2ZNJ A;  2YXL A;  2DYS B;  3E35 A;  1W2B U;  1PNM A;  2Z5U A;  1E1R G;  3JCZ A;  3L72 H;  3OT7 A;  1FJG B;  1UJW B;  2Y69 B;  3ETQ A;  2ETN A;  2K1E A;  4LC1 A;  3P30 A;  4NXN O;  4MW3 A;  4J9Y B;  3JAR B;  5EIB C;  1HNW B;  2O57 A;  3K06 A;  4U3F H;  2QWR B;  3F5T A;  1O9H A;  3X2Q C;  3RYI A;  4RAI A;  3KCY A;  1XMQ O;  1PP9 H;  5LHI A;  3CJH B;  2DWD C;  4LR3 A;  3K3W A;  1WPB A;  2MK3 A;  5KA6 A;  1MSD A;  2EZO A;  2IJK A;  4OX9 B;  1S72 V;  4O4I A;  3TET A;  1OCO C;  2ZCE A;  2BSK A;  4YJ2 A;  1HP8 A;  4G28 B;  4X1K A;  4YJ3 B;  3O65 A;  2QTO A;  1NVP D;  4AI8 A;  5CA1 A;  2FYU H;  4YXW G;  1WB8 A;  4J7J A;  3JD4 A;  2RDC A;  3W7X A;  1HNZ O;  1CEZ A;  3SYA A;  1KEC A;  1R6K A;  1F23 A;  4YY3 B;  4UCR A;  4L87 A;  3JAS B;  2NNU A;  1F4N A;  1NVP B;  2OWO A;  5J2U B;  2WLN A;  1K34 A;  4DR3 B;  2AGA A;  3EXA A;  4B3T B;  1I08 A;  5B3S B;  5LGN A;  3MAQ A;  4JI6 O;  3RYF B;  2ZKO A;  3OEH G;  1U96 A;  2UXD B;  2AHY A;  2CGO A;  1N33 O;  4X64 B;  2Q0O C;  3K5L A;  2ZIN A;  3RVZ A;  4JAV A;  4OPA A;  1SZX A;  5LMU O;  4J7K A;  1S5L Z;  4ASU G;  4LF4 O;  1BSM A;  2KG7 A;  2HJD A;  1Y76 B;  2WLM A;  4ZI7 A;  2HG5 C;  3S3X A;  3K9A A;  4LNU A;  1NH2 D;  1FXK A;  1KC8 W;  5LP6 B;  3IC9 A;  1IBL B;  4P2Z A;  4BAY A;  5LA6 A;  3TJT A;  1KP2 A;  4JAS A;  4TT3 G;  3C90 A;  1BL8 A;  5H6R A;  1MA1 A;  2PYJ A;  2KSD A;  1NH2 B;  4DO2 A;  3CXC U;  1XNR O;  4K35 A;  4X65 O;  1N4C A;  5CA0 A;  3W7W A;  2Q9L A;  1COW G;  2WLJ A;  2YS8 A;  2UUA B;  1QR9 A;  1Q82 W;  4IIJ A;  4N23 A;  2ZM6 O;  4UV8 A;  3E86 A;  4U7N A;  2WLI A;  1YTF D;  4FLU A;  4DR6 O;  3H1J H;  1J5E O;  3TXQ A;  3ABT A;  1JFF B;  2Q5Z A;  4WBN A;  4PDV A;  2ZDI A;  4PA6 A;  1ZSP A;  4X66 O;  4Q6G A;  4EB6 B;  2EBO A;  3HKC A;  3R66 A;  3LDC A;  4LP8 A;  4MVR A;  1S5J A;  1XMO B;  1EBO A;  4GX2 A;  4K0K O;  2ODM A;  1YTF B;  3E2E A;  4BIZ A;  4I9Q A;  2EIK C;  2DWE C;  2LFS A;  2XAG A;  4OPH A;  5AG2 A;  4ZHQ A;  1IBM O;  3JAT A;  1OV9 A;  2VQF B;  2K9P A;  3VQW A;  1D5N A;  4FZ0 A;  1NR1 A;  2W0F C;  5FNV A;  3OMI B;  3G6B A;  4JPR A;  3EFF K;  2ATK C;  1M93 A;  1Q90 D;  1Q8I A;  2BE3 A;  2PYL A;  2ITD C;  3SPJ A;  3CB2 A;  4CS4 A;  2CTQ A;  3E89 A;  1K92 A;  4MTX A;  1B3Q A;  5GW7 A;  5BR8 B;  4E4E A;  1VEW A;  3QNE A;  3LDE A;  2JVD A;  2OTL V;  5J2T B;  3CE2 A;  5EZY A;  3TXS A;  4O4L B;  2P6J A;  5IY5 C;  2VQE O;  4HYO A;  1MZE A;  1MAB G;  4J11 A;  3AG4 C;  1FFT B;  3JAW A;  4TOI A;  1I5Y A;  4E2L A;  3ZJZ A;  2PI5 A;  4TSF G;  3C3S A;  1I7F A;  4UVC A;  2JEX A;  3ZIA G;  5ITZ A;  4DV5 B;  1HDJ A;  2YID A;  2YIB A;  1YJN V;  5D5P A;  3OUF A;  2R9I A;  5LYJ A;  4DV1 O;  2ZT9 B;  5LOV A;  4XBF A;  4LFB B;  1NT2 B;  1M5I A;  4JYB A;  3LNM B;  3RVY A;  1FXV A;  3SYC A;  3ZMU A;  4UV9 A;  2E3C A;  1CP9 A;  2LJ2 A;  2XAF A;  3A0B Z;  1GRJ A;  3OUS A;  2C2A A;  5EC2 C;  3SJB C;  1TAE A;  1TUE B;  1VQ9 V;  2H94 A;  4K8Z A;  4MT8 A;  2XTA A;  4CS3 A;  3CCE V;  2JEU A;  2QKA A;  3R65 A;  2ARH A;  2YSU B;  5H2F Z;  1MSW D;  1VF5 B;  2YIA A;  3T2M A;  3ZRW B;  4FM0 A;  5KX5 A;  2V7Q G;  1K4C C;  5IJ9 B;  4MSW C;  3K08 A;  2QJ1 A;  4JI1 B;  4U7O A;  4X62 B;  2HHH B;  3FAV B;  3SYO A;  4JGS A;  1M9N A;  4RUF A;  4BW5 A;  4WCE V;  1H2L A;  2MW2 B;  3IJ4 A;  1ZL8 B;  3T1H B;  1DF4 A;  4Q20 A;  1MZF A;  1PPJ H;  3FD9 A;  3STL C;  4LF6 B;  2EIK B;  2FTK A;  1N36 B;  1XDC A;  1GTO A;  1QHT A;  1HR0 O;  2ZE7 A;  3CHX A;  1K5S A;  3GWK C;  3G71 V;  4DV6 B;  3L74 H;  2HVJ C;  3PJS K;  3G67 A;  1TVK B;  2BOB C;  3CP1 A;  1AB3 A;  1K5Q A;  3DC6 A;  2CDY A;  3CCM V;  4DV5 O;  3ZHR A;  4FLY A;  3HKD B;  3Q4H A;  4QPK A;  4U3J A;  4FK5 C;  1TGO A;  1ZUQ A;  2GSM B;  1S3J A;  1AP5 A;  4JI2 B;  4JI4 B;  4MVO A;  1M56 C;  1YJW V;  4O4H A;  1FFX B;  1HNX O;  1V55 C;  4FJC C;  3RYC B;  1K33 A;  1AVM A;  2FKX A;  5IY5 B;  2P4K A;  5HFM A;  4BR6 A;  2RNB A;  3AG4 B;  4IHJ B;  4GKJ O;  3UM7 A;  3AK3 A;  3ZHT A;  4JYY A;  5IJ0 B;  1BQZ A;  4B3S O;  5JJJ B;  4B08 A;  5B66 Z;  1GN3 A;  1FKA O;  2EIM C;  1IXB A;  1VF7 A;  2A0L A;  4WFF A;  4DR5 O;  3CD6 V;  4HNA A;  4TV8 B;  4JI3 B;  1RPO A;  5JCO A;  2QKC A;  3K9S A;  2EJ7 A;  4DV4 B;  4I0X A;  5FPR A;  2HP8 A;  5CBH A;  2LO1 A;  2GV9 A;  1SER A;  4I50 A;  3E8H A;  4N21 A;  2ZR3 A;  5GON B;  3WG7 C;  4LF6 O;  1QNM A;  4MVU A;  4GT1 A;  3CC4 V;  3CME V;  5BZB A;  4D6T H;  4GLX A;  4D7T A;  1HWY A;  3I55 V;  5E1A C;  5JH7 A;  1A32 A;  2LP7 A;  3DXR A;  5LXT A;  3K59 A;  4I5S A;  4B3R O;  4FLT A;  4MW8 A;  1VP7 A;  1NI8 A;  5GTI Z;  1Y74 A;  3G80 A;  3CCQ V;  4ZIB A;  4X1Y B;  3OGC C;  5BMV B;  3K0D A;  1BS3 A;  3N2K A;  4BIU A;  4X8A A;  4DUY O;  1CXZ B;  3ABM C;  2Y0I A;  3AG3 C;  3QO8 A;  5JWP A;  3HPL C;  2NR5 A;  1THZ A;  1MNG A;  2Q68 A;  4I55 A;  1MMM A;  1PV0 A;  3JD0 A;  4I4T A;  2HEP A;  4UCS A;  4X1I A;  2YEV A;  3ZHQ A;  5JQG A;  1PL4 A;  4W4L A;  1WA8 A;  4QJF B;  4LF7 B;  3ZHS A;  4GKK B;  1G8M A;  4KHP O;  3ZN0 A;  2IW5 A;  3SPC A;  3K58 A;  3K5O A;  4Z1M G;  4JZG A;  4DUZ O;  5GTH Z;  2QEX V;  3RYI B;  3N2G A;  5H6Q A;  1RM1 C;  1QU7 A;  2B5U A;  1L0L H;  2ZDI C;  4JV5 B;  1PKX A;  4IT5 A;  2A79 B;  3J7A U;  4UCV A;  4DW0 A;  1VAR A;  2UUC O;  2EIN B;  1W0K G;  2X0L A;  1YF2 A;  2YC0 A;  1TUB A;  4B3M B;  4JI7 B;  4H0L B;  4UB8 Z;  3ETE A;  4BIO A;  3UT5 A;  4ZKI A;  1AJP A;  5CBG A;  4NXM B;  2F4V O;  4O4I B;  4UXN A;  1YXB A;  2BSK B;  1GM8 A;  4YJ2 B;  1K4D C;  4P30 A;  4X1K B;  1G1X B;  2V1D A;  2XOK G;  4YHH B;  1DTO A;  2DQ0 A;  1WP7 A;  1M1K W;  2IU3 A;  5CA1 B;  4UVA A;  3RFR A;  3HKE A;  3BAA A;  2ZQM A;  3F5W C;  1R3K C;  3ABL B;  2UU9 O;  2OCC C;  1I94 B;  2NLJ C;  1EN4 A;  3FYI B;  4KUM A;  1BHB A;  1ENV A;  1N0J A;  2Q67 A;  3L75 H;  4O2B A;  5KAI Z;  2QA4 V;  1KYO F;  2XAH A;  5IYZ A;  4CH5 A;  4EFE A;  1AJQ A;  4DR4 O;  2E5L O;  2A06 H;  3BVO A;  1K8A W;  1YIT V;  1SKV A;  3JYC A;  4DV7 O;  1ROP A;  4LF9 B;  4PI2 A;  4DYL A;  2IJH A;  1EN6 A;  1V9P A;  2ITC C;  1YZB A;  3K79 A;  1OHH G;  3BAB A;  5IWA O;  3OMA B;  3OTF A;  4L8J A;  3T1Y B;  4DR1 B;  2QSA A;  1GK9 A;  3LSS A;  4CH4 A;  2F43 G;  2VRZ A;  2KG7 B;  4KP4 A;  1OCC C;  2EZP A;  1NQT A;  4ZI7 B;  4WF9 V;  3G4S V;  4LNU B;  3ZED A;  1FXK B;  3CEI A;  1FAF A;  4MTF A;  2AXT Z;  1I5X A;  1SQV H;  4CH6 A;  1N0N A;  3ABM B;  2CAZ C;  3AG3 B;  1QVF U;  5DM6 V;  2PGG A;  5LA6 B;  4LFC B;  4YIO A;  3ML0 A;  5H5N A;  4GYC B;  2ZE6 A;  1OJH A;  4OXS A;  3VOU A;  3JSN A;  1ZX3 A;  5KHK A;  4JZ2 A;  1QLE B;  2LW7 A;  2ADP A;  3N27 A;  4JI8 B;  5CA0 B;  1R1B A;  3B2E E;  3QF7 A;  1Q43 A;  1WP8 A;  4IIJ B;  2CTP A;  1R6T A;  1K9M W;  5FLX N;  2A7W A;  2AHZ A;  2Z0A A;  3CCS V;  2QGN A;  2WLI B;  3OR7 C;  2DW4 A;  3DGE A;  2GDS A;  3F7V C;  3O9O A;  5CB4 A;  4KXR A;  4F6R A;  4PA4 A;  3WB0 A;  1WAZ A;  3BFR A;  3LUT B;  1NTZ H;  1RM1 B;  4WBN B;  3ZHV A;  3ZMS A;  2H3O A;  1FJG O;  3RN4 A;  3CWB H;  3HKC B;  3ICX A;  5CMU A;  1FXH A;  1R3J C;  4QE9 A;  3KKY A;  3OR6 C;  1HNW O;  4TV9 A;  4B7E A;  3SDL A;  1H2M A;  4ZHQ B;  3NR7 A;  2PF4 E;  3JAT B;  1WNS A;  2X6A A;  4IYH A;  4MTG A;  5L3F A;  2BTO A;  4P9P A;  1AP6 A;  3SGI A;  5FNV B;  3CRA A;  1FPO A;  2ZD9 A;  2DN9 A;  1RSO A;  4OX9 O;  2GHY A;  1AIL A;  3H1K H;  5B1A C;  5EIB D;  4HAM A;  3T1C A;  1XOU A;  2OCC B;  2QWP B;  1IVS A;  3BPZ A;  3OM3 B;  3SPG A;  1P49 A;  3GVM A;  3CSX A;  4FLV A;  2Q8V A;  3JAK A;  4K8X A;  1S76 D;  5EZY B;  1H2N A;  3ZRS A;  2YIB D;  4A5U B;  1WLE A;  1I0H A;  4FZ1 A;  1H8E G;  3X2Q B;  1M57 C;  2WLK A;  4YY3 O;  2QTS A;  3CYO A;  3JD2 A;  1Y4M A;  3CXH F;  3JAW B;  4OGQ B;  4LFA B;  3FX7 A;  1N34 B;  4DR3 O;  4B3T O;  4X88 A;  2UXD O;  4NR1 A;  3E8B A;  5ITZ B;  4X64 O;  1BZK A;  1OCO B;  1PNK A;  5LYJ B;  4LF8 B;  4EEQ A;  5LOV B;  2H8P C;  2AZ0 A;  2XAQ A;  2PY5 A;  1K73 W;  5JCO C;  3ZN1 A;  1GN6 A;  4UVB A;  3OEE G;  2A3Q A;  4R7C A;  5C93 A;  4DV2 B;  2QR4 A;  1ZLZ A;  1MG1 A;  5EBM C;  1BE3 H;  1NBM G;  3NXS A;  2Q7H A;  2WLL A;  3JAL A;  2WA4 A;  2A9H A;  1IBL O;  3CCV V;  3L9D A;  3ZBH A;  4NTX A;  1VQL V;  2HKO A;  5KX5 B;  2DQ3 A;  3RBZ A;  1GH6 A;  4H37 A;  3ZS8 C;  1IXM A;  5K1X A;  3CS5 A;  1EZV H;  2JIZ G;  1XL6 A;  2UUA O;  3AG2 C;  1GN2 A;  5HFL A;  1P4R A;  3GB7 C;  4R8C A;  3ZX6 A;  4R50 A;  1QCE A;  4O2A A;  3C3T A;  3E8F A;  4W4K A;  2QM7 A;  3WFV A;  1XEQ A;  4JI0 B;  1JOY A;  1F51 A;  4UCU A;  2CTR A;  2IM9 A;  4TUY A;  2UXB B;  2UXC B;  1XMO O;  1Z5V A;  4D7S A;  3CRC A;  2CH7 A;  2GUZ A;  3AK2 A;  4FVM A;  1G6U A;  1ZTE A;  3W7T A;  3Q4H B;  4U3J B;  2VQF O;  2YI8 A;  5B5E Z;  4EFB A;  2QE7 G;  2VWK A;  1WB7 A;  4ABM A;  4JTD B;  3A0R A;  4O4H B;  2R9R B;  4Z1V A;  4GX0 A;  5KHJ A;  4DV2 O;  1YEW A;  3B09 A;  1M57 B;  4LH6 A;  2XAS A;  1ZAU A;  4WFE A;  5BR8 O;  1RP3 B;  1KMI Z;  2PTM A;  1N32 B;  2LGQ A;  1YIJ V;  1BT8 A;  1URF A;  5LL6 Y;  2Q7G A;  3K5N A;  5KMG A;  2CE4 A;  4AHC A;  5KA5 A;  5KHH A;  1IBK B;  2OIE A;  2HLD G;  4LCU C;  2ZIM A;  5DN6 G;  3HR0 A;  1YHQ V;  2RN9 A;  4HNA B;  1VF6 C;  1VQ6 V;  4JYA B;  2PZS A;  3P32 A;  3VQV A;  4I0X B;  4JYC A;  3KG2 A;  2WSS G;  1JMK C;  2Y4U A;  1AI7 A;  5FPO A;  4LFB O;  4MVQ A;  2QKS A;  1GKF A;  3P3P A;  3STZ C;  4I50 B;  2N05 A;  2F95 B;  1KU9 A;  1YCI A;  2IH1 C;  4GZR B;  4IYI A;  3ETD A;  2NN4 A;  2EX3 A;  2FB5 A;  1FYJ A;  1EFR G;  2JRI A;  5LHG A;  2JJ2 G;  4FM2 A;  4CZZ A;  3IAY A;  5JH7 B;  5B1N A;  4DV0 B;  3DXR B;  4FLX A;  5LXT B;  3ZMT A;  5CBF A;  2KQX A;  5L3C A;  4F6E A;  4I7Z B;  3ASO C;  5B1B C;  4UCO A;  1SQX H;  3RWR D;  2ZIO A;  1Y74 B;  4LH7 A;  2GBO A;  2YI9 A;  2BCC H;  1H2G A;  3AEI A;  3M7M X;  5IYB O;  3AG2 B;  3E22 A;  4DV3 B;  4PV1 B;  3N2K B;  1SF9 A;  4JI1 O;  2YDE A;  1Q7Y W;  4X62 O;  5EC1 C;  3JD3 A;  2HHH O;  3THO A;  2JGU A;  2EUL A;  4AQY B;  4Z2W A;  1VMG A;  3K03 A;  5KUK A;  3JD1 A;  2JK5 C;  3T1H O;  4I55 B;  5E79 Z;  2KB1 A;  2V4D A;  5CN0 A;  1L0N H;  2BTQ A;  4CBC A;  4MVM A;  4I4T B;  1EM1 A;  2YIC A;  4X1I B;  3ZRV A;  1BMF G;  1T5E A;  2YEV B;  5JQG B;  4FLZ A;  2Y48 A;  2DYS C;  2X6B A;  1N36 O;  2CK3 G;  3OTO B;  1WA8 B;  1PD3 A;  4DR2 B;  1AI4 A;  3AK1 A;  3BRC A;  4DV6 O;  3M99 B;  4RWU A;  3OGI B;  3OE7 G;  5J9P C;  4LF5 B;  3H01 A;  4RUE A;  2AW9 A;  2JDI G;  2ZE8 A;  3N2G B;  3WU2 Z;  1XNQ B;  2N04 A;  1YDX A;  4PDR A;  1K97 A;  5JVD A;  4FFB A;  3FB5 C;  1RFY A;  3CRR A;  1TUB B;  4NB5 A;  1XUQ A;  2B9Z A;  4JI2 O;  4JI4 O;  4CH3 A;  3UQ8 A;  3UT5 B;  3EHB B;  4J7Z A;  1JR9 A;  3ZRX A;  2P5O A;  1XBL A;  3IFX A;  4DRX A;  1R3L C;  4ZOL A;  5EBL C;  1SC5 B;  2L35 A;  1XIL A;  3CX5 F;  3HKE B;  3RT3 C;  1Z5W A;  2JS5 A;  2PI4 A;  1VQO V;  1BGY H;  1KB9 F;  2CTW A;  2FML A;  4NXN B;  4J10 A;  1SQG A;  2YUA A;  4JTA B;  1AJN A;  1SQP H;  1VQP V;  4O2B B;  2W6J G;  3H9V A;  1HW7 A;  2D3O W;  1VIB A;  2XHB A;  5IYZ B;  2G38 A;  2P4V A;  4JI3 O;  4LBE C;  4XDK A;  5KHI A;  1XMQ B;  4PJ0 Z;  3QO7 A;  4DV4 O;  1M56 B;  1RPR A;  5B3S C;  1V55 B;  4NTW A;  1NJI W;  1G4Y B;  2JGD A;  4LWS A;  5KLV H;  2OIG A;  1O9G A;  3QTC A;  3B4S A;  1YI2 V;  3WB2 A;  1GMG A;  1IUR A;  2ZR2 A;  2Q6A A;  3K57 A;  1VQ5 V;  5C8Y A;  3VQX A;  1Y6X A;  3CC7 V;  1NR7 A;  3A8T A;  4PI0 A;  3ETG A;  4X20 A;  3FB7 C;  2EIM B;  3QO5 A;  2IBZ H;  1CPY A;  1HNZ B;  4TWK A;  4FFK A;  4PEL A;  3VQY A;  3RYH A;  2D2C B;  2XAJ A;  4IL6 Z;  1F7Y A;  1JX9 A;  1VF6 A;  4UFZ A;  1Q81 W;  1GO3 F;  4O4J A;  1R6N A;  5KAF Z;  4JI6 B;  4MVZ A;  2B1I A;  3DSQ A;  4HZ3 A;  2QWN B;  3CCR V;  4JF3 A;  1N33 B;  1QQC A;  3SPH A;  2VWJ A;  1SQQ H;  4TQF A;  3WG7 B;  2F93 B;  5LHH A;  3D8C A;  3UCS C;  5LMU B;  3B8M A;  3FB8 C;  2OYQ A;  3OMN B;  4LF4 B;  1L8D A;  1VQ8 V;  1VQ4 V;  5CB4 B;  4F6R B;  2F23 A;  1WN7 A;  4DK1 A;  1NU1 H;  5EYP A;  1IX9 A;  3CRQ A;  3E8G A;  4LF7 O;  4GKK O;  4P9O A;  1SRY A;  1JVM A;  3HKB A;  5IYC O;  2WLH A;  1LNQ A;  2GTA A;  4PDM A;  2BOC C;  3LSQ A;  2Q69 A;  2WA3 A;  4IGG A;  1PL0 A;  2QWQ B;  3TK1 A;  4TV9 B;  1D5A A;  4KL1 A;  5LMN B;  3DC5 A;  2Z3Y A;  4JV5 O;  1SA0 A;  1K3E A;  3JSL A;  4NTY A;  1XNR B;  1IDS A;  4JI7 O;  1ORQ C;  2OT5 A;  4B3M O;  3RW0 A;  4ICG A;  4X65 B;  2ILM A;  1XHZ A;  1Y67 A;  1KKC A;  2AZ2 A;  3U0Z A;  4I9W A;  1RSO B;  4NXM O;  2ZM6 B;  2R9A A;  2DYR C;  5L3E A;  3FKS G;  4FLW A;  1WPX A;  2RJZ A;  1SQB H;  4DR6 B;  1X4T A;  3QG5 A;  1J5E B;  4YHH O;  2HVK C;  3UO2 A;  4X66 B;  2Y4T A;  3JAK B;  4K0K B;  3J81 N;  1I94 O;  4CC6 A;  3CMA V;  3JAR A;  4BWA A;  3IGA C;  5CA3 A;  1SS3 A;  1JCH A;  3E83 A;  2HJF C;  1IBM B;  3APO A;  1S77 D;  4AIL C;  1QR8 A;  3CJH A;  2LGW A;  1ARO P;  4LF9 O;  3B77 A;  2HFE C;  3P3N A;  3BEH A;  1JQ0 A;  4C7U A;  4GX1 A;  3L71 H;  4NKG B;  1Q6I A;  3I56 V;  4DR1 O;  3T1Y O;  4BW9 A;  3FYE B;  2Q0A A;  4YJ3 A;  3D36 A;  3H1H H;  4J41 A;  2M7W A;  4G27 B;  5EK0 A;  1QVG U;  4EKW A;  1KQS U;  5TIS Z;  5K1P A;  3AG1 C;  3L73 H;  1P7B A;  3SPI A;  5LMN O;  2WLL B;  3JAL B;  3TCU A;  2VQE B;  4FMT A;  1P7G A;  3RGB A;  3K5M A;  3JAS A;  1XQ8 A;  5F2V O;  3MHH C;  4NVP A;  2OCH A;  4WFA V;  4LFC O;  3SJC C;  5J2U A;  3UO3 A;  1VQK V;  1BHA A;  3RYF A;  1MOF A;  3CCU V;  5EBW C;  1FD9 A;  1DF5 A;  3BHP A;  2RMK B;  1AI5 A;  2WPD G;  4WFB V;  4DV1 B;  1KBH A;  4JI8 O;  2QM4 A;  2UXN A;  5IE9 A;  1Z2G A;  2E74 B;  1E1Q G;  1OCC B;  1UPG A;  1M4U A;  2P22 C;  1SES A;  4DXW A;  4H13 B;  4X89 A;  3S3W A;  3HB3 B;  1Y76 A;  4O2A B;  2VS0 A;  4XDJ A;  2YXY A;  5JJE B;  2YXH A;  1H2K A;  5LP6 A;  4TUY B;  3ZHU A;  4WFG A;  1NZ6 A;  1OCR C;  4MVS A;  3IC7 A;  2CH7 B;  5D5Q A;  2GUZ B;  1DK1 A;  2KKW A;  1QLN A;  2DYR B;  5LBQ A;  4CC5 A;  4PA7 A;  2N74 A;  4YIP A;  5JJN B;  5IDJ A;  4NYK A;  2GTS A;  1D2D A;  1V54 C;  5KUM A;  3BY6 A;  3SJQ C;  3L70 H;  4FM1 A;  2IH3 C;  4JAA A;  5L3D A;  4JI5 B;  1YSC A;  3K04 A;  4XDL A;  3K0G A;  1S0V A;  3ASN C;  1JFF A;  2UXX A;  4UB6 Z;  1HR0 B;  4EB6 A;  3ZCC A;  3CCJ V;  4QGP A;  5KMG B;  1Q6H A;  2CUG A;  1LUV A;  1AR4 A;  4MTO A;  2OTJ V;  4LFA O;  1YJ9 V;  1NTK H;  4J80 A;  3APQ A;  2F66 C;  2EIJ C;  4DR7 B;  1N34 O;  2JJ1 G;  1OCZ C;  3FFQ A;  4WFH A;  1Q3E A;  4GUN A;  2Q4P A;  1NS1 A;  1TA8 A;  2DE0 X;  1VQN V;  5B1A B;  5KHG A;  2QWO B;  4LF8 O;  2IJJ A;  1HNX B;  3AG1 B;  1Q5O A;  1X59 A;  3A2F A;  2UUB B;  3KCX A;  1QBZ A;  3EVK A;  2EIL C;  3MDS A;  1H2S B;  4GKJ B;  3H1I H;  2B1G A;  3B40 A;  4TQD A;  2EJR A;  2PUS A;  5J2T A;  3U10 A;  4JTC B;  4FIP C;  4B3S B;  4JAU A;  1LUW A;  4O4L A;  1P84 F;  4RO2 A;  3UKM A;  4PDL A;  1XRE A;  3LNN A;  1AR5 A;  2XUM A;  4DR5 B;  1N8R W;  2E75 B;  1H8H G;  3SJA C;  4F4L A;  1AR1 B;  2P67 A;  2JS3 A;  2W0X A;  3JAM N;  1KUQ A;  3E22 B;  1NTM H;  3WB1 A;  4JI5 O;  3SYQ A;  1U97 A;  3T4D A;  3BCC H;  4K3A A;  2ZXW C;  4DW1 A;  2DJV A;  3OAA G;  1W59 A;  3MD0 A;  3MHS C;  4RQE A;  2P7T C;  1EN5 A;  2BTQ B;  3CRM A;  3ABK C;  1OZ0 A;  5BY1 A;  1OCR B;  1NKD A;  2WAM A;  1Q86 W;  4H44 B;  1FS0 G;  2Q73 A;  2HR3 A;  3T4Z A;  1H38 A;  1EZJ A;  5A9G A;  4JI0 O;  2LFR A;  2R72 A;  2IJI A;  3W7U A;  3TGU H;  2FL4 A;  2UXB O;  1DLB A;  3ABU A;  2UXC O;  2XT9 A;  4B3R B;  4FPP A;  4DR7 O;  1SZT A;  2DOS A;  1V54 B;  4QIW F;  3ZRW A;  3QVN A;  2XND G; 
#chains in the Genus database with same CATH homology
 1BGY H;  1KB9 F;  1SQQ H;  2A06 H;  3H1I H;  1BCC H;  4U3F H;  3L73 H;  5KLV H;  1NTM H;  1SQX H;  3L74 H;  1L0N H;  1SQP H;  1NTZ H;  2BCC H;  3H1J H;  2FYU H;  3BCC H;  3L70 H;  1BE3 H;  3L71 H;  3CWB H;  1PP9 H;  1P84 F;  3TGU H;  1SQB H;  1SQV H;  3L72 H;  1PPJ H;  1EZV H;  3H1L H;  3L75 H;  3H1H H;  1KYO F;  3H1K H;  3CX5 F;  1NTK H;  1NU1 H;  1L0L H;  3CXH F;  4D6T H;  4PD4 F;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...