3CXHF

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3cxhF00
1SQXH 1SQQH 3H1LH 1SQBH 5KLVH 1NU1H 1P84F 3H1HH 3L74H 1KB9F 3L70H 1NTZH 2A06H 4PD4F 3H1IH 1EZVH 3H1KH 4D6TH 1NTMH 3CXHF 3L71H 3L73H 1SQVH 3TGUH 1BGYH 1BE3H 3CX5F 2FYUH 1KYOF 1L0LH 3L75H 2BCCH 1PPJH 1SQPH 3H1JH 1PP9H 1L0NH 3CWBH 3L72H 1BCCH 1NTKH 4U3FH 3BCCH 2IBZH
chains in the Genus database with same CATH superfamily
3T4DA 1SA0A 4UUJC 3E83A 4TV9B 1N33O 1QU7A 1K8AW 2YIDA 1YJNV 4X20B 5IY5B 4UCUA 2DYSB 5IYZB 5JJJB 1EN4A 2KB1A 3ABMB 3FD9A 3WG7B 3UQ8A 4J42A 3QF7A 3A2FA 4PI2A 5AG2A 1BCCH 1I7FA 4H0LB 1R3LC 3RVZA 4D7SA 1VQ9V 2XOKG 1W0JG 3BABA 1FXHA 1J95A 1S0VA 3L74H 4J7KA 2EILB 3RN4A 1VMGA 1SA0B 2YIBA 3JAKA 2ZNIA 5L3EA 2IM9A 1G8MA 4KP4A 3K9AA 4MVZA 3RWRD 2ZIOA 1FS0G 4EB6A 2IU0A 2ETNA 4G28B 3ML0A 4MVSA 1DF4A 2E75B 5LGTA 3D36C 3CCUV 4FLZA 1N0JA 1K34A 2ZR2A 5EIBC 2HR3A 4UB8Z 4D7TA 4F6RB 2NN4A 1FXVA 2JEUA 4JPRA 4J41A 1YJWV 4JGSA 5H6RA 3BHPA 3JAKB 1M1KW 4UFZA 1JQ0A 5CBFA 2B9ZA 3O9OA 4EFEA 2VQEB 4WFHA 3W7TA 4FM2A 2H8PC 2PYJA 4EB6B 4KHPB 3TK1A 1WPBA 5IE9A 3OAAG 5BR8B 3HR0A 3LSUA 4UCVA 3CP1A 4BIZA 5B1AC 1BZKA 1DF5A 2DYRB 1OZ0A 1QCEA 3PJSK 4X62B 4N21A 4CH6A 2JS5A 2CDYA 4LFAB 3JSLA 1ORQC 1QNMA 3G6EV 2X6BA 1W0KG 2OCHA 4FFBA 4W4KA 2E3CA 3E22A 4GX1A 1SQPH 3ASNC 1ROPA 1DTOA 1XNRB 2YC0A 4ZI7A 5B1BC 1LUVA 4NKGB 5KMGA 1VQ7V 1AI4A 2QGNA 3SPIA 3EHBB 3FX7A 1UFIA 3LDCA 3ZHQA 1YITV 1IURA 1Q7YW 5B3SB 1Q6HA 4JI2B 4FFBB 3VQVA 3E35A 3E22B 3CCEV 3N2GA 1VF6A 4YHHB 4L87A 2QM7A 4KFMA 2FTKA 1N32O 4ZI7B 1M56C 3CXHF 5JH7A 5KMGB 4MVRA 1XMOB 2EBOA 4UCOA 4BW9A 2QKSA 1VQPV 1HP8A 5IY5C 3N27A 4J9ZB 5B66Z 2YS8A 2LW1A 1MSWD 1IBMO 4J7JA 1BHAA 3UKMA 2DYSC 2QSAA 5H6QA 2PI4A 2F43G 1S3JA 1WP8A 4PD4F 4ZOLA 4RWUA 3SYAA 2ZXWB 3N2GB 4I50A 3ZHSA 4P30A 4MW3A 3VQYA 4MVQA 2KG7A 4CH4A 3U10A 1FYJA 3AG4C 4JYAB 5JH7B 1QR8A 1NT2B 1SQXH 3DTUB 3TXSA 3ZX6A 3N2KA 1IVSA 1GN6A 1YZBA 1ZX3A 4B3TB 3CRRA 3DC5A 5EC2C 1X4TA 1QLEB 3CEIA 1Z2GA 3EVKA 3OGCC 4RAIA 5IJ0A 2UU9B 4K3AA 4ZOLB 3B77A 1OCCB 4I50B 4NYKA 1R6NA 1RM1B 2KG7B 1EM1A 3CCQV 3E8BA 1E1QG 4WCEV 5IYDO 1LNQA 1M4UA 2ZINA 3N2KB 5EZYA 5CA1A 4DK0A 1WLEA 2QTSA 4DUZO 3CRMA 1YTFD 2UUBO 4GKKO 1PPJH 4GT1A 4IIJA 1YHQV 4UCSA 3SJCC 1N8RW 2ZCEA 1HNWB 4PA7A 5IJ0B 2A9HA 4DR7O 4JTCB 1MG1A 4MW8A 2QDOA 2UXCB 2IW5A 2DYRC 4JI0O 1H2KA 1PD3A 4LFCB 1XL4A 3JD4A 1RPRA 2ZE6A 4DV1B 2P6JA 1V9PA 1WB7A 5EZYB 4FVMA 5CA1B 1FKAO 1Q3EA 1XMQB 1FJGB 2ADPA 4B3MB 1NU1H 4AILC 4LF9B 2CTQA 1PNLA 1U96A 1MOFA 1TUBA 5KA6A 4B7KA 3H1KH 1SESA 1AROP 4P9PA 2IH3C 4FM1A 1BQ0A 4E2LA 5LGNA 2HJDA 3JD1A 3I55V 2RQ6A 3T1YB 4GCZA 3TJTA 2YI8A 2PF4E 4FM0A 4YJ3A 3K3WA 2HJFC 4NVPA 5EIBD 1EZJA 2EIJC 4B3RO 2Y0IA 3THOA 4JYCA 4LF8B 4D6TH 3SR2C 3F5WC 2HHHO 2BSKA 4ZBMA 3K5NA 2G38A 1TUBB 1N36B 2A7WA 3LUTB 2F4VO 1HR0O 1K4CC 4WFAV 1HDJA 1N33B 2N05A 1XBLA 2Q69A 4J7ZA 3FB8C 3MHHC 3AK3A 3CRAA 2GTSA 2Q7EA 1YIJV 1W2BU 4YJ3B 2CTRA 1QVGU 2D3OW 4DR4B 4H33A 2WLMA 3ZS8C 2KSDA 3H9VA 2Y0PA 1D5NA 4UV9A 3K04A 4JYYA 3CCMV 1IXMA 4QPJA 4YJ2A 4I9WA 2Q7HA 4DV4O 4TWKA 3FYEB 2JJ1G 2ZXWC 1ENVA 3HKCA 3ASOC 2X7RB 3CCSV 1FFTB 2AHZA 4ASUG 3CD6V 1YTFB 4MTGA 3QTCA 3IC7A 3S3WA 2GTAA 2CH7A 1PP9H 1L0NH 2P90A 1XOUA 4X64O 2QWOB 1M9NA 2PY5A 4XBFA 3H1LH 3HKBA 2HVJC 3I56V 2QKAA 4R7CA 2ZQMA 3CRQA 4GLXA 1WPXA 3D36A 4TUYA 4YJ2B 1BSMA 1EN6A 5JCOC 4MVOA 1MNGA 2RMKB 3HKCB 4FLTA 1RM1C 2WA4A 3H1JH 4JZ2A 3F7VC 4HBNA 2DE0X 1KKDA 3QG5A 1N34O 2A0LA 5KAIZ 2ILMA 2CH7B 5E79Z 1EBOA 4LBEC 3H1HH 4NB5A 4U3JA 2OT5A 4NXNB 2A06H 4O4HA 1R73A 4OPAA 4MTOA 2UUAO 1BGYH 3RYCA 2OCCB 1HWYA 2RJZA 4PA3A 4TUYB 4DR6O 1DLBA 5ITZA 1DGSA 2MK3A 4DV7O 1F23A 1IBKO 2JS3A 3CRCA 2PTMA 4LF6O 3JCZA 1Q86W 4JASA 3OUFA 5CN0A 4J9YB 4OX9O 3P3PA 4LP8A 1SQVH 4FZ0A 2ZDIC 3UO2A 4R6ZA 3RGBA 3J81N 4U3JB 5GTIZ 1VQ4V 2DN9A 4I7ZB 4ZHQA 1VIBA 4O4HB 4PA4A 5LA6A 4EFBA 1IX9A 3W7UA 1XQ8A 3BCCH 4CS2A 3D3IA 3RYCB 1QLNA 1KKCA 2QR4A 4CC6A 3OR6C 3GWOA 4DYLA 5B1AB 2PGGA 3A0BZ 3ZMVA 5ITZB 1WAZA 3ABLC 1XUQA 4ICGA 5GONA 4DO2A 1GM7A 3OMIB 1JMKC 4PJ0Z 4O2BA 1H2NA 2XAHA 1GRJA 2ADQB 2NNUA 4JF3A 1GN4A 1Y6XA 4JI4O 4JTAB 2Q6AA 2YIBD 1N32B 4ZHQB 5LA6B 3ASNB 4DV6O 2M7WA 3F7YC 3OTFA 4LNUA 4DK1A 5B1BB 1D5AA 1OCZB 4FLUA 1IBMB 1XI1A 3ZEDA 5LBQA 3JAWA 2QWPB 3FFQA 2ZKOA 4ABMA 3TCUA 5GONB 4LF4O 5B1OA 3JSNA 4O2BB 2RNBA 2JEXA 3L70H 3R66A 2ZM6O 1BMFG 1KMIZ 4JV5O 1GTOA 3IC9A 2QWRB 2ZNJA 3CX5F 2Y69C 3FAVA 3SYQA 2LO1A 1ZLZA 4LNUB 4KL1A 4G27B 1M56B 5B1NA 1SC5B 1F4NA 4UXNA 3OTOO 2A3QA 3JAWB 1NTZH 4QE7A 3E8FA 3SJAC 3G71V 1S77D 2RCVA 2Y4TA 2UXBB 3KCXA 5J2TA 1G6UA 2R9IA 3ZJZA 4QE9A 3GVMA 3K9SA 1PNMA 3OGIB 1NTKH 3T4ZA 3FAVB 4XDLA 4TOIA 3ABUA 2EZOA 1KECA 3NXSA 4NTYA 3AG4B 4F6RA 1S5LZ 3X2QB 4A5UB 4GKKB 4MS2A 1F4MA 1NJIW 1Z5WA 3DSQA 1KUQA 2Z0AA 4PDMA 3T1HB 3DC6A 2PUSA 5KUMA 5CB4B 3JALB 2QTOA 5J2TB 5LXTA 2D2CB 4DR7B 3A0HZ 3ZN1A 2OCCC 4JI0B 2M6YA 2EIMC 3BA8A 3JD0A 3DXRA 4DRXA 5LHHA 3L71H 4O4LA 3T1CA 1VQLV 1VQNV 4GKJO 2E5LO 1ZTEA 4J10A 3P30A 3W7XA 1JCHA 2K9PA 3U0ZA 3S3XA 3ETDA 3GWKC 1H2MA 3E89A 1X59A 3K57A 2OIGA 3BY6A 1XDCA 1SS3A 1XREA 1K4DC 1IDSA 3K08A 5LXTB 1VEWA 3JATA 2VWKA 2LQTA 1KD1W 3DXRB 3EXAA 4JAVA 4DRXB 4N23A 5KHJA 1EN5A 1OCOB 3LSQA 4O4LB 4WF9V 3IAYA 2AXTZ 4B3RB 1HNZO 1PKXA 4OGQB 3ZMUA 3APOA 2L35A 3CE2A 2RN9A 2X0LA 4FJCC 1Q6UA 4IT5A 1NTMH 3SPCA 1FAFA 1GH6A 4X66O 1YCIA 3ZBHA 2F4VB 1XNQO 5CMUA 1ZL8A 2JK5C 3B2EE 2CE4A 2ZT9B 3JATB 3ZRXA 3K0DA 1I94O 1KU9A 1BQZA 1YXBA 1HNXO 1NI8A 1OCZC 2LFRA 2WAMA 1IBLO 1KP2A 1BS3A 4JI7B 3B4SA 2ZE5A 4LH7A 1NH2B 2ZE8A 3JAMN 1WNSA 2DMXA 1GO3F 4W4LA 4NXMO 1KQSU 4LFBO 5B5EZ 2EIJB 4DV4B 3K5LA 4U7NA 1Q5OA 2CK3G 3ZN0A 4WFFA 2YI9A 1ZL8B 4AHCA 4JI6B 1A32A 1J5EB 2EJ7A 2Q73A 1BT8A 1EZVH 3VQXA 2XTAA 2VWJA 4PDVA 4DV0O 4QJFB 2QWQB 5LL6Y 1OCRC 4LWSA 4H37A 2XAFA 3IJ4A 2HVKC 2ZE7A 3BAAA 3J7AU 3JYCA 5JCOA 2OIEA 1PV0A 1SRYA 5FLXN 2XAGA 3ASOB 1N34B 5EBLC 5H9CA 1YVWA 1P7GA 3X2QC 3CC4V 4X89A 4B3SO 4Z2WA 3RYFA 4DUYO 2DQ3A 4RO2A 3RFRA 2YSUB 5J2UB 1BL8A 5C8YA 4DV3O 4CH5A 1RPOA 4DR1O 2UUAB 5LP6C 3ZCCA 5K1PA 1NR1A 3W7WA 4LWSB 1TVKA 2YEVA 4GX5A 3B40A 4K0KB 2HKOA 4JYBA 4DR6B 5D5QA 4RUEA 3GB7C 4DV7B 2BE3A 3K5OA 1OV9A 5H2FZ 1Y74A 5CBGA 3K06A 4LF6B 3CS5A 2GDSA 4ZKIA 4X65B 1XILA 3AK1A 4PI0A 5L3FA 1IXBA 5C93A 4OX9B 4YIPA 4P2ZA 2E76B 5BZBA 3STZC 3RYFB 1NBMG 5C8YB 2ZDIA 2VQFO 1Z5VA 1M90W 2QJ1A 1Y4MA 2IJHA 2ATKC 1TVKB 2YEVB 4U3FH 2EX3A 5EC1C 5EYPA 1Y74B 4I55A 4I4TA 1UPGA 3Q4HA 1OCOC 1EFRG 4TQFA 4YY3B 1FXKA 3MD0A 4JI4B 4O4IA 3CJHA 1TUEB 1S76D 3BA9A 1VQ5V 1NS1A 1VF7A 3QO7A 3SYCA 5CBHA 1H2GA 5KHIA 4WFEA 5EYPB 1MSDA 1B06A 3ZHRA 4NTWA 4QPKA 3D3QA 4I55B 4I4TB 4U7OA 3JARA 3Q4HB 3ABLB 3G6BA 1GM9A 2ZM6B 1AP5A 2BOCC 4JV5B 1CPYA 1AR1B 1FXKB 1GMGA 1H2LA 4O4IB 3CJHB 4UCTA 2A79B 4I5SA 4KHPO 1I5XA 5BR8O 1VQMV 1TAEA 2ITDC 4JI1O 2HG5C 2QKCA 2AHYA 3OTOB 3D8CA 1JVMA 3ETQA 2W0FC 3P32A 1G1XB 3JARB 3SPGA 5IDJA 4JI3O 1JA8A 2XNDG 1G4YB 2B1GA 1M57C 4NTXA 4PA9A 1V54B 2QEXV 1OHHG 1VARA 4EKWA 1YI2V 4X9QA 3OD4A 1I08A 4K8XA 2DWDC 3C90A 2Y69B 1VQOV 1R3IC 2IU3A 1AR5A 3MDSA 4CC5A 3LDDA 3E86A 4RQFA 2XAJA 2EIKB 3ZHTA 4K35A 2Q68A 3M99B 2FYUH 4UVCA 1Q82W 3G67A 3MAQA 2WA3A 2EINC 1K5QA 3ZRSA 2ZD9A 2UUCO 3B8MA 5LOVA 4JI2O 3C3TA 4YHHO 1WP7A 2XT9A 4PDRA 3FB5C 1M93A 5EBWC 4CH3A 3AG3C 4GKJB 2E5LB 3OMAB 1XMOO 2XUMA 4MVUA 4K8ZA 3K0GA 4LF5O 3OEHG 1V55B 2Q7GA 1JJ2U 1P84F 1SQGA 2JRIA 5A2QN 1P49A 1K3EA 1RSOA 4X1YA 2W6IG 4JAUA 4IYIA 5LMNO 2DJVA 2VS0A 5LOVB 1GKFA 4RQEA 1WJZA 3L75H 1JOYA 5L3DA 2EIMB 2Q67A 3WB2A 1HNZB 4OXSA 1K7DA 3RVYA 3RYIA 3SYPA 4BW5A 4FIPC 5KHKA 3R65A 1PL0A 1XNQB 3B09A 1RSOB 4X1YB 3HKEA 2YDEA 2IJIA 2N04A 1SETA 5BXZA 1IBLB 1HNXB 3LSSA 2B5UA 5GW7A 4BWAA 1JR9A 1AP6A 4JI5O 4MTXA 4TV8A 1D2DA 5JQGA 2DOSA 5FL7G 4NXMB 4LFBB 3RYIB 3OE7G 4KUMA 4BIOA 3CPWU 2WLNA 1N36O 1Y66A 3AK2A 1FXKC 4R50A 4J11A 1ZAUA 2DQ0A 1F7YA 4DV2O 3CC2V 4LCUC 3HKEB 5KA5A 5F2VO 2F95B 1AILA 3H01A 1BHBA 2FL4A 2YXHA 3RYHA 3E2EA 2JVDA 2RDCA 4TV8B 5JQGB 2WWWA 3M8AA 1S5HC 4PDLA 5IYBO 4DV1O 2IJKA 4QNHB 1Q43A 1SQBH 1K33A 5L3BA 2V7QG 1V54C 1FJGO 1NVPD 2CUGA 3W7SA 3AG2C 4DXWA 3OW2U 3A0RA 2N74A 1W59A 1VF5B 4AQYO 3B8NA 2FB5A 1IZ3A 2Q0OC 3HPLC 2R9AA 3JD3A 2EIKC 3T1YO 1JJOA 3PN1A 3RYHB 2ODMA 4FLWA 5KLVH 4EEQA 4DR1B 4DV5O 4KXRA 2BTQA 1NR7A 1URFA 4P9OA 2Z5UA 2X6AA 1FFXA 1SKVA 5LP6A 1OCRB 2NR5A 4CBCA 5CB4A 1PNKA 3JALA 3OUSA 1NH2D 4IGGA 1E79G 1AI6A 1R6TA 5L3CA 1SERA 1YDXA 2WLIA 5JVDA 2OYQA 1Q90D 3SGIA 2IBZH 5E1AC 1K9MW 1NQTA 1XL6A 2F23A 1TA8A 2P4KA 1NZ6A 5JWPA 1KB9F 3H1IH 1L1FA 2VQFB 4DUZB 3L73H 3WFVA 2UUBB 2YXYA 2BTQB 4HYOA 3KZIZ 1V55C 3UT5A 1R3JC 1UJWB 4DR4O 1US6A 2GV9A 1FFXB 5LP6B 2UXDO 2EJRA 4CS3A 2JIZG 2LGWA 4BIUA 1T5EA 3VOUA 1AJQA 4X88A 2WLIB 5JVDB 4DR2O 4GX2A 2F66C 2V1DA 3O65A 1L0LH 4WBNA 3CMAV 1P7BA 2R9RB 3C3SA 1SZXA 3ICXA 1MA1A 1CEZA 1B6QA 3UT5B 1H8EG 2P4VA 5J9PC 5IWAO 1I5YA 1YJ9V 3OFNG 5GTHZ 1QQCA 2PZSA 4XDJA 1O9HA 3G4SV 2ITCC 4UB6Z 1THZA 2WLKA 5LHIA 4WFBV 3CCVV 4JAAA 1RFYA 1NVPB 4WBNB 3ZRVA 2H94A 3IGAC 2F1MA 3G80A 2HHHB 4NXNO 3AEIA 4QIWF 3CXCU 2LW7A 1SF9A 2YICA 1WA8A 4JI1B 1MMMA 2HLDG 2P5OA 1HR0B 2OWOA 4NR1A 4LF7O 1VQKV 4IYHA 1QR9A 3HKDA 4DR3O 2MW2B 4AI8A 4JI3B 5JJNB 2R72A 1VQ6V 1KP3A 5CA0A 3K03A 1KC8W 2CTPA 4YXWG 3TETA 5K1XA 3BFRA 4Z1MG 1MZEA 1ZSPA 2BCCH 4R8CA 3WU2Z 4DW0A 3CWBH 3L72H 2AGAA 1Q6IA 3CB2A 4ZIBA 5FPOA 2Q8VA 1WA8B 3APQA 4B08A 2WLHA 3CYOA 1GN2A 1VP7A 5L3GA 2LGQA 4F6EA 4BAYA 3HKDB 2P06A 5EBMC 4Q20A 4LH6A 4PELA 5LMUO 4MSWC 3FKSG 2CTWA 5CA0B 3TXQA 1WN7A 4X64B 1SZTA 2Q9LA 5CA3A 5J2UA 2UUCB 1M57B 2VRZA 2KQXA 4B7EA 4PHZA 3BVOA 1GAXA 1FD9A 5TISZ 4O4JA 2EZPA 3KCYA 1KYOF 1OJHA 2XAQA 4LF5B 3SJBC 2HFEC 3L9DA 2WLLA 1SQQH 2HP8A 3ABMC 5LMNB 4GYCB 1H2SB 4FPPA 4FK5C 3WG7C 1KBHA 4JZGA 2GUZA 2EINB 3OMNB 1Y67A 2Q0AA 2LFSA 2QM4A 4DR5O 4O2AA 1AR4A 4JI8O 1N4CA 3SJQC 4FLYA 4HNAA 1IBKB 3ZMZA 2EILC 4O4JB 2X6CA 3ZRWA 3M7MX 3AG3B 3J80N 1B3QA 2P67A 2WLLB 4E4EA 4XDKA 4F4LA 3LNMB 4PV1B 1DK1A 1BE3H 2UXBO 2GUZB 1R3KC 2JDIG 3FB7C 1QVFU 1CXZB 3SPHA 2V4DA 3FB6C 3ETEA 4YIOA 4O2AB 4JI5B 1QHTA 3OT7A 5H5NA 3ABKB 4GZRB 3UCSC 4UVBA 4HNAB 2AW9A 3OEEG 4IHJA 1N0NA 3ZRWB 1HW7A 5FNVA 2Z3YA 3A8TA 3LNNA 3E8HA 1H38A 3ABTA 5DECA 4DV2B 3T1HO 4G2KA 2DWEC 1K73W 1H8HG 3AG1B 4X1KA 4TSFG 2AZ0A 4DV6B 3MHSC 2Q4PA 5LHGA 4X1IA 2WLJA 2QM8A 4FMTA 3K58A 3OM3B 1AJNA 3CCLV 1K92A 1LUWA 3OR7C 5HFMA 4IHJB 3BRCA 3SDLA 2OTLV 5FNVB 4LF4B 2PI5A 3CHXA 1K97A 2JJ2G 4IIJB 3KKYA 2Y48A 2B1IA 5KUKA 2YXLA 4UV8A 2GSMB 1JFFA 4AQYB 2VQEO 4X1KB 4UCRA 2H3OA 3TGUH 4H13B 2GHYA 2ZR3A 3KG2A 4QGPA 3ZMSA 4X1IB 3ZIAG 4DV5B 1Q81W 1AJPA 1YF2A 1JPXA 2UXXA 2W0XA 4X62O 4TQDA 3ZMTA 1AVMA 2QWNB 4LFAO 3HB3B 3IFXA 3FYIB 5B3SC 5FPRA 2XASA 2EULA 3UO3A 2YIAA 4CS4A 4Z1VA 1YSCA 1ZUQA 3ZHVA 5IYCO 1JFFB 2LP7A 3AG2B 3E8GA 2GBOA 5KX5A 3EFFK 4MT8A 4X8AA 1XNRO 4MVMA 5A9GA 3CSXA 1SQFA 4JI7O 3QO8A 2FKXA 5IJ9A 2LJ2A 3CC7V 1XHZA 1U97A 5JJEB 2UXDB 2DW4A 2CAZC 3JASA 2QE7G 1QBZA 2BSKB 2L6LA 3JCUZ 2PYLA 3SYOA 3AG7A 3SPJA 1VF6C 4DR2B 4RUFA 3VBBA 2BOBC 3WB0A 4JI6O 1LR1A 5KX5B 1J5EO 2YUAA 2ARHA 3I5DA 2O57A 4LC1A 2BTOA 5IT9N 4MTFA 3QO5A 5IJ9B 4IL6Z 4I0XA 4HAMA 4GX0A 2K1EA 1NKDA 1XEQA 1Y76A 5IWAB 2JGUA 1WB8A 1VQ8V 1QLEC 3JASB 2AZ2A 2UXNA 3T2MA 1L8DA 2CGOA 1OCCC 2QA4V 4FFKA 4HZ3A 3ZHUA 3WB1A 1S72V 1AI7A 3ABKC 1FPOA 4UVAA 5BMVA 4JYAO 1TGOA 2XHBA 5D5PA 4I0XB 5HFLA 3LDEA 3HKBB 3CCRV 3UM7A 1CP9A 1Y76B 1COWG 4X66B 4B3TO 3STLC 3AG1C 4LR3A 4LF7B 4K0KO 3BPZA 1GM8A 5EK0A 3P3NA 4DR3B 1I94B 3F5TA 2UU9O 2P22C 4FLXA 4TT3G 1B04A 2F93B 3K59A 1PM9A 2HEPA 1GN3A 1O9GA 4X65O 2Q5ZA 2FMLA 2R70A 5DM6V 4FLVA 4PA6A 5BMVB 5KHGA 5LYJA 5DN6G 2JGDA 4I9QA 1YEWA 3QVNA 4J80A 4CZZA 2NLJC 1MZFA 1R6KA 5BY1A 1HNWO 5LGUA 2E74B 2WPDG 5LMUB 1K5SA 1XHXA 1P4RA 2UXCO 3BEHA 2Y4UA 4LFCO 4DV0B 2OTJV 4YY3O 3K79A 5LYJB 1I0HA 2JGDB 2IJJA 1ZWIC 1RP3B 2P7TC 2W6JG 1XMQO 4B3MO 1AB3A 3RW0A 4C7UA 3K5MA 4LF9O 4H44B 2IH1C 2CGNA 5DEDA 3DGEA 4GUNA 1AI5A 4TV9A 1F51A 1R1BA 4B3SB 4X20A 5KAFZ 3RT3C 3U11A 4DUYB 4L8JA 4WFGA 2C2AA 3NR7A 1Q8IA 5IYZA 4DV3B 4BR6A 3JD2A 5KHHA 1JX9A 3RBZA 3CMEV 4DR5B 2ZIMA 1M5IA 3VQWA 1E1RG 4JI8B 1GK9A 4OPHA 1PL4A 3CCJV 4DW1A 4Q6GA 3QNEA 4LF8O 1S5JA 2WSSG 2KKWA 4JTDB 4FZ1A 3ETGA 1MABG
chains in the Genus database with same CATH topology
1SQXH 1SQQH 3H1LH 1SQBH 5KLVH 1NU1H 1P84F 3H1HH 3L74H 1KB9F 3L70H 1NTZH 2A06H 4PD4F 3H1IH 1EZVH 3H1KH 4D6TH 1NTMH 3CXHF 3L71H 3L73H 1SQVH 3TGUH 1BGYH 1BE3H 3CX5F 2FYUH 1KYOF 1L0LH 3L75H 2BCCH 1PPJH 1SQPH 3H1JH 1PP9H 1L0NH 3CWBH 3L72H 1BCCH 1NTKH 4U3FH 3BCCH 2IBZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX H;  1SQQ H;  3H1L H;  1SQB H;  5KLV H;  1NU1 H;  1P84 F;  3H1H H;  3L74 H;  1KB9 F;  3L70 H;  1NTZ H;  2A06 H;  4PD4 F;  3H1I H;  1EZV H;  3H1K H;  4D6T H;  1NTM H;  3CXH F;  3L71 H;  3L73 H;  1SQV H;  3TGU H;  1BGY H;  1BE3 H;  3CX5 F;  2FYU H;  1KYO F;  1L0L H;  3L75 H;  2BCC H;  1PPJ H;  1SQP H;  3H1J H;  1PP9 H;  1L0N H;  3CWB H;  3L72 H;  1BCC H;  1NTK H;  4U3F H;  3BCC H;  2IBZ H; 
#chains in the Genus database with same CATH topology
 3T4D A;  1SA0 A;  4UUJ C;  3E83 A;  4TV9 B;  1N33 O;  1QU7 A;  1K8A W;  2YID A;  1YJN V;  4X20 B;  5IY5 B;  4UCU A;  2DYS B;  5IYZ B;  5JJJ B;  1EN4 A;  2KB1 A;  3ABM B;  3FD9 A;  3WG7 B;  3UQ8 A;  4J42 A;  3QF7 A;  3A2F A;  4PI2 A;  5AG2 A;  1BCC H;  1I7F A;  4H0L B;  1R3L C;  3RVZ A;  4D7S A;  1VQ9 V;  2XOK G;  1W0J G;  3BAB A;  1FXH A;  1J95 A;  1S0V A;  3L74 H;  4J7K A;  2EIL B;  3RN4 A;  1VMG A;  1SA0 B;  2YIB A;  3JAK A;  2ZNI A;  5L3E A;  2IM9 A;  1G8M A;  4KP4 A;  3K9A A;  4MVZ A;  3RWR D;  2ZIO A;  1FS0 G;  4EB6 A;  2IU0 A;  2ETN A;  4G28 B;  3ML0 A;  4MVS A;  1DF4 A;  2E75 B;  5LGT A;  3D36 C;  3CCU V;  4FLZ A;  1N0J A;  1K34 A;  2ZR2 A;  5EIB C;  2HR3 A;  4UB8 Z;  4D7T A;  4F6R B;  2NN4 A;  1FXV A;  2JEU A;  4JPR A;  4J41 A;  1YJW V;  4JGS A;  5H6R A;  3BHP A;  3JAK B;  1M1K W;  4UFZ A;  1JQ0 A;  5CBF A;  2B9Z A;  3O9O A;  4EFE A;  2VQE B;  4WFH A;  3W7T A;  4FM2 A;  2H8P C;  2PYJ A;  4EB6 B;  4KHP B;  3TK1 A;  1WPB A;  5IE9 A;  3OAA G;  5BR8 B;  3HR0 A;  3LSU A;  4UCV A;  3CP1 A;  4BIZ A;  5B1A C;  1BZK A;  1DF5 A;  2DYR B;  1OZ0 A;  1QCE A;  3PJS K;  4X62 B;  4N21 A;  4CH6 A;  2JS5 A;  2CDY A;  4LFA B;  3JSL A;  1ORQ C;  1QNM A;  3G6E V;  2X6B A;  1W0K G;  2OCH A;  4FFB A;  4W4K A;  2E3C A;  3E22 A;  4GX1 A;  1SQP H;  3ASN C;  1ROP A;  1DTO A;  1XNR B;  2YC0 A;  4ZI7 A;  5B1B C;  1LUV A;  4NKG B;  5KMG A;  1VQ7 V;  1AI4 A;  2QGN A;  3SPI A;  3EHB B;  3FX7 A;  1UFI A;  3LDC A;  3ZHQ A;  1YIT V;  1IUR A;  1Q7Y W;  5B3S B;  1Q6H A;  4JI2 B;  4FFB B;  3VQV A;  3E35 A;  3E22 B;  3CCE V;  3N2G A;  1VF6 A;  4YHH B;  4L87 A;  2QM7 A;  4KFM A;  2FTK A;  1N32 O;  4ZI7 B;  1M56 C;  3CXH F;  5JH7 A;  5KMG B;  4MVR A;  1XMO B;  2EBO A;  4UCO A;  4BW9 A;  2QKS A;  1VQP V;  1HP8 A;  5IY5 C;  3N27 A;  4J9Z B;  5B66 Z;  2YS8 A;  2LW1 A;  1MSW D;  1IBM O;  4J7J A;  1BHA A;  3UKM A;  2DYS C;  2QSA A;  5H6Q A;  2PI4 A;  2F43 G;  1S3J A;  1WP8 A;  4PD4 F;  4ZOL A;  4RWU A;  3SYA A;  2ZXW B;  3N2G B;  4I50 A;  3ZHS A;  4P30 A;  4MW3 A;  3VQY A;  4MVQ A;  2KG7 A;  4CH4 A;  3U10 A;  1FYJ A;  3AG4 C;  4JYA B;  5JH7 B;  1QR8 A;  1NT2 B;  1SQX H;  3DTU B;  3TXS A;  3ZX6 A;  3N2K A;  1IVS A;  1GN6 A;  1YZB A;  1ZX3 A;  4B3T B;  3CRR A;  3DC5 A;  5EC2 C;  1X4T A;  1QLE B;  3CEI A;  1Z2G A;  3EVK A;  3OGC C;  4RAI A;  5IJ0 A;  2UU9 B;  4K3A A;  4ZOL B;  3B77 A;  1OCC B;  4I50 B;  4NYK A;  1R6N A;  1RM1 B;  2KG7 B;  1EM1 A;  3CCQ V;  3E8B A;  1E1Q G;  4WCE V;  5IYD O;  1LNQ A;  1M4U A;  2ZIN A;  3N2K B;  5EZY A;  5CA1 A;  4DK0 A;  1WLE A;  2QTS A;  4DUZ O;  3CRM A;  1YTF D;  2UUB O;  4GKK O;  1PPJ H;  4GT1 A;  4IIJ A;  1YHQ V;  4UCS A;  3SJC C;  1N8R W;  2ZCE A;  1HNW B;  4PA7 A;  5IJ0 B;  2A9H A;  4DR7 O;  4JTC B;  1MG1 A;  4MW8 A;  2QDO A;  2UXC B;  2IW5 A;  2DYR C;  4JI0 O;  1H2K A;  1PD3 A;  4LFC B;  1XL4 A;  3JD4 A;  1RPR A;  2ZE6 A;  4DV1 B;  2P6J A;  1V9P A;  1WB7 A;  5EZY B;  4FVM A;  5CA1 B;  1FKA O;  1Q3E A;  1XMQ B;  1FJG B;  2ADP A;  4B3M B;  1NU1 H;  4AIL C;  4LF9 B;  2CTQ A;  1PNL A;  1U96 A;  1MOF A;  1TUB A;  5KA6 A;  4B7K A;  3H1K H;  1SES A;  1ARO P;  4P9P A;  2IH3 C;  4FM1 A;  1BQ0 A;  4E2L A;  5LGN A;  2HJD A;  3JD1 A;  3I55 V;  2RQ6 A;  3T1Y B;  4GCZ A;  3TJT A;  2YI8 A;  2PF4 E;  4FM0 A;  4YJ3 A;  3K3W A;  2HJF C;  4NVP A;  5EIB D;  1EZJ A;  2EIJ C;  4B3R O;  2Y0I A;  3THO A;  4JYC A;  4LF8 B;  4D6T H;  3SR2 C;  3F5W C;  2HHH O;  2BSK A;  4ZBM A;  3K5N A;  2G38 A;  1TUB B;  1N36 B;  2A7W A;  3LUT B;  2F4V O;  1HR0 O;  1K4C C;  4WFA V;  1HDJ A;  1N33 B;  2N05 A;  1XBL A;  2Q69 A;  4J7Z A;  3FB8 C;  3MHH C;  3AK3 A;  3CRA A;  2GTS A;  2Q7E A;  1YIJ V;  1W2B U;  4YJ3 B;  2CTR A;  1QVG U;  2D3O W;  4DR4 B;  4H33 A;  2WLM A;  3ZS8 C;  2KSD A;  3H9V A;  2Y0P A;  1D5N A;  4UV9 A;  3K04 A;  4JYY A;  3CCM V;  1IXM A;  4QPJ A;  4YJ2 A;  4I9W A;  2Q7H A;  4DV4 O;  4TWK A;  3FYE B;  2JJ1 G;  2ZXW C;  1ENV A;  3HKC A;  3ASO C;  2X7R B;  3CCS V;  1FFT B;  2AHZ A;  4ASU G;  3CD6 V;  1YTF B;  4MTG A;  3QTC A;  3IC7 A;  3S3W A;  2GTA A;  2CH7 A;  1PP9 H;  1L0N H;  2P90 A;  1XOU A;  4X64 O;  2QWO B;  1M9N A;  2PY5 A;  4XBF A;  3H1L H;  3HKB A;  2HVJ C;  3I56 V;  2QKA A;  4R7C A;  2ZQM A;  3CRQ A;  4GLX A;  1WPX A;  3D36 A;  4TUY A;  4YJ2 B;  1BSM A;  1EN6 A;  5JCO C;  4MVO A;  1MNG A;  2RMK B;  3HKC B;  4FLT A;  1RM1 C;  2WA4 A;  3H1J H;  4JZ2 A;  3F7V C;  4HBN A;  2DE0 X;  1KKD A;  3QG5 A;  1N34 O;  2A0L A;  5KAI Z;  2ILM A;  2CH7 B;  5E79 Z;  1EBO A;  4LBE C;  3H1H H;  4NB5 A;  4U3J A;  2OT5 A;  4NXN B;  2A06 H;  4O4H A;  1R73 A;  4OPA A;  4MTO A;  2UUA O;  1BGY H;  3RYC A;  2OCC B;  1HWY A;  2RJZ A;  4PA3 A;  4TUY B;  4DR6 O;  1DLB A;  5ITZ A;  1DGS A;  2MK3 A;  4DV7 O;  1F23 A;  1IBK O;  2JS3 A;  3CRC A;  2PTM A;  4LF6 O;  3JCZ A;  1Q86 W;  4JAS A;  3OUF A;  5CN0 A;  4J9Y B;  4OX9 O;  3P3P A;  4LP8 A;  1SQV H;  4FZ0 A;  2ZDI C;  3UO2 A;  4R6Z A;  3RGB A;  3J81 N;  4U3J B;  5GTI Z;  1VQ4 V;  2DN9 A;  4I7Z B;  4ZHQ A;  1VIB A;  4O4H B;  4PA4 A;  5LA6 A;  4EFB A;  1IX9 A;  3W7U A;  1XQ8 A;  3BCC H;  4CS2 A;  3D3I A;  3RYC B;  1QLN A;  1KKC A;  2QR4 A;  4CC6 A;  3OR6 C;  3GWO A;  4DYL A;  5B1A B;  2PGG A;  3A0B Z;  3ZMV A;  5ITZ B;  1WAZ A;  3ABL C;  1XUQ A;  4ICG A;  5GON A;  4DO2 A;  1GM7 A;  3OMI B;  1JMK C;  4PJ0 Z;  4O2B A;  1H2N A;  2XAH A;  1GRJ A;  2ADQ B;  2NNU A;  4JF3 A;  1GN4 A;  1Y6X A;  4JI4 O;  4JTA B;  2Q6A A;  2YIB D;  1N32 B;  4ZHQ B;  5LA6 B;  3ASN B;  4DV6 O;  2M7W A;  3F7Y C;  3OTF A;  4LNU A;  4DK1 A;  5B1B B;  1D5A A;  1OCZ B;  4FLU A;  1IBM B;  1XI1 A;  3ZED A;  5LBQ A;  3JAW A;  2QWP B;  3FFQ A;  2ZKO A;  4ABM A;  3TCU A;  5GON B;  4LF4 O;  5B1O A;  3JSN A;  4O2B B;  2RNB A;  2JEX A;  3L70 H;  3R66 A;  2ZM6 O;  1BMF G;  1KMI Z;  4JV5 O;  1GTO A;  3IC9 A;  2QWR B;  2ZNJ A;  3CX5 F;  2Y69 C;  3FAV A;  3SYQ A;  2LO1 A;  1ZLZ A;  4LNU B;  4KL1 A;  4G27 B;  1M56 B;  5B1N A;  1SC5 B;  1F4N A;  4UXN A;  3OTO O;  2A3Q A;  3JAW B;  1NTZ H;  4QE7 A;  3E8F A;  3SJA C;  3G71 V;  1S77 D;  2RCV A;  2Y4T A;  2UXB B;  3KCX A;  5J2T A;  1G6U A;  2R9I A;  3ZJZ A;  4QE9 A;  3GVM A;  3K9S A;  1PNM A;  3OGI B;  1NTK H;  3T4Z A;  3FAV B;  4XDL A;  4TOI A;  3ABU A;  2EZO A;  1KEC A;  3NXS A;  4NTY A;  3AG4 B;  4F6R A;  1S5L Z;  3X2Q B;  4A5U B;  4GKK B;  4MS2 A;  1F4M A;  1NJI W;  1Z5W A;  3DSQ A;  1KUQ A;  2Z0A A;  4PDM A;  3T1H B;  3DC6 A;  2PUS A;  5KUM A;  5CB4 B;  3JAL B;  2QTO A;  5J2T B;  5LXT A;  2D2C B;  4DR7 B;  3A0H Z;  3ZN1 A;  2OCC C;  4JI0 B;  2M6Y A;  2EIM C;  3BA8 A;  3JD0 A;  3DXR A;  4DRX A;  5LHH A;  3L71 H;  4O4L A;  3T1C A;  1VQL V;  1VQN V;  4GKJ O;  2E5L O;  1ZTE A;  4J10 A;  3P30 A;  3W7X A;  1JCH A;  2K9P A;  3U0Z A;  3S3X A;  3ETD A;  3GWK C;  1H2M A;  3E89 A;  1X59 A;  3K57 A;  2OIG A;  3BY6 A;  1XDC A;  1SS3 A;  1XRE A;  1K4D C;  1IDS A;  3K08 A;  5LXT B;  1VEW A;  3JAT A;  2VWK A;  2LQT A;  1KD1 W;  3DXR B;  3EXA A;  4JAV A;  4DRX B;  4N23 A;  5KHJ A;  1EN5 A;  1OCO B;  3LSQ A;  4O4L B;  4WF9 V;  3IAY A;  2AXT Z;  4B3R B;  1HNZ O;  1PKX A;  4OGQ B;  3ZMU A;  3APO A;  2L35 A;  3CE2 A;  2RN9 A;  2X0L A;  4FJC C;  1Q6U A;  4IT5 A;  1NTM H;  3SPC A;  1FAF A;  1GH6 A;  4X66 O;  1YCI A;  3ZBH A;  2F4V B;  1XNQ O;  5CMU A;  1ZL8 A;  2JK5 C;  3B2E E;  2CE4 A;  2ZT9 B;  3JAT B;  3ZRX A;  3K0D A;  1I94 O;  1KU9 A;  1BQZ A;  1YXB A;  1HNX O;  1NI8 A;  1OCZ C;  2LFR A;  2WAM A;  1IBL O;  1KP2 A;  1BS3 A;  4JI7 B;  3B4S A;  2ZE5 A;  4LH7 A;  1NH2 B;  2ZE8 A;  3JAM N;  1WNS A;  2DMX A;  1GO3 F;  4W4L A;  4NXM O;  1KQS U;  4LFB O;  5B5E Z;  2EIJ B;  4DV4 B;  3K5L A;  4U7N A;  1Q5O A;  2CK3 G;  3ZN0 A;  4WFF A;  2YI9 A;  1ZL8 B;  4AHC A;  4JI6 B;  1A32 A;  1J5E B;  2EJ7 A;  2Q73 A;  1BT8 A;  1EZV H;  3VQX A;  2XTA A;  2VWJ A;  4PDV A;  4DV0 O;  4QJF B;  2QWQ B;  5LL6 Y;  1OCR C;  4LWS A;  4H37 A;  2XAF A;  3IJ4 A;  2HVK C;  2ZE7 A;  3BAA A;  3J7A U;  3JYC A;  5JCO A;  2OIE A;  1PV0 A;  1SRY A;  5FLX N;  2XAG A;  3ASO B;  1N34 B;  5EBL C;  5H9C A;  1YVW A;  1P7G A;  3X2Q C;  3CC4 V;  4X89 A;  4B3S O;  4Z2W A;  3RYF A;  4DUY O;  2DQ3 A;  4RO2 A;  3RFR A;  2YSU B;  5J2U B;  1BL8 A;  5C8Y A;  4DV3 O;  4CH5 A;  1RPO A;  4DR1 O;  2UUA B;  5LP6 C;  3ZCC A;  5K1P A;  1NR1 A;  3W7W A;  4LWS B;  1TVK A;  2YEV A;  4GX5 A;  3B40 A;  4K0K B;  2HKO A;  4JYB A;  4DR6 B;  5D5Q A;  4RUE A;  3GB7 C;  4DV7 B;  2BE3 A;  3K5O A;  1OV9 A;  5H2F Z;  1Y74 A;  5CBG A;  3K06 A;  4LF6 B;  3CS5 A;  2GDS A;  4ZKI A;  4X65 B;  1XIL A;  3AK1 A;  4PI0 A;  5L3F A;  1IXB A;  5C93 A;  4OX9 B;  4YIP A;  4P2Z A;  2E76 B;  5BZB A;  3STZ C;  3RYF B;  1NBM G;  5C8Y B;  2ZDI A;  2VQF O;  1Z5V A;  1M90 W;  2QJ1 A;  1Y4M A;  2IJH A;  2ATK C;  1TVK B;  2YEV B;  4U3F H;  2EX3 A;  5EC1 C;  5EYP A;  1Y74 B;  4I55 A;  4I4T A;  1UPG A;  3Q4H A;  1OCO C;  1EFR G;  4TQF A;  4YY3 B;  1FXK A;  3MD0 A;  4JI4 B;  4O4I A;  3CJH A;  1TUE B;  1S76 D;  3BA9 A;  1VQ5 V;  1NS1 A;  1VF7 A;  3QO7 A;  3SYC A;  5CBH A;  1H2G A;  5KHI A;  4WFE A;  5EYP B;  1MSD A;  1B06 A;  3ZHR A;  4NTW A;  4QPK A;  3D3Q A;  4I55 B;  4I4T B;  4U7O A;  3JAR A;  3Q4H B;  3ABL B;  3G6B A;  1GM9 A;  2ZM6 B;  1AP5 A;  2BOC C;  4JV5 B;  1CPY A;  1AR1 B;  1FXK B;  1GMG A;  1H2L A;  4O4I B;  3CJH B;  4UCT A;  2A79 B;  4I5S A;  4KHP O;  1I5X A;  5BR8 O;  1VQM V;  1TAE A;  2ITD C;  4JI1 O;  2HG5 C;  2QKC A;  2AHY A;  3OTO B;  3D8C A;  1JVM A;  3ETQ A;  2W0F C;  3P32 A;  1G1X B;  3JAR B;  3SPG A;  5IDJ A;  4JI3 O;  1JA8 A;  2XND G;  1G4Y B;  2B1G A;  1M57 C;  4NTX A;  4PA9 A;  1V54 B;  2QEX V;  1OHH G;  1VAR A;  4EKW A;  1YI2 V;  4X9Q A;  3OD4 A;  1I08 A;  4K8X A;  2DWD C;  3C90 A;  2Y69 B;  1VQO V;  1R3I C;  2IU3 A;  1AR5 A;  3MDS A;  4CC5 A;  3LDD A;  3E86 A;  4RQF A;  2XAJ A;  2EIK B;  3ZHT A;  4K35 A;  2Q68 A;  3M99 B;  2FYU H;  4UVC A;  1Q82 W;  3G67 A;  3MAQ A;  2WA3 A;  2EIN C;  1K5Q A;  3ZRS A;  2ZD9 A;  2UUC O;  3B8M A;  5LOV A;  4JI2 O;  3C3T A;  4YHH O;  1WP7 A;  2XT9 A;  4PDR A;  3FB5 C;  1M93 A;  5EBW C;  4CH3 A;  3AG3 C;  4GKJ B;  2E5L B;  3OMA B;  1XMO O;  2XUM A;  4MVU A;  4K8Z A;  3K0G A;  4LF5 O;  3OEH G;  1V55 B;  2Q7G A;  1JJ2 U;  1P84 F;  1SQG A;  2JRI A;  5A2Q N;  1P49 A;  1K3E A;  1RSO A;  4X1Y A;  2W6I G;  4JAU A;  4IYI A;  5LMN O;  2DJV A;  2VS0 A;  5LOV B;  1GKF A;  4RQE A;  1WJZ A;  3L75 H;  1JOY A;  5L3D A;  2EIM B;  2Q67 A;  3WB2 A;  1HNZ B;  4OXS A;  1K7D A;  3RVY A;  3RYI A;  3SYP A;  4BW5 A;  4FIP C;  5KHK A;  3R65 A;  1PL0 A;  1XNQ B;  3B09 A;  1RSO B;  4X1Y B;  3HKE A;  2YDE A;  2IJI A;  2N04 A;  1SET A;  5BXZ A;  1IBL B;  1HNX B;  3LSS A;  2B5U A;  5GW7 A;  4BWA A;  1JR9 A;  1AP6 A;  4JI5 O;  4MTX A;  4TV8 A;  1D2D A;  5JQG A;  2DOS A;  5FL7 G;  4NXM B;  4LFB B;  3RYI B;  3OE7 G;  4KUM A;  4BIO A;  3CPW U;  2WLN A;  1N36 O;  1Y66 A;  3AK2 A;  1FXK C;  4R50 A;  4J11 A;  1ZAU A;  2DQ0 A;  1F7Y A;  4DV2 O;  3CC2 V;  4LCU C;  3HKE B;  5KA5 A;  5F2V O;  2F95 B;  1AIL A;  3H01 A;  1BHB A;  2FL4 A;  2YXH A;  3RYH A;  3E2E A;  2JVD A;  2RDC A;  4TV8 B;  5JQG B;  2WWW A;  3M8A A;  1S5H C;  4PDL A;  5IYB O;  4DV1 O;  2IJK A;  4QNH B;  1Q43 A;  1SQB H;  1K33 A;  5L3B A;  2V7Q G;  1V54 C;  1FJG O;  1NVP D;  2CUG A;  3W7S A;  3AG2 C;  4DXW A;  3OW2 U;  3A0R A;  2N74 A;  1W59 A;  1VF5 B;  4AQY O;  3B8N A;  2FB5 A;  1IZ3 A;  2Q0O C;  3HPL C;  2R9A A;  3JD3 A;  2EIK C;  3T1Y O;  1JJO A;  3PN1 A;  3RYH B;  2ODM A;  4FLW A;  5KLV H;  4EEQ A;  4DR1 B;  4DV5 O;  4KXR A;  2BTQ A;  1NR7 A;  1URF A;  4P9O A;  2Z5U A;  2X6A A;  1FFX A;  1SKV A;  5LP6 A;  1OCR B;  2NR5 A;  4CBC A;  5CB4 A;  1PNK A;  3JAL A;  3OUS A;  1NH2 D;  4IGG A;  1E79 G;  1AI6 A;  1R6T A;  5L3C A;  1SER A;  1YDX A;  2WLI A;  5JVD A;  2OYQ A;  1Q90 D;  3SGI A;  2IBZ H;  5E1A C;  1K9M W;  1NQT A;  1XL6 A;  2F23 A;  1TA8 A;  2P4K A;  1NZ6 A;  5JWP A;  1KB9 F;  3H1I H;  1L1F A;  2VQF B;  4DUZ B;  3L73 H;  3WFV A;  2UUB B;  2YXY A;  2BTQ B;  4HYO A;  3KZI Z;  1V55 C;  3UT5 A;  1R3J C;  1UJW B;  4DR4 O;  1US6 A;  2GV9 A;  1FFX B;  5LP6 B;  2UXD O;  2EJR A;  4CS3 A;  2JIZ G;  2LGW A;  4BIU A;  1T5E A;  3VOU A;  1AJQ A;  4X88 A;  2WLI B;  5JVD B;  4DR2 O;  4GX2 A;  2F66 C;  2V1D A;  3O65 A;  1L0L H;  4WBN A;  3CMA V;  1P7B A;  2R9R B;  3C3S A;  1SZX A;  3ICX A;  1MA1 A;  1CEZ A;  1B6Q A;  3UT5 B;  1H8E G;  2P4V A;  5J9P C;  5IWA O;  1I5Y A;  1YJ9 V;  3OFN G;  5GTH Z;  1QQC A;  2PZS A;  4XDJ A;  1O9H A;  3G4S V;  2ITC C;  4UB6 Z;  1THZ A;  2WLK A;  5LHI A;  4WFB V;  3CCV V;  4JAA A;  1RFY A;  1NVP B;  4WBN B;  3ZRV A;  2H94 A;  3IGA C;  2F1M A;  3G80 A;  2HHH B;  4NXN O;  3AEI A;  4QIW F;  3CXC U;  2LW7 A;  1SF9 A;  2YIC A;  1WA8 A;  4JI1 B;  1MMM A;  2HLD G;  2P5O A;  1HR0 B;  2OWO A;  4NR1 A;  4LF7 O;  1VQK V;  4IYH A;  1QR9 A;  3HKD A;  4DR3 O;  2MW2 B;  4AI8 A;  4JI3 B;  5JJN B;  2R72 A;  1VQ6 V;  1KP3 A;  5CA0 A;  3K03 A;  1KC8 W;  2CTP A;  4YXW G;  3TET A;  5K1X A;  3BFR A;  4Z1M G;  1MZE A;  1ZSP A;  2BCC H;  4R8C A;  3WU2 Z;  4DW0 A;  3CWB H;  3L72 H;  2AGA A;  1Q6I A;  3CB2 A;  4ZIB A;  5FPO A;  2Q8V A;  1WA8 B;  3APQ A;  4B08 A;  2WLH A;  3CYO A;  1GN2 A;  1VP7 A;  5L3G A;  2LGQ A;  4F6E A;  4BAY A;  3HKD B;  2P06 A;  5EBM C;  4Q20 A;  4LH6 A;  4PEL A;  5LMU O;  4MSW C;  3FKS G;  2CTW A;  5CA0 B;  3TXQ A;  1WN7 A;  4X64 B;  1SZT A;  2Q9L A;  5CA3 A;  5J2U A;  2UUC B;  1M57 B;  2VRZ A;  2KQX A;  4B7E A;  4PHZ A;  3BVO A;  1GAX A;  1FD9 A;  5TIS Z;  4O4J A;  2EZP A;  3KCY A;  1KYO F;  1OJH A;  2XAQ A;  4LF5 B;  3SJB C;  2HFE C;  3L9D A;  2WLL A;  1SQQ H;  2HP8 A;  3ABM C;  5LMN B;  4GYC B;  1H2S B;  4FPP A;  4FK5 C;  3WG7 C;  1KBH A;  4JZG A;  2GUZ A;  2EIN B;  3OMN B;  1Y67 A;  2Q0A A;  2LFS A;  2QM4 A;  4DR5 O;  4O2A A;  1AR4 A;  4JI8 O;  1N4C A;  3SJQ C;  4FLY A;  4HNA A;  1IBK B;  3ZMZ A;  2EIL C;  4O4J B;  2X6C A;  3ZRW A;  3M7M X;  3AG3 B;  3J80 N;  1B3Q A;  2P67 A;  2WLL B;  4E4E A;  4XDK A;  4F4L A;  3LNM B;  4PV1 B;  1DK1 A;  1BE3 H;  2UXB O;  2GUZ B;  1R3K C;  2JDI G;  3FB7 C;  1QVF U;  1CXZ B;  3SPH A;  2V4D A;  3FB6 C;  3ETE A;  4YIO A;  4O2A B;  4JI5 B;  1QHT A;  3OT7 A;  5H5N A;  3ABK B;  4GZR B;  3UCS C;  4UVB A;  4HNA B;  2AW9 A;  3OEE G;  4IHJ A;  1N0N A;  3ZRW B;  1HW7 A;  5FNV A;  2Z3Y A;  3A8T A;  3LNN A;  3E8H A;  1H38 A;  3ABT A;  5DEC A;  4DV2 B;  3T1H O;  4G2K A;  2DWE C;  1K73 W;  1H8H G;  3AG1 B;  4X1K A;  4TSF G;  2AZ0 A;  4DV6 B;  3MHS C;  2Q4P A;  5LHG A;  4X1I A;  2WLJ A;  2QM8 A;  4FMT A;  3K58 A;  3OM3 B;  1AJN A;  3CCL V;  1K92 A;  1LUW A;  3OR7 C;  5HFM A;  4IHJ B;  3BRC A;  3SDL A;  2OTL V;  5FNV B;  4LF4 B;  2PI5 A;  3CHX A;  1K97 A;  2JJ2 G;  4IIJ B;  3KKY A;  2Y48 A;  2B1I A;  5KUK A;  2YXL A;  4UV8 A;  2GSM B;  1JFF A;  4AQY B;  2VQE O;  4X1K B;  4UCR A;  2H3O A;  3TGU H;  4H13 B;  2GHY A;  2ZR3 A;  3KG2 A;  4QGP A;  3ZMS A;  4X1I B;  3ZIA G;  4DV5 B;  1Q81 W;  1AJP A;  1YF2 A;  1JPX A;  2UXX A;  2W0X A;  4X62 O;  4TQD A;  3ZMT A;  1AVM A;  2QWN B;  4LFA O;  3HB3 B;  3IFX A;  3FYI B;  5B3S C;  5FPR A;  2XAS A;  2EUL A;  3UO3 A;  2YIA A;  4CS4 A;  4Z1V A;  1YSC A;  1ZUQ A;  3ZHV A;  5IYC O;  1JFF B;  2LP7 A;  3AG2 B;  3E8G A;  2GBO A;  5KX5 A;  3EFF K;  4MT8 A;  4X8A A;  1XNR O;  4MVM A;  5A9G A;  3CSX A;  1SQF A;  4JI7 O;  3QO8 A;  2FKX A;  5IJ9 A;  2LJ2 A;  3CC7 V;  1XHZ A;  1U97 A;  5JJE B;  2UXD B;  2DW4 A;  2CAZ C;  3JAS A;  2QE7 G;  1QBZ A;  2BSK B;  2L6L A;  3JCU Z;  2PYL A;  3SYO A;  3AG7 A;  3SPJ A;  1VF6 C;  4DR2 B;  4RUF A;  3VBB A;  2BOB C;  3WB0 A;  4JI6 O;  1LR1 A;  5KX5 B;  1J5E O;  2YUA A;  2ARH A;  3I5D A;  2O57 A;  4LC1 A;  2BTO A;  5IT9 N;  4MTF A;  3QO5 A;  5IJ9 B;  4IL6 Z;  4I0X A;  4HAM A;  4GX0 A;  2K1E A;  1NKD A;  1XEQ A;  1Y76 A;  5IWA B;  2JGU A;  1WB8 A;  1VQ8 V;  1QLE C;  3JAS B;  2AZ2 A;  2UXN A;  3T2M A;  1L8D A;  2CGO A;  1OCC C;  2QA4 V;  4FFK A;  4HZ3 A;  3ZHU A;  3WB1 A;  1S72 V;  1AI7 A;  3ABK C;  1FPO A;  4UVA A;  5BMV A;  4JYA O;  1TGO A;  2XHB A;  5D5P A;  4I0X B;  5HFL A;  3LDE A;  3HKB B;  3CCR V;  3UM7 A;  1CP9 A;  1Y76 B;  1COW G;  4X66 B;  4B3T O;  3STL C;  3AG1 C;  4LR3 A;  4LF7 B;  4K0K O;  3BPZ A;  1GM8 A;  5EK0 A;  3P3N A;  4DR3 B;  1I94 B;  3F5T A;  2UU9 O;  2P22 C;  4FLX A;  4TT3 G;  1B04 A;  2F93 B;  3K59 A;  1PM9 A;  2HEP A;  1GN3 A;  1O9G A;  4X65 O;  2Q5Z A;  2FML A;  2R70 A;  5DM6 V;  4FLV A;  4PA6 A;  5BMV B;  5KHG A;  5LYJ A;  5DN6 G;  2JGD A;  4I9Q A;  1YEW A;  3QVN A;  4J80 A;  4CZZ A;  2NLJ C;  1MZF A;  1R6K A;  5BY1 A;  1HNW O;  5LGU A;  2E74 B;  2WPD G;  5LMU B;  1K5S A;  1XHX A;  1P4R A;  2UXC O;  3BEH A;  2Y4U A;  4LFC O;  4DV0 B;  2OTJ V;  4YY3 O;  3K79 A;  5LYJ B;  1I0H A;  2JGD B;  2IJJ A;  1ZWI C;  1RP3 B;  2P7T C;  2W6J G;  1XMQ O;  4B3M O;  1AB3 A;  3RW0 A;  4C7U A;  3K5M A;  4LF9 O;  4H44 B;  2IH1 C;  2CGN A;  5DED A;  3DGE A;  4GUN A;  1AI5 A;  4TV9 A;  1F51 A;  1R1B A;  4B3S B;  4X20 A;  5KAF Z;  3RT3 C;  3U11 A;  4DUY B;  4L8J A;  4WFG A;  2C2A A;  3NR7 A;  1Q8I A;  5IYZ A;  4DV3 B;  4BR6 A;  3JD2 A;  5KHH A;  1JX9 A;  3RBZ A;  3CME V;  4DR5 B;  2ZIM A;  1M5I A;  3VQW A;  1E1R G;  4JI8 B;  1GK9 A;  4OPH A;  1PL4 A;  3CCJ V;  4DW1 A;  4Q6G A;  3QNE A;  4LF8 O;  1S5J A;  2WSS G;  2KKW A;  4JTD B;  4FZ1 A;  3ETG A;  1MAB G; 
#chains in the Genus database with same CATH homology
 1SQX H;  1SQQ H;  3H1L H;  1SQB H;  5KLV H;  1NU1 H;  1P84 F;  3H1H H;  3L74 H;  1KB9 F;  3L70 H;  1NTZ H;  2A06 H;  4PD4 F;  3H1I H;  1EZV H;  3H1K H;  4D6T H;  1NTM H;  3CXH F;  3L71 H;  3L73 H;  1SQV H;  3TGU H;  1BGY H;  1BE3 H;  3CX5 F;  2FYU H;  1KYO F;  1L0L H;  3L75 H;  2BCC H;  1PPJ H;  1SQP H;  3H1J H;  1PP9 H;  1L0N H;  3CWB H;  3L72 H;  1BCC H;  1NTK H;  4U3F H;  3BCC H;  2IBZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...