3CXHF

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 28
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cxhF00
3H1KH 1P84F 3H1LH 3H1IH 1SQBH 3L75H 1SQPH 3CX5F 1KYOF 1SQXH 1BGYH 2A06H 2BCCH 1KB9F 3L70H 1L0NH 3L72H 4U3FH 4D6TH 1BE3H 1SQVH 3L71H 5KLVH 1PP9H 1L0LH 3L73H 1BCCH 3H1JH 3TGUH 1NU1H 1EZVH 3CWBH 3L74H 4PD4F 1NTMH 2FYUH 3H1HH 1SQQH 3BCCH 2IBZH 1NTZH 1NTKH 1PPJH 3CXHF
chains in the Genus database with same CATH superfamily
4LNUB 2W6JG 1HNXB 4K35A 3APOA 3FKSG 4B3TB 2EINC 4ZIBA 5KX5A 2H8PC 5DN6G 1LUVA 3B40A 4DR1B 1VP7A 2GUZA 1QLNA 3RBZA 2W6IG 5CMUA 3AG4B 4H33A 2FMLA 4FJCC 1SESA 5LA6B 1SERA 4RQFA 2P7TC 1Z2GA 1PKXA 3JCZA 3FFQA 2QWQB 5IWAO 2YIAA 2P67A 4U3JB 4CH3A 1XMQB 4F6RB 4BW9A 3SYOA 5H2FZ 4PA7A 2PTMA 2LGQA 3ABMC 3OTFA 2UU9O 4AILC 3DTUB 4QPKA 3SDLA 2DYRC 1PM9A 3ICXA 4U7OA 1FS0G 4MTFA 3A8TA 2UUBB 1DF5A 4Z1VA 5JCOA 4GCZA 4ICGA 5J2TB 1VQKV 1XNRO 3K5NA 2HVJC 4GKJO 3CHXA 1D5AA 5LXTA 1K5SA 3P3PA 2WLNA 4FLVA 4NXMO 4IYHA 4HNAA 1X4TA 1KECA 3AG4C 1WB7A 1H38A 4HAMA 3IC7A 4J7JA 1Y6XA 1RSOA 3ZRWA 3BRCA 1K73W 4GKKO 1KB9F 2BOBC 3T4ZA 5JJNB 5GONA 4LFCB 3W7TA 4X66B 4I0XB 1PNLA 4B7EA 5LBQA 2P5OA 2Z0AA 4DV4B 5KAFZ 4DV6B 4OX9B 2K1EA 2QR4A 4J9ZB 3RVZA 1S3JA 1SRYA 3E2EA 1H2KA 3T1HB 3A0HZ 4MVUA 1HR0B 3JATA 2WLIA 1YDXA 1QLEB 4LF6B 1BCCH 2D2CB 1DK1A 4ZI7B 4MW3A 2B9ZA 3QO7A 5IJ0B 5LHIA 4K8ZA 3RYCB 2IBZH 3RVYA 2OT5A 4N23A 2D3OW 4UVCA 2BTQA 5LHHA 1NH2B 1L0NH 3BHPA 4UUJC 1OV9A 1TAEA 2A79B 2Q0OC 1FKAO 3G67A 4KXRA 4X8AA 5FNVA 3LDEA 2DWDC 1VQPV 2KSDA 1XHXA 1E79G 4TV9A 5L3FA 4JYAO 1YIJV 2CE4A 3QO5A 2UXDO 4FK5C 4JI6B 5HFMA 1Q43A 1Z5VA 1R6NA 1YJNV 4YHHO 1KP2A 3T2MA 3WFVA 5CA1B 4LF4B 4K0KO 1X59A 2PZSA 2Q9LA 1YI2V 2HVKC 1QLEC 1CP9A 4DV0B 2VWJA 4B3MB 2QWNB 3FD9A 2RMKB 1WJZA 5K1XA 1H2GA 1SQXH 3ZHSA 1GRJA 1ZUQA 2WLKA 2E74B 5IY5B 5KUKA 2Z3YA 3L73H 3OUFA 1BHBA 2H3OA 3CJHA 2ITDC 1SA0A 3OM3B 2MK3A 3RYHB 5JH7A 2CTWA 4MSWC 4Q6GA 2FKXA 1U96A 3O9OA 1FXKB 2FB5A 3ASOB 5D5PA 3ZIAG 2RNBA 4JV5O 2R70A 1TVKA 4QE9A 4TQFA 4LFBO 1EZVH 2XAGA 4QNHB 3PN1A 1K4CC 5H6RA 2YC0A 4CZZA 1N34O 5BMVA 3CXHF 1Y74A 4E4EA 5LGTA 2Q4PA 2F43G 4X64O 5LOVB 3L75H 3UM7A 4JTDB 2B5UA 3HPLC 3F5TA 4JI3O 1V55B 4UCTA 1IVSA 1NZ6A 1XQ8A 3HKBB 4QE7A 1WA8B 1QNMA 4MW8A 1FFTB 2IJHA 4X1KB 5IYZA 2VS0A 4BAYA 5IY5C 2Z5UA 4LCUC 2XAFA 2LW7A 2A0LA 4L87A 1DTOA 1OJHA 3E22A 5CA0A 2UUCO 3QO8A 5L3CA 1FXKC 3A0RA 3ASOC 4MVQA 1JA8A 3JARA 4FM2A 1KU9A 2JGUA 1B04A 1M9NA 5LMNO 4PD4F 2L35A 1AILA 1HNWO 4G2KA 2HHHB 1VMGA 4ZHQA 4DV7B 3CMAV 3MHHC 4HYOA 1TA8A 3UQ8A 1R3KC 1AI6A 4Q20A 4X65B 3CCJV 3B2EE 4J9YB 5B1NA 3OTOO 2ZE7A 1SZXA 1XOUA 1RM1B 4DR2O 4LF7B 2ARHA 3E8GA 4CC5A 1VQ4V 1V55C 4XDLA 2WPDG 4D7TA 5FPOA 2E5LB 2WA4A 1GN3A 1SQBH 1W0KG 3N2KA 1YSCA 3CCUV 2XNDG 5FPRA 5LMUB 2CH7B 2Q7HA 2V7QG 4MS2A 4X1IA 3CS5A 3RT3C 3KG2A 5BR8O 4K3AA 3OMNB 3Q4HA 1LR1A 3OEEG 3TXQA 1CPYA 1F4NA 2K9PA 5J2UB 4JI2O 4FZ1A 2ZR2A 4PDMA 1AP6A 4ZKIA 4BR6A 4B3SO 1WAZA 2CGOA 3RWRD 2QM8A 1VF5B 1IBMB 4QGPA 4UCUA 5E1AC 5CBGA 5EZYA 1NQTA 1LUWA 1YXBA 2VWKA 1K5QA 1RM1C 2IW5A 4BWAA 3FB5C 3ZX6A 1IDSA 3KCXA 2Y4UA 1ZLZA 1LNQA 2IH1C 3A0BZ 3SR2C 4ZHQB 5ITZA 2QWOB 1K4DC 3JAWB 4FLZA 4NXNB 2DQ0A 3OAAG 5JQGB 2DWEC 2F4VB 2JIZG 1I08A 4DR4O 4IIJA 1SETA 3OUSA 2Q0AA 2XAQA 5IJ9A 4I7ZB 3OR6C 1EN5A 2OYQA 5KA6A 1I5XA 4DR7O 1W59A 2CTPA 1T5EA 1KUQA 5KMGB 4CH4A 4LF9B 1K92A 4PJ0Z 1G8MA 2JGDB 4X1IB 5FL7G 4B3RO 4GLXA 1SZTA 4GYCB 5JJEB 4DV3B 4GX2A 3CCEV 1ORQC 2BE3A 1YVWA 5IWAB 2Q8VA 2E76B 2CTRA 5IYBO 1KD1W 1B3QA 1GH6A 4YY3O 4JAAA 2QEXV 3ETQA 3BA9A 1GKFA 2YXLA 4O4LB 4TV8B 4X1YB 3AEIA 2Q69A 3WB2A 2VQEO 3T1YB 4LH6A 4CH6A 2GTSA 3AK3A 3CX5F 2XASA 4PDLA 2Q67A 4CS4A 4YJ3A 2IJJA 2YXHA 1K7DA 1I94O 3OT7A 4H13B 4I4TA 1OCOB 4JI5B 1DLBA 4CBCA 1N32B 4PA4A 3LSQA 4GKJB 2WLLA 4AQYB 5KLVH 1OCZB 2JS5A 3RYIB 4YIPA 1SKVA 1Y76B 3HKEA 2P90A 2YIBD 1R6TA 4EKWA 1R1BA 1RPRA 1N4CA 3THOA 3HKDB 4ZOLB 1WPBA 2Q7GA 3PJSK 4LWSB 1S76D 1PP9H 2RJZA 2OWOA 5IJ9B 4JI4O 1BQZA 2UXBO 1JPXA 3ETDA 1VQ9V 1R6KA 3M7MX 1J5EO 4DR5O 1IBLO 4LF5B 3SJAC 3MD0A 4KFMA 2RCVA 4EB6B 2OIEA 3P32A 2LFSA 3H01A 4FFBA 3B8MA 3E8HA 4PA3A 4KHPB 3CCQV 3OGIB 2IH3C 1AI5A 3HB3B 1N8RW 4JI0B 3BVOA 1IXBA 2JK5C 1MOFA 2ZE6A 4IYIA 1OCOC 1XMOO 1ZAUA 2JS3A 2YEVB 4H44B 5KA5A 2EZOA 4DR3O 4JYBA 1YEWA 4PA6A 1OCZC 4O4HA 4W4LA 3DSQA 3SJCC 1UFIA 2WA3A 1NH2D 1K8AW 4GT1A 4HZ3A 3ZHVA 1VQMV 3JSNA 1D2DA 4J7ZA 1K3EA 4KUMA 5A2QN 3KCYA 5DEDA 3SYPA 4P2ZA 1ZTEA 2F93B 3VQXA 1BL8A 1N33B 5JVDB 1Q82W 3T4DA 4U3FH 1URFA 4P9OA 3ASNB 4E2LA 4OXSA 5IE9A 4MVSA 3J81N 1NVPB 2DN9A 1FXHA 4OPHA 1JMKC 4I55A 1Q7YW 2IJIA 1WLEA 1EBOA 3FAVB 1S5JA 4IGGA 5BY1A 4X62O 4NTYA 4TQDA 4KL1A 4NB5A 5IDJA 4XDKA 3D36C 3RW0A 2LO1A 4YJ2A 2UXCB 1BE3H 3G6BA 2VRZA 2PUSA 3VQVA 3RYFA 4FFBB 4FLUA 5C8YB 2L6LA 2QM4A 3JALA 3BA8A 2WLJA 4X20B 2LW1A 1GM8A 3CYOA 1Q86W 3SYQA 4FFKA 4I50A 4O2BB 1GN6A 4QIWF 3IFXA 3K5LA 2GV9A 5A9GA 4DYLA 1F51A 5IT9N 3DC6A 2HG5C 3ASNC 1GMGA 4LFBB 4FM1A 4Z2WA 2WLMA 3CRCA 5LYJB 1U97A 5EIBC 2UUAO 2BSKA 3UT5A 1N34B 4F6EA 1UPGA 2DW4A 3JCUZ 5BZBA 4B7KA 5KX5B 2OTLV 3HR0A 3FX7A 2GDSA 2GUZB 1M90W 2IM9A 3OMAB 1AVMA 2QM7A 1N36O 3CC4V 1FJGB 4YIOA 2ODMA 4J80A 3FB8C 1WPXA 4OGQB 4WBNA 2ZM6B 1S5LZ 2Q6AA 3DXRA 1QVGU 2A7WA 3VOUA 2YUAA 3CCVV 1YITV 4UCOA 1H2MA 2AHYA 3G4SV 5LMNB 3DGEA 2QTOA 1KYOF 3BEHA 4PA9A 3ZBHA 1HNWB 1Y4MA 4LF8O 2QWPB 1F4MA 1VQOV 4I50B 4ASUG 1PPJH 1WP8A 2EIMB 2KG7A 2HJFC 4DR2B 3M8AA 5LXTB 3KZIZ 2Y4TA 1P49A 4HNAB 2EJRA 4UB6Z 4FLYA 4MTGA 3JSLA 1HNXO 1RSOB 1Q90D 3ZRWB 4D7SA 2BSKB 2P4VA 4GX5A 4TWKA 4B3TO 3L9DA 1JFFA 3LUTB 5GONB 3ZHRA 1PD3A 1MSDA 3K79A 2PY5A 3AG1B 2ZNJA 2PF4E 4B08A 2NNUA 2W0FC 4IL6Z 4QPJA 1G6UA 1H2SB 3AG7A 1IBKB 4MTXA 1NU1H 1XMQO 1H2NA 1SQFA 1NTMH 3JATB 2WLIB 3K9SA 4EFBA 3JD1A 3OW2U 2P22C 3SPJA 1THZA 5JCOC 2ADQB 1VF7A 1IURA 3N2GA 4RWUA 4JI7B 2A06H 5JWPA 3QF7A 3TK1A 1HWYA 1QU7A 1BZKA 2EIMC 1VF6A 5H6QA 5CB4A 1BHAA 1BS3A 3D3IA 2UUBO 4JI8B 1GAXA 2BTQB 1BMFG 1SQQH 5L3BA 3T1CA 2ZKOA 2EZPA 1SQGA 5FNVB 4DUYB 3IJ4A 1PV0A 1ZL8A 1VEWA 1GN2A 2ZIMA 4TV9B 3AG1C 3E86A 1AP5A 4PV1B 1FFXA 3VQWA 4PDVA 1I5YA 4LFCO 1OHHG 4GUNA 4X66O 3K9AA 3ZRSA 1BGYH 3O65A 3ZCCA 2ADPA 5TISZ 4DV4O 4DV6O 4OX9O 1JCHA 1NR7A 1SQVH 4B3RB 4LFAO 2ZR3A 3CCRV 4FLWA 4RUEA 1QHTA 1MABG 3F5WC 1BSMA 4MVOA 4JGSA 4JZGA 5EBMC 1KQSU 4LF6O 2MW2B 3CJHB 2JRIA 1SA0B 2XHBA 5LGUA 5LL6Y 2WLHA 3K06A 5JH7B 1B06A 1FPOA 3ZMTA 2A9HA 2Y0IA 4DRXA 1B6QA 3WB0A 1RPOA 5LP6A 3VQYA 2N05A 5L3DA 4MT8A 2OCHA 1TVKB 3S3WA 1Q5OA 1Q6UA 4JAUA 2NN4A 3W7WA 4DW0A 1XEQA 2AGAA 5BMVB 1Y74B 3FB6C 1XL6A 2DMXA 4P30A 1ROPA 1Y66A 1Q3EA 4DV1B 2LP7A 1ZL8B 1Z5WA 1GTOA 4KP4A 4DR6B 5GTHZ 1VARA 3D8CA 2CGNA 4RAIA 4JI6O 3ABLB 1ZSPA 4DK1A 4JI4B 3SPGA 5IYZB 1MNGA 4LF4O 2UXBB 2AHZA 4WFFA 1CXZB 2YSUB 3I5DA 4DR5B 3OMIB 3W7UA 1MMMA 3L71H 1XNQO 4B3MO 4JI1B 1P7GA 3TJTA 3E22B 5CA0B 2LGWA 4FIPC 2ZDIA 3BCCH 4O4IA 3HKCA 4J42A 3JARB 2DJVA 4RUFA 2QSAA 5B1AB 1SC5B 1XMOB 2EIKB 2WSSG 1R3LC 1VIBA 2B1IA 1ZX3A 3JAKA 1R3IC 3EHBB 2QKCA 5EYPA 2QGNA 5CA3A 2HLDG 1VQ8V 1NKDA 1V54B 1F7YA 1YTFB 1NT2B 3G80A 1I0HA 4QJFB 3ABLC 4XDJA 2FTKA 5LGNA 3ZHUA 3JAMN 4TSFG 1OCRB 3H1JH 3N2KB 1J95A 1G4YB 1MSWD 4R50A 1NVPD 2EULA 1GM7A 5EIBD 3Q4HB 2XTAA 3LSSA 1QQCA 2P06A 1AB3A 1V9PA 3C90A 3EXAA 2RQ6A 5EC2C 2JJ2G 4RQEA 5FLXN 3I55V 2ZIOA 4UV8A 5B1AC 3BY6A 3CEIA 3QG5A 4RO2A 1TUBA 2EIKC 4JZ2A 5EZYB 4CC6A 3QNEA 2UU9B 2IJKA 4LR3A 3CRQA 3R66A 5GW7A 1AJNA 1V54C 3MHSC 2N04A 2ITCC 2UXXA 2HHHO 1IXMA 3APQA 4DV7O 3BFRA 4CS3A 1IZ3A 1XNRB 2X6AA 2ETNA 2FYUH 3SJBC 1HDJA 1AR4A 2OCCB 3H1KH 1OCRC 4IHJA 4PI0A 4UVAA 5ITZB 3CRAA 4TUYA 4NXMB 2N74A 2PYLA 4LF7O 2Y48A 3X2QB 2O57A 2ATKC 4IIJB 2GBOA 4LNUA 5KAIZ 1EFRG 3K57A 3CMEV 3CRRA 4GKKB 4MVZA 3JD2A 2QA4V 2XAJA 1OZ0A 2EILB 3OEHG 4I9WA 2ZCEA 5CBFA 4DK0A 1JVMA 5IYDO 2W0XA 2PGGA 3AG2B 1XI1A 2ZD9A 1GN4A 5B3SB 3H9VA 3KKYA 1NJIW 1BT8A 1XHZA 2V4DA 4FZ0A 1N36B 3TGUH 4U3JA 2AZ2A 2LJ2A 3CE2A 2X6CA 4F6RA 4EEQA 3CXCU 1M4UA 1FYJA 3ZMSA 1OCCB 1NTZH 1IBMO 4FPPA 2HR3A 1US6A 3B77A 4DV2O 1F23A 3H1LH 3MAQA 1SQPH 2OTJV 2F66C 1M5IA 3OR7C 1Q8IA 2OCCC 2EX3A 4JAVA 2YS8A 4R7CA 1D5NA 3LDCA 4NVPA 1L1FA 3CCSV 4YJ3B 3X2QC 4JF3A 5J2TA 5B1OA 1VQ6V 5EBWC 1KP3A 4I4TB 2F23A 4NR1A 3WG7B 4G27B 1HP8A 4LH7A 1JR9A 3CPWU 2XAHA 1M56B 1DGSA 2ZT9B 1MG1A 2EILC 2WLLB 2YIBA 4NXNO 3ML0A 2F4VO 1KBHA 3JASA 3STLC 4JYAB 3HKEB 3AG2C 2UXDB 2X0LA 4K8XA 5B3SC 3K08A 3J80N 4LBEC 4X88A 3G71V 4YHHB 1YHQV 4K0KB 4GX1A 4I0XA 2GSMB 5CN0A 4LF9O 4DV5O 1OCCC 4PI2A 4J7KA 5C93A 3DC5A 4AI8A 3NR7A 2JEUA 4J41A 4JTAB 3L74H 2EJ7A 1QR9A 4DV3O 1FAFA 3J7AU 5H9CA 4P9PA 1DF4A 4ZI7A 5IYCO 1JX9A 3S3XA 3LDDA 5IJ0A 1QCEA 2QJ1A 2WAMA 3B09A 3RYCA 1VQNV 3WG7C 1EN4A 3LSUA 3T1YO 4MVRA 5K1PA 4JV5B 1M56C 4UCRA 4YXWG 4H37A 1MA1A 4O4HB 2UXNA 4X89A 3I56V 2YDEA 4JI5O 3G6EV 1N32O 2ILMA 2DYSB 5EC1C 3K58A 4JYYA 1N0JA 4X64B 4AQYO 3U11A 3B8NA 4DW1A 3E8FA 4UV9A 1NS1A 2HFEC 2QE7G 4Z1MG 1N0NA 4JI3B 1YZBA 2KB1A 1UJWB 4EFEA 5J9PC 1NTKH 4WFGA 3JASB 3U10A 5CA1A 2HJDA 2CDYA 4LC1A 1TGOA 1Q81W 2Y0PA 2EBOA 4I55B 2ZE8A 1RP3B 4WFEA 3AK2A 3CD6V 1L8DA 3UKMA 3W7XA 2E3CA 4LF5O 4YJ2B 2UUCB 2JVDA 1Y67A 2EIJB 4LFAB 2M6YA 3TETA 2WWWA 4KHPO 3L70H 3RYFB 2VQFO 2ZNIA 3OE7G 1I7FA 4JI0O 2XOKG 4O4JA 4GZRB 3RYHA 4JPRA 1YJWV 2QDOA 1HNZO 4R8CA 3GB7C 1XREA 3JALB 1FXKA 3FB7C 1WNSA 2DYSC 4BIZA 4PHZA 3OTOB 4DUZO 1P7BA 1IX9A 2DQ3A 2CAZC 3MDSA 1VQ5V 4JASA 3E89A 3K5OA 1L0LH 4LP8A 1NI8A 3K03A 3ZMVA 3F7VC 5LOVA 3JD4A 3UT5B 4WFBV 4UXNA 1N33O 2IU3A 2YI9A 4DR1O 4J10A 3E8BA 5BR8B 3HKBA 1WA8A 1S77D 4X1KA 1YF2A 1KMIZ 2EIJC 3W7SA 1O9GA 2DOSA 2P6JA 2M7WA 3B4SA 2PI4A 5LHGA 4JI2B 1A32A 1MZEA 3A2FA 4B3SB 4JTCB 1XNQB 2YXYA 2UXCO 1O9HA 2AZ0A 4UCVA 5JJJB 2R9RB 1H8HG 2QKAA 4WBNB 1AJQA 1CEZA 5F2VO 3DXRB 4BIUA 2BTOA 1PNMA 3ZN1A 4FVMA 5AG2A 4BIOA 3VBBA 4U7NA 3BPZA 2CTQA 1Q6HA 5GTIZ 3BAAA 4O4JB 3ZEDA 1JJ2U 5KHGA 3UCSC 3ETEA 3JYCA 2R9IA 3AG3B 3P3NA 4UB8Z 1GM9A 3D3QA 1P84F 1M57B 2ZE5A 1E1RG 3M99B 1JJOA 4TT3G 4DR4B 5KUMA 1AR1B 1SF9A 2F1MA 1YTFD 2V1DA 1FD9A 2KG7B 3ZMZA 2KKWA 1YCIA 3CC2V 3GWOA 3CSXA 1W2BU 2YIDA 4DR7B 2CH7A 1NR1A 1XDCA 2HEPA 5CBHA 3LNNA 1EN6A 1H8EG 3K0GA 1JFFB 3JD0A 1M93A 2RN9A 2GHYA 5DM6V 4BW5A 5E79Z 5J2UA 3UO3A 5KHJA 3OD4A 1WB8A 4PELA 4N21A 4XBFA 3T1HO 2BOCC 3H1HH 1JQ0A 3SYAA 1HR0O 2HP8A 2CK3G 5L3EA 4YY3B 3E83A 1FJGO 4MVMA 4FLXA 2ZM6O 3AG3C 1M1KW 5BXZA 1XUQA 2VQEB 1M57C 1COWG 2XT9A 4C7UA 4X9QA 2OIGA 3CWBH 3FYIB 4FMTA 3N2GB 1FXVA 3ABKB 1I94B 3ABUA 1TUEB 4I9QA 5B1BB 4FLTA 5CB4B 2RDCA 1WN7A 1S72V 3K59A 2Q7EA 3SJQC 3JAWA 2H94A 5KHKA 5JQGA 3CP1A 1XBLA 5B66Z 3C3TA 3ZRXA 2YICA 5D5QA 2PYJA 2X6BA 2FL4A 3L72H 2AXTZ 2Q73A 2B1GA 5KMGA 3BABA 1R3JC 4ZBMA 3ZMUA 3N27A 5DECA 5L3GA 2JGDA 1FFXB 4D6TH 4WCEV 1J5EB 3STZC 1IBLB 1QBZA 3EFFK 3IGAC 2KQXA 1K34A 4DV0O 2YI8A 1QVFU 3CRMA 2QTSA 2XUMA 4G28B 3ETGA 2JDIG 1ENVA 4WFAV 1IBKO 1AR5A 3ABKC 1R73A 4O4LA 4TV8A 4X1YA 5B1BC 4WF9V 1GO3F 1VF6C 3TXSA 4DV2B 4J11A 5EK0A 3GVMA 4DR3B 3AK1A 1PNKA 1NBMG 1VQ7V 1H2LA 4UVBA 4DO2A 2Q68A 4JI7O 3SGIA 3SPHA 4DRXB 5B5EZ 1P4RA 3H1IH 5LP6B 4JI8O 2QKSA 3K3WA 3RYIA 1Y76A 1ZWIC 3RGBA 2Y69B 3NXSA 3HKDA 4ZOLA 4DUYO 1YJ9V 3LNMB 4LWSA 2JJ1G 1AI4A 4I5SA 4MTOA 4DXWA 3CCLV 1AI7A 4UFZA 3OFNG 2BCCH 2R9AA 1XILA 4W4KA 2NR5A 2ZXWB 4PDRA 4X62B 4O2AA 3P30A 1G1XB 3ZHQA 4DV5B 4EB6A 1S5HC 1Q6IA 3CB2A 1PL4A 3ZS8C 2NLJC 4IT5A 3K04A 1QR8A 1KC8W 2ZQMA 2GTAA 4JYCA 3D36A 3ZJZA 2IU0A 2ZINA 4O4IB 3HKCB 3ZRVA 1AJPA 1K33A 2YEVA 3QVNA 3SYCA 1EM1A 5LP6C 3K5MA 1K9MW 3WU2Z 2P4KA 4R6ZA 3RFRA 4HBNA 2PI5A 3F7YC 1KKDA 3ABTA 5KHHA 4X65O 3JAKB 2Y69C 3QTCA 5EYPB 3K0DA 4GX0A 1HW7A 3E35A 3ZHTA 4AHCA 4FM0A 1WP7A 3SPIA 3SPCA 1VQLV 1E1QG 2UUAB 2QWRB 2E5LO 5HFLA 5JVDA 2ZXWC 1EZJA 4WFHA 3IC9A 4F4LA 5LMUO 5H5NA 2AW9A 2R72A 2C2AA 5LA6A 3GWKC 1JOYA 3UO2A 4DV1O 3ZN0A 3FAVA 2DE0X 3JD3A 4DR6O 3RN4A 1RFYA 4NTWA 1PL0A 1KKCA 3CCMV 2ZDIC 2EINB 3OGCC 5EBLC 2CUGA 4O2AB 5KHIA 1K97A 1SS3A 4H0LB 4A5UB 4JI1O 1GK9A 1TUBB 1S0VA 1W0JG 5C8YA 4ABMA 3U0ZA 2VQFB 1BQ0A 2Q5ZA 4CS2A 2HKOA 4X20A 3EVKA 1HNZB 2X7RB 2LFRA 4CH5A 4LF8B 2JEXA 4O2BA 4NYKA 3R65A 1AROP 3FYEB 4NKGB 3ABMB 2F95B 4UCSA 3C3SA 4OPAA 4DUZB 5LYJA 4IHJB 2DYRB 1MZFA 1XL4A 4NTXA 3IAYA 4TUYB 2A3QA 3WB1A 2E75B 3CC7V 3TCUA 4TOIA 2G38A 2LQTA 4L8JA
chains in the Genus database with same CATH topology
3H1KH 1P84F 3H1LH 3H1IH 1SQBH 3L75H 1SQPH 3CX5F 1KYOF 1SQXH 1BGYH 2A06H 2BCCH 1KB9F 3L70H 1L0NH 3L72H 4U3FH 4D6TH 1BE3H 1SQVH 3L71H 5KLVH 1PP9H 1L0LH 3L73H 1BCCH 3H1JH 3TGUH 1NU1H 1EZVH 3CWBH 3L74H 4PD4F 1NTMH 2FYUH 3H1HH 1SQQH 3BCCH 2IBZH 1NTZH 1NTKH 1PPJH 3CXHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K H;  1P84 F;  3H1L H;  3H1I H;  1SQB H;  3L75 H;  1SQP H;  3CX5 F;  1KYO F;  1SQX H;  1BGY H;  2A06 H;  2BCC H;  1KB9 F;  3L70 H;  1L0N H;  3L72 H;  4U3F H;  4D6T H;  1BE3 H;  1SQV H;  3L71 H;  5KLV H;  1PP9 H;  1L0L H;  3L73 H;  1BCC H;  3H1J H;  3TGU H;  1NU1 H;  1EZV H;  3CWB H;  3L74 H;  4PD4 F;  1NTM H;  2FYU H;  3H1H H;  1SQQ H;  3BCC H;  2IBZ H;  1NTZ H;  1NTK H;  1PPJ H;  3CXH F; 
#chains in the Genus database with same CATH topology
 4LNU B;  2W6J G;  1HNX B;  4K35 A;  3APO A;  3FKS G;  4B3T B;  2EIN C;  4ZIB A;  5KX5 A;  2H8P C;  5DN6 G;  1LUV A;  3B40 A;  4DR1 B;  1VP7 A;  2GUZ A;  1QLN A;  3RBZ A;  2W6I G;  5CMU A;  3AG4 B;  4H33 A;  2FML A;  4FJC C;  1SES A;  5LA6 B;  1SER A;  4RQF A;  2P7T C;  1Z2G A;  1PKX A;  3JCZ A;  3FFQ A;  2QWQ B;  5IWA O;  2YIA A;  2P67 A;  4U3J B;  4CH3 A;  1XMQ B;  4F6R B;  4BW9 A;  3SYO A;  5H2F Z;  4PA7 A;  2PTM A;  2LGQ A;  3ABM C;  3OTF A;  2UU9 O;  4AIL C;  3DTU B;  4QPK A;  3SDL A;  2DYR C;  1PM9 A;  3ICX A;  4U7O A;  1FS0 G;  4MTF A;  3A8T A;  2UUB B;  1DF5 A;  4Z1V A;  5JCO A;  4GCZ A;  4ICG A;  5J2T B;  1VQK V;  1XNR O;  3K5N A;  2HVJ C;  4GKJ O;  3CHX A;  1D5A A;  5LXT A;  1K5S A;  3P3P A;  2WLN A;  4FLV A;  4NXM O;  4IYH A;  4HNA A;  1X4T A;  1KEC A;  3AG4 C;  1WB7 A;  1H38 A;  4HAM A;  3IC7 A;  4J7J A;  1Y6X A;  1RSO A;  3ZRW A;  3BRC A;  1K73 W;  4GKK O;  1KB9 F;  2BOB C;  3T4Z A;  5JJN B;  5GON A;  4LFC B;  3W7T A;  4X66 B;  4I0X B;  1PNL A;  4B7E A;  5LBQ A;  2P5O A;  2Z0A A;  4DV4 B;  5KAF Z;  4DV6 B;  4OX9 B;  2K1E A;  2QR4 A;  4J9Z B;  3RVZ A;  1S3J A;  1SRY A;  3E2E A;  1H2K A;  3T1H B;  3A0H Z;  4MVU A;  1HR0 B;  3JAT A;  2WLI A;  1YDX A;  1QLE B;  4LF6 B;  1BCC H;  2D2C B;  1DK1 A;  4ZI7 B;  4MW3 A;  2B9Z A;  3QO7 A;  5IJ0 B;  5LHI A;  4K8Z A;  3RYC B;  2IBZ H;  3RVY A;  2OT5 A;  4N23 A;  2D3O W;  4UVC A;  2BTQ A;  5LHH A;  1NH2 B;  1L0N H;  3BHP A;  4UUJ C;  1OV9 A;  1TAE A;  2A79 B;  2Q0O C;  1FKA O;  3G67 A;  4KXR A;  4X8A A;  5FNV A;  3LDE A;  2DWD C;  1VQP V;  2KSD A;  1XHX A;  1E79 G;  4TV9 A;  5L3F A;  4JYA O;  1YIJ V;  2CE4 A;  3QO5 A;  2UXD O;  4FK5 C;  4JI6 B;  5HFM A;  1Q43 A;  1Z5V A;  1R6N A;  1YJN V;  4YHH O;  1KP2 A;  3T2M A;  3WFV A;  5CA1 B;  4LF4 B;  4K0K O;  1X59 A;  2PZS A;  2Q9L A;  1YI2 V;  2HVK C;  1QLE C;  1CP9 A;  4DV0 B;  2VWJ A;  4B3M B;  2QWN B;  3FD9 A;  2RMK B;  1WJZ A;  5K1X A;  1H2G A;  1SQX H;  3ZHS A;  1GRJ A;  1ZUQ A;  2WLK A;  2E74 B;  5IY5 B;  5KUK A;  2Z3Y A;  3L73 H;  3OUF A;  1BHB A;  2H3O A;  3CJH A;  2ITD C;  1SA0 A;  3OM3 B;  2MK3 A;  3RYH B;  5JH7 A;  2CTW A;  4MSW C;  4Q6G A;  2FKX A;  1U96 A;  3O9O A;  1FXK B;  2FB5 A;  3ASO B;  5D5P A;  3ZIA G;  2RNB A;  4JV5 O;  2R70 A;  1TVK A;  4QE9 A;  4TQF A;  4LFB O;  1EZV H;  2XAG A;  4QNH B;  3PN1 A;  1K4C C;  5H6R A;  2YC0 A;  4CZZ A;  1N34 O;  5BMV A;  3CXH F;  1Y74 A;  4E4E A;  5LGT A;  2Q4P A;  2F43 G;  4X64 O;  5LOV B;  3L75 H;  3UM7 A;  4JTD B;  2B5U A;  3HPL C;  3F5T A;  4JI3 O;  1V55 B;  4UCT A;  1IVS A;  1NZ6 A;  1XQ8 A;  3HKB B;  4QE7 A;  1WA8 B;  1QNM A;  4MW8 A;  1FFT B;  2IJH A;  4X1K B;  5IYZ A;  2VS0 A;  4BAY A;  5IY5 C;  2Z5U A;  4LCU C;  2XAF A;  2LW7 A;  2A0L A;  4L87 A;  1DTO A;  1OJH A;  3E22 A;  5CA0 A;  2UUC O;  3QO8 A;  5L3C A;  1FXK C;  3A0R A;  3ASO C;  4MVQ A;  1JA8 A;  3JAR A;  4FM2 A;  1KU9 A;  2JGU A;  1B04 A;  1M9N A;  5LMN O;  4PD4 F;  2L35 A;  1AIL A;  1HNW O;  4G2K A;  2HHH B;  1VMG A;  4ZHQ A;  4DV7 B;  3CMA V;  3MHH C;  4HYO A;  1TA8 A;  3UQ8 A;  1R3K C;  1AI6 A;  4Q20 A;  4X65 B;  3CCJ V;  3B2E E;  4J9Y B;  5B1N A;  3OTO O;  2ZE7 A;  1SZX A;  1XOU A;  1RM1 B;  4DR2 O;  4LF7 B;  2ARH A;  3E8G A;  4CC5 A;  1VQ4 V;  1V55 C;  4XDL A;  2WPD G;  4D7T A;  5FPO A;  2E5L B;  2WA4 A;  1GN3 A;  1SQB H;  1W0K G;  3N2K A;  1YSC A;  3CCU V;  2XND G;  5FPR A;  5LMU B;  2CH7 B;  2Q7H A;  2V7Q G;  4MS2 A;  4X1I A;  3CS5 A;  3RT3 C;  3KG2 A;  5BR8 O;  4K3A A;  3OMN B;  3Q4H A;  1LR1 A;  3OEE G;  3TXQ A;  1CPY A;  1F4N A;  2K9P A;  5J2U B;  4JI2 O;  4FZ1 A;  2ZR2 A;  4PDM A;  1AP6 A;  4ZKI A;  4BR6 A;  4B3S O;  1WAZ A;  2CGO A;  3RWR D;  2QM8 A;  1VF5 B;  1IBM B;  4QGP A;  4UCU A;  5E1A C;  5CBG A;  5EZY A;  1NQT A;  1LUW A;  1YXB A;  2VWK A;  1K5Q A;  1RM1 C;  2IW5 A;  4BWA A;  3FB5 C;  3ZX6 A;  1IDS A;  3KCX A;  2Y4U A;  1ZLZ A;  1LNQ A;  2IH1 C;  3A0B Z;  3SR2 C;  4ZHQ B;  5ITZ A;  2QWO B;  1K4D C;  3JAW B;  4FLZ A;  4NXN B;  2DQ0 A;  3OAA G;  5JQG B;  2DWE C;  2F4V B;  2JIZ G;  1I08 A;  4DR4 O;  4IIJ A;  1SET A;  3OUS A;  2Q0A A;  2XAQ A;  5IJ9 A;  4I7Z B;  3OR6 C;  1EN5 A;  2OYQ A;  5KA6 A;  1I5X A;  4DR7 O;  1W59 A;  2CTP A;  1T5E A;  1KUQ A;  5KMG B;  4CH4 A;  4LF9 B;  1K92 A;  4PJ0 Z;  1G8M A;  2JGD B;  4X1I B;  5FL7 G;  4B3R O;  4GLX A;  1SZT A;  4GYC B;  5JJE B;  4DV3 B;  4GX2 A;  3CCE V;  1ORQ C;  2BE3 A;  1YVW A;  5IWA B;  2Q8V A;  2E76 B;  2CTR A;  5IYB O;  1KD1 W;  1B3Q A;  1GH6 A;  4YY3 O;  4JAA A;  2QEX V;  3ETQ A;  3BA9 A;  1GKF A;  2YXL A;  4O4L B;  4TV8 B;  4X1Y B;  3AEI A;  2Q69 A;  3WB2 A;  2VQE O;  3T1Y B;  4LH6 A;  4CH6 A;  2GTS A;  3AK3 A;  3CX5 F;  2XAS A;  4PDL A;  2Q67 A;  4CS4 A;  4YJ3 A;  2IJJ A;  2YXH A;  1K7D A;  1I94 O;  3OT7 A;  4H13 B;  4I4T A;  1OCO B;  4JI5 B;  1DLB A;  4CBC A;  1N32 B;  4PA4 A;  3LSQ A;  4GKJ B;  2WLL A;  4AQY B;  5KLV H;  1OCZ B;  2JS5 A;  3RYI B;  4YIP A;  1SKV A;  1Y76 B;  3HKE A;  2P90 A;  2YIB D;  1R6T A;  4EKW A;  1R1B A;  1RPR A;  1N4C A;  3THO A;  3HKD B;  4ZOL B;  1WPB A;  2Q7G A;  3PJS K;  4LWS B;  1S76 D;  1PP9 H;  2RJZ A;  2OWO A;  5IJ9 B;  4JI4 O;  1BQZ A;  2UXB O;  1JPX A;  3ETD A;  1VQ9 V;  1R6K A;  3M7M X;  1J5E O;  4DR5 O;  1IBL O;  4LF5 B;  3SJA C;  3MD0 A;  4KFM A;  2RCV A;  4EB6 B;  2OIE A;  3P32 A;  2LFS A;  3H01 A;  4FFB A;  3B8M A;  3E8H A;  4PA3 A;  4KHP B;  3CCQ V;  3OGI B;  2IH3 C;  1AI5 A;  3HB3 B;  1N8R W;  4JI0 B;  3BVO A;  1IXB A;  2JK5 C;  1MOF A;  2ZE6 A;  4IYI A;  1OCO C;  1XMO O;  1ZAU A;  2JS3 A;  2YEV B;  4H44 B;  5KA5 A;  2EZO A;  4DR3 O;  4JYB A;  1YEW A;  4PA6 A;  1OCZ C;  4O4H A;  4W4L A;  3DSQ A;  3SJC C;  1UFI A;  2WA3 A;  1NH2 D;  1K8A W;  4GT1 A;  4HZ3 A;  3ZHV A;  1VQM V;  3JSN A;  1D2D A;  4J7Z A;  1K3E A;  4KUM A;  5A2Q N;  3KCY A;  5DED A;  3SYP A;  4P2Z A;  1ZTE A;  2F93 B;  3VQX A;  1BL8 A;  1N33 B;  5JVD B;  1Q82 W;  3T4D A;  4U3F H;  1URF A;  4P9O A;  3ASN B;  4E2L A;  4OXS A;  5IE9 A;  4MVS A;  3J81 N;  1NVP B;  2DN9 A;  1FXH A;  4OPH A;  1JMK C;  4I55 A;  1Q7Y W;  2IJI A;  1WLE A;  1EBO A;  3FAV B;  1S5J A;  4IGG A;  5BY1 A;  4X62 O;  4NTY A;  4TQD A;  4KL1 A;  4NB5 A;  5IDJ A;  4XDK A;  3D36 C;  3RW0 A;  2LO1 A;  4YJ2 A;  2UXC B;  1BE3 H;  3G6B A;  2VRZ A;  2PUS A;  3VQV A;  3RYF A;  4FFB B;  4FLU A;  5C8Y B;  2L6L A;  2QM4 A;  3JAL A;  3BA8 A;  2WLJ A;  4X20 B;  2LW1 A;  1GM8 A;  3CYO A;  1Q86 W;  3SYQ A;  4FFK A;  4I50 A;  4O2B B;  1GN6 A;  4QIW F;  3IFX A;  3K5L A;  2GV9 A;  5A9G A;  4DYL A;  1F51 A;  5IT9 N;  3DC6 A;  2HG5 C;  3ASN C;  1GMG A;  4LFB B;  4FM1 A;  4Z2W A;  2WLM A;  3CRC A;  5LYJ B;  1U97 A;  5EIB C;  2UUA O;  2BSK A;  3UT5 A;  1N34 B;  4F6E A;  1UPG A;  2DW4 A;  3JCU Z;  5BZB A;  4B7K A;  5KX5 B;  2OTL V;  3HR0 A;  3FX7 A;  2GDS A;  2GUZ B;  1M90 W;  2IM9 A;  3OMA B;  1AVM A;  2QM7 A;  1N36 O;  3CC4 V;  1FJG B;  4YIO A;  2ODM A;  4J80 A;  3FB8 C;  1WPX A;  4OGQ B;  4WBN A;  2ZM6 B;  1S5L Z;  2Q6A A;  3DXR A;  1QVG U;  2A7W A;  3VOU A;  2YUA A;  3CCV V;  1YIT V;  4UCO A;  1H2M A;  2AHY A;  3G4S V;  5LMN B;  3DGE A;  2QTO A;  1KYO F;  3BEH A;  4PA9 A;  3ZBH A;  1HNW B;  1Y4M A;  4LF8 O;  2QWP B;  1F4M A;  1VQO V;  4I50 B;  4ASU G;  1PPJ H;  1WP8 A;  2EIM B;  2KG7 A;  2HJF C;  4DR2 B;  3M8A A;  5LXT B;  3KZI Z;  2Y4T A;  1P49 A;  4HNA B;  2EJR A;  4UB6 Z;  4FLY A;  4MTG A;  3JSL A;  1HNX O;  1RSO B;  1Q90 D;  3ZRW B;  4D7S A;  2BSK B;  2P4V A;  4GX5 A;  4TWK A;  4B3T O;  3L9D A;  1JFF A;  3LUT B;  5GON B;  3ZHR A;  1PD3 A;  1MSD A;  3K79 A;  2PY5 A;  3AG1 B;  2ZNJ A;  2PF4 E;  4B08 A;  2NNU A;  2W0F C;  4IL6 Z;  4QPJ A;  1G6U A;  1H2S B;  3AG7 A;  1IBK B;  4MTX A;  1NU1 H;  1XMQ O;  1H2N A;  1SQF A;  1NTM H;  3JAT B;  2WLI B;  3K9S A;  4EFB A;  3JD1 A;  3OW2 U;  2P22 C;  3SPJ A;  1THZ A;  5JCO C;  2ADQ B;  1VF7 A;  1IUR A;  3N2G A;  4RWU A;  4JI7 B;  2A06 H;  5JWP A;  3QF7 A;  3TK1 A;  1HWY A;  1QU7 A;  1BZK A;  2EIM C;  1VF6 A;  5H6Q A;  5CB4 A;  1BHA A;  1BS3 A;  3D3I A;  2UUB O;  4JI8 B;  1GAX A;  2BTQ B;  1BMF G;  1SQQ H;  5L3B A;  3T1C A;  2ZKO A;  2EZP A;  1SQG A;  5FNV B;  4DUY B;  3IJ4 A;  1PV0 A;  1ZL8 A;  1VEW A;  1GN2 A;  2ZIM A;  4TV9 B;  3AG1 C;  3E86 A;  1AP5 A;  4PV1 B;  1FFX A;  3VQW A;  4PDV A;  1I5Y A;  4LFC O;  1OHH G;  4GUN A;  4X66 O;  3K9A A;  3ZRS A;  1BGY H;  3O65 A;  3ZCC A;  2ADP A;  5TIS Z;  4DV4 O;  4DV6 O;  4OX9 O;  1JCH A;  1NR7 A;  1SQV H;  4B3R B;  4LFA O;  2ZR3 A;  3CCR V;  4FLW A;  4RUE A;  1QHT A;  1MAB G;  3F5W C;  1BSM A;  4MVO A;  4JGS A;  4JZG A;  5EBM C;  1KQS U;  4LF6 O;  2MW2 B;  3CJH B;  2JRI A;  1SA0 B;  2XHB A;  5LGU A;  5LL6 Y;  2WLH A;  3K06 A;  5JH7 B;  1B06 A;  1FPO A;  3ZMT A;  2A9H A;  2Y0I A;  4DRX A;  1B6Q A;  3WB0 A;  1RPO A;  5LP6 A;  3VQY A;  2N05 A;  5L3D A;  4MT8 A;  2OCH A;  1TVK B;  3S3W A;  1Q5O A;  1Q6U A;  4JAU A;  2NN4 A;  3W7W A;  4DW0 A;  1XEQ A;  2AGA A;  5BMV B;  1Y74 B;  3FB6 C;  1XL6 A;  2DMX A;  4P30 A;  1ROP A;  1Y66 A;  1Q3E A;  4DV1 B;  2LP7 A;  1ZL8 B;  1Z5W A;  1GTO A;  4KP4 A;  4DR6 B;  5GTH Z;  1VAR A;  3D8C A;  2CGN A;  4RAI A;  4JI6 O;  3ABL B;  1ZSP A;  4DK1 A;  4JI4 B;  3SPG A;  5IYZ B;  1MNG A;  4LF4 O;  2UXB B;  2AHZ A;  4WFF A;  1CXZ B;  2YSU B;  3I5D A;  4DR5 B;  3OMI B;  3W7U A;  1MMM A;  3L71 H;  1XNQ O;  4B3M O;  4JI1 B;  1P7G A;  3TJT A;  3E22 B;  5CA0 B;  2LGW A;  4FIP C;  2ZDI A;  3BCC H;  4O4I A;  3HKC A;  4J42 A;  3JAR B;  2DJV A;  4RUF A;  2QSA A;  5B1A B;  1SC5 B;  1XMO B;  2EIK B;  2WSS G;  1R3L C;  1VIB A;  2B1I A;  1ZX3 A;  3JAK A;  1R3I C;  3EHB B;  2QKC A;  5EYP A;  2QGN A;  5CA3 A;  2HLD G;  1VQ8 V;  1NKD A;  1V54 B;  1F7Y A;  1YTF B;  1NT2 B;  3G80 A;  1I0H A;  4QJF B;  3ABL C;  4XDJ A;  2FTK A;  5LGN A;  3ZHU A;  3JAM N;  4TSF G;  1OCR B;  3H1J H;  3N2K B;  1J95 A;  1G4Y B;  1MSW D;  4R50 A;  1NVP D;  2EUL A;  1GM7 A;  5EIB D;  3Q4H B;  2XTA A;  3LSS A;  1QQC A;  2P06 A;  1AB3 A;  1V9P A;  3C90 A;  3EXA A;  2RQ6 A;  5EC2 C;  2JJ2 G;  4RQE A;  5FLX N;  3I55 V;  2ZIO A;  4UV8 A;  5B1A C;  3BY6 A;  3CEI A;  3QG5 A;  4RO2 A;  1TUB A;  2EIK C;  4JZ2 A;  5EZY B;  4CC6 A;  3QNE A;  2UU9 B;  2IJK A;  4LR3 A;  3CRQ A;  3R66 A;  5GW7 A;  1AJN A;  1V54 C;  3MHS C;  2N04 A;  2ITC C;  2UXX A;  2HHH O;  1IXM A;  3APQ A;  4DV7 O;  3BFR A;  4CS3 A;  1IZ3 A;  1XNR B;  2X6A A;  2ETN A;  2FYU H;  3SJB C;  1HDJ A;  1AR4 A;  2OCC B;  3H1K H;  1OCR C;  4IHJ A;  4PI0 A;  4UVA A;  5ITZ B;  3CRA A;  4TUY A;  4NXM B;  2N74 A;  2PYL A;  4LF7 O;  2Y48 A;  3X2Q B;  2O57 A;  2ATK C;  4IIJ B;  2GBO A;  4LNU A;  5KAI Z;  1EFR G;  3K57 A;  3CME V;  3CRR A;  4GKK B;  4MVZ A;  3JD2 A;  2QA4 V;  2XAJ A;  1OZ0 A;  2EIL B;  3OEH G;  4I9W A;  2ZCE A;  5CBF A;  4DK0 A;  1JVM A;  5IYD O;  2W0X A;  2PGG A;  3AG2 B;  1XI1 A;  2ZD9 A;  1GN4 A;  5B3S B;  3H9V A;  3KKY A;  1NJI W;  1BT8 A;  1XHZ A;  2V4D A;  4FZ0 A;  1N36 B;  3TGU H;  4U3J A;  2AZ2 A;  2LJ2 A;  3CE2 A;  2X6C A;  4F6R A;  4EEQ A;  3CXC U;  1M4U A;  1FYJ A;  3ZMS A;  1OCC B;  1NTZ H;  1IBM O;  4FPP A;  2HR3 A;  1US6 A;  3B77 A;  4DV2 O;  1F23 A;  3H1L H;  3MAQ A;  1SQP H;  2OTJ V;  2F66 C;  1M5I A;  3OR7 C;  1Q8I A;  2OCC C;  2EX3 A;  4JAV A;  2YS8 A;  4R7C A;  1D5N A;  3LDC A;  4NVP A;  1L1F A;  3CCS V;  4YJ3 B;  3X2Q C;  4JF3 A;  5J2T A;  5B1O A;  1VQ6 V;  5EBW C;  1KP3 A;  4I4T B;  2F23 A;  4NR1 A;  3WG7 B;  4G27 B;  1HP8 A;  4LH7 A;  1JR9 A;  3CPW U;  2XAH A;  1M56 B;  1DGS A;  2ZT9 B;  1MG1 A;  2EIL C;  2WLL B;  2YIB A;  4NXN O;  3ML0 A;  2F4V O;  1KBH A;  3JAS A;  3STL C;  4JYA B;  3HKE B;  3AG2 C;  2UXD B;  2X0L A;  4K8X A;  5B3S C;  3K08 A;  3J80 N;  4LBE C;  4X88 A;  3G71 V;  4YHH B;  1YHQ V;  4K0K B;  4GX1 A;  4I0X A;  2GSM B;  5CN0 A;  4LF9 O;  4DV5 O;  1OCC C;  4PI2 A;  4J7K A;  5C93 A;  3DC5 A;  4AI8 A;  3NR7 A;  2JEU A;  4J41 A;  4JTA B;  3L74 H;  2EJ7 A;  1QR9 A;  4DV3 O;  1FAF A;  3J7A U;  5H9C A;  4P9P A;  1DF4 A;  4ZI7 A;  5IYC O;  1JX9 A;  3S3X A;  3LDD A;  5IJ0 A;  1QCE A;  2QJ1 A;  2WAM A;  3B09 A;  3RYC A;  1VQN V;  3WG7 C;  1EN4 A;  3LSU A;  3T1Y O;  4MVR A;  5K1P A;  4JV5 B;  1M56 C;  4UCR A;  4YXW G;  4H37 A;  1MA1 A;  4O4H B;  2UXN A;  4X89 A;  3I56 V;  2YDE A;  4JI5 O;  3G6E V;  1N32 O;  2ILM A;  2DYS B;  5EC1 C;  3K58 A;  4JYY A;  1N0J A;  4X64 B;  4AQY O;  3U11 A;  3B8N A;  4DW1 A;  3E8F A;  4UV9 A;  1NS1 A;  2HFE C;  2QE7 G;  4Z1M G;  1N0N A;  4JI3 B;  1YZB A;  2KB1 A;  1UJW B;  4EFE A;  5J9P C;  1NTK H;  4WFG A;  3JAS B;  3U10 A;  5CA1 A;  2HJD A;  2CDY A;  4LC1 A;  1TGO A;  1Q81 W;  2Y0P A;  2EBO A;  4I55 B;  2ZE8 A;  1RP3 B;  4WFE A;  3AK2 A;  3CD6 V;  1L8D A;  3UKM A;  3W7X A;  2E3C A;  4LF5 O;  4YJ2 B;  2UUC B;  2JVD A;  1Y67 A;  2EIJ B;  4LFA B;  2M6Y A;  3TET A;  2WWW A;  4KHP O;  3L70 H;  3RYF B;  2VQF O;  2ZNI A;  3OE7 G;  1I7F A;  4JI0 O;  2XOK G;  4O4J A;  4GZR B;  3RYH A;  4JPR A;  1YJW V;  2QDO A;  1HNZ O;  4R8C A;  3GB7 C;  1XRE A;  3JAL B;  1FXK A;  3FB7 C;  1WNS A;  2DYS C;  4BIZ A;  4PHZ A;  3OTO B;  4DUZ O;  1P7B A;  1IX9 A;  2DQ3 A;  2CAZ C;  3MDS A;  1VQ5 V;  4JAS A;  3E89 A;  3K5O A;  1L0L H;  4LP8 A;  1NI8 A;  3K03 A;  3ZMV A;  3F7V C;  5LOV A;  3JD4 A;  3UT5 B;  4WFB V;  4UXN A;  1N33 O;  2IU3 A;  2YI9 A;  4DR1 O;  4J10 A;  3E8B A;  5BR8 B;  3HKB A;  1WA8 A;  1S77 D;  4X1K A;  1YF2 A;  1KMI Z;  2EIJ C;  3W7S A;  1O9G A;  2DOS A;  2P6J A;  2M7W A;  3B4S A;  2PI4 A;  5LHG A;  4JI2 B;  1A32 A;  1MZE A;  3A2F A;  4B3S B;  4JTC B;  1XNQ B;  2YXY A;  2UXC O;  1O9H A;  2AZ0 A;  4UCV A;  5JJJ B;  2R9R B;  1H8H G;  2QKA A;  4WBN B;  1AJQ A;  1CEZ A;  5F2V O;  3DXR B;  4BIU A;  2BTO A;  1PNM A;  3ZN1 A;  4FVM A;  5AG2 A;  4BIO A;  3VBB A;  4U7N A;  3BPZ A;  2CTQ A;  1Q6H A;  5GTI Z;  3BAA A;  4O4J B;  3ZED A;  1JJ2 U;  5KHG A;  3UCS C;  3ETE A;  3JYC A;  2R9I A;  3AG3 B;  3P3N A;  4UB8 Z;  1GM9 A;  3D3Q A;  1P84 F;  1M57 B;  2ZE5 A;  1E1R G;  3M99 B;  1JJO A;  4TT3 G;  4DR4 B;  5KUM A;  1AR1 B;  1SF9 A;  2F1M A;  1YTF D;  2V1D A;  1FD9 A;  2KG7 B;  3ZMZ A;  2KKW A;  1YCI A;  3CC2 V;  3GWO A;  3CSX A;  1W2B U;  2YID A;  4DR7 B;  2CH7 A;  1NR1 A;  1XDC A;  2HEP A;  5CBH A;  3LNN A;  1EN6 A;  1H8E G;  3K0G A;  1JFF B;  3JD0 A;  1M93 A;  2RN9 A;  2GHY A;  5DM6 V;  4BW5 A;  5E79 Z;  5J2U A;  3UO3 A;  5KHJ A;  3OD4 A;  1WB8 A;  4PEL A;  4N21 A;  4XBF A;  3T1H O;  2BOC C;  3H1H H;  1JQ0 A;  3SYA A;  1HR0 O;  2HP8 A;  2CK3 G;  5L3E A;  4YY3 B;  3E83 A;  1FJG O;  4MVM A;  4FLX A;  2ZM6 O;  3AG3 C;  1M1K W;  5BXZ A;  1XUQ A;  2VQE B;  1M57 C;  1COW G;  2XT9 A;  4C7U A;  4X9Q A;  2OIG A;  3CWB H;  3FYI B;  4FMT A;  3N2G B;  1FXV A;  3ABK B;  1I94 B;  3ABU A;  1TUE B;  4I9Q A;  5B1B B;  4FLT A;  5CB4 B;  2RDC A;  1WN7 A;  1S72 V;  3K59 A;  2Q7E A;  3SJQ C;  3JAW A;  2H94 A;  5KHK A;  5JQG A;  3CP1 A;  1XBL A;  5B66 Z;  3C3T A;  3ZRX A;  2YIC A;  5D5Q A;  2PYJ A;  2X6B A;  2FL4 A;  3L72 H;  2AXT Z;  2Q73 A;  2B1G A;  5KMG A;  3BAB A;  1R3J C;  4ZBM A;  3ZMU A;  3N27 A;  5DEC A;  5L3G A;  2JGD A;  1FFX B;  4D6T H;  4WCE V;  1J5E B;  3STZ C;  1IBL B;  1QBZ A;  3EFF K;  3IGA C;  2KQX A;  1K34 A;  4DV0 O;  2YI8 A;  1QVF U;  3CRM A;  2QTS A;  2XUM A;  4G28 B;  3ETG A;  2JDI G;  1ENV A;  4WFA V;  1IBK O;  1AR5 A;  3ABK C;  1R73 A;  4O4L A;  4TV8 A;  4X1Y A;  5B1B C;  4WF9 V;  1GO3 F;  1VF6 C;  3TXS A;  4DV2 B;  4J11 A;  5EK0 A;  3GVM A;  4DR3 B;  3AK1 A;  1PNK A;  1NBM G;  1VQ7 V;  1H2L A;  4UVB A;  4DO2 A;  2Q68 A;  4JI7 O;  3SGI A;  3SPH A;  4DRX B;  5B5E Z;  1P4R A;  3H1I H;  5LP6 B;  4JI8 O;  2QKS A;  3K3W A;  3RYI A;  1Y76 A;  1ZWI C;  3RGB A;  2Y69 B;  3NXS A;  3HKD A;  4ZOL A;  4DUY O;  1YJ9 V;  3LNM B;  4LWS A;  2JJ1 G;  1AI4 A;  4I5S A;  4MTO A;  4DXW A;  3CCL V;  1AI7 A;  4UFZ A;  3OFN G;  2BCC H;  2R9A A;  1XIL A;  4W4K A;  2NR5 A;  2ZXW B;  4PDR A;  4X62 B;  4O2A A;  3P30 A;  1G1X B;  3ZHQ A;  4DV5 B;  4EB6 A;  1S5H C;  1Q6I A;  3CB2 A;  1PL4 A;  3ZS8 C;  2NLJ C;  4IT5 A;  3K04 A;  1QR8 A;  1KC8 W;  2ZQM A;  2GTA A;  4JYC A;  3D36 A;  3ZJZ A;  2IU0 A;  2ZIN A;  4O4I B;  3HKC B;  3ZRV A;  1AJP A;  1K33 A;  2YEV A;  3QVN A;  3SYC A;  1EM1 A;  5LP6 C;  3K5M A;  1K9M W;  3WU2 Z;  2P4K A;  4R6Z A;  3RFR A;  4HBN A;  2PI5 A;  3F7Y C;  1KKD A;  3ABT A;  5KHH A;  4X65 O;  3JAK B;  2Y69 C;  3QTC A;  5EYP B;  3K0D A;  4GX0 A;  1HW7 A;  3E35 A;  3ZHT A;  4AHC A;  4FM0 A;  1WP7 A;  3SPI A;  3SPC A;  1VQL V;  1E1Q G;  2UUA B;  2QWR B;  2E5L O;  5HFL A;  5JVD A;  2ZXW C;  1EZJ A;  4WFH A;  3IC9 A;  4F4L A;  5LMU O;  5H5N A;  2AW9 A;  2R72 A;  2C2A A;  5LA6 A;  3GWK C;  1JOY A;  3UO2 A;  4DV1 O;  3ZN0 A;  3FAV A;  2DE0 X;  3JD3 A;  4DR6 O;  3RN4 A;  1RFY A;  4NTW A;  1PL0 A;  1KKC A;  3CCM V;  2ZDI C;  2EIN B;  3OGC C;  5EBL C;  2CUG A;  4O2A B;  5KHI A;  1K97 A;  1SS3 A;  4H0L B;  4A5U B;  4JI1 O;  1GK9 A;  1TUB B;  1S0V A;  1W0J G;  5C8Y A;  4ABM A;  3U0Z A;  2VQF B;  1BQ0 A;  2Q5Z A;  4CS2 A;  2HKO A;  4X20 A;  3EVK A;  1HNZ B;  2X7R B;  2LFR A;  4CH5 A;  4LF8 B;  2JEX A;  4O2B A;  4NYK A;  3R65 A;  1ARO P;  3FYE B;  4NKG B;  3ABM B;  2F95 B;  4UCS A;  3C3S A;  4OPA A;  4DUZ B;  5LYJ A;  4IHJ B;  2DYR B;  1MZF A;  1XL4 A;  4NTX A;  3IAY A;  4TUY B;  2A3Q A;  3WB1 A;  2E75 B;  3CC7 V;  3TCU A;  4TOI A;  2G38 A;  2LQT A;  4L8J A; 
#chains in the Genus database with same CATH homology
 3H1K H;  1P84 F;  3H1L H;  3H1I H;  1SQB H;  3L75 H;  1SQP H;  3CX5 F;  1KYO F;  1SQX H;  1BGY H;  2A06 H;  2BCC H;  1KB9 F;  3L70 H;  1L0N H;  3L72 H;  4U3F H;  4D6T H;  1BE3 H;  1SQV H;  3L71 H;  5KLV H;  1PP9 H;  1L0L H;  3L73 H;  1BCC H;  3H1J H;  3TGU H;  1NU1 H;  1EZV H;  3CWB H;  3L74 H;  4PD4 F;  1NTM H;  2FYU H;  3H1H H;  1SQQ H;  3BCC H;  2IBZ H;  1NTZ H;  1NTK H;  1PPJ H;  3CXH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...