3FB6C

Kcsa potassium channel in the partially open state with 16 a opening at t112
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
QWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
publication title KcsA Potassium channel in the partially open state with 16 A opening at T112
rcsb
source organism Streptomyces lividans
total genus 34
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb6C00
3F7YC 4UUJC 3ZRSA 2AHYA 4J9YB 3IFXA 4GX1A 2ATKC 4MTOA 4MVUA 3E8FA 2Q68A 4JTDB 2W0FC 4PA3A 5B1AC 2BOBC 3R65A 4WFHA 3SYOA 2EIMC 2EINC 4OXSA 2IH1C 4MVMA 4MW3A 2AHZA 3ASNC 3AG1C 4MVSA 3SPIA 3UM7A 1P7BA 2WLIA 1OCZC 4X88A 4R6ZA 1G4YB 3ABKC 4XDKA 4CBCA 5IY5C 3KG2A 4JTCB 3K08A 3SYQA 3OR6C 2A0LA 3IGAC 4DXWA 5B3SC 3BEHA 2BOCC 5EK0A 4GX5A 5EC2C 5BZBA 4TWKA 4F4LA 4MVZA 3RVYA 3SPCA 3F5WC 5EBMC 4RUEA 3STLC 4R50A 3T2MA 3AG2C 4QNHB 3RBZA 4MVQA 4PDRA 2NLJC 3SPJA 2DYRC 3E8GA 4EKWA 1R3KC 2X6BA 2WLMA 3RVZA 4PDMA 3SYCA 3VOUA 4WFFA 4XDLA 5J9PC 2DWEC 2HVKC 4PDLA 4GX0A 3K06A 1OCCC 3OR7C 1R3JC 2QKSA 3FB6C 4PDVA 5CBFA 2Q69A 1K4CC 5CBGA 4MSWC 2HJFC 4BW5A 5E1AC 2HVJC 2JK5C 4JTAB 4WFGA 3ASOC 3FB5C 2X6AA 2A79B 3LNMB 2EIKC 2DYSC 1J95A 4RO2A 1JVMA 2KB1A 3E8HA 3T1CA 4QE9A 3T4ZA 2WLHA 3PJSK 4GX2A 1K4DC 1ZWIC 3FB7C 4J9ZB 4X8AA 3SYAA 3K03A 2HG5C 4R8CA 4PA7A 4MTGA 5CBHA 1OCRC 4R7CA 1OCOC 1S5HC 1QLEC 3K0DA 1R3IC 3LDCA 2WLIB 1R3LC 3STZC 4KFMA 4QE7A 1M57C 4WFEA 2HFEC 5KUMA 2X6CA 3K04A 4MVRA 3TETA 2ITDC 4XDJA 2Q67A 5B1BC 4G27B 3F7VC 4H33A 2P7TC 2ZXWC 3E86A 3ZJZA 2A9HA 2H8PC 4LBEC 2K1EA 3FB8C 2WLLB 3E89A 4PA6A 3EFFK 3OUSA 3OUFA 3SPHA 4MTFA 3SPGA 5EBLC 4ZBMA 3AG4C 4X89A 3ABMC 4I9WA 1M56C 1ORQC 5EBWC 2QTOA 1V54C 4P30A 1KKDA 4PA9A 2EIJC 3ABLC 3K0GA 4LP8A 3T4DA 5KUKA 3LUTB 3TCUA 4P9OA 3E8BA 4HYOA 4MW8A 5EC1C 3HPLC 4MS2A 3SJQC 1XL6A 3LDDA 2ZD9A 3RW0A 4RAIA 4LCUC 2DWDC 4HZ3A 3SYPA 1BL8A 3JYCA 3E83A 2WLKA 4P9PA 4G28B 2IH3C 4P2ZA 2OCCC 4PA4A 2Y69C 2EILC 1V55C 3X2QC 2WLNA 2WLJA 2YEVA 3WG7C 3GB7C 1XL4A 3AG3C 4H37A 1LNQA 2R9RB 3UKMA 2Q6AA 4MVOA 4RUFA 3OGCC 2ITCC 2WLLA 3LDEA
chains in the Genus database with same CATH superfamily
4UUJC 4B7KA 3IFXA 2A7WA 1OCCB 3HKCB 1PL4A 5B1AC 1IXBA 5B1NA 3UO2A 1IZ3A 3SDLA 3JALA 1CP9A 3CCQV 1O9HA 4DV1B 2CDYA 4YHHO 2X6BA 5J9PC 2PUSA 1Q81W 2N05A 4B3SO 2EBOA 5IJ0B 3JATB 3ZBHA 4HNAB 3RYHB 1VQ8V 2EIJB 1BGYH 5K1PA 2QGNA 2WLHA 2IJIA 1K4DC 1NKDA 2YXHA 1N33B 5ITZB 5IT9N 3W7SA 4QIWF 5CBHA 4NXMB 1XI1A 3IAYA 5BY1A 1M57C 2FL4A 5CA0A 4W4KA 1XMOB 2EILB 2OTLV 4F6RB 1AILA 1AVMA 4XBFA 2JVDA 3JCZA 2Y4UA 1GMGA 3E89A 3OEEG 3CSXA 2QR4A 2FB5A 3HKDA 1K5SA 1M1KW 2OIGA 2LFSA 1YIJV 2UUCO 4MW8A 5LP6B 1RPRA 1XNRO 3CYOA 1XL6A 3K5OA 1YTFB 2CK3G 1NJIW 1ZL8A 1AI5A 3ZIAG 4P9PA 2Y69C 3QO5A 1TAEA 4YIOA 4JYBA 3AK1A 2PYLA 3G4SV 1BCCH 4F6EA 1KC8W 3E8FA 2Q68A 1EZVH 1H2MA 5DM6V 4JYYA 1Z5WA 2JGDB 1TUBB 2WAMA 2EIMC 2EINC 3RYFA 2UXXA 2LO1A 3UM7A 4DV2B 1I5XA 4X66O 4DV4O 4TV9A 4UVCA 1FFTB 4Q20A 3ETEA 5LMUB 3H9VA 2N04A 3RYIA 4RUEA 3STLC 4LFCO 1YSCA 2ETNA 2F4VB 4EKWA 2XTAA 3E22A 2KSDA 2CAZC 1CPYA 4GX0A 4IYIA 3S3XA 4I7ZB 4DV3O 2F66C 3B4SA 3WB2A 1K4CC 2GTSA 1K33A 1P84F 2BTOA 5HFMA 4JI5B 1F4NA 1J95A 4TQFA 1ZTEA 3FAVA 1M57B 1JQ0A 5H6RA 1SESA 3STZC 4DV5O 4K8ZA 1N34B 5JJEB 4TV8B 5B1BC 3E35A 4G27B 3ZN1A 3F7VC 4FLUA 3ZMTA 2K1EA 5CMUA 1SERA 3OUFA 1H2GA 4YJ3B 1Q86W 1KU9A 3SPGA 5EBLC 4J41A 1XILA 4X1IA 3ABMC 1NS1A 5EBWC 4LP8A 4X62O 4ASUG 2LW7A 4UCOA 3HPLC 3VQWA 1AR5A 2VQEO 4FIPC 1J5EO 4U3FH 4B3TB 4OPHA 3B40A 1TA8A 2Y69B 2ARHA 1QBZA 2LP7A 4BIUA 2FKXA 5IYZB 3X2QC 3B8MA 3QG5A 2Q4PA 5LXTA 3QO7A 4FM1A 2W6IG 4DR2O 1F7YA 2Q6AA 4O4JA 4U7NA 2AHYA 2JS5A 5J2TB 1BS3A 1R6NA 2EIMB 3K59A 1QLNA 2W0FC 4BIOA 3R65A 4UVAA 4YY3B 1S3JA 3JASA 4X88A 2CTPA 4XDKA 1Y76A 2Y48A 3KZIZ 4KL1A 4TQDA 2R9IA 5GW7A 4NTXA 4KHPO 2UXDB 4R50A 3DGEA 3T1YO 1I0HA 3E8GA 1I7FA 2ZCEA 3W7UA 4LF5B 1GM8A 2UU9O 3HKCA 4JI3O 5JJJB 1ROPA 2Q69A 1RSOB 4MSWC 2IJHA 3ETQA 2R72A 3M8AA 1FAFA 1V54B 2G38A 3BRCA 3T1CA 1I94O 1EM1A 3K03A 2DQ3A 4ZOLB 2Q73A 2JJ2G 4GUNA 5B1BB 1E79G 2HFEC 2X6CA 3L70H 1K8AW 1L1FA 4JI2O 2P7TC 3E86A 3SJCC 2UUBO 4UCUA 3SPHA 3ABMB 5IJ0A 3H1KH 4FM2A 3JATA 3ZMZA 1WJZA 3R66A 4K0KO 1QNMA 1GO3F 4EB6B 5IJ9B 4DW1A 4HNAA 1HWYA 4JYAO 2ZIOA 5FPRA 5KUKA 3LSQA 5IWAO 3CCUV 1PKXA 4DR1B 4DR5B 5L3EA 2K9PA 3OMNB 4LF8B 2ZR2A 5KLVH 3X2QB 4I5SA 3ZEDA 3JD4A 4GKJB 1KKCA 3OMAB 3A0HZ 4F6RA 1O9GA 1W0KG 4JAAA 5L3BA 4GLXA 2ITCC 3G6BA 1W2BU 1FXKC 2QWPB 4ZKIA 3NXSA 4NR1A 2Q0OC 4B3RO 2EX3A 4GKKO 1NBMG 2YI8A 3CRCA 1K3EA 4CH3A 4UVBA 1M90W 4KUMA 5LP6A 3RN4A 3ABKC 5IY5C 1SQQH 4K35A 3SYQA 2AZ2A 4DXWA 3QNEA 4F4LA 4O4IB 1BHBA 4DR3B 4NXNO 3JAKB 4ZHQA 1VQMV 2XAHA 3BAAA 2UXCO 3FB6C 1DLBA 4LFAO 1RP3B 2JGDA 4X64B 3ASOC 3FB5C 1U96A 2DYSC 3E8HA 1K9MW 4QE9A 5KAFZ 1VQ5V 3PJSK 3L71H 2JEXA 3UT5B 2HG5C 1OCRC 1FD9A 1HNZB 1H2SB 2AXTZ 3BA9A 4Z2WA 3EXAA 2ADPA 4J7JA 1SZXA 4K8XA 3KKYA 4FK5C 4I0XB 1GN3A 2QWQB 1NT2B 3QTCA 1SQFA 1R73A 2WLLB 1BHAA 2M7WA 5JH7B 5KHJA 1Q8IA 5B1OA 4J80A 1M56C 1HNXO 4X65O 3G80A 1TVKB 1CEZA 1P7GA 2P06A 1OCZB 1MMMA 3LSUA 4UB6Z 4D6TH 4UV9A 2ZM6O 2R9AA 4JZ2A 1MG1A 3IC9A 5DEDA 2OCCC 3CC4V 2DN9A 5BXZA 1FXKB 1QQCA 5IE9A 1K92A 1SF9A 3LDEA 4YJ3A 4LNUA 2HKOA 1HNWB 4MVUA 5JWPA 3JSLA 2QKAA 1XEQA 3CCLV 3I56V 4EFEA 1UJWB 4TT3G 2HLDG 3ABKB 5IY5B 1AJPA 4OXSA 5JQGA 4W4LA 2ODMA 1JJOA 1NH2B 3ZMSA 5LOVA 5FLXN 1KBHA 3AG2C 4JV5O 3F5TA 2DYRC 1WNSA 1VQ9V 1YVWA 5A9GA 1OJHA 1L0NH 1SC5B 4DR4O 1OCCC 3BVOA 5CBFA 4GYCB 2DYSB 2A06H 5LGTA 4H0LB 4WBNB 2VQFB 2ZNJA 1Y74B 4DV7O 1GKFA 1KD1W 3CS5A 3K0DA 4WFEA 4GCZA 2EJ7A 4LR3A 1VF5B 4JI1O 2WSSG 4YHHB 5LA6B 1H8EG 3ETGA 1IURA 5TISZ 2VWKA 3FB8C 4B3SB 1Q90D 1BMFG 1RM1C 2IU0A 5KA6A 2EIJC 4WCEV 1B06A 4DUZO 4P9OA 4ZOLA 3LDDA 3W7TA 1JFFB 2OCCB 2Q7HA 3P3NA 3JYCA 4LF9O 4QPJA 5KHKA 2EILC 2W6JG 1WP7A 1IBKO 1ENVA 4RUFA 2C2AA 5JVDB 3GWOA 1AJNA 3CJHB 1URFA 5IJ9A 1S77D 3ZMUA 2F43G 2IH1C 2Y0IA 1P7BA 2B9ZA 1SS3A 1PL0A 4JTCB 3IJ4A 2HHHO 3ZHQA 4CH4A 1XNRB 1DGSA 4I55B 4X1YA 1IBMO 3F5WC 3SJBC 1NR7A 3P30A 4O4HA 3ZHVA 4E4EA 4WFFA 3ZHTA 2CH7B 3H1IH 1XMQB 1IBLO 2CTRA 3ZHSA 1M9NA 1M5IA 3LSSA 3AG7A 2X6AA 3ML0A 2DJVA 2PYJA 1MSWD 2PI4A 2W0XA 3L72H 2H3OA 2XASA 4BAYA 3FB7C 4KXRA 3VQVA 1K34A 2L35A 4J7KA 4O4IA 4DV4B 4AI8A 3N2GB 2PY5A 2YS8A 4QE7A 3JAKA 2GBOA 4LFCB 3SR2C 1ZUQA 2YEVB 2FMLA 1H8HG 1S0VA 4X20B 1RM1B 5L3GA 1W59A 2QKCA 1FJGB 1WPBA 4ZBMA 5E79Z 4DV3B 2UUAB 4AQYO 5J2UA 4HYOA 1D5NA 2YDEA 2ZD9A 3CX5F 4RAIA 3E83A 4LWSB 2WLKA 1JCHA 5GTHZ 3BPZA 4I0XA 4CS3A 4DV5B 3AK2A 3ZRXA 1LNQA 1Z2GA 1JR9A 2V1DA 2WLLA 3ZRSA 5B5EZ 5JH7A 4JTDB 3VBBA 4DR7O 1VQOV 3FX7A 3OFNG 1PPJH 2N74A 2ZE6A 1TVKA 1YJ9V 3HKBB 2WLIA 1XNQO 2YXYA 4X62B 2M6YA 3OR6C 3BEHA 5BR8O 2VQEB 5EC2C 1J5EB 1OCOB 1X4TA 2B1IA 4QNHB 4CH5A 5A2QN 3T1HO 2QWNB 5LHGA 1FXKA 5EIBC 3GWKC 4DR2B 1GM7A 4JI0O 2ZE5A 2QKSA 1JOYA 3I55V 2R70A 3K9SA 2XHBA 2IBZH 3L75H 4FM0A 3B77A 3T4ZA 3JAWB 4JAVA 4X1KB 4ZI7B 4UV8A 1PNMA 4IGGA 3N2KB 1A32A 3LDCA 3CRAA 5JCOA 3RYCB 1NVPB 4JGSA 3IC7A 3TETA 1VF6C 1FYJA 3T1YB 4DV1O 3I5DA 4PJ0Z 5L3FA 4GT1A 4MTFA 1IX9A 3OM3B 3ZRVA 3MAQA 3BHPA 3CE2A 3CMEV 1ORQC 1V54C 1GK9A 1G6UA 1Y74A 1HR0O 2P4KA 3TCUA 4D7TA 2QTSA 2ZINA 1I94B 4CS2A 4UCVA 2BSKB 3RW0A 1MSDA 3MD0A 4HZ3A 1HDJA 4IYHA 1B3QA 1QVFU 4DW0A 5LA6A 4H37A 4RWUA 1WA8B 4FLYA 2F1MA 2YIBA 2YXLA 4FLZA 4O2BB 3H1LH 4MTOA 2ATKC 4I4TB 2YI9A 2UUBB 1QR9A 1E1QG 2PTMA 4K0KB 2IJKA 2Z0AA 5LHIA 4NYKA 3SPIA 1BSMA 3LNNA 2OTJV 1EFRG 3ZCCA 4JYAB 1JJ2U 5IWAB 1JFFA 4GX5A 4FPPA 4LC1A 3CRQA 3RVYA 5LGUA 2ILMA 5GONB 4J11A 1US6A 2XAFA 2NLJC 1FXHA 1EN4A 4UFZA 1KP2A 1Q7YW 5JVDA 2MW2B 5KX5B 3L74H 1KMIZ 3CJHA 3K06A 3Q4HA 2KKWA 4B3RB 5C93A 2RNBA 1Y6XA 2RMKB 1SETA 1SZTA 2GUZB 2DQ0A 2HJDA 4DV6O 2FTKA 1NR1A 4DV2O 5KHHA 4DO2A 5KUMA 5EIBD 5LMUO 2X0LA 1V55B 2Q67A 1K73W 4B08A 4H33A 3AG3B 4IT5A 4C7UA 4NXNB 2CH7A 3UO3A 3JD0A 4BR6A 3WFVA 1D2DA 2UXCB 3OTOO 4X89A 4LFAB 3K0GA 3ABLC 2V4DA 1K7DA 3CD6V 3SJQC 3J80N 2Q7GA 4JI6O 4PHZA 3N2GA 3NR7A 4JI8O 2IH3C 1ZX3A 2WLNA 2YEVA 4JAUA 5IDJA 3W7XA 2E5LB 3QO8A 2R9RB 1JA8A 1N32O 1JMKC 4X20A 1AR1B 3EHBB 3K57A 2HR3A 1V9PA 3CRMA 3RYHA 3K9AA 5ITZA 1KYOF 2WPDG 4MW3A 4MVSA 1HNXB 1OCZC 2QE7G 3O9OA 4QJFB 5LHHA 1Q3EA 1QR8A 2A0LA 2CUGA 1OV9A 1XREA 3FFQA 5LGNA 4LWSA 5EBMC 2ZM6B 3T2MA 2Q8VA 1UPGA 1Q6UA 3VOUA 3UQ8A 1VQKV 4XDLA 1LUWA 2EZPA 1F4MA 4PDLA 2P6JA 3KCYA 4IHJB 1EN5A 4EEQA 4FLTA 5CBGA 2YUAA 4BW5A 4I9QA 2RN9A 5H2FZ 2YC0A 5C8YB 5LL6Y 1G1XB 4JI4O 2D2CB 2DMXA 3K79A 3CCSV 3OW2U 1Y66A 3D3QA 4TUYB 5JCOC 2ZE8A 1IDSA 3D8CA 3K04A 1AI6A 4JV5B 3WG7B 1COWG 2ZXWC 2P90A 3ABTA 3ZX6A 1TUBA 1R1BA 2A9HA 4PA6A 4LH7A 3CCMV 4DR4B 3ABLB 3A0BZ 1DK1A 1KKDA 3JD1A 3JAWA 2YICA 4X1KA 1XHXA 4ZI7A 3QVNA 2JJ1G 4MS2A 4DV7B 1X59A 3BCCH 3N2KA 4N21A 1N0NA 1EBOA 2BCCH 3SYPA 1OHHG 1AP5A 2A3QA 1AB3A 1K5QA 3UKMA 4JI1B 4E2LA 2ADQB 3UCSC 5CB4B 3TXSA 2NR5A 4J10A 3L73H 1F51A 1Q43A 4D7SA 2UXBO 2Z3YA 1SQPH 3A2FA 4CBCA 1G4YB 3KG2A 2GTAA 4DUZB 2BSKA 1FFXB 5EYPB 1Q5OA 4TV8A 3ZHRA 2X7RB 5BZBA 1XHZA 4J7ZA 1H2KA 3OGIB 3TJTA 4LF9B 3SPJA 1WA8A 4B3MO 3D36C 4FVMA 4PDMA 4Q6GA 1IBKB 3D3IA 4O2BA 4I4TA 3FD9A 3DXRB 2CTWA 2XAGA 2D3OW 3CXHF 1XQ8A 1CXZB 1VQ4V 2LGQA 3HKEB 4UB8Z 4RO2A 3N27A 3ABUA 4J9ZB 3VQYA 5IYZA 1VQLV 5IYBO 3RYFB 3APQA 2HHHB 2O57A 5GONA 2JGUA 4QPKA 1R3LC 1JPXA 1IBMB 5J2TA 2ZXWB 2DE0X 5CA3A 5KX5A 4WFAV 3M7MX 4OPAA 3ZJZA 3B2EE 4FZ1A 3OD4A 2PZSA 3OEHG 1IBLB 2BE3A 1VQ7V 3C3SA 1NH2D 1FS0G 2KG7B 2YIAA 3ASNB 4OX9O 1NI8A 5EC1C 4LH6A 5CN0A 4X9QA 1QVGU 1VF6A 2OIEA 1FXVA 3P3PA 4LF6O 1AROP 3FAVB 2Q0AA 3FYIB 3CP1A 1RSOA 1SQBH 2HP8A 2JS3A 2AZ0A 1N4CA 3BY6A 4WFHA 1YZBA 1VARA 2EIKB 1OZ0A 2Y0PA 4R6ZA 3DSQA 1MOFA 4AQYB 4HBNA 1VP7A 3JD3A 4DV0O 1QLEB 2Z5UA 3G71V 2DOSA 4DR6O 2QM4A 5CA1B 3PN1A 5F2VO 2YIBD 1JX9A 1IVSA 2OCHA 3L9DA 2QDOA 4EB6A 2DWEC 1MNGA 2KQXA 5LXTB 3CCRV 5LMNO 2PGGA 3AG4B 4DR7B 4WFGA 2UUCB 3THOA 2IU3A 4L8JA 4NVPA 2RQ6A 1JVMA 3K58A 4GX2A 4I50B 4NTWA 3CB2A 4MTGA 4UCRA 1OCOC 5FNVB 1R3IC 5BR8B 3SGIA 1Y76B 1YF2A 4PI2A 1BE3H 3T1HB 4N23A 2P22C 5FPOA 4JF3A 2OWOA 2H8PC 1GH6A 4FLXA 4IHJA 4JI0B 5KHIA 4K3AA 5C8YA 4FLVA 2QA4V 1NTMH 4X66B 2VQFO 2GV9A 3RWRD 3JARB 2GDSA 4RQFA 5IYDO 1N8RW 2HEPA 1QCEA 5EZYB 4TUYA 2QJ1A 2JEUA 1AR4A 3GVMA 4PA4A 1ZLZA 5KAIZ 1NQTA 1G8MA 2H94A 1YJNV 1N36O 2GHYA 4FZ0A 4GX1A 1VQNV 1UFIA 2P4VA 1KB9F 4H13B 1E1RG 3UT5A 3WB0A 2OYQA 4JPRA 1LR1A 1SQGA 5K1XA 4LFBO 3FKSG 2PI5A 1YITV 2QM8A 1MZFA 1HR0B 1BZKA 1L0LH 2XAQA 1Q6HA 5EK0A 1I5YA 4MVZA 2ZR3A 1S5LZ 1GRJA 3K3WA 2CGNA 3RBZA 1GN6A 1R6KA 3SYCA 5CB4A 4JI7O 4DUYO 2EZOA 3CEIA 1R3JC 4LF4O 1AJQA 2WWWA 2HJFC 2MK3A 2JK5C 1PD3A 2A79B 2RDCA 4ICGA 4LF7O 1FFXA 5EYPA 5BMVB 1S5HC 1AP6A 3EVKA 1RFYA 5KHGA 2NN4A 1GM9A 4FFBB 2EULA 1H2LA 3DXRA 3KCXA 1FPOA 2JDIG 3WB1A 1PP9H 1XMQO 4ZHQB 1YTFD 3HKEA 5B1AB 3TGUH 4PA9A 4AHCA 4CH6A 3T4DA 2Q9LA 1VIBA 3K5NA 4DV6B 4KHPB 4LCUC 2DW4A 3ZRWB 3M99B 1V55C 1SKVA 4B7EA 1VMGA 4KP4A 3AG3C 3K5LA 1PNLA 1NTKH 4PD4F 2UU9B 3E8BA 4WBNA 3CCEV 4JI3B 3OAAG 3MHSC 4UXNA 5LYJB 4NTYA 2YSUB 1FJGO 2AW9A 3OTOB 1S5JA 3ZHUA 2KG7A 1XBLA 3AG1C 2UUAO 2YIDA 1N33O 2ZDIA 4U3JB 4EFBA 1QHTA 1YXBA 4IIJB 3P32A 3K08A 4NXMO 1NVPD 2E75B 3MHHC 3SPCA 4JI6B 3ETDA 1XMOO 4JI2B 4O2AB 4JI8B 2VS0A 1YJWV 2RCVA 2ZIMA 1T5EA 1NU1H 4DK0A 1PNKA 1Z5VA 2BTQB 1N32B 3U10A 3CMAV 1NTZH 2CTQA 3RT3C 3B09A 3U0ZA 2ZE7A 4JTAB 4TSFG 1VQPV 4LNUB 5LBQA 1D5AA 3SYAA 4X8AA 4R8CA 3ZMVA 5JQGB 1TGOA 1GN4A 2E76B 3D36A 3DC6A 1YHQV 1YCIA 5CA1A 4MVRA 5LOVB 1AI4A 5L3CA 3OTFA 4GKKB 4QGPA 1SQVH 2ZQMA 4YJ2B 2Y4TA 4I9WA 2EJRA 4I55A 1TUEB 2EINB 2LW1A 4I50A 4YXWG 3RFRA 2UXNA 5FNVA 1Q6IA 1DTOA 4JI4B 4OGQB 4DRXB 1BL8A 1HW7A 2B1GA 5D5PA 2F4VO 2OT5A 3WG7C 5FL7G 3CRRA 1H2NA 2P67A 3OGCC 4FLWA 5KA5A 2V7QG 4U7OA 1PV0A 4JI5O 1XOUA 2XAJA 1SA0B 3AG1B 1NZ6A 1MZEA 5JJNB 2LJ2A 4UCSA 3JARA 3G67A 4IL6Z 5EZYA 5B3SC 3S3WA 2QM7A 1WN7A 1EZJA 1N34O 4ABMA 2ZNIA 1M4UA 2LQTA 2WLMA 3RVZA 1QU7A 4PELA 3DTUB 3A0RA 2LFRA 3OE7G 4WFBV 3CC7V 1I08A 5H5NA 1KP3A 3OMIB 5E1AC 4X65B 1WP8A 2UXBB 4YIPA 1ZAUA 4G2KA 2KB1A 3B8NA 4B3TO 3E2EA 1DF5A 4R7CA 3ZS8C 1RPOA 1KQSU 3AEIA 5KMGB 4XDJA 4X1YB 1WB7A 1MABG 2XOKG 2WA4A 4B3MB 4O4LB 1P49A 3EFFK 3OUSA 4O4HB 3HKBA 1F23A 2QWOB 4YY3O 4P30A 1WB8A 3LUTB 5BMVA 4PV1B 4CZZA 1PM9A 1KECA 1DF4A 2UXDO 3JALB 1H38A 2E3CA 1YEWA 4TOIA 3JAMN 4ZIBA 4LF5O 4FFBA 4Z1VA 4MVOA 4G28B 3BFRA 3F7YC 3ICXA 4BW9A 3ZN0A 4FFKA 1U97A 4WF9V 4CC5A 2QEXV 2IJJA 1W0JG 4A5UB 4PA3A 5D5QA 3SYOA 5H9CA 4MVMA 1VEWA 3ASNC 5B3SB 1Y67A 2ZDIC 2GSMB 3RYCA 4OX9B 3DC5A 4CS4A 3W7WA 1KUQA 2QSAA 2BOCC 3ZRWA 2B5UA 2F93B 4TWKA 3BA8A 2CGOA 5J2UB 1BT8A 4RQEA 3K5MA 4PDRA 5H6QA 4LF6B 5CA0B 4FJCC 4PI0A 2L6LA 3U11A 1MA1A 2E5LO 2HVKC 1BQ0A 3CPWU 3OT7A 5LYJA 5DN6G 1FKAO 3HKDB 5GTIZ 2HVJC 4GZRB 2F95B 2JRIA 3LNMB 2EIKC 4U3JA 3TK1A 3A8TA 4DR1O 4IIJA 3HR0A 4DR5O 1ZWIC 3SJAC 4LF8O 4PA7A 3H1HH 1WLEA 4DK1A 4GKJO 1QLEC 5L3DA 2WLIB 1ZL8B 4KFMA 4DV0B 4O2AA 1P4RA 1AI7A 3CCVV 3CHXA 4DR6B 1ZSPA 4J42A 2BTQA 2WA3A 2VWJA 4LBEC 1M93A 2PF4E 3CCJV 3AG4C 2ZT9B 5LMNB 1EN6A 2IW5A 4TV9B 3O65A 2ZKOA 2AGAA 4H44B 1S72V 3CXCU 4DR3O 4P2ZA 3RYIB 4BIZA 2Q5ZA 1XL4A 2FYUH 3E22B 3VQXA 4UCTA 2RJZA 2IM9A 3JSNA 3TXQA 4J9YB 4MTXA 1L8DA 3CWBH 4JASA 2JIZG 4YJ2A 2GUZA 3JCUZ 4X64O 4NKGB 1YI2V 1SQXH 2BOBC 3APOA 3ASOB 2AHZA 3FYEB 3JD2A 1K97A 1XDCA 1IXMA 5AG2A 3J81N 1Q82W 1HNZO 3WU2Z 3IGAC 5B66Z 3HB3B 4DRXA 1OCRB 3QF7A 1LUVA 4Z1MG 4CC6A 4MVQA 1XUQA 2CE4A 1R3KC 3C90A 1WPXA 2NNUA 3G6EV 1N0JA 3C3TA 3OR7C 1N36B 1GAXA 3AK3A 4PDVA 4AILC 4BWAA 1SA0A 1B04A 4JZGA 1BQZA 1R6TA 4X1IB 4HAMA 1M56B 5DECA 2F23A 4L87A 2Q7EA 4LFBB 1S76D 3BABA 1GTOA 4MT8A 4FMTA 2VRZA 2XUMA 2ITDC 2XNDG 1HNWO 1SRYA 2E74B 4O4JB 4JI7B 4DUYB 2XT9A 1WAZA 4LF4B 1HP8A 2LGWA 1XNQB 2QTOA 1VQ6V 1VF7A 3Q4HB 3JASB 1GN2A 2QWRB 4JYCA 1YDXA 3MDSA 4LF7B 1Y4MA 1B6QA 3H01A 5LP6C 2DWDC 5IYCO 3CC2V 3J7AU 2P5OA 1THZA 5KMGA 4DYLA 3AG2B 2WLJA 3GB7C 4NB5A 5HFLA 2DYRB 3H1JH 4O4LA 3RGBA
chains in the Genus database with same CATH topology
3OAAG 3MHSC 4UUJC 1AR1B 3EHBB 4UXNA 3IFXA 2HR3A 2HKOA 4MVUA 1OCCB 3K9AA 3CCLV 3I56V 5B1AC 1UJWB 2YSUB 4TT3G 3ABKB 2HLDG 5IY5B 1AJPA 4OXSA 2WPDG 4MW3A 3AG1C 4MVSA 2ZDIA 1OCZC 5B1NA 2QE7G 5LHHA 4QJFB 3P32A 3K08A 1QR8A 2A0LA 1NH2B 3ZMSA 1NVPD 5LGNA 3MHHC 3SPCA 1CP9A 3CCQV 5EBMC 3T2MA 3AG2C 3ETDA 2DYRC 1VQ9V 2X6BA 1YJWV 3VOUA 1VQKV 4XDLA 5J9PC 1PNKA 2EZPA 1Q81W 1F4MA 4PDLA 2P6JA 1OCCC 3CMAV 5CBFA 2EBOA 5CBGA 2DYSB 4BW5A 5LGTA 4JTAB 4TSFG 1VQPV 5LBQA 1VQ8V 2EIJB 2WLHA 2IJIA 1K4DC 1NKDA 3SYAA 4X8AA 3K79A 3W7SA 1GKFA 4QIWF 4R8CA 3ZMVA 3CCSV 3OW2U 1Y66A 5CBHA 1KD1W 3K0DA 3D36A 1M57C 1YHQV 4WFEA 4GCZA 3K04A 4MVRA 2EILB 1AI6A 1AI4A 3WG7B 5L3CA 2WSSG 2OTLV 1COWG 2ZXWC 1H8EG 2P90A 3ABTA 3ETGA 4XBFA 2A9HA 3JCZA 3FB8C 1GMGA 3E89A 3OEEG 4PA6A 3CCMV 2ZQMA 1K5SA 1M1KW 3ABLB 1BMFG 2LFSA 4I9WA 1RM1C 2EJRA 2IU0A 1YIJV 5KA6A 1KKDA 1TUEB 2EIJC 2EINB 3JD1A 4WCEV 4P9OA 3E8BA 4YXWG 4MW8A 1RPRA 2JJ1G 4MS2A 3CYOA 1XL6A 2UXNA 3LDDA 4N21A 1DTOA 2CK3G 1YTFB 1NJIW 3W7TA 1EBOA 2OCCB 1AI5A 3ZIAG 3SYPA 1OHHG 1BL8A 2B1GA 3JYCA 4P9PA 4QPJA 2Y69C 2EILC 2OT5A 2W6JG 3QO5A 3WG7C 5FL7G 4JYBA 1ENVA 1K5QA 3UKMA 4RUFA 2P67A 3OGCC 2C2AA 4E2LA 3G4SV 5KA5A 2V7QG 3GWOA 1AJNA 1KC8W 3E8FA 2Q68A 5DM6V 4U7OA 1F51A 2XAJA 3AG1B 1S77D 2WAMA 2EIMC 2EINC 3ZMUA 2Z3YA 2F43G 2IH1C 2UXXA 3UM7A 1P7BA 4CBCA 1G4YB 3KG2A 1I5XA 1PL0A 4JTCB 5B3SC 4UVCA 1FFTB 2QM7A 5BZBA 2X7RB 4Q20A 3ETEA 3F5WC 1EZJA 1NR7A 4RUEA 3STLC 1YSCA 3P30A 3SPJA 4EKWA 2WLMA 3RVZA 4PDMA 4PELA 3D3IA 4WFFA 3DTUB 1CPYA 4GX0A 3A0RA 2LFRA 3OE7G 4WFBV 3CC7V 1K4CC 1M9NA 2XAGA 2D3OW 1KP3A 3OMIB 1K33A 5E1AC 3LSSA 1VQ4V 5HFMA 2X6AA 3ML0A 1MSWD 2PI4A 1F4NA 1J95A 4RO2A 4G2KA 2KB1A 3ABUA 2XASA 3B8NA 4BAYA 3FB7C 4J9ZB 1VQLV 3E2EA 1DF5A 1K34A 1M57B 4R7CA 5IYBO 1JQ0A 1RPOA 4QPKA 1R3LC 1JPXA 1SESA 5H6RA 4QE7A 3STZC 3AEIA 1KQSU 2ZXWB 4XDJA 5CA3A 4WFAV 5B1BC 2YEVB 3E35A 4G27B 3ZN1A 3F7VC 1H8HG 1MABG 2XOKG 3ZMTA 3ZJZA 1S0VA 2K1EA 5CMUA 3EFFK 3OEHG 3OUFA 1H2GA 3OUSA 1Q86W 1SERA 1RM1B 5L3GA 3SPGA 5EBLC 1F23A 4ZBMA 3ABMC 5EBWC 4P30A 1VQ7V 4LP8A 1NH2D 3LUTB 1FS0G 3ASNB 4ASUG 4HYOA 5EC1C 3HPLC 4CZZA 4FIPC 5CN0A 1KECA 1QVGU 2ZD9A 4RAIA 1DF4A 2Y69B 1QBZA 2LP7A 1FXVA 4BIUA 3E83A 1AROP 2WLKA 1H38A 1JCHA 3X2QC 3FYIB 3CP1A 3B8MA 3QO7A 2W6IG 3ZRXA 1LNQA 2Q6AA 4MVOA 2WLLA 2V1DA 4G28B 3F7YC 3ZRSA 4U7NA 2AHYA 3ZN0A 1R6NA 4WF9V 4JTDB 2EIMB 3VBBA 2QEXV 1QLNA 2IJJA 1W0JG 2W0FC 3BY6A 4PA3A 1VQOV 3R65A 4WFHA 4UVAA 3OFNG 3SYOA 1S3JA 5H9CA 4MVMA 1YJ9V 3ASNC 5B3SB 4X88A 2WLIA 2EIKB 1OZ0A 2ZDIC 4R6ZA 4XDKA 1MOFA 2GSMB 2Y48A 3OR6C 3W7WA 3BEHA 2BOCC 3ZRWA 5EC2C 2B5UA 3JD3A 4TWKA 1OCOB 2B1IA 1QLEB 2Z5UA 3G71V 2R9IA 5GW7A 4QNHB 4R50A 4RQEA 3DGEA 4PDRA 5H6QA 5LHGA 3E8GA 1FXKA 4FJCC 1JX9A 3W7UA 1GM8A 2DWEC 2HVKC 1GM7A 3CPWU 2QKSA 5DN6G 1ROPA 3CCRV 2Q69A 1JOYA 3I55V 4MSWC 2IJHA 2HVJC 3AG4B 4WFGA 2IU3A 3LNMB 2EIKC 3TK1A 1V54B 1JVMA 3B77A 3T1CA 3T4ZA 4GX2A 1ZWIC 4JAVA 3K03A 4PA7A 4MTGA 2DQ3A 4UV8A 1PNMA 1OCOC 1WLEA 1QLEC 2JJ2G 1R3IC 5L3DA 3LDCA 2WLIB 4KFMA 5B1BB 1E79G 1NVPB 2HFEC 1P4RA 4JGSA 1AI7A 2X6CA 3CCVV 3IC7A 3TETA 1K8AW 4N23A 1L1FA 2P7TC 4JF3A 3E86A 2H8PC 4LBEC 4GT1A 5L3FA 3SPHA 3ABMB 4MTFA 3ZMZA 3OM3B 3ZRVA 3CCJV 3AG4C 1GO3F 3CMEV 1ORQC 2QA4V 1V54C 1HWYA 1GK9A 5KUKA 3LSQA 3TCUA 3CCUV 2IW5A 4RQFA 1PKXA 5IYDO 1N8RW 1QCEA 5L3EA 3RW0A 3OMNB 3MD0A 2ZR2A 3X2QB 4I5SA 4HZ3A 3JD4A 2JEUA 1S72V 3CXCU 3OMAB 4P2ZA 4PA4A 1QVFU 4BIZA 1NQTA 1XL4A 1W0KG 4H37A 1G8MA 5L3BA 2ITCC 2H94A 1YJNV 2GHYA 4J9YB 4MTOA 4GX1A 2ATKC 1FXKC 4MTXA 1W2BU 4JASA 3NXSA 4ZKIA 1QR9A 2JIZG 1E1QG 1VQNV 1NBMG 1YI2V 1E1RG 2BOBC 1K3EA 2IJKA 4JPRA 5LHIA 4UVBA 3ASOB 2AHZA 3SPIA 1M90W 3FYEB 4KUMA 2OTJV 3JD2A 1EFRG 1K97A 3FKSG 1IXMA 3ABKC 3ZCCA 1YITV 2QM8A 5IY5C 2PI5A 1Q82W 1JJ2U 3SYQA 2XAQA 3IGAC 4DXWA 3QNEA 3HB3B 5EK0A 4GX5A 4FPPA 4LC1A 1I5YA 1OCRB 4F4LA 4MVZA 2ZR3A 3RVYA 5LGUA 4Z1MG 3K3WA 3RBZA 4MVQA 1BHBA 2XAFA 2NLJC 1R6KA 1FXHA 1R3KC 1KP2A 1Q7YW 1WPXA 2NNUA 3G6EV 3SYCA 1VQMV 2EZOA 2XAHA 3K06A 3OR7C 1R3JC 3FB6C 4PDVA 1AJQA 1DLBA 2WWWA 2HJFC 2MK3A 5C93A 2JK5C 1SETA 3ASOC 3FB5C 1PD3A 4HAMA 1M56B 1SZTA 2A79B 2DYSC 4L87A 3E8HA 2DQ0A 4QE9A 1K9MW 2FTKA 1VQ5V 3PJSK 1NR1A 2JEXA 2HG5C 1S76D 1OCRC 1GTOA 4MT8A 1S5HC 4FMTA 4DO2A 5KUMA 2X0LA 2ITDC 4FK5C 1V55B 2Q67A 1K73W 2XNDG 4H33A 3AG3B 1GM9A 1R73A 1SRYA 2WLLB 3JD0A 3WFVA 1BHAA 2M7WA 2JDIG 1YTFD 4X89A 5B1OA 5B1AB 1M56C 2QTOA 4PA9A 3K0GA 3ABLC 1VQ6V 3T4DA 1CEZA 1K7DA 4JYCA 3CD6V 1OCZB 3SJQC 1Y4MA 1B6QA 3H01A 4UV9A 4LCUC 2DWDC 2DW4A 3ZRWB 5IYCO 3CC2V 1MG1A 1THZA 3M99B 2IH3C 2OCCC 1V55C 3AG2B 2WLNA 2WLJA 2YEVA 4JAUA 5IDJA 4KP4A 3W7XA 3GB7C 3CC4V 5HFLA 3AG3C 1PNLA 2DYRB 3QO8A 1FXKB 2R9RB 1K92A 3CCEV 3LDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7Y C;  4UUJ C;  3ZRS A;  2AHY A;  4J9Y B;  3IFX A;  4GX1 A;  2ATK C;  4MTO A;  4MVU A;  3E8F A;  2Q68 A;  4JTD B;  2W0F C;  4PA3 A;  5B1A C;  2BOB C;  3R65 A;  4WFH A;  3SYO A;  2EIM C;  2EIN C;  4OXS A;  2IH1 C;  4MVM A;  4MW3 A;  2AHZ A;  3ASN C;  3AG1 C;  4MVS A;  3SPI A;  3UM7 A;  1P7B A;  2WLI A;  1OCZ C;  4X88 A;  4R6Z A;  1G4Y B;  3ABK C;  4XDK A;  4CBC A;  5IY5 C;  3KG2 A;  4JTC B;  3K08 A;  3SYQ A;  3OR6 C;  2A0L A;  3IGA C;  4DXW A;  5B3S C;  3BEH A;  2BOC C;  5EK0 A;  4GX5 A;  5EC2 C;  5BZB A;  4TWK A;  4F4L A;  4MVZ A;  3RVY A;  3SPC A;  3F5W C;  5EBM C;  4RUE A;  3STL C;  4R50 A;  3T2M A;  3AG2 C;  4QNH B;  3RBZ A;  4MVQ A;  4PDR A;  2NLJ C;  3SPJ A;  2DYR C;  3E8G A;  4EKW A;  1R3K C;  2X6B A;  2WLM A;  3RVZ A;  4PDM A;  3SYC A;  3VOU A;  4WFF A;  4XDL A;  5J9P C;  2DWE C;  2HVK C;  4PDL A;  4GX0 A;  3K06 A;  1OCC C;  3OR7 C;  1R3J C;  2QKS A;  3FB6 C;  4PDV A;  5CBF A;  2Q69 A;  1K4C C;  5CBG A;  4MSW C;  2HJF C;  4BW5 A;  5E1A C;  2HVJ C;  2JK5 C;  4JTA B;  4WFG A;  3ASO C;  3FB5 C;  2X6A A;  2A79 B;  3LNM B;  2EIK C;  2DYS C;  1J95 A;  4RO2 A;  1JVM A;  2KB1 A;  3E8H A;  3T1C A;  4QE9 A;  3T4Z A;  2WLH A;  3PJS K;  4GX2 A;  1K4D C;  1ZWI C;  3FB7 C;  4J9Z B;  4X8A A;  3SYA A;  3K03 A;  2HG5 C;  4R8C A;  4PA7 A;  4MTG A;  5CBH A;  1OCR C;  4R7C A;  1OCO C;  1S5H C;  1QLE C;  3K0D A;  1R3I C;  3LDC A;  2WLI B;  1R3L C;  3STZ C;  4KFM A;  4QE7 A;  1M57 C;  4WFE A;  2HFE C;  5KUM A;  2X6C A;  3K04 A;  4MVR A;  3TET A;  2ITD C;  4XDJ A;  2Q67 A;  5B1B C;  4G27 B;  3F7V C;  4H33 A;  2P7T C;  2ZXW C;  3E86 A;  3ZJZ A;  2A9H A;  2H8P C;  4LBE C;  2K1E A;  3FB8 C;  2WLL B;  3E89 A;  4PA6 A;  3EFF K;  3OUS A;  3OUF A;  3SPH A;  4MTF A;  3SPG A;  5EBL C;  4ZBM A;  3AG4 C;  4X89 A;  3ABM C;  4I9W A;  1M56 C;  1ORQ C;  5EBW C;  2QTO A;  1V54 C;  4P30 A;  1KKD A;  4PA9 A;  2EIJ C;  3ABL C;  3K0G A;  4LP8 A;  3T4D A;  5KUK A;  3LUT B;  3TCU A;  4P9O A;  3E8B A;  4HYO A;  4MW8 A;  5EC1 C;  3HPL C;  4MS2 A;  3SJQ C;  1XL6 A;  3LDD A;  2ZD9 A;  3RW0 A;  4RAI A;  4LCU C;  2DWD C;  4HZ3 A;  3SYP A;  1BL8 A;  3JYC A;  3E83 A;  2WLK A;  4P9P A;  4G28 B;  2IH3 C;  4P2Z A;  2OCC C;  4PA4 A;  2Y69 C;  2EIL C;  1V55 C;  3X2Q C;  2WLN A;  2WLJ A;  2YEV A;  3WG7 C;  3GB7 C;  1XL4 A;  3AG3 C;  4H37 A;  1LNQ A;  2R9R B;  3UKM A;  2Q6A A;  4MVO A;  4RUF A;  3OGC C;  2ITC C;  2WLL A;  3LDE A; 
#chains in the Genus database with same CATH topology
 4UUJ C;  4B7K A;  3IFX A;  2A7W A;  1OCC B;  3HKC B;  1PL4 A;  5B1A C;  1IXB A;  5B1N A;  3UO2 A;  1IZ3 A;  3SDL A;  3JAL A;  1CP9 A;  3CCQ V;  1O9H A;  4DV1 B;  2CDY A;  4YHH O;  2X6B A;  5J9P C;  2PUS A;  1Q81 W;  2N05 A;  4B3S O;  2EBO A;  5IJ0 B;  3JAT B;  3ZBH A;  4HNA B;  3RYH B;  1VQ8 V;  2EIJ B;  1BGY H;  5K1P A;  2QGN A;  2WLH A;  2IJI A;  1K4D C;  1NKD A;  2YXH A;  1N33 B;  5ITZ B;  5IT9 N;  3W7S A;  4QIW F;  5CBH A;  4NXM B;  1XI1 A;  3IAY A;  5BY1 A;  1M57 C;  2FL4 A;  5CA0 A;  4W4K A;  1XMO B;  2EIL B;  2OTL V;  4F6R B;  1AIL A;  1AVM A;  4XBF A;  2JVD A;  3JCZ A;  2Y4U A;  1GMG A;  3E89 A;  3OEE G;  3CSX A;  2QR4 A;  2FB5 A;  3HKD A;  1K5S A;  1M1K W;  2OIG A;  2LFS A;  1YIJ V;  2UUC O;  4MW8 A;  5LP6 B;  1RPR A;  1XNR O;  3CYO A;  1XL6 A;  3K5O A;  1YTF B;  2CK3 G;  1NJI W;  1ZL8 A;  1AI5 A;  3ZIA G;  4P9P A;  2Y69 C;  3QO5 A;  1TAE A;  4YIO A;  4JYB A;  3AK1 A;  2PYL A;  3G4S V;  1BCC H;  4F6E A;  1KC8 W;  3E8F A;  2Q68 A;  1EZV H;  1H2M A;  5DM6 V;  4JYY A;  1Z5W A;  2JGD B;  1TUB B;  2WAM A;  2EIM C;  2EIN C;  3RYF A;  2UXX A;  2LO1 A;  3UM7 A;  4DV2 B;  1I5X A;  4X66 O;  4DV4 O;  4TV9 A;  4UVC A;  1FFT B;  4Q20 A;  3ETE A;  5LMU B;  3H9V A;  2N04 A;  3RYI A;  4RUE A;  3STL C;  4LFC O;  1YSC A;  2ETN A;  2F4V B;  4EKW A;  2XTA A;  3E22 A;  2KSD A;  2CAZ C;  1CPY A;  4GX0 A;  4IYI A;  3S3X A;  4I7Z B;  4DV3 O;  2F66 C;  3B4S A;  3WB2 A;  1K4C C;  2GTS A;  1K33 A;  1P84 F;  2BTO A;  5HFM A;  4JI5 B;  1F4N A;  1J95 A;  4TQF A;  1ZTE A;  3FAV A;  1M57 B;  1JQ0 A;  5H6R A;  1SES A;  3STZ C;  4DV5 O;  4K8Z A;  1N34 B;  5JJE B;  4TV8 B;  5B1B C;  3E35 A;  4G27 B;  3ZN1 A;  3F7V C;  4FLU A;  3ZMT A;  2K1E A;  5CMU A;  1SER A;  3OUF A;  1H2G A;  4YJ3 B;  1Q86 W;  1KU9 A;  3SPG A;  5EBL C;  4J41 A;  1XIL A;  4X1I A;  3ABM C;  1NS1 A;  5EBW C;  4LP8 A;  4X62 O;  4ASU G;  2LW7 A;  4UCO A;  3HPL C;  3VQW A;  1AR5 A;  2VQE O;  4FIP C;  1J5E O;  4U3F H;  4B3T B;  4OPH A;  3B40 A;  1TA8 A;  2Y69 B;  2ARH A;  1QBZ A;  2LP7 A;  4BIU A;  2FKX A;  5IYZ B;  3X2Q C;  3B8M A;  3QG5 A;  2Q4P A;  5LXT A;  3QO7 A;  4FM1 A;  2W6I G;  4DR2 O;  1F7Y A;  2Q6A A;  4O4J A;  4U7N A;  2AHY A;  2JS5 A;  5J2T B;  1BS3 A;  1R6N A;  2EIM B;  3K59 A;  1QLN A;  2W0F C;  4BIO A;  3R65 A;  4UVA A;  4YY3 B;  1S3J A;  3JAS A;  4X88 A;  2CTP A;  4XDK A;  1Y76 A;  2Y48 A;  3KZI Z;  4KL1 A;  4TQD A;  2R9I A;  5GW7 A;  4NTX A;  4KHP O;  2UXD B;  4R50 A;  3DGE A;  3T1Y O;  1I0H A;  3E8G A;  1I7F A;  2ZCE A;  3W7U A;  4LF5 B;  1GM8 A;  2UU9 O;  3HKC A;  4JI3 O;  5JJJ B;  1ROP A;  2Q69 A;  1RSO B;  4MSW C;  2IJH A;  3ETQ A;  2R72 A;  3M8A A;  1FAF A;  1V54 B;  2G38 A;  3BRC A;  3T1C A;  1I94 O;  1EM1 A;  3K03 A;  2DQ3 A;  4ZOL B;  2Q73 A;  2JJ2 G;  4GUN A;  5B1B B;  1E79 G;  2HFE C;  2X6C A;  3L70 H;  1K8A W;  1L1F A;  4JI2 O;  2P7T C;  3E86 A;  3SJC C;  2UUB O;  4UCU A;  3SPH A;  3ABM B;  5IJ0 A;  3H1K H;  4FM2 A;  3JAT A;  3ZMZ A;  1WJZ A;  3R66 A;  4K0K O;  1QNM A;  1GO3 F;  4EB6 B;  5IJ9 B;  4DW1 A;  4HNA A;  1HWY A;  4JYA O;  2ZIO A;  5FPR A;  5KUK A;  3LSQ A;  5IWA O;  3CCU V;  1PKX A;  4DR1 B;  4DR5 B;  5L3E A;  2K9P A;  3OMN B;  4LF8 B;  2ZR2 A;  5KLV H;  3X2Q B;  4I5S A;  3ZED A;  3JD4 A;  4GKJ B;  1KKC A;  3OMA B;  3A0H Z;  4F6R A;  1O9G A;  1W0K G;  4JAA A;  5L3B A;  4GLX A;  2ITC C;  3G6B A;  1W2B U;  1FXK C;  2QWP B;  4ZKI A;  3NXS A;  4NR1 A;  2Q0O C;  4B3R O;  2EX3 A;  4GKK O;  1NBM G;  2YI8 A;  3CRC A;  1K3E A;  4CH3 A;  4UVB A;  1M90 W;  4KUM A;  5LP6 A;  3RN4 A;  3ABK C;  5IY5 C;  1SQQ H;  4K35 A;  3SYQ A;  2AZ2 A;  4DXW A;  3QNE A;  4F4L A;  4O4I B;  1BHB A;  4DR3 B;  4NXN O;  3JAK B;  4ZHQ A;  1VQM V;  2XAH A;  3BAA A;  2UXC O;  3FB6 C;  1DLB A;  4LFA O;  1RP3 B;  2JGD A;  4X64 B;  3ASO C;  3FB5 C;  1U96 A;  2DYS C;  3E8H A;  1K9M W;  4QE9 A;  5KAF Z;  1VQ5 V;  3PJS K;  3L71 H;  2JEX A;  3UT5 B;  2HG5 C;  1OCR C;  1FD9 A;  1HNZ B;  1H2S B;  2AXT Z;  3BA9 A;  4Z2W A;  3EXA A;  2ADP A;  4J7J A;  1SZX A;  4K8X A;  3KKY A;  4FK5 C;  4I0X B;  1GN3 A;  2QWQ B;  1NT2 B;  3QTC A;  1SQF A;  1R73 A;  2WLL B;  1BHA A;  2M7W A;  5JH7 B;  5KHJ A;  1Q8I A;  5B1O A;  4J80 A;  1M56 C;  1HNX O;  4X65 O;  3G80 A;  1TVK B;  1CEZ A;  1P7G A;  2P06 A;  1OCZ B;  1MMM A;  3LSU A;  4UB6 Z;  4D6T H;  4UV9 A;  2ZM6 O;  2R9A A;  4JZ2 A;  1MG1 A;  3IC9 A;  5DED A;  2OCC C;  3CC4 V;  2DN9 A;  5BXZ A;  1FXK B;  1QQC A;  5IE9 A;  1K92 A;  1SF9 A;  3LDE A;  4YJ3 A;  4LNU A;  2HKO A;  1HNW B;  4MVU A;  5JWP A;  3JSL A;  2QKA A;  1XEQ A;  3CCL V;  3I56 V;  4EFE A;  1UJW B;  4TT3 G;  2HLD G;  3ABK B;  5IY5 B;  1AJP A;  4OXS A;  5JQG A;  4W4L A;  2ODM A;  1JJO A;  1NH2 B;  3ZMS A;  5LOV A;  5FLX N;  1KBH A;  3AG2 C;  4JV5 O;  3F5T A;  2DYR C;  1WNS A;  1VQ9 V;  1YVW A;  5A9G A;  1OJH A;  1L0N H;  1SC5 B;  4DR4 O;  1OCC C;  3BVO A;  5CBF A;  4GYC B;  2DYS B;  2A06 H;  5LGT A;  4H0L B;  4WBN B;  2VQF B;  2ZNJ A;  1Y74 B;  4DV7 O;  1GKF A;  1KD1 W;  3CS5 A;  3K0D A;  4WFE A;  4GCZ A;  2EJ7 A;  4LR3 A;  1VF5 B;  4JI1 O;  2WSS G;  4YHH B;  5LA6 B;  1H8E G;  3ETG A;  1IUR A;  5TIS Z;  2VWK A;  3FB8 C;  4B3S B;  1Q90 D;  1BMF G;  1RM1 C;  2IU0 A;  5KA6 A;  2EIJ C;  4WCE V;  1B06 A;  4DUZ O;  4P9O A;  4ZOL A;  3LDD A;  3W7T A;  1JFF B;  2OCC B;  2Q7H A;  3P3N A;  3JYC A;  4LF9 O;  4QPJ A;  5KHK A;  2EIL C;  2W6J G;  1WP7 A;  1IBK O;  1ENV A;  4RUF A;  2C2A A;  5JVD B;  3GWO A;  1AJN A;  3CJH B;  1URF A;  5IJ9 A;  1S77 D;  3ZMU A;  2F43 G;  2IH1 C;  2Y0I A;  1P7B A;  2B9Z A;  1SS3 A;  1PL0 A;  4JTC B;  3IJ4 A;  2HHH O;  3ZHQ A;  4CH4 A;  1XNR B;  1DGS A;  4I55 B;  4X1Y A;  1IBM O;  3F5W C;  3SJB C;  1NR7 A;  3P30 A;  4O4H A;  3ZHV A;  4E4E A;  4WFF A;  3ZHT A;  2CH7 B;  3H1I H;  1XMQ B;  1IBL O;  2CTR A;  3ZHS A;  1M9N A;  1M5I A;  3LSS A;  3AG7 A;  2X6A A;  3ML0 A;  2DJV A;  2PYJ A;  1MSW D;  2PI4 A;  2W0X A;  3L72 H;  2H3O A;  2XAS A;  4BAY A;  3FB7 C;  4KXR A;  3VQV A;  1K34 A;  2L35 A;  4J7K A;  4O4I A;  4DV4 B;  4AI8 A;  3N2G B;  2PY5 A;  2YS8 A;  4QE7 A;  3JAK A;  2GBO A;  4LFC B;  3SR2 C;  1ZUQ A;  2YEV B;  2FML A;  1H8H G;  1S0V A;  4X20 B;  1RM1 B;  5L3G A;  1W59 A;  2QKC A;  1FJG B;  1WPB A;  4ZBM A;  5E79 Z;  4DV3 B;  2UUA B;  4AQY O;  5J2U A;  4HYO A;  1D5N A;  2YDE A;  2ZD9 A;  3CX5 F;  4RAI A;  3E83 A;  4LWS B;  2WLK A;  1JCH A;  5GTH Z;  3BPZ A;  4I0X A;  4CS3 A;  4DV5 B;  3AK2 A;  3ZRX A;  1LNQ A;  1Z2G A;  1JR9 A;  2V1D A;  2WLL A;  3ZRS A;  5B5E Z;  5JH7 A;  4JTD B;  3VBB A;  4DR7 O;  1VQO V;  3FX7 A;  3OFN G;  1PPJ H;  2N74 A;  2ZE6 A;  1TVK A;  1YJ9 V;  3HKB B;  2WLI A;  1XNQ O;  2YXY A;  4X62 B;  2M6Y A;  3OR6 C;  3BEH A;  5BR8 O;  2VQE B;  5EC2 C;  1J5E B;  1OCO B;  1X4T A;  2B1I A;  4QNH B;  4CH5 A;  5A2Q N;  3T1H O;  2QWN B;  5LHG A;  1FXK A;  5EIB C;  3GWK C;  4DR2 B;  1GM7 A;  4JI0 O;  2ZE5 A;  2QKS A;  1JOY A;  3I55 V;  2R70 A;  3K9S A;  2XHB A;  2IBZ H;  3L75 H;  4FM0 A;  3B77 A;  3T4Z A;  3JAW B;  4JAV A;  4X1K B;  4ZI7 B;  4UV8 A;  1PNM A;  4IGG A;  3N2K B;  1A32 A;  3LDC A;  3CRA A;  5JCO A;  3RYC B;  1NVP B;  4JGS A;  3IC7 A;  3TET A;  1VF6 C;  1FYJ A;  3T1Y B;  4DV1 O;  3I5D A;  4PJ0 Z;  5L3F A;  4GT1 A;  4MTF A;  1IX9 A;  3OM3 B;  3ZRV A;  3MAQ A;  3BHP A;  3CE2 A;  3CME V;  1ORQ C;  1V54 C;  1GK9 A;  1G6U A;  1Y74 A;  1HR0 O;  2P4K A;  3TCU A;  4D7T A;  2QTS A;  2ZIN A;  1I94 B;  4CS2 A;  4UCV A;  2BSK B;  3RW0 A;  1MSD A;  3MD0 A;  4HZ3 A;  1HDJ A;  4IYH A;  1B3Q A;  1QVF U;  4DW0 A;  5LA6 A;  4H37 A;  4RWU A;  1WA8 B;  4FLY A;  2F1M A;  2YIB A;  2YXL A;  4FLZ A;  4O2B B;  3H1L H;  4MTO A;  2ATK C;  4I4T B;  2YI9 A;  2UUB B;  1QR9 A;  1E1Q G;  2PTM A;  4K0K B;  2IJK A;  2Z0A A;  5LHI A;  4NYK A;  3SPI A;  1BSM A;  3LNN A;  2OTJ V;  1EFR G;  3ZCC A;  4JYA B;  1JJ2 U;  5IWA B;  1JFF A;  4GX5 A;  4FPP A;  4LC1 A;  3CRQ A;  3RVY A;  5LGU A;  2ILM A;  5GON B;  4J11 A;  1US6 A;  2XAF A;  2NLJ C;  1FXH A;  1EN4 A;  4UFZ A;  1KP2 A;  1Q7Y W;  5JVD A;  2MW2 B;  5KX5 B;  3L74 H;  1KMI Z;  3CJH A;  3K06 A;  3Q4H A;  2KKW A;  4B3R B;  5C93 A;  2RNB A;  1Y6X A;  2RMK B;  1SET A;  1SZT A;  2GUZ B;  2DQ0 A;  2HJD A;  4DV6 O;  2FTK A;  1NR1 A;  4DV2 O;  5KHH A;  4DO2 A;  5KUM A;  5EIB D;  5LMU O;  2X0L A;  1V55 B;  2Q67 A;  1K73 W;  4B08 A;  4H33 A;  3AG3 B;  4IT5 A;  4C7U A;  4NXN B;  2CH7 A;  3UO3 A;  3JD0 A;  4BR6 A;  3WFV A;  1D2D A;  2UXC B;  3OTO O;  4X89 A;  4LFA B;  3K0G A;  3ABL C;  2V4D A;  1K7D A;  3CD6 V;  3SJQ C;  3J80 N;  2Q7G A;  4JI6 O;  4PHZ A;  3N2G A;  3NR7 A;  4JI8 O;  2IH3 C;  1ZX3 A;  2WLN A;  2YEV A;  4JAU A;  5IDJ A;  3W7X A;  2E5L B;  3QO8 A;  2R9R B;  1JA8 A;  1N32 O;  1JMK C;  4X20 A;  1AR1 B;  3EHB B;  3K57 A;  2HR3 A;  1V9P A;  3CRM A;  3RYH A;  3K9A A;  5ITZ A;  1KYO F;  2WPD G;  4MW3 A;  4MVS A;  1HNX B;  1OCZ C;  2QE7 G;  3O9O A;  4QJF B;  5LHH A;  1Q3E A;  1QR8 A;  2A0L A;  2CUG A;  1OV9 A;  1XRE A;  3FFQ A;  5LGN A;  4LWS A;  5EBM C;  2ZM6 B;  3T2M A;  2Q8V A;  1UPG A;  1Q6U A;  3VOU A;  3UQ8 A;  1VQK V;  4XDL A;  1LUW A;  2EZP A;  1F4M A;  4PDL A;  2P6J A;  3KCY A;  4IHJ B;  1EN5 A;  4EEQ A;  4FLT A;  5CBG A;  2YUA A;  4BW5 A;  4I9Q A;  2RN9 A;  5H2F Z;  2YC0 A;  5C8Y B;  5LL6 Y;  1G1X B;  4JI4 O;  2D2C B;  2DMX A;  3K79 A;  3CCS V;  3OW2 U;  1Y66 A;  3D3Q A;  4TUY B;  5JCO C;  2ZE8 A;  1IDS A;  3D8C A;  3K04 A;  1AI6 A;  4JV5 B;  3WG7 B;  1COW G;  2ZXW C;  2P90 A;  3ABT A;  3ZX6 A;  1TUB A;  1R1B A;  2A9H A;  4PA6 A;  4LH7 A;  3CCM V;  4DR4 B;  3ABL B;  3A0B Z;  1DK1 A;  1KKD A;  3JD1 A;  3JAW A;  2YIC A;  4X1K A;  1XHX A;  4ZI7 A;  3QVN A;  2JJ1 G;  4MS2 A;  4DV7 B;  1X59 A;  3BCC H;  3N2K A;  4N21 A;  1N0N A;  1EBO A;  2BCC H;  3SYP A;  1OHH G;  1AP5 A;  2A3Q A;  1AB3 A;  1K5Q A;  3UKM A;  4JI1 B;  4E2L A;  2ADQ B;  3UCS C;  5CB4 B;  3TXS A;  2NR5 A;  4J10 A;  3L73 H;  1F51 A;  1Q43 A;  4D7S A;  2UXB O;  2Z3Y A;  1SQP H;  3A2F A;  4CBC A;  1G4Y B;  3KG2 A;  2GTA A;  4DUZ B;  2BSK A;  1FFX B;  5EYP B;  1Q5O A;  4TV8 A;  3ZHR A;  2X7R B;  5BZB A;  1XHZ A;  4J7Z A;  1H2K A;  3OGI B;  3TJT A;  4LF9 B;  3SPJ A;  1WA8 A;  4B3M O;  3D36 C;  4FVM A;  4PDM A;  4Q6G A;  1IBK B;  3D3I A;  4O2B A;  4I4T A;  3FD9 A;  3DXR B;  2CTW A;  2XAG A;  2D3O W;  3CXH F;  1XQ8 A;  1CXZ B;  1VQ4 V;  2LGQ A;  3HKE B;  4UB8 Z;  4RO2 A;  3N27 A;  3ABU A;  4J9Z B;  3VQY A;  5IYZ A;  1VQL V;  5IYB O;  3RYF B;  3APQ A;  2HHH B;  2O57 A;  5GON A;  2JGU A;  4QPK A;  1R3L C;  1JPX A;  1IBM B;  5J2T A;  2ZXW B;  2DE0 X;  5CA3 A;  5KX5 A;  4WFA V;  3M7M X;  4OPA A;  3ZJZ A;  3B2E E;  4FZ1 A;  3OD4 A;  2PZS A;  3OEH G;  1IBL B;  2BE3 A;  1VQ7 V;  3C3S A;  1NH2 D;  1FS0 G;  2KG7 B;  2YIA A;  3ASN B;  4OX9 O;  1NI8 A;  5EC1 C;  4LH6 A;  5CN0 A;  4X9Q A;  1QVG U;  1VF6 A;  2OIE A;  1FXV A;  3P3P A;  4LF6 O;  1ARO P;  3FAV B;  2Q0A A;  3FYI B;  3CP1 A;  1RSO A;  1SQB H;  2HP8 A;  2JS3 A;  2AZ0 A;  1N4C A;  3BY6 A;  4WFH A;  1YZB A;  1VAR A;  2EIK B;  1OZ0 A;  2Y0P A;  4R6Z A;  3DSQ A;  1MOF A;  4AQY B;  4HBN A;  1VP7 A;  3JD3 A;  4DV0 O;  1QLE B;  2Z5U A;  3G71 V;  2DOS A;  4DR6 O;  2QM4 A;  5CA1 B;  3PN1 A;  5F2V O;  2YIB D;  1JX9 A;  1IVS A;  2OCH A;  3L9D A;  2QDO A;  4EB6 A;  2DWE C;  1MNG A;  2KQX A;  5LXT B;  3CCR V;  5LMN O;  2PGG A;  3AG4 B;  4DR7 B;  4WFG A;  2UUC B;  3THO A;  2IU3 A;  4L8J A;  4NVP A;  2RQ6 A;  1JVM A;  3K58 A;  4GX2 A;  4I50 B;  4NTW A;  3CB2 A;  4MTG A;  4UCR A;  1OCO C;  5FNV B;  1R3I C;  5BR8 B;  3SGI A;  1Y76 B;  1YF2 A;  4PI2 A;  1BE3 H;  3T1H B;  4N23 A;  2P22 C;  5FPO A;  4JF3 A;  2OWO A;  2H8P C;  1GH6 A;  4FLX A;  4IHJ A;  4JI0 B;  5KHI A;  4K3A A;  5C8Y A;  4FLV A;  2QA4 V;  1NTM H;  4X66 B;  2VQF O;  2GV9 A;  3RWR D;  3JAR B;  2GDS A;  4RQF A;  5IYD O;  1N8R W;  2HEP A;  1QCE A;  5EZY B;  4TUY A;  2QJ1 A;  2JEU A;  1AR4 A;  3GVM A;  4PA4 A;  1ZLZ A;  5KAI Z;  1NQT A;  1G8M A;  2H94 A;  1YJN V;  1N36 O;  2GHY A;  4FZ0 A;  4GX1 A;  1VQN V;  1UFI A;  2P4V A;  1KB9 F;  4H13 B;  1E1R G;  3UT5 A;  3WB0 A;  2OYQ A;  4JPR A;  1LR1 A;  1SQG A;  5K1X A;  4LFB O;  3FKS G;  2PI5 A;  1YIT V;  2QM8 A;  1MZF A;  1HR0 B;  1BZK A;  1L0L H;  2XAQ A;  1Q6H A;  5EK0 A;  1I5Y A;  4MVZ A;  2ZR3 A;  1S5L Z;  1GRJ A;  3K3W A;  2CGN A;  3RBZ A;  1GN6 A;  1R6K A;  3SYC A;  5CB4 A;  4JI7 O;  4DUY O;  2EZO A;  3CEI A;  1R3J C;  4LF4 O;  1AJQ A;  2WWW A;  2HJF C;  2MK3 A;  2JK5 C;  1PD3 A;  2A79 B;  2RDC A;  4ICG A;  4LF7 O;  1FFX A;  5EYP A;  5BMV B;  1S5H C;  1AP6 A;  3EVK A;  1RFY A;  5KHG A;  2NN4 A;  1GM9 A;  4FFB B;  2EUL A;  1H2L A;  3DXR A;  3KCX A;  1FPO A;  2JDI G;  3WB1 A;  1PP9 H;  1XMQ O;  4ZHQ B;  1YTF D;  3HKE A;  5B1A B;  3TGU H;  4PA9 A;  4AHC A;  4CH6 A;  3T4D A;  2Q9L A;  1VIB A;  3K5N A;  4DV6 B;  4KHP B;  4LCU C;  2DW4 A;  3ZRW B;  3M99 B;  1V55 C;  1SKV A;  4B7E A;  1VMG A;  4KP4 A;  3AG3 C;  3K5L A;  1PNL A;  1NTK H;  4PD4 F;  2UU9 B;  3E8B A;  4WBN A;  3CCE V;  4JI3 B;  3OAA G;  3MHS C;  4UXN A;  5LYJ B;  4NTY A;  2YSU B;  1FJG O;  2AW9 A;  3OTO B;  1S5J A;  3ZHU A;  2KG7 A;  1XBL A;  3AG1 C;  2UUA O;  2YID A;  1N33 O;  2ZDI A;  4U3J B;  4EFB A;  1QHT A;  1YXB A;  4IIJ B;  3P32 A;  3K08 A;  4NXM O;  1NVP D;  2E75 B;  3MHH C;  3SPC A;  4JI6 B;  3ETD A;  1XMO O;  4JI2 B;  4O2A B;  4JI8 B;  2VS0 A;  1YJW V;  2RCV A;  2ZIM A;  1T5E A;  1NU1 H;  4DK0 A;  1PNK A;  1Z5V A;  2BTQ B;  1N32 B;  3U10 A;  3CMA V;  1NTZ H;  2CTQ A;  3RT3 C;  3B09 A;  3U0Z A;  2ZE7 A;  4JTA B;  4TSF G;  1VQP V;  4LNU B;  5LBQ A;  1D5A A;  3SYA A;  4X8A A;  4R8C A;  3ZMV A;  5JQG B;  1TGO A;  1GN4 A;  2E76 B;  3D36 A;  3DC6 A;  1YHQ V;  1YCI A;  5CA1 A;  4MVR A;  5LOV B;  1AI4 A;  5L3C A;  3OTF A;  4GKK B;  4QGP A;  1SQV H;  2ZQM A;  4YJ2 B;  2Y4T A;  4I9W A;  2EJR A;  4I55 A;  1TUE B;  2EIN B;  2LW1 A;  4I50 A;  4YXW G;  3RFR A;  2UXN A;  5FNV A;  1Q6I A;  1DTO A;  4JI4 B;  4OGQ B;  4DRX B;  1BL8 A;  1HW7 A;  2B1G A;  5D5P A;  2F4V O;  2OT5 A;  3WG7 C;  5FL7 G;  3CRR A;  1H2N A;  2P67 A;  3OGC C;  4FLW A;  5KA5 A;  2V7Q G;  4U7O A;  1PV0 A;  4JI5 O;  1XOU A;  2XAJ A;  1SA0 B;  3AG1 B;  1NZ6 A;  1MZE A;  5JJN B;  2LJ2 A;  4UCS A;  3JAR A;  3G67 A;  4IL6 Z;  5EZY A;  5B3S C;  3S3W A;  2QM7 A;  1WN7 A;  1EZJ A;  1N34 O;  4ABM A;  2ZNI A;  1M4U A;  2LQT A;  2WLM A;  3RVZ A;  1QU7 A;  4PEL A;  3DTU B;  3A0R A;  2LFR A;  3OE7 G;  4WFB V;  3CC7 V;  1I08 A;  5H5N A;  1KP3 A;  3OMI B;  5E1A C;  4X65 B;  1WP8 A;  2UXB B;  4YIP A;  1ZAU A;  4G2K A;  2KB1 A;  3B8N A;  4B3T O;  3E2E A;  1DF5 A;  4R7C A;  3ZS8 C;  1RPO A;  1KQS U;  3AEI A;  5KMG B;  4XDJ A;  4X1Y B;  1WB7 A;  1MAB G;  2XOK G;  2WA4 A;  4B3M B;  4O4L B;  1P49 A;  3EFF K;  3OUS A;  4O4H B;  3HKB A;  1F23 A;  2QWO B;  4YY3 O;  4P30 A;  1WB8 A;  3LUT B;  5BMV A;  4PV1 B;  4CZZ A;  1PM9 A;  1KEC A;  1DF4 A;  2UXD O;  3JAL B;  1H38 A;  2E3C A;  1YEW A;  4TOI A;  3JAM N;  4ZIB A;  4LF5 O;  4FFB A;  4Z1V A;  4MVO A;  4G28 B;  3BFR A;  3F7Y C;  3ICX A;  4BW9 A;  3ZN0 A;  4FFK A;  1U97 A;  4WF9 V;  4CC5 A;  2QEX V;  2IJJ A;  1W0J G;  4A5U B;  4PA3 A;  5D5Q A;  3SYO A;  5H9C A;  4MVM A;  1VEW A;  3ASN C;  5B3S B;  1Y67 A;  2ZDI C;  2GSM B;  3RYC A;  4OX9 B;  3DC5 A;  4CS4 A;  3W7W A;  1KUQ A;  2QSA A;  2BOC C;  3ZRW A;  2B5U A;  2F93 B;  4TWK A;  3BA8 A;  2CGO A;  5J2U B;  1BT8 A;  4RQE A;  3K5M A;  4PDR A;  5H6Q A;  4LF6 B;  5CA0 B;  4FJC C;  4PI0 A;  2L6L A;  3U11 A;  1MA1 A;  2E5L O;  2HVK C;  1BQ0 A;  3CPW U;  3OT7 A;  5LYJ A;  5DN6 G;  1FKA O;  3HKD B;  5GTI Z;  2HVJ C;  4GZR B;  2F95 B;  2JRI A;  3LNM B;  2EIK C;  4U3J A;  3TK1 A;  3A8T A;  4DR1 O;  4IIJ A;  3HR0 A;  4DR5 O;  1ZWI C;  3SJA C;  4LF8 O;  4PA7 A;  3H1H H;  1WLE A;  4DK1 A;  4GKJ O;  1QLE C;  5L3D A;  2WLI B;  1ZL8 B;  4KFM A;  4DV0 B;  4O2A A;  1P4R A;  1AI7 A;  3CCV V;  3CHX A;  4DR6 B;  1ZSP A;  4J42 A;  2BTQ A;  2WA3 A;  2VWJ A;  4LBE C;  1M93 A;  2PF4 E;  3CCJ V;  3AG4 C;  2ZT9 B;  5LMN B;  1EN6 A;  2IW5 A;  4TV9 B;  3O65 A;  2ZKO A;  2AGA A;  4H44 B;  1S72 V;  3CXC U;  4DR3 O;  4P2Z A;  3RYI B;  4BIZ A;  2Q5Z A;  1XL4 A;  2FYU H;  3E22 B;  3VQX A;  4UCT A;  2RJZ A;  2IM9 A;  3JSN A;  3TXQ A;  4J9Y B;  4MTX A;  1L8D A;  3CWB H;  4JAS A;  2JIZ G;  4YJ2 A;  2GUZ A;  3JCU Z;  4X64 O;  4NKG B;  1YI2 V;  1SQX H;  2BOB C;  3APO A;  3ASO B;  2AHZ A;  3FYE B;  3JD2 A;  1K97 A;  1XDC A;  1IXM A;  5AG2 A;  3J81 N;  1Q82 W;  1HNZ O;  3WU2 Z;  3IGA C;  5B66 Z;  3HB3 B;  4DRX A;  1OCR B;  3QF7 A;  1LUV A;  4Z1M G;  4CC6 A;  4MVQ A;  1XUQ A;  2CE4 A;  1R3K C;  3C90 A;  1WPX A;  2NNU A;  3G6E V;  1N0J A;  3C3T A;  3OR7 C;  1N36 B;  1GAX A;  3AK3 A;  4PDV A;  4AIL C;  4BWA A;  1SA0 A;  1B04 A;  4JZG A;  1BQZ A;  1R6T A;  4X1I B;  4HAM A;  1M56 B;  5DEC A;  2F23 A;  4L87 A;  2Q7E A;  4LFB B;  1S76 D;  3BAB A;  1GTO A;  4MT8 A;  4FMT A;  2VRZ A;  2XUM A;  2ITD C;  2XND G;  1HNW O;  1SRY A;  2E74 B;  4O4J B;  4JI7 B;  4DUY B;  2XT9 A;  1WAZ A;  4LF4 B;  1HP8 A;  2LGW A;  1XNQ B;  2QTO A;  1VQ6 V;  1VF7 A;  3Q4H B;  3JAS B;  1GN2 A;  2QWR B;  4JYC A;  1YDX A;  3MDS A;  4LF7 B;  1Y4M A;  1B6Q A;  3H01 A;  5LP6 C;  2DWD C;  5IYC O;  3CC2 V;  3J7A U;  2P5O A;  1THZ A;  5KMG A;  4DYL A;  3AG2 B;  2WLJ A;  3GB7 C;  4NB5 A;  5HFL A;  2DYR B;  3H1J H;  4O4L A;  3RGB A; 
#chains in the Genus database with same CATH homology
 3OAA G;  3MHS C;  4UUJ C;  1AR1 B;  3EHB B;  4UXN A;  3IFX A;  2HR3 A;  2HKO A;  4MVU A;  1OCC B;  3K9A A;  3CCL V;  3I56 V;  5B1A C;  1UJW B;  2YSU B;  4TT3 G;  3ABK B;  2HLD G;  5IY5 B;  1AJP A;  4OXS A;  2WPD G;  4MW3 A;  3AG1 C;  4MVS A;  2ZDI A;  1OCZ C;  5B1N A;  2QE7 G;  5LHH A;  4QJF B;  3P32 A;  3K08 A;  1QR8 A;  2A0L A;  1NH2 B;  3ZMS A;  1NVP D;  5LGN A;  3MHH C;  3SPC A;  1CP9 A;  3CCQ V;  5EBM C;  3T2M A;  3AG2 C;  3ETD A;  2DYR C;  1VQ9 V;  2X6B A;  1YJW V;  3VOU A;  1VQK V;  4XDL A;  5J9P C;  1PNK A;  2EZP A;  1Q81 W;  1F4M A;  4PDL A;  2P6J A;  1OCC C;  3CMA V;  5CBF A;  2EBO A;  5CBG A;  2DYS B;  4BW5 A;  5LGT A;  4JTA B;  4TSF G;  1VQP V;  5LBQ A;  1VQ8 V;  2EIJ B;  2WLH A;  2IJI A;  1K4D C;  1NKD A;  3SYA A;  4X8A A;  3K79 A;  3W7S A;  1GKF A;  4QIW F;  4R8C A;  3ZMV A;  3CCS V;  3OW2 U;  1Y66 A;  5CBH A;  1KD1 W;  3K0D A;  3D36 A;  1M57 C;  1YHQ V;  4WFE A;  4GCZ A;  3K04 A;  4MVR A;  2EIL B;  1AI6 A;  1AI4 A;  3WG7 B;  5L3C A;  2WSS G;  2OTL V;  1COW G;  2ZXW C;  1H8E G;  2P90 A;  3ABT A;  3ETG A;  4XBF A;  2A9H A;  3JCZ A;  3FB8 C;  1GMG A;  3E89 A;  3OEE G;  4PA6 A;  3CCM V;  2ZQM A;  1K5S A;  1M1K W;  3ABL B;  1BMF G;  2LFS A;  4I9W A;  1RM1 C;  2EJR A;  2IU0 A;  1YIJ V;  5KA6 A;  1KKD A;  1TUE B;  2EIJ C;  2EIN B;  3JD1 A;  4WCE V;  4P9O A;  3E8B A;  4YXW G;  4MW8 A;  1RPR A;  2JJ1 G;  4MS2 A;  3CYO A;  1XL6 A;  2UXN A;  3LDD A;  4N21 A;  1DTO A;  2CK3 G;  1YTF B;  1NJI W;  3W7T A;  1EBO A;  2OCC B;  1AI5 A;  3ZIA G;  3SYP A;  1OHH G;  1BL8 A;  2B1G A;  3JYC A;  4P9P A;  4QPJ A;  2Y69 C;  2EIL C;  2OT5 A;  2W6J G;  3QO5 A;  3WG7 C;  5FL7 G;  4JYB A;  1ENV A;  1K5Q A;  3UKM A;  4RUF A;  2P67 A;  3OGC C;  2C2A A;  4E2L A;  3G4S V;  5KA5 A;  2V7Q G;  3GWO A;  1AJN A;  1KC8 W;  3E8F A;  2Q68 A;  5DM6 V;  4U7O A;  1F51 A;  2XAJ A;  3AG1 B;  1S77 D;  2WAM A;  2EIM C;  2EIN C;  3ZMU A;  2Z3Y A;  2F43 G;  2IH1 C;  2UXX A;  3UM7 A;  1P7B A;  4CBC A;  1G4Y B;  3KG2 A;  1I5X A;  1PL0 A;  4JTC B;  5B3S C;  4UVC A;  1FFT B;  2QM7 A;  5BZB A;  2X7R B;  4Q20 A;  3ETE A;  3F5W C;  1EZJ A;  1NR7 A;  4RUE A;  3STL C;  1YSC A;  3P30 A;  3SPJ A;  4EKW A;  2WLM A;  3RVZ A;  4PDM A;  4PEL A;  3D3I A;  4WFF A;  3DTU B;  1CPY A;  4GX0 A;  3A0R A;  2LFR A;  3OE7 G;  4WFB V;  3CC7 V;  1K4C C;  1M9N A;  2XAG A;  2D3O W;  1KP3 A;  3OMI B;  1K33 A;  5E1A C;  3LSS A;  1VQ4 V;  5HFM A;  2X6A A;  3ML0 A;  1MSW D;  2PI4 A;  1F4N A;  1J95 A;  4RO2 A;  4G2K A;  2KB1 A;  3ABU A;  2XAS A;  3B8N A;  4BAY A;  3FB7 C;  4J9Z B;  1VQL V;  3E2E A;  1DF5 A;  1K34 A;  1M57 B;  4R7C A;  5IYB O;  1JQ0 A;  1RPO A;  4QPK A;  1R3L C;  1JPX A;  1SES A;  5H6R A;  4QE7 A;  3STZ C;  3AEI A;  1KQS U;  2ZXW B;  4XDJ A;  5CA3 A;  4WFA V;  5B1B C;  2YEV B;  3E35 A;  4G27 B;  3ZN1 A;  3F7V C;  1H8H G;  1MAB G;  2XOK G;  3ZMT A;  3ZJZ A;  1S0V A;  2K1E A;  5CMU A;  3EFF K;  3OEH G;  3OUF A;  1H2G A;  3OUS A;  1Q86 W;  1SER A;  1RM1 B;  5L3G A;  3SPG A;  5EBL C;  1F23 A;  4ZBM A;  3ABM C;  5EBW C;  4P30 A;  1VQ7 V;  4LP8 A;  1NH2 D;  3LUT B;  1FS0 G;  3ASN B;  4ASU G;  4HYO A;  5EC1 C;  3HPL C;  4CZZ A;  4FIP C;  5CN0 A;  1KEC A;  1QVG U;  2ZD9 A;  4RAI A;  1DF4 A;  2Y69 B;  1QBZ A;  2LP7 A;  1FXV A;  4BIU A;  3E83 A;  1ARO P;  2WLK A;  1H38 A;  1JCH A;  3X2Q C;  3FYI B;  3CP1 A;  3B8M A;  3QO7 A;  2W6I G;  3ZRX A;  1LNQ A;  2Q6A A;  4MVO A;  2WLL A;  2V1D A;  4G28 B;  3F7Y C;  3ZRS A;  4U7N A;  2AHY A;  3ZN0 A;  1R6N A;  4WF9 V;  4JTD B;  2EIM B;  3VBB A;  2QEX V;  1QLN A;  2IJJ A;  1W0J G;  2W0F C;  3BY6 A;  4PA3 A;  1VQO V;  3R65 A;  4WFH A;  4UVA A;  3OFN G;  3SYO A;  1S3J A;  5H9C A;  4MVM A;  1YJ9 V;  3ASN C;  5B3S B;  4X88 A;  2WLI A;  2EIK B;  1OZ0 A;  2ZDI C;  4R6Z A;  4XDK A;  1MOF A;  2GSM B;  2Y48 A;  3OR6 C;  3W7W A;  3BEH A;  2BOC C;  3ZRW A;  5EC2 C;  2B5U A;  3JD3 A;  4TWK A;  1OCO B;  2B1I A;  1QLE B;  2Z5U A;  3G71 V;  2R9I A;  5GW7 A;  4QNH B;  4R50 A;  4RQE A;  3DGE A;  4PDR A;  5H6Q A;  5LHG A;  3E8G A;  1FXK A;  4FJC C;  1JX9 A;  3W7U A;  1GM8 A;  2DWE C;  2HVK C;  1GM7 A;  3CPW U;  2QKS A;  5DN6 G;  1ROP A;  3CCR V;  2Q69 A;  1JOY A;  3I55 V;  4MSW C;  2IJH A;  2HVJ C;  3AG4 B;  4WFG A;  2IU3 A;  3LNM B;  2EIK C;  3TK1 A;  1V54 B;  1JVM A;  3B77 A;  3T1C A;  3T4Z A;  4GX2 A;  1ZWI C;  4JAV A;  3K03 A;  4PA7 A;  4MTG A;  2DQ3 A;  4UV8 A;  1PNM A;  1OCO C;  1WLE A;  1QLE C;  2JJ2 G;  1R3I C;  5L3D A;  3LDC A;  2WLI B;  4KFM A;  5B1B B;  1E79 G;  1NVP B;  2HFE C;  1P4R A;  4JGS A;  1AI7 A;  2X6C A;  3CCV V;  3IC7 A;  3TET A;  1K8A W;  4N23 A;  1L1F A;  2P7T C;  4JF3 A;  3E86 A;  2H8P C;  4LBE C;  4GT1 A;  5L3F A;  3SPH A;  3ABM B;  4MTF A;  3ZMZ A;  3OM3 B;  3ZRV A;  3CCJ V;  3AG4 C;  1GO3 F;  3CME V;  1ORQ C;  2QA4 V;  1V54 C;  1HWY A;  1GK9 A;  5KUK A;  3LSQ A;  3TCU A;  3CCU V;  2IW5 A;  4RQF A;  1PKX A;  5IYD O;  1N8R W;  1QCE A;  5L3E A;  3RW0 A;  3OMN B;  3MD0 A;  2ZR2 A;  3X2Q B;  4I5S A;  4HZ3 A;  3JD4 A;  2JEU A;  1S72 V;  3CXC U;  3OMA B;  4P2Z A;  4PA4 A;  1QVF U;  4BIZ A;  1NQT A;  1XL4 A;  1W0K G;  4H37 A;  1G8M A;  5L3B A;  2ITC C;  2H94 A;  1YJN V;  2GHY A;  4J9Y B;  4MTO A;  4GX1 A;  2ATK C;  1FXK C;  4MTX A;  1W2B U;  4JAS A;  3NXS A;  4ZKI A;  1QR9 A;  2JIZ G;  1E1Q G;  1VQN V;  1NBM G;  1YI2 V;  1E1R G;  2BOB C;  1K3E A;  2IJK A;  4JPR A;  5LHI A;  4UVB A;  3ASO B;  2AHZ A;  3SPI A;  1M90 W;  3FYE B;  4KUM A;  2OTJ V;  3JD2 A;  1EFR G;  1K97 A;  3FKS G;  1IXM A;  3ABK C;  3ZCC A;  1YIT V;  2QM8 A;  5IY5 C;  2PI5 A;  1Q82 W;  1JJ2 U;  3SYQ A;  2XAQ A;  3IGA C;  4DXW A;  3QNE A;  3HB3 B;  5EK0 A;  4GX5 A;  4FPP A;  4LC1 A;  1I5Y A;  1OCR B;  4F4L A;  4MVZ A;  2ZR3 A;  3RVY A;  5LGU A;  4Z1M G;  3K3W A;  3RBZ A;  4MVQ A;  1BHB A;  2XAF A;  2NLJ C;  1R6K A;  1FXH A;  1R3K C;  1KP2 A;  1Q7Y W;  1WPX A;  2NNU A;  3G6E V;  3SYC A;  1VQM V;  2EZO A;  2XAH A;  3K06 A;  3OR7 C;  1R3J C;  3FB6 C;  4PDV A;  1AJQ A;  1DLB A;  2WWW A;  2HJF C;  2MK3 A;  5C93 A;  2JK5 C;  1SET A;  3ASO C;  3FB5 C;  1PD3 A;  4HAM A;  1M56 B;  1SZT A;  2A79 B;  2DYS C;  4L87 A;  3E8H A;  2DQ0 A;  4QE9 A;  1K9M W;  2FTK A;  1VQ5 V;  3PJS K;  1NR1 A;  2JEX A;  2HG5 C;  1S76 D;  1OCR C;  1GTO A;  4MT8 A;  1S5H C;  4FMT A;  4DO2 A;  5KUM A;  2X0L A;  2ITD C;  4FK5 C;  1V55 B;  2Q67 A;  1K73 W;  2XND G;  4H33 A;  3AG3 B;  1GM9 A;  1R73 A;  1SRY A;  2WLL B;  3JD0 A;  3WFV A;  1BHA A;  2M7W A;  2JDI G;  1YTF D;  4X89 A;  5B1O A;  5B1A B;  1M56 C;  2QTO A;  4PA9 A;  3K0G A;  3ABL C;  1VQ6 V;  3T4D A;  1CEZ A;  1K7D A;  4JYC A;  3CD6 V;  1OCZ B;  3SJQ C;  1Y4M A;  1B6Q A;  3H01 A;  4UV9 A;  4LCU C;  2DWD C;  2DW4 A;  3ZRW B;  5IYC O;  3CC2 V;  1MG1 A;  1THZ A;  3M99 B;  2IH3 C;  2OCC C;  1V55 C;  3AG2 B;  2WLN A;  2WLJ A;  2YEV A;  4JAU A;  5IDJ A;  4KP4 A;  3W7X A;  3GB7 C;  3CC4 V;  5HFL A;  3AG3 C;  1PNL A;  2DYR B;  3QO8 A;  1FXK B;  2R9R B;  1K92 A;  3CCE V;  3LDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...