3CXHF

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
b'VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
total genus 28
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cxhF00
3CWBH 1EZVH 1L0NH 1NTZH 2A06H 1BE3H 1KB9F 1PP9H 2BCCH 3CXHF 1SQPH 3L71H 1SQXH 5KLVH 1KYOF 1SQVH 3L73H 1SQQH 2FYUH 1PPJH 1NTKH 3H1IH 3CX5F 1P84F 3L74H 4D6TH 2IBZH 1SQBH 3H1JH 3L72H 1BCCH 4U3FH 1BGYH 3TGUH 3L75H 3H1HH 1L0LH 3H1LH 4PD4F 3BCCH 1NU1H 1NTMH 3H1KH 3L70H
chains in the Genus database with same CATH superfamily
2ETNA 4P9PA 3OFNG 4FZ1A 1RM1B 3AK2A 1SQXH 2LO1A 4GKJB 2WA4A 3WFVA 2QGNA 1WA8A 4KHPO 2NNUA 1XL6A 1GN4A 2YIBA 2ZR2A 3LDDA 3JD1A 1GAXA 2EJ7A 2E5LB 5EBLC 4MT8A 1Q6UA 2QM4A 2PUSA 3KCYA 5IJ0A 1S77D 3TXQA 4PA4A 4MVQA 3CJHB 3ZMUA 2P90A 2XT9A 1AVMA 3ABUA 4LWSB 1CPYA 1OHHG 3C3SA 4BIUA 2QWPB 3DSQA 3GWOA 4O4JA 2DW4A 4WF9V 1WJZA 2WLIA 3AG7A 4X20B 4B7EA 1VQ6V 4JYAB 3MAQA 1BE3H 4NXNO 1XQ8A 4TQDA 2GTSA 5CBGA 4J10A 1V54B 1KKCA 4TT3G 2Q6AA 1I5XA 1COWG 4K8ZA 3G71V 4QE9A 1AI4A 2DYRC 3AG1B 3CCSV 3I56V 4CH4A 1M57B 5JVDA 2ZR3A 3W7UA 1GN6A 5B1AB 4ZHQB 5AG2A 1IBKO 4AI8A 3O65A 4D7SA 4DV7O 4YY3B 4TV8B 3L72H 1K3EA 1BGYH 3G80A 4IHJB 2F1MA 2BTQA 4DUZO 3DC6A 4OXSA 4NKGB 2CH7A 3CMEV 2UXDO 1K92A 4WCEV 3S3WA 2Z3YA 3KKYA 4GUNA 2ADPA 2ZIOA 4LF8B 1L1FA 2HP8A 4PI0A 1CEZA 4AILC 4OPAA 3FAVB 2LJ2A 1S3JA 4CC5A 3OE7G 5L3FA 3CPWU 4DR3O 4F6RA 3ASOC 1R3JC 3D36C 1ZL8B 3QVNA 1YZBA 4DV0O 1QVGU 1FXKA 4N21A 5CA1A 1N8RW 2OIEA 1RSOB 1R6KA 3N2GB 4DR7O 3J7AU 5JCOC 4B3SO 1HNZB 1NKDA 1M90W 1NTKH 3JARB 1VARA 5KMGA 3STZC 2D3OW 3EFFK 1M5IA 5EZYB 5E1AC 2YICA 1Z5VA 1KD1W 4HAMA 3K03A 4ASUG 4L87A 1UJWB 3T1YO 1YDXA 5CBFA 3OT7A 1QLEB 1FJGO 1FPOA 1PNLA 3E8HA 3G6BA 4X62B 2VQEB 4H13B 2P06A 1NS1A 4RO2A 1MSWD 1ROPA 5EC1C 3B2EE 2DWDC 3U11A 3OR6C 4I0XA 4X1IA 4X64O 1SESA 1IZ3A 4X64B 3F5TA 3QO5A 4X8AA 3THOA 3VQWA 1WPXA 2E74B 1DF4A 2FYUH 1B06A 3ABLC 5L3CA 3TJTA 3A8TA 1QQCA 4GZRB 2NN4A 1Y76B 5FLXN 1OZ0A 4BW5A 4U3JB 2Y69B 2RCVA 4X1KB 4Z1VA 5B1AC 5DN6G 4NTXA 1TVKA 4GKJO 1MOFA 1R6NA 4DV4B 2B5UA 3SPJA 1I08A 2A79B 4A5UB 3AG1C 3E86A 1J5EB 5K1XA 5A2QN 1RSOA 2IH3C 5D5PA 4KP4A 1N34O 5FL7G 2P5OA 1BCCH 4JPRA 1KKDA 4LFAO 2ZDIC 3H1LH 2GDSA 1BMFG 4LF7O 5KHJA 1K73W 3JAWB 4DW1A 3T2MA 1WLEA 4TUYA 4LF9B 2X0LA 2ATKC 2VWJA 1SA0A 5E79Z 3MHHC 4DXWA 5LA6B 2D2CB 4HBNA 1BHAA 3IJ4A 3QF7A 4U3FH 3CP1A 4H37A 1JCHA 3L75H 4FLZA 2YI9A 2K9PA 2JEXA 1LR1A 1NR1A 4PV1B 3A2FA 4R50A 5LGTA 4JI0O 3BEHA 5LXTA 3BABA 4DW0A 1I7FA 3CEIA 4XBFA 3KZIZ 3TCUA 2AZ2A 1X4TA 1Q82W 3H1IH 2JS5A 2QWQB 4JI8B 4I9QA 3PJSK 4JASA 1N36B 2Y4UA 3UCSC 3LSUA 2Z0AA 2QKSA 3WG7B 1SA0B 2WLHA 2YXHA 1BHBA 3TETA 1IBKB 1AJQA 1BT8A 3T1HB 1ZL8A 2L35A 4LCUC 3CRQA 3M7MX 2ZKOA 4DV6O 2RQ6A 4CH3A 4DV6B 1XBLA 2QTSA 2ODMA 2Q73A 4O2AB 1HP8A 3ML0A 4DRXB 2DJVA 4LBEC 3HKEB 1D5NA 2F95B 4JTDB 2A7WA 1GM8A 3GB7C 4IIJA 4U3JA 1PNMA 1VQLV 1QCEA 4TV8A 3T1CA 5BY1A 1S72V 2Q7HA 4D7TA 1OCOB 1V9PA 3RBZA 1NH2B 4PHZA 1H2KA 1XOUA 4NXMO 1Q8IA 3JD0A 3O9OA 1FXKC 4RUEA 4DR7B 1LUVA 4ZOLB 5KX5A 3L9DA 3HB3B 1AJNA 4UXNA 4G27B 5LMUO 1K5QA 1K33A 5LP6B 3PN1A 3H9VA 3RFRA 3CD6V 3AG3B 3K59A 5L3DA 4HZ3A 1G4YB 2IJIA 4DO2A 4K0KB 2N05A 1BL8A 3RYIA 1IBMB 2LW1A 3K57A 4X62O 1MA1A 4I55B 1H2SB 3RYHB 1B6QA 4B3RO 2DN9A 2HJFC 3EVKA 2LFRA 2QM8A 1W0JG 2DWEC 3ZN0A 1GMGA 3MD0A 1I0HA 3WU2Z 4EB6A 2QWOB 2V1DA 4NVPA 5KAFZ 3CWBH 1WPBA 2MK3A 4LF5O 3CCQV 5LHGA 3W7WA 4MSWC 5A9GA 5LMNO 1VQ5V 2DYSB 5ITZA 1IBLB 4DR1B 1AI6A 4D6TH 1TGOA 1JPXA 1XREA 3BFRA 1SETA 3BHPA 1HR0O 1N0JA 3BRCA 1U96A 3P3NA 4F4LA 5C93A 5EYPB 3ETGA 2VWKA 4R7CA 4LFAB 3ZIAG 2BTOA 2C2AA 4DV5O 1H2NA 3FB5C 1VQ8V 4ZHQA 4FFBB 1GRJA 5IYZA 3EXAA 4MW8A 4BAYA 4O2AA 1Y4MA 1JOYA 1AP6A 4I7ZB 3NR7A 3JAKA 5L3GA 3N27A 1QR8A 3LNNA 1WN7A 4DK0A 1BQZA 2DQ0A 3CYOA 3ABKC 4UCSA 1JVMA 1R73A 3SJCC 2EZOA 4JI0B 4N23A 4HYOA 3H1KH 4DUYO 4K3AA 2ZIMA 2ARHA 1L0NH 2ZXWB 4AHCA 3C90A 3CXHF 3CRMA 1HW7A 2P4VA 4LH6A 4B3TB 4WFHA 5B1BC 2CUGA 5JJNB 1DF5A 1YJNV 5BXZA 3OEEG 1NJIW 1M56B 4X66B 4O4HA 1JJ2U 4YIOA 2Q5ZA 3ZMSA 2YXYA 5JQGA 1N0NA 3K9AA 2EILC 4LFCO 2F4VB 1UPGA 1ZTEA 1VF6A 4UVBA 2QKCA 1RM1C 4DR5O 5IWAO 2HLDG 4CS2A 4JYAO 5IWAB 1NH2D 3SYQA 1D2DA 1K4CC 1Q6IA 2KG7A 2WAMA 2XASA 2VQFO 3LSQA 4WFFA 4LF4O 3SYCA 4GKKB 4FM2A 1VQ4V 4LC1A 4JZGA 3BCCH 1M1KW 3UM7A 1FXHA 1NU1H 2JJ1G 2M6YA 1T5EA 3ZRWA 1SERA 2XOKG 4DR6O 2A9HA 2PYJA 2FKXA 3U10A 2WSSG 4B3SB 5LGUA 3AG3C 2N74A 4X1KA 2CTRA 5LOVA 2XAQA 2BOCC 3J80N 2BSKA 2LGQA 4GX5A 3CS5A 1QNMA 3JAMN 3K5LA 5D5QA 3ABMB 3N2KB 4MW3A 1FFXB 4J7ZA 3TXSA 5GTIZ 4JV5B 4X1IB 1Z2GA 1PL0A 1U97A 3JAWA 1EBOA 1ZUQA 1XEQA 3JASB 5JJJB 2E75B 4H33A 5LOVB 2JS3A 4QGPA 3MDSA 3Q4HB 4QJFB 4GX0A 5CA0B 2UUBB 3UO3A 1E79G 4EKWA 5B1NA 2PF4E 1QBZA 1JQ0A 3VOUA 5JH7A 4PELA 1TVKB 3SPGA 1UFIA 1RP3B 3QNEA 2PI4A 5LP6C 1OCZC 2OCCC 5EZYA 4FK5C 3SPIA 3W7SA 1Y76A 2KSDA 3ZRWB 3VBBA 4JAVA 5CA0A 1JJOA 3WB2A 3OUSA 3JARA 4FFKA 3OTOO 2F93B 4KFMA 2UXCO 4J41A 4DV7B 4JI3O 1GK9A 3DGEA 1I5YA 3CCUV 3K0DA 1ZX3A 2QDOA 1WP7A 5J2TB 3L74H 5H5NA 4P9OA 5CA1B 2EIKB 3JATA 3ZEDA 1Y6XA 1FXKB 1M4UA 4PD4F 3ZHVA 5FPRA 2GUZA 1H38A 3OTFA 3SPCA 4IHJA 1OCZB 2OCCB 5H6RA 2PY5A 2P6JA 4WFAV 4IYIA 4BW9A 2JEUA 4DR2B 4JI5O 1Q6HA 4UVCA 1M93A 2W0FC 3SYOA 4X88A 2X6BA 1THZA 3B8MA 1HNZO 4IT5A 3AG4C 1JFFA 1M56C 4X89A 5JVDB 2QA4V 1K4DC 1J5EO 3OR7C 4YXWG 1F4NA 5LL6Y 1MZFA 4FFBA 4F6RB 1OCCB 1GM9A 2Q0AA 3VQXA 1HNWO 1VQNV 2B9ZA 3FAVA 4FLTA 2H8PC 3AG4B 5JQGB 4PA7A 4UCVA 1Q90D 2M7WA 4XDLA 1XHXA 1CXZB 3HKBA 1SQVH 1ENVA 1MMMA 4LWSA 2XTAA 1AP5A 2JJ2G 5JWPA 2Q7EA 4LFCB 4PDRA 2B1GA 2CTWA 2QTOA 2HVJC 1KU9A 4CS4A 4MTFA 3GWKC 3E35A 5EYPA 2UU9B 2CTQA 2XAGA 1OCRB 1YITV 3STLC 3CJHA 4LFBO 2CE4A 3ASNC 2ZCEA 4I4TA 5C8YB 1PL4A 4R6ZA 4ZI7A 3IGAC 5H6QA 3L73H 3E8FA 3ZHUA 1XMQO 1X59A 1HR0B 2AHZA 5IJ9B 1VF7A 4NB5A 4LF6O 1GH6A 1R6TA 4JZ2A 2XUMA 5EK0A 2EILB 5IYZB 1PV0A 4FLXA 3K79A 3IAYA 1K7DA 2RDCA 4X20A 3OEHG 4IYHA 4JYYA 3SYPA 1DGSA 3E22B 2YDEA 3HKBB 4JYBA 1AB3A 1YJ9V 1Q86W 3ZHSA 1Y66A 4PI2A 3K5NA 1WAZA 3AG2B 4JV5O 3DTUB 3OMIB 5TISZ 1K9MW 1V55B 4FLWA 4JAAA 2JVDA 2Y69C 3ASOB 2EJRA 5FNVB 3TGUH 4WFBV 2HFEC 1XMOB 2AW9A 1WA8B 4NXMB 1G8MA 4I50A 1HNXO 5KX5B 4K35A 3ZMVA 2BCCH 1NVPB 3ZJZA 4DV1B 3JSLA 4X9QA 1KMIZ 1GKFA 4JI8O 1M9NA 1O9GA 4QNHB 5LMUB 1KC8W 1YJWV 4DR1O 1CP9A 1YEWA 2ZXWC 3RYIB 2JRIA 3SJQC 1I94B 2ZINA 1FAFA 2XHBA 3OMNB 1F23A 4DRXA 2HHHB 3FD9A 1HDJA 3LSSA 2HHHO 2GTAA 3JCUZ 3X2QB 4JI4B 4JYCA 1XL4A 3ETQA 5B1OA 3HKCB 4W4LA 2BE3A 5LHHA 4LF8O 5KUMA 4FLVA 1L0LH 1QU7A 3ABLB 5BMVB 2XAHA 4DR3B 4RQFA 1GM7A 2Q7GA 4O4IB 4DR6B 2CDYA 1GO3F 3RVZA 3ETDA 3JYCA 3ZRVA 5LGNA 4JI7B 3D8CA 4IIJB 3CMAV 3WB1A 4FJCC 1FD9A 1SRYA 4R8CA 4CC6A 2UXDB 1EZJA 3JALB 4PJ0Z 4FVMA 3SR2C 5KUKA 4B3TO 4RUFA 1SQBH 1IX9A 4RAIA 4H0LB 2X6CA 3N2KA 1URFA 5KA5A 2A0LA 1F51A 2DQ3A 3E8GA 2MW2B 5LBQA 5HFLA 4TUYB 5J2TA 1NTZH 3APOA 1JR9A 4O4LB 2RNBA 1EN4A 3CSXA 3CB2A 2LGWA 3DXRA 2R72A 4JI1O 5LYJB 3ZHRA 5KHKA 3A0BZ 3WB0A 4WFEA 4WFGA 5KHGA 2RJZA 4YJ3A 2Y0PA 4J7KA 5LXTB 2WLMA 3F5WC 4JI2O 4JI3B 3CRRA 2EBOA 1IBLO 1US6A 1XMQB 1LNQA 1VQ7V 2HEPA 1KQSU 3VQYA 4B3MO 3SDLA 3RVYA 3QG5A 3P32A 3SPHA 1FXVA 5KHHA 3IC9A 2R70A 2BSKB 1EZVH 4CZZA 4MVOA 3RW0A 5IY5C 1W2BU 5GONA 4OX9O 2KKWA 4UV9A 5K1PA 2CK3G 1YF2A 3FB8C 2F43G 2EIMC 2GV9A 1NR7A 1SQGA 1DLBA 1OV9A 2EIJC 2P7TC 5H9CA 2YC0A 2PYLA 3FB7C 4QPJA 5H2FZ 4MTOA 1S5HC 1P7GA 1KP2A 3K0GA 3L71H 1F4MA 5BR8O 4DV4O 1K5SA 4JI6B 4DR4B 4UB6Z 4E2LA 5BR8B 2EULA 5KMGB 4LH7A 3H1JH 1XILA 5LYJA 2E3CA 1HNXB 1BS3A 3DXRB 2LP7A 4Z1MG 1N33B 2PZSA 1N36O 1N33O 5DECA 1Q81W 5CBHA 1Q5OA 3ABMC 4EEQA 3OMAB 3ZBHA 5B3SC 4TV9A 3NXSA 2F66C 4E4EA 2JGDA 3ETEA 4ZBMA 4X1YA 4QE7A 5L3BA 1IDSA 4FM0A 1TUBA 2YUAA 2ITCC 4DUZB 5GW7A 3CC2V 1Y74A 4P2ZA 3OGIB 4J9YB 1D5AA 3MHSC 2EINB 4P30A 4UV8A 1N4CA 1B04A 1VMGA 5LHIA 3G4SV 1IXBA 5EBWC 4GKKO 4G28B 4TSFG 1SKVA 1XUQA 4LP8A 4UCUA 4WBNA 2ZT9B 3AK1A 4JF3A 5BZBA 3N2GA 4O4IA 3F7YC 3K58A 3ZHTA 2OCHA 4YHHO 3CCLV 1FFTB 1E1RG 4G2KA 1VQKV 2PI5A 1GN2A 1P7BA 1AR5A 2E76B 2Q68A 4JI7O 3CHXA 1SZXA 4I5SA 2ZM6B 1AR4A 2CAZC 3H1HH 2V7QG 1YXBA 2XAFA 3RYHA 4LNUB 2HG5C 4BWAA 1ZAUA 3SYAA 3FKSG 2JIZG 2WLIB 1AR1B 5IJ0B 2ZNJA 1QR9A 1IBMO 1KYOF 1K97A 1TUBB 1Z5WA 4RWUA 2XNDG 1XI1A 3QO7A 3DC5A 2OYQA 3ZN1A 3BPZA 3KCXA 2JGDB 2AGAA 1IVSA 2Y48A 1NQTA 3QO8A 3ZMTA 3CC7V 1RFYA 1E1QG 4ZOLA 1NVPD 4DV1O 1TAEA 3FB6C 4ZI7B 1EN5A 2VRZA 1AROP 3AEIA 4FPPA 4OPHA 3LDCA 2OIGA 4RQEA 4GLXA 1I94O 3T1YB 1FKAO 3W7XA 4UCRA 2F23A 1TA8A 3HKEA 3W7TA 3C3TA 4O2BA 4JI4O 4DK1A 5IT9N 4GT1A 2UUAB 3UT5B 4NR1A 2HJDA 1G6UA 1WP8A 1SS3A 4NTYA 4JTAB 2QSAA 1KUQA 5FPOA 3ABKB 2R9RB 4PDLA 4DV5B 1B3QA 2KQXA 3FX7A 2QR4A 5EC2C 3P3PA 3D3QA 3CCMV 1KB9F 4UUJC 4MVMA 3HPLC 4MVZA 1WB8A 3M99B 4W4KA 2YIDA 1VIBA 1A32A 1Q3EA 3BA9A 1AI5A 1Y67A 2Y4TA 2IM9A 2QE7G 4DV2O 1NBMG 4EFEA 1EN6A 3CCJV 3RYFA 4EFBA 3S3XA 1NTMH 3BVOA 4BR6A 3JD3A 5B3SB 2A06H 1XNRB 2ADQB 4OGQB 4DR4O 3FYIB 3CC4V 3ZRSA 5B5EZ 2UXXA 2WWWA 2P67A 2ZE7A 3VQVA 1SQQH 3KG2A 2FL4A 2HKOA 1P84F 2PTMA 4HNAB 2IBZH 1YI2V 2BOBC 2YXLA 1N32O 5BMVA 2W6IG 2GUZB 4FMTA 4X66O 3E8BA 2GBOA 2WPDG 4FLYA 4YJ2A 1Q43A 1YCIA 2KG7B 5EIBD 1PP9H 5HFMA 4J11A 4JI1B 1SQPH 2HVKC 2YI8A 2LW7A 3R66A 4FZ0A 4HNAA 4XDKA 3M8AA 3P30A 3ZS8C 4BIZA 2UU9O 2YEVA 4NYKA 3AG2C 4JI2B 4Z2WA 3HR0A 4DUYB 3CRCA 1LUWA 3RN4A 5B1BB 4KL1A 3LUTB 4AQYB 3BA8A 3I55V 1YTFB 4MS2A 4KHPB 2WLKA 3G6EV 4DV3O 2WLNA 1MSDA 4FIPC 4DV3B 5CB4A 2E5LO 5IY5B 4XDJA 5J2UB 4CS3A 3JD2A 1RPOA 1KBHA 4JAUA 3ZCCA 3T1HO 3F7VC 1SC5B 2F4VO 1MNGA 2IW5A 5IYDO 2ZE6A 4ICGA 1M57C 2RMKB 3JAKB 1OCRC 1XDCA 2LQTA 3E2EA 2WA3A 2VQFB 3ZRXA 3CCRV 1BQ0A 2NR5A 3UT5A 2OWOA 2G38A 3B8NA 2XAJA 4TWKA 4B08A 3UKMA 3ASNB 4PDVA 1R1BA 4UFZA 2DOSA 3J81N 2L6LA 2ZE5A 2GSMB 3RYFB 3RYCB 2OT5A 2LFSA 1JX9A 4IL6Z 4GX2A 3ZX6A 4FLUA 5IYBO 4NTWA 5LMNB 4CBCA 2AZ0A 1PPJH 3K3WA 4X65B 1W59A 2VQEO 4X65O 1OCCC 4F6EA 1VQPV 4B3MB 2IU3A 1KP3A 4O4HB 4NXNB 3B40A 1P49A 3SJAC 3L70H 1VQMV 4B7KA 2Q8VA 1ORQC 1VP7A 3SGIA 2UUBO 3U0ZA 2UXBO 3K04A 4O2BB 1RPRA 1NT2B 5GTHZ 4IGGA 1XNQO 2Q0OC 1J95A 3GVMA 3EHBB 1XNQB 1VF6C 4GCZA 1ZLZA 2W0XA 4PA6A 5IJ9A 1R3KC 1VEWA 1JA8A 3OTOB 1YVWA 5KLVH 3OUFA 1NI8A 4CH5A 2OTLV 2Y0IA 1S5JA 1GN3A 3HKCA 1H2GA 3X2QC 1Q7YW 5KA6A 4I4TB 5C8YA 1YIJV 4DYLA 1XNRO 1WNSA 4WBNB 2CH7B 1PKXA 1PNKA 2UXNA 1HNWB 4C7UA 3LNMB 4LR3A 2B1IA 2X7RB 3APQA 3BAAA 2CTPA 3AK3A 4QPKA 2YSUB 3K08A 4LNUA 1VF5B 5IDJA 1KECA 2YIBD 5DEDA 4DV0B 1IURA 1L8DA 1BSMA 1FYJA 4YIPA 2BTQB 1AI7A 4J42A 4J80A 4U7OA 1IXMA 4DR5B 2DE0X 5F2VO 2CGOA 4I50B 2VS0A 3OW2U 1H2LA 3H01A 4TV9B 4LF4B 2ITDC 2FMLA 5FNVA 1PD3A 1V55C 1JFFB 2JK5C 3SJBC 1HWYA 2QEXV 4PDMA 1NZ6A 2QJ1A 1QLNA 2X6AA 3ICXA 2EIKC 2IJKA 2Q4PA 4PA3A 3E83A 2ZNIA 3OAAG 1XHZA 5JH7B 2UUAO 1R3LC 3B77A 4YHHB 2EX3A 3CE2A 2ZD9A 1N34B 2Q67A 3RT3C 2QM7A 2IU0A 3WG7C 1AILA 1BZKA 3OM3B 3Q4HA 1Y74B 1SF9A 4LF7B 4O4JB 5GONB 4J9ZB 5L3EA 3JASA 1F7YA 2H3OA 1WB7A 2EZPA 3HKDB 2FB5A 4JGSA 4OX9B 2GHYA 4X1YB 3QTCA 3G67A 4QIWF 1ZSPA 2KB1A 2QKAA 3K9SA 3JATB 2R9AA 2W6JG 1G1XB 5ITZB 1FS0G 3A0RA 3JCZA 3I5DA 3RYCA 5J2UA 1H2MA 1SQFA 1EM1A 4UB8Z 2UUCB 2QWRB 2UUCO 5KAIZ 1QLEC 2YIAA 4JI6O 1JMKC 4I9WA 1SZTA 4EB6B 5IYCO 2N04A 1W0KG 2P22C 2JGUA 1YHQV 5CMUA 2YS8A 3RGBA 3D3IA 3JSNA 2Q9LA 5CA3A 2ZM6O 3UQ8A 4FM1A 2WLLB 4LF9O 4MVRA 3BY6A 2UXCB 1R3IC 1S5LZ 1FJGB 3TK1A 3ZHQA 1P4RA 4I0XB 1AJPA 4B3RB 2NLJC 1S0VA 1DTOA 3ABTA 5LP6A 1FFXA 2ZE8A 5DM6V 2DYSC 4TOIA 3CCVV 5KHIA 1XMOO 4Q6GA 2UXBB 1ZWIC 4ZIBA 3FFQA 2IH1C 4AQYO 4UVAA 1VQ9V 4JTCB 5CB4B 1YTFD 3JALA 2Q69A 4LF5B 2JDIG 3CX5F 1GTOA 5EIBC 4JI5B 4DR2O 4KXRA 3CRAA 4YJ3B 2O57A 2V4DA 5EBMC 4K8XA 4YY3O 3OGCC 2AHYA 2A3QA 4CH6A 1YSCA 4DV2B 3K06A 2HR3A 5LA6A 2DYRB 3OD4A 4O4LA 2QWNB 4H44B 3IC7A 3UO2A 2OTJV 4ABMA 1S76D 3E89A 2AXTZ 3K5OA 3B09A 2P4KA 3LDEA 5B66Z 1VQOV 1V54C 4KUMA 1MG1A 3K5MA 4MVSA 5JCOA 2RN9A 2WLLA 4TQFA 2H94A 3FYEB 1TUEB 1DK1A 2EIJB 3RWRD 3A0HZ 4GYCB 2EIMB 3B4SA 4J7JA 2FTKA 4MVUA 4ZKIA 2R9IA 4UCOA 2YEVB 3JD4A 4MTGA 2ILMA 4PA9A 4UCTA 5IE9A 1EFRG 3T4DA 2DMXA 1O9HA 4L8JA 1H8HG 2WLJA 1QVFU 2PGGA 4U7NA 2Z5UA 4K0KO 3R65A 4GX1A 1N32B 1QHTA 4LF6B 5CN0A 5JJEB 2IJJA 4YJ2B 3D36A 2ZQMA 4Q20A 3HKDA 4I55A 3E22A 3CXCU 1OJHA 2EINC 2IJHA 2K1EA 4BIOA 1MZEA 3IFXA 4MTXA 1K34A 1PM9A 3ZMZA 3T4ZA 1OCOC 1K8AW 2CGNA 1H8EG 1MABG 5J9PC 4LFBB 3CCEV 2ZDIA
chains in the Genus database with same CATH topology
3CWBH 1EZVH 1L0NH 1NTZH 2A06H 1BE3H 1KB9F 1PP9H 2BCCH 3CXHF 1SQPH 3L71H 1SQXH 5KLVH 1KYOF 1SQVH 3L73H 1SQQH 2FYUH 1PPJH 1NTKH 3H1IH 3CX5F 1P84F 3L74H 4D6TH 2IBZH 1SQBH 3H1JH 3L72H 1BCCH 4U3FH 1BGYH 3TGUH 3L75H 3H1HH 1L0LH 3H1LH 4PD4F 3BCCH 1NU1H 1NTMH 3H1KH 3L70H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB H;  1EZV H;  1L0N H;  1NTZ H;  2A06 H;  1BE3 H;  1KB9 F;  1PP9 H;  2BCC H;  3CXH F;  1SQP H;  3L71 H;  1SQX H;  5KLV H;  1KYO F;  1SQV H;  3L73 H;  1SQQ H;  2FYU H;  1PPJ H;  1NTK H;  3H1I H;  3CX5 F;  1P84 F;  3L74 H;  4D6T H;  2IBZ H;  1SQB H;  3H1J H;  3L72 H;  1BCC H;  4U3F H;  1BGY H;  3TGU H;  3L75 H;  3H1H H;  1L0L H;  3H1L H;  4PD4 F;  3BCC H;  1NU1 H;  1NTM H;  3H1K H;  3L70 H; 
#chains in the Genus database with same CATH topology
 2ETN A;  4P9P A;  3OFN G;  4FZ1 A;  1RM1 B;  3AK2 A;  1SQX H;  2LO1 A;  4GKJ B;  2WA4 A;  3WFV A;  2QGN A;  1WA8 A;  4KHP O;  2NNU A;  1XL6 A;  1GN4 A;  2YIB A;  2ZR2 A;  3LDD A;  3JD1 A;  1GAX A;  2EJ7 A;  2E5L B;  5EBL C;  4MT8 A;  1Q6U A;  2QM4 A;  2PUS A;  3KCY A;  5IJ0 A;  1S77 D;  3TXQ A;  4PA4 A;  4MVQ A;  3CJH B;  3ZMU A;  2P90 A;  2XT9 A;  1AVM A;  3ABU A;  4LWS B;  1CPY A;  1OHH G;  3C3S A;  4BIU A;  2QWP B;  3DSQ A;  3GWO A;  4O4J A;  2DW4 A;  4WF9 V;  1WJZ A;  2WLI A;  3AG7 A;  4X20 B;  4B7E A;  1VQ6 V;  4JYA B;  3MAQ A;  1BE3 H;  4NXN O;  1XQ8 A;  4TQD A;  2GTS A;  5CBG A;  4J10 A;  1V54 B;  1KKC A;  4TT3 G;  2Q6A A;  1I5X A;  1COW G;  4K8Z A;  3G71 V;  4QE9 A;  1AI4 A;  2DYR C;  3AG1 B;  3CCS V;  3I56 V;  4CH4 A;  1M57 B;  5JVD A;  2ZR3 A;  3W7U A;  1GN6 A;  5B1A B;  4ZHQ B;  5AG2 A;  1IBK O;  4AI8 A;  3O65 A;  4D7S A;  4DV7 O;  4YY3 B;  4TV8 B;  3L72 H;  1K3E A;  1BGY H;  3G80 A;  4IHJ B;  2F1M A;  2BTQ A;  4DUZ O;  3DC6 A;  4OXS A;  4NKG B;  2CH7 A;  3CME V;  2UXD O;  1K92 A;  4WCE V;  3S3W A;  2Z3Y A;  3KKY A;  4GUN A;  2ADP A;  2ZIO A;  4LF8 B;  1L1F A;  2HP8 A;  4PI0 A;  1CEZ A;  4AIL C;  4OPA A;  3FAV B;  2LJ2 A;  1S3J A;  4CC5 A;  3OE7 G;  5L3F A;  3CPW U;  4DR3 O;  4F6R A;  3ASO C;  1R3J C;  3D36 C;  1ZL8 B;  3QVN A;  1YZB A;  4DV0 O;  1QVG U;  1FXK A;  4N21 A;  5CA1 A;  1N8R W;  2OIE A;  1RSO B;  1R6K A;  3N2G B;  4DR7 O;  3J7A U;  5JCO C;  4B3S O;  1HNZ B;  1NKD A;  1M90 W;  1NTK H;  3JAR B;  1VAR A;  5KMG A;  3STZ C;  2D3O W;  3EFF K;  1M5I A;  5EZY B;  5E1A C;  2YIC A;  1Z5V A;  1KD1 W;  4HAM A;  3K03 A;  4ASU G;  4L87 A;  1UJW B;  3T1Y O;  1YDX A;  5CBF A;  3OT7 A;  1QLE B;  1FJG O;  1FPO A;  1PNL A;  3E8H A;  3G6B A;  4X62 B;  2VQE B;  4H13 B;  2P06 A;  1NS1 A;  4RO2 A;  1MSW D;  1ROP A;  5EC1 C;  3B2E E;  2DWD C;  3U11 A;  3OR6 C;  4I0X A;  4X1I A;  4X64 O;  1SES A;  1IZ3 A;  4X64 B;  3F5T A;  3QO5 A;  4X8A A;  3THO A;  3VQW A;  1WPX A;  2E74 B;  1DF4 A;  2FYU H;  1B06 A;  3ABL C;  5L3C A;  3TJT A;  3A8T A;  1QQC A;  4GZR B;  2NN4 A;  1Y76 B;  5FLX N;  1OZ0 A;  4BW5 A;  4U3J B;  2Y69 B;  2RCV A;  4X1K B;  4Z1V A;  5B1A C;  5DN6 G;  4NTX A;  1TVK A;  4GKJ O;  1MOF A;  1R6N A;  4DV4 B;  2B5U A;  3SPJ A;  1I08 A;  2A79 B;  4A5U B;  3AG1 C;  3E86 A;  1J5E B;  5K1X A;  5A2Q N;  1RSO A;  2IH3 C;  5D5P A;  4KP4 A;  1N34 O;  5FL7 G;  2P5O A;  1BCC H;  4JPR A;  1KKD A;  4LFA O;  2ZDI C;  3H1L H;  2GDS A;  1BMF G;  4LF7 O;  5KHJ A;  1K73 W;  3JAW B;  4DW1 A;  3T2M A;  1WLE A;  4TUY A;  4LF9 B;  2X0L A;  2ATK C;  2VWJ A;  1SA0 A;  5E79 Z;  3MHH C;  4DXW A;  5LA6 B;  2D2C B;  4HBN A;  1BHA A;  3IJ4 A;  3QF7 A;  4U3F H;  3CP1 A;  4H37 A;  1JCH A;  3L75 H;  4FLZ A;  2YI9 A;  2K9P A;  2JEX A;  1LR1 A;  1NR1 A;  4PV1 B;  3A2F A;  4R50 A;  5LGT A;  4JI0 O;  3BEH A;  5LXT A;  3BAB A;  4DW0 A;  1I7F A;  3CEI A;  4XBF A;  3KZI Z;  3TCU A;  2AZ2 A;  1X4T A;  1Q82 W;  3H1I H;  2JS5 A;  2QWQ B;  4JI8 B;  4I9Q A;  3PJS K;  4JAS A;  1N36 B;  2Y4U A;  3UCS C;  3LSU A;  2Z0A A;  2QKS A;  3WG7 B;  1SA0 B;  2WLH A;  2YXH A;  1BHB A;  3TET A;  1IBK B;  1AJQ A;  1BT8 A;  3T1H B;  1ZL8 A;  2L35 A;  4LCU C;  3CRQ A;  3M7M X;  2ZKO A;  4DV6 O;  2RQ6 A;  4CH3 A;  4DV6 B;  1XBL A;  2QTS A;  2ODM A;  2Q73 A;  4O2A B;  1HP8 A;  3ML0 A;  4DRX B;  2DJV A;  4LBE C;  3HKE B;  1D5N A;  2F95 B;  4JTD B;  2A7W A;  1GM8 A;  3GB7 C;  4IIJ A;  4U3J A;  1PNM A;  1VQL V;  1QCE A;  4TV8 A;  3T1C A;  5BY1 A;  1S72 V;  2Q7H A;  4D7T A;  1OCO B;  1V9P A;  3RBZ A;  1NH2 B;  4PHZ A;  1H2K A;  1XOU A;  4NXM O;  1Q8I A;  3JD0 A;  3O9O A;  1FXK C;  4RUE A;  4DR7 B;  1LUV A;  4ZOL B;  5KX5 A;  3L9D A;  3HB3 B;  1AJN A;  4UXN A;  4G27 B;  5LMU O;  1K5Q A;  1K33 A;  5LP6 B;  3PN1 A;  3H9V A;  3RFR A;  3CD6 V;  3AG3 B;  3K59 A;  5L3D A;  4HZ3 A;  1G4Y B;  2IJI A;  4DO2 A;  4K0K B;  2N05 A;  1BL8 A;  3RYI A;  1IBM B;  2LW1 A;  3K57 A;  4X62 O;  1MA1 A;  4I55 B;  1H2S B;  3RYH B;  1B6Q A;  4B3R O;  2DN9 A;  2HJF C;  3EVK A;  2LFR A;  2QM8 A;  1W0J G;  2DWE C;  3ZN0 A;  1GMG A;  3MD0 A;  1I0H A;  3WU2 Z;  4EB6 A;  2QWO B;  2V1D A;  4NVP A;  5KAF Z;  3CWB H;  1WPB A;  2MK3 A;  4LF5 O;  3CCQ V;  5LHG A;  3W7W A;  4MSW C;  5A9G A;  5LMN O;  1VQ5 V;  2DYS B;  5ITZ A;  1IBL B;  4DR1 B;  1AI6 A;  4D6T H;  1TGO A;  1JPX A;  1XRE A;  3BFR A;  1SET A;  3BHP A;  1HR0 O;  1N0J A;  3BRC A;  1U96 A;  3P3N A;  4F4L A;  5C93 A;  5EYP B;  3ETG A;  2VWK A;  4R7C A;  4LFA B;  3ZIA G;  2BTO A;  2C2A A;  4DV5 O;  1H2N A;  3FB5 C;  1VQ8 V;  4ZHQ A;  4FFB B;  1GRJ A;  5IYZ A;  3EXA A;  4MW8 A;  4BAY A;  4O2A A;  1Y4M A;  1JOY A;  1AP6 A;  4I7Z B;  3NR7 A;  3JAK A;  5L3G A;  3N27 A;  1QR8 A;  3LNN A;  1WN7 A;  4DK0 A;  1BQZ A;  2DQ0 A;  3CYO A;  3ABK C;  4UCS A;  1JVM A;  1R73 A;  3SJC C;  2EZO A;  4JI0 B;  4N23 A;  4HYO A;  3H1K H;  4DUY O;  4K3A A;  2ZIM A;  2ARH A;  1L0N H;  2ZXW B;  4AHC A;  3C90 A;  3CXH F;  3CRM A;  1HW7 A;  2P4V A;  4LH6 A;  4B3T B;  4WFH A;  5B1B C;  2CUG A;  5JJN B;  1DF5 A;  1YJN V;  5BXZ A;  3OEE G;  1NJI W;  1M56 B;  4X66 B;  4O4H A;  1JJ2 U;  4YIO A;  2Q5Z A;  3ZMS A;  2YXY A;  5JQG A;  1N0N A;  3K9A A;  2EIL C;  4LFC O;  2F4V B;  1UPG A;  1ZTE A;  1VF6 A;  4UVB A;  2QKC A;  1RM1 C;  4DR5 O;  5IWA O;  2HLD G;  4CS2 A;  4JYA O;  5IWA B;  1NH2 D;  3SYQ A;  1D2D A;  1K4C C;  1Q6I A;  2KG7 A;  2WAM A;  2XAS A;  2VQF O;  3LSQ A;  4WFF A;  4LF4 O;  3SYC A;  4GKK B;  4FM2 A;  1VQ4 V;  4LC1 A;  4JZG A;  3BCC H;  1M1K W;  3UM7 A;  1FXH A;  1NU1 H;  2JJ1 G;  2M6Y A;  1T5E A;  3ZRW A;  1SER A;  2XOK G;  4DR6 O;  2A9H A;  2PYJ A;  2FKX A;  3U10 A;  2WSS G;  4B3S B;  5LGU A;  3AG3 C;  2N74 A;  4X1K A;  2CTR A;  5LOV A;  2XAQ A;  2BOC C;  3J80 N;  2BSK A;  2LGQ A;  4GX5 A;  3CS5 A;  1QNM A;  3JAM N;  3K5L A;  5D5Q A;  3ABM B;  3N2K B;  4MW3 A;  1FFX B;  4J7Z A;  3TXS A;  5GTI Z;  4JV5 B;  4X1I B;  1Z2G A;  1PL0 A;  1U97 A;  3JAW A;  1EBO A;  1ZUQ A;  1XEQ A;  3JAS B;  5JJJ B;  2E75 B;  4H33 A;  5LOV B;  2JS3 A;  4QGP A;  3MDS A;  3Q4H B;  4QJF B;  4GX0 A;  5CA0 B;  2UUB B;  3UO3 A;  1E79 G;  4EKW A;  5B1N A;  2PF4 E;  1QBZ A;  1JQ0 A;  3VOU A;  5JH7 A;  4PEL A;  1TVK B;  3SPG A;  1UFI A;  1RP3 B;  3QNE A;  2PI4 A;  5LP6 C;  1OCZ C;  2OCC C;  5EZY A;  4FK5 C;  3SPI A;  3W7S A;  1Y76 A;  2KSD A;  3ZRW B;  3VBB A;  4JAV A;  5CA0 A;  1JJO A;  3WB2 A;  3OUS A;  3JAR A;  4FFK A;  3OTO O;  2F93 B;  4KFM A;  2UXC O;  4J41 A;  4DV7 B;  4JI3 O;  1GK9 A;  3DGE A;  1I5Y A;  3CCU V;  3K0D A;  1ZX3 A;  2QDO A;  1WP7 A;  5J2T B;  3L74 H;  5H5N A;  4P9O A;  5CA1 B;  2EIK B;  3JAT A;  3ZED A;  1Y6X A;  1FXK B;  1M4U A;  4PD4 F;  3ZHV A;  5FPR A;  2GUZ A;  1H38 A;  3OTF A;  3SPC A;  4IHJ A;  1OCZ B;  2OCC B;  5H6R A;  2PY5 A;  2P6J A;  4WFA V;  4IYI A;  4BW9 A;  2JEU A;  4DR2 B;  4JI5 O;  1Q6H A;  4UVC A;  1M93 A;  2W0F C;  3SYO A;  4X88 A;  2X6B A;  1THZ A;  3B8M A;  1HNZ O;  4IT5 A;  3AG4 C;  1JFF A;  1M56 C;  4X89 A;  5JVD B;  2QA4 V;  1K4D C;  1J5E O;  3OR7 C;  4YXW G;  1F4N A;  5LL6 Y;  1MZF A;  4FFB A;  4F6R B;  1OCC B;  1GM9 A;  2Q0A A;  3VQX A;  1HNW O;  1VQN V;  2B9Z A;  3FAV A;  4FLT A;  2H8P C;  3AG4 B;  5JQG B;  4PA7 A;  4UCV A;  1Q90 D;  2M7W A;  4XDL A;  1XHX A;  1CXZ B;  3HKB A;  1SQV H;  1ENV A;  1MMM A;  4LWS A;  2XTA A;  1AP5 A;  2JJ2 G;  5JWP A;  2Q7E A;  4LFC B;  4PDR A;  2B1G A;  2CTW A;  2QTO A;  2HVJ C;  1KU9 A;  4CS4 A;  4MTF A;  3GWK C;  3E35 A;  5EYP A;  2UU9 B;  2CTQ A;  2XAG A;  1OCR B;  1YIT V;  3STL C;  3CJH A;  4LFB O;  2CE4 A;  3ASN C;  2ZCE A;  4I4T A;  5C8Y B;  1PL4 A;  4R6Z A;  4ZI7 A;  3IGA C;  5H6Q A;  3L73 H;  3E8F A;  3ZHU A;  1XMQ O;  1X59 A;  1HR0 B;  2AHZ A;  5IJ9 B;  1VF7 A;  4NB5 A;  4LF6 O;  1GH6 A;  1R6T A;  4JZ2 A;  2XUM A;  5EK0 A;  2EIL B;  5IYZ B;  1PV0 A;  4FLX A;  3K79 A;  3IAY A;  1K7D A;  2RDC A;  4X20 A;  3OEH G;  4IYH A;  4JYY A;  3SYP A;  1DGS A;  3E22 B;  2YDE A;  3HKB B;  4JYB A;  1AB3 A;  1YJ9 V;  1Q86 W;  3ZHS A;  1Y66 A;  4PI2 A;  3K5N A;  1WAZ A;  3AG2 B;  4JV5 O;  3DTU B;  3OMI B;  5TIS Z;  1K9M W;  1V55 B;  4FLW A;  4JAA A;  2JVD A;  2Y69 C;  3ASO B;  2EJR A;  5FNV B;  3TGU H;  4WFB V;  2HFE C;  1XMO B;  2AW9 A;  1WA8 B;  4NXM B;  1G8M A;  4I50 A;  1HNX O;  5KX5 B;  4K35 A;  3ZMV A;  2BCC H;  1NVP B;  3ZJZ A;  4DV1 B;  3JSL A;  4X9Q A;  1KMI Z;  1GKF A;  4JI8 O;  1M9N A;  1O9G A;  4QNH B;  5LMU B;  1KC8 W;  1YJW V;  4DR1 O;  1CP9 A;  1YEW A;  2ZXW C;  3RYI B;  2JRI A;  3SJQ C;  1I94 B;  2ZIN A;  1FAF A;  2XHB A;  3OMN B;  1F23 A;  4DRX A;  2HHH B;  3FD9 A;  1HDJ A;  3LSS A;  2HHH O;  2GTA A;  3JCU Z;  3X2Q B;  4JI4 B;  4JYC A;  1XL4 A;  3ETQ A;  5B1O A;  3HKC B;  4W4L A;  2BE3 A;  5LHH A;  4LF8 O;  5KUM A;  4FLV A;  1L0L H;  1QU7 A;  3ABL B;  5BMV B;  2XAH A;  4DR3 B;  4RQF A;  1GM7 A;  2Q7G A;  4O4I B;  4DR6 B;  2CDY A;  1GO3 F;  3RVZ A;  3ETD A;  3JYC A;  3ZRV A;  5LGN A;  4JI7 B;  3D8C A;  4IIJ B;  3CMA V;  3WB1 A;  4FJC C;  1FD9 A;  1SRY A;  4R8C A;  4CC6 A;  2UXD B;  1EZJ A;  3JAL B;  4PJ0 Z;  4FVM A;  3SR2 C;  5KUK A;  4B3T O;  4RUF A;  1SQB H;  1IX9 A;  4RAI A;  4H0L B;  2X6C A;  3N2K A;  1URF A;  5KA5 A;  2A0L A;  1F51 A;  2DQ3 A;  3E8G A;  2MW2 B;  5LBQ A;  5HFL A;  4TUY B;  5J2T A;  1NTZ H;  3APO A;  1JR9 A;  4O4L B;  2RNB A;  1EN4 A;  3CSX A;  3CB2 A;  2LGW A;  3DXR A;  2R72 A;  4JI1 O;  5LYJ B;  3ZHR A;  5KHK A;  3A0B Z;  3WB0 A;  4WFE A;  4WFG A;  5KHG A;  2RJZ A;  4YJ3 A;  2Y0P A;  4J7K A;  5LXT B;  2WLM A;  3F5W C;  4JI2 O;  4JI3 B;  3CRR A;  2EBO A;  1IBL O;  1US6 A;  1XMQ B;  1LNQ A;  1VQ7 V;  2HEP A;  1KQS U;  3VQY A;  4B3M O;  3SDL A;  3RVY A;  3QG5 A;  3P32 A;  3SPH A;  1FXV A;  5KHH A;  3IC9 A;  2R70 A;  2BSK B;  1EZV H;  4CZZ A;  4MVO A;  3RW0 A;  5IY5 C;  1W2B U;  5GON A;  4OX9 O;  2KKW A;  4UV9 A;  5K1P A;  2CK3 G;  1YF2 A;  3FB8 C;  2F43 G;  2EIM C;  2GV9 A;  1NR7 A;  1SQG A;  1DLB A;  1OV9 A;  2EIJ C;  2P7T C;  5H9C A;  2YC0 A;  2PYL A;  3FB7 C;  4QPJ A;  5H2F Z;  4MTO A;  1S5H C;  1P7G A;  1KP2 A;  3K0G A;  3L71 H;  1F4M A;  5BR8 O;  4DV4 O;  1K5S A;  4JI6 B;  4DR4 B;  4UB6 Z;  4E2L A;  5BR8 B;  2EUL A;  5KMG B;  4LH7 A;  3H1J H;  1XIL A;  5LYJ A;  2E3C A;  1HNX B;  1BS3 A;  3DXR B;  2LP7 A;  4Z1M G;  1N33 B;  2PZS A;  1N36 O;  1N33 O;  5DEC A;  1Q81 W;  5CBH A;  1Q5O A;  3ABM C;  4EEQ A;  3OMA B;  3ZBH A;  5B3S C;  4TV9 A;  3NXS A;  2F66 C;  4E4E A;  2JGD A;  3ETE A;  4ZBM A;  4X1Y A;  4QE7 A;  5L3B A;  1IDS A;  4FM0 A;  1TUB A;  2YUA A;  2ITC C;  4DUZ B;  5GW7 A;  3CC2 V;  1Y74 A;  4P2Z A;  3OGI B;  4J9Y B;  1D5A A;  3MHS C;  2EIN B;  4P30 A;  4UV8 A;  1N4C A;  1B04 A;  1VMG A;  5LHI A;  3G4S V;  1IXB A;  5EBW C;  4GKK O;  4G28 B;  4TSF G;  1SKV A;  1XUQ A;  4LP8 A;  4UCU A;  4WBN A;  2ZT9 B;  3AK1 A;  4JF3 A;  5BZB A;  3N2G A;  4O4I A;  3F7Y C;  3K58 A;  3ZHT A;  2OCH A;  4YHH O;  3CCL V;  1FFT B;  1E1R G;  4G2K A;  1VQK V;  2PI5 A;  1GN2 A;  1P7B A;  1AR5 A;  2E76 B;  2Q68 A;  4JI7 O;  3CHX A;  1SZX A;  4I5S A;  2ZM6 B;  1AR4 A;  2CAZ C;  3H1H H;  2V7Q G;  1YXB A;  2XAF A;  3RYH A;  4LNU B;  2HG5 C;  4BWA A;  1ZAU A;  3SYA A;  3FKS G;  2JIZ G;  2WLI B;  1AR1 B;  5IJ0 B;  2ZNJ A;  1QR9 A;  1IBM O;  1KYO F;  1K97 A;  1TUB B;  1Z5W A;  4RWU A;  2XND G;  1XI1 A;  3QO7 A;  3DC5 A;  2OYQ A;  3ZN1 A;  3BPZ A;  3KCX A;  2JGD B;  2AGA A;  1IVS A;  2Y48 A;  1NQT A;  3QO8 A;  3ZMT A;  3CC7 V;  1RFY A;  1E1Q G;  4ZOL A;  1NVP D;  4DV1 O;  1TAE A;  3FB6 C;  4ZI7 B;  1EN5 A;  2VRZ A;  1ARO P;  3AEI A;  4FPP A;  4OPH A;  3LDC A;  2OIG A;  4RQE A;  4GLX A;  1I94 O;  3T1Y B;  1FKA O;  3W7X A;  4UCR A;  2F23 A;  1TA8 A;  3HKE A;  3W7T A;  3C3T A;  4O2B A;  4JI4 O;  4DK1 A;  5IT9 N;  4GT1 A;  2UUA B;  3UT5 B;  4NR1 A;  2HJD A;  1G6U A;  1WP8 A;  1SS3 A;  4NTY A;  4JTA B;  2QSA A;  1KUQ A;  5FPO A;  3ABK B;  2R9R B;  4PDL A;  4DV5 B;  1B3Q A;  2KQX A;  3FX7 A;  2QR4 A;  5EC2 C;  3P3P A;  3D3Q A;  3CCM V;  1KB9 F;  4UUJ C;  4MVM A;  3HPL C;  4MVZ A;  1WB8 A;  3M99 B;  4W4K A;  2YID A;  1VIB A;  1A32 A;  1Q3E A;  3BA9 A;  1AI5 A;  1Y67 A;  2Y4T A;  2IM9 A;  2QE7 G;  4DV2 O;  1NBM G;  4EFE A;  1EN6 A;  3CCJ V;  3RYF A;  4EFB A;  3S3X A;  1NTM H;  3BVO A;  4BR6 A;  3JD3 A;  5B3S B;  2A06 H;  1XNR B;  2ADQ B;  4OGQ B;  4DR4 O;  3FYI B;  3CC4 V;  3ZRS A;  5B5E Z;  2UXX A;  2WWW A;  2P67 A;  2ZE7 A;  3VQV A;  1SQQ H;  3KG2 A;  2FL4 A;  2HKO A;  1P84 F;  2PTM A;  4HNA B;  2IBZ H;  1YI2 V;  2BOB C;  2YXL A;  1N32 O;  5BMV A;  2W6I G;  2GUZ B;  4FMT A;  4X66 O;  3E8B A;  2GBO A;  2WPD G;  4FLY A;  4YJ2 A;  1Q43 A;  1YCI A;  2KG7 B;  5EIB D;  1PP9 H;  5HFM A;  4J11 A;  4JI1 B;  1SQP H;  2HVK C;  2YI8 A;  2LW7 A;  3R66 A;  4FZ0 A;  4HNA A;  4XDK A;  3M8A A;  3P30 A;  3ZS8 C;  4BIZ A;  2UU9 O;  2YEV A;  4NYK A;  3AG2 C;  4JI2 B;  4Z2W A;  3HR0 A;  4DUY B;  3CRC A;  1LUW A;  3RN4 A;  5B1B B;  4KL1 A;  3LUT B;  4AQY B;  3BA8 A;  3I55 V;  1YTF B;  4MS2 A;  4KHP B;  2WLK A;  3G6E V;  4DV3 O;  2WLN A;  1MSD A;  4FIP C;  4DV3 B;  5CB4 A;  2E5L O;  5IY5 B;  4XDJ A;  5J2U B;  4CS3 A;  3JD2 A;  1RPO A;  1KBH A;  4JAU A;  3ZCC A;  3T1H O;  3F7V C;  1SC5 B;  2F4V O;  1MNG A;  2IW5 A;  5IYD O;  2ZE6 A;  4ICG A;  1M57 C;  2RMK B;  3JAK B;  1OCR C;  1XDC A;  2LQT A;  3E2E A;  2WA3 A;  2VQF B;  3ZRX A;  3CCR V;  1BQ0 A;  2NR5 A;  3UT5 A;  2OWO A;  2G38 A;  3B8N A;  2XAJ A;  4TWK A;  4B08 A;  3UKM A;  3ASN B;  4PDV A;  1R1B A;  4UFZ A;  2DOS A;  3J81 N;  2L6L A;  2ZE5 A;  2GSM B;  3RYF B;  3RYC B;  2OT5 A;  2LFS A;  1JX9 A;  4IL6 Z;  4GX2 A;  3ZX6 A;  4FLU A;  5IYB O;  4NTW A;  5LMN B;  4CBC A;  2AZ0 A;  1PPJ H;  3K3W A;  4X65 B;  1W59 A;  2VQE O;  4X65 O;  1OCC C;  4F6E A;  1VQP V;  4B3M B;  2IU3 A;  1KP3 A;  4O4H B;  4NXN B;  3B40 A;  1P49 A;  3SJA C;  3L70 H;  1VQM V;  4B7K A;  2Q8V A;  1ORQ C;  1VP7 A;  3SGI A;  2UUB O;  3U0Z A;  2UXB O;  3K04 A;  4O2B B;  1RPR A;  1NT2 B;  5GTH Z;  4IGG A;  1XNQ O;  2Q0O C;  1J95 A;  3GVM A;  3EHB B;  1XNQ B;  1VF6 C;  4GCZ A;  1ZLZ A;  2W0X A;  4PA6 A;  5IJ9 A;  1R3K C;  1VEW A;  1JA8 A;  3OTO B;  1YVW A;  5KLV H;  3OUF A;  1NI8 A;  4CH5 A;  2OTL V;  2Y0I A;  1S5J A;  1GN3 A;  3HKC A;  1H2G A;  3X2Q C;  1Q7Y W;  5KA6 A;  4I4T B;  5C8Y A;  1YIJ V;  4DYL A;  1XNR O;  1WNS A;  4WBN B;  2CH7 B;  1PKX A;  1PNK A;  2UXN A;  1HNW B;  4C7U A;  3LNM B;  4LR3 A;  2B1I A;  2X7R B;  3APQ A;  3BAA A;  2CTP A;  3AK3 A;  4QPK A;  2YSU B;  3K08 A;  4LNU A;  1VF5 B;  5IDJ A;  1KEC A;  2YIB D;  5DED A;  4DV0 B;  1IUR A;  1L8D A;  1BSM A;  1FYJ A;  4YIP A;  2BTQ B;  1AI7 A;  4J42 A;  4J80 A;  4U7O A;  1IXM A;  4DR5 B;  2DE0 X;  5F2V O;  2CGO A;  4I50 B;  2VS0 A;  3OW2 U;  1H2L A;  3H01 A;  4TV9 B;  4LF4 B;  2ITD C;  2FML A;  5FNV A;  1PD3 A;  1V55 C;  1JFF B;  2JK5 C;  3SJB C;  1HWY A;  2QEX V;  4PDM A;  1NZ6 A;  2QJ1 A;  1QLN A;  2X6A A;  3ICX A;  2EIK C;  2IJK A;  2Q4P A;  4PA3 A;  3E83 A;  2ZNI A;  3OAA G;  1XHZ A;  5JH7 B;  2UUA O;  1R3L C;  3B77 A;  4YHH B;  2EX3 A;  3CE2 A;  2ZD9 A;  1N34 B;  2Q67 A;  3RT3 C;  2QM7 A;  2IU0 A;  3WG7 C;  1AIL A;  1BZK A;  3OM3 B;  3Q4H A;  1Y74 B;  1SF9 A;  4LF7 B;  4O4J B;  5GON B;  4J9Z B;  5L3E A;  3JAS A;  1F7Y A;  2H3O A;  1WB7 A;  2EZP A;  3HKD B;  2FB5 A;  4JGS A;  4OX9 B;  2GHY A;  4X1Y B;  3QTC A;  3G67 A;  4QIW F;  1ZSP A;  2KB1 A;  2QKA A;  3K9S A;  3JAT B;  2R9A A;  2W6J G;  1G1X B;  5ITZ B;  1FS0 G;  3A0R A;  3JCZ A;  3I5D A;  3RYC A;  5J2U A;  1H2M A;  1SQF A;  1EM1 A;  4UB8 Z;  2UUC B;  2QWR B;  2UUC O;  5KAI Z;  1QLE C;  2YIA A;  4JI6 O;  1JMK C;  4I9W A;  1SZT A;  4EB6 B;  5IYC O;  2N04 A;  1W0K G;  2P22 C;  2JGU A;  1YHQ V;  5CMU A;  2YS8 A;  3RGB A;  3D3I A;  3JSN A;  2Q9L A;  5CA3 A;  2ZM6 O;  3UQ8 A;  4FM1 A;  2WLL B;  4LF9 O;  4MVR A;  3BY6 A;  2UXC B;  1R3I C;  1S5L Z;  1FJG B;  3TK1 A;  3ZHQ A;  1P4R A;  4I0X B;  1AJP A;  4B3R B;  2NLJ C;  1S0V A;  1DTO A;  3ABT A;  5LP6 A;  1FFX A;  2ZE8 A;  5DM6 V;  2DYS C;  4TOI A;  3CCV V;  5KHI A;  1XMO O;  4Q6G A;  2UXB B;  1ZWI C;  4ZIB A;  3FFQ A;  2IH1 C;  4AQY O;  4UVA A;  1VQ9 V;  4JTC B;  5CB4 B;  1YTF D;  3JAL A;  2Q69 A;  4LF5 B;  2JDI G;  3CX5 F;  1GTO A;  5EIB C;  4JI5 B;  4DR2 O;  4KXR A;  3CRA A;  4YJ3 B;  2O57 A;  2V4D A;  5EBM C;  4K8X A;  4YY3 O;  3OGC C;  2AHY A;  2A3Q A;  4CH6 A;  1YSC A;  4DV2 B;  3K06 A;  2HR3 A;  5LA6 A;  2DYR B;  3OD4 A;  4O4L A;  2QWN B;  4H44 B;  3IC7 A;  3UO2 A;  2OTJ V;  4ABM A;  1S76 D;  3E89 A;  2AXT Z;  3K5O A;  3B09 A;  2P4K A;  3LDE A;  5B66 Z;  1VQO V;  1V54 C;  4KUM A;  1MG1 A;  3K5M A;  4MVS A;  5JCO A;  2RN9 A;  2WLL A;  4TQF A;  2H94 A;  3FYE B;  1TUE B;  1DK1 A;  2EIJ B;  3RWR D;  3A0H Z;  4GYC B;  2EIM B;  3B4S A;  4J7J A;  2FTK A;  4MVU A;  4ZKI A;  2R9I A;  4UCO A;  2YEV B;  3JD4 A;  4MTG A;  2ILM A;  4PA9 A;  4UCT A;  5IE9 A;  1EFR G;  3T4D A;  2DMX A;  1O9H A;  4L8J A;  1H8H G;  2WLJ A;  1QVF U;  2PGG A;  4U7N A;  2Z5U A;  4K0K O;  3R65 A;  4GX1 A;  1N32 B;  1QHT A;  4LF6 B;  5CN0 A;  5JJE B;  2IJJ A;  4YJ2 B;  3D36 A;  2ZQM A;  4Q20 A;  3HKD A;  4I55 A;  3E22 A;  3CXC U;  1OJH A;  2EIN C;  2IJH A;  2K1E A;  4BIO A;  1MZE A;  3IFX A;  4MTX A;  1K34 A;  1PM9 A;  3ZMZ A;  3T4Z A;  1OCO C;  1K8A W;  2CGN A;  1H8E G;  1MAB G;  5J9P C;  4LFB B;  3CCE V;  2ZDI A; 
#chains in the Genus database with same CATH homology
 3CWB H;  1EZV H;  1L0N H;  1NTZ H;  2A06 H;  1BE3 H;  1KB9 F;  1PP9 H;  2BCC H;  3CXH F;  1SQP H;  3L71 H;  1SQX H;  5KLV H;  1KYO F;  1SQV H;  3L73 H;  1SQQ H;  2FYU H;  1PPJ H;  1NTK H;  3H1I H;  3CX5 F;  1P84 F;  3L74 H;  4D6T H;  2IBZ H;  1SQB H;  3H1J H;  3L72 H;  1BCC H;  4U3F H;  1BGY H;  3TGU H;  3L75 H;  3H1H H;  1L0L H;  3H1L H;  4PD4 F;  3BCC H;  1NU1 H;  1NTM H;  3H1K H;  3L70 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...