3CXHF

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 28
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cxhF00
3H1HH 4D6TH 3BCCH 3L71H 3CWBH 3H1IH 3L73H 1SQBH 1BE3H 3L72H 1SQXH 1EZVH 3L75H 1BGYH 3CXHF 3H1JH 1SQPH 1SQQH 1SQVH 1PP9H 3TGUH 1L0NH 2BCCH 4PD4F 1PPJH 1NU1H 1KYOF 3H1KH 5KLVH 1P84F 1NTKH 2IBZH 3L70H 1L0LH 2FYUH 1BCCH 4U3FH 3H1LH 1KB9F 3CX5F 2A06H 1NTZH 1NTMH 3L74H
chains in the Genus database with same CATH superfamily
4X20A 2YC0A 3G6EV 3WG7C 2HKOA 2F4VO 3SYCA 1TVKA 1QHTA 1YIJV 3HKCA 4JYAO 3C3TA 3P32A 4X65B 2QE7G 2X0LA 3CRMA 3CYOA 4I55A 3W7UA 5EC1C 2KQXA 3E2EA 4LBEC 1KP3A 4NXMB 2CDYA 2Q7GA 3ZHTA 2HHHB 1VQNV 3L75H 1DF5A 4W4KA 4J42A 2W0FC 3CC4V 2LGQA 4B3MB 1GN6A 1ZL8A 1FAFA 2CTPA 1R6NA 3WU2Z 2VQEO 3AG1B 4DW0A 2YUAA 5HFMA 1P7GA 3ZRSA 4MVRA 5BR8B 3J7AU 1THZA 3JARA 4IIJB 5L3FA 3JSLA 3L73H 4OX9O 4ICGA 2R9RB 1LUVA 3X2QB 4D7SA 1XHXA 1U97A 2GTSA 1Q86W 3RYHA 2E76B 4WCEV 2JDIG 2OCCB 1B04A 4I7ZB 3P3PA 4CS2A 1NQTA 3DSQA 3QO5A 4KUMA 3FYIB 4PA3A 4XBFA 3H1IH 5BMVA 4LH6A 4I4TA 4X1KA 1Q5OA 3FYEB 4I50A 3OW2U 1SRYA 4JGSA 3T2MA 2P90A 1SA0A 2DW4A 3RW0A 4DR4O 2F4VB 5EBWC 1SETA 1DGSA 4MSWC 4WFFA 1EZVH 4U3JB 5JH7B 1VQ9V 3MD0A 4LR3A 1H2GA 3ZHQA 2HG5C 2QWOB 2Q67A 2DMXA 1QR8A 3RYCA 4GX0A 4JYAB 2BOCC 1BL8A 4IHJA 4XDKA 1EN4A 5CA0A 1XI1A 3ZBHA 2EX3A 1PNKA 4CC5A 4JI4B 5BY1A 1RSOB 3WB1A 3CSXA 1NI8A 2IH1C 1KQSU 4NXNO 1LUWA 2UXCB 3X2QC 1FD9A 4YY3B 2Q69A 1JMKC 5IYBO 3KCXA 3AEIA 1AR5A 5EYPA 4QJFB 5J2TB 5JJJB 3T4ZA 3B8MA 2PY5A 5IY5B 3TK1A 1ZLZA 2GHYA 5LMNB 1BCCH 2V7QG 3ABTA 1GAXA 5CB4B 3OT7A 3ZMZA 2V4DA 2IJIA 1AP5A 5KHHA 3JALA 4H13B 4H33A 1Q90D 2N04A 3ETEA 4C7UA 1F7YA 1V55B 5B3SB 3D3QA 1M5IA 2QKCA 1AVMA 2Q73A 5BZBA 2LJ2A 2XASA 2A7WA 4DV0B 3G67A 1MSDA 2Q7EA 5GTHZ 2P5OA 3RWRD 3IFXA 4PA9A 2JIZG 5JCOA 1JJ2U 3N2GA 2Z3YA 2Q0AA 1R3LC 5A2QN 1N0JA 5B66Z 4YHHO 2ZE8A 1Q8IA 4FLUA 4LF9O 1K33A 1NS1A 3ABMC 3N27A 4LFCB 1BS3A 1IZ3A 4MTXA 1XNRO 1Z5WA 4DR7O 3SJCC 4X1IB 4R8CA 5IDJA 1GKFA 5CBFA 2GBOA 4FLWA 3FB5C 1KUQA 2F43G 4X66O 3K57A 3RGBA 3HKCB 2RDCA 1K4CC 2QKSA 1KMIZ 2UXNA 2B1IA 3CCQV 3UCSC 4K8XA 1X59A 4R6ZA 2HVJC 4EEQA 3BY6A 3APQA 1VEWA 1TGOA 3B4SA 3OEEG 4O2AA 1P84F 3K59A 1Q6IA 3RN4A 4HAMA 1HNXB 4DUYO 3RT3C 2XOKG 5CA1A 2UUBB 1BMFG 3CCVV 4DV1B 1SQQH 3WB2A 2JS3A 4W4LA 4PJ0Z 4GZRB 5BMVB 1RM1C 1O9GA 3JARB 4H44B 1Y6XA 1VARA 3HKEB 5LXTA 3CS5A 1AP6A 1Z5VA 4LF5O 1R73A 3OFNG 3ZMSA 4I9QA 1K73W 1NTZH 4X88A 1YJWV 1QBZA 1YJNV 1WAZA 5H2FZ 2OYQA 1SQBH 3I56V 1MZEA 4F6EA 5IWAO 1SA0B 4NYKA 1MOFA 4JI1B 3RVYA 2AHZA 2IU3A 1VMGA 5B1OA 2IU0A 5CN0A 1QVGU 3LDCA 1PNLA 3OTOB 4GYCB 3W7WA 4NXMO 2HFEC 4LWSB 3OD4A 3K03A 2LW7A 3JATA 2YI9A 1G4YB 1HP8A 3CE2A 3HR0A 1K7DA 1RSOA 4P30A 1SZXA 4YJ3A 1G8MA 2W6IG 3VOUA 1WB8A 2Y69C 3K3WA 4DV2B 2AGAA 4WFEA 1JPXA 1XBLA 3JAKA 3IC7A 4B08A 4MW3A 5KUKA 2ZD9A 2NN4A 1XUQA 2YI8A 3DC5A 4H0LB 4UVCA 2VQFO 1YDXA 5CA0B 4EB6B 4O2BB 3ABMB 3ETDA 4JI8B 3OTOO 3H1LH 1H8HG 4Z2WA 1IVSA 5LMNO 2K1EA 4BIUA 1I5YA 3UKMA 4K8ZA 3U10A 3CRQA 1JJOA 2ZR3A 3OM3B 4O4IB 4JI5B 3ABLC 4JI2O 5KLVH 2ZQMA 4CC6A 4DR1O 1US6A 1F23A 5LA6B 2RQ6A 5DEDA 2P6JA 4PV1B 2EJ7A 1JCHA 1SKVA 5JQGB 4QE9A 4DUZO 1AJPA 1N33O 2K9PA 2YIBD 3AG2C 1W0JG 4E4EA 1R6KA 4GLXA 2WLMA 1SF9A 4DV6B 1FFXB 4LCUC 2ZM6O 1PPJH 5LMUO 4B3RB 3Q4HA 2EULA 5KHJA 4XDLA 4RAIA 5J2UB 2IH3C 2OIGA 2LGWA 4DV5B 4DYLA 1FYJA 2UUAO 3CD6V 4DV6O 5LYJB 2EIMC 3S3XA 2Q8VA 2X7RB 4CH3A 5L3BA 1KBHA 1GM8A 1COWG 3UT5A 4GUNA 4LH7A 1YCIA 4DR6B 1EZJA 5KA5A 1R3JC 2ARHA 4TV9A 1H2LA 4BIZA 5IYZA 1AI5A 3VQXA 4PA7A 2E5LO 4CZZA 4LFBO 4KL1A 3C3SA 4LP8A 2XT9A 4LFAB 1ZWIC 1NT2B 5E79Z 1D2DA 2ITDC 4JTDB 4NB5A 2H94A 3SJQC 5LOVB 2XAHA 4PA6A 1J5EO 2B1GA 3GWOA 2IBZH 1WJZA 1N32O 1XNQB 1VQ7V 3DTUB 2WAMA 2HJFC 1XQ8A 1XMQO 3JD1A 1S5JA 4R50A 1M56B 1NR7A 4CBCA 4CS4A 3JD3A 4P9PA 4DR7B 3OEHG 2BCCH 2ZXWC 3UM7A 1VQOV 3FB7C 5CA1B 3HB3B 2VWKA 4K0KB 4X1YB 4WFGA 1KB9F 2X6BA 2QM8A 4TT3G 5JVDA 2UXXA 3IGAC 2UUCO 3OE7G 2PYLA 2Q6AA 3L72H 4LF6B 3MHSC 4OXSA 4DV7O 4DK1A 1I0HA 3B2EE 4LWSA 3S3WA 4GX1A 3QG5A 4UCRA 3A2FA 4DUZB 3WFVA 4IYIA 1YVWA 2PUSA 2L6LA 1HW7A 4JYYA 3NR7A 5LOVA 4JI0O 3ZMTA 2FMLA 4B3TO 3VQWA 3PJSK 1AI4A 4WBNA 2JVDA 3JASA 2GUZA 1DF4A 3N2KB 1IBMO 1RPRA 5C8YA 1OCOB 4PHZA 1YHQV 5IJ9A 3SYAA 3VQYA 2ZCEA 2F95B 3CCUV 2RN9A 4ZBMA 1QLEB 1FXVA 3J80N 5EIBD 4PDVA 3JAWA 2AZ0A 2N05A 1UJWB 3A0BZ 1PP9H 2VQFB 1Q82W 2O57A 3LNNA 2A79B 4PDLA 1B6QA 5EIBC 3VBBA 3SYPA 4UUJC 1MSWD 4I0XB 2WLHA 2QWRB 4O4LA 2CK3G 2LQTA 3A8TA 2JEUA 1T5EA 2WA4A 2Q7HA 3H01A 2EIJB 4TSFG 1HWYA 3CPWU 2H8PC 2UXDO 1PL4A 2W0XA 2EZPA 3SPIA 2YICA 4HYOA 5C93A 1XMQB 3ETGA 2YS8A 3NXSA 3G71V 1KP2A 5IJ9B 5JQGA 4FPPA 2ZT9B 1NH2B 4D7TA 4UB6Z 3KG2A 4EFEA 1F51A 4LNUA 4J41A 1JFFA 2LO1A 3SPHA 2XTAA 4QNHB 3E22B 1CP9A 4DV5O 4MTGA 5JJEB 2GDSA 2YDEA 2E75B 2ZNJA 1Y76A 1S77D 1I5XA 2XAQA 4DV0O 3BEHA 2FB5A 3JD0A 1TUEB 3AG7A 4TV9B 1OHHG 2ZE6A 1NKDA 1QLNA 1EN5A 3G4SV 1NR1A 1R3KC 2WLLB 1XL6A 1M93A 4HZ3A 2VRZA 3SR2C 3H1HH 5CMUA 3UT5B 1BZKA 4AI8A 4FLVA 1H2SB 2IJJA 1AR1B 3T1HO 4J9ZB 3EFFK 1TUBB 2YIDA 3OR6C 4J7ZA 3IC9A 2ZE7A 2M7WA 3A0HZ 2B5UA 2Q0OC 1CXZB 1YF2A 1JOYA 3AG3C 2WSSG 1MNGA 3T4DA 4X62O 3CB2A 2BTOA 4UCSA 1KKDA 1VQ5V 2XHBA 2FTKA 1N33B 2QDOA 4G2KA 1XMOO 3I55V 1XNRB 3O9OA 4CS3A 5E1AC 4DR1B 3WB0A 3LSQA 3K04A 2ODMA 5BXZA 1VQ4V 2KB1A 3F7YC 1HNZB 4MTOA 4B3SO 3CHXA 2BSKA 4F6RB 4BIOA 3KZIZ 2JEXA 2FL4A 4X1YA 4ZKIA 1A32A 1N36O 4UCVA 4NTYA 3K5OA 3M99B 1VQKV 4DR3O 1XREA 5LHIA 1BQZA 4G27B 2ETNA 4RUEA 4LF5B 2DOSA 3AG3B 2E5LB 3CCEV 4LFBB 3IAYA 3RVZA 4ABMA 4F4LA 5LHGA 1JR9A 4DR4B 3G6BA 5B5EZ 1VQLV 5C8YB 2WLJA 4MVUA 3ASOB 3E8GA 1AILA 4ZHQB 1FXKC 3QNEA 1SQVH 1K9MW 1L0NH 2D3OW 3CMEV 3AK1A 2DWEC 4LF7O 4O4HB 4BW5A 3L70H 1VP7A 3HKDB 2ATKC 1Q3EA 3TJTA 2JGUA 1U96A 3OUFA 1Q81W 3Q4HB 2UXBB 2RJZA 4JTAB 4UVAA 4I0XA 3ABKC 4AILC 5AG2A 3RYFB 4X20B 1RFYA 5CB4A 2UXCO 2CGOA 1QCEA 1OCZC 4IYHA 3CXCU 3BVOA 3ZHVA 2B9ZA 4L8JA 2A9HA 3IJ4A 4OX9B 2UUBO 3CRAA 4LF7B 1K5SA 2ZIMA 1J95A 4MVMA 3GVMA 3OR7C 2RCVA 5J9PC 4WFAV 3EHBB 4WF9V 1SERA 5B1BC 2DQ3A 4LF4B 1OCZB 4JV5B 1NJIW 1TAEA 1EN6A 4X89A 1ZUQA 4CH6A 4FZ0A 1V9PA 4LNUB 1K4DC 2IJHA 3M7MX 2CTQA 4UCTA 4JI8O 3HKDA 1Y4MA 4PA4A 2YEVB 3F5TA 3BHPA 1HR0B 4FFKA 4QGPA 4X65O 1NZ6A 4B3SB 1Y76B 1DTOA 4JI3B 1IBKO 1K3EA 1N34B 4J7JA 5H6QA 3STZC 4KXRA 2W6JG 4JPRA 2PI4A 5IJ0A 5GW7A 3U0ZA 4LF9B 4K35A 3N2GB 4FFBB 4E2LA 4FIPC 5KAIZ 2R70A 3OUSA 2Z5UA 2PZSA 2A3QA 1LR1A 3ZMVA 2EBOA 5KAFZ 5LGNA 5KX5B 2QGNA 3BCCH 4AQYO 4O2AB 2CE4A 4JZGA 2VS0A 4KHPB 4DO2A 4FLZA 4RUFA 1IBKB 1PKXA 2UU9O 4YXWG 3FAVA 1JVMA 4X62B 1WA8B 3ZHRA 2EIKB 1OCRC 4U3JA 5FNVA 1IDSA 3DXRA 3CCLV 3PN1A 3ZX6A 1AB3A 1IXMA 4MVOA 1PD3A 3LSSA 1Y74A 1BGYH 1N4CA 3T1YO 5J2UA 3HKBB 4GX5A 1NH2D 4JI7B 3B09A 1FKAO 1IBLB 5FLXN 4NTWA 1F4MA 1B3QA 1KD1W 4JAUA 1G6UA 1GO3F 2QWNB 1D5AA 1I94B 2AW9A 2HLDG 1FXKB 3OGCC 1WLEA 4Z1MG 2ZXWB 3APOA 1XNQO 1V54C 4I55B 4QPKA 4P9OA 3K58A 2UU9B 1K5QA 3LNMB 2BSKB 4F6RA 3BABA 1P7BA 2F93B 3E86A 1O9HA 5L3DA 4UV9A 2AXTZ 5B1NA 4Q20A 1V54B 1GN4A 1S3JA 3CCMV 3JAKB 4UV8A 3O65A 2ADQB 2KSDA 3G80A 4FMTA 2UXDB 4MTFA 3JATB 4J80A 5LHHA 4UFZA 2LP7A 3ZN0A 1ZTEA 2P4VA 4WFHA 3T1HB 3K5MA 1MMMA 5KUMA 3LDDA 1AJQA 2E3CA 3K79A 2EIMB 1M9NA 4GKKO 3JSNA 3MDSA 1DLBA 1EFRG 1NTKH 4I5SA 1YTFD 1OCRB 3SDLA 2DQ0A 1R3IC 1FPOA 4O4IA 3OAAG 3RYFA 3L74H 5JJNB 2LW1A 1SESA 1WPXA 3B40A 3P30A 1RM1B 1ZSPA 2AHYA 3DC6A 4EFBA 3QF7A 1N36B 1JQ0A 1SC5B 3P3NA 5KHKA 3UO2A 5KHIA 4TUYB 2EJRA 4J11A 3CJHA 1EBOA 4KFMA 4NKGB 5JH7A 1FS0G 3EVKA 3R65A 1W2BU 2Y0IA 4TQDA 2ZIOA 4OPHA 1QR9A 4DK0A 5LA6A 2F23A 2OCHA 4IHJB 3SJAC 1URFA 2XAFA 4JI6O 4LF6O 4NTXA 4TV8A 4PD4F 1OJHA 1S76D 2MK3A 3CC7V 1VQ6V 1OCOC 3HPLC 4X64B 1E1RG 2H3OA 4JAVA 5FPRA 2QA4V 3QO8A 2UXBO 4K0KO 5EC2C 5JWPA 1ROPA 2QJ1A 3AG4C 1XOUA 4DV7B 1TA8A 4GX2A 2CH7B 3ZRWB 4HNAB 1Y67A 2HJDA 1PNMA 5H5NA 1Y66A 5IJ0B 1H2MA 4UVBA 1H38A 2JK5C 2PF4E 3OTFA 2DYSB 2Q5ZA 1MABG 2PTMA 3ML0A 4H37A 1M90W 2LFSA 4DRXB 4DR5B 5LP6C 3CJHB 3AK2A 2YXLA 5H6RA 3THOA 3E83A 1HNWB 1NU1H 4PDRA 1ZX3A 3H9VA 3DGEA 2HEPA 3ICXA 5EBMC 4N23A 4WFBV 4X66B 2FKXA 2YXHA 2F66C 3RYHB 2WPDG 5B3SC 1YXBA 2OWOA 5L3GA 3R66A 1IX9A 5K1PA 2GSMB 3BFRA 4N21A 4DR2O 3FD9A 3ZN1A 4YJ2A 4KP4A 3DXRB 3ETQA 3L9DA 1GK9A 4LF8O 2OT5A 1BT8A 1Z2GA 2P7TC 4QPJA 2NNUA 1HNWO 2CH7A 2BOBC 1M57C 1VIBA 3CMAV 3OMNB 4JI7O 4HNAA 3RBZA 2HVKC 5LGUA 1BE3H 3ASOC 2WLLA 1K97A 3BRCA 4DV1O 4MT8A 2LFRA 5LGTA 3STLC 2X6AA 3D36A 1SQFA 4MS2A 4GKJO 4L87A 4I4TB 1WP7A 2AZ2A 4BW9A 4WBNB 4UCUA 4X64O 2CTRA 2EIKC 3N2KA 3K5LA 5ITZA 3CWBH 4LF8B 4JI6B 2WLNA 3RFRA 1BHBA 3BA8A 5GTIZ 3FFQA 2JJ1G 4FLXA 4KHPO 2PI5A 5KMGB 1YJ9V 4U3FH 4K3AA 1FFXA 3CRCA 5EYPB 2YEVA 4U7OA 3ZIAG 1Q7YW 1N32B 3JASB 2DYRB 4O4JB 2JGDB 1OCCB 2GUZB 1AI7A 1P49A 2BE3A 2VWJA 1H2NA 3H1JH 1L1FA 3AG2B 3JCUZ 4JI3O 2Z0AA 4JI1O 4HBNA 1OCCC 2YIBA 4Z1VA 4ASUG 2WWWA 4A5UB 2QM4A 1M1KW 1GRJA 4ZIBA 1M57B 2KKWA 3CC2V 1I94O 2YIAA 2N74A 3ABLB 3SYQA 5J2TA 1KC8W 4ZI7B 2OCCC 2ZNIA 3W7XA 3SPGA 2P4KA 2L35A 4O4LB 2P06A 3GWKC 1NVPB 5CBGA 5LP6A 1GN2A 4ZHQA 4QIWF 3CCRV 1HDJA 3FAVB 3E8FA 5B1BB 1N0NA 4FM0A 4TUYA 1CEZA 4Q6GA 1R1BA 3QO7A 2F1MA 1E1QG 2IM9A 2RNBA 2PGGA 1H8EG 1J5EB 2GTAA 3K5NA 4U7NA 2ILMA 5CBHA 2NLJC 1GH6A 1NBMG 4MVSA 2Y69B 2DYSC 3TXQA 5DM6V 5IYDO 1QQCA 1K34A 4LFAO 1NTMH 3CCSV 1BSMA 1G1XB 4YIOA 4B3TB 2Y0PA 2HR3A 2G38A 3JYCA 1VF5B 3E89A 1IURA 3SPJA 5GONB 5JVDB 2JRIA 3JAMN 4P2ZA 3CRRA 2WLIB 1FXKA 1S5HC 1Q43A 1IBLO 2NR5A 3AG1C 5TISZ 1W59A 2VQEB 3CX5F 3I5DA 3JCZA 1TUBA 1YI2V 1HNXO 4LC1A 1Q6UA 2XNDG 4LFCO 4DV4O 2WLKA 4DV3B 1P4RA 2EIJC 2ZDIA 5KHGA 3E8HA 4DR5O 4DR3B 1SQGA 2CGNA 1HR0O 5IE9A 4YIPA 1GM7A 1XEQA 4DRXA 1SS3A 1YEWA 4JZ2A 2EINB 5HFLA 2UUCB 1VQPV 1VF7A 1HNZO 1QLEC 2YXYA 3ZHUA 2M6YA 1QU7A 3TGUH 4PELA 1B06A 3AG4B 3LUTB 2D2CB 4FLTA 1NVPD 4YHHB 2ZE5A 2CAZC 2EILC 3JAWB 2C2AA 3SJBC 1BHAA 4X9QA 1UPGA 4YJ2B 3OMIB 1GM9A 5IYCO 2KG7B 4AQYB 1WN7A 2WLIA 4JI5O 3T1CA 1VQMV 1RPOA 4TQFA 2EZOA 4PI2A 3UQ8A 1M4UA 4OGQB 1JX9A 1MA1A 3MHHC 4B7KA 1K8AW 2DE0X 2IW5A 4JAAA 1XDCA 1CPYA 3E8BA 3F7VC 3ZRXA 4YY3O 4GT1A 1MG1A 1PV0A 1VF6A 4YJ3B 2A0LA 4O4HA 3K9SA 3C90A 1YITV 1N8RW 1WA8A 5H9CA 3KKYA 3VQVA 2QSAA 1AR4A 5FNVB 2Y4UA 2YSUB 3K0GA 4TOIA 4PDMA 2JGDA 3RYIB 5EK0A 3JD2A 4B3RO 4IIJA 2PYJA 5ITZB 1FFTB 3BA9A 5KA6A 4EB6A 1OZ0A 1ENVA 2UUAB 4MVQA 1WB7A 2E74B 2X6CA 3SYOA 4FM1A 5LL6Y 4G28B 1XILA 2CUGA 3M8AA 4RQEA 1M56C 1VQ8V 3E22A 3QTCA 2Y4TA 1FJGO 4DV3O 3K9AA 2BTQB 5B1AB 4X1KB 1GMGA 4J10A 2OIEA 3D3IA 4O2BA 1AROP 3CP1A 4FJCC 2P22C 4J9YB 1EM1A 1XL4A 5LP6B 5A9GA 1JA8A 4BR6A 5CA3A 4NXNB 3H1KH 2XUMA 4TWKA 1ORQC 4ZI7A 3OGIB 3GB7C 1L0LH 2P67A 4MW8A 4GKJB 4JYCA 2QWPB 3K0DA 3K08A 1ZAUA 1SQXH 2XAGA 4GCZA 4EKWA 1F4NA 1SQPH 5EZYB 1Q6HA 1FXHA 4B3MO 1IXBA 2DYRC 1QNMA 4ZOLA 4DV2O 1W0KG 5F2VO 4CH4A 3MAQA 3FX7A 2HP8A 4IGGA 5LYJA 5IT9N 2DJVA 4FFBA 1XHZA 5LMUB 2JJ2G 3OMAB 3HKEA 1KKCA 3K06A 1WP8A 5LXTB 1KU9A 3KCYA 1GN3A 2QWQB 2BTQA 4DR2B 5LBQA 5FL7G 3U11A 4UXNA 5KX5A 3TCUA 4FK5C 3ZRVA 4AHCA 3ASNB 2FYUH 1TVKB 1V55C 2Q9LA 1KECA 2QTSA 3B77A 5GONA 4DW1A 3JALB 4FZ1A 3L71H 1WPBA 1ZL8B 3ABUA 4B7EA 4I9WA 4JASA 3EXAA 4OPAA 3FB8C 1S0VA 5D5PA 3QVNA 2R9AA 5BR8O 3B8NA 4JI2B 4JI4O 3FB6C 4BWAA 5FPOA 5IWAB 2JS5A 3W7TA 3ZCCA 5IY5C 4RO2A 3HKBA 5L3EA 4GKKB 1S5LZ 3LDEA 3ABKB 1SZTA 2R72A 5JCOC 1UFIA 3WG7B 4O4JA 2KG7A 3D36C 4FVMA 1BQ0A 1N34O 2ADPA 3JD4A 4JV5O 4RQFA 4I50B 3ZRWA 2OTLV 3F5WC 4X1IA 3LSUA 2DWDC 4MVZA 3ZHSA 3ZEDA 3TETA 1AI6A 5L3CA 3CCJV 4DV4B 1X4TA 1OV9A 2WA3A 4DUYB 1H2KA 3FKSG 4IL6Z 2OTJV 4J7KA 1YZBA 1PL0A 1S72V 3W7SA 1L8DA 3UO3A 4QE7A 3BPZA 4JYBA 2A06H 3ZJZA 1QVFU 2Q68A 1R6TA 2RMKB 3RYIA 1I7FA 1VF6C 1YSCA 1MZFA 2ZINA 3E35A 1AJNA 3A0RA 4IT5A 2R9IA 2CTWA 1IBMB 3J81N 4R7CA 3SPCA 3ZMUA 2QKAA 4DXWA 2QM7A 1RP3B 5DN6G 1D5NA 2QR4A 2Q4PA 4UB8Z 5B1AC 4JI0B 4FM2A 4NVPA 2DN9A 1DK1A 3ASNC 3RYCB 3SGIA 2V1DA 3AK3A 2ZKOA 4JTCB 2HHHO 1YTFB 5EBLC 4LF4O 3T1YB 2ZDIC 3D8CA 4UCOA 1GTOA 4JF3A 1LNQA 1K92A 3ZS8C 1PM9A 2ZM6B 2Y48A 3CXHF 3CEIA 5IYZB 1KYOF 4CH5A 1E79G 5DECA 2EINC 4NR1A 4TV8B 5D5QA 4ZOLB 4D6TH 4XDJA 2ZR2A 5KMGA 1I08A 4FLYA 2XAJA 1WNSA 2MW2B 4BAYA 1JFFB 2ITCC 4RWUA 2QEXV 1XMOB 4DR6O 3TXSA 4X8AA 1FJGB 3BAAA 4PI0A 2IJKA 1Y74B 2EILB 2QTOA 5K1XA 5EZYA 2GV9A
chains in the Genus database with same CATH topology
3H1HH 4D6TH 3BCCH 3L71H 3CWBH 3H1IH 3L73H 1SQBH 1BE3H 3L72H 1SQXH 1EZVH 3L75H 1BGYH 3CXHF 3H1JH 1SQPH 1SQQH 1SQVH 1PP9H 3TGUH 1L0NH 2BCCH 4PD4F 1PPJH 1NU1H 1KYOF 3H1KH 5KLVH 1P84F 1NTKH 2IBZH 3L70H 1L0LH 2FYUH 1BCCH 4U3FH 3H1LH 1KB9F 3CX5F 2A06H 1NTZH 1NTMH 3L74H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H H;  4D6T H;  3BCC H;  3L71 H;  3CWB H;  3H1I H;  3L73 H;  1SQB H;  1BE3 H;  3L72 H;  1SQX H;  1EZV H;  3L75 H;  1BGY H;  3CXH F;  3H1J H;  1SQP H;  1SQQ H;  1SQV H;  1PP9 H;  3TGU H;  1L0N H;  2BCC H;  4PD4 F;  1PPJ H;  1NU1 H;  1KYO F;  3H1K H;  5KLV H;  1P84 F;  1NTK H;  2IBZ H;  3L70 H;  1L0L H;  2FYU H;  1BCC H;  4U3F H;  3H1L H;  1KB9 F;  3CX5 F;  2A06 H;  1NTZ H;  1NTM H;  3L74 H; 
#chains in the Genus database with same CATH topology
 4X20 A;  2YC0 A;  3G6E V;  3WG7 C;  2HKO A;  2F4V O;  3SYC A;  1TVK A;  1QHT A;  1YIJ V;  3HKC A;  4JYA O;  3C3T A;  3P32 A;  4X65 B;  2QE7 G;  2X0L A;  3CRM A;  3CYO A;  4I55 A;  3W7U A;  5EC1 C;  2KQX A;  3E2E A;  4LBE C;  1KP3 A;  4NXM B;  2CDY A;  2Q7G A;  3ZHT A;  2HHH B;  1VQN V;  3L75 H;  1DF5 A;  4W4K A;  4J42 A;  2W0F C;  3CC4 V;  2LGQ A;  4B3M B;  1GN6 A;  1ZL8 A;  1FAF A;  2CTP A;  1R6N A;  3WU2 Z;  2VQE O;  3AG1 B;  4DW0 A;  2YUA A;  5HFM A;  1P7G A;  3ZRS A;  4MVR A;  5BR8 B;  3J7A U;  1THZ A;  3JAR A;  4IIJ B;  5L3F A;  3JSL A;  3L73 H;  4OX9 O;  4ICG A;  2R9R B;  1LUV A;  3X2Q B;  4D7S A;  1XHX A;  1U97 A;  2GTS A;  1Q86 W;  3RYH A;  2E76 B;  4WCE V;  2JDI G;  2OCC B;  1B04 A;  4I7Z B;  3P3P A;  4CS2 A;  1NQT A;  3DSQ A;  3QO5 A;  4KUM A;  3FYI B;  4PA3 A;  4XBF A;  3H1I H;  5BMV A;  4LH6 A;  4I4T A;  4X1K A;  1Q5O A;  3FYE B;  4I50 A;  3OW2 U;  1SRY A;  4JGS A;  3T2M A;  2P90 A;  1SA0 A;  2DW4 A;  3RW0 A;  4DR4 O;  2F4V B;  5EBW C;  1SET A;  1DGS A;  4MSW C;  4WFF A;  1EZV H;  4U3J B;  5JH7 B;  1VQ9 V;  3MD0 A;  4LR3 A;  1H2G A;  3ZHQ A;  2HG5 C;  2QWO B;  2Q67 A;  2DMX A;  1QR8 A;  3RYC A;  4GX0 A;  4JYA B;  2BOC C;  1BL8 A;  4IHJ A;  4XDK A;  1EN4 A;  5CA0 A;  1XI1 A;  3ZBH A;  2EX3 A;  1PNK A;  4CC5 A;  4JI4 B;  5BY1 A;  1RSO B;  3WB1 A;  3CSX A;  1NI8 A;  2IH1 C;  1KQS U;  4NXN O;  1LUW A;  2UXC B;  3X2Q C;  1FD9 A;  4YY3 B;  2Q69 A;  1JMK C;  5IYB O;  3KCX A;  3AEI A;  1AR5 A;  5EYP A;  4QJF B;  5J2T B;  5JJJ B;  3T4Z A;  3B8M A;  2PY5 A;  5IY5 B;  3TK1 A;  1ZLZ A;  2GHY A;  5LMN B;  1BCC H;  2V7Q G;  3ABT A;  1GAX A;  5CB4 B;  3OT7 A;  3ZMZ A;  2V4D A;  2IJI A;  1AP5 A;  5KHH A;  3JAL A;  4H13 B;  4H33 A;  1Q90 D;  2N04 A;  3ETE A;  4C7U A;  1F7Y A;  1V55 B;  5B3S B;  3D3Q A;  1M5I A;  2QKC A;  1AVM A;  2Q73 A;  5BZB A;  2LJ2 A;  2XAS A;  2A7W A;  4DV0 B;  3G67 A;  1MSD A;  2Q7E A;  5GTH Z;  2P5O A;  3RWR D;  3IFX A;  4PA9 A;  2JIZ G;  5JCO A;  1JJ2 U;  3N2G A;  2Z3Y A;  2Q0A A;  1R3L C;  5A2Q N;  1N0J A;  5B66 Z;  4YHH O;  2ZE8 A;  1Q8I A;  4FLU A;  4LF9 O;  1K33 A;  1NS1 A;  3ABM C;  3N27 A;  4LFC B;  1BS3 A;  1IZ3 A;  4MTX A;  1XNR O;  1Z5W A;  4DR7 O;  3SJC C;  4X1I B;  4R8C A;  5IDJ A;  1GKF A;  5CBF A;  2GBO A;  4FLW A;  3FB5 C;  1KUQ A;  2F43 G;  4X66 O;  3K57 A;  3RGB A;  3HKC B;  2RDC A;  1K4C C;  2QKS A;  1KMI Z;  2UXN A;  2B1I A;  3CCQ V;  3UCS C;  4K8X A;  1X59 A;  4R6Z A;  2HVJ C;  4EEQ A;  3BY6 A;  3APQ A;  1VEW A;  1TGO A;  3B4S A;  3OEE G;  4O2A A;  1P84 F;  3K59 A;  1Q6I A;  3RN4 A;  4HAM A;  1HNX B;  4DUY O;  3RT3 C;  2XOK G;  5CA1 A;  2UUB B;  1BMF G;  3CCV V;  4DV1 B;  1SQQ H;  3WB2 A;  2JS3 A;  4W4L A;  4PJ0 Z;  4GZR B;  5BMV B;  1RM1 C;  1O9G A;  3JAR B;  4H44 B;  1Y6X A;  1VAR A;  3HKE B;  5LXT A;  3CS5 A;  1AP6 A;  1Z5V A;  4LF5 O;  1R73 A;  3OFN G;  3ZMS A;  4I9Q A;  1K73 W;  1NTZ H;  4X88 A;  1YJW V;  1QBZ A;  1YJN V;  1WAZ A;  5H2F Z;  2OYQ A;  1SQB H;  3I56 V;  1MZE A;  4F6E A;  5IWA O;  1SA0 B;  4NYK A;  1MOF A;  4JI1 B;  3RVY A;  2AHZ A;  2IU3 A;  1VMG A;  5B1O A;  2IU0 A;  5CN0 A;  1QVG U;  3LDC A;  1PNL A;  3OTO B;  4GYC B;  3W7W A;  4NXM O;  2HFE C;  4LWS B;  3OD4 A;  3K03 A;  2LW7 A;  3JAT A;  2YI9 A;  1G4Y B;  1HP8 A;  3CE2 A;  3HR0 A;  1K7D A;  1RSO A;  4P30 A;  1SZX A;  4YJ3 A;  1G8M A;  2W6I G;  3VOU A;  1WB8 A;  2Y69 C;  3K3W A;  4DV2 B;  2AGA A;  4WFE A;  1JPX A;  1XBL A;  3JAK A;  3IC7 A;  4B08 A;  4MW3 A;  5KUK A;  2ZD9 A;  2NN4 A;  1XUQ A;  2YI8 A;  3DC5 A;  4H0L B;  4UVC A;  2VQF O;  1YDX A;  5CA0 B;  4EB6 B;  4O2B B;  3ABM B;  3ETD A;  4JI8 B;  3OTO O;  3H1L H;  1H8H G;  4Z2W A;  1IVS A;  5LMN O;  2K1E A;  4BIU A;  1I5Y A;  3UKM A;  4K8Z A;  3U10 A;  3CRQ A;  1JJO A;  2ZR3 A;  3OM3 B;  4O4I B;  4JI5 B;  3ABL C;  4JI2 O;  5KLV H;  2ZQM A;  4CC6 A;  4DR1 O;  1US6 A;  1F23 A;  5LA6 B;  2RQ6 A;  5DED A;  2P6J A;  4PV1 B;  2EJ7 A;  1JCH A;  1SKV A;  5JQG B;  4QE9 A;  4DUZ O;  1AJP A;  1N33 O;  2K9P A;  2YIB D;  3AG2 C;  1W0J G;  4E4E A;  1R6K A;  4GLX A;  2WLM A;  1SF9 A;  4DV6 B;  1FFX B;  4LCU C;  2ZM6 O;  1PPJ H;  5LMU O;  4B3R B;  3Q4H A;  2EUL A;  5KHJ A;  4XDL A;  4RAI A;  5J2U B;  2IH3 C;  2OIG A;  2LGW A;  4DV5 B;  4DYL A;  1FYJ A;  2UUA O;  3CD6 V;  4DV6 O;  5LYJ B;  2EIM C;  3S3X A;  2Q8V A;  2X7R B;  4CH3 A;  5L3B A;  1KBH A;  1GM8 A;  1COW G;  3UT5 A;  4GUN A;  4LH7 A;  1YCI A;  4DR6 B;  1EZJ A;  5KA5 A;  1R3J C;  2ARH A;  4TV9 A;  1H2L A;  4BIZ A;  5IYZ A;  1AI5 A;  3VQX A;  4PA7 A;  2E5L O;  4CZZ A;  4LFB O;  4KL1 A;  3C3S A;  4LP8 A;  2XT9 A;  4LFA B;  1ZWI C;  1NT2 B;  5E79 Z;  1D2D A;  2ITD C;  4JTD B;  4NB5 A;  2H94 A;  3SJQ C;  5LOV B;  2XAH A;  4PA6 A;  1J5E O;  2B1G A;  3GWO A;  2IBZ H;  1WJZ A;  1N32 O;  1XNQ B;  1VQ7 V;  3DTU B;  2WAM A;  2HJF C;  1XQ8 A;  1XMQ O;  3JD1 A;  1S5J A;  4R50 A;  1M56 B;  1NR7 A;  4CBC A;  4CS4 A;  3JD3 A;  4P9P A;  4DR7 B;  3OEH G;  2BCC H;  2ZXW C;  3UM7 A;  1VQO V;  3FB7 C;  5CA1 B;  3HB3 B;  2VWK A;  4K0K B;  4X1Y B;  4WFG A;  1KB9 F;  2X6B A;  2QM8 A;  4TT3 G;  5JVD A;  2UXX A;  3IGA C;  2UUC O;  3OE7 G;  2PYL A;  2Q6A A;  3L72 H;  4LF6 B;  3MHS C;  4OXS A;  4DV7 O;  4DK1 A;  1I0H A;  3B2E E;  4LWS A;  3S3W A;  4GX1 A;  3QG5 A;  4UCR A;  3A2F A;  4DUZ B;  3WFV A;  4IYI A;  1YVW A;  2PUS A;  2L6L A;  1HW7 A;  4JYY A;  3NR7 A;  5LOV A;  4JI0 O;  3ZMT A;  2FML A;  4B3T O;  3VQW A;  3PJS K;  1AI4 A;  4WBN A;  2JVD A;  3JAS A;  2GUZ A;  1DF4 A;  3N2K B;  1IBM O;  1RPR A;  5C8Y A;  1OCO B;  4PHZ A;  1YHQ V;  5IJ9 A;  3SYA A;  3VQY A;  2ZCE A;  2F95 B;  3CCU V;  2RN9 A;  4ZBM A;  1QLE B;  1FXV A;  3J80 N;  5EIB D;  4PDV A;  3JAW A;  2AZ0 A;  2N05 A;  1UJW B;  3A0B Z;  1PP9 H;  2VQF B;  1Q82 W;  2O57 A;  3LNN A;  2A79 B;  4PDL A;  1B6Q A;  5EIB C;  3VBB A;  3SYP A;  4UUJ C;  1MSW D;  4I0X B;  2WLH A;  2QWR B;  4O4L A;  2CK3 G;  2LQT A;  3A8T A;  2JEU A;  1T5E A;  2WA4 A;  2Q7H A;  3H01 A;  2EIJ B;  4TSF G;  1HWY A;  3CPW U;  2H8P C;  2UXD O;  1PL4 A;  2W0X A;  2EZP A;  3SPI A;  2YIC A;  4HYO A;  5C93 A;  1XMQ B;  3ETG A;  2YS8 A;  3NXS A;  3G71 V;  1KP2 A;  5IJ9 B;  5JQG A;  4FPP A;  2ZT9 B;  1NH2 B;  4D7T A;  4UB6 Z;  3KG2 A;  4EFE A;  1F51 A;  4LNU A;  4J41 A;  1JFF A;  2LO1 A;  3SPH A;  2XTA A;  4QNH B;  3E22 B;  1CP9 A;  4DV5 O;  4MTG A;  5JJE B;  2GDS A;  2YDE A;  2E75 B;  2ZNJ A;  1Y76 A;  1S77 D;  1I5X A;  2XAQ A;  4DV0 O;  3BEH A;  2FB5 A;  3JD0 A;  1TUE B;  3AG7 A;  4TV9 B;  1OHH G;  2ZE6 A;  1NKD A;  1QLN A;  1EN5 A;  3G4S V;  1NR1 A;  1R3K C;  2WLL B;  1XL6 A;  1M93 A;  4HZ3 A;  2VRZ A;  3SR2 C;  3H1H H;  5CMU A;  3UT5 B;  1BZK A;  4AI8 A;  4FLV A;  1H2S B;  2IJJ A;  1AR1 B;  3T1H O;  4J9Z B;  3EFF K;  1TUB B;  2YID A;  3OR6 C;  4J7Z A;  3IC9 A;  2ZE7 A;  2M7W A;  3A0H Z;  2B5U A;  2Q0O C;  1CXZ B;  1YF2 A;  1JOY A;  3AG3 C;  2WSS G;  1MNG A;  3T4D A;  4X62 O;  3CB2 A;  2BTO A;  4UCS A;  1KKD A;  1VQ5 V;  2XHB A;  2FTK A;  1N33 B;  2QDO A;  4G2K A;  1XMO O;  3I55 V;  1XNR B;  3O9O A;  4CS3 A;  5E1A C;  4DR1 B;  3WB0 A;  3LSQ A;  3K04 A;  2ODM A;  5BXZ A;  1VQ4 V;  2KB1 A;  3F7Y C;  1HNZ B;  4MTO A;  4B3S O;  3CHX A;  2BSK A;  4F6R B;  4BIO A;  3KZI Z;  2JEX A;  2FL4 A;  4X1Y A;  4ZKI A;  1A32 A;  1N36 O;  4UCV A;  4NTY A;  3K5O A;  3M99 B;  1VQK V;  4DR3 O;  1XRE A;  5LHI A;  1BQZ A;  4G27 B;  2ETN A;  4RUE A;  4LF5 B;  2DOS A;  3AG3 B;  2E5L B;  3CCE V;  4LFB B;  3IAY A;  3RVZ A;  4ABM A;  4F4L A;  5LHG A;  1JR9 A;  4DR4 B;  3G6B A;  5B5E Z;  1VQL V;  5C8Y B;  2WLJ A;  4MVU A;  3ASO B;  3E8G A;  1AIL A;  4ZHQ B;  1FXK C;  3QNE A;  1SQV H;  1K9M W;  1L0N H;  2D3O W;  3CME V;  3AK1 A;  2DWE C;  4LF7 O;  4O4H B;  4BW5 A;  3L70 H;  1VP7 A;  3HKD B;  2ATK C;  1Q3E A;  3TJT A;  2JGU A;  1U96 A;  3OUF A;  1Q81 W;  3Q4H B;  2UXB B;  2RJZ A;  4JTA B;  4UVA A;  4I0X A;  3ABK C;  4AIL C;  5AG2 A;  3RYF B;  4X20 B;  1RFY A;  5CB4 A;  2UXC O;  2CGO A;  1QCE A;  1OCZ C;  4IYH A;  3CXC U;  3BVO A;  3ZHV A;  2B9Z A;  4L8J A;  2A9H A;  3IJ4 A;  4OX9 B;  2UUB O;  3CRA A;  4LF7 B;  1K5S A;  2ZIM A;  1J95 A;  4MVM A;  3GVM A;  3OR7 C;  2RCV A;  5J9P C;  4WFA V;  3EHB B;  4WF9 V;  1SER A;  5B1B C;  2DQ3 A;  4LF4 B;  1OCZ B;  4JV5 B;  1NJI W;  1TAE A;  1EN6 A;  4X89 A;  1ZUQ A;  4CH6 A;  4FZ0 A;  1V9P A;  4LNU B;  1K4D C;  2IJH A;  3M7M X;  2CTQ A;  4UCT A;  4JI8 O;  3HKD A;  1Y4M A;  4PA4 A;  2YEV B;  3F5T A;  3BHP A;  1HR0 B;  4FFK A;  4QGP A;  4X65 O;  1NZ6 A;  4B3S B;  1Y76 B;  1DTO A;  4JI3 B;  1IBK O;  1K3E A;  1N34 B;  4J7J A;  5H6Q A;  3STZ C;  4KXR A;  2W6J G;  4JPR A;  2PI4 A;  5IJ0 A;  5GW7 A;  3U0Z A;  4LF9 B;  4K35 A;  3N2G B;  4FFB B;  4E2L A;  4FIP C;  5KAI Z;  2R70 A;  3OUS A;  2Z5U A;  2PZS A;  2A3Q A;  1LR1 A;  3ZMV A;  2EBO A;  5KAF Z;  5LGN A;  5KX5 B;  2QGN A;  3BCC H;  4AQY O;  4O2A B;  2CE4 A;  4JZG A;  2VS0 A;  4KHP B;  4DO2 A;  4FLZ A;  4RUF A;  1IBK B;  1PKX A;  2UU9 O;  4YXW G;  3FAV A;  1JVM A;  4X62 B;  1WA8 B;  3ZHR A;  2EIK B;  1OCR C;  4U3J A;  5FNV A;  1IDS A;  3DXR A;  3CCL V;  3PN1 A;  3ZX6 A;  1AB3 A;  1IXM A;  4MVO A;  1PD3 A;  3LSS A;  1Y74 A;  1BGY H;  1N4C A;  3T1Y O;  5J2U A;  3HKB B;  4GX5 A;  1NH2 D;  4JI7 B;  3B09 A;  1FKA O;  1IBL B;  5FLX N;  4NTW A;  1F4M A;  1B3Q A;  1KD1 W;  4JAU A;  1G6U A;  1GO3 F;  2QWN B;  1D5A A;  1I94 B;  2AW9 A;  2HLD G;  1FXK B;  3OGC C;  1WLE A;  4Z1M G;  2ZXW B;  3APO A;  1XNQ O;  1V54 C;  4I55 B;  4QPK A;  4P9O A;  3K58 A;  2UU9 B;  1K5Q A;  3LNM B;  2BSK B;  4F6R A;  3BAB A;  1P7B A;  2F93 B;  3E86 A;  1O9H A;  5L3D A;  4UV9 A;  2AXT Z;  5B1N A;  4Q20 A;  1V54 B;  1GN4 A;  1S3J A;  3CCM V;  3JAK B;  4UV8 A;  3O65 A;  2ADQ B;  2KSD A;  3G80 A;  4FMT A;  2UXD B;  4MTF A;  3JAT B;  4J80 A;  5LHH A;  4UFZ A;  2LP7 A;  3ZN0 A;  1ZTE A;  2P4V A;  4WFH A;  3T1H B;  3K5M A;  1MMM A;  5KUM A;  3LDD A;  1AJQ A;  2E3C A;  3K79 A;  2EIM B;  1M9N A;  4GKK O;  3JSN A;  3MDS A;  1DLB A;  1EFR G;  1NTK H;  4I5S A;  1YTF D;  1OCR B;  3SDL A;  2DQ0 A;  1R3I C;  1FPO A;  4O4I A;  3OAA G;  3RYF A;  3L74 H;  5JJN B;  2LW1 A;  1SES A;  1WPX A;  3B40 A;  3P30 A;  1RM1 B;  1ZSP A;  2AHY A;  3DC6 A;  4EFB A;  3QF7 A;  1N36 B;  1JQ0 A;  1SC5 B;  3P3N A;  5KHK A;  3UO2 A;  5KHI A;  4TUY B;  2EJR A;  4J11 A;  3CJH A;  1EBO A;  4KFM A;  4NKG B;  5JH7 A;  1FS0 G;  3EVK A;  3R65 A;  1W2B U;  2Y0I A;  4TQD A;  2ZIO A;  4OPH A;  1QR9 A;  4DK0 A;  5LA6 A;  2F23 A;  2OCH A;  4IHJ B;  3SJA C;  1URF A;  2XAF A;  4JI6 O;  4LF6 O;  4NTX A;  4TV8 A;  4PD4 F;  1OJH A;  1S76 D;  2MK3 A;  3CC7 V;  1VQ6 V;  1OCO C;  3HPL C;  4X64 B;  1E1R G;  2H3O A;  4JAV A;  5FPR A;  2QA4 V;  3QO8 A;  2UXB O;  4K0K O;  5EC2 C;  5JWP A;  1ROP A;  2QJ1 A;  3AG4 C;  1XOU A;  4DV7 B;  1TA8 A;  4GX2 A;  2CH7 B;  3ZRW B;  4HNA B;  1Y67 A;  2HJD A;  1PNM A;  5H5N A;  1Y66 A;  5IJ0 B;  1H2M A;  4UVB A;  1H38 A;  2JK5 C;  2PF4 E;  3OTF A;  2DYS B;  2Q5Z A;  1MAB G;  2PTM A;  3ML0 A;  4H37 A;  1M90 W;  2LFS A;  4DRX B;  4DR5 B;  5LP6 C;  3CJH B;  3AK2 A;  2YXL A;  5H6R A;  3THO A;  3E83 A;  1HNW B;  1NU1 H;  4PDR A;  1ZX3 A;  3H9V A;  3DGE A;  2HEP A;  3ICX A;  5EBM C;  4N23 A;  4WFB V;  4X66 B;  2FKX A;  2YXH A;  2F66 C;  3RYH B;  2WPD G;  5B3S C;  1YXB A;  2OWO A;  5L3G A;  3R66 A;  1IX9 A;  5K1P A;  2GSM B;  3BFR A;  4N21 A;  4DR2 O;  3FD9 A;  3ZN1 A;  4YJ2 A;  4KP4 A;  3DXR B;  3ETQ A;  3L9D A;  1GK9 A;  4LF8 O;  2OT5 A;  1BT8 A;  1Z2G A;  2P7T C;  4QPJ A;  2NNU A;  1HNW O;  2CH7 A;  2BOB C;  1M57 C;  1VIB A;  3CMA V;  3OMN B;  4JI7 O;  4HNA A;  3RBZ A;  2HVK C;  5LGU A;  1BE3 H;  3ASO C;  2WLL A;  1K97 A;  3BRC A;  4DV1 O;  4MT8 A;  2LFR A;  5LGT A;  3STL C;  2X6A A;  3D36 A;  1SQF A;  4MS2 A;  4GKJ O;  4L87 A;  4I4T B;  1WP7 A;  2AZ2 A;  4BW9 A;  4WBN B;  4UCU A;  4X64 O;  2CTR A;  2EIK C;  3N2K A;  3K5L A;  5ITZ A;  3CWB H;  4LF8 B;  4JI6 B;  2WLN A;  3RFR A;  1BHB A;  3BA8 A;  5GTI Z;  3FFQ A;  2JJ1 G;  4FLX A;  4KHP O;  2PI5 A;  5KMG B;  1YJ9 V;  4U3F H;  4K3A A;  1FFX A;  3CRC A;  5EYP B;  2YEV A;  4U7O A;  3ZIA G;  1Q7Y W;  1N32 B;  3JAS B;  2DYR B;  4O4J B;  2JGD B;  1OCC B;  2GUZ B;  1AI7 A;  1P49 A;  2BE3 A;  2VWJ A;  1H2N A;  3H1J H;  1L1F A;  3AG2 B;  3JCU Z;  4JI3 O;  2Z0A A;  4JI1 O;  4HBN A;  1OCC C;  2YIB A;  4Z1V A;  4ASU G;  2WWW A;  4A5U B;  2QM4 A;  1M1K W;  1GRJ A;  4ZIB A;  1M57 B;  2KKW A;  3CC2 V;  1I94 O;  2YIA A;  2N74 A;  3ABL B;  3SYQ A;  5J2T A;  1KC8 W;  4ZI7 B;  2OCC C;  2ZNI A;  3W7X A;  3SPG A;  2P4K A;  2L35 A;  4O4L B;  2P06 A;  3GWK C;  1NVP B;  5CBG A;  5LP6 A;  1GN2 A;  4ZHQ A;  4QIW F;  3CCR V;  1HDJ A;  3FAV B;  3E8F A;  5B1B B;  1N0N A;  4FM0 A;  4TUY A;  1CEZ A;  4Q6G A;  1R1B A;  3QO7 A;  2F1M A;  1E1Q G;  2IM9 A;  2RNB A;  2PGG A;  1H8E G;  1J5E B;  2GTA A;  3K5N A;  4U7N A;  2ILM A;  5CBH A;  2NLJ C;  1GH6 A;  1NBM G;  4MVS A;  2Y69 B;  2DYS C;  3TXQ A;  5DM6 V;  5IYD O;  1QQC A;  1K34 A;  4LFA O;  1NTM H;  3CCS V;  1BSM A;  1G1X B;  4YIO A;  4B3T B;  2Y0P A;  2HR3 A;  2G38 A;  3JYC A;  1VF5 B;  3E89 A;  1IUR A;  3SPJ A;  5GON B;  5JVD B;  2JRI A;  3JAM N;  4P2Z A;  3CRR A;  2WLI B;  1FXK A;  1S5H C;  1Q43 A;  1IBL O;  2NR5 A;  3AG1 C;  5TIS Z;  1W59 A;  2VQE B;  3CX5 F;  3I5D A;  3JCZ A;  1TUB A;  1YI2 V;  1HNX O;  4LC1 A;  1Q6U A;  2XND G;  4LFC O;  4DV4 O;  2WLK A;  4DV3 B;  1P4R A;  2EIJ C;  2ZDI A;  5KHG A;  3E8H A;  4DR5 O;  4DR3 B;  1SQG A;  2CGN A;  1HR0 O;  5IE9 A;  4YIP A;  1GM7 A;  1XEQ A;  4DRX A;  1SS3 A;  1YEW A;  4JZ2 A;  2EIN B;  5HFL A;  2UUC B;  1VQP V;  1VF7 A;  1HNZ O;  1QLE C;  2YXY A;  3ZHU A;  2M6Y A;  1QU7 A;  3TGU H;  4PEL A;  1B06 A;  3AG4 B;  3LUT B;  2D2C B;  4FLT A;  1NVP D;  4YHH B;  2ZE5 A;  2CAZ C;  2EIL C;  3JAW B;  2C2A A;  3SJB C;  1BHA A;  4X9Q A;  1UPG A;  4YJ2 B;  3OMI B;  1GM9 A;  5IYC O;  2KG7 B;  4AQY B;  1WN7 A;  2WLI A;  4JI5 O;  3T1C A;  1VQM V;  1RPO A;  4TQF A;  2EZO A;  4PI2 A;  3UQ8 A;  1M4U A;  4OGQ B;  1JX9 A;  1MA1 A;  3MHH C;  4B7K A;  1K8A W;  2DE0 X;  2IW5 A;  4JAA A;  1XDC A;  1CPY A;  3E8B A;  3F7V C;  3ZRX A;  4YY3 O;  4GT1 A;  1MG1 A;  1PV0 A;  1VF6 A;  4YJ3 B;  2A0L A;  4O4H A;  3K9S A;  3C90 A;  1YIT V;  1N8R W;  1WA8 A;  5H9C A;  3KKY A;  3VQV A;  2QSA A;  1AR4 A;  5FNV B;  2Y4U A;  2YSU B;  3K0G A;  4TOI A;  4PDM A;  2JGD A;  3RYI B;  5EK0 A;  3JD2 A;  4B3R O;  4IIJ A;  2PYJ A;  5ITZ B;  1FFT B;  3BA9 A;  5KA6 A;  4EB6 A;  1OZ0 A;  1ENV A;  2UUA B;  4MVQ A;  1WB7 A;  2E74 B;  2X6C A;  3SYO A;  4FM1 A;  5LL6 Y;  4G28 B;  1XIL A;  2CUG A;  3M8A A;  4RQE A;  1M56 C;  1VQ8 V;  3E22 A;  3QTC A;  2Y4T A;  1FJG O;  4DV3 O;  3K9A A;  2BTQ B;  5B1A B;  4X1K B;  1GMG A;  4J10 A;  2OIE A;  3D3I A;  4O2B A;  1ARO P;  3CP1 A;  4FJC C;  2P22 C;  4J9Y B;  1EM1 A;  1XL4 A;  5LP6 B;  5A9G A;  1JA8 A;  4BR6 A;  5CA3 A;  4NXN B;  3H1K H;  2XUM A;  4TWK A;  1ORQ C;  4ZI7 A;  3OGI B;  3GB7 C;  1L0L H;  2P67 A;  4MW8 A;  4GKJ B;  4JYC A;  2QWP B;  3K0D A;  3K08 A;  1ZAU A;  1SQX H;  2XAG A;  4GCZ A;  4EKW A;  1F4N A;  1SQP H;  5EZY B;  1Q6H A;  1FXH A;  4B3M O;  1IXB A;  2DYR C;  1QNM A;  4ZOL A;  4DV2 O;  1W0K G;  5F2V O;  4CH4 A;  3MAQ A;  3FX7 A;  2HP8 A;  4IGG A;  5LYJ A;  5IT9 N;  2DJV A;  4FFB A;  1XHZ A;  5LMU B;  2JJ2 G;  3OMA B;  3HKE A;  1KKC A;  3K06 A;  1WP8 A;  5LXT B;  1KU9 A;  3KCY A;  1GN3 A;  2QWQ B;  2BTQ A;  4DR2 B;  5LBQ A;  5FL7 G;  3U11 A;  4UXN A;  5KX5 A;  3TCU A;  4FK5 C;  3ZRV A;  4AHC A;  3ASN B;  2FYU H;  1TVK B;  1V55 C;  2Q9L A;  1KEC A;  2QTS A;  3B77 A;  5GON A;  4DW1 A;  3JAL B;  4FZ1 A;  3L71 H;  1WPB A;  1ZL8 B;  3ABU A;  4B7E A;  4I9W A;  4JAS A;  3EXA A;  4OPA A;  3FB8 C;  1S0V A;  5D5P A;  3QVN A;  2R9A A;  5BR8 O;  3B8N A;  4JI2 B;  4JI4 O;  3FB6 C;  4BWA A;  5FPO A;  5IWA B;  2JS5 A;  3W7T A;  3ZCC A;  5IY5 C;  4RO2 A;  3HKB A;  5L3E A;  4GKK B;  1S5L Z;  3LDE A;  3ABK B;  1SZT A;  2R72 A;  5JCO C;  1UFI A;  3WG7 B;  4O4J A;  2KG7 A;  3D36 C;  4FVM A;  1BQ0 A;  1N34 O;  2ADP A;  3JD4 A;  4JV5 O;  4RQF A;  4I50 B;  3ZRW A;  2OTL V;  3F5W C;  4X1I A;  3LSU A;  2DWD C;  4MVZ A;  3ZHS A;  3ZED A;  3TET A;  1AI6 A;  5L3C A;  3CCJ V;  4DV4 B;  1X4T A;  1OV9 A;  2WA3 A;  4DUY B;  1H2K A;  3FKS G;  4IL6 Z;  2OTJ V;  4J7K A;  1YZB A;  1PL0 A;  1S72 V;  3W7S A;  1L8D A;  3UO3 A;  4QE7 A;  3BPZ A;  4JYB A;  2A06 H;  3ZJZ A;  1QVF U;  2Q68 A;  1R6T A;  2RMK B;  3RYI A;  1I7F A;  1VF6 C;  1YSC A;  1MZF A;  2ZIN A;  3E35 A;  1AJN A;  3A0R A;  4IT5 A;  2R9I A;  2CTW A;  1IBM B;  3J81 N;  4R7C A;  3SPC A;  3ZMU A;  2QKA A;  4DXW A;  2QM7 A;  1RP3 B;  5DN6 G;  1D5N A;  2QR4 A;  2Q4P A;  4UB8 Z;  5B1A C;  4JI0 B;  4FM2 A;  4NVP A;  2DN9 A;  1DK1 A;  3ASN C;  3RYC B;  3SGI A;  2V1D A;  3AK3 A;  2ZKO A;  4JTC B;  2HHH O;  1YTF B;  5EBL C;  4LF4 O;  3T1Y B;  2ZDI C;  3D8C A;  4UCO A;  1GTO A;  4JF3 A;  1LNQ A;  1K92 A;  3ZS8 C;  1PM9 A;  2ZM6 B;  2Y48 A;  3CXH F;  3CEI A;  5IYZ B;  1KYO F;  4CH5 A;  1E79 G;  5DEC A;  2EIN C;  4NR1 A;  4TV8 B;  5D5Q A;  4ZOL B;  4D6T H;  4XDJ A;  2ZR2 A;  5KMG A;  1I08 A;  4FLY A;  2XAJ A;  1WNS A;  2MW2 B;  4BAY A;  1JFF B;  2ITC C;  4RWU A;  2QEX V;  1XMO B;  4DR6 O;  3TXS A;  4X8A A;  1FJG B;  3BAA A;  4PI0 A;  2IJK A;  1Y74 B;  2EIL B;  2QTO A;  5K1X A;  5EZY A;  2GV9 A; 
#chains in the Genus database with same CATH homology
 3H1H H;  4D6T H;  3BCC H;  3L71 H;  3CWB H;  3H1I H;  3L73 H;  1SQB H;  1BE3 H;  3L72 H;  1SQX H;  1EZV H;  3L75 H;  1BGY H;  3CXH F;  3H1J H;  1SQP H;  1SQQ H;  1SQV H;  1PP9 H;  3TGU H;  1L0N H;  2BCC H;  4PD4 F;  1PPJ H;  1NU1 H;  1KYO F;  3H1K H;  5KLV H;  1P84 F;  1NTK H;  2IBZ H;  3L70 H;  1L0L H;  2FYU H;  1BCC H;  4U3F H;  3H1L H;  1KB9 F;  3CX5 F;  2A06 H;  1NTZ H;  1NTM H;  3L74 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...