3FB6C

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
molecule tags Membrane protein/metal transport
source organism Streptomyces lividans
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb6C00
2HJFC 2HVKC 3TETA 4R6ZA 1XL6A 3FB5C 3T4ZA 1R3KC 3E83A 1P7BA 3OUSA 4PDRA 4R50A 4QNHB 2ITCC 5KUKA 1V54C 1V55C 2R9RB 4XDLA 4XDJA 4RUEA 2Q6AA 1OCZC 4PA7A 4G27B 3RBZA 1M56C 1BL8A 5EC1C 3SPHA 3AG2C 2P7TC 3SPIA 4PDVA 3OUFA 2A9HA 3SYOA 3TCUA 3WG7C 2BOBC 4I9WA 4R8CA 4EKWA 2Y69C 4LCUC 4H37A 4MTGA 2Q68A 3LNMB 3ZRSA 4DXWA 3SPGA 2AHZA 3LDEA 3OR7C 2AHYA 3RW0A 2EIMC 5EK0A 3STZC 4RO2A 1XL4A 3LUTB 1R3JC 4LP8A 2DWDC 4QE9A 4WFHA 2EIJC 4ZBMA 4MW3A 3K06A 3F5WC 1OCRC 3STLC 4MVUA 3SYAA 1JVMA 4PDMA 3UM7A 1K4CC 3F7VC 4CBCA 3AG1C 1ORQC 4P2ZA 4RAIA 3VOUA 5B1BC 5J9PC 4MTFA 4MVQA 1OCCC 2WLLA 3ZJZA 2HVJC 4OXSA 2QKSA 4TWKA 4XDKA 2H8PC 2HFEC 2W0FC 2X6CA 4MVRA 3AG3C 1G4YB 3T1CA 4MSWC 2WLHA 1KKDA 3K0DA 3FB7C 3ABMC 3SYPA 3SPCA 3JYCA 3T2MA 5IY5C 1QLEC 2Q69A 2ZD9A 2WLIB 5CBGA 5KUMA 3X2QC 2Q67A 3E86A 2KB1A 3R65A 1R3LC 2DWEC 1M57C 2EIKC 3KG2A 3RVYA 4GX1A 1ZWIC 2A79B 2ATKC 4PA6A 3K0GA 4G28B 2EILC 3SJQC 3UKMA 3ABLC 3E8BA 4GX0A 4P9PA 5CBFA 2ITDC 3SYQA 2WLIA 3ABKC 3FB6C 3K08A 4PDLA 3SYCA 4UUJC 4HYOA 4MVSA 4QE7A 5CBHA 4WFEA 5B1AC 3BEHA 2WLLB 3LDCA 5EBWC 4WFGA 1K4DC 1R3IC 2ZXWC 3E8FA 4JTDB 4R7CA 2WLNA 4GX2A 4P30A 5EBMC 3E8GA 4J9ZB 2WLMA 3RVZA 2IH1C 4MW8A 3FB8C 3LDDA 4H33A 4LBEC 1OCOC 2X6BA 4PA9A 2JK5C 4JTAB 2DYRC 2X6AA 4HZ3A 4MVOA 3E89A 3OGCC 5BZBA 2NLJC 2HG5C 2DYSC 2OCCC 4WFFA 2EINC 5E1AC 4J9YB 1J95A 3PJSK 2IH3C 4BW5A 2A0LA 3GB7C 4MVMA 3F7YC 4X88A 3AG4C 1S5HC 5EBLC 4PA3A 4MS2A 3SPJA 2YEVA 3ASNC 3E8HA 3K04A 3OR6C 5B3SC 2QTOA 4X89A 5EC2C 2K1EA 4MTOA 4RUFA 3K03A 3HPLC 2WLJA 3ASOC 3EFFK 4GX5A 4MVZA 4JTCB 4P9OA 4X8AA 1LNQA 3IFXA 3IGAC 2BOCC 4KFMA 4F4LA 2WLKA 3T4DA 4PA4A
chains in the Genus database with same CATH superfamily
1AP5A 3AK2A 1SA0B 1N33B 3DC5A 2JGDB 2AZ0A 3ZS8C 4LF8O 2YDEA 3M8AA 1J5EB 3H1JH 4G2KA 4ZHQB 1THZA 3JSLA 4D7SA 2ZNIA 3LDEA 2EIMC 2CGNA 1HR0B 4I0XB 1OCRC 1SETA 4BAYA 1VF7A 2XAGA 1COWG 3OM3B 1F23A 1GO3F 2YI8A 2ZINA 4AQYO 2WLLA 4DR1B 4ZI7B 5JQGA 4GCZA 1FFXA 1G4YB 1NVPD 3APQA 4DV0O 4DK1A 4CH6A 3HKCA 4UCRA 1QLEC 4FFKA 2Q0OC 3ETQA 3BAAA 5LBQA 1URFA 1WA8B 2QEXV 1SF9A 3ABLC 5LMNO 3IC7A 3JD3A 1EFRG 1WLEA 2GUZB 2YIBA 4WBNA 4TQDA 1I08A 5IWAO 1Q3EA 1S3JA 2GBOA 1IBMO 3RWRD 4HNAA 2UXCO 2M7WA 1Y4MA 1FJGO 1FAFA 3OMIB 2V4DA 4CH5A 2Y48A 1JCHA 2X6AA 4WFAV 1BT8A 3ETEA 3RYCA 3ABMB 2RN9A 4JI8B 1FS0G 1DGSA 4UVAA 1VQ6V 2RNBA 5B3SC 1K9MW 2YIDA 4E2LA 4IT5A 1VMGA 3RYCB 1TUBB 5KHGA 1I7FA 4JZ2A 3T4DA 1AROP 1DTOA 5A2QN 3T4ZA 4LF5O 4QNHB 4IHJA 1N0NA 1G1XB 2Q9LA 2Z0AA 3U11A 5L3CA 3RYHB 1U97A 5JJJB 1M56C 4JZGA 2A9HA 1EN5A 2XAJA 3UO3A 1VQ7V 1RSOB 1OZ0A 1VQKV 3SDLA 3H1IH 4DV7B 1TVKA 3LSSA 1SQFA 1GM8A 3LUTB 3G71V 2IW5A 1IBMB 1YTFB 3UM7A 5JH7A 1FXKC 4DUZO 4I7ZB 2OIEA 2ZE7A 4RAIA 5B1BC 1I94O 2LW7A 2PYLA 1BZKA 1VARA 4YJ3A 1SA0A 1IDSA 3BCCH 3CHXA 3SPCA 5IY5C 2IJKA 1Q6IA 5KUMA 3CMAV 1M57C 2GV9A 2MW2B 1ZWIC 2A79B 2X7RB 2E3CA 2OT5A 4JI2B 5GTIZ 3I5DA 3P3NA 4QGPA 1QR8A 2WLIA 4PI2A 4O4JA 4JAVA 4JI6B 3OAAG 5B1AC 1K3EA 4D7TA 4DV3B 3CRMA 1GK9A 1R3IC 3L72H 5C93A 2CAZC 1NR7A 2E74B 5JQGB 1Q6UA 3LDDA 1L0LH 5DM6V 4DR2O 2DYRC 2FYUH 4L8JA 4DV3O 4TUYA 2GTAA 5LA6B 2A0LA 1S5JA 1HNZO 3ZRWA 5BMVB 1K8AW 3KCYA 3FAVB 2EULA 2LFSA 1SQGA 2UU9B 5CMUA 4Q6GA 4I50A 2HVKC 5LP6A 1XHZA 1P7BA 3ML0A 2Q7HA 1XBLA 2RQ6A 1AJPA 1LR1A 3CCEV 4X1YB 4LF6O 4PDVA 1GRJA 3QO8A 4IIJA 5BR8B 1GM7A 4IYIA 3OFNG 2QJ1A 1W0JG 3I55V 3ZMSA 4BW9A 3C3SA 3CP1A 3N2GB 4DV1B 3B4SA 4I4TA 4FLYA 1NZ6A 2PY5A 3ZJZA 2F23A 2V1DA 3PN1A 4YJ2B 3H1HH 2UU9O 2ZIOA 1FYJA 3UT5A 1N36O 1YHQV 2QWOB 1PPJH 3APOA 4RWUA 2YICA 1VP7A 1KMIZ 5CBGA 4O2BA 1N4CA 5LGNA 3N27A 3GWOA 4K0KO 4BWAA 2OCHA 1MG1A 2QDOA 2CTWA 3K08A 4LH6A 4UVBA 1NT2B 1EBOA 2VWKA 1IXBA 1GN6A 1AR5A 2HKOA 4JI3B 3QO5A 1PKXA 4UCOA 3ZRXA 1US6A 2G38A 4MVOA 1E1RG 5CA3A 3OGCC 1A32A 1YI2V 3HB3B 4GKJO 2Y4TA 4I0XA 4DR3O 5DEDA 4TT3G 4CC5A 1VQMV 2HHHO 1VQ8V 4NR1A 2JEUA 2QTOA 4LFCO 1HNXO 3UQ8A 5GONA 3T1YB 4X8AA 4JAUA 1XMQB 4UCVA 1TUBA 1I0HA 2HJFC 2JIZG 4DV5B 1YIJV 2V7QG 2HHHB 1SQVH 4J7JA 3CD6V 2XUMA 2R9RB 1SERA 2FKXA 1F51A 2UXBO 2IJJA 3K58A 2ZR2A 1S76D 1QBZA 1IBLB 3TCUA 4U7NA 5FNVA 4X20B 5J2UA 4HNAB 2ZT9B 3J80N 4JPRA 1MSWD 1L1FA 3A8TA 3BPZA 3WB2A 4X1YA 1P84F 4O4HB 3L71H 5ITZB 1Q82W 3TXSA 2A7WA 4NYKA 5LL6Y 3OD4A 2QTSA 1FJGB 2Q7EA 4MVQA 3DXRB 4Q20A 4FLUA 2HVJC 1IBKB 4XDKA 2ZCEA 4LF7O 2P22C 3H01A 4LF7B 3UO2A 2JEXA 1TA8A 3T2MA 5LHGA 2EINB 2B9ZA 3E86A 2ZDIA 1VIBA 4OPHA 4DW1A 4NKGB 3A0RA 1K5SA 3AG1B 3ABKC 2QKCA 4OX9O 2UUBB 1ENVA 2Q4PA 2PI4A 1BMFG 2IJIA 5B1OA 2PUSA 5B5EZ 4MT8A 3ZHQA 2RMKB 1WJZA 1R1BA 4W4KA 3CMEV 4B7KA 2YXLA 2JJ1G 1M57B 1XQ8A 1FKAO 3BRCA 3SJBC 3QG5A 4GKKO 1N8RW 1KP3A 4PV1B 1YVWA 1MNGA 3BY6A 3G6EV 3ZRWB 4LF8B 1EZJA 2KKWA 2K1EA 2KQXA 3K03A 3UT5B 3EHBB 4R6ZA 3I56V 1RPRA 5EZYA 2B1IA 4X62B 3CRCA 2IBZH 2EBOA 2Q0AA 5H9CA 1R6TA 3RBZA 3CJHA 4YIOA 2BTQA 3DTUB 1Y66A 4X65O 3SPGA 4DRXB 1N34B 1M93A 5DECA 5CB4A 3JASB 4FM0A 1BHBA 3HR0A 4UV9A 2B1GA 2L6LA 5TISZ 1MMMA 1NTKH 1NQTA 1UPGA 2W0FC 4JYAB 4FLZA 4MSWC 1KKDA 2E5LB 3JYCA 3NXSA 4CH3A 2N05A 2FMLA 3SGIA 4FLXA 4ZOLA 3H9VA 3OE7G 3RVYA 2XAQA 4JYAO 2ITDC 1W2BU 5IE9A 3IC9A 2CTQA 2FL4A 1T5EA 3VQYA 4J9ZB 5FNVB 4QJFB 1OJHA 4HBNA 2WLMA 4TV9B 1SZXA 1XOUA 1OCOC 1K7DA 2A06H 1KBHA 2Z3YA 1CPYA 5H2FZ 1QLEB 3FX7A 5CA0A 1WP7A 4K35A 2GUZA 3H1KH 4F6RB 3ASNC 2ILMA 1MOFA 2OTJV 3W7SA 3JSNA 3OR6C 2EILB 3WG7B 3OTOB 4GX5A 2QWRB 2VQFB 2OIGA 3ZIAG 1Q5OA 2AXTZ 3QTCA 3FB5C 3FKSG 4J42A 1NTZH 4FZ1A 1V54C 4PJ0Z 4U3FH 1NJIW 1M4UA 1DLBA 1VQLV 2Q6AA 5B1BB 1FD9A 3SPHA 4JI4O 1OCOB 4JYBA 4GLXA 1H38A 3W7TA 3KCXA 4JV5O 1RM1B 1XREA 1N32B 3D36A 1HNWB 4IGGA 4IYHA 4JI6O 5EYPB 1NI8A 2DWDC 4MW3A 4CS2A 1JVMA 3R66A 3P3PA 1B3QA 3F7VC 3B8MA 3AG1C 2NR5A 4FPPA 4I5SA 1BCCH 5JCOA 5KMGB 1K33A 2EJRA 4JV5B 3ZX6A 4DR6O 1XMQO 2IM9A 1YZBA 4DUYO 1KUQA 4EB6A 1YXBA 2Z5UA 1FXVA 4X1IA 4O4LA 1M1KW 4KXRA 2HJDA 2ETNA 3WB1A 5L3FA 2EIKC 2JS5A 4BIUA 4NXMO 3OTOO 5EIBC 1SQQH 4MVSA 3K9AA 5LP6C 2CUGA 4WFGA 3E8FA 3OMNB 3M7MX 5LOVB 1NH2B 3CC2V 1G8MA 1VF6C 1HWYA 1WNSA 2P4KA 4EFBA 1M5IA 1AJQA 3E89A 3LSUA 4AHCA 1WPXA 3J81N 3CXHF 4O4LB 4FFBB 1VQNV 4ABMA 5EBLC 1MZFA 3SPJA 3U10A 1WN7A 1XNRO 4X89A 3AG2B 2JS3A 3MHHC 3RT3C 3IFXA 3IGAC 2BOCC 4I50B 4JI7B 2A3QA 1B06A 4DUYB 1D5NA 4DV1O 3A0HZ 4X1IB 5A9GA 3ZCCA 1Z2GA 1H8HG 4NXNB 1IBLO 5KAIZ 3WB0A 4H0LB 1PNKA 3MAQA 3OR7C 3RW0A 2Q5ZA 5JCOC 4RO2A 1JR9A 2Y69B 5J2UB 4MVUA 4CBCA 2EX3A 4EFEA 2BCCH 2DE0X 2F1MA 4YIPA 2VS0A 3AG3C 2E76B 4ASUG 4F6RA 2WLHA 1H2SB 1ZX3A 5HFMA 4DV0B 4B3RO 2PGGA 3HKBB 4FLVA 4DR4B 4DR3B 2Q67A 1KP2A 4OPAA 3ZEDA 1R3LC 1JJ2U 1ZAUA 3MDSA 4H13B 3SJQC 3FAVA 1AR4A 2P4VA 2ZM6O 4LF9O 2EZOA 1JMKC 2WPDG 5HFLA 3S3XA 2R9IA 2W6JG 1DK1A 1QNMA 5H6RA 5K1PA 1N33O 2F66C 5LGUA 1NTMH 2AGAA 1OCRB 2QGNA 4RQEA 3ZMUA 2ZE6A 4PA3A 4FIPC 3CCRV 2RDCA 4MTOA 5B1NA 4MVZA 3CRAA 1LNQA 4GKKB 3FFQA 2HP8A 3JAWA 2UXDB 2E5LO 2WA4A 1MABG 3ZHRA 5KUKA 2ZE8A 2OYQA 4NTXA 1WP8A 4B3TB 1OCZC 3K57A 2HEPA 4G27B 4TQFA 1VQ5V 1FXHA 3SYOA 1R6NA 2D2CB 4JYCA 4UCSA 3ICXA 2YIAA 3JD1A 1R6KA 3CPWU 5KA6A 3QVNA 1N34O 4I55B 4TV9A 1XMOB 4MTFA 4UB6Z 3HKEA 3L74H 1BGYH 5IWAB 3K0DA 1S5LZ 1D5AA 5L3GA 3B09A 4Z1VA 2XAFA 5C8YB 2XNDG 1NVPB 3ZMZA 3ZN1A 3K0GA 4P9PA 3C3TA 1JPXA 1GN3A 5LGTA 3SYCA 5CBHA 5JJNB 1YJNV 3BEHA 2ZXWB 5EBWC 3LNNA 4R7CA 4P30A 1NBMG 3E8GA 2IH1C 4B3TO 5BR8O 3JASA 2AW9A 3D36C 2EIKB 1N32O 4K8XA 4PA9A 2R72A 4J41A 2HR3A 3OMAB 3P30A 3ZBHA 2UUBO 4BW5A 4W4LA 3J7AU 1GKFA 3CB2A 1PD3A 2YEVA 3U0ZA 3EFFK 4JTCB 4DK0A 1YCIA 2XT9A 1UJWB 4ZOLB 2WLKA 2QM8A 2JRIA 1S0VA 4LR3A 1RP3B 1VQPV 1HNZB 4DR7O 2JVDA 1FPOA 4DR5O 4JI5B 2ARHA 1MZEA 1BQZA 3SPIA 4GZRB 4LWSA 2P6JA 1JX9A 2Y69C 4DV4B 2CDYA 2Q68A 2LFRA 3ZRSA 1GMGA 5EK0A 2KSDA 1R3JC 1E1QG 4X1KB 5IYCO 1ROPA 4JI5O 2P06A 3ABKB 4X62O 5LYJA 2LP7A 3OW2U 4U3JA 1Y76A 1OV9A 2P90A 4J10A 4JI2O 1IX9A 4LC1A 4YXWG 3ZMTA 3Q4HA 4YY3B 2N74A 4IHJB 5E79Z 2WSSG 4U3JB 3BA9A 3TJTA 2ZD9A 2WLIB 3AG3B 1JFFA 3X2QC 4LFCB 1JQ0A 2YS8A 3KG2A 4JI7O 5EYPA 5LA6A 1QU7A 1XDCA 5H5NA 3JALB 3FB6C 4PDLA 4WFEA 5GONB 3A0BZ 3E22A 3LDCA 2UUAB 4WCEV 2ZDIC 2BTQB 3CCQV 1YF2A 2ZXWC 3RYFA 1Q6HA 5DN6G 1MA1A 4FLTA 5EBMC 5KLVH 3BVOA 2QWPB 4NXNO 5EIBD 1N0JA 1AB3A 4NB5A 2X6BA 1JJOA 2JK5C 3ETDA 1SKVA 1CEZA 3JCZA 2HG5C 2D3OW 5KA5A 1ZL8B 2CH7B 4X64O 1S5HC 3JATA 1XNQB 4BR6A 2Y0IA 3OEEG 1PP9H 2CK3G 4P9OA 2NNUA 4Z2WA 2WWWA 2CTRA 3HKDA 4PA4A 4QE9A 4B3RB 1H2KA 4DV2O 3OUSA 5IYZA 4B3MB 4XDLA 5LXTB 1RSOA 2QM7A 2OTLV 2YSUB 3AG2C 3TK1A 2UXXA 4LNUB 4I9WA 4WF9V 4DRXA 4EKWA 3E2EA 4LCUC 1QVGU 1WB8A 4DXWA 4LWSB 1Z5WA 1K73W 2AHZA 3STZC 2WAMA 2X0LA 3K5OA 4ZBMA 2EIJC 2UUAO 2OCCB 3ABTA 4PDMA 1SQBH 4DO2A 1SQXH 1TAEA 4UCTA 1XHXA 5LMNB 5J9PC 1OCCC 5J2TB 3N2KA 4UV8A 4FJCC 3CCVV 4LFBO 1D2DA 4O2BB 2FTKA 5K1XA 3CSXA 3SYPA 1Y76B 3B8NA 3CCLV 3A2FA 5AG2A 4O4JB 4B3MO 1AP6A 2QE7G 3WU2Z 2HLDG 2ATKC 3TGUH 4DR1O 3E8BA 3ASNB 2IU3A 1CP9A 3D3QA 1PL0A 4B7EA 2H94A 5IJ0A 3N2KB 1KU9A 1KYOF 4MW8A 1PV0A 4FLWA 5JJEB 4LF9B 4X65B 3AK1A 1LUWA 4UXNA 3FD9A 1YJWV 1OCZB 1SESA 2IH3C 2EZPA 3F7YC 3GWKC 2UXBB 4DV6B 2M6YA 4E4EA 1NR1A 1NKDA 1SRYA 4RUFA 1F7YA 1AR1B 2O57A 1L0NH 5BMVA 4JI8O 3MD0A 4KL1A 4JAAA 2ITCC 3G67A 4BIZA 4XDJA 4RUEA 2L35A 2B5UA 2DYSB 3JAKB 4BIOA 1I94B 2IU0A 5F2VO 4EB6B 5FPRA 5LMUB 2YEVB 5LXTA 5GW7A 2AHYA 4I4TB 1XL4A 5LHIA 5B66Z 4FMTA 3B40A 1EN6A 1GH6A 5JWPA 5JVDA 3IAYA 3K9SA 3P32A 3DGEA 2ZM6B 4N23A 2HFEC 3T1CA 1B04A 4KHPB 2Y0PA 5KAFZ 4LF4O 2Q7GA 5IY5B 4J11A 5JVDB 1QR9A 4GT1A 4QPJA 3K5MA 2VQFO 2KG7A 4IL6Z 2PZSA 5IYZB 1M9NA 3JD0A 3N2GA 1P49A 3CCMV 4X20A 4H44B 2WLLB 1F4NA 4ZIBA 3SJAC 2XASA 1Q86W 3B77A 2ZIMA 2Y4UA 5JH7B 5IT9N 4TUYB 5FL7G 1H2MA 1PNMA 1W59A 1KQSU 2MK3A 3X2QB 5C8YA 1JFFB 3WFVA 4J9YB 1HNWO 2JGDA 3AG4C 1HW7A 4EEQA 1PM9A 2LO1A 1FXKA 1VQ4V 2ZQMA 2PYJA 3FYEB 1I5YA 3ASOC 2BE3A 1Y6XA 4F4LA 2VWJA 1GM9A 4R50A 4TSFG 4JASA 3QNEA 1JA8A 4PA7A 4DV6O 5IDJA 2QSAA 1BHAA 2DMXA 2P7TC 1LUVA 3WG7C 1GN2A 4J80A 2XHBA 1AILA 3LNMB 1KKCA 1RFYA 1XEQA 4XBFA 4WFBV 4WFHA 2YIBD 1QLNA 1K4CC 3ASOB 3SJCC 2PI5A 2Q8VA 1L8DA 2RCVA 1DF4A 1HP8A 1SQPH 2C2AA 3ZHUA 5D5QA 2XAHA 4U7OA 3FB7C 1IURA 2R70A 2BSKB 4F6EA 3CC4V 1KECA 3OEHG 2EJ7A 1RPOA 2H3OA 3R65A 2LW1A 1XMOO 3T1YO 2GTSA 5CN0A 1HDJA 3LSQA 3CYOA 3HKDB 1DF5A 1W0KG 4QE7A 4ZI7A 4YY3O 3O65A 4RQFA 2W6IG 2JJ2G 4GX2A 4CC6A 4YJ2A 3BHPA 1YEWA 1AI7A 2Q73A 4H33A 5CA0B 3OTFA 4JTAB 4HZ3A 5BZBA 4WFFA 2OCCC 5LOVA 2YI9A 1S77D 1J95A 3PJSK 4MVMA 4WBNB 3ZHTA 1P7GA 3E8HA 3VQWA 4MTXA 5L3EA 1OCCB 5L3BA 2GDSA 5EC2C 3DXRA 1IXMA 1KD1W 2UUCB 1EZVH 3D8CA 4FM2A 3CXCU 2QM4A 3CWBH 1FFTB 4OGQB 3TETA 4FK5C 3M99B 1R3KC 2QWNB 4PHZA 4DR4O 1WAZA 3CEIA 1XNQO 1N36B 1V9PA 2R9AA 2BSKA 5D5PA 4GUNA 4JI3O 5EC1C 3AG7A 3RYFB 3OUFA 1M56B 4PI0A 3CCJV 5B3SB 3ZRVA 4KUMA 4X66B 1BS3A 4FM1A 3ZN0A 3JAWB 3K06A 5LP6B 1WB7A 4DR7B 3VQXA 1O9HA 4QPKA 5CB4B 2ADPA 2PF4E 3RYIB 5FPOA 3BABA 5KHKA 4MVRA 2JGUA 3KZIZ 3CJHB 3ABMC 3E35A 3G4SV 2FB5A 4LFAB 4X64B 5L3DA 3RYIA 2VQEO 2QKAA 4X1KA 4X9QA 2F43G 3G80A 4L87A 4JI1B 3SYQA 3GVMA 2ZNJA 5BY1A 3QO7A 4O4HA 5ITZA 4TV8B 5IJ9A 3CCSV 1YTFD 4GKJB 1K4DC 4GYCB 1U96A 1ZTEA 4NTYA 3CX5F 2VRZA 3C90A 5IYDO 5FLXN 2LGWA 3FB8C 4LBEC 4CH4A 1H2GA 4TV8A 5IJ9B 1QVFU 2GSMB 2QA4V 2NLJC 4ZKIA 2DYSC 2EINC 4X66O 4ICGA 4UCUA 3GB7C 1V54B 3JAMN 4X88A 1Y74B 1QHTA 4FVMA 3K04A 3D3IA 3THOA 1Q7YW 4K0KB 1FXKB 4NXMB 1AI5A 1BSMA 2BTOA 2JDIG 2EIMB 4UB8Z 3O9OA 3F5TA 1AVMA 3CS5A 2W0XA 3ABUA 3CC7V 1K5QA 5IYBO 1BL8A 1H2LA 1XUQA 3SR2C 4Z1MG 3JCUZ 1J5EO 4R8CA 3JAKA 4MTGA 3ETGA 2ADQB 3CE2A 3ZMVA 3NR7A 2UXCB 3F5WC 1GN4A 4K8ZA 2CE4A 3B2EE 1M90W 5EZYB 3HKCB 1R73A 2E75B 4D6TH 3K5NA 3ZHVA 2UXDO 1X4TA 1ZUQA 2LJ2A 5KHJA 4OX9B 1ZLZA 3RGBA 4LH7A 2DWEC 1VQOV 3UKMA 2WA3A 2ZE5A 1IBKO 2EIJB 5IJ0B 4KHPO 4B3SB 4YHHB 1NH2D 2F4VO 2WLNA 1HR0O 3Q4HB 1O9GA 4PELA 4FZ0A 2ZR3A 4IIJB 4JI4B 3AEIA 4DV4O 4FFBA 1YITV 5CA1B 1P4RA 4B3SO 4YHHO 2F4VB 1QQCA 1K97A 1AI6A 1QCEA 4MS2A 1SZTA 3CRRA 1FFXB 4YJ3B 3K79A 4QIWF 4LNUA 4LF4B 4LF6B 2F93B 4I9QA 1YSCA 5LYJB 2NN4A 4NVPA 4KFMA 1EM1A 4N21A 1EN4A 1YDXA 2YXHA 1XL6A 2DN9A 2XOKG 3E83A 3IJ4A 4PDRA 1V55B 3T1HO 4AI8A 1KB9F 1VF5B 3TXQA 2YC0A 3DC6A 1B6QA 1XILA 1H8EG 2LQTA 4I55A 4CZZA 2BOBC 2LGQA 5KX5B 4JYYA 4H37A 1JOYA 1Y74A 4CS4A 3L9DA 1Z5VA 1SC5B 4DV7O 3EXAA 3BA8A 3SYAA 1K34A 1IVSA 1ORQC 4P2ZA 3JARB 3VOUA 1S72V 2DOSA 3E22B 3BFRA 1WPBA 1IZ3A 4OXSA 4TWKA 3OGIB 2CTPA 1SS3A 4LF5B 1WA8A 1Q90D 1VQ9V 4DR5B 2DW4A 2OWOA 2Q69A 1ZL8A 2CH7A 1Y67A 3RYHA 3ABLB 1NS1A 4PA6A 1ZSPA 4G28B 2EILC 2UUCO 2QR4A 1PNLA 4J7ZA 4UUJC 3EVKA 5J2TA 3JD4A 5KMGA 1TVKB 4J7KA 1BQ0A 1NU1H 4K3AA 1Q43A 4HAMA 1RM1C 1K92A 2ODMA 3RVZA 3G6BA 3OT7A 4C7UA 3L73H 4JGSA 1KC8W 4DUZB 1H2NA 1XI1A 1TUEB 3VQVA 2K9PA 4JF3A 1X59A 5CA1A 5E1AC 3JD2A 3K3WA 4UVCA 2PTMA 3MHSC 4ZHQA 3RFRA 5KHHA 4DYLA 2DQ3A 4UFZA 2VQEB 1OHHG 1MSDA 3CRQA 3S3WA 3H1LH 4O2AA 3UCSC 4LFAO 3FYIB 3JATB 2DQ0A 3HKBA 1I5XA 4DV2B 2UXNA 1V55C 3K59A 1G6UA 4O2AB 4AQYB 1XNRB 5BXZA 3W7UA 2F95B 2GHYA 2N04A 4DR2B 1E79G 2QWQB 4B08A 4JI0O 1PL4A 1YJ9V 3AG4B 4LP8A 3T1HB 1BE3H 3STLC 5KX5A 1VF6A 2YUAA 3VBBA 1TGOA 2YXYA 2QKSA 2H8PC 2X6CA 5GTHZ 1F4MA 2RJZA 3JARA 4AILC 3W7XA 2KB1A 1VEWA 4GX1A 2DJVA 5LHHA 1GAXA 4PD4F 4GX0A 5CBFA 4LFBB 4HYOA 4DR6B 1AJNA 2AZ2A 2XTAA 4JI0B 4JTDB 3DSQA 4KP4A 1GTOA 2DYRB 1AI4A 2ZKOA 4TOIA 3RN4A 3CCUV 3KKYA 4O4IA 5LMUO 3L70H 2P67A 2KG7B 4NTWA 1Q8IA 4JI1O 3K5LA 4DV5O 4A5UB 3L75H 3W7WA 1UFIA 1CXZB 2CGOA 4O4IB 3AK3A 5B1AB 3QF7A 3ZHSA 1Q81W 4DW0A 4CS3A 1HNXB 5H6QA 3HKEB 3HPLC 2WLJA 2P5OA 5KHIA 2IJHA 3JALA
chains in the Genus database with same CATH topology
3TETA 4R6ZA 4FK5C 3I56V 3M99B 1R3KC 2QM8A 1RPRA 1S0VA 1VQPV 2B1IA 2EBOA 5H9CA 3RBZA 5EC1C 3SPIA 3OUFA 1M56B 3DTUB 4G2KA 3CCJV 1Y66A 2P6JA 1JX9A 5B3SB 2Y69C 3ZRVA 4KUMA 2Q68A 2LFRA 3ZRSA 1THZA 3SPGA 3LDEA 1GMGA 2EIMC 5EK0A 1BHBA 1R3JC 1E1QG 5IYCO 3ZN0A 1ROPA 3K06A 1OCRC 1SETA 4BAYA 4UV9A 2B1GA 3ABKB 2XAGA 1COWG 2LP7A 3OM3B 1F23A 4QPKA 1GO3F 3OW2U 2P90A 2WLLA 1NQTA 4GCZA 4LC1A 4MVRA 2W0FC 4YXWG 3ZMTA 1G4YB 1NVPD 4MSWC 1KKDA 3ABMC 3E35A 3G4SV 3JYCA 3NXSA 1QLEC 2WSSG 2ZD9A 2WLIB 5L3DA 3AG3B 3X2QC 1JQ0A 5LBQA 3KG2A 3OE7G 3RVYA 2XAQA 2F43G 2QEXV 4L87A 3ABLC 2ITDC 1W2BU 3SYQA 3IC7A 3FB6C 4PDLA 3JD3A 1EFRG 1WLEA 4WFEA 3QO7A 3LDCA 4WCEV 2ZDIC 3CCSV 1YTFD 1S3JA 3CCQV 1K4DC 2ZXWC 5DN6G 5EBMC 5IYDO 4J9ZB 4QJFB 2WLMA 2M7WA 3FB8C 1Y4MA 4LBEC 1OCOC 1H2GA 3OMIB 2X6BA 2JK5C 2Y48A 3ETDA 1JCHA 1K7DA 1QVFU 2X6AA 2GSMB 4WFAV 2Z3YA 1CPYA 2QA4V 2NLJC 2HG5C 2DYSC 3JCZA 4ZKIA 2EINC 5KA5A 2D3OW 1CEZA 1QLEB 3ETEA 3ABMB 3GB7C 1V54B 1FS0G 4X88A 1S5HC 1VQ6V 4UVAA 3ASNC 1MOFA 2OTJV 3W7SA 3K04A 3OEEG 3OR6C 5B3SC 2EILB 2CK3G 3D3IA 1K9MW 4E2LA 3WG7B 1Q7YW 4GX5A 1FXKB 4P9OA 2NNUA 1AI5A 2WWWA 3ZIAG 3T4DA 4PA4A 4QE9A 1AROP 1DTOA 3T4ZA 3FB5C 3FKSG 4QNHB 3OUSA 2JDIG 2EIMB 1V54C 1NJIW 4XDLA 1DLBA 5L3CA 1VQLV 2QM7A 2Q6AA 3ABUA 3CC7V 1K5QA 2OTLV 5B1BB 2YSUB 5IYBO 1BL8A 1M56C 3SPHA 3AG2C 3TK1A 4Z1MG 2A9HA 1OCOB 2UXXA 4JYBA 4I9WA 2XAJA 4WF9V 1H38A 4R8CA 4EKWA 3E2EA 4LCUC 3W7TA 1VQ7V 4MTGA 1QVGU 1VQKV 1OZ0A 4DXWA 3ETGA 1RM1B 1K73W 2AHZA 3STZC 2WAMA 3ZMVA 3D36A 2X0LA 3LSSA 3LUTB 1GM8A 3G71V 2IW5A 2DWDC 4ZBMA 2EIJC 4MW3A 3F5WC 2OCCB 1JVMA 3ABTA 1YTFB 4PDMA 3UM7A 5CBFA 4DO2A 3F7VC 1FXKC 3B8MA 3AG1C 4FPPA 4I5SA 1M90W 4RAIA 5B1BC 5J9PC 1K33A 1OCCC 1R73A 2EJRA 4UV8A 4FJCC 3CCVV 2FTKA 3SYPA 3SPCA 5IY5C 2Z5UA 1FXVA 3B8NA 3CCLV 2IJKA 1M1KW 5KUMA 2QE7G 3CMAV 2DWEC 5L3FA 1M57C 2EIKC 1ZWIC 2A79B 2ATKC 2HLDG 2OT5A 2X7RB 4BIUA 1VQOV 3UKMA 3E8BA 3ASNB 1QR8A 2WLIA 2IU3A 4MVSA 4JAVA 3OAAG 3K9AA 5B1AC 1K3EA 1CP9A 2EIJB 1GK9A 4WFGA 1PL0A 3E8FA 1R3IC 2H94A 5C93A 1NH2D 2WLNA 3OMNB 1NR7A 1NH2B 4PELA 1G8MA 3CC2V 2ZR3A 1HWYA 4MW8A 3AEIA 3LDDA 1YITV 5DM6V 2DYRC 1AJQA 1P4RA 3E89A 4UXNA 1WPXA 1YJWV 1OCZB 1SESA 1K97A 1AI6A 1QCEA 2A0LA 2IH3C 2EZPA 3F7YC 1VQNV 5EBLC 4MS2A 1SZTA 3ZRWA 3SPJA 1K8AW 3K79A 4QIWF 1NR1A 2LFSA 4X89A 1NKDA 1SRYA 4RUFA 3AG2B 1YSCA 3MHHC 3IFXA 3IGAC 2BOCC 1AR1B 5CMUA 4KFMA 4N21A 2HVKC 3MD0A 1XL6A 2XOKG 3E83A 1P7BA 4PDRA 1V55B 2ITCC 4BIZA 3ML0A 4XDJA 4RUEA 2B5UA 2DYSB 1AJPA 3ZCCA 3CCEV 1B6QA 2IU0A 1H8EG 4PDVA 4CZZA 1H8HG 2BOBC 3QO8A 2YEVB 4H37A 1GM7A 1JOYA 5GW7A 3OFNG 1PNKA 3OR7C 2AHYA 3RW0A 4RO2A 1XL4A 1W0JG 3I55V 5LHIA 3ZMSA 2Y69B 4FMTA 4MVUA 3CP1A 1K34A 3SYAA 4CBCA 1ORQC 4P2ZA 3VOUA 1S72V 3ZJZA 3P32A 3DGEA 4OXSA 2V1DA 4TWKA 4N23A 2HFEC 3AG3C 3T1CA 4ASUG 2WLHA 5HFMA 1YHQV 1VQ9V 5IY5B 2DW4A 2Q69A 1QR9A 5CBGA 4GT1A 4QPJA 5LGNA 2Q67A 1KP2A 1R3LC 3ABLB 3GWOA 1JJ2U 1MG1A 4PA6A 4G28B 2EILC 3SJQC 1M9NA 3JD0A 1PNLA 5LGTA 3K08A 4UUJC 2EZOA 3CCMV 2WPDG 4UVBA 5HFLA 2WLLB 3JD4A 1F4NA 2XASA 1EBOA 2R9IA 2W6JG 1Q86W 3B77A 4HAMA 5FL7G 1RM1C 1K92A 5H6RA 3RVZA 2HKOA 4JGSA 1KC8W 3QO5A 1PNMA 1PKXA 3ZRXA 5LGUA 1TUEB 1KQSU 2MK3A 3X2QB 4MVOA 1E1RG 4JF3A 3OGCC 5CA3A 1YI2V 3HB3B 1OCRB 5E1AC 3JD2A 3WFVA 4J9YB 4RQEA 3K3WA 3ZMUA 4UVCA 3MHSC 4TT3G 3AG4C 1VQMV 4PA3A 4FIPC 1VQ8V 2DQ3A 3CCRV 2JEUA 1VQ4V 1FXKA 2QTOA 2ZQMA 1OHHG 3FYEB 1I5YA 4MTOA 5B1NA 4MVZA 3ASOC 4X8AA 1LNQA 4JAUA 4F4LA 2HJFC 2JIZG 3FYIB 1YIJV 1GM9A 2DQ0A 4R50A 2V7QG 1I5XA 4TSFG 1MABG 5KUKA 3CD6V 2UXNA 1V55C 1SERA 2R9RB 4JASA 1F51A 2IJJA 1OCZC 3QNEA 2ZR2A 4PA7A 1S76D 4G27B 1QBZA 5IDJA 1BHAA 3W7UA 2P7TC 1VQ5V 3TCUA 1FXHA 3SYOA 3WG7C 1R6NA 4JYCA 2GHYA 4U7NA 3JD1A 1E79G 3LNMB 1R6KA 3CPWU 1YJ9V 5KA6A 3AG4B 4JPRA 1MSWD 1L1FA 4LP8A 4XBFA 4WFBV 4WFHA 1Q82W 3STLC 1QLNA 1K4CC 3ASOB 3VBBA 2PI5A 4MTFA 4MVQA 4Q20A 2HVJC 2QKSA 4XDKA 1DF4A 2H8PC 2C2AA 2X6CA 3H01A 1F4MA 2XAHA 3K0DA 4U7OA 2JEXA 5L3GA 3FB7C 3T2MA 5LHGA 2EINB 3CC4V 1KECA 3OEHG 1RPOA 2XAFA 3W7XA 3E86A 2KB1A 2XNDG 3R65A 2ZDIA 1NVPB 4GX1A 5LHHA 3ZMZA 3ZN1A 3K0GA 3A0RA 1K5SA 4GX0A 1JPXA 3LSQA 3AG1B 3CYOA 4P9PA 1DF5A 5CN0A 1W0KG 3ABKC 3SYCA 5CBHA 4HYOA 4QE7A 1AJNA 1ENVA 1YJNV 3BEHA 2ZXWB 5EBWC 2PI4A 1BMFG 2W6IG 4JTDB 2IJIA 4RQFA 4R7CA 5B1OA 2JJ2G 4GX2A 4KP4A 1GTOA 4MT8A 4P30A 1NBMG 2DYRB 3E8GA 1AI7A 1AI4A 3CMEV 3CCUV 2IH1C 4H33A 2JJ1G 1M57B 2EIKB 2P67A 4PA9A 4JTAB 4HZ3A 5BZBA 2HR3A 2OCCC 3OMAB 4WFFA 1S77D 3P30A 1N8RW 3W7WA 1J95A 1KP3A 3PJSK 4BW5A 4MVMA 5B1AB 1GKFA 1PD3A 2YEVA 3BY6A 3E8HA 3G6EV 1Q81W 4MTXA 3ZRWB 5L3EA 1OCCB 5H6QA 5L3BA 1EZJA 5EC2C 2K1EA 1IXMA 3K03A 3HPLC 2WLJA 3EFFK 1KD1W 3EHBB 4JTCB 1UJWB 3CXCU 2IJHA 2WLKA 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJF C;  2HVK C;  3TET A;  4R6Z A;  1XL6 A;  3FB5 C;  3T4Z A;  1R3K C;  3E83 A;  1P7B A;  3OUS A;  4PDR A;  4R50 A;  4QNH B;  2ITC C;  5KUK A;  1V54 C;  1V55 C;  2R9R B;  4XDL A;  4XDJ A;  4RUE A;  2Q6A A;  1OCZ C;  4PA7 A;  4G27 B;  3RBZ A;  1M56 C;  1BL8 A;  5EC1 C;  3SPH A;  3AG2 C;  2P7T C;  3SPI A;  4PDV A;  3OUF A;  2A9H A;  3SYO A;  3TCU A;  3WG7 C;  2BOB C;  4I9W A;  4R8C A;  4EKW A;  2Y69 C;  4LCU C;  4H37 A;  4MTG A;  2Q68 A;  3LNM B;  3ZRS A;  4DXW A;  3SPG A;  2AHZ A;  3LDE A;  3OR7 C;  2AHY A;  3RW0 A;  2EIM C;  5EK0 A;  3STZ C;  4RO2 A;  1XL4 A;  3LUT B;  1R3J C;  4LP8 A;  2DWD C;  4QE9 A;  4WFH A;  2EIJ C;  4ZBM A;  4MW3 A;  3K06 A;  3F5W C;  1OCR C;  3STL C;  4MVU A;  3SYA A;  1JVM A;  4PDM A;  3UM7 A;  1K4C C;  3F7V C;  4CBC A;  3AG1 C;  1ORQ C;  4P2Z A;  4RAI A;  3VOU A;  5B1B C;  5J9P C;  4MTF A;  4MVQ A;  1OCC C;  2WLL A;  3ZJZ A;  2HVJ C;  4OXS A;  2QKS A;  4TWK A;  4XDK A;  2H8P C;  2HFE C;  2W0F C;  2X6C A;  4MVR A;  3AG3 C;  1G4Y B;  3T1C A;  4MSW C;  2WLH A;  1KKD A;  3K0D A;  3FB7 C;  3ABM C;  3SYP A;  3SPC A;  3JYC A;  3T2M A;  5IY5 C;  1QLE C;  2Q69 A;  2ZD9 A;  2WLI B;  5CBG A;  5KUM A;  3X2Q C;  2Q67 A;  3E86 A;  2KB1 A;  3R65 A;  1R3L C;  2DWE C;  1M57 C;  2EIK C;  3KG2 A;  3RVY A;  4GX1 A;  1ZWI C;  2A79 B;  2ATK C;  4PA6 A;  3K0G A;  4G28 B;  2EIL C;  3SJQ C;  3UKM A;  3ABL C;  3E8B A;  4GX0 A;  4P9P A;  5CBF A;  2ITD C;  3SYQ A;  2WLI A;  3ABK C;  3FB6 C;  3K08 A;  4PDL A;  3SYC A;  4UUJ C;  4HYO A;  4MVS A;  4QE7 A;  5CBH A;  4WFE A;  5B1A C;  3BEH A;  2WLL B;  3LDC A;  5EBW C;  4WFG A;  1K4D C;  1R3I C;  2ZXW C;  3E8F A;  4JTD B;  4R7C A;  2WLN A;  4GX2 A;  4P30 A;  5EBM C;  3E8G A;  4J9Z B;  2WLM A;  3RVZ A;  2IH1 C;  4MW8 A;  3FB8 C;  3LDD A;  4H33 A;  4LBE C;  1OCO C;  2X6B A;  4PA9 A;  2JK5 C;  4JTA B;  2DYR C;  2X6A A;  4HZ3 A;  4MVO A;  3E89 A;  3OGC C;  5BZB A;  2NLJ C;  2HG5 C;  2DYS C;  2OCC C;  4WFF A;  2EIN C;  5E1A C;  4J9Y B;  1J95 A;  3PJS K;  2IH3 C;  4BW5 A;  2A0L A;  3GB7 C;  4MVM A;  3F7Y C;  4X88 A;  3AG4 C;  1S5H C;  5EBL C;  4PA3 A;  4MS2 A;  3SPJ A;  2YEV A;  3ASN C;  3E8H A;  3K04 A;  3OR6 C;  5B3S C;  2QTO A;  4X89 A;  5EC2 C;  2K1E A;  4MTO A;  4RUF A;  3K03 A;  3HPL C;  2WLJ A;  3ASO C;  3EFF K;  4GX5 A;  4MVZ A;  4JTC B;  4P9O A;  4X8A A;  1LNQ A;  3IFX A;  3IGA C;  2BOC C;  4KFM A;  4F4L A;  2WLK A;  3T4D A;  4PA4 A; 
#chains in the Genus database with same CATH topology
 1AP5 A;  3AK2 A;  1SA0 B;  1N33 B;  3DC5 A;  2JGD B;  2AZ0 A;  3ZS8 C;  4LF8 O;  2YDE A;  3M8A A;  1J5E B;  3H1J H;  4G2K A;  4ZHQ B;  1THZ A;  3JSL A;  4D7S A;  2ZNI A;  3LDE A;  2EIM C;  2CGN A;  1HR0 B;  4I0X B;  1OCR C;  1SET A;  4BAY A;  1VF7 A;  2XAG A;  1COW G;  3OM3 B;  1F23 A;  1GO3 F;  2YI8 A;  2ZIN A;  4AQY O;  2WLL A;  4DR1 B;  4ZI7 B;  5JQG A;  4GCZ A;  1FFX A;  1G4Y B;  1NVP D;  3APQ A;  4DV0 O;  4DK1 A;  4CH6 A;  3HKC A;  4UCR A;  1QLE C;  4FFK A;  2Q0O C;  3ETQ A;  3BAA A;  5LBQ A;  1URF A;  1WA8 B;  2QEX V;  1SF9 A;  3ABL C;  5LMN O;  3IC7 A;  3JD3 A;  1EFR G;  1WLE A;  2GUZ B;  2YIB A;  4WBN A;  4TQD A;  1I08 A;  5IWA O;  1Q3E A;  1S3J A;  2GBO A;  1IBM O;  3RWR D;  4HNA A;  2UXC O;  2M7W A;  1Y4M A;  1FJG O;  1FAF A;  3OMI B;  2V4D A;  4CH5 A;  2Y48 A;  1JCH A;  2X6A A;  4WFA V;  1BT8 A;  3ETE A;  3RYC A;  3ABM B;  2RN9 A;  4JI8 B;  1FS0 G;  1DGS A;  4UVA A;  1VQ6 V;  2RNB A;  5B3S C;  1K9M W;  2YID A;  4E2L A;  4IT5 A;  1VMG A;  3RYC B;  1TUB B;  5KHG A;  1I7F A;  4JZ2 A;  3T4D A;  1ARO P;  1DTO A;  5A2Q N;  3T4Z A;  4LF5 O;  4QNH B;  4IHJ A;  1N0N A;  1G1X B;  2Q9L A;  2Z0A A;  3U11 A;  5L3C A;  3RYH B;  1U97 A;  5JJJ B;  1M56 C;  4JZG A;  2A9H A;  1EN5 A;  2XAJ A;  3UO3 A;  1VQ7 V;  1RSO B;  1OZ0 A;  1VQK V;  3SDL A;  3H1I H;  4DV7 B;  1TVK A;  3LSS A;  1SQF A;  1GM8 A;  3LUT B;  3G71 V;  2IW5 A;  1IBM B;  1YTF B;  3UM7 A;  5JH7 A;  1FXK C;  4DUZ O;  4I7Z B;  2OIE A;  2ZE7 A;  4RAI A;  5B1B C;  1I94 O;  2LW7 A;  2PYL A;  1BZK A;  1VAR A;  4YJ3 A;  1SA0 A;  1IDS A;  3BCC H;  3CHX A;  3SPC A;  5IY5 C;  2IJK A;  1Q6I A;  5KUM A;  3CMA V;  1M57 C;  2GV9 A;  2MW2 B;  1ZWI C;  2A79 B;  2X7R B;  2E3C A;  2OT5 A;  4JI2 B;  5GTI Z;  3I5D A;  3P3N A;  4QGP A;  1QR8 A;  2WLI A;  4PI2 A;  4O4J A;  4JAV A;  4JI6 B;  3OAA G;  5B1A C;  1K3E A;  4D7T A;  4DV3 B;  3CRM A;  1GK9 A;  1R3I C;  3L72 H;  5C93 A;  2CAZ C;  1NR7 A;  2E74 B;  5JQG B;  1Q6U A;  3LDD A;  1L0L H;  5DM6 V;  4DR2 O;  2DYR C;  2FYU H;  4L8J A;  4DV3 O;  4TUY A;  2GTA A;  5LA6 B;  2A0L A;  1S5J A;  1HNZ O;  3ZRW A;  5BMV B;  1K8A W;  3KCY A;  3FAV B;  2EUL A;  2LFS A;  1SQG A;  2UU9 B;  5CMU A;  4Q6G A;  4I50 A;  2HVK C;  5LP6 A;  1XHZ A;  1P7B A;  3ML0 A;  2Q7H A;  1XBL A;  2RQ6 A;  1AJP A;  1LR1 A;  3CCE V;  4X1Y B;  4LF6 O;  4PDV A;  1GRJ A;  3QO8 A;  4IIJ A;  5BR8 B;  1GM7 A;  4IYI A;  3OFN G;  2QJ1 A;  1W0J G;  3I55 V;  3ZMS A;  4BW9 A;  3C3S A;  3CP1 A;  3N2G B;  4DV1 B;  3B4S A;  4I4T A;  4FLY A;  1NZ6 A;  2PY5 A;  3ZJZ A;  2F23 A;  2V1D A;  3PN1 A;  4YJ2 B;  3H1H H;  2UU9 O;  2ZIO A;  1FYJ A;  3UT5 A;  1N36 O;  1YHQ V;  2QWO B;  1PPJ H;  3APO A;  4RWU A;  2YIC A;  1VP7 A;  1KMI Z;  5CBG A;  4O2B A;  1N4C A;  5LGN A;  3N27 A;  3GWO A;  4K0K O;  4BWA A;  2OCH A;  1MG1 A;  2QDO A;  2CTW A;  3K08 A;  4LH6 A;  4UVB A;  1NT2 B;  1EBO A;  2VWK A;  1IXB A;  1GN6 A;  1AR5 A;  2HKO A;  4JI3 B;  3QO5 A;  1PKX A;  4UCO A;  3ZRX A;  1US6 A;  2G38 A;  4MVO A;  1E1R G;  5CA3 A;  3OGC C;  1A32 A;  1YI2 V;  3HB3 B;  4GKJ O;  2Y4T A;  4I0X A;  4DR3 O;  5DED A;  4TT3 G;  4CC5 A;  1VQM V;  2HHH O;  1VQ8 V;  4NR1 A;  2JEU A;  2QTO A;  4LFC O;  1HNX O;  3UQ8 A;  5GON A;  3T1Y B;  4X8A A;  4JAU A;  1XMQ B;  4UCV A;  1TUB A;  1I0H A;  2HJF C;  2JIZ G;  4DV5 B;  1YIJ V;  2V7Q G;  2HHH B;  1SQV H;  4J7J A;  3CD6 V;  2XUM A;  2R9R B;  1SER A;  2FKX A;  1F51 A;  2UXB O;  2IJJ A;  3K58 A;  2ZR2 A;  1S76 D;  1QBZ A;  1IBL B;  3TCU A;  4U7N A;  5FNV A;  4X20 B;  5J2U A;  4HNA B;  2ZT9 B;  3J80 N;  4JPR A;  1MSW D;  1L1F A;  3A8T A;  3BPZ A;  3WB2 A;  4X1Y A;  1P84 F;  4O4H B;  3L71 H;  5ITZ B;  1Q82 W;  3TXS A;  2A7W A;  4NYK A;  5LL6 Y;  3OD4 A;  2QTS A;  1FJG B;  2Q7E A;  4MVQ A;  3DXR B;  4Q20 A;  4FLU A;  2HVJ C;  1IBK B;  4XDK A;  2ZCE A;  4LF7 O;  2P22 C;  3H01 A;  4LF7 B;  3UO2 A;  2JEX A;  1TA8 A;  3T2M A;  5LHG A;  2EIN B;  2B9Z A;  3E86 A;  2ZDI A;  1VIB A;  4OPH A;  4DW1 A;  4NKG B;  3A0R A;  1K5S A;  3AG1 B;  3ABK C;  2QKC A;  4OX9 O;  2UUB B;  1ENV A;  2Q4P A;  2PI4 A;  1BMF G;  2IJI A;  5B1O A;  2PUS A;  5B5E Z;  4MT8 A;  3ZHQ A;  2RMK B;  1WJZ A;  1R1B A;  4W4K A;  3CME V;  4B7K A;  2YXL A;  2JJ1 G;  1M57 B;  1XQ8 A;  1FKA O;  3BRC A;  3SJB C;  3QG5 A;  4GKK O;  1N8R W;  1KP3 A;  4PV1 B;  1YVW A;  1MNG A;  3BY6 A;  3G6E V;  3ZRW B;  4LF8 B;  1EZJ A;  2KKW A;  2K1E A;  2KQX A;  3K03 A;  3UT5 B;  3EHB B;  4R6Z A;  3I56 V;  1RPR A;  5EZY A;  2B1I A;  4X62 B;  3CRC A;  2IBZ H;  2EBO A;  2Q0A A;  5H9C A;  1R6T A;  3RBZ A;  3CJH A;  4YIO A;  2BTQ A;  3DTU B;  1Y66 A;  4X65 O;  3SPG A;  4DRX B;  1N34 B;  1M93 A;  5DEC A;  5CB4 A;  3JAS B;  4FM0 A;  1BHB A;  3HR0 A;  4UV9 A;  2B1G A;  2L6L A;  5TIS Z;  1MMM A;  1NTK H;  1NQT A;  1UPG A;  2W0F C;  4JYA B;  4FLZ A;  4MSW C;  1KKD A;  2E5L B;  3JYC A;  3NXS A;  4CH3 A;  2N05 A;  2FML A;  3SGI A;  4FLX A;  4ZOL A;  3H9V A;  3OE7 G;  3RVY A;  2XAQ A;  4JYA O;  2ITD C;  1W2B U;  5IE9 A;  3IC9 A;  2CTQ A;  2FL4 A;  1T5E A;  3VQY A;  4J9Z B;  5FNV B;  4QJF B;  1OJH A;  4HBN A;  2WLM A;  4TV9 B;  1SZX A;  1XOU A;  1OCO C;  1K7D A;  2A06 H;  1KBH A;  2Z3Y A;  1CPY A;  5H2F Z;  1QLE B;  3FX7 A;  5CA0 A;  1WP7 A;  4K35 A;  2GUZ A;  3H1K H;  4F6R B;  3ASN C;  2ILM A;  1MOF A;  2OTJ V;  3W7S A;  3JSN A;  3OR6 C;  2EIL B;  3WG7 B;  3OTO B;  4GX5 A;  2QWR B;  2VQF B;  2OIG A;  3ZIA G;  1Q5O A;  2AXT Z;  3QTC A;  3FB5 C;  3FKS G;  4J42 A;  1NTZ H;  4FZ1 A;  1V54 C;  4PJ0 Z;  4U3F H;  1NJI W;  1M4U A;  1DLB A;  1VQL V;  2Q6A A;  5B1B B;  1FD9 A;  3SPH A;  4JI4 O;  1OCO B;  4JYB A;  4GLX A;  1H38 A;  3W7T A;  3KCX A;  4JV5 O;  1RM1 B;  1XRE A;  1N32 B;  3D36 A;  1HNW B;  4IGG A;  4IYH A;  4JI6 O;  5EYP B;  1NI8 A;  2DWD C;  4MW3 A;  4CS2 A;  1JVM A;  3R66 A;  3P3P A;  1B3Q A;  3F7V C;  3B8M A;  3AG1 C;  2NR5 A;  4FPP A;  4I5S A;  1BCC H;  5JCO A;  5KMG B;  1K33 A;  2EJR A;  4JV5 B;  3ZX6 A;  4DR6 O;  1XMQ O;  2IM9 A;  1YZB A;  4DUY O;  1KUQ A;  4EB6 A;  1YXB A;  2Z5U A;  1FXV A;  4X1I A;  4O4L A;  1M1K W;  4KXR A;  2HJD A;  2ETN A;  3WB1 A;  5L3F A;  2EIK C;  2JS5 A;  4BIU A;  4NXM O;  3OTO O;  5EIB C;  1SQQ H;  4MVS A;  3K9A A;  5LP6 C;  2CUG A;  4WFG A;  3E8F A;  3OMN B;  3M7M X;  5LOV B;  1NH2 B;  3CC2 V;  1G8M A;  1VF6 C;  1HWY A;  1WNS A;  2P4K A;  4EFB A;  1M5I A;  1AJQ A;  3E89 A;  3LSU A;  4AHC A;  1WPX A;  3J81 N;  3CXH F;  4O4L B;  4FFB B;  1VQN V;  4ABM A;  5EBL C;  1MZF A;  3SPJ A;  3U10 A;  1WN7 A;  1XNR O;  4X89 A;  3AG2 B;  2JS3 A;  3MHH C;  3RT3 C;  3IFX A;  3IGA C;  2BOC C;  4I50 B;  4JI7 B;  2A3Q A;  1B06 A;  4DUY B;  1D5N A;  4DV1 O;  3A0H Z;  4X1I B;  5A9G A;  3ZCC A;  1Z2G A;  1H8H G;  4NXN B;  1IBL O;  5KAI Z;  3WB0 A;  4H0L B;  1PNK A;  3MAQ A;  3OR7 C;  3RW0 A;  2Q5Z A;  5JCO C;  4RO2 A;  1JR9 A;  2Y69 B;  5J2U B;  4MVU A;  4CBC A;  2EX3 A;  4EFE A;  2BCC H;  2DE0 X;  2F1M A;  4YIP A;  2VS0 A;  3AG3 C;  2E76 B;  4ASU G;  4F6R A;  2WLH A;  1H2S B;  1ZX3 A;  5HFM A;  4DV0 B;  4B3R O;  2PGG A;  3HKB B;  4FLV A;  4DR4 B;  4DR3 B;  2Q67 A;  1KP2 A;  4OPA A;  3ZED A;  1R3L C;  1JJ2 U;  1ZAU A;  3MDS A;  4H13 B;  3SJQ C;  3FAV A;  1AR4 A;  2P4V A;  2ZM6 O;  4LF9 O;  2EZO A;  1JMK C;  2WPD G;  5HFL A;  3S3X A;  2R9I A;  2W6J G;  1DK1 A;  1QNM A;  5H6R A;  5K1P A;  1N33 O;  2F66 C;  5LGU A;  1NTM H;  2AGA A;  1OCR B;  2QGN A;  4RQE A;  3ZMU A;  2ZE6 A;  4PA3 A;  4FIP C;  3CCR V;  2RDC A;  4MTO A;  5B1N A;  4MVZ A;  3CRA A;  1LNQ A;  4GKK B;  3FFQ A;  2HP8 A;  3JAW A;  2UXD B;  2E5L O;  2WA4 A;  1MAB G;  3ZHR A;  5KUK A;  2ZE8 A;  2OYQ A;  4NTX A;  1WP8 A;  4B3T B;  1OCZ C;  3K57 A;  2HEP A;  4G27 B;  4TQF A;  1VQ5 V;  1FXH A;  3SYO A;  1R6N A;  2D2C B;  4JYC A;  4UCS A;  3ICX A;  2YIA A;  3JD1 A;  1R6K A;  3CPW U;  5KA6 A;  3QVN A;  1N34 O;  4I55 B;  4TV9 A;  1XMO B;  4MTF A;  4UB6 Z;  3HKE A;  3L74 H;  1BGY H;  5IWA B;  3K0D A;  1S5L Z;  1D5A A;  5L3G A;  3B09 A;  4Z1V A;  2XAF A;  5C8Y B;  2XND G;  1NVP B;  3ZMZ A;  3ZN1 A;  3K0G A;  4P9P A;  3C3T A;  1JPX A;  1GN3 A;  5LGT A;  3SYC A;  5CBH A;  5JJN B;  1YJN V;  3BEH A;  2ZXW B;  5EBW C;  3LNN A;  4R7C A;  4P30 A;  1NBM G;  3E8G A;  2IH1 C;  4B3T O;  5BR8 O;  3JAS A;  2AW9 A;  3D36 C;  2EIK B;  1N32 O;  4K8X A;  4PA9 A;  2R72 A;  4J41 A;  2HR3 A;  3OMA B;  3P30 A;  3ZBH A;  2UUB O;  4BW5 A;  4W4L A;  3J7A U;  1GKF A;  3CB2 A;  1PD3 A;  2YEV A;  3U0Z A;  3EFF K;  4JTC B;  4DK0 A;  1YCI A;  2XT9 A;  1UJW B;  4ZOL B;  2WLK A;  2QM8 A;  2JRI A;  1S0V A;  4LR3 A;  1RP3 B;  1VQP V;  1HNZ B;  4DR7 O;  2JVD A;  1FPO A;  4DR5 O;  4JI5 B;  2ARH A;  1MZE A;  1BQZ A;  3SPI A;  4GZR B;  4LWS A;  2P6J A;  1JX9 A;  2Y69 C;  4DV4 B;  2CDY A;  2Q68 A;  2LFR A;  3ZRS A;  1GMG A;  5EK0 A;  2KSD A;  1R3J C;  1E1Q G;  4X1K B;  5IYC O;  1ROP A;  4JI5 O;  2P06 A;  3ABK B;  4X62 O;  5LYJ A;  2LP7 A;  3OW2 U;  4U3J A;  1Y76 A;  1OV9 A;  2P90 A;  4J10 A;  4JI2 O;  1IX9 A;  4LC1 A;  4YXW G;  3ZMT A;  3Q4H A;  4YY3 B;  2N74 A;  4IHJ B;  5E79 Z;  2WSS G;  4U3J B;  3BA9 A;  3TJT A;  2ZD9 A;  2WLI B;  3AG3 B;  1JFF A;  3X2Q C;  4LFC B;  1JQ0 A;  2YS8 A;  3KG2 A;  4JI7 O;  5EYP A;  5LA6 A;  1QU7 A;  1XDC A;  5H5N A;  3JAL B;  3FB6 C;  4PDL A;  4WFE A;  5GON B;  3A0B Z;  3E22 A;  3LDC A;  2UUA B;  4WCE V;  2ZDI C;  2BTQ B;  3CCQ V;  1YF2 A;  2ZXW C;  3RYF A;  1Q6H A;  5DN6 G;  1MA1 A;  4FLT A;  5EBM C;  5KLV H;  3BVO A;  2QWP B;  4NXN O;  5EIB D;  1N0J A;  1AB3 A;  4NB5 A;  2X6B A;  1JJO A;  2JK5 C;  3ETD A;  1SKV A;  1CEZ A;  3JCZ A;  2HG5 C;  2D3O W;  5KA5 A;  1ZL8 B;  2CH7 B;  4X64 O;  1S5H C;  3JAT A;  1XNQ B;  4BR6 A;  2Y0I A;  3OEE G;  1PP9 H;  2CK3 G;  4P9O A;  2NNU A;  4Z2W A;  2WWW A;  2CTR A;  3HKD A;  4PA4 A;  4QE9 A;  4B3R B;  1H2K A;  4DV2 O;  3OUS A;  5IYZ A;  4B3M B;  4XDL A;  5LXT B;  1RSO A;  2QM7 A;  2OTL V;  2YSU B;  3AG2 C;  3TK1 A;  2UXX A;  4LNU B;  4I9W A;  4WF9 V;  4DRX A;  4EKW A;  3E2E A;  4LCU C;  1QVG U;  1WB8 A;  4DXW A;  4LWS B;  1Z5W A;  1K73 W;  2AHZ A;  3STZ C;  2WAM A;  2X0L A;  3K5O A;  4ZBM A;  2EIJ C;  2UUA O;  2OCC B;  3ABT A;  4PDM A;  1SQB H;  4DO2 A;  1SQX H;  1TAE A;  4UCT A;  1XHX A;  5LMN B;  5J9P C;  1OCC C;  5J2T B;  3N2K A;  4UV8 A;  4FJC C;  3CCV V;  4LFB O;  1D2D A;  4O2B B;  2FTK A;  5K1X A;  3CSX A;  3SYP A;  1Y76 B;  3B8N A;  3CCL V;  3A2F A;  5AG2 A;  4O4J B;  4B3M O;  1AP6 A;  2QE7 G;  3WU2 Z;  2HLD G;  2ATK C;  3TGU H;  4DR1 O;  3E8B A;  3ASN B;  2IU3 A;  1CP9 A;  3D3Q A;  1PL0 A;  4B7E A;  2H94 A;  5IJ0 A;  3N2K B;  1KU9 A;  1KYO F;  4MW8 A;  1PV0 A;  4FLW A;  5JJE B;  4LF9 B;  4X65 B;  3AK1 A;  1LUW A;  4UXN A;  3FD9 A;  1YJW V;  1OCZ B;  1SES A;  2IH3 C;  2EZP A;  3F7Y C;  3GWK C;  2UXB B;  4DV6 B;  2M6Y A;  4E4E A;  1NR1 A;  1NKD A;  1SRY A;  4RUF A;  1F7Y A;  1AR1 B;  2O57 A;  1L0N H;  5BMV A;  4JI8 O;  3MD0 A;  4KL1 A;  4JAA A;  2ITC C;  3G67 A;  4BIZ A;  4XDJ A;  4RUE A;  2L35 A;  2B5U A;  2DYS B;  3JAK B;  4BIO A;  1I94 B;  2IU0 A;  5F2V O;  4EB6 B;  5FPR A;  5LMU B;  2YEV B;  5LXT A;  5GW7 A;  2AHY A;  4I4T B;  1XL4 A;  5LHI A;  5B66 Z;  4FMT A;  3B40 A;  1EN6 A;  1GH6 A;  5JWP A;  5JVD A;  3IAY A;  3K9S A;  3P32 A;  3DGE A;  2ZM6 B;  4N23 A;  2HFE C;  3T1C A;  1B04 A;  4KHP B;  2Y0P A;  5KAF Z;  4LF4 O;  2Q7G A;  5IY5 B;  4J11 A;  5JVD B;  1QR9 A;  4GT1 A;  4QPJ A;  3K5M A;  2VQF O;  2KG7 A;  4IL6 Z;  2PZS A;  5IYZ B;  1M9N A;  3JD0 A;  3N2G A;  1P49 A;  3CCM V;  4X20 A;  4H44 B;  2WLL B;  1F4N A;  4ZIB A;  3SJA C;  2XAS A;  1Q86 W;  3B77 A;  2ZIM A;  2Y4U A;  5JH7 B;  5IT9 N;  4TUY B;  5FL7 G;  1H2M A;  1PNM A;  1W59 A;  1KQS U;  2MK3 A;  3X2Q B;  5C8Y A;  1JFF B;  3WFV A;  4J9Y B;  1HNW O;  2JGD A;  3AG4 C;  1HW7 A;  4EEQ A;  1PM9 A;  2LO1 A;  1FXK A;  1VQ4 V;  2ZQM A;  2PYJ A;  3FYE B;  1I5Y A;  3ASO C;  2BE3 A;  1Y6X A;  4F4L A;  2VWJ A;  1GM9 A;  4R50 A;  4TSF G;  4JAS A;  3QNE A;  1JA8 A;  4PA7 A;  4DV6 O;  5IDJ A;  2QSA A;  1BHA A;  2DMX A;  2P7T C;  1LUV A;  3WG7 C;  1GN2 A;  4J80 A;  2XHB A;  1AIL A;  3LNM B;  1KKC A;  1RFY A;  1XEQ A;  4XBF A;  4WFB V;  4WFH A;  2YIB D;  1QLN A;  1K4C C;  3ASO B;  3SJC C;  2PI5 A;  2Q8V A;  1L8D A;  2RCV A;  1DF4 A;  1HP8 A;  1SQP H;  2C2A A;  3ZHU A;  5D5Q A;  2XAH A;  4U7O A;  3FB7 C;  1IUR A;  2R70 A;  2BSK B;  4F6E A;  3CC4 V;  1KEC A;  3OEH G;  2EJ7 A;  1RPO A;  2H3O A;  3R65 A;  2LW1 A;  1XMO O;  3T1Y O;  2GTS A;  5CN0 A;  1HDJ A;  3LSQ A;  3CYO A;  3HKD B;  1DF5 A;  1W0K G;  4QE7 A;  4ZI7 A;  4YY3 O;  3O65 A;  4RQF A;  2W6I G;  2JJ2 G;  4GX2 A;  4CC6 A;  4YJ2 A;  3BHP A;  1YEW A;  1AI7 A;  2Q73 A;  4H33 A;  5CA0 B;  3OTF A;  4JTA B;  4HZ3 A;  5BZB A;  4WFF A;  2OCC C;  5LOV A;  2YI9 A;  1S77 D;  1J95 A;  3PJS K;  4MVM A;  4WBN B;  3ZHT A;  1P7G A;  3E8H A;  3VQW A;  4MTX A;  5L3E A;  1OCC B;  5L3B A;  2GDS A;  5EC2 C;  3DXR A;  1IXM A;  1KD1 W;  2UUC B;  1EZV H;  3D8C A;  4FM2 A;  3CXC U;  2QM4 A;  3CWB H;  1FFT B;  4OGQ B;  3TET A;  4FK5 C;  3M99 B;  1R3K C;  2QWN B;  4PHZ A;  4DR4 O;  1WAZ A;  3CEI A;  1XNQ O;  1N36 B;  1V9P A;  2R9A A;  2BSK A;  5D5P A;  4GUN A;  4JI3 O;  5EC1 C;  3AG7 A;  3RYF B;  3OUF A;  1M56 B;  4PI0 A;  3CCJ V;  5B3S B;  3ZRV A;  4KUM A;  4X66 B;  1BS3 A;  4FM1 A;  3ZN0 A;  3JAW B;  3K06 A;  5LP6 B;  1WB7 A;  4DR7 B;  3VQX A;  1O9H A;  4QPK A;  5CB4 B;  2ADP A;  2PF4 E;  3RYI B;  5FPO A;  3BAB A;  5KHK A;  4MVR A;  2JGU A;  3KZI Z;  3CJH B;  3ABM C;  3E35 A;  3G4S V;  2FB5 A;  4LFA B;  4X64 B;  5L3D A;  3RYI A;  2VQE O;  2QKA A;  4X1K A;  4X9Q A;  2F43 G;  3G80 A;  4L87 A;  4JI1 B;  3SYQ A;  3GVM A;  2ZNJ A;  5BY1 A;  3QO7 A;  4O4H A;  5ITZ A;  4TV8 B;  5IJ9 A;  3CCS V;  1YTF D;  4GKJ B;  1K4D C;  4GYC B;  1U96 A;  1ZTE A;  4NTY A;  3CX5 F;  2VRZ A;  3C90 A;  5IYD O;  5FLX N;  2LGW A;  3FB8 C;  4LBE C;  4CH4 A;  1H2G A;  4TV8 A;  5IJ9 B;  1QVF U;  2GSM B;  2QA4 V;  2NLJ C;  4ZKI A;  2DYS C;  2EIN C;  4X66 O;  4ICG A;  4UCU A;  3GB7 C;  1V54 B;  3JAM N;  4X88 A;  1Y74 B;  1QHT A;  4FVM A;  3K04 A;  3D3I A;  3THO A;  1Q7Y W;  4K0K B;  1FXK B;  4NXM B;  1AI5 A;  1BSM A;  2BTO A;  2JDI G;  2EIM B;  4UB8 Z;  3O9O A;  3F5T A;  1AVM A;  3CS5 A;  2W0X A;  3ABU A;  3CC7 V;  1K5Q A;  5IYB O;  1BL8 A;  1H2L A;  1XUQ A;  3SR2 C;  4Z1M G;  3JCU Z;  1J5E O;  4R8C A;  3JAK A;  4MTG A;  3ETG A;  2ADQ B;  3CE2 A;  3ZMV A;  3NR7 A;  2UXC B;  3F5W C;  1GN4 A;  4K8Z A;  2CE4 A;  3B2E E;  1M90 W;  5EZY B;  3HKC B;  1R73 A;  2E75 B;  4D6T H;  3K5N A;  3ZHV A;  2UXD O;  1X4T A;  1ZUQ A;  2LJ2 A;  5KHJ A;  4OX9 B;  1ZLZ A;  3RGB A;  4LH7 A;  2DWE C;  1VQO V;  3UKM A;  2WA3 A;  2ZE5 A;  1IBK O;  2EIJ B;  5IJ0 B;  4KHP O;  4B3S B;  4YHH B;  1NH2 D;  2F4V O;  2WLN A;  1HR0 O;  3Q4H B;  1O9G A;  4PEL A;  4FZ0 A;  2ZR3 A;  4IIJ B;  4JI4 B;  3AEI A;  4DV4 O;  4FFB A;  1YIT V;  5CA1 B;  1P4R A;  4B3S O;  4YHH O;  2F4V B;  1QQC A;  1K97 A;  1AI6 A;  1QCE A;  4MS2 A;  1SZT A;  3CRR A;  1FFX B;  4YJ3 B;  3K79 A;  4QIW F;  4LNU A;  4LF4 B;  4LF6 B;  2F93 B;  4I9Q A;  1YSC A;  5LYJ B;  2NN4 A;  4NVP A;  4KFM A;  1EM1 A;  4N21 A;  1EN4 A;  1YDX A;  2YXH A;  1XL6 A;  2DN9 A;  2XOK G;  3E83 A;  3IJ4 A;  4PDR A;  1V55 B;  3T1H O;  4AI8 A;  1KB9 F;  1VF5 B;  3TXQ A;  2YC0 A;  3DC6 A;  1B6Q A;  1XIL A;  1H8E G;  2LQT A;  4I55 A;  4CZZ A;  2BOB C;  2LGQ A;  5KX5 B;  4JYY A;  4H37 A;  1JOY A;  1Y74 A;  4CS4 A;  3L9D A;  1Z5V A;  1SC5 B;  4DV7 O;  3EXA A;  3BA8 A;  3SYA A;  1K34 A;  1IVS A;  1ORQ C;  4P2Z A;  3JAR B;  3VOU A;  1S72 V;  2DOS A;  3E22 B;  3BFR A;  1WPB A;  1IZ3 A;  4OXS A;  4TWK A;  3OGI B;  2CTP A;  1SS3 A;  4LF5 B;  1WA8 A;  1Q90 D;  1VQ9 V;  4DR5 B;  2DW4 A;  2OWO A;  2Q69 A;  1ZL8 A;  2CH7 A;  1Y67 A;  3RYH A;  3ABL B;  1NS1 A;  4PA6 A;  1ZSP A;  4G28 B;  2EIL C;  2UUC O;  2QR4 A;  1PNL A;  4J7Z A;  4UUJ C;  3EVK A;  5J2T A;  3JD4 A;  5KMG A;  1TVK B;  4J7K A;  1BQ0 A;  1NU1 H;  4K3A A;  1Q43 A;  4HAM A;  1RM1 C;  1K92 A;  2ODM A;  3RVZ A;  3G6B A;  3OT7 A;  4C7U A;  3L73 H;  4JGS A;  1KC8 W;  4DUZ B;  1H2N A;  1XI1 A;  1TUE B;  3VQV A;  2K9P A;  4JF3 A;  1X59 A;  5CA1 A;  5E1A C;  3JD2 A;  3K3W A;  4UVC A;  2PTM A;  3MHS C;  4ZHQ A;  3RFR A;  5KHH A;  4DYL A;  2DQ3 A;  4UFZ A;  2VQE B;  1OHH G;  1MSD A;  3CRQ A;  3S3W A;  3H1L H;  4O2A A;  3UCS C;  4LFA O;  3FYI B;  3JAT B;  2DQ0 A;  3HKB A;  1I5X A;  4DV2 B;  2UXN A;  1V55 C;  3K59 A;  1G6U A;  4O2A B;  4AQY B;  1XNR B;  5BXZ A;  3W7U A;  2F95 B;  2GHY A;  2N04 A;  4DR2 B;  1E79 G;  2QWQ B;  4B08 A;  4JI0 O;  1PL4 A;  1YJ9 V;  3AG4 B;  4LP8 A;  3T1H B;  1BE3 H;  3STL C;  5KX5 A;  1VF6 A;  2YUA A;  3VBB A;  1TGO A;  2YXY A;  2QKS A;  2H8P C;  2X6C A;  5GTH Z;  1F4M A;  2RJZ A;  3JAR A;  4AIL C;  3W7X A;  2KB1 A;  1VEW A;  4GX1 A;  2DJV A;  5LHH A;  1GAX A;  4PD4 F;  4GX0 A;  5CBF A;  4LFB B;  4HYO A;  4DR6 B;  1AJN A;  2AZ2 A;  2XTA A;  4JI0 B;  4JTD B;  3DSQ A;  4KP4 A;  1GTO A;  2DYR B;  1AI4 A;  2ZKO A;  4TOI A;  3RN4 A;  3CCU V;  3KKY A;  4O4I A;  5LMU O;  3L70 H;  2P67 A;  2KG7 B;  4NTW A;  1Q8I A;  4JI1 O;  3K5L A;  4DV5 O;  4A5U B;  3L75 H;  3W7W A;  1UFI A;  1CXZ B;  2CGO A;  4O4I B;  3AK3 A;  5B1A B;  3QF7 A;  3ZHS A;  1Q81 W;  4DW0 A;  4CS3 A;  1HNX B;  5H6Q A;  3HKE B;  3HPL C;  2WLJ A;  2P5O A;  5KHI A;  2IJH A;  3JAL A; 
#chains in the Genus database with same CATH homology
 3TET A;  4R6Z A;  4FK5 C;  3I56 V;  3M99 B;  1R3K C;  2QM8 A;  1RPR A;  1S0V A;  1VQP V;  2B1I A;  2EBO A;  5H9C A;  3RBZ A;  5EC1 C;  3SPI A;  3OUF A;  1M56 B;  3DTU B;  4G2K A;  3CCJ V;  1Y66 A;  2P6J A;  1JX9 A;  5B3S B;  2Y69 C;  3ZRV A;  4KUM A;  2Q68 A;  2LFR A;  3ZRS A;  1THZ A;  3SPG A;  3LDE A;  1GMG A;  2EIM C;  5EK0 A;  1BHB A;  1R3J C;  1E1Q G;  5IYC O;  3ZN0 A;  1ROP A;  3K06 A;  1OCR C;  1SET A;  4BAY A;  4UV9 A;  2B1G A;  3ABK B;  2XAG A;  1COW G;  2LP7 A;  3OM3 B;  1F23 A;  4QPK A;  1GO3 F;  3OW2 U;  2P90 A;  2WLL A;  1NQT A;  4GCZ A;  4LC1 A;  4MVR A;  2W0F C;  4YXW G;  3ZMT A;  1G4Y B;  1NVP D;  4MSW C;  1KKD A;  3ABM C;  3E35 A;  3G4S V;  3JYC A;  3NXS A;  1QLE C;  2WSS G;  2ZD9 A;  2WLI B;  5L3D A;  3AG3 B;  3X2Q C;  1JQ0 A;  5LBQ A;  3KG2 A;  3OE7 G;  3RVY A;  2XAQ A;  2F43 G;  2QEX V;  4L87 A;  3ABL C;  2ITD C;  1W2B U;  3SYQ A;  3IC7 A;  3FB6 C;  4PDL A;  3JD3 A;  1EFR G;  1WLE A;  4WFE A;  3QO7 A;  3LDC A;  4WCE V;  2ZDI C;  3CCS V;  1YTF D;  1S3J A;  3CCQ V;  1K4D C;  2ZXW C;  5DN6 G;  5EBM C;  5IYD O;  4J9Z B;  4QJF B;  2WLM A;  2M7W A;  3FB8 C;  1Y4M A;  4LBE C;  1OCO C;  1H2G A;  3OMI B;  2X6B A;  2JK5 C;  2Y48 A;  3ETD A;  1JCH A;  1K7D A;  1QVF U;  2X6A A;  2GSM B;  4WFA V;  2Z3Y A;  1CPY A;  2QA4 V;  2NLJ C;  2HG5 C;  2DYS C;  3JCZ A;  4ZKI A;  2EIN C;  5KA5 A;  2D3O W;  1CEZ A;  1QLE B;  3ETE A;  3ABM B;  3GB7 C;  1V54 B;  1FS0 G;  4X88 A;  1S5H C;  1VQ6 V;  4UVA A;  3ASN C;  1MOF A;  2OTJ V;  3W7S A;  3K04 A;  3OEE G;  3OR6 C;  5B3S C;  2EIL B;  2CK3 G;  3D3I A;  1K9M W;  4E2L A;  3WG7 B;  1Q7Y W;  4GX5 A;  1FXK B;  4P9O A;  2NNU A;  1AI5 A;  2WWW A;  3ZIA G;  3T4D A;  4PA4 A;  4QE9 A;  1ARO P;  1DTO A;  3T4Z A;  3FB5 C;  3FKS G;  4QNH B;  3OUS A;  2JDI G;  2EIM B;  1V54 C;  1NJI W;  4XDL A;  1DLB A;  5L3C A;  1VQL V;  2QM7 A;  2Q6A A;  3ABU A;  3CC7 V;  1K5Q A;  2OTL V;  5B1B B;  2YSU B;  5IYB O;  1BL8 A;  1M56 C;  3SPH A;  3AG2 C;  3TK1 A;  4Z1M G;  2A9H A;  1OCO B;  2UXX A;  4JYB A;  4I9W A;  2XAJ A;  4WF9 V;  1H38 A;  4R8C A;  4EKW A;  3E2E A;  4LCU C;  3W7T A;  1VQ7 V;  4MTG A;  1QVG U;  1VQK V;  1OZ0 A;  4DXW A;  3ETG A;  1RM1 B;  1K73 W;  2AHZ A;  3STZ C;  2WAM A;  3ZMV A;  3D36 A;  2X0L A;  3LSS A;  3LUT B;  1GM8 A;  3G71 V;  2IW5 A;  2DWD C;  4ZBM A;  2EIJ C;  4MW3 A;  3F5W C;  2OCC B;  1JVM A;  3ABT A;  1YTF B;  4PDM A;  3UM7 A;  5CBF A;  4DO2 A;  3F7V C;  1FXK C;  3B8M A;  3AG1 C;  4FPP A;  4I5S A;  1M90 W;  4RAI A;  5B1B C;  5J9P C;  1K33 A;  1OCC C;  1R73 A;  2EJR A;  4UV8 A;  4FJC C;  3CCV V;  2FTK A;  3SYP A;  3SPC A;  5IY5 C;  2Z5U A;  1FXV A;  3B8N A;  3CCL V;  2IJK A;  1M1K W;  5KUM A;  2QE7 G;  3CMA V;  2DWE C;  5L3F A;  1M57 C;  2EIK C;  1ZWI C;  2A79 B;  2ATK C;  2HLD G;  2OT5 A;  2X7R B;  4BIU A;  1VQO V;  3UKM A;  3E8B A;  3ASN B;  1QR8 A;  2WLI A;  2IU3 A;  4MVS A;  4JAV A;  3OAA G;  3K9A A;  5B1A C;  1K3E A;  1CP9 A;  2EIJ B;  1GK9 A;  4WFG A;  1PL0 A;  3E8F A;  1R3I C;  2H94 A;  5C93 A;  1NH2 D;  2WLN A;  3OMN B;  1NR7 A;  1NH2 B;  4PEL A;  1G8M A;  3CC2 V;  2ZR3 A;  1HWY A;  4MW8 A;  3AEI A;  3LDD A;  1YIT V;  5DM6 V;  2DYR C;  1AJQ A;  1P4R A;  3E89 A;  4UXN A;  1WPX A;  1YJW V;  1OCZ B;  1SES A;  1K97 A;  1AI6 A;  1QCE A;  2A0L A;  2IH3 C;  2EZP A;  3F7Y C;  1VQN V;  5EBL C;  4MS2 A;  1SZT A;  3ZRW A;  3SPJ A;  1K8A W;  3K79 A;  4QIW F;  1NR1 A;  2LFS A;  4X89 A;  1NKD A;  1SRY A;  4RUF A;  3AG2 B;  1YSC A;  3MHH C;  3IFX A;  3IGA C;  2BOC C;  1AR1 B;  5CMU A;  4KFM A;  4N21 A;  2HVK C;  3MD0 A;  1XL6 A;  2XOK G;  3E83 A;  1P7B A;  4PDR A;  1V55 B;  2ITC C;  4BIZ A;  3ML0 A;  4XDJ A;  4RUE A;  2B5U A;  2DYS B;  1AJP A;  3ZCC A;  3CCE V;  1B6Q A;  2IU0 A;  1H8E G;  4PDV A;  4CZZ A;  1H8H G;  2BOB C;  3QO8 A;  2YEV B;  4H37 A;  1GM7 A;  1JOY A;  5GW7 A;  3OFN G;  1PNK A;  3OR7 C;  2AHY A;  3RW0 A;  4RO2 A;  1XL4 A;  1W0J G;  3I55 V;  5LHI A;  3ZMS A;  2Y69 B;  4FMT A;  4MVU A;  3CP1 A;  1K34 A;  3SYA A;  4CBC A;  1ORQ C;  4P2Z A;  3VOU A;  1S72 V;  3ZJZ A;  3P32 A;  3DGE A;  4OXS A;  2V1D A;  4TWK A;  4N23 A;  2HFE C;  3AG3 C;  3T1C A;  4ASU G;  2WLH A;  5HFM A;  1YHQ V;  1VQ9 V;  5IY5 B;  2DW4 A;  2Q69 A;  1QR9 A;  5CBG A;  4GT1 A;  4QPJ A;  5LGN A;  2Q67 A;  1KP2 A;  1R3L C;  3ABL B;  3GWO A;  1JJ2 U;  1MG1 A;  4PA6 A;  4G28 B;  2EIL C;  3SJQ C;  1M9N A;  3JD0 A;  1PNL A;  5LGT A;  3K08 A;  4UUJ C;  2EZO A;  3CCM V;  2WPD G;  4UVB A;  5HFL A;  2WLL B;  3JD4 A;  1F4N A;  2XAS A;  1EBO A;  2R9I A;  2W6J G;  1Q86 W;  3B77 A;  4HAM A;  5FL7 G;  1RM1 C;  1K92 A;  5H6R A;  3RVZ A;  2HKO A;  4JGS A;  1KC8 W;  3QO5 A;  1PNM A;  1PKX A;  3ZRX A;  5LGU A;  1TUE B;  1KQS U;  2MK3 A;  3X2Q B;  4MVO A;  1E1R G;  4JF3 A;  3OGC C;  5CA3 A;  1YI2 V;  3HB3 B;  1OCR B;  5E1A C;  3JD2 A;  3WFV A;  4J9Y B;  4RQE A;  3K3W A;  3ZMU A;  4UVC A;  3MHS C;  4TT3 G;  3AG4 C;  1VQM V;  4PA3 A;  4FIP C;  1VQ8 V;  2DQ3 A;  3CCR V;  2JEU A;  1VQ4 V;  1FXK A;  2QTO A;  2ZQM A;  1OHH G;  3FYE B;  1I5Y A;  4MTO A;  5B1N A;  4MVZ A;  3ASO C;  4X8A A;  1LNQ A;  4JAU A;  4F4L A;  2HJF C;  2JIZ G;  3FYI B;  1YIJ V;  1GM9 A;  2DQ0 A;  4R50 A;  2V7Q G;  1I5X A;  4TSF G;  1MAB G;  5KUK A;  3CD6 V;  2UXN A;  1V55 C;  1SER A;  2R9R B;  4JAS A;  1F51 A;  2IJJ A;  1OCZ C;  3QNE A;  2ZR2 A;  4PA7 A;  1S76 D;  4G27 B;  1QBZ A;  5IDJ A;  1BHA A;  3W7U A;  2P7T C;  1VQ5 V;  3TCU A;  1FXH A;  3SYO A;  3WG7 C;  1R6N A;  4JYC A;  2GHY A;  4U7N A;  3JD1 A;  1E79 G;  3LNM B;  1R6K A;  3CPW U;  1YJ9 V;  5KA6 A;  3AG4 B;  4JPR A;  1MSW D;  1L1F A;  4LP8 A;  4XBF A;  4WFB V;  4WFH A;  1Q82 W;  3STL C;  1QLN A;  1K4C C;  3ASO B;  3VBB A;  2PI5 A;  4MTF A;  4MVQ A;  4Q20 A;  2HVJ C;  2QKS A;  4XDK A;  1DF4 A;  2H8P C;  2C2A A;  2X6C A;  3H01 A;  1F4M A;  2XAH A;  3K0D A;  4U7O A;  2JEX A;  5L3G A;  3FB7 C;  3T2M A;  5LHG A;  2EIN B;  3CC4 V;  1KEC A;  3OEH G;  1RPO A;  2XAF A;  3W7X A;  3E86 A;  2KB1 A;  2XND G;  3R65 A;  2ZDI A;  1NVP B;  4GX1 A;  5LHH A;  3ZMZ A;  3ZN1 A;  3K0G A;  3A0R A;  1K5S A;  4GX0 A;  1JPX A;  3LSQ A;  3AG1 B;  3CYO A;  4P9P A;  1DF5 A;  5CN0 A;  1W0K G;  3ABK C;  3SYC A;  5CBH A;  4HYO A;  4QE7 A;  1AJN A;  1ENV A;  1YJN V;  3BEH A;  2ZXW B;  5EBW C;  2PI4 A;  1BMF G;  2W6I G;  4JTD B;  2IJI A;  4RQF A;  4R7C A;  5B1O A;  2JJ2 G;  4GX2 A;  4KP4 A;  1GTO A;  4MT8 A;  4P30 A;  1NBM G;  2DYR B;  3E8G A;  1AI7 A;  1AI4 A;  3CME V;  3CCU V;  2IH1 C;  4H33 A;  2JJ1 G;  1M57 B;  2EIK B;  2P67 A;  4PA9 A;  4JTA B;  4HZ3 A;  5BZB A;  2HR3 A;  2OCC C;  3OMA B;  4WFF A;  1S77 D;  3P30 A;  1N8R W;  3W7W A;  1J95 A;  1KP3 A;  3PJS K;  4BW5 A;  4MVM A;  5B1A B;  1GKF A;  1PD3 A;  2YEV A;  3BY6 A;  3E8H A;  3G6E V;  1Q81 W;  4MTX A;  3ZRW B;  5L3E A;  1OCC B;  5H6Q A;  5L3B A;  1EZJ A;  5EC2 C;  2K1E A;  1IXM A;  3K03 A;  3HPL C;  2WLJ A;  3EFF K;  1KD1 W;  3EHB B;  4JTC B;  1UJW B;  3CXC U;  2IJH A;  2WLK A;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...